# OCA database search on: Thu Sep 21 16:00:45 2023
# Query: ev=10&ex=any&fa=VEIGSQRYKLGVRLYYRVMESMLKSEEERL&m=du
# Hits: 16 (search time 3 sec)
1AD6     Domain A Of Human Retinoblastoma Tumor Su ... Kim               2.30 1997-02-21   0.0000
1O9K     Crystal Structure Of Retinoblastoma Tumou ... Xiao              2.60 2002-12-16   0.0000
1GUX     Rb Pocket Bound To E7 Lxcxe Motif             Lee               1.85 1997-11-15   0.0000
2R7G     Structure Of Retinoblastoma Protein Pocke ... Liu               1.67 2007-09-07   0.0000
3POM     Crystal Structure Of Unliganded Retinobla ... Balog             2.50 2010-11-23   0.0000
4ELL     Structure Of Inactive Retinoblastoma Prot ... Burke             1.98 2012-04-10   0.0000
4ELJ     Crystal Structure Of Inactive Retinoblast ... Burke             2.70 2012-04-10   0.0000
1GH6     Retinoblastoma Pocket Complexed With Sv40 ... Kim               3.20 2000-11-15   0.0000
1N4M     Structure Of Rb Tumor Suppressor Bound To ... Lee               2.20 2002-10-31   0.0000
4YOO     P107 Pocket Domain In Complex With Lin52  ... Guiley            2.40 2015-03-12   7.6000
4YOS     P107 Pocket Domain Complexed With Lin52 P ... Guiley            2.30 2015-03-12   7.6000
7SMD     P107 Pocket Domain Complexed With Eid1 Pe ... Putta             2.15 2021-10-25   7.7000
7SME     P107 Pocket Domain Complexed With Hdac1 P ... Putta             2.64 2021-10-25   7.7000
7SMC     P107 Pocket Domain Complexed With Arid4a  ... Putta             2.70 2021-10-25   7.7000
7SMF     P107 Pocket Domain Complexed With Mutated ... Putta             3.00 2021-10-25   7.7000
4YOZ     P107 Pocket Domain In Complex With Hpv E7 ... Liban             2.25 2015-03-12   7.7000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science