# OCA database search on: Thu Sep 21 15:12:07 2023
# Query: ev=10&ex=any&fa=STFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLT&m=du
# Hits: 24 (search time 2 sec)
2QLR     Crystal Structure Of Human Kynurenine Ami ... Han               2.30 2007-07-13   0.0000
5EFS     The Crystal Structure Of Human Kynurenine ... Nematollahi       1.83 2015-10-26   0.0000
3DC1     Crystal Structure Of Kynurenine Aminotran ... Han               2.50 2008-06-03   0.0000
5TF5     Crystal Structure Of Human Kat-2 In Compl ... Nematollahi       1.81 2016-09-24   0.0000
2R2N     The Crystal Structure Of Human Kynurenine ... Han               1.95 2007-08-27   0.0000
5EUN     The Crystal Structure Of Human Kynurenine ... Nematollahi       1.82 2015-11-18   0.0000
2XH1     Crystal Structure Of Human Kat II-Inhibit ... Rossi             2.10 2010-06-08   0.0000
2VGZ     Crystal Structure Of Human Kynurenine Ami ... Rossi             2.30 2007-11-16   0.0000
6D0A     Crystal Structure Of Kynurenine Aminotran ... Jayawickrama      1.47 2018-04-10   0.0000
4GE9     Kynurenine Aminotransferase II Inhibitors     Pandit            2.43 2012-08-01   0.0000
4GEB     Kynurenine Aminotransferase II Inhibitors     Pandit            2.15 2012-08-01   0.0000
4GDY     Kynurenine Aminotransferase II Inhibitors     Pandit            2.89 2012-08-01   0.0000
4GE4     Kynurenine Aminotransferase II Inhibitors     Pandit            2.41 2012-08-01   0.0000
4GE7     Kynurenine Aminotransferase II Inhibitors     Pandit            2.10 2012-08-01   0.0000
3UE8     Kynurenine Aminotransferase II Inhibitors     Dounay            3.22 2011-10-28   0.0000
6T8P     Hkatii In Complex With Ligand (2r)-N-Benz ... Blaesse           2.02 2019-10-24   0.0000
6T8Q     Hkatii In Complex With Ligand (2r)-N-Benz ... Blaesse           2.51 2019-10-24   0.0000
6S8W     Aromatic Aminotransferase Aroh (Aro8) For ... Giardina          2.40 2019-07-10   3.1000
2ZP7     Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita            2.26 2008-06-30   6.2000
2EGY     Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita            2.67 2007-03-02   6.2000
2Z1Y     Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita            1.75 2007-05-16   6.2000
3CBF     Crystal Structure Of Lysn, Alpha-Aminoadi ... Tomita            1.67 2008-02-21   6.2000
2ZYJ     Crystal Structure Of Lysn, Alpha-Aminoadi ... Ouchi             1.67 2009-01-26   6.2000
1WST     Crystal Structure Of Multiple Substrate A ... Lee               1.95 2004-11-10   6.6000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science