# OCA database search on: Fri Dec  2 12:19:20 2022
# Query: ev=10&ex=any&fa=VPKQFDYLVNSMRVMMDRVRTQERLIMKLCV&m=du
# Hits: 120 (search time 2 sec)
1SIG     Crystal Structure Of A Sigma70 Subunit Fr ... Malhotra          2.60 1997-02-18   0.0000
4XSX     Crystal Structure Of Cbr 703 Bound To Esc ... Bae               3.71 2015-01-22   0.0000
4XSY     Crystal Structure Of Cbr 9379 Bound To Es ... Bae               4.01 2015-01-22   0.0000
4XSZ     Crystal Structure Of Cbr 9393 Bound To Es ... Bae               3.68 2015-01-22   0.0000
4LK0     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.91 2013-07-05   0.0000
4LJZ     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.59 2013-07-05   0.0000
5VT0     Escherichia Coli 6s RNA Derivative In Com ... Chen              3.78 2017-05-15   0.0000
6N4C     Em Structure Of DNA Wrapping In Bacterial ... Florez-Ariza      17.00 2018-11-19   0.0000
4KN7     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.69 2013-05-08   0.0000
7KHI     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-21   0.0000
4JK2     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.20 2013-03-09   0.0000
4JK1     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.90 2013-03-09   0.0000
7KHB     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-20   0.0000
7KHE     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-21   0.0000
4MEX     Crystal Structure Of Escherichia Coli RNA ... Feng              3.90 2013-08-27   0.0000
7MKE     Cryo-Em Structure Of Escherichia Coli RNA ... Saecker           0.00 2021-04-23   0.0000
7MKI     Cryo-Em Structure Of Escherichia Coli RNA ... Saecker           0.00 2021-04-23   0.0000
7MKJ     Cryo-Em Structure Of Escherichia Coli RNA ... Saecker           0.00 2021-04-23   0.0000
7KHC     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-20   0.0000
4MEY     Crystal Structure Of Escherichia Coli RNA ... Feng              3.95 2013-08-27   0.0000
6XLL     Cryo-Em Structure Of E. Coli Rnap-Promote ... Yang              0.00 2020-06-28   0.0000
6XLM     Cryo-Em Structure Of E.Coli Rnap-DNA Elon ... Yang              0.00 2020-06-28   0.0000
5UAJ     Escherichia Coli RNA Polymerase Rpob S531 ... Molodtsov         3.92 2016-12-19   0.0000
4KN4     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.96 2013-05-08   0.0000
6CA0     Cryo-Em Structure Of E. Coli Rnap Sigma70 ... Narayanan         5.75 2018-01-29   0.0000
6C9Y     Cryo-Em Structure Of E. Coli Rnap Sigma70 ... Narayanan         4.25 2018-01-29   0.0000
7DY6     A Refined Cryo-Em Structure Of An Escheri ... Lin               3.68 2021-01-20   0.0000
5UAC     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         3.80 2016-12-19   0.0000
6VJS     Escherichia Coli RNA Polymerase And Ureid ... Murakami          4.02 2020-01-17   0.0000
6WMU     E. Coli Rnaps70-Sspa-Gada DNA Complex         Travis            0.00 2020-04-21   0.0000
4YFX     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.84 2015-02-25   0.0000
6N62     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.80 2018-11-24   0.0000
6N61     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.25 2018-11-24   0.0000
4LK1     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.84 2013-07-05   0.0000
6XL5     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
4YFN     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.82 2015-02-25   0.0000
6XLJ     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
5UAQ     Escherichia Coli RNA Polymerase Rpob H526 ... Molodtsov         3.60 2016-12-19   0.0000
6BYU     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.60 2017-12-21   0.0000
4ZH2     Crystal Structure Of Escherichia Coli RNA ... Feng              4.20 2015-04-24   0.0000
5UAL     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         3.89 2016-12-19   0.0000
4ZH3     Crystal Structure Of Escherichia Coli RNA ... Feng              4.08 2015-04-24   0.0000
7XUI     Cryo-Em Structure Of Sigma70 Bound Hk022  ... Hwang             0.00 2022-05-18   0.0000
4ZH4     Crystal Structure Of Escherichia Coli RNA ... Feng              3.99 2015-04-24   0.0000
7W5Y     Cryo-Em Structure Of Soxs-Dependent Trans ... Lin               4.20 2021-11-30   0.0000
7CHW     Cryo-Em Structure Of An Escherichia Coli  ... Lin               3.58 2020-07-06   0.0000
5W1S     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.81 2017-06-04   0.0000
5VSW     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.29 2017-05-12   0.0000
4YG2     X-Ray Crystal Structur Of Escherichia Col ... Murakami          3.70 2015-02-25   0.0000
7VWY     Crystal Structure Of (+)-Pulegone Reducta ... Lin               4.57 2021-11-12   0.0000
7VWZ     Cryo-Em Structure Of Rob-Dependent Transc ... Lin               4.00 2021-11-12   0.0000
7C97     Cryo-Em Structure Of An Escherichia Coli  ... Lin               3.68 2020-06-05   0.0000
6JNX     Cryo-Em Structure Of A Q-Engaged Arrested ... Feng              4.08 2019-03-18   0.0000
5W1T     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.50 2017-06-04   0.0000
7SZJ     Cryo-Em Structure Of Rifamycin Bound To E ... Shin              0.00 2021-11-28   0.0000
7SZK     Cryo-Em Structure Of 27a Bound To E. Coli ... Shin              0.00 2021-11-28   0.0000
4LLG     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.79 2013-07-09   0.0000
7MKD     Cryo-Em Structure Of Escherichia Coli RNA ... Saecker           0.00 2021-04-23   0.0000
7W5X     Cryo-Em Structure Of Soxs-Dependent Trans ... Lin               3.40 2021-11-30   0.0000
5UAG     Escherichia Coli RNA Polymerase Mutant -  ... Molodtsov         3.40 2016-12-19   0.0000
5UAH     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         4.10 2016-12-19   0.0000
7N4E     Escherichia Coli Sigma 70-Dependent Pause ... Molodtsov         3.80 2021-06-04   0.0000
8AD1     RNA Polymerase At U-Rich Pause Bound To R ... Dey               0.00 2022-07-07   0.0000
4YFK     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.57 2015-02-25   0.0000
3IYD     Three-Dimensional Em Structure Of An Inta ... Hudson            19.80 2009-08-01   0.0000
6CUX     Escherichia Coli Rpob S531l Mutant RNA Po ... Molodtsov         4.10 2018-03-26   0.0000
4KMU     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.85 2013-05-08   0.0000
6XL9     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
6K4Y     Cryoem Structure Of Sigma Appropriation C ... Shi               3.79 2019-05-27   0.0000
7W5W     Cryo-Em Structure Of Soxs-Dependent Trans ... Lin               4.55 2021-11-30   0.0000
6PSW     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.70 2019-07-13   0.0000
6PSQ     Escherichia Coli RNA Polymerase Closed Co ... Chen              3.40 2019-07-13   0.0000
6PST     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.00 2019-07-13   0.0000
6PSV     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.50 2019-07-13   0.0000
6P1K     Cryo-Em Structure Of Escherichia Coli Sig ... Chen              0.00 2019-05-20   0.0000
6OUL     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              3.40 2019-05-04   0.0000
6PSS     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.50 2019-07-13   0.0000
6N58     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              0.00 2018-11-21   0.0000
6PSR     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.40 2019-07-13   0.0000
6N57     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              0.00 2018-11-21   0.0000
6PSU     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.90 2019-07-13   0.0000
7UBM     Transcription Antitermination Complex: "" ... Yin               0.00 2022-03-15   0.0000
6P18     Q21 Transcription Antitermination Complex ... Yin               0.00 2019-05-19   0.0000
7UBN     Transcription Antitermination Complex: Nu ... Yin               0.00 2022-03-15   0.0000
6PB5     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.52 2019-06-13   0.0000
6PB4     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.35 2019-06-13   0.0000
6XH8     Cuer-Transcription Activation Complex Wit ... Liu               4.10 2020-06-18   0.0000
6B6H     The Cryo-Em Structure Of A Bacterial Clas ... Liu               3.90 2017-10-02   0.0000
4YLP     E. Coli Transcription Initiation Complex  ... Zuo               5.50 2015-03-05   0.0000
4YLO     E. Coli Transcription Initiation Complex  ... Zuo               6.00 2015-03-05   0.0000
6XH7     Cuer-Tac Without RNA                          Liu               3.90 2020-06-18   0.0000
4YLN     E. Coli Transcription Initiation Complex  ... Zuo               5.50 2015-03-05   0.0000
6PB6     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.29 2019-06-13   0.0000
4JKR     Crystal Structure Of E. Coli RNA Polymera ... Zuo               4.20 2013-03-11   0.0000
7BEG     Structures Of Class I Bacterial Transcrip ... Ye                4.20 2020-12-23   0.0000
7BEF     Structures Of Class II Bacterial Transcri ... Hao               4.50 2020-12-23   0.0000
6LDI     The Cryo-Em Structure Of E. Coli Cuer Tra ... Fang              3.69 2019-11-21   0.0000
7C17     The Cryo-Em Structure Of E. Coli Cuer Tra ... Fang              4.22 2020-05-02   0.0000
6N60     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.68 2018-11-23   0.0000
7XYA     The Cryo-Em Structure Of An Alpa-Loading  ... Wen               3.30 2022-06-01   0.0000
8GXQ     Pic-Mediator In Complex With +1 Nucleosom ... Chen              5.04 2022-09-21   6.8000
7EDX     P53-Bound Tfiid-Based Core Pic On Hdm2 Pr ... Chen              4.50 2021-03-17   6.8000
6MZM     Human Tfiid Bound To Promoter DNA And Tfiia   Patel             0.00 2018-11-05   6.8000
7EGJ     Scp Promoter-Bound Tfiid-Tfiia In Post Tb ... Chen              8.64 2021-03-24   6.8000
7EG9     Tfiid-Based Intermediate Pic On Scp Promoter  Chen              3.70 2021-03-24   6.8000
7ENC     Tfiid-Based Pic-Mediator Holo-Complex In  ... Chen              4.13 2021-04-16   6.8000
7EG8     Tfiid-Based Core Pic On Puma Promoter         Chen              7.40 2021-03-24   6.8000
7EGC     P53-Bound Tfiid-Based Holo Pic On Hdm2 Pr ... Chen              3.90 2021-03-24   6.8000
7ENA     Tfiid-Based Pic-Mediator Holo-Complex In  ... Chen              4.07 2021-04-16   6.8000
7EGD     Scp Promoter-Bound Tfiid-Tfiia In Initial ... Chen              6.75 2021-03-24   6.8000
5FUR     Structure Of Human Tfiid-Iia Bound To Cor ... Louder            8.50 2016-01-29   6.8000
7EGI     Tfiid In Rearranged Conformation              Chen              9.82 2021-03-24   6.8000
7EG7     Tfiid-Based Core Pic On Scp Promoter          Chen              6.20 2021-03-24   6.8000
7EGB     Tfiid-Based Holo Pic On Scp Promoter          Chen              3.30 2021-03-24   6.8000
7EGH     Tfiid Lobe C Subcomplex                       Chen              3.04 2021-03-24   6.8000
7EGA     Tfiid-Based Intermediate Pic On Puma Promoter Chen              4.10 2021-03-24   6.8000
7EGE     Tfiid In Canonical Conformation               Chen              9.00 2021-03-24   6.8000
6MZL     Human Tfiid Canonical State                   Patel             23.00 2018-11-05   6.8000
8GXS     Pic-Mediator In Complex With +1 Nucleosom ... Chen              4.16 2022-09-21   6.8000
4RGW     Crystal Structure Of A Taf1-Taf7 Complex  ... Wang              2.30 2014-09-30   6.8000

OCA© by Jaime Prilusky, 1996-2013,2015,2021,2022
Bioinformatics Unit
Weizmann Institute of Science