# OCA database search on: Thu Sep 21 15:12:07 2023 # Query: ev=10&ex=any&fa=STFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLT&m=du # Hits: 24 (search time 2 sec) 2QLR Crystal Structure Of Human Kynurenine Ami ... Han 2.30 2007-07-13 0.0000 5EFS The Crystal Structure Of Human Kynurenine ... Nematollahi 1.83 2015-10-26 0.0000 3DC1 Crystal Structure Of Kynurenine Aminotran ... Han 2.50 2008-06-03 0.0000 5TF5 Crystal Structure Of Human Kat-2 In Compl ... Nematollahi 1.81 2016-09-24 0.0000 2R2N The Crystal Structure Of Human Kynurenine ... Han 1.95 2007-08-27 0.0000 5EUN The Crystal Structure Of Human Kynurenine ... Nematollahi 1.82 2015-11-18 0.0000 2XH1 Crystal Structure Of Human Kat II-Inhibit ... Rossi 2.10 2010-06-08 0.0000 2VGZ Crystal Structure Of Human Kynurenine Ami ... Rossi 2.30 2007-11-16 0.0000 6D0A Crystal Structure Of Kynurenine Aminotran ... Jayawickrama 1.47 2018-04-10 0.0000 4GE9 Kynurenine Aminotransferase II Inhibitors Pandit 2.43 2012-08-01 0.0000 4GEB Kynurenine Aminotransferase II Inhibitors Pandit 2.15 2012-08-01 0.0000 4GDY Kynurenine Aminotransferase II Inhibitors Pandit 2.89 2012-08-01 0.0000 4GE4 Kynurenine Aminotransferase II Inhibitors Pandit 2.41 2012-08-01 0.0000 4GE7 Kynurenine Aminotransferase II Inhibitors Pandit 2.10 2012-08-01 0.0000 3UE8 Kynurenine Aminotransferase II Inhibitors Dounay 3.22 2011-10-28 0.0000 6T8P Hkatii In Complex With Ligand (2r)-N-Benz ... Blaesse 2.02 2019-10-24 0.0000 6T8Q Hkatii In Complex With Ligand (2r)-N-Benz ... Blaesse 2.51 2019-10-24 0.0000 6S8W Aromatic Aminotransferase Aroh (Aro8) For ... Giardina 2.40 2019-07-10 3.1000 2ZP7 Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita 2.26 2008-06-30 6.2000 2EGY Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita 2.67 2007-03-02 6.2000 2Z1Y Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita 1.75 2007-05-16 6.2000 3CBF Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita 1.67 2008-02-21 6.2000 2ZYJ Crystal Structure Of Lysn, Alpha-Aminoadi ... Ouchi 1.67 2009-01-26 6.2000 1WST Crystal Structure Of Multiple Substrate A ... Lee 1.95 2004-11-10 6.6000
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |