# OCA database search on: Sun Feb 25 20:28:20 2024
# Query: ev=10&ex=any&fa=KSVREAAERMAFNMPVQGTAADLMKLAMVKLFPRLEE&m=du
# Hits: 244 (search time 3 sec)
2KTQ     Open Ternary Complex Of Large Fragment Of ... Li                2.30 1998-07-30   0.0000
1QSY     Ddatp-Trapped Closed Ternary Complex Of L ... Li                2.30 1999-06-24   0.0000
5YTF     Structure Of Large Fragment Of DNA Polyme ... Zeng              1.98 2017-11-17   0.0000
5YTH     Structure Of Large Fragment Of DNA Polyme ... Zeng              2.53 2017-11-17   0.0000
4KTQ     Binary Complex Of Large Fragment Of DNA P ... Li                2.50 1998-09-09   0.0000
1QTM     Ddttp-Trapped Closed Ternary Complex Of L ... Li                2.30 1999-06-28   0.0000
5YTD     Large Fragment Of DNA Polymerase I From T ... Zeng              2.00 2017-11-17   0.0000
5YTC     Large Fragment Of DNA Polymerase I From T ... Zeng              2.28 2017-11-17   0.0000
5YTG     Structure Of Large Fragment Of DNA Polyme ... Zeng              2.07 2017-11-17   0.0000
1QSS     Ddgtp-Trapped Closed Ternary Complex Of L ... Li                2.30 1999-06-23   0.0000
5YTE     Large Fragment Of DNA Polymerase I From T ... Zeng              2.21 2017-11-17   0.0000
5Z3N     Structure Of Large Fragment Of DNA Polyme ... Zeng              1.91 2018-01-08   0.0000
4XIU     Binary Complex Structure Of Klenow Fragme ... Wu                2.50 2015-01-07   0.0000
4DF4     Crystal Structure Of Large Fragment Of DN ... Bergen            2.20 2012-01-23   0.0000
3RTV     Crystal Structure Of Large Fragment Of DN ... Marx              1.90 2011-05-04   0.0000
5W6Q     Structural Basis For Recognition Of Artif ... Singh             2.66 2017-06-16   0.0000
5SZT     Crystal Structure Of Large Fragment Of DN ... Hottin            1.80 2016-08-15   0.0000
3SV3     Crystal Structure Of Large Fragment Of DN ... Betz              2.10 2011-07-12   0.0000
3LWM     Structure Of Large Fragment Of Thermus Aq ... Marx              2.19 2010-02-24   0.0000
4DFM     Crystal Structure Of Large Fragment Of DN ... Bergen            1.89 2012-01-24   0.0000
4DF8     Crystal Structure Of Large Fragment Of DN ... Bergen            2.00 2012-01-23   0.0000
3OJU     Snapshot Of Large Fragment Of DNA Polymer ... Marx              2.00 2010-08-23   0.0000
3SZ2     Crystal Structure Of Large Fragment Of DN ... Betz              2.15 2011-07-18   0.0000
3LWL     Structure Of Klenow Fragment Of Taq Polym ... Marx              2.25 2010-02-24   0.0000
1JXE     Stoffel Fragment Of Taq DNA Polymerase I      Oefner            2.85 1996-10-09   0.0000
3SYZ     Crystal Structure Of Large Fragment Of DN ... Betz              1.95 2011-07-18   0.0000
3T3F     Ternary Structure Of Large Fragment Of Ta ... Marx              1.90 2011-07-25   0.0000
4DFK     Large Fragment Of DNA Polymerase I From T ... Bergen            1.65 2012-01-24   0.0000
4C8N     Binary Complex Of Large Fragment Of DNA P ... Betz              1.88 2013-10-01   0.0000
4C8O     Binary Complex Of Large Fragment Of DNA P ... Betz              1.75 2013-10-01   0.0000
3RRH     Ternary Structure Of Large Fragment Of Ta ... Marx              1.80 2011-04-29   0.0000
3RRG     Ternary Structure Of Large Fragment Of Ta ... Marx              2.30 2011-04-29   0.0000
4DFP     Crystal Structure Of Large Fragment Of DN ... Bergen            2.00 2012-01-24   0.0000
3RR7     Binary Structure Of Large Fragment Of Taq ... Marx              1.95 2011-04-29   0.0000
3SV4     Crystal Structure Of Large Fragment Of DN ... Betz              1.99 2011-07-12   0.0000
4ELT     Snapshot Of Large Fragment Of DNA Polymer ... Marx              2.20 2012-04-11   0.0000
4DLG     Ternary Structure Of Large Fragment Of Ta ... Marx              1.89 2012-02-06   0.0000
3M8S     Crystal Structure Of Large Fragment Of DN ... Diederichs        2.20 2010-03-19   0.0000
4ELU     Snapshot Of Large Fragment Of DNA Polymer ... Marx              1.80 2012-04-11   0.0000
4C8L     Binary Complex Of Large Fragment Of DNA P ... Betz              1.70 2013-10-01   0.0000
5W6K     Structure Of Mutant Taq Polymerase Incorp ... Singh             2.34 2017-06-16   0.0000
3OJS     Snapshots Of Large Fragment Of DNA Polyme ... Marx              1.90 2010-08-23   0.0000
5E41     Crystal Structure Of Large Fragment Of DN ... Hottin            1.80 2015-10-05   0.0000
3M8R     Crystal Structure Of Large Fragment Of DN ... Diederichs        2.00 2010-03-19   0.0000
3KTQ     Crystal Structure Of An Active Ternary Co ... Li                2.30 1998-07-28   0.0000
4C8K     Crystal Structure Of Large Fragment Of DN ... Betz              2.17 2013-10-01   0.0000
4C8M     Binary Complex Of Large Fragment Of DNA P ... Betz              1.57 2013-10-01   0.0000
7OWF     Klentaq DNA Polymerase In A Ternary Compl ... Betz              1.91 2021-06-18   0.0000
4ELV     Snapshot Of Large Fragment Of DNA Polymer ... Marx              1.90 2012-04-11   0.0000
4DLE     Ternary Structure Of Large Fragment Of Ta ... Holzberger        2.44 2012-02-06   0.0000
4CCH     Crystal Structure Of Large Fragment Of DN ... Betz              2.55 2013-10-23   0.0000
5NKL     Crystal Structure Of Large Fragment Of DN ... Betz              1.70 2017-03-31   0.0000
3RR8     Ternary Structure Of Large Fragment Of Ta ... Marx              2.40 2011-04-29   0.0000
4DFJ     Crystal Structure Of Large Fragment Of DN ... Bergen            1.90 2012-01-23   0.0000
6FBG     Klentaq DNA Polymerase Processing A Modif ... Kropp             1.70 2017-12-19   0.0000
6FBH     Klentaq DNA Polymerase Processing A Modif ... Kropp             1.80 2017-12-19   0.0000
6FBF     Klentaq DNA Polymerase Processing A Modif ... Kropp             2.00 2017-12-19   0.0000
6FBD     Klentaq DNA Polymerase Processing A Modif ... Kropp             2.10 2017-12-19   0.0000
6FBE     Klentaq DNA Polymerase Processing A Modif ... Kropp             1.59 2017-12-19   0.0000
6FBI     Klentaq DNA Polymerase In A Closed, Terna ... Kropp             1.90 2017-12-19   0.0000
6FBC     Klentaq DNA Polymerase Processing A Modif ... Kropp             1.54 2017-12-19   0.0000
6Q4U     Klentaq DNA Pol In A Closed Ternary Compl ... Kropp             2.00 2018-12-06   0.0000
6Q4V     Klentaq DNA Polymerase In Complex With Datp   Kropp             2.01 2018-12-06   0.0000
1KTQ     DNA Polymerase                                Korolev           2.50 1995-08-16   0.0000
5KTQ     Large Fragment Of Taq DNA Polymerase Boun ... Li                2.50 1998-09-22   0.0000
4N56     Binary Complex Structure Of Klenow Fragme ... Wu                2.20 2013-10-09   0.0000
4N5S     Ternary Complex Structure Of Klenow Fragm ... Wu                1.67 2013-10-10   0.0000
1BGX     Taq Polymerase In Complex With Tp7, An In ... Murali            2.30 1998-06-02   0.0000
1TAU     Taq Polymerase /DNA/B-Octylglucoside Complex  Eom               3.00 1996-06-17   0.0000
1TAQ     Structure Of Taq DNA Polymerase               Kim               2.40 1996-06-04   0.0000
5OXJ     Crystal Structure Of Klentaq Mutant M747k ... Betz              2.00 2017-09-06   0.0000
5O7T     Crystal Structure Of Klentaq Mutant M747k ... Betz              1.80 2017-06-09   0.0000
4BWJ     Klentaq Mutant In Complex With DNA And Ddctp  Blatter           1.55 2013-07-03   0.0000
4BWM     Klentaq Mutant In Complex With A RNA/DNA  ... Blatter           1.75 2013-07-03   0.0000
3PO4     Structure Of A Mutant Of Large Fragment O ... Marx              1.80 2010-11-22   0.0000
3PY8     Crystal Structure Of A Mutant Of Large Fr ... Schnur            1.74 2010-12-12   0.0000
3PO5     Structure Of A Mutant Of Large Fragment O ... Marx              2.39 2010-11-22   0.0000
6MU4     Bst DNA Polymerase I Fana/DNA Binary Complex  Jackson           1.62 2018-10-22   0.0000
8SCT     Bst DNA Polymerase I Large Fragment Wildt ... Fang              2.34 2023-04-05   0.0000
8SCO     Bst DNA Polymerase I Large Fragment Wildt ... Fang              1.92 2023-04-05   0.0000
8SCU     Bst DNA Polymerase I Large Fragment Wildt ... Fang              2.38 2023-04-05   0.0000
6UR9     DNA Polymerase I Large Fragment From Baci ... Zhang             2.10 2019-10-22   0.0000
4DSJ     Crystal Structure Of Fragment DNA Polymer ... Gan               2.86 2012-02-19   0.0000
8SCL     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.44 2023-04-05   0.0000
3HT3     Crystal Structure Of Fragment DNA Polymer ... Wu                1.70 2009-06-11   0.0000
4DSL     Crystal Structure Of Fragment DNA Polymer ... Gan               2.45 2012-02-19   0.0000
6UR4     DNA Polymerase I Large Fragment From Baci ... Zhang             2.25 2019-10-22   0.0000
8SCI     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.67 2023-04-05   0.0000
8SCP     Bst DNA Polymerase I Large Fragment Wildt ... Fang              2.08 2023-04-05   0.0000
8SCK     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.30 2023-04-05   0.0000
8SCJ     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.68 2023-04-05   0.0000
6UR2     DNA Polymerase I Large Fragment From Baci ... Zhang             2.27 2019-10-21   0.0000
8SCR     Bst DNA Polymerase I Large Fragment Wildt ... Fang              2.00 2023-04-05   0.0000
8SCN     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.30 2023-04-05   0.0000
8SCQ     Bst DNA Polymerase I Large Fragment Wildt ... Fang              2.18 2023-04-05   0.0000
8SCG     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.00 2023-04-05   0.0000
8SCS     Bst DNA Polymerase I Large Fragment Wildt ... Fang              2.10 2023-04-05   0.0000
6US5     DNA Polymerase I Large Fragment From Baci ... Zhang             2.25 2019-10-24   0.0000
4UQG     A New Bio-Isosteric Base Pair Based On Re ... Tomas-Gamasa      2.00 2014-06-23   0.0000
8SCM     Bst DNA Polymerase I Large Fragment Mutan ... Fang              2.30 2023-04-05   0.0000
4DSK     Crystal Structure Of Fragment DNA Polymer ... Gan               2.18 2012-02-19   0.0000
2BDP     Crystal Structure Of Bacillus DNA Polymer ... Kiefer            1.80 1997-11-17   0.0000
1NJY     Thymine-Thymine Mismatch At The Polymeras ... Johnson           2.00 2003-01-02   0.0000
1NK0     Adenine-Guanine Mismatch At The Polymeras ... Johnson           1.70 2003-01-02   0.0000
2HHW     Ddttp:O6-Methyl-Guanine Pair In The Polym ... Warren            1.88 2006-06-28   0.0000
1L3T     Crystal Structure Of Bacillus DNA Polymer ... Johnson           1.70 2002-03-01   0.0000
1U49     Adenine-8oxoguanine Mismatch At The Polym ... Hsu               2.15 2004-07-23   0.0000
1L3U     Crystal Structure Of Bacillus DNA Polymer ... Johnson           1.80 2002-03-01   0.0000
2HVI     Ddctp:G Pair In The Polymerase Active Sit ... Warren            1.98 2006-07-28   0.0000
1NJZ     Cytosine-Thymine Mismatch At The Polymera ... Johnson           2.00 2003-01-02   0.0000
3BDP     DNA Polymerase I/DNA Complex                  Kiefer            1.90 1997-11-17   0.0000
7K5S     Bst DNA Polymerase I Time-Resolved Struct ... Chim              1.67 2020-09-17   0.0000
1NJW     Guanine-Thymine Mismatch At The Polymeras ... Johnson           1.90 2003-01-02   0.0000
1NK6     Cytosine-Cytosine Mismatch At The Polymer ... Johnson           2.10 2003-01-02   0.0000
3HP6     Crystal Structure Of Fragment DNA Polymer ... Wu                1.81 2009-06-03   0.0000
1NK9     A Bacillus DNA Polymerase I Product Compl ... Johnson           1.90 2003-01-02   0.0000
2XO7     Crystal Structure Of A Da:O-Allylhydroxyl ... Muenzel           2.85 2010-08-10   0.0000
1NKB     A Bacillus DNA Polymerase I Product Compl ... Johnson           2.00 2003-01-02   0.0000
4BDP     Crystal Structure Of Bacillus DNA Polymer ... Kiefer            1.80 1997-11-17   0.0000
2HHQ     O6-Methyl-Guanine:T Pair In The Polymeras ... Warren            1.80 2006-06-28   0.0000
6DSY     Bst DNA Polymerase I Post-Chemistry (N+1) ... Chim              1.98 2018-06-14   0.0000
2HW3     T:O6-Methyl-Guanine Pair In The Polymeras ... Warren            1.98 2006-07-31   0.0000
4O0I     Crystal Structure Of Fragment DNA Polymer ... Jiang             2.20 2013-12-13   0.0000
1U48     Extension Of A Cytosine-8-Oxoguanine Base ... Hsu               2.10 2004-07-23   0.0000
7K5U     Bst DNA Polymerase I Time-Resolved Struct ... Chim              2.00 2020-09-17   0.0000
1NK7     Guanine-Adenine Mismatch At The Polymeras ... Johnson           1.90 2003-01-02   0.0000
3EZ5     Cocrystal Structure Of Bacillus Fragment  ... Warren            1.90 2008-10-22   0.0000
1NKC     A Bacillus DNA Polymerase I Product Compl ... Johnson           1.80 2003-01-02   0.0000
2HHV     T:O6-Methyl-Guanine In The Polymerase-2 B ... Warren            1.55 2006-06-28   0.0000
2HVH     Ddctp:O6meg Pair In The Polymerase Active ... Warren            2.49 2006-07-28   0.0000
2HHX     O6-Methyl-Guanine In The Polymerase Templ ... Warren            2.26 2006-06-28   0.0000
1U4B     Extension Of An Adenine-8oxoguanine Mismatch  Hsu               1.60 2004-07-23   0.0000
1L5U     Crystal Structure Of Bacillus DNA Polymer ... Johnson           1.95 2002-03-08   0.0000
1UA1     Structure Of Aminofluorene Adduct Paired  ... Hsu               2.00 2004-08-11   0.0000
4YFU     Crystal Structure Of Open Bacillus Fragme ... Wu                1.50 2015-02-25   0.0000
1LV5     Crystal Structure Of Closed Conformation  ... Johnson           1.95 2002-05-24   0.0000
7K5Q     Bst DNA Polymerase I Time-Resolved Struct ... Chim              2.00 2020-09-17   0.0000
7K5R     Bst DNA Polymerase I Time-Resolved Struct ... Chim              2.30 2020-09-17   0.0000
6DSX     Bst DNA Polymerase I Post-Chemistry (N+1  ... Chim              1.99 2018-06-14   0.0000
1NKE     A Bacillus DNA Polymerase I Product Compl ... Johnson           1.80 2003-01-02   0.0000
1XWL     Bacillus Stearothermophilus (Newly Identi ... Kiefer            1.70 1998-07-22   0.0000
7K5P     Bst DNA Polymerase I Time-Resolved Struct ... Chim              1.97 2020-09-17   0.0000
6UEU     Crystal Structure Of Bf DNA Polymerase F7 ... Wu                1.80 2019-09-23   0.0000
1NJX     Thymine-Guanine Mismatch At The Polymeras ... Johnson           1.65 2003-01-02   0.0000
6DSV     Bst DNA Polymerase I Post-Chemistry (N+2) ... Chim              1.99 2018-06-14   0.0000
1NK5     Adenine-Adenine Mismatch At The Polymeras ... Johnson           2.10 2003-01-02   0.0000
2HHT     C:O6-Methyl-Guanine Pair In The Polymeras ... Warren            2.05 2006-06-28   0.0000
1NK4     Guanine-Guanine Mismatch At The Polymeras ... Johnson           1.60 2003-01-02   0.0000
1U45     8oxoguanine At The Pre-Insertion Site Of  ... Hsu               2.01 2004-07-23   0.0000
7K5T     Bst DNA Polymerase I Time-Resolved Struct ... Chim              2.30 2020-09-17   0.0000
3EYZ     Cocrystal Structure Of Bacillus Fragment  ... Warren            2.10 2008-10-22   0.0000
1UA0     Aminofluorene DNA Adduct At The Pre-Inser ... Hsu               2.10 2004-08-11   0.0000
2Y1I     Crystal Structure Of A S-Diastereomer Ana ... Heil              2.78 2010-12-08   0.0000
1XC9     Structure Of A High-Fidelity Polymerase B ... Hsu               1.90 2004-09-01   0.0000
1L3V     Crystal Structure Of Bacillus DNA Polymer ... Johnson           1.71 2002-03-01   0.0000
2HHU     C:O6-Methyl-Guanine In The Polymerase Pos ... Warren            1.80 2006-06-28   0.0000
6DSU     Bst DNA Polymerase I Pre-Insertion Comple ... Chim              1.98 2018-06-14   0.0000
3HPO     Crystal Structure Of Fragment DNA Polymer ... Wu                1.75 2009-06-04   0.0000
7K5O     Bst DNA Polymerase I Time-Resolved Struct ... Chim              2.16 2020-09-17   0.0000
6MU5     Bst DNA Polymerase I Tna/DNA Binary Complex   Jackson           1.91 2018-10-22   0.0000
1U47     Cytosine-8-Oxoguanine Base Pair At The Po ... Hsu               2.00 2004-07-23   0.0000
6DSW     Bst DNA Polymerase I Pre-Chemistry (N) St ... Chim              1.59 2018-06-14   0.0000
2HHS     O6-Methyl:C Pair In The Polymerase-10 Bas ... Warren            1.80 2006-06-28   0.0000
2Y1J     Crystal Structure Of A R-Diastereomer Ana ... Heil              2.15 2010-12-08   0.0000
1L3S     Crystal Structure Of Bacillus DNA Polymer ... Johnson           1.70 2002-03-01   0.0000
2XY7     Crystal Structure Of A Salicylic Aldehyde ... Kaul              3.05 2010-11-15   0.0000
1NK8     A Bacillus DNA Polymerase I Product Compl ... Johnson           1.90 2003-01-02   0.0000
4DSI     Crystal Structure Of Fragment DNA Polymer ... Gan               2.05 2012-02-19   0.0000
2XY6     Crystal Structure Of A Salicylic Aldehyde ... Kaul              2.30 2010-11-15   0.0000
6P5C     Bacillus Fragment DNA Polymerase Mutant I716m Wu                2.20 2019-05-30   0.0000
4DWI     Crystal Structure Of Fragment DNA Polymer ... Gan               1.85 2012-02-24   0.0000
2XY5     Crystal Structure Of An Artificial Salen- ... Kaul              2.22 2010-11-15   0.0000
3TAR     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.60 2011-08-04   0.0000
4DQQ     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.59 2012-02-16   0.0000
4F8R     Bacillus DNA Polymerase I Large Fragment  ... Wang              1.64 2012-05-17   0.0000
4DS4     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.68 2012-02-17   0.0000
3PV8     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.52 2010-12-06   0.0000
4DS5     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.68 2012-02-17   0.0000
3PX0     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.73 2010-12-09   0.0000
4F2S     DNA Polymerase I Large Fragment Complex 4     Wang              1.65 2012-05-08   0.0000
4DQR     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.95 2012-02-16   0.0000
4DQS     Binary Complex Of Bacillus DNA Polymerase ... Wang              1.66 2012-02-16   0.0000
3PX6     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.59 2010-12-09   0.0000
3THV     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.61 2011-08-19   0.0000
4F4K     DNA Polymerase I Large Fragment Complex 6     Wang              1.60 2012-05-10   0.0000
3TI0     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.62 2011-08-19   0.0000
4F3O     DNA Polymerase I Large Fragment Complex 5     Wang              1.57 2012-05-09   0.0000
3TAQ     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.65 2011-08-04   0.0000
4DQP     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.74 2012-02-16   0.0000
4DQI     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.69 2012-02-15   0.0000
3TAP     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.66 2011-08-04   0.0000
3PX4     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.58 2010-12-09   0.0000
4E0D     Binary Complex Of Bacillus DNA Polymerase ... Wang              1.58 2012-03-02   0.0000
4DSE     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.67 2012-02-18   0.0000
4EZ9     Bacillus DNA Polymerase I Large Fragment  ... Wang              1.64 2012-05-02   0.0000
4EZ6     Bacillus DNA Polymerase I Large Fragment  ... Wang              1.64 2012-05-02   0.0000
4DSF     Ternary Complex Of Bacillus DNA Polymeras ... Wang              1.66 2012-02-18   0.0000
3TAN     Crystal Structure Of Bacillus DNA Polymer ... Wang              1.53 2011-08-04   0.0000
4F2R     DNA Polymerase I Large Fragment Complex 3     Wang              1.63 2012-05-08   0.0000
4B9L     Structure Of High Fidelity DNA Polymerase ... Gehrke            2.05 2012-09-05   0.0000
4B9V     Structure Of High Fidelity DNA Polymerase ... Gehrke            2.00 2012-09-06   0.0000
4B9T     Structure Of High Fidelity DNA Polymerase ... Gehrke            2.65 2012-09-06   0.0000
4B9S     Structure Of High Fidelity DNA Polymerase ... Gehrke            1.73 2012-09-06   0.0000
4B9M     Structure Of High Fidelity DNA Polymerase ... Gehrke            2.05 2012-09-05   0.0000
4B9N     Structure Of High Fidelity DNA Polymerase ... Gehrke            2.20 2012-09-05   0.0000
4B9U     Structure Of High Fidelity DNA Polymerase ... Gehrke            2.10 2012-09-06   0.0000
6VDD     Pol Domain Of Pol1 From M. Smegmatis Comp ... Shuman            1.90 2019-12-24   0.0000
6VDC     Pol Domain Of Pol1 From M. Smegmatis          Shuman            2.40 2019-12-24   0.0000
6VDE     Full-Length M. Smegmatis Pol1                 Shuman            2.71 2019-12-24   0.0000
4XVM     Binary Complex Of Human Polymerase Nu And ... Lee               3.20 2015-01-27   0.0015
4XVK     Binary Complex Of Human Polymerase Nu And ... Lee               2.95 2015-01-27   0.0015
4XVL     Binary Complex Of Human Polymerase Nu And ... Lee               3.30 2015-01-27   0.0015
4XVI     Binary Complex Of Human Polymerase Nu And ... Lee               3.10 2015-01-27   0.0015
8OO6     Pol I Bound To Extended And Displaced DNA ... Botto             4.30 2023-04-04   0.0021
8OOY     Pol I Bound To Extended And Displaced DNA ... Botto             4.00 2023-04-06   0.0021
1KFD     Crystal Structures Of Klenow Fragment Of  ... Beese             3.90 1993-09-23   0.0021
2KFZ     Klenow Fragment With Bridging-Sulfur Subs ... Brautigam         2.03 1998-07-02   0.0021
1D8Y     Crystal Structure Of Complex Of DNA Polym ... Teplova           2.08 1999-10-26   0.0021
2KZM     Klenow Fragment With Normal Substrate And ... Brautigam         2.60 1998-07-03   0.0021
1KRP     DNA Polymerase I Klenow Fragment Mutant/D ... Brautigam         2.20 1997-08-19   0.0021
1QSL     Klenow Fragment Complexed With Single-Str ... Brautigam         2.20 1999-06-22   0.0021
2KFN     Klenow Fragment With Bridging-Sulfur Subs ... Brautigam         2.03 1998-07-01   0.0021
1DPI     Structure Of Large Fragment Of Escherichi ... Beese             2.80 1987-08-11   0.0021
1KSP     DNA Polymerase I Klenow Fragment Mutant/D ... Brautigam         2.30 1997-08-19   0.0021
1KFS     DNA Polymerase I Klenow Fragment Mutant/D ... Brautigam         2.10 1997-08-18   0.0021
1D9D     Crystall Structure Of Complex Of DNA Poly ... Teplova           2.18 1999-10-27   0.0021
1D9F     Crystal Structure Of Complex Of DNA Polym ... Teplova           3.00 1999-10-27   0.0021
2KZZ     Klenow Fragment With Normal Substrate And ... Brautigam         2.25 1998-07-07   0.0021
1KLN     DNA Polymerase I Klenow Fragment Mutant/D ... Beese             3.20 1994-05-24   0.0021
7SXL     Plasmodium Falciparum Apicoplast DNA Poly ... Nieto             2.70 2021-11-23   0.0170
7SXQ     Plasmodium Falciparum Apicoplast DNA Poly ... Nieto             2.50 2021-11-24   0.0170
5DKU     C-Terminal His Tagged Appol Exonuclease M ... Milton            2.90 2015-09-04   0.0170
5DKT     N-Terminal His Tagged Appol Exonuclease M ... Milton            2.90 2015-09-04   0.0180
8EFK     Structure Of Lates Calcarifer DNA Polymer ... Li                3.00 2022-09-08   0.0210
8EFC     Structure Of Lates Calcarifer DNA Polymer ... Li                2.80 2022-09-08   0.0210
8EF9     Structure Of Lates Calcarifer DNA Polymer ... Li                2.40 2022-09-08   0.0210
6XBU     Polymerase Domain Of Polymerase-Theta         Chen              3.29 2020-06-07   0.1000
8E23     Human DNA Polymerase Theta In Complex Wit ... Mader             2.59 2022-08-13   0.1100
8E24     Human DNA Polymerase Theta In Complex Wit ... Mader             2.34 2022-08-13   0.1100
7ZX0     Crystal Structure Of Pol Theta Polymerase ... Krajewski         2.99 2022-05-19   0.1200
7ZUS     Crystal Structure Of Ternary Complex Of P ... Krajewski         2.26 2022-05-13   0.1200
7ZX1     Crystal Structure Of Pol Theta Polymerase ... Krajewski         2.83 2022-05-19   0.1200
4X0Q     Ternary Complex Of Human DNA Polymerase T ... Zahn              3.90 2014-11-22   0.1300
4X0P     Ternary Complex Of Human DNA Polymerase T ... Zahn              3.91 2014-11-21   0.1400

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science