# OCA database search on: Sat Aug 13 00:26:00 2022
# Query: ev=10.000&ex=any&fa=SSKAMGIMNSFVNDIFERIAGEASRLAHYN&m=du
# Hits: 395 (search time 1 sec)
2XQL     Fitting Of H2a-H2b Histones In The Electr ... Ramos             19.50 2010-09-02   0.0000
6MUP     Cenp-A Nucleosome Bound By Two Copies Of  ... Allu              3.50 2018-10-23   0.0000
6MUO     Cenp-A Nucleosome Bound By Two Copies Of  ... Allu              3.60 2018-10-23   0.0000
7CCQ     Structure Of 1:1 Cgas-Nucleosome Complex      Cao               0.00 2020-06-17   0.0000
7CCR     Structure Of 2:2 Cgas-Nucleosome Complex      Cao               0.00 2020-06-17   0.0000
6Y5E     Structure Of Human Cgas (K394e) Bound To  ... Pathare           3.15 2020-02-25   0.0000
6KE9     The Human Telomeric Nucleosome Displays D ... Soman             2.22 2019-07-04   0.0000
6L9H     The Human Telomeric Nucleosome Displays D ... Soman             2.60 2019-11-10   0.0000
6IQ4     Nucleosome Core Particle Cross-Linked Wit ... Defalco           2.25 2018-11-06   0.0000
6IPU     Human Nucleosome Core Particle Containing ... Defalco           1.99 2018-11-04   0.0000
6LE9     The Human Telomeric Nucleosome Displays D ... Soman             2.60 2019-11-24   0.0000
5FUG     Crystal Structure Of A Human Yl1-H2a.Z-H2 ... Latrick           2.70 2016-01-27   0.0000
6JXD     Human Nucleosome Core Particle With Cohes ... Defalco           2.25 2019-04-23   0.0000
4CAY     Crystal Structure Of A Human Anp32e-H2a.Z ... Obri              1.48 2013-10-09   0.0000
6KBB     Role Of Def/Y Motif Of Swc5 In Histone H2 ... Huang             2.37 2019-06-24   0.0000
3W97     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.20 2013-04-01   0.0000
3X1U     Crystal Structure Of Nucleosome Core Part ... Sivaraman         3.25 2014-11-28   0.0000
6X5A     The Mouse Cgas Catalytic Domain Binding T ... Pengbiao          0.00 2020-05-25   0.0000
5GT0     Crystal Structure Of Nucleosome Complex W ... Kumarevel         2.82 2016-08-18   0.0000
7JZV     Cryo-Em Structure Of Brca1-Ubch5c/Bard1 E ... Witus             3.90 2020-09-02   0.0000
7BWD     Structure Of Dot1l-H2bk34ub Nucleosome Co ... Lou               4.32 2020-04-14   0.0000
6XJD     Two Mouse Cgas Catalytic Domain Binding T ... Xu                0.00 2020-06-23   0.0000
6FML     Cryoem Structure Ino80core Nucleosome Complex Eustermann        4.34 2018-01-31   0.0000
3X1S     Crystal Structure Of Nucleosome Core Particle Sivaraman         2.81 2014-11-27   0.0000
7JO9     1:1 Cgas-Nucleosome Complex                   Boyer             0.00 2020-08-06   0.0000
7JOA     2:1 Cgas-Nucleosome Complex                   Boyer             0.00 2020-08-06   0.0000
6X59     The Mouse Cgas Catalytic Domain Binding T ... Pengbiao          0.00 2020-05-25   0.0000
7A08     Cryoem Structure Of Cgas Nucleosome Complex   Michalski         0.00 2020-08-07   0.0000
2HIO     Histone Octamer (Chicken), Chromosomal Pr ... Arents            3.10 1999-06-15   0.0000
6L9Z     338 Bp Di-Nucleosome Assembled With Linke ... Adhireksan        2.50 2019-11-11   0.0000
6LA2     343 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan        3.89 2019-11-11   0.0000
7LYC     Cryo-Em Structure Of Human Nucleosome Cor ... Hu                0.00 2021-03-06   0.0000
6RNY     Pfv Intasome - Nucleosome Strand Transfer ... Pye               3.90 2019-05-09   0.0000
2ARO     Crystal Structure Of Native Histone Octam ... Wood              2.10 2005-08-20   0.0000
2CV5     Crystal Structure Of Human Nucleosome Cor ... Tsunaka           2.50 2005-05-31   0.0000
7BY0     The Cryo-Em Structure Of Cenp-A Nucleosom ... Ariyoshi          0.00 2020-04-21   0.0000
1HQ3     Crystal Structure Of Histone-Core-Octamer ... Chantalat         2.15 2000-12-14   0.0000
6UPL     Structure Of Fact_subnucleosome Complex 2     Zhou              0.00 2019-10-17   0.0000
6SEE     Class2a : Cenp-A Nucleosome In Complex Wi ... Ali-Ahmad         0.00 2019-07-29   0.0000
6UPK     Structure Of Fact_subnucleosome Complex 1     Zhou              0.00 2019-10-17   0.0000
7K61     Cryo-Em Structure Of 197bp Nucleosome Aid ... Zhou              0.00 2020-09-17   0.0000
6SE0     Class 1 : Cenp-A Nucleosome                   Ali-Ahmad         0.00 2019-07-29   0.0000
6M4G     Structural Mechanism Of Nucleosome Dynami ... Zhou              0.00 2020-03-06   0.0000
7DBP     Linker Histone Defines Structure And Self ... Wang              0.00 2020-10-21   0.0000
6LER     169 Bp Nucleosome Harboring Non-Identical ... Sharma            3.00 2019-11-26   0.0000
6BUZ     Cryo-Em Structure Of Cenp-A Nucleosome In ... Chittori          0.00 2017-12-11   0.0000
6E0P     Cryo-Em Structure Of Centromeric Nucleoso ... Yadav             2.60 2018-07-06   0.0000
6LAB     169 Bp Nucleosome, Harboring Cohesive DNA ... Adhireksan        3.20 2019-11-12   0.0000
7K5X     Cryo-Em Structure Of A Chromatosome Conta ... Zhou              0.00 2020-09-17   0.0000
5KGF     Structural Model Of 53bp1 Bound To A Ubiq ... Wilson            4.54 2016-06-13   0.0000
6SEG     Class1: Cenp-A Nucleosome In Complex With ... Ali-Ahmad         0.00 2019-07-30   0.0000
6SEF     Class2c : Cenp-A Nucleosome In Complex Wi ... Ali-Ahmad         0.00 2019-07-29   0.0000
6LA9     349 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan        3.70 2019-11-12   0.0000
7K5Y     Cryo-Em Structure Of A Chromatosome Conta ... Zhou              0.00 2020-09-17   0.0000
7K60     Cryo-Em Structure Of A Chromatosome Conta ... Zhou              0.00 2020-09-17   0.0000
6T7C     Structure Of Two Copies Of Human Sox11 Tr ... Dodonova          4.00 2019-10-21   0.0000
6M4D     Structural Mechanism Of Nucleosome Dynami ... Zhou              0.00 2020-03-06   0.0000
7K63     Cryo-Em Structure Of A Chromatosome Conta ... Zhou              0.00 2020-09-18   0.0000
6T7B     Structure Of Human Sox2 Transcription Fac ... Dodonova          5.10 2019-10-21   0.0000
6T7A     Structure Of Human Sox11 Transcription Fa ... Dodonova          3.70 2019-10-21   0.0000
6T79     Structure Of A Human Nucleosome At 3.2 A  ... Dodonova          3.20 2019-10-21   0.0000
6HTS     Cryo-Em Structure Of Human Ino80 Complex  ... Ayala             0.00 2018-10-04   0.0000
6SE6     Class2 : Cenp-A Nucleosome In Complex Wit ... Ali-Ahmad         0.00 2019-07-29   0.0000
6E0C     Cryo-Em Structure Of Cenp-A Nucleosome (W ... Yadav             2.63 2018-07-06   0.0000
6V92     Rsc-Ncp                                       Patel             20.00 2019-12-13   0.0000
6T7D     Structure Of Human Sox11 Transcription Fa ... Dodonova          4.40 2019-10-21   0.0000
5XF3     Nucleosome Core Particle With An Adduct O ... Ma                2.60 2017-04-07   0.0000
5XF4     Nucleosome Core Particle With An Adduct O ... Ma                2.87 2017-04-07   0.0000
5XF5     Nucleosome Core Particle With An Adduct O ... Ma                2.82 2017-04-07   0.0000
6M3V     355 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan        4.60 2020-03-04   0.0000
6Y5D     Structure Of Human Cgas (K394e) Bound To  ... Pathare           4.10 2020-02-25   0.0000
1EQZ     X-Ray Structure Of Nucleosome Core Partic ... Hanson            2.50 2000-04-06   0.0000
6LA8     349 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan        3.40 2019-11-12   0.0000
6M44     355 Bp Di-Nucleosome Harboring Cohesive D ... Adhireksan        3.81 2020-03-05   0.0000
6O1D     Cryo-Em Structure Of Centromeric Nucleoso ... Zhou              3.40 2019-02-19   0.0000
6R0C     Human-D02 Nucleosome Core Particle With B ... Pye               4.20 2019-03-12   0.0000
6C0W     Cryo-Em Structure Of Human Kinetochore Pr ... Zhou              0.00 2018-01-02   0.0000
6M4H     Structural Mechanism Of Nucleosome Dynami ... Zhou              0.00 2020-03-07   0.0000
1TZY     Crystal Structure Of Core-Histone Octamer ... Wood              1.90 2004-07-12   0.0000
6YOV     Oct4-Sox2-Bound Nucleosome - Shl+6            Michael           3.42 2020-04-15   0.0000
6T90     Oct4-Sox2-Bound Nucleosome - Shl-6            Michael           0.00 2019-10-25   0.0000
6L4A     H3-H3-H3 Tri-Nucleosome With The 22 Base- ... Takizawa          12.30 2019-10-16   0.0000
5Z30     The Crystal Structure Of Nucleosome Conta ... Horikoshi         2.45 2018-01-05   0.0000
3AYW     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.90 2011-05-19   0.0000
6JR1     Crystal Structure Of Human Nucleosome Pha ... Saotome           2.40 2019-04-02   0.0000
3AZG     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.40 2011-05-25   0.0000
6KVD     Crystal Structure Of Human Nucleosome Con ... Tanaka            2.21 2019-09-04   0.0000
6A5T     RNA Polymerase II Elongation Complex Stal ... Kujirai           6.70 2018-06-25   0.0000
3AZI     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.70 2011-05-25   0.0000
5B2I     Human Nucleosome Containing Cpg Unmethyla ... Fujii             3.00 2016-01-16   0.0000
6R90     Cryo-Em Structure Of Ncp-Thf2(+1)-Uv-Ddb  ... Matsumoto         4.50 2019-04-02   0.0000
6R93     Cryo-Em Structure Of Ncp-6-4pp                Matsumoto         4.00 2019-04-02   0.0000
6L49     H3-Ca-H3 Tri-Nucleosome With The 22 Base- ... Takizawa          18.90 2019-10-16   0.0000
4YM5     Crystal Structure Of Human Nucleosome Con ... Osakabe           4.00 2015-03-06   0.0000
5AV8     Human Nucleosome Core Particle                Wakamori          2.20 2015-06-12   0.0000
5B40     The Nucleosome Structure Containing H2b-K ... Machida           3.33 2016-03-22   0.0000
5Z23     Crystal Structure Of Nucleosome Containin ... Arimura           2.73 2017-12-28   0.0000
3WTP     Crystal Structure Of Heterotypic Nucleoso ... Arimura           2.67 2014-04-14   0.0000
5GSE     Crystal Structure Of Unusual Nucleosome       Kato              3.14 2016-08-16   0.0000
6IR9     RNA Polymerase II Elongation Complex Boun ... Ehara             3.80 2018-11-12   0.0000
3AZF     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.70 2011-05-25   0.0000
7C0M     Human Cgas-Nucleosome Complex                 Kujirai           3.90 2020-05-01   0.0000
6J50     RNA Polymerase II Elongation Complex Boun ... Ehara             4.70 2019-01-10   0.0000
7BXT     The Cryo-Em Structure Of Cenp-A Nucleosom ... Ariyoshi          0.00 2020-04-20   0.0000
6HKT     Structure Of An H1-Bound 6-Nucleosome Array   Garcia-Saez       9.70 2018-09-08   0.0000
5AV5     Human Nucleosome Core Particle                Wakamori          2.40 2015-06-11   0.0000
6R8Z     Cryo-Em Structure Of Ncp_thf2(-1)-Uv-Ddb      Matsumoto         3.90 2019-04-02   0.0000
3AN2     The Structure Of Centromeric Nucleosome C ... Tachiwana         3.60 2010-08-27   0.0000
6R91     Cryo-Em Structure Of Ncp_thf2(-3)-Uv-Ddb      Matsumoto         4.10 2019-04-02   0.0000
3AZH     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.49 2011-05-25   0.0000
3AV2     The Human Nucleosome Structure Containing ... Tachiwana         2.80 2011-02-18   0.0000
5B24     The Crystal Structure Of Nucleosome Conta ... Horikoshi         3.60 2015-12-31   0.0000
3A6N     The Nucleosome Containing A Testis-Specif ... Tachiwana         2.70 2009-09-04   0.0000
6JR0     Crystal Structure Of Human Nucleosome Pha ... Saotome           2.50 2019-04-02   0.0000
5B0Z     The Crystal Structure Of Nucleosome Conta ... Suzuki            1.99 2015-11-14   0.0000
6A5L     RNA Polymerase II Elongation Complex Stal ... Kujirai           5.60 2018-06-24   0.0000
6A5U     RNA Polymerase II Elongation Complex Stal ... Kujirai           7.60 2018-06-25   0.0000
5AVB     Human Nucleosome Core Particle                Wakamori          2.40 2015-06-12   0.0000
4Z5T     The Nucleosome Containing Human H3.5          Urahama           2.80 2015-04-03   0.0000
7D20     Cryo-Em Structure Of Set8-Cenp-A-Nucleoso ... Ho                0.00 2020-09-15   0.0000
3WAA     The Nucleosome Containing Human H2a.Z.2       Horikoshi         3.20 2013-04-30   0.0000
6A5P     RNA Polymerase II Elongation Complex Stal ... Kujirai           7.00 2018-06-25   0.0000
3AZL     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.70 2011-05-25   0.0000
6R94     Cryo-Em Structure Of Ncp_thf2(-3)             Matsumoto         3.50 2019-04-02   0.0000
6JOU     Crystal Structure Of Human Nucleosome Con ... Horikoshi         2.17 2019-03-23   0.0000
6A5R     RNA Polymerase II Elongation Complex Stal ... Kujirai           8.70 2018-06-25   0.0000
6R92     Cryo-Em Structure Of Ncp-Thf2(+1)-Uv-Ddb  ... Matsumoto         4.80 2019-04-02   0.0000
3AFA     The Human Nucleosome Structure                Tachiwana         2.50 2010-02-24   0.0000
5CPI     Nucleosome Containing Unmethylated Sat2r DNA  Osakabe           2.90 2015-07-21   0.0000
5CPJ     Nucleosome Containing Methylated Sat2r DNA    Osakabe           3.15 2015-07-21   0.0000
6J51     RNA Polymerase II Elongation Complex Boun ... Ehara             4.20 2019-01-10   0.0000
5X7X     The Crystal Structure Of Nucleosome Conta ... Arimura           2.18 2017-02-27   0.0000
5GXQ     The Crystal Structure Of Nucleosome Conta ... Taguchi           2.85 2016-09-19   0.0000
6J4Z     RNA Polymerase II Elongation Complex Boun ... Ehara             4.10 2019-01-10   0.0000
6J4Y     RNA Polymerase II Elongation Complex Boun ... Ehara             4.30 2019-01-10   0.0000
4YM6     Crystal Structure Of Human Nucleosome Con ... Osakabe           3.51 2015-03-06   0.0000
6J4X     RNA Polymerase II Elongation Complex Boun ... Ehara             4.30 2019-01-10   0.0000
6J4W     RNA Polymerase II Elongation Complex Boun ... Ehara             7.90 2019-01-10   0.0000
5ZBX     The Crystal Structure Of Nucleosome Conta ... Arimura           2.58 2018-02-13   0.0000
6K1I     Human Nucleosome Core Particle With Gamma ... Sharma            2.75 2019-05-10   0.0000
5B32     The Crystal Structure Of Heterotypic H2az ... Horikoshi         2.35 2016-02-08   0.0000
6A5O     RNA Polymerase II Elongation Complex Stal ... Kujirai           9.90 2018-06-25   0.0000
6KXV     Crystal Structure Of A Nucleosome Contain ... Dacher            3.63 2019-09-13   0.0000
5JRG     Crystal Structure Of Nucleosome Containin ... Osakabe           2.50 2016-05-06   0.0000
3AV1     The Human Nucleosome Structure Containing ... Tachiwana         2.50 2011-02-18   0.0000
6K1J     Human Nucleosome Core Particle With H2a.X ... Sharma            2.85 2019-05-10   0.0000
3AZK     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.20 2011-05-25   0.0000
5AY8     Crystal Structure Of Human Nucleosome Con ... Kujirai           2.80 2015-08-10   0.0000
3WA9     The Nucleosome Containing Human H2a.Z.1       Horikoshi         3.07 2013-04-30   0.0000
6INQ     RNA Polymerase II Elongation Complex Stal ... Kujirai           6.90 2018-10-26   0.0000
5AV6     Human Nucleosome Core Particle                Wakamori          2.20 2015-06-12   0.0000
5CPK     Nucleosome Containing Methylated Sat2l DNA    Osakabe           2.63 2015-07-21   0.0000
3AZJ     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.89 2011-05-25   0.0000
5GTC     Crystal Structure Of Complex Between Dmap ... Arimura           2.70 2016-08-19   0.0000
5B31     The Crystal Structure Of Heterotypic H2az ... Horikoshi         2.20 2016-02-08   0.0000
6USJ     Structure Of Two Nucleosomes Bridged By H ... Gaullier          0.00 2019-10-27   0.0000
3AZN     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.00 2011-05-25   0.0000
3W99     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.00 2013-04-01   0.0000
2RVQ     Solution Structure Of Isolated Histone H2 ... Moriwaki               2016-03-28   0.0000
7D1Z     Cryo-Em Structure Of Set8-Nucleosome Complex  Ho                0.00 2020-09-15   0.0000
5B2J     Human Nucleosome Containing Cpg Methylate ... Fujii             2.60 2016-01-18   0.0000
3AZE     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.00 2011-05-25   0.0000
5Y0C     Crystal Structure Of Human Nucleosome At  ... Kurumizaka        2.09 2017-07-16   0.0000
3W96     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.00 2013-04-01   0.0000
5AV9     Human Nucleosome Core Particle                Wakamori          2.20 2015-06-12   0.0000
3AZM     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           2.89 2011-05-25   0.0000
5B33     The Crystal Structure Of H2az Nucleosome  ... Horikoshi         2.92 2016-02-08   0.0000
3W98     Crystal Structure Of Human Nucleosome Cor ... Iwasaki           3.42 2013-04-01   0.0000
6K1K     Human Nucleosome Core Particle With H2a.X ... Sharma            2.20 2019-05-10   0.0000
5B0Y     Crystal Structure Of Nucleosome Containin ... Suzuki            2.56 2015-11-13   0.0000
5AVC     Human Nucleosome Core Particle                Wakamori          2.40 2015-06-12   0.0000
6V2K     The Nucleosome Structure After H2a-H2b Ex ... Arimura           2.60 2019-11-24   0.0000
6R8Y     Cryo-Em Structure Of Ncp-6-4pp(-1)-Uv-Ddb     Matsumoto         4.30 2019-04-02   0.0000
6T93     Nucleosome With Oct4-Sox2 Motif At Shl-6      Michael           3.49 2019-10-25   0.0000
7BG9     The Catalytic Core Lobe Of Human Telomera ... Nguyen            3.80 2021-01-06   0.0000
5CHL     Structural Basis Of H2a.Z Recognition By  ... Shan              1.89 2015-07-10   0.0000
5VEY     Solution NMR Structure Of Histone H2a-H2b ... Hu                     2017-04-06   0.0000
4NFT     Crystal Structure Of Human Lnkh2b-H2a.Z-A ... Shan              2.61 2013-11-01   0.0000
6A7U     Crystal Structure Of Histone H2a.Bbd-H2b  ... Dai               2.60 2018-07-04   0.0000
5Y0D     Crystal Structure Of Human Nucleosome Con ... Kurumizaka        1.99 2017-07-16   0.0000
7K6P     Active State Dot1 Bound To The Unacetylat ... Valencia-Sanchez  3.20 2020-09-21   0.0000
6Z6P     Hdac-Pc-Nuc                                   Lee               0.00 2020-05-28   0.0000
4YS3     Nucleosome Disassembly By Rsc And Swi/Snf ... Dechassa          3.00 2015-03-16   0.0000
3KWQ     Structural Characterization Of H3k56q Nuc ... Lilyestrom        3.50 2009-12-01   0.0000
4XZQ     Nucleosome Disassembly By Rsc And Swi/Snf ... Dechassa          2.40 2015-02-04   0.0000
7K6Q     Active State Dot1 Bound To The H4k16ac Nu ... Valencia-Sanchez  3.10 2020-09-21   0.0000
5MLU     Crystal Structure Of Pfv Gag Cbs Bound To ... Pye               2.80 2016-12-07   0.0000
6NE3     Cryo-Em Structure Of Singly-Bound Snf2h-N ... Armache           0.00 2018-12-16   0.0000
6JM9     Cryo-Em Structure Of Dot1l Bound To Unmod ... Jang              7.30 2019-03-07   0.0000
4Z66     Nucleosome Disassembly By Rsc And Swi/Snf ... Dechassa          2.50 2015-04-03   0.0000
6JMA     Cryo-Em Structure Of Dot1l Bound To H2b U ... Jang              6.80 2019-03-07   0.0000
6FQ6     Class 2 : Distorted Nucleosome                Bilokapic         0.00 2018-02-13   0.0000
6FQ8     Class 3 : Translocated Nucleosome             Bilokapic         0.00 2018-02-13   0.0000
6FQ5     Class 1 : Canonical Nucleosome                Bilokapic         0.00 2018-02-13   0.0000
7KTQ     Nucleosome From A Dimeric Prc2 Bound To A ... Grau              3.30 2020-11-24   0.0000
6R1T     Structure Of Lsd2/Npac-Linker/Nucleosome  ... Marabelli         3.70 2019-03-15   0.0000
6IY3     Structure Of Snf2-Mmtv-A Nucleosome Compl ... Li                0.00 2018-12-12   0.0000
6K01     Crystal Structure Of Xh2a-H2b                 Liu               2.84 2019-05-05   0.0000
1AOI     Complex Between Nucleosome Core Particle  ... Luger             2.80 1997-07-03   0.0000
5G2E     Structure Of Nap1 H2a H2b Complex             Aguilargurrieri   6.70 2016-04-07   0.0000
6IY2     Structure Of Snf2-Mmtv-A Nucleosome Compl ... Li                0.00 2018-12-12   0.0000
3C9K     Model Of Histone Octamer Tubular Crystals     Frouws            20.00 2008-02-16   0.0000
1U35     Crystal Structure Of Nucleosome Core Part ... Chakravarthy      3.00 2004-07-20   0.0000
2F8N     2.9 Angstrom X-Ray Structure Of Hybrid Ma ... Chakravarthy      2.90 2005-12-02   0.0000
5B1M     The Mouse Nucleosome Structure Containing ... Urahama           2.34 2015-12-08   0.0000
5XM1     The Mouse Nucleosome Structure Containing ... Taguchi           3.45 2017-05-12   0.0000
5B1L     The Mouse Nucleosome Structure Containing H3t Urahama           2.35 2015-12-08   0.0000
5XM0     The Mouse Nucleosome Structure Containing ... Taguchi           2.87 2017-05-12   0.0000
1S32     Molecular Recognition Of Nucleosomal 'Sup ... Edayathumangalam  2.05 2004-01-12   0.0000
6W5I     Cryo-Em Structure Of Mll1 In Complex With ... Park              0.00 2020-03-13   0.0000
5Z3V     Structure Of Snf2-Nucleosome Complex At S ... Li                0.00 2018-01-08   0.0000
5ONG     X-Ray Crystal Structure Of A Nucleosome C ... Frouws            2.80 2017-08-03   0.0000
6PWV     Cryo-Em Structure Of Mll1 Core Complex Bo ... Park              6.20 2019-07-23   0.0000
7CRR     Native Nsd3 Bound To 187-Bp Nucleosome        Li                0.00 2020-08-14   0.0000
6NJ9     Active State Dot1l Bound To The H2b-Ubiqu ... Worden            2.96 2019-01-02   0.0000
3REK     2.6 Angstrom Crystal Structure Of Nucleos ... Wu                2.60 2011-04-04   0.0000
5Z3L     Structure Of Snf2-Nucleosome Complex In A ... Li                0.00 2018-01-08   0.0000
6VYP     Crystal Structure Of Lsd1/Corest Histone  ... Kim               4.99 2020-02-27   0.0000
6WZ5     Bridging Of Double-Strand DNA Break Activ ... Halic             0.00 2020-05-13   0.0000
6R1U     Structure Of Lsd2/Npac-Linker/Nucleosome  ... Marabelli         4.36 2019-03-15   0.0000
5NL0     Crystal Structure Of A 197-Bp Palindromic ... Garcia-Saez       5.40 2017-04-03   0.0000
7CRQ     Nsd3 Bearing E1181k/T1232a Dual Mutation  ... Li                0.00 2020-08-14   0.0000
6ESH     Nucleosome Breathing : Class 3                Bilokapic         0.00 2017-10-20   0.0000
6NOG     Poised-State Dot1l Bound To The H2b-Ubiqu ... Worden            3.90 2019-01-16   0.0000
6ESG     Nucleosome Breathing : Class 2                Bilokapic         0.00 2017-10-20   0.0000
6ESF     Nucleosome : Class 1                          Bilokapic         0.00 2017-10-20   0.0000
3REI     2.65 Angstrom Crystal Structure Of Nucleo ... Wu                2.65 2011-04-04   0.0000
5O9G     Structure Of Nucleosome-Chd1 Complex          Farnung           4.80 2017-06-19   0.0000
5X0Y     Complex Of Snf2-Nucleosome Complex With S ... Li                0.00 2017-01-23   0.0000
3LJA     Using Soft X-Rays For A Detailed Picture  ... Wu                2.75 2010-01-26   0.0000
5OMX     X-Ray Structure Of H2a-N38c Nucleosome Co ... Frouws            2.32 2017-08-02   0.0000
3REJ     2.55 Angstrom Crystal Structure Of Nucleo ... Wu                2.55 2011-04-04   0.0000
6UXW     Swi/Snf Nucleosome Complex With Adp-Befx      He                0.00 2019-11-08   0.0000
6S01     Structure Of Ledgf Pwwp Domain Bound H3k3 ... Wang              3.20 2019-06-13   0.0000
5ONW     X-Ray Crystal Structure Of A Nucleosome C ... Frouws            2.80 2017-08-04   0.0000
6KIU     Cryo-Em Structure Of Human Mll1-Ubncp Com ... Huang             0.00 2019-07-20   0.0000
6TDA     Structure Of Swi/Snf Chromatin Remodeler  ... Wagner            15.00 2019-11-08   0.0000
7CRP     Nsd3 Bearing E1181k/T1232a Dual Mutation  ... Li                0.00 2020-08-14   0.0000
3TU4     Crystal Structure Of Sir3 Bah Domain In C ... Armache           3.00 2011-09-15   0.0000
3REL     2.7 Angstrom Crystal Structure Of Nucleos ... Wu                2.70 2011-04-04   0.0000
3MVD     Crystal Structure Of Chromatin Factor Rcc ... Makde             2.90 2010-05-04   0.0000
5F99     X-Ray Structure Of Mmtv-A Nucleosome Core ... Frouws            2.63 2015-12-09   0.0000
6IRO     The Crosslinked Complex Of Iswi-Nucleosom ... Yan               0.00 2018-11-13   0.0000
6VEN     Yeast Compass In Complex With A Ubiquitin ... Worden            3.37 2020-01-02   0.0000
6T9L     Saga Dub Module Bound To A Ubiqitinated N ... Wang              3.60 2019-10-28   0.0000
6NQA     Active State Dot1l Bound To The H2b-Ubiqu ... Worden            3.54 2019-01-19   0.0000
6WZ9     Bridging Of Double-Strand DNA Break Activ ... Halic             0.00 2020-05-13   0.0000
7CRO     Nsd2 Bearing E1099k/T1150a Dual Mutation  ... Li                0.00 2020-08-14   0.0000
5Z3O     Structure Of Snf2-Nucleosome Complex In A ... Li                0.00 2018-01-08   0.0000
6KIX     Cryo-Em Structure Of Human Mll1-Ncp Compl ... Huang             0.00 2019-07-20   0.0000
6K1P     The Complex Of Iswi-Nucleosome In The Adp ... Yan               3.87 2019-05-10   0.0000
4R8P     Crystal Structure Of Ring1b/Bmi1/Ubch5c P ... Mcginty           3.28 2014-09-02   0.0000
7AT8     Histone H3 Recognition By Nucleosome-Boun ... Finogenova        4.40 2020-10-29   0.0000
6X0N     Bridging Of Double-Strand DNA Break Activ ... Halic             0.00 2020-05-16   0.0000
6ESI     Nucleosome Breathing : Class 4                Bilokapic         0.00 2017-10-20   0.0000
6JYL     The Crosslinked Complex Of Iswi-Nucleosom ... Yan               3.37 2019-04-26   0.0000
3KXB     Structural Characterization Of H3k56q Nuc ... Clark             3.20 2009-12-02   0.0000
6KIZ     Cryo-Em Structure Of Human Mll1-Ncp Compl ... Huang             0.00 2019-07-20   0.0000
5Z3U     Structure Of Snf2-Nucleosome Complex At S ... Li                0.00 2018-01-08   0.0000
5HQ2     Structural Model Of Set8 Histone H4 Lys20 ... Tavarekere        4.50 2016-01-21   0.0000
3O62     Nucleosome Core Particle Modified With A  ... Lippard           3.22 2010-07-28   0.0000
6KIV     Cryo-Em Structure Of Human Mll1-Ubncp Com ... Huang             0.00 2019-07-20   0.0000
3REH     2.5 Angstrom Crystal Structure Of Nucleos ... Wu                2.50 2011-04-04   0.0000
6KIW     Cryo-Em Structure Of Human Mll3-Ubncp Com ... Huang             0.00 2019-07-20   0.0000
6RYU     Nucleosome-Chd4 Complex Structure (Two Ch ... Farnung           0.00 2019-06-12   0.0000
6N1Z     Importin-9 Bound To H2a-H2b                   Tomchick          2.70 2018-11-12   0.0000
6O96     Dot1l Bound To The H2bk120 Ubiquitinated  ... Valencia-Sanchez  0.00 2019-03-13   0.0000
6PX1     Set2 Bound To Nucleosome                      Halic             0.00 2019-07-24   0.0000
6PA7     The Cryo-Em Structure Of Human Dnmt3a2-Dn ... Xu                0.00 2019-06-11   0.0000
6PX3     Set2 Bound To Nucleosome                      Halic             0.00 2019-07-24   0.0000
6PWW     Cryo-Em Structure Of Mll1 In Complex With ... Park              0.00 2019-07-23   0.0000
5E5A     Crystal Structure Of Chromatin-Tethering  ... Fang              2.81 2015-10-08   0.0000
6RYR     Nucleosome-Chd4 Complex Structure (Single ... Farnung           0.00 2019-06-11   0.0000
4ZUX     Saga Dub Module Ubp8/Sgf11/Sus1/Sgf73 Bou ... Morgan            3.82 2015-05-17   0.0000
6PWX     Cryo-Em Structure Of Rbbp5 Bound To The N ... Park              0.00 2019-07-23   0.0000
6W5M     Cryo-Em Structure Of Mll1 In Complex With ... Park              0.00 2020-03-13   0.0000
6J99     Cryo-Em Structure Of Human Dot1l In Compl ... Yao               0.00 2019-01-22   0.0000
6I84     Structure Of Transcribing RNA Polymerase  ... Farnung           4.40 2018-11-19   0.0000
6ZHX     Cryo-Em Structure Of Regulatory Linker Of ... Bacic             2.50 2020-06-24   0.0000
6ZHY     Cryo-Em Structure Of Regulatory Linker Of ... Bacic             3.00 2020-06-24   0.0000
6W5N     Cryo-Em Structure Of Mll1 In Complex With ... Park              0.00 2020-03-13   0.0000
6NZO     Set2 Bound To Nucleosome                      Halic             0.00 2019-02-14   0.0000
6NN6     Structure Of Dot1l-H2bk120ub Nucleosome C ... Anderson          3.90 2019-01-14   0.0000
3UTA     Crystal Structure Of Nucleosome Core Part ... Chua              2.07 2011-11-25   0.0000
6UGM     Structural Basis Of Compass Ecm Recogniti ... Hsu               0.00 2019-09-26   0.0000
3C1B     The Effect Of H3 K79 Dimethylation And H4 ... Lu                2.20 2008-01-22   0.0000
3MGQ     Binding Of Nickel Ions To The Nucleosome  ... Mohideen          2.65 2010-04-07   0.0000
3B6G     Nucleosome Core Particle Treated With Oxa ... Wu                3.45 2007-10-29   0.0000
5CP6     Nucleosome Core Particle With Adducts Fro ... Ma                2.60 2015-07-21   0.0000
1P3I     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.30 2003-04-17   0.0000
1ZBB     Structure Of 4_601_167 Tetranucleosome        Schalch           9.00 2005-04-08   0.0000
1P3A     Crystallographic Studies Of Nucleosome Co ... Muthurajan        3.00 2003-04-17   0.0000
3LZ1     Crystal Structure Of Nucleosome Core Part ... Vasudevan         2.50 2010-03-01   0.0000
1P3B     Crystallographic Studies Of Nucleosome Co ... Muthurajan        3.00 2003-04-17   0.0000
1P3G     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.70 2003-04-17   0.0000
3LEL     Structural Insight Into The Sequence-Depe ... Wu                2.95 2010-01-15   0.0000
2FJ7     Crystal Structure Of Nucleosome Core Part ... Bao               3.20 2005-12-31   0.0000
3MNN     A Ruthenium Antitumour Agent Forms Specif ... Ong               2.50 2010-04-22   0.0000
1M19     Ligand Binding Alters The Structure And D ... Suto              2.30 2002-06-18   0.0000
4J8U     X-Ray Structure Of Ncp145 With Chlorido(E ... Adhireksan        2.38 2013-02-15   0.0000
3UT9     Crystal Structure Of Nucleosome Core Part ... Chua              2.20 2011-11-25   0.0000
6UH5     Structural Basis Of Compass Ecm Recogniti ... Hsu               0.00 2019-09-26   0.0000
4WU9     Structure Of Cisptnap-Ncp145                  Chua              2.60 2014-10-31   0.0000
5XF6     Nucleosome Core Particle With An Adduct O ... Ma                2.63 2017-04-07   0.0000
3C1C     The Effect Of H3 K79 Dimethylation And H4 ... Lu                3.15 2008-01-22   0.0000
4XUJ     Nucleosome Core Particle Containing Adduc ... Adhireksan        3.18 2015-01-26   0.0000
1P34     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.70 2003-04-17   0.0000
1KX4     X-Ray Structure Of Nucleosome Core Partic ... Davey             2.60 2002-01-31   0.0000
1P3L     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.40 2003-04-17   0.0000
1P3O     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.75 2003-04-17   0.0000
1M18     Ligand Binding Alters The Structure And D ... Suto              2.45 2002-06-18   0.0000
1P3P     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.70 2003-04-17   0.0000
1ZLA     X-Ray Structure Of A Kaposi'S Sarcoma Her ... Chodaparambil     2.90 2005-05-05   0.0000
5X0X     Complex Of Snf2-Nucleosome Complex With S ... Li                0.00 2017-01-23   0.0000
1KX3     X-Ray Structure Of Nucleosome Core Partic ... Davey             2.00 2002-01-31   0.0000
4J8X     X-Ray Structure Of Ncp145 With Bound Chlo ... Adhireksan        2.87 2013-02-15   0.0000
4J8V     X-Ray Structure Of Ncp145 With Bound Chlo ... Adhireksan        2.58 2013-02-15   0.0000
1P3F     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.90 2003-04-17   0.0000
2NZD     Nucleosome Core Particle Containing 145 B ... Ong               2.65 2006-11-23   0.0000
4J8W     X-Ray Structure Of Ncp145 With Chlorido(E ... Adhireksan        2.41 2013-02-15   0.0000
1P3M     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.90 2003-04-17   0.0000
3MGR     Binding Of Rubidium Ions To The Nucleosom ... Mohideen          2.30 2010-04-07   0.0000
3KUY     DNA Stretching In The Nucleosome Facilita ... Wu                2.90 2009-11-28   0.0000
3MGP     Binding Of Cobalt Ions To The Nucleosome  ... Mohideen          2.44 2010-04-07   0.0000
1P3K     Crystallographic Studies Of Nucleosome Co ... Muthurajan        2.90 2003-04-17   0.0000
5DNN     Nucleosome Core Particle Containing Adduc ... Adhireksan        2.80 2015-09-10   0.0000
3B6F     Nucleosome Core Particle Treated With Cis ... Wu                3.45 2007-10-29   0.0000
1KX5     X-Ray Structure Of Nucleosome Core Partic ... Davey             1.94 2002-01-31   0.0000
3MGS     Binding Of Cesium Ions To The Nucleosome  ... Mohideen          3.15 2010-04-07   0.0000
4WU8     Structure Of Trptnap-Ncp145                   Chua              2.45 2014-10-31   0.0000
6VZ4     Cryo-Em Structure Of Sth1-Arp7-Arp9-Rtt10 ... Leschziner        3.90 2020-02-27   0.0000
1M1A     Ligand Binding Alters The Structure And D ... Suto              2.65 2002-06-18   0.0000
3LZ0     Crystal Structure Of Nucleosome Core Part ... Vasudevan         2.50 2010-03-01   0.0000
3UTB     Crystal Structure Of Nucleosome Core Part ... Chua              2.20 2011-11-25   0.0000
6TEM     Cenp-A Nucleosome Core Particle With 145  ... Boopathi          3.90 2019-11-12   0.0000
5DNM     Nucleosome Core Particle Containing Adduc ... Adhireksan        2.81 2015-09-10   0.0000
6KW5     The Classc Rsc-Nucleosome Complex             Ye                10.13 2019-09-06   0.0000
6KW4     The Classb Rsc-Nucleosome Complex             Ye                7.55 2019-09-06   0.0000
6OM3     Crystal Structure Of Orc1 Bah Domain In C ... De Ioannes        3.30 2019-04-18   0.0000
6WKR     Prc2-Aebp2-Jarid2 Bound To H2ak119ub1 Nuc ... Kasinath          0.00 2020-04-16   0.0000
6LTJ     Structure Of Nucleosome-Bound Human Baf C ... He                3.70 2020-01-22   0.0000
6R25     Structure Of Lsd2/Npac-Linker/Nucleosome  ... Marabelli         4.61 2019-03-15   0.0000
5OXV     Structure Of 4_601_157 Tetranucleosome (C ... Ekundayo          6.72 2017-09-07   0.0000
6KW3     The Classa Rsc-Nucleosome Complex             Ye                7.13 2019-09-05   0.0000
4LD9     Crystal Structure Of N-Terminally Acetyla ... Arnaudo           3.31 2013-06-24   0.0000
5OY7     Structure Of 4_601_157 Tetranucleosome (P ... Ekundayo          5.77 2017-09-07   0.0000
4KGC     Nucleosome Core Particle Containing (Eta6 ... Adhireksan        2.69 2013-04-29   0.0000
6G0L     Structure Of Two Molecules Of Chromatin R ... Sundaramoorthy    10.00 2018-03-19   0.0000
1F66     2.6 A Crystal Structure Of A Nucleosome C ... Suto              2.60 2000-06-20   0.0000
6FTX     Structure Of Chromatin Remodelling Enzyme ... Sundaramoorthy    4.50 2018-02-25   0.0000
6W4L     The Crystal Structure Of A Single Chain H ... Warren            1.31 2020-03-11   0.0000
4X23     Crystal Structure Of Cenp-C In Complex Wi ... Jiang             3.50 2014-11-25   0.0000
5WCU     Crystal Structure Of 167 Bp Nucleosome Bo ... Jiang             5.53 2017-07-02   0.0000
4KHA     Structural Basis Of Histone H2a-H2b Recog ... Hondele           2.35 2013-04-30   0.0000
1HIO     Histone Octamer (Chicken), Chromosomal Pr ... Arents            3.10 1991-09-19   0.0000
2PYO     Drosophila Nucleosome Core                    Clapier           2.43 2007-05-16   0.0000
4QLC     Crystal Structure Of Chromatosome At 3.5  ... Jiang             3.50 2014-06-11   0.0000
6PWF     Cryo-Em Structure Of Atpase Domain Of Chr ... Chittori          4.07 2019-07-22   0.0000
2NQB     Drosophila Nucleosome Structure               Luger             2.30 2006-10-30   0.0000
6PWE     Cryo-Em Structure Of Nucleosome Core Particle Chittori          3.95 2019-07-22   0.0000
6DZT     Cryo-Em Structure Of Nucleosome In Comple ... Yadav             0.00 2018-07-05   0.0000
6K0C     Crystal Structure Of Cenap1-H2a.Z-H2b Complex Liu               2.28 2019-05-05   0.0000
6K09     Crystal Structure B Of Cenap1-H2a-H2b Complex Liu               2.25 2019-05-05   0.0000
6K03     Crystal Structure Of Ceh2a-H2b                Liu               2.86 2019-05-05   0.0000
6K00     Crystal Structure A Of Cenap1-H2a-H2b Complex Liu               2.20 2019-05-05   0.0000
3X1V     Crystal Structure Of Nucleosome Core Part ... Sivaraman         2.92 2014-11-28   0.0000
3X1T     Crystal Structure Of Nucleosome Core Part ... Sivaraman         2.81 2014-11-27   0.0000
5GSU     Crystal Structure Of Nucleosome Core Part ... Kumarevel         3.10 2016-08-17   0.0000
5GT3     Crystal Structure Of Nucleosome Particle  ... Kumarevel         2.91 2016-08-18   0.0000
3WKJ     The Nucleosome Containing Human Tsh2b         Urahama           2.80 2013-10-22   0.0000
7BP2     Structural Mechanism Directing Nucleosome ... Luo               1.58 2020-03-21   0.0000
6M2M     A Role For Histone Chaperone Oschz1 In Hi ... Luo               2.85 2020-02-28   0.0000
7BP4     Structural Insights Into Nucleosome Reorg ... Luo               2.10 2020-03-21   0.0000
7C7X     Structural Insights Into Nucleosome Reorg ... Luo               3.00 2020-05-27   0.0000
7BP6     Structural Insights Into Nucleosome Reorg ... Luo               1.58 2020-03-21   0.0000
7BP5     Structural Insights Into Nucleosome Reorg ... Luo               1.90 2020-03-21   0.0000
6QLD     Structure Of Inner Kinetochore Ccan-Cenp- ... Yan               4.15 2019-01-31   0.0000
4WNN     Spt16-H2a-H2b Fact Histone Complex            Kemble            1.80 2014-10-13   0.0000
1ID3     Crystal Structure Of Yeast Nucleosome Cor ... White             3.10 2001-04-03   0.0000
4JJN     Crystal Structure Of Heterochromatin Prot ... Wang              3.09 2013-03-08   0.0000
6GEN     Chromatin Remodeller-Nucleosome Complex A ... Willhoft          0.00 2018-04-27   0.0000
7K7G     Nucleosome And Gal4 Complex                   Ruifang           4.20 2020-09-22   0.0000
7K78     Antibody And Nucleosome Complex               Ruifang           3.10 2020-09-22   0.0000
4KUD     Crystal Structure Of N-Terminal Acetylate ... Yang              3.20 2013-05-22   0.0000
6GEJ     Chromatin Remodeller-Nucleosome Complex A ... Willhoft          0.00 2018-04-26   0.0000
5BT1     Histone Chaperone Hif1 Playing With Histo ... Liu               2.62 2015-06-02   0.0000
2JSS     NMR Structure Of Chaperone Chz1 Complexed ... Zhou                   2007-07-11   0.0000
6AE8     Structure Insight Into Histone Chaperone  ... Wang              1.65 2018-08-03   0.0000
4M6B     Crystal Structure Of Yeast Swr1-Z Domain  ... Hong              1.78 2013-08-09   0.0000
7DLX     Crystal Structure Of H2am4>Z-H2b              Dai               2.40 2020-11-30   0.0000
6UPH     Structure Of A Yeast Centromeric Nucleoso ... Migl              0.00 2019-10-17   0.0000
6BIZ     Hla-Drb1 In Complex With Citrullinated Hi ... Ting              2.10 2017-11-03   0.0047
6BIY     Hla-Drb1 In Complex With Histone 2b Peptide   Ting              2.05 2017-11-03   0.0880
1RFZ     Structure Of Protein Of Unknown Function  ... Kim               2.80 2003-11-10   3.3000
2RP5     Solution Structure Of Oligomerization Dom ... Ou                     2008-05-01   7.1000

OCA© by Jaime Prilusky, 1996-2013,2015,2021
Bioinformatics Unit
Weizmann Institute of Science