# OCA database search on: Fri Aug 12 23:51:48 2022
# Query: ev=10.000&ex=any&fa=TAGERYNKVIDIWAAANDRVSKAMMDNLQT&m=du
# Hits: 211 (search time 3 sec)
6VZ3     Escherichia Coli Transcription-Translatio ... Molodtsov         8.90 2020-02-27   0.0000
6VYS     Escherichia Coli Transcription-Translatio ... Molodtsov         3.70 2020-02-27   0.0000
6N4C     Em Structure Of DNA Wrapping In Bacterial ... Florez-Ariza      17.00 2018-11-19   0.0000
6VZ7     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-02-27   0.0000
7MKP     Escherichia Coli RNA Polymerase Core Enzyme   Qayyum            0.00 2021-04-26   0.0000
7MKQ     Escherichia Coli RNA Polymerase And Rapa  ... Qayyum            0.00 2021-04-26   0.0000
7MKN     Escherichia Coli RNA Polymerase And Rapa  ... Qayyum            0.00 2021-04-26   0.0000
7MKO     Escherichia Coli RNA Polymerase Elongatio ... Qayyum            0.00 2021-04-26   0.0000
6AWC     Structure Of 30s Ribosomal Subunit And RN ... Demo              7.90 2017-09-05   0.0000
6AWB     Structure Of 30s Ribosomal Subunit And RN ... Demo              6.70 2017-09-05   0.0000
6AWD     Structure Of 30s (S1 Depleted) Ribosomal  ... Demo              8.10 2017-09-05   0.0000
4YLN     E. Coli Transcription Initiation Complex  ... Zuo               5.50 2015-03-05   0.0000
4JK2     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.20 2013-03-09   0.0000
4LK0     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.91 2013-07-05   0.0000
4LK1     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.84 2013-07-05   0.0000
5UAC     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         3.80 2016-12-19   0.0000
4YLO     E. Coli Transcription Initiation Complex  ... Zuo               6.00 2015-03-05   0.0000
4LJZ     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.59 2013-07-05   0.0000
4YLP     E. Coli Transcription Initiation Complex  ... Zuo               5.50 2015-03-05   0.0000
6C9Y     Cryo-Em Structure Of E. Coli Rnap Sigma70 ... Narayanan         4.25 2018-01-29   0.0000
5BYH     Crystal Structure Of Escherichia Coli RNA ... Zhang             3.76 2015-06-10   0.0000
5VT0     Escherichia Coli 6s RNA Derivative In Com ... Chen              3.78 2017-05-15   0.0000
4MEX     Crystal Structure Of Escherichia Coli RNA ... Feng              3.90 2013-08-27   0.0000
4MEY     Crystal Structure Of Escherichia Coli RNA ... Feng              3.95 2013-08-27   0.0000
5W1S     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.81 2017-06-04   0.0000
5VSW     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.29 2017-05-12   0.0000
6PB6     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.29 2019-06-13   0.0000
4LLG     Crystal Structure Analysis Of E.Coli Holo ... Bae               3.79 2013-07-09   0.0000
6VYR     Escherichia Coli Transcription-Translatio ... Molodtsov         3.80 2020-02-27   0.0000
7C97     Cryo-Em Structure Of An Escherichia Coli  ... Lin               3.68 2020-06-05   0.0000
6C6U     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2018-01-19   0.0000
6C6T     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2018-01-19   0.0000
6C6S     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2018-01-19   0.0000
6XL5     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
4KMU     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.85 2013-05-08   0.0000
5UAJ     Escherichia Coli RNA Polymerase Rpob S531 ... Molodtsov         3.92 2016-12-19   0.0000
4ZH4     Crystal Structure Of Escherichia Coli RNA ... Feng              3.99 2015-04-24   0.0000
6ALH     Cryoem Structure Of E.Coli RNA Polymerase ... Kang              0.00 2017-08-07   0.0000
7D7C     Cryoem Structure Of Gp55-Dependent RNA Po ... Shi               3.60 2020-10-03   0.0000
4XSZ     Crystal Structure Of Cbr 9393 Bound To Es ... Bae               3.68 2015-01-22   0.0000
4XSY     Crystal Structure Of Cbr 9379 Bound To Es ... Bae               4.01 2015-01-22   0.0000
4XSX     Crystal Structure Of Cbr 703 Bound To Esc ... Bae               3.71 2015-01-22   0.0000
6B6H     The Cryo-Em Structure Of A Bacterial Clas ... Liu               3.90 2017-10-02   0.0000
4YG2     X-Ray Crystal Structur Of Escherichia Col ... Murakami          3.70 2015-02-25   0.0000
4YFX     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.84 2015-02-25   0.0000
5NWT     Crystal Structure Of Escherichia Coli RNA ... Zhang             3.76 2017-05-08   0.0000
6VYX     Escherichia Coli Transcription-Translatio ... Molodtsov         9.90 2020-02-27   0.0000
6ALG     Cryoem Structure Of Hk022 Nun - E.Coli RN ... Kang              0.00 2017-08-07   0.0000
6PMI     Sigm28-Transcription Initiation Complex W ... Liu               3.86 2019-07-02   0.0000
4YFN     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.82 2015-02-25   0.0000
6X26     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-20   0.0000
5UAQ     Escherichia Coli RNA Polymerase Rpob H526 ... Molodtsov         3.60 2016-12-19   0.0000
5UAL     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         3.89 2016-12-19   0.0000
6X2F     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-20   0.0000
6VYW     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-02-27   0.0000
6XL9     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
6XLJ     Cryo-Em Structure Of Ecmrr-Rnap-Promoter  ... Yang              0.00 2020-06-28   0.0000
6XLL     Cryo-Em Structure Of E. Coli Rnap-Promote ... Yang              0.00 2020-06-28   0.0000
6XLM     Cryo-Em Structure Of E.Coli Rnap-DNA Elon ... Yang              0.00 2020-06-28   0.0000
6XLN     Cryo-Em Structure Of E. Coli Rnap-DNA Elo ... Yang              0.00 2020-06-28   0.0000
6UTZ     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.80 2019-10-30   0.0000
6UU0     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.90 2019-10-30   0.0000
6BJS     Cryoem Structure Of E.Coli His Pause Elon ... Kang              0.00 2017-11-06   0.0000
6RIP     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.40 2019-04-24   0.0000
6UU4     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.30 2019-10-30   0.0000
6UU5     E. Coli Sigma-S Transcription Initiation  ... Zuo               5.40 2019-10-30   0.0000
6RIN     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.70 2019-04-24   0.0000
4KN7     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.69 2013-05-08   0.0000
4KN4     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.96 2013-05-08   0.0000
6VU3     Cryo-Em Structure Of Escherichia Coli Tra ... Molodtsov         3.70 2020-02-14   0.0000
6VYQ     Escherichia Coli Transcription-Translatio ... Molodtsov         3.70 2020-02-27   0.0000
6R9G     Structural Basis Of Transcription Inhibit ... Ye                0.00 2019-04-03   0.0000
3LU0     Molecular Model Of Escherichia Coli Core  ... Darst             11.20 2010-02-16   0.0000
6ALF     Cryoem Structure Of Crosslinked E.Coli RN ... Kang              0.00 2017-08-07   0.0000
6XDR     Escherichia Coli Transcription-Translatio ... Molodtsov         4.70 2020-06-11   0.0000
4ZH2     Crystal Structure Of Escherichia Coli RNA ... Feng              4.20 2015-04-24   0.0000
6ZTJ     E. Coli 70s-Rnap Expressome Complex In Nu ... Webster           0.00 2020-07-20   0.0000
6X7F     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.50 2020-05-29   0.0000
6VJS     Escherichia Coli RNA Polymerase And Ureid ... Murakami          4.02 2020-01-17   0.0000
6UU7     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.40 2019-10-30   0.0000
6K4Y     Cryoem Structure Of Sigma Appropriation C ... Shi               3.79 2019-05-27   0.0000
6X2N     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-20   0.0000
6X7K     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.10 2020-05-30   0.0000
6X4W     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-24   0.0000
6FLQ     Cryoem Structure Of E.Coli RNA Polymerase ... Guo               4.10 2018-01-26   0.0000
6X50     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewelyn          0.00 2020-05-24   0.0000
5TBZ     E. Coli RNA Polymerase Complexed With Nusg    Liu               7.00 2016-09-13   0.0000
6X9Q     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         4.80 2020-06-03   0.0000
6FLP     Cryoem Structure Of E.Coli RNA Polymerase ... Guo               0.00 2018-01-26   0.0000
6XIJ     Escherichia Coli Transcription-Translatio ... Molodtsov         8.00 2020-06-20   0.0000
5W1T     X-Ray Crystal Structure Of Escherichia Co ... Murakami          4.50 2017-06-04   0.0000
7KHC     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-20   0.0000
6PB4     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.35 2019-06-13   0.0000
5UAH     Escherichia Coli RNA Polymerase And Rifam ... Molodtsov         4.10 2016-12-19   0.0000
5UAG     Escherichia Coli RNA Polymerase Mutant -  ... Molodtsov         3.40 2016-12-19   0.0000
6X4Y     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-24   0.0000
6CUX     Escherichia Coli Rpob S531l Mutant RNA Po ... Molodtsov         4.10 2018-03-26   0.0000
6ZU1     E. Coli 70s-Rnap Expressome Complex In Un ... Webster           0.00 2020-07-21   0.0000
6XH7     Cuer-Tac Without RNA                          Liu               3.90 2020-06-18   0.0000
5MY1     E. Coli Expressome                            Kohler            7.60 2017-01-25   0.0000
6VZJ     Escherichia Coli Transcription-Translatio ... Molodtsov         4.10 2020-02-28   0.0000
6ZTO     E. Coli 70s-Rnap Expressome Complex In Un ... Webster           0.00 2020-07-20   0.0000
4JK1     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.90 2013-03-09   0.0000
6VYZ     Escherichia Coli Transcription-Translatio ... Molodtsov         9.90 2020-02-27   0.0000
6ZTP     E. Coli 70s-Rnap Expressome Complex In Un ... Webster           0.00 2020-07-20   0.0000
6BYU     X-Ray Crystal Structure Of Escherichia Co ... Murakami          3.60 2017-12-21   0.0000
5EZK     RNA Polymerase Model Placed By Molecular  ... Darbari           8.50 2015-11-26   0.0000
6XII     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-06-20   0.0000
6UU1     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.10 2019-10-30   0.0000
6R9B     Cryo-Em Structure Of Bacterial Rnap With  ... Ye                0.00 2019-04-03   0.0000
6UU6     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.20 2019-10-30   0.0000
7CHW     Cryo-Em Structure Of An Escherichia Coli  ... Lin               3.58 2020-07-06   0.0000
6OMF     Cryoem Structure Of Sigmas-Transcription  ... Jaramillo Car ... 3.26 2019-04-18   0.0000
7KHE     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-21   0.0000
6UUA     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.00 2019-10-30   0.0000
6UUB     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.96 2019-10-30   0.0000
4ZH3     Crystal Structure Of Escherichia Coli RNA ... Feng              4.08 2015-04-24   0.0000
6VYT     Escherichia Coli Transcription-Translatio ... Molodtsov         14.00 2020-02-27   0.0000
6UU9     E. Coli Mutant Sigma-S Transcription Init ... Zuo               5.40 2019-10-30   0.0000
6ZTM     E. Coli 70s-Rnap Expressome Complex In Co ... Webster           0.00 2020-07-20   0.0000
6VYU     Escherichia Coli Transcription-Translatio ... Molodtsov         7.00 2020-02-27   0.0000
6UTV     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.45 2019-10-30   0.0000
6PMJ     Sigm28-Transcription Initiation Complex W ... Liu               3.91 2019-07-02   0.0000
6UU8     E. Coli Mutant Sigma-S Transcription Init ... Zuo               4.40 2019-10-30   0.0000
6ZTL     E. Coli 70s-Rnap Expressome Complex In Co ... Webster           0.00 2020-07-20   0.0000
6GH6     Cryo-Em Structure Of Bacterial RNA Polyme ... Glyde             0.00 2018-05-04   0.0000
6GH5     Cryo-Em Structure Of Bacterial RNA Polyme ... Glyde             3.40 2018-05-04   0.0000
5UI8     Structure Of Sigman-Holoenzyme                Darst             3.76 2017-01-13   0.0000
6ASX     Cryoem Structure Of E.Coli His Pause Elon ... Kang              0.00 2017-08-25   0.0000
6X6T     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.20 2020-05-29   0.0000
5IPN     Sigmas-Transcription Initiation Complex W ... Liu               4.61 2016-03-09   0.0000
5IPM     Sigmas-Transcription Initiation Complex W ... Liu               4.20 2016-03-09   0.0000
5IPL     Sigmas-Transcription Initiation Complex W ... Liu               3.60 2016-03-09   0.0000
4YFK     Escherichia Coli RNA Polymerase In Comple ... Molodtsov         3.57 2015-02-25   0.0000
6RI9     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.70 2019-04-23   0.0000
6PB5     The E. Coli Class-II Cap-Dependent Transc ... Liu               4.52 2019-06-13   0.0000
6RH3     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.60 2019-04-18   0.0000
6GFW     Cryo-Em Structure Of Bacterial RNA Polyme ... Glyde             3.70 2018-05-02   0.0000
6XDQ     Cryo-Em Structure Of An Escherichia Coli  ... Molodtsov         3.70 2020-06-11   0.0000
6UU3     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.00 2019-10-30   0.0000
6UTY     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.15 2019-10-30   0.0000
6UU2     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.40 2019-10-30   0.0000
6VYY     Escherichia Coli Transcription-Translatio ... Molodtsov         9.90 2020-02-27   0.0000
6CA0     Cryo-Em Structure Of E. Coli Rnap Sigma70 ... Narayanan         5.75 2018-01-29   0.0000
6JNX     Cryo-Em Structure Of A Q-Engaged Arrested ... Feng              4.08 2019-03-18   0.0000
6VZ5     Escherichia Coli Transcription-Translatio ... Molodtsov         8.90 2020-02-27   0.0000
7KHB     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-20   0.0000
6UTX     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.05 2019-10-30   0.0000
6UTW     E. Coli Sigma-S Transcription Initiation  ... Zuo               3.85 2019-10-30   0.0000
6X43     Mfd-Bound E.Coli RNA Polymerase Elongatio ... Llewellyn         0.00 2020-05-22   0.0000
6XGF     Escherichia Coli Transcription-Translatio ... Molodtsov         5.00 2020-06-17   0.0000
6XH8     Cuer-Transcription Activation Complex Wit ... Liu               4.10 2020-06-18   0.0000
6RI7     Cryo-Em Structure Of E. Coli RNA Polymera ... Abdelkareem       3.90 2019-04-23   0.0000
6UUC     E. Coli Sigma-S Transcription Initiation  ... Zuo               4.10 2019-10-30   0.0000
7D7D     Cryoem Structure Of Gp45-Dependent Transc ... Shi               4.50 2020-10-03   0.0000
6ZTN     E. Coli 70s-Rnap Expressome Complex In Nu ... Webster           0.00 2020-07-20   0.0000
5NSR     Cryo-Em Structure Of RNA Polymerase-Sigma ... Glyde             0.00 2017-04-26   0.0000
6VZ2     Escherichia Coli Transcription-Translatio ... Molodtsov         10.00 2020-02-27   0.0000
7KHI     Escherichia Coli RNA Polymerase And Rrnbp ... Shin              0.00 2020-10-21   0.0000
6N60     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.68 2018-11-23   0.0000
6N62     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.80 2018-11-24   0.0000
6N61     Escherichia Coli RNA Polymerase Sigma70-H ... Braffman          3.25 2018-11-24   0.0000
3IYD     Three-Dimensional Em Structure Of An Inta ... Hudson            19.80 2009-08-01   0.0000
7ADE     Transcription Termination Complex Iva         Said              0.00 2020-09-14   0.0000
6Z9R     Transcription Termination Intermediate Co ... Said              4.10 2020-06-04   0.0000
4S20     Structural Basis For Transcription Reacti ... Liu               4.70 2015-01-16   0.0000
6XAS     Cryoem Structure Of E. Coli Rho-Dependent ... Hao               0.00 2020-06-04   0.0000
6XAV     Cryoem Structure Of E. Coli Rho-Dependent ... Hao               0.00 2020-06-04   0.0000
6KJ6     Cryo-Em Structure Of Escherichia Coli Crl ... Xu                3.80 2019-07-21   0.0000
7C17     The Cryo-Em Structure Of E. Coli Cuer Tra ... Fang              4.22 2020-05-02   0.0000
4JKR     Crystal Structure Of E. Coli RNA Polymera ... Zuo               4.20 2013-03-11   0.0000
7ADD     Transcription Termination Intermediate Co ... Said              0.00 2020-09-14   0.0000
6Z9S     Transcription Termination Intermediate Co ... Said              4.40 2020-06-04   0.0000
6Z9Q     Transcription Termination Intermediate Co ... Said              5.70 2020-06-04   0.0000
6LDI     The Cryo-Em Structure Of E. Coli Cuer Tra ... Fang              3.69 2019-11-21   0.0000
6Z9T     Transcription Termination Intermediate Co ... Said              4.10 2020-06-04   0.0000
7ADB     Transcription Termination Intermediate Co ... Said              0.00 2020-09-14   0.0000
5MS0     Pseudo-Atomic Model Of RNA Polymerase Lam ... Said              9.80 2016-12-29   0.0000
6Z9P     Transcription Termination Intermediate Co ... Said              3.90 2020-06-04   0.0000
7ADC     Transcription Termination Intermediate Co ... Said              0.00 2020-09-14   0.0000
6JBQ     Cryoem Structure Of Escherichia Coli Sigm ... Fang              4.02 2019-01-26   0.0000
6TQO     Rrn Anti-Termination Complex                  Huang             0.00 2019-12-17   0.0000
6TQN     Rrn Anti-Termination Complex Without S4       Huang             0.00 2019-12-17   0.0000
6GOV     Structure Of RNA Polymerase Lambda-Based  ... Loll              3.70 2018-06-04   0.0000
6PST     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.00 2019-07-13   0.0000
6N58     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              0.00 2018-11-21   0.0000
6N57     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              0.00 2018-11-21   0.0000
6PSR     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.40 2019-07-13   0.0000
6PSV     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.50 2019-07-13   0.0000
6P1K     Cryo-Em Structure Of Escherichia Coli Sig ... Chen              0.00 2019-05-20   0.0000
6PSS     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.50 2019-07-13   0.0000
6WMU     E. Coli Rnaps70-Sspa-Gada DNA Complex         Travis            0.00 2020-04-21   0.0000
6PSW     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.70 2019-07-13   0.0000
6P18     Q21 Transcription Antitermination Complex ... Yin               0.00 2019-05-19   0.0000
6P19     Q21 Transcription Antitermination Complex ... Yin               3.80 2019-05-19   0.0000
6PSQ     Escherichia Coli RNA Polymerase Closed Co ... Chen              3.40 2019-07-13   0.0000
6PSU     Escherichia Coli RNA Polymerase Promoter  ... Chen              3.90 2019-07-13   0.0000
6OUL     Cryo-Em Structure Of Escherichia Coli Rna ... Chen              3.40 2019-05-04   0.0000
5NSS     Cryo-Em Structure Of RNA Polymerase-Sigma ... Glyde             0.00 2017-04-26   0.0000
6J9F     Cryo-Em Structure Of Xanthomonos Oryzae T ... You               3.95 2019-01-22   0.0000
6J9E     Cryo-Em Structure Of Xanthomonos Oryzae T ... You               3.41 2019-01-22   0.0000
6WMR     F. Tularensis Rnaps70-(Mgla-Sspa)-Igla DN ... Travis            0.00 2020-04-21   0.1100
6WMT     F. Tularensis Rnaps70-(Mgla-Sspa)-Ppgpp-P ... Travis            4.43 2020-04-21   0.1300
6WMP     F. Tularensis Rnaps70-Igla DNA Complex        Travis            2.98 2020-04-21   0.1300
6ZFB     Structure Of B. Subtilis RNA Polymerase I ... Pei               0.00 2020-06-17   2.1000
7CKQ     The Cryo-Em Structure Of B. Subtilis Bmrr ... Fang              4.40 2020-07-18   2.1000
6ZCA     Structure Of B. Subtilis RNA Polymerase I ... Pei               4.20 2020-06-10   2.1000
6WVJ     Cryo-Em Structure Of Bacillus Subtilis RN ... Newing            3.36 2020-05-06   2.1000
6WVK     Cryo-Em Structure Of Bacillus Subtilis RN ... Newing            0.00 2020-05-06   2.1000
1I6V     Thermus Aquaticus Core RNA Polymerase-Rif ... Campbell          3.30 2001-03-05   5.9000
1HQM     Crystal Structure Of Thermus Aquaticus Co ... Minakhin          3.30 2000-12-18   5.9000

OCA© by Jaime Prilusky, 1996-2013,2015,2021
Bioinformatics Unit
Weizmann Institute of Science