# OCA database search on: Sat Sep 30 02:50:11 2023
# Query: ev=10&ex=any&fa=NDALRAIWEQELTDMRQRIQRMRQLFVNTLQEK&m=du
# Hits: 120 (search time 2 sec)
1ASL     Crystal Structures Of Escherichia Coli As ... Jaeger            2.60 1993-09-16   0.0000
3PAA     Mechanism Of Inactivation Of E. Coli Aspa ... Liu               1.90 2010-10-19   0.0000
3PA9     Mechanism Of Inactivation Of E. Coli Aspa ... Liu               1.70 2010-10-19   0.0000
1ASM     Crystal Structures Of Escherichia Coli As ... Jaeger            2.35 1993-09-16   0.0000
2QBT     Structural Studies Reveal The Inactivatio ... Liu               1.75 2007-06-18   0.0000
1ASN     Crystal Structures Of Escherichia Coli As ... Jaeger            2.50 1993-09-16   0.0000
2QB3     Structural Studies Reveal The Inactivatio ... Liu               1.45 2007-06-15   0.0000
1AMQ     X-Ray Crystallographic Study Of Pyridoxam ... Miyahara          2.20 1994-07-01   0.0000
1AMR     X-Ray Crystallographic Study Of Pyridoxam ... Miyahara          2.10 1994-07-01   0.0000
1AMS     X-Ray Crystallographic Study Of Pyridoxam ... Miyahara          2.70 1994-07-01   0.0000
1X29     Crystal Structure Of E.Coli Aspat Complex ... Goto              2.20 2005-04-21   0.0000
1X28     Crystal Structure Of E.Coli Aspat Complex ... Goto              2.40 2005-04-21   0.0000
1TOI     Hydrocinnamic Acid-Bound Structure Of Hex ... Chow              1.90 2004-06-14   0.0000
1ASD     The Structure Of Wild Type E. Coli Aspart ... Schumacher        2.20 1993-08-27   0.0000
1TOG     Hydrocinnamic Acid-Bound Structure Of Srh ... Chow              2.31 2004-06-14   0.0000
1B4X     Aspartate Aminotransferase From E. Coli,  ... Jeffery           2.45 1998-12-30   0.0000
1ASG     The Structural Basis For The Reduced Acti ... Schumacher        2.80 1993-08-27   0.0000
1TOE     Unliganded Structure Of Hexamutant + A293 ... Chow              2.00 2004-06-14   0.0000
3QN6     Crystal Structures Of Escherichia Coli As ... Griswold          1.79 2011-02-08   0.0000
2QA3     Structural Studies Reveal The Inactivatio ... Liu               1.75 2007-06-14   0.0000
1CZE     Aspartate Aminotransferase Mutant Atb17/1 ... Okamoto           2.40 1999-09-02   0.0000
1AHX     Aspartate Aminotransferase Hexamutant         Malashkevich      2.00 1995-02-21   0.0000
1C9C     Aspartate Aminotransferase Complexed With ... Ishijima          2.40 1999-08-02   0.0000
1SPA     Role Of Asp222 In The Catalytic Mechanism ... Hinoue            2.00 1993-01-26   0.0000
1AIA     Structural Basis For The Catalytic Activi ... Jaeger            2.20 1994-05-10   0.0000
1QIT     Aspartate Aminotransferase From Escherich ... Jeffery           1.90 1999-06-15   0.0000
1QIS     Aspartate Aminotransferase From Escherich ... Jeffery           1.90 1999-06-15   0.0000
1QIR     Aspartate Aminotransferase From Escherich ... Jeffery           2.20 1999-06-15   0.0000
5T4L     Plp And Gaba Trigger Gabr-Mediated Transc ... Wu                1.53 2016-08-29   0.0000
1AHF     Aspartate Aminotransferase Hexamutant         Malashkevich      2.30 1995-02-22   0.0000
1ASA     The Structural Basis For The Reduced Acti ... Schumacher        2.40 1993-08-27   0.0000
1ASB     The Structural Basis For The Reduced Acti ... Schumacher        2.60 1993-08-27   0.0000
1ASC     The Structural Basis For The Reduced Acti ... Schumacher        2.40 1993-08-27   0.0000
2D63     Aspartate Aminotransferase Mutant Ma With ... Tanaka            2.05 2005-11-09   0.0000
1ASE     The Structure Of Wild Type E. Coli Aspart ... Schumacher        2.50 1993-08-27   0.0000
1ASF     The Structural Basis For The Reduced Acti ... Schumacher        2.80 1993-08-27   0.0000
1TOK     Maleic Acid-Bound Structure Of Srhept Mut ... Chow              1.85 2004-06-14   0.0000
4DBC     Substrate Activation In Aspartate Aminotr ... Toney             1.50 2012-01-14   0.0000
1ARH     Aspartate Aminotransferase, Y225r/R386a M ... Malashkevich      2.30 1995-08-23   0.0000
1CZC     Aspartate Aminotransferase Mutant Atb17/1 ... Okamoto           2.50 1999-09-02   0.0000
2AAT     2.8-Angstroms-Resolution Crystal Structur ... Smith             2.80 1989-05-30   0.0000
1ARS     X-Ray Crystallographic Study Of Pyridoxal ... Okamoto           1.80 1993-08-02   0.0000
4A00     Structure Of An Engineered Aspartate Amin ... Fernandez         2.34 2011-09-06   0.0000
1IX6     Aspartate Aminotransferase Active Site Mu ... Hayashi           2.20 2002-06-14   0.0000
1IX7     Aspartate Aminotransferase Active Site Mu ... Hayashi           2.20 2002-06-14   0.0000
1CQ7     Aspartate Aminotransferase Complexed With ... Ishijima          2.40 1999-08-06   0.0000
1IX8     Aspartate Aminotransferase Active Site Mu ... Hayashi           2.20 2002-06-14   0.0000
1AIC     Structural Basis For The Catalytic Activi ... Jaeger            2.40 1994-05-10   0.0000
1AIB     Structural Basis For The Catalytic Activi ... Jaeger            2.80 1994-05-10   0.0000
1AHG     Aspartate Aminotransferase Hexamutant         Malashkevich      2.50 1995-02-22   0.0000
2Q7W     Structural Studies Reveals The Inactivati ... Liu               1.40 2007-06-07   0.0000
1TOJ     Hydrocinnamic Acid-Bound Structure Of Srh ... Chow              1.90 2004-06-14   0.0000
1AHE     Aspartate Aminotransferase Hexamutant         Malashkevich      2.30 1995-02-22   0.0000
5VWQ     E.Coli Aspartate Aminotransferase-(1r,3s, ... Mascarenhas       1.80 2017-05-22   0.0000
3QPG     Crystal Structures Of Escherichia Coli As ... Griswold          1.79 2011-02-13   0.0000
1G4V     Aspartate Aminotransferase Active Site Mu ... Mizuguchi         2.00 2000-10-28   0.0000
2D66     Aspartate Aminotransferase Mutant Mab         Tanaka            2.18 2005-11-09   0.0000
1ART     X-Ray Crystallographic Study Of Pyridoxal ... Okamoto           1.80 1993-08-02   0.0000
3AAT     Activity And Structure Of Active-Site Mut ... Danishefsky       2.80 1990-12-06   0.0000
1AHY     Aspartate Aminotransferase Hexamutant         Malashkevich      2.30 1995-02-21   0.0000
1YOO     Aspartate Aminotransferase Mutant Atb17 W ... Oue               2.40 1998-06-26   0.0000
2QB2     Structural Studies Reveal The Inactivatio ... Liu               1.70 2007-06-15   0.0000
1X2A     Crystal Structure Of E.Coli Aspat Complex ... Goto              2.20 2005-04-21   0.0000
5EAA     Aspartate Aminotransferase From E. Coli,  ... Jeffery           2.40 1998-12-29   0.0000
1BQA     Aspartate Aminotransferase P195a Mutant       Malashkevich      2.10 1998-08-13   0.0000
3ZZJ     Structure Of An Engineered Aspartate Amin ... Fernandez         2.50 2011-09-01   0.0000
1CQ6     Aspartate Aminotransferase Complex With C ... Ishijima          2.70 1999-08-06   0.0000
1G4X     Aspartate Aminotransferase Active Site Mu ... Mizuguchi         2.20 2000-10-29   0.0000
2D5Y     Aspartate Aminotransferase Mutant Mc With ... Tanaka            1.98 2005-11-08   0.0000
1AAW     The Structural Basis For The Altered Subs ... Almo              2.40 1993-07-13   0.0000
1ARI     Aspartate Aminotransferase, W140h Mutant, ... Malashkevich      2.30 1995-08-23   0.0000
2D64     Aspartate Aminotransferase Mutant Mabc Wi ... Tanaka            2.05 2005-11-09   0.0000
1AAM     The Structural Basis For The Altered Subs ... Almo              2.80 1993-07-13   0.0000
2D7Z     Aspartate Aminotransferase Mutant Mab Com ... Tanaka            2.65 2005-11-30   0.0000
1BQD     Aspartate Aminotransferase P138a/P195a Do ... Malashkevich      2.10 1998-08-14   0.0000
3ZZK     Structure Of An Engineered Aspartate Amin ... Fernandez         1.78 2011-09-01   0.0000
1G7W     Aspartate Aminotransferase Active Site Mu ... Mizuguchi         2.20 2000-11-15   0.0000
1ARG     Aspartate Aminotransferase, Phospho-5'-Py ... Malashkevich      2.20 1995-08-23   0.0000
2D61     Aspartate Aminotransferase Mutant Ma With ... Tanaka            2.01 2005-11-08   0.0000
1G7X     Aspartate Aminotransferase Active Site Mu ... Mizuguchi         2.20 2000-11-15   0.0000
2D65     Aspartate Aminotransferase Mutant Mabc        Tanaka            2.30 2005-11-09   0.0000
1CQ8     Aspartate Aminotransferase Complexed With ... Ishijima          2.40 1999-08-06   0.0000
2D7Y     Aspartate Aminotransferase Mutant Ma          Tanaka            2.66 2005-11-30   0.0000
5VWR     E.Coli Aspartate Aminotransferase-(1r,3s, ... Mascarenhas       1.72 2017-05-22   0.0000
4F5K     Substrate Specificity Conversion Of Aspar ... Addington         2.20 2012-05-13   0.0000
4F5L     A Theoretical Optimized Mutant For The Co ... Addington         1.40 2012-05-13   0.0000
3UAK     Crystal Structure Of De Novo Designed Cys ... Kuzin             3.23 2011-10-21   0.0000
8E9P     Crystal Structure Of Wild-Type E. Coli As ... Chica             2.08 2022-08-26   0.0000
4F5M     Wild-Type E. Coli Aspartate Aminotransfer ... Addington         1.65 2012-05-13   0.0000
8E9U     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.94 2022-08-26   0.0000
8E9Q     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.80 2022-08-26   0.0000
8E9R     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.90 2022-08-26   0.0000
4F5J     Rational Design And Directed Evolution Fo ... Addington         1.95 2012-05-13   0.0000
8E9V     Crystal Structure Of E. Coli Aspartate Am ... Chica             2.01 2022-08-26   0.0000
8E9D     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.37 2022-08-26   0.0000
8E9L     Crystal Structure Of E. Coli Aspartate Am ... Chica             2.31 2022-08-26   0.0000
4F5G     Rational Design And Directed Evolution Of ... Addington         1.67 2012-05-13   0.0000
8E9N     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.88 2022-08-26   0.0000
8E9S     Crystal Structure Of E. Coli Aspartate Am ... Chica             2.00 2022-08-26   0.0000
8E9T     Crystal Structure Of Wild-Type E. Coli As ... Chica             2.13 2022-08-26   0.0000
8E9J     Crystal Structure Of E. Coli Aspartate Am ... Chica             2.09 2022-08-26   0.0000
8E9K     Crystal Structure Of Wild-Type E. Coli As ... Chica             1.83 2022-08-26   0.0000
8E9C     Crystal Structure Of E. Coli Aspartate Am ... Chica             2.18 2022-08-26   0.0000
8E9M     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.76 2022-08-26   0.0000
8E9O     Crystal Structure Of E. Coli Aspartate Am ... Chica             1.96 2022-08-26   0.0000
4F5F     Structure Of Aspartate Aminotransferase C ... Addington         2.25 2012-05-13   0.0000
4F5I     Substrate Specificity Conversion Of E. Co ... Addington         2.20 2012-05-13   0.0000
4F5H     Intercoversion Of Substrate Specificity:  ... Addington         1.60 2012-05-13   0.0000
3FSL     Crystal Structure Of Tyrosine Aminotransf ... Malashkevich      2.35 2009-01-09   0.5100
4WD2     Crystal Structure Of An Aromatic Amino Ac ... Seattle Struc ... 1.95 2014-09-06   0.5200
4F4E     Crystal Structure Of Aromatic-Amino-Acid  ... Seattle Struc ... 1.80 2012-05-10   0.5400
4EFF     Crystal Structure Of Aromatic-Amino-Acid  ... Seattle Struc ... 1.85 2012-03-29   0.5400
3TAT     Tyrosine Aminotransferase From E. Coli        Ko                3.50 1998-08-12   1.0000
6EZL     Crystal Structure Of Aspartate Aminotrans ... Jagoe             2.07 2017-11-15   1.3000
2JO8     Solution Structure Of C-Terminal Domain O ... Hwang                  2007-02-26   3.0000
4NR2     Crystal Structure Of Stk4 (Mst1) Sarah Domain Chaikuad          2.00 2013-11-26   3.0000
4OH8     Crystal Structure Of Human Mst1-Rassf5 Sa ... Hwang             2.28 2014-01-17   3.0000
4WB0     Crystal Structure Of Broad Specificity Am ... Wen               1.91 2014-09-02   3.3000
4H51     Crystal Structure Of A Putative Aspartate ... Seattle Struc ... 1.85 2012-09-18   3.4000
3K7Y     Aspartate Aminotransferase Of Plasmodium  ... Groves            2.80 2009-10-13   5.2000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science