# OCA database search on: Thu Sep 21 16:00:45 2023 # Query: ev=10&ex=any&fa=VEIGSQRYKLGVRLYYRVMESMLKSEEERL&m=du # Hits: 16 (search time 3 sec) 1AD6 Domain A Of Human Retinoblastoma Tumor Su ... Kim 2.30 1997-02-21 0.0000 1O9K Crystal Structure Of Retinoblastoma Tumou ... Xiao 2.60 2002-12-16 0.0000 1GUX Rb Pocket Bound To E7 Lxcxe Motif Lee 1.85 1997-11-15 0.0000 2R7G Structure Of Retinoblastoma Protein Pocke ... Liu 1.67 2007-09-07 0.0000 3POM Crystal Structure Of Unliganded Retinobla ... Balog 2.50 2010-11-23 0.0000 4ELL Structure Of Inactive Retinoblastoma Prot ... Burke 1.98 2012-04-10 0.0000 4ELJ Crystal Structure Of Inactive Retinoblast ... Burke 2.70 2012-04-10 0.0000 1GH6 Retinoblastoma Pocket Complexed With Sv40 ... Kim 3.20 2000-11-15 0.0000 1N4M Structure Of Rb Tumor Suppressor Bound To ... Lee 2.20 2002-10-31 0.0000 4YOO P107 Pocket Domain In Complex With Lin52 ... Guiley 2.40 2015-03-12 7.6000 4YOS P107 Pocket Domain Complexed With Lin52 P ... Guiley 2.30 2015-03-12 7.6000 7SMD P107 Pocket Domain Complexed With Eid1 Pe ... Putta 2.15 2021-10-25 7.7000 7SME P107 Pocket Domain Complexed With Hdac1 P ... Putta 2.64 2021-10-25 7.7000 7SMC P107 Pocket Domain Complexed With Arid4a ... Putta 2.70 2021-10-25 7.7000 7SMF P107 Pocket Domain Complexed With Mutated ... Putta 3.00 2021-10-25 7.7000 4YOZ P107 Pocket Domain In Complex With Hpv E7 ... Liban 2.25 2015-03-12 7.7000
OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022 Bioinformatics Unit Weizmann Institute of Science |