# OCA database search on: Thu Sep 21 14:54:34 2023
# Query: ev=10&ex=any&fa=TVRDSLKKALRGLIPECCAVYRIQKKPIGWDTDISWLTGEELHVEVLENVPLTSHQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALRGLIPECCAVYRIQEKKPIGWDTDISWLTGEELHVEVLENVPLTTHQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALRGLIPECCAVYRIQKKPIGWDTDISWLTGEELHVEVLENVPLTTHHQKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALRGLIPECCAVYRIKKPIGWDTDISWLTGEELHVEVLENVPL&m=du
# Hits: 70 (search time 3 sec)
5J2R     Solution Structure Of Ras Binding Domain  ... Dutta                  2016-03-29   0.0000
5J18     Solution Structure Of Ras Binding Domain  ... Dutta                  2016-03-29   0.0000
5J17     Solution Structure Of Ras Binding Domain  ... Dutta                  2016-03-29   0.0000
7MFE     Autoinhibited Braf:(14-3-3)2 Complex With ... Martinez Fiesco   4.07 2021-04-09   0.0000
7MFF     Dimeric (Braf)2:(14-3-3)2 Complex Bound T ... Martinez Fiesco   3.89 2021-04-09   0.0000
7MFD     Autoinhibited Braf:(14-3-3)2:Mek Complex  ... Martinez Fiesco   3.66 2021-04-09   0.0000
6UAN     B-Raf:14-3-3 Complex                          Kondo             3.90 2019-09-11   0.0000
8DGS     Cryo-Em Structure Of A Ras/Raf Complex (S ... Eck               4.30 2022-06-24   0.0000
8DGT     Cryo-Em Structure Of A Ras/Raf Complex (S ... Eck               3.90 2022-06-24   0.0000
6Q0J     Structure Of A Mapk Pathway Complex           Park              4.90 2019-08-01   0.0000
6Q0T     Structure Of A Mapk Pathway Complex           Park              5.70 2019-08-02   0.0000
6Q0K     Structure Of A Mapk Pathway Complex           Park              6.80 2019-08-01   0.0000
6NYB     Structure Of A Mapk Pathway Complex           Park              4.10 2019-02-11   0.0000
7ZR0     Cryoem Structure Of Hsp90-Cdc37-Braf(V600 ... Oberoi            3.40 2022-05-03   0.0000
7ZR5     Cryoem Structure Of Hsp90-Cdc37-Braf(V600 ... Oberoi            3.90 2022-05-03   0.0000
7ZR6     Cryoem Structure Of Hsp90-Cdc37-Braf(V600 ... Oberoi            4.20 2022-05-03   0.0000
2L05     Solution NMR Structure Of Ras-Binding Dom ... Aramini                2010-06-30   0.0000
3NY5     Crystal Structure Of Rbd Domain Of Serine ... Vorobiev          1.99 2010-07-14   0.0000
6PTS     NMR Data-Driven Model Of Kras-Gmppnp:Rbd- ... Fang                   2019-07-16   0.0000
6PTW     NMR Data-Driven Model Of Kras-Gmppnp:Rbd- ... Fang                   2019-07-16   0.0000
6XHA     Crystal Structure Of Kras-G12v (Gmppnp-Bo ... Tran              2.87 2020-06-18   0.0000
6XI7     Crystal Structure Of Wild-Type Kras (Gmpp ... Chan              1.95 2020-06-19   0.0000
6XHB     Crystal Structure Of Wild-Type Kras (Gmpp ... Tran              2.50 2020-06-18   0.0000
6XGV     Crystal Structure Of Kras-G13d (Gmppnp-Bo ... Tran              2.11 2020-06-18   0.0000
6XGU     Crystal Structure Of Kras-Q61r (Gmppnp-Bo ... Tran              2.70 2020-06-18   0.0000
7JHP     Crystal Structure Of Hras In Complex With ... Cookis            2.77 2020-07-21   0.0000
7Z38     Structure Of Raf1-Hsp90-Cdc37 Complex (Rhc-I) Mesa              3.16 2022-03-01   0.0000
7Z37     Structure Of Raf1-Hsp90-Cdc37 Complex (Rh ... Mesa              3.67 2022-03-01   0.0000
1RRB     The Ras-Binding Domain Of Raf-1 From Rat, ... Terada                 1998-03-26   0.0000
1RFA     NMR Solution Structure Of Ras-Binding Dom ... Emerson                1995-04-26   0.0000
1C1Y     Crystal Structure Of Rap.Gmppnp In Comple ... Nassar            1.90 1999-07-22   0.0000
4G3X     Crystal Structure Of Q61l H-Ras-Gppnhp Bo ... Fetics            3.25 2012-07-15   0.0000
4G0N     Crystal Structure Of Wt H-Ras-Gppnhp Boun ... Fetics            2.45 2012-07-09   0.0000
6VJJ     Crystal Structure Of Wild-Type Kras4b (Gm ... Tran              1.40 2020-01-16   0.0000
8EPW     Crystal Structure Of Kras4b-G13d (Gmppnp- ... Tran              2.00 2022-10-06   0.0000
1GUA     Human Rap1a, Residues 1-167, Double Mutan ... Nassar            2.00 1996-06-18   0.0000
2MSE     NMR Data-Driven Model Of Gtpase Kras-Gnp: ... Mazhab-Jafari          2014-07-29   0.0000
1WXM     Solution Structure Of N-Terminal Ras-Bind ... Zhao                   2005-01-26   0.0000
3KUD     Complex Of Ras-Gdp With Rafrbd(A85k)          Filchtinski       2.15 2009-11-27   0.0000
3KUC     Complex Of Rap1a(E30d/K31e)Gdp With Rafrb ... Filchtinski       1.92 2009-11-27   0.0000
6NTD     Crystal Structure Of G12v Hras-Gppnhp Bou ... Maisonneuve       3.15 2019-01-28   0.0000
6NTC     Crystal Structure Of G12v Hras-Gppnhp Bou ... Maisonneuve       2.90 2019-01-28   0.0000
5YXI     Designed Protein Drafx6                       Liu                    2017-12-05   0.0003
3QB4     Crystal Structure Of A Tgf-Beta Ligand-Re ... Mueller           2.28 2011-01-12   0.2800
6Z3M     Repulsive Guidance Molecule B (Rgmb) In C ... Malinauskas       5.50 2020-05-21   0.3400
1WAQ     Crystal Structure Of Human Growth And Dif ... Mueller           2.28 2004-10-27   0.3400
6Z3G     Repulsive Guidance Molecule A (Rgma) In C ... Malinauskas       2.78 2020-05-20   0.3400
3EVS     Crystal Structure Of Gdf-5:Bmp Receptor I ... Kotzsch           2.10 2008-10-13   0.3400
6Z3L     Repulsive Guidance Molecule C (Rgmc, Hemo ... Malinauskas       2.51 2020-05-20   0.3400
6Z3H     Repulsive Guidance Molecule B (Rgmb) In C ... Malinauskas       3.16 2020-05-20   0.3400
5HK5     Structure Of Grem2-Gdf5 Inhibitory Complex    Nolan             2.90 2016-01-13   0.3500
8E3G     Bmp2/Gdf5 Heterodimer                         Gipson            2.80 2022-08-17   0.3500
2BHK     Crystal Structure Of Human Growth And Dif ... Schreuder         2.40 2005-01-12   0.3500
1JZT     Crystal Structure Of Yeast Ynu0, Ynl200c      Jiang             1.94 2001-09-17   0.3800
6B11     Tylhi In Complex With Native Substrate 23 ... Demars            1.99 2017-09-15   2.9000
7BQF     Dimerization Of Sav1 Ww Tandem                Lin               1.70 2020-03-24   7.7000
4BC6     Crystal Structure Of Human Serine Threoni ... Vollmar           2.20 2012-10-01   8.9000
5AJQ     Human Lok (Stk10) In Complex With Bosutinib   Elkins            2.20 2015-02-26   9.0000
1Z2M     Crystal Structure Of Isg15, The Interfero ... Narasimhan        2.50 2005-03-08   9.3000
2J7T     Crystal Structure Of Human Serine Threoni ... Pike              2.00 2006-10-17   9.4000
4USE     Human Stk10 (Lok) With Sb-633825              Elkins            2.65 2014-07-07   9.4000
6HXF     Human Stk10 Bound To A Maleimide Inhibitor    Sorrell           2.09 2018-10-17   9.4000
5OWQ     Human Stk10 Bound To Dovitinib                Szklarz           2.70 2017-09-04   9.4000
4USD     Human Stk10 (Lok) With Sb-633825              Elkins            3.05 2014-07-07   9.4000
4AOT     Crystal Structure Of Human Serine Threoni ... Elkins            2.33 2012-03-29   9.4000
4EQU     Human Stk-10 (Lok) Kinase Domain In Dfg-O ... Merritt           2.00 2012-04-19   9.4000
5OWR     Human Stk10 Bound To Dasatinib                Szklarz           2.30 2017-09-04   9.4000
6BI8     X-Ray Structure Of Mers Coronavirus Papai ... Clasman           2.29 2017-11-01   9.4000
3PSE     Structure Of A Viral Otu Domain Protease  ... Bacik             2.30 2010-12-01   9.4000
3RT3     Complex Of Influenza Virus Protein With H ... Wang              2.01 2011-05-03   9.6000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science