# OCA database search on: Thu Sep 21 14:33:12 2023
# Query: ev=10&ex=any&fa=FQSVSNRIIDMKLRLEQCRLMLYRACWKHDQ&m=du
# Hits: 24 (search time 3 sec)
5ZW0     Apo-Form Piga                                 Lee               2.54 2018-05-14   0.0000
5ZW8     Piga With Fad And Proline                     Lee               1.69 2018-05-14   0.0000
6AF6     Piga With Fad And Proline                     Lee               1.62 2018-08-08   0.0000
5ZW2     Fad Complex Of Piga                           Lee               1.80 2018-05-14   0.0000
5ZW7     Fad-Piga Complex At 1.3 A                     Lee               1.30 2018-05-14   0.0000
6CY8     Crystal Structure Of Fad-Dependent Dehydr ... Agarwal           2.73 2018-04-05   0.0000
6CXT     Crystal Structure Of Fad-Dependent Dehydr ... Agarwal           1.90 2018-04-04   0.0000
4IRN     Crystal Structure Of Prolyl Acyl Carrier  ... Moncoq            2.80 2013-01-15   0.0050
1BUC     Three-Dimensional Structure Of Butyryl-Co ... Djordjevic        2.50 1994-09-06   0.0980
1UKW     Crystal Structure Of Medium-Chain Acyl-Co ... Hamada            2.40 2003-09-02   0.2100
3D9F     Nitroalkane Oxidase: Active Site Mutant S ... Heroux            2.20 2008-05-27   0.3200
3D9E     Nitroalkane Oxidase: Active Site Mutant D ... Heroux            2.20 2008-05-27   0.3200
3D9D     Nitroalkane Oxidase: Mutant D402n Crystal ... Heroux            2.10 2008-05-27   0.3200
3D9G     Nitroalkane Oxidase: Wild Type Crystalliz ... Heroux            2.15 2008-05-27   0.3200
3FCJ     Nitroalkane Oxidase: Mutant402n Crystalli ... Major             2.40 2008-11-21   0.3200
2REH     Mechanistic And Structural Analyses Of Ro ... Fitzpatrick       2.40 2007-09-26   0.3200
2ZAF     Mechanistic And Structural Analyses Of Ro ... Fitzpatrick       2.50 2007-10-05   0.3200
2C0U     Crystal Structure Of A Covalent Complex O ... Nagpal            2.20 2005-09-07   0.3200
2C12     Crystal Structure Of Nitroalkane Oxidase  ... Nagpal            2.07 2005-09-10   0.3200
5IDU     Crystal Structure Of An Acyl-Coa Dehydrog ... Seattle Struc ... 1.95 2016-02-24   0.8200
5JSC     Crystal Structure Of A Putative Acyl-Coa  ... Seattle Struc ... 1.50 2016-05-07   1.1000
3MDE     Crystal Structures Of Medium Chain Acyl-C ... Kim               2.40 1994-07-13   7.6000
3MDD     Crystal Structures Of Medium Chain Acyl-C ... Kim               2.40 1994-07-13   7.6000
1UDY     Medium-Chain Acyl-Coa Dehydrogenase With  ... Satoh             2.40 2003-05-07   7.9000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science