# OCA database search on: Thu Apr 18 22:17:43 2024 # Query: ev=10&ex=any&fa=MGFKIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENR&m=du # Hits: 66 (search time 3 sec) 2VIG Crystal Structure Of Human Short-Chain Ac ... Pike 1.90 2007-11-30 0.0000 7Y0B Crystal Structure Of Human Short-Chain Ac ... Huang 2.08 2022-06-04 0.0000 7Y0A Crystal Structure Of Human Short-Chain Ac ... Huang 2.32 2022-06-04 0.0000 8SGS Human Liver Mitochondrial Short-Chain Spe ... Zhang 3.15 2023-04-13 0.0000 1JQI Crystal Structure Of Rat Short Chain Acyl ... Battaile 2.25 2001-08-07 0.0000 5OL2 The Electron Transferring Flavoprotein/Bu ... Demmer 3.10 2017-07-26 0.0000 4L1F Electron Transferring Flavoprotein Of Aci ... Mowafy 1.79 2013-06-03 0.0000 6FAH Molecular Basis Of Flavin-Based Electron- ... Demmer 3.13 2017-12-15 0.0000 1BUC Three-Dimensional Structure Of Butyryl-Co ... Djordjevic 2.50 1994-09-06 0.0000 5LNX Crystal Structure Of Mmgc, An Acyl-Coa De ... Baker 2.60 2016-08-07 0.0000 4N5F Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 2.20 2013-10-09 0.0000 3NF4 Crystal Structure Of Acyl-Coa Dehydrogena ... Seattle Struc ... 2.35 2010-06-09 0.0000 4U83 Structure Of Brucella Abortus Butyryl-Coa ... Seattle Struc ... 1.80 2014-07-31 0.0000 4M9A Crystal Structure Of Acyl-Coa Dehydrogena ... Seattle Struc ... 2.20 2013-08-14 0.0000 1UKW Crystal Structure Of Medium-Chain Acyl-Co ... Hamada 2.40 2003-09-02 0.0000 3PFD Crystal Structure Of An Acyl-Coa Dehydrog ... Seattle Struc ... 2.10 2010-10-28 0.0000 2CX9 Crystal Structure Of Acyl-Coa Dehydrogenase Murayama 2.00 2005-06-28 0.0000 2D29 Structural Study On Project Id Tt0172 Fro ... Shimizu 1.65 2005-09-05 0.0000 1WS9 Crystal Structure Of Project Id Tt0172 Fr ... Shimizu 2.30 2004-11-02 0.0000 2DVL Crystal Structure Of Project Tt0160 From ... Shimizu 2.50 2006-07-31 0.0001 7W0J Acyl-Coa Dehydrogenase, Tfu_1647 Liu 3.13 2021-11-18 0.0001 8I4P Crystal Structure Of Acyl-Coa Dehydrogena ... Choi 1.90 2023-01-20 0.0001 8I4R Crystal Structure Of Acyl-Coa Dehydrogena ... Choi 2.51 2023-01-20 0.0001 3MDD Crystal Structures Of Medium Chain Acyl-C ... Kim 2.40 1994-07-13 0.0002 3MDE Crystal Structures Of Medium Chain Acyl-C ... Kim 2.40 1994-07-13 0.0002 1UDY Medium-Chain Acyl-Coa Dehydrogenase With ... Satoh 2.40 2003-05-07 0.0002 2JIF Structure Of Human Short-Branched Chain A ... Pike 2.00 2007-02-28 0.0002 7P98 Cyclohex-1-Ene-1-Carboxyl-Coa Dehydrogena ... Ermler 2.00 2021-07-26 0.0004 7P9A Structure Of Cyclohex-1-Ene-1-Carboxyl-Co ... Ermler 1.50 2021-07-26 0.0004 7P9X Structure Of Cyclohex-1-Ene-1-Carboxyl-Co ... Ermler 1.65 2021-07-28 0.0004 7XP7 Crystal Structure Of Flavoprotein Colb1 C ... Ma 1.95 2022-05-03 0.0006 4P13 Medium Chain Acyl-Coa Dehydrogenase, K304 ... Battaile 1.73 2014-02-24 0.0011 1EGE Structure Of T255e, E376g Mutant Of Human ... Lee 2.75 1996-04-11 0.0012 1T9G Structure Of Human Mcad:Etf Complex Toogood 2.90 2004-05-17 0.0012 8SGP Human Liver Mitochondrial Medium-Chain Sp ... Zhang 2.69 2023-04-12 0.0013 2A1T Structure Of Human Mcad:Etf E165betaa Complex Toogood 2.80 2005-06-21 0.0013 1EGD Structure Of T255e, E376g Mutant Of Human ... Lee 2.40 1996-04-11 0.0015 1EGC Structure Of T255e, E376g Mutant Of Human ... Lee 2.60 1996-04-11 0.0015 5IDU Crystal Structure Of An Acyl-Coa Dehydrog ... Seattle Struc ... 1.95 2016-02-24 0.0055 7SZV Crystal Structure Of Acyl-Coa Dehydrogena ... Seattle Struc ... 2.40 2021-11-29 0.0083 5JSC Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 1.50 2016-05-07 0.0120 4IV6 X-Ray Crystal Structure Of An Isovaleryl- ... Seattle Struc ... 2.00 2013-01-22 0.0220 6ES9 Methylsuccinyl-Coa Dehydrogenase Of Parac ... Zarzycki 1.37 2017-10-19 0.0290 3B96 Structural Basis For Substrate Fatty-Acyl ... Mcandrew 1.91 2007-11-02 0.0310 2UXW Crystal Structure Of Human Very Long Chai ... Pike 1.45 2007-03-30 0.0330 7S7G Crystal Structure Analysis Of Human Vlcad Seo 1.34 2021-09-15 0.0340 8CA1 Cryo-Em Structure Of Acadvl Dimer From Mu ... Yin 4.30 2023-01-24 0.0770 5AF7 3-Sulfinopropionyl-Coenzyme A (3sp-Coa) D ... Cianci 1.89 2015-01-20 0.4600 5AHS 3-Sulfinopropionyl-Coenzyme A (3sp-Coa) D ... Cianci 2.30 2015-02-06 0.4600 3R7K Crystal Structure Of A Probable Acyl Coa ... Seattle Struc ... 2.50 2011-03-22 0.4600 2Z1Q Crystal Structure Of Acyl Coa Dehydrogenase Hikima 2.30 2007-05-11 0.6000 3MPJ Structure Of Glutaryl-Coenzyme A Dehydrog ... Wischgoll 2.10 2010-04-27 0.9500 3MPI Structure Of Glutaryl-Coenzyme A Dehydrog ... Wischgoll 2.05 2010-04-27 0.9500 4RM7 The Crystal Structure Of Acyl-Coa Dehydro ... Wu 2.53 2014-10-20 1.2000 8PHF Cryo-Em Structure Of Human Acad9-S191a Mcgregor 3.60 2023-06-19 2.1000 8PHE Acad9-Wt In Complex With Ecsit-Cter Mcgregor 3.10 2023-06-19 2.1000 2EBA Crystal Structure Of Putative Glutaryl-Co ... Kumarevel 2.21 2007-02-07 3.1000 4KTO Crystal Structure Of A Putative Isovalery ... Kumar 2.14 2013-05-20 3.4000 4O5M X-Ray Crystal Structure Of Isovaleryl-Coa ... Seattle Struc ... 2.20 2013-12-19 4.1000 1RX0 Crystal Structure Of Isobutyryl-Coa Dehyd ... Battaile 1.77 2003-12-18 4.1000 3SWO Crystal Structure Of A Glutaryl-Coa Dehyd ... Seattle Struc ... 1.45 2011-07-14 5.4000 3P4T Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 1.70 2010-10-07 7.1000 3OIB Crystal Structure Of A Putative Acyl-Coa ... Seattle Struc ... 2.10 2010-08-18 7.1000 6IJC Structure Of Mmpa-Coa Dehydrogenase From ... Shao 2.30 2018-10-09 7.4000 1IVH Structure Of Human Isovaleryl-Coa Dehydro ... Tiffany 2.60 1997-05-15 8.8000 8SGR Human Liver Mitochondrial Isovaleryl-Coa ... Zhang 2.84 2023-04-13 9.8000
|
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |