# OCA database search on: Thu Apr 25 10:45:33 2024 # Query: ev=10&ex=any&fa=LQVIQFKLADMALALESARLLTWRAAMLKDN&m=du # Hits: 69 (search time 3 sec) 2VIG Crystal Structure Of Human Short-Chain Ac ... Pike 1.90 2007-11-30 0.0000 7Y0A Crystal Structure Of Human Short-Chain Ac ... Huang 2.32 2022-06-04 0.0000 7Y0B Crystal Structure Of Human Short-Chain Ac ... Huang 2.08 2022-06-04 0.0000 8SGS Human Liver Mitochondrial Short-Chain Spe ... Zhang 3.15 2023-04-13 0.0000 1JQI Crystal Structure Of Rat Short Chain Acyl ... Battaile 2.25 2001-08-07 0.0000 4L1F Electron Transferring Flavoprotein Of Aci ... Mowafy 1.79 2013-06-03 0.0004 1UKW Crystal Structure Of Medium-Chain Acyl-Co ... Hamada 2.40 2003-09-02 0.0006 6FAH Molecular Basis Of Flavin-Based Electron- ... Demmer 3.13 2017-12-15 0.0023 7P9X Structure Of Cyclohex-1-Ene-1-Carboxyl-Co ... Ermler 1.65 2021-07-28 0.0033 7P98 Cyclohex-1-Ene-1-Carboxyl-Coa Dehydrogena ... Ermler 2.00 2021-07-26 0.0033 7P9A Structure Of Cyclohex-1-Ene-1-Carboxyl-Co ... Ermler 1.50 2021-07-26 0.0033 5IDU Crystal Structure Of An Acyl-Coa Dehydrog ... Seattle Struc ... 1.95 2016-02-24 0.0043 5JSC Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 1.50 2016-05-07 0.0056 2CX9 Crystal Structure Of Acyl-Coa Dehydrogenase Murayama 2.00 2005-06-28 0.0200 1WS9 Crystal Structure Of Project Id Tt0172 Fr ... Shimizu 2.30 2004-11-02 0.0200 2D29 Structural Study On Project Id Tt0172 Fro ... Shimizu 1.65 2005-09-05 0.0200 3PFD Crystal Structure Of An Acyl-Coa Dehydrog ... Seattle Struc ... 2.10 2010-10-28 0.0200 1BUC Three-Dimensional Structure Of Butyryl-Co ... Djordjevic 2.50 1994-09-06 0.0450 4N5F Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 2.20 2013-10-09 0.0450 5OL2 The Electron Transferring Flavoprotein/Bu ... Demmer 3.10 2017-07-26 0.0570 4U83 Structure Of Brucella Abortus Butyryl-Coa ... Seattle Struc ... 1.80 2014-07-31 0.0580 7W0J Acyl-Coa Dehydrogenase, Tfu_1647 Liu 3.13 2021-11-18 0.0590 8I4P Crystal Structure Of Acyl-Coa Dehydrogena ... Choi 1.90 2023-01-20 0.0600 8I4R Crystal Structure Of Acyl-Coa Dehydrogena ... Choi 2.51 2023-01-20 0.0600 6CXT Crystal Structure Of Fad-Dependent Dehydr ... Agarwal 1.90 2018-04-04 0.1700 6CY8 Crystal Structure Of Fad-Dependent Dehydr ... Agarwal 2.73 2018-04-05 0.1700 5LNX Crystal Structure Of Mmgc, An Acyl-Coa De ... Baker 2.60 2016-08-07 0.2200 3MPI Structure Of Glutaryl-Coenzyme A Dehydrog ... Wischgoll 2.05 2010-04-27 0.4000 3MPJ Structure Of Glutaryl-Coenzyme A Dehydrog ... Wischgoll 2.10 2010-04-27 0.4000 2DVL Crystal Structure Of Project Tt0160 From ... Shimizu 2.50 2006-07-31 0.6400 3MDD Crystal Structures Of Medium Chain Acyl-C ... Kim 2.40 1994-07-13 0.6700 4M9A Crystal Structure Of Acyl-Coa Dehydrogena ... Seattle Struc ... 2.20 2013-08-14 0.6700 3MDE Crystal Structures Of Medium Chain Acyl-C ... Kim 2.40 1994-07-13 0.6700 1RX0 Crystal Structure Of Isobutyryl-Coa Dehyd ... Battaile 1.77 2003-12-18 0.6800 1UDY Medium-Chain Acyl-Coa Dehydrogenase With ... Satoh 2.40 2003-05-07 0.6900 2EBA Crystal Structure Of Putative Glutaryl-Co ... Kumarevel 2.21 2007-02-07 0.8700 4P13 Medium Chain Acyl-Coa Dehydrogenase, K304 ... Battaile 1.73 2014-02-24 1.5000 1EGE Structure Of T255e, E376g Mutant Of Human ... Lee 2.75 1996-04-11 1.6000 1T9G Structure Of Human Mcad:Etf Complex Toogood 2.90 2004-05-17 1.6000 1EGC Structure Of T255e, E376g Mutant Of Human ... Lee 2.60 1996-04-11 1.6000 1EGD Structure Of T255e, E376g Mutant Of Human ... Lee 2.40 1996-04-11 1.6000 2JIF Structure Of Human Short-Branched Chain A ... Pike 2.00 2007-02-28 1.6000 2A1T Structure Of Human Mcad:Etf E165betaa Complex Toogood 2.80 2005-06-21 1.7000 8SGP Human Liver Mitochondrial Medium-Chain Sp ... Zhang 2.69 2023-04-12 1.7000 7MDX Lolcde Nucleotide-Free Sharma 3.80 2021-04-06 3.5000 7ARH Lolcde In Complex With Lipoprotein Tang 3.30 2020-10-25 3.5000 7ARJ Lolcde In Complex With Lipoprotein And Am ... Tang 3.20 2020-10-25 3.5000 7ARM Lolcde In Complex With Lipoprotein And Lola Tang 3.60 2020-10-25 3.5000 7V8M Lolcde-Apo In Nanodiscs Luo 4.20 2021-08-23 3.5000 7ARI Lolcde Apo Structure Tang 3.40 2020-10-25 3.5000 7ARK Lolcde In Complex With Amp-Pnp In The Clo ... Tang 4.10 2020-10-25 3.5000 7V8L Lolcde With Bound Rcsf In Nanodiscs Bei 3.50 2021-08-23 3.5000 7V8I Lolcd(E171q)E With Bound Amppnp In Nanodiscs Bei 3.60 2021-08-23 3.5000 7MDY Lolcde Nucleotide-Bound Sharma 3.50 2021-04-06 3.5000 7ARL Lolcde In Complex With Lipoprotein And Adp Tang 3.20 2020-10-25 3.5000 4IRN Crystal Structure Of Prolyl Acyl Carrier ... Moncoq 2.80 2013-01-15 3.7000 3D9F Nitroalkane Oxidase: Active Site Mutant S ... Heroux 2.20 2008-05-27 3.9000 3D9D Nitroalkane Oxidase: Mutant D402n Crystal ... Heroux 2.10 2008-05-27 3.9000 3D9E Nitroalkane Oxidase: Active Site Mutant D ... Heroux 2.20 2008-05-27 3.9000 3FCJ Nitroalkane Oxidase: Mutant402n Crystalli ... Major 2.40 2008-11-21 3.9000 3D9G Nitroalkane Oxidase: Wild Type Crystalliz ... Heroux 2.15 2008-05-27 3.9000 2ZAF Mechanistic And Structural Analyses Of Ro ... Fitzpatrick 2.50 2007-10-05 4.0000 2REH Mechanistic And Structural Analyses Of Ro ... Fitzpatrick 2.40 2007-09-26 4.0000 2C12 Crystal Structure Of Nitroalkane Oxidase ... Nagpal 2.07 2005-09-10 4.0000 2C0U Crystal Structure Of A Covalent Complex O ... Nagpal 2.20 2005-09-07 4.0000 5AHS 3-Sulfinopropionyl-Coenzyme A (3sp-Coa) D ... Cianci 2.30 2015-02-06 4.6000 5AF7 3-Sulfinopropionyl-Coenzyme A (3sp-Coa) D ... Cianci 1.89 2015-01-20 4.6000 6WY9 Tcur3481-Tcur3483 Steroid Acad G363a Variant Kimber 2.00 2020-05-12 9.3000 6WY8 Tcur3481-Tcur3483 Steroid Acad Kimber 2.10 2020-05-12 9.3000
|
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |