# OCA database search on: Sun Feb 25 20:13:31 2024
# Query: ev=10&ex=any&fa=EEQAKTFLDKFNHEAEDLFYQSSLASWNYNTN&m=du
# Hits: 377 (search time 2 sec)
8WRO     Xbb.1.5.10 Spike Protein In Complex With Ace2 Feng              3.90 2023-10-15   0.0000
8WRM     Xbb.1.5 Spike Protein In Complex With Ace2    Feng              4.34 2023-10-15   0.0000
8WRL     Xbb.1.5 Rbd In Complex With Ace2              Feng              3.36 2023-10-15   0.0000
7WGB     Neutral Omicron Spike Trimer In Complex W ... Cui               3.50 2021-12-28   0.0000
8WTJ     Xbb.1.5.70 Spike Protein In Complex With Ace2 Feng              4.64 2023-10-18   0.0000
7WGC     Neutral Omicron Spike Trimer In Complex W ... Cui               3.60 2021-12-28   0.0000
7WSA     Structures Of Omicron Spike Complexes Ill ... Guo               3.00 2022-01-28   0.0000
7WS9     Structures Of Omicron Spike Complexes Ill ... Guo               2.90 2022-01-28   0.0000
7WS8     Structures Of Omicron Spike Complexes Ill ... Guo               3.00 2022-01-28   0.0000
7DRV     Structural Basis Of Sars-Cov-2-Closely-Re ... Liu               3.09 2020-12-29   0.0000
8H06     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhao              2.66 2022-09-28   0.0000
7XCH     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Gao               3.40 2022-03-24   0.0000
7XCI     Cryo-Em Structure Of Sars-Cov-2 Omicron R ... Gao               3.20 2022-03-24   0.0000
7XAZ     Crystal Structure Of Omicron Ba.1.1 Rbd C ... Liao              3.00 2022-03-19   0.0000
7PKI     Crystal Structure Of Human Ace2 Bound To  ... Baquero           2.94 2021-08-25   0.0000
7YA1     Cryo-Em Structure Of Hace2-Bound Sars-Cov ... Zhao              3.11 2022-06-27   0.0000
7YA0     Cryo-Em Structure Of Hace2-Bound Sars-Cov ... Zhao              3.10 2022-06-26   0.0000
8H5C     Structure Of Sars-Cov-2 Omicron Ba.2.75 R ... Zhao              2.90 2022-10-12   0.0000
7YJ3     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhao              3.14 2022-07-19   0.0000
7YHW     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhao              3.09 2022-07-14   0.0000
7WBP     Crystal Structure Of Receptor Binding Dom ... Qi                3.00 2021-12-17   0.0000
7XB1     Crystal Structure Of Omicron Ba.3 Rbd Com ... Li                2.70 2022-03-19   0.0000
6LZG     Structure Of Novel Coronavirus Spike Rece ... Wang              2.50 2020-02-19   0.0000
7WBL     Cryo-Em Structure Of Human Ace2 Complexed ... Liu               3.40 2021-12-17   0.0000
7WBQ     Crystal Structure Of Receptor Binding Dom ... Qi                3.34 2021-12-17   0.0000
7LO4     Sars-Cov-2 Spike Receptor-Binding Domain  ... Weekley           2.46 2021-02-09   0.0000
7XB0     Crystal Structure Of Omicron Ba.2 Rbd Com ... Li                2.90 2022-03-19   0.0000
7XCP     Cryo-Em Structure Of Omicron Rbd Complexe ... Zhao              3.05 2022-03-24   0.0000
7Y9Z     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Gao               2.85 2022-06-26   0.0000
7YEG     Sars-Cov-2 Spike (6p) In Complex With 3 R ... Liu               3.73 2022-07-05   0.0000
7KMS     Cryo-Em Structure Of Triple Ace2-Bound Sa ... Gorman            3.64 2020-11-03   0.0000
7KNE     Cryo-Em Structure Of Single Ace2-Bound Sa ... Gorman            3.85 2020-11-04   0.0000
7DDO     Cryo-Em Structure Of Human Ace2 And Gd/1/ ... Niu               3.40 2020-10-29   0.0000
2AJF     Structure Of Sars Coronavirus Spike Recep ... Li                2.90 2005-08-01   0.0000
3KBH     Crystal Structure Of Nl63 Respiratory Cor ... Wu                3.31 2009-10-20   0.0000
7DX4     The Structure Of Fc08 Fab-Ha.Ce2-Rbd Complex  Cao               3.60 2021-01-18   0.0000
7UFK     Crystal Structure Of Chimeric Omicron Rbd ... Zhang             2.38 2022-03-22   0.0000
8SPI     Crystal Structure Of Chimeric Omicron Rbd ... Zhang             3.06 2023-05-03   0.0000
7VIB     Crystal Structure Of Human Ace2 And Gx/P2 ... Guo               3.20 2021-09-26   0.0000
7RPV     Crystal Structure Of Affinity-Enhancing A ... Chen              3.54 2021-08-04   0.0000
8HRL     Sars-Cov-2 Delta S-Rbd-Ace2                   Xu                2.80 2022-12-15   0.0000
7KNI     Cryo-Em Structure Of Triple Ace2-Bound Sa ... Gorman            3.91 2020-11-04   0.0000
7KMZ     Cryo-Em Structure Of Double Ace2-Bound Sa ... Gorman            3.62 2020-11-03   0.0000
6VW1     Structure Of Sars-Cov-2 Chimeric Receptor ... Shang             2.68 2020-02-18   0.0000
7KNH     Cryo-Em Structure Of Double Ace2-Bound Sa ... Gorman            3.74 2020-11-04   0.0000
7DDP     Cryo-Em Structure Of Human Ace2 And Gx/P2 ... Niu               3.40 2020-10-29   0.0000
8SPH     Crystal Structure Of Chimeric Omicron Rbd ... Zhang             2.71 2023-05-03   0.0000
7L0N     Circulating Sars-Cov-2 Spike N439k Varian ... Snell             2.78 2020-12-11   0.0000
7KNB     Cryo-Em Structure Of Single Ace2-Bound Sa ... Gorman            3.93 2020-11-04   0.0000
7KMB     Ace2-Rbd Focused Refinement Using Symmetr ... Gorman            3.39 2020-11-02   0.0000
7U0N     Crystal Structure Of Chimeric Omicron Rbd ... Geng              2.61 2022-02-18   0.0000
8HRK     Sars-Cov-2 Delta S-Rbd-Ace2 Complex           Xu                3.30 2022-12-15   0.0000
7VX9     Sars-Cov-2 Kappa Variant Spike Protein In ... Xu                4.00 2021-11-12   0.0000
7XBG     The Crystal Structure Of Rshstt182/200 Rb ... Hu                3.37 2022-03-21   0.0000
7WHH     Crystal Structure Of Sars-Cov-2 Omicron R ... Wang              2.60 2021-12-30   0.0000
7XBF     The Complex Structure Of Rshstt182/200 Rb ... Hu                3.51 2022-03-21   0.0000
7EFP     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Lu                2.70 2021-03-22   0.0000
7P19     Crystal Structure Of Sars-Cov-2 Rbd Q498y ... Erausquin         3.24 2021-07-01   0.0000
7TN0     Sars-Cov-2 Omicron Rbd In Complex With Hu ... Mccallum          2.85 2022-01-20   0.0000
7P8I     Receptor-Binding Domain (Rbd) Of Spike Pr ... Scietti           4.50 2021-07-22   0.0000
7XBH     The Complex Structure Of Rshstt182/200 Rb ... Hu                3.02 2022-03-21   0.0000
7P8J     Receptor-Binding Domain (Rbd) Of Spike Pr ... Scietti           6.58 2021-07-22   0.0000
7YDI     Sars-Cov-2 Spike (6p) In Complex With 3 R ... Liu               3.98 2022-07-04   0.0000
7YR4     Sars-Cov-2 Ba.2.75 S Trimer In Complex Wi ... Wang              4.12 2022-08-08   0.0000
6ACG     Trypsin-Cleaved And Low Ph-Treated Sars-C ... Gui               5.40 2018-07-26   0.0000
7YR2     Sars-Cov-2 Ba.2.75 S Trimer In Complex Wi ... Wang              3.30 2022-08-08   0.0000
3SCI     Crystal Structure Of Spike Protein Recept ... Wu                2.90 2011-06-07   0.0000
7EKH     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Han               2.40 2021-04-05   0.0000
3SCJ     Crystal Structure Of Spike Protein Recept ... Wu                3.00 2011-06-07   0.0000
7EKF     Structure Of Sars-Cov-2 Alpha Variant Spi ... Han               2.85 2021-04-05   0.0000
7EKG     Structure Of Sars-Cov-2 Beta Variant Spik ... Han               2.63 2021-04-05   0.0000
6ACK     Trypsin-Cleaved And Low Ph-Treated Sars-C ... Gui               4.50 2018-07-26   0.0000
6ACJ     Trypsin-Cleaved And Low Ph-Treated Sars-C ... Gui               4.20 2018-07-26   0.0000
7EKC     Structure Of Sars-Cov-2 Gamma Variant Spi ... Han               2.80 2021-04-05   0.0000
7EKE     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Han               2.70 2021-04-05   0.0000
6M0J     Crystal Structure Of Sars-Cov-2 Spike Rec ... Wang              2.45 2020-02-21   0.0000
7YR3     Sars-Cov-2 Ba.2.75 S Trimer In Complex Wi ... Wang              3.52 2022-08-08   0.0000
7NXC     Crystal Structure Of Receptor Binding Dom ... Zhou              3.14 2021-03-17   0.0000
7ZF7     Sars-Cov-2 Omicron Ba.2 Rbd In Complex Wi ... Zhou              3.46 2022-04-01   0.0000
8ASY     Sars-Cov-2 Omicron Ba.2.75 Rbd In Complex ... Zhou              2.85 2022-08-22   0.0000
6CS2     Sars Spike Glycoprotein - Human Ace2 Comp ... Kirchdoerfer      4.40 2018-03-19   0.0000
7SY8     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               3.14 2021-11-24   0.0000
8DLK     Cryo-Em Structure Of Sars-Cov-2 Alpha (B. ... Zhu               3.04 2022-07-08   0.0000
7SY6     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               2.81 2021-11-24   0.0000
8DLN     Cryo-Em Structure Of Sars-Cov-2 Beta (B.1 ... Zhu               3.04 2022-07-08   0.0000
7SY7     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               2.81 2021-11-24   0.0000
8DLP     Cryo-Em Structure Of Sars-Cov-2 Gamma (P. ... Zhu               2.64 2022-07-08   0.0000
7SXY     Cryo-Em Structure Of Sars-Cov-2 D614g Mut ... Zhu               2.79 2021-11-24   0.0000
7SY3     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               2.95 2021-11-24   0.0000
8DLJ     Cryo-Em Structure Of Sars-Cov-2 Alpha (B. ... Zhu               2.91 2022-07-08   0.0000
7TEX     Cryo-Em Structure Of Sars-Cov-2 Delta (B. ... Zhu               3.27 2022-01-06   0.0000
8DM6     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhu               2.77 2022-07-08   0.0000
8DLM     Cryo-Em Structure Of Sars-Cov-2 Beta (B.1 ... Zhu               2.89 2022-07-08   0.0000
7SY5     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               2.59 2021-11-24   0.0000
7SY2     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               3.11 2021-11-24   0.0000
7SY0     Cryo-Em Structure Of Sars-Cov-2 D614g,L45 ... Zhu               3.00 2021-11-24   0.0000
8DM5     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhu               2.51 2022-07-08   0.0000
7SXZ     Cryo-Em Structure Of Sars-Cov-2 D614g,L45 ... Zhu               2.61 2021-11-24   0.0000
7E7E     The Co-Crystal Structure Of Ace2 With Fab     Xiao              3.80 2021-02-26   0.0000
7MJM     Cryo-Em Structure Of Sars-Cov-2 N501y Mut ... Zhu               2.83 2021-04-20   0.0000
7TEZ     Cryo-Em Structure Of Sars-Cov-2 Kappa (B. ... Zhu               3.27 2022-01-06   0.0000
8VKP     Cryo-Em Structure Of Sars-Cov-2 Xbb.1.5 S ... Zhu               2.77 2024-01-09   0.0000
8VKO     Cryo-Em Structure Of Sars-Cov-2 Xbb.1.5 S ... Zhu               2.68 2024-01-09   0.0000
8DLQ     Cryo-Em Structure Of Sars-Cov-2 Gamma (P. ... Zhu               2.77 2022-07-08   0.0000
8DLU     Cryo-Em Structure Of Sars-Cov-2 Epsilon ( ... Zhu               3.14 2022-07-08   0.0000
7SY4     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               3.35 2021-11-24   0.0000
7SXX     Cryo-Em Structure Of Sars-Cov-2 D614g Mut ... Zhu               2.66 2021-11-24   0.0000
7MJN     Cryo-Em Structure Of Sars-Cov-2 N501y Mut ... Zhu               3.29 2021-04-20   0.0000
8DLV     Cryo-Em Structure Of Sars-Cov-2 Epsilon ( ... Zhu               3.11 2022-07-08   0.0000
7T9L     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Zhu               2.66 2021-12-19   0.0000
7SY1     Cryo-Em Structure Of Sars-Cov-2 D614g,N50 ... Zhu               2.83 2021-11-24   0.0000
7T9K     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Zhu               2.45 2021-12-19   0.0000
7TF0     Cryo-Em Structure Of Sars-Cov-2 Kappa (B. ... Zhu               3.02 2022-01-06   0.0000
7TEW     Cryo-Em Structure Of Sars-Cov-2 Delta (B. ... Zhu               3.52 2022-01-06   0.0000
8JYP     Structure Of Sars-Cov-2 Xbb.1.5 Spike Rbd ... Yajima            3.38 2023-07-03   0.0000
7XWA     Crystal Structure Of Receptor Binding Dom ... Suzuki            3.36 2022-05-26   0.0000
8JYN     Structure Of Sars-Cov-2 Xbb.1.5 Spike Gly ... Yajima            3.04 2023-07-03   0.0000
8IOV     Structure Of Sars-Cov-2 Xbb.1 Spike Rbd I ... Anraku            3.29 2023-03-13   0.0000
8IF2     Crystal Structure Of Receptor Binding Dom ... Kimura            2.78 2023-02-17   0.0000
8IOU     Structure Of Sars-Cov-2 Xbb.1 Spike Glyco ... Anraku            3.18 2023-03-13   0.0000
8JYO     Structure Of Sars-Cov-2 Xbb.1.5 Spike Gly ... Yajima            3.20 2023-07-03   0.0000
8BFW     The Structures Of Ace2 In Complex With Bi ... Brear             2.33 2022-10-27   0.0000
8BYJ     The Structures Of Ace2 In Complex With Bi ... Brear             2.07 2022-12-13   0.0000
8B9P     Ace2 In Complex With Bicyclic Peptide Inh ... Brear             2.11 2022-10-06   0.0000
8BN1     The Structures Of Ace2 In Complex With Bi ... Brear             2.61 2022-11-11   0.0000
7BH9     Sars-Cov-2 Rbd-62 In Complex With Ace2 Pe ... Elad              2.90 2021-01-11   0.0000
1R42     Native Human Angiotensin Converting Enzym ... Towler            2.20 2003-10-07   0.0000
7KJ3     Sars-Cov-2 Spike Glycoprotein With Two Ac ... Zhang             3.70 2020-10-25   0.0000
7KJ4     Sars-Cov-2 Spike Glycoprotein With Three  ... Zhang             3.40 2020-10-25   0.0000
7KJ2     Sars-Cov-2 Spike Glycoprotein With One Ac ... Zhang             3.60 2020-10-25   0.0000
1R4L     Inhibitor Bound Human Angiotensin Convert ... Towler            3.00 2003-10-07   0.0000
8I9H     S-Rbd (Omicron Xbb.1) In Complex With Pd  ... Li                3.60 2023-02-06   0.0000
8I9F     S-Rbd (Omicron Ba.2.75) In Complex With P ... Li                2.90 2023-02-06   0.0000
8I9E     S-Rbd(Omicron Ba.3) In Complex With Pd Of ... Li                3.20 2023-02-06   0.0000
8I9G     S-Rbd (Omicron Bf.7) In Complex With Pd O ... Li                3.20 2023-02-06   0.0000
7ZDQ     Cryo-Em Structure Of Human Ace2 Bound To  ... Bate              3.20 2022-03-29   0.0000
7FDH     Sars-Cov-2 Spike Rbdmacsp25 Binding To Hace2  Wang              3.72 2021-07-16   0.0000
7FDG     Sars-Cov-2 Spike Rbdmacsp6 Binding To Hace2   Wang              3.69 2021-07-16   0.0000
7SN0     Crystal Structure Of Spike Protein Recept ... Pan               3.08 2021-10-27   0.0000
7FDI     Sars-Cov-2 Spike Rbdmacsp36 Binding To Hace2  Wang              3.12 2021-07-16   0.0000
7Y21     S-Ecd (Omicron Ba.5) In Complex With Pd O ... Li                2.80 2022-06-09   0.0000
7Y1Y     S-Ecd (Omicron Ba.2) In Complex With Pd O ... Li                3.30 2022-06-09   0.0000
8I9B     S-Ecd (Omicron Ba.2.75) In Complex With P ... Li                3.50 2023-02-06   0.0000
7Y20     S-Ecd (Omicron Ba.3) In Complex With Two  ... Li                3.80 2022-06-09   0.0000
8I9C     S-Ecd (Omicron Bf.7) In Complex With Pd O ... Li                3.85 2023-02-06   0.0000
7Y1Z     S-Ecd (Omicron Ba.3) In Complex With Thre ... Li                3.40 2022-06-09   0.0000
8I9D     S-Ecd (Omicron Xbb.1) In Complex With Pd  ... Li                3.95 2023-02-06   0.0000
7W99     Sars-Cov-2 Delta S-Ace2-C2a                   Cong              3.40 2021-12-09   0.0000
7VXA     Sars-Cov-2 Kappa Variant Spike Protein In ... Xu                3.90 2021-11-12   0.0000
7VXK     Sars-Cov-2 Spike Protein In Complex With  ... Xu                3.70 2021-11-12   0.0000
8TOT     Ace2-Peptide2 Complex Crystal Form 2          Christie          2.80 2023-08-03   0.0000
7VX4     Ace2-Rbd In Sars-Cov-2 Beta Variant S-Ace ... Xu                3.90 2021-11-12   0.0000
7VXF     Sars-Cov-2 Spike Protein In Complex With  ... Xu                3.60 2021-11-12   0.0000
7W9C     Sars-Cov-2 Delta S-Ace2-C3                    Cong              3.20 2021-12-09   0.0000
7WK6     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Han               3.67 2022-01-08   0.0000
8TOQ     Ace2-Peptide 1 Complex                        Christie          2.30 2023-08-03   0.0000
7W9B     Sars-Cov-2 Delta S-Ace2-C2b                   Cong              3.40 2021-12-09   0.0000
7WVP     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Han               3.70 2022-02-10   0.0000
8HRU     Cryo-Em Structure Of Ace2                     Xu                3.90 2022-12-16   0.0000
7W9I     Sars-Cov-2 Delta S-Rbd-Ace2                   Cong              3.40 2021-12-09   0.0000
7VXB     Sars-Cov-2 Kappa Variant Spike Protein In ... Xu                3.90 2021-11-12   0.0000
7WVQ     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Han               4.04 2022-02-10   0.0000
7VX5     Ace2-Rbd In Sars-Cov-2 Kappa Variant S-Ac ... Xu                3.80 2021-11-12   0.0000
8HRN     Cryo-Em Structure Of Ace2                     Xu                3.90 2022-12-15   0.0000
7VXC     Sars-Cov-2 Kappa Variant Spike Protein In ... Xu                3.90 2021-11-12   0.0000
7DF4     Sars-Cov-2 S-Ace2 Complex                     Cong              3.80 2020-11-06   0.0000
8TOU     Ace2-Peptide 2 Complex Crystal Form 3         Franck            3.10 2023-08-04   0.0000
7WK4     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Han               3.69 2022-01-08   0.0000
7W98     Sars-Cov-2 Delta S-Ace2-C1                    Cong              3.60 2021-12-09   0.0000
7WK5     Cryo-Em Structure Of Omicron S-Ace2, C2 State Han               3.66 2022-01-08   0.0000
8TOR     Ace2-Peptide 2 Complex                        Christie          2.20 2023-08-03   0.0000
7VXM     Sars-Cov-2 Spike Protein In Complex With  ... Xu                3.60 2021-11-12   0.0000
7VXD     Sars-Cov-2 Spike Protein In Complex With  ... Xu                4.00 2021-11-12   0.0000
8TOS     Ace2-Peptide 6 Complex                        Christie          2.35 2023-08-03   0.0000
8E7M     Structure Of Human Ace2 Receptor In Compl ... Barnes            3.30 2022-08-24   0.0000
8S9G     Sars-Cov-2 Bn.1 Spike Rbd Bound To The Hu ... Park              3.00 2023-03-28   0.0000
8FXC     Sars-Cov-2 Bq.1.1 Spike Rbd Bound To The  ... Park              3.20 2023-01-24   0.0000
8FXB     Sars-Cov-2 Xbb.1 Spike Rbd Bound To The H ... Park              3.10 2023-01-24   0.0000
7R1A     Furin Cleaved Alpha Variant Sars-Cov-2 Sp ... Benton            3.90 2022-02-02   0.0000
7R10     Dissociated S1 Domain Of Alpha Variant Sa ... Benton            4.00 2022-02-02   0.0000
7R12     Dissociated S1 Domain Of Mink Variant Sar ... Benton            3.30 2022-02-02   0.0000
7A98     Sars-Cov-2 Spike Glycoprotein With 3 Ace2 ... Benton            5.40 2020-09-01   0.0000
7A92     Dissociated S1 Domain Of Sars-Cov-2 Spike ... Benton            4.20 2020-09-01   0.0000
7A94     Sars-Cov-2 Spike Glycoprotein With 1 Ace2 ... Benton            3.90 2020-09-01   0.0000
7R11     Dissociated S1 Domain Of Beta Variant Sar ... Benton            3.50 2022-02-02   0.0000
7A91     Dissociated S1 Domain Of Sars-Cov-2 Spike ... Benton            3.60 2020-09-01   0.0000
7A97     Sars-Cov-2 Spike Glycoprotein With 2 Ace2 ... Benton            4.40 2020-09-01   0.0000
7R0Z     Dissociated S1 Domain Of Alpha Variant Sa ... Benton            3.50 2022-02-02   0.0000
7A95     Sars-Cov-2 Spike Glycoprotein With 1 Ace2 ... Benton            4.30 2020-09-01   0.0000
7A96     Sars-Cov-2 Spike Glycoprotein With 1 Ace2 ... Benton            4.80 2020-09-01   0.0000
7CT5     S Protein Of Sars-Cov-2 In Complex Bound  ... Guo               4.00 2020-08-18   0.0000
7FEM     Sars-Cov-2 B.1.1.7 S-Ace2 Complex             Wen               4.10 2021-07-21   0.0000
8I93     Ace2-B0at1 Complex Bound With Methionine      Li                3.10 2023-02-06   0.0000
7WPC     The Second Rbd Of Sars-Cov-2 Omicron Vari ... Yin               2.57 2022-01-23   0.0000
7XO9     Sars-Cov-2 Omicron Ba.2 Variant Rbd Compl ... Xu                3.00 2022-05-01   0.0000
7XO8     Sars-Cov-2 Omicron Ba.2 Variant Spike Tri ... Xu                3.48 2022-05-01   0.0000
7L7F     Cryo-Em Structure Of Human Ace2 Receptor  ... Lees              3.24 2020-12-28   0.0000
7XO7     Sars-Cov-2 Omicron Ba.2 Variant Spike Tri ... Xu                3.38 2022-05-01   0.0000
8WRH     Sars-Cov-2 Xbb.1.5.70 In Complex With Ace2    Feng              3.08 2023-10-14   0.0000
8DF5     Sars-Cov-2 Beta Rbd In Complex With Human ... Mccallum          2.70 2022-06-21   0.0000
7DQA     Cryo-Em Structure Of Sars-Cov2 Rbd-Ace2 C ... Wang              2.80 2020-12-22   0.0000
7WPA     Sars-Cov-2 Omicron Variant Spike Trimer C ... Yin               2.77 2022-01-23   0.0000
7WPB     Sars-Cov-2 Omicron Variant Rbd Complexed  ... Yin               2.79 2022-01-23   0.0000
8WTD     Xbb.1.5.10 Rbd In Complex With Ace2           Feng              3.06 2023-10-18   0.0000
6M1D     Ace2-B0at1 Complex, Open Conformation         Yan               4.50 2020-02-25   0.0000
6M17     The 2019-Ncov Rbd/Ace2-B0at1 Complex          Yan               2.90 2020-02-24   0.0000
6M18     Ace2-B0at1 Complex                            Yan               2.90 2020-02-25   0.0000
7DX7     Trypsin-Digested S Protein Of Sars-Cov-2  ... Yan               3.40 2021-01-18   0.0000
7DX9     Trypsin-Digested S Protein Of Sars-Cov-2  ... Yan               3.60 2021-01-18   0.0000
7DX5     S Protein Of Sars-Cov-2 Bound With Pd Of  ... Yan               3.30 2021-01-18   0.0000
7DWX     Conformation 1 Of S-Ace2-B0at1 Ternary Co ... Yan               8.30 2021-01-18   0.0000
7V61     Ace2 -Targeting Monoclonal Antibody As Po ... Yan               3.20 2021-08-18   0.0000
7XID     S-Ecd (Omicron) In Complex With Pd Of Ace2    Li                3.30 2022-04-12   0.0000
7DX8     Trypsin-Digested S Protein Of Sars-Cov-2  ... Yan               2.90 2021-01-18   0.0000
7DX6     S Protein Of Sars-Cov-2 Bound With Pd Of  ... Yan               3.00 2021-01-18   0.0000
7Y76     Sit1-Ace2-Ba.5 Rbd                            Shen              3.20 2022-06-21   0.0000
7Y75     Sit1-Ace2-Ba.2 Rbd                            Shen              3.10 2022-06-21   0.0000
8I91     Ace2-Sit1 Complex Bound With Proline          Li                3.30 2023-02-06   0.0000
8I92     Ace2-B0at1 Complex Bound With Glutamine       Li                3.20 2023-02-06   0.0000
7V8A     Cryo-Em Structure Of Sars-Cov-2 S-Delta V ... Yang              2.70 2021-08-22   0.0000
7V89     Cryo-Em Structure Of Sars-Cov-2 S-Delta V ... Yang              2.80 2021-08-22   0.0000
7V81     Cryo-Em Structure Of Sars-Cov-2 S-Gamma V ... Yang              3.20 2021-08-22   0.0000
7V86     Cryo-Em Structure Of Sars-Cov-2 S-Kappa V ... Yang              2.80 2021-08-22   0.0000
7V82     Cryo-Em Structure Of Sars-Cov-2 S-Gamma V ... Yang              2.80 2021-08-22   0.0000
7V87     Local Refinement Of Sars-Cov-2 S-Kappa Va ... Yang              3.30 2021-08-22   0.0000
7V8B     Local Refinement Of Sars-Cov-2 S-Delta Va ... Yang              3.20 2021-08-22   0.0000
7V85     Cryo-Em Structure Of Sars-Cov-2 S-Kappa V ... Yang              3.30 2021-08-22   0.0000
7EDJ     Cryo-Em Structure Of Sars-Cov-2 S-Uk Vari ... Yang              3.30 2021-03-16   0.0000
7V88     Cryo-Em Structure Of Sars-Cov-2 S-Delta V ... Yang              3.30 2021-08-22   0.0000
7V80     Local Refinement Of Sars-Cov-2 S-Beta Var ... Yang              3.90 2021-08-22   0.0000
7V7Z     Cryo-Em Structure Of Sars-Cov-2 S-Beta Va ... Yang              3.10 2021-08-22   0.0000
7V83     Cryo-Em Structure Of Sars-Cov-2 S-Gamma V ... Yang              2.80 2021-08-22   0.0000
7V84     Local Refinement Of Sars-Cov-2 S-Gamma Va ... Yang              3.00 2021-08-22   0.0000
8AQS     Ba.4/5 Sars-Cov-2 Spike Bound To Human Ac ... Lau               2.92 2022-08-13   0.0000
7WNM     Structure Of Sars-Cov-2 Gamma Variant Rec ... Ma                2.70 2022-01-18   0.0000
7EFR     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Lu                2.49 2021-03-23   0.0000
8JJE     Rbd Of Sars-Cov2 Spike Protein With Ace2  ... Kishikawa         3.40 2023-05-30   0.0000
8HFY     Sars-Cov-2 Omicron Ba.1 Spike Protein Rec ... Han               3.21 2022-11-13   0.0000
8HFX     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Han               2.98 2022-11-13   0.0000
8HG0     Cryo-Em Structure Of Sars-Cov-2 Prototype ... Han               3.51 2022-11-13   0.0000
8IFY     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Han               2.55 2023-02-20   0.0000
8IFZ     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Han               2.85 2023-02-20   0.0000
8HFZ     Cryo-Em Structure Of Sars-Cov-2 Prototype ... Han               2.71 2022-11-13   0.0000
7DMU     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Arimori           3.20 2020-12-07   0.0000
8KC2     Cryo-Em Structure Of Sars-Cov-2 Ba.3 Rbd  ... Niu               2.60 2023-08-05   0.0000
8KA8     Cryo-Em Structure Of Sars-Cov-2 Delta Rbd ... Niu               2.96 2023-08-02   0.0000
7YV8     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhao              2.94 2022-08-18   0.0000
8DV2     Sars-Cov-2 Wuhan-Hu-1-Spike-Rbd Bound To  ... Qcrg Structur ... 3.50 2022-07-27   0.0000
7WSE     Cryo-Em Structure Of Sars-Cov-2 Spike Rec ... Li                2.93 2022-01-29   0.0000
7WSF     Cryo-Em Structure Of Sars-Cov Spike Recep ... Li                2.87 2022-01-29   0.0000
8DV1     Sars-Cov-2 Wuhan-Hu-1-Spike-Rbd Bound To  ... Qcrg Structur ... 3.40 2022-07-27   0.0000
7C8D     Cryo-Em Structure Of Cat Ace2 And Sars-Co ... Gao               3.00 2020-05-29   0.0000
7YVU     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhao              3.20 2022-08-19   0.0000
7UFL     Crystal Structure Of Chimeric Omicron Rbd ... Zhang             2.84 2022-03-22   0.0000
8GRY     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhao              3.29 2022-09-03   0.0000
7WRI     Cryo-Em Structure Of Sars-Cov-2 Omicron S ... Han               3.03 2022-01-26   0.0000
7WRH     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Han               2.66 2022-01-26   0.0000
8DM9     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhu               2.56 2022-07-08   0.0000
8VKL     Cryo-Em Structure Of Sars-Cov-2 Xbb.1.5 S ... Zhu               2.91 2024-01-09   0.0000
8DM7     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhu               2.49 2022-07-08   0.0000
8DMA     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhu               2.79 2022-07-08   0.0000
8VKN     Cryo-Em Structure Of Sars-Cov-2 Xbb.1.5 S ... Zhu               2.93 2024-01-09   0.0000
8VKM     Cryo-Em Structure Of Sars-Cov-2 Xbb.1.5 S ... Zhu               2.83 2024-01-09   0.0000
8DM8     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Zhu               2.68 2022-07-08   0.0000
7FDK     Sars-Cov-2 Spike Rbdmacsp36 Binding To Mace2  Wang              3.69 2021-07-16   0.0000
7XOB     Sars-Cov-2 Omicron Ba.2 Variant Spike Tri ... Xu                3.30 2022-05-01   0.0000
7XOC     Sars-Cov-2 Omicron Ba.2 Variant Rbd Compl ... Xu                3.00 2022-05-01   0.0000
7XO6     Sars-Cov-2 Omicron Ba.1 Variant Rbd With  ... Xu                2.60 2022-05-01   0.0000
7XO5     Sars-Cov-2 Omicron Ba.1 Variant Spike Tri ... Xu                3.13 2022-05-01   0.0000
7XOA     Sars-Cov-2 Omicron Ba.2 Variant Spike Tri ... Xu                3.20 2022-05-01   0.0000
7XO4     Sars-Cov-2 Omicron Ba.1 Variant Spike Tri ... Xu                3.24 2022-04-30   0.0000
8HXK     Banal-20-236 S1 In Complex With R. Affini ... Wang              3.80 2023-01-04   0.0000
8AQW     Ba.4/5 Sars-Cov-2 Spike Bound To Mouse Ac ... Lau               3.30 2022-08-13   0.0000
8AQT     Beta Sars-Cov-2 Spike Bound To Mouse Ace2 ... Lau               4.40 2022-08-13   0.0000
8AQV     Ba.2.12.1 Sars-Cov-2 Spike Bound To Mouse ... Lau               2.96 2022-08-13   0.0000
8AQU     Ba.1 Sars-Cov-2 Spike Bound To Mouse Ace2 ... Lau               3.22 2022-08-13   0.0000
7DHX     Crystal Structure Of Sars-Cov-2 Rbd Bindi ... Wang              2.30 2020-11-17   0.0000
8WOX     Cryo-Em Structure Of Sars-Cov-2 Prototype ... Li                2.75 2023-10-08   0.0000
8WOY     Cryo-Em Structure Of Sars-Cov-2 Omicron B ... Li                3.14 2023-10-08   0.0000
8WOZ     Cryo-Em Structure Of Sars-Cov Rbd In Comp ... Li                3.25 2023-10-08   0.0000
7F5R     Crystal Structure Of Sars-Cov-2 Y453f-Rbd ... Wang              3.01 2021-06-22   0.0000
7WA3     Structure Of American Mink Ace2               Su                2.28 2021-12-11   0.0000
7WA1     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Su                2.90 2021-12-11   0.0000
7W8S     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Su                2.85 2021-12-08   0.0000
8T20     Cryo-Em Structure Of Mink Variant Y453f T ... Ahn               3.36 2023-06-05   0.0000
8TAZ     Cryo-Em Structure Of Mink Variant Y453f T ... Ahn               3.75 2023-06-28   0.0000
8T23     Cryo-Em Structure Of Rbd-Ace2 Interface O ... Ahn               3.87 2023-06-05   0.0000
8T22     Cryo-Em Structure Of Mink Variant Y453f T ... Ahn               3.83 2023-06-05   0.0000
8T25     Cryo-Em Structure Of Rbd-Ace2 Interface O ... Ahn               3.62 2023-06-05   0.0000
7C8K     Structural Basis For Cross-Species Recogn ... Liu               3.20 2020-06-02   0.0000
7C8J     Structural Basis For Cross-Species Recogn ... Liu               3.18 2020-06-01   0.0000
7WSH     Cryo-Em Structure Of Sars-Cov-2 Spike Rec ... Li                2.89 2022-01-29   0.0000
7WSG     Cryo-Em Structure Of Sars-Cov Spike Recep ... Li                3.03 2022-01-29   0.0000
3D0G     Crystal Structure Of Spike Protein Recept ... Li                2.80 2008-05-01   0.0000
3D0I     Crystal Structure Of Spike Protein Recept ... Li                2.90 2008-05-01   0.0000
3D0H     Crystal Structure Of Spike Protein Recept ... Li                3.10 2008-05-01   0.0000
7WSK     Crystal Structure Of Sars-Cov-2 Omicron S ... Huang             3.30 2022-01-29   0.0000
3SCL     Crystal Structure Of Spike Protein Recept ... Wu                3.00 2011-06-07   0.0000
3SCK     Crystal Structure Of Spike Protein Recept ... Wu                3.00 2011-06-07   0.0000
7E3J     Crystal Structure Of Sars-Cov-2 Rbd Bindi ... Zhang             2.99 2021-02-08   0.0000
7XA7     Crystal Structure Of Sars-Cov-2 Receptor- ... Tang              3.31 2022-03-17   0.0000
7P55     NMR Structure Of Human Ace2 21-42 Fragmen ... Santoro                2021-07-14   0.0000
7FC3     Structure Of Nl63 Receptor-Binding Domain ... Wang              3.19 2021-07-13   0.0000
7FC6     Crystal Structure Of Sars-Cov Rbd And Hor ... Wang              2.66 2021-07-13   0.0000
7FC5     Crystal Structure Of Sars-Cov-2 Rbd And H ... Wang              2.89 2021-07-13   0.0000
7W6U     Structure Of Sars-Cov-2 Spike Receptor-Bi ... Xu                2.56 2021-12-02   0.0000
7W6R     Structure Of Bat Coronavirus Ratg13 Spike ... Xu                2.60 2021-12-02   0.0000
7XBY     The Crystal Structure Of Sars-Cov-2 Omicr ... Xu                2.85 2022-03-22   0.0000
7WPZ     Structure Of Pdf-2180-Cov Rbd Binding To  ... Cao               3.80 2022-01-24   0.0000
7WPO     Structure Of Neocov Rbd Binding To Bat37 Ace2 Cao               3.50 2022-01-24   0.0000
8U0T     Prd-0038 Rbd Bound To Rhinolophus Alcyone ... Park              3.20 2023-08-29   0.0000
7KL9     Structure Of Sars-Cov-2 S 6p Trimer In Co ... Barnes            4.10 2020-10-29   0.0120
2C6N     Structure Of Human Somatic Angiontensin-I ... Corradi           3.00 2005-11-10   0.3600
2C6F     Structure Of Human Somatic Angiontensin-I ... Corradi           3.01 2005-11-09   0.3600
4BZS     Human Angiotenisn Converting Enzyme N-Dom ... Kramer            2.10 2013-07-29   0.3700
7Q3Y     Structure Of Full-Length, Monomeric, Solu ... Lubbe             4.34 2021-10-29   0.8000
7Q49     Local Refinement Structure Of N-Domain Of ... Lubbe             3.72 2021-10-29   0.8000
7Q4C     Local Refinement Structure Of C-Domain Of ... Lubbe             4.08 2021-10-30   0.8000
7Q4D     Local Refinement Structure Of Two Interac ... Lubbe             3.78 2021-10-30   0.8000
7Q4E     Local Refinement Structure Of A Single N- ... Lubbe             3.63 2021-10-30   0.8000
2XYD     Human Angiotenisn Converting Enzyme N-Dom ... Akif              2.15 2010-11-17   2.1000
4CA6     Human Angiotensin Converting Enzyme N-Dom ... Masuyer           1.91 2013-10-07   2.1000
7Z6Z     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.75 2022-03-14   2.1000
8QHL     Human Angiotensin-1 Converting Enzyme N-D ... Gregory           1.90 2023-09-08   2.1000
8QFX     Human Angiotensin-1 Converting Enzyme N-D ... Gregory           1.60 2023-09-05   2.1000
5AMA     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.80 2015-03-10   2.2000
5AM8     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.90 2015-03-10   2.2000
6F9R     Crystal Structure Of Human Angiotensin-1  ... Cozier            1.85 2017-12-15   2.2000
6EN5     Crystal Structure A Of Angiotensin-1 Conv ... Cozier            1.75 2017-10-04   2.2000
6TT3     Crystal Structure Of 'Res_s2 Mutant Human ... Cozier            1.70 2019-12-23   2.2000
5AM9     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.80 2015-03-10   2.2000
4BXK     Crystal Structure Of Angiotensin-1 Conver ... Douglas           2.20 2013-07-12   2.2000
4UFA     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.80 2015-03-16   2.2000
5AMB     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.55 2015-03-10   2.2000
6ZPQ     Crystal Structure Of Open Conformation Of ... Cozier            1.85 2020-07-09   2.2000
4UFB     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.80 2015-03-16   2.2000
5AMC     Crystal Structure Of Angiotensin-1 Conver ... Masuyer           1.65 2015-03-10   2.2000
7Q24     Crystal Structure Of Angiotensin-1 Conver ... Cozier            2.00 2021-10-23   2.2000
6QS1     Crystal Structure Of Human Angiotensin-1  ... Cozier            1.80 2019-02-20   2.2000
6EN6     Crystal Structure B Of Angiotensin-1 Conv ... Cozier            1.80 2017-10-04   2.2000
6F9V     Crystal Structure Of Human Angiotensin-1  ... Cozier            1.69 2017-12-15   2.2000
6TT4     Crystal Structure Of 'Res_s2 Mutant Human ... Cozier            1.80 2019-12-23   2.2000
7Q25     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.60 2021-10-23   2.2000
6TT1     Crystal Structure Of 'Res_s2 Mutant Human ... Cozier            1.80 2019-12-23   2.2000
6H5X     Crystal Structure Of Human Angiotensin-1  ... Cozier            1.80 2018-07-25   2.2000
6ZPT     Crystal Structure Of Open Conformation Of ... Cozier            2.80 2020-07-09   2.2000
7Q26     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.70 2021-10-23   2.2000
3NXQ     Angiotensin Converting Enzyme N Domain Gl ... Anthony           1.99 2010-07-14   2.2000
2XY9     Human Angiotensin Converting Enzyme In Co ... Akif              1.97 2010-11-16   3.3000
4BZR     Human Testis Angiotensin Converting Enzym ... Kramer            1.84 2013-07-29   3.3000
4C2Q     Crystal Structure Of Human Testis Angiote ... Masuyer           2.40 2013-08-19   3.3000
4APH     Human Angiotensin-Converting Enzyme In Co ... Masuyer           1.99 2012-04-03   3.3000
4CA5     Human Angiotensin Converting Enzyme In Co ... Masuyer           1.85 2013-10-07   3.3000
4C2P     Crystal Structure Of Human Testis Angiote ... Masuyer           1.99 2013-08-19   3.3000
4C2O     Crystal Structure Of Human Testis Angiote ... Masuyer           1.80 2013-08-19   3.3000
1UZF     Complex Of Anti-Hypertensive Drug Captopr ... Natesh            2.00 2004-03-11   3.3000
2YDM     Structural Characterization Of Angiotensi ... Akif              2.44 2011-03-22   3.3000
1UZE     Complex Of Anti-Hypertensive Drug Enalapr ... Natesh            1.82 2004-03-11   3.3000
4C2N     Crystal Structure Of Human Testis Angiote ... Masuyer           2.59 2013-08-19   3.3000
1O8A     Crystal Structure Of Human Angiotensin Co ... Natesh            2.00 2002-11-26   3.3000
1O86     Crystal Structure Of Human Angiotensin Co ... Natesh            2.00 2002-11-25   3.3000
4APJ     Human Angiotensin-Converting Enzyme In Co ... Masuyer           2.60 2012-04-03   3.3000
4C2R     Crystal Structure Of Human Testis Angiote ... Masuyer           2.30 2013-08-19   3.3000
2IUL     Human Tace G13 Mutant                         Watermeyer        2.01 2006-06-06   3.3000
2OC2     Structure Of Testis Ace With Rxpa380          Corradi           2.25 2006-12-20   3.3000
2IUX     Human Tace Mutant G1234                       Watermeyer        2.80 2006-06-07   3.3000
6F9U     Crystal Structure Of Human Testis Angiote ... Cozier            1.90 2017-12-15   4.3000
3L3N     Testis Ace Co-Crystal Structure With Nove ... Watermeyer        2.30 2009-12-17   4.3000
6H5W     Crystal Structure Of Human Angiotensin-1  ... Cozier            1.37 2018-07-25   4.3000
6F9T     Crystal Structure Of Human Testis Angiote ... Cozier            1.60 2017-12-15   4.3000
3BKK     Tesis Ace Co-Crystal Structure With Keton ... Watermeyer        2.17 2007-12-07   4.3000
3BKL     Testis Ace Co-Crystal Structure With Keto ... Watermeyer        2.18 2007-12-07   4.3000
7Q29     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.60 2021-10-23   4.3000
7Q28     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.65 2021-10-23   4.3000
6ZPU     Crystal Structure Of Angiotensin-1 Conver ... Cozier            2.00 2020-07-09   4.3000
7Q27     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.50 2021-10-23   4.3000
7Z70     Crystal Structure Of Angiotensin-1 Conver ... Cozier            1.85 2022-03-14   4.3000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science