data_108L
# 
_entry.id   108L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   108L         
WWPDB D_1000170021 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        108L 
_pdbx_database_status.recvd_initial_deposition_date   1992-12-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blaber, M.'     1 
'Matthews, B.W.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis of amino acid alpha helix propensity.'                     Science     260 1637 1640 1993 SCIEAS US 
0036-8075 0038 ? 8503008 ? 
1       'Control of Enzyme Activity by an Engineered Disulfide Bond'                 Science     243 792  ?    1989 SCIEAS US 
0036-8075 0038 ? ?       ? 
2       'Structure of Bacteriophage T4 Lysozyme Refined at 1.7 Angstroms Resolution' J.Mol.Biol. 193 189  ?    1987 JMOBAK UK 
0022-2836 0070 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blaber, M.'     1 
primary 'Zhang, X.J.'    2 
primary 'Matthews, B.W.' 3 
1       'Matsumura, M.'  4 
1       'Matthews, B.W.' 5 
2       'Weaver, L.H.'   6 
2       'Matthews, B.W.' 7 
# 
_cell.entry_id           108L 
_cell.length_a           61.000 
_cell.length_b           61.000 
_cell.length_c           96.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         108L 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'T4 LYSOZYME'        18654.443 1   3.2.1.17 ? ? ? 
2 non-polymer syn 'CHLORIDE ION'       35.453    2   ?        ? ? ? 
3 non-polymer syn BETA-MERCAPTOETHANOL 78.133    2   ?        ? ? ? 
4 water       nat water                18.015    170 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKIELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKIELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   ILE n 
1 4   PHE n 
1 5   GLU n 
1 6   MET n 
1 7   LEU n 
1 8   ARG n 
1 9   ILE n 
1 10  ASP n 
1 11  GLU n 
1 12  GLY n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  LYS n 
1 17  ILE n 
1 18  TYR n 
1 19  LYS n 
1 20  ASP n 
1 21  THR n 
1 22  GLU n 
1 23  GLY n 
1 24  TYR n 
1 25  TYR n 
1 26  THR n 
1 27  ILE n 
1 28  GLY n 
1 29  ILE n 
1 30  GLY n 
1 31  HIS n 
1 32  LEU n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  SER n 
1 37  PRO n 
1 38  SER n 
1 39  LEU n 
1 40  ASN n 
1 41  ALA n 
1 42  ALA n 
1 43  LYS n 
1 44  ILE n 
1 45  GLU n 
1 46  LEU n 
1 47  ASP n 
1 48  LYS n 
1 49  ALA n 
1 50  ILE n 
1 51  GLY n 
1 52  ARG n 
1 53  ASN n 
1 54  THR n 
1 55  ASN n 
1 56  GLY n 
1 57  VAL n 
1 58  ILE n 
1 59  THR n 
1 60  LYS n 
1 61  ASP n 
1 62  GLU n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  LEU n 
1 67  PHE n 
1 68  ASN n 
1 69  GLN n 
1 70  ASP n 
1 71  VAL n 
1 72  ASP n 
1 73  ALA n 
1 74  ALA n 
1 75  VAL n 
1 76  ARG n 
1 77  GLY n 
1 78  ILE n 
1 79  LEU n 
1 80  ARG n 
1 81  ASN n 
1 82  ALA n 
1 83  LYS n 
1 84  LEU n 
1 85  LYS n 
1 86  PRO n 
1 87  VAL n 
1 88  TYR n 
1 89  ASP n 
1 90  SER n 
1 91  LEU n 
1 92  ASP n 
1 93  ALA n 
1 94  VAL n 
1 95  ARG n 
1 96  ARG n 
1 97  ALA n 
1 98  ALA n 
1 99  LEU n 
1 100 ILE n 
1 101 ASN n 
1 102 MET n 
1 103 VAL n 
1 104 PHE n 
1 105 GLN n 
1 106 MET n 
1 107 GLY n 
1 108 GLU n 
1 109 THR n 
1 110 GLY n 
1 111 VAL n 
1 112 ALA n 
1 113 GLY n 
1 114 PHE n 
1 115 THR n 
1 116 ASN n 
1 117 SER n 
1 118 LEU n 
1 119 ARG n 
1 120 MET n 
1 121 LEU n 
1 122 GLN n 
1 123 GLN n 
1 124 LYS n 
1 125 ARG n 
1 126 TRP n 
1 127 ASP n 
1 128 GLU n 
1 129 ALA n 
1 130 ALA n 
1 131 VAL n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 LYS n 
1 136 SER n 
1 137 ARG n 
1 138 TRP n 
1 139 TYR n 
1 140 ASN n 
1 141 GLN n 
1 142 THR n 
1 143 PRO n 
1 144 ASN n 
1 145 ARG n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 VAL n 
1 150 ILE n 
1 151 THR n 
1 152 THR n 
1 153 PHE n 
1 154 ARG n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 TRP n 
1 159 ASP n 
1 160 ALA n 
1 161 TYR n 
1 162 LYS n 
1 163 ASN n 
1 164 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Enterobacteria phage T4 sensu lato' 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       M13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYCV_BPT4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00720 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              108L 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 164 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00720 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  164 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       164 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 108L ILE A 44 ? UNP P00720 SER 44 CONFLICT 44 1 
1 108L THR A 54 ? UNP P00720 CYS 54 CONFLICT 54 2 
1 108L ALA A 97 ? UNP P00720 CYS 97 CONFLICT 97 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
BME non-polymer         . BETA-MERCAPTOETHANOL ? 'C2 H6 O S'      78.133  
CL  non-polymer         . 'CHLORIDE ION'       ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          108L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.79 
_exptl_crystal.density_percent_sol   55.90 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 108L 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.149 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES
ARE EXTREMELY MOBILE.  THUS THE COORDINATES FOR THESE
RESIDUES ARE VERY UNRELIABLE.  THIS ENTRY DOES NOT INCLUDE
RESIDUES 163 AND 164.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1294 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               1474 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  108L 
_struct.title                     'STRUCTURAL BASIS OF ALPHA-HELIX PROPENSITY AT TWO SITES IN T4 LYSOZYME' 
_struct.pdbx_descriptor           
'LYSOZYME (E.C.3.2.1.17) MUTANT WITH SER 44 REPLACED BY ILE, CYS 54 REPLACED BY THR, CYS 97 REPLACED BY ALA (S44I,C54T, C97A)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        108L 
_struct_keywords.pdbx_keywords   'HYDROLASE(O-GLYCOSYL)' 
_struct_keywords.text            'HYDROLASE(O-GLYCOSYL)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  ILE A 3   ? GLU A 11  ? ILE A 3   GLU A 11  1 ? 9  
HELX_P HELX_P2  H2  LEU A 39  ? ILE A 50  ? LEU A 39  ILE A 50  1 ? 12 
HELX_P HELX_P3  H3  LYS A 60  ? ARG A 80  ? LYS A 60  ARG A 80  1 ? 21 
HELX_P HELX_P4  H4  ALA A 82  ? SER A 90  ? ALA A 82  SER A 90  1 ? 9  
HELX_P HELX_P5  H5  ALA A 93  ? MET A 106 ? ALA A 93  MET A 106 1 ? 14 
HELX_P HELX_P6  H6  GLU A 108 ? GLY A 113 ? GLU A 108 GLY A 113 1 ? 6  
HELX_P HELX_P7  H7  THR A 115 ? GLN A 123 ? THR A 115 GLN A 123 1 ? 9  
HELX_P HELX_P8  H8  TRP A 126 ? ALA A 134 ? TRP A 126 ALA A 134 1 ? 9  
HELX_P HELX_P9  H9  ARG A 137 ? GLN A 141 ? ARG A 137 GLN A 141 1 ? 5  
HELX_P HELX_P10 H10 PRO A 143 ? THR A 155 ? PRO A 143 THR A 155 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           D 
_struct_conn.ptnr1_label_comp_id           BME 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           S2 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           E 
_struct_conn.ptnr2_label_comp_id           BME 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           S2 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            BME 
_struct_conn.ptnr1_auth_seq_id             901 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            BME 
_struct_conn.ptnr2_auth_seq_id             902 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.027 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 14 ? LYS A 19 ? ARG A 14 LYS A 19 
A 2 TYR A 25 ? GLY A 28 ? TYR A 25 GLY A 28 
A 3 HIS A 31 ? THR A 34 ? HIS A 31 THR A 34 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 18 ? O TYR A 18 N THR A 26 ? N THR A 26 
A 2 3 O ILE A 27 ? O ILE A 27 N HIS A 31 ? N HIS A 31 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL A 173'  
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 178'  
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BME A 901' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE BME A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 LYS A 124 ? LYS A 124 . ? 4_655 ? 
2  AC1 6 THR A 142 ? THR A 142 . ? 1_555 ? 
3  AC1 6 ASN A 144 ? ASN A 144 . ? 1_555 ? 
4  AC1 6 ARG A 145 ? ARG A 145 . ? 1_555 ? 
5  AC1 6 HOH F .   ? HOH A 209 . ? 1_555 ? 
6  AC1 6 HOH F .   ? HOH A 291 . ? 4_655 ? 
7  AC2 2 LYS A 135 ? LYS A 135 . ? 3_665 ? 
8  AC2 2 HOH F .   ? HOH A 215 . ? 1_555 ? 
9  AC3 2 ASP A 72  ? ASP A 72  . ? 5_555 ? 
10 AC3 2 BME E .   ? BME A 902 . ? 1_555 ? 
11 AC4 5 ASN A 68  ? ASN A 68  . ? 5_555 ? 
12 AC4 5 ALA A 93  ? ALA A 93  . ? 1_555 ? 
13 AC4 5 ILE A 100 ? ILE A 100 . ? 1_555 ? 
14 AC4 5 HOH F .   ? HOH A 195 . ? 1_555 ? 
15 AC4 5 BME D .   ? BME A 901 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          108L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    108L 
_atom_sites.fract_transf_matrix[1][1]   0.016393 
_atom_sites.fract_transf_matrix[1][2]   0.009465 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018930 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010320 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 
;RESIDUES 162 - 164 IN WILD-TYPE AND ALL MUTANT LYSOZYMES ARE EXTREMELY MOBILE.  THUS THE COORDINATES FOR THESE RESIDUES ARE VERY UNRELIABLE.  THIS ENTRY DOES NOT INCLUDE RESIDUES 163 AND 164.
;
2 'SEO 901 FORMS AN S-S LINKAGE TO SEO 902.' 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 44.088 -3.177 8.889   1.00 22.99 ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 43.657 -1.806 9.001   1.00 14.62 ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 42.241 -1.917 9.550   1.00 17.70 ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 41.580 -2.945 9.352   1.00 16.63 ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 43.721 -1.211 7.582   1.00 16.05 ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 43.035 0.106  7.470   1.00 35.22 ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 44.097 1.486  7.902   1.00 34.46 ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 45.665 0.894  7.273   1.00 36.57 ? 1   MET A CE  1 
ATOM   9    N  N   . ASN A 1 2   ? 41.807 -0.907 10.263  1.00 12.70 ? 2   ASN A N   1 
ATOM   10   C  CA  . ASN A 1 2   ? 40.451 -0.846 10.828  1.00 10.76 ? 2   ASN A CA  1 
ATOM   11   C  C   . ASN A 1 2   ? 40.000 0.635  10.891  1.00 13.60 ? 2   ASN A C   1 
ATOM   12   O  O   . ASN A 1 2   ? 40.790 1.498  10.642  1.00 12.71 ? 2   ASN A O   1 
ATOM   13   C  CB  . ASN A 1 2   ? 40.362 -1.592 12.205  1.00 10.04 ? 2   ASN A CB  1 
ATOM   14   C  CG  . ASN A 1 2   ? 41.290 -0.991 13.210  1.00 17.83 ? 2   ASN A CG  1 
ATOM   15   O  OD1 . ASN A 1 2   ? 41.270 0.235  13.424  1.00 17.26 ? 2   ASN A OD1 1 
ATOM   16   N  ND2 . ASN A 1 2   ? 42.139 -1.835 13.786  1.00 15.92 ? 2   ASN A ND2 1 
ATOM   17   N  N   . ILE A 1 3   ? 38.755 0.923  11.234  1.00 8.33  ? 3   ILE A N   1 
ATOM   18   C  CA  . ILE A 1 3   ? 38.229 2.270  11.277  1.00 12.96 ? 3   ILE A CA  1 
ATOM   19   C  C   . ILE A 1 3   ? 39.077 3.216  12.123  1.00 20.03 ? 3   ILE A C   1 
ATOM   20   O  O   . ILE A 1 3   ? 39.248 4.393  11.782  1.00 11.48 ? 3   ILE A O   1 
ATOM   21   C  CB  . ILE A 1 3   ? 36.724 2.280  11.622  1.00 10.39 ? 3   ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 3   ? 36.125 3.692  11.498  1.00 12.96 ? 3   ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 3   ? 36.499 1.735  13.062  1.00 7.97  ? 3   ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 3   ? 36.341 4.409  10.145  1.00 11.68 ? 3   ILE A CD1 1 
ATOM   25   N  N   . PHE A 1 4   ? 39.594 2.741  13.269  1.00 10.42 ? 4   PHE A N   1 
ATOM   26   C  CA  . PHE A 1 4   ? 40.403 3.605  14.130  1.00 11.76 ? 4   PHE A CA  1 
ATOM   27   C  C   . PHE A 1 4   ? 41.711 3.983  13.463  1.00 12.71 ? 4   PHE A C   1 
ATOM   28   O  O   . PHE A 1 4   ? 42.097 5.151  13.453  1.00 13.58 ? 4   PHE A O   1 
ATOM   29   C  CB  . PHE A 1 4   ? 40.680 2.964  15.504  1.00 10.43 ? 4   PHE A CB  1 
ATOM   30   C  CG  . PHE A 1 4   ? 39.404 2.873  16.327  1.00 14.02 ? 4   PHE A CG  1 
ATOM   31   C  CD1 . PHE A 1 4   ? 38.582 1.736  16.261  1.00 11.12 ? 4   PHE A CD1 1 
ATOM   32   C  CD2 . PHE A 1 4   ? 39.040 3.923  17.185  1.00 18.65 ? 4   PHE A CD2 1 
ATOM   33   C  CE1 . PHE A 1 4   ? 37.423 1.673  17.044  1.00 14.49 ? 4   PHE A CE1 1 
ATOM   34   C  CE2 . PHE A 1 4   ? 37.887 3.857  17.972  1.00 14.81 ? 4   PHE A CE2 1 
ATOM   35   C  CZ  . PHE A 1 4   ? 37.074 2.728  17.894  1.00 12.39 ? 4   PHE A CZ  1 
ATOM   36   N  N   . GLU A 1 5   ? 42.411 3.003  12.910  1.00 11.45 ? 5   GLU A N   1 
ATOM   37   C  CA  . GLU A 1 5   ? 43.669 3.297  12.214  1.00 13.21 ? 5   GLU A CA  1 
ATOM   38   C  C   . GLU A 1 5   ? 43.442 4.163  10.994  1.00 18.56 ? 5   GLU A C   1 
ATOM   39   O  O   . GLU A 1 5   ? 44.231 5.008  10.667  1.00 15.35 ? 5   GLU A O   1 
ATOM   40   C  CB  . GLU A 1 5   ? 44.359 2.033  11.754  1.00 9.33  ? 5   GLU A CB  1 
ATOM   41   C  CG  . GLU A 1 5   ? 44.671 1.117  12.959  1.00 12.75 ? 5   GLU A CG  1 
ATOM   42   C  CD  . GLU A 1 5   ? 45.236 -0.206 12.483  1.00 33.98 ? 5   GLU A CD  1 
ATOM   43   O  OE1 . GLU A 1 5   ? 45.384 -0.472 11.312  1.00 49.26 ? 5   GLU A OE1 1 
ATOM   44   O  OE2 . GLU A 1 5   ? 45.592 -1.021 13.443  1.00 39.20 ? 5   GLU A OE2 1 
ATOM   45   N  N   . MET A 1 6   ? 42.318 3.993  10.341  1.00 13.59 ? 6   MET A N   1 
ATOM   46   C  CA  . MET A 1 6   ? 42.019 4.783  9.167   1.00 10.46 ? 6   MET A CA  1 
ATOM   47   C  C   . MET A 1 6   ? 41.839 6.241  9.539   1.00 11.72 ? 6   MET A C   1 
ATOM   48   O  O   . MET A 1 6   ? 42.409 7.178  8.926   1.00 13.33 ? 6   MET A O   1 
ATOM   49   C  CB  . MET A 1 6   ? 40.721 4.228  8.534   1.00 9.30  ? 6   MET A CB  1 
ATOM   50   C  CG  . MET A 1 6   ? 40.307 4.878  7.201   1.00 9.18  ? 6   MET A CG  1 
ATOM   51   S  SD  . MET A 1 6   ? 38.557 4.546  6.889   1.00 13.73 ? 6   MET A SD  1 
ATOM   52   C  CE  . MET A 1 6   ? 38.476 4.522  5.071   1.00 15.52 ? 6   MET A CE  1 
ATOM   53   N  N   . LEU A 1 7   ? 40.964 6.483  10.491  1.00 12.35 ? 7   LEU A N   1 
ATOM   54   C  CA  . LEU A 1 7   ? 40.719 7.875  10.905  1.00 13.23 ? 7   LEU A CA  1 
ATOM   55   C  C   . LEU A 1 7   ? 41.943 8.536  11.579  1.00 17.37 ? 7   LEU A C   1 
ATOM   56   O  O   . LEU A 1 7   ? 42.137 9.732  11.534  1.00 14.37 ? 7   LEU A O   1 
ATOM   57   C  CB  . LEU A 1 7   ? 39.511 7.949  11.835  1.00 13.05 ? 7   LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 7   ? 38.209 7.875  11.067  1.00 10.70 ? 7   LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 7   ? 37.089 7.572  12.041  1.00 13.19 ? 7   LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 7   ? 37.972 9.212  10.342  1.00 11.15 ? 7   LEU A CD2 1 
ATOM   61   N  N   . ARG A 1 8   ? 42.773 7.754  12.239  1.00 10.76 ? 8   ARG A N   1 
ATOM   62   C  CA  . ARG A 1 8   ? 43.970 8.337  12.855  1.00 10.17 ? 8   ARG A CA  1 
ATOM   63   C  C   . ARG A 1 8   ? 44.911 8.862  11.771  1.00 14.27 ? 8   ARG A C   1 
ATOM   64   O  O   . ARG A 1 8   ? 45.568 9.861  11.949  1.00 19.80 ? 8   ARG A O   1 
ATOM   65   C  CB  . ARG A 1 8   ? 44.665 7.288  13.655  1.00 15.98 ? 8   ARG A CB  1 
ATOM   66   C  CG  . ARG A 1 8   ? 46.039 7.725  14.043  1.00 23.43 ? 8   ARG A CG  1 
ATOM   67   C  CD  . ARG A 1 8   ? 46.051 8.646  15.255  1.00 33.65 ? 8   ARG A CD  1 
ATOM   68   N  NE  . ARG A 1 8   ? 47.403 9.086  15.597  1.00 35.20 ? 8   ARG A NE  1 
ATOM   69   C  CZ  . ARG A 1 8   ? 48.230 9.778  14.768  1.00 48.91 ? 8   ARG A CZ  1 
ATOM   70   N  NH1 . ARG A 1 8   ? 47.908 10.148 13.505  1.00 28.76 ? 8   ARG A NH1 1 
ATOM   71   N  NH2 . ARG A 1 8   ? 49.443 10.110 15.234  1.00 45.05 ? 8   ARG A NH2 1 
ATOM   72   N  N   . ILE A 1 9   ? 44.952 8.185  10.610  1.00 12.73 ? 9   ILE A N   1 
ATOM   73   C  CA  . ILE A 1 9   ? 45.754 8.613  9.489   1.00 11.97 ? 9   ILE A CA  1 
ATOM   74   C  C   . ILE A 1 9   ? 45.147 9.868  8.869   1.00 17.30 ? 9   ILE A C   1 
ATOM   75   O  O   . ILE A 1 9   ? 45.832 10.858 8.617   1.00 14.22 ? 9   ILE A O   1 
ATOM   76   C  CB  . ILE A 1 9   ? 45.854 7.516  8.432   1.00 15.74 ? 9   ILE A CB  1 
ATOM   77   C  CG1 . ILE A 1 9   ? 46.906 6.465  8.807   1.00 14.21 ? 9   ILE A CG1 1 
ATOM   78   C  CG2 . ILE A 1 9   ? 46.124 8.092  7.044   1.00 13.75 ? 9   ILE A CG2 1 
ATOM   79   C  CD1 . ILE A 1 9   ? 46.586 5.119  8.144   1.00 15.01 ? 9   ILE A CD1 1 
ATOM   80   N  N   . ASP A 1 10  ? 43.817 9.880  8.701   1.00 10.72 ? 10  ASP A N   1 
ATOM   81   C  CA  . ASP A 1 10  ? 43.146 11.031 8.100   1.00 13.01 ? 10  ASP A CA  1 
ATOM   82   C  C   . ASP A 1 10  ? 43.099 12.316 8.949   1.00 16.15 ? 10  ASP A C   1 
ATOM   83   O  O   . ASP A 1 10  ? 43.106 13.419 8.444   1.00 13.68 ? 10  ASP A O   1 
ATOM   84   C  CB  . ASP A 1 10  ? 41.710 10.709 7.611   1.00 8.80  ? 10  ASP A CB  1 
ATOM   85   C  CG  . ASP A 1 10  ? 41.763 9.892  6.329   1.00 12.67 ? 10  ASP A CG  1 
ATOM   86   O  OD1 . ASP A 1 10  ? 42.654 9.991  5.515   1.00 15.35 ? 10  ASP A OD1 1 
ATOM   87   O  OD2 . ASP A 1 10  ? 40.760 9.076  6.183   1.00 14.26 ? 10  ASP A OD2 1 
ATOM   88   N  N   . GLU A 1 11  ? 43.028 12.165 10.257  1.00 15.47 ? 11  GLU A N   1 
ATOM   89   C  CA  . GLU A 1 11  ? 42.836 13.293 11.161  1.00 21.12 ? 11  GLU A CA  1 
ATOM   90   C  C   . GLU A 1 11  ? 44.104 13.713 11.871  1.00 13.79 ? 11  GLU A C   1 
ATOM   91   O  O   . GLU A 1 11  ? 44.245 14.846 12.242  1.00 18.18 ? 11  GLU A O   1 
ATOM   92   C  CB  . GLU A 1 11  ? 41.732 12.915 12.178  1.00 10.31 ? 11  GLU A CB  1 
ATOM   93   C  CG  . GLU A 1 11  ? 40.407 12.605 11.495  1.00 10.09 ? 11  GLU A CG  1 
ATOM   94   C  CD  . GLU A 1 11  ? 39.654 13.819 10.968  1.00 16.84 ? 11  GLU A CD  1 
ATOM   95   O  OE1 . GLU A 1 11  ? 40.250 14.951 11.199  1.00 20.80 ? 11  GLU A OE1 1 
ATOM   96   O  OE2 . GLU A 1 11  ? 38.584 13.762 10.368  1.00 20.51 ? 11  GLU A OE2 1 
ATOM   97   N  N   . GLY A 1 12  ? 45.012 12.796 12.050  1.00 9.31  ? 12  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 12  ? 46.286 13.011 12.737  1.00 12.82 ? 12  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 12  ? 46.021 13.071 14.228  1.00 20.71 ? 12  GLY A C   1 
ATOM   100  O  O   . GLY A 1 12  ? 44.920 12.736 14.713  1.00 17.09 ? 12  GLY A O   1 
ATOM   101  N  N   . LEU A 1 13  ? 47.015 13.515 14.972  1.00 16.47 ? 13  LEU A N   1 
ATOM   102  C  CA  . LEU A 1 13  ? 46.825 13.667 16.412  1.00 19.09 ? 13  LEU A CA  1 
ATOM   103  C  C   . LEU A 1 13  ? 47.511 14.936 16.874  1.00 26.78 ? 13  LEU A C   1 
ATOM   104  O  O   . LEU A 1 13  ? 48.687 15.151 16.622  1.00 25.14 ? 13  LEU A O   1 
ATOM   105  C  CB  . LEU A 1 13  ? 47.391 12.459 17.152  1.00 18.51 ? 13  LEU A CB  1 
ATOM   106  C  CG  . LEU A 1 13  ? 47.590 12.664 18.664  1.00 29.14 ? 13  LEU A CG  1 
ATOM   107  C  CD1 . LEU A 1 13  ? 46.289 12.447 19.385  1.00 31.28 ? 13  LEU A CD1 1 
ATOM   108  C  CD2 . LEU A 1 13  ? 48.557 11.624 19.199  1.00 34.08 ? 13  LEU A CD2 1 
ATOM   109  N  N   . ARG A 1 14  ? 46.769 15.782 17.561  1.00 17.09 ? 14  ARG A N   1 
ATOM   110  C  CA  . ARG A 1 14  ? 47.321 17.014 18.120  1.00 14.45 ? 14  ARG A CA  1 
ATOM   111  C  C   . ARG A 1 14  ? 46.824 17.160 19.549  1.00 19.34 ? 14  ARG A C   1 
ATOM   112  O  O   . ARG A 1 14  ? 45.636 17.036 19.801  1.00 16.31 ? 14  ARG A O   1 
ATOM   113  C  CB  . ARG A 1 14  ? 47.032 18.233 17.267  1.00 19.13 ? 14  ARG A CB  1 
ATOM   114  C  CG  . ARG A 1 14  ? 47.508 17.976 15.833  1.00 31.08 ? 14  ARG A CG  1 
ATOM   115  C  CD  . ARG A 1 14  ? 47.507 19.202 14.906  1.00 35.07 ? 14  ARG A CD  1 
ATOM   116  N  NE  . ARG A 1 14  ? 48.397 20.278 15.340  1.00 42.91 ? 14  ARG A NE  1 
ATOM   117  C  CZ  . ARG A 1 14  ? 48.475 21.499 14.755  1.00 52.71 ? 14  ARG A CZ  1 
ATOM   118  N  NH1 . ARG A 1 14  ? 47.712 21.837 13.705  1.00 39.57 ? 14  ARG A NH1 1 
ATOM   119  N  NH2 . ARG A 1 14  ? 49.351 22.412 15.235  1.00 48.49 ? 14  ARG A NH2 1 
ATOM   120  N  N   . LEU A 1 15  ? 47.742 17.435 20.469  1.00 20.04 ? 15  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 15  ? 47.419 17.562 21.882  1.00 17.06 ? 15  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 15  ? 47.142 18.965 22.387  1.00 25.77 ? 15  LEU A C   1 
ATOM   123  O  O   . LEU A 1 15  ? 46.863 19.118 23.569  1.00 26.02 ? 15  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 15  ? 48.488 16.924 22.775  1.00 22.97 ? 15  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 15  ? 48.766 15.484 22.410  1.00 20.00 ? 15  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 15  ? 49.750 14.931 23.417  1.00 25.60 ? 15  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 15  ? 47.477 14.689 22.476  1.00 20.13 ? 15  LEU A CD2 1 
ATOM   128  N  N   . LYS A 1 16  ? 47.226 19.963 21.515  1.00 17.14 ? 16  LYS A N   1 
ATOM   129  C  CA  . LYS A 1 16  ? 46.984 21.367 21.835  1.00 21.31 ? 16  LYS A CA  1 
ATOM   130  C  C   . LYS A 1 16  ? 45.887 21.852 20.915  1.00 26.51 ? 16  LYS A C   1 
ATOM   131  O  O   . LYS A 1 16  ? 45.769 21.318 19.817  1.00 24.05 ? 16  LYS A O   1 
ATOM   132  C  CB  . LYS A 1 16  ? 48.305 22.163 21.708  1.00 22.88 ? 16  LYS A CB  1 
ATOM   133  C  CG  . LYS A 1 16  ? 48.230 23.681 21.868  1.00 51.20 ? 16  LYS A CG  1 
ATOM   134  C  CD  . LYS A 1 16  ? 48.192 24.207 23.326  1.00 58.39 ? 16  LYS A CD  1 
ATOM   135  C  CE  . LYS A 1 16  ? 46.771 24.605 23.807  1.00 58.58 ? 16  LYS A CE  1 
ATOM   136  N  NZ  . LYS A 1 16  ? 46.403 26.053 23.813  1.00 58.77 ? 16  LYS A NZ  1 
ATOM   137  N  N   . ILE A 1 17  ? 45.006 22.773 21.355  1.00 18.94 ? 17  ILE A N   1 
ATOM   138  C  CA  . ILE A 1 17  ? 43.905 23.250 20.477  1.00 16.48 ? 17  ILE A CA  1 
ATOM   139  C  C   . ILE A 1 17  ? 44.467 23.706 19.144  1.00 24.85 ? 17  ILE A C   1 
ATOM   140  O  O   . ILE A 1 17  ? 45.488 24.369 19.121  1.00 18.84 ? 17  ILE A O   1 
ATOM   141  C  CB  . ILE A 1 17  ? 43.104 24.391 21.138  1.00 13.82 ? 17  ILE A CB  1 
ATOM   142  C  CG1 . ILE A 1 17  ? 42.281 23.776 22.282  1.00 16.41 ? 17  ILE A CG1 1 
ATOM   143  C  CG2 . ILE A 1 17  ? 42.173 25.134 20.176  1.00 15.38 ? 17  ILE A CG2 1 
ATOM   144  C  CD1 . ILE A 1 17  ? 41.621 24.843 23.146  1.00 18.71 ? 17  ILE A CD1 1 
ATOM   145  N  N   . TYR A 1 18  ? 43.799 23.402 18.049  1.00 12.97 ? 18  TYR A N   1 
ATOM   146  C  CA  . TYR A 1 18  ? 44.325 23.832 16.750  1.00 21.07 ? 18  TYR A CA  1 
ATOM   147  C  C   . TYR A 1 18  ? 43.152 24.140 15.859  1.00 17.15 ? 18  TYR A C   1 
ATOM   148  O  O   . TYR A 1 18  ? 42.024 23.863 16.216  1.00 17.72 ? 18  TYR A O   1 
ATOM   149  C  CB  . TYR A 1 18  ? 45.258 22.784 16.105  1.00 17.51 ? 18  TYR A CB  1 
ATOM   150  C  CG  . TYR A 1 18  ? 44.546 21.522 15.708  1.00 25.60 ? 18  TYR A CG  1 
ATOM   151  C  CD1 . TYR A 1 18  ? 44.336 20.474 16.615  1.00 17.63 ? 18  TYR A CD1 1 
ATOM   152  C  CD2 . TYR A 1 18  ? 44.050 21.373 14.411  1.00 27.90 ? 18  TYR A CD2 1 
ATOM   153  C  CE1 . TYR A 1 18  ? 43.657 19.314 16.216  1.00 27.34 ? 18  TYR A CE1 1 
ATOM   154  C  CE2 . TYR A 1 18  ? 43.392 20.210 13.986  1.00 23.68 ? 18  TYR A CE2 1 
ATOM   155  C  CZ  . TYR A 1 18  ? 43.164 19.195 14.910  1.00 23.99 ? 18  TYR A CZ  1 
ATOM   156  O  OH  . TYR A 1 18  ? 42.509 18.071 14.510  1.00 30.00 ? 18  TYR A OH  1 
ATOM   157  N  N   . LYS A 1 19  ? 43.373 24.727 14.708  1.00 15.97 ? 19  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 19  ? 42.281 24.989 13.826  1.00 12.63 ? 19  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 19  ? 42.221 23.928 12.730  1.00 26.51 ? 19  LYS A C   1 
ATOM   160  O  O   . LYS A 1 19  ? 43.261 23.538 12.204  1.00 21.95 ? 19  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 19  ? 42.395 26.349 13.201  1.00 21.48 ? 19  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 19  ? 42.090 27.426 14.170  1.00 19.45 ? 19  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 19  ? 41.806 28.680 13.418  1.00 25.44 ? 19  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 19  ? 42.332 29.905 14.128  1.00 29.33 ? 19  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 19  ? 41.616 31.121 13.761  1.00 45.74 ? 19  LYS A NZ  1 
ATOM   166  N  N   . ASP A 1 20  ? 41.007 23.433 12.411  1.00 20.26 ? 20  ASP A N   1 
ATOM   167  C  CA  . ASP A 1 20  ? 40.880 22.432 11.372  1.00 17.75 ? 20  ASP A CA  1 
ATOM   168  C  C   . ASP A 1 20  ? 41.006 23.075 9.975   1.00 23.52 ? 20  ASP A C   1 
ATOM   169  O  O   . ASP A 1 20  ? 41.329 24.260 9.819   1.00 17.81 ? 20  ASP A O   1 
ATOM   170  C  CB  . ASP A 1 20  ? 39.655 21.532 11.545  1.00 14.48 ? 20  ASP A CB  1 
ATOM   171  C  CG  . ASP A 1 20  ? 38.326 22.161 11.222  1.00 19.28 ? 20  ASP A CG  1 
ATOM   172  O  OD1 . ASP A 1 20  ? 38.397 23.353 10.838  1.00 22.23 ? 20  ASP A OD1 1 
ATOM   173  O  OD2 . ASP A 1 20  ? 37.274 21.644 11.358  1.00 22.45 ? 20  ASP A OD2 1 
ATOM   174  N  N   . THR A 1 21  ? 40.740 22.302 8.943   1.00 23.73 ? 21  THR A N   1 
ATOM   175  C  CA  . THR A 1 21  ? 40.913 22.837 7.582   1.00 19.23 ? 21  THR A CA  1 
ATOM   176  C  C   . THR A 1 21  ? 39.917 23.913 7.271   1.00 34.51 ? 21  THR A C   1 
ATOM   177  O  O   . THR A 1 21  ? 40.187 24.709 6.373   1.00 29.73 ? 21  THR A O   1 
ATOM   178  C  CB  . THR A 1 21  ? 40.835 21.785 6.457   1.00 31.19 ? 21  THR A CB  1 
ATOM   179  O  OG1 . THR A 1 21  ? 39.492 21.428 6.391   1.00 34.16 ? 21  THR A OG1 1 
ATOM   180  C  CG2 . THR A 1 21  ? 41.652 20.524 6.822   1.00 31.17 ? 21  THR A CG2 1 
ATOM   181  N  N   . GLU A 1 22  ? 38.787 23.939 8.023   1.00 22.19 ? 22  GLU A N   1 
ATOM   182  C  CA  . GLU A 1 22  ? 37.735 24.961 7.852   1.00 15.04 ? 22  GLU A CA  1 
ATOM   183  C  C   . GLU A 1 22  ? 37.933 26.204 8.756   1.00 25.43 ? 22  GLU A C   1 
ATOM   184  O  O   . GLU A 1 22  ? 37.212 27.168 8.716   1.00 24.11 ? 22  GLU A O   1 
ATOM   185  C  CB  . GLU A 1 22  ? 36.378 24.350 8.067   1.00 16.23 ? 22  GLU A CB  1 
ATOM   186  C  CG  . GLU A 1 22  ? 36.057 23.220 7.071   1.00 40.00 ? 22  GLU A CG  1 
ATOM   187  C  CD  . GLU A 1 22  ? 35.806 23.721 5.655   1.00 42.88 ? 22  GLU A CD  1 
ATOM   188  O  OE1 . GLU A 1 22  ? 35.451 24.974 5.604   1.00 33.00 ? 22  GLU A OE1 1 
ATOM   189  O  OE2 . GLU A 1 22  ? 35.950 23.043 4.651   1.00 55.47 ? 22  GLU A OE2 1 
ATOM   190  N  N   . GLY A 1 23  ? 38.957 26.138 9.600   1.00 20.19 ? 23  GLY A N   1 
ATOM   191  C  CA  . GLY A 1 23  ? 39.299 27.177 10.546  1.00 17.92 ? 23  GLY A CA  1 
ATOM   192  C  C   . GLY A 1 23  ? 38.639 26.984 11.912  1.00 24.35 ? 23  GLY A C   1 
ATOM   193  O  O   . GLY A 1 23  ? 38.619 27.907 12.724  1.00 25.74 ? 23  GLY A O   1 
ATOM   194  N  N   . TYR A 1 24  ? 38.066 25.797 12.178  1.00 17.09 ? 24  TYR A N   1 
ATOM   195  C  CA  . TYR A 1 24  ? 37.422 25.618 13.491  1.00 20.63 ? 24  TYR A CA  1 
ATOM   196  C  C   . TYR A 1 24  ? 38.314 24.989 14.534  1.00 23.87 ? 24  TYR A C   1 
ATOM   197  O  O   . TYR A 1 24  ? 39.135 24.092 14.241  1.00 17.05 ? 24  TYR A O   1 
ATOM   198  C  CB  . TYR A 1 24  ? 36.187 24.772 13.417  1.00 17.20 ? 24  TYR A CB  1 
ATOM   199  C  CG  . TYR A 1 24  ? 35.181 25.280 12.427  1.00 24.62 ? 24  TYR A CG  1 
ATOM   200  C  CD1 . TYR A 1 24  ? 34.748 26.603 12.486  1.00 30.76 ? 24  TYR A CD1 1 
ATOM   201  C  CD2 . TYR A 1 24  ? 34.622 24.404 11.489  1.00 17.88 ? 24  TYR A CD2 1 
ATOM   202  C  CE1 . TYR A 1 24  ? 33.766 27.052 11.602  1.00 41.15 ? 24  TYR A CE1 1 
ATOM   203  C  CE2 . TYR A 1 24  ? 33.666 24.852 10.586  1.00 20.23 ? 24  TYR A CE2 1 
ATOM   204  C  CZ  . TYR A 1 24  ? 33.230 26.177 10.659  1.00 43.94 ? 24  TYR A CZ  1 
ATOM   205  O  OH  . TYR A 1 24  ? 32.267 26.617 9.796   1.00 49.04 ? 24  TYR A OH  1 
ATOM   206  N  N   . TYR A 1 25  ? 38.101 25.434 15.780  1.00 19.10 ? 25  TYR A N   1 
ATOM   207  C  CA  . TYR A 1 25  ? 38.856 24.943 16.921  1.00 12.81 ? 25  TYR A CA  1 
ATOM   208  C  C   . TYR A 1 25  ? 38.535 23.479 17.138  1.00 10.72 ? 25  TYR A C   1 
ATOM   209  O  O   . TYR A 1 25  ? 37.372 23.099 17.301  1.00 13.82 ? 25  TYR A O   1 
ATOM   210  C  CB  . TYR A 1 25  ? 38.475 25.792 18.150  1.00 16.41 ? 25  TYR A CB  1 
ATOM   211  C  CG  . TYR A 1 25  ? 39.098 27.147 18.031  1.00 30.00 ? 25  TYR A CG  1 
ATOM   212  C  CD1 . TYR A 1 25  ? 40.486 27.268 17.929  1.00 21.35 ? 25  TYR A CD1 1 
ATOM   213  C  CD2 . TYR A 1 25  ? 38.310 28.302 17.999  1.00 30.50 ? 25  TYR A CD2 1 
ATOM   214  C  CE1 . TYR A 1 25  ? 41.095 28.532 17.864  1.00 30.00 ? 25  TYR A CE1 1 
ATOM   215  C  CE2 . TYR A 1 25  ? 38.899 29.570 17.920  1.00 29.01 ? 25  TYR A CE2 1 
ATOM   216  C  CZ  . TYR A 1 25  ? 40.294 29.678 17.862  1.00 22.59 ? 25  TYR A CZ  1 
ATOM   217  O  OH  . TYR A 1 25  ? 40.855 30.931 17.774  1.00 32.07 ? 25  TYR A OH  1 
ATOM   218  N  N   . THR A 1 26  ? 39.602 22.703 17.190  1.00 13.24 ? 26  THR A N   1 
ATOM   219  C  CA  . THR A 1 26  ? 39.600 21.242 17.282  1.00 12.59 ? 26  THR A CA  1 
ATOM   220  C  C   . THR A 1 26  ? 40.738 20.821 18.211  1.00 15.58 ? 26  THR A C   1 
ATOM   221  O  O   . THR A 1 26  ? 41.623 21.584 18.531  1.00 16.48 ? 26  THR A O   1 
ATOM   222  C  CB  . THR A 1 26  ? 39.841 20.724 15.783  1.00 19.30 ? 26  THR A CB  1 
ATOM   223  O  OG1 . THR A 1 26  ? 38.868 21.267 14.917  1.00 15.40 ? 26  THR A OG1 1 
ATOM   224  C  CG2 . THR A 1 26  ? 39.859 19.227 15.547  1.00 9.34  ? 26  THR A CG2 1 
ATOM   225  N  N   . ILE A 1 27  ? 40.747 19.573 18.622  1.00 15.21 ? 27  ILE A N   1 
ATOM   226  C  CA  . ILE A 1 27  ? 41.834 19.009 19.435  1.00 16.95 ? 27  ILE A CA  1 
ATOM   227  C  C   . ILE A 1 27  ? 41.866 17.489 19.222  1.00 11.74 ? 27  ILE A C   1 
ATOM   228  O  O   . ILE A 1 27  ? 40.916 16.916 18.740  1.00 12.74 ? 27  ILE A O   1 
ATOM   229  C  CB  . ILE A 1 27  ? 41.674 19.359 20.938  1.00 22.31 ? 27  ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 27  ? 43.002 19.133 21.687  1.00 20.95 ? 27  ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 27  ? 40.554 18.499 21.542  1.00 16.47 ? 27  ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 27  ? 43.219 20.110 22.816  1.00 19.29 ? 27  ILE A CD1 1 
ATOM   233  N  N   . GLY A 1 28  ? 42.945 16.834 19.538  1.00 10.02 ? 28  GLY A N   1 
ATOM   234  C  CA  . GLY A 1 28  ? 43.015 15.387 19.505  1.00 14.53 ? 28  GLY A CA  1 
ATOM   235  C  C   . GLY A 1 28  ? 43.019 14.835 18.113  1.00 16.38 ? 28  GLY A C   1 
ATOM   236  O  O   . GLY A 1 28  ? 43.787 15.316 17.271  1.00 15.83 ? 28  GLY A O   1 
ATOM   237  N  N   . ILE A 1 29  ? 42.176 13.823 17.925  1.00 12.78 ? 29  ILE A N   1 
ATOM   238  C  CA  . ILE A 1 29  ? 42.021 13.149 16.629  1.00 10.75 ? 29  ILE A CA  1 
ATOM   239  C  C   . ILE A 1 29  ? 40.739 13.648 15.952  1.00 9.43  ? 29  ILE A C   1 
ATOM   240  O  O   . ILE A 1 29  ? 39.677 13.007 15.933  1.00 15.05 ? 29  ILE A O   1 
ATOM   241  C  CB  . ILE A 1 29  ? 42.066 11.628 16.799  1.00 12.28 ? 29  ILE A CB  1 
ATOM   242  C  CG1 . ILE A 1 29  ? 43.356 11.270 17.537  1.00 13.91 ? 29  ILE A CG1 1 
ATOM   243  C  CG2 . ILE A 1 29  ? 42.027 10.953 15.433  1.00 15.52 ? 29  ILE A CG2 1 
ATOM   244  C  CD1 . ILE A 1 29  ? 43.333 9.875  18.155  1.00 17.84 ? 29  ILE A CD1 1 
ATOM   245  N  N   . GLY A 1 30  ? 40.817 14.874 15.436  1.00 11.79 ? 30  GLY A N   1 
ATOM   246  C  CA  . GLY A 1 30  ? 39.704 15.443 14.733  1.00 11.58 ? 30  GLY A CA  1 
ATOM   247  C  C   . GLY A 1 30  ? 38.479 15.727 15.575  1.00 17.64 ? 30  GLY A C   1 
ATOM   248  O  O   . GLY A 1 30  ? 37.385 15.719 15.067  1.00 18.21 ? 30  GLY A O   1 
ATOM   249  N  N   . HIS A 1 31  ? 38.663 16.026 16.855  1.00 12.08 ? 31  HIS A N   1 
ATOM   250  C  CA  . HIS A 1 31  ? 37.512 16.299 17.728  1.00 10.98 ? 31  HIS A CA  1 
ATOM   251  C  C   . HIS A 1 31  ? 37.108 17.755 17.658  1.00 15.96 ? 31  HIS A C   1 
ATOM   252  O  O   . HIS A 1 31  ? 37.779 18.599 18.237  1.00 12.58 ? 31  HIS A O   1 
ATOM   253  C  CB  . HIS A 1 31  ? 37.752 15.854 19.222  1.00 8.24  ? 31  HIS A CB  1 
ATOM   254  C  CG  . HIS A 1 31  ? 36.499 16.105 20.054  1.00 12.18 ? 31  HIS A CG  1 
ATOM   255  N  ND1 . HIS A 1 31  ? 35.421 15.231 20.037  1.00 14.43 ? 31  HIS A ND1 1 
ATOM   256  C  CD2 . HIS A 1 31  ? 36.160 17.147 20.887  1.00 15.66 ? 31  HIS A CD2 1 
ATOM   257  C  CE1 . HIS A 1 31  ? 34.456 15.740 20.826  1.00 12.05 ? 31  HIS A CE1 1 
ATOM   258  N  NE2 . HIS A 1 31  ? 34.858 16.909 21.337  1.00 9.53  ? 31  HIS A NE2 1 
ATOM   259  N  N   . LEU A 1 32  ? 36.042 18.076 16.928  1.00 16.06 ? 32  LEU A N   1 
ATOM   260  C  CA  . LEU A 1 32  ? 35.617 19.465 16.805  1.00 17.22 ? 32  LEU A CA  1 
ATOM   261  C  C   . LEU A 1 32  ? 35.142 20.050 18.154  1.00 16.94 ? 32  LEU A C   1 
ATOM   262  O  O   . LEU A 1 32  ? 34.353 19.448 18.883  1.00 19.09 ? 32  LEU A O   1 
ATOM   263  C  CB  . LEU A 1 32  ? 34.500 19.567 15.761  1.00 19.39 ? 32  LEU A CB  1 
ATOM   264  C  CG  . LEU A 1 32  ? 33.835 20.955 15.802  1.00 26.17 ? 32  LEU A CG  1 
ATOM   265  C  CD1 . LEU A 1 32  ? 34.772 22.003 15.208  1.00 25.13 ? 32  LEU A CD1 1 
ATOM   266  C  CD2 . LEU A 1 32  ? 32.563 20.923 14.974  1.00 30.94 ? 32  LEU A CD2 1 
ATOM   267  N  N   . LEU A 1 33  ? 35.626 21.202 18.496  1.00 11.46 ? 33  LEU A N   1 
ATOM   268  C  CA  . LEU A 1 33  ? 35.244 21.791 19.788  1.00 18.95 ? 33  LEU A CA  1 
ATOM   269  C  C   . LEU A 1 33  ? 34.064 22.739 19.647  1.00 24.43 ? 33  LEU A C   1 
ATOM   270  O  O   . LEU A 1 33  ? 33.054 22.628 20.344  1.00 19.07 ? 33  LEU A O   1 
ATOM   271  C  CB  . LEU A 1 33  ? 36.439 22.484 20.515  1.00 12.81 ? 33  LEU A CB  1 
ATOM   272  C  CG  . LEU A 1 33  ? 37.489 21.472 21.036  1.00 14.14 ? 33  LEU A CG  1 
ATOM   273  C  CD1 . LEU A 1 33  ? 38.735 22.232 21.441  1.00 14.48 ? 33  LEU A CD1 1 
ATOM   274  C  CD2 . LEU A 1 33  ? 36.935 20.786 22.291  1.00 15.64 ? 33  LEU A CD2 1 
ATOM   275  N  N   . THR A 1 34  ? 34.221 23.701 18.746  1.00 20.19 ? 34  THR A N   1 
ATOM   276  C  CA  . THR A 1 34  ? 33.199 24.709 18.507  1.00 36.24 ? 34  THR A CA  1 
ATOM   277  C  C   . THR A 1 34  ? 33.446 25.359 17.162  1.00 30.91 ? 34  THR A C   1 
ATOM   278  O  O   . THR A 1 34  ? 34.586 25.375 16.688  1.00 28.59 ? 34  THR A O   1 
ATOM   279  C  CB  . THR A 1 34  ? 33.242 25.818 19.629  1.00 24.90 ? 34  THR A CB  1 
ATOM   280  O  OG1 . THR A 1 34  ? 32.227 26.791 19.446  1.00 25.91 ? 34  THR A OG1 1 
ATOM   281  C  CG2 . THR A 1 34  ? 34.616 26.480 19.735  1.00 18.76 ? 34  THR A CG2 1 
ATOM   282  N  N   . LYS A 1 35  ? 32.398 25.925 16.591  1.00 25.35 ? 35  LYS A N   1 
ATOM   283  C  CA  . LYS A 1 35  ? 32.506 26.640 15.336  1.00 31.58 ? 35  LYS A CA  1 
ATOM   284  C  C   . LYS A 1 35  ? 32.696 28.096 15.641  1.00 40.05 ? 35  LYS A C   1 
ATOM   285  O  O   . LYS A 1 35  ? 32.989 28.894 14.759  1.00 39.67 ? 35  LYS A O   1 
ATOM   286  C  CB  . LYS A 1 35  ? 31.278 26.468 14.479  1.00 22.36 ? 35  LYS A CB  1 
ATOM   287  C  CG  . LYS A 1 35  ? 31.161 25.018 14.030  1.00 30.39 ? 35  LYS A CG  1 
ATOM   288  C  CD  . LYS A 1 35  ? 30.405 24.811 12.747  1.00 34.02 ? 35  LYS A CD  1 
ATOM   289  C  CE  . LYS A 1 35  ? 30.620 23.397 12.267  1.00 39.19 ? 35  LYS A CE  1 
ATOM   290  N  NZ  . LYS A 1 35  ? 29.364 22.697 11.924  1.00 56.17 ? 35  LYS A NZ  1 
ATOM   291  N  N   . SER A 1 36  ? 32.529 28.427 16.911  1.00 25.00 ? 36  SER A N   1 
ATOM   292  C  CA  . SER A 1 36  ? 32.721 29.808 17.328  1.00 29.52 ? 36  SER A CA  1 
ATOM   293  C  C   . SER A 1 36  ? 34.173 30.267 17.177  1.00 31.79 ? 36  SER A C   1 
ATOM   294  O  O   . SER A 1 36  ? 35.134 29.517 17.392  1.00 26.34 ? 36  SER A O   1 
ATOM   295  C  CB  . SER A 1 36  ? 32.169 30.069 18.734  1.00 31.99 ? 36  SER A CB  1 
ATOM   296  O  OG  . SER A 1 36  ? 32.884 31.111 19.392  1.00 44.04 ? 36  SER A OG  1 
ATOM   297  N  N   . PRO A 1 37  ? 34.355 31.538 16.825  1.00 40.47 ? 37  PRO A N   1 
ATOM   298  C  CA  . PRO A 1 37  ? 35.683 32.080 16.590  1.00 29.59 ? 37  PRO A CA  1 
ATOM   299  C  C   . PRO A 1 37  ? 36.485 32.376 17.824  1.00 36.50 ? 37  PRO A C   1 
ATOM   300  O  O   . PRO A 1 37  ? 37.674 32.699 17.765  1.00 52.63 ? 37  PRO A O   1 
ATOM   301  C  CB  . PRO A 1 37  ? 35.494 33.369 15.809  1.00 33.42 ? 37  PRO A CB  1 
ATOM   302  C  CG  . PRO A 1 37  ? 34.022 33.464 15.484  1.00 26.78 ? 37  PRO A CG  1 
ATOM   303  C  CD  . PRO A 1 37  ? 33.297 32.352 16.207  1.00 28.76 ? 37  PRO A CD  1 
ATOM   304  N  N   . SER A 1 38  ? 35.855 32.261 18.953  1.00 31.41 ? 38  SER A N   1 
ATOM   305  C  CA  . SER A 1 38  ? 36.561 32.576 20.166  1.00 19.37 ? 38  SER A CA  1 
ATOM   306  C  C   . SER A 1 38  ? 37.320 31.384 20.709  1.00 23.47 ? 38  SER A C   1 
ATOM   307  O  O   . SER A 1 38  ? 36.745 30.342 20.975  1.00 29.87 ? 38  SER A O   1 
ATOM   308  C  CB  . SER A 1 38  ? 35.481 33.029 21.184  1.00 20.29 ? 38  SER A CB  1 
ATOM   309  O  OG  . SER A 1 38  ? 36.051 33.175 22.489  1.00 32.95 ? 38  SER A OG  1 
ATOM   310  N  N   . LEU A 1 39  ? 38.590 31.563 20.915  1.00 23.25 ? 39  LEU A N   1 
ATOM   311  C  CA  . LEU A 1 39  ? 39.422 30.537 21.469  1.00 22.47 ? 39  LEU A CA  1 
ATOM   312  C  C   . LEU A 1 39  ? 38.984 30.286 22.888  1.00 24.76 ? 39  LEU A C   1 
ATOM   313  O  O   . LEU A 1 39  ? 39.137 29.230 23.468  1.00 21.58 ? 39  LEU A O   1 
ATOM   314  C  CB  . LEU A 1 39  ? 40.900 30.962 21.461  1.00 25.11 ? 39  LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 39  ? 41.787 29.984 22.207  1.00 29.96 ? 39  LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 39  ? 41.831 28.677 21.430  1.00 32.14 ? 39  LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 39  ? 43.193 30.537 22.337  1.00 28.65 ? 39  LEU A CD2 1 
ATOM   318  N  N   . ASN A 1 40  ? 38.421 31.272 23.493  1.00 26.05 ? 40  ASN A N   1 
ATOM   319  C  CA  . ASN A 1 40  ? 37.989 31.040 24.859  1.00 25.45 ? 40  ASN A CA  1 
ATOM   320  C  C   . ASN A 1 40  ? 36.808 30.132 24.947  1.00 21.17 ? 40  ASN A C   1 
ATOM   321  O  O   . ASN A 1 40  ? 36.750 29.317 25.866  1.00 26.88 ? 40  ASN A O   1 
ATOM   322  C  CB  . ASN A 1 40  ? 37.687 32.320 25.638  1.00 43.25 ? 40  ASN A CB  1 
ATOM   323  C  CG  . ASN A 1 40  ? 38.988 32.889 26.128  1.00 49.85 ? 40  ASN A CG  1 
ATOM   324  O  OD1 . ASN A 1 40  ? 39.889 32.161 26.626  1.00 66.06 ? 40  ASN A OD1 1 
ATOM   325  N  ND2 . ASN A 1 40  ? 39.133 34.193 25.892  1.00 69.04 ? 40  ASN A ND2 1 
ATOM   326  N  N   . ALA A 1 41  ? 35.858 30.340 24.039  1.00 18.33 ? 41  ALA A N   1 
ATOM   327  C  CA  . ALA A 1 41  ? 34.694 29.486 23.973  1.00 21.76 ? 41  ALA A CA  1 
ATOM   328  C  C   . ALA A 1 41  ? 35.167 28.043 23.699  1.00 29.11 ? 41  ALA A C   1 
ATOM   329  O  O   . ALA A 1 41  ? 34.557 27.097 24.141  1.00 21.86 ? 41  ALA A O   1 
ATOM   330  C  CB  . ALA A 1 41  ? 33.728 29.951 22.919  1.00 15.21 ? 41  ALA A CB  1 
ATOM   331  N  N   . ALA A 1 42  ? 36.287 27.870 22.985  1.00 21.13 ? 42  ALA A N   1 
ATOM   332  C  CA  . ALA A 1 42  ? 36.846 26.549 22.689  1.00 19.03 ? 42  ALA A CA  1 
ATOM   333  C  C   . ALA A 1 42  ? 37.426 25.919 23.928  1.00 20.89 ? 42  ALA A C   1 
ATOM   334  O  O   . ALA A 1 42  ? 37.257 24.709 24.155  1.00 17.10 ? 42  ALA A O   1 
ATOM   335  C  CB  . ALA A 1 42  ? 37.956 26.599 21.637  1.00 20.74 ? 42  ALA A CB  1 
ATOM   336  N  N   . LYS A 1 43  ? 38.134 26.742 24.722  1.00 19.70 ? 43  LYS A N   1 
ATOM   337  C  CA  . LYS A 1 43  ? 38.715 26.246 25.977  1.00 25.22 ? 43  LYS A CA  1 
ATOM   338  C  C   . LYS A 1 43  ? 37.617 25.769 26.951  1.00 14.63 ? 43  LYS A C   1 
ATOM   339  O  O   . LYS A 1 43  ? 37.756 24.760 27.598  1.00 22.42 ? 43  LYS A O   1 
ATOM   340  C  CB  . LYS A 1 43  ? 39.585 27.297 26.608  1.00 24.62 ? 43  LYS A CB  1 
ATOM   341  C  CG  . LYS A 1 43  ? 40.953 27.281 25.984  1.00 23.58 ? 43  LYS A CG  1 
ATOM   342  C  CD  . LYS A 1 43  ? 41.655 28.621 26.075  1.00 37.00 ? 43  LYS A CD  1 
ATOM   343  C  CE  . LYS A 1 43  ? 43.172 28.490 26.222  1.00 38.53 ? 43  LYS A CE  1 
ATOM   344  N  NZ  . LYS A 1 43  ? 43.705 29.314 27.327  1.00 45.84 ? 43  LYS A NZ  1 
ATOM   345  N  N   . ILE A 1 44  ? 36.508 26.503 26.982  1.00 15.92 ? 44  ILE A N   1 
ATOM   346  C  CA  . ILE A 1 44  ? 35.375 26.143 27.834  1.00 18.51 ? 44  ILE A CA  1 
ATOM   347  C  C   . ILE A 1 44  ? 34.781 24.788 27.403  1.00 26.83 ? 44  ILE A C   1 
ATOM   348  O  O   . ILE A 1 44  ? 34.477 23.913 28.218  1.00 17.34 ? 44  ILE A O   1 
ATOM   349  C  CB  . ILE A 1 44  ? 34.305 27.239 27.778  1.00 21.39 ? 44  ILE A CB  1 
ATOM   350  C  CG1 . ILE A 1 44  ? 34.718 28.494 28.544  1.00 18.40 ? 44  ILE A CG1 1 
ATOM   351  C  CG2 . ILE A 1 44  ? 32.955 26.750 28.277  1.00 21.32 ? 44  ILE A CG2 1 
ATOM   352  C  CD1 . ILE A 1 44  ? 33.899 29.691 28.037  1.00 29.00 ? 44  ILE A CD1 1 
ATOM   353  N  N   . GLU A 1 45  ? 34.636 24.608 26.093  1.00 21.13 ? 45  GLU A N   1 
ATOM   354  C  CA  . GLU A 1 45  ? 34.105 23.372 25.543  1.00 16.00 ? 45  GLU A CA  1 
ATOM   355  C  C   . GLU A 1 45  ? 35.057 22.242 25.868  1.00 20.03 ? 45  GLU A C   1 
ATOM   356  O  O   . GLU A 1 45  ? 34.636 21.128 26.211  1.00 17.38 ? 45  GLU A O   1 
ATOM   357  C  CB  . GLU A 1 45  ? 33.934 23.419 24.016  1.00 11.14 ? 45  GLU A CB  1 
ATOM   358  C  CG  . GLU A 1 45  ? 32.760 24.312 23.580  1.00 11.42 ? 45  GLU A CG  1 
ATOM   359  C  CD  . GLU A 1 45  ? 31.433 23.833 24.118  1.00 26.26 ? 45  GLU A CD  1 
ATOM   360  O  OE1 . GLU A 1 45  ? 31.038 22.697 24.038  1.00 20.11 ? 45  GLU A OE1 1 
ATOM   361  O  OE2 . GLU A 1 45  ? 30.677 24.784 24.541  1.00 25.49 ? 45  GLU A OE2 1 
ATOM   362  N  N   . LEU A 1 46  ? 36.366 22.507 25.752  1.00 15.69 ? 46  LEU A N   1 
ATOM   363  C  CA  . LEU A 1 46  ? 37.368 21.473 26.025  1.00 16.01 ? 46  LEU A CA  1 
ATOM   364  C  C   . LEU A 1 46  ? 37.349 20.951 27.476  1.00 18.77 ? 46  LEU A C   1 
ATOM   365  O  O   . LEU A 1 46  ? 37.374 19.754 27.734  1.00 21.31 ? 46  LEU A O   1 
ATOM   366  C  CB  . LEU A 1 46  ? 38.766 21.958 25.622  1.00 13.80 ? 46  LEU A CB  1 
ATOM   367  C  CG  . LEU A 1 46  ? 39.880 20.977 25.968  1.00 13.36 ? 46  LEU A CG  1 
ATOM   368  C  CD1 . LEU A 1 46  ? 39.709 19.692 25.216  1.00 13.06 ? 46  LEU A CD1 1 
ATOM   369  C  CD2 . LEU A 1 46  ? 41.218 21.593 25.552  1.00 14.52 ? 46  LEU A CD2 1 
ATOM   370  N  N   . ASP A 1 47  ? 37.340 21.887 28.427  1.00 14.40 ? 47  ASP A N   1 
ATOM   371  C  CA  . ASP A 1 47  ? 37.326 21.552 29.849  1.00 17.87 ? 47  ASP A CA  1 
ATOM   372  C  C   . ASP A 1 47  ? 36.086 20.815 30.171  1.00 11.41 ? 47  ASP A C   1 
ATOM   373  O  O   . ASP A 1 47  ? 36.098 19.896 30.959  1.00 17.39 ? 47  ASP A O   1 
ATOM   374  C  CB  . ASP A 1 47  ? 37.351 22.820 30.715  1.00 15.44 ? 47  ASP A CB  1 
ATOM   375  C  CG  . ASP A 1 47  ? 38.735 23.448 30.745  1.00 20.24 ? 47  ASP A CG  1 
ATOM   376  O  OD1 . ASP A 1 47  ? 39.717 22.991 30.201  1.00 22.75 ? 47  ASP A OD1 1 
ATOM   377  O  OD2 . ASP A 1 47  ? 38.737 24.586 31.314  1.00 35.38 ? 47  ASP A OD2 1 
ATOM   378  N  N   . LYS A 1 48  ? 34.990 21.257 29.577  1.00 13.11 ? 48  LYS A N   1 
ATOM   379  C  CA  . LYS A 1 48  ? 33.755 20.569 29.772  1.00 11.04 ? 48  LYS A CA  1 
ATOM   380  C  C   . LYS A 1 48  ? 33.830 19.143 29.172  1.00 16.53 ? 48  LYS A C   1 
ATOM   381  O  O   . LYS A 1 48  ? 33.304 18.201 29.717  1.00 13.59 ? 48  LYS A O   1 
ATOM   382  C  CB  . LYS A 1 48  ? 32.647 21.357 29.082  1.00 17.38 ? 48  LYS A CB  1 
ATOM   383  C  CG  . LYS A 1 48  ? 31.329 20.594 29.024  1.00 15.69 ? 48  LYS A CG  1 
ATOM   384  C  CD  . LYS A 1 48  ? 30.192 21.402 28.409  1.00 19.98 ? 48  LYS A CD  1 
ATOM   385  C  CE  . LYS A 1 48  ? 30.464 21.725 26.951  1.00 25.02 ? 48  LYS A CE  1 
ATOM   386  N  NZ  . LYS A 1 48  ? 29.263 22.137 26.248  1.00 23.72 ? 48  LYS A NZ  1 
ATOM   387  N  N   . ALA A 1 49  ? 34.477 18.966 28.007  1.00 13.10 ? 49  ALA A N   1 
ATOM   388  C  CA  . ALA A 1 49  ? 34.539 17.627 27.388  1.00 13.89 ? 49  ALA A CA  1 
ATOM   389  C  C   . ALA A 1 49  ? 35.386 16.630 28.173  1.00 15.90 ? 49  ALA A C   1 
ATOM   390  O  O   . ALA A 1 49  ? 35.074 15.453 28.230  1.00 14.65 ? 49  ALA A O   1 
ATOM   391  C  CB  . ALA A 1 49  ? 35.023 17.750 25.939  1.00 13.71 ? 49  ALA A CB  1 
ATOM   392  N  N   . ILE A 1 50  ? 36.463 17.128 28.796  1.00 13.37 ? 50  ILE A N   1 
ATOM   393  C  CA  . ILE A 1 50  ? 37.472 16.380 29.542  1.00 16.15 ? 50  ILE A CA  1 
ATOM   394  C  C   . ILE A 1 50  ? 37.154 16.238 31.030  1.00 25.07 ? 50  ILE A C   1 
ATOM   395  O  O   . ILE A 1 50  ? 37.483 15.241 31.664  1.00 22.94 ? 50  ILE A O   1 
ATOM   396  C  CB  . ILE A 1 50  ? 38.899 16.984 29.308  1.00 14.36 ? 50  ILE A CB  1 
ATOM   397  C  CG1 . ILE A 1 50  ? 39.268 16.922 27.814  1.00 28.63 ? 50  ILE A CG1 1 
ATOM   398  C  CG2 . ILE A 1 50  ? 39.980 16.315 30.139  1.00 14.86 ? 50  ILE A CG2 1 
ATOM   399  C  CD1 . ILE A 1 50  ? 39.228 15.513 27.212  1.00 18.67 ? 50  ILE A CD1 1 
ATOM   400  N  N   . GLY A 1 51  ? 36.479 17.222 31.576  1.00 18.30 ? 51  GLY A N   1 
ATOM   401  C  CA  . GLY A 1 51  ? 36.126 17.152 32.976  1.00 21.79 ? 51  GLY A CA  1 
ATOM   402  C  C   . GLY A 1 51  ? 37.232 17.659 33.901  1.00 33.40 ? 51  GLY A C   1 
ATOM   403  O  O   . GLY A 1 51  ? 37.343 17.251 35.048  1.00 29.95 ? 51  GLY A O   1 
ATOM   404  N  N   . ARG A 1 52  ? 38.044 18.572 33.400  1.00 22.83 ? 52  ARG A N   1 
ATOM   405  C  CA  . ARG A 1 52  ? 39.107 19.197 34.175  1.00 19.32 ? 52  ARG A CA  1 
ATOM   406  C  C   . ARG A 1 52  ? 39.524 20.473 33.490  1.00 31.60 ? 52  ARG A C   1 
ATOM   407  O  O   . ARG A 1 52  ? 39.165 20.735 32.338  1.00 22.77 ? 52  ARG A O   1 
ATOM   408  C  CB  . ARG A 1 52  ? 40.337 18.313 34.425  1.00 28.59 ? 52  ARG A CB  1 
ATOM   409  C  CG  . ARG A 1 52  ? 41.203 18.088 33.182  1.00 24.07 ? 52  ARG A CG  1 
ATOM   410  C  CD  . ARG A 1 52  ? 42.211 17.008 33.394  1.00 25.50 ? 52  ARG A CD  1 
ATOM   411  N  NE  . ARG A 1 52  ? 43.140 16.859 32.285  1.00 25.20 ? 52  ARG A NE  1 
ATOM   412  C  CZ  . ARG A 1 52  ? 44.052 17.745 31.965  1.00 23.87 ? 52  ARG A CZ  1 
ATOM   413  N  NH1 . ARG A 1 52  ? 44.168 18.888 32.626  1.00 22.83 ? 52  ARG A NH1 1 
ATOM   414  N  NH2 . ARG A 1 52  ? 44.837 17.500 30.923  1.00 25.92 ? 52  ARG A NH2 1 
ATOM   415  N  N   . ASN A 1 53  ? 40.247 21.281 34.239  1.00 22.30 ? 53  ASN A N   1 
ATOM   416  C  CA  . ASN A 1 53  ? 40.766 22.530 33.737  1.00 19.00 ? 53  ASN A CA  1 
ATOM   417  C  C   . ASN A 1 53  ? 41.964 22.214 32.939  1.00 23.82 ? 53  ASN A C   1 
ATOM   418  O  O   . ASN A 1 53  ? 42.967 21.834 33.513  1.00 34.79 ? 53  ASN A O   1 
ATOM   419  C  CB  . ASN A 1 53  ? 41.287 23.347 34.911  1.00 29.49 ? 53  ASN A CB  1 
ATOM   420  C  CG  . ASN A 1 53  ? 40.590 24.643 34.767  1.00 51.37 ? 53  ASN A CG  1 
ATOM   421  O  OD1 . ASN A 1 53  ? 39.396 24.726 35.127  1.00 61.87 ? 53  ASN A OD1 1 
ATOM   422  N  ND2 . ASN A 1 53  ? 41.239 25.559 34.024  1.00 52.24 ? 53  ASN A ND2 1 
ATOM   423  N  N   . THR A 1 54  ? 41.872 22.302 31.632  1.00 20.51 ? 54  THR A N   1 
ATOM   424  C  CA  . THR A 1 54  ? 42.996 21.860 30.827  1.00 26.20 ? 54  THR A CA  1 
ATOM   425  C  C   . THR A 1 54  ? 43.912 22.924 30.355  1.00 25.43 ? 54  THR A C   1 
ATOM   426  O  O   . THR A 1 54  ? 44.989 22.588 29.916  1.00 32.09 ? 54  THR A O   1 
ATOM   427  C  CB  . THR A 1 54  ? 42.534 21.162 29.529  1.00 25.61 ? 54  THR A CB  1 
ATOM   428  O  OG1 . THR A 1 54  ? 41.853 22.117 28.733  1.00 21.94 ? 54  THR A OG1 1 
ATOM   429  C  CG2 . THR A 1 54  ? 41.622 19.994 29.831  1.00 23.45 ? 54  THR A CG2 1 
ATOM   430  N  N   . ASN A 1 55  ? 43.437 24.147 30.260  1.00 36.79 ? 55  ASN A N   1 
ATOM   431  C  CA  . ASN A 1 55  ? 44.255 25.177 29.662  1.00 35.34 ? 55  ASN A CA  1 
ATOM   432  C  C   . ASN A 1 55  ? 44.657 24.876 28.183  1.00 46.82 ? 55  ASN A C   1 
ATOM   433  O  O   . ASN A 1 55  ? 45.744 25.266 27.728  1.00 36.70 ? 55  ASN A O   1 
ATOM   434  C  CB  . ASN A 1 55  ? 45.435 25.686 30.551  1.00 34.40 ? 55  ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 55  ? 45.803 27.174 30.280  1.00 33.88 ? 55  ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 55  ? 44.984 28.027 29.836  1.00 38.01 ? 55  ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 55  ? 47.066 27.487 30.507  1.00 46.77 ? 55  ASN A ND2 1 
ATOM   438  N  N   . GLY A 1 56  ? 43.770 24.189 27.410  1.00 23.66 ? 56  GLY A N   1 
ATOM   439  C  CA  . GLY A 1 56  ? 44.005 23.924 25.984  1.00 19.97 ? 56  GLY A CA  1 
ATOM   440  C  C   . GLY A 1 56  ? 44.949 22.790 25.689  1.00 18.45 ? 56  GLY A C   1 
ATOM   441  O  O   . GLY A 1 56  ? 45.223 22.478 24.550  1.00 29.03 ? 56  GLY A O   1 
ATOM   442  N  N   . VAL A 1 57  ? 45.398 22.103 26.705  1.00 20.83 ? 57  VAL A N   1 
ATOM   443  C  CA  . VAL A 1 57  ? 46.250 20.971 26.433  1.00 13.80 ? 57  VAL A CA  1 
ATOM   444  C  C   . VAL A 1 57  ? 45.740 19.684 27.113  1.00 25.81 ? 57  VAL A C   1 
ATOM   445  O  O   . VAL A 1 57  ? 45.361 19.674 28.280  1.00 23.08 ? 57  VAL A O   1 
ATOM   446  C  CB  . VAL A 1 57  ? 47.661 21.293 26.892  1.00 30.15 ? 57  VAL A CB  1 
ATOM   447  C  CG1 . VAL A 1 57  ? 48.518 20.042 26.775  1.00 27.54 ? 57  VAL A CG1 1 
ATOM   448  C  CG2 . VAL A 1 57  ? 48.199 22.399 25.997  1.00 39.58 ? 57  VAL A CG2 1 
ATOM   449  N  N   . ILE A 1 58  ? 45.768 18.571 26.379  1.00 17.03 ? 58  ILE A N   1 
ATOM   450  C  CA  . ILE A 1 58  ? 45.288 17.300 26.906  1.00 13.69 ? 58  ILE A CA  1 
ATOM   451  C  C   . ILE A 1 58  ? 46.360 16.247 26.726  1.00 19.65 ? 58  ILE A C   1 
ATOM   452  O  O   . ILE A 1 58  ? 47.347 16.477 26.062  1.00 22.82 ? 58  ILE A O   1 
ATOM   453  C  CB  . ILE A 1 58  ? 43.955 16.916 26.190  1.00 17.68 ? 58  ILE A CB  1 
ATOM   454  C  CG1 . ILE A 1 58  ? 44.144 16.656 24.650  1.00 16.61 ? 58  ILE A CG1 1 
ATOM   455  C  CG2 . ILE A 1 58  ? 42.914 18.025 26.388  1.00 18.26 ? 58  ILE A CG2 1 
ATOM   456  C  CD1 . ILE A 1 58  ? 42.918 15.953 24.011  1.00 12.34 ? 58  ILE A CD1 1 
ATOM   457  N  N   . THR A 1 59  ? 46.185 15.081 27.302  1.00 15.07 ? 59  THR A N   1 
ATOM   458  C  CA  . THR A 1 59  ? 47.162 14.036 27.160  1.00 11.03 ? 59  THR A CA  1 
ATOM   459  C  C   . THR A 1 59  ? 46.706 13.085 26.063  1.00 26.53 ? 59  THR A C   1 
ATOM   460  O  O   . THR A 1 59  ? 45.558 13.154 25.600  1.00 18.77 ? 59  THR A O   1 
ATOM   461  C  CB  . THR A 1 59  ? 47.252 13.246 28.490  1.00 22.09 ? 59  THR A CB  1 
ATOM   462  O  OG1 . THR A 1 59  ? 46.045 12.479 28.718  1.00 21.82 ? 59  THR A OG1 1 
ATOM   463  C  CG2 . THR A 1 59  ? 47.454 14.236 29.633  1.00 28.13 ? 59  THR A CG2 1 
ATOM   464  N  N   . LYS A 1 60  ? 47.599 12.161 25.673  1.00 24.35 ? 60  LYS A N   1 
ATOM   465  C  CA  . LYS A 1 60  ? 47.277 11.164 24.642  1.00 14.97 ? 60  LYS A CA  1 
ATOM   466  C  C   . LYS A 1 60  ? 46.074 10.285 25.017  1.00 17.79 ? 60  LYS A C   1 
ATOM   467  O  O   . LYS A 1 60  ? 45.214 10.056 24.170  1.00 17.51 ? 60  LYS A O   1 
ATOM   468  C  CB  . LYS A 1 60  ? 48.497 10.375 24.208  1.00 25.64 ? 60  LYS A CB  1 
ATOM   469  C  CG  . LYS A 1 60  ? 48.234 9.298  23.151  1.00 37.47 ? 60  LYS A CG  1 
ATOM   470  C  CD  . LYS A 1 60  ? 49.542 8.598  22.785  1.00 46.35 ? 60  LYS A CD  1 
ATOM   471  C  CE  . LYS A 1 60  ? 49.432 7.590  21.647  1.00 44.89 ? 60  LYS A CE  1 
ATOM   472  N  NZ  . LYS A 1 60  ? 49.751 8.167  20.329  1.00 60.21 ? 60  LYS A NZ  1 
ATOM   473  N  N   . ASP A 1 61  ? 45.998 9.817  26.300  1.00 17.15 ? 61  ASP A N   1 
ATOM   474  C  CA  . ASP A 1 61  ? 44.888 9.007  26.795  1.00 15.33 ? 61  ASP A CA  1 
ATOM   475  C  C   . ASP A 1 61  ? 43.563 9.751  26.670  1.00 15.12 ? 61  ASP A C   1 
ATOM   476  O  O   . ASP A 1 61  ? 42.546 9.146  26.362  1.00 15.91 ? 61  ASP A O   1 
ATOM   477  C  CB  . ASP A 1 61  ? 45.028 8.733  28.279  1.00 22.45 ? 61  ASP A CB  1 
ATOM   478  C  CG  . ASP A 1 61  ? 46.107 7.786  28.540  1.00 48.53 ? 61  ASP A CG  1 
ATOM   479  O  OD1 . ASP A 1 61  ? 46.590 7.297  27.423  1.00 46.32 ? 61  ASP A OD1 1 
ATOM   480  O  OD2 . ASP A 1 61  ? 46.483 7.523  29.672  1.00 68.06 ? 61  ASP A OD2 1 
ATOM   481  N  N   . GLU A 1 62  ? 43.587 11.061 26.998  1.00 17.07 ? 62  GLU A N   1 
ATOM   482  C  CA  . GLU A 1 62  ? 42.420 11.917 26.908  1.00 12.32 ? 62  GLU A CA  1 
ATOM   483  C  C   . GLU A 1 62  ? 42.014 12.072 25.423  1.00 13.36 ? 62  GLU A C   1 
ATOM   484  O  O   . GLU A 1 62  ? 40.845 12.013 25.113  1.00 16.34 ? 62  GLU A O   1 
ATOM   485  C  CB  . GLU A 1 62  ? 42.663 13.300 27.523  1.00 10.39 ? 62  GLU A CB  1 
ATOM   486  C  CG  . GLU A 1 62  ? 42.609 13.220 29.038  1.00 13.96 ? 62  GLU A CG  1 
ATOM   487  C  CD  . GLU A 1 62  ? 43.174 14.445 29.682  1.00 26.95 ? 62  GLU A CD  1 
ATOM   488  O  OE1 . GLU A 1 62  ? 43.855 15.256 29.106  1.00 19.85 ? 62  GLU A OE1 1 
ATOM   489  O  OE2 . GLU A 1 62  ? 42.849 14.547 30.929  1.00 21.30 ? 62  GLU A OE2 1 
ATOM   490  N  N   . ALA A 1 63  ? 42.994 12.241 24.503  1.00 15.53 ? 63  ALA A N   1 
ATOM   491  C  CA  . ALA A 1 63  ? 42.701 12.317 23.085  1.00 13.63 ? 63  ALA A CA  1 
ATOM   492  C  C   . ALA A 1 63  ? 42.030 11.039 22.607  1.00 14.17 ? 63  ALA A C   1 
ATOM   493  O  O   . ALA A 1 63  ? 41.033 11.083 21.885  1.00 19.87 ? 63  ALA A O   1 
ATOM   494  C  CB  . ALA A 1 63  ? 43.946 12.592 22.235  1.00 12.53 ? 63  ALA A CB  1 
ATOM   495  N  N   . GLU A 1 64  ? 42.581 9.885  23.006  1.00 11.35 ? 64  GLU A N   1 
ATOM   496  C  CA  . GLU A 1 64  ? 42.006 8.607  22.623  1.00 12.60 ? 64  GLU A CA  1 
ATOM   497  C  C   . GLU A 1 64  ? 40.639 8.338  23.215  1.00 12.96 ? 64  GLU A C   1 
ATOM   498  O  O   . GLU A 1 64  ? 39.820 7.638  22.624  1.00 13.13 ? 64  GLU A O   1 
ATOM   499  C  CB  . GLU A 1 64  ? 42.967 7.468  22.977  1.00 19.96 ? 64  GLU A CB  1 
ATOM   500  C  CG  . GLU A 1 64  ? 44.080 7.449  21.917  1.00 29.39 ? 64  GLU A CG  1 
ATOM   501  C  CD  . GLU A 1 64  ? 45.297 6.746  22.406  1.00 41.89 ? 64  GLU A CD  1 
ATOM   502  O  OE1 . GLU A 1 64  ? 45.342 6.192  23.497  1.00 46.73 ? 64  GLU A OE1 1 
ATOM   503  O  OE2 . GLU A 1 64  ? 46.286 6.821  21.551  1.00 42.27 ? 64  GLU A OE2 1 
ATOM   504  N  N   . LYS A 1 65  ? 40.360 8.884  24.367  1.00 11.89 ? 65  LYS A N   1 
ATOM   505  C  CA  . LYS A 1 65  ? 39.060 8.671  24.937  1.00 10.66 ? 65  LYS A CA  1 
ATOM   506  C  C   . LYS A 1 65  ? 38.015 9.473  24.157  1.00 13.36 ? 65  LYS A C   1 
ATOM   507  O  O   . LYS A 1 65  ? 36.962 8.964  23.778  1.00 15.12 ? 65  LYS A O   1 
ATOM   508  C  CB  . LYS A 1 65  ? 39.065 9.050  26.412  1.00 16.03 ? 65  LYS A CB  1 
ATOM   509  C  CG  . LYS A 1 65  ? 37.650 9.107  26.973  1.00 27.92 ? 65  LYS A CG  1 
ATOM   510  C  CD  . LYS A 1 65  ? 37.597 8.723  28.448  1.00 42.03 ? 65  LYS A CD  1 
ATOM   511  C  CE  . LYS A 1 65  ? 36.305 8.021  28.867  1.00 41.68 ? 65  LYS A CE  1 
ATOM   512  N  NZ  . LYS A 1 65  ? 36.048 8.180  30.323  1.00 45.82 ? 65  LYS A NZ  1 
ATOM   513  N  N   . LEU A 1 66  ? 38.335 10.719 23.792  1.00 10.51 ? 66  LEU A N   1 
ATOM   514  C  CA  . LEU A 1 66  ? 37.396 11.484 22.962  1.00 6.32  ? 66  LEU A CA  1 
ATOM   515  C  C   . LEU A 1 66  ? 37.184 10.778 21.615  1.00 12.44 ? 66  LEU A C   1 
ATOM   516  O  O   . LEU A 1 66  ? 36.089 10.783 21.056  1.00 10.80 ? 66  LEU A O   1 
ATOM   517  C  CB  . LEU A 1 66  ? 37.913 12.901 22.597  1.00 11.62 ? 66  LEU A CB  1 
ATOM   518  C  CG  . LEU A 1 66  ? 38.061 13.776 23.846  1.00 18.19 ? 66  LEU A CG  1 
ATOM   519  C  CD1 . LEU A 1 66  ? 38.544 15.168 23.463  1.00 20.58 ? 66  LEU A CD1 1 
ATOM   520  C  CD2 . LEU A 1 66  ? 36.740 13.894 24.587  1.00 18.95 ? 66  LEU A CD2 1 
ATOM   521  N  N   . PHE A 1 67  ? 38.241 10.161 21.112  1.00 14.40 ? 67  PHE A N   1 
ATOM   522  C  CA  . PHE A 1 67  ? 38.174 9.476  19.823  1.00 12.35 ? 67  PHE A CA  1 
ATOM   523  C  C   . PHE A 1 67  ? 37.287 8.266  19.929  1.00 14.74 ? 67  PHE A C   1 
ATOM   524  O  O   . PHE A 1 67  ? 36.389 8.014  19.118  1.00 13.46 ? 67  PHE A O   1 
ATOM   525  C  CB  . PHE A 1 67  ? 39.600 9.172  19.358  1.00 9.31  ? 67  PHE A CB  1 
ATOM   526  C  CG  . PHE A 1 67  ? 39.782 8.511  17.988  1.00 13.48 ? 67  PHE A CG  1 
ATOM   527  C  CD1 . PHE A 1 67  ? 39.119 8.980  16.850  1.00 16.76 ? 67  PHE A CD1 1 
ATOM   528  C  CD2 . PHE A 1 67  ? 40.716 7.480  17.840  1.00 12.79 ? 67  PHE A CD2 1 
ATOM   529  C  CE1 . PHE A 1 67  ? 39.320 8.407  15.586  1.00 11.33 ? 67  PHE A CE1 1 
ATOM   530  C  CE2 . PHE A 1 67  ? 40.981 6.924  16.588  1.00 15.26 ? 67  PHE A CE2 1 
ATOM   531  C  CZ  . PHE A 1 67  ? 40.254 7.381  15.483  1.00 13.20 ? 67  PHE A CZ  1 
ATOM   532  N  N   . ASN A 1 68  ? 37.475 7.474  20.953  1.00 12.96 ? 68  ASN A N   1 
ATOM   533  C  CA  . ASN A 1 68  ? 36.592 6.344  21.134  1.00 10.15 ? 68  ASN A CA  1 
ATOM   534  C  C   . ASN A 1 68  ? 35.156 6.774  21.173  1.00 11.57 ? 68  ASN A C   1 
ATOM   535  O  O   . ASN A 1 68  ? 34.266 6.124  20.634  1.00 13.05 ? 68  ASN A O   1 
ATOM   536  C  CB  . ASN A 1 68  ? 36.911 5.576  22.434  1.00 15.19 ? 68  ASN A CB  1 
ATOM   537  C  CG  . ASN A 1 68  ? 38.085 4.622  22.260  1.00 23.28 ? 68  ASN A CG  1 
ATOM   538  O  OD1 . ASN A 1 68  ? 38.180 3.976  21.233  1.00 31.88 ? 68  ASN A OD1 1 
ATOM   539  N  ND2 . ASN A 1 68  ? 38.948 4.477  23.292  1.00 27.66 ? 68  ASN A ND2 1 
ATOM   540  N  N   . GLN A 1 69  ? 34.860 7.880  21.871  1.00 10.41 ? 69  GLN A N   1 
ATOM   541  C  CA  . GLN A 1 69  ? 33.481 8.330  21.948  1.00 8.02  ? 69  GLN A CA  1 
ATOM   542  C  C   . GLN A 1 69  ? 32.951 8.787  20.604  1.00 12.18 ? 69  GLN A C   1 
ATOM   543  O  O   . GLN A 1 69  ? 31.782 8.587  20.287  1.00 14.93 ? 69  GLN A O   1 
ATOM   544  C  CB  . GLN A 1 69  ? 33.339 9.543  22.889  1.00 12.24 ? 69  GLN A CB  1 
ATOM   545  C  CG  . GLN A 1 69  ? 33.637 9.115  24.331  1.00 9.46  ? 69  GLN A CG  1 
ATOM   546  C  CD  . GLN A 1 69  ? 33.746 10.256 25.347  1.00 22.81 ? 69  GLN A CD  1 
ATOM   547  O  OE1 . GLN A 1 69  ? 33.825 9.976  26.534  1.00 19.17 ? 69  GLN A OE1 1 
ATOM   548  N  NE2 . GLN A 1 69  ? 33.734 11.515 24.921  1.00 16.30 ? 69  GLN A NE2 1 
ATOM   549  N  N   . ASP A 1 70  ? 33.816 9.491  19.866  1.00 10.32 ? 70  ASP A N   1 
ATOM   550  C  CA  . ASP A 1 70  ? 33.421 10.032 18.594  1.00 9.17  ? 70  ASP A CA  1 
ATOM   551  C  C   . ASP A 1 70  ? 33.125 8.949  17.538  1.00 10.31 ? 70  ASP A C   1 
ATOM   552  O  O   . ASP A 1 70  ? 32.165 9.072  16.755  1.00 12.31 ? 70  ASP A O   1 
ATOM   553  C  CB  . ASP A 1 70  ? 34.509 10.997 18.113  1.00 8.81  ? 70  ASP A CB  1 
ATOM   554  C  CG  . ASP A 1 70  ? 34.454 12.312 18.838  1.00 15.57 ? 70  ASP A CG  1 
ATOM   555  O  OD1 . ASP A 1 70  ? 33.542 12.638 19.548  1.00 13.99 ? 70  ASP A OD1 1 
ATOM   556  O  OD2 . ASP A 1 70  ? 35.490 13.049 18.630  1.00 14.93 ? 70  ASP A OD2 1 
ATOM   557  N  N   . VAL A 1 71  ? 33.913 7.865  17.554  1.00 10.72 ? 71  VAL A N   1 
ATOM   558  C  CA  . VAL A 1 71  ? 33.695 6.783  16.605  1.00 13.98 ? 71  VAL A CA  1 
ATOM   559  C  C   . VAL A 1 71  ? 32.374 6.103  16.926  1.00 12.27 ? 71  VAL A C   1 
ATOM   560  O  O   . VAL A 1 71  ? 31.518 5.823  16.061  1.00 15.83 ? 71  VAL A O   1 
ATOM   561  C  CB  . VAL A 1 71  ? 34.864 5.763  16.497  1.00 10.60 ? 71  VAL A CB  1 
ATOM   562  C  CG1 . VAL A 1 71  ? 34.490 4.584  15.571  1.00 12.62 ? 71  VAL A CG1 1 
ATOM   563  C  CG2 . VAL A 1 71  ? 36.148 6.418  15.955  1.00 11.15 ? 71  VAL A CG2 1 
ATOM   564  N  N   . ASP A 1 72  ? 32.185 5.833  18.222  1.00 12.57 ? 72  ASP A N   1 
ATOM   565  C  CA  . ASP A 1 72  ? 30.943 5.210  18.714  1.00 12.34 ? 72  ASP A CA  1 
ATOM   566  C  C   . ASP A 1 72  ? 29.716 6.054  18.341  1.00 12.40 ? 72  ASP A C   1 
ATOM   567  O  O   . ASP A 1 72  ? 28.711 5.573  17.816  1.00 13.63 ? 72  ASP A O   1 
ATOM   568  C  CB  . ASP A 1 72  ? 31.086 4.841  20.233  1.00 12.74 ? 72  ASP A CB  1 
ATOM   569  C  CG  . ASP A 1 72  ? 29.927 4.090  20.865  1.00 19.16 ? 72  ASP A CG  1 
ATOM   570  O  OD1 . ASP A 1 72  ? 29.754 2.893  20.386  1.00 30.21 ? 72  ASP A OD1 1 
ATOM   571  O  OD2 . ASP A 1 72  ? 29.248 4.539  21.752  1.00 29.04 ? 72  ASP A OD2 1 
ATOM   572  N  N   . ALA A 1 73  ? 29.782 7.362  18.534  1.00 13.99 ? 73  ALA A N   1 
ATOM   573  C  CA  . ALA A 1 73  ? 28.678 8.206  18.175  1.00 10.13 ? 73  ALA A CA  1 
ATOM   574  C  C   . ALA A 1 73  ? 28.409 8.167  16.665  1.00 24.62 ? 73  ALA A C   1 
ATOM   575  O  O   . ALA A 1 73  ? 27.252 8.187  16.257  1.00 16.91 ? 73  ALA A O   1 
ATOM   576  C  CB  . ALA A 1 73  ? 28.994 9.649  18.529  1.00 12.96 ? 73  ALA A CB  1 
ATOM   577  N  N   . ALA A 1 74  ? 29.478 8.140  15.828  1.00 16.29 ? 74  ALA A N   1 
ATOM   578  C  CA  . ALA A 1 74  ? 29.333 8.116  14.367  1.00 20.10 ? 74  ALA A CA  1 
ATOM   579  C  C   . ALA A 1 74  ? 28.588 6.841  13.972  1.00 14.08 ? 74  ALA A C   1 
ATOM   580  O  O   . ALA A 1 74  ? 27.598 6.885  13.242  1.00 16.28 ? 74  ALA A O   1 
ATOM   581  C  CB  . ALA A 1 74  ? 30.680 8.265  13.607  1.00 15.22 ? 74  ALA A CB  1 
ATOM   582  N  N   . VAL A 1 75  ? 29.078 5.693  14.461  1.00 15.00 ? 75  VAL A N   1 
ATOM   583  C  CA  . VAL A 1 75  ? 28.384 4.436  14.174  1.00 18.72 ? 75  VAL A CA  1 
ATOM   584  C  C   . VAL A 1 75  ? 26.895 4.460  14.609  1.00 27.70 ? 75  VAL A C   1 
ATOM   585  O  O   . VAL A 1 75  ? 25.987 4.129  13.818  1.00 20.03 ? 75  VAL A O   1 
ATOM   586  C  CB  . VAL A 1 75  ? 29.133 3.199  14.709  1.00 26.43 ? 75  VAL A CB  1 
ATOM   587  C  CG1 . VAL A 1 75  ? 28.305 1.895  14.532  1.00 20.26 ? 75  VAL A CG1 1 
ATOM   588  C  CG2 . VAL A 1 75  ? 30.501 3.102  14.019  1.00 17.31 ? 75  VAL A CG2 1 
ATOM   589  N  N   . ARG A 1 76  ? 26.623 4.883  15.858  1.00 21.35 ? 76  ARG A N   1 
ATOM   590  C  CA  . ARG A 1 76  ? 25.246 4.907  16.378  1.00 17.81 ? 76  ARG A CA  1 
ATOM   591  C  C   . ARG A 1 76  ? 24.368 5.885  15.599  1.00 22.96 ? 76  ARG A C   1 
ATOM   592  O  O   . ARG A 1 76  ? 23.199 5.606  15.343  1.00 24.60 ? 76  ARG A O   1 
ATOM   593  C  CB  . ARG A 1 76  ? 25.207 5.116  17.904  1.00 22.57 ? 76  ARG A CB  1 
ATOM   594  C  CG  . ARG A 1 76  ? 25.401 3.797  18.694  1.00 40.49 ? 76  ARG A CG  1 
ATOM   595  C  CD  . ARG A 1 76  ? 25.409 3.962  20.234  1.00 43.61 ? 76  ARG A CD  1 
ATOM   596  N  NE  . ARG A 1 76  ? 26.480 4.846  20.705  1.00 46.60 ? 76  ARG A NE  1 
ATOM   597  C  CZ  . ARG A 1 76  ? 26.365 6.171  20.939  1.00 48.33 ? 76  ARG A CZ  1 
ATOM   598  N  NH1 . ARG A 1 76  ? 25.220 6.845  20.759  1.00 52.84 ? 76  ARG A NH1 1 
ATOM   599  N  NH2 . ARG A 1 76  ? 27.443 6.863  21.352  1.00 37.95 ? 76  ARG A NH2 1 
ATOM   600  N  N   . GLY A 1 77  ? 24.956 6.999  15.134  1.00 16.28 ? 77  GLY A N   1 
ATOM   601  C  CA  . GLY A 1 77  ? 24.207 7.964  14.329  1.00 19.34 ? 77  GLY A CA  1 
ATOM   602  C  C   . GLY A 1 77  ? 23.807 7.406  12.950  1.00 28.90 ? 77  GLY A C   1 
ATOM   603  O  O   . GLY A 1 77  ? 22.791 7.733  12.380  1.00 27.45 ? 77  GLY A O   1 
ATOM   604  N  N   . ILE A 1 78  ? 24.656 6.567  12.389  1.00 24.16 ? 78  ILE A N   1 
ATOM   605  C  CA  . ILE A 1 78  ? 24.385 5.913  11.127  1.00 17.35 ? 78  ILE A CA  1 
ATOM   606  C  C   . ILE A 1 78  ? 23.219 4.953  11.321  1.00 19.02 ? 78  ILE A C   1 
ATOM   607  O  O   . ILE A 1 78  ? 22.272 4.942  10.543  1.00 19.80 ? 78  ILE A O   1 
ATOM   608  C  CB  . ILE A 1 78  ? 25.634 5.117  10.659  1.00 16.24 ? 78  ILE A CB  1 
ATOM   609  C  CG1 . ILE A 1 78  ? 26.651 6.030  9.950   1.00 15.86 ? 78  ILE A CG1 1 
ATOM   610  C  CG2 . ILE A 1 78  ? 25.242 4.000  9.711   1.00 15.61 ? 78  ILE A CG2 1 
ATOM   611  C  CD1 . ILE A 1 78  ? 28.002 5.350  9.732   1.00 15.11 ? 78  ILE A CD1 1 
ATOM   612  N  N   . LEU A 1 79  ? 23.276 4.147  12.385  1.00 16.55 ? 79  LEU A N   1 
ATOM   613  C  CA  . LEU A 1 79  ? 22.236 3.128  12.648  1.00 20.33 ? 79  LEU A CA  1 
ATOM   614  C  C   . LEU A 1 79  ? 20.896 3.679  13.030  1.00 22.95 ? 79  LEU A C   1 
ATOM   615  O  O   . LEU A 1 79  ? 19.904 2.995  12.902  1.00 30.05 ? 79  LEU A O   1 
ATOM   616  C  CB  . LEU A 1 79  ? 22.651 2.043  13.666  1.00 21.61 ? 79  LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 79  ? 23.964 1.350  13.327  1.00 28.83 ? 79  LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 79  ? 24.389 0.474  14.490  1.00 24.00 ? 79  LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 79  ? 23.796 0.510  12.073  1.00 26.78 ? 79  LEU A CD2 1 
ATOM   620  N  N   . ARG A 1 80  ? 20.885 4.904  13.479  1.00 21.41 ? 80  ARG A N   1 
ATOM   621  C  CA  . ARG A 1 80  ? 19.668 5.573  13.866  1.00 21.99 ? 80  ARG A CA  1 
ATOM   622  C  C   . ARG A 1 80  ? 19.104 6.365  12.707  1.00 31.80 ? 80  ARG A C   1 
ATOM   623  O  O   . ARG A 1 80  ? 17.983 6.833  12.753  1.00 41.93 ? 80  ARG A O   1 
ATOM   624  C  CB  . ARG A 1 80  ? 20.004 6.621  14.936  1.00 33.89 ? 80  ARG A CB  1 
ATOM   625  C  CG  . ARG A 1 80  ? 19.766 6.160  16.367  1.00 44.77 ? 80  ARG A CG  1 
ATOM   626  C  CD  . ARG A 1 80  ? 19.781 7.354  17.364  1.00 52.19 ? 80  ARG A CD  1 
ATOM   627  N  NE  . ARG A 1 80  ? 21.144 7.735  17.770  1.00 54.79 ? 80  ARG A NE  1 
ATOM   628  C  CZ  . ARG A 1 80  ? 21.792 8.857  17.378  1.00 62.49 ? 80  ARG A CZ  1 
ATOM   629  N  NH1 . ARG A 1 80  ? 21.246 9.820  16.571  1.00 46.97 ? 80  ARG A NH1 1 
ATOM   630  N  NH2 . ARG A 1 80  ? 23.050 9.001  17.823  1.00 41.05 ? 80  ARG A NH2 1 
ATOM   631  N  N   . ASN A 1 81  ? 19.909 6.607  11.690  1.00 19.44 ? 81  ASN A N   1 
ATOM   632  C  CA  . ASN A 1 81  ? 19.481 7.426  10.620  1.00 15.91 ? 81  ASN A CA  1 
ATOM   633  C  C   . ASN A 1 81  ? 18.728 6.632  9.548   1.00 30.33 ? 81  ASN A C   1 
ATOM   634  O  O   . ASN A 1 81  ? 19.234 5.660  9.012   1.00 19.56 ? 81  ASN A O   1 
ATOM   635  C  CB  . ASN A 1 81  ? 20.679 8.204  10.085  1.00 21.58 ? 81  ASN A CB  1 
ATOM   636  C  CG  . ASN A 1 81  ? 20.270 9.255  9.099   1.00 30.84 ? 81  ASN A CG  1 
ATOM   637  O  OD1 . ASN A 1 81  ? 19.782 8.966  7.998   1.00 25.72 ? 81  ASN A OD1 1 
ATOM   638  N  ND2 . ASN A 1 81  ? 20.495 10.495 9.479   1.00 25.78 ? 81  ASN A ND2 1 
ATOM   639  N  N   . ALA A 1 82  ? 17.505 7.033  9.224   1.00 26.60 ? 82  ALA A N   1 
ATOM   640  C  CA  . ALA A 1 82  ? 16.732 6.305  8.231   1.00 22.14 ? 82  ALA A CA  1 
ATOM   641  C  C   . ALA A 1 82  ? 17.345 6.305  6.863   1.00 20.68 ? 82  ALA A C   1 
ATOM   642  O  O   . ALA A 1 82  ? 17.033 5.427  6.077   1.00 30.00 ? 82  ALA A O   1 
ATOM   643  C  CB  . ALA A 1 82  ? 15.334 6.863  8.089   1.00 30.03 ? 82  ALA A CB  1 
ATOM   644  N  N   . LYS A 1 83  ? 18.164 7.292  6.531   1.00 25.19 ? 83  LYS A N   1 
ATOM   645  C  CA  . LYS A 1 83  ? 18.778 7.303  5.206   1.00 20.27 ? 83  LYS A CA  1 
ATOM   646  C  C   . LYS A 1 83  ? 20.085 6.549  5.174   1.00 16.22 ? 83  LYS A C   1 
ATOM   647  O  O   . LYS A 1 83  ? 20.477 5.982  4.168   1.00 25.97 ? 83  LYS A O   1 
ATOM   648  C  CB  . LYS A 1 83  ? 19.127 8.700  4.722   1.00 29.24 ? 83  LYS A CB  1 
ATOM   649  C  CG  . LYS A 1 83  ? 17.964 9.408  4.072   1.00 39.13 ? 83  LYS A CG  1 
ATOM   650  C  CD  . LYS A 1 83  ? 17.311 10.322 5.091   1.00 52.02 ? 83  LYS A CD  1 
ATOM   651  C  CE  . LYS A 1 83  ? 16.717 11.588 4.483   1.00 56.63 ? 83  LYS A CE  1 
ATOM   652  N  NZ  . LYS A 1 83  ? 17.566 12.152 3.405   1.00 67.14 ? 83  LYS A NZ  1 
ATOM   653  N  N   . LEU A 1 84  ? 20.782 6.581  6.297   1.00 14.83 ? 84  LEU A N   1 
ATOM   654  C  CA  . LEU A 1 84  ? 22.085 5.960  6.357   1.00 16.32 ? 84  LEU A CA  1 
ATOM   655  C  C   . LEU A 1 84  ? 22.078 4.478  6.635   1.00 21.38 ? 84  LEU A C   1 
ATOM   656  O  O   . LEU A 1 84  ? 22.860 3.711  6.102   1.00 15.30 ? 84  LEU A O   1 
ATOM   657  C  CB  . LEU A 1 84  ? 23.043 6.724  7.307   1.00 10.21 ? 84  LEU A CB  1 
ATOM   658  C  CG  . LEU A 1 84  ? 23.302 8.164  6.879   1.00 17.48 ? 84  LEU A CG  1 
ATOM   659  C  CD1 . LEU A 1 84  ? 24.174 8.864  7.901   1.00 18.58 ? 84  LEU A CD1 1 
ATOM   660  C  CD2 . LEU A 1 84  ? 23.969 8.254  5.509   1.00 16.73 ? 84  LEU A CD2 1 
ATOM   661  N  N   . LYS A 1 85  ? 21.233 4.090  7.534   1.00 14.62 ? 85  LYS A N   1 
ATOM   662  C  CA  . LYS A 1 85  ? 21.177 2.719  7.930   1.00 15.26 ? 85  LYS A CA  1 
ATOM   663  C  C   . LYS A 1 85  ? 21.078 1.694  6.787   1.00 14.80 ? 85  LYS A C   1 
ATOM   664  O  O   . LYS A 1 85  ? 21.765 0.678  6.787   1.00 12.75 ? 85  LYS A O   1 
ATOM   665  C  CB  . LYS A 1 85  ? 20.039 2.540  8.922   1.00 14.16 ? 85  LYS A CB  1 
ATOM   666  C  CG  . LYS A 1 85  ? 20.160 1.183  9.548   1.00 18.02 ? 85  LYS A CG  1 
ATOM   667  C  CD  . LYS A 1 85  ? 19.147 0.907  10.625  1.00 30.35 ? 85  LYS A CD  1 
ATOM   668  C  CE  . LYS A 1 85  ? 19.541 -0.380 11.323  1.00 33.62 ? 85  LYS A CE  1 
ATOM   669  N  NZ  . LYS A 1 85  ? 19.187 -1.556 10.514  1.00 30.42 ? 85  LYS A NZ  1 
ATOM   670  N  N   . PRO A 1 86  ? 20.143 1.869  5.860   1.00 12.58 ? 86  PRO A N   1 
ATOM   671  C  CA  . PRO A 1 86  ? 19.984 0.920  4.795   1.00 21.98 ? 86  PRO A CA  1 
ATOM   672  C  C   . PRO A 1 86  ? 21.236 0.811  3.955   1.00 19.49 ? 86  PRO A C   1 
ATOM   673  O  O   . PRO A 1 86  ? 21.580 -0.278 3.515   1.00 13.48 ? 86  PRO A O   1 
ATOM   674  C  CB  . PRO A 1 86  ? 18.809 1.388  3.930   1.00 16.01 ? 86  PRO A CB  1 
ATOM   675  C  CG  . PRO A 1 86  ? 18.416 2.744  4.435   1.00 27.53 ? 86  PRO A CG  1 
ATOM   676  C  CD  . PRO A 1 86  ? 19.173 2.972  5.724   1.00 16.86 ? 86  PRO A CD  1 
ATOM   677  N  N   . VAL A 1 87  ? 21.931 1.934  3.738   1.00 12.21 ? 87  VAL A N   1 
ATOM   678  C  CA  . VAL A 1 87  ? 23.201 1.886  2.995   1.00 12.05 ? 87  VAL A CA  1 
ATOM   679  C  C   . VAL A 1 87  ? 24.273 1.094  3.760   1.00 13.31 ? 87  VAL A C   1 
ATOM   680  O  O   . VAL A 1 87  ? 24.927 0.194  3.243   1.00 14.75 ? 87  VAL A O   1 
ATOM   681  C  CB  . VAL A 1 87  ? 23.712 3.297  2.608   1.00 18.65 ? 87  VAL A CB  1 
ATOM   682  C  CG1 . VAL A 1 87  ? 24.973 3.195  1.719   1.00 17.69 ? 87  VAL A CG1 1 
ATOM   683  C  CG2 . VAL A 1 87  ? 22.600 4.030  1.861   1.00 22.23 ? 87  VAL A CG2 1 
ATOM   684  N  N   . TYR A 1 88  ? 24.444 1.412  5.036   1.00 12.46 ? 88  TYR A N   1 
ATOM   685  C  CA  . TYR A 1 88  ? 25.381 0.713  5.891   1.00 11.96 ? 88  TYR A CA  1 
ATOM   686  C  C   . TYR A 1 88  ? 25.129 -0.790 5.893   1.00 12.97 ? 88  TYR A C   1 
ATOM   687  O  O   . TYR A 1 88  ? 26.057 -1.585 5.716   1.00 13.76 ? 88  TYR A O   1 
ATOM   688  C  CB  . TYR A 1 88  ? 25.301 1.299  7.306   1.00 12.98 ? 88  TYR A CB  1 
ATOM   689  C  CG  . TYR A 1 88  ? 26.401 0.799  8.216   1.00 13.01 ? 88  TYR A CG  1 
ATOM   690  C  CD1 . TYR A 1 88  ? 27.592 1.504  8.334   1.00 12.18 ? 88  TYR A CD1 1 
ATOM   691  C  CD2 . TYR A 1 88  ? 26.214 -0.318 9.021   1.00 23.08 ? 88  TYR A CD2 1 
ATOM   692  C  CE1 . TYR A 1 88  ? 28.580 1.083  9.225   1.00 12.36 ? 88  TYR A CE1 1 
ATOM   693  C  CE2 . TYR A 1 88  ? 27.205 -0.786 9.883   1.00 27.74 ? 88  TYR A CE2 1 
ATOM   694  C  CZ  . TYR A 1 88  ? 28.401 -0.069 9.995   1.00 32.52 ? 88  TYR A CZ  1 
ATOM   695  O  OH  . TYR A 1 88  ? 29.406 -0.494 10.833  1.00 24.68 ? 88  TYR A OH  1 
ATOM   696  N  N   . ASP A 1 89  ? 23.850 -1.189 6.061   1.00 15.07 ? 89  ASP A N   1 
ATOM   697  C  CA  . ASP A 1 89  ? 23.477 -2.624 6.087   1.00 12.75 ? 89  ASP A CA  1 
ATOM   698  C  C   . ASP A 1 89  ? 23.811 -3.334 4.799   1.00 19.07 ? 89  ASP A C   1 
ATOM   699  O  O   . ASP A 1 89  ? 24.133 -4.500 4.801   1.00 20.92 ? 89  ASP A O   1 
ATOM   700  C  CB  . ASP A 1 89  ? 21.965 -2.827 6.343   1.00 14.02 ? 89  ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 89  ? 21.559 -2.545 7.779   1.00 21.52 ? 89  ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 89  ? 22.541 -2.540 8.637   1.00 21.56 ? 89  ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 89  ? 20.440 -2.331 8.113   1.00 25.07 ? 89  ASP A OD2 1 
ATOM   704  N  N   . SER A 1 90  ? 23.760 -2.604 3.680   1.00 16.44 ? 90  SER A N   1 
ATOM   705  C  CA  . SER A 1 90  ? 24.054 -3.202 2.374   1.00 17.73 ? 90  SER A CA  1 
ATOM   706  C  C   . SER A 1 90  ? 25.514 -3.379 2.071   1.00 14.42 ? 90  SER A C   1 
ATOM   707  O  O   . SER A 1 90  ? 25.859 -4.153 1.192   1.00 14.86 ? 90  SER A O   1 
ATOM   708  C  CB  . SER A 1 90  ? 23.402 -2.435 1.235   1.00 12.14 ? 90  SER A CB  1 
ATOM   709  O  OG  . SER A 1 90  ? 24.150 -1.266 1.038   1.00 10.27 ? 90  SER A OG  1 
ATOM   710  N  N   . LEU A 1 91  ? 26.398 -2.645 2.770   1.00 8.68  ? 91  LEU A N   1 
ATOM   711  C  CA  . LEU A 1 91  ? 27.815 -2.691 2.500   1.00 12.07 ? 91  LEU A CA  1 
ATOM   712  C  C   . LEU A 1 91  ? 28.615 -3.793 3.171   1.00 10.54 ? 91  LEU A C   1 
ATOM   713  O  O   . LEU A 1 91  ? 28.249 -4.294 4.248   1.00 15.86 ? 91  LEU A O   1 
ATOM   714  C  CB  . LEU A 1 91  ? 28.453 -1.319 2.869   1.00 14.68 ? 91  LEU A CB  1 
ATOM   715  C  CG  . LEU A 1 91  ? 27.860 -0.062 2.147   1.00 17.12 ? 91  LEU A CG  1 
ATOM   716  C  CD1 . LEU A 1 91  ? 28.357 1.242  2.810   1.00 17.20 ? 91  LEU A CD1 1 
ATOM   717  C  CD2 . LEU A 1 91  ? 28.316 0.000  0.685   1.00 15.52 ? 91  LEU A CD2 1 
ATOM   718  N  N   . ASP A 1 92  ? 29.771 -4.130 2.564   1.00 13.10 ? 92  ASP A N   1 
ATOM   719  C  CA  . ASP A 1 92  ? 30.735 -5.070 3.114   1.00 11.49 ? 92  ASP A CA  1 
ATOM   720  C  C   . ASP A 1 92  ? 31.557 -4.338 4.206   1.00 13.70 ? 92  ASP A C   1 
ATOM   721  O  O   . ASP A 1 92  ? 31.437 -3.120 4.349   1.00 13.28 ? 92  ASP A O   1 
ATOM   722  C  CB  . ASP A 1 92  ? 31.680 -5.558 2.022   1.00 11.30 ? 92  ASP A CB  1 
ATOM   723  C  CG  . ASP A 1 92  ? 32.351 -4.375 1.393   1.00 12.95 ? 92  ASP A CG  1 
ATOM   724  O  OD1 . ASP A 1 92  ? 31.635 -3.855 0.434   1.00 16.68 ? 92  ASP A OD1 1 
ATOM   725  O  OD2 . ASP A 1 92  ? 33.448 -3.931 1.742   1.00 16.45 ? 92  ASP A OD2 1 
ATOM   726  N  N   . ALA A 1 93  ? 32.418 -5.036 4.993   1.00 14.29 ? 93  ALA A N   1 
ATOM   727  C  CA  . ALA A 1 93  ? 33.112 -4.374 6.096   1.00 12.38 ? 93  ALA A CA  1 
ATOM   728  C  C   . ALA A 1 93  ? 34.003 -3.187 5.785   1.00 11.52 ? 93  ALA A C   1 
ATOM   729  O  O   . ALA A 1 93  ? 34.038 -2.189 6.536   1.00 16.02 ? 93  ALA A O   1 
ATOM   730  C  CB  . ALA A 1 93  ? 33.760 -5.372 7.047   1.00 10.46 ? 93  ALA A CB  1 
ATOM   731  N  N   . VAL A 1 94  ? 34.743 -3.286 4.686   1.00 12.48 ? 94  VAL A N   1 
ATOM   732  C  CA  . VAL A 1 94  ? 35.632 -2.186 4.323   1.00 13.46 ? 94  VAL A CA  1 
ATOM   733  C  C   . VAL A 1 94  ? 34.876 -0.927 3.951   1.00 18.31 ? 94  VAL A C   1 
ATOM   734  O  O   . VAL A 1 94  ? 35.176 0.177  4.370   1.00 13.45 ? 94  VAL A O   1 
ATOM   735  C  CB  . VAL A 1 94  ? 36.596 -2.608 3.215   1.00 15.85 ? 94  VAL A CB  1 
ATOM   736  C  CG1 . VAL A 1 94  ? 37.616 -1.471 2.902   1.00 14.40 ? 94  VAL A CG1 1 
ATOM   737  C  CG2 . VAL A 1 94  ? 37.302 -3.866 3.688   1.00 15.51 ? 94  VAL A CG2 1 
ATOM   738  N  N   . ARG A 1 95  ? 33.894 -1.087 3.101   1.00 11.11 ? 95  ARG A N   1 
ATOM   739  C  CA  . ARG A 1 95  ? 33.126 0.036  2.677   1.00 11.79 ? 95  ARG A CA  1 
ATOM   740  C  C   . ARG A 1 95  ? 32.356 0.674  3.797   1.00 12.51 ? 95  ARG A C   1 
ATOM   741  O  O   . ARG A 1 95  ? 32.092 1.885  3.740   1.00 14.01 ? 95  ARG A O   1 
ATOM   742  C  CB  . ARG A 1 95  ? 32.253 -0.360 1.495   1.00 12.40 ? 95  ARG A CB  1 
ATOM   743  C  CG  . ARG A 1 95  ? 33.092 -0.640 0.263   1.00 10.76 ? 95  ARG A CG  1 
ATOM   744  C  CD  . ARG A 1 95  ? 32.161 -0.947 -0.908  1.00 17.01 ? 95  ARG A CD  1 
ATOM   745  N  NE  . ARG A 1 95  ? 32.835 -1.029 -2.201  1.00 11.55 ? 95  ARG A NE  1 
ATOM   746  C  CZ  . ARG A 1 95  ? 33.212 -2.191 -2.769  1.00 17.39 ? 95  ARG A CZ  1 
ATOM   747  N  NH1 . ARG A 1 95  ? 33.088 -3.347 -2.114  1.00 12.77 ? 95  ARG A NH1 1 
ATOM   748  N  NH2 . ARG A 1 95  ? 33.787 -2.162 -3.992  1.00 9.84  ? 95  ARG A NH2 1 
ATOM   749  N  N   . ARG A 1 96  ? 31.941 -0.141 4.786   1.00 11.96 ? 96  ARG A N   1 
ATOM   750  C  CA  . ARG A 1 96  ? 31.262 0.363  6.003   1.00 13.91 ? 96  ARG A CA  1 
ATOM   751  C  C   . ARG A 1 96  ? 32.177 1.382  6.726   1.00 10.55 ? 96  ARG A C   1 
ATOM   752  O  O   . ARG A 1 96  ? 31.742 2.448  7.160   1.00 13.04 ? 96  ARG A O   1 
ATOM   753  C  CB  . ARG A 1 96  ? 30.916 -0.775 6.967   1.00 8.95  ? 96  ARG A CB  1 
ATOM   754  C  CG  . ARG A 1 96  ? 29.590 -1.338 6.559   1.00 11.16 ? 96  ARG A CG  1 
ATOM   755  C  CD  . ARG A 1 96  ? 29.248 -2.592 7.370   1.00 23.49 ? 96  ARG A CD  1 
ATOM   756  N  NE  . ARG A 1 96  ? 28.010 -3.229 6.885   1.00 20.88 ? 96  ARG A NE  1 
ATOM   757  C  CZ  . ARG A 1 96  ? 27.476 -4.321 7.409   1.00 23.21 ? 96  ARG A CZ  1 
ATOM   758  N  NH1 . ARG A 1 96  ? 28.040 -4.891 8.473   1.00 22.60 ? 96  ARG A NH1 1 
ATOM   759  N  NH2 . ARG A 1 96  ? 26.363 -4.853 6.859   1.00 12.93 ? 96  ARG A NH2 1 
ATOM   760  N  N   . ALA A 1 97  ? 33.445 1.071  6.750   1.00 13.03 ? 97  ALA A N   1 
ATOM   761  C  CA  . ALA A 1 97  ? 34.425 1.977  7.344   1.00 12.27 ? 97  ALA A CA  1 
ATOM   762  C  C   . ALA A 1 97  ? 34.543 3.313  6.589   1.00 13.97 ? 97  ALA A C   1 
ATOM   763  O  O   . ALA A 1 97  ? 34.704 4.343  7.199   1.00 12.65 ? 97  ALA A O   1 
ATOM   764  C  CB  . ALA A 1 97  ? 35.774 1.266  7.450   1.00 13.27 ? 97  ALA A CB  1 
ATOM   765  N  N   . ALA A 1 98  ? 34.449 3.306  5.259   1.00 13.80 ? 98  ALA A N   1 
ATOM   766  C  CA  . ALA A 1 98  ? 34.491 4.527  4.462   1.00 20.30 ? 98  ALA A CA  1 
ATOM   767  C  C   . ALA A 1 98  ? 33.279 5.391  4.812   1.00 15.43 ? 98  ALA A C   1 
ATOM   768  O  O   . ALA A 1 98  ? 33.371 6.594  4.868   1.00 11.88 ? 98  ALA A O   1 
ATOM   769  C  CB  . ALA A 1 98  ? 34.428 4.233  2.932   1.00 11.63 ? 98  ALA A CB  1 
ATOM   770  N  N   . LEU A 1 99  ? 32.109 4.788  5.007   1.00 7.31  ? 99  LEU A N   1 
ATOM   771  C  CA  . LEU A 1 99  ? 30.963 5.593  5.349   1.00 8.14  ? 99  LEU A CA  1 
ATOM   772  C  C   . LEU A 1 99  ? 31.093 6.187  6.737   1.00 8.40  ? 99  LEU A C   1 
ATOM   773  O  O   . LEU A 1 99  ? 30.668 7.311  6.970   1.00 12.13 ? 99  LEU A O   1 
ATOM   774  C  CB  . LEU A 1 99  ? 29.641 4.747  5.244   1.00 10.85 ? 99  LEU A CB  1 
ATOM   775  C  CG  . LEU A 1 99  ? 28.351 5.519  5.454   1.00 14.35 ? 99  LEU A CG  1 
ATOM   776  C  CD1 . LEU A 1 99  ? 28.079 6.393  4.245   1.00 16.96 ? 99  LEU A CD1 1 
ATOM   777  C  CD2 . LEU A 1 99  ? 27.200 4.515  5.570   1.00 22.64 ? 99  LEU A CD2 1 
ATOM   778  N  N   . ILE A 1 100 ? 31.675 5.420  7.671   1.00 9.38  ? 100 ILE A N   1 
ATOM   779  C  CA  . ILE A 1 100 ? 31.884 5.920  9.001   1.00 14.34 ? 100 ILE A CA  1 
ATOM   780  C  C   . ILE A 1 100 ? 32.831 7.119  8.929   1.00 15.07 ? 100 ILE A C   1 
ATOM   781  O  O   . ILE A 1 100 ? 32.649 8.175  9.561   1.00 11.92 ? 100 ILE A O   1 
ATOM   782  C  CB  . ILE A 1 100 ? 32.403 4.833  9.978   1.00 15.17 ? 100 ILE A CB  1 
ATOM   783  C  CG1 . ILE A 1 100 ? 31.385 3.650  10.118  1.00 7.64  ? 100 ILE A CG1 1 
ATOM   784  C  CG2 . ILE A 1 100 ? 32.714 5.491  11.336  1.00 11.10 ? 100 ILE A CG2 1 
ATOM   785  C  CD1 . ILE A 1 100 ? 31.949 2.457  10.933  1.00 5.97  ? 100 ILE A CD1 1 
ATOM   786  N  N   . ASN A 1 101 ? 33.842 6.980  8.095   1.00 9.04  ? 101 ASN A N   1 
ATOM   787  C  CA  . ASN A 1 101 ? 34.799 8.064  7.948   1.00 9.01  ? 101 ASN A CA  1 
ATOM   788  C  C   . ASN A 1 101 ? 34.134 9.351  7.525   1.00 15.24 ? 101 ASN A C   1 
ATOM   789  O  O   . ASN A 1 101 ? 34.369 10.421 8.113   1.00 14.65 ? 101 ASN A O   1 
ATOM   790  C  CB  . ASN A 1 101 ? 35.907 7.610  6.959   1.00 13.98 ? 101 ASN A CB  1 
ATOM   791  C  CG  . ASN A 1 101 ? 37.117 8.526  6.864   1.00 16.94 ? 101 ASN A CG  1 
ATOM   792  O  OD1 . ASN A 1 101 ? 36.988 9.748  6.692   1.00 14.93 ? 101 ASN A OD1 1 
ATOM   793  N  ND2 . ASN A 1 101 ? 38.299 7.940  6.897   1.00 9.34  ? 101 ASN A ND2 1 
ATOM   794  N  N   . MET A 1 102 ? 33.267 9.262  6.513   1.00 8.56  ? 102 MET A N   1 
ATOM   795  C  CA  . MET A 1 102 ? 32.575 10.441 6.033   1.00 12.45 ? 102 MET A CA  1 
ATOM   796  C  C   . MET A 1 102 ? 31.686 11.031 7.120   1.00 12.66 ? 102 MET A C   1 
ATOM   797  O  O   . MET A 1 102 ? 31.550 12.247 7.261   1.00 13.89 ? 102 MET A O   1 
ATOM   798  C  CB  . MET A 1 102 ? 31.666 10.118 4.843   1.00 12.46 ? 102 MET A CB  1 
ATOM   799  C  CG  . MET A 1 102 ? 32.414 9.788  3.558   1.00 10.82 ? 102 MET A CG  1 
ATOM   800  S  SD  . MET A 1 102 ? 31.280 9.528  2.154   1.00 23.27 ? 102 MET A SD  1 
ATOM   801  C  CE  . MET A 1 102 ? 30.787 11.232 1.868   1.00 16.11 ? 102 MET A CE  1 
ATOM   802  N  N   . VAL A 1 103 ? 31.003 10.165 7.865   1.00 12.87 ? 103 VAL A N   1 
ATOM   803  C  CA  . VAL A 1 103 ? 30.106 10.700 8.898   1.00 11.18 ? 103 VAL A CA  1 
ATOM   804  C  C   . VAL A 1 103 ? 30.926 11.369 10.025  1.00 20.21 ? 103 VAL A C   1 
ATOM   805  O  O   . VAL A 1 103 ? 30.546 12.371 10.589  1.00 17.88 ? 103 VAL A O   1 
ATOM   806  C  CB  . VAL A 1 103 ? 29.226 9.598  9.465   1.00 7.06  ? 103 VAL A CB  1 
ATOM   807  C  CG1 . VAL A 1 103 ? 28.554 10.087 10.772  1.00 15.50 ? 103 VAL A CG1 1 
ATOM   808  C  CG2 . VAL A 1 103 ? 28.147 9.216  8.429   1.00 9.37  ? 103 VAL A CG2 1 
ATOM   809  N  N   . PHE A 1 104 ? 32.081 10.821 10.335  1.00 12.47 ? 104 PHE A N   1 
ATOM   810  C  CA  . PHE A 1 104 ? 32.904 11.389 11.368  1.00 12.20 ? 104 PHE A CA  1 
ATOM   811  C  C   . PHE A 1 104 ? 33.332 12.795 10.991  1.00 20.07 ? 104 PHE A C   1 
ATOM   812  O  O   . PHE A 1 104 ? 33.371 13.731 11.795  1.00 14.85 ? 104 PHE A O   1 
ATOM   813  C  CB  . PHE A 1 104 ? 34.148 10.476 11.540  1.00 12.19 ? 104 PHE A CB  1 
ATOM   814  C  CG  . PHE A 1 104 ? 35.083 10.894 12.670  1.00 12.49 ? 104 PHE A CG  1 
ATOM   815  C  CD1 . PHE A 1 104 ? 36.059 11.875 12.473  1.00 12.71 ? 104 PHE A CD1 1 
ATOM   816  C  CD2 . PHE A 1 104 ? 35.006 10.257 13.918  1.00 15.20 ? 104 PHE A CD2 1 
ATOM   817  C  CE1 . PHE A 1 104 ? 36.938 12.237 13.503  1.00 16.72 ? 104 PHE A CE1 1 
ATOM   818  C  CE2 . PHE A 1 104 ? 35.916 10.565 14.930  1.00 13.74 ? 104 PHE A CE2 1 
ATOM   819  C  CZ  . PHE A 1 104 ? 36.847 11.588 14.732  1.00 11.90 ? 104 PHE A CZ  1 
ATOM   820  N  N   . GLN A 1 105 ? 33.681 12.955 9.718   1.00 17.10 ? 105 GLN A N   1 
ATOM   821  C  CA  . GLN A 1 105 ? 34.162 14.244 9.179   1.00 14.61 ? 105 GLN A CA  1 
ATOM   822  C  C   . GLN A 1 105 ? 33.075 15.293 8.981   1.00 16.14 ? 105 GLN A C   1 
ATOM   823  O  O   . GLN A 1 105 ? 33.227 16.442 9.322   1.00 23.49 ? 105 GLN A O   1 
ATOM   824  C  CB  . GLN A 1 105 ? 34.920 14.020 7.823   1.00 14.73 ? 105 GLN A CB  1 
ATOM   825  C  CG  . GLN A 1 105 ? 35.397 15.352 7.222   1.00 16.71 ? 105 GLN A CG  1 
ATOM   826  C  CD  . GLN A 1 105 ? 36.040 15.242 5.863   1.00 20.78 ? 105 GLN A CD  1 
ATOM   827  O  OE1 . GLN A 1 105 ? 36.071 14.173 5.253   1.00 15.78 ? 105 GLN A OE1 1 
ATOM   828  N  NE2 . GLN A 1 105 ? 36.580 16.357 5.389   1.00 18.86 ? 105 GLN A NE2 1 
ATOM   829  N  N   . MET A 1 106 ? 31.960 14.922 8.385   1.00 14.04 ? 106 MET A N   1 
ATOM   830  C  CA  . MET A 1 106 ? 30.918 15.894 8.043   1.00 13.91 ? 106 MET A CA  1 
ATOM   831  C  C   . MET A 1 106 ? 29.625 15.790 8.790   1.00 22.47 ? 106 MET A C   1 
ATOM   832  O  O   . MET A 1 106 ? 28.708 16.569 8.520   1.00 21.92 ? 106 MET A O   1 
ATOM   833  C  CB  . MET A 1 106 ? 30.442 15.555 6.637   1.00 18.65 ? 106 MET A CB  1 
ATOM   834  C  CG  . MET A 1 106 ? 31.449 15.805 5.557   1.00 32.47 ? 106 MET A CG  1 
ATOM   835  S  SD  . MET A 1 106 ? 30.640 15.309 4.048   1.00 51.70 ? 106 MET A SD  1 
ATOM   836  C  CE  . MET A 1 106 ? 31.942 14.383 3.327   1.00 36.30 ? 106 MET A CE  1 
ATOM   837  N  N   . GLY A 1 107 ? 29.503 14.790 9.632   1.00 16.15 ? 107 GLY A N   1 
ATOM   838  C  CA  . GLY A 1 107 ? 28.301 14.630 10.392  1.00 14.86 ? 107 GLY A CA  1 
ATOM   839  C  C   . GLY A 1 107 ? 27.226 13.920 9.582   1.00 20.17 ? 107 GLY A C   1 
ATOM   840  O  O   . GLY A 1 107 ? 27.235 13.911 8.370   1.00 21.70 ? 107 GLY A O   1 
ATOM   841  N  N   . GLU A 1 108 ? 26.300 13.322 10.302  1.00 22.73 ? 108 GLU A N   1 
ATOM   842  C  CA  . GLU A 1 108 ? 25.207 12.545 9.769   1.00 20.60 ? 108 GLU A CA  1 
ATOM   843  C  C   . GLU A 1 108 ? 24.310 13.288 8.775   1.00 28.47 ? 108 GLU A C   1 
ATOM   844  O  O   . GLU A 1 108 ? 23.925 12.759 7.715   1.00 21.36 ? 108 GLU A O   1 
ATOM   845  C  CB  . GLU A 1 108 ? 24.485 11.929 10.981  1.00 23.35 ? 108 GLU A CB  1 
ATOM   846  C  CG  . GLU A 1 108 ? 23.179 11.247 10.661  1.00 41.09 ? 108 GLU A CG  1 
ATOM   847  C  CD  . GLU A 1 108 ? 22.356 11.123 11.914  1.00 45.67 ? 108 GLU A CD  1 
ATOM   848  O  OE1 . GLU A 1 108 ? 23.092 10.983 12.975  1.00 56.44 ? 108 GLU A OE1 1 
ATOM   849  O  OE2 . GLU A 1 108 ? 21.138 11.145 11.929  1.00 47.37 ? 108 GLU A OE2 1 
ATOM   850  N  N   . THR A 1 109 ? 23.968 14.540 9.101   1.00 25.92 ? 109 THR A N   1 
ATOM   851  C  CA  . THR A 1 109 ? 23.133 15.312 8.221   1.00 24.30 ? 109 THR A CA  1 
ATOM   852  C  C   . THR A 1 109 ? 23.809 15.562 6.897   1.00 23.91 ? 109 THR A C   1 
ATOM   853  O  O   . THR A 1 109 ? 23.200 15.441 5.809   1.00 27.27 ? 109 THR A O   1 
ATOM   854  C  CB  . THR A 1 109 ? 22.711 16.645 8.863   1.00 28.13 ? 109 THR A CB  1 
ATOM   855  O  OG1 . THR A 1 109 ? 22.086 16.346 10.080  1.00 38.12 ? 109 THR A OG1 1 
ATOM   856  C  CG2 . THR A 1 109 ? 21.700 17.304 7.925   1.00 36.25 ? 109 THR A CG2 1 
ATOM   857  N  N   . GLY A 1 110 ? 25.102 15.897 7.017   1.00 20.82 ? 110 GLY A N   1 
ATOM   858  C  CA  . GLY A 1 110 ? 25.915 16.163 5.840   1.00 23.55 ? 110 GLY A CA  1 
ATOM   859  C  C   . GLY A 1 110 ? 25.916 14.977 4.872   1.00 32.61 ? 110 GLY A C   1 
ATOM   860  O  O   . GLY A 1 110 ? 25.599 15.110 3.696   1.00 22.64 ? 110 GLY A O   1 
ATOM   861  N  N   . VAL A 1 111 ? 26.274 13.795 5.401   1.00 24.37 ? 111 VAL A N   1 
ATOM   862  C  CA  . VAL A 1 111 ? 26.328 12.604 4.596   1.00 14.68 ? 111 VAL A CA  1 
ATOM   863  C  C   . VAL A 1 111 ? 24.986 12.205 3.980   1.00 26.64 ? 111 VAL A C   1 
ATOM   864  O  O   . VAL A 1 111 ? 24.882 11.891 2.795   1.00 17.68 ? 111 VAL A O   1 
ATOM   865  C  CB  . VAL A 1 111 ? 26.996 11.495 5.351   1.00 18.14 ? 111 VAL A CB  1 
ATOM   866  C  CG1 . VAL A 1 111 ? 27.078 10.276 4.410   1.00 14.98 ? 111 VAL A CG1 1 
ATOM   867  C  CG2 . VAL A 1 111 ? 28.380 12.037 5.738   1.00 15.63 ? 111 VAL A CG2 1 
ATOM   868  N  N   . ALA A 1 112 ? 23.948 12.252 4.794   1.00 19.32 ? 112 ALA A N   1 
ATOM   869  C  CA  . ALA A 1 112 ? 22.603 11.933 4.336   1.00 16.65 ? 112 ALA A CA  1 
ATOM   870  C  C   . ALA A 1 112 ? 22.226 12.822 3.150   1.00 26.89 ? 112 ALA A C   1 
ATOM   871  O  O   . ALA A 1 112 ? 21.398 12.437 2.322   1.00 33.15 ? 112 ALA A O   1 
ATOM   872  C  CB  . ALA A 1 112 ? 21.611 12.114 5.479   1.00 25.11 ? 112 ALA A CB  1 
ATOM   873  N  N   . GLY A 1 113 ? 22.883 13.995 3.045   1.00 19.76 ? 113 GLY A N   1 
ATOM   874  C  CA  . GLY A 1 113 ? 22.634 14.875 1.942   1.00 26.40 ? 113 GLY A CA  1 
ATOM   875  C  C   . GLY A 1 113 ? 23.114 14.350 0.575   1.00 37.59 ? 113 GLY A C   1 
ATOM   876  O  O   . GLY A 1 113 ? 22.692 14.858 -0.461  1.00 30.49 ? 113 GLY A O   1 
ATOM   877  N  N   . PHE A 1 114 ? 24.012 13.363 0.557   1.00 21.06 ? 114 PHE A N   1 
ATOM   878  C  CA  . PHE A 1 114 ? 24.572 12.817 -0.680  1.00 13.01 ? 114 PHE A CA  1 
ATOM   879  C  C   . PHE A 1 114 ? 23.609 11.754 -1.206  1.00 18.96 ? 114 PHE A C   1 
ATOM   880  O  O   . PHE A 1 114 ? 23.959 10.629 -1.492  1.00 16.93 ? 114 PHE A O   1 
ATOM   881  C  CB  . PHE A 1 114 ? 25.975 12.197 -0.434  1.00 18.23 ? 114 PHE A CB  1 
ATOM   882  C  CG  . PHE A 1 114 ? 27.175 13.130 -0.245  1.00 22.37 ? 114 PHE A CG  1 
ATOM   883  C  CD1 . PHE A 1 114 ? 27.245 14.033 0.808   1.00 33.13 ? 114 PHE A CD1 1 
ATOM   884  C  CD2 . PHE A 1 114 ? 28.267 13.097 -1.114  1.00 28.10 ? 114 PHE A CD2 1 
ATOM   885  C  CE1 . PHE A 1 114 ? 28.335 14.893 0.978   1.00 19.47 ? 114 PHE A CE1 1 
ATOM   886  C  CE2 . PHE A 1 114 ? 29.371 13.951 -0.981  1.00 27.04 ? 114 PHE A CE2 1 
ATOM   887  C  CZ  . PHE A 1 114 ? 29.411 14.840 0.092   1.00 22.80 ? 114 PHE A CZ  1 
ATOM   888  N  N   . THR A 1 115 ? 22.379 12.154 -1.371  1.00 12.89 ? 115 THR A N   1 
ATOM   889  C  CA  . THR A 1 115 ? 21.325 11.269 -1.777  1.00 12.17 ? 115 THR A CA  1 
ATOM   890  C  C   . THR A 1 115 ? 21.581 10.400 -2.971  1.00 23.03 ? 115 THR A C   1 
ATOM   891  O  O   . THR A 1 115 ? 21.314 9.212  -2.933  1.00 15.31 ? 115 THR A O   1 
ATOM   892  C  CB  . THR A 1 115 ? 19.977 12.008 -1.935  1.00 21.23 ? 115 THR A CB  1 
ATOM   893  O  OG1 . THR A 1 115 ? 19.609 12.605 -0.711  1.00 38.60 ? 115 THR A OG1 1 
ATOM   894  C  CG2 . THR A 1 115 ? 18.902 10.992 -2.306  1.00 26.60 ? 115 THR A CG2 1 
ATOM   895  N  N   . ASN A 1 116 ? 22.048 10.988 -4.058  1.00 15.67 ? 116 ASN A N   1 
ATOM   896  C  CA  . ASN A 1 116 ? 22.295 10.216 -5.301  1.00 15.36 ? 116 ASN A CA  1 
ATOM   897  C  C   . ASN A 1 116 ? 23.434 9.196  -5.193  1.00 12.13 ? 116 ASN A C   1 
ATOM   898  O  O   . ASN A 1 116 ? 23.395 8.081  -5.736  1.00 15.02 ? 116 ASN A O   1 
ATOM   899  C  CB  . ASN A 1 116 ? 22.468 11.142 -6.568  1.00 22.65 ? 116 ASN A CB  1 
ATOM   900  C  CG  . ASN A 1 116 ? 21.283 12.113 -6.788  1.00 20.43 ? 116 ASN A CG  1 
ATOM   901  O  OD1 . ASN A 1 116 ? 20.122 11.739 -6.574  1.00 23.46 ? 116 ASN A OD1 1 
ATOM   902  N  ND2 . ASN A 1 116 ? 21.552 13.368 -7.152  1.00 18.12 ? 116 ASN A ND2 1 
ATOM   903  N  N   . SER A 1 117 ? 24.524 9.637  -4.552  1.00 13.22 ? 117 SER A N   1 
ATOM   904  C  CA  . SER A 1 117 ? 25.708 8.787  -4.352  1.00 13.93 ? 117 SER A CA  1 
ATOM   905  C  C   . SER A 1 117 ? 25.340 7.622  -3.461  1.00 12.75 ? 117 SER A C   1 
ATOM   906  O  O   . SER A 1 117 ? 25.762 6.513  -3.704  1.00 16.17 ? 117 SER A O   1 
ATOM   907  C  CB  . SER A 1 117 ? 26.841 9.536  -3.652  1.00 14.72 ? 117 SER A CB  1 
ATOM   908  O  OG  . SER A 1 117 ? 27.189 10.734 -4.334  1.00 22.83 ? 117 SER A OG  1 
ATOM   909  N  N   . LEU A 1 118 ? 24.539 7.888  -2.425  1.00 16.11 ? 118 LEU A N   1 
ATOM   910  C  CA  . LEU A 1 118 ? 24.081 6.831  -1.496  1.00 15.57 ? 118 LEU A CA  1 
ATOM   911  C  C   . LEU A 1 118 ? 23.299 5.749  -2.217  1.00 14.94 ? 118 LEU A C   1 
ATOM   912  O  O   . LEU A 1 118 ? 23.422 4.578  -1.909  1.00 18.51 ? 118 LEU A O   1 
ATOM   913  C  CB  . LEU A 1 118 ? 23.215 7.394  -0.312  1.00 14.29 ? 118 LEU A CB  1 
ATOM   914  C  CG  . LEU A 1 118 ? 24.001 8.338  0.650   1.00 19.28 ? 118 LEU A CG  1 
ATOM   915  C  CD1 . LEU A 1 118 ? 23.064 8.834  1.711   1.00 19.45 ? 118 LEU A CD1 1 
ATOM   916  C  CD2 . LEU A 1 118 ? 25.156 7.612  1.353   1.00 13.48 ? 118 LEU A CD2 1 
ATOM   917  N  N   . ARG A 1 119 ? 22.450 6.148  -3.161  1.00 17.92 ? 119 ARG A N   1 
ATOM   918  C  CA  . ARG A 1 119 ? 21.629 5.197  -3.931  1.00 15.94 ? 119 ARG A CA  1 
ATOM   919  C  C   . ARG A 1 119 ? 22.506 4.331  -4.811  1.00 14.05 ? 119 ARG A C   1 
ATOM   920  O  O   . ARG A 1 119 ? 22.368 3.107  -4.885  1.00 18.68 ? 119 ARG A O   1 
ATOM   921  C  CB  . ARG A 1 119 ? 20.602 5.988  -4.716  1.00 20.88 ? 119 ARG A CB  1 
ATOM   922  C  CG  . ARG A 1 119 ? 19.792 5.179  -5.712  1.00 27.93 ? 119 ARG A CG  1 
ATOM   923  C  CD  . ARG A 1 119 ? 18.954 6.135  -6.571  1.00 32.62 ? 119 ARG A CD  1 
ATOM   924  N  NE  . ARG A 1 119 ? 19.590 6.371  -7.869  1.00 53.09 ? 119 ARG A NE  1 
ATOM   925  C  CZ  . ARG A 1 119 ? 20.351 7.436  -8.137  1.00 59.07 ? 119 ARG A CZ  1 
ATOM   926  N  NH1 . ARG A 1 119 ? 20.552 8.407  -7.235  1.00 54.62 ? 119 ARG A NH1 1 
ATOM   927  N  NH2 . ARG A 1 119 ? 20.907 7.538  -9.357  1.00 65.05 ? 119 ARG A NH2 1 
ATOM   928  N  N   . MET A 1 120 ? 23.527 4.975  -5.400  1.00 13.99 ? 120 MET A N   1 
ATOM   929  C  CA  . MET A 1 120 ? 24.517 4.242  -6.194  1.00 15.39 ? 120 MET A CA  1 
ATOM   930  C  C   . MET A 1 120 ? 25.312 3.246  -5.344  1.00 14.27 ? 120 MET A C   1 
ATOM   931  O  O   . MET A 1 120 ? 25.598 2.121  -5.760  1.00 16.72 ? 120 MET A O   1 
ATOM   932  C  CB  . MET A 1 120 ? 25.519 5.136  -7.009  1.00 12.00 ? 120 MET A CB  1 
ATOM   933  C  CG  . MET A 1 120 ? 24.814 5.916  -8.108  1.00 23.31 ? 120 MET A CG  1 
ATOM   934  S  SD  . MET A 1 120 ? 25.906 7.206  -8.678  1.00 29.41 ? 120 MET A SD  1 
ATOM   935  C  CE  . MET A 1 120 ? 24.759 8.418  -9.361  1.00 30.03 ? 120 MET A CE  1 
ATOM   936  N  N   . LEU A 1 121 ? 25.676 3.630  -4.109  1.00 16.27 ? 121 LEU A N   1 
ATOM   937  C  CA  . LEU A 1 121 ? 26.424 2.667  -3.284  1.00 9.67  ? 121 LEU A CA  1 
ATOM   938  C  C   . LEU A 1 121 ? 25.517 1.483  -2.935  1.00 14.35 ? 121 LEU A C   1 
ATOM   939  O  O   . LEU A 1 121 ? 25.884 0.304  -2.937  1.00 14.07 ? 121 LEU A O   1 
ATOM   940  C  CB  . LEU A 1 121 ? 26.947 3.343  -1.985  1.00 15.93 ? 121 LEU A CB  1 
ATOM   941  C  CG  . LEU A 1 121 ? 28.065 4.361  -2.257  1.00 15.82 ? 121 LEU A CG  1 
ATOM   942  C  CD1 . LEU A 1 121 ? 28.210 5.246  -1.014  1.00 21.28 ? 121 LEU A CD1 1 
ATOM   943  C  CD2 . LEU A 1 121 ? 29.392 3.652  -2.518  1.00 11.17 ? 121 LEU A CD2 1 
ATOM   944  N  N   . GLN A 1 122 ? 24.293 1.824  -2.607  1.00 11.36 ? 122 GLN A N   1 
ATOM   945  C  CA  . GLN A 1 122 ? 23.395 0.806  -2.260  1.00 11.28 ? 122 GLN A CA  1 
ATOM   946  C  C   . GLN A 1 122 ? 23.221 -0.161 -3.417  1.00 28.74 ? 122 GLN A C   1 
ATOM   947  O  O   . GLN A 1 122 ? 23.117 -1.374 -3.238  1.00 24.08 ? 122 GLN A O   1 
ATOM   948  C  CB  . GLN A 1 122 ? 22.101 1.401  -1.744  1.00 14.65 ? 122 GLN A CB  1 
ATOM   949  C  CG  . GLN A 1 122 ? 21.282 0.311  -1.088  1.00 31.28 ? 122 GLN A CG  1 
ATOM   950  C  CD  . GLN A 1 122 ? 20.118 0.880  -0.339  1.00 48.42 ? 122 GLN A CD  1 
ATOM   951  O  OE1 . GLN A 1 122 ? 20.013 2.113  -0.155  1.00 42.83 ? 122 GLN A OE1 1 
ATOM   952  N  NE2 . GLN A 1 122 ? 19.242 -0.043 0.084   1.00 61.09 ? 122 GLN A NE2 1 
ATOM   953  N  N   . GLN A 1 123 ? 23.252 0.365  -4.635  1.00 18.36 ? 123 GLN A N   1 
ATOM   954  C  CA  . GLN A 1 123 ? 23.099 -0.478 -5.804  1.00 15.27 ? 123 GLN A CA  1 
ATOM   955  C  C   . GLN A 1 123 ? 24.351 -1.171 -6.199  1.00 25.45 ? 123 GLN A C   1 
ATOM   956  O  O   . GLN A 1 123 ? 24.319 -1.846 -7.219  1.00 20.21 ? 123 GLN A O   1 
ATOM   957  C  CB  . GLN A 1 123 ? 22.590 0.298  -7.036  1.00 15.63 ? 123 GLN A CB  1 
ATOM   958  C  CG  . GLN A 1 123 ? 21.182 0.842  -6.782  1.00 23.66 ? 123 GLN A CG  1 
ATOM   959  C  CD  . GLN A 1 123 ? 20.660 1.650  -7.934  1.00 30.56 ? 123 GLN A CD  1 
ATOM   960  O  OE1 . GLN A 1 123 ? 20.184 1.069  -8.903  1.00 62.99 ? 123 GLN A OE1 1 
ATOM   961  N  NE2 . GLN A 1 123 ? 20.775 2.972  -7.874  1.00 49.42 ? 123 GLN A NE2 1 
ATOM   962  N  N   . LYS A 1 124 ? 25.439 -0.962 -5.460  1.00 14.44 ? 124 LYS A N   1 
ATOM   963  C  CA  . LYS A 1 124 ? 26.730 -1.558 -5.797  1.00 13.98 ? 124 LYS A CA  1 
ATOM   964  C  C   . LYS A 1 124 ? 27.330 -1.114 -7.138  1.00 16.42 ? 124 LYS A C   1 
ATOM   965  O  O   . LYS A 1 124 ? 28.065 -1.890 -7.775  1.00 16.45 ? 124 LYS A O   1 
ATOM   966  C  CB  . LYS A 1 124 ? 26.843 -3.071 -5.601  1.00 24.58 ? 124 LYS A CB  1 
ATOM   967  C  CG  . LYS A 1 124 ? 26.258 -3.528 -4.262  1.00 17.09 ? 124 LYS A CG  1 
ATOM   968  C  CD  . LYS A 1 124 ? 26.847 -4.817 -3.717  1.00 16.29 ? 124 LYS A CD  1 
ATOM   969  C  CE  . LYS A 1 124 ? 26.234 -5.146 -2.359  1.00 15.44 ? 124 LYS A CE  1 
ATOM   970  N  NZ  . LYS A 1 124 ? 26.882 -4.411 -1.312  1.00 22.56 ? 124 LYS A NZ  1 
ATOM   971  N  N   . ARG A 1 125 ? 27.055 0.141  -7.527  1.00 16.90 ? 125 ARG A N   1 
ATOM   972  C  CA  . ARG A 1 125 ? 27.588 0.765  -8.732  1.00 17.47 ? 125 ARG A CA  1 
ATOM   973  C  C   . ARG A 1 125 ? 28.786 1.615  -8.322  1.00 15.33 ? 125 ARG A C   1 
ATOM   974  O  O   . ARG A 1 125 ? 28.715 2.845  -8.267  1.00 19.29 ? 125 ARG A O   1 
ATOM   975  C  CB  . ARG A 1 125 ? 26.508 1.604  -9.435  1.00 17.25 ? 125 ARG A CB  1 
ATOM   976  C  CG  . ARG A 1 125 ? 25.402 0.763  -10.104 1.00 18.93 ? 125 ARG A CG  1 
ATOM   977  C  CD  . ARG A 1 125 ? 24.250 1.676  -10.511 1.00 29.21 ? 125 ARG A CD  1 
ATOM   978  N  NE  . ARG A 1 125 ? 23.481 1.315  -11.712 1.00 62.55 ? 125 ARG A NE  1 
ATOM   979  C  CZ  . ARG A 1 125 ? 22.488 0.383  -11.763 1.00 67.74 ? 125 ARG A CZ  1 
ATOM   980  N  NH1 . ARG A 1 125 ? 22.135 -0.379 -10.710 1.00 69.00 ? 125 ARG A NH1 1 
ATOM   981  N  NH2 . ARG A 1 125 ? 21.839 0.182  -12.918 1.00 57.93 ? 125 ARG A NH2 1 
ATOM   982  N  N   . TRP A 1 126 ? 29.867 0.928  -8.006  1.00 17.33 ? 126 TRP A N   1 
ATOM   983  C  CA  . TRP A 1 126 ? 31.080 1.487  -7.451  1.00 13.24 ? 126 TRP A CA  1 
ATOM   984  C  C   . TRP A 1 126 ? 31.713 2.620  -8.203  1.00 18.01 ? 126 TRP A C   1 
ATOM   985  O  O   . TRP A 1 126 ? 31.998 3.682  -7.644  1.00 15.80 ? 126 TRP A O   1 
ATOM   986  C  CB  . TRP A 1 126 ? 32.106 0.436  -7.041  1.00 8.87  ? 126 TRP A CB  1 
ATOM   987  C  CG  . TRP A 1 126 ? 31.500 -0.733 -6.300  1.00 14.96 ? 126 TRP A CG  1 
ATOM   988  C  CD1 . TRP A 1 126 ? 31.658 -2.042 -6.647  1.00 15.05 ? 126 TRP A CD1 1 
ATOM   989  C  CD2 . TRP A 1 126 ? 30.701 -0.730 -5.104  1.00 16.53 ? 126 TRP A CD2 1 
ATOM   990  N  NE1 . TRP A 1 126 ? 31.005 -2.857 -5.754  1.00 13.00 ? 126 TRP A NE1 1 
ATOM   991  C  CE2 . TRP A 1 126 ? 30.424 -2.071 -4.777  1.00 16.12 ? 126 TRP A CE2 1 
ATOM   992  C  CE3 . TRP A 1 126 ? 30.220 0.294  -4.254  1.00 14.88 ? 126 TRP A CE3 1 
ATOM   993  C  CZ2 . TRP A 1 126 ? 29.706 -2.433 -3.616  1.00 14.47 ? 126 TRP A CZ2 1 
ATOM   994  C  CZ3 . TRP A 1 126 ? 29.434 -0.044 -3.161  1.00 10.99 ? 126 TRP A CZ3 1 
ATOM   995  C  CH2 . TRP A 1 126 ? 29.209 -1.398 -2.817  1.00 15.31 ? 126 TRP A CH2 1 
ATOM   996  N  N   . ASP A 1 127 ? 31.966 2.388  -9.476  1.00 20.28 ? 127 ASP A N   1 
ATOM   997  C  CA  . ASP A 1 127 ? 32.570 3.417  -10.308 1.00 19.56 ? 127 ASP A CA  1 
ATOM   998  C  C   . ASP A 1 127 ? 31.680 4.642  -10.472 1.00 15.87 ? 127 ASP A C   1 
ATOM   999  O  O   . ASP A 1 127 ? 32.139 5.799  -10.419 1.00 20.04 ? 127 ASP A O   1 
ATOM   1000 C  CB  . ASP A 1 127 ? 33.008 2.846  -11.673 1.00 18.42 ? 127 ASP A CB  1 
ATOM   1001 C  CG  . ASP A 1 127 ? 34.199 1.924  -11.543 1.00 19.22 ? 127 ASP A CG  1 
ATOM   1002 O  OD1 . ASP A 1 127 ? 34.543 1.388  -10.509 1.00 44.62 ? 127 ASP A OD1 1 
ATOM   1003 O  OD2 . ASP A 1 127 ? 34.791 1.702  -12.676 1.00 37.43 ? 127 ASP A OD2 1 
ATOM   1004 N  N   . GLU A 1 128 ? 30.377 4.388  -10.652 1.00 10.33 ? 128 GLU A N   1 
ATOM   1005 C  CA  . GLU A 1 128 ? 29.502 5.497  -10.804 1.00 17.14 ? 128 GLU A CA  1 
ATOM   1006 C  C   . GLU A 1 128 ? 29.424 6.320  -9.547  1.00 25.88 ? 128 GLU A C   1 
ATOM   1007 O  O   . GLU A 1 128 ? 29.374 7.536  -9.628  1.00 18.22 ? 128 GLU A O   1 
ATOM   1008 C  CB  . GLU A 1 128 ? 28.107 5.096  -11.302 1.00 26.23 ? 128 GLU A CB  1 
ATOM   1009 C  CG  . GLU A 1 128 ? 28.265 4.157  -12.515 1.00 35.67 ? 128 GLU A CG  1 
ATOM   1010 C  CD  . GLU A 1 128 ? 26.980 3.474  -12.903 1.00 50.57 ? 128 GLU A CD  1 
ATOM   1011 O  OE1 . GLU A 1 128 ? 26.017 4.328  -13.229 1.00 48.78 ? 128 GLU A OE1 1 
ATOM   1012 O  OE2 . GLU A 1 128 ? 26.864 2.254  -12.928 1.00 60.42 ? 128 GLU A OE2 1 
ATOM   1013 N  N   . ALA A 1 129 ? 29.394 5.632  -8.394  1.00 20.46 ? 129 ALA A N   1 
ATOM   1014 C  CA  . ALA A 1 129 ? 29.320 6.326  -7.100  1.00 16.21 ? 129 ALA A CA  1 
ATOM   1015 C  C   . ALA A 1 129 ? 30.573 7.208  -6.860  1.00 14.35 ? 129 ALA A C   1 
ATOM   1016 O  O   . ALA A 1 129 ? 30.470 8.335  -6.331  1.00 15.77 ? 129 ALA A O   1 
ATOM   1017 C  CB  . ALA A 1 129 ? 29.099 5.337  -5.960  1.00 13.32 ? 129 ALA A CB  1 
ATOM   1018 N  N   . ALA A 1 130 ? 31.747 6.670  -7.244  1.00 14.00 ? 130 ALA A N   1 
ATOM   1019 C  CA  . ALA A 1 130 ? 32.995 7.354  -7.041  1.00 11.57 ? 130 ALA A CA  1 
ATOM   1020 C  C   . ALA A 1 130 ? 33.050 8.645  -7.834  1.00 25.26 ? 130 ALA A C   1 
ATOM   1021 O  O   . ALA A 1 130 ? 33.519 9.668  -7.352  1.00 17.24 ? 130 ALA A O   1 
ATOM   1022 C  CB  . ALA A 1 130 ? 34.152 6.421  -7.320  1.00 10.52 ? 130 ALA A CB  1 
ATOM   1023 N  N   . VAL A 1 131 ? 32.481 8.613  -9.046  1.00 15.20 ? 131 VAL A N   1 
ATOM   1024 C  CA  . VAL A 1 131 ? 32.440 9.793  -9.894  1.00 20.05 ? 131 VAL A CA  1 
ATOM   1025 C  C   . VAL A 1 131 ? 31.513 10.844 -9.297  1.00 16.40 ? 131 VAL A C   1 
ATOM   1026 O  O   . VAL A 1 131 ? 31.820 12.018 -9.239  1.00 21.85 ? 131 VAL A O   1 
ATOM   1027 C  CB  . VAL A 1 131 ? 31.988 9.412  -11.309 1.00 18.20 ? 131 VAL A CB  1 
ATOM   1028 C  CG1 . VAL A 1 131 ? 31.435 10.626 -12.024 1.00 24.84 ? 131 VAL A CG1 1 
ATOM   1029 C  CG2 . VAL A 1 131 ? 33.170 8.855  -12.063 1.00 19.29 ? 131 VAL A CG2 1 
ATOM   1030 N  N   . ASN A 1 132 ? 30.355 10.418 -8.840  1.00 17.93 ? 132 ASN A N   1 
ATOM   1031 C  CA  . ASN A 1 132 ? 29.369 11.325 -8.231  1.00 15.93 ? 132 ASN A CA  1 
ATOM   1032 C  C   . ASN A 1 132 ? 29.862 11.927 -6.901  1.00 17.67 ? 132 ASN A C   1 
ATOM   1033 O  O   . ASN A 1 132 ? 29.601 13.084 -6.563  1.00 15.78 ? 132 ASN A O   1 
ATOM   1034 C  CB  . ASN A 1 132 ? 28.032 10.556 -8.029  1.00 17.52 ? 132 ASN A CB  1 
ATOM   1035 C  CG  . ASN A 1 132 ? 26.856 11.483 -7.799  1.00 25.47 ? 132 ASN A CG  1 
ATOM   1036 O  OD1 . ASN A 1 132 ? 26.308 11.584 -6.701  1.00 34.08 ? 132 ASN A OD1 1 
ATOM   1037 N  ND2 . ASN A 1 132 ? 26.536 12.226 -8.824  1.00 29.44 ? 132 ASN A ND2 1 
ATOM   1038 N  N   . LEU A 1 133 ? 30.545 11.106 -6.081  1.00 10.35 ? 133 LEU A N   1 
ATOM   1039 C  CA  . LEU A 1 133 ? 31.034 11.606 -4.778  1.00 7.62  ? 133 LEU A CA  1 
ATOM   1040 C  C   . LEU A 1 133 ? 32.007 12.763 -4.968  1.00 13.22 ? 133 LEU A C   1 
ATOM   1041 O  O   . LEU A 1 133 ? 32.069 13.667 -4.131  1.00 16.23 ? 133 LEU A O   1 
ATOM   1042 C  CB  . LEU A 1 133 ? 31.732 10.441 -4.029  1.00 9.77  ? 133 LEU A CB  1 
ATOM   1043 C  CG  . LEU A 1 133 ? 30.773 9.478  -3.281  1.00 16.89 ? 133 LEU A CG  1 
ATOM   1044 C  CD1 . LEU A 1 133 ? 31.532 8.206  -2.838  1.00 13.56 ? 133 LEU A CD1 1 
ATOM   1045 C  CD2 . LEU A 1 133 ? 30.137 10.193 -2.096  1.00 14.67 ? 133 LEU A CD2 1 
ATOM   1046 N  N   . ALA A 1 134 ? 32.787 12.715 -6.092  1.00 13.69 ? 134 ALA A N   1 
ATOM   1047 C  CA  . ALA A 1 134 ? 33.836 13.732 -6.405  1.00 14.12 ? 134 ALA A CA  1 
ATOM   1048 C  C   . ALA A 1 134 ? 33.281 15.078 -6.837  1.00 11.26 ? 134 ALA A C   1 
ATOM   1049 O  O   . ALA A 1 134 ? 33.988 16.060 -6.845  1.00 16.70 ? 134 ALA A O   1 
ATOM   1050 C  CB  . ALA A 1 134 ? 34.851 13.203 -7.414  1.00 16.28 ? 134 ALA A CB  1 
ATOM   1051 N  N   . LYS A 1 135 ? 32.013 15.112 -7.209  1.00 16.13 ? 135 LYS A N   1 
ATOM   1052 C  CA  . LYS A 1 135 ? 31.387 16.382 -7.619  1.00 16.99 ? 135 LYS A CA  1 
ATOM   1053 C  C   . LYS A 1 135 ? 30.799 17.061 -6.382  1.00 18.39 ? 135 LYS A C   1 
ATOM   1054 O  O   . LYS A 1 135 ? 29.579 17.180 -6.239  1.00 18.89 ? 135 LYS A O   1 
ATOM   1055 C  CB  . LYS A 1 135 ? 30.255 16.141 -8.610  1.00 12.59 ? 135 LYS A CB  1 
ATOM   1056 C  CG  . LYS A 1 135 ? 30.804 15.472 -9.837  1.00 21.46 ? 135 LYS A CG  1 
ATOM   1057 C  CD  . LYS A 1 135 ? 29.695 15.029 -10.765 1.00 39.03 ? 135 LYS A CD  1 
ATOM   1058 C  CE  . LYS A 1 135 ? 30.225 14.875 -12.192 1.00 46.98 ? 135 LYS A CE  1 
ATOM   1059 N  NZ  . LYS A 1 135 ? 29.598 13.737 -12.907 1.00 51.10 ? 135 LYS A NZ  1 
ATOM   1060 N  N   . SER A 1 136 ? 31.673 17.418 -5.461  1.00 12.07 ? 136 SER A N   1 
ATOM   1061 C  CA  . SER A 1 136 ? 31.223 17.964 -4.204  1.00 11.97 ? 136 SER A CA  1 
ATOM   1062 C  C   . SER A 1 136 ? 32.228 18.964 -3.649  1.00 15.85 ? 136 SER A C   1 
ATOM   1063 O  O   . SER A 1 136 ? 33.413 18.914 -3.946  1.00 19.41 ? 136 SER A O   1 
ATOM   1064 C  CB  . SER A 1 136 ? 31.110 16.833 -3.165  1.00 9.09  ? 136 SER A CB  1 
ATOM   1065 O  OG  . SER A 1 136 ? 32.366 16.122 -3.089  1.00 13.11 ? 136 SER A OG  1 
ATOM   1066 N  N   . ARG A 1 137 ? 31.746 19.827 -2.768  1.00 9.85  ? 137 ARG A N   1 
ATOM   1067 C  CA  . ARG A 1 137 ? 32.616 20.773 -2.088  1.00 12.13 ? 137 ARG A CA  1 
ATOM   1068 C  C   . ARG A 1 137 ? 33.623 19.993 -1.275  1.00 11.00 ? 137 ARG A C   1 
ATOM   1069 O  O   . ARG A 1 137 ? 34.796 20.304 -1.183  1.00 16.05 ? 137 ARG A O   1 
ATOM   1070 C  CB  . ARG A 1 137 ? 31.782 21.592 -1.104  1.00 15.30 ? 137 ARG A CB  1 
ATOM   1071 C  CG  . ARG A 1 137 ? 32.718 22.533 -0.333  1.00 14.07 ? 137 ARG A CG  1 
ATOM   1072 C  CD  . ARG A 1 137 ? 31.978 23.377 0.687   1.00 21.59 ? 137 ARG A CD  1 
ATOM   1073 N  NE  . ARG A 1 137 ? 32.783 24.494 1.161   1.00 32.13 ? 137 ARG A NE  1 
ATOM   1074 C  CZ  . ARG A 1 137 ? 33.585 24.424 2.219   1.00 42.45 ? 137 ARG A CZ  1 
ATOM   1075 N  NH1 . ARG A 1 137 ? 33.714 23.321 2.929   1.00 26.07 ? 137 ARG A NH1 1 
ATOM   1076 N  NH2 . ARG A 1 137 ? 34.293 25.493 2.580   1.00 38.68 ? 137 ARG A NH2 1 
ATOM   1077 N  N   . TRP A 1 138 ? 33.113 18.895 -0.698  1.00 13.00 ? 138 TRP A N   1 
ATOM   1078 C  CA  . TRP A 1 138 ? 33.941 17.979 0.126   1.00 13.46 ? 138 TRP A CA  1 
ATOM   1079 C  C   . TRP A 1 138 ? 35.233 17.610 -0.591  1.00 15.16 ? 138 TRP A C   1 
ATOM   1080 O  O   . TRP A 1 138 ? 36.360 17.735 -0.090  1.00 13.41 ? 138 TRP A O   1 
ATOM   1081 C  CB  . TRP A 1 138 ? 33.119 16.691 0.466   1.00 19.74 ? 138 TRP A CB  1 
ATOM   1082 C  CG  . TRP A 1 138 ? 33.928 15.558 1.080   1.00 13.63 ? 138 TRP A CG  1 
ATOM   1083 C  CD1 . TRP A 1 138 ? 34.696 15.625 2.223   1.00 14.47 ? 138 TRP A CD1 1 
ATOM   1084 C  CD2 . TRP A 1 138 ? 34.043 14.206 0.571   1.00 11.53 ? 138 TRP A CD2 1 
ATOM   1085 N  NE1 . TRP A 1 138 ? 35.261 14.381 2.481   1.00 15.26 ? 138 TRP A NE1 1 
ATOM   1086 C  CE2 . TRP A 1 138 ? 34.839 13.481 1.498   1.00 10.18 ? 138 TRP A CE2 1 
ATOM   1087 C  CE3 . TRP A 1 138 ? 33.472 13.547 -0.499  1.00 8.83  ? 138 TRP A CE3 1 
ATOM   1088 C  CZ2 . TRP A 1 138 ? 35.084 12.111 1.345   1.00 13.12 ? 138 TRP A CZ2 1 
ATOM   1089 C  CZ3 . TRP A 1 138 ? 33.774 12.211 -0.677  1.00 17.26 ? 138 TRP A CZ3 1 
ATOM   1090 C  CH2 . TRP A 1 138 ? 34.534 11.496 0.263   1.00 15.20 ? 138 TRP A CH2 1 
ATOM   1091 N  N   . TYR A 1 139 ? 35.074 17.137 -1.820  1.00 8.40  ? 139 TYR A N   1 
ATOM   1092 C  CA  . TYR A 1 139 ? 36.213 16.697 -2.613  1.00 10.43 ? 139 TYR A CA  1 
ATOM   1093 C  C   . TYR A 1 139 ? 37.091 17.864 -2.973  1.00 19.96 ? 139 TYR A C   1 
ATOM   1094 O  O   . TYR A 1 139 ? 38.325 17.780 -2.949  1.00 16.12 ? 139 TYR A O   1 
ATOM   1095 C  CB  . TYR A 1 139 ? 35.673 16.112 -3.920  1.00 10.82 ? 139 TYR A CB  1 
ATOM   1096 C  CG  . TYR A 1 139 ? 36.752 15.595 -4.804  1.00 20.04 ? 139 TYR A CG  1 
ATOM   1097 C  CD1 . TYR A 1 139 ? 37.234 14.301 -4.629  1.00 18.87 ? 139 TYR A CD1 1 
ATOM   1098 C  CD2 . TYR A 1 139 ? 37.268 16.384 -5.842  1.00 23.85 ? 139 TYR A CD2 1 
ATOM   1099 C  CE1 . TYR A 1 139 ? 38.224 13.756 -5.455  1.00 21.40 ? 139 TYR A CE1 1 
ATOM   1100 C  CE2 . TYR A 1 139 ? 38.270 15.862 -6.665  1.00 36.00 ? 139 TYR A CE2 1 
ATOM   1101 C  CZ  . TYR A 1 139 ? 38.733 14.551 -6.472  1.00 39.91 ? 139 TYR A CZ  1 
ATOM   1102 O  OH  . TYR A 1 139 ? 39.713 14.038 -7.257  1.00 43.41 ? 139 TYR A OH  1 
ATOM   1103 N  N   . ASN A 1 140 ? 36.453 18.969 -3.336  1.00 13.45 ? 140 ASN A N   1 
ATOM   1104 C  CA  . ASN A 1 140 ? 37.256 20.141 -3.726  1.00 13.14 ? 140 ASN A CA  1 
ATOM   1105 C  C   . ASN A 1 140 ? 38.058 20.778 -2.575  1.00 18.04 ? 140 ASN A C   1 
ATOM   1106 O  O   . ASN A 1 140 ? 39.147 21.321 -2.748  1.00 18.98 ? 140 ASN A O   1 
ATOM   1107 C  CB  . ASN A 1 140 ? 36.385 21.195 -4.451  1.00 21.30 ? 140 ASN A CB  1 
ATOM   1108 C  CG  . ASN A 1 140 ? 36.098 20.755 -5.860  1.00 16.27 ? 140 ASN A CG  1 
ATOM   1109 O  OD1 . ASN A 1 140 ? 35.020 20.245 -6.131  1.00 24.12 ? 140 ASN A OD1 1 
ATOM   1110 N  ND2 . ASN A 1 140 ? 37.086 20.843 -6.741  1.00 23.96 ? 140 ASN A ND2 1 
ATOM   1111 N  N   . GLN A 1 141 ? 37.511 20.724 -1.382  1.00 14.01 ? 141 GLN A N   1 
ATOM   1112 C  CA  . GLN A 1 141 ? 38.173 21.289 -0.215  1.00 16.19 ? 141 GLN A CA  1 
ATOM   1113 C  C   . GLN A 1 141 ? 39.226 20.369 0.406   1.00 21.49 ? 141 GLN A C   1 
ATOM   1114 O  O   . GLN A 1 141 ? 40.241 20.834 0.895   1.00 18.58 ? 141 GLN A O   1 
ATOM   1115 C  CB  . GLN A 1 141 ? 37.164 21.779 0.881   1.00 18.27 ? 141 GLN A CB  1 
ATOM   1116 C  CG  . GLN A 1 141 ? 36.201 22.868 0.345   1.00 28.16 ? 141 GLN A CG  1 
ATOM   1117 C  CD  . GLN A 1 141 ? 36.846 24.144 -0.199  1.00 31.66 ? 141 GLN A CD  1 
ATOM   1118 O  OE1 . GLN A 1 141 ? 36.512 24.630 -1.313  1.00 25.15 ? 141 GLN A OE1 1 
ATOM   1119 N  NE2 . GLN A 1 141 ? 37.745 24.717 0.595   1.00 19.17 ? 141 GLN A NE2 1 
ATOM   1120 N  N   . THR A 1 142 ? 38.990 19.064 0.463   1.00 13.99 ? 142 THR A N   1 
ATOM   1121 C  CA  . THR A 1 142 ? 39.991 18.160 1.048   1.00 7.50  ? 142 THR A CA  1 
ATOM   1122 C  C   . THR A 1 142 ? 40.157 17.043 0.070   1.00 17.68 ? 142 THR A C   1 
ATOM   1123 O  O   . THR A 1 142 ? 39.779 15.926 0.349   1.00 13.38 ? 142 THR A O   1 
ATOM   1124 C  CB  . THR A 1 142 ? 39.552 17.577 2.423   1.00 15.57 ? 142 THR A CB  1 
ATOM   1125 O  OG1 . THR A 1 142 ? 38.196 17.137 2.332   1.00 17.07 ? 142 THR A OG1 1 
ATOM   1126 C  CG2 . THR A 1 142 ? 39.564 18.666 3.501   1.00 12.61 ? 142 THR A CG2 1 
ATOM   1127 N  N   . PRO A 1 143 ? 40.747 17.332 -1.073  1.00 16.34 ? 143 PRO A N   1 
ATOM   1128 C  CA  . PRO A 1 143 ? 40.914 16.326 -2.137  1.00 13.30 ? 143 PRO A CA  1 
ATOM   1129 C  C   . PRO A 1 143 ? 41.711 15.046 -1.782  1.00 12.20 ? 143 PRO A C   1 
ATOM   1130 O  O   . PRO A 1 143 ? 41.354 13.945 -2.226  1.00 15.56 ? 143 PRO A O   1 
ATOM   1131 C  CB  . PRO A 1 143 ? 41.545 17.042 -3.344  1.00 14.65 ? 143 PRO A CB  1 
ATOM   1132 C  CG  . PRO A 1 143 ? 42.151 18.318 -2.759  1.00 18.51 ? 143 PRO A CG  1 
ATOM   1133 C  CD  . PRO A 1 143 ? 41.476 18.581 -1.400  1.00 13.45 ? 143 PRO A CD  1 
ATOM   1134 N  N   . ASN A 1 144 ? 42.831 15.171 -1.031  1.00 7.31  ? 144 ASN A N   1 
ATOM   1135 C  CA  . ASN A 1 144 ? 43.600 13.999 -0.769  1.00 9.00  ? 144 ASN A CA  1 
ATOM   1136 C  C   . ASN A 1 144 ? 42.868 13.001 0.114   1.00 20.43 ? 144 ASN A C   1 
ATOM   1137 O  O   . ASN A 1 144 ? 42.941 11.801 -0.088  1.00 15.44 ? 144 ASN A O   1 
ATOM   1138 C  CB  . ASN A 1 144 ? 44.977 14.318 -0.193  1.00 10.96 ? 144 ASN A CB  1 
ATOM   1139 C  CG  . ASN A 1 144 ? 45.863 14.984 -1.248  1.00 23.77 ? 144 ASN A CG  1 
ATOM   1140 O  OD1 . ASN A 1 144 ? 45.716 14.763 -2.447  1.00 29.80 ? 144 ASN A OD1 1 
ATOM   1141 N  ND2 . ASN A 1 144 ? 46.786 15.787 -0.808  1.00 24.28 ? 144 ASN A ND2 1 
ATOM   1142 N  N   . ARG A 1 145 ? 42.195 13.531 1.127   1.00 13.95 ? 145 ARG A N   1 
ATOM   1143 C  CA  . ARG A 1 145 ? 41.421 12.690 1.996   1.00 11.75 ? 145 ARG A CA  1 
ATOM   1144 C  C   . ARG A 1 145 ? 40.198 12.101 1.267   1.00 10.01 ? 145 ARG A C   1 
ATOM   1145 O  O   . ARG A 1 145 ? 39.877 10.895 1.404   1.00 14.14 ? 145 ARG A O   1 
ATOM   1146 C  CB  . ARG A 1 145 ? 40.892 13.483 3.166   1.00 14.45 ? 145 ARG A CB  1 
ATOM   1147 C  CG  . ARG A 1 145 ? 40.029 12.549 4.033   1.00 19.74 ? 145 ARG A CG  1 
ATOM   1148 C  CD  . ARG A 1 145 ? 39.474 13.242 5.213   1.00 22.00 ? 145 ARG A CD  1 
ATOM   1149 N  NE  . ARG A 1 145 ? 38.756 12.332 6.079   1.00 24.48 ? 145 ARG A NE  1 
ATOM   1150 C  CZ  . ARG A 1 145 ? 38.651 12.689 7.343   1.00 17.22 ? 145 ARG A CZ  1 
ATOM   1151 N  NH1 . ARG A 1 145 ? 39.199 13.835 7.722   1.00 14.70 ? 145 ARG A NH1 1 
ATOM   1152 N  NH2 . ARG A 1 145 ? 37.976 11.935 8.218   1.00 13.61 ? 145 ARG A NH2 1 
ATOM   1153 N  N   . ALA A 1 146 ? 39.450 12.977 0.528   1.00 11.27 ? 146 ALA A N   1 
ATOM   1154 C  CA  . ALA A 1 146 ? 38.298 12.505 -0.219  1.00 14.08 ? 146 ALA A CA  1 
ATOM   1155 C  C   . ALA A 1 146 ? 38.725 11.382 -1.196  1.00 17.35 ? 146 ALA A C   1 
ATOM   1156 O  O   . ALA A 1 146 ? 38.019 10.409 -1.366  1.00 13.68 ? 146 ALA A O   1 
ATOM   1157 C  CB  . ALA A 1 146 ? 37.635 13.637 -1.003  1.00 13.76 ? 146 ALA A CB  1 
ATOM   1158 N  N   . LYS A 1 147 ? 39.860 11.532 -1.892  1.00 12.83 ? 147 LYS A N   1 
ATOM   1159 C  CA  . LYS A 1 147 ? 40.321 10.503 -2.827  1.00 13.83 ? 147 LYS A CA  1 
ATOM   1160 C  C   . LYS A 1 147 ? 40.542 9.176  -2.141  1.00 15.81 ? 147 LYS A C   1 
ATOM   1161 O  O   . LYS A 1 147 ? 40.277 8.117  -2.734  1.00 13.28 ? 147 LYS A O   1 
ATOM   1162 C  CB  . LYS A 1 147 ? 41.600 10.872 -3.545  1.00 18.70 ? 147 LYS A CB  1 
ATOM   1163 C  CG  . LYS A 1 147 ? 41.325 11.907 -4.600  1.00 28.60 ? 147 LYS A CG  1 
ATOM   1164 C  CD  . LYS A 1 147 ? 42.571 12.389 -5.321  1.00 26.29 ? 147 LYS A CD  1 
ATOM   1165 C  CE  . LYS A 1 147 ? 42.258 13.656 -6.092  1.00 40.16 ? 147 LYS A CE  1 
ATOM   1166 N  NZ  . LYS A 1 147 ? 43.478 14.362 -6.499  1.00 51.99 ? 147 LYS A NZ  1 
ATOM   1167 N  N   . ARG A 1 148 ? 41.093 9.248  -0.903  1.00 12.50 ? 148 ARG A N   1 
ATOM   1168 C  CA  . ARG A 1 148 ? 41.331 8.015  -0.127  1.00 13.55 ? 148 ARG A CA  1 
ATOM   1169 C  C   . ARG A 1 148 ? 40.003 7.352  0.229   1.00 14.33 ? 148 ARG A C   1 
ATOM   1170 O  O   . ARG A 1 148 ? 39.848 6.141  0.083   1.00 16.17 ? 148 ARG A O   1 
ATOM   1171 C  CB  . ARG A 1 148 ? 42.164 8.238  1.155   1.00 14.66 ? 148 ARG A CB  1 
ATOM   1172 C  CG  . ARG A 1 148 ? 43.635 8.565  0.942   1.00 13.57 ? 148 ARG A CG  1 
ATOM   1173 C  CD  . ARG A 1 148 ? 44.448 8.452  2.229   1.00 11.09 ? 148 ARG A CD  1 
ATOM   1174 N  NE  . ARG A 1 148 ? 44.117 9.520  3.156   1.00 15.85 ? 148 ARG A NE  1 
ATOM   1175 C  CZ  . ARG A 1 148 ? 44.672 10.735 3.198   1.00 17.19 ? 148 ARG A CZ  1 
ATOM   1176 N  NH1 . ARG A 1 148 ? 45.601 11.063 2.292   1.00 15.30 ? 148 ARG A NH1 1 
ATOM   1177 N  NH2 . ARG A 1 148 ? 44.277 11.614 4.103   1.00 13.80 ? 148 ARG A NH2 1 
ATOM   1178 N  N   . VAL A 1 149 ? 39.035 8.156  0.658   1.00 10.53 ? 149 VAL A N   1 
ATOM   1179 C  CA  . VAL A 1 149 ? 37.744 7.558  0.978   1.00 9.85  ? 149 VAL A CA  1 
ATOM   1180 C  C   . VAL A 1 149 ? 37.046 6.993  -0.249  1.00 15.20 ? 149 VAL A C   1 
ATOM   1181 O  O   . VAL A 1 149 ? 36.491 5.886  -0.264  1.00 13.16 ? 149 VAL A O   1 
ATOM   1182 C  CB  . VAL A 1 149 ? 36.901 8.571  1.732   1.00 13.01 ? 149 VAL A CB  1 
ATOM   1183 C  CG1 . VAL A 1 149 ? 35.493 8.020  1.945   1.00 10.49 ? 149 VAL A CG1 1 
ATOM   1184 C  CG2 . VAL A 1 149 ? 37.598 8.862  3.062   1.00 8.02  ? 149 VAL A CG2 1 
ATOM   1185 N  N   . ILE A 1 150 ? 37.061 7.782  -1.314  1.00 11.78 ? 150 ILE A N   1 
ATOM   1186 C  CA  . ILE A 1 150 ? 36.423 7.396  -2.562  1.00 8.80  ? 150 ILE A CA  1 
ATOM   1187 C  C   . ILE A 1 150 ? 37.031 6.123  -3.139  1.00 11.08 ? 150 ILE A C   1 
ATOM   1188 O  O   . ILE A 1 150 ? 36.319 5.275  -3.608  1.00 15.43 ? 150 ILE A O   1 
ATOM   1189 C  CB  . ILE A 1 150 ? 36.396 8.535  -3.633  1.00 10.44 ? 150 ILE A CB  1 
ATOM   1190 C  CG1 . ILE A 1 150 ? 35.460 9.702  -3.265  1.00 14.15 ? 150 ILE A CG1 1 
ATOM   1191 C  CG2 . ILE A 1 150 ? 35.983 7.923  -4.971  1.00 14.06 ? 150 ILE A CG2 1 
ATOM   1192 C  CD1 . ILE A 1 150 ? 35.780 10.997 -4.018  1.00 14.69 ? 150 ILE A CD1 1 
ATOM   1193 N  N   . THR A 1 151 ? 38.372 6.003  -3.110  1.00 9.70  ? 151 THR A N   1 
ATOM   1194 C  CA  . THR A 1 151 ? 39.029 4.778  -3.605  1.00 17.63 ? 151 THR A CA  1 
ATOM   1195 C  C   . THR A 1 151 ? 38.611 3.554  -2.796  1.00 13.82 ? 151 THR A C   1 
ATOM   1196 O  O   . THR A 1 151 ? 38.527 2.438  -3.340  1.00 16.82 ? 151 THR A O   1 
ATOM   1197 C  CB  . THR A 1 151 ? 40.561 4.930  -3.533  1.00 13.99 ? 151 THR A CB  1 
ATOM   1198 O  OG1 . THR A 1 151 ? 40.904 5.910  -4.472  1.00 22.79 ? 151 THR A OG1 1 
ATOM   1199 C  CG2 . THR A 1 151 ? 41.286 3.644  -3.868  1.00 15.84 ? 151 THR A CG2 1 
ATOM   1200 N  N   . THR A 1 152 ? 38.357 3.781  -1.491  1.00 14.23 ? 152 THR A N   1 
ATOM   1201 C  CA  . THR A 1 152 ? 37.918 2.732  -0.549  1.00 14.90 ? 152 THR A CA  1 
ATOM   1202 C  C   . THR A 1 152 ? 36.520 2.236  -0.977  1.00 16.31 ? 152 THR A C   1 
ATOM   1203 O  O   . THR A 1 152 ? 36.275 1.034  -1.072  1.00 11.13 ? 152 THR A O   1 
ATOM   1204 C  CB  . THR A 1 152 ? 38.016 3.211  0.929   1.00 9.63  ? 152 THR A CB  1 
ATOM   1205 O  OG1 . THR A 1 152 ? 39.364 3.596  1.176   1.00 12.07 ? 152 THR A OG1 1 
ATOM   1206 C  CG2 . THR A 1 152 ? 37.701 2.056  1.881   1.00 12.46 ? 152 THR A CG2 1 
ATOM   1207 N  N   . PHE A 1 153 ? 35.613 3.181  -1.318  1.00 10.86 ? 153 PHE A N   1 
ATOM   1208 C  CA  . PHE A 1 153 ? 34.307 2.807  -1.824  1.00 14.09 ? 153 PHE A CA  1 
ATOM   1209 C  C   . PHE A 1 153 ? 34.388 2.098  -3.184  1.00 20.32 ? 153 PHE A C   1 
ATOM   1210 O  O   . PHE A 1 153 ? 33.679 1.129  -3.492  1.00 17.61 ? 153 PHE A O   1 
ATOM   1211 C  CB  . PHE A 1 153 ? 33.422 4.047  -2.009  1.00 9.09  ? 153 PHE A CB  1 
ATOM   1212 C  CG  . PHE A 1 153 ? 32.778 4.511  -0.736  1.00 11.73 ? 153 PHE A CG  1 
ATOM   1213 C  CD1 . PHE A 1 153 ? 31.942 3.663  -0.006  1.00 19.34 ? 153 PHE A CD1 1 
ATOM   1214 C  CD2 . PHE A 1 153 ? 32.906 5.835  -0.319  1.00 11.60 ? 153 PHE A CD2 1 
ATOM   1215 C  CE1 . PHE A 1 153 ? 31.256 4.103  1.128   1.00 16.10 ? 153 PHE A CE1 1 
ATOM   1216 C  CE2 . PHE A 1 153 ? 32.244 6.295  0.825   1.00 19.84 ? 153 PHE A CE2 1 
ATOM   1217 C  CZ  . PHE A 1 153 ? 31.418 5.426  1.544   1.00 13.99 ? 153 PHE A CZ  1 
ATOM   1218 N  N   . ARG A 1 154 ? 35.275 2.606  -4.030  1.00 15.23 ? 154 ARG A N   1 
ATOM   1219 C  CA  . ARG A 1 154 ? 35.473 2.055  -5.366  1.00 16.94 ? 154 ARG A CA  1 
ATOM   1220 C  C   . ARG A 1 154 ? 36.006 0.622  -5.372  1.00 22.93 ? 154 ARG A C   1 
ATOM   1221 O  O   . ARG A 1 154 ? 35.454 -0.243 -6.048  1.00 22.70 ? 154 ARG A O   1 
ATOM   1222 C  CB  . ARG A 1 154 ? 36.303 2.971  -6.302  1.00 20.57 ? 154 ARG A CB  1 
ATOM   1223 C  CG  . ARG A 1 154 ? 36.071 2.706  -7.803  1.00 22.75 ? 154 ARG A CG  1 
ATOM   1224 C  CD  . ARG A 1 154 ? 36.957 3.555  -8.709  1.00 18.86 ? 154 ARG A CD  1 
ATOM   1225 N  NE  . ARG A 1 154 ? 38.275 3.789  -8.115  1.00 46.51 ? 154 ARG A NE  1 
ATOM   1226 C  CZ  . ARG A 1 154 ? 39.355 2.969  -8.205  1.00 52.94 ? 154 ARG A CZ  1 
ATOM   1227 N  NH1 . ARG A 1 154 ? 39.338 1.804  -8.883  1.00 45.09 ? 154 ARG A NH1 1 
ATOM   1228 N  NH2 . ARG A 1 154 ? 40.500 3.343  -7.606  1.00 41.23 ? 154 ARG A NH2 1 
ATOM   1229 N  N   . THR A 1 155 ? 37.052 0.358  -4.585  1.00 17.94 ? 155 THR A N   1 
ATOM   1230 C  CA  . THR A 1 155 ? 37.660 -0.958 -4.589  1.00 16.40 ? 155 THR A CA  1 
ATOM   1231 C  C   . THR A 1 155 ? 37.239 -1.927 -3.519  1.00 24.25 ? 155 THR A C   1 
ATOM   1232 O  O   . THR A 1 155 ? 37.413 -3.118 -3.707  1.00 21.81 ? 155 THR A O   1 
ATOM   1233 C  CB  . THR A 1 155 ? 39.193 -0.826 -4.542  1.00 22.63 ? 155 THR A CB  1 
ATOM   1234 O  OG1 . THR A 1 155 ? 39.562 -0.253 -3.312  1.00 18.92 ? 155 THR A OG1 1 
ATOM   1235 C  CG2 . THR A 1 155 ? 39.621 0.077  -5.665  1.00 21.31 ? 155 THR A CG2 1 
ATOM   1236 N  N   . GLY A 1 156 ? 36.785 -1.438 -2.370  1.00 22.05 ? 156 GLY A N   1 
ATOM   1237 C  CA  . GLY A 1 156 ? 36.456 -2.307 -1.280  1.00 13.49 ? 156 GLY A CA  1 
ATOM   1238 C  C   . GLY A 1 156 ? 37.703 -2.883 -0.653  1.00 23.21 ? 156 GLY A C   1 
ATOM   1239 O  O   . GLY A 1 156 ? 37.649 -3.920 -0.020  1.00 16.83 ? 156 GLY A O   1 
ATOM   1240 N  N   . THR A 1 157 ? 38.862 -2.233 -0.833  1.00 13.09 ? 157 THR A N   1 
ATOM   1241 C  CA  . THR A 1 157 ? 40.108 -2.671 -0.200  1.00 11.39 ? 157 THR A CA  1 
ATOM   1242 C  C   . THR A 1 157 ? 40.678 -1.468 0.550   1.00 21.36 ? 157 THR A C   1 
ATOM   1243 O  O   . THR A 1 157 ? 40.192 -0.388 0.377   1.00 15.00 ? 157 THR A O   1 
ATOM   1244 C  CB  . THR A 1 157 ? 41.150 -3.019 -1.247  1.00 13.62 ? 157 THR A CB  1 
ATOM   1245 O  OG1 . THR A 1 157 ? 41.557 -1.795 -1.889  1.00 19.22 ? 157 THR A OG1 1 
ATOM   1246 C  CG2 . THR A 1 157 ? 40.509 -3.953 -2.265  1.00 25.90 ? 157 THR A CG2 1 
ATOM   1247 N  N   . TRP A 1 158 ? 41.735 -1.650 1.318   1.00 12.49 ? 158 TRP A N   1 
ATOM   1248 C  CA  . TRP A 1 158 ? 42.408 -0.608 2.073   1.00 16.57 ? 158 TRP A CA  1 
ATOM   1249 C  C   . TRP A 1 158 ? 43.631 -0.095 1.319   1.00 20.71 ? 158 TRP A C   1 
ATOM   1250 O  O   . TRP A 1 158 ? 44.534 0.502  1.884   1.00 19.33 ? 158 TRP A O   1 
ATOM   1251 C  CB  . TRP A 1 158 ? 42.955 -1.172 3.395   1.00 14.04 ? 158 TRP A CB  1 
ATOM   1252 C  CG  . TRP A 1 158 ? 41.902 -1.645 4.320   1.00 14.87 ? 158 TRP A CG  1 
ATOM   1253 C  CD1 . TRP A 1 158 ? 41.671 -2.920 4.615   1.00 16.59 ? 158 TRP A CD1 1 
ATOM   1254 C  CD2 . TRP A 1 158 ? 40.949 -0.844 5.054   1.00 16.81 ? 158 TRP A CD2 1 
ATOM   1255 N  NE1 . TRP A 1 158 ? 40.618 -2.988 5.487   1.00 17.87 ? 158 TRP A NE1 1 
ATOM   1256 C  CE2 . TRP A 1 158 ? 40.183 -1.735 5.819   1.00 19.06 ? 158 TRP A CE2 1 
ATOM   1257 C  CE3 . TRP A 1 158 ? 40.735 0.544  5.213   1.00 18.85 ? 158 TRP A CE3 1 
ATOM   1258 C  CZ2 . TRP A 1 158 ? 39.184 -1.304 6.707   1.00 22.33 ? 158 TRP A CZ2 1 
ATOM   1259 C  CZ3 . TRP A 1 158 ? 39.789 0.971  6.116   1.00 15.10 ? 158 TRP A CZ3 1 
ATOM   1260 C  CH2 . TRP A 1 158 ? 39.004 0.054  6.852   1.00 18.70 ? 158 TRP A CH2 1 
ATOM   1261 N  N   . ASP A 1 159 ? 43.679 -0.353 0.034   1.00 16.11 ? 159 ASP A N   1 
ATOM   1262 C  CA  . ASP A 1 159 ? 44.853 0.078  -0.716  1.00 14.36 ? 159 ASP A CA  1 
ATOM   1263 C  C   . ASP A 1 159 ? 45.249 1.525  -0.598  1.00 19.73 ? 159 ASP A C   1 
ATOM   1264 O  O   . ASP A 1 159 ? 46.410 1.805  -0.614  1.00 21.04 ? 159 ASP A O   1 
ATOM   1265 C  CB  . ASP A 1 159 ? 44.681 -0.260 -2.178  1.00 23.39 ? 159 ASP A CB  1 
ATOM   1266 C  CG  . ASP A 1 159 ? 44.817 -1.757 -2.433  1.00 45.17 ? 159 ASP A CG  1 
ATOM   1267 O  OD1 . ASP A 1 159 ? 45.051 -2.473 -1.356  1.00 42.49 ? 159 ASP A OD1 1 
ATOM   1268 O  OD2 . ASP A 1 159 ? 44.700 -2.248 -3.531  1.00 47.46 ? 159 ASP A OD2 1 
ATOM   1269 N  N   . ALA A 1 160 ? 44.320 2.466  -0.501  1.00 15.67 ? 160 ALA A N   1 
ATOM   1270 C  CA  . ALA A 1 160 ? 44.652 3.883  -0.460  1.00 15.56 ? 160 ALA A CA  1 
ATOM   1271 C  C   . ALA A 1 160 ? 45.306 4.239  0.848   1.00 20.32 ? 160 ALA A C   1 
ATOM   1272 O  O   . ALA A 1 160 ? 45.866 5.298  1.003   1.00 21.82 ? 160 ALA A O   1 
ATOM   1273 C  CB  . ALA A 1 160 ? 43.432 4.784  -0.708  1.00 15.60 ? 160 ALA A CB  1 
ATOM   1274 N  N   . TYR A 1 161 ? 45.215 3.352  1.792   1.00 14.05 ? 161 TYR A N   1 
ATOM   1275 C  CA  . TYR A 1 161 ? 45.773 3.653  3.101   1.00 14.34 ? 161 TYR A CA  1 
ATOM   1276 C  C   . TYR A 1 161 ? 47.017 2.870  3.320   1.00 32.22 ? 161 TYR A C   1 
ATOM   1277 O  O   . TYR A 1 161 ? 47.592 2.968  4.375   1.00 24.94 ? 161 TYR A O   1 
ATOM   1278 C  CB  . TYR A 1 161 ? 44.803 3.374  4.297   1.00 21.18 ? 161 TYR A CB  1 
ATOM   1279 C  CG  . TYR A 1 161 ? 43.700 4.373  4.364   1.00 14.93 ? 161 TYR A CG  1 
ATOM   1280 C  CD1 . TYR A 1 161 ? 42.561 4.172  3.575   1.00 10.91 ? 161 TYR A CD1 1 
ATOM   1281 C  CD2 . TYR A 1 161 ? 43.832 5.544  5.103   1.00 9.05  ? 161 TYR A CD2 1 
ATOM   1282 C  CE1 . TYR A 1 161 ? 41.540 5.124  3.531   1.00 14.78 ? 161 TYR A CE1 1 
ATOM   1283 C  CE2 . TYR A 1 161 ? 42.810 6.502  5.097   1.00 8.99  ? 161 TYR A CE2 1 
ATOM   1284 C  CZ  . TYR A 1 161 ? 41.689 6.293  4.295   1.00 13.39 ? 161 TYR A CZ  1 
ATOM   1285 O  OH  . TYR A 1 161 ? 40.669 7.204  4.275   1.00 13.92 ? 161 TYR A OH  1 
ATOM   1286 N  N   . LYS A 1 162 ? 47.410 2.069  2.354   1.00 38.12 ? 162 LYS A N   1 
ATOM   1287 C  CA  . LYS A 1 162 ? 48.614 1.294  2.575   1.00 42.98 ? 162 LYS A CA  1 
ATOM   1288 C  C   . LYS A 1 162 ? 49.802 1.888  1.835   1.00 37.10 ? 162 LYS A C   1 
ATOM   1289 O  O   . LYS A 1 162 ? 50.853 2.121  2.442   1.00 48.67 ? 162 LYS A O   1 
ATOM   1290 C  CB  . LYS A 1 162 ? 48.446 -0.205 2.373   1.00 39.52 ? 162 LYS A CB  1 
ATOM   1291 C  CG  . LYS A 1 162 ? 47.393 -0.795 3.294   1.00 34.81 ? 162 LYS A CG  1 
ATOM   1292 C  CD  . LYS A 1 162 ? 47.344 -2.317 3.197   1.00 51.66 ? 162 LYS A CD  1 
ATOM   1293 C  CE  . LYS A 1 162 ? 45.929 -2.931 3.242   1.00 56.62 ? 162 LYS A CE  1 
ATOM   1294 N  NZ  . LYS A 1 162 ? 45.629 -3.736 4.466   1.00 55.81 ? 162 LYS A NZ  1 
HETATM 1295 CL CL  . CL  B 2 .   ? 43.082 16.570 1.956   1.00 27.83 ? 173 CL  A CL  1 
HETATM 1296 CL CL  . CL  C 2 .   ? 32.102 15.342 24.126  0.50 36.51 ? 178 CL  A CL  1 
HETATM 1297 C  C1  . BME D 3 .   ? 32.114 -1.270 15.125  1.00 20.11 ? 901 BME A C1  1 
HETATM 1298 C  C2  . BME D 3 .   ? 32.189 -0.903 13.660  1.00 30.74 ? 901 BME A C2  1 
HETATM 1299 O  O1  . BME D 3 .   ? 33.323 -0.771 15.775  1.00 34.87 ? 901 BME A O1  1 
HETATM 1300 S  S2  . BME D 3 .   ? 33.724 -1.530 12.918  1.00 45.83 ? 901 BME A S2  1 
HETATM 1301 C  C1  . BME E 3 .   ? 33.957 -2.974 9.640   1.00 37.90 ? 902 BME A C1  1 
HETATM 1302 C  C2  . BME E 3 .   ? 33.007 -1.817 10.029  1.00 30.43 ? 902 BME A C2  1 
HETATM 1303 O  O1  . BME E 3 .   ? 35.167 -2.461 9.087   1.00 38.41 ? 902 BME A O1  1 
HETATM 1304 S  S2  . BME E 3 .   ? 33.801 -0.608 11.114  1.00 90.67 ? 902 BME A S2  1 
HETATM 1305 O  O   . HOH F 4 .   ? 38.150 12.458 18.276  1.00 13.51 ? 171 HOH A O   1 
HETATM 1306 O  O   . HOH F 4 .   ? 36.081 18.881 3.081   1.00 27.18 ? 172 HOH A O   1 
HETATM 1307 O  O   . HOH F 4 .   ? 41.849 23.332 1.052   1.00 18.94 ? 174 HOH A O   1 
HETATM 1308 O  O   . HOH F 4 .   ? 41.321 2.248  0.226   1.00 21.52 ? 175 HOH A O   1 
HETATM 1309 O  O   . HOH F 4 .   ? 32.920 -7.856 4.349   1.00 21.96 ? 177 HOH A O   1 
HETATM 1310 O  O   . HOH F 4 .   ? 40.312 13.015 19.945  1.00 12.64 ? 179 HOH A O   1 
HETATM 1311 O  O   . HOH F 4 .   ? 44.859 10.723 -1.824  1.00 23.21 ? 180 HOH A O   1 
HETATM 1312 O  O   . HOH F 4 .   ? 28.396 -6.850 5.029   1.00 22.66 ? 181 HOH A O   1 
HETATM 1313 O  O   . HOH F 4 .   ? 33.427 12.820 22.524  1.00 22.58 ? 182 HOH A O   1 
HETATM 1314 O  O   . HOH F 4 .   ? 33.977 11.214 29.047  1.00 31.38 ? 183 HOH A O   1 
HETATM 1315 O  O   . HOH F 4 .   ? 48.743 9.781  28.313  1.00 39.50 ? 184 HOH A O   1 
HETATM 1316 O  O   . HOH F 4 .   ? 30.756 6.070  23.646  1.00 37.36 ? 185 HOH A O   1 
HETATM 1317 O  O   . HOH F 4 .   ? 40.870 5.447  20.589  1.00 28.82 ? 186 HOH A O   1 
HETATM 1318 O  O   . HOH F 4 .   ? 44.485 -3.572 11.775  1.00 34.31 ? 187 HOH A O   1 
HETATM 1319 O  O   . HOH F 4 .   ? 39.278 22.610 -6.736  1.00 35.23 ? 188 HOH A O   1 
HETATM 1320 O  O   . HOH F 4 .   ? 50.612 17.407 19.979  1.00 35.64 ? 189 HOH A O   1 
HETATM 1321 O  O   . HOH F 4 .   ? 35.982 27.357 15.969  1.00 33.21 ? 190 HOH A O   1 
HETATM 1322 O  O   . HOH F 4 .   ? 37.267 29.731 14.451  1.00 39.30 ? 191 HOH A O   1 
HETATM 1323 O  O   . HOH F 4 .   ? 44.228 25.386 9.926   1.00 32.68 ? 192 HOH A O   1 
HETATM 1324 O  O   . HOH F 4 .   ? 20.048 -2.324 3.060   1.00 23.77 ? 193 HOH A O   1 
HETATM 1325 O  O   . HOH F 4 .   ? 35.136 5.935  -11.135 1.00 44.04 ? 194 HOH A O   1 
HETATM 1326 O  O   . HOH F 4 .   ? 36.997 -1.276 10.874  1.00 14.73 ? 195 HOH A O   1 
HETATM 1327 O  O   . HOH F 4 .   ? 46.378 20.107 30.644  1.00 32.89 ? 196 HOH A O   1 
HETATM 1328 O  O   . HOH F 4 .   ? 24.778 12.887 -4.272  1.00 8.38  ? 197 HOH A O   1 
HETATM 1329 O  O   . HOH F 4 .   ? 33.321 18.502 22.518  1.00 25.01 ? 200 HOH A O   1 
HETATM 1330 O  O   . HOH F 4 .   ? 29.798 7.928  22.228  1.00 23.89 ? 201 HOH A O   1 
HETATM 1331 O  O   . HOH F 4 .   ? 31.058 12.291 21.189  1.00 48.86 ? 202 HOH A O   1 
HETATM 1332 O  O   . HOH F 4 .   ? 37.412 19.593 13.268  1.00 26.05 ? 203 HOH A O   1 
HETATM 1333 O  O   . HOH F 4 .   ? 39.235 17.784 11.879  1.00 31.84 ? 204 HOH A O   1 
HETATM 1334 O  O   . HOH F 4 .   ? 25.994 17.141 9.269   1.00 42.96 ? 206 HOH A O   1 
HETATM 1335 O  O   . HOH F 4 .   ? 41.725 15.929 8.572   1.00 42.55 ? 207 HOH A O   1 
HETATM 1336 O  O   . HOH F 4 .   ? 35.525 11.556 4.883   1.00 15.16 ? 208 HOH A O   1 
HETATM 1337 O  O   . HOH F 4 .   ? 42.606 16.887 4.878   1.00 25.82 ? 209 HOH A O   1 
HETATM 1338 O  O   . HOH F 4 .   ? 35.421 -5.554 0.757   1.00 33.56 ? 210 HOH A O   1 
HETATM 1339 O  O   . HOH F 4 .   ? 46.779 9.775  -0.167  1.00 22.36 ? 211 HOH A O   1 
HETATM 1340 O  O   . HOH F 4 .   ? 22.717 17.333 -1.385  1.00 23.32 ? 212 HOH A O   1 
HETATM 1341 O  O   . HOH F 4 .   ? 25.826 -1.856 -1.178  1.00 20.69 ? 213 HOH A O   1 
HETATM 1342 O  O   . HOH F 4 .   ? 22.093 -3.890 -1.653  1.00 35.46 ? 214 HOH A O   1 
HETATM 1343 O  O   . HOH F 4 .   ? 33.258 14.039 26.536  1.00 19.12 ? 215 HOH A O   1 
HETATM 1344 O  O   . HOH F 4 .   ? 36.294 10.038 -8.454  1.00 29.08 ? 216 HOH A O   1 
HETATM 1345 O  O   . HOH F 4 .   ? 33.994 -1.464 -9.850  1.00 39.70 ? 217 HOH A O   1 
HETATM 1346 O  O   . HOH F 4 .   ? 28.134 9.033  -11.811 1.00 29.30 ? 218 HOH A O   1 
HETATM 1347 O  O   . HOH F 4 .   ? 27.642 11.628 -11.651 1.00 39.62 ? 219 HOH A O   1 
HETATM 1348 O  O   . HOH F 4 .   ? 34.275 18.475 -8.595  1.00 33.29 ? 220 HOH A O   1 
HETATM 1349 O  O   . HOH F 4 .   ? 44.345 5.730  17.430  1.00 44.04 ? 221 HOH A O   1 
HETATM 1350 O  O   . HOH F 4 .   ? 29.626 25.545 17.689  1.00 34.68 ? 222 HOH A O   1 
HETATM 1351 O  O   . HOH F 4 .   ? 42.673 -4.516 12.827  1.00 32.12 ? 223 HOH A O   1 
HETATM 1352 O  O   . HOH F 4 .   ? 36.266 17.076 13.033  1.00 36.20 ? 224 HOH A O   1 
HETATM 1353 O  O   . HOH F 4 .   ? 34.083 16.835 12.451  1.00 42.23 ? 225 HOH A O   1 
HETATM 1354 O  O   . HOH F 4 .   ? 22.768 -2.964 11.370  1.00 49.36 ? 226 HOH A O   1 
HETATM 1355 O  O   . HOH F 4 .   ? 49.010 6.715  11.796  1.00 44.08 ? 227 HOH A O   1 
HETATM 1356 O  O   . HOH F 4 .   ? 47.990 11.239 10.819  1.00 46.74 ? 228 HOH A O   1 
HETATM 1357 O  O   . HOH F 4 .   ? 42.123 16.815 12.038  1.00 28.49 ? 229 HOH A O   1 
HETATM 1358 O  O   . HOH F 4 .   ? 43.693 14.230 5.966   1.00 33.83 ? 230 HOH A O   1 
HETATM 1359 O  O   . HOH F 4 .   ? 42.524 -4.605 1.618   1.00 38.54 ? 231 HOH A O   1 
HETATM 1360 O  O   . HOH F 4 .   ? 46.498 7.115  -1.121  1.00 33.90 ? 232 HOH A O   1 
HETATM 1361 O  O   . HOH F 4 .   ? 44.694 8.240  -2.632  1.00 40.17 ? 233 HOH A O   1 
HETATM 1362 O  O   . HOH F 4 .   ? 40.375 19.001 -7.107  1.00 42.56 ? 234 HOH A O   1 
HETATM 1363 O  O   . HOH F 4 .   ? 31.329 -0.061 -11.127 1.00 32.48 ? 235 HOH A O   1 
HETATM 1364 O  O   . HOH F 4 .   ? 46.862 20.215 12.348  1.00 38.67 ? 236 HOH A O   1 
HETATM 1365 O  O   . HOH F 4 .   ? 40.388 16.184 6.312   1.00 33.83 ? 237 HOH A O   1 
HETATM 1366 O  O   . HOH F 4 .   ? 35.264 -2.431 -7.742  1.00 24.01 ? 238 HOH A O   1 
HETATM 1367 O  O   . HOH F 4 .   ? 36.053 12.717 28.476  1.00 30.32 ? 239 HOH A O   1 
HETATM 1368 O  O   . HOH F 4 .   ? 43.781 5.160  25.405  1.00 31.82 ? 240 HOH A O   1 
HETATM 1369 O  O   . HOH F 4 .   ? 25.254 9.436  17.659  1.00 31.92 ? 242 HOH A O   1 
HETATM 1370 O  O   . HOH F 4 .   ? 47.042 4.578  11.885  1.00 28.26 ? 244 HOH A O   1 
HETATM 1371 O  O   . HOH F 4 .   ? 47.161 13.534 2.835   1.00 50.66 ? 245 HOH A O   1 
HETATM 1372 O  O   . HOH F 4 .   ? 30.767 16.168 20.649  1.00 39.05 ? 246 HOH A O   1 
HETATM 1373 O  O   . HOH F 4 .   ? 46.059 26.360 14.197  1.00 48.71 ? 247 HOH A O   1 
HETATM 1374 O  O   . HOH F 4 .   ? 39.399 -5.735 6.155   1.00 31.33 ? 248 HOH A O   1 
HETATM 1375 O  O   . HOH F 4 .   ? 38.590 10.506 -6.867  1.00 43.47 ? 249 HOH A O   1 
HETATM 1376 O  O   . HOH F 4 .   ? 36.205 11.730 -10.369 1.00 42.25 ? 250 HOH A O   1 
HETATM 1377 O  O   . HOH F 4 .   ? 33.961 13.230 -11.153 1.00 29.84 ? 251 HOH A O   1 
HETATM 1378 O  O   . HOH F 4 .   ? 19.128 5.854  1.477   1.00 53.40 ? 253 HOH A O   1 
HETATM 1379 O  O   . HOH F 4 .   ? 24.721 16.350 11.699  1.00 46.20 ? 254 HOH A O   1 
HETATM 1380 O  O   . HOH F 4 .   ? 36.922 15.740 10.827  1.00 38.81 ? 256 HOH A O   1 
HETATM 1381 O  O   . HOH F 4 .   ? 46.363 7.009  18.601  1.00 52.96 ? 257 HOH A O   1 
HETATM 1382 O  O   . HOH F 4 .   ? 46.612 26.197 21.003  1.00 50.86 ? 258 HOH A O   1 
HETATM 1383 O  O   . HOH F 4 .   ? 41.047 13.235 32.312  1.00 38.06 ? 259 HOH A O   1 
HETATM 1384 O  O   . HOH F 4 .   ? 45.452 11.008 31.012  1.00 50.80 ? 260 HOH A O   1 
HETATM 1385 O  O   . HOH F 4 .   ? 39.284 6.025  -7.317  1.00 44.34 ? 261 HOH A O   1 
HETATM 1386 O  O   . HOH F 4 .   ? 44.590 16.907 8.742   1.00 62.91 ? 263 HOH A O   1 
HETATM 1387 O  O   . HOH F 4 .   ? 34.742 14.207 16.265  1.00 49.42 ? 265 HOH A O   1 
HETATM 1388 O  O   . HOH F 4 .   ? 34.219 16.314 15.546  1.00 41.45 ? 266 HOH A O   1 
HETATM 1389 O  O   . HOH F 4 .   ? 35.139 15.120 13.475  1.00 26.34 ? 267 HOH A O   1 
HETATM 1390 O  O   . HOH F 4 .   ? 16.295 9.143  10.207  1.00 46.49 ? 268 HOH A O   1 
HETATM 1391 O  O   . HOH F 4 .   ? 44.349 22.211 10.157  1.00 35.55 ? 269 HOH A O   1 
HETATM 1392 O  O   . HOH F 4 .   ? 30.008 18.629 -0.288  1.00 19.21 ? 270 HOH A O   1 
HETATM 1393 O  O   . HOH F 4 .   ? 36.929 7.518  -9.622  1.00 48.66 ? 271 HOH A O   1 
HETATM 1394 O  O   . HOH F 4 .   ? 17.574 12.105 -6.473  1.00 58.99 ? 272 HOH A O   1 
HETATM 1395 O  O   . HOH F 4 .   ? 38.739 -6.291 0.946   1.00 33.01 ? 273 HOH A O   1 
HETATM 1396 O  O   . HOH F 4 .   ? 31.372 11.611 15.656  1.00 30.85 ? 274 HOH A O   1 
HETATM 1397 O  O   . HOH F 4 .   ? 28.336 18.821 6.707   1.00 51.37 ? 275 HOH A O   1 
HETATM 1398 O  O   . HOH F 4 .   ? 19.125 11.074 1.542   1.00 39.42 ? 276 HOH A O   1 
HETATM 1399 O  O   . HOH F 4 .   ? 34.519 -4.444 -6.123  1.00 38.55 ? 277 HOH A O   1 
HETATM 1400 O  O   . HOH F 4 .   ? 41.192 25.970 31.062  1.00 41.45 ? 278 HOH A O   1 
HETATM 1401 O  O   . HOH F 4 .   ? 32.872 17.345 18.463  1.00 47.51 ? 280 HOH A O   1 
HETATM 1402 O  O   . HOH F 4 .   ? 31.901 21.168 21.893  1.00 40.79 ? 281 HOH A O   1 
HETATM 1403 O  O   . HOH F 4 .   ? 32.586 19.808 24.665  1.00 32.60 ? 282 HOH A O   1 
HETATM 1404 O  O   . HOH F 4 .   ? 44.837 3.721  15.872  1.00 35.18 ? 283 HOH A O   1 
HETATM 1405 O  O   . HOH F 4 .   ? 50.261 12.600 26.829  1.00 39.03 ? 284 HOH A O   1 
HETATM 1406 O  O   . HOH F 4 .   ? 43.503 15.975 15.093  1.00 37.91 ? 285 HOH A O   1 
HETATM 1407 O  O   . HOH F 4 .   ? 50.221 16.281 26.970  1.00 43.92 ? 286 HOH A O   1 
HETATM 1408 O  O   . HOH F 4 .   ? 44.191 -1.243 15.694  1.00 26.76 ? 288 HOH A O   1 
HETATM 1409 O  O   . HOH F 4 .   ? 20.740 9.526  14.028  1.00 49.92 ? 289 HOH A O   1 
HETATM 1410 O  O   . HOH F 4 .   ? 21.448 -6.350 4.689   1.00 40.74 ? 290 HOH A O   1 
HETATM 1411 O  O   . HOH F 4 .   ? 23.634 -5.786 -0.184  1.00 37.49 ? 291 HOH A O   1 
HETATM 1412 O  O   . HOH F 4 .   ? 19.336 7.499  -1.567  1.00 45.99 ? 292 HOH A O   1 
HETATM 1413 O  O   . HOH F 4 .   ? 28.094 -0.445 -12.207 1.00 49.43 ? 293 HOH A O   1 
HETATM 1414 O  O   . HOH F 4 .   ? 47.162 1.869  10.346  1.00 55.56 ? 294 HOH A O   1 
HETATM 1415 O  O   . HOH F 4 .   ? 47.069 3.965  14.701  1.00 40.77 ? 295 HOH A O   1 
HETATM 1416 O  O   . HOH F 4 .   ? 42.085 -6.407 5.998   1.00 35.59 ? 296 HOH A O   1 
HETATM 1417 O  O   . HOH F 4 .   ? 40.481 -6.093 3.319   1.00 52.23 ? 297 HOH A O   1 
HETATM 1418 O  O   . HOH F 4 .   ? 45.566 16.504 14.299  1.00 37.07 ? 298 HOH A O   1 
HETATM 1419 O  O   . HOH F 4 .   ? 33.032 13.332 14.664  1.00 32.54 ? 299 HOH A O   1 
HETATM 1420 O  O   . HOH F 4 .   ? 37.418 19.883 -9.358  1.00 60.04 ? 300 HOH A O   1 
HETATM 1421 O  O   . HOH F 4 .   ? 18.806 4.329  -2.203  1.00 57.41 ? 301 HOH A O   1 
HETATM 1422 O  O   . HOH F 4 .   ? 18.531 -1.925 6.477   1.00 53.62 ? 302 HOH A O   1 
HETATM 1423 O  O   . HOH F 4 .   ? 33.339 19.293 3.605   1.00 47.37 ? 303 HOH A O   1 
HETATM 1424 O  O   . HOH F 4 .   ? 42.266 19.449 10.007  1.00 56.97 ? 304 HOH A O   1 
HETATM 1425 O  O   . HOH F 4 .   ? 34.886 21.265 10.556  1.00 39.94 ? 306 HOH A O   1 
HETATM 1426 O  O   . HOH F 4 .   ? 31.951 19.016 19.950  1.00 56.71 ? 307 HOH A O   1 
HETATM 1427 O  O   . HOH F 4 .   ? 38.794 14.552 34.306  1.00 50.75 ? 308 HOH A O   1 
HETATM 1428 O  O   . HOH F 4 .   ? 34.932 27.274 1.206   1.00 53.65 ? 309 HOH A O   1 
HETATM 1429 O  O   . HOH F 4 .   ? 29.325 1.586  -11.736 1.00 26.28 ? 311 HOH A O   1 
HETATM 1430 O  O   . HOH F 4 .   ? 39.741 12.001 -8.267  1.00 55.57 ? 312 HOH A O   1 
HETATM 1431 O  O   . HOH F 4 .   ? 40.316 8.413  -6.274  1.00 65.42 ? 313 HOH A O   1 
HETATM 1432 O  O   . HOH F 4 .   ? 36.312 20.487 5.248   1.00 58.30 ? 314 HOH A O   1 
HETATM 1433 O  O   . HOH F 4 .   ? 49.992 11.609 12.703  1.00 50.63 ? 315 HOH A O   1 
HETATM 1434 O  O   . HOH F 4 .   ? 42.971 17.057 -7.325  1.00 53.84 ? 316 HOH A O   1 
HETATM 1435 O  O   . HOH F 4 .   ? 48.154 17.918 30.373  1.00 47.85 ? 317 HOH A O   1 
HETATM 1436 O  O   . HOH F 4 .   ? 15.279 3.479  6.636   1.00 54.00 ? 318 HOH A O   1 
HETATM 1437 O  O   . HOH F 4 .   ? 47.700 24.491 17.856  1.00 44.52 ? 319 HOH A O   1 
HETATM 1438 O  O   . HOH F 4 .   ? 38.025 18.607 7.131   1.00 57.64 ? 321 HOH A O   1 
HETATM 1439 O  O   . HOH F 4 .   ? 48.712 21.935 18.438  1.00 60.18 ? 322 HOH A O   1 
HETATM 1440 O  O   . HOH F 4 .   ? 35.261 30.187 13.366  1.00 40.75 ? 323 HOH A O   1 
HETATM 1441 O  O   . HOH F 4 .   ? 44.267 19.518 35.399  1.00 51.16 ? 324 HOH A O   1 
HETATM 1442 O  O   . HOH F 4 .   ? 29.752 7.502  -14.311 1.00 38.90 ? 325 HOH A O   1 
HETATM 1443 O  O   . HOH F 4 .   ? 47.132 16.448 32.569  1.00 49.84 ? 326 HOH A O   1 
HETATM 1444 O  O   . HOH F 4 .   ? 38.690 12.267 27.586  1.00 45.30 ? 327 HOH A O   1 
HETATM 1445 O  O   . HOH F 4 .   ? 48.024 26.325 26.412  1.00 58.07 ? 328 HOH A O   1 
HETATM 1446 O  O   . HOH F 4 .   ? 28.166 1.590  18.860  1.00 62.16 ? 329 HOH A O   1 
HETATM 1447 O  O   . HOH F 4 .   ? 45.287 14.326 32.418  1.00 48.28 ? 330 HOH A O   1 
HETATM 1448 O  O   . HOH F 4 .   ? 38.670 -4.655 -6.067  1.00 58.41 ? 331 HOH A O   1 
HETATM 1449 O  O   . HOH F 4 .   ? 34.704 16.040 -10.236 1.00 55.20 ? 332 HOH A O   1 
HETATM 1450 O  O   . HOH F 4 .   ? 46.261 11.868 -3.588  1.00 54.95 ? 334 HOH A O   1 
HETATM 1451 O  O   . HOH F 4 .   ? 38.943 12.319 30.713  1.00 53.93 ? 335 HOH A O   1 
HETATM 1452 O  O   . HOH F 4 .   ? 17.017 3.443  11.584  1.00 62.58 ? 336 HOH A O   1 
HETATM 1453 O  O   . HOH F 4 .   ? 39.092 31.878 14.888  1.00 53.81 ? 337 HOH A O   1 
HETATM 1454 O  O   . HOH F 4 .   ? 41.369 20.584 36.940  1.00 52.70 ? 338 HOH A O   1 
HETATM 1455 O  O   . HOH F 4 .   ? 21.902 3.966  17.526  1.00 61.08 ? 339 HOH A O   1 
HETATM 1456 O  O   . HOH F 4 .   ? 30.628 13.810 13.079  1.00 51.80 ? 340 HOH A O   1 
HETATM 1457 O  O   . HOH F 4 .   ? 39.430 34.329 19.948  1.00 50.51 ? 341 HOH A O   1 
HETATM 1458 O  O   . HOH F 4 .   ? 49.484 14.076 13.338  1.00 48.97 ? 342 HOH A O   1 
HETATM 1459 O  O   . HOH F 4 .   ? 20.869 16.239 4.984   1.00 56.77 ? 343 HOH A O   1 
HETATM 1460 O  O   . HOH F 4 .   ? 19.224 -0.018 -14.345 1.00 53.19 ? 344 HOH A O   1 
HETATM 1461 O  O   . HOH F 4 .   ? 48.774 3.556  -1.515  1.00 58.20 ? 346 HOH A O   1 
HETATM 1462 O  O   . HOH F 4 .   ? 48.125 16.422 12.765  1.00 49.90 ? 347 HOH A O   1 
HETATM 1463 O  O   . HOH F 4 .   ? 18.598 14.188 3.660   1.00 54.99 ? 348 HOH A O   1 
HETATM 1464 O  O   . HOH F 4 .   ? 46.767 -3.294 0.528   1.00 60.90 ? 349 HOH A O   1 
HETATM 1465 O  O   . HOH F 4 .   ? 30.185 22.859 21.057  1.00 49.02 ? 350 HOH A O   1 
HETATM 1466 O  O   . HOH F 4 .   ? 28.764 11.688 13.933  1.00 56.47 ? 351 HOH A O   1 
HETATM 1467 O  O   . HOH F 4 .   ? 49.096 3.787  10.330  1.00 59.96 ? 352 HOH A O   1 
HETATM 1468 O  O   . HOH F 4 .   ? 45.432 5.182  -3.865  1.00 56.71 ? 353 HOH A O   1 
HETATM 1469 O  O   . HOH F 4 .   ? 40.219 23.890 3.892   1.00 60.20 ? 354 HOH A O   1 
HETATM 1470 O  O   . HOH F 4 .   ? 48.172 10.463 30.707  1.00 59.88 ? 355 HOH A O   1 
HETATM 1471 O  O   . HOH F 4 .   ? 29.663 25.451 21.124  1.00 57.61 ? 356 HOH A O   1 
HETATM 1472 O  O   . HOH F 4 .   ? 24.633 18.418 0.938   1.00 63.55 ? 357 HOH A O   1 
HETATM 1473 O  O   . HOH F 4 .   ? 48.336 25.405 15.450  1.00 62.32 ? 358 HOH A O   1 
HETATM 1474 O  O   . HOH F 4 .   ? 41.726 14.962 -9.829  1.00 58.13 ? 359 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   MET 6   6   6   MET MET A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  ILE 44  44  44  ILE ILE A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 TRP 138 138 138 TRP TRP A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ASN 163 163 ?   ?   ?   A . n 
A 1 164 LEU 164 164 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   173 173 CL  CL  A . 
C 2 CL  1   178 178 CL  CL  A . 
D 3 BME 1   901 901 BME SEO A . 
E 3 BME 1   902 902 BME SEO A . 
F 4 HOH 1   171 171 HOH HOH A . 
F 4 HOH 2   172 172 HOH HOH A . 
F 4 HOH 3   174 174 HOH HOH A . 
F 4 HOH 4   175 175 HOH HOH A . 
F 4 HOH 5   177 177 HOH HOH A . 
F 4 HOH 6   179 179 HOH HOH A . 
F 4 HOH 7   180 180 HOH HOH A . 
F 4 HOH 8   181 181 HOH HOH A . 
F 4 HOH 9   182 182 HOH HOH A . 
F 4 HOH 10  183 183 HOH HOH A . 
F 4 HOH 11  184 184 HOH HOH A . 
F 4 HOH 12  185 185 HOH HOH A . 
F 4 HOH 13  186 186 HOH HOH A . 
F 4 HOH 14  187 187 HOH HOH A . 
F 4 HOH 15  188 188 HOH HOH A . 
F 4 HOH 16  189 189 HOH HOH A . 
F 4 HOH 17  190 190 HOH HOH A . 
F 4 HOH 18  191 191 HOH HOH A . 
F 4 HOH 19  192 192 HOH HOH A . 
F 4 HOH 20  193 193 HOH HOH A . 
F 4 HOH 21  194 194 HOH HOH A . 
F 4 HOH 22  195 195 HOH HOH A . 
F 4 HOH 23  196 196 HOH HOH A . 
F 4 HOH 24  197 197 HOH HOH A . 
F 4 HOH 25  200 200 HOH HOH A . 
F 4 HOH 26  201 201 HOH HOH A . 
F 4 HOH 27  202 202 HOH HOH A . 
F 4 HOH 28  203 203 HOH HOH A . 
F 4 HOH 29  204 204 HOH HOH A . 
F 4 HOH 30  206 206 HOH HOH A . 
F 4 HOH 31  207 207 HOH HOH A . 
F 4 HOH 32  208 208 HOH HOH A . 
F 4 HOH 33  209 209 HOH HOH A . 
F 4 HOH 34  210 210 HOH HOH A . 
F 4 HOH 35  211 211 HOH HOH A . 
F 4 HOH 36  212 212 HOH HOH A . 
F 4 HOH 37  213 213 HOH HOH A . 
F 4 HOH 38  214 214 HOH HOH A . 
F 4 HOH 39  215 215 HOH HOH A . 
F 4 HOH 40  216 216 HOH HOH A . 
F 4 HOH 41  217 217 HOH HOH A . 
F 4 HOH 42  218 218 HOH HOH A . 
F 4 HOH 43  219 219 HOH HOH A . 
F 4 HOH 44  220 220 HOH HOH A . 
F 4 HOH 45  221 221 HOH HOH A . 
F 4 HOH 46  222 222 HOH HOH A . 
F 4 HOH 47  223 223 HOH HOH A . 
F 4 HOH 48  224 224 HOH HOH A . 
F 4 HOH 49  225 225 HOH HOH A . 
F 4 HOH 50  226 226 HOH HOH A . 
F 4 HOH 51  227 227 HOH HOH A . 
F 4 HOH 52  228 228 HOH HOH A . 
F 4 HOH 53  229 229 HOH HOH A . 
F 4 HOH 54  230 230 HOH HOH A . 
F 4 HOH 55  231 231 HOH HOH A . 
F 4 HOH 56  232 232 HOH HOH A . 
F 4 HOH 57  233 233 HOH HOH A . 
F 4 HOH 58  234 234 HOH HOH A . 
F 4 HOH 59  235 235 HOH HOH A . 
F 4 HOH 60  236 236 HOH HOH A . 
F 4 HOH 61  237 237 HOH HOH A . 
F 4 HOH 62  238 238 HOH HOH A . 
F 4 HOH 63  239 239 HOH HOH A . 
F 4 HOH 64  240 240 HOH HOH A . 
F 4 HOH 65  242 242 HOH HOH A . 
F 4 HOH 66  244 244 HOH HOH A . 
F 4 HOH 67  245 245 HOH HOH A . 
F 4 HOH 68  246 246 HOH HOH A . 
F 4 HOH 69  247 247 HOH HOH A . 
F 4 HOH 70  248 248 HOH HOH A . 
F 4 HOH 71  249 249 HOH HOH A . 
F 4 HOH 72  250 250 HOH HOH A . 
F 4 HOH 73  251 251 HOH HOH A . 
F 4 HOH 74  253 253 HOH HOH A . 
F 4 HOH 75  254 254 HOH HOH A . 
F 4 HOH 76  256 256 HOH HOH A . 
F 4 HOH 77  257 257 HOH HOH A . 
F 4 HOH 78  258 258 HOH HOH A . 
F 4 HOH 79  259 259 HOH HOH A . 
F 4 HOH 80  260 260 HOH HOH A . 
F 4 HOH 81  261 261 HOH HOH A . 
F 4 HOH 82  263 263 HOH HOH A . 
F 4 HOH 83  265 265 HOH HOH A . 
F 4 HOH 84  266 266 HOH HOH A . 
F 4 HOH 85  267 267 HOH HOH A . 
F 4 HOH 86  268 268 HOH HOH A . 
F 4 HOH 87  269 269 HOH HOH A . 
F 4 HOH 88  270 270 HOH HOH A . 
F 4 HOH 89  271 271 HOH HOH A . 
F 4 HOH 90  272 272 HOH HOH A . 
F 4 HOH 91  273 273 HOH HOH A . 
F 4 HOH 92  274 274 HOH HOH A . 
F 4 HOH 93  275 275 HOH HOH A . 
F 4 HOH 94  276 276 HOH HOH A . 
F 4 HOH 95  277 277 HOH HOH A . 
F 4 HOH 96  278 278 HOH HOH A . 
F 4 HOH 97  280 280 HOH HOH A . 
F 4 HOH 98  281 281 HOH HOH A . 
F 4 HOH 99  282 282 HOH HOH A . 
F 4 HOH 100 283 283 HOH HOH A . 
F 4 HOH 101 284 284 HOH HOH A . 
F 4 HOH 102 285 285 HOH HOH A . 
F 4 HOH 103 286 286 HOH HOH A . 
F 4 HOH 104 288 288 HOH HOH A . 
F 4 HOH 105 289 289 HOH HOH A . 
F 4 HOH 106 290 290 HOH HOH A . 
F 4 HOH 107 291 291 HOH HOH A . 
F 4 HOH 108 292 292 HOH HOH A . 
F 4 HOH 109 293 293 HOH HOH A . 
F 4 HOH 110 294 294 HOH HOH A . 
F 4 HOH 111 295 295 HOH HOH A . 
F 4 HOH 112 296 296 HOH HOH A . 
F 4 HOH 113 297 297 HOH HOH A . 
F 4 HOH 114 298 298 HOH HOH A . 
F 4 HOH 115 299 299 HOH HOH A . 
F 4 HOH 116 300 300 HOH HOH A . 
F 4 HOH 117 301 301 HOH HOH A . 
F 4 HOH 118 302 302 HOH HOH A . 
F 4 HOH 119 303 303 HOH HOH A . 
F 4 HOH 120 304 304 HOH HOH A . 
F 4 HOH 121 306 306 HOH HOH A . 
F 4 HOH 122 307 307 HOH HOH A . 
F 4 HOH 123 308 308 HOH HOH A . 
F 4 HOH 124 309 309 HOH HOH A . 
F 4 HOH 125 311 311 HOH HOH A . 
F 4 HOH 126 312 312 HOH HOH A . 
F 4 HOH 127 313 313 HOH HOH A . 
F 4 HOH 128 314 314 HOH HOH A . 
F 4 HOH 129 315 315 HOH HOH A . 
F 4 HOH 130 316 316 HOH HOH A . 
F 4 HOH 131 317 317 HOH HOH A . 
F 4 HOH 132 318 318 HOH HOH A . 
F 4 HOH 133 319 319 HOH HOH A . 
F 4 HOH 134 321 321 HOH HOH A . 
F 4 HOH 135 322 322 HOH HOH A . 
F 4 HOH 136 323 323 HOH HOH A . 
F 4 HOH 137 324 324 HOH HOH A . 
F 4 HOH 138 325 325 HOH HOH A . 
F 4 HOH 139 326 326 HOH HOH A . 
F 4 HOH 140 327 327 HOH HOH A . 
F 4 HOH 141 328 328 HOH HOH A . 
F 4 HOH 142 329 329 HOH HOH A . 
F 4 HOH 143 330 330 HOH HOH A . 
F 4 HOH 144 331 331 HOH HOH A . 
F 4 HOH 145 332 332 HOH HOH A . 
F 4 HOH 146 334 334 HOH HOH A . 
F 4 HOH 147 335 335 HOH HOH A . 
F 4 HOH 148 336 336 HOH HOH A . 
F 4 HOH 149 337 337 HOH HOH A . 
F 4 HOH 150 338 338 HOH HOH A . 
F 4 HOH 151 339 339 HOH HOH A . 
F 4 HOH 152 340 340 HOH HOH A . 
F 4 HOH 153 341 341 HOH HOH A . 
F 4 HOH 154 342 342 HOH HOH A . 
F 4 HOH 155 343 343 HOH HOH A . 
F 4 HOH 156 344 344 HOH HOH A . 
F 4 HOH 157 346 346 HOH HOH A . 
F 4 HOH 158 347 347 HOH HOH A . 
F 4 HOH 159 348 348 HOH HOH A . 
F 4 HOH 160 349 349 HOH HOH A . 
F 4 HOH 161 350 350 HOH HOH A . 
F 4 HOH 162 351 351 HOH HOH A . 
F 4 HOH 163 352 352 HOH HOH A . 
F 4 HOH 164 353 353 HOH HOH A . 
F 4 HOH 165 354 354 HOH HOH A . 
F 4 HOH 166 355 355 HOH HOH A . 
F 4 HOH 167 356 356 HOH HOH A . 
F 4 HOH 168 357 357 HOH HOH A . 
F 4 HOH 169 358 358 HOH HOH A . 
F 4 HOH 170 359 359 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1993-10-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_database_remark.id     700 
_pdbx_database_remark.text   
;SHEET
THERE ARE SEVERAL SUBTLE ASPECTS OF THE SECONDARY STRUCTURE
OF THIS MOLECULE WHICH CANNOT CONVENIENTLY BE REPRESENTED
IN THE HELIX AND SHEET RECORDS BELOW.  THESE ASPECTS
INFLUENCE THE REPRESENTATION OF HELIX 6 AND STRAND 3 OF
SHEET *S1*.  THE PAPER J.MOL.BIOL., V. 118, P. 81, 1978
SHOULD BE CONSULTED FOR THESE SUBTLETIES.
;
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    BME 
_pdbx_validate_symm_contact.auth_seq_id_1     901 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    BME 
_pdbx_validate_symm_contact.auth_seq_id_2     901 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_555 
_pdbx_validate_symm_contact.dist              1.71 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             128 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             128 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.328 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.076 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 8   ? ? CZ A ARG 8   ? ? NH1 A ARG 8   ? ? 124.23 120.30 3.93  0.50 N 
2  1 CB A ASP 20  ? ? CG A ASP 20  ? ? OD2 A ASP 20  ? ? 125.40 118.30 7.10  0.90 N 
3  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD1 A ASP 47  ? ? 124.96 118.30 6.66  0.90 N 
4  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD2 A ASP 47  ? ? 112.32 118.30 -5.98 0.90 N 
5  1 CB A ASP 61  ? ? CG A ASP 61  ? ? OD1 A ASP 61  ? ? 111.22 118.30 -7.08 0.90 N 
6  1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH1 A ARG 80  ? ? 124.22 120.30 3.92  0.50 N 
7  1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH2 A ARG 80  ? ? 116.21 120.30 -4.09 0.50 N 
8  1 CB A ASP 92  ? ? CG A ASP 92  ? ? OD1 A ASP 92  ? ? 112.17 118.30 -6.13 0.90 N 
9  1 CB A ASP 92  ? ? CG A ASP 92  ? ? OD2 A ASP 92  ? ? 124.30 118.30 6.00  0.90 N 
10 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD1 A ASP 127 ? ? 124.44 118.30 6.14  0.90 N 
11 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD2 A ASP 127 ? ? 112.87 118.30 -5.43 0.90 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ILE 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     29 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -102.14 
_pdbx_validate_torsion.psi             74.76 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 163 ? A ASN 163 
2 1 Y 1 A LEU 164 ? A LEU 164 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'       CL  
3 BETA-MERCAPTOETHANOL BME 
4 water                HOH 
#