# OCA database search on: Wed Jun 29 21:50:48 2022
# Query: ev=10&ex=any&fa=NVLQYFISTHGARKGLADTALKTANSGYLTRRLVD&m=du
# Hits: 632 (search time 2 sec)
6VYS     Escherichia Coli Transcription-Translatio ... Molodtsov         3.70 2020-02-27   0.0000
6N4C     Em Structure Of DNA Wrapping In Bacterial ... Florez-Ariza      17.00 2018-11-19   0.0000
6VZ3     Escherichia Coli Transcription-Translatio ... Molodtsov         8.90 2020-02-27   0.0000
6VZ7     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-02-27   0.0000
7MKN     Escherichia Coli RNA Polymerase And Rapa  ... Qayyum            0.00 2021-04-26   0.0000
7MKO     Escherichia Coli RNA Polymerase Elongatio ... Qayyum            0.00 2021-04-26   0.0000
7MKQ     Escherichia Coli RNA Polymerase And Rapa  ... Qayyum            0.00 2021-04-26   0.0000
7MKP     Escherichia Coli RNA Polymerase Core Enzyme   Qayyum            0.00 2021-04-26   0.0000
6AWB     Structure Of 30s Ribosomal Subunit And RN ... Demo              6.70 2017-09-05   0.0000
6AWD     Structure Of 30s (S1 Depleted) Ribosomal  ... Demo              8.10 2017-09-05   0.0000
6AWC     Structure Of 30s Ribosomal Subunit And RN ... Demo              7.90 2017-09-05   0.0000
6XDQ     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.70 2020-06-11   0.0000
6R9G     Structural Basis Of Transcription Inhibit ... Ye                0.00 2019-04-03   0.0000
4XSY     Crystal Structure Of Cbr 9379 Bound To Es ... Bae               4.01 2015-01-22   0.0000
6VYX     Escherichia Coli Transcription-Translatio ... Molodtsov         9.90 2020-02-27   0.0000
5IPN     Sigmas-Transcription Initiation Complex W ... Liu               4.61 2016-03-09   0.0000
7C97     Cryo-Em Structure Of An Escherichia Coli  ... Lin               3.68 2020-06-05   0.0000
6RIN     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.70 2019-04-24   0.0000
7CHW     Cryo-Em Structure Of An Escherichia Coli  ... Lin               3.58 2020-07-06   0.0000
6UU7     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.40 2019-10-30   0.0000
4JK1     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.90 2013-03-09   0.0000
6UU5     E. Coli Sigma-S Transcription Initiation  ... Zuo               5.40 2019-10-30   0.0000
5EZK     RNA Polymerase Model Placed By Molecular  ... Darbari           8.50 2015-11-26   0.0000
4ZH3     Crystal Structure Of Escherichia Coli RNA ... Feng              4.08 2015-04-24   0.0000
6VYT     Escherichia Coli Transcription-Translatio ... Molodtsov         14.00 2020-02-27   0.0000
6ZTL     E. Coli 70s-Rnap Expressome Complex In Co ... Webster           0.00 2020-07-20   0.0000
4YFN     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.82 2015-02-25   0.0000
6VZ5     Escherichia Coli Transcription-Translatio ... Molodtsov         8.90 2020-02-27   0.0000
6RH3     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.60 2019-04-18   0.0000
6UU4     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.30 2019-10-30   0.0000
6VZ2     Escherichia Coli Transcription-Translatio ... Molodtsov         10.00 2020-02-27   0.0000
4YFX     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.84 2015-02-25   0.0000
6CA0     Cryo-Em Structure Of E. Coli Rnap Sigma70 ... Narayanan         5.75 2018-01-29   0.0000
6UTX     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.05 2019-10-30   0.0000
6GH5     Cryo-Em Structure Of Bacterial RNA Polyme ... Glyde             3.40 2018-05-04   0.0000
5TBZ     E. Coli RNA Polymerase Complexed With Nusg    Liu               7.00 2016-09-13   0.0000
4JK2     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.20 2013-03-09   0.0000
4YG2     X-Ray Crystal Structur Of Escherichia Col ... Murakami          3.70 2015-02-25   0.0000
7KHE     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-21   0.0000
7KHI     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-21   0.0000
4YFK     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.57 2015-02-25   0.0000
6X2N     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-20   0.0000
6VYY     Escherichia Coli Transcription-Translatio ... Molodtsov         9.90 2020-02-27   0.0000
6C6U     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2018-01-19   0.0000
6X50     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewelyn          0.00 2020-05-24   0.0000
6C6T     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2018-01-19   0.0000
6C6S     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2018-01-19   0.0000
5MY1     E. Coli Expressome                            Kohler            7.60 2017-01-25   0.0000
6VYZ     Escherichia Coli Transcription-Translatio ... Molodtsov         9.90 2020-02-27   0.0000
6VYW     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-02-27   0.0000
5W1S     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.81 2017-06-04   0.0000
5BYH     Crystal Structure Of Escherichia Coli RNA ... Zhang             3.76 2015-06-10   0.0000
6VJS     Escherichia Coli RNA Polymerase And Ureid ... Murakami          4.02 2020-01-17   0.0000
5UI8     Structure Of Sigman-Holoenzyme                Darst             3.76 2017-01-13   0.0000
6PMI     Sigm28-Transcription Initiation Complex W ... Liu               3.86 2019-07-02   0.0000
6B6H     The Cryo-Em Structure Of A Bacterial Clas ... Liu               3.90 2017-10-02   0.0000
6XL5     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
6X9Q     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         4.80 2020-06-03   0.0000
6XGF     Escherichia Coli Transcription-Translatio ... Molodtsov         5.00 2020-06-17   0.0000
6X7F     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.50 2020-05-29   0.0000
5UAJ     Escherichia Coli RNA Polymerase Rpob S531 ... Molodtsov         3.92 2016-12-19   0.0000
6XIJ     Escherichia Coli Transcription-Translatio ... Molodtsov         8.00 2020-06-20   0.0000
4YLN     E. Coli Transcription Initiation Complex  ... Zuo               5.50 2015-03-05   0.0000
5NWT     Crystal Structure Of Escherichia Coli RNA ... Zhang             3.76 2017-05-08   0.0000
6VYU     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-02-27   0.0000
6K4Y     Cryoem Structure Of Sigma Appropriation C ... Shi               3.79 2019-05-27   0.0000
4YLO     E. Coli Transcription Initiation Complex  ... Zuo               6.00 2015-03-05   0.0000
4YLP     E. Coli Transcription Initiation Complex  ... Zuo               5.50 2015-03-05   0.0000
4LK0     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.91 2013-07-05   0.0000
4KN7     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.69 2013-05-08   0.0000
6X7K     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.10 2020-05-30   0.0000
6OMF     Cryoem Structure Of Sigmas-Transcription  ... Jaramillo Car ... 3.26 2019-04-18   0.0000
6RI7     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.90 2019-04-23   0.0000
6X2F     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-20   0.0000
4LK1     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.84 2013-07-05   0.0000
6X26     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-20   0.0000
4ZH2     Crystal Structure Of Escherichia Coli RNA ... Feng              4.20 2015-04-24   0.0000
6UU8     E. Coli Mutant Sigma-S Transcription Init ... Zuo               4.40 2019-10-30   0.0000
4ZH4     Crystal Structure Of Escherichia Coli RNA ... Feng              3.99 2015-04-24   0.0000
6BYU     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.60 2017-12-21   0.0000
5IPM     Sigmas-Transcription Initiation Complex W ... Liu               4.20 2016-03-09   0.0000
4XSZ     Crystal Structure Of Cbr 9393 Bound To Es ... Bae               3.68 2015-01-22   0.0000
5IPL     Sigmas-Transcription Initiation Complex W ... Liu               3.60 2016-03-09   0.0000
6ZTN     E. Coli 70s-Rnap Expressome Complex In Nu ... Webster           0.00 2020-07-20   0.0000
6VYQ     Escherichia Coli Transcription-Translatio ... Molodtsov         3.70 2020-02-27   0.0000
5UAC     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         3.80 2016-12-19   0.0000
5W1T     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.50 2017-06-04   0.0000
6ALH     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2017-08-07   0.0000
6ALF     Cryoem Structure Of Crosslinked E.Coli RN ... Kang              0.00 2017-08-07   0.0000
7D7C     Cryoem Structure Of Gp55-Dependent RNA Po ... Shi               3.60 2020-10-03   0.0000
6PMJ     Sigm28-Transcription Initiation Complex W ... Liu               3.91 2019-07-02   0.0000
4LJZ     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.59 2013-07-05   0.0000
6X4W     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-24   0.0000
5UAL     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         3.89 2016-12-19   0.0000
6RIP     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.40 2019-04-24   0.0000
5VT0     Escherichia Coli 6s RNA Derivative In Com ... Chen              3.78 2017-05-15   0.0000
6ZTM     E. Coli 70s-Rnap Expressome Complex In Co ... Webster           0.00 2020-07-20   0.0000
5VSW     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.29 2017-05-12   0.0000
6R9B     Cryo-Em Structure Of Bacterial Rnap With  ... Ye                0.00 2019-04-03   0.0000
6UUC     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.10 2019-10-30   0.0000
6GH6     Cryo-Em Structure Of Bacterial RNA Polyme ... Glyde             0.00 2018-05-04   0.0000
6UUA     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.00 2019-10-30   0.0000
6XH8     Cuer-Transcription Activation Complex Wit ... Liu               4.10 2020-06-18   0.0000
6XH7     Cuer-Tac Without RNA                          Liu               3.90 2020-06-18   0.0000
7D7D     Cryoem Structure Of Gp45-Dependent Transc ... Shi               4.50 2020-10-03   0.0000
6UU6     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.20 2019-10-30   0.0000
7KHC     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-20   0.0000
6UTZ     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.80 2019-10-30   0.0000
6XDR     Escherichia Coli Transcription-Translatio ... Molodtsov         4.70 2020-06-11   0.0000
6UU2     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.40 2019-10-30   0.0000
6UU1     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.10 2019-10-30   0.0000
6UU0     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.90 2019-10-30   0.0000
6X6T     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.20 2020-05-29   0.0000
6UTY     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.15 2019-10-30   0.0000
6UTW     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.85 2019-10-30   0.0000
4MEY     Crystal Structure Of Escherichia Coli RNA ... Feng              3.95 2013-08-27   0.0000
4XSX     Crystal Structure Of Cbr 703 Bound To Esc ... Bae               3.71 2015-01-22   0.0000
6JNX     Cryo-Em Structure Of A Q-Engaged Arrested ... Feng              4.08 2019-03-18   0.0000
6UU3     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.00 2019-10-30   0.0000
6XLJ     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
6XL9     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
6FLP     Cryoem Structure Of E.Coli RNA Polymerase ... Guo               0.00 2018-01-26   0.0000
6UTV     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.45 2019-10-30   0.0000
6ALG     Cryoem Structure Of Hk022 Nun - E.Coli RN ... Kang              0.00 2017-08-07   0.0000
6ZTO     E. Coli 70s-Rnap Expressome Complex In Un ... Webster           0.00 2020-07-20   0.0000
6ASX     Cryoem Structure Of E.Coli His Pause Elon ... Kang              0.00 2017-08-25   0.0000
6X4Y     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-24   0.0000
4KMU     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.85 2013-05-08   0.0000
6XLN     Cryo-Em Structure Of E. Coli Rnap-DNA Elo ... Yang              0.00 2020-06-28   0.0000
6VYR     Escherichia Coli Transcription-Translatio ... Molodtsov         3.80 2020-02-27   0.0000
6XLM     Cryo-Em Structure Of E.Coli Rnap-DNA Elon ... Yang              0.00 2020-06-28   0.0000
3LU0     Molecular Model Of Escherichia Coli Core  ... Darst             11.20 2010-02-16   0.0000
6XLL     Cryo-Em Structure Of E. Coli Rnap-Promote ... Yang              0.00 2020-06-28   0.0000
6XII     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-06-20   0.0000
6VZJ     Escherichia Coli Transcription-Translatio ... Molodtsov         4.10 2020-02-28   0.0000
6X43     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-22   0.0000
5UAQ     Escherichia Coli RNA Polymerase Rpob H526 ... Molodtsov         3.60 2016-12-19   0.0000
4KN4     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.96 2013-05-08   0.0000
6PB6     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.29 2019-06-13   0.0000
4LLG     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.79 2013-07-09   0.0000
6CUX     Escherichia Coli Rpob S531l Mutant RNA Po ... Molodtsov         4.10 2018-03-26   0.0000
6GFW     Cryo-Em Structure Of Bacterial RNA Polyme ... Glyde             3.70 2018-05-02   0.0000
5UAH     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         4.10 2016-12-19   0.0000
6UU9     E. Coli Mutant Sigma-S Transcription Init ... Zuo               5.40 2019-10-30   0.0000
6PB5     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.52 2019-06-13   0.0000
6PB4     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.35 2019-06-13   0.0000
4MEX     Crystal Structure Of Escherichia Coli RNA ... Feng              3.90 2013-08-27   0.0000
6UUB     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.96 2019-10-30   0.0000
6ZU1     E. Coli 70s-Rnap Expressome Complex In Un ... Webster           0.00 2020-07-21   0.0000
6C9Y     Cryo-Em Structure Of E. Coli Rnap Sigma70 ... Narayanan         4.25 2018-01-29   0.0000
6ZTP     E. Coli 70s-Rnap Expressome Complex In Un ... Webster           0.00 2020-07-20   0.0000
7KHB     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-20   0.0000
6RI9     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.70 2019-04-23   0.0000
5NSR     Cryo-Em Structure Of RNA Polymerase-Sigma ... Glyde             0.00 2017-04-26   0.0000
5UAG     Escherichia Coli RNA Polymerase Mutant -  ... Molodtsov         3.40 2016-12-19   0.0000
6VU3     Cryo-Em Structure Of Escherichia Coli Tra ... Molodtsov         3.70 2020-02-14   0.0000
6ZTJ     E. Coli 70s-Rnap Expressome Complex In Nu ... Webster           0.00 2020-07-20   0.0000
6BJS     Cryoem Structure Of E.Coli His Pause Elon ... Kang              0.00 2017-11-06   0.0000
6FLQ     Cryoem Structure Of E.Coli RNA Polymerase ... Guo               4.10 2018-01-26   0.0000
6N61     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.25 2018-11-24   0.0000
6N62     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.80 2018-11-24   0.0000
6N60     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.68 2018-11-23   0.0000
3IYD     Three-Dimensional Em Structure Of An Inta ... Hudson            19.80 2009-08-01   0.0000
4JKR     Crystal Structure Of E. Coli RNA Polymera ... Zuo               4.20 2013-03-11   0.0000
6Z9S     Transcription Termination Intermediate Co ... Said              4.40 2020-06-04   0.0000
7ADE     Transcription Termination Complex Iva         Said              0.00 2020-09-14   0.0000
4S20     Structural Basis For Transcription Reacti ... Liu               4.70 2015-01-16   0.0000
6LDI     The Cryo-Em Structure Of E. Coli Cuer Tra ... Fang              3.69 2019-11-21   0.0000
6Z9P     Transcription Termination Intermediate Co ... Said              3.90 2020-06-04   0.0000
6Z9T     Transcription Termination Intermediate Co ... Said              4.10 2020-06-04   0.0000
6XAS     Cryoem Structure Of E. Coli Rho-Dependent ... Hao               0.00 2020-06-04   0.0000
7C17     The Cryo-Em Structure Of E. Coli Cuer Tra ... Fang              4.22 2020-05-02   0.0000
6XAV     Cryoem Structure Of E. Coli Rho-Dependent ... Hao               0.00 2020-06-04   0.0000
6Z9R     Transcription Termination Intermediate Co ... Said              4.10 2020-06-04   0.0000
7ADD     Transcription Termination Intermediate Co ... Said              0.00 2020-09-14   0.0000
7ADB     Transcription Termination Intermediate Co ... Said              0.00 2020-09-14   0.0000
6KJ6     Cryo-Em Structure Of Escherichia Coli Crl ... Xu                3.80 2019-07-21   0.0000
5MS0     Pseudo-Atomic Model Of RNA Polymerase Lam ... Said              9.80 2016-12-29   0.0000
6Z9Q     Transcription Termination Intermediate Co ... Said              5.70 2020-06-04   0.0000
6JBQ     Cryoem Structure Of Escherichia Coli Sigm ... Fang              4.02 2019-01-26   0.0000
7ADC     Transcription Termination Intermediate Co ... Said              0.00 2020-09-14   0.0000
6GOV     Structure Of RNA Polymerase Lambda-Based  ... Loll              3.70 2018-06-04   0.0000
6TQN     Rrn Anti-Termination Complex Without S4       Huang             0.00 2019-12-17   0.0000
6TQO     Rrn Anti-Termination Complex                  Huang             0.00 2019-12-17   0.0000
6PSV     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.50 2019-07-13   0.0000
6OUL     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              3.40 2019-05-04   0.0000
6PSQ     Escherichia Coli RNA Polymerase Closed Co ... Chen              3.40 2019-07-13   0.0000
6PSS     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.50 2019-07-13   0.0000
6P1K     Cryo-Em Structure Of Escherichia Coli Sig ... Chen              0.00 2019-05-20   0.0000
6P19     Q21 Transcription Antitermination Complex ... Yin               3.80 2019-05-19   0.0000
6WMU     E. Coli Rnaps70-Sspa-Gada DNA Complex         Travis            0.00 2020-04-21   0.0000
6PSU     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.90 2019-07-13   0.0000
6PSW     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.70 2019-07-13   0.0000
6PST     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.00 2019-07-13   0.0000
6PSR     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.40 2019-07-13   0.0000
6N58     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              0.00 2018-11-21   0.0000
6P18     Q21 Transcription Antitermination Complex ... Yin               0.00 2019-05-19   0.0000
6N57     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              0.00 2018-11-21   0.0000
5NSS     Cryo-Em Structure Of RNA Polymerase-Sigma ... Glyde             0.00 2017-04-26   0.0000
6WMR     F. Tularensis Rnaps70-(Mgla-Sspa)-Igla DN ... Travis            0.00 2020-04-21   0.0000
6ZFB     Structure Of B. Subtilis RNA Polymerase I ... Pei               0.00 2020-06-17   0.0000
7CKQ     The Cryo-Em Structure Of B. Subtilis Bmrr ... Fang              4.40 2020-07-18   0.0000
6WVK     Cryo-Em Structure Of Bacillus Subtilis RN ... Newing            0.00 2020-05-06   0.0000
6WVJ     Cryo-Em Structure Of Bacillus Subtilis RN ... Newing            3.36 2020-05-06   0.0000
6ZCA     Structure Of B. Subtilis RNA Polymerase I ... Pei               4.20 2020-06-10   0.0000
6WMP     F. Tularensis Rnaps70-Igla DNA Complex        Travis            2.98 2020-04-21   0.0000
6WMT     F. Tularensis Rnaps70-(Mgla-Sspa)-Ppgpp-P ... Travis            4.43 2020-04-21   0.0000
6J9F     Cryo-Em Structure Of Xanthomonos Oryzae T ... You               3.95 2019-01-22   0.0000
6J9E     Cryo-Em Structure Of Xanthomonos Oryzae T ... You               3.41 2019-01-22   0.0000
6DVE     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.81 2018-06-23   0.0000
6DVC     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.30 2018-06-23   0.0000
6TYG     Crystal Structure Of Mtb Sigma L Transcri ... Molodtsov         3.50 2019-08-08   0.0000
6FBV     Single Particle Cryo Em Structure Of Myco ... Das               3.50 2017-12-19   0.0000
5UHC     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.80 2017-01-11   0.0000
6TYE     Crystal Structure Of Mtb Sigma L Transcri ... Molodtsov         3.79 2019-08-08   0.0000
5UHG     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.97 2017-01-11   0.0000
5UH5     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.75 2017-01-10   0.0000
5UHB     Crystal Structure Of Mycobacterium Tuberc ... Lin               4.29 2017-01-11   0.0000
5UH6     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.84 2017-01-11   0.0000
5UH8     Crystal Structure Of Mycobacterium Tuberc ... Lin               4.18 2017-01-11   0.0000
5UH9     Crystal Structure Of Mycobacterium Tuberc ... Lin               4.40 2017-01-11   0.0000
5UHE     Crystal Structure Of Mycobacterium Tuberc ... Lin               4.04 2017-01-11   0.0000
6DVB     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.80 2018-06-23   0.0000
6DVD     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.90 2018-06-23   0.0000
5UHD     Crystal Structure Of Mycobacterium Tuberc ... Lin               4.01 2017-01-11   0.0000
6DV9     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.80 2018-06-23   0.0000
5UHF     Crystal Structure Of Mycobacterium Tuberc ... Lin               4.34 2017-01-11   0.0000
6TYF     Crystal Structure Of Mtb Sigma L Transcri ... Molodtsov         3.80 2019-08-08   0.0000
5UHA     Crystal Structure Of Mycobacterium Tuberc ... Lin               3.91 2017-01-11   0.0000
6JCY     Mycobacterium Tuberculosis RNA Polymerase ... Li                3.11 2019-01-30   0.0000
5VI5     Structure Of Mycobacterium Smegmatis Tran ... Darst             3.20 2017-04-14   0.0000
5VI8     Structure Of A Mycobacterium Smegmatis Tr ... Hubin             2.76 2017-04-14   0.0000
6VVS     Crystal Structure Of A Mycobacterium Smeg ... Lilic             3.11 2020-02-18   0.0000
6KOO     Mycobacterium Tuberculosis Initial Transc ... Li                2.80 2019-08-12   0.0000
6VVV     Crystal Structure Of A Mycobacterium Smeg ... Lilic             3.20 2020-02-18   0.0000
5ZX2     Mycobacterium Tuberculosis RNA Polymerase ... Li                2.80 2018-05-17   0.0000
6KOP     Mycobacterium Tuberculosis Initial Transc ... Li                3.30 2019-08-12   0.0000
5TW1     Crystal Structure Of A Mycobacterium Smeg ... Hubin             2.76 2016-11-10   0.0000
6JCX     Mycobacterium Tuberculosis Transcription  ... Li                2.90 2019-01-30   0.0000
6Z11     Structure Of Mycobacterium Smegmatis Held ... Kouba             3.36 2020-05-11   0.0000
6KON     Mycobacterium Tuberculosis Initial Transc ... Li                3.00 2019-08-12   0.0000
6CCE     Crystal Structure Of A Mycobacterium Smeg ... Lilic             3.05 2018-02-07   0.0000
6CCV     Crystal Structure Of A Mycobacterium Smeg ... Lilic             3.05 2018-02-07   0.0000
6VVT     Crystal Structure Of A Mycobacterium Smeg ... Lilic             2.90 2020-02-18   0.0000
6YYS     Structure Of Mycobacterium Smegmatis Held ... Kouba             0.00 2020-05-05   0.0000
5ZX3     Mycobacterium Tuberculosis RNA Polymerase ... Li                2.75 2018-05-17   0.0000
6YXU     Structure Of Mycobacterium Smegmatis Held ... Kouba             0.00 2020-05-03   0.0000
6KOQ     Mycobacterium Tuberculosis Initial Transc ... Li                3.35 2019-08-12   0.0000
6DCF     Crystal Structure Of A Mycobacterium Smeg ... Lilic             3.45 2018-05-06   0.0000
7KIM     Mycobacterium Tuberculosis Wt Rnap Transc ... Lilic             0.00 2020-10-23   0.0000
7KIN     Mycobacterium Tuberculosis Wt Rnap Transc ... Lilic             0.00 2020-10-23   0.0000
7KIF     Mycobacterium Tuberculosis Wt Rnap Transc ... Lilic             0.00 2020-10-23   0.0000
6C06     Mycobacterium Tuberculosis Rnap Holo/Rbpa ... Darst             0.00 2017-12-27   0.0000
6C05     Mycobacterium Tuberculosis Rnap Holo/Rbpa ... Darst             0.00 2017-12-27   0.0000
6BZO     Mtb Rnap Holo/Rbpa/Fidaxomicin/Upstream F ... Darst             0.00 2017-12-25   0.0000
6F6W     Structure Of Mycobacterium Smegmatis RNA  ... Kouba             3.80 2017-12-06   0.0000
6EYD     Structure Of Mycobacterium Smegmatis RNA  ... Kouba             4.20 2017-11-11   0.0000
6EEC     Mycobacterium Tuberculosis Rnap Promoter  ... Darst             0.00 2018-08-13   0.0000
6C04     Mtb Rnap Holo/Rbpa/Double Fork DNA -Close ... Darst             0.00 2017-12-27   0.0000
6VVX     Mycobacterium Tuberculosis Wt Rnap Transc ... Lilic             0.00 2020-02-18   0.0000
6VVZ     Mycobacterium Tuberculosis Rnap S456l Mut ... Lilic             0.00 2020-02-18   0.0000
6VVY     Mycobacterium Tuberculosis Wt Rnap Transc ... Lilic             0.00 2020-02-18   0.0000
6VW0     Mycobacterium Tuberculosis Rnap S456l Mut ... Lilic             0.00 2020-02-18   0.0000
6M7J     Mycobacterium Tuberculosis Rnap With Rbpa ... Darst             0.00 2018-08-20   0.0000
6EE8     Mycobacterium Tuberculosis Rnap Promoter  ... Darst             0.00 2018-08-13   0.0000
6EDT     Mycobacterium Tuberculosis Rnap Open Prom ... Darst             0.00 2018-08-10   0.0000
2GHO     Recombinant Thermus Aquaticus RNA Polymer ... Lamour            5.00 2006-03-27   0.0000
1I6V     Thermus Aquaticus Core RNA Polymerase-Rif ... Campbell          3.30 2001-03-05   0.0000
1HQM     Crystal Structure Of Thermus Aquaticus Co ... Minakhin          3.30 2000-12-18   0.0000
6OY6     X-Ray Crystal Structure Of A Bacterial Re ... Shin              3.10 2019-05-14   0.0000
6WOX     Thermus Thermophilus RNA Polymerase Initi ... Shin              3.14 2020-04-26   0.0000
6WOY     Thermus Thermophilus RNA Polymerase Initi ... Shin              3.00 2020-04-26   0.0000
5X21     Crystal Structure Of Thermus Thermophilus ... Zhang             3.32 2017-01-29   0.0000
3DXJ     Crystal Structure Of Thermus Thermophilus ... Das               3.00 2008-07-24   0.0000
1ZYR     Structure Of Thermus Thermophilus RNA Pol ... Tuske             3.00 2005-06-10   0.0000
4XLR     Crystal Structure Of T.Aquaticus Transcri ... Bae               4.30 2015-01-13   0.0000
4MQ9     Crystal Structure Of Thermus Thermophilus ... Ho                3.35 2013-09-16   0.0000
4XLQ     Crystal Structure Of T.Aquaticus Transcri ... Bae               4.60 2015-01-13   0.0000
5XJ0     T. Thermophilus RNA Polymerase Holoenzyme ... Ooi               4.00 2017-04-28   0.0000
4G7Z     Crystal Structure Of Thermus Thermophilus ... Zhang             3.81 2012-07-20   0.0000
6KQH     Thermus Thermophilus Initial Transcriptio ... Zhang             3.18 2019-08-17   0.0000
5D4D     Crystal Structure Of Thermus Thermophilus ... Zhang             3.00 2015-08-07   0.0000
2BE5     Crystal Structure Of T. Thermophilus RNA  ... Vassylyev         2.40 2005-10-22   0.0000
2O5I     Crystal Structure Of T. Thermophilus RNA  ... Vassylyev         2.50 2006-12-06   0.0000
5TMF     Re-Refinement Of Thermus Thermophilus RNA ... Wang              3.00 2016-10-12   0.0000
6P71     X-Ray Crystal Structure Of A Bacterial Re ... Shin              2.92 2019-06-04   0.0000
1YNN     Taq RNA Polymerase-Rifampicin Complex         Campbell          3.30 2005-01-24   0.0000
4OIO     Crystal Structure Of Thermus Thermophilus ... Zhang             3.10 2014-01-20   0.0000
1YNJ     Taq RNA Polymerase-Sorangicin Complex         Campbell          3.20 2005-01-24   0.0000
2A68     Crystal Structure Of T. Thermophilus RNA  ... Artsimovitch      2.50 2005-07-01   0.0000
4XLP     Crystal Structure Of T.Aquaticus Transcri ... Bae               4.00 2015-01-13   0.0000
5X22     Crystal Structure Of Thermus Thermophilus ... Zhang             3.35 2017-01-29   0.0000
5D4E     Crystal Structure Of Thermus Thermophilus ... Zhang             3.08 2015-08-07   0.0000
4XLN     Crystal Structure Of T. Aquaticus Transcr ... Bae               4.00 2015-01-13   0.0000
4Q5S     Thermus Thermophilus RNA Polymerase Initi ... Murakami          3.00 2014-04-17   0.0000
3AOH     RNA Polymerase-Gfh1 Complex (Crystal Type 1)  Tagami            4.10 2010-09-28   0.0000
6KQG     Thermus Thermophilus Initial Transcriptio ... Zhang             2.78 2019-08-17   0.0000
4WQT     Thermus Thermophilus RNA Polymerase Compl ... Murayama          4.40 2014-10-22   0.0000
5VO8     X-Ray Crystal Structure Of A Bacterial Re ... Murakami          3.30 2017-05-02   0.0000
3EQL     Crystal Structure Of T. Thermophilus RNA  ... Vassylyev         2.70 2008-09-30   0.0000
2CW0     Crystal Structure Of Thermus Thermophilus ... Tuske             3.30 2005-06-15   0.0000
5I2D     Crystal Structure Of T. Thermophilus Tthb ... Feng              4.41 2016-02-08   0.0000
6KQL     Thermus Thermophilus Initial Transcriptio ... Zhang             2.89 2019-08-18   0.0000
6OW3     X-Ray Crystal Structure Of A Bacterial Re ... Shin              2.77 2019-05-09   0.0000
6OVY     X-Ray Crystal Structure Of A Bacterial Re ... Shin              3.00 2019-05-08   0.0000
1SMY     Structural Basis For Transcription Regula ... Artsimovitch      2.70 2004-03-10   0.0000
1IW7     Crystal Structure Of RNA Polymerase Holoe ... Riken Structu ... 2.60 2002-04-22   0.0000
5TMC     Re-Refinement Of Thermus Thermopiles DNA- ... Wang              2.71 2016-10-12   0.0000
2A69     Crystal Structure Of T. Thermophilus RNA  ... Artsimovitch      2.50 2005-07-02   0.0000
3AOI     RNA Polymerase-Gfh1 Complex (Crystal Type 2)  Tagami            4.30 2010-09-30   0.0000
6M6A     Cryo-Em Structure Of Thermus Thermophilus ... Shi               5.00 2020-03-14   0.0000
6CUU     Thermus Thermophiles RNA Polymerase In Co ... Molodtsov         2.99 2018-03-26   0.0000
6KQD     Thermus Thermophilus Initial Transcriptio ... Zhang             3.30 2019-08-17   0.0000
6OY7     X-Ray Crystal Structure Of A Bacterial Re ... Shin              3.04 2019-05-14   0.0000
6OY5     X-Ray Crystal Structure Of A Bacterial Re ... Shin              3.10 2019-05-14   0.0000
4OIP     Crystal Structure Of Thermus Thermophilus ... Zhang             3.40 2014-01-20   0.0000
2O5J     Crystal Structure Of T. Thermophilus Rnap ... Vassylyev         3.00 2006-12-06   0.0000
2A6E     Crystal Structure Of T. Thermophilus RNA  ... Artsimovitch      2.80 2005-07-02   0.0000
4G7H     Crystal Structure Of Thermus Thermophilus ... Zhang             2.90 2012-07-20   0.0000
4XLS     Crystal Structure Of T. Aquaticus Transcr ... Bae               4.01 2015-01-13   0.0000
6KQF     Thermus Thermophilus Initial Transcriptio ... Zhang             2.45 2019-08-17   0.0000
1L9Z     Thermus Aquaticus RNA Polymerase Holoenzy ... Murakami          6.50 2002-03-27   0.0000
5VOI     X-Ray Crystal Structure Of Bacterial RNA  ... Murakami          2.80 2017-05-02   0.0000
5D4C     Crystal Structure Of Thermus Thermophilus ... Zhang             3.28 2015-08-07   0.0000
4OIN     Crystal Structure Of Thermus Thermophilus ... Zhang             2.80 2014-01-20   0.0000
1L9U     Thermus Aquaticus RNA Polymerase Holoenzy ... Murakami          4.00 2002-03-26   0.0000
4G7O     Crystal Structure Of Thermus Thermophilus ... Zhang             2.99 2012-07-20   0.0000
6P70     X-Ray Crystal Structure Of Bacterial RNA  ... Shin              3.05 2019-06-04   0.0000
6KQM     Thermus Thermophilus Initial Transcriptio ... Zhang             3.20 2019-08-18   0.0000
6LTS     Crystal Structure Of Thermus Thermophilus ... Zhang             3.45 2020-01-23   0.0000
2PPB     Crystal Structure Of T. Thermophilus Rnap ... Vassylyev         3.00 2007-04-28   0.0000
2A6H     Crystal Structure Of T. Thermophilus RNA  ... Temiakov          2.40 2005-07-02   0.0000
5E17     T. Thermophilus Transcription Initiation  ... Zhang             3.20 2015-09-29   0.0000
5TJG     Thermus Aquaticus Delta1.1-Sigmaa Holoenz ... Darst             2.60 2016-10-04   0.0000
6ASG     Crystal Structure Of Thermus Thermophilus ... Liu               3.80 2017-08-24   0.0000
6M6C     Cryoem Structure Of Thermus Thermophilus  ... Shi               3.10 2020-03-14   0.0000
4WQS     Thermus Thermophilus RNA Polymerase Backt ... Murayama          4.31 2014-10-22   0.0000
6KQN     Thermus Thermophilus Initial Transcriptio ... Zhang             3.49 2019-08-18   0.0000
4Q4Z     Thermus Thermophilus RNA Polymerase De No ... Murakami          2.90 2014-04-15   0.0000
4OIR     Crystal Structure Of Thermus Thermophilus ... Zhang             3.10 2014-01-20   0.0000
3WOD     RNA Polymerase-Gp39 Complex                   Tagami            3.60 2013-12-26   0.0000
6KQE     Thermus Thermophilus Initial Transcriptio ... Zhang             3.30 2019-08-17   0.0000
5E18     T. Thermophilus Transcription Initiation  ... Zhang             3.30 2015-09-29   0.0000
6OVR     X-Ray Crystal Structure Of A Bacterial Re ... Shin              2.84 2019-05-08   0.0000
6L74     Thermus Thermophilus Initial Transcriptio ... Zhang             3.12 2019-10-31   0.0000
4OIQ     Crystal Structure Of Thermus Thermophilus ... Zhang             3.62 2014-01-20   0.0000
6M6B     Cryo-Em Structure Of Thermus Thermophilus ... Shi               0.00 2020-03-14   0.0000
4GZZ     Crystal Structures Of Bacterial RNA Polym ... Weixlbaumer       4.29 2012-09-06   0.0000
4GZY     Crystal Structures Of Bacterial RNA Polym ... Weixlbaumer       3.51 2012-09-06   0.0000
6KF3     Cryo-Em Structure Of Thermococcus Kodakar ... Jun               3.90 2019-07-06   0.0000
4QIW     Crystal Structure Of Euryarchaeal RNA Pol ... Jun               3.50 2014-06-02   0.0000
6KF9     Cryo-Em Structure Of Thermococcus Kodakar ... Jun               3.79 2019-07-07   0.0000
6KF4     Cryo-Em Structure Of Thermococcus Kodakar ... Jun               3.97 2019-07-06   0.0000
3J0K     Orientation Of RNA Polymerase II Within T ... Bernecky          36.00 2011-10-04   0.0003
3J1N     Cryo-Em Map Of A Yeast Minimal Preinitiat ... Asturias          16.00 2012-03-29   0.0003
7A6H     Cryo-Em Structure Of Human Apo RNA Polyme ... Girbig            3.30 2020-08-25   0.0003
7D58     Cryo-Em Structure Of Human RNA Polymerase ... Wang              2.90 2020-09-25   0.0003
7AEA     Cryo-Em Structure Of Human RNA Polymerase ... Girbig            3.40 2020-09-17   0.0003
7DU2     RNA Polymerase Iii Ec Complex In Post-Tra ... Li                3.35 2021-01-07   0.0003
7AE1     Cryo-Em Structure Of Human RNA Polymerase ... Girbig            2.80 2020-09-17   0.0003
7AST     Apo Human RNA Polymerase Iii                  Ramsay            0.00 2020-10-28   0.0003
7DN3     Structure Of Human RNA Polymerase Iii Elo ... Li                3.50 2020-12-08   0.0003
7D59     Cryo-Em Structure Of Human RNA Polymerase ... Wang              3.10 2020-09-25   0.0003
7AE3     Cryo-Em Structure Of Human RNA Polymerase ... Girbig            3.10 2020-09-17   0.0003
4A3L     RNA Polymerase II Initial Transcribing Co ... Cheung            3.50 2011-09-30   0.0003
4A3C     RNA Polymerase II Initial Transcribing Co ... Cheung            3.50 2011-09-30   0.0003
4A3J     RNA Polymerase II Initial Transcribing Co ... Cheung            3.70 2011-09-30   0.0003
4A3I     RNA Polymerase II Binary Complex With DNA     Cheung            3.80 2011-09-30   0.0003
5IP9     Structure Of RNA Polymerase II-Tfiif Complex  Plaschka          3.90 2016-03-09   0.0003
4A3F     RNA Polymerase II Initial Transcribing Co ... Cheung            3.50 2011-09-30   0.0003
4A3G     RNA Polymerase II Initial Transcribing Co ... Cheung            3.50 2011-09-30   0.0003
4A3E     RNA Polymerase II Initial Transcribing Co ... Cheung            3.40 2011-09-30   0.0003
4A93     RNA Polymerase II Elongation Complex Cont ... Walmacq           3.40 2011-11-23   0.0003
4A3M     RNA Polymerase II Initial Transcribing Co ... Cheung            3.90 2011-09-30   0.0003
4A3B     RNA Polymerase II Initial Transcribing Co ... Cheung            3.50 2011-09-30   0.0003
5IP7     Structure Of RNA Polymerase II-Tfg1 Pepti ... Plaschka          3.52 2016-03-09   0.0003
4A3D     RNA Polymerase II Initial Transcribing Co ... Cheung            3.40 2011-09-30   0.0003
4A3K     RNA Polymerase II Initial Transcribing Co ... Cheung            3.50 2011-09-30   0.0003
2R7Z     Cisplatin Lesion Containing RNA Polymeras ... Damsma            3.80 2007-09-10   0.0003
3FKI     12-Subunit RNA Polymerase II Refined With ... Meyer             3.88 2008-12-16   0.0003
3H3V     Yeast Rnap II Containing Poly(A)-Signal S ... Dengl             4.00 2009-04-17   0.0003
3QT1     RNA Polymerase II Variant Containing A Ch ... Ruan              4.30 2011-02-22   0.0003
3HOX     Complete RNA Polymerase II Elongation Com ... Sydow             3.65 2009-06-03   0.0003
6UQ1     RNA Polymerase II Elongation Complex With ... Oh                3.60 2019-10-18   0.0003
1TWC     RNA Polymerase II Complexed With Gtp          Westover          3.00 2004-06-30   0.0003
1PQV     RNA Polymerase II-Tfiis Complex               Kettenberger      3.80 2003-06-19   0.0003
3GTP     Backtracked RNA Polymerase II Complex Wit ... Wang              3.90 2009-03-27   0.0003
4BBS     Structure Of An Initially Transcribing RN ... Sainsbury         3.60 2012-09-27   0.0003
3HOZ     Complete RNA Polymerase II Elongation Com ... Sydow             3.65 2009-06-03   0.0003
6UQ2     RNA Polymerase II Elongation Complex With ... Oh                3.20 2019-10-18   0.0003
5OT2     RNA Polymerase II Elongation Complex In T ... Malvezzi          3.20 2017-08-19   0.0003
7O75     Yeast RNA Polymerase II Transcription Pre ... Schilbach         0.00 2021-04-13   0.0003
1R9S     RNA Polymerase II Strand Separated Elonga ... Westover          4.25 2003-10-30   0.0003
5FYW     Transcription Initiation Complex Structur ... Plaschka          4.35 2016-03-10   0.0003
4BBR     Structure Of RNA Polymerase II-Tfiib Complex  Sainsbury         3.40 2012-09-27   0.0003
1R5U     RNA Polymerase II Tfiib Complex               Bushnell          4.50 2003-10-13   0.0003
5C44     Crystal Structure Of A Transcribing RNA P ... Barnes            3.95 2015-06-17   0.0003
6I84     Structure Of Transcribing RNA Polymerase  ... Farnung           4.40 2018-11-19   0.0003
3HOV     Complete RNA Polymerase II Elongation Com ... Sydow             3.50 2009-06-03   0.0003
3S1R     RNA Polymerase II Initiation Complex With ... Liu               3.20 2011-05-16   0.0003
4BY1     Elongating RNA Polymerase II-Bye1 Tld Com ... Kinkelin          3.60 2013-07-17   0.0003
1SFO     RNA Polymerase II Strand Separated Elonga ... Westover          3.61 2004-02-20   0.0003
3HOU     Complete RNA Polymerase II Elongation Com ... Sydow             3.20 2009-06-03   0.0003
4V1N     Architecture Of RNA Polymerase II-Mediato ... Plaschka          7.80 2014-09-29   0.0003
5U5Q     12 Subunit RNA Polymerase II At Room Temp ... Bushnell          3.80 2016-12-07   0.0003
5OQM     Structure Of Yeast Transcription Pre-Init ... Schilbach         5.80 2017-08-13   0.0003
3GTL     Backtracked RNA Polymerase II Complex Wit ... Wang              3.38 2009-03-27   0.0003
3GTG     Backtracked RNA Polymerase II Complex Wit ... Wang              3.78 2009-03-27   0.0003
3I4M     8-Oxoguanine Containing RNA Polymerase II ... Damsma            3.70 2009-07-02   0.0003
5FMF     The P-Lobe Of RNA Polymerase II Pre-Initi ... Murakami          6.00 2015-11-03   0.0003
6GYM     Structure Of A Yeast Closed Complex With  ... Dienemann         6.70 2018-06-30   0.0003
4V1M     Architecture Of RNA Polymerase II-Mediato ... Plaschka          6.60 2014-09-29   0.0003
3CQZ     Crystal Structure Of 10 Subunit RNA Polym ... Kaplan            2.80 2008-04-03   0.0003
1TWF     RNA Polymerase II Complexed With Utp At 2 ... Westover          2.30 2004-06-30   0.0003
3GTQ     Backtracked RNA Polymerase II Complex Ind ... Wang              3.80 2009-03-27   0.0003
3PO2     Arrested RNA Polymerase II Elongation Complex Cheung            3.30 2010-11-21   0.0003
6BM4     Pol II Elongation Complex With An Abasic  ... Wang              2.95 2017-11-13   0.0003
2NVY     RNA Polymerase II Form II In 150 Mm Mn+2      Wang              3.40 2006-11-13   0.0003
3S15     RNA Polymerase II Initiation Complex With ... Liu               3.30 2011-05-14   0.0003
3I4N     8-Oxoguanine Containing RNA Polymerase II ... Damsma            3.90 2009-07-02   0.0003
3HOY     Complete RNA Polymerase II Elongation Com ... Sydow             3.40 2009-06-03   0.0003
2B8K     12-Subunit RNA Polymerase II                  Meyer             4.15 2005-10-07   0.0003
6BLO     Pol II Elongation Complex With An Abasic  ... Wang              3.40 2017-11-10   0.0003
5FZ5     Transcription Initiation Complex Structur ... Plaschka          8.80 2016-03-10   0.0003
5VVS     RNA Pol II Elongation Complex                 Lahiri            6.40 2017-05-20   0.0003
1TWG     RNA Polymerase II Complexed With Ctp          Westover          3.30 2004-06-30   0.0003
7O4J     Yeast RNA Polymerase II Transcription Pre ... Schilbach         2.90 2021-04-06   0.0003
5C3E     Crystal Structure Of A Transcribing RNA P ... Barnes            3.70 2015-06-17   0.0003
2YU9     RNA Polymerase II Elongation Complex In 1 ... Wang              3.40 2007-04-06   0.0003
3S1Q     RNA Polymerase II Initiation Complex With ... Liu               3.30 2011-05-16   0.0003
4X67     Crystal Structure Of Elongating Yeast RNA ... Wang              4.10 2014-12-07   0.0003
5SVA     Mediator-RNA Polymerase II Pre-Initiation ... Robinson          15.30 2016-08-05   0.0003
1I50     RNA Polymerase II Crystal Form II At 2.8  ... Cramer            2.80 2001-02-23   0.0003
1Y1V     Refined RNA Polymerase II-Tfiis Complex       Kettenberger      3.80 2004-11-19   0.0003
3GTO     Backtracked RNA Polymerase II Complex Wit ... Wang              4.00 2009-03-27   0.0003
5OQJ     Structure Of Yeast Transcription Pre-Init ... Schilbach         4.70 2017-08-11   0.0003
2B63     Complete RNA Polymerase II-RNA Inhibitor  ... Kettenberger      3.80 2005-09-30   0.0003
4BY7     Elongating RNA Polymerase II-Bye1 Tld Complex Kinkelin          3.15 2013-07-18   0.0003
7O4K     Yeast Tfiih In The Contracted State Withi ... Schilbach         3.60 2021-04-06   0.0003
1WCM     Complete 12-Subunit RNA Polymerase II At  ... Armache           3.80 2004-11-17   0.0003
1R9T     RNA Polymerase II Strand Separated Elonga ... Westover          3.50 2003-10-30   0.0003
5C4A     Crystal Structure Of A Transcribing RNA P ... Barnes            4.20 2015-06-17   0.0003
5C4X     Crystal Structure Of A Transcribing RNA P ... Barnes            4.00 2015-06-18   0.0003
7O4I     Yeast RNA Polymerase II Transcription Pre ... Schilbach         3.20 2021-04-06   0.0003
3RZO     RNA Polymerase II Initiation Complex With ... Liu               3.00 2011-05-12   0.0003
2JA5     Cpd Lesion Containing RNA Polymerase II E ... Brueckner         3.80 2006-11-23   0.0003
7O72     Yeast RNA Polymerase II Transcription Pre ... Schilbach         0.00 2021-04-12   0.0003
3M3Y     RNA Polymerase II Elongation Complex C        Wang              3.18 2010-03-10   0.0003
6BLP     Pol II Elongation Complex With An Abasic  ... Wang              3.20 2017-11-11   0.0003
3M4O     RNA Polymerase II Elongation Complex B        Wang              3.57 2010-03-11   0.0003
4Y7N     The Structure Insight Into 5-Carboxycytos ... Wang              3.30 2015-02-15   0.0003
1I6H     RNA Polymerase II Elongation Complex          Gnatt             3.30 2001-03-02   0.0003
2E2I     RNA Polymerase II Elongation Complex In 5 ... Wang              3.41 2006-11-14   0.0003
1TWA     RNA Polymerase II Complexed With Atp          Westover          3.20 2004-06-30   0.0003
2R93     Elongation Complex Of RNA Polymerase II W ... Lehmann           4.00 2007-09-12   0.0003
1TWH     RNA Polymerase II Complexed With 2'Datp       Westover          3.40 2004-06-30   0.0003
4BXZ     RNA Polymerase II-Bye1 Complex                Kinkelin          4.80 2013-07-16   0.0003
6O6C     RNA Polymerase II Elongation Complex Arre ... Lahiri            3.10 2019-03-05   0.0003
2NVQ     RNA Polymerase II Elongation Complex In 1 ... Wang              2.90 2006-11-13   0.0003
6UPX     RNA Polymerase II Elongation Complex With ... Oh                3.40 2019-10-18   0.0003
7O73     Yeast RNA Polymerase II Transcription Pre ... Schilbach         3.40 2021-04-12   0.0003
3S16     RNA Polymerase II Initiation Complex With ... Liu               3.24 2011-05-14   0.0003
2R92     Elongation Complex Of RNA Polymerase II W ... Lehmann           3.80 2007-09-12   0.0003
2JA6     Cpd Lesion Containing RNA Polymerase II E ... Brueckner         4.00 2006-11-23   0.0003
1I3Q     RNA Polymerase II Crystal Form I At 3.1 A ... Cramer            3.10 2001-02-15   0.0003
5C4J     Crystal Structure Of A Transcribing RNA P ... Barnes            4.00 2015-06-18   0.0003
2JA8     Cpd Lesion Containing RNA Polymerase II E ... Brueckner         3.80 2006-11-23   0.0003
3GTJ     Backtracked RNA Polymerase II Complex Wit ... Wang              3.42 2009-03-27   0.0003
1NIK     Wild Type RNA Polymerase II                   Bushnell          4.10 2002-12-24   0.0003
4Y52     Crystal Structure Of 5-Carboxycytosine Re ... Wang              3.50 2015-02-11   0.0003
6UPZ     RNA Polymerase II Elongation Complex With ... Oh                3.10 2019-10-18   0.0003
6BM2     Pol II Elongation Complex With An Abasic  ... Wang              3.40 2017-11-13   0.0003
3S2H     RNA Polymerase II Initiation Complex With ... Liu               3.30 2011-05-16   0.0003
6BQF     Pol II Elongation Complex With 'Dt-Ap' At ... Wang              3.35 2017-11-27   0.0003
2NVZ     RNA Polymerase II Elongation Complex With ... Wang              4.30 2006-11-14   0.0003
2JA7     Cpd Lesion Containing RNA Polymerase II E ... Brueckner         3.80 2006-11-23   0.0003
6GYL     Structure Of A Yeast Closed Complex With  ... Dienemann         4.80 2018-06-30   0.0003
7KED     RNA Polymerase II Elongation Complex With ... Oh                3.60 2020-10-10   0.0003
3S14     RNA Polymerase II Initiation Complex With ... Liu               2.85 2011-05-14   0.0003
3GTM     Co-Complex Of Backtracked RNA Polymerase  ... Wang              3.80 2009-03-27   0.0003
4BXX     Arrested RNA Polymerase II-Bye1 Complex       Kinkelin          3.28 2013-07-16   0.0003
3RZD     RNA Polymerase II Initiation Complex With ... Liu               3.30 2011-05-11   0.0003
6UQ0     RNA Polymerase II Elongation Complex With ... Oh                3.56 2019-10-18   0.0003
1Y1W     Complete RNA Polymerase II Elongation Complex Cramer            4.00 2004-11-19   0.0003
4X6A     Crystal Structure Of Yeast RNA Polymerase ... Wang              3.96 2014-12-07   0.0003
2E2J     RNA Polymerase II Elongation Complex In 5 ... Wang              3.50 2006-11-14   0.0003
5W4U     Pol II Elongation Complex With An N6-Meth ... Wang              3.60 2017-06-13   0.0003
6UPY     RNA Polymerase II Elongation Complex With ... Oh                3.40 2019-10-18   0.0003
2NVX     RNA Polymerase II Elongation Complex In 5 ... Wang              3.60 2006-11-13   0.0003
6UQ3     RNA Polymerase II Elongation Complex With ... Oh                3.47 2019-10-18   0.0003
5VVR     Ternary Complex Of RNA Pol II, Transcript ... Lahiri            5.80 2017-05-19   0.0003
7O4L     Yeast Tfiih In The Expanded State Within  ... Schilbach         3.40 2021-04-06   0.0003
3K7A     Crystal Structure Of An RNA Polymerase II ... Liu               3.80 2009-10-12   0.0003
3S1N     RNA Polymerase II Initiation Complex With ... Liu               3.10 2011-05-15   0.0003
1Y1Y     RNA Polymerase II-Tfiis-DNA/RNA Complex       Cramer            4.00 2004-11-19   0.0003
3S2D     RNA Polymerase II Initiation Complex With ... Liu               3.20 2011-05-16   0.0003
7KEF     RNA Polymerase II Elongation Complex With ... Oh                3.89 2020-10-10   0.0003
3S1M     RNA Polymerase II Initiation Complex With ... Liu               3.13 2011-05-15   0.0003
2E2H     RNA Polymerase II Elongation Complex At 5 ... Wang              3.95 2006-11-14   0.0003
1K83     Crystal Structure Of Yeast RNA Polymerase ... Bushnell          2.80 2001-10-22   0.0003
3HOW     Complete RNA Polymerase II Elongation Com ... Sydow             3.60 2009-06-03   0.0003
3S17     RNA Polymerase II Initiation Complex With ... Liu               3.20 2011-05-14   0.0003
1NT9     Complete 12-Subunit RNA Polymerase II         Armache           4.20 2003-01-29   0.0003
3K1F     Crystal Structure Of RNA Polymerase II In ... Kostrewa          4.30 2009-09-27   0.0003
2NVT     RNA Polymerase II Elongation Complex In 1 ... Wang              3.36 2006-11-13   0.0003
6GYK     Structure Of A Yeast Closed Complex (Core ... Dienemann         5.10 2018-06-30   0.0003
3GTK     Backtracked RNA Polymerase II Complex Wit ... Wang              3.80 2009-03-27   0.0003
5W51     Pol II Elongation Complex With An N6-Meth ... Wang              3.40 2017-06-13   0.0003
4V1O     Architecture Of RNA Polymerase II-Mediato ... Plaschka          9.70 2014-09-29   0.0003
3PO3     Arrested RNA Polymerase II Reactivation I ... Cheung            3.30 2010-11-21   0.0003
2VUM     Alpha-Amanitin Inhibited Complete RNA Pol ... Brueckner         3.40 2008-05-27   0.0003
7KEE     RNA Polymerase II Elongation Complex With ... Oh                3.45 2020-10-10   0.0003
1Y77     Complete RNA Polymerase II Elongation Com ... Kettenberger      4.50 2004-12-08   0.0003
7EGA     Tfiid-Based Intermediate Pic On Puma Promoter Chen              4.10 2021-03-24   0.0003
6DRD     RNA Pol II(G)                                 Yu                0.00 2018-06-11   0.0005
5IY6     Human Holo-Pic In The Closed State            He                7.20 2016-03-24   0.0005
7EDX     P53-Bound Tfiid-Based Core Pic On Hdm2 Pr ... Chen              4.50 2021-03-17   0.0005
7EG9     Tfiid-Based Intermediate Pic On Scp Promoter  Chen              3.70 2021-03-24   0.0005
7NVZ     RNA Polymerase II Pre-Initiation Complex  ... Aibara            7.20 2021-03-16   0.0005
5IYC     Human Core-Pic In The Initial Transcribin ... He                3.90 2016-03-24   0.0005
7B0Y     Structure Of A Transcribing RNA Polymeras ... Zhang             3.60 2020-11-23   0.0005
5IY9     Human Holo-Pic In The Initial Transcribin ... He                6.30 2016-03-24   0.0005
7NVU     RNA Polymerase II Core Pre-Initiation Com ... Aibara            2.50 2021-03-16   0.0005
7ENA     Tfiid-Based Pic-Mediator Holo-Complex In  ... Chen              4.07 2021-04-16   0.0005
5FLM     Structure Of Transcribing Mammalian RNA P ... Bernecky          3.40 2015-10-26   0.0005
5IYA     Human Core-Pic In The Closed State            He                5.40 2016-03-24   0.0005
7NVS     RNA Polymerase II Core Pre-Initiation Com ... Aibara            2.80 2021-03-16   0.0005
5IYB     Human Core-Pic In The Open State              He                3.90 2016-03-24   0.0005
7NVY     RNA Polymerase II Pre-Initiation Complex  ... Aibara            7.30 2021-03-16   0.0005
6GML     Structure Of Paused Transcription Complex ... Vos               3.20 2018-05-27   0.0005
7ENC     Tfiid-Based Pic-Mediator Holo-Complex In  ... Chen              4.13 2021-04-16   0.0005
7NVT     RNA Polymerase II Core Pre-Initiation Com ... Aibara            2.90 2021-03-16   0.0005
6EXV     Structure Of Mammalian RNA Polymerase II  ... Liu               0.00 2017-11-09   0.0005
5IY8     Human Holo-Pic In The Initial Transcribin ... He                7.90 2016-03-24   0.0005
7B7U     Cryo-Em Structure Of Mammalian RNA Polyme ... Fianu             0.00 2020-12-11   0.0005
5OIK     Structure Of An RNA Polymerase II-Dsif Tr ... Bernecky          0.00 2017-07-18   0.0005
7EGC     P53-Bound Tfiid-Based Holo Pic On Hdm2 Pr ... Chen              3.90 2021-03-24   0.0005
5IYD     Human Core-Pic In The Initial Transcribin ... He                3.90 2016-03-24   0.0005
7LBM     Structure Of Human Mediator-Bound Transcr ... Abdella           4.80 2021-01-08   0.0005
7EG8     Tfiid-Based Core Pic On Puma Promoter         Chen              7.40 2021-03-24   0.0005
6XRE     Structure Of P53/RNA Polymerase II Assembly   Liou              4.60 2020-07-12   0.0005
7EGB     Tfiid-Based Holo Pic On Scp Promoter          Chen              3.30 2021-03-24   0.0005
6GMH     Structure Of Activated Transcription Comp ... Vos               3.10 2018-05-26   0.0005
6O9L     Human Holo-Pic In The Closed State            Yan               7.20 2019-03-14   0.0005
7NVR     Human Mediator With RNA Polymerase II Pre ... Rengachari        4.50 2021-03-15   0.0005
7EG7     Tfiid-Based Core Pic On Scp Promoter          Chen              6.20 2021-03-24   0.0005
5IY7     Human Holo-Pic In The Open State              He                8.60 2016-03-24   0.0005
7NW0     RNA Polymerase II Pre-Initiation Complex  ... Aibara            6.60 2021-03-16   0.0005
6TED     Structure Of Complete, Activated Transcri ... Vos               0.00 2019-11-11   0.0005
4V8S     Archaeal Rnap-DNA Binary Complex At 4.32ang   Wojtas            4.32 2012-07-12   0.0008
4AYB     Rnap At 3.2ang                                Wojtas            3.20 2012-06-19   0.0008
2PMZ     Archaeal RNA Polymerase From Sulfolobus S ... Murakami          3.40 2007-04-23   0.0008
2Y0S     Crystal Structure Of Sulfolobus Shibatae  ... Wojtas            3.80 2010-12-07   0.0008
3HKZ     The X-Ray Crystal Structure Of RNA Polyme ... Murakami          3.40 2009-05-26   0.0008
2WB1     The Complete Structure Of Archaeal 13-Sub ... Korkhin           3.52 2009-02-19   0.0008
2WAQ     The Complete Structure Of Archaeal 13-Sub ... Korkhin           3.35 2009-02-11   0.0008
6A5T     RNA Polymerase II Elongation Complex Stal ... Kujirai           6.70 2018-06-25   0.0028
5XOG     RNA Polymerase II Elongation Complex Boun ... Ehara             3.00 2017-05-28   0.0028
6A5L     RNA Polymerase II Elongation Complex Stal ... Kujirai           5.60 2018-06-24   0.0028
6J51     RNA Polymerase II Elongation Complex Boun ... Ehara             4.20 2019-01-10   0.0028
5X50     RNA Polymerase II From Komagataella Pasto ... Ehara             4.29 2017-02-14   0.0028
5X51     RNA Polymerase II From Komagataella Pasto ... Ehara             7.00 2017-02-14   0.0028
5X4Z     RNA Polymerase II From Komagataella Pasto ... Ehara             7.80 2017-02-14   0.0028
6J4Z     RNA Polymerase II Elongation Complex Boun ... Ehara             4.10 2019-01-10   0.0028
6J4W     RNA Polymerase II Elongation Complex Boun ... Ehara             7.90 2019-01-10   0.0028
6A5R     RNA Polymerase II Elongation Complex Stal ... Kujirai           8.70 2018-06-25   0.0028
6A5U     RNA Polymerase II Elongation Complex Stal ... Kujirai           7.60 2018-06-25   0.0028
6INQ     RNA Polymerase II Elongation Complex Stal ... Kujirai           6.90 2018-10-26   0.0028
6J4X     RNA Polymerase II Elongation Complex Boun ... Ehara             4.30 2019-01-10   0.0028
6IR9     RNA Polymerase II Elongation Complex Boun ... Ehara             3.80 2018-11-12   0.0028
6J50     RNA Polymerase II Elongation Complex Boun ... Ehara             4.70 2019-01-10   0.0028
5XON     RNA Polymerase II Elongation Complex Boun ... Ehara             3.83 2017-05-29   0.0028
6A5O     RNA Polymerase II Elongation Complex Stal ... Kujirai           9.90 2018-06-25   0.0028
6A5P     RNA Polymerase II Elongation Complex Stal ... Kujirai           7.00 2018-06-25   0.0028
6J4Y     RNA Polymerase II Elongation Complex Boun ... Ehara             4.30 2019-01-10   0.0028
3H0G     RNA Polymerase II From Schizosaccharomyce ... Spahr             3.65 2009-04-09   0.0028
5U0S     Cryo-Em Structure Of Mediator-Rnapii Complex  Tsai              7.80 2016-11-26   0.0028
6EU3     Apo RNA Polymerase Iii - Closed Conformat ... Abascal-Palacios  0.00 2017-10-27   0.0240
5FJ9     Cryo-Em Structure Of Yeast Apo RNA Polyme ... Hoffmann          4.60 2015-10-06   0.0240
5FJA     Cryo-Em Structure Of Yeast RNA Polymerase ... Hoffmann          4.65 2015-10-06   0.0240
6CNC     Yeast RNA Polymerase Iii Open Complex         Han               0.00 2018-03-08   0.0240
6F41     RNA Polymerase Iii Initially Transcribing ... Vorlaender        4.30 2017-11-29   0.0240
6F44     RNA Polymerase Iii Closed Complex Cc2.        Vorlaender        4.20 2017-11-29   0.0240
6EU2     Apo RNA Polymerase Iii - Open Conformatio ... Abascal-Palacios  0.00 2017-10-27   0.0240
5FJ8     Cryo-Em Structure Of Yeast RNA Polymerase ... Hoffmann          3.90 2015-10-06   0.0240
6EU0     RNA Polymerase Iii Open Pre-Initiation Co ... Abascal-Palacios  0.00 2017-10-27   0.0240
6F42     RNA Polymerase Iii Closed Complex Cc1.        Vorlaender        5.50 2017-11-29   0.0240
6EU1     RNA Polymerase Iii - Open DNA Complex (Oc ... Abascal-Palacios  0.00 2017-10-27   0.0240
6CNF     Yeast RNA Polymerase Iii Elongation Complex   Han               0.00 2018-03-08   0.0240
6CNB     Yeast RNA Polymerase Iii Initial Transcri ... Han               0.00 2018-03-08   0.0240
6CND     Yeast RNA Polymerase Iii Natural Open Com ... Han               0.00 2018-03-08   0.0240
6F40     RNA Polymerase Iii Open Complex               Vorlaender        3.70 2017-11-29   0.0240
6TUT     Cryo-Em Structure Of RNA Polymerase Iii-M ... Vorlaender        3.25 2020-01-08   0.0240
7AOD     Schizosaccharomyces Pombe RNA Polymerase  ... Heiss             0.00 2020-10-14   0.1500
7AOE     Schizosaccharomyces Pombe RNA Polymerase  ... Heiss             0.00 2020-10-14   0.1500
7AOC     Schizosaccharomyces Pombe RNA Polymerase  ... Heiss             0.00 2020-10-14   0.1500
4C3H     Structure Of 14-Subunit RNA Polymerase I  ... Fernandez-Tornero 3.27 2013-08-24   0.1900
5N60     Cryo-Em Structure Of RNA Polymerase I In  ... Engel             7.70 2017-02-14   0.1900
5G5L     RNA Polymerase I-Rrn3 Complex At 4.8 A Re ... Engel             4.80 2016-05-26   0.1900
5M5X     RNA Polymerase I Elongation Complex 1         Tafur             4.00 2016-10-23   0.1900
5LMX     Monomeric RNA Polymerase I At 4.9 A Resol ... Torreira          4.90 2016-08-02   0.1900
6RRD     RNA Polymerase I Pre-Initiation Complex D ... Mueller           3.10 2019-05-17   0.1900
6RQL     RNA Polymerase I Closed Conformation 2 (Cc2)  Mueller           2.90 2019-05-16   0.1900
4YM7     RNA Polymerase I Structure With An Altern ... Kostrewa          5.50 2015-03-06   0.1900
5M3F     Yeast RNA Polymerase I Elongation Complex ... Neyer             0.00 2016-10-14   0.1900
5OA1     RNA Polymerase I Pre-Initiation Complex       Sadian            4.40 2017-06-20   0.1900
6H67     Yeast RNA Polymerase I Elongation Complex ... Sanz-Murillo      0.00 2018-07-26   0.1900
5M5Y     RNA Polymerase I Elongation Complex 2         Tafur             4.00 2016-10-23   0.1900
5M64     RNA Polymerase I Elongation Complex With  ... Tafur             4.60 2016-10-24   0.1900
5W5Y     RNA Polymerase I Initial Transcribing Complex Han               3.80 2017-06-16   0.1900
5M5W     RNA Polymerase I Open Complex                 Tafur             3.80 2016-10-23   0.1900
6HLS     Yeast Apo RNA Polymerase I*                   Tafur             0.00 2018-09-11   0.1900
5N5Y     Cryo-Em Structure Of RNA Polymerase I In  ... Engel             7.70 2017-02-14   0.1900
6HKO     Yeast RNA Polymerase I Elongation Complex ... Tafur             0.00 2018-09-07   0.1900
4C2M     Structure Of RNA Polymerase I At 2.8 A Re ... Engel             2.80 2013-08-19   0.1900
6H68     Yeast RNA Polymerase I Elongation Complex ... Sanz-Murillo      0.00 2018-07-26   0.1900
4C3I     Structure Of 14-Subunit RNA Polymerase I  ... Fernandez-Tornero 3.00 2013-08-24   0.1900
6RUI     RNA Polymerase I Pre-Initiation Complex D ... Mueller           2.70 2019-05-28   0.1900
6RWE     RNA Polymerase I Open Complex Conformation 2  Mueller           3.00 2019-06-04   0.1900
5M3M     Free Monomeric RNA Polymerase I At 4.0a R ... Neyer             4.00 2016-10-15   0.1900
6RQT     RNA Polymerase I-Twh-Rrn3-DNA                 Mueller           4.00 2019-05-16   0.1900
6RQH     RNA Polymerase I Closed Conformation 1 (Cc1)  Mueller           3.70 2019-05-15   0.1900
5W65     RNA Polymerase I Initial Transcribing Com ... Han               4.30 2017-06-16   0.1900
6HLQ     Yeast RNA Polymerase I* Elongation Comple ... Tafur             0.00 2018-09-11   0.1900
6HLR     Yeast RNA Polymerase I Elongation Complex ... Tafur             0.00 2018-09-11   0.1900
5W64     RNA Polymerase I Initial Transcribing Com ... Han               4.20 2017-06-16   0.1900
4C3J     Structure Of 14-Subunit RNA Polymerase I  ... Fernandez-Tornero 3.35 2013-08-24   0.1900
6RUO     RNA Polymerase I Open Complex Conformation 1  Mueller           3.50 2019-05-28   0.1900
5W66     RNA Polymerase I Initial Transcribing Com ... Han               3.90 2017-06-16   0.1900
5N5Z     Cryo-Em Structure Of RNA Polymerase I In  ... Engel             7.70 2017-02-14   0.1900
5N61     RNA Polymerase I Initially Transcribing C ... Engel             0.00 2017-02-14   0.1900
6TPS     Early Intermediate RNA Polymerase I Pre-I ... Pilsl             0.00 2019-12-14   0.1900

OCA© by Jaime Prilusky, 1996-2013,2015,2021
Bioinformatics Unit
Weizmann Institute of Science