# OCA database search on: Fri Dec  2 10:51:44 2022
# Query: ev=10&ex=any&fa=LGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEE&m=du
# Hits: 36 (search time 2 sec)
6CM1     Mt1-Mmp Hpx Domain With Blade 2 Loop Boun ... Marcink                2018-03-02   0.0000
6CLZ     Mt1-Mmp Hpx Domain With Blade 4 Loop Boun ... Marcink                2018-03-02   0.0000
3R2P     2.2 Angstrom Crystal Structure Of C Termi ... Mei               2.20 2011-03-14   0.0000
6PTS     NMR Data-Driven Model Of Kras-Gmppnp:Rbd- ... Fang                   2019-07-16   0.0000
6PTW     NMR Data-Driven Model Of Kras-Gmppnp:Rbd- ... Fang                   2019-07-16   0.0000
6CC9     NMR Data-Driven Model Of Gtpase Kras-Gmpp ... Fang                   2018-02-06   0.0000
2MSC     NMR Data-Driven Model Of Gtpase Kras-Gdp  ... Mazhab-Jafari          2014-07-29   0.0000
7RSC     NMR-Driven Structure Of Kras4b-G12d ""Alp ... Lee                    2021-08-11   0.0000
4V6M     Structure Of Ribosome-Secye Complex In Th ... Frauenfeld        7.10 2011-02-08   0.0000
6CCH     NMR Data-Driven Model Of Gtpase Kras-Gmpp ... Fang                   2018-02-07   0.0000
2MSD     NMR Data-Driven Model Of Gtpase Kras-Gnp  ... Mazhab-Jafari          2014-07-29   0.0000
6CCX     NMR Data-Driven Model Of Gtpase Kras-Gmpp ... Fang                   2018-02-07   0.0000
2MSE     NMR Data-Driven Model Of Gtpase Kras-Gnp: ... Mazhab-Jafari          2014-07-29   0.0000
6W4E     NMR-Driven Structure Of Kras4b-Gtp Homodi ... Lee                    2020-03-10   0.0000
6W4F     NMR-Driven Structure Of Kras4b-Gdp Homodi ... Lee                    2020-03-10   0.0000
7RSE     NMR-Driven Structure Of Kras4b-G12d ""Alp ... Lee                    2021-08-11   0.0000
1AV1     Crystal Structure Of Human Apolipoprotein A-I Borhani           4.00 1997-09-23   0.0000
7KJR     Cryo-Em Structure Of Sars-Cov-2 Orf3a         Kern              0.00 2020-10-26   0.0000
3K2S     Solution Structure Of Double Super Helix  ... Wu                     2009-09-30   0.0000
2N5E     The 3D Solution Structure Of Discoidal Hi ... Bibow                  2015-07-15   0.0000
2LEM     Monomeric Mouse Apoai(1-216)                  Chen                   2011-06-17   0.0000
3S84     Dimeric Apoa-Iv                               Deng              2.40 2011-05-27   0.0010
1YA9     Crystal Structure Of 22kda N-Terminal Fra ... Peters-Libeu      2.09 2004-12-17   0.0099
1B68     Apolipoprotein E4 (Apoe4), 22k Fragment       Rupp              2.00 1999-01-21   0.0290
1NFN     Apolipoprotein E3 (Apoe3)                     Rupp              1.80 1996-07-17   0.0700
7FCR     Crystal Structure Of N-Terminal Domain Of ... Cherakara         1.40 2021-07-15   0.0710
7FCS     Crystal Structure Of N-Terminal Domain Of ... Cherakara         1.60 2021-07-15   0.0710
1NFO     Apolipoprotein E2 (Apoe2, D154a Mutation)     Rupp              2.00 1996-07-17   0.1300
1H7I     Apolipoprotein E3 22kd Fragment Lys146gln ... Rupp              1.90 2001-07-08   0.1300
1EA8     Apolipoprotein E3 22kd Fragment Lys146glu ... Rupp              1.95 2001-07-11   0.1500
2KC3     NMR Solution Structure Of Complete Recept ... Wang                   2008-12-15   0.2500
4TQL     Computationally Designed Three Helix Bundle   Nannenga          2.80 2014-06-11   2.1000
7SGS     Cryo-Em Structure Of Full-Length Map7 Bou ... Ferro             3.30 2021-10-07   5.3000
6YIP     Structure Of Mklp2 Coiled Coil                Serena            1.43 2020-04-01   5.8000
2QAG     Crystal Structure Of Human Septin Trimer  ... Sirajuddin        4.00 2007-06-15   6.4000
7M6J     Human Septin Hexameric Complex Sept2g/Sep ... Mendonca          0.00 2021-03-25   6.4000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science