# OCA database search on: Wed Jun 29 23:03:33 2022 # Query: ev=10&ex=any&fa=SSKAMGIMNSFVNDIFERIAGEASRLAHYN&m=du # Hits: 395 (search time 2 sec) 2XQL Fitting Of H2a-H2b Histones In The Electr ... Ramos 19.50 2010-09-02 0.0000 6MUP Cenp-A Nucleosome Bound By Two Copies Of ... Allu 3.50 2018-10-23 0.0000 6MUO Cenp-A Nucleosome Bound By Two Copies Of ... Allu 3.60 2018-10-23 0.0000 6Y5E Structure Of Human Cgas (K394e) Bound To ... Pathare 3.15 2020-02-25 0.0000 7CCR Structure Of 2:2 Cgas-Nucleosome Complex Cao 0.00 2020-06-17 0.0000 7CCQ Structure Of 1:1 Cgas-Nucleosome Complex Cao 0.00 2020-06-17 0.0000 6LE9 The Human Telomeric Nucleosome Displays D ... Soman 2.60 2019-11-24 0.0000 6IPU Human Nucleosome Core Particle Containing ... Defalco 1.99 2018-11-04 0.0000 6L9H The Human Telomeric Nucleosome Displays D ... Soman 2.60 2019-11-10 0.0000 6KE9 The Human Telomeric Nucleosome Displays D ... Soman 2.22 2019-07-04 0.0000 6IQ4 Nucleosome Core Particle Cross-Linked Wit ... Defalco 2.25 2018-11-06 0.0000 5FUG Crystal Structure Of A Human Yl1-H2a.Z-H2 ... Latrick 2.70 2016-01-27 0.0000 4CAY Crystal Structure Of A Human Anp32e-H2a.Z ... Obri 1.48 2013-10-09 0.0000 6JXD Human Nucleosome Core Particle With Cohes ... Defalco 2.25 2019-04-23 0.0000 6KBB Role Of Def/Y Motif Of Swc5 In Histone H2 ... Huang 2.37 2019-06-24 0.0000 3W97 Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.20 2013-04-01 0.0000 3X1U Crystal Structure Of Nucleosome Core Part ... Sivaraman 3.25 2014-11-28 0.0000 6X5A The Mouse Cgas Catalytic Domain Binding T ... Pengbiao 0.00 2020-05-25 0.0000 6X59 The Mouse Cgas Catalytic Domain Binding T ... Pengbiao 0.00 2020-05-25 0.0000 3X1S Crystal Structure Of Nucleosome Core Particle Sivaraman 2.81 2014-11-27 0.0000 7BWD Structure Of Dot1l-H2bk34ub Nucleosome Co ... Lou 4.32 2020-04-14 0.0000 6XJD Two Mouse Cgas Catalytic Domain Binding T ... Xu 0.00 2020-06-23 0.0000 6FML Cryoem Structure Ino80core Nucleosome Complex Eustermann 4.34 2018-01-31 0.0000 7JOA 2:1 Cgas-Nucleosome Complex Boyer 0.00 2020-08-06 0.0000 7JO9 1:1 Cgas-Nucleosome Complex Boyer 0.00 2020-08-06 0.0000 7A08 Cryoem Structure Of Cgas Nucleosome Complex Michalski 0.00 2020-08-07 0.0000 5GT0 Crystal Structure Of Nucleosome Complex W ... Kumarevel 2.82 2016-08-18 0.0000 2HIO Histone Octamer (Chicken), Chromosomal Pr ... Arents 3.10 1999-06-15 0.0000 7JZV Cryo-Em Structure Of Brca1-Ubch5c/Bard1 E ... Witus 3.90 2020-09-02 0.0000 7LYC Cryo-Em Structure Of Human Nucleosome Cor ... Hu 0.00 2021-03-06 0.0000 6L9Z 338 Bp Di-Nucleosome Assembled With Linke ... Adhireksan 2.50 2019-11-11 0.0000 6SEF Class2c : Cenp-A Nucleosome In Complex Wi ... Ali-Ahmad 0.00 2019-07-29 0.0000 6M3V 355 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan 4.60 2020-03-04 0.0000 6R0C Human-D02 Nucleosome Core Particle With B ... Pye 4.20 2019-03-12 0.0000 6V92 Rsc-Ncp Patel 20.00 2019-12-13 0.0000 6M4D Structural Mechanism Of Nucleosome Dynami ... Zhou 0.00 2020-03-06 0.0000 5KGF Structural Model Of 53bp1 Bound To A Ubiq ... Wilson 4.54 2016-06-13 0.0000 6M4H Structural Mechanism Of Nucleosome Dynami ... Zhou 0.00 2020-03-07 0.0000 5XF5 Nucleosome Core Particle With An Adduct O ... Ma 2.82 2017-04-07 0.0000 6BUZ Cryo-Em Structure Of Cenp-A Nucleosome In ... Chittori 0.00 2017-12-11 0.0000 6UPL Structure Of Fact_subnucleosome Complex 2 Zhou 0.00 2019-10-17 0.0000 6RNY Pfv Intasome - Nucleosome Strand Transfer ... Pye 3.90 2019-05-09 0.0000 6LER 169 Bp Nucleosome Harboring Non-Identical ... Sharma 3.00 2019-11-26 0.0000 6LA8 349 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan 3.40 2019-11-12 0.0000 6LAB 169 Bp Nucleosome, Harboring Cohesive DNA ... Adhireksan 3.20 2019-11-12 0.0000 2CV5 Crystal Structure Of Human Nucleosome Cor ... Tsunaka 2.50 2005-05-31 0.0000 7BY0 The Cryo-Em Structure Of Cenp-A Nucleosom ... Ariyoshi 0.00 2020-04-21 0.0000 7K5X Cryo-Em Structure Of A Chromatosome Conta ... Zhou 0.00 2020-09-17 0.0000 5XF3 Nucleosome Core Particle With An Adduct O ... Ma 2.60 2017-04-07 0.0000 6T7A Structure Of Human Sox11 Transcription Fa ... Dodonova 3.70 2019-10-21 0.0000 6LA2 343 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan 3.89 2019-11-11 0.0000 6SEE Class2a : Cenp-A Nucleosome In Complex Wi ... Ali-Ahmad 0.00 2019-07-29 0.0000 6T79 Structure Of A Human Nucleosome At 3.2 A ... Dodonova 3.20 2019-10-21 0.0000 6T7D Structure Of Human Sox11 Transcription Fa ... Dodonova 4.40 2019-10-21 0.0000 6LA9 349 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan 3.70 2019-11-12 0.0000 6M4G Structural Mechanism Of Nucleosome Dynami ... Zhou 0.00 2020-03-06 0.0000 6SE6 Class2 : Cenp-A Nucleosome In Complex Wit ... Ali-Ahmad 0.00 2019-07-29 0.0000 6SE0 Class 1 : Cenp-A Nucleosome Ali-Ahmad 0.00 2019-07-29 0.0000 6M44 355 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan 3.81 2020-03-05 0.0000 6T7C Structure Of Two Copies Of Human Sox11 Tr ... Dodonova 4.00 2019-10-21 0.0000 6HTS Cryo-Em Structure Of Human Ino80 Complex ... Ayala 0.00 2018-10-04 0.0000 6E0C Cryo-Em Structure Of Cenp-A Nucleosome (W ... Yadav 2.63 2018-07-06 0.0000 6T7B Structure Of Human Sox2 Transcription Fac ... Dodonova 5.10 2019-10-21 0.0000 6O1D Cryo-Em Structure Of Centromeric Nucleoso ... Zhou 3.40 2019-02-19 0.0000 7K61 Cryo-Em Structure Of 197bp Nucleosome Aid ... Zhou 0.00 2020-09-17 0.0000 1TZY Crystal Structure Of Core-Histone Octamer ... Wood 1.90 2004-07-12 0.0000 6UPK Structure Of Fact_subnucleosome Complex 1 Zhou 0.00 2019-10-17 0.0000 6C0W Cryo-Em Structure Of Human Kinetochore Pr ... Zhou 0.00 2018-01-02 0.0000 6SEG Class1: Cenp-A Nucleosome In Complex With ... Ali-Ahmad 0.00 2019-07-30 0.0000 6E0P Cryo-Em Structure Of Centromeric Nucleoso ... Yadav 2.60 2018-07-06 0.0000 2ARO Crystal Structure Of Native Histone Octam ... Wood 2.10 2005-08-20 0.0000 1HQ3 Crystal Structure Of Histone-Core-Octamer ... Chantalat 2.15 2000-12-14 0.0000 6Y5D Structure Of Human Cgas (K394e) Bound To ... Pathare 4.10 2020-02-25 0.0000 7K63 Cryo-Em Structure Of A Chromatosome Conta ... Zhou 0.00 2020-09-18 0.0000 5XF4 Nucleosome Core Particle With An Adduct O ... Ma 2.87 2017-04-07 0.0000 1EQZ X-Ray Structure Of Nucleosome Core Partic ... Hanson 2.50 2000-04-06 0.0000 7K5Y Cryo-Em Structure Of A Chromatosome Conta ... Zhou 0.00 2020-09-17 0.0000 7DBP Linker Histone Defines Structure And Self ... Wang 0.00 2020-10-21 0.0000 7K60 Cryo-Em Structure Of A Chromatosome Conta ... Zhou 0.00 2020-09-17 0.0000 6T90 Oct4-Sox2-Bound Nucleosome - Shl-6 Michael 0.00 2019-10-25 0.0000 6YOV Oct4-Sox2-Bound Nucleosome - Shl+6 Michael 3.42 2020-04-15 0.0000 6A5L RNA Polymerase II Elongation Complex Stal ... Kujirai 5.60 2018-06-24 0.0000 6K1I Human Nucleosome Core Particle With Gamma ... Sharma 2.75 2019-05-10 0.0000 6HKT Structure Of An H1-Bound 6-Nucleosome Array Garcia-Saez 9.70 2018-09-08 0.0000 6L4A H3-H3-H3 Tri-Nucleosome With The 22 Base- ... Takizawa 12.30 2019-10-16 0.0000 6J4X RNA Polymerase II Elongation Complex Boun ... Ehara 4.30 2019-01-10 0.0000 6JR0 Crystal Structure Of Human Nucleosome Pha ... Saotome 2.50 2019-04-02 0.0000 6A5O RNA Polymerase II Elongation Complex Stal ... Kujirai 9.90 2018-06-25 0.0000 6A5P RNA Polymerase II Elongation Complex Stal ... Kujirai 7.00 2018-06-25 0.0000 6K1J Human Nucleosome Core Particle With H2a.X ... Sharma 2.85 2019-05-10 0.0000 3AZH Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.49 2011-05-25 0.0000 5Y0C Crystal Structure Of Human Nucleosome At ... Kurumizaka 2.09 2017-07-16 0.0000 5GSE Crystal Structure Of Unusual Nucleosome Kato 3.14 2016-08-16 0.0000 3AZN Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.00 2011-05-25 0.0000 6L49 H3-Ca-H3 Tri-Nucleosome With The 22 Base- ... Takizawa 18.90 2019-10-16 0.0000 6A5U RNA Polymerase II Elongation Complex Stal ... Kujirai 7.60 2018-06-25 0.0000 6USJ Structure Of Two Nucleosomes Bridged By H ... Gaullier 0.00 2019-10-27 0.0000 5Z30 The Crystal Structure Of Nucleosome Conta ... Horikoshi 2.45 2018-01-05 0.0000 6K1K Human Nucleosome Core Particle With H2a.X ... Sharma 2.20 2019-05-10 0.0000 6J51 RNA Polymerase II Elongation Complex Boun ... Ehara 4.20 2019-01-10 0.0000 6IR9 RNA Polymerase II Elongation Complex Boun ... Ehara 3.80 2018-11-12 0.0000 6V2K The Nucleosome Structure After H2a-H2b Ex ... Arimura 2.60 2019-11-24 0.0000 5JRG Crystal Structure Of Nucleosome Containin ... Osakabe 2.50 2016-05-06 0.0000 5X7X The Crystal Structure Of Nucleosome Conta ... Arimura 2.18 2017-02-27 0.0000 6A5T RNA Polymerase II Elongation Complex Stal ... Kujirai 6.70 2018-06-25 0.0000 5B31 The Crystal Structure Of Heterotypic H2az ... Horikoshi 2.20 2016-02-08 0.0000 4YM5 Crystal Structure Of Human Nucleosome Con ... Osakabe 4.00 2015-03-06 0.0000 6J4W RNA Polymerase II Elongation Complex Boun ... Ehara 7.90 2019-01-10 0.0000 6R90 Cryo-Em Structure Of Ncp-Thf2(+1)-Uv-Ddb ... Matsumoto 4.50 2019-04-02 0.0000 3AZK Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.20 2011-05-25 0.0000 3WTP Crystal Structure Of Heterotypic Nucleoso ... Arimura 2.67 2014-04-14 0.0000 5B24 The Crystal Structure Of Nucleosome Conta ... Horikoshi 3.60 2015-12-31 0.0000 5AV9 Human Nucleosome Core Particle Wakamori 2.20 2015-06-12 0.0000 5B0Y Crystal Structure Of Nucleosome Containin ... Suzuki 2.56 2015-11-13 0.0000 6INQ RNA Polymerase II Elongation Complex Stal ... Kujirai 6.90 2018-10-26 0.0000 6J50 RNA Polymerase II Elongation Complex Boun ... Ehara 4.70 2019-01-10 0.0000 6JR1 Crystal Structure Of Human Nucleosome Pha ... Saotome 2.40 2019-04-02 0.0000 5B2J Human Nucleosome Containing Cpg Methylate ... Fujii 2.60 2016-01-18 0.0000 3AZI Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.70 2011-05-25 0.0000 4Z5T The Nucleosome Containing Human H3.5 Urahama 2.80 2015-04-03 0.0000 5AY8 Crystal Structure Of Human Nucleosome Con ... Kujirai 2.80 2015-08-10 0.0000 3AZG Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.40 2011-05-25 0.0000 6R8Y Cryo-Em Structure Of Ncp-6-4pp(-1)-Uv-Ddb Matsumoto 4.30 2019-04-02 0.0000 3AZJ Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.89 2011-05-25 0.0000 6R94 Cryo-Em Structure Of Ncp_thf2(-3) Matsumoto 3.50 2019-04-02 0.0000 5AV6 Human Nucleosome Core Particle Wakamori 2.20 2015-06-12 0.0000 6JOU Crystal Structure Of Human Nucleosome Con ... Horikoshi 2.17 2019-03-23 0.0000 3AV2 The Human Nucleosome Structure Containing ... Tachiwana 2.80 2011-02-18 0.0000 3AZE Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.00 2011-05-25 0.0000 6T93 Nucleosome With Oct4-Sox2 Motif At Shl-6 Michael 3.49 2019-10-25 0.0000 5B33 The Crystal Structure Of H2az Nucleosome ... Horikoshi 2.92 2016-02-08 0.0000 3W99 Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.00 2013-04-01 0.0000 5ZBX The Crystal Structure Of Nucleosome Conta ... Arimura 2.58 2018-02-13 0.0000 5B0Z The Crystal Structure Of Nucleosome Conta ... Suzuki 1.99 2015-11-14 0.0000 3AN2 The Structure Of Centromeric Nucleosome C ... Tachiwana 3.60 2010-08-27 0.0000 5GXQ The Crystal Structure Of Nucleosome Conta ... Taguchi 2.85 2016-09-19 0.0000 3WA9 The Nucleosome Containing Human H2a.Z.1 Horikoshi 3.07 2013-04-30 0.0000 3AZM Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.89 2011-05-25 0.0000 5Z23 Crystal Structure Of Nucleosome Containin ... Arimura 2.73 2017-12-28 0.0000 6R91 Cryo-Em Structure Of Ncp_thf2(-3)-Uv-Ddb Matsumoto 4.10 2019-04-02 0.0000 3AZF Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.70 2011-05-25 0.0000 3WAA The Nucleosome Containing Human H2a.Z.2 Horikoshi 3.20 2013-04-30 0.0000 3W96 Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.00 2013-04-01 0.0000 7D1Z Cryo-Em Structure Of Set8-Nucleosome Complex Ho 0.00 2020-09-15 0.0000 4YM6 Crystal Structure Of Human Nucleosome Con ... Osakabe 3.51 2015-03-06 0.0000 5AVC Human Nucleosome Core Particle Wakamori 2.40 2015-06-12 0.0000 5CPI Nucleosome Containing Unmethylated Sat2r DNA Osakabe 2.90 2015-07-21 0.0000 7C0M Human Cgas-Nucleosome Complex Kujirai 3.90 2020-05-01 0.0000 5AV5 Human Nucleosome Core Particle Wakamori 2.40 2015-06-11 0.0000 6R93 Cryo-Em Structure Of Ncp-6-4pp Matsumoto 4.00 2019-04-02 0.0000 7BXT The Cryo-Em Structure Of Cenp-A Nucleosom ... Ariyoshi 0.00 2020-04-20 0.0000 3AZL Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.70 2011-05-25 0.0000 3A6N The Nucleosome Containing A Testis-Specif ... Tachiwana 2.70 2009-09-04 0.0000 3AYW Crystal Structure Of Human Nucleosome Cor ... Iwasaki 2.90 2011-05-19 0.0000 6J4Y RNA Polymerase II Elongation Complex Boun ... Ehara 4.30 2019-01-10 0.0000 6R92 Cryo-Em Structure Of Ncp-Thf2(+1)-Uv-Ddb ... Matsumoto 4.80 2019-04-02 0.0000 3AFA The Human Nucleosome Structure Tachiwana 2.50 2010-02-24 0.0000 5AVB Human Nucleosome Core Particle Wakamori 2.40 2015-06-12 0.0000 5B2I Human Nucleosome Containing Cpg Unmethyla ... Fujii 3.00 2016-01-16 0.0000 6R8Z Cryo-Em Structure Of Ncp_thf2(-1)-Uv-Ddb Matsumoto 3.90 2019-04-02 0.0000 5GTC Crystal Structure Of Complex Between Dmap ... Arimura 2.70 2016-08-19 0.0000 5B40 The Nucleosome Structure Containing H2b-K ... Machida 3.33 2016-03-22 0.0000 3W98 Crystal Structure Of Human Nucleosome Cor ... Iwasaki 3.42 2013-04-01 0.0000 3AV1 The Human Nucleosome Structure Containing ... Tachiwana 2.50 2011-02-18 0.0000 7D20 Cryo-Em Structure Of Set8-Cenp-A-Nucleoso ... Ho 0.00 2020-09-15 0.0000 5AV8 Human Nucleosome Core Particle Wakamori 2.20 2015-06-12 0.0000 6KXV Crystal Structure Of A Nucleosome Contain ... Dacher 3.63 2019-09-13 0.0000 2RVQ Solution Structure Of Isolated Histone H2 ... Moriwaki 2016-03-28 0.0000 6J4Z RNA Polymerase II Elongation Complex Boun ... Ehara 4.10 2019-01-10 0.0000 5CPJ Nucleosome Containing Methylated Sat2r DNA Osakabe 3.15 2015-07-21 0.0000 6A5R RNA Polymerase II Elongation Complex Stal ... Kujirai 8.70 2018-06-25 0.0000 5B32 The Crystal Structure Of Heterotypic H2az ... Horikoshi 2.35 2016-02-08 0.0000 5CPK Nucleosome Containing Methylated Sat2l DNA Osakabe 2.63 2015-07-21 0.0000 6KVD Crystal Structure Of Human Nucleosome Con ... Tanaka 2.21 2019-09-04 0.0000 7BG9 The Catalytic Core Lobe Of Human Telomera ... Nguyen 3.80 2021-01-06 0.0000 5CHL Structural Basis Of H2a.Z Recognition By ... Shan 1.89 2015-07-10 0.0000 5VEY Solution NMR Structure Of Histone H2a-H2b ... Hu 2017-04-06 0.0000 4NFT Crystal Structure Of Human Lnkh2b-H2a.Z-A ... Shan 2.61 2013-11-01 0.0000 6A7U Crystal Structure Of Histone H2a.Bbd-H2b ... Dai 2.60 2018-07-04 0.0000 5Y0D Crystal Structure Of Human Nucleosome Con ... Kurumizaka 1.99 2017-07-16 0.0000 7K6P Active State Dot1 Bound To The Unacetylat ... Valencia-Sanchez 3.20 2020-09-21 0.0000 5MLU Crystal Structure Of Pfv Gag Cbs Bound To ... Pye 2.80 2016-12-07 0.0000 3KWQ Structural Characterization Of H3k56q Nuc ... Lilyestrom 3.50 2009-12-01 0.0000 6Z6P Hdac-Pc-Nuc Lee 0.00 2020-05-28 0.0000 7K6Q Active State Dot1 Bound To The H4k16ac Nu ... Valencia-Sanchez 3.10 2020-09-21 0.0000 4YS3 Nucleosome Disassembly By Rsc And Swi/Snf ... Dechassa 3.00 2015-03-16 0.0000 6NE3 Cryo-Em Structure Of Singly-Bound Snf2h-N ... Armache 0.00 2018-12-16 0.0000 4XZQ Nucleosome Disassembly By Rsc And Swi/Snf ... Dechassa 2.40 2015-02-04 0.0000 6JM9 Cryo-Em Structure Of Dot1l Bound To Unmod ... Jang 7.30 2019-03-07 0.0000 6JMA Cryo-Em Structure Of Dot1l Bound To H2b U ... Jang 6.80 2019-03-07 0.0000 4Z66 Nucleosome Disassembly By Rsc And Swi/Snf ... Dechassa 2.50 2015-04-03 0.0000 6FQ8 Class 3 : Translocated Nucleosome Bilokapic 0.00 2018-02-13 0.0000 6FQ5 Class 1 : Canonical Nucleosome Bilokapic 0.00 2018-02-13 0.0000 6FQ6 Class 2 : Distorted Nucleosome Bilokapic 0.00 2018-02-13 0.0000 7KTQ Nucleosome From A Dimeric Prc2 Bound To A ... Grau 3.30 2020-11-24 0.0000 6R1T Structure Of Lsd2/Npac-Linker/Nucleosome ... Marabelli 3.70 2019-03-15 0.0000 6IY3 Structure Of Snf2-Mmtv-A Nucleosome Compl ... Li 0.00 2018-12-12 0.0000 1AOI Complex Between Nucleosome Core Particle ... Luger 2.80 1997-07-03 0.0000 6K01 Crystal Structure Of Xh2a-H2b Liu 2.84 2019-05-05 0.0000 5G2E Structure Of Nap1 H2a H2b Complex Aguilargurrieri 6.70 2016-04-07 0.0000 6IY2 Structure Of Snf2-Mmtv-A Nucleosome Compl ... Li 0.00 2018-12-12 0.0000 3C9K Model Of Histone Octamer Tubular Crystals Frouws 20.00 2008-02-16 0.0000 1U35 Crystal Structure Of Nucleosome Core Part ... Chakravarthy 3.00 2004-07-20 0.0000 2F8N 2.9 Angstrom X-Ray Structure Of Hybrid Ma ... Chakravarthy 2.90 2005-12-02 0.0000 5XM1 The Mouse Nucleosome Structure Containing ... Taguchi 3.45 2017-05-12 0.0000 5XM0 The Mouse Nucleosome Structure Containing ... Taguchi 2.87 2017-05-12 0.0000 5B1L The Mouse Nucleosome Structure Containing H3t Urahama 2.35 2015-12-08 0.0000 5B1M The Mouse Nucleosome Structure Containing ... Urahama 2.34 2015-12-08 0.0000 6ESF Nucleosome : Class 1 Bilokapic 0.00 2017-10-20 0.0000 6R1U Structure Of Lsd2/Npac-Linker/Nucleosome ... Marabelli 4.36 2019-03-15 0.0000 3MVD Crystal Structure Of Chromatin Factor Rcc ... Makde 2.90 2010-05-04 0.0000 6NJ9 Active State Dot1l Bound To The H2b-Ubiqu ... Worden 2.96 2019-01-02 0.0000 3O62 Nucleosome Core Particle Modified With A ... Lippard 3.22 2010-07-28 0.0000 6S01 Structure Of Ledgf Pwwp Domain Bound H3k3 ... Wang 3.20 2019-06-13 0.0000 6ESG Nucleosome Breathing : Class 2 Bilokapic 0.00 2017-10-20 0.0000 6WZ9 Bridging Of Double-Strand DNA Break Activ ... Halic 0.00 2020-05-13 0.0000 6KIZ Cryo-Em Structure Of Human Mll1-Ncp Compl ... Huang 0.00 2019-07-20 0.0000 7CRO Nsd2 Bearing E1099k/T1150a Dual Mutation ... Li 0.00 2020-08-14 0.0000 6KIX Cryo-Em Structure Of Human Mll1-Ncp Compl ... Huang 0.00 2019-07-20 0.0000 6KIV Cryo-Em Structure Of Human Mll1-Ubncp Com ... Huang 0.00 2019-07-20 0.0000 4R8P Crystal Structure Of Ring1b/Bmi1/Ubch5c P ... Mcginty 3.28 2014-09-02 0.0000 5F99 X-Ray Structure Of Mmtv-A Nucleosome Core ... Frouws 2.63 2015-12-09 0.0000 6KIU Cryo-Em Structure Of Human Mll1-Ubncp Com ... Huang 0.00 2019-07-20 0.0000 3REH 2.5 Angstrom Crystal Structure Of Nucleos ... Wu 2.50 2011-04-04 0.0000 6X0N Bridging Of Double-Strand DNA Break Activ ... Halic 0.00 2020-05-16 0.0000 5OMX X-Ray Structure Of H2a-N38c Nucleosome Co ... Frouws 2.32 2017-08-02 0.0000 3REK 2.6 Angstrom Crystal Structure Of Nucleos ... Wu 2.60 2011-04-04 0.0000 6WZ5 Bridging Of Double-Strand DNA Break Activ ... Halic 0.00 2020-05-13 0.0000 6JYL The Crosslinked Complex Of Iswi-Nucleosom ... Yan 3.37 2019-04-26 0.0000 3REJ 2.55 Angstrom Crystal Structure Of Nucleo ... Wu 2.55 2011-04-04 0.0000 3REI 2.65 Angstrom Crystal Structure Of Nucleo ... Wu 2.65 2011-04-04 0.0000 5X0Y Complex Of Snf2-Nucleosome Complex With S ... Li 0.00 2017-01-23 0.0000 6IRO The Crosslinked Complex Of Iswi-Nucleosom ... Yan 0.00 2018-11-13 0.0000 5NL0 Crystal Structure Of A 197-Bp Palindromic ... Garcia-Saez 5.40 2017-04-03 0.0000 6VEN Yeast Compass In Complex With A Ubiquitin ... Worden 3.37 2020-01-02 0.0000 6ESH Nucleosome Breathing : Class 3 Bilokapic 0.00 2017-10-20 0.0000 7CRP Nsd3 Bearing E1181k/T1232a Dual Mutation ... Li 0.00 2020-08-14 0.0000 7AT8 Histone H3 Recognition By Nucleosome-Boun ... Finogenova 4.40 2020-10-29 0.0000 1S32 Molecular Recognition Of Nucleosomal 'Sup ... Edayathumangalam 2.05 2004-01-12 0.0000 6W5I Cryo-Em Structure Of Mll1 In Complex With ... Park 0.00 2020-03-13 0.0000 6PWV Cryo-Em Structure Of Mll1 Core Complex Bo ... Park 6.20 2019-07-23 0.0000 6UXW Swi/Snf Nucleosome Complex With Adp-Befx He 0.00 2019-11-08 0.0000 5ONG X-Ray Crystal Structure Of A Nucleosome C ... Frouws 2.80 2017-08-03 0.0000 6KIW Cryo-Em Structure Of Human Mll3-Ubncp Com ... Huang 0.00 2019-07-20 0.0000 5ONW X-Ray Crystal Structure Of A Nucleosome C ... Frouws 2.80 2017-08-04 0.0000 6T9L Saga Dub Module Bound To A Ubiqitinated N ... Wang 3.60 2019-10-28 0.0000 5Z3L Structure Of Snf2-Nucleosome Complex In A ... Li 0.00 2018-01-08 0.0000 6TDA Structure Of Swi/Snf Chromatin Remodeler ... Wagner 15.00 2019-11-08 0.0000 5Z3U Structure Of Snf2-Nucleosome Complex At S ... Li 0.00 2018-01-08 0.0000 5Z3V Structure Of Snf2-Nucleosome Complex At S ... Li 0.00 2018-01-08 0.0000 3REL 2.7 Angstrom Crystal Structure Of Nucleos ... Wu 2.70 2011-04-04 0.0000 6NOG Poised-State Dot1l Bound To The H2b-Ubiqu ... Worden 3.90 2019-01-16 0.0000 3KXB Structural Characterization Of H3k56q Nuc ... Clark 3.20 2009-12-02 0.0000 3LJA Using Soft X-Rays For A Detailed Picture ... Wu 2.75 2010-01-26 0.0000 7CRQ Nsd3 Bearing E1181k/T1232a Dual Mutation ... Li 0.00 2020-08-14 0.0000 7CRR Native Nsd3 Bound To 187-Bp Nucleosome Li 0.00 2020-08-14 0.0000 3TU4 Crystal Structure Of Sir3 Bah Domain In C ... Armache 3.00 2011-09-15 0.0000 6VYP Crystal Structure Of Lsd1/Corest Histone ... Kim 4.99 2020-02-27 0.0000 5HQ2 Structural Model Of Set8 Histone H4 Lys20 ... Tavarekere 4.50 2016-01-21 0.0000 5Z3O Structure Of Snf2-Nucleosome Complex In A ... Li 0.00 2018-01-08 0.0000 6K1P The Complex Of Iswi-Nucleosome In The Adp ... Yan 3.87 2019-05-10 0.0000 6ESI Nucleosome Breathing : Class 4 Bilokapic 0.00 2017-10-20 0.0000 6NQA Active State Dot1l Bound To The H2b-Ubiqu ... Worden 3.54 2019-01-19 0.0000 5O9G Structure Of Nucleosome-Chd1 Complex Farnung 4.80 2017-06-19 0.0000 4ZUX Saga Dub Module Ubp8/Sgf11/Sus1/Sgf73 Bou ... Morgan 3.82 2015-05-17 0.0000 6RYU Nucleosome-Chd4 Complex Structure (Two Ch ... Farnung 0.00 2019-06-12 0.0000 6PX3 Set2 Bound To Nucleosome Halic 0.00 2019-07-24 0.0000 6I84 Structure Of Transcribing RNA Polymerase ... Farnung 4.40 2018-11-19 0.0000 6NZO Set2 Bound To Nucleosome Halic 0.00 2019-02-14 0.0000 6ZHY Cryo-Em Structure Of Regulatory Linker Of ... Bacic 3.00 2020-06-24 0.0000 6W5N Cryo-Em Structure Of Mll1 In Complex With ... Park 0.00 2020-03-13 0.0000 6PA7 The Cryo-Em Structure Of Human Dnmt3a2-Dn ... Xu 0.00 2019-06-11 0.0000 6PWW Cryo-Em Structure Of Mll1 In Complex With ... Park 0.00 2019-07-23 0.0000 6RYR Nucleosome-Chd4 Complex Structure (Single ... Farnung 0.00 2019-06-11 0.0000 6J99 Cryo-Em Structure Of Human Dot1l In Compl ... Yao 0.00 2019-01-22 0.0000 6N1Z Importin-9 Bound To H2a-H2b Tomchick 2.70 2018-11-12 0.0000 6ZHX Cryo-Em Structure Of Regulatory Linker Of ... Bacic 2.50 2020-06-24 0.0000 6W5M Cryo-Em Structure Of Mll1 In Complex With ... Park 0.00 2020-03-13 0.0000 6PWX Cryo-Em Structure Of Rbbp5 Bound To The N ... Park 0.00 2019-07-23 0.0000 5E5A Crystal Structure Of Chromatin-Tethering ... Fang 2.81 2015-10-08 0.0000 6O96 Dot1l Bound To The H2bk120 Ubiquitinated ... Valencia-Sanchez 0.00 2019-03-13 0.0000 6PX1 Set2 Bound To Nucleosome Halic 0.00 2019-07-24 0.0000 6NN6 Structure Of Dot1l-H2bk120ub Nucleosome C ... Anderson 3.90 2019-01-14 0.0000 1P3G Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.70 2003-04-17 0.0000 1M1A Ligand Binding Alters The Structure And D ... Suto 2.65 2002-06-18 0.0000 3KUY DNA Stretching In The Nucleosome Facilita ... Wu 2.90 2009-11-28 0.0000 3C1B The Effect Of H3 K79 Dimethylation And H4 ... Lu 2.20 2008-01-22 0.0000 3B6F Nucleosome Core Particle Treated With Cis ... Wu 3.45 2007-10-29 0.0000 3LEL Structural Insight Into The Sequence-Depe ... Wu 2.95 2010-01-15 0.0000 3MGQ Binding Of Nickel Ions To The Nucleosome ... Mohideen 2.65 2010-04-07 0.0000 1KX5 X-Ray Structure Of Nucleosome Core Partic ... Davey 1.94 2002-01-31 0.0000 4J8X X-Ray Structure Of Ncp145 With Bound Chlo ... Adhireksan 2.87 2013-02-15 0.0000 6UGM Structural Basis Of Compass Ecm Recogniti ... Hsu 0.00 2019-09-26 0.0000 3MGR Binding Of Rubidium Ions To The Nucleosom ... Mohideen 2.30 2010-04-07 0.0000 6VZ4 Cryo-Em Structure Of Sth1-Arp7-Arp9-Rtt10 ... Leschziner 3.90 2020-02-27 0.0000 1ZLA X-Ray Structure Of A Kaposi'S Sarcoma Her ... Chodaparambil 2.90 2005-05-05 0.0000 3MGP Binding Of Cobalt Ions To The Nucleosome ... Mohideen 2.44 2010-04-07 0.0000 4WU8 Structure Of Trptnap-Ncp145 Chua 2.45 2014-10-31 0.0000 5XF6 Nucleosome Core Particle With An Adduct O ... Ma 2.63 2017-04-07 0.0000 1P3A Crystallographic Studies Of Nucleosome Co ... Muthurajan 3.00 2003-04-17 0.0000 3UTB Crystal Structure Of Nucleosome Core Part ... Chua 2.20 2011-11-25 0.0000 1P3F Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.90 2003-04-17 0.0000 3LZ0 Crystal Structure Of Nucleosome Core Part ... Vasudevan 2.50 2010-03-01 0.0000 1KX4 X-Ray Structure Of Nucleosome Core Partic ... Davey 2.60 2002-01-31 0.0000 4XUJ Nucleosome Core Particle Containing Adduc ... Adhireksan 3.18 2015-01-26 0.0000 5DNM Nucleosome Core Particle Containing Adduc ... Adhireksan 2.81 2015-09-10 0.0000 5CP6 Nucleosome Core Particle With Adducts Fro ... Ma 2.60 2015-07-21 0.0000 4WU9 Structure Of Cisptnap-Ncp145 Chua 2.60 2014-10-31 0.0000 1P3I Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.30 2003-04-17 0.0000 2FJ7 Crystal Structure Of Nucleosome Core Part ... Bao 3.20 2005-12-31 0.0000 3UTA Crystal Structure Of Nucleosome Core Part ... Chua 2.07 2011-11-25 0.0000 3LZ1 Crystal Structure Of Nucleosome Core Part ... Vasudevan 2.50 2010-03-01 0.0000 6TEM Cenp-A Nucleosome Core Particle With 145 ... Boopathi 3.90 2019-11-12 0.0000 1P3M Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.90 2003-04-17 0.0000 1ZBB Structure Of 4_601_167 Tetranucleosome Schalch 9.00 2005-04-08 0.0000 1M18 Ligand Binding Alters The Structure And D ... Suto 2.45 2002-06-18 0.0000 1KX3 X-Ray Structure Of Nucleosome Core Partic ... Davey 2.00 2002-01-31 0.0000 1P3L Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.40 2003-04-17 0.0000 4J8W X-Ray Structure Of Ncp145 With Chlorido(E ... Adhireksan 2.41 2013-02-15 0.0000 3MGS Binding Of Cesium Ions To The Nucleosome ... Mohideen 3.15 2010-04-07 0.0000 1P3O Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.75 2003-04-17 0.0000 1P3K Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.90 2003-04-17 0.0000 1P3B Crystallographic Studies Of Nucleosome Co ... Muthurajan 3.00 2003-04-17 0.0000 1P34 Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.70 2003-04-17 0.0000 5DNN Nucleosome Core Particle Containing Adduc ... Adhireksan 2.80 2015-09-10 0.0000 2NZD Nucleosome Core Particle Containing 145 B ... Ong 2.65 2006-11-23 0.0000 3MNN A Ruthenium Antitumour Agent Forms Specif ... Ong 2.50 2010-04-22 0.0000 4J8U X-Ray Structure Of Ncp145 With Chlorido(E ... Adhireksan 2.38 2013-02-15 0.0000 1P3P Crystallographic Studies Of Nucleosome Co ... Muthurajan 2.70 2003-04-17 0.0000 3B6G Nucleosome Core Particle Treated With Oxa ... Wu 3.45 2007-10-29 0.0000 6UH5 Structural Basis Of Compass Ecm Recogniti ... Hsu 0.00 2019-09-26 0.0000 3C1C The Effect Of H3 K79 Dimethylation And H4 ... Lu 3.15 2008-01-22 0.0000 5X0X Complex Of Snf2-Nucleosome Complex With S ... Li 0.00 2017-01-23 0.0000 3UT9 Crystal Structure Of Nucleosome Core Part ... Chua 2.20 2011-11-25 0.0000 1M19 Ligand Binding Alters The Structure And D ... Suto 2.30 2002-06-18 0.0000 4J8V X-Ray Structure Of Ncp145 With Bound Chlo ... Adhireksan 2.58 2013-02-15 0.0000 6OM3 Crystal Structure Of Orc1 Bah Domain In C ... De Ioannes 3.30 2019-04-18 0.0000 5OXV Structure Of 4_601_157 Tetranucleosome (C ... Ekundayo 6.72 2017-09-07 0.0000 6WKR Prc2-Aebp2-Jarid2 Bound To H2ak119ub1 Nuc ... Kasinath 0.00 2020-04-16 0.0000 1F66 2.6 A Crystal Structure Of A Nucleosome C ... Suto 2.60 2000-06-20 0.0000 6KW4 The Classb Rsc-Nucleosome Complex Ye 7.55 2019-09-06 0.0000 6KW5 The Classc Rsc-Nucleosome Complex Ye 10.13 2019-09-06 0.0000 5OY7 Structure Of 4_601_157 Tetranucleosome (P ... Ekundayo 5.77 2017-09-07 0.0000 6FTX Structure Of Chromatin Remodelling Enzyme ... Sundaramoorthy 4.50 2018-02-25 0.0000 4LD9 Crystal Structure Of N-Terminally Acetyla ... Arnaudo 3.31 2013-06-24 0.0000 6R25 Structure Of Lsd2/Npac-Linker/Nucleosome ... Marabelli 4.61 2019-03-15 0.0000 6KW3 The Classa Rsc-Nucleosome Complex Ye 7.13 2019-09-05 0.0000 4KGC Nucleosome Core Particle Containing (Eta6 ... Adhireksan 2.69 2013-04-29 0.0000 6LTJ Structure Of Nucleosome-Bound Human Baf C ... He 3.70 2020-01-22 0.0000 6G0L Structure Of Two Molecules Of Chromatin R ... Sundaramoorthy 10.00 2018-03-19 0.0000 6W4L The Crystal Structure Of A Single Chain H ... Warren 1.31 2020-03-11 0.0000 4X23 Crystal Structure Of Cenp-C In Complex Wi ... Jiang 3.50 2014-11-25 0.0000 5WCU Crystal Structure Of 167 Bp Nucleosome Bo ... Jiang 5.53 2017-07-02 0.0000 4KHA Structural Basis Of Histone H2a-H2b Recog ... Hondele 2.35 2013-04-30 0.0000 1HIO Histone Octamer (Chicken), Chromosomal Pr ... Arents 3.10 1991-09-19 0.0000 4QLC Crystal Structure Of Chromatosome At 3.5 ... Jiang 3.50 2014-06-11 0.0000 2PYO Drosophila Nucleosome Core Clapier 2.43 2007-05-16 0.0000 2NQB Drosophila Nucleosome Structure Luger 2.30 2006-10-30 0.0000 6PWE Cryo-Em Structure Of Nucleosome Core Particle Chittori 3.95 2019-07-22 0.0000 6PWF Cryo-Em Structure Of Atpase Domain Of Chr ... Chittori 4.07 2019-07-22 0.0000 6DZT Cryo-Em Structure Of Nucleosome In Comple ... Yadav 0.00 2018-07-05 0.0000 6K0C Crystal Structure Of Cenap1-H2a.Z-H2b Complex Liu 2.28 2019-05-05 0.0000 6K09 Crystal Structure B Of Cenap1-H2a-H2b Complex Liu 2.25 2019-05-05 0.0000 6K00 Crystal Structure A Of Cenap1-H2a-H2b Complex Liu 2.20 2019-05-05 0.0000 6K03 Crystal Structure Of Ceh2a-H2b Liu 2.86 2019-05-05 0.0000 3X1V Crystal Structure Of Nucleosome Core Part ... Sivaraman 2.92 2014-11-28 0.0000 3X1T Crystal Structure Of Nucleosome Core Part ... Sivaraman 2.81 2014-11-27 0.0000 5GT3 Crystal Structure Of Nucleosome Particle ... Kumarevel 2.91 2016-08-18 0.0000 5GSU Crystal Structure Of Nucleosome Core Part ... Kumarevel 3.10 2016-08-17 0.0000 3WKJ The Nucleosome Containing Human Tsh2b Urahama 2.80 2013-10-22 0.0000 6M2M A Role For Histone Chaperone Oschz1 In Hi ... Luo 2.85 2020-02-28 0.0000 7BP2 Structural Mechanism Directing Nucleosome ... Luo 1.58 2020-03-21 0.0000 7BP4 Structural Insights Into Nucleosome Reorg ... Luo 2.10 2020-03-21 0.0000 7BP5 Structural Insights Into Nucleosome Reorg ... Luo 1.90 2020-03-21 0.0000 7C7X Structural Insights Into Nucleosome Reorg ... Luo 3.00 2020-05-27 0.0000 7BP6 Structural Insights Into Nucleosome Reorg ... Luo 1.58 2020-03-21 0.0000 6QLD Structure Of Inner Kinetochore Ccan-Cenp- ... Yan 4.15 2019-01-31 0.0000 4WNN Spt16-H2a-H2b Fact Histone Complex Kemble 1.80 2014-10-13 0.0000 1ID3 Crystal Structure Of Yeast Nucleosome Cor ... White 3.10 2001-04-03 0.0000 4JJN Crystal Structure Of Heterochromatin Prot ... Wang 3.09 2013-03-08 0.0000 7K78 Antibody And Nucleosome Complex Ruifang 3.10 2020-09-22 0.0000 6GEN Chromatin Remodeller-Nucleosome Complex A ... Willhoft 0.00 2018-04-27 0.0000 4KUD Crystal Structure Of N-Terminal Acetylate ... Yang 3.20 2013-05-22 0.0000 7K7G Nucleosome And Gal4 Complex Ruifang 4.20 2020-09-22 0.0000 6GEJ Chromatin Remodeller-Nucleosome Complex A ... Willhoft 0.00 2018-04-26 0.0000 5BT1 Histone Chaperone Hif1 Playing With Histo ... Liu 2.62 2015-06-02 0.0000 2JSS NMR Structure Of Chaperone Chz1 Complexed ... Zhou 2007-07-11 0.0000 6AE8 Structure Insight Into Histone Chaperone ... Wang 1.65 2018-08-03 0.0000 4M6B Crystal Structure Of Yeast Swr1-Z Domain ... Hong 1.78 2013-08-09 0.0000 7DLX Crystal Structure Of H2am4>Z-H2b Dai 2.40 2020-11-30 0.0000 6UPH Structure Of A Yeast Centromeric Nucleoso ... Migl 0.00 2019-10-17 0.0000 6BIZ Hla-Drb1 In Complex With Citrullinated Hi ... Ting 2.10 2017-11-03 0.0050 6BIY Hla-Drb1 In Complex With Histone 2b Peptide Ting 2.05 2017-11-03 0.0920 1RFZ Structure Of Protein Of Unknown Function ... Kim 2.80 2003-11-10 3.4000 2RP5 Solution Structure Of Oligomerization Dom ... Ou 2008-05-01 7.3000
OCA© by Jaime Prilusky, 1996-2013,2015,2021 Bioinformatics Unit Weizmann Institute of Science |