# OCA database search on: Thu Sep 21 14:54:34 2023 # Query: ev=10&ex=any&fa=TVRDSLKKALRGLIPECCAVYRIQKKPIGWDTDISWLTGEELHVEVLENVPLTSHQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALRGLIPECCAVYRIQEKKPIGWDTDISWLTGEELHVEVLENVPLTTHQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALRGLIPECCAVYRIQKKPIGWDTDISWLTGEELHVEVLENVPLTTHHQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALRGLIPECCAVYRIKKPIGWDTDISWLTGEELHVEVLENVPL&m=du # Hits: 70 (search time 3 sec) 5J2R Solution Structure Of Ras Binding Domain ... Dutta 2016-03-29 0.0000 5J18 Solution Structure Of Ras Binding Domain ... Dutta 2016-03-29 0.0000 5J17 Solution Structure Of Ras Binding Domain ... Dutta 2016-03-29 0.0000 7MFE Autoinhibited Braf:(14-3-3)2 Complex With ... Martinez Fiesco 4.07 2021-04-09 0.0000 7MFF Dimeric (Braf)2:(14-3-3)2 Complex Bound T ... Martinez Fiesco 3.89 2021-04-09 0.0000 7MFD Autoinhibited Braf:(14-3-3)2:Mek Complex ... Martinez Fiesco 3.66 2021-04-09 0.0000 6UAN B-Raf:14-3-3 Complex Kondo 3.90 2019-09-11 0.0000 8DGS Cryo-Em Structure Of A Ras/Raf Complex (S ... Eck 4.30 2022-06-24 0.0000 8DGT Cryo-Em Structure Of A Ras/Raf Complex (S ... Eck 3.90 2022-06-24 0.0000 6Q0J Structure Of A Mapk Pathway Complex Park 4.90 2019-08-01 0.0000 6Q0T Structure Of A Mapk Pathway Complex Park 5.70 2019-08-02 0.0000 6Q0K Structure Of A Mapk Pathway Complex Park 6.80 2019-08-01 0.0000 6NYB Structure Of A Mapk Pathway Complex Park 4.10 2019-02-11 0.0000 7ZR0 Cryoem Structure Of Hsp90-Cdc37-Braf(V600 ... Oberoi 3.40 2022-05-03 0.0000 7ZR5 Cryoem Structure Of Hsp90-Cdc37-Braf(V600 ... Oberoi 3.90 2022-05-03 0.0000 7ZR6 Cryoem Structure Of Hsp90-Cdc37-Braf(V600 ... Oberoi 4.20 2022-05-03 0.0000 2L05 Solution NMR Structure Of Ras-Binding Dom ... Aramini 2010-06-30 0.0000 3NY5 Crystal Structure Of Rbd Domain Of Serine ... Vorobiev 1.99 2010-07-14 0.0000 6PTS NMR Data-Driven Model Of Kras-Gmppnp:Rbd- ... Fang 2019-07-16 0.0000 6PTW NMR Data-Driven Model Of Kras-Gmppnp:Rbd- ... Fang 2019-07-16 0.0000 6XHA Crystal Structure Of Kras-G12v (Gmppnp-Bo ... Tran 2.87 2020-06-18 0.0000 6XI7 Crystal Structure Of Wild-Type Kras (Gmpp ... Chan 1.95 2020-06-19 0.0000 6XHB Crystal Structure Of Wild-Type Kras (Gmpp ... Tran 2.50 2020-06-18 0.0000 6XGV Crystal Structure Of Kras-G13d (Gmppnp-Bo ... Tran 2.11 2020-06-18 0.0000 6XGU Crystal Structure Of Kras-Q61r (Gmppnp-Bo ... Tran 2.70 2020-06-18 0.0000 7JHP Crystal Structure Of Hras In Complex With ... Cookis 2.77 2020-07-21 0.0000 7Z38 Structure Of Raf1-Hsp90-Cdc37 Complex (Rhc-I) Mesa 3.16 2022-03-01 0.0000 7Z37 Structure Of Raf1-Hsp90-Cdc37 Complex (Rh ... Mesa 3.67 2022-03-01 0.0000 1RRB The Ras-Binding Domain Of Raf-1 From Rat, ... Terada 1998-03-26 0.0000 1RFA NMR Solution Structure Of Ras-Binding Dom ... Emerson 1995-04-26 0.0000 1C1Y Crystal Structure Of Rap.Gmppnp In Comple ... Nassar 1.90 1999-07-22 0.0000 4G3X Crystal Structure Of Q61l H-Ras-Gppnhp Bo ... Fetics 3.25 2012-07-15 0.0000 4G0N Crystal Structure Of Wt H-Ras-Gppnhp Boun ... Fetics 2.45 2012-07-09 0.0000 6VJJ Crystal Structure Of Wild-Type Kras4b (Gm ... Tran 1.40 2020-01-16 0.0000 8EPW Crystal Structure Of Kras4b-G13d (Gmppnp- ... Tran 2.00 2022-10-06 0.0000 1GUA Human Rap1a, Residues 1-167, Double Mutan ... Nassar 2.00 1996-06-18 0.0000 2MSE NMR Data-Driven Model Of Gtpase Kras-Gnp: ... Mazhab-Jafari 2014-07-29 0.0000 1WXM Solution Structure Of N-Terminal Ras-Bind ... Zhao 2005-01-26 0.0000 3KUD Complex Of Ras-Gdp With Rafrbd(A85k) Filchtinski 2.15 2009-11-27 0.0000 3KUC Complex Of Rap1a(E30d/K31e)Gdp With Rafrb ... Filchtinski 1.92 2009-11-27 0.0000 6NTD Crystal Structure Of G12v Hras-Gppnhp Bou ... Maisonneuve 3.15 2019-01-28 0.0000 6NTC Crystal Structure Of G12v Hras-Gppnhp Bou ... Maisonneuve 2.90 2019-01-28 0.0000 5YXI Designed Protein Drafx6 Liu 2017-12-05 0.0003 3QB4 Crystal Structure Of A Tgf-Beta Ligand-Re ... Mueller 2.28 2011-01-12 0.2800 6Z3M Repulsive Guidance Molecule B (Rgmb) In C ... Malinauskas 5.50 2020-05-21 0.3400 1WAQ Crystal Structure Of Human Growth And Dif ... Mueller 2.28 2004-10-27 0.3400 6Z3G Repulsive Guidance Molecule A (Rgma) In C ... Malinauskas 2.78 2020-05-20 0.3400 3EVS Crystal Structure Of Gdf-5:Bmp Receptor I ... Kotzsch 2.10 2008-10-13 0.3400 6Z3L Repulsive Guidance Molecule C (Rgmc, Hemo ... Malinauskas 2.51 2020-05-20 0.3400 6Z3H Repulsive Guidance Molecule B (Rgmb) In C ... Malinauskas 3.16 2020-05-20 0.3400 5HK5 Structure Of Grem2-Gdf5 Inhibitory Complex Nolan 2.90 2016-01-13 0.3500 8E3G Bmp2/Gdf5 Heterodimer Gipson 2.80 2022-08-17 0.3500 2BHK Crystal Structure Of Human Growth And Dif ... Schreuder 2.40 2005-01-12 0.3500 1JZT Crystal Structure Of Yeast Ynu0, Ynl200c Jiang 1.94 2001-09-17 0.3800 6B11 Tylhi In Complex With Native Substrate 23 ... Demars 1.99 2017-09-15 2.9000 7BQF Dimerization Of Sav1 Ww Tandem Lin 1.70 2020-03-24 7.7000 4BC6 Crystal Structure Of Human Serine Threoni ... Vollmar 2.20 2012-10-01 8.9000 5AJQ Human Lok (Stk10) In Complex With Bosutinib Elkins 2.20 2015-02-26 9.0000 1Z2M Crystal Structure Of Isg15, The Interfero ... Narasimhan 2.50 2005-03-08 9.3000 2J7T Crystal Structure Of Human Serine Threoni ... Pike 2.00 2006-10-17 9.4000 4USE Human Stk10 (Lok) With Sb-633825 Elkins 2.65 2014-07-07 9.4000 6HXF Human Stk10 Bound To A Maleimide Inhibitor Sorrell 2.09 2018-10-17 9.4000 5OWQ Human Stk10 Bound To Dovitinib Szklarz 2.70 2017-09-04 9.4000 4USD Human Stk10 (Lok) With Sb-633825 Elkins 3.05 2014-07-07 9.4000 4AOT Crystal Structure Of Human Serine Threoni ... Elkins 2.33 2012-03-29 9.4000 4EQU Human Stk-10 (Lok) Kinase Domain In Dfg-O ... Merritt 2.00 2012-04-19 9.4000 5OWR Human Stk10 Bound To Dasatinib Szklarz 2.30 2017-09-04 9.4000 6BI8 X-Ray Structure Of Mers Coronavirus Papai ... Clasman 2.29 2017-11-01 9.4000 3PSE Structure Of A Viral Otu Domain Protease ... Bacik 2.30 2010-12-01 9.4000 3RT3 Complex Of Influenza Virus Protein With H ... Wang 2.01 2011-05-03 9.6000
|
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |