# OCA database search on: Tue Apr 30 23:46:59 2024 # Query: ev=10&ex=any&fa=DALRAIWEQELTDMRQRIQRMRQLFVNTLQE&m=du # Hits: 117 (search time 2 sec) 1AHE Aspartate Aminotransferase Hexamutant Malashkevich 2.30 1995-02-22 0.0000 1AHF Aspartate Aminotransferase Hexamutant Malashkevich 2.30 1995-02-22 0.0000 1AHG Aspartate Aminotransferase Hexamutant Malashkevich 2.50 1995-02-22 0.0000 1X28 Crystal Structure Of E.Coli Aspat Complex ... Goto 2.40 2005-04-21 0.0000 1X29 Crystal Structure Of E.Coli Aspat Complex ... Goto 2.20 2005-04-21 0.0000 1ARG Aspartate Aminotransferase, Phospho-5'-Py ... Malashkevich 2.20 1995-08-23 0.0000 1ARH Aspartate Aminotransferase, Y225r/R386a M ... Malashkevich 2.30 1995-08-23 0.0000 3PAA Mechanism Of Inactivation Of E. Coli Aspa ... Liu 1.90 2010-10-19 0.0000 3PA9 Mechanism Of Inactivation Of E. Coli Aspa ... Liu 1.70 2010-10-19 0.0000 1TOI Hydrocinnamic Acid-Bound Structure Of Hex ... Chow 1.90 2004-06-14 0.0000 1X2A Crystal Structure Of E.Coli Aspat Complex ... Goto 2.20 2005-04-21 0.0000 1G7W Aspartate Aminotransferase Active Site Mu ... Mizuguchi 2.20 2000-11-15 0.0000 4DBC Substrate Activation In Aspartate Aminotr ... Toney 1.50 2012-01-14 0.0000 2QBT Structural Studies Reveal The Inactivatio ... Liu 1.75 2007-06-18 0.0000 2D61 Aspartate Aminotransferase Mutant Ma With ... Tanaka 2.01 2005-11-08 0.0000 1QIR Aspartate Aminotransferase From Escherich ... Jeffery 2.20 1999-06-15 0.0000 2D63 Aspartate Aminotransferase Mutant Ma With ... Tanaka 2.05 2005-11-09 0.0000 1CZE Aspartate Aminotransferase Mutant Atb17/1 ... Okamoto 2.40 1999-09-02 0.0000 2D65 Aspartate Aminotransferase Mutant Mabc Tanaka 2.30 2005-11-09 0.0000 2D66 Aspartate Aminotransferase Mutant Mab Tanaka 2.18 2005-11-09 0.0000 1IX8 Aspartate Aminotransferase Active Site Mu ... Hayashi 2.20 2002-06-14 0.0000 1IX7 Aspartate Aminotransferase Active Site Mu ... Hayashi 2.20 2002-06-14 0.0000 1IX6 Aspartate Aminotransferase Active Site Mu ... Hayashi 2.20 2002-06-14 0.0000 1ARI Aspartate Aminotransferase, W140h Mutant, ... Malashkevich 2.30 1995-08-23 0.0000 2D64 Aspartate Aminotransferase Mutant Mabc Wi ... Tanaka 2.05 2005-11-09 0.0000 1AIA Structural Basis For The Catalytic Activi ... Jaeger 2.20 1994-05-10 0.0000 2QA3 Structural Studies Reveal The Inactivatio ... Liu 1.75 2007-06-14 0.0000 1AIB Structural Basis For The Catalytic Activi ... Jaeger 2.80 1994-05-10 0.0000 1AIC Structural Basis For The Catalytic Activi ... Jaeger 2.40 1994-05-10 0.0000 1B4X Aspartate Aminotransferase From E. Coli, ... Jeffery 2.45 1998-12-30 0.0000 1ASM Crystal Structures Of Escherichia Coli As ... Jaeger 2.35 1993-09-16 0.0000 5VWR E.Coli Aspartate Aminotransferase-(1r,3s, ... Mascarenhas 1.72 2017-05-22 0.0000 4A00 Structure Of An Engineered Aspartate Amin ... Fernandez 2.34 2011-09-06 0.0000 1CZC Aspartate Aminotransferase Mutant Atb17/1 ... Okamoto 2.50 1999-09-02 0.0000 1AHY Aspartate Aminotransferase Hexamutant Malashkevich 2.30 1995-02-21 0.0000 1ARS X-Ray Crystallographic Study Of Pyridoxal ... Okamoto 1.80 1993-08-02 0.0000 1AHX Aspartate Aminotransferase Hexamutant Malashkevich 2.00 1995-02-21 0.0000 3ZZK Structure Of An Engineered Aspartate Amin ... Fernandez 1.78 2011-09-01 0.0000 3ZZJ Structure Of An Engineered Aspartate Amin ... Fernandez 2.50 2011-09-01 0.0000 5VWQ E.Coli Aspartate Aminotransferase-(1r,3s, ... Mascarenhas 1.80 2017-05-22 0.0000 1C9C Aspartate Aminotransferase Complexed With ... Ishijima 2.40 1999-08-02 0.0000 3QN6 Crystal Structures Of Escherichia Coli As ... Griswold 1.79 2011-02-08 0.0000 2AAT 2.8-Angstroms-Resolution Crystal Structur ... Smith 2.80 1989-05-30 0.0000 1ASB The Structural Basis For The Reduced Acti ... Schumacher 2.60 1993-08-27 0.0000 1ASD The Structure Of Wild Type E. Coli Aspart ... Schumacher 2.20 1993-08-27 0.0000 5T4L Plp And Gaba Trigger Gabr-Mediated Transc ... Wu 1.53 2016-08-29 0.0000 1ASF The Structural Basis For The Reduced Acti ... Schumacher 2.80 1993-08-27 0.0000 1ASG The Structural Basis For The Reduced Acti ... Schumacher 2.80 1993-08-27 0.0000 3QPG Crystal Structures Of Escherichia Coli As ... Griswold 1.79 2011-02-13 0.0000 2D7Z Aspartate Aminotransferase Mutant Mab Com ... Tanaka 2.65 2005-11-30 0.0000 2Q7W Structural Studies Reveals The Inactivati ... Liu 1.40 2007-06-07 0.0000 1G7X Aspartate Aminotransferase Active Site Mu ... Mizuguchi 2.20 2000-11-15 0.0000 2D5Y Aspartate Aminotransferase Mutant Mc With ... Tanaka 1.98 2005-11-08 0.0000 1BQA Aspartate Aminotransferase P195a Mutant Malashkevich 2.10 1998-08-13 0.0000 1ASC The Structural Basis For The Reduced Acti ... Schumacher 2.40 1993-08-27 0.0000 1ASN Crystal Structures Of Escherichia Coli As ... Jaeger 2.50 1993-09-16 0.0000 1BQD Aspartate Aminotransferase P138a/P195a Do ... Malashkevich 2.10 1998-08-14 0.0000 1TOE Unliganded Structure Of Hexamutant + A293 ... Chow 2.00 2004-06-14 0.0000 1TOG Hydrocinnamic Acid-Bound Structure Of Srh ... Chow 2.31 2004-06-14 0.0000 1TOJ Hydrocinnamic Acid-Bound Structure Of Srh ... Chow 1.90 2004-06-14 0.0000 2QB3 Structural Studies Reveal The Inactivatio ... Liu 1.45 2007-06-15 0.0000 1ASL Crystal Structures Of Escherichia Coli As ... Jaeger 2.60 1993-09-16 0.0000 2QB2 Structural Studies Reveal The Inactivatio ... Liu 1.70 2007-06-15 0.0000 1TOK Maleic Acid-Bound Structure Of Srhept Mut ... Chow 1.85 2004-06-14 0.0000 1QIS Aspartate Aminotransferase From Escherich ... Jeffery 1.90 1999-06-15 0.0000 3AAT Activity And Structure Of Active-Site Mut ... Danishefsky 2.80 1990-12-06 0.0000 5EAA Aspartate Aminotransferase From E. Coli, ... Jeffery 2.40 1998-12-29 0.0000 1AAM The Structural Basis For The Altered Subs ... Almo 2.80 1993-07-13 0.0000 1CQ8 Aspartate Aminotransferase Complexed With ... Ishijima 2.40 1999-08-06 0.0000 1G4V Aspartate Aminotransferase Active Site Mu ... Mizuguchi 2.00 2000-10-28 0.0000 1AAW The Structural Basis For The Altered Subs ... Almo 2.40 1993-07-13 0.0000 1ART X-Ray Crystallographic Study Of Pyridoxal ... Okamoto 1.80 1993-08-02 0.0000 1QIT Aspartate Aminotransferase From Escherich ... Jeffery 1.90 1999-06-15 0.0000 1YOO Aspartate Aminotransferase Mutant Atb17 W ... Oue 2.40 1998-06-26 0.0000 1CQ7 Aspartate Aminotransferase Complexed With ... Ishijima 2.40 1999-08-06 0.0000 1SPA Role Of Asp222 In The Catalytic Mechanism ... Hinoue 2.00 1993-01-26 0.0000 1CQ6 Aspartate Aminotransferase Complex With C ... Ishijima 2.70 1999-08-06 0.0000 1G4X Aspartate Aminotransferase Active Site Mu ... Mizuguchi 2.20 2000-10-29 0.0000 1ASE The Structure Of Wild Type E. Coli Aspart ... Schumacher 2.50 1993-08-27 0.0000 1ASA The Structural Basis For The Reduced Acti ... Schumacher 2.40 1993-08-27 0.0000 1AMS X-Ray Crystallographic Study Of Pyridoxam ... Miyahara 2.70 1994-07-01 0.0000 2D7Y Aspartate Aminotransferase Mutant Ma Tanaka 2.66 2005-11-30 0.0000 1AMQ X-Ray Crystallographic Study Of Pyridoxam ... Miyahara 2.20 1994-07-01 0.0000 1AMR X-Ray Crystallographic Study Of Pyridoxam ... Miyahara 2.10 1994-07-01 0.0000 4F5G Rational Design And Directed Evolution Of ... Addington 1.67 2012-05-13 0.0000 4F5M Wild-Type E. Coli Aspartate Aminotransfer ... Addington 1.65 2012-05-13 0.0000 8E9C Crystal Structure Of E. Coli Aspartate Am ... Chica 2.18 2022-08-26 0.0000 8E9V Crystal Structure Of E. Coli Aspartate Am ... Chica 2.01 2022-08-26 0.0000 4F5K Substrate Specificity Conversion Of Aspar ... Addington 2.20 2012-05-13 0.0000 8E9M Crystal Structure Of E. Coli Aspartate Am ... Chica 1.76 2022-08-26 0.0000 3UAK Crystal Structure Of De Novo Designed Cys ... Kuzin 3.23 2011-10-21 0.0000 8E9D Crystal Structure Of E. Coli Aspartate Am ... Chica 1.37 2022-08-26 0.0000 8E9L Crystal Structure Of E. Coli Aspartate Am ... Chica 2.31 2022-08-26 0.0000 8E9K Crystal Structure Of Wild-Type E. Coli As ... Chica 1.83 2022-08-26 0.0000 8E9Q Crystal Structure Of E. Coli Aspartate Am ... Chica 1.80 2022-08-26 0.0000 4F5I Substrate Specificity Conversion Of E. Co ... Addington 2.20 2012-05-13 0.0000 8E9R Crystal Structure Of E. Coli Aspartate Am ... Chica 1.90 2022-08-26 0.0000 8E9P Crystal Structure Of Wild-Type E. Coli As ... Chica 2.08 2022-08-26 0.0000 8E9O Crystal Structure Of E. Coli Aspartate Am ... Chica 1.96 2022-08-26 0.0000 8E9U Crystal Structure Of E. Coli Aspartate Am ... Chica 1.94 2022-08-26 0.0000 8E9S Crystal Structure Of E. Coli Aspartate Am ... Chica 2.00 2022-08-26 0.0000 4F5J Rational Design And Directed Evolution Fo ... Addington 1.95 2012-05-13 0.0000 8E9N Crystal Structure Of E. Coli Aspartate Am ... Chica 1.88 2022-08-26 0.0000 4F5L A Theoretical Optimized Mutant For The Co ... Addington 1.40 2012-05-13 0.0000 8E9J Crystal Structure Of E. Coli Aspartate Am ... Chica 2.09 2022-08-26 0.0000 4F5F Structure Of Aspartate Aminotransferase C ... Addington 2.25 2012-05-13 0.0000 8E9T Crystal Structure Of Wild-Type E. Coli As ... Chica 2.13 2022-08-26 0.0000 4F5H Intercoversion Of Substrate Specificity: ... Addington 1.60 2012-05-13 0.0000 4WD2 Crystal Structure Of An Aromatic Amino Ac ... Seattle Struc ... 1.95 2014-09-06 0.4500 4F4E Crystal Structure Of Aromatic-Amino-Acid ... Seattle Struc ... 1.80 2012-05-10 0.4600 4EFF Crystal Structure Of Aromatic-Amino-Acid ... Seattle Struc ... 1.85 2012-03-29 0.4600 3FSL Crystal Structure Of Tyrosine Aminotransf ... Malashkevich 2.35 2009-01-09 0.6900 6EZL Crystal Structure Of Aspartate Aminotrans ... Jagoe 2.07 2017-11-15 1.1000 3TAT Tyrosine Aminotransferase From E. Coli Ko 3.50 1998-08-12 1.4000 2JO8 Solution Structure Of C-Terminal Domain O ... Hwang 2007-02-26 9.4000 4NR2 Crystal Structure Of Stk4 (Mst1) Sarah Domain Chaikuad 2.00 2013-11-26 9.4000 4OH8 Crystal Structure Of Human Mst1-Rassf5 Sa ... Hwang 2.28 2014-01-17 9.4000
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |