# OCA database search on: Sat Apr 20 05:22:02 2024 # Query: ev=10&ex=any&fa=FQSVSNRIIDMKLRLEQCRLMLYRACWKHDQ&m=du # Hits: 24 (search time 5 sec) 5ZW0 Apo-Form Piga Lee 2.54 2018-05-14 0.0000 5ZW7 Fad-Piga Complex At 1.3 A Lee 1.30 2018-05-14 0.0000 5ZW2 Fad Complex Of Piga Lee 1.80 2018-05-14 0.0000 5ZW8 Piga With Fad And Proline Lee 1.69 2018-05-14 0.0000 6AF6 Piga With Fad And Proline Lee 1.62 2018-08-08 0.0000 6CXT Crystal Structure Of Fad-Dependent Dehydr ... Agarwal 1.90 2018-04-04 0.0000 6CY8 Crystal Structure Of Fad-Dependent Dehydr ... Agarwal 2.73 2018-04-05 0.0000 4IRN Crystal Structure Of Prolyl Acyl Carrier ... Moncoq 2.80 2013-01-15 0.0055 1BUC Three-Dimensional Structure Of Butyryl-Co ... Djordjevic 2.50 1994-09-06 0.1100 1UKW Crystal Structure Of Medium-Chain Acyl-Co ... Hamada 2.40 2003-09-02 0.2300 3D9F Nitroalkane Oxidase: Active Site Mutant S ... Heroux 2.20 2008-05-27 0.3500 3D9E Nitroalkane Oxidase: Active Site Mutant D ... Heroux 2.20 2008-05-27 0.3500 3FCJ Nitroalkane Oxidase: Mutant402n Crystalli ... Major 2.40 2008-11-21 0.3500 3D9D Nitroalkane Oxidase: Mutant D402n Crystal ... Heroux 2.10 2008-05-27 0.3500 3D9G Nitroalkane Oxidase: Wild Type Crystalliz ... Heroux 2.15 2008-05-27 0.3500 2C12 Crystal Structure Of Nitroalkane Oxidase ... Nagpal 2.07 2005-09-10 0.3500 2REH Mechanistic And Structural Analyses Of Ro ... Fitzpatrick 2.40 2007-09-26 0.3500 2C0U Crystal Structure Of A Covalent Complex O ... Nagpal 2.20 2005-09-07 0.3500 2ZAF Mechanistic And Structural Analyses Of Ro ... Fitzpatrick 2.50 2007-10-05 0.3500 5IDU Crystal Structure Of An Acyl-Coa Dehydrog ... Seattle Struc ... 1.95 2016-02-24 0.9000 5JSC Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 1.50 2016-05-07 1.2000 3MDE Crystal Structures Of Medium Chain Acyl-C ... Kim 2.40 1994-07-13 8.3000 3MDD Crystal Structures Of Medium Chain Acyl-C ... Kim 2.40 1994-07-13 8.3000 1UDY Medium-Chain Acyl-Coa Dehydrogenase With ... Satoh 2.40 2003-05-07 8.6000
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |