data_10GS
# 
_entry.id   10GS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   10GS         
WWPDB D_1000170026 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        10GS 
_pdbx_database_status.recvd_initial_deposition_date   1997-08-14 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Oakley, A.' 1 
'Parker, M.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'The structures of human glutathione transferase P1-1 in complex with glutathione and various inhibitors at high resolution.' 
J.Mol.Biol. 274 84  100 1997 JMOBAK UK 0022-2836 0070 ? 9398518 10.1006/jmbi.1997.1364 
1       
;Three-Dimensional Structure of Class Pi Glutathione S-Transferase from Human Placenta in Complex with S-Hexylglutathione at 2.8 A Resolution
;
J.Mol.Biol. 227 214 ?   1992 JMOBAK UK 0022-2836 0070 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Oakley, A.J.'   1  
primary 'Bello, M.L.'    2  
primary 'Battistoni, A.' 3  
primary 'Ricci, G.'      4  
primary 'Rossjohn, J.'   5  
primary 'Villar, H.O.'   6  
primary 'Parker, M.W.'   7  
1       'Reinemer, P.'   8  
1       'Dirr, H.W.'     9  
1       'Ladenstein, R.' 10 
1       'Huber, R.'      11 
1       'Lo Bello, M.'   12 
1       'Federici, G.'   13 
1       'Parker, M.W.'   14 
# 
_cell.entry_id           10GS 
_cell.length_a           79.723 
_cell.length_b           90.460 
_cell.length_c           69.404 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.19 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         10GS 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLUTATHIONE S-TRANSFERASE P1-1'                                         23246.570 2   2.5.1.18 ? ? ? 
2 non-polymer syn 'L-gamma-glutamyl-S-benzyl-N-[(S)-carboxy(phenyl)methyl]-L-cysteinamide' 473.542   2   ?        ? ? ? 
3 non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                   195.237   2   ?        ? ? ? 
4 water       nat water                                                                    18.015    169 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 GSTP1-1               
2 'TER117, GLU-BCS-PGY' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYG
KDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLL
IHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYG
KDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLL
IHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   PRO n 
1 3   TYR n 
1 4   THR n 
1 5   VAL n 
1 6   VAL n 
1 7   TYR n 
1 8   PHE n 
1 9   PRO n 
1 10  VAL n 
1 11  ARG n 
1 12  GLY n 
1 13  ARG n 
1 14  CYS n 
1 15  ALA n 
1 16  ALA n 
1 17  LEU n 
1 18  ARG n 
1 19  MET n 
1 20  LEU n 
1 21  LEU n 
1 22  ALA n 
1 23  ASP n 
1 24  GLN n 
1 25  GLY n 
1 26  GLN n 
1 27  SER n 
1 28  TRP n 
1 29  LYS n 
1 30  GLU n 
1 31  GLU n 
1 32  VAL n 
1 33  VAL n 
1 34  THR n 
1 35  VAL n 
1 36  GLU n 
1 37  THR n 
1 38  TRP n 
1 39  GLN n 
1 40  GLU n 
1 41  GLY n 
1 42  SER n 
1 43  LEU n 
1 44  LYS n 
1 45  ALA n 
1 46  SER n 
1 47  CYS n 
1 48  LEU n 
1 49  TYR n 
1 50  GLY n 
1 51  GLN n 
1 52  LEU n 
1 53  PRO n 
1 54  LYS n 
1 55  PHE n 
1 56  GLN n 
1 57  ASP n 
1 58  GLY n 
1 59  ASP n 
1 60  LEU n 
1 61  THR n 
1 62  LEU n 
1 63  TYR n 
1 64  GLN n 
1 65  SER n 
1 66  ASN n 
1 67  THR n 
1 68  ILE n 
1 69  LEU n 
1 70  ARG n 
1 71  HIS n 
1 72  LEU n 
1 73  GLY n 
1 74  ARG n 
1 75  THR n 
1 76  LEU n 
1 77  GLY n 
1 78  LEU n 
1 79  TYR n 
1 80  GLY n 
1 81  LYS n 
1 82  ASP n 
1 83  GLN n 
1 84  GLN n 
1 85  GLU n 
1 86  ALA n 
1 87  ALA n 
1 88  LEU n 
1 89  VAL n 
1 90  ASP n 
1 91  MET n 
1 92  VAL n 
1 93  ASN n 
1 94  ASP n 
1 95  GLY n 
1 96  VAL n 
1 97  GLU n 
1 98  ASP n 
1 99  LEU n 
1 100 ARG n 
1 101 CYS n 
1 102 LYS n 
1 103 TYR n 
1 104 ILE n 
1 105 SER n 
1 106 LEU n 
1 107 ILE n 
1 108 TYR n 
1 109 THR n 
1 110 ASN n 
1 111 TYR n 
1 112 GLU n 
1 113 ALA n 
1 114 GLY n 
1 115 LYS n 
1 116 ASP n 
1 117 ASP n 
1 118 TYR n 
1 119 VAL n 
1 120 LYS n 
1 121 ALA n 
1 122 LEU n 
1 123 PRO n 
1 124 GLY n 
1 125 GLN n 
1 126 LEU n 
1 127 LYS n 
1 128 PRO n 
1 129 PHE n 
1 130 GLU n 
1 131 THR n 
1 132 LEU n 
1 133 LEU n 
1 134 SER n 
1 135 GLN n 
1 136 ASN n 
1 137 GLN n 
1 138 GLY n 
1 139 GLY n 
1 140 LYS n 
1 141 THR n 
1 142 PHE n 
1 143 ILE n 
1 144 VAL n 
1 145 GLY n 
1 146 ASP n 
1 147 GLN n 
1 148 ILE n 
1 149 SER n 
1 150 PHE n 
1 151 ALA n 
1 152 ASP n 
1 153 TYR n 
1 154 ASN n 
1 155 LEU n 
1 156 LEU n 
1 157 ASP n 
1 158 LEU n 
1 159 LEU n 
1 160 LEU n 
1 161 ILE n 
1 162 HIS n 
1 163 GLU n 
1 164 VAL n 
1 165 LEU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 CYS n 
1 170 LEU n 
1 171 ASP n 
1 172 ALA n 
1 173 PHE n 
1 174 PRO n 
1 175 LEU n 
1 176 LEU n 
1 177 SER n 
1 178 ALA n 
1 179 TYR n 
1 180 VAL n 
1 181 GLY n 
1 182 ARG n 
1 183 LEU n 
1 184 SER n 
1 185 ALA n 
1 186 ARG n 
1 187 PRO n 
1 188 LYS n 
1 189 LEU n 
1 190 LYS n 
1 191 ALA n 
1 192 PHE n 
1 193 LEU n 
1 194 ALA n 
1 195 SER n 
1 196 PRO n 
1 197 GLU n 
1 198 TYR n 
1 199 VAL n 
1 200 ASN n 
1 201 LEU n 
1 202 PRO n 
1 203 ILE n 
1 204 ASN n 
1 205 GLY n 
1 206 ASN n 
1 207 GLY n 
1 208 LYS n 
1 209 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 GTP_HUMAN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                PLACENTA 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GTP_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P09211 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYG
KDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLL
IHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 10GS A 1 ? 209 ? P09211 1 ? 209 ? 1 209 
2 1 10GS B 1 ? 209 ? P09211 1 ? 209 ? 1 209 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                  ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                 ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                               ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                          ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                 ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                          ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                  ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                    ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                               ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                  ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                   ? 'C6 H15 N2 O2 1'  147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                   ? 'C6 H13 N O4 S'   195.237 
MET 'L-peptide linking' y METHIONINE                                                               ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                            ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                  ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                   ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                               ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                 ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                   ? 'C5 H11 N O2'     117.146 
VWW peptide-like        . 'L-gamma-glutamyl-S-benzyl-N-[(S)-carboxy(phenyl)methyl]-L-cysteinamide' ? 'C23 H27 N3 O6 S' 473.542 
# 
_exptl.entry_id          10GS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.61 
_exptl_crystal.density_percent_sol   52.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.8' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           288 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1996-04-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     10GS 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   27006 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         83 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0790000 
_reflns.pdbx_netI_over_sigmaI        12.5 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.30 
_reflns_shell.percent_possible_all   77 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1780000 
_reflns_shell.meanI_over_sigI_obs    17.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 10GS 
_refine.ls_number_reflns_obs                     18704 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.20 
_refine.ls_percent_reflns_obs                    90.18 
_refine.ls_R_factor_obs                          0.1762000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1762000 
_refine.ls_R_factor_R_free                       0.2140000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.38 
_refine.ls_number_reflns_R_free                  949 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1GSS' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3262 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         90 
_refine_hist.number_atoms_solvent             169 
_refine_hist.number_atoms_total               3521 
_refine_hist.d_res_high                       2.20 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.0  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.30 
_refine_ls_shell.number_reflns_R_work             2401 
_refine_ls_shell.R_factor_R_work                  0.2329000 
_refine_ls_shell.percent_reflns_obs               81.40 
_refine_ls_shell.R_factor_R_free                  0.2945000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.75 
_refine_ls_shell.number_reflns_R_free             116 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 ?            ?            'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.945333 
_struct_ncs_oper.matrix[1][2]   0.099229 
_struct_ncs_oper.matrix[1][3]   0.310644 
_struct_ncs_oper.matrix[2][1]   0.099832 
_struct_ncs_oper.matrix[2][2]   -0.994906 
_struct_ncs_oper.matrix[2][3]   0.013998 
_struct_ncs_oper.matrix[3][1]   0.310451 
_struct_ncs_oper.matrix[3][2]   0.017779 
_struct_ncs_oper.matrix[3][3]   -0.950423 
_struct_ncs_oper.vector[1]      -5.48795 
_struct_ncs_oper.vector[2]      21.83043 
_struct_ncs_oper.vector[3]      27.67516 
# 
_struct.entry_id                  10GS 
_struct.title                     'HUMAN GLUTATHIONE S-TRANSFERASE P1-1, COMPLEX WITH TER117' 
_struct.pdbx_descriptor           'GLUTATHIONE S-TRANSFERASE P1-1, 2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        10GS 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
_struct_keywords.text            
;DETOXIFYING ENZYME, TER117, TLK117, RP298, TELINTRA, EZATIOSTAT HCL, MYELODYSPLASTIC SYNDROME, TRANSFERASE-TRANSFERASE INHIBITOR complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 12  ? ASP A 23  ? GLY A 12  ASP A 23  5 ? 12 
HELX_P HELX_P2  2  VAL A 35  ? GLU A 40  ? VAL A 35  GLU A 40  1 ? 6  
HELX_P HELX_P3  3  SER A 42  ? SER A 46  ? SER A 42  SER A 46  1 ? 5  
HELX_P HELX_P4  4  SER A 65  ? LEU A 76  ? SER A 65  LEU A 76  1 ? 12 
HELX_P HELX_P5  5  GLN A 83  ? THR A 109 ? GLN A 83  THR A 109 1 ? 27 
HELX_P HELX_P6  6  TYR A 111 ? SER A 134 ? TYR A 111 SER A 134 1 ? 24 
HELX_P HELX_P7  7  GLN A 137 ? GLY A 139 ? GLN A 137 GLY A 139 5 ? 3  
HELX_P HELX_P8  8  PHE A 150 ? LEU A 165 ? PHE A 150 LEU A 165 1 ? 16 
HELX_P HELX_P9  9  PRO A 174 ? ALA A 185 ? PRO A 174 ALA A 185 1 ? 12 
HELX_P HELX_P10 10 PRO A 187 ? ALA A 194 ? PRO A 187 ALA A 194 1 ? 8  
HELX_P HELX_P11 11 PRO A 196 ? VAL A 199 ? PRO A 196 VAL A 199 1 ? 4  
HELX_P HELX_P12 12 GLY B 12  ? ASP B 23  ? GLY B 12  ASP B 23  5 ? 12 
HELX_P HELX_P13 13 VAL B 35  ? GLU B 40  ? VAL B 35  GLU B 40  1 ? 6  
HELX_P HELX_P14 14 SER B 42  ? SER B 46  ? SER B 42  SER B 46  1 ? 5  
HELX_P HELX_P15 15 SER B 65  ? LEU B 76  ? SER B 65  LEU B 76  1 ? 12 
HELX_P HELX_P16 16 GLN B 83  ? THR B 109 ? GLN B 83  THR B 109 1 ? 27 
HELX_P HELX_P17 17 TYR B 111 ? SER B 134 ? TYR B 111 SER B 134 1 ? 24 
HELX_P HELX_P18 18 GLN B 137 ? GLY B 139 ? GLN B 137 GLY B 139 5 ? 3  
HELX_P HELX_P19 19 PHE B 150 ? LEU B 165 ? PHE B 150 LEU B 165 1 ? 16 
HELX_P HELX_P20 20 PRO B 174 ? ALA B 185 ? PRO B 174 ALA B 185 1 ? 12 
HELX_P HELX_P21 21 PRO B 187 ? ALA B 194 ? PRO B 187 ALA B 194 1 ? 8  
HELX_P HELX_P22 22 PRO B 196 ? VAL B 199 ? PRO B 196 VAL B 199 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 52 A . ? LEU 52 A PRO 53 A ? PRO 53 A 1 0.61 
2 LEU 52 B . ? LEU 52 B PRO 53 B ? PRO 53 B 1 0.53 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 28 ? VAL A 33 ? TRP A 28 VAL A 33 
A 2 TYR A 3  ? PHE A 8  ? TYR A 3  PHE A 8  
A 3 LYS A 54 ? ASP A 57 ? LYS A 54 ASP A 57 
A 4 LEU A 60 ? TYR A 63 ? LEU A 60 TYR A 63 
B 1 TRP B 28 ? VAL B 33 ? TRP B 28 VAL B 33 
B 2 TYR B 3  ? PHE B 8  ? TYR B 3  PHE B 8  
B 3 LYS B 54 ? ASP B 57 ? LYS B 54 ASP B 57 
B 4 LEU B 60 ? TYR B 63 ? LEU B 60 TYR B 63 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LYS A 29 ? O LYS A 29 N TYR A 3  ? N TYR A 3  
A 2 3 O THR A 4  ? O THR A 4  N GLN A 56 ? N GLN A 56 
A 3 4 O PHE A 55 ? O PHE A 55 N LEU A 62 ? N LEU A 62 
B 1 2 O LYS B 29 ? O LYS B 29 N TYR B 3  ? N TYR B 3  
B 2 3 O THR B 4  ? O THR B 4  N GLN B 56 ? N GLN B 56 
B 3 4 O PHE B 55 ? O PHE B 55 N LEU B 62 ? N LEU B 62 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE VWW A 210' 
AC2 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE VWW B 210' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MES A 211' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MES B 211' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 15 TYR A 7   ? TYR A 7   . ? 1_555 ? 
2  AC1 15 PHE A 8   ? PHE A 8   . ? 1_555 ? 
3  AC1 15 ARG A 13  ? ARG A 13  . ? 1_555 ? 
4  AC1 15 TRP A 38  ? TRP A 38  . ? 1_555 ? 
5  AC1 15 LYS A 44  ? LYS A 44  . ? 1_555 ? 
6  AC1 15 GLY A 50  ? GLY A 50  . ? 1_555 ? 
7  AC1 15 GLN A 51  ? GLN A 51  . ? 1_555 ? 
8  AC1 15 LEU A 52  ? LEU A 52  . ? 1_555 ? 
9  AC1 15 PRO A 53  ? PRO A 53  . ? 1_555 ? 
10 AC1 15 GLN A 64  ? GLN A 64  . ? 1_555 ? 
11 AC1 15 SER A 65  ? SER A 65  . ? 1_555 ? 
12 AC1 15 TYR A 108 ? TYR A 108 . ? 1_555 ? 
13 AC1 15 HOH G .   ? HOH A 229 . ? 1_555 ? 
14 AC1 15 HOH G .   ? HOH A 303 . ? 1_555 ? 
15 AC1 15 ASP B 98  ? ASP B 98  . ? 1_555 ? 
16 AC2 15 ASP A 98  ? ASP A 98  . ? 1_555 ? 
17 AC2 15 TYR B 7   ? TYR B 7   . ? 1_555 ? 
18 AC2 15 PHE B 8   ? PHE B 8   . ? 1_555 ? 
19 AC2 15 ARG B 13  ? ARG B 13  . ? 1_555 ? 
20 AC2 15 TRP B 38  ? TRP B 38  . ? 1_555 ? 
21 AC2 15 LYS B 44  ? LYS B 44  . ? 1_555 ? 
22 AC2 15 GLY B 50  ? GLY B 50  . ? 1_555 ? 
23 AC2 15 GLN B 51  ? GLN B 51  . ? 1_555 ? 
24 AC2 15 LEU B 52  ? LEU B 52  . ? 1_555 ? 
25 AC2 15 PRO B 53  ? PRO B 53  . ? 1_555 ? 
26 AC2 15 GLN B 64  ? GLN B 64  . ? 1_555 ? 
27 AC2 15 SER B 65  ? SER B 65  . ? 1_555 ? 
28 AC2 15 TYR B 108 ? TYR B 108 . ? 1_555 ? 
29 AC2 15 HOH H .   ? HOH B 224 . ? 1_555 ? 
30 AC2 15 HOH H .   ? HOH B 287 . ? 1_555 ? 
31 AC3 5  ALA A 22  ? ALA A 22  . ? 1_555 ? 
32 AC3 5  TRP A 28  ? TRP A 28  . ? 1_555 ? 
33 AC3 5  GLU A 30  ? GLU A 30  . ? 1_555 ? 
34 AC3 5  GLU A 197 ? GLU A 197 . ? 1_555 ? 
35 AC3 5  ASP B 171 ? ASP B 171 . ? 4_546 ? 
36 AC4 6  ASP A 171 ? ASP A 171 . ? 4_555 ? 
37 AC4 6  HOH G .   ? HOH A 246 . ? 4_555 ? 
38 AC4 6  ALA B 22  ? ALA B 22  . ? 1_555 ? 
39 AC4 6  TRP B 28  ? TRP B 28  . ? 1_555 ? 
40 AC4 6  GLU B 30  ? GLU B 30  . ? 1_555 ? 
41 AC4 6  GLU B 197 ? GLU B 197 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          10GS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    10GS 
_atom_sites.fract_transf_matrix[1][1]   0.012543 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001805 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011055 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014557 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . PRO A 1 2   ? 31.242 3.064   39.284  1.00 39.90 ? 2   PRO A N    1 
ATOM   2    C CA   . PRO A 1 2   ? 31.195 2.392   37.963  1.00 31.96 ? 2   PRO A CA   1 
ATOM   3    C C    . PRO A 1 2   ? 29.975 2.923   37.197  1.00 30.23 ? 2   PRO A C    1 
ATOM   4    O O    . PRO A 1 2   ? 29.727 4.132   37.181  1.00 27.03 ? 2   PRO A O    1 
ATOM   5    C CB   . PRO A 1 2   ? 31.063 0.905   38.251  1.00 36.57 ? 2   PRO A CB   1 
ATOM   6    C CG   . PRO A 1 2   ? 30.276 0.947   39.549  1.00 35.11 ? 2   PRO A CG   1 
ATOM   7    C CD   . PRO A 1 2   ? 30.829 2.121   40.343  1.00 42.06 ? 2   PRO A CD   1 
ATOM   8    N N    . TYR A 1 3   ? 29.189 2.020   36.613  1.00 22.83 ? 3   TYR A N    1 
ATOM   9    C CA   . TYR A 1 3   ? 28.011 2.405   35.850  1.00 18.42 ? 3   TYR A CA   1 
ATOM   10   C C    . TYR A 1 3   ? 26.711 1.995   36.517  1.00 19.46 ? 3   TYR A C    1 
ATOM   11   O O    . TYR A 1 3   ? 26.629 0.949   37.161  1.00 24.89 ? 3   TYR A O    1 
ATOM   12   C CB   . TYR A 1 3   ? 28.055 1.772   34.459  1.00 17.73 ? 3   TYR A CB   1 
ATOM   13   C CG   . TYR A 1 3   ? 29.318 2.059   33.684  1.00 17.23 ? 3   TYR A CG   1 
ATOM   14   C CD1  . TYR A 1 3   ? 29.678 3.366   33.355  1.00 19.19 ? 3   TYR A CD1  1 
ATOM   15   C CD2  . TYR A 1 3   ? 30.149 1.023   33.267  1.00 16.84 ? 3   TYR A CD2  1 
ATOM   16   C CE1  . TYR A 1 3   ? 30.835 3.633   32.629  1.00 18.79 ? 3   TYR A CE1  1 
ATOM   17   C CE2  . TYR A 1 3   ? 31.308 1.279   32.539  1.00 20.85 ? 3   TYR A CE2  1 
ATOM   18   C CZ   . TYR A 1 3   ? 31.645 2.584   32.226  1.00 20.77 ? 3   TYR A CZ   1 
ATOM   19   O OH   . TYR A 1 3   ? 32.803 2.828   31.528  1.00 22.24 ? 3   TYR A OH   1 
ATOM   20   N N    . THR A 1 4   ? 25.683 2.804   36.297  1.00 13.22 ? 4   THR A N    1 
ATOM   21   C CA   . THR A 1 4   ? 24.361 2.547   36.835  1.00 19.34 ? 4   THR A CA   1 
ATOM   22   C C    . THR A 1 4   ? 23.337 2.985   35.797  1.00 20.48 ? 4   THR A C    1 
ATOM   23   O O    . THR A 1 4   ? 23.374 4.124   35.335  1.00 22.30 ? 4   THR A O    1 
ATOM   24   C CB   . THR A 1 4   ? 24.097 3.357   38.132  1.00 18.80 ? 4   THR A CB   1 
ATOM   25   O OG1  . THR A 1 4   ? 25.094 3.042   39.110  1.00 19.60 ? 4   THR A OG1  1 
ATOM   26   C CG2  . THR A 1 4   ? 22.713 3.031   38.699  1.00 12.79 ? 4   THR A CG2  1 
ATOM   27   N N    . VAL A 1 5   ? 22.463 2.071   35.385  1.00 18.58 ? 5   VAL A N    1 
ATOM   28   C CA   . VAL A 1 5   ? 21.420 2.437   34.438  1.00 17.96 ? 5   VAL A CA   1 
ATOM   29   C C    . VAL A 1 5   ? 20.078 2.369   35.160  1.00 19.40 ? 5   VAL A C    1 
ATOM   30   O O    . VAL A 1 5   ? 19.743 1.367   35.790  1.00 22.04 ? 5   VAL A O    1 
ATOM   31   C CB   . VAL A 1 5   ? 21.436 1.582   33.113  1.00 17.57 ? 5   VAL A CB   1 
ATOM   32   C CG1  . VAL A 1 5   ? 22.717 0.779   32.989  1.00 12.49 ? 5   VAL A CG1  1 
ATOM   33   C CG2  . VAL A 1 5   ? 20.204 0.704   32.988  1.00 22.38 ? 5   VAL A CG2  1 
ATOM   34   N N    . VAL A 1 6   ? 19.366 3.488   35.149  1.00 19.86 ? 6   VAL A N    1 
ATOM   35   C CA   . VAL A 1 6   ? 18.059 3.585   35.781  1.00 19.18 ? 6   VAL A CA   1 
ATOM   36   C C    . VAL A 1 6   ? 17.049 3.522   34.638  1.00 21.26 ? 6   VAL A C    1 
ATOM   37   O O    . VAL A 1 6   ? 17.045 4.385   33.752  1.00 18.67 ? 6   VAL A O    1 
ATOM   38   C CB   . VAL A 1 6   ? 17.906 4.919   36.550  1.00 19.15 ? 6   VAL A CB   1 
ATOM   39   C CG1  . VAL A 1 6   ? 16.592 4.937   37.304  1.00 13.21 ? 6   VAL A CG1  1 
ATOM   40   C CG2  . VAL A 1 6   ? 19.084 5.122   37.497  1.00 16.31 ? 6   VAL A CG2  1 
ATOM   41   N N    . TYR A 1 7   ? 16.196 2.504   34.657  1.00 16.48 ? 7   TYR A N    1 
ATOM   42   C CA   . TYR A 1 7   ? 15.226 2.331   33.585  1.00 17.51 ? 7   TYR A CA   1 
ATOM   43   C C    . TYR A 1 7   ? 14.067 1.427   33.993  1.00 15.22 ? 7   TYR A C    1 
ATOM   44   O O    . TYR A 1 7   ? 14.097 0.789   35.042  1.00 21.57 ? 7   TYR A O    1 
ATOM   45   C CB   . TYR A 1 7   ? 15.954 1.735   32.372  1.00 17.21 ? 7   TYR A CB   1 
ATOM   46   C CG   . TYR A 1 7   ? 15.202 1.810   31.064  1.00 19.24 ? 7   TYR A CG   1 
ATOM   47   C CD1  . TYR A 1 7   ? 14.713 3.025   30.580  1.00 23.22 ? 7   TYR A CD1  1 
ATOM   48   C CD2  . TYR A 1 7   ? 14.995 0.665   30.297  1.00 18.29 ? 7   TYR A CD2  1 
ATOM   49   C CE1  . TYR A 1 7   ? 14.036 3.095   29.363  1.00 18.22 ? 7   TYR A CE1  1 
ATOM   50   C CE2  . TYR A 1 7   ? 14.323 0.723   29.083  1.00 19.10 ? 7   TYR A CE2  1 
ATOM   51   C CZ   . TYR A 1 7   ? 13.846 1.938   28.621  1.00 21.78 ? 7   TYR A CZ   1 
ATOM   52   O OH   . TYR A 1 7   ? 13.180 1.997   27.419  1.00 19.49 ? 7   TYR A OH   1 
ATOM   53   N N    . PHE A 1 8   ? 13.041 1.388   33.152  1.00 17.17 ? 8   PHE A N    1 
ATOM   54   C CA   . PHE A 1 8   ? 11.870 0.551   33.384  1.00 20.97 ? 8   PHE A CA   1 
ATOM   55   C C    . PHE A 1 8   ? 12.265 -0.902  33.111  1.00 23.22 ? 8   PHE A C    1 
ATOM   56   O O    . PHE A 1 8   ? 13.297 -1.157  32.496  1.00 22.12 ? 8   PHE A O    1 
ATOM   57   C CB   . PHE A 1 8   ? 10.742 0.990   32.454  1.00 20.14 ? 8   PHE A CB   1 
ATOM   58   C CG   . PHE A 1 8   ? 10.344 2.426   32.635  1.00 26.86 ? 8   PHE A CG   1 
ATOM   59   C CD1  . PHE A 1 8   ? 9.655  2.833   33.777  1.00 28.34 ? 8   PHE A CD1  1 
ATOM   60   C CD2  . PHE A 1 8   ? 10.680 3.380   31.679  1.00 25.81 ? 8   PHE A CD2  1 
ATOM   61   C CE1  . PHE A 1 8   ? 9.306  4.171   33.966  1.00 26.11 ? 8   PHE A CE1  1 
ATOM   62   C CE2  . PHE A 1 8   ? 10.337 4.724   31.856  1.00 27.24 ? 8   PHE A CE2  1 
ATOM   63   C CZ   . PHE A 1 8   ? 9.649  5.120   33.002  1.00 31.55 ? 8   PHE A CZ   1 
ATOM   64   N N    . PRO A 1 9   ? 11.475 -1.874  33.599  1.00 22.45 ? 9   PRO A N    1 
ATOM   65   C CA   . PRO A 1 9   ? 11.810 -3.285  33.365  1.00 25.63 ? 9   PRO A CA   1 
ATOM   66   C C    . PRO A 1 9   ? 11.527 -3.784  31.939  1.00 23.89 ? 9   PRO A C    1 
ATOM   67   O O    . PRO A 1 9   ? 10.777 -4.740  31.743  1.00 27.87 ? 9   PRO A O    1 
ATOM   68   C CB   . PRO A 1 9   ? 10.955 -4.005  34.409  1.00 26.37 ? 9   PRO A CB   1 
ATOM   69   C CG   . PRO A 1 9   ? 9.724  -3.141  34.473  1.00 23.87 ? 9   PRO A CG   1 
ATOM   70   C CD   . PRO A 1 9   ? 10.312 -1.748  34.496  1.00 24.97 ? 9   PRO A CD   1 
ATOM   71   N N    . VAL A 1 10  ? 12.125 -3.123  30.949  1.00 23.67 ? 10  VAL A N    1 
ATOM   72   C CA   . VAL A 1 10  ? 11.969 -3.489  29.541  1.00 19.23 ? 10  VAL A CA   1 
ATOM   73   C C    . VAL A 1 10  ? 13.312 -3.289  28.850  1.00 20.13 ? 10  VAL A C    1 
ATOM   74   O O    . VAL A 1 10  ? 14.214 -2.661  29.407  1.00 21.70 ? 10  VAL A O    1 
ATOM   75   C CB   . VAL A 1 10  ? 10.906 -2.613  28.810  1.00 22.15 ? 10  VAL A CB   1 
ATOM   76   C CG1  . VAL A 1 10  ? 9.550  -2.724  29.493  1.00 20.17 ? 10  VAL A CG1  1 
ATOM   77   C CG2  . VAL A 1 10  ? 11.359 -1.160  28.743  1.00 22.63 ? 10  VAL A CG2  1 
ATOM   78   N N    . ARG A 1 11  ? 13.460 -3.848  27.653  1.00 18.71 ? 11  ARG A N    1 
ATOM   79   C CA   . ARG A 1 11  ? 14.701 -3.694  26.898  1.00 18.17 ? 11  ARG A CA   1 
ATOM   80   C C    . ARG A 1 11  ? 14.738 -2.278  26.338  1.00 15.50 ? 11  ARG A C    1 
ATOM   81   O O    . ARG A 1 11  ? 15.679 -1.529  26.597  1.00 14.31 ? 11  ARG A O    1 
ATOM   82   C CB   . ARG A 1 11  ? 14.773 -4.713  25.762  1.00 18.01 ? 11  ARG A CB   1 
ATOM   83   C CG   . ARG A 1 11  ? 14.797 -6.150  26.244  1.00 27.60 ? 11  ARG A CG   1 
ATOM   84   C CD   . ARG A 1 11  ? 14.943 -7.120  25.092  1.00 27.61 ? 11  ARG A CD   1 
ATOM   85   N NE   . ARG A 1 11  ? 14.609 -8.476  25.509  1.00 37.28 ? 11  ARG A NE   1 
ATOM   86   C CZ   . ARG A 1 11  ? 14.246 -9.448  24.679  1.00 34.90 ? 11  ARG A CZ   1 
ATOM   87   N NH1  . ARG A 1 11  ? 14.176 -9.219  23.375  1.00 34.05 ? 11  ARG A NH1  1 
ATOM   88   N NH2  . ARG A 1 11  ? 13.917 -10.638 25.163  1.00 34.82 ? 11  ARG A NH2  1 
ATOM   89   N N    . GLY A 1 12  ? 13.692 -1.933  25.585  1.00 16.37 ? 12  GLY A N    1 
ATOM   90   C CA   . GLY A 1 12  ? 13.546 -0.612  24.995  1.00 15.31 ? 12  GLY A CA   1 
ATOM   91   C C    . GLY A 1 12  ? 14.805 0.095   24.539  1.00 16.39 ? 12  GLY A C    1 
ATOM   92   O O    . GLY A 1 12  ? 15.615 -0.464  23.794  1.00 12.85 ? 12  GLY A O    1 
ATOM   93   N N    . ARG A 1 13  ? 14.993 1.315   25.032  1.00 15.58 ? 13  ARG A N    1 
ATOM   94   C CA   . ARG A 1 13  ? 16.152 2.121   24.667  1.00 18.28 ? 13  ARG A CA   1 
ATOM   95   C C    . ARG A 1 13  ? 17.452 1.819   25.406  1.00 17.33 ? 13  ARG A C    1 
ATOM   96   O O    . ARG A 1 13  ? 18.432 2.551   25.256  1.00 17.22 ? 13  ARG A O    1 
ATOM   97   C CB   . ARG A 1 13  ? 15.815 3.611   24.771  1.00 20.29 ? 13  ARG A CB   1 
ATOM   98   C CG   . ARG A 1 13  ? 14.896 4.098   23.662  1.00 17.00 ? 13  ARG A CG   1 
ATOM   99   C CD   . ARG A 1 13  ? 14.694 5.596   23.736  1.00 15.27 ? 13  ARG A CD   1 
ATOM   100  N NE   . ARG A 1 13  ? 13.987 6.117   22.568  1.00 18.44 ? 13  ARG A NE   1 
ATOM   101  C CZ   . ARG A 1 13  ? 14.584 6.502   21.444  1.00 16.41 ? 13  ARG A CZ   1 
ATOM   102  N NH1  . ARG A 1 13  ? 15.904 6.417   21.320  1.00 13.14 ? 13  ARG A NH1  1 
ATOM   103  N NH2  . ARG A 1 13  ? 13.856 6.965   20.438  1.00 10.51 ? 13  ARG A NH2  1 
ATOM   104  N N    . CYS A 1 14  ? 17.470 0.750   26.199  1.00 14.56 ? 14  CYS A N    1 
ATOM   105  C CA   . CYS A 1 14  ? 18.685 0.383   26.927  1.00 11.34 ? 14  CYS A CA   1 
ATOM   106  C C    . CYS A 1 14  ? 19.309 -0.901  26.413  1.00 11.79 ? 14  CYS A C    1 
ATOM   107  O O    . CYS A 1 14  ? 20.429 -1.250  26.795  1.00 10.40 ? 14  CYS A O    1 
ATOM   108  C CB   . CYS A 1 14  ? 18.411 0.265   28.428  1.00 13.29 ? 14  CYS A CB   1 
ATOM   109  S SG   . CYS A 1 14  ? 18.129 1.852   29.221  1.00 17.53 ? 14  CYS A SG   1 
ATOM   110  N N    . ALA A 1 15  ? 18.591 -1.590  25.530  1.00 10.15 ? 15  ALA A N    1 
ATOM   111  C CA   . ALA A 1 15  ? 19.059 -2.847  24.959  1.00 13.24 ? 15  ALA A CA   1 
ATOM   112  C C    . ALA A 1 15  ? 20.445 -2.728  24.332  1.00 13.21 ? 15  ALA A C    1 
ATOM   113  O O    . ALA A 1 15  ? 21.353 -3.490  24.667  1.00 18.26 ? 15  ALA A O    1 
ATOM   114  C CB   . ALA A 1 15  ? 18.048 -3.362  23.935  1.00 11.30 ? 15  ALA A CB   1 
ATOM   115  N N    . ALA A 1 16  ? 20.620 -1.732  23.470  1.00 16.63 ? 16  ALA A N    1 
ATOM   116  C CA   . ALA A 1 16  ? 21.892 -1.515  22.794  1.00 10.39 ? 16  ALA A CA   1 
ATOM   117  C C    . ALA A 1 16  ? 23.036 -1.185  23.745  1.00 15.32 ? 16  ALA A C    1 
ATOM   118  O O    . ALA A 1 16  ? 24.125 -1.760  23.631  1.00 17.28 ? 16  ALA A O    1 
ATOM   119  C CB   . ALA A 1 16  ? 21.747 -0.433  21.742  1.00 14.07 ? 16  ALA A CB   1 
ATOM   120  N N    . LEU A 1 17  ? 22.792 -0.282  24.694  1.00 15.12 ? 17  LEU A N    1 
ATOM   121  C CA   . LEU A 1 17  ? 23.834 0.100   25.648  1.00 17.17 ? 17  LEU A CA   1 
ATOM   122  C C    . LEU A 1 17  ? 24.190 -1.056  26.589  1.00 15.48 ? 17  LEU A C    1 
ATOM   123  O O    . LEU A 1 17  ? 25.335 -1.168  27.035  1.00 17.10 ? 17  LEU A O    1 
ATOM   124  C CB   . LEU A 1 17  ? 23.454 1.381   26.416  1.00 19.50 ? 17  LEU A CB   1 
ATOM   125  C CG   . LEU A 1 17  ? 22.302 1.445   27.420  1.00 23.29 ? 17  LEU A CG   1 
ATOM   126  C CD1  . LEU A 1 17  ? 22.845 1.235   28.820  1.00 21.79 ? 17  LEU A CD1  1 
ATOM   127  C CD2  . LEU A 1 17  ? 21.617 2.808   27.334  1.00 20.62 ? 17  LEU A CD2  1 
ATOM   128  N N    . ARG A 1 18  ? 23.223 -1.931  26.859  1.00 10.96 ? 18  ARG A N    1 
ATOM   129  C CA   . ARG A 1 18  ? 23.468 -3.096  27.707  1.00 15.98 ? 18  ARG A CA   1 
ATOM   130  C C    . ARG A 1 18  ? 24.332 -4.104  26.951  1.00 17.26 ? 18  ARG A C    1 
ATOM   131  O O    . ARG A 1 18  ? 25.273 -4.670  27.516  1.00 17.70 ? 18  ARG A O    1 
ATOM   132  C CB   . ARG A 1 18  ? 22.155 -3.748  28.125  1.00 15.83 ? 18  ARG A CB   1 
ATOM   133  C CG   . ARG A 1 18  ? 21.408 -2.979  29.195  1.00 13.17 ? 18  ARG A CG   1 
ATOM   134  C CD   . ARG A 1 18  ? 19.985 -3.478  29.308  1.00 14.43 ? 18  ARG A CD   1 
ATOM   135  N NE   . ARG A 1 18  ? 19.289 -2.858  30.426  1.00 11.87 ? 18  ARG A NE   1 
ATOM   136  C CZ   . ARG A 1 18  ? 17.970 -2.717  30.505  1.00 15.61 ? 18  ARG A CZ   1 
ATOM   137  N NH1  . ARG A 1 18  ? 17.188 -3.148  29.523  1.00 15.54 ? 18  ARG A NH1  1 
ATOM   138  N NH2  . ARG A 1 18  ? 17.430 -2.148  31.577  1.00 13.98 ? 18  ARG A NH2  1 
ATOM   139  N N    . MET A 1 19  ? 24.019 -4.313  25.671  1.00 16.80 ? 19  MET A N    1 
ATOM   140  C CA   . MET A 1 19  ? 24.787 -5.237  24.834  1.00 15.14 ? 19  MET A CA   1 
ATOM   141  C C    . MET A 1 19  ? 26.219 -4.743  24.714  1.00 17.68 ? 19  MET A C    1 
ATOM   142  O O    . MET A 1 19  ? 27.158 -5.536  24.713  1.00 20.00 ? 19  MET A O    1 
ATOM   143  C CB   . MET A 1 19  ? 24.185 -5.341  23.433  1.00 19.56 ? 19  MET A CB   1 
ATOM   144  C CG   . MET A 1 19  ? 22.786 -5.920  23.379  1.00 21.18 ? 19  MET A CG   1 
ATOM   145  S SD   . MET A 1 19  ? 22.261 -6.218  21.687  1.00 31.83 ? 19  MET A SD   1 
ATOM   146  C CE   . MET A 1 19  ? 22.032 -4.592  21.115  1.00 33.49 ? 19  MET A CE   1 
ATOM   147  N N    . LEU A 1 20  ? 26.374 -3.425  24.611  1.00 14.60 ? 20  LEU A N    1 
ATOM   148  C CA   . LEU A 1 20  ? 27.689 -2.804  24.493  1.00 16.07 ? 20  LEU A CA   1 
ATOM   149  C C    . LEU A 1 20  ? 28.521 -3.068  25.751  1.00 19.64 ? 20  LEU A C    1 
ATOM   150  O O    . LEU A 1 20  ? 29.675 -3.501  25.665  1.00 15.82 ? 20  LEU A O    1 
ATOM   151  C CB   . LEU A 1 20  ? 27.529 -1.296  24.252  1.00 17.09 ? 20  LEU A CB   1 
ATOM   152  C CG   . LEU A 1 20  ? 28.749 -0.433  23.902  1.00 21.27 ? 20  LEU A CG   1 
ATOM   153  C CD1  . LEU A 1 20  ? 28.275 0.862   23.265  1.00 19.18 ? 20  LEU A CD1  1 
ATOM   154  C CD2  . LEU A 1 20  ? 29.615 -0.147  25.128  1.00 16.96 ? 20  LEU A CD2  1 
ATOM   155  N N    . LEU A 1 21  ? 27.932 -2.792  26.914  1.00 19.49 ? 21  LEU A N    1 
ATOM   156  C CA   . LEU A 1 21  ? 28.607 -3.002  28.192  1.00 18.96 ? 21  LEU A CA   1 
ATOM   157  C C    . LEU A 1 21  ? 28.966 -4.472  28.388  1.00 17.46 ? 21  LEU A C    1 
ATOM   158  O O    . LEU A 1 21  ? 30.093 -4.793  28.748  1.00 18.27 ? 21  LEU A O    1 
ATOM   159  C CB   . LEU A 1 21  ? 27.728 -2.518  29.350  1.00 14.89 ? 21  LEU A CB   1 
ATOM   160  C CG   . LEU A 1 21  ? 27.585 -1.001  29.494  1.00 14.97 ? 21  LEU A CG   1 
ATOM   161  C CD1  . LEU A 1 21  ? 26.521 -0.668  30.522  1.00 13.48 ? 21  LEU A CD1  1 
ATOM   162  C CD2  . LEU A 1 21  ? 28.925 -0.394  29.884  1.00 13.27 ? 21  LEU A CD2  1 
ATOM   163  N N    . ALA A 1 22  ? 28.013 -5.356  28.115  1.00 16.24 ? 22  ALA A N    1 
ATOM   164  C CA   . ALA A 1 22  ? 28.224 -6.793  28.258  1.00 17.75 ? 22  ALA A CA   1 
ATOM   165  C C    . ALA A 1 22  ? 29.358 -7.280  27.364  1.00 18.70 ? 22  ALA A C    1 
ATOM   166  O O    . ALA A 1 22  ? 30.309 -7.909  27.836  1.00 24.16 ? 22  ALA A O    1 
ATOM   167  C CB   . ALA A 1 22  ? 26.946 -7.539  27.928  1.00 16.02 ? 22  ALA A CB   1 
ATOM   168  N N    . ASP A 1 23  ? 29.276 -6.943  26.081  1.00 19.77 ? 23  ASP A N    1 
ATOM   169  C CA   . ASP A 1 23  ? 30.281 -7.348  25.105  1.00 20.00 ? 23  ASP A CA   1 
ATOM   170  C C    . ASP A 1 23  ? 31.676 -6.787  25.386  1.00 20.89 ? 23  ASP A C    1 
ATOM   171  O O    . ASP A 1 23  ? 32.681 -7.407  25.036  1.00 23.31 ? 23  ASP A O    1 
ATOM   172  C CB   . ASP A 1 23  ? 29.836 -6.954  23.693  1.00 24.93 ? 23  ASP A CB   1 
ATOM   173  C CG   . ASP A 1 23  ? 30.595 -7.706  22.612  1.00 28.30 ? 23  ASP A CG   1 
ATOM   174  O OD1  . ASP A 1 23  ? 30.503 -8.949  22.578  1.00 29.29 ? 23  ASP A OD1  1 
ATOM   175  O OD2  . ASP A 1 23  ? 31.316 -7.074  21.815  1.00 26.02 ? 23  ASP A OD2  1 
ATOM   176  N N    . GLN A 1 24  ? 31.738 -5.613  26.006  1.00 24.47 ? 24  GLN A N    1 
ATOM   177  C CA   . GLN A 1 24  ? 33.020 -4.987  26.329  1.00 23.19 ? 24  GLN A CA   1 
ATOM   178  C C    . GLN A 1 24  ? 33.566 -5.446  27.673  1.00 22.46 ? 24  GLN A C    1 
ATOM   179  O O    . GLN A 1 24  ? 34.592 -4.950  28.133  1.00 29.52 ? 24  GLN A O    1 
ATOM   180  C CB   . GLN A 1 24  ? 32.897 -3.461  26.306  1.00 19.66 ? 24  GLN A CB   1 
ATOM   181  C CG   . GLN A 1 24  ? 32.696 -2.884  24.907  1.00 17.35 ? 24  GLN A CG   1 
ATOM   182  C CD   . GLN A 1 24  ? 33.820 -3.268  23.968  1.00 20.22 ? 24  GLN A CD   1 
ATOM   183  O OE1  . GLN A 1 24  ? 34.994 -3.138  24.317  1.00 19.83 ? 24  GLN A OE1  1 
ATOM   184  N NE2  . GLN A 1 24  ? 33.472 -3.759  22.785  1.00 13.55 ? 24  GLN A NE2  1 
ATOM   185  N N    . GLY A 1 25  ? 32.870 -6.391  28.298  1.00 23.76 ? 25  GLY A N    1 
ATOM   186  C CA   . GLY A 1 25  ? 33.295 -6.918  29.582  1.00 23.57 ? 25  GLY A CA   1 
ATOM   187  C C    . GLY A 1 25  ? 33.165 -5.936  30.730  1.00 22.99 ? 25  GLY A C    1 
ATOM   188  O O    . GLY A 1 25  ? 33.950 -5.973  31.667  1.00 26.83 ? 25  GLY A O    1 
ATOM   189  N N    . GLN A 1 26  ? 32.171 -5.058  30.658  1.00 26.31 ? 26  GLN A N    1 
ATOM   190  C CA   . GLN A 1 26  ? 31.943 -4.060  31.700  1.00 28.99 ? 26  GLN A CA   1 
ATOM   191  C C    . GLN A 1 26  ? 30.861 -4.495  32.677  1.00 27.54 ? 26  GLN A C    1 
ATOM   192  O O    . GLN A 1 26  ? 29.915 -5.189  32.306  1.00 30.40 ? 26  GLN A O    1 
ATOM   193  C CB   . GLN A 1 26  ? 31.540 -2.719  31.078  1.00 31.87 ? 26  GLN A CB   1 
ATOM   194  C CG   . GLN A 1 26  ? 32.541 -2.161  30.083  1.00 32.88 ? 26  GLN A CG   1 
ATOM   195  C CD   . GLN A 1 26  ? 33.901 -1.926  30.700  1.00 33.03 ? 26  GLN A CD   1 
ATOM   196  O OE1  . GLN A 1 26  ? 34.008 -1.498  31.850  1.00 28.41 ? 26  GLN A OE1  1 
ATOM   197  N NE2  . GLN A 1 26  ? 34.953 -2.229  29.948  1.00 38.94 ? 26  GLN A NE2  1 
ATOM   198  N N    . SER A 1 27  ? 31.007 -4.064  33.926  1.00 28.74 ? 27  SER A N    1 
ATOM   199  C CA   . SER A 1 27  ? 30.052 -4.378  34.983  1.00 26.82 ? 27  SER A CA   1 
ATOM   200  C C    . SER A 1 27  ? 29.194 -3.143  35.206  1.00 25.69 ? 27  SER A C    1 
ATOM   201  O O    . SER A 1 27  ? 29.686 -2.018  35.124  1.00 27.06 ? 27  SER A O    1 
ATOM   202  C CB   . SER A 1 27  ? 30.786 -4.692  36.291  1.00 29.20 ? 27  SER A CB   1 
ATOM   203  O OG   . SER A 1 27  ? 31.909 -5.523  36.071  1.00 41.28 ? 27  SER A OG   1 
ATOM   204  N N    . TRP A 1 28  ? 27.915 -3.345  35.493  1.00 21.96 ? 28  TRP A N    1 
ATOM   205  C CA   . TRP A 1 28  ? 27.033 -2.220  35.755  1.00 24.43 ? 28  TRP A CA   1 
ATOM   206  C C    . TRP A 1 28  ? 25.903 -2.616  36.697  1.00 26.77 ? 28  TRP A C    1 
ATOM   207  O O    . TRP A 1 28  ? 25.584 -3.795  36.841  1.00 25.34 ? 28  TRP A O    1 
ATOM   208  C CB   . TRP A 1 28  ? 26.472 -1.638  34.453  1.00 21.55 ? 28  TRP A CB   1 
ATOM   209  C CG   . TRP A 1 28  ? 25.449 -2.498  33.757  1.00 14.67 ? 28  TRP A CG   1 
ATOM   210  C CD1  . TRP A 1 28  ? 24.090 -2.375  33.830  1.00 9.31  ? 28  TRP A CD1  1 
ATOM   211  C CD2  . TRP A 1 28  ? 25.709 -3.566  32.833  1.00 12.15 ? 28  TRP A CD2  1 
ATOM   212  N NE1  . TRP A 1 28  ? 23.491 -3.293  33.002  1.00 11.46 ? 28  TRP A NE1  1 
ATOM   213  C CE2  . TRP A 1 28  ? 24.457 -4.035  32.378  1.00 10.63 ? 28  TRP A CE2  1 
ATOM   214  C CE3  . TRP A 1 28  ? 26.877 -4.171  32.344  1.00 12.67 ? 28  TRP A CE3  1 
ATOM   215  C CZ2  . TRP A 1 28  ? 24.341 -5.078  31.453  1.00 9.14  ? 28  TRP A CZ2  1 
ATOM   216  C CZ3  . TRP A 1 28  ? 26.759 -5.209  31.426  1.00 13.30 ? 28  TRP A CZ3  1 
ATOM   217  C CH2  . TRP A 1 28  ? 25.497 -5.650  30.991  1.00 9.78  ? 28  TRP A CH2  1 
ATOM   218  N N    . LYS A 1 29  ? 25.311 -1.615  37.337  1.00 24.24 ? 29  LYS A N    1 
ATOM   219  C CA   . LYS A 1 29  ? 24.219 -1.817  38.272  1.00 22.87 ? 29  LYS A CA   1 
ATOM   220  C C    . LYS A 1 29  ? 22.915 -1.406  37.610  1.00 23.70 ? 29  LYS A C    1 
ATOM   221  O O    . LYS A 1 29  ? 22.855 -0.391  36.920  1.00 25.40 ? 29  LYS A O    1 
ATOM   222  C CB   . LYS A 1 29  ? 24.465 -0.976  39.529  1.00 29.03 ? 29  LYS A CB   1 
ATOM   223  C CG   . LYS A 1 29  ? 23.266 -0.813  40.449  1.00 39.95 ? 29  LYS A CG   1 
ATOM   224  C CD   . LYS A 1 29  ? 22.942 -2.085  41.219  1.00 51.60 ? 29  LYS A CD   1 
ATOM   225  C CE   . LYS A 1 29  ? 21.690 -1.893  42.070  1.00 57.02 ? 29  LYS A CE   1 
ATOM   226  N NZ   . LYS A 1 29  ? 21.792 -0.670  42.925  1.00 61.59 ? 29  LYS A NZ   1 
ATOM   227  N N    . GLU A 1 30  ? 21.883 -2.220  37.792  1.00 25.07 ? 30  GLU A N    1 
ATOM   228  C CA   . GLU A 1 30  ? 20.575 -1.930  37.229  1.00 27.49 ? 30  GLU A CA   1 
ATOM   229  C C    . GLU A 1 30  ? 19.651 -1.439  38.332  1.00 30.70 ? 30  GLU A C    1 
ATOM   230  O O    . GLU A 1 30  ? 19.456 -2.119  39.339  1.00 35.30 ? 30  GLU A O    1 
ATOM   231  C CB   . GLU A 1 30  ? 19.971 -3.182  36.581  1.00 25.50 ? 30  GLU A CB   1 
ATOM   232  C CG   . GLU A 1 30  ? 20.635 -3.620  35.278  1.00 28.34 ? 30  GLU A CG   1 
ATOM   233  C CD   . GLU A 1 30  ? 20.113 -2.894  34.036  1.00 30.13 ? 30  GLU A CD   1 
ATOM   234  O OE1  . GLU A 1 30  ? 19.166 -2.081  34.132  1.00 26.14 ? 30  GLU A OE1  1 
ATOM   235  O OE2  . GLU A 1 30  ? 20.642 -3.166  32.940  1.00 25.20 ? 30  GLU A OE2  1 
ATOM   236  N N    . GLU A 1 31  ? 19.141 -0.226  38.162  1.00 30.04 ? 31  GLU A N    1 
ATOM   237  C CA   . GLU A 1 31  ? 18.212 0.369   39.109  1.00 25.07 ? 31  GLU A CA   1 
ATOM   238  C C    . GLU A 1 31  ? 16.875 0.323   38.411  1.00 23.26 ? 31  GLU A C    1 
ATOM   239  O O    . GLU A 1 31  ? 16.590 1.143   37.543  1.00 29.50 ? 31  GLU A O    1 
ATOM   240  C CB   . GLU A 1 31  ? 18.600 1.815   39.412  1.00 34.10 ? 31  GLU A CB   1 
ATOM   241  C CG   . GLU A 1 31  ? 19.672 1.960   40.474  1.00 50.28 ? 31  GLU A CG   1 
ATOM   242  C CD   . GLU A 1 31  ? 19.149 1.662   41.865  1.00 60.18 ? 31  GLU A CD   1 
ATOM   243  O OE1  . GLU A 1 31  ? 19.103 0.473   42.253  1.00 64.38 ? 31  GLU A OE1  1 
ATOM   244  O OE2  . GLU A 1 31  ? 18.780 2.623   42.572  1.00 67.09 ? 31  GLU A OE2  1 
ATOM   245  N N    . VAL A 1 32  ? 16.074 -0.675  38.753  1.00 23.05 ? 32  VAL A N    1 
ATOM   246  C CA   . VAL A 1 32  ? 14.771 -0.841  38.132  1.00 20.87 ? 32  VAL A CA   1 
ATOM   247  C C    . VAL A 1 32  ? 13.711 0.081   38.711  1.00 23.88 ? 32  VAL A C    1 
ATOM   248  O O    . VAL A 1 32  ? 13.533 0.168   39.922  1.00 29.17 ? 32  VAL A O    1 
ATOM   249  C CB   . VAL A 1 32  ? 14.290 -2.303  38.222  1.00 18.51 ? 32  VAL A CB   1 
ATOM   250  C CG1  . VAL A 1 32  ? 12.968 -2.469  37.496  1.00 11.00 ? 32  VAL A CG1  1 
ATOM   251  C CG2  . VAL A 1 32  ? 15.342 -3.230  37.632  1.00 19.20 ? 32  VAL A CG2  1 
ATOM   252  N N    . VAL A 1 33  ? 13.021 0.782   37.821  1.00 26.92 ? 33  VAL A N    1 
ATOM   253  C CA   . VAL A 1 33  ? 11.956 1.693   38.197  1.00 20.59 ? 33  VAL A CA   1 
ATOM   254  C C    . VAL A 1 33  ? 10.673 1.115   37.629  1.00 27.61 ? 33  VAL A C    1 
ATOM   255  O O    . VAL A 1 33  ? 10.568 0.885   36.422  1.00 28.93 ? 33  VAL A O    1 
ATOM   256  C CB   . VAL A 1 33  ? 12.180 3.106   37.603  1.00 21.72 ? 33  VAL A CB   1 
ATOM   257  C CG1  . VAL A 1 33  ? 10.984 4.002   37.892  1.00 15.74 ? 33  VAL A CG1  1 
ATOM   258  C CG2  . VAL A 1 33  ? 13.446 3.720   38.172  1.00 15.51 ? 33  VAL A CG2  1 
ATOM   259  N N    . THR A 1 34  ? 9.713  0.850   38.506  1.00 31.68 ? 34  THR A N    1 
ATOM   260  C CA   . THR A 1 34  ? 8.429  0.298   38.090  1.00 36.01 ? 34  THR A CA   1 
ATOM   261  C C    . THR A 1 34  ? 7.491  1.426   37.669  1.00 38.72 ? 34  THR A C    1 
ATOM   262  O O    . THR A 1 34  ? 7.734  2.591   37.983  1.00 41.66 ? 34  THR A O    1 
ATOM   263  C CB   . THR A 1 34  ? 7.770  -0.500  39.231  1.00 36.94 ? 34  THR A CB   1 
ATOM   264  O OG1  . THR A 1 34  ? 7.449  0.386   40.311  1.00 39.11 ? 34  THR A OG1  1 
ATOM   265  C CG2  . THR A 1 34  ? 8.716  -1.576  39.739  1.00 37.02 ? 34  THR A CG2  1 
ATOM   266  N N    . VAL A 1 35  ? 6.421  1.072   36.961  1.00 45.54 ? 35  VAL A N    1 
ATOM   267  C CA   . VAL A 1 35  ? 5.430  2.046   36.503  1.00 49.15 ? 35  VAL A CA   1 
ATOM   268  C C    . VAL A 1 35  ? 4.763  2.744   37.696  1.00 50.88 ? 35  VAL A C    1 
ATOM   269  O O    . VAL A 1 35  ? 4.352  3.900   37.599  1.00 50.67 ? 35  VAL A O    1 
ATOM   270  C CB   . VAL A 1 35  ? 4.345  1.367   35.624  1.00 54.47 ? 35  VAL A CB   1 
ATOM   271  C CG1  . VAL A 1 35  ? 3.464  0.436   36.471  1.00 59.75 ? 35  VAL A CG1  1 
ATOM   272  C CG2  . VAL A 1 35  ? 3.508  2.415   34.905  1.00 54.91 ? 35  VAL A CG2  1 
ATOM   273  N N    . GLU A 1 36  ? 4.677  2.035   38.820  1.00 52.65 ? 36  GLU A N    1 
ATOM   274  C CA   . GLU A 1 36  ? 4.078  2.572   40.039  1.00 52.64 ? 36  GLU A CA   1 
ATOM   275  C C    . GLU A 1 36  ? 4.960  3.681   40.599  1.00 50.05 ? 36  GLU A C    1 
ATOM   276  O O    . GLU A 1 36  ? 4.495  4.800   40.823  1.00 53.84 ? 36  GLU A O    1 
ATOM   277  C CB   . GLU A 1 36  ? 3.948  1.473   41.092  1.00 61.16 ? 36  GLU A CB   1 
ATOM   278  C CG   . GLU A 1 36  ? 3.445  0.142   40.565  1.00 69.73 ? 36  GLU A CG   1 
ATOM   279  C CD   . GLU A 1 36  ? 4.198  -1.038  41.164  1.00 76.39 ? 36  GLU A CD   1 
ATOM   280  O OE1  . GLU A 1 36  ? 4.757  -0.902  42.277  1.00 77.39 ? 36  GLU A OE1  1 
ATOM   281  O OE2  . GLU A 1 36  ? 4.238  -2.105  40.518  1.00 77.77 ? 36  GLU A OE2  1 
ATOM   282  N N    . THR A 1 37  ? 6.232  3.355   40.828  1.00 44.55 ? 37  THR A N    1 
ATOM   283  C CA   . THR A 1 37  ? 7.204  4.305   41.364  1.00 42.71 ? 37  THR A CA   1 
ATOM   284  C C    . THR A 1 37  ? 7.276  5.562   40.490  1.00 42.44 ? 37  THR A C    1 
ATOM   285  O O    . THR A 1 37  ? 7.340  6.681   41.003  1.00 42.10 ? 37  THR A O    1 
ATOM   286  C CB   . THR A 1 37  ? 8.615  3.672   41.447  1.00 44.66 ? 37  THR A CB   1 
ATOM   287  O OG1  . THR A 1 37  ? 8.528  2.371   42.040  1.00 46.34 ? 37  THR A OG1  1 
ATOM   288  C CG2  . THR A 1 37  ? 9.544  4.536   42.290  1.00 41.79 ? 37  THR A CG2  1 
ATOM   289  N N    . TRP A 1 38  ? 7.239  5.364   39.172  1.00 42.16 ? 38  TRP A N    1 
ATOM   290  C CA   . TRP A 1 38  ? 7.305  6.459   38.203  1.00 39.46 ? 38  TRP A CA   1 
ATOM   291  C C    . TRP A 1 38  ? 6.096  7.393   38.300  1.00 42.03 ? 38  TRP A C    1 
ATOM   292  O O    . TRP A 1 38  ? 6.249  8.617   38.278  1.00 41.15 ? 38  TRP A O    1 
ATOM   293  C CB   . TRP A 1 38  ? 7.428  5.896   36.780  1.00 32.30 ? 38  TRP A CB   1 
ATOM   294  C CG   . TRP A 1 38  ? 7.661  6.931   35.701  1.00 24.31 ? 38  TRP A CG   1 
ATOM   295  C CD1  . TRP A 1 38  ? 6.790  7.298   34.715  1.00 18.18 ? 38  TRP A CD1  1 
ATOM   296  C CD2  . TRP A 1 38  ? 8.859  7.693   35.485  1.00 16.86 ? 38  TRP A CD2  1 
ATOM   297  N NE1  . TRP A 1 38  ? 7.369  8.235   33.897  1.00 19.40 ? 38  TRP A NE1  1 
ATOM   298  C CE2  . TRP A 1 38  ? 8.638  8.498   34.344  1.00 19.29 ? 38  TRP A CE2  1 
ATOM   299  C CE3  . TRP A 1 38  ? 10.097 7.773   36.138  1.00 22.01 ? 38  TRP A CE3  1 
ATOM   300  C CZ2  . TRP A 1 38  ? 9.611  9.372   33.842  1.00 14.35 ? 38  TRP A CZ2  1 
ATOM   301  C CZ3  . TRP A 1 38  ? 11.065 8.641   35.639  1.00 17.86 ? 38  TRP A CZ3  1 
ATOM   302  C CH2  . TRP A 1 38  ? 10.813 9.429   34.501  1.00 17.91 ? 38  TRP A CH2  1 
ATOM   303  N N    . GLN A 1 39  ? 4.902  6.813   38.421  1.00 42.44 ? 39  GLN A N    1 
ATOM   304  C CA   . GLN A 1 39  ? 3.676  7.599   38.523  1.00 44.49 ? 39  GLN A CA   1 
ATOM   305  C C    . GLN A 1 39  ? 3.551  8.367   39.836  1.00 46.94 ? 39  GLN A C    1 
ATOM   306  O O    . GLN A 1 39  ? 2.690  9.236   39.972  1.00 47.20 ? 39  GLN A O    1 
ATOM   307  C CB   . GLN A 1 39  ? 2.456  6.715   38.288  1.00 44.40 ? 39  GLN A CB   1 
ATOM   308  C CG   . GLN A 1 39  ? 2.354  6.233   36.850  1.00 53.16 ? 39  GLN A CG   1 
ATOM   309  C CD   . GLN A 1 39  ? 1.292  5.173   36.648  1.00 59.98 ? 39  GLN A CD   1 
ATOM   310  O OE1  . GLN A 1 39  ? 0.797  4.578   37.607  1.00 67.08 ? 39  GLN A OE1  1 
ATOM   311  N NE2  . GLN A 1 39  ? 0.943  4.922   35.392  1.00 59.24 ? 39  GLN A NE2  1 
ATOM   312  N N    . GLU A 1 40  ? 4.421  8.053   40.795  1.00 49.96 ? 40  GLU A N    1 
ATOM   313  C CA   . GLU A 1 40  ? 4.428  8.743   42.080  1.00 52.49 ? 40  GLU A CA   1 
ATOM   314  C C    . GLU A 1 40  ? 4.853  10.200  41.834  1.00 52.77 ? 40  GLU A C    1 
ATOM   315  O O    . GLU A 1 40  ? 4.470  11.100  42.581  1.00 54.24 ? 40  GLU A O    1 
ATOM   316  C CB   . GLU A 1 40  ? 5.373  8.031   43.054  1.00 53.55 ? 40  GLU A CB   1 
ATOM   317  C CG   . GLU A 1 40  ? 5.412  8.617   44.451  1.00 59.79 ? 40  GLU A CG   1 
ATOM   318  C CD   . GLU A 1 40  ? 6.628  9.486   44.674  1.00 66.11 ? 40  GLU A CD   1 
ATOM   319  O OE1  . GLU A 1 40  ? 7.700  8.924   44.984  1.00 70.23 ? 40  GLU A OE1  1 
ATOM   320  O OE2  . GLU A 1 40  ? 6.517  10.723  44.528  1.00 69.73 ? 40  GLU A OE2  1 
ATOM   321  N N    . GLY A 1 41  ? 5.649  10.415  40.783  1.00 50.64 ? 41  GLY A N    1 
ATOM   322  C CA   . GLY A 1 41  ? 6.069  11.757  40.415  1.00 44.43 ? 41  GLY A CA   1 
ATOM   323  C C    . GLY A 1 41  ? 7.438  12.310  40.773  1.00 42.61 ? 41  GLY A C    1 
ATOM   324  O O    . GLY A 1 41  ? 8.028  13.035  39.974  1.00 43.64 ? 41  GLY A O    1 
ATOM   325  N N    . SER A 1 42  ? 7.949  11.983  41.955  1.00 42.42 ? 42  SER A N    1 
ATOM   326  C CA   . SER A 1 42  ? 9.241  12.506  42.405  1.00 44.32 ? 42  SER A CA   1 
ATOM   327  C C    . SER A 1 42  ? 10.445 12.287  41.484  1.00 41.57 ? 42  SER A C    1 
ATOM   328  O O    . SER A 1 42  ? 11.182 13.233  41.205  1.00 44.27 ? 42  SER A O    1 
ATOM   329  C CB   . SER A 1 42  ? 9.560  12.000  43.812  1.00 41.72 ? 42  SER A CB   1 
ATOM   330  O OG   . SER A 1 42  ? 9.633  10.588  43.833  1.00 54.29 ? 42  SER A OG   1 
ATOM   331  N N    . LEU A 1 43  ? 10.649 11.053  41.023  1.00 39.95 ? 43  LEU A N    1 
ATOM   332  C CA   . LEU A 1 43  ? 11.777 10.738  40.141  1.00 34.67 ? 43  LEU A CA   1 
ATOM   333  C C    . LEU A 1 43  ? 11.672 11.474  38.803  1.00 31.40 ? 43  LEU A C    1 
ATOM   334  O O    . LEU A 1 43  ? 12.646 12.074  38.344  1.00 30.49 ? 43  LEU A O    1 
ATOM   335  C CB   . LEU A 1 43  ? 11.865 9.229   39.883  1.00 31.59 ? 43  LEU A CB   1 
ATOM   336  C CG   . LEU A 1 43  ? 13.242 8.567   39.694  1.00 30.92 ? 43  LEU A CG   1 
ATOM   337  C CD1  . LEU A 1 43  ? 13.109 7.457   38.677  1.00 27.88 ? 43  LEU A CD1  1 
ATOM   338  C CD2  . LEU A 1 43  ? 14.315 9.549   39.246  1.00 29.03 ? 43  LEU A CD2  1 
ATOM   339  N N    . LYS A 1 44  ? 10.494 11.415  38.184  1.00 24.34 ? 44  LYS A N    1 
ATOM   340  C CA   . LYS A 1 44  ? 10.247 12.071  36.901  1.00 27.16 ? 44  LYS A CA   1 
ATOM   341  C C    . LYS A 1 44  ? 10.612 13.551  36.969  1.00 31.60 ? 44  LYS A C    1 
ATOM   342  O O    . LYS A 1 44  ? 11.250 14.086  36.062  1.00 33.78 ? 44  LYS A O    1 
ATOM   343  C CB   . LYS A 1 44  ? 8.775  11.939  36.516  1.00 24.51 ? 44  LYS A CB   1 
ATOM   344  C CG   . LYS A 1 44  ? 8.460  12.409  35.105  1.00 25.49 ? 44  LYS A CG   1 
ATOM   345  C CD   . LYS A 1 44  ? 6.964  12.558  34.887  1.00 25.65 ? 44  LYS A CD   1 
ATOM   346  C CE   . LYS A 1 44  ? 6.572  12.269  33.444  1.00 27.65 ? 44  LYS A CE   1 
ATOM   347  N NZ   . LYS A 1 44  ? 7.455  12.940  32.449  1.00 30.67 ? 44  LYS A NZ   1 
ATOM   348  N N    . ALA A 1 45  ? 10.226 14.189  38.071  1.00 32.54 ? 45  ALA A N    1 
ATOM   349  C CA   . ALA A 1 45  ? 10.485 15.604  38.295  1.00 27.71 ? 45  ALA A CA   1 
ATOM   350  C C    . ALA A 1 45  ? 11.972 15.932  38.382  1.00 29.20 ? 45  ALA A C    1 
ATOM   351  O O    . ALA A 1 45  ? 12.385 17.032  38.017  1.00 35.04 ? 45  ALA A O    1 
ATOM   352  C CB   . ALA A 1 45  ? 9.769  16.070  39.554  1.00 31.87 ? 45  ALA A CB   1 
ATOM   353  N N    . SER A 1 46  ? 12.772 14.989  38.874  1.00 25.18 ? 46  SER A N    1 
ATOM   354  C CA   . SER A 1 46  ? 14.214 15.203  38.996  1.00 27.63 ? 46  SER A CA   1 
ATOM   355  C C    . SER A 1 46  ? 14.982 14.889  37.710  1.00 27.98 ? 46  SER A C    1 
ATOM   356  O O    . SER A 1 46  ? 16.181 15.164  37.620  1.00 30.37 ? 46  SER A O    1 
ATOM   357  C CB   . SER A 1 46  ? 14.785 14.382  40.150  1.00 29.21 ? 46  SER A CB   1 
ATOM   358  O OG   . SER A 1 46  ? 14.561 12.999  39.945  1.00 44.20 ? 46  SER A OG   1 
ATOM   359  N N    . CYS A 1 47  ? 14.304 14.271  36.742  1.00 23.03 ? 47  CYS A N    1 
ATOM   360  C CA   . CYS A 1 47  ? 14.919 13.937  35.454  1.00 26.37 ? 47  CYS A CA   1 
ATOM   361  C C    . CYS A 1 47  ? 14.912 15.173  34.559  1.00 25.13 ? 47  CYS A C    1 
ATOM   362  O O    . CYS A 1 47  ? 13.866 15.806  34.386  1.00 22.91 ? 47  CYS A O    1 
ATOM   363  C CB   . CYS A 1 47  ? 14.152 12.808  34.760  1.00 23.46 ? 47  CYS A CB   1 
ATOM   364  S SG   . CYS A 1 47  ? 14.304 11.197  35.554  1.00 27.54 ? 47  CYS A SG   1 
ATOM   365  N N    . LEU A 1 48  ? 16.067 15.487  33.971  1.00 21.04 ? 48  LEU A N    1 
ATOM   366  C CA   . LEU A 1 48  ? 16.221 16.659  33.103  1.00 20.83 ? 48  LEU A CA   1 
ATOM   367  C C    . LEU A 1 48  ? 15.094 16.874  32.084  1.00 23.19 ? 48  LEU A C    1 
ATOM   368  O O    . LEU A 1 48  ? 14.545 17.971  31.989  1.00 22.36 ? 48  LEU A O    1 
ATOM   369  C CB   . LEU A 1 48  ? 17.572 16.613  32.388  1.00 21.43 ? 48  LEU A CB   1 
ATOM   370  C CG   . LEU A 1 48  ? 17.905 17.809  31.494  1.00 23.36 ? 48  LEU A CG   1 
ATOM   371  C CD1  . LEU A 1 48  ? 17.888 19.098  32.309  1.00 22.48 ? 48  LEU A CD1  1 
ATOM   372  C CD2  . LEU A 1 48  ? 19.263 17.598  30.853  1.00 22.00 ? 48  LEU A CD2  1 
ATOM   373  N N    . TYR A 1 49  ? 14.754 15.834  31.326  1.00 17.93 ? 49  TYR A N    1 
ATOM   374  C CA   . TYR A 1 49  ? 13.688 15.931  30.332  1.00 17.34 ? 49  TYR A CA   1 
ATOM   375  C C    . TYR A 1 49  ? 12.441 15.158  30.766  1.00 21.20 ? 49  TYR A C    1 
ATOM   376  O O    . TYR A 1 49  ? 11.530 14.928  29.961  1.00 14.11 ? 49  TYR A O    1 
ATOM   377  C CB   . TYR A 1 49  ? 14.175 15.426  28.970  1.00 17.04 ? 49  TYR A CB   1 
ATOM   378  C CG   . TYR A 1 49  ? 15.371 16.179  28.427  1.00 14.10 ? 49  TYR A CG   1 
ATOM   379  C CD1  . TYR A 1 49  ? 15.281 17.531  28.084  1.00 14.26 ? 49  TYR A CD1  1 
ATOM   380  C CD2  . TYR A 1 49  ? 16.596 15.538  28.252  1.00 10.28 ? 49  TYR A CD2  1 
ATOM   381  C CE1  . TYR A 1 49  ? 16.391 18.223  27.578  1.00 7.64  ? 49  TYR A CE1  1 
ATOM   382  C CE2  . TYR A 1 49  ? 17.707 16.215  27.748  1.00 10.99 ? 49  TYR A CE2  1 
ATOM   383  C CZ   . TYR A 1 49  ? 17.599 17.555  27.413  1.00 14.17 ? 49  TYR A CZ   1 
ATOM   384  O OH   . TYR A 1 49  ? 18.697 18.217  26.906  1.00 19.78 ? 49  TYR A OH   1 
ATOM   385  N N    . GLY A 1 50  ? 12.413 14.771  32.043  1.00 20.57 ? 50  GLY A N    1 
ATOM   386  C CA   . GLY A 1 50  ? 11.288 14.033  32.598  1.00 16.47 ? 50  GLY A CA   1 
ATOM   387  C C    . GLY A 1 50  ? 11.147 12.622  32.061  1.00 19.02 ? 50  GLY A C    1 
ATOM   388  O O    . GLY A 1 50  ? 10.043 12.068  32.051  1.00 21.41 ? 50  GLY A O    1 
ATOM   389  N N    . GLN A 1 51  ? 12.254 12.036  31.608  1.00 16.59 ? 51  GLN A N    1 
ATOM   390  C CA   . GLN A 1 51  ? 12.215 10.686  31.059  1.00 15.75 ? 51  GLN A CA   1 
ATOM   391  C C    . GLN A 1 51  ? 13.437 9.843   31.405  1.00 18.20 ? 51  GLN A C    1 
ATOM   392  O O    . GLN A 1 51  ? 14.458 10.358  31.865  1.00 15.12 ? 51  GLN A O    1 
ATOM   393  C CB   . GLN A 1 51  ? 12.079 10.738  29.534  1.00 13.21 ? 51  GLN A CB   1 
ATOM   394  C CG   . GLN A 1 51  ? 10.789 11.340  29.017  1.00 14.77 ? 51  GLN A CG   1 
ATOM   395  C CD   . GLN A 1 51  ? 10.609 11.132  27.529  1.00 15.60 ? 51  GLN A CD   1 
ATOM   396  O OE1  . GLN A 1 51  ? 9.567  10.663  27.080  1.00 16.69 ? 51  GLN A OE1  1 
ATOM   397  N NE2  . GLN A 1 51  ? 11.640 11.452  26.758  1.00 14.70 ? 51  GLN A NE2  1 
ATOM   398  N N    . LEU A 1 52  ? 13.300 8.535   31.194  1.00 18.47 ? 52  LEU A N    1 
ATOM   399  C CA   . LEU A 1 52  ? 14.378 7.575   31.417  1.00 18.09 ? 52  LEU A CA   1 
ATOM   400  C C    . LEU A 1 52  ? 14.744 7.029   30.028  1.00 18.83 ? 52  LEU A C    1 
ATOM   401  O O    . LEU A 1 52  ? 13.942 7.114   29.101  1.00 20.56 ? 52  LEU A O    1 
ATOM   402  C CB   . LEU A 1 52  ? 13.906 6.449   32.346  1.00 17.44 ? 52  LEU A CB   1 
ATOM   403  C CG   . LEU A 1 52  ? 13.559 6.853   33.787  1.00 18.00 ? 52  LEU A CG   1 
ATOM   404  C CD1  . LEU A 1 52  ? 13.012 5.654   34.554  1.00 13.76 ? 52  LEU A CD1  1 
ATOM   405  C CD2  . LEU A 1 52  ? 14.787 7.422   34.491  1.00 13.17 ? 52  LEU A CD2  1 
ATOM   406  N N    . PRO A 1 53  ? 15.916 6.393   29.879  1.00 19.09 ? 53  PRO A N    1 
ATOM   407  C CA   . PRO A 1 53  ? 16.958 6.104   30.868  1.00 19.90 ? 53  PRO A CA   1 
ATOM   408  C C    . PRO A 1 53  ? 17.741 7.269   31.463  1.00 19.01 ? 53  PRO A C    1 
ATOM   409  O O    . PRO A 1 53  ? 17.821 8.365   30.900  1.00 19.10 ? 53  PRO A O    1 
ATOM   410  C CB   . PRO A 1 53  ? 17.899 5.173   30.101  1.00 14.57 ? 53  PRO A CB   1 
ATOM   411  C CG   . PRO A 1 53  ? 17.827 5.716   28.710  1.00 15.00 ? 53  PRO A CG   1 
ATOM   412  C CD   . PRO A 1 53  ? 16.329 5.916   28.543  1.00 15.74 ? 53  PRO A CD   1 
ATOM   413  N N    . LYS A 1 54  ? 18.298 6.988   32.634  1.00 18.09 ? 54  LYS A N    1 
ATOM   414  C CA   . LYS A 1 54  ? 19.153 7.896   33.370  1.00 15.15 ? 54  LYS A CA   1 
ATOM   415  C C    . LYS A 1 54  ? 20.388 7.017   33.525  1.00 14.00 ? 54  LYS A C    1 
ATOM   416  O O    . LYS A 1 54  ? 20.275 5.817   33.763  1.00 14.38 ? 54  LYS A O    1 
ATOM   417  C CB   . LYS A 1 54  ? 18.557 8.225   34.736  1.00 20.85 ? 54  LYS A CB   1 
ATOM   418  C CG   . LYS A 1 54  ? 19.461 9.088   35.602  1.00 22.60 ? 54  LYS A CG   1 
ATOM   419  C CD   . LYS A 1 54  ? 18.866 9.289   36.976  1.00 24.68 ? 54  LYS A CD   1 
ATOM   420  C CE   . LYS A 1 54  ? 19.861 9.935   37.918  1.00 28.90 ? 54  LYS A CE   1 
ATOM   421  N NZ   . LYS A 1 54  ? 19.290 10.038  39.285  1.00 35.09 ? 54  LYS A NZ   1 
ATOM   422  N N    . PHE A 1 55  ? 21.564 7.600   33.378  1.00 15.39 ? 55  PHE A N    1 
ATOM   423  C CA   . PHE A 1 55  ? 22.793 6.830   33.465  1.00 15.69 ? 55  PHE A CA   1 
ATOM   424  C C    . PHE A 1 55  ? 23.797 7.525   34.363  1.00 16.50 ? 55  PHE A C    1 
ATOM   425  O O    . PHE A 1 55  ? 23.813 8.746   34.460  1.00 22.85 ? 55  PHE A O    1 
ATOM   426  C CB   . PHE A 1 55  ? 23.367 6.672   32.056  1.00 15.26 ? 55  PHE A CB   1 
ATOM   427  C CG   . PHE A 1 55  ? 24.585 5.793   31.971  1.00 15.55 ? 55  PHE A CG   1 
ATOM   428  C CD1  . PHE A 1 55  ? 24.465 4.407   31.997  1.00 14.64 ? 55  PHE A CD1  1 
ATOM   429  C CD2  . PHE A 1 55  ? 25.848 6.352   31.796  1.00 17.14 ? 55  PHE A CD2  1 
ATOM   430  C CE1  . PHE A 1 55  ? 25.585 3.590   31.845  1.00 17.76 ? 55  PHE A CE1  1 
ATOM   431  C CE2  . PHE A 1 55  ? 26.974 5.543   31.643  1.00 22.44 ? 55  PHE A CE2  1 
ATOM   432  C CZ   . PHE A 1 55  ? 26.840 4.160   31.667  1.00 19.74 ? 55  PHE A CZ   1 
ATOM   433  N N    . GLN A 1 56  ? 24.620 6.739   35.041  1.00 19.92 ? 56  GLN A N    1 
ATOM   434  C CA   . GLN A 1 56  ? 25.636 7.294   35.912  1.00 18.05 ? 56  GLN A CA   1 
ATOM   435  C C    . GLN A 1 56  ? 26.976 6.626   35.693  1.00 15.01 ? 56  GLN A C    1 
ATOM   436  O O    . GLN A 1 56  ? 27.080 5.402   35.614  1.00 22.29 ? 56  GLN A O    1 
ATOM   437  C CB   . GLN A 1 56  ? 25.212 7.189   37.379  1.00 23.86 ? 56  GLN A CB   1 
ATOM   438  C CG   . GLN A 1 56  ? 24.110 8.162   37.756  1.00 28.42 ? 56  GLN A CG   1 
ATOM   439  C CD   . GLN A 1 56  ? 23.567 7.936   39.146  1.00 39.11 ? 56  GLN A CD   1 
ATOM   440  O OE1  . GLN A 1 56  ? 23.592 6.820   39.662  1.00 41.93 ? 56  GLN A OE1  1 
ATOM   441  N NE2  . GLN A 1 56  ? 23.039 8.992   39.750  1.00 46.95 ? 56  GLN A NE2  1 
ATOM   442  N N    . ASP A 1 57  ? 27.985 7.462   35.507  1.00 13.98 ? 57  ASP A N    1 
ATOM   443  C CA   . ASP A 1 57  ? 29.354 7.026   35.324  1.00 19.23 ? 57  ASP A CA   1 
ATOM   444  C C    . ASP A 1 57  ? 30.075 7.835   36.396  1.00 21.08 ? 57  ASP A C    1 
ATOM   445  O O    . ASP A 1 57  ? 30.418 8.994   36.180  1.00 22.39 ? 57  ASP A O    1 
ATOM   446  C CB   . ASP A 1 57  ? 29.844 7.403   33.925  1.00 19.42 ? 57  ASP A CB   1 
ATOM   447  C CG   . ASP A 1 57  ? 31.292 7.016   33.683  1.00 26.39 ? 57  ASP A CG   1 
ATOM   448  O OD1  . ASP A 1 57  ? 31.934 6.448   34.592  1.00 30.68 ? 57  ASP A OD1  1 
ATOM   449  O OD2  . ASP A 1 57  ? 31.802 7.305   32.583  1.00 28.67 ? 57  ASP A OD2  1 
ATOM   450  N N    . GLY A 1 58  ? 30.265 7.231   37.565  1.00 21.95 ? 58  GLY A N    1 
ATOM   451  C CA   . GLY A 1 58  ? 30.895 7.942   38.660  1.00 21.98 ? 58  GLY A CA   1 
ATOM   452  C C    . GLY A 1 58  ? 29.869 8.974   39.091  1.00 24.46 ? 58  GLY A C    1 
ATOM   453  O O    . GLY A 1 58  ? 28.704 8.631   39.307  1.00 25.96 ? 58  GLY A O    1 
ATOM   454  N N    . ASP A 1 59  ? 30.265 10.240  39.167  1.00 27.61 ? 59  ASP A N    1 
ATOM   455  C CA   . ASP A 1 59  ? 29.319 11.280  39.556  1.00 32.20 ? 59  ASP A CA   1 
ATOM   456  C C    . ASP A 1 59  ? 28.710 11.998  38.347  1.00 33.47 ? 59  ASP A C    1 
ATOM   457  O O    . ASP A 1 59  ? 27.966 12.967  38.505  1.00 33.57 ? 59  ASP A O    1 
ATOM   458  C CB   . ASP A 1 59  ? 29.950 12.273  40.545  1.00 33.78 ? 59  ASP A CB   1 
ATOM   459  C CG   . ASP A 1 59  ? 30.968 13.201  39.901  1.00 38.79 ? 59  ASP A CG   1 
ATOM   460  O OD1  . ASP A 1 59  ? 31.544 12.862  38.847  1.00 43.22 ? 59  ASP A OD1  1 
ATOM   461  O OD2  . ASP A 1 59  ? 31.192 14.287  40.472  1.00 40.49 ? 59  ASP A OD2  1 
ATOM   462  N N    . LEU A 1 60  ? 29.027 11.512  37.145  1.00 29.38 ? 60  LEU A N    1 
ATOM   463  C CA   . LEU A 1 60  ? 28.494 12.085  35.913  1.00 22.30 ? 60  LEU A CA   1 
ATOM   464  C C    . LEU A 1 60  ? 27.126 11.457  35.671  1.00 22.13 ? 60  LEU A C    1 
ATOM   465  O O    . LEU A 1 60  ? 27.011 10.243  35.526  1.00 20.79 ? 60  LEU A O    1 
ATOM   466  C CB   . LEU A 1 60  ? 29.409 11.766  34.728  1.00 23.91 ? 60  LEU A CB   1 
ATOM   467  C CG   . LEU A 1 60  ? 29.465 12.720  33.524  1.00 26.34 ? 60  LEU A CG   1 
ATOM   468  C CD1  . LEU A 1 60  ? 29.646 11.916  32.249  1.00 18.46 ? 60  LEU A CD1  1 
ATOM   469  C CD2  . LEU A 1 60  ? 28.221 13.580  33.425  1.00 19.40 ? 60  LEU A CD2  1 
ATOM   470  N N    . THR A 1 61  ? 26.090 12.288  35.654  1.00 21.76 ? 61  THR A N    1 
ATOM   471  C CA   . THR A 1 61  ? 24.728 11.824  35.426  1.00 20.59 ? 61  THR A CA   1 
ATOM   472  C C    . THR A 1 61  ? 24.315 12.239  34.018  1.00 22.88 ? 61  THR A C    1 
ATOM   473  O O    . THR A 1 61  ? 24.400 13.412  33.662  1.00 26.82 ? 61  THR A O    1 
ATOM   474  C CB   . THR A 1 61  ? 23.750 12.425  36.458  1.00 19.20 ? 61  THR A CB   1 
ATOM   475  O OG1  . THR A 1 61  ? 24.142 12.018  37.774  1.00 23.37 ? 61  THR A OG1  1 
ATOM   476  C CG2  . THR A 1 61  ? 22.324 11.965  36.189  1.00 14.22 ? 61  THR A CG2  1 
ATOM   477  N N    . LEU A 1 62  ? 23.876 11.266  33.226  1.00 20.75 ? 62  LEU A N    1 
ATOM   478  C CA   . LEU A 1 62  ? 23.472 11.496  31.843  1.00 20.15 ? 62  LEU A CA   1 
ATOM   479  C C    . LEU A 1 62  ? 22.042 11.063  31.553  1.00 16.48 ? 62  LEU A C    1 
ATOM   480  O O    . LEU A 1 62  ? 21.476 10.226  32.251  1.00 19.11 ? 62  LEU A O    1 
ATOM   481  C CB   . LEU A 1 62  ? 24.410 10.730  30.899  1.00 17.43 ? 62  LEU A CB   1 
ATOM   482  C CG   . LEU A 1 62  ? 25.628 11.376  30.228  1.00 20.64 ? 62  LEU A CG   1 
ATOM   483  C CD1  . LEU A 1 62  ? 25.999 12.710  30.841  1.00 16.69 ? 62  LEU A CD1  1 
ATOM   484  C CD2  . LEU A 1 62  ? 26.794 10.404  30.272  1.00 13.52 ? 62  LEU A CD2  1 
ATOM   485  N N    . TYR A 1 63  ? 21.458 11.681  30.536  1.00 15.84 ? 63  TYR A N    1 
ATOM   486  C CA   . TYR A 1 63  ? 20.116 11.356  30.068  1.00 15.90 ? 63  TYR A CA   1 
ATOM   487  C C    . TYR A 1 63  ? 20.251 11.221  28.550  1.00 18.36 ? 63  TYR A C    1 
ATOM   488  O O    . TYR A 1 63  ? 21.303 11.560  27.995  1.00 14.60 ? 63  TYR A O    1 
ATOM   489  C CB   . TYR A 1 63  ? 19.116 12.453  30.432  1.00 14.13 ? 63  TYR A CB   1 
ATOM   490  C CG   . TYR A 1 63  ? 18.897 12.591  31.921  1.00 25.28 ? 63  TYR A CG   1 
ATOM   491  C CD1  . TYR A 1 63  ? 17.919 11.843  32.579  1.00 23.89 ? 63  TYR A CD1  1 
ATOM   492  C CD2  . TYR A 1 63  ? 19.688 13.453  32.682  1.00 23.41 ? 63  TYR A CD2  1 
ATOM   493  C CE1  . TYR A 1 63  ? 17.741 11.951  33.961  1.00 26.69 ? 63  TYR A CE1  1 
ATOM   494  C CE2  . TYR A 1 63  ? 19.519 13.567  34.054  1.00 25.36 ? 63  TYR A CE2  1 
ATOM   495  C CZ   . TYR A 1 63  ? 18.548 12.814  34.688  1.00 29.54 ? 63  TYR A CZ   1 
ATOM   496  O OH   . TYR A 1 63  ? 18.403 12.911  36.051  1.00 30.00 ? 63  TYR A OH   1 
ATOM   497  N N    . GLN A 1 64  ? 19.210 10.705  27.893  1.00 18.04 ? 64  GLN A N    1 
ATOM   498  C CA   . GLN A 1 64  ? 19.207 10.506  26.440  1.00 13.42 ? 64  GLN A CA   1 
ATOM   499  C C    . GLN A 1 64  ? 20.039 9.271   26.079  1.00 10.82 ? 64  GLN A C    1 
ATOM   500  O O    . GLN A 1 64  ? 21.266 9.262   26.226  1.00 8.81  ? 64  GLN A O    1 
ATOM   501  C CB   . GLN A 1 64  ? 19.732 11.757  25.718  1.00 14.07 ? 64  GLN A CB   1 
ATOM   502  C CG   . GLN A 1 64  ? 18.864 12.999  25.915  1.00 13.48 ? 64  GLN A CG   1 
ATOM   503  C CD   . GLN A 1 64  ? 17.596 12.954  25.091  1.00 13.00 ? 64  GLN A CD   1 
ATOM   504  O OE1  . GLN A 1 64  ? 17.369 12.010  24.339  1.00 15.01 ? 64  GLN A OE1  1 
ATOM   505  N NE2  . GLN A 1 64  ? 16.786 13.992  25.195  1.00 16.67 ? 64  GLN A NE2  1 
ATOM   506  N N    . SER A 1 65  ? 19.354 8.232   25.607  1.00 9.18  ? 65  SER A N    1 
ATOM   507  C CA   . SER A 1 65  ? 19.990 6.965   25.253  1.00 11.06 ? 65  SER A CA   1 
ATOM   508  C C    . SER A 1 65  ? 21.186 7.099   24.315  1.00 14.01 ? 65  SER A C    1 
ATOM   509  O O    . SER A 1 65  ? 22.228 6.480   24.552  1.00 13.57 ? 65  SER A O    1 
ATOM   510  C CB   . SER A 1 65  ? 18.962 6.000   24.665  1.00 9.51  ? 65  SER A CB   1 
ATOM   511  O OG   . SER A 1 65  ? 18.347 6.550   23.517  1.00 13.08 ? 65  SER A OG   1 
ATOM   512  N N    . ASN A 1 66  ? 21.050 7.922   23.273  1.00 13.94 ? 66  ASN A N    1 
ATOM   513  C CA   . ASN A 1 66  ? 22.142 8.122   22.315  1.00 8.62  ? 66  ASN A CA   1 
ATOM   514  C C    . ASN A 1 66  ? 23.332 8.882   22.895  1.00 9.76  ? 66  ASN A C    1 
ATOM   515  O O    . ASN A 1 66  ? 24.466 8.685   22.462  1.00 12.73 ? 66  ASN A O    1 
ATOM   516  C CB   . ASN A 1 66  ? 21.634 8.801   21.040  1.00 11.38 ? 66  ASN A CB   1 
ATOM   517  C CG   . ASN A 1 66  ? 20.720 7.895   20.233  1.00 13.25 ? 66  ASN A CG   1 
ATOM   518  O OD1  . ASN A 1 66  ? 21.144 6.837   19.781  1.00 17.17 ? 66  ASN A OD1  1 
ATOM   519  N ND2  . ASN A 1 66  ? 19.475 8.304   20.046  1.00 6.17  ? 66  ASN A ND2  1 
ATOM   520  N N    . THR A 1 67  ? 23.081 9.762   23.862  1.00 9.23  ? 67  THR A N    1 
ATOM   521  C CA   . THR A 1 67  ? 24.164 10.497  24.511  1.00 11.51 ? 67  THR A CA   1 
ATOM   522  C C    . THR A 1 67  ? 24.961 9.464   25.313  1.00 13.47 ? 67  THR A C    1 
ATOM   523  O O    . THR A 1 67  ? 26.188 9.489   25.338  1.00 14.69 ? 67  THR A O    1 
ATOM   524  C CB   . THR A 1 67  ? 23.628 11.586  25.453  1.00 11.68 ? 67  THR A CB   1 
ATOM   525  O OG1  . THR A 1 67  ? 23.059 12.638  24.674  1.00 12.63 ? 67  THR A OG1  1 
ATOM   526  C CG2  . THR A 1 67  ? 24.737 12.150  26.313  1.00 10.29 ? 67  THR A CG2  1 
ATOM   527  N N    . ILE A 1 68  ? 24.243 8.537   25.943  1.00 14.73 ? 68  ILE A N    1 
ATOM   528  C CA   . ILE A 1 68  ? 24.864 7.475   26.724  1.00 14.48 ? 68  ILE A CA   1 
ATOM   529  C C    . ILE A 1 68  ? 25.715 6.613   25.791  1.00 11.25 ? 68  ILE A C    1 
ATOM   530  O O    . ILE A 1 68  ? 26.866 6.311   26.106  1.00 9.56  ? 68  ILE A O    1 
ATOM   531  C CB   . ILE A 1 68  ? 23.793 6.616   27.436  1.00 12.79 ? 68  ILE A CB   1 
ATOM   532  C CG1  . ILE A 1 68  ? 22.972 7.505   28.374  1.00 9.13  ? 68  ILE A CG1  1 
ATOM   533  C CG2  . ILE A 1 68  ? 24.449 5.488   28.217  1.00 9.82  ? 68  ILE A CG2  1 
ATOM   534  C CD1  . ILE A 1 68  ? 21.649 6.904   28.789  1.00 13.17 ? 68  ILE A CD1  1 
ATOM   535  N N    . LEU A 1 69  ? 25.160 6.244   24.636  1.00 13.07 ? 69  LEU A N    1 
ATOM   536  C CA   . LEU A 1 69  ? 25.890 5.439   23.655  1.00 12.02 ? 69  LEU A CA   1 
ATOM   537  C C    . LEU A 1 69  ? 27.159 6.151   23.193  1.00 15.87 ? 69  LEU A C    1 
ATOM   538  O O    . LEU A 1 69  ? 28.242 5.555   23.182  1.00 12.15 ? 69  LEU A O    1 
ATOM   539  C CB   . LEU A 1 69  ? 25.009 5.117   22.444  1.00 12.58 ? 69  LEU A CB   1 
ATOM   540  C CG   . LEU A 1 69  ? 24.017 3.967   22.607  1.00 12.17 ? 69  LEU A CG   1 
ATOM   541  C CD1  . LEU A 1 69  ? 23.139 3.859   21.380  1.00 19.20 ? 69  LEU A CD1  1 
ATOM   542  C CD2  . LEU A 1 69  ? 24.776 2.669   22.825  1.00 15.60 ? 69  LEU A CD2  1 
ATOM   543  N N    . ARG A 1 70  ? 27.034 7.436   22.857  1.00 13.86 ? 70  ARG A N    1 
ATOM   544  C CA   . ARG A 1 70  ? 28.183 8.215   22.397  1.00 15.49 ? 70  ARG A CA   1 
ATOM   545  C C    . ARG A 1 70  ? 29.235 8.388   23.479  1.00 12.74 ? 70  ARG A C    1 
ATOM   546  O O    . ARG A 1 70  ? 30.434 8.364   23.196  1.00 17.08 ? 70  ARG A O    1 
ATOM   547  C CB   . ARG A 1 70  ? 27.743 9.572   21.846  1.00 15.49 ? 70  ARG A CB   1 
ATOM   548  C CG   . ARG A 1 70  ? 27.052 9.453   20.506  1.00 14.53 ? 70  ARG A CG   1 
ATOM   549  C CD   . ARG A 1 70  ? 26.774 10.795  19.854  1.00 16.53 ? 70  ARG A CD   1 
ATOM   550  N NE   . ARG A 1 70  ? 26.441 10.597  18.447  1.00 14.43 ? 70  ARG A NE   1 
ATOM   551  C CZ   . ARG A 1 70  ? 25.205 10.484  17.969  1.00 20.23 ? 70  ARG A CZ   1 
ATOM   552  N NH1  . ARG A 1 70  ? 24.159 10.568  18.784  1.00 16.25 ? 70  ARG A NH1  1 
ATOM   553  N NH2  . ARG A 1 70  ? 25.016 10.217  16.680  1.00 18.14 ? 70  ARG A NH2  1 
ATOM   554  N N    . HIS A 1 71  ? 28.782 8.527   24.721  1.00 13.52 ? 71  HIS A N    1 
ATOM   555  C CA   . HIS A 1 71  ? 29.689 8.682   25.850  1.00 16.67 ? 71  HIS A CA   1 
ATOM   556  C C    . HIS A 1 71  ? 30.530 7.419   26.031  1.00 17.31 ? 71  HIS A C    1 
ATOM   557  O O    . HIS A 1 71  ? 31.750 7.487   26.199  1.00 22.38 ? 71  HIS A O    1 
ATOM   558  C CB   . HIS A 1 71  ? 28.904 8.974   27.125  1.00 13.99 ? 71  HIS A CB   1 
ATOM   559  C CG   . HIS A 1 71  ? 29.754 8.985   28.353  1.00 18.15 ? 71  HIS A CG   1 
ATOM   560  N ND1  . HIS A 1 71  ? 30.773 9.893   28.542  1.00 19.19 ? 71  HIS A ND1  1 
ATOM   561  C CD2  . HIS A 1 71  ? 29.774 8.167   29.431  1.00 17.73 ? 71  HIS A CD2  1 
ATOM   562  C CE1  . HIS A 1 71  ? 31.389 9.633   29.681  1.00 18.15 ? 71  HIS A CE1  1 
ATOM   563  N NE2  . HIS A 1 71  ? 30.800 8.591   30.241  1.00 21.88 ? 71  HIS A NE2  1 
ATOM   564  N N    . LEU A 1 72  ? 29.861 6.269   26.017  1.00 21.14 ? 72  LEU A N    1 
ATOM   565  C CA   . LEU A 1 72  ? 30.529 4.976   26.151  1.00 17.46 ? 72  LEU A CA   1 
ATOM   566  C C    . LEU A 1 72  ? 31.444 4.720   24.950  1.00 16.31 ? 72  LEU A C    1 
ATOM   567  O O    . LEU A 1 72  ? 32.557 4.215   25.109  1.00 18.77 ? 72  LEU A O    1 
ATOM   568  C CB   . LEU A 1 72  ? 29.487 3.858   26.274  1.00 14.33 ? 72  LEU A CB   1 
ATOM   569  C CG   . LEU A 1 72  ? 29.079 3.354   27.668  1.00 18.13 ? 72  LEU A CG   1 
ATOM   570  C CD1  . LEU A 1 72  ? 29.458 4.336   28.757  1.00 20.50 ? 72  LEU A CD1  1 
ATOM   571  C CD2  . LEU A 1 72  ? 27.586 3.061   27.692  1.00 13.42 ? 72  LEU A CD2  1 
ATOM   572  N N    . GLY A 1 73  ? 30.986 5.098   23.757  1.00 13.56 ? 73  GLY A N    1 
ATOM   573  C CA   . GLY A 1 73  ? 31.785 4.909   22.557  1.00 10.32 ? 73  GLY A CA   1 
ATOM   574  C C    . GLY A 1 73  ? 33.052 5.737   22.606  1.00 14.46 ? 73  GLY A C    1 
ATOM   575  O O    . GLY A 1 73  ? 34.115 5.308   22.169  1.00 17.30 ? 73  GLY A O    1 
ATOM   576  N N    . ARG A 1 74  ? 32.946 6.915   23.200  1.00 19.09 ? 74  ARG A N    1 
ATOM   577  C CA   . ARG A 1 74  ? 34.077 7.821   23.322  1.00 22.29 ? 74  ARG A CA   1 
ATOM   578  C C    . ARG A 1 74  ? 35.078 7.358   24.384  1.00 22.87 ? 74  ARG A C    1 
ATOM   579  O O    . ARG A 1 74  ? 36.281 7.313   24.130  1.00 23.07 ? 74  ARG A O    1 
ATOM   580  C CB   . ARG A 1 74  ? 33.551 9.217   23.650  1.00 22.22 ? 74  ARG A CB   1 
ATOM   581  C CG   . ARG A 1 74  ? 34.495 10.364  23.359  1.00 24.79 ? 74  ARG A CG   1 
ATOM   582  C CD   . ARG A 1 74  ? 33.688 11.611  22.990  1.00 22.08 ? 74  ARG A CD   1 
ATOM   583  N NE   . ARG A 1 74  ? 32.500 11.712  23.828  1.00 20.83 ? 74  ARG A NE   1 
ATOM   584  C CZ   . ARG A 1 74  ? 31.296 12.067  23.399  1.00 19.72 ? 74  ARG A CZ   1 
ATOM   585  N NH1  . ARG A 1 74  ? 31.099 12.383  22.127  1.00 15.61 ? 74  ARG A NH1  1 
ATOM   586  N NH2  . ARG A 1 74  ? 30.266 12.022  24.234  1.00 13.95 ? 74  ARG A NH2  1 
ATOM   587  N N    . THR A 1 75  ? 34.578 6.983   25.560  1.00 23.78 ? 75  THR A N    1 
ATOM   588  C CA   . THR A 1 75  ? 35.441 6.542   26.658  1.00 22.93 ? 75  THR A CA   1 
ATOM   589  C C    . THR A 1 75  ? 36.019 5.137   26.492  1.00 25.60 ? 75  THR A C    1 
ATOM   590  O O    . THR A 1 75  ? 37.124 4.858   26.957  1.00 26.22 ? 75  THR A O    1 
ATOM   591  C CB   . THR A 1 75  ? 34.714 6.627   28.022  1.00 23.97 ? 75  THR A CB   1 
ATOM   592  O OG1  . THR A 1 75  ? 33.496 5.877   27.965  1.00 21.64 ? 75  THR A OG1  1 
ATOM   593  C CG2  . THR A 1 75  ? 34.388 8.079   28.374  1.00 23.63 ? 75  THR A CG2  1 
ATOM   594  N N    . LEU A 1 76  ? 35.275 4.258   25.826  1.00 23.96 ? 76  LEU A N    1 
ATOM   595  C CA   . LEU A 1 76  ? 35.714 2.880   25.608  1.00 21.23 ? 76  LEU A CA   1 
ATOM   596  C C    . LEU A 1 76  ? 36.415 2.637   24.270  1.00 20.61 ? 76  LEU A C    1 
ATOM   597  O O    . LEU A 1 76  ? 36.886 1.531   24.008  1.00 22.38 ? 76  LEU A O    1 
ATOM   598  C CB   . LEU A 1 76  ? 34.533 1.921   25.761  1.00 22.16 ? 76  LEU A CB   1 
ATOM   599  C CG   . LEU A 1 76  ? 34.257 1.322   27.141  1.00 25.44 ? 76  LEU A CG   1 
ATOM   600  C CD1  . LEU A 1 76  ? 34.700 2.254   28.253  1.00 21.65 ? 76  LEU A CD1  1 
ATOM   601  C CD2  . LEU A 1 76  ? 32.779 0.986   27.255  1.00 19.89 ? 76  LEU A CD2  1 
ATOM   602  N N    . GLY A 1 77  ? 36.477 3.663   23.426  1.00 19.21 ? 77  GLY A N    1 
ATOM   603  C CA   . GLY A 1 77  ? 37.136 3.529   22.136  1.00 19.25 ? 77  GLY A CA   1 
ATOM   604  C C    . GLY A 1 77  ? 36.347 2.799   21.057  1.00 21.37 ? 77  GLY A C    1 
ATOM   605  O O    . GLY A 1 77  ? 36.911 2.017   20.290  1.00 22.06 ? 77  GLY A O    1 
ATOM   606  N N    . LEU A 1 78  ? 35.043 3.050   21.004  1.00 21.08 ? 78  LEU A N    1 
ATOM   607  C CA   . LEU A 1 78  ? 34.157 2.437   20.017  1.00 20.30 ? 78  LEU A CA   1 
ATOM   608  C C    . LEU A 1 78  ? 33.549 3.548   19.152  1.00 21.27 ? 78  LEU A C    1 
ATOM   609  O O    . LEU A 1 78  ? 32.349 3.542   18.875  1.00 20.83 ? 78  LEU A O    1 
ATOM   610  C CB   . LEU A 1 78  ? 33.033 1.677   20.731  1.00 19.64 ? 78  LEU A CB   1 
ATOM   611  C CG   . LEU A 1 78  ? 33.385 0.763   21.909  1.00 20.25 ? 78  LEU A CG   1 
ATOM   612  C CD1  . LEU A 1 78  ? 32.114 0.167   22.472  1.00 22.57 ? 78  LEU A CD1  1 
ATOM   613  C CD2  . LEU A 1 78  ? 34.336 -0.335  21.467  1.00 16.31 ? 78  LEU A CD2  1 
ATOM   614  N N    . TYR A 1 79  ? 34.393 4.469   18.693  1.00 21.06 ? 79  TYR A N    1 
ATOM   615  C CA   . TYR A 1 79  ? 33.939 5.612   17.899  1.00 22.29 ? 79  TYR A CA   1 
ATOM   616  C C    . TYR A 1 79  ? 34.769 5.849   16.627  1.00 20.37 ? 79  TYR A C    1 
ATOM   617  O O    . TYR A 1 79  ? 34.968 6.994   16.214  1.00 27.12 ? 79  TYR A O    1 
ATOM   618  C CB   . TYR A 1 79  ? 33.999 6.862   18.789  1.00 20.87 ? 79  TYR A CB   1 
ATOM   619  C CG   . TYR A 1 79  ? 32.852 7.830   18.629  1.00 18.26 ? 79  TYR A CG   1 
ATOM   620  C CD1  . TYR A 1 79  ? 32.340 8.145   17.368  1.00 16.41 ? 79  TYR A CD1  1 
ATOM   621  C CD2  . TYR A 1 79  ? 32.280 8.442   19.746  1.00 17.98 ? 79  TYR A CD2  1 
ATOM   622  C CE1  . TYR A 1 79  ? 31.290 9.044   17.220  1.00 11.88 ? 79  TYR A CE1  1 
ATOM   623  C CE2  . TYR A 1 79  ? 31.227 9.342   19.613  1.00 14.70 ? 79  TYR A CE2  1 
ATOM   624  C CZ   . TYR A 1 79  ? 30.737 9.636   18.348  1.00 20.42 ? 79  TYR A CZ   1 
ATOM   625  O OH   . TYR A 1 79  ? 29.678 10.501  18.215  1.00 19.40 ? 79  TYR A OH   1 
ATOM   626  N N    . GLY A 1 80  ? 35.227 4.770   15.998  1.00 18.70 ? 80  GLY A N    1 
ATOM   627  C CA   . GLY A 1 80  ? 36.034 4.887   14.792  1.00 16.59 ? 80  GLY A CA   1 
ATOM   628  C C    . GLY A 1 80  ? 37.505 5.119   15.093  1.00 19.71 ? 80  GLY A C    1 
ATOM   629  O O    . GLY A 1 80  ? 37.863 5.471   16.216  1.00 22.37 ? 80  GLY A O    1 
ATOM   630  N N    . LYS A 1 81  ? 38.362 4.948   14.091  1.00 25.55 ? 81  LYS A N    1 
ATOM   631  C CA   . LYS A 1 81  ? 39.796 5.138   14.284  1.00 26.60 ? 81  LYS A CA   1 
ATOM   632  C C    . LYS A 1 81  ? 40.212 6.598   14.102  1.00 29.26 ? 81  LYS A C    1 
ATOM   633  O O    . LYS A 1 81  ? 41.284 7.003   14.552  1.00 31.28 ? 81  LYS A O    1 
ATOM   634  C CB   . LYS A 1 81  ? 40.596 4.233   13.342  1.00 31.07 ? 81  LYS A CB   1 
ATOM   635  C CG   . LYS A 1 81  ? 40.530 4.637   11.884  1.00 41.33 ? 81  LYS A CG   1 
ATOM   636  C CD   . LYS A 1 81  ? 41.422 3.755   11.026  1.00 48.82 ? 81  LYS A CD   1 
ATOM   637  C CE   . LYS A 1 81  ? 41.602 4.351   9.636   1.00 49.83 ? 81  LYS A CE   1 
ATOM   638  N NZ   . LYS A 1 81  ? 40.302 4.551   8.932   1.00 56.81 ? 81  LYS A NZ   1 
ATOM   639  N N    . ASP A 1 82  ? 39.365 7.385   13.440  1.00 28.30 ? 82  ASP A N    1 
ATOM   640  C CA   . ASP A 1 82  ? 39.653 8.801   13.217  1.00 25.32 ? 82  ASP A CA   1 
ATOM   641  C C    . ASP A 1 82  ? 38.375 9.620   13.058  1.00 22.03 ? 82  ASP A C    1 
ATOM   642  O O    . ASP A 1 82  ? 37.273 9.077   13.162  1.00 28.02 ? 82  ASP A O    1 
ATOM   643  C CB   . ASP A 1 82  ? 40.592 8.991   12.014  1.00 24.51 ? 82  ASP A CB   1 
ATOM   644  C CG   . ASP A 1 82  ? 40.061 8.359   10.727  1.00 32.40 ? 82  ASP A CG   1 
ATOM   645  O OD1  . ASP A 1 82  ? 38.830 8.305   10.521  1.00 34.79 ? 82  ASP A OD1  1 
ATOM   646  O OD2  . ASP A 1 82  ? 40.893 7.928   9.899   1.00 39.16 ? 82  ASP A OD2  1 
ATOM   647  N N    . GLN A 1 83  ? 38.520 10.916  12.787  1.00 21.04 ? 83  GLN A N    1 
ATOM   648  C CA   . GLN A 1 83  ? 37.363 11.800  12.634  1.00 23.73 ? 83  GLN A CA   1 
ATOM   649  C C    . GLN A 1 83  ? 36.439 11.419  11.493  1.00 21.99 ? 83  GLN A C    1 
ATOM   650  O O    . GLN A 1 83  ? 35.218 11.519  11.621  1.00 21.68 ? 83  GLN A O    1 
ATOM   651  C CB   . GLN A 1 83  ? 37.800 13.254  12.480  1.00 27.64 ? 83  GLN A CB   1 
ATOM   652  C CG   . GLN A 1 83  ? 38.391 13.863  13.739  1.00 32.38 ? 83  GLN A CG   1 
ATOM   653  C CD   . GLN A 1 83  ? 38.797 15.314  13.549  1.00 39.94 ? 83  GLN A CD   1 
ATOM   654  O OE1  . GLN A 1 83  ? 38.739 16.112  14.488  1.00 41.54 ? 83  GLN A OE1  1 
ATOM   655  N NE2  . GLN A 1 83  ? 39.201 15.667  12.330  1.00 41.00 ? 83  GLN A NE2  1 
ATOM   656  N N    . GLN A 1 84  ? 37.017 10.983  10.379  1.00 23.16 ? 84  GLN A N    1 
ATOM   657  C CA   . GLN A 1 84  ? 36.213 10.583  9.231   1.00 27.70 ? 84  GLN A CA   1 
ATOM   658  C C    . GLN A 1 84  ? 35.293 9.425   9.614   1.00 24.54 ? 84  GLN A C    1 
ATOM   659  O O    . GLN A 1 84  ? 34.089 9.466   9.338   1.00 20.97 ? 84  GLN A O    1 
ATOM   660  C CB   . GLN A 1 84  ? 37.102 10.188  8.048   1.00 36.18 ? 84  GLN A CB   1 
ATOM   661  C CG   . GLN A 1 84  ? 36.307 9.704   6.836   1.00 50.12 ? 84  GLN A CG   1 
ATOM   662  C CD   . GLN A 1 84  ? 37.162 9.503   5.597   1.00 58.08 ? 84  GLN A CD   1 
ATOM   663  O OE1  . GLN A 1 84  ? 37.992 10.348  5.256   1.00 57.17 ? 84  GLN A OE1  1 
ATOM   664  N NE2  . GLN A 1 84  ? 36.938 8.392   4.895   1.00 62.96 ? 84  GLN A NE2  1 
ATOM   665  N N    . GLU A 1 85  ? 35.860 8.413   10.273  1.00 21.12 ? 85  GLU A N    1 
ATOM   666  C CA   . GLU A 1 85  ? 35.083 7.255   10.709  1.00 20.98 ? 85  GLU A CA   1 
ATOM   667  C C    . GLU A 1 85  ? 34.068 7.668   11.764  1.00 18.69 ? 85  GLU A C    1 
ATOM   668  O O    . GLU A 1 85  ? 32.944 7.169   11.765  1.00 23.76 ? 85  GLU A O    1 
ATOM   669  C CB   . GLU A 1 85  ? 35.984 6.148   11.258  1.00 19.30 ? 85  GLU A CB   1 
ATOM   670  C CG   . GLU A 1 85  ? 36.903 5.533   10.221  1.00 27.09 ? 85  GLU A CG   1 
ATOM   671  C CD   . GLU A 1 85  ? 37.334 4.115   10.564  1.00 31.89 ? 85  GLU A CD   1 
ATOM   672  O OE1  . GLU A 1 85  ? 37.249 3.715   11.744  1.00 24.91 ? 85  GLU A OE1  1 
ATOM   673  O OE2  . GLU A 1 85  ? 37.768 3.393   9.641   1.00 35.97 ? 85  GLU A OE2  1 
ATOM   674  N N    . ALA A 1 86  ? 34.461 8.591   12.644  1.00 15.73 ? 86  ALA A N    1 
ATOM   675  C CA   . ALA A 1 86  ? 33.578 9.090   13.699  1.00 12.91 ? 86  ALA A CA   1 
ATOM   676  C C    . ALA A 1 86  ? 32.331 9.705   13.078  1.00 13.59 ? 86  ALA A C    1 
ATOM   677  O O    . ALA A 1 86  ? 31.220 9.502   13.569  1.00 18.91 ? 86  ALA A O    1 
ATOM   678  C CB   . ALA A 1 86  ? 34.301 10.118  14.548  1.00 8.01  ? 86  ALA A CB   1 
ATOM   679  N N    . ALA A 1 87  ? 32.518 10.435  11.981  1.00 14.25 ? 87  ALA A N    1 
ATOM   680  C CA   . ALA A 1 87  ? 31.406 11.066  11.279  1.00 16.97 ? 87  ALA A CA   1 
ATOM   681  C C    . ALA A 1 87  ? 30.487 10.006  10.668  1.00 17.71 ? 87  ALA A C    1 
ATOM   682  O O    . ALA A 1 87  ? 29.262 10.136  10.708  1.00 19.60 ? 87  ALA A O    1 
ATOM   683  C CB   . ALA A 1 87  ? 31.933 12.003  10.194  1.00 19.44 ? 87  ALA A CB   1 
ATOM   684  N N    . LEU A 1 88  ? 31.083 8.946   10.124  1.00 19.06 ? 88  LEU A N    1 
ATOM   685  C CA   . LEU A 1 88  ? 30.315 7.861   9.512   1.00 18.23 ? 88  LEU A CA   1 
ATOM   686  C C    . LEU A 1 88  ? 29.525 7.075   10.557  1.00 15.42 ? 88  LEU A C    1 
ATOM   687  O O    . LEU A 1 88  ? 28.387 6.674   10.309  1.00 16.23 ? 88  LEU A O    1 
ATOM   688  C CB   . LEU A 1 88  ? 31.240 6.935   8.717   1.00 18.52 ? 88  LEU A CB   1 
ATOM   689  C CG   . LEU A 1 88  ? 32.029 7.627   7.600   1.00 22.88 ? 88  LEU A CG   1 
ATOM   690  C CD1  . LEU A 1 88  ? 32.885 6.613   6.851   1.00 22.76 ? 88  LEU A CD1  1 
ATOM   691  C CD2  . LEU A 1 88  ? 31.075 8.333   6.647   1.00 19.08 ? 88  LEU A CD2  1 
ATOM   692  N N    . VAL A 1 89  ? 30.125 6.884   11.732  1.00 14.71 ? 89  VAL A N    1 
ATOM   693  C CA   . VAL A 1 89  ? 29.477 6.172   12.837  1.00 14.76 ? 89  VAL A CA   1 
ATOM   694  C C    . VAL A 1 89  ? 28.221 6.938   13.260  1.00 12.99 ? 89  VAL A C    1 
ATOM   695  O O    . VAL A 1 89  ? 27.168 6.338   13.491  1.00 13.64 ? 89  VAL A O    1 
ATOM   696  C CB   . VAL A 1 89  ? 30.437 6.024   14.048  1.00 19.85 ? 89  VAL A CB   1 
ATOM   697  C CG1  . VAL A 1 89  ? 29.708 5.422   15.235  1.00 18.51 ? 89  VAL A CG1  1 
ATOM   698  C CG2  . VAL A 1 89  ? 31.630 5.154   13.674  1.00 14.51 ? 89  VAL A CG2  1 
ATOM   699  N N    . ASP A 1 90  ? 28.345 8.264   13.344  1.00 14.29 ? 90  ASP A N    1 
ATOM   700  C CA   . ASP A 1 90  ? 27.232 9.141   13.709  1.00 11.39 ? 90  ASP A CA   1 
ATOM   701  C C    . ASP A 1 90  ? 26.126 9.050   12.666  1.00 11.60 ? 90  ASP A C    1 
ATOM   702  O O    . ASP A 1 90  ? 24.947 8.987   13.006  1.00 11.04 ? 90  ASP A O    1 
ATOM   703  C CB   . ASP A 1 90  ? 27.698 10.603  13.812  1.00 11.00 ? 90  ASP A CB   1 
ATOM   704  C CG   . ASP A 1 90  ? 28.359 10.920  15.140  1.00 16.99 ? 90  ASP A CG   1 
ATOM   705  O OD1  . ASP A 1 90  ? 28.036 10.253  16.145  1.00 21.77 ? 90  ASP A OD1  1 
ATOM   706  O OD2  . ASP A 1 90  ? 29.183 11.856  15.204  1.00 16.30 ? 90  ASP A OD2  1 
ATOM   707  N N    . MET A 1 91  ? 26.515 9.064   11.393  1.00 12.69 ? 91  MET A N    1 
ATOM   708  C CA   . MET A 1 91  ? 25.559 8.986   10.294  1.00 11.58 ? 91  MET A CA   1 
ATOM   709  C C    . MET A 1 91  ? 24.767 7.687   10.358  1.00 11.44 ? 91  MET A C    1 
ATOM   710  O O    . MET A 1 91  ? 23.562 7.672   10.086  1.00 11.56 ? 91  MET A O    1 
ATOM   711  C CB   . MET A 1 91  ? 26.285 9.112   8.953   1.00 13.28 ? 91  MET A CB   1 
ATOM   712  C CG   . MET A 1 91  ? 25.365 9.077   7.742   1.00 19.12 ? 91  MET A CG   1 
ATOM   713  S SD   . MET A 1 91  ? 26.261 9.399   6.211   1.00 20.72 ? 91  MET A SD   1 
ATOM   714  C CE   . MET A 1 91  ? 27.389 7.993   6.160   1.00 19.81 ? 91  MET A CE   1 
ATOM   715  N N    . VAL A 1 92  ? 25.448 6.598   10.717  1.00 13.48 ? 92  VAL A N    1 
ATOM   716  C CA   . VAL A 1 92  ? 24.790 5.297   10.848  1.00 16.12 ? 92  VAL A CA   1 
ATOM   717  C C    . VAL A 1 92  ? 23.827 5.340   12.037  1.00 13.38 ? 92  VAL A C    1 
ATOM   718  O O    . VAL A 1 92  ? 22.655 4.994   11.902  1.00 15.39 ? 92  VAL A O    1 
ATOM   719  C CB   . VAL A 1 92  ? 25.821 4.145   11.051  1.00 16.05 ? 92  VAL A CB   1 
ATOM   720  C CG1  . VAL A 1 92  ? 25.096 2.839   11.354  1.00 12.02 ? 92  VAL A CG1  1 
ATOM   721  C CG2  . VAL A 1 92  ? 26.686 3.980   9.802   1.00 10.91 ? 92  VAL A CG2  1 
ATOM   722  N N    . ASN A 1 93  ? 24.307 5.821   13.183  1.00 12.98 ? 93  ASN A N    1 
ATOM   723  C CA   . ASN A 1 93  ? 23.479 5.900   14.382  1.00 9.74  ? 93  ASN A CA   1 
ATOM   724  C C    . ASN A 1 93  ? 22.250 6.778   14.203  1.00 8.46  ? 93  ASN A C    1 
ATOM   725  O O    . ASN A 1 93  ? 21.165 6.419   14.666  1.00 17.18 ? 93  ASN A O    1 
ATOM   726  C CB   . ASN A 1 93  ? 24.288 6.373   15.595  1.00 13.20 ? 93  ASN A CB   1 
ATOM   727  C CG   . ASN A 1 93  ? 23.665 5.908   16.906  1.00 19.58 ? 93  ASN A CG   1 
ATOM   728  O OD1  . ASN A 1 93  ? 23.627 4.712   17.178  1.00 17.40 ? 93  ASN A OD1  1 
ATOM   729  N ND2  . ASN A 1 93  ? 23.154 6.841   17.703  1.00 12.48 ? 93  ASN A ND2  1 
ATOM   730  N N    . ASP A 1 94  ? 22.415 7.919   13.535  1.00 9.64  ? 94  ASP A N    1 
ATOM   731  C CA   . ASP A 1 94  ? 21.289 8.824   13.290  1.00 12.35 ? 94  ASP A CA   1 
ATOM   732  C C    . ASP A 1 94  ? 20.267 8.122   12.411  1.00 11.61 ? 94  ASP A C    1 
ATOM   733  O O    . ASP A 1 94  ? 19.061 8.323   12.564  1.00 17.27 ? 94  ASP A O    1 
ATOM   734  C CB   . ASP A 1 94  ? 21.763 10.119  12.621  1.00 16.96 ? 94  ASP A CB   1 
ATOM   735  C CG   . ASP A 1 94  ? 22.494 11.048  13.581  1.00 23.49 ? 94  ASP A CG   1 
ATOM   736  O OD1  . ASP A 1 94  ? 22.683 10.691  14.766  1.00 19.71 ? 94  ASP A OD1  1 
ATOM   737  O OD2  . ASP A 1 94  ? 22.859 12.161  13.148  1.00 23.12 ? 94  ASP A OD2  1 
ATOM   738  N N    . GLY A 1 95  ? 20.761 7.293   11.493  1.00 13.22 ? 95  GLY A N    1 
ATOM   739  C CA   . GLY A 1 95  ? 19.880 6.538   10.619  1.00 10.03 ? 95  GLY A CA   1 
ATOM   740  C C    . GLY A 1 95  ? 19.112 5.525   11.445  1.00 11.14 ? 95  GLY A C    1 
ATOM   741  O O    . GLY A 1 95  ? 17.902 5.384   11.295  1.00 7.80  ? 95  GLY A O    1 
ATOM   742  N N    . VAL A 1 96  ? 19.814 4.835   12.341  1.00 12.14 ? 96  VAL A N    1 
ATOM   743  C CA   . VAL A 1 96  ? 19.182 3.849   13.216  1.00 15.54 ? 96  VAL A CA   1 
ATOM   744  C C    . VAL A 1 96  ? 18.107 4.531   14.072  1.00 16.58 ? 96  VAL A C    1 
ATOM   745  O O    . VAL A 1 96  ? 16.984 4.041   14.176  1.00 17.30 ? 96  VAL A O    1 
ATOM   746  C CB   . VAL A 1 96  ? 20.220 3.177   14.144  1.00 14.32 ? 96  VAL A CB   1 
ATOM   747  C CG1  . VAL A 1 96  ? 19.522 2.296   15.178  1.00 16.11 ? 96  VAL A CG1  1 
ATOM   748  C CG2  . VAL A 1 96  ? 21.207 2.364   13.320  1.00 11.14 ? 96  VAL A CG2  1 
ATOM   749  N N    . GLU A 1 97  ? 18.453 5.686   14.638  1.00 18.63 ? 97  GLU A N    1 
ATOM   750  C CA   . GLU A 1 97  ? 17.539 6.455   15.481  1.00 16.85 ? 97  GLU A CA   1 
ATOM   751  C C    . GLU A 1 97  ? 16.254 6.851   14.748  1.00 18.25 ? 97  GLU A C    1 
ATOM   752  O O    . GLU A 1 97  ? 15.164 6.790   15.326  1.00 18.70 ? 97  GLU A O    1 
ATOM   753  C CB   . GLU A 1 97  ? 18.257 7.692   16.042  1.00 17.30 ? 97  GLU A CB   1 
ATOM   754  C CG   . GLU A 1 97  ? 17.372 8.657   16.838  1.00 23.07 ? 97  GLU A CG   1 
ATOM   755  C CD   . GLU A 1 97  ? 16.645 8.001   18.012  1.00 25.82 ? 97  GLU A CD   1 
ATOM   756  O OE1  . GLU A 1 97  ? 17.222 7.119   18.680  1.00 22.62 ? 97  GLU A OE1  1 
ATOM   757  O OE2  . GLU A 1 97  ? 15.485 8.377   18.267  1.00 25.38 ? 97  GLU A OE2  1 
ATOM   758  N N    . ASP A 1 98  ? 16.381 7.249   13.481  1.00 20.78 ? 98  ASP A N    1 
ATOM   759  C CA   . ASP A 1 98  ? 15.216 7.630   12.677  1.00 17.53 ? 98  ASP A CA   1 
ATOM   760  C C    . ASP A 1 98  ? 14.257 6.455   12.514  1.00 17.65 ? 98  ASP A C    1 
ATOM   761  O O    . ASP A 1 98  ? 13.046 6.599   12.700  1.00 15.70 ? 98  ASP A O    1 
ATOM   762  C CB   . ASP A 1 98  ? 15.640 8.139   11.293  1.00 23.36 ? 98  ASP A CB   1 
ATOM   763  C CG   . ASP A 1 98  ? 16.111 9.590   11.309  1.00 26.68 ? 98  ASP A CG   1 
ATOM   764  O OD1  . ASP A 1 98  ? 15.894 10.294  12.320  1.00 29.04 ? 98  ASP A OD1  1 
ATOM   765  O OD2  . ASP A 1 98  ? 16.676 10.041  10.291  1.00 25.14 ? 98  ASP A OD2  1 
ATOM   766  N N    . LEU A 1 99  ? 14.799 5.290   12.166  1.00 16.91 ? 99  LEU A N    1 
ATOM   767  C CA   . LEU A 1 99  ? 13.960 4.108   12.000  1.00 19.92 ? 99  LEU A CA   1 
ATOM   768  C C    . LEU A 1 99  ? 13.397 3.643   13.346  1.00 13.19 ? 99  LEU A C    1 
ATOM   769  O O    . LEU A 1 99  ? 12.263 3.173   13.420  1.00 18.49 ? 99  LEU A O    1 
ATOM   770  C CB   . LEU A 1 99  ? 14.729 2.982   11.302  1.00 18.14 ? 99  LEU A CB   1 
ATOM   771  C CG   . LEU A 1 99  ? 13.939 1.700   11.014  1.00 17.66 ? 99  LEU A CG   1 
ATOM   772  C CD1  . LEU A 1 99  ? 12.600 2.021   10.370  1.00 13.77 ? 99  LEU A CD1  1 
ATOM   773  C CD2  . LEU A 1 99  ? 14.759 0.792   10.119  1.00 16.06 ? 99  LEU A CD2  1 
ATOM   774  N N    . ARG A 1 100 ? 14.170 3.824   14.415  1.00 14.47 ? 100 ARG A N    1 
ATOM   775  C CA   . ARG A 1 100 ? 13.717 3.435   15.748  1.00 15.31 ? 100 ARG A CA   1 
ATOM   776  C C    . ARG A 1 100 ? 12.487 4.256   16.153  1.00 17.03 ? 100 ARG A C    1 
ATOM   777  O O    . ARG A 1 100 ? 11.551 3.710   16.735  1.00 19.64 ? 100 ARG A O    1 
ATOM   778  C CB   . ARG A 1 100 ? 14.836 3.593   16.786  1.00 10.73 ? 100 ARG A CB   1 
ATOM   779  C CG   . ARG A 1 100 ? 14.465 3.035   18.156  1.00 10.42 ? 100 ARG A CG   1 
ATOM   780  C CD   . ARG A 1 100 ? 15.599 3.165   19.162  1.00 11.98 ? 100 ARG A CD   1 
ATOM   781  N NE   . ARG A 1 100 ? 16.748 2.327   18.828  1.00 11.76 ? 100 ARG A NE   1 
ATOM   782  C CZ   . ARG A 1 100 ? 16.822 1.019   19.057  1.00 15.85 ? 100 ARG A CZ   1 
ATOM   783  N NH1  . ARG A 1 100 ? 15.807 0.373   19.621  1.00 11.89 ? 100 ARG A NH1  1 
ATOM   784  N NH2  . ARG A 1 100 ? 17.923 0.354   18.732  1.00 15.06 ? 100 ARG A NH2  1 
ATOM   785  N N    . CYS A 1 101 ? 12.479 5.550   15.820  1.00 14.20 ? 101 CYS A N    1 
ATOM   786  C CA   . CYS A 1 101 ? 11.343 6.417   16.136  1.00 17.83 ? 101 CYS A CA   1 
ATOM   787  C C    . CYS A 1 101 ? 10.089 5.953   15.421  1.00 19.55 ? 101 CYS A C    1 
ATOM   788  O O    . CYS A 1 101 ? 8.996  5.993   15.985  1.00 22.33 ? 101 CYS A O    1 
ATOM   789  C CB   . CYS A 1 101 ? 11.628 7.871   15.765  1.00 19.32 ? 101 CYS A CB   1 
ATOM   790  S SG   . CYS A 1 101 ? 12.723 8.699   16.921  1.00 32.81 ? 101 CYS A SG   1 
ATOM   791  N N    . LYS A 1 102 ? 10.247 5.518   14.175  1.00 19.38 ? 102 LYS A N    1 
ATOM   792  C CA   . LYS A 1 102 ? 9.113  5.028   13.400  1.00 20.61 ? 102 LYS A CA   1 
ATOM   793  C C    . LYS A 1 102 ? 8.593  3.749   14.042  1.00 18.02 ? 102 LYS A C    1 
ATOM   794  O O    . LYS A 1 102 ? 7.386  3.549   14.152  1.00 19.13 ? 102 LYS A O    1 
ATOM   795  C CB   . LYS A 1 102 ? 9.528  4.764   11.956  1.00 22.86 ? 102 LYS A CB   1 
ATOM   796  C CG   . LYS A 1 102 ? 9.926  6.019   11.212  1.00 30.03 ? 102 LYS A CG   1 
ATOM   797  C CD   . LYS A 1 102 ? 10.355 5.710   9.800   1.00 32.90 ? 102 LYS A CD   1 
ATOM   798  C CE   . LYS A 1 102 ? 10.687 6.985   9.057   1.00 35.78 ? 102 LYS A CE   1 
ATOM   799  N NZ   . LYS A 1 102 ? 11.177 6.693   7.686   1.00 40.87 ? 102 LYS A NZ   1 
ATOM   800  N N    . TYR A 1 103 ? 9.520  2.900   14.485  1.00 20.01 ? 103 TYR A N    1 
ATOM   801  C CA   . TYR A 1 103 ? 9.180  1.640   15.140  1.00 21.91 ? 103 TYR A CA   1 
ATOM   802  C C    . TYR A 1 103 ? 8.402  1.933   16.422  1.00 22.68 ? 103 TYR A C    1 
ATOM   803  O O    . TYR A 1 103 ? 7.340  1.360   16.665  1.00 21.81 ? 103 TYR A O    1 
ATOM   804  C CB   . TYR A 1 103 ? 10.458 0.853   15.466  1.00 23.90 ? 103 TYR A CB   1 
ATOM   805  C CG   . TYR A 1 103 ? 10.249 -0.354  16.367  1.00 26.18 ? 103 TYR A CG   1 
ATOM   806  C CD1  . TYR A 1 103 ? 9.838  -1.583  15.845  1.00 25.52 ? 103 TYR A CD1  1 
ATOM   807  C CD2  . TYR A 1 103 ? 10.462 -0.265  17.745  1.00 25.90 ? 103 TYR A CD2  1 
ATOM   808  C CE1  . TYR A 1 103 ? 9.645  -2.694  16.681  1.00 27.92 ? 103 TYR A CE1  1 
ATOM   809  C CE2  . TYR A 1 103 ? 10.273 -1.363  18.585  1.00 25.72 ? 103 TYR A CE2  1 
ATOM   810  C CZ   . TYR A 1 103 ? 9.865  -2.573  18.050  1.00 31.25 ? 103 TYR A CZ   1 
ATOM   811  O OH   . TYR A 1 103 ? 9.681  -3.656  18.882  1.00 22.76 ? 103 TYR A OH   1 
ATOM   812  N N    . ILE A 1 104 ? 8.935  2.846   17.228  1.00 23.14 ? 104 ILE A N    1 
ATOM   813  C CA   . ILE A 1 104 ? 8.312  3.237   18.486  1.00 24.08 ? 104 ILE A CA   1 
ATOM   814  C C    . ILE A 1 104 ? 6.922  3.823   18.249  1.00 24.55 ? 104 ILE A C    1 
ATOM   815  O O    . ILE A 1 104 ? 5.977  3.516   18.973  1.00 23.23 ? 104 ILE A O    1 
ATOM   816  C CB   . ILE A 1 104 ? 9.210  4.239   19.250  1.00 22.12 ? 104 ILE A CB   1 
ATOM   817  C CG1  . ILE A 1 104 ? 10.470 3.521   19.736  1.00 18.44 ? 104 ILE A CG1  1 
ATOM   818  C CG2  . ILE A 1 104 ? 8.458  4.863   20.423  1.00 18.42 ? 104 ILE A CG2  1 
ATOM   819  C CD1  . ILE A 1 104 ? 11.541 4.448   20.257  1.00 17.78 ? 104 ILE A CD1  1 
ATOM   820  N N    . SER A 1 105 ? 6.796  4.638   17.208  1.00 28.06 ? 105 SER A N    1 
ATOM   821  C CA   . SER A 1 105 ? 5.517  5.246   16.876  1.00 27.79 ? 105 SER A CA   1 
ATOM   822  C C    . SER A 1 105 ? 4.501  4.156   16.555  1.00 30.25 ? 105 SER A C    1 
ATOM   823  O O    . SER A 1 105 ? 3.354  4.239   16.973  1.00 30.82 ? 105 SER A O    1 
ATOM   824  C CB   . SER A 1 105 ? 5.665  6.190   15.684  1.00 28.66 ? 105 SER A CB   1 
ATOM   825  O OG   . SER A 1 105 ? 4.436  6.833   15.401  1.00 34.23 ? 105 SER A OG   1 
ATOM   826  N N    . LEU A 1 106 ? 4.929  3.128   15.827  1.00 27.81 ? 106 LEU A N    1 
ATOM   827  C CA   . LEU A 1 106 ? 4.042  2.021   15.472  1.00 25.38 ? 106 LEU A CA   1 
ATOM   828  C C    . LEU A 1 106 ? 3.581  1.263   16.716  1.00 26.48 ? 106 LEU A C    1 
ATOM   829  O O    . LEU A 1 106 ? 2.384  1.084   16.937  1.00 25.64 ? 106 LEU A O    1 
ATOM   830  C CB   . LEU A 1 106 ? 4.752  1.049   14.524  1.00 23.69 ? 106 LEU A CB   1 
ATOM   831  C CG   . LEU A 1 106 ? 4.014  -0.266  14.255  1.00 24.87 ? 106 LEU A CG   1 
ATOM   832  C CD1  . LEU A 1 106 ? 2.744  -0.010  13.457  1.00 22.06 ? 106 LEU A CD1  1 
ATOM   833  C CD2  . LEU A 1 106 ? 4.920  -1.225  13.515  1.00 21.05 ? 106 LEU A CD2  1 
ATOM   834  N N    . ILE A 1 107 ? 4.549  0.831   17.521  1.00 25.21 ? 107 ILE A N    1 
ATOM   835  C CA   . ILE A 1 107 ? 4.295  0.075   18.745  1.00 25.72 ? 107 ILE A CA   1 
ATOM   836  C C    . ILE A 1 107 ? 3.351  0.758   19.738  1.00 29.40 ? 107 ILE A C    1 
ATOM   837  O O    . ILE A 1 107 ? 2.390  0.149   20.212  1.00 30.38 ? 107 ILE A O    1 
ATOM   838  C CB   . ILE A 1 107 ? 5.625  -0.253  19.465  1.00 24.29 ? 107 ILE A CB   1 
ATOM   839  C CG1  . ILE A 1 107 ? 6.497  -1.148  18.582  1.00 22.58 ? 107 ILE A CG1  1 
ATOM   840  C CG2  . ILE A 1 107 ? 5.364  -0.923  20.802  1.00 23.25 ? 107 ILE A CG2  1 
ATOM   841  C CD1  . ILE A 1 107 ? 5.864  -2.479  18.228  1.00 25.00 ? 107 ILE A CD1  1 
ATOM   842  N N    . TYR A 1 108 ? 3.608  2.031   20.018  1.00 30.44 ? 108 TYR A N    1 
ATOM   843  C CA   . TYR A 1 108 ? 2.807  2.785   20.975  1.00 30.83 ? 108 TYR A CA   1 
ATOM   844  C C    . TYR A 1 108 ? 1.609  3.571   20.439  1.00 30.90 ? 108 TYR A C    1 
ATOM   845  O O    . TYR A 1 108 ? 0.682  3.856   21.189  1.00 34.64 ? 108 TYR A O    1 
ATOM   846  C CB   . TYR A 1 108 ? 3.722  3.715   21.775  1.00 28.66 ? 108 TYR A CB   1 
ATOM   847  C CG   . TYR A 1 108 ? 4.720  2.979   22.647  1.00 25.90 ? 108 TYR A CG   1 
ATOM   848  C CD1  . TYR A 1 108 ? 4.365  2.515   23.915  1.00 26.12 ? 108 TYR A CD1  1 
ATOM   849  C CD2  . TYR A 1 108 ? 6.025  2.749   22.208  1.00 24.41 ? 108 TYR A CD2  1 
ATOM   850  C CE1  . TYR A 1 108 ? 5.295  1.837   24.731  1.00 26.04 ? 108 TYR A CE1  1 
ATOM   851  C CE2  . TYR A 1 108 ? 6.956  2.076   23.008  1.00 24.30 ? 108 TYR A CE2  1 
ATOM   852  C CZ   . TYR A 1 108 ? 6.587  1.623   24.267  1.00 26.98 ? 108 TYR A CZ   1 
ATOM   853  O OH   . TYR A 1 108 ? 7.520  0.967   25.041  1.00 21.61 ? 108 TYR A OH   1 
ATOM   854  N N    . THR A 1 109 ? 1.610  3.901   19.151  1.00 38.71 ? 109 THR A N    1 
ATOM   855  C CA   . THR A 1 109 ? 0.519  4.686   18.568  1.00 37.68 ? 109 THR A CA   1 
ATOM   856  C C    . THR A 1 109 ? -0.558 3.908   17.809  1.00 40.73 ? 109 THR A C    1 
ATOM   857  O O    . THR A 1 109 ? -1.747 4.110   18.057  1.00 45.84 ? 109 THR A O    1 
ATOM   858  C CB   . THR A 1 109 ? 1.076  5.835   17.695  1.00 38.41 ? 109 THR A CB   1 
ATOM   859  O OG1  . THR A 1 109 ? 1.792  6.750   18.533  1.00 42.97 ? 109 THR A OG1  1 
ATOM   860  C CG2  . THR A 1 109 ? -0.035 6.575   16.966  1.00 42.51 ? 109 THR A CG2  1 
ATOM   861  N N    . ASN A 1 110 ? -0.163 3.025   16.896  1.00 37.79 ? 110 ASN A N    1 
ATOM   862  C CA   . ASN A 1 110 ? -1.148 2.257   16.138  1.00 38.19 ? 110 ASN A CA   1 
ATOM   863  C C    . ASN A 1 110 ? -0.610 0.938   15.594  1.00 34.78 ? 110 ASN A C    1 
ATOM   864  O O    . ASN A 1 110 ? -0.471 0.748   14.385  1.00 33.68 ? 110 ASN A O    1 
ATOM   865  C CB   . ASN A 1 110 ? -1.760 3.113   15.016  1.00 40.98 ? 110 ASN A CB   1 
ATOM   866  C CG   . ASN A 1 110 ? -0.760 3.483   13.932  1.00 47.50 ? 110 ASN A CG   1 
ATOM   867  O OD1  . ASN A 1 110 ? -1.130 3.620   12.768  1.00 47.36 ? 110 ASN A OD1  1 
ATOM   868  N ND2  . ASN A 1 110 ? 0.509  3.639   14.305  1.00 51.99 ? 110 ASN A ND2  1 
ATOM   869  N N    . TYR A 1 111 ? -0.326 0.020   16.510  1.00 34.51 ? 111 TYR A N    1 
ATOM   870  C CA   . TYR A 1 111 ? 0.192  -1.292  16.159  1.00 34.67 ? 111 TYR A CA   1 
ATOM   871  C C    . TYR A 1 111 ? -0.764 -2.088  15.271  1.00 35.97 ? 111 TYR A C    1 
ATOM   872  O O    . TYR A 1 111 ? -0.399 -2.504  14.174  1.00 36.36 ? 111 TYR A O    1 
ATOM   873  C CB   . TYR A 1 111 ? 0.503  -2.084  17.431  1.00 33.29 ? 111 TYR A CB   1 
ATOM   874  C CG   . TYR A 1 111 ? 1.084  -3.453  17.167  1.00 36.30 ? 111 TYR A CG   1 
ATOM   875  C CD1  . TYR A 1 111 ? 2.460  -3.631  17.026  1.00 35.63 ? 111 TYR A CD1  1 
ATOM   876  C CD2  . TYR A 1 111 ? 0.257  -4.569  17.042  1.00 35.82 ? 111 TYR A CD2  1 
ATOM   877  C CE1  . TYR A 1 111 ? 2.999  -4.888  16.764  1.00 38.80 ? 111 TYR A CE1  1 
ATOM   878  C CE2  . TYR A 1 111 ? 0.784  -5.827  16.779  1.00 42.59 ? 111 TYR A CE2  1 
ATOM   879  C CZ   . TYR A 1 111 ? 2.156  -5.980  16.640  1.00 41.19 ? 111 TYR A CZ   1 
ATOM   880  O OH   . TYR A 1 111 ? 2.677  -7.224  16.363  1.00 47.64 ? 111 TYR A OH   1 
ATOM   881  N N    . GLU A 1 112 ? -1.989 -2.281  15.752  1.00 39.49 ? 112 GLU A N    1 
ATOM   882  C CA   . GLU A 1 112 ? -3.007 -3.045  15.032  1.00 42.50 ? 112 GLU A CA   1 
ATOM   883  C C    . GLU A 1 112 ? -3.254 -2.534  13.627  1.00 41.35 ? 112 GLU A C    1 
ATOM   884  O O    . GLU A 1 112 ? -3.144 -3.283  12.656  1.00 40.61 ? 112 GLU A O    1 
ATOM   885  C CB   . GLU A 1 112 ? -4.331 -3.045  15.803  1.00 45.99 ? 112 GLU A CB   1 
ATOM   886  C CG   . GLU A 1 112 ? -4.324 -3.861  17.094  1.00 54.63 ? 112 GLU A CG   1 
ATOM   887  C CD   . GLU A 1 112 ? -3.417 -3.281  18.172  1.00 59.58 ? 112 GLU A CD   1 
ATOM   888  O OE1  . GLU A 1 112 ? -3.449 -2.047  18.386  1.00 58.39 ? 112 GLU A OE1  1 
ATOM   889  O OE2  . GLU A 1 112 ? -2.683 -4.065  18.813  1.00 60.37 ? 112 GLU A OE2  1 
ATOM   890  N N    . ALA A 1 113 ? -3.564 -1.247  13.528  1.00 41.54 ? 113 ALA A N    1 
ATOM   891  C CA   . ALA A 1 113 ? -3.849 -0.616  12.250  1.00 41.20 ? 113 ALA A CA   1 
ATOM   892  C C    . ALA A 1 113 ? -2.657 -0.486  11.305  1.00 42.16 ? 113 ALA A C    1 
ATOM   893  O O    . ALA A 1 113 ? -2.724 -0.928  10.161  1.00 48.91 ? 113 ALA A O    1 
ATOM   894  C CB   . ALA A 1 113 ? -4.485 0.746   12.478  1.00 37.49 ? 113 ALA A CB   1 
ATOM   895  N N    . GLY A 1 114 ? -1.558 0.080   11.794  1.00 41.37 ? 114 GLY A N    1 
ATOM   896  C CA   . GLY A 1 114 ? -0.394 0.294   10.949  1.00 37.31 ? 114 GLY A CA   1 
ATOM   897  C C    . GLY A 1 114 ? 0.639  -0.795  10.719  1.00 37.83 ? 114 GLY A C    1 
ATOM   898  O O    . GLY A 1 114 ? 1.560  -0.588  9.924   1.00 37.80 ? 114 GLY A O    1 
ATOM   899  N N    . LYS A 1 115 ? 0.492  -1.949  11.366  1.00 35.61 ? 115 LYS A N    1 
ATOM   900  C CA   . LYS A 1 115 ? 1.468  -3.033  11.221  1.00 36.68 ? 115 LYS A CA   1 
ATOM   901  C C    . LYS A 1 115 ? 1.736  -3.496  9.788   1.00 34.47 ? 115 LYS A C    1 
ATOM   902  O O    . LYS A 1 115 ? 2.882  -3.750  9.422   1.00 32.43 ? 115 LYS A O    1 
ATOM   903  C CB   . LYS A 1 115 ? 1.077  -4.233  12.091  1.00 36.74 ? 115 LYS A CB   1 
ATOM   904  C CG   . LYS A 1 115 ? 2.133  -5.332  12.151  1.00 35.81 ? 115 LYS A CG   1 
ATOM   905  C CD   . LYS A 1 115 ? 1.627  -6.547  12.921  1.00 43.03 ? 115 LYS A CD   1 
ATOM   906  C CE   . LYS A 1 115 ? 2.602  -7.713  12.839  1.00 41.39 ? 115 LYS A CE   1 
ATOM   907  N NZ   . LYS A 1 115 ? 3.915  -7.402  13.469  1.00 51.56 ? 115 LYS A NZ   1 
ATOM   908  N N    . ASP A 1 116 ? 0.689  -3.584  8.975   1.00 36.82 ? 116 ASP A N    1 
ATOM   909  C CA   . ASP A 1 116 ? 0.837  -4.035  7.594   1.00 40.04 ? 116 ASP A CA   1 
ATOM   910  C C    . ASP A 1 116 ? 1.599  -3.073  6.686   1.00 38.48 ? 116 ASP A C    1 
ATOM   911  O O    . ASP A 1 116 ? 2.517  -3.485  5.975   1.00 34.17 ? 116 ASP A O    1 
ATOM   912  C CB   . ASP A 1 116 ? -0.528 -4.380  6.997   1.00 46.19 ? 116 ASP A CB   1 
ATOM   913  C CG   . ASP A 1 116 ? -1.194 -5.549  7.707   1.00 52.56 ? 116 ASP A CG   1 
ATOM   914  O OD1  . ASP A 1 116 ? -0.476 -6.491  8.114   1.00 49.30 ? 116 ASP A OD1  1 
ATOM   915  O OD2  . ASP A 1 116 ? -2.436 -5.529  7.847   1.00 54.99 ? 116 ASP A OD2  1 
ATOM   916  N N    . ASP A 1 117 ? 1.230  -1.796  6.721   1.00 36.15 ? 117 ASP A N    1 
ATOM   917  C CA   . ASP A 1 117 ? 1.897  -0.788  5.903   1.00 35.75 ? 117 ASP A CA   1 
ATOM   918  C C    . ASP A 1 117 ? 3.364  -0.656  6.285   1.00 35.68 ? 117 ASP A C    1 
ATOM   919  O O    . ASP A 1 117 ? 4.231  -0.529  5.417   1.00 36.69 ? 117 ASP A O    1 
ATOM   920  C CB   . ASP A 1 117 ? 1.202  0.567   6.045   1.00 39.41 ? 117 ASP A CB   1 
ATOM   921  C CG   . ASP A 1 117 ? -0.170 0.596   5.394   1.00 46.88 ? 117 ASP A CG   1 
ATOM   922  O OD1  . ASP A 1 117 ? -0.525 -0.364  4.671   1.00 47.91 ? 117 ASP A OD1  1 
ATOM   923  O OD2  . ASP A 1 117 ? -0.900 1.586   5.612   1.00 46.96 ? 117 ASP A OD2  1 
ATOM   924  N N    . TYR A 1 118 ? 3.631  -0.700  7.589   1.00 31.28 ? 118 TYR A N    1 
ATOM   925  C CA   . TYR A 1 118 ? 4.987  -0.593  8.117   1.00 30.67 ? 118 TYR A CA   1 
ATOM   926  C C    . TYR A 1 118 ? 5.884  -1.718  7.598   1.00 29.93 ? 118 TYR A C    1 
ATOM   927  O O    . TYR A 1 118 ? 7.026  -1.475  7.198   1.00 28.34 ? 118 TYR A O    1 
ATOM   928  C CB   . TYR A 1 118 ? 4.959  -0.608  9.653   1.00 27.14 ? 118 TYR A CB   1 
ATOM   929  C CG   . TYR A 1 118 ? 6.302  -0.352  10.304  1.00 26.38 ? 118 TYR A CG   1 
ATOM   930  C CD1  . TYR A 1 118 ? 7.217  -1.384  10.486  1.00 19.86 ? 118 TYR A CD1  1 
ATOM   931  C CD2  . TYR A 1 118 ? 6.659  0.928   10.732  1.00 26.08 ? 118 TYR A CD2  1 
ATOM   932  C CE1  . TYR A 1 118 ? 8.453  -1.151  11.075  1.00 29.45 ? 118 TYR A CE1  1 
ATOM   933  C CE2  . TYR A 1 118 ? 7.891  1.172   11.324  1.00 24.22 ? 118 TYR A CE2  1 
ATOM   934  C CZ   . TYR A 1 118 ? 8.785  0.128   11.492  1.00 25.80 ? 118 TYR A CZ   1 
ATOM   935  O OH   . TYR A 1 118 ? 10.010 0.352   12.079  1.00 24.95 ? 118 TYR A OH   1 
ATOM   936  N N    . VAL A 1 119 ? 5.376  -2.948  7.625   1.00 29.06 ? 119 VAL A N    1 
ATOM   937  C CA   . VAL A 1 119 ? 6.144  -4.098  7.151   1.00 33.03 ? 119 VAL A CA   1 
ATOM   938  C C    . VAL A 1 119 ? 6.403  -4.022  5.637   1.00 34.40 ? 119 VAL A C    1 
ATOM   939  O O    . VAL A 1 119 ? 7.460  -4.445  5.164   1.00 34.05 ? 119 VAL A O    1 
ATOM   940  C CB   . VAL A 1 119 ? 5.451  -5.433  7.529   1.00 30.33 ? 119 VAL A CB   1 
ATOM   941  C CG1  . VAL A 1 119 ? 6.251  -6.620  7.013   1.00 29.73 ? 119 VAL A CG1  1 
ATOM   942  C CG2  . VAL A 1 119 ? 5.314  -5.532  9.037   1.00 31.80 ? 119 VAL A CG2  1 
ATOM   943  N N    . LYS A 1 120 ? 5.452  -3.460  4.890   1.00 35.61 ? 120 LYS A N    1 
ATOM   944  C CA   . LYS A 1 120 ? 5.590  -3.309  3.439   1.00 38.35 ? 120 LYS A CA   1 
ATOM   945  C C    . LYS A 1 120 ? 6.695  -2.307  3.108   1.00 35.33 ? 120 LYS A C    1 
ATOM   946  O O    . LYS A 1 120 ? 7.451  -2.494  2.155   1.00 32.78 ? 120 LYS A O    1 
ATOM   947  C CB   . LYS A 1 120 ? 4.279  -2.819  2.816   1.00 42.82 ? 120 LYS A CB   1 
ATOM   948  C CG   . LYS A 1 120 ? 3.118  -3.784  2.943   1.00 52.09 ? 120 LYS A CG   1 
ATOM   949  C CD   . LYS A 1 120 ? 1.806  -3.093  2.601   1.00 58.43 ? 120 LYS A CD   1 
ATOM   950  C CE   . LYS A 1 120 ? 0.608  -3.969  2.947   1.00 62.88 ? 120 LYS A CE   1 
ATOM   951  N NZ   . LYS A 1 120 ? -0.678 -3.221  2.833   1.00 66.35 ? 120 LYS A NZ   1 
ATOM   952  N N    . ALA A 1 121 ? 6.782  -1.247  3.910   1.00 33.79 ? 121 ALA A N    1 
ATOM   953  C CA   . ALA A 1 121 ? 7.782  -0.198  3.716   1.00 30.02 ? 121 ALA A CA   1 
ATOM   954  C C    . ALA A 1 121 ? 9.154  -0.551  4.280   1.00 25.90 ? 121 ALA A C    1 
ATOM   955  O O    . ALA A 1 121 ? 10.148 0.101   3.956   1.00 31.21 ? 121 ALA A O    1 
ATOM   956  C CB   . ALA A 1 121 ? 7.291  1.108   4.326   1.00 28.93 ? 121 ALA A CB   1 
ATOM   957  N N    . LEU A 1 122 ? 9.210  -1.591  5.107   1.00 23.28 ? 122 LEU A N    1 
ATOM   958  C CA   . LEU A 1 122 ? 10.460 -2.020  5.727   1.00 22.18 ? 122 LEU A CA   1 
ATOM   959  C C    . LEU A 1 122 ? 11.676 -2.186  4.810   1.00 22.91 ? 122 LEU A C    1 
ATOM   960  O O    . LEU A 1 122 ? 12.755 -1.693  5.130   1.00 25.90 ? 122 LEU A O    1 
ATOM   961  C CB   . LEU A 1 122 ? 10.252 -3.306  6.526   1.00 23.32 ? 122 LEU A CB   1 
ATOM   962  C CG   . LEU A 1 122 ? 10.454 -3.225  8.038   1.00 27.19 ? 122 LEU A CG   1 
ATOM   963  C CD1  . LEU A 1 122 ? 10.569 -4.640  8.584   1.00 23.58 ? 122 LEU A CD1  1 
ATOM   964  C CD2  . LEU A 1 122 ? 11.711 -2.429  8.373   1.00 16.96 ? 122 LEU A CD2  1 
ATOM   965  N N    . PRO A 1 123 ? 11.527 -2.896  3.672   1.00 22.26 ? 123 PRO A N    1 
ATOM   966  C CA   . PRO A 1 123 ? 12.660 -3.094  2.756   1.00 18.74 ? 123 PRO A CA   1 
ATOM   967  C C    . PRO A 1 123 ? 13.358 -1.797  2.365   1.00 16.63 ? 123 PRO A C    1 
ATOM   968  O O    . PRO A 1 123 ? 14.588 -1.730  2.334   1.00 17.65 ? 123 PRO A O    1 
ATOM   969  C CB   . PRO A 1 123 ? 12.003 -3.767  1.553   1.00 19.28 ? 123 PRO A CB   1 
ATOM   970  C CG   . PRO A 1 123 ? 10.920 -4.574  2.181   1.00 19.49 ? 123 PRO A CG   1 
ATOM   971  C CD   . PRO A 1 123 ? 10.332 -3.600  3.176   1.00 21.84 ? 123 PRO A CD   1 
ATOM   972  N N    . GLY A 1 124 ? 12.568 -0.762  2.095   1.00 22.67 ? 124 GLY A N    1 
ATOM   973  C CA   . GLY A 1 124 ? 13.130 0.523   1.720   1.00 19.75 ? 124 GLY A CA   1 
ATOM   974  C C    . GLY A 1 124 ? 13.902 1.143   2.865   1.00 20.52 ? 124 GLY A C    1 
ATOM   975  O O    . GLY A 1 124 ? 14.898 1.830   2.645   1.00 22.10 ? 124 GLY A O    1 
ATOM   976  N N    . GLN A 1 125 ? 13.438 0.890   4.087   1.00 20.90 ? 125 GLN A N    1 
ATOM   977  C CA   . GLN A 1 125 ? 14.077 1.403   5.297   1.00 22.94 ? 125 GLN A CA   1 
ATOM   978  C C    . GLN A 1 125 ? 15.373 0.672   5.632   1.00 20.70 ? 125 GLN A C    1 
ATOM   979  O O    . GLN A 1 125 ? 16.293 1.260   6.191   1.00 23.81 ? 125 GLN A O    1 
ATOM   980  C CB   . GLN A 1 125 ? 13.127 1.286   6.491   1.00 21.63 ? 125 GLN A CB   1 
ATOM   981  C CG   . GLN A 1 125 ? 11.857 2.102   6.356   1.00 30.39 ? 125 GLN A CG   1 
ATOM   982  C CD   . GLN A 1 125 ? 12.147 3.573   6.155   1.00 35.70 ? 125 GLN A CD   1 
ATOM   983  O OE1  . GLN A 1 125 ? 12.847 4.187   6.960   1.00 40.10 ? 125 GLN A OE1  1 
ATOM   984  N NE2  . GLN A 1 125 ? 11.607 4.148   5.093   1.00 41.34 ? 125 GLN A NE2  1 
ATOM   985  N N    . LEU A 1 126 ? 15.438 -0.613  5.295   1.00 22.14 ? 126 LEU A N    1 
ATOM   986  C CA   . LEU A 1 126 ? 16.622 -1.423  5.577   1.00 21.23 ? 126 LEU A CA   1 
ATOM   987  C C    . LEU A 1 126 ? 17.730 -1.341  4.530   1.00 21.20 ? 126 LEU A C    1 
ATOM   988  O O    . LEU A 1 126 ? 18.905 -1.537  4.860   1.00 21.15 ? 126 LEU A O    1 
ATOM   989  C CB   . LEU A 1 126 ? 16.220 -2.884  5.801   1.00 21.21 ? 126 LEU A CB   1 
ATOM   990  C CG   . LEU A 1 126 ? 15.309 -3.130  7.005   1.00 24.35 ? 126 LEU A CG   1 
ATOM   991  C CD1  . LEU A 1 126 ? 14.871 -4.588  7.049   1.00 19.36 ? 126 LEU A CD1  1 
ATOM   992  C CD2  . LEU A 1 126 ? 16.036 -2.735  8.285   1.00 18.94 ? 126 LEU A CD2  1 
ATOM   993  N N    . LYS A 1 127 ? 17.365 -1.054  3.278   1.00 22.93 ? 127 LYS A N    1 
ATOM   994  C CA   . LYS A 1 127 ? 18.350 -0.955  2.193   1.00 26.44 ? 127 LYS A CA   1 
ATOM   995  C C    . LYS A 1 127 ? 19.580 -0.097  2.486   1.00 20.06 ? 127 LYS A C    1 
ATOM   996  O O    . LYS A 1 127 ? 20.699 -0.511  2.187   1.00 22.94 ? 127 LYS A O    1 
ATOM   997  C CB   . LYS A 1 127 ? 17.693 -0.504  0.886   1.00 33.61 ? 127 LYS A CB   1 
ATOM   998  C CG   . LYS A 1 127 ? 17.200 -1.656  0.044   1.00 47.30 ? 127 LYS A CG   1 
ATOM   999  C CD   . LYS A 1 127 ? 16.323 -1.193  -1.104  1.00 56.32 ? 127 LYS A CD   1 
ATOM   1000 C CE   . LYS A 1 127 ? 15.743 -2.395  -1.838  1.00 58.09 ? 127 LYS A CE   1 
ATOM   1001 N NZ   . LYS A 1 127 ? 14.710 -2.002  -2.834  1.00 63.23 ? 127 LYS A NZ   1 
ATOM   1002 N N    . PRO A 1 128 ? 19.397 1.102   3.079   1.00 19.14 ? 128 PRO A N    1 
ATOM   1003 C CA   . PRO A 1 128 ? 20.549 1.958   3.381   1.00 15.28 ? 128 PRO A CA   1 
ATOM   1004 C C    . PRO A 1 128 ? 21.665 1.260   4.167   1.00 18.17 ? 128 PRO A C    1 
ATOM   1005 O O    . PRO A 1 128 ? 22.847 1.484   3.901   1.00 21.95 ? 128 PRO A O    1 
ATOM   1006 C CB   . PRO A 1 128 ? 19.920 3.089   4.189   1.00 12.31 ? 128 PRO A CB   1 
ATOM   1007 C CG   . PRO A 1 128 ? 18.589 3.241   3.542   1.00 14.29 ? 128 PRO A CG   1 
ATOM   1008 C CD   . PRO A 1 128 ? 18.137 1.804   3.401   1.00 15.76 ? 128 PRO A CD   1 
ATOM   1009 N N    . PHE A 1 129 ? 21.293 0.394   5.109   1.00 13.72 ? 129 PHE A N    1 
ATOM   1010 C CA   . PHE A 1 129 ? 22.279 -0.313  5.927   1.00 20.85 ? 129 PHE A CA   1 
ATOM   1011 C C    . PHE A 1 129 ? 22.978 -1.442  5.168   1.00 19.98 ? 129 PHE A C    1 
ATOM   1012 O O    . PHE A 1 129 ? 24.153 -1.729  5.413   1.00 18.84 ? 129 PHE A O    1 
ATOM   1013 C CB   . PHE A 1 129 ? 21.631 -0.804  7.226   1.00 20.05 ? 129 PHE A CB   1 
ATOM   1014 C CG   . PHE A 1 129 ? 20.973 0.300   8.017   1.00 20.02 ? 129 PHE A CG   1 
ATOM   1015 C CD1  . PHE A 1 129 ? 21.740 1.275   8.652   1.00 22.94 ? 129 PHE A CD1  1 
ATOM   1016 C CD2  . PHE A 1 129 ? 19.587 0.396   8.084   1.00 22.16 ? 129 PHE A CD2  1 
ATOM   1017 C CE1  . PHE A 1 129 ? 21.133 2.330   9.337   1.00 19.18 ? 129 PHE A CE1  1 
ATOM   1018 C CE2  . PHE A 1 129 ? 18.972 1.448   8.767   1.00 18.57 ? 129 PHE A CE2  1 
ATOM   1019 C CZ   . PHE A 1 129 ? 19.748 2.415   9.393   1.00 14.53 ? 129 PHE A CZ   1 
ATOM   1020 N N    . GLU A 1 130 ? 22.251 -2.068  4.243   1.00 19.42 ? 130 GLU A N    1 
ATOM   1021 C CA   . GLU A 1 130 ? 22.800 -3.126  3.398   1.00 18.85 ? 130 GLU A CA   1 
ATOM   1022 C C    . GLU A 1 130 ? 23.848 -2.466  2.493   1.00 21.85 ? 130 GLU A C    1 
ATOM   1023 O O    . GLU A 1 130 ? 24.926 -3.018  2.255   1.00 20.87 ? 130 GLU A O    1 
ATOM   1024 C CB   . GLU A 1 130 ? 21.680 -3.743  2.545   1.00 21.87 ? 130 GLU A CB   1 
ATOM   1025 C CG   . GLU A 1 130 ? 22.118 -4.851  1.575   1.00 27.47 ? 130 GLU A CG   1 
ATOM   1026 C CD   . GLU A 1 130 ? 22.396 -6.192  2.248   1.00 29.84 ? 130 GLU A CD   1 
ATOM   1027 O OE1  . GLU A 1 130 ? 22.104 -6.336  3.453   1.00 29.88 ? 130 GLU A OE1  1 
ATOM   1028 O OE2  . GLU A 1 130 ? 22.898 -7.111  1.564   1.00 32.39 ? 130 GLU A OE2  1 
ATOM   1029 N N    . THR A 1 131 ? 23.527 -1.256  2.031   1.00 22.30 ? 131 THR A N    1 
ATOM   1030 C CA   . THR A 1 131 ? 24.407 -0.468  1.167   1.00 21.34 ? 131 THR A CA   1 
ATOM   1031 C C    . THR A 1 131 ? 25.690 -0.079  1.897   1.00 20.14 ? 131 THR A C    1 
ATOM   1032 O O    . THR A 1 131 ? 26.787 -0.218  1.359   1.00 19.79 ? 131 THR A O    1 
ATOM   1033 C CB   . THR A 1 131 ? 23.704 0.819   0.699   1.00 26.14 ? 131 THR A CB   1 
ATOM   1034 O OG1  . THR A 1 131 ? 22.470 0.483   0.053   1.00 25.68 ? 131 THR A OG1  1 
ATOM   1035 C CG2  . THR A 1 131 ? 24.588 1.592   -0.269  1.00 23.33 ? 131 THR A CG2  1 
ATOM   1036 N N    . LEU A 1 132 ? 25.540 0.438   3.115   1.00 22.42 ? 132 LEU A N    1 
ATOM   1037 C CA   . LEU A 1 132 ? 26.688 0.833   3.930   1.00 24.35 ? 132 LEU A CA   1 
ATOM   1038 C C    . LEU A 1 132 ? 27.625 -0.360  4.110   1.00 24.17 ? 132 LEU A C    1 
ATOM   1039 O O    . LEU A 1 132 ? 28.840 -0.242  3.954   1.00 23.15 ? 132 LEU A O    1 
ATOM   1040 C CB   . LEU A 1 132 ? 26.218 1.335   5.299   1.00 25.57 ? 132 LEU A CB   1 
ATOM   1041 C CG   . LEU A 1 132 ? 25.560 2.719   5.320   1.00 29.69 ? 132 LEU A CG   1 
ATOM   1042 C CD1  . LEU A 1 132 ? 24.784 2.930   6.608   1.00 24.66 ? 132 LEU A CD1  1 
ATOM   1043 C CD2  . LEU A 1 132 ? 26.627 3.786   5.148   1.00 20.42 ? 132 LEU A CD2  1 
ATOM   1044 N N    . LEU A 1 133 ? 27.034 -1.515  4.398   1.00 25.87 ? 133 LEU A N    1 
ATOM   1045 C CA   . LEU A 1 133 ? 27.771 -2.755  4.595   1.00 23.23 ? 133 LEU A CA   1 
ATOM   1046 C C    . LEU A 1 133 ? 28.514 -3.154  3.316   1.00 25.78 ? 133 LEU A C    1 
ATOM   1047 O O    . LEU A 1 133 ? 29.706 -3.472  3.360   1.00 18.93 ? 133 LEU A O    1 
ATOM   1048 C CB   . LEU A 1 133 ? 26.793 -3.856  5.021   1.00 24.05 ? 133 LEU A CB   1 
ATOM   1049 C CG   . LEU A 1 133 ? 27.066 -4.681  6.283   1.00 26.72 ? 133 LEU A CG   1 
ATOM   1050 C CD1  . LEU A 1 133 ? 27.859 -3.901  7.312   1.00 23.16 ? 133 LEU A CD1  1 
ATOM   1051 C CD2  . LEU A 1 133 ? 25.739 -5.146  6.861   1.00 24.18 ? 133 LEU A CD2  1 
ATOM   1052 N N    . SER A 1 134 ? 27.832 -3.081  2.172   1.00 23.49 ? 134 SER A N    1 
ATOM   1053 C CA   . SER A 1 134 ? 28.447 -3.445  0.893   1.00 29.74 ? 134 SER A CA   1 
ATOM   1054 C C    . SER A 1 134 ? 29.633 -2.564  0.505   1.00 30.07 ? 134 SER A C    1 
ATOM   1055 O O    . SER A 1 134 ? 30.515 -3.003  -0.237  1.00 36.18 ? 134 SER A O    1 
ATOM   1056 C CB   . SER A 1 134 ? 27.407 -3.459  -0.236  1.00 27.59 ? 134 SER A CB   1 
ATOM   1057 O OG   . SER A 1 134 ? 26.940 -2.158  -0.544  1.00 32.05 ? 134 SER A OG   1 
ATOM   1058 N N    . GLN A 1 135 ? 29.666 -1.334  1.013   1.00 28.62 ? 135 GLN A N    1 
ATOM   1059 C CA   . GLN A 1 135 ? 30.760 -0.412  0.713   1.00 27.90 ? 135 GLN A CA   1 
ATOM   1060 C C    . GLN A 1 135 ? 31.928 -0.516  1.688   1.00 30.39 ? 135 GLN A C    1 
ATOM   1061 O O    . GLN A 1 135 ? 32.943 0.159   1.517   1.00 31.64 ? 135 GLN A O    1 
ATOM   1062 C CB   . GLN A 1 135 ? 30.241 1.019   0.685   1.00 32.68 ? 135 GLN A CB   1 
ATOM   1063 C CG   . GLN A 1 135 ? 29.215 1.262   -0.393  1.00 39.38 ? 135 GLN A CG   1 
ATOM   1064 C CD   . GLN A 1 135 ? 28.499 2.581   -0.212  1.00 45.11 ? 135 GLN A CD   1 
ATOM   1065 O OE1  . GLN A 1 135 ? 28.712 3.293   0.775   1.00 46.94 ? 135 GLN A OE1  1 
ATOM   1066 N NE2  . GLN A 1 135 ? 27.625 2.907   -1.154  1.00 45.99 ? 135 GLN A NE2  1 
ATOM   1067 N N    . ASN A 1 136 ? 31.780 -1.335  2.724   1.00 27.75 ? 136 ASN A N    1 
ATOM   1068 C CA   . ASN A 1 136 ? 32.832 -1.515  3.709   1.00 28.91 ? 136 ASN A CA   1 
ATOM   1069 C C    . ASN A 1 136 ? 33.346 -2.952  3.680   1.00 29.42 ? 136 ASN A C    1 
ATOM   1070 O O    . ASN A 1 136 ? 32.749 -3.841  4.281   1.00 28.45 ? 136 ASN A O    1 
ATOM   1071 C CB   . ASN A 1 136 ? 32.329 -1.150  5.113   1.00 27.76 ? 136 ASN A CB   1 
ATOM   1072 C CG   . ASN A 1 136 ? 33.410 -1.294  6.176   1.00 28.46 ? 136 ASN A CG   1 
ATOM   1073 O OD1  . ASN A 1 136 ? 34.596 -1.124  5.895   1.00 30.75 ? 136 ASN A OD1  1 
ATOM   1074 N ND2  . ASN A 1 136 ? 33.001 -1.620  7.393   1.00 24.24 ? 136 ASN A ND2  1 
ATOM   1075 N N    . GLN A 1 137 ? 34.448 -3.170  2.956   1.00 36.91 ? 137 GLN A N    1 
ATOM   1076 C CA   . GLN A 1 137 ? 35.068 -4.498  2.828   1.00 38.50 ? 137 GLN A CA   1 
ATOM   1077 C C    . GLN A 1 137 ? 34.067 -5.603  2.494   1.00 37.08 ? 137 GLN A C    1 
ATOM   1078 O O    . GLN A 1 137 ? 34.145 -6.708  3.036   1.00 37.53 ? 137 GLN A O    1 
ATOM   1079 C CB   . GLN A 1 137 ? 35.820 -4.858  4.109   1.00 42.36 ? 137 GLN A CB   1 
ATOM   1080 C CG   . GLN A 1 137 ? 37.003 -3.968  4.421   1.00 49.91 ? 137 GLN A CG   1 
ATOM   1081 C CD   . GLN A 1 137 ? 37.478 -4.127  5.853   1.00 59.50 ? 137 GLN A CD   1 
ATOM   1082 O OE1  . GLN A 1 137 ? 38.189 -5.084  6.172   1.00 59.71 ? 137 GLN A OE1  1 
ATOM   1083 N NE2  . GLN A 1 137 ? 37.096 -3.193  6.717   1.00 62.55 ? 137 GLN A NE2  1 
ATOM   1084 N N    . GLY A 1 138 ? 33.109 -5.283  1.628   1.00 34.54 ? 138 GLY A N    1 
ATOM   1085 C CA   . GLY A 1 138 ? 32.106 -6.255  1.223   1.00 33.64 ? 138 GLY A CA   1 
ATOM   1086 C C    . GLY A 1 138 ? 31.214 -6.793  2.328   1.00 35.93 ? 138 GLY A C    1 
ATOM   1087 O O    . GLY A 1 138 ? 30.678 -7.895  2.206   1.00 40.71 ? 138 GLY A O    1 
ATOM   1088 N N    . GLY A 1 139 ? 31.047 -6.021  3.399   1.00 33.49 ? 139 GLY A N    1 
ATOM   1089 C CA   . GLY A 1 139 ? 30.209 -6.447  4.509   1.00 33.25 ? 139 GLY A CA   1 
ATOM   1090 C C    . GLY A 1 139 ? 30.785 -7.588  5.326   1.00 32.97 ? 139 GLY A C    1 
ATOM   1091 O O    . GLY A 1 139 ? 30.050 -8.282  6.024   1.00 35.18 ? 139 GLY A O    1 
ATOM   1092 N N    . LYS A 1 140 ? 32.102 -7.761  5.266   1.00 35.47 ? 140 LYS A N    1 
ATOM   1093 C CA   . LYS A 1 140 ? 32.778 -8.833  5.990   1.00 36.91 ? 140 LYS A CA   1 
ATOM   1094 C C    . LYS A 1 140 ? 33.083 -8.498  7.449   1.00 34.37 ? 140 LYS A C    1 
ATOM   1095 O O    . LYS A 1 140 ? 33.253 -9.404  8.263   1.00 35.42 ? 140 LYS A O    1 
ATOM   1096 C CB   . LYS A 1 140 ? 34.074 -9.228  5.266   1.00 39.70 ? 140 LYS A CB   1 
ATOM   1097 C CG   . LYS A 1 140 ? 33.871 -9.767  3.849   1.00 48.70 ? 140 LYS A CG   1 
ATOM   1098 C CD   . LYS A 1 140 ? 33.284 -11.175 3.843   1.00 55.06 ? 140 LYS A CD   1 
ATOM   1099 C CE   . LYS A 1 140 ? 34.358 -12.227 4.096   1.00 64.02 ? 140 LYS A CE   1 
ATOM   1100 N NZ   . LYS A 1 140 ? 33.805 -13.614 4.138   1.00 62.77 ? 140 LYS A NZ   1 
ATOM   1101 N N    . THR A 1 141 ? 33.139 -7.207  7.778   1.00 32.83 ? 141 THR A N    1 
ATOM   1102 C CA   . THR A 1 141 ? 33.442 -6.773  9.144   1.00 31.17 ? 141 THR A CA   1 
ATOM   1103 C C    . THR A 1 141 ? 32.293 -6.063  9.875   1.00 31.32 ? 141 THR A C    1 
ATOM   1104 O O    . THR A 1 141 ? 31.255 -6.671  10.135  1.00 32.43 ? 141 THR A O    1 
ATOM   1105 C CB   . THR A 1 141 ? 34.715 -5.896  9.192   1.00 28.55 ? 141 THR A CB   1 
ATOM   1106 O OG1  . THR A 1 141 ? 34.603 -4.835  8.235   1.00 28.25 ? 141 THR A OG1  1 
ATOM   1107 C CG2  . THR A 1 141 ? 35.956 -6.726  8.901   1.00 31.43 ? 141 THR A CG2  1 
ATOM   1108 N N    . PHE A 1 142 ? 32.481 -4.782  10.200  1.00 26.40 ? 142 PHE A N    1 
ATOM   1109 C CA   . PHE A 1 142 ? 31.481 -4.007  10.924  1.00 19.15 ? 142 PHE A CA   1 
ATOM   1110 C C    . PHE A 1 142 ? 30.814 -2.954  10.043  1.00 21.96 ? 142 PHE A C    1 
ATOM   1111 O O    . PHE A 1 142 ? 31.162 -2.817  8.872   1.00 24.65 ? 142 PHE A O    1 
ATOM   1112 C CB   . PHE A 1 142 ? 32.131 -3.388  12.158  1.00 19.57 ? 142 PHE A CB   1 
ATOM   1113 C CG   . PHE A 1 142 ? 32.807 -4.402  13.044  1.00 18.76 ? 142 PHE A CG   1 
ATOM   1114 C CD1  . PHE A 1 142 ? 32.062 -5.181  13.928  1.00 20.46 ? 142 PHE A CD1  1 
ATOM   1115 C CD2  . PHE A 1 142 ? 34.182 -4.604  12.971  1.00 19.75 ? 142 PHE A CD2  1 
ATOM   1116 C CE1  . PHE A 1 142 ? 32.677 -6.150  14.720  1.00 18.82 ? 142 PHE A CE1  1 
ATOM   1117 C CE2  . PHE A 1 142 ? 34.807 -5.570  13.757  1.00 18.62 ? 142 PHE A CE2  1 
ATOM   1118 C CZ   . PHE A 1 142 ? 34.053 -6.343  14.634  1.00 19.03 ? 142 PHE A CZ   1 
ATOM   1119 N N    . ILE A 1 143 ? 29.845 -2.224  10.590  1.00 18.32 ? 143 ILE A N    1 
ATOM   1120 C CA   . ILE A 1 143 ? 29.126 -1.227  9.802   1.00 19.44 ? 143 ILE A CA   1 
ATOM   1121 C C    . ILE A 1 143 ? 30.020 -0.086  9.302   1.00 21.45 ? 143 ILE A C    1 
ATOM   1122 O O    . ILE A 1 143 ? 29.805 0.444   8.211   1.00 21.50 ? 143 ILE A O    1 
ATOM   1123 C CB   . ILE A 1 143 ? 27.875 -0.687  10.560  1.00 20.67 ? 143 ILE A CB   1 
ATOM   1124 C CG1  . ILE A 1 143 ? 26.946 0.047   9.593   1.00 19.72 ? 143 ILE A CG1  1 
ATOM   1125 C CG2  . ILE A 1 143 ? 28.281 0.224   11.719  1.00 18.85 ? 143 ILE A CG2  1 
ATOM   1126 C CD1  . ILE A 1 143 ? 26.301 -0.847  8.546   1.00 12.02 ? 143 ILE A CD1  1 
ATOM   1127 N N    . VAL A 1 144 ? 31.032 0.266   10.093  1.00 21.38 ? 144 VAL A N    1 
ATOM   1128 C CA   . VAL A 1 144 ? 31.981 1.325   9.743   1.00 20.03 ? 144 VAL A CA   1 
ATOM   1129 C C    . VAL A 1 144 ? 33.383 0.903   10.171  1.00 19.62 ? 144 VAL A C    1 
ATOM   1130 O O    . VAL A 1 144 ? 33.608 0.590   11.341  1.00 21.10 ? 144 VAL A O    1 
ATOM   1131 C CB   . VAL A 1 144 ? 31.644 2.669   10.449  1.00 16.54 ? 144 VAL A CB   1 
ATOM   1132 C CG1  . VAL A 1 144 ? 32.764 3.681   10.217  1.00 16.44 ? 144 VAL A CG1  1 
ATOM   1133 C CG2  . VAL A 1 144 ? 30.329 3.228   9.931   1.00 16.31 ? 144 VAL A CG2  1 
ATOM   1134 N N    . GLY A 1 145 ? 34.316 0.884   9.223   1.00 18.27 ? 145 GLY A N    1 
ATOM   1135 C CA   . GLY A 1 145 ? 35.686 0.504   9.534   1.00 19.01 ? 145 GLY A CA   1 
ATOM   1136 C C    . GLY A 1 145 ? 35.887 -0.978  9.801   1.00 25.00 ? 145 GLY A C    1 
ATOM   1137 O O    . GLY A 1 145 ? 35.046 -1.803  9.438   1.00 24.24 ? 145 GLY A O    1 
ATOM   1138 N N    . ASP A 1 146 ? 36.995 -1.316  10.456  1.00 27.91 ? 146 ASP A N    1 
ATOM   1139 C CA   . ASP A 1 146 ? 37.312 -2.709  10.761  1.00 34.30 ? 146 ASP A CA   1 
ATOM   1140 C C    . ASP A 1 146 ? 37.306 -3.027  12.257  1.00 35.84 ? 146 ASP A C    1 
ATOM   1141 O O    . ASP A 1 146 ? 37.840 -4.051  12.687  1.00 35.68 ? 146 ASP A O    1 
ATOM   1142 C CB   . ASP A 1 146 ? 38.657 -3.102  10.132  1.00 42.87 ? 146 ASP A CB   1 
ATOM   1143 C CG   . ASP A 1 146 ? 39.828 -2.277  10.659  1.00 52.43 ? 146 ASP A CG   1 
ATOM   1144 O OD1  . ASP A 1 146 ? 39.608 -1.262  11.360  1.00 54.33 ? 146 ASP A OD1  1 
ATOM   1145 O OD2  . ASP A 1 146 ? 40.984 -2.651  10.357  1.00 57.94 ? 146 ASP A OD2  1 
ATOM   1146 N N    . GLN A 1 147 ? 36.707 -2.136  13.042  1.00 34.42 ? 147 GLN A N    1 
ATOM   1147 C CA   . GLN A 1 147 ? 36.601 -2.303  14.488  1.00 30.30 ? 147 GLN A CA   1 
ATOM   1148 C C    . GLN A 1 147 ? 35.160 -1.956  14.863  1.00 30.17 ? 147 GLN A C    1 
ATOM   1149 O O    . GLN A 1 147 ? 34.537 -1.092  14.236  1.00 28.56 ? 147 GLN A O    1 
ATOM   1150 C CB   . GLN A 1 147 ? 37.592 -1.388  15.220  1.00 33.96 ? 147 GLN A CB   1 
ATOM   1151 C CG   . GLN A 1 147 ? 37.435 0.091   14.880  1.00 50.43 ? 147 GLN A CG   1 
ATOM   1152 C CD   . GLN A 1 147 ? 38.307 0.998   15.731  1.00 55.59 ? 147 GLN A CD   1 
ATOM   1153 O OE1  . GLN A 1 147 ? 39.418 1.354   15.340  1.00 58.58 ? 147 GLN A OE1  1 
ATOM   1154 N NE2  . GLN A 1 147 ? 37.796 1.390   16.897  1.00 54.63 ? 147 GLN A NE2  1 
ATOM   1155 N N    . ILE A 1 148 ? 34.617 -2.658  15.855  1.00 25.06 ? 148 ILE A N    1 
ATOM   1156 C CA   . ILE A 1 148 ? 33.241 -2.435  16.296  1.00 19.11 ? 148 ILE A CA   1 
ATOM   1157 C C    . ILE A 1 148 ? 33.045 -1.043  16.919  1.00 18.93 ? 148 ILE A C    1 
ATOM   1158 O O    . ILE A 1 148 ? 33.955 -0.495  17.541  1.00 17.85 ? 148 ILE A O    1 
ATOM   1159 C CB   . ILE A 1 148 ? 32.792 -3.554  17.276  1.00 15.67 ? 148 ILE A CB   1 
ATOM   1160 C CG1  . ILE A 1 148 ? 31.267 -3.653  17.308  1.00 18.87 ? 148 ILE A CG1  1 
ATOM   1161 C CG2  . ILE A 1 148 ? 33.347 -3.305  18.673  1.00 14.46 ? 148 ILE A CG2  1 
ATOM   1162 C CD1  . ILE A 1 148 ? 30.755 -4.966  17.868  1.00 13.44 ? 148 ILE A CD1  1 
ATOM   1163 N N    . SER A 1 149 ? 31.867 -0.463  16.710  1.00 14.56 ? 149 SER A N    1 
ATOM   1164 C CA   . SER A 1 149 ? 31.556 0.859   17.245  1.00 15.61 ? 149 SER A CA   1 
ATOM   1165 C C    . SER A 1 149 ? 30.213 0.784   17.956  1.00 12.88 ? 149 SER A C    1 
ATOM   1166 O O    . SER A 1 149 ? 29.525 -0.232  17.867  1.00 12.22 ? 149 SER A O    1 
ATOM   1167 C CB   . SER A 1 149 ? 31.488 1.894   16.116  1.00 10.55 ? 149 SER A CB   1 
ATOM   1168 O OG   . SER A 1 149 ? 30.349 1.690   15.295  1.00 13.07 ? 149 SER A OG   1 
ATOM   1169 N N    . PHE A 1 150 ? 29.833 1.860   18.645  1.00 14.89 ? 150 PHE A N    1 
ATOM   1170 C CA   . PHE A 1 150 ? 28.557 1.881   19.357  1.00 15.23 ? 150 PHE A CA   1 
ATOM   1171 C C    . PHE A 1 150 ? 27.379 1.783   18.396  1.00 9.66  ? 150 PHE A C    1 
ATOM   1172 O O    . PHE A 1 150 ? 26.310 1.299   18.765  1.00 19.65 ? 150 PHE A O    1 
ATOM   1173 C CB   . PHE A 1 150 ? 28.435 3.119   20.270  1.00 14.25 ? 150 PHE A CB   1 
ATOM   1174 C CG   . PHE A 1 150 ? 28.325 4.432   19.531  1.00 8.22  ? 150 PHE A CG   1 
ATOM   1175 C CD1  . PHE A 1 150 ? 27.084 4.915   19.129  1.00 2.64  ? 150 PHE A CD1  1 
ATOM   1176 C CD2  . PHE A 1 150 ? 29.461 5.184   19.246  1.00 6.27  ? 150 PHE A CD2  1 
ATOM   1177 C CE1  . PHE A 1 150 ? 26.974 6.130   18.449  1.00 11.07 ? 150 PHE A CE1  1 
ATOM   1178 C CE2  . PHE A 1 150 ? 29.363 6.401   18.566  1.00 10.05 ? 150 PHE A CE2  1 
ATOM   1179 C CZ   . PHE A 1 150 ? 28.115 6.875   18.167  1.00 7.03  ? 150 PHE A CZ   1 
ATOM   1180 N N    . ALA A 1 151 ? 27.588 2.222   17.156  1.00 16.82 ? 151 ALA A N    1 
ATOM   1181 C CA   . ALA A 1 151 ? 26.545 2.170   16.130  1.00 17.83 ? 151 ALA A CA   1 
ATOM   1182 C C    . ALA A 1 151 ? 26.207 0.716   15.793  1.00 13.16 ? 151 ALA A C    1 
ATOM   1183 O O    . ALA A 1 151 ? 25.063 0.395   15.466  1.00 11.09 ? 151 ALA A O    1 
ATOM   1184 C CB   . ALA A 1 151 ? 26.991 2.923   14.873  1.00 17.78 ? 151 ALA A CB   1 
ATOM   1185 N N    . ASP A 1 152 ? 27.206 -0.157  15.888  1.00 8.88  ? 152 ASP A N    1 
ATOM   1186 C CA   . ASP A 1 152 ? 27.009 -1.575  15.618  1.00 15.04 ? 152 ASP A CA   1 
ATOM   1187 C C    . ASP A 1 152 ? 26.000 -2.181  16.578  1.00 17.03 ? 152 ASP A C    1 
ATOM   1188 O O    . ASP A 1 152 ? 25.059 -2.856  16.148  1.00 15.36 ? 152 ASP A O    1 
ATOM   1189 C CB   . ASP A 1 152 ? 28.335 -2.330  15.726  1.00 16.98 ? 152 ASP A CB   1 
ATOM   1190 C CG   . ASP A 1 152 ? 29.198 -2.166  14.497  1.00 16.02 ? 152 ASP A CG   1 
ATOM   1191 O OD1  . ASP A 1 152 ? 28.763 -2.584  13.411  1.00 16.20 ? 152 ASP A OD1  1 
ATOM   1192 O OD2  . ASP A 1 152 ? 30.310 -1.622  14.614  1.00 19.68 ? 152 ASP A OD2  1 
ATOM   1193 N N    . TYR A 1 153 ? 26.177 -1.910  17.873  1.00 16.69 ? 153 TYR A N    1 
ATOM   1194 C CA   . TYR A 1 153 ? 25.273 -2.436  18.901  1.00 14.36 ? 153 TYR A CA   1 
ATOM   1195 C C    . TYR A 1 153 ? 23.861 -1.912  18.711  1.00 13.55 ? 153 TYR A C    1 
ATOM   1196 O O    . TYR A 1 153 ? 22.898 -2.654  18.843  1.00 12.86 ? 153 TYR A O    1 
ATOM   1197 C CB   . TYR A 1 153 ? 25.778 -2.085  20.309  1.00 12.46 ? 153 TYR A CB   1 
ATOM   1198 C CG   . TYR A 1 153 ? 27.110 -2.701  20.625  1.00 8.60  ? 153 TYR A CG   1 
ATOM   1199 C CD1  . TYR A 1 153 ? 27.225 -4.070  20.886  1.00 12.19 ? 153 TYR A CD1  1 
ATOM   1200 C CD2  . TYR A 1 153 ? 28.269 -1.929  20.612  1.00 12.86 ? 153 TYR A CD2  1 
ATOM   1201 C CE1  . TYR A 1 153 ? 28.472 -4.652  21.122  1.00 6.65  ? 153 TYR A CE1  1 
ATOM   1202 C CE2  . TYR A 1 153 ? 29.514 -2.500  20.844  1.00 9.42  ? 153 TYR A CE2  1 
ATOM   1203 C CZ   . TYR A 1 153 ? 29.607 -3.859  21.097  1.00 9.97  ? 153 TYR A CZ   1 
ATOM   1204 O OH   . TYR A 1 153 ? 30.840 -4.419  21.320  1.00 15.89 ? 153 TYR A OH   1 
ATOM   1205 N N    . ASN A 1 154 ? 23.740 -0.634  18.361  1.00 14.34 ? 154 ASN A N    1 
ATOM   1206 C CA   . ASN A 1 154 ? 22.441 -0.022  18.163  1.00 10.38 ? 154 ASN A CA   1 
ATOM   1207 C C    . ASN A 1 154 ? 21.757 -0.575  16.909  1.00 11.97 ? 154 ASN A C    1 
ATOM   1208 O O    . ASN A 1 154 ? 20.550 -0.830  16.913  1.00 16.19 ? 154 ASN A O    1 
ATOM   1209 C CB   . ASN A 1 154 ? 22.570 1.500   18.093  1.00 9.39  ? 154 ASN A CB   1 
ATOM   1210 C CG   . ASN A 1 154 ? 21.255 2.204   18.378  1.00 14.97 ? 154 ASN A CG   1 
ATOM   1211 O OD1  . ASN A 1 154 ? 20.266 1.567   18.750  1.00 13.26 ? 154 ASN A OD1  1 
ATOM   1212 N ND2  . ASN A 1 154 ? 21.250 3.517   18.239  1.00 16.92 ? 154 ASN A ND2  1 
ATOM   1213 N N    . LEU A 1 155 ? 22.531 -0.765  15.844  1.00 19.22 ? 155 LEU A N    1 
ATOM   1214 C CA   . LEU A 1 155 ? 21.980 -1.296  14.597  1.00 14.98 ? 155 LEU A CA   1 
ATOM   1215 C C    . LEU A 1 155 ? 21.551 -2.744  14.831  1.00 15.25 ? 155 LEU A C    1 
ATOM   1216 O O    . LEU A 1 155 ? 20.461 -3.144  14.420  1.00 12.96 ? 155 LEU A O    1 
ATOM   1217 C CB   . LEU A 1 155 ? 23.015 -1.219  13.467  1.00 14.29 ? 155 LEU A CB   1 
ATOM   1218 C CG   . LEU A 1 155 ? 22.609 -1.888  12.144  1.00 11.29 ? 155 LEU A CG   1 
ATOM   1219 C CD1  . LEU A 1 155 ? 21.292 -1.328  11.634  1.00 11.27 ? 155 LEU A CD1  1 
ATOM   1220 C CD2  . LEU A 1 155 ? 23.708 -1.695  11.117  1.00 11.69 ? 155 LEU A CD2  1 
ATOM   1221 N N    . LEU A 1 156 ? 22.394 -3.507  15.529  1.00 11.39 ? 156 LEU A N    1 
ATOM   1222 C CA   . LEU A 1 156 ? 22.099 -4.907  15.840  1.00 15.34 ? 156 LEU A CA   1 
ATOM   1223 C C    . LEU A 1 156 ? 20.770 -5.011  16.575  1.00 16.71 ? 156 LEU A C    1 
ATOM   1224 O O    . LEU A 1 156 ? 19.918 -5.822  16.208  1.00 15.34 ? 156 LEU A O    1 
ATOM   1225 C CB   . LEU A 1 156 ? 23.206 -5.517  16.699  1.00 15.98 ? 156 LEU A CB   1 
ATOM   1226 C CG   . LEU A 1 156 ? 23.016 -6.998  17.041  1.00 20.69 ? 156 LEU A CG   1 
ATOM   1227 C CD1  . LEU A 1 156 ? 22.962 -7.831  15.764  1.00 16.39 ? 156 LEU A CD1  1 
ATOM   1228 C CD2  . LEU A 1 156 ? 24.150 -7.473  17.933  1.00 17.86 ? 156 LEU A CD2  1 
ATOM   1229 N N    . ASP A 1 157 ? 20.591 -4.182  17.605  1.00 14.16 ? 157 ASP A N    1 
ATOM   1230 C CA   . ASP A 1 157 ? 19.346 -4.187  18.362  1.00 12.86 ? 157 ASP A CA   1 
ATOM   1231 C C    . ASP A 1 157 ? 18.166 -3.885  17.443  1.00 15.32 ? 157 ASP A C    1 
ATOM   1232 O O    . ASP A 1 157 ? 17.145 -4.577  17.482  1.00 17.32 ? 157 ASP A O    1 
ATOM   1233 C CB   . ASP A 1 157 ? 19.381 -3.161  19.500  1.00 15.85 ? 157 ASP A CB   1 
ATOM   1234 C CG   . ASP A 1 157 ? 18.058 -3.075  20.232  1.00 17.29 ? 157 ASP A CG   1 
ATOM   1235 O OD1  . ASP A 1 157 ? 17.627 -4.101  20.788  1.00 18.97 ? 157 ASP A OD1  1 
ATOM   1236 O OD2  . ASP A 1 157 ? 17.401 -2.015  20.187  1.00 21.13 ? 157 ASP A OD2  1 
ATOM   1237 N N    . LEU A 1 158 ? 18.311 -2.853  16.615  1.00 17.19 ? 158 LEU A N    1 
ATOM   1238 C CA   . LEU A 1 158 ? 17.254 -2.470  15.687  1.00 16.57 ? 158 LEU A CA   1 
ATOM   1239 C C    . LEU A 1 158 ? 16.878 -3.653  14.781  1.00 16.21 ? 158 LEU A C    1 
ATOM   1240 O O    . LEU A 1 158 ? 15.698 -3.948  14.591  1.00 16.75 ? 158 LEU A O    1 
ATOM   1241 C CB   . LEU A 1 158 ? 17.690 -1.268  14.840  1.00 18.13 ? 158 LEU A CB   1 
ATOM   1242 C CG   . LEU A 1 158 ? 16.608 -0.654  13.942  1.00 17.58 ? 158 LEU A CG   1 
ATOM   1243 C CD1  . LEU A 1 158 ? 15.533 0.000   14.795  1.00 16.39 ? 158 LEU A CD1  1 
ATOM   1244 C CD2  . LEU A 1 158 ? 17.224 0.367   13.005  1.00 20.43 ? 158 LEU A CD2  1 
ATOM   1245 N N    . LEU A 1 159 ? 17.882 -4.359  14.271  1.00 15.78 ? 159 LEU A N    1 
ATOM   1246 C CA   . LEU A 1 159 ? 17.638 -5.507  13.394  1.00 16.75 ? 159 LEU A CA   1 
ATOM   1247 C C    . LEU A 1 159 ? 16.930 -6.650  14.124  1.00 17.74 ? 159 LEU A C    1 
ATOM   1248 O O    . LEU A 1 159 ? 15.953 -7.204  13.618  1.00 18.77 ? 159 LEU A O    1 
ATOM   1249 C CB   . LEU A 1 159 ? 18.955 -5.991  12.774  1.00 10.89 ? 159 LEU A CB   1 
ATOM   1250 C CG   . LEU A 1 159 ? 19.658 -4.948  11.901  1.00 13.04 ? 159 LEU A CG   1 
ATOM   1251 C CD1  . LEU A 1 159 ? 21.008 -5.451  11.432  1.00 13.47 ? 159 LEU A CD1  1 
ATOM   1252 C CD2  . LEU A 1 159 ? 18.776 -4.591  10.721  1.00 12.50 ? 159 LEU A CD2  1 
ATOM   1253 N N    . LEU A 1 160 ? 17.400 -6.968  15.330  1.00 21.94 ? 160 LEU A N    1 
ATOM   1254 C CA   . LEU A 1 160 ? 16.811 -8.035  16.136  1.00 18.20 ? 160 LEU A CA   1 
ATOM   1255 C C    . LEU A 1 160 ? 15.341 -7.806  16.466  1.00 15.43 ? 160 LEU A C    1 
ATOM   1256 O O    . LEU A 1 160 ? 14.534 -8.729  16.347  1.00 18.09 ? 160 LEU A O    1 
ATOM   1257 C CB   . LEU A 1 160 ? 17.607 -8.239  17.430  1.00 13.38 ? 160 LEU A CB   1 
ATOM   1258 C CG   . LEU A 1 160 ? 19.042 -8.755  17.277  1.00 12.46 ? 160 LEU A CG   1 
ATOM   1259 C CD1  . LEU A 1 160 ? 19.712 -8.790  18.626  1.00 11.30 ? 160 LEU A CD1  1 
ATOM   1260 C CD2  . LEU A 1 160 ? 19.050 -10.140 16.648  1.00 13.65 ? 160 LEU A CD2  1 
ATOM   1261 N N    . ILE A 1 161 ? 14.978 -6.586  16.863  1.00 16.94 ? 161 ILE A N    1 
ATOM   1262 C CA   . ILE A 1 161 ? 13.579 -6.313  17.201  1.00 16.79 ? 161 ILE A CA   1 
ATOM   1263 C C    . ILE A 1 161 ? 12.678 -6.332  15.971  1.00 20.31 ? 161 ILE A C    1 
ATOM   1264 O O    . ILE A 1 161 ? 11.464 -6.527  16.090  1.00 18.59 ? 161 ILE A O    1 
ATOM   1265 C CB   . ILE A 1 161 ? 13.388 -4.988  17.990  1.00 18.55 ? 161 ILE A CB   1 
ATOM   1266 C CG1  . ILE A 1 161 ? 13.787 -3.775  17.144  1.00 17.34 ? 161 ILE A CG1  1 
ATOM   1267 C CG2  . ILE A 1 161 ? 14.181 -5.037  19.285  1.00 17.38 ? 161 ILE A CG2  1 
ATOM   1268 C CD1  . ILE A 1 161 ? 13.656 -2.450  17.877  1.00 17.09 ? 161 ILE A CD1  1 
ATOM   1269 N N    . HIS A 1 162 ? 13.264 -6.118  14.793  1.00 20.06 ? 162 HIS A N    1 
ATOM   1270 C CA   . HIS A 1 162 ? 12.488 -6.155  13.556  1.00 21.37 ? 162 HIS A CA   1 
ATOM   1271 C C    . HIS A 1 162 ? 12.280 -7.595  13.104  1.00 23.90 ? 162 HIS A C    1 
ATOM   1272 O O    . HIS A 1 162 ? 11.306 -7.896  12.420  1.00 25.36 ? 162 HIS A O    1 
ATOM   1273 C CB   . HIS A 1 162 ? 13.137 -5.315  12.459  1.00 21.13 ? 162 HIS A CB   1 
ATOM   1274 C CG   . HIS A 1 162 ? 12.784 -3.864  12.537  1.00 19.46 ? 162 HIS A CG   1 
ATOM   1275 N ND1  . HIS A 1 162 ? 13.518 -2.955  13.265  1.00 17.03 ? 162 HIS A ND1  1 
ATOM   1276 C CD2  . HIS A 1 162 ? 11.745 -3.170  12.012  1.00 17.18 ? 162 HIS A CD2  1 
ATOM   1277 C CE1  . HIS A 1 162 ? 12.948 -1.765  13.191  1.00 19.49 ? 162 HIS A CE1  1 
ATOM   1278 N NE2  . HIS A 1 162 ? 11.871 -1.872  12.435  1.00 16.66 ? 162 HIS A NE2  1 
ATOM   1279 N N    . GLU A 1 163 ? 13.209 -8.473  13.480  1.00 22.19 ? 163 GLU A N    1 
ATOM   1280 C CA   . GLU A 1 163 ? 13.102 -9.892  13.166  1.00 25.77 ? 163 GLU A CA   1 
ATOM   1281 C C    . GLU A 1 163 ? 11.895 -10.415 13.937  1.00 25.49 ? 163 GLU A C    1 
ATOM   1282 O O    . GLU A 1 163 ? 11.157 -11.269 13.452  1.00 29.64 ? 163 GLU A O    1 
ATOM   1283 C CB   . GLU A 1 163 ? 14.359 -10.638 13.620  1.00 31.23 ? 163 GLU A CB   1 
ATOM   1284 C CG   . GLU A 1 163 ? 15.385 -10.879 12.527  1.00 41.95 ? 163 GLU A CG   1 
ATOM   1285 C CD   . GLU A 1 163 ? 14.896 -11.866 11.476  1.00 54.94 ? 163 GLU A CD   1 
ATOM   1286 O OE1  . GLU A 1 163 ? 14.238 -12.862 11.851  1.00 58.13 ? 163 GLU A OE1  1 
ATOM   1287 O OE2  . GLU A 1 163 ? 15.162 -11.646 10.272  1.00 59.34 ? 163 GLU A OE2  1 
ATOM   1288 N N    . VAL A 1 164 ? 11.693 -9.871  15.134  1.00 22.87 ? 164 VAL A N    1 
ATOM   1289 C CA   . VAL A 1 164 ? 10.575 -10.255 15.984  1.00 20.92 ? 164 VAL A CA   1 
ATOM   1290 C C    . VAL A 1 164 ? 9.273  -9.677  15.424  1.00 28.41 ? 164 VAL A C    1 
ATOM   1291 O O    . VAL A 1 164 ? 8.242  -10.350 15.417  1.00 29.35 ? 164 VAL A O    1 
ATOM   1292 C CB   . VAL A 1 164 ? 10.775 -9.754  17.440  1.00 19.90 ? 164 VAL A CB   1 
ATOM   1293 C CG1  . VAL A 1 164 ? 9.558  -10.094 18.297  1.00 16.40 ? 164 VAL A CG1  1 
ATOM   1294 C CG2  . VAL A 1 164 ? 12.035 -10.365 18.041  1.00 14.12 ? 164 VAL A CG2  1 
ATOM   1295 N N    . LEU A 1 165 ? 9.330  -8.435  14.946  1.00 27.12 ? 165 LEU A N    1 
ATOM   1296 C CA   . LEU A 1 165 ? 8.154  -7.767  14.389  1.00 26.84 ? 165 LEU A CA   1 
ATOM   1297 C C    . LEU A 1 165 ? 7.706  -8.388  13.066  1.00 30.90 ? 165 LEU A C    1 
ATOM   1298 O O    . LEU A 1 165 ? 6.535  -8.718  12.887  1.00 30.74 ? 165 LEU A O    1 
ATOM   1299 C CB   . LEU A 1 165 ? 8.443  -6.278  14.180  1.00 26.41 ? 165 LEU A CB   1 
ATOM   1300 C CG   . LEU A 1 165 ? 7.319  -5.438  13.569  1.00 26.41 ? 165 LEU A CG   1 
ATOM   1301 C CD1  . LEU A 1 165 ? 6.193  -5.259  14.570  1.00 25.87 ? 165 LEU A CD1  1 
ATOM   1302 C CD2  . LEU A 1 165 ? 7.861  -4.090  13.140  1.00 27.12 ? 165 LEU A CD2  1 
ATOM   1303 N N    . ALA A 1 166 ? 8.649  -8.520  12.142  1.00 31.46 ? 166 ALA A N    1 
ATOM   1304 C CA   . ALA A 1 166 ? 8.392  -9.085  10.823  1.00 30.90 ? 166 ALA A CA   1 
ATOM   1305 C C    . ALA A 1 166 ? 9.403  -10.199 10.566  1.00 28.84 ? 166 ALA A C    1 
ATOM   1306 O O    . ALA A 1 166 ? 10.457 -9.967  9.973   1.00 26.85 ? 166 ALA A O    1 
ATOM   1307 C CB   . ALA A 1 166 ? 8.519  -7.999  9.758   1.00 24.89 ? 166 ALA A CB   1 
ATOM   1308 N N    . PRO A 1 167 ? 9.104  -11.420 11.045  1.00 28.75 ? 167 PRO A N    1 
ATOM   1309 C CA   . PRO A 1 167 ? 9.986  -12.581 10.873  1.00 28.20 ? 167 PRO A CA   1 
ATOM   1310 C C    . PRO A 1 167 ? 10.393 -12.789 9.417   1.00 27.27 ? 167 PRO A C    1 
ATOM   1311 O O    . PRO A 1 167 ? 9.550  -12.802 8.519   1.00 31.49 ? 167 PRO A O    1 
ATOM   1312 C CB   . PRO A 1 167 ? 9.124  -13.733 11.389  1.00 28.10 ? 167 PRO A CB   1 
ATOM   1313 C CG   . PRO A 1 167 ? 8.316  -13.082 12.462  1.00 26.81 ? 167 PRO A CG   1 
ATOM   1314 C CD   . PRO A 1 167 ? 7.894  -11.792 11.798  1.00 26.71 ? 167 PRO A CD   1 
ATOM   1315 N N    . GLY A 1 168 ? 11.696 -12.906 9.190   1.00 26.50 ? 168 GLY A N    1 
ATOM   1316 C CA   . GLY A 1 168 ? 12.200 -13.110 7.847   1.00 25.10 ? 168 GLY A CA   1 
ATOM   1317 C C    . GLY A 1 168 ? 12.401 -11.847 7.030   1.00 30.53 ? 168 GLY A C    1 
ATOM   1318 O O    . GLY A 1 168 ? 12.748 -11.929 5.855   1.00 29.45 ? 168 GLY A O    1 
ATOM   1319 N N    . CYS A 1 169 ? 12.193 -10.679 7.636   1.00 29.85 ? 169 CYS A N    1 
ATOM   1320 C CA   . CYS A 1 169 ? 12.371 -9.410  6.925   1.00 29.39 ? 169 CYS A CA   1 
ATOM   1321 C C    . CYS A 1 169 ? 13.805 -9.218  6.419   1.00 25.88 ? 169 CYS A C    1 
ATOM   1322 O O    . CYS A 1 169 ? 14.038 -8.450  5.489   1.00 33.52 ? 169 CYS A O    1 
ATOM   1323 C CB   . CYS A 1 169 ? 11.966 -8.223  7.813   1.00 30.10 ? 169 CYS A CB   1 
ATOM   1324 S SG   . CYS A 1 169 ? 12.993 -7.986  9.287   1.00 22.23 ? 169 CYS A SG   1 
ATOM   1325 N N    . LEU A 1 170 ? 14.758 -9.917  7.035   1.00 27.50 ? 170 LEU A N    1 
ATOM   1326 C CA   . LEU A 1 170 ? 16.168 -9.838  6.645   1.00 25.42 ? 170 LEU A CA   1 
ATOM   1327 C C    . LEU A 1 170 ? 16.587 -10.837 5.561   1.00 27.18 ? 170 LEU A C    1 
ATOM   1328 O O    . LEU A 1 170 ? 17.747 -10.845 5.142   1.00 24.27 ? 170 LEU A O    1 
ATOM   1329 C CB   . LEU A 1 170 ? 17.069 -10.023 7.868   1.00 24.92 ? 170 LEU A CB   1 
ATOM   1330 C CG   . LEU A 1 170 ? 17.552 -8.773  8.608   1.00 29.22 ? 170 LEU A CG   1 
ATOM   1331 C CD1  . LEU A 1 170 ? 16.385 -7.864  8.965   1.00 26.39 ? 170 LEU A CD1  1 
ATOM   1332 C CD2  . LEU A 1 170 ? 18.319 -9.194  9.853   1.00 25.70 ? 170 LEU A CD2  1 
ATOM   1333 N N    . ASP A 1 171 ? 15.654 -11.679 5.119   1.00 29.82 ? 171 ASP A N    1 
ATOM   1334 C CA   . ASP A 1 171 ? 15.938 -12.684 4.091   1.00 30.23 ? 171 ASP A CA   1 
ATOM   1335 C C    . ASP A 1 171 ? 16.437 -12.059 2.796   1.00 29.49 ? 171 ASP A C    1 
ATOM   1336 O O    . ASP A 1 171 ? 17.368 -12.568 2.170   1.00 30.95 ? 171 ASP A O    1 
ATOM   1337 C CB   . ASP A 1 171 ? 14.692 -13.525 3.797   1.00 31.47 ? 171 ASP A CB   1 
ATOM   1338 C CG   . ASP A 1 171 ? 14.366 -14.510 4.906   1.00 34.37 ? 171 ASP A CG   1 
ATOM   1339 O OD1  . ASP A 1 171 ? 15.242 -14.771 5.762   1.00 36.67 ? 171 ASP A OD1  1 
ATOM   1340 O OD2  . ASP A 1 171 ? 13.229 -15.034 4.910   1.00 30.92 ? 171 ASP A OD2  1 
ATOM   1341 N N    . ALA A 1 172 ? 15.827 -10.941 2.416   1.00 28.00 ? 172 ALA A N    1 
ATOM   1342 C CA   . ALA A 1 172 ? 16.192 -10.225 1.198   1.00 27.15 ? 172 ALA A CA   1 
ATOM   1343 C C    . ALA A 1 172 ? 17.515 -9.465  1.289   1.00 25.27 ? 172 ALA A C    1 
ATOM   1344 O O    . ALA A 1 172 ? 17.976 -8.899  0.298   1.00 29.11 ? 172 ALA A O    1 
ATOM   1345 C CB   . ALA A 1 172 ? 15.073 -9.267  0.816   1.00 30.36 ? 172 ALA A CB   1 
ATOM   1346 N N    . PHE A 1 173 ? 18.133 -9.461  2.469   1.00 25.07 ? 173 PHE A N    1 
ATOM   1347 C CA   . PHE A 1 173 ? 19.388 -8.742  2.672   1.00 20.75 ? 173 PHE A CA   1 
ATOM   1348 C C    . PHE A 1 173 ? 20.503 -9.646  3.186   1.00 25.58 ? 173 PHE A C    1 
ATOM   1349 O O    . PHE A 1 173 ? 20.754 -9.716  4.389   1.00 30.09 ? 173 PHE A O    1 
ATOM   1350 C CB   . PHE A 1 173 ? 19.161 -7.575  3.639   1.00 20.04 ? 173 PHE A CB   1 
ATOM   1351 C CG   . PHE A 1 173 ? 18.082 -6.626  3.198   1.00 21.17 ? 173 PHE A CG   1 
ATOM   1352 C CD1  . PHE A 1 173 ? 18.353 -5.626  2.270   1.00 22.04 ? 173 PHE A CD1  1 
ATOM   1353 C CD2  . PHE A 1 173 ? 16.783 -6.759  3.681   1.00 20.44 ? 173 PHE A CD2  1 
ATOM   1354 C CE1  . PHE A 1 173 ? 17.346 -4.768  1.829   1.00 20.70 ? 173 PHE A CE1  1 
ATOM   1355 C CE2  . PHE A 1 173 ? 15.767 -5.907  3.247   1.00 24.35 ? 173 PHE A CE2  1 
ATOM   1356 C CZ   . PHE A 1 173 ? 16.050 -4.911  2.317   1.00 22.90 ? 173 PHE A CZ   1 
ATOM   1357 N N    . PRO A 1 174 ? 21.226 -10.308 2.266   1.00 26.61 ? 174 PRO A N    1 
ATOM   1358 C CA   . PRO A 1 174 ? 22.326 -11.221 2.597   1.00 24.56 ? 174 PRO A CA   1 
ATOM   1359 C C    . PRO A 1 174 ? 23.421 -10.678 3.514   1.00 23.65 ? 174 PRO A C    1 
ATOM   1360 O O    . PRO A 1 174 ? 23.911 -11.401 4.380   1.00 27.88 ? 174 PRO A O    1 
ATOM   1361 C CB   . PRO A 1 174 ? 22.867 -11.624 1.221   1.00 23.89 ? 174 PRO A CB   1 
ATOM   1362 C CG   . PRO A 1 174 ? 22.428 -10.507 0.318   1.00 25.80 ? 174 PRO A CG   1 
ATOM   1363 C CD   . PRO A 1 174 ? 21.052 -10.214 0.808   1.00 25.20 ? 174 PRO A CD   1 
ATOM   1364 N N    . LEU A 1 175 ? 23.812 -9.421  3.320   1.00 24.36 ? 175 LEU A N    1 
ATOM   1365 C CA   . LEU A 1 175 ? 24.853 -8.810  4.147   1.00 21.66 ? 175 LEU A CA   1 
ATOM   1366 C C    . LEU A 1 175 ? 24.374 -8.521  5.573   1.00 22.29 ? 175 LEU A C    1 
ATOM   1367 O O    . LEU A 1 175 ? 25.099 -8.764  6.536   1.00 14.38 ? 175 LEU A O    1 
ATOM   1368 C CB   . LEU A 1 175 ? 25.387 -7.538  3.486   1.00 23.93 ? 175 LEU A CB   1 
ATOM   1369 C CG   . LEU A 1 175 ? 26.597 -7.654  2.549   1.00 25.32 ? 175 LEU A CG   1 
ATOM   1370 C CD1  . LEU A 1 175 ? 26.691 -9.025  1.906   1.00 24.32 ? 175 LEU A CD1  1 
ATOM   1371 C CD2  . LEU A 1 175 ? 26.524 -6.570  1.501   1.00 20.24 ? 175 LEU A CD2  1 
ATOM   1372 N N    . LEU A 1 176 ? 23.151 -8.015  5.706   1.00 19.43 ? 176 LEU A N    1 
ATOM   1373 C CA   . LEU A 1 176 ? 22.601 -7.726  7.025   1.00 20.80 ? 176 LEU A CA   1 
ATOM   1374 C C    . LEU A 1 176 ? 22.419 -9.024  7.810   1.00 26.52 ? 176 LEU A C    1 
ATOM   1375 O O    . LEU A 1 176 ? 22.737 -9.080  8.997   1.00 26.72 ? 176 LEU A O    1 
ATOM   1376 C CB   . LEU A 1 176 ? 21.270 -6.976  6.917   1.00 15.04 ? 176 LEU A CB   1 
ATOM   1377 C CG   . LEU A 1 176 ? 21.346 -5.504  6.497   1.00 15.49 ? 176 LEU A CG   1 
ATOM   1378 C CD1  . LEU A 1 176 ? 19.948 -4.931  6.360   1.00 16.94 ? 176 LEU A CD1  1 
ATOM   1379 C CD2  . LEU A 1 176 ? 22.152 -4.707  7.510   1.00 19.22 ? 176 LEU A CD2  1 
ATOM   1380 N N    . SER A 1 177 ? 21.942 -10.070 7.134   1.00 22.83 ? 177 SER A N    1 
ATOM   1381 C CA   . SER A 1 177 ? 21.735 -11.376 7.763   1.00 21.26 ? 177 SER A CA   1 
ATOM   1382 C C    . SER A 1 177 ? 23.046 -11.955 8.289   1.00 23.19 ? 177 SER A C    1 
ATOM   1383 O O    . SER A 1 177 ? 23.110 -12.438 9.423   1.00 21.54 ? 177 SER A O    1 
ATOM   1384 C CB   . SER A 1 177 ? 21.107 -12.356 6.773   1.00 23.24 ? 177 SER A CB   1 
ATOM   1385 O OG   . SER A 1 177 ? 19.812 -11.933 6.397   1.00 22.38 ? 177 SER A OG   1 
ATOM   1386 N N    . ALA A 1 178 ? 24.087 -11.909 7.462   1.00 10.68 ? 178 ALA A N    1 
ATOM   1387 C CA   . ALA A 1 178 ? 25.392 -12.423 7.865   1.00 15.92 ? 178 ALA A CA   1 
ATOM   1388 C C    . ALA A 1 178 ? 25.938 -11.572 9.010   1.00 22.27 ? 178 ALA A C    1 
ATOM   1389 O O    . ALA A 1 178 ? 26.549 -12.088 9.946   1.00 25.04 ? 178 ALA A O    1 
ATOM   1390 C CB   . ALA A 1 178 ? 26.355 -12.398 6.684   1.00 8.34  ? 178 ALA A CB   1 
ATOM   1391 N N    . TYR A 1 179 ? 25.713 -10.262 8.912   1.00 27.13 ? 179 TYR A N    1 
ATOM   1392 C CA   . TYR A 1 179 ? 26.153 -9.289  9.909   1.00 22.12 ? 179 TYR A CA   1 
ATOM   1393 C C    . TYR A 1 179 ? 25.547 -9.630  11.271  1.00 17.98 ? 179 TYR A C    1 
ATOM   1394 O O    . TYR A 1 179 ? 26.266 -9.713  12.269  1.00 21.41 ? 179 TYR A O    1 
ATOM   1395 C CB   . TYR A 1 179 ? 25.733 -7.889  9.447   1.00 21.29 ? 179 TYR A CB   1 
ATOM   1396 C CG   . TYR A 1 179 ? 25.950 -6.759  10.430  1.00 17.70 ? 179 TYR A CG   1 
ATOM   1397 C CD1  . TYR A 1 179 ? 27.218 -6.215  10.639  1.00 16.63 ? 179 TYR A CD1  1 
ATOM   1398 C CD2  . TYR A 1 179 ? 24.871 -6.191  11.106  1.00 19.36 ? 179 TYR A CD2  1 
ATOM   1399 C CE1  . TYR A 1 179 ? 27.401 -5.124  11.495  1.00 18.66 ? 179 TYR A CE1  1 
ATOM   1400 C CE2  . TYR A 1 179 ? 25.043 -5.108  11.961  1.00 17.79 ? 179 TYR A CE2  1 
ATOM   1401 C CZ   . TYR A 1 179 ? 26.306 -4.578  12.151  1.00 19.82 ? 179 TYR A CZ   1 
ATOM   1402 O OH   . TYR A 1 179 ? 26.461 -3.498  12.990  1.00 20.41 ? 179 TYR A OH   1 
ATOM   1403 N N    . VAL A 1 180 ? 24.236 -9.866  11.291  1.00 13.07 ? 180 VAL A N    1 
ATOM   1404 C CA   . VAL A 1 180 ? 23.515 -10.225 12.511  1.00 19.19 ? 180 VAL A CA   1 
ATOM   1405 C C    . VAL A 1 180 ? 24.049 -11.533 13.104  1.00 24.64 ? 180 VAL A C    1 
ATOM   1406 O O    . VAL A 1 180 ? 24.326 -11.605 14.299  1.00 27.93 ? 180 VAL A O    1 
ATOM   1407 C CB   . VAL A 1 180 ? 21.992 -10.363 12.249  1.00 18.03 ? 180 VAL A CB   1 
ATOM   1408 C CG1  . VAL A 1 180 ? 21.289 -10.990 13.449  1.00 19.19 ? 180 VAL A CG1  1 
ATOM   1409 C CG2  . VAL A 1 180 ? 21.395 -9.008  11.960  1.00 18.40 ? 180 VAL A CG2  1 
ATOM   1410 N N    . GLY A 1 181 ? 24.214 -12.554 12.263  1.00 26.02 ? 181 GLY A N    1 
ATOM   1411 C CA   . GLY A 1 181 ? 24.720 -13.831 12.737  1.00 17.35 ? 181 GLY A CA   1 
ATOM   1412 C C    . GLY A 1 181 ? 26.131 -13.720 13.288  1.00 22.26 ? 181 GLY A C    1 
ATOM   1413 O O    . GLY A 1 181 ? 26.453 -14.290 14.331  1.00 22.16 ? 181 GLY A O    1 
ATOM   1414 N N    . ARG A 1 182 ? 26.963 -12.951 12.596  1.00 17.36 ? 182 ARG A N    1 
ATOM   1415 C CA   . ARG A 1 182 ? 28.350 -12.743 12.981  1.00 19.45 ? 182 ARG A CA   1 
ATOM   1416 C C    . ARG A 1 182 ? 28.482 -12.033 14.334  1.00 24.92 ? 182 ARG A C    1 
ATOM   1417 O O    . ARG A 1 182 ? 29.239 -12.474 15.204  1.00 25.69 ? 182 ARG A O    1 
ATOM   1418 C CB   . ARG A 1 182 ? 29.061 -11.936 11.895  1.00 17.30 ? 182 ARG A CB   1 
ATOM   1419 C CG   . ARG A 1 182 ? 30.575 -11.862 12.029  1.00 20.82 ? 182 ARG A CG   1 
ATOM   1420 C CD   . ARG A 1 182 ? 31.154 -10.905 10.993  1.00 22.91 ? 182 ARG A CD   1 
ATOM   1421 N NE   . ARG A 1 182 ? 30.577 -11.137 9.675   1.00 30.38 ? 182 ARG A NE   1 
ATOM   1422 C CZ   . ARG A 1 182 ? 29.982 -10.204 8.938   1.00 32.33 ? 182 ARG A CZ   1 
ATOM   1423 N NH1  . ARG A 1 182 ? 29.886 -8.954  9.369   1.00 29.87 ? 182 ARG A NH1  1 
ATOM   1424 N NH2  . ARG A 1 182 ? 29.424 -10.540 7.786   1.00 33.52 ? 182 ARG A NH2  1 
ATOM   1425 N N    . LEU A 1 183 ? 27.754 -10.931 14.507  1.00 25.45 ? 183 LEU A N    1 
ATOM   1426 C CA   . LEU A 1 183 ? 27.813 -10.182 15.762  1.00 25.98 ? 183 LEU A CA   1 
ATOM   1427 C C    . LEU A 1 183 ? 27.200 -10.962 16.926  1.00 27.07 ? 183 LEU A C    1 
ATOM   1428 O O    . LEU A 1 183 ? 27.736 -10.949 18.032  1.00 26.87 ? 183 LEU A O    1 
ATOM   1429 C CB   . LEU A 1 183 ? 27.141 -8.813  15.621  1.00 22.10 ? 183 LEU A CB   1 
ATOM   1430 C CG   . LEU A 1 183 ? 27.844 -7.758  14.758  1.00 24.72 ? 183 LEU A CG   1 
ATOM   1431 C CD1  . LEU A 1 183 ? 27.252 -6.391  15.057  1.00 24.76 ? 183 LEU A CD1  1 
ATOM   1432 C CD2  . LEU A 1 183 ? 29.336 -7.732  15.045  1.00 25.15 ? 183 LEU A CD2  1 
ATOM   1433 N N    . SER A 1 184 ? 26.090 -11.650 16.661  1.00 26.24 ? 184 SER A N    1 
ATOM   1434 C CA   . SER A 1 184 ? 25.405 -12.458 17.666  1.00 24.33 ? 184 SER A CA   1 
ATOM   1435 C C    . SER A 1 184 ? 26.284 -13.607 18.155  1.00 29.02 ? 184 SER A C    1 
ATOM   1436 O O    . SER A 1 184 ? 25.998 -14.209 19.194  1.00 33.54 ? 184 SER A O    1 
ATOM   1437 C CB   . SER A 1 184 ? 24.118 -13.055 17.089  1.00 20.98 ? 184 SER A CB   1 
ATOM   1438 O OG   . SER A 1 184 ? 23.195 -12.052 16.720  1.00 28.40 ? 184 SER A OG   1 
ATOM   1439 N N    . ALA A 1 185 ? 27.334 -13.917 17.395  1.00 24.81 ? 185 ALA A N    1 
ATOM   1440 C CA   . ALA A 1 185 ? 28.244 -15.008 17.733  1.00 27.24 ? 185 ALA A CA   1 
ATOM   1441 C C    . ALA A 1 185 ? 29.406 -14.603 18.636  1.00 27.33 ? 185 ALA A C    1 
ATOM   1442 O O    . ALA A 1 185 ? 30.141 -15.462 19.126  1.00 31.32 ? 185 ALA A O    1 
ATOM   1443 C CB   . ALA A 1 185 ? 28.772 -15.663 16.461  1.00 26.67 ? 185 ALA A CB   1 
ATOM   1444 N N    . ARG A 1 186 ? 29.591 -13.302 18.841  1.00 26.43 ? 186 ARG A N    1 
ATOM   1445 C CA   . ARG A 1 186 ? 30.670 -12.824 19.702  1.00 21.21 ? 186 ARG A CA   1 
ATOM   1446 C C    . ARG A 1 186 ? 30.437 -13.421 21.092  1.00 24.23 ? 186 ARG A C    1 
ATOM   1447 O O    . ARG A 1 186 ? 29.338 -13.329 21.632  1.00 20.12 ? 186 ARG A O    1 
ATOM   1448 C CB   . ARG A 1 186 ? 30.678 -11.294 19.734  1.00 17.88 ? 186 ARG A CB   1 
ATOM   1449 C CG   . ARG A 1 186 ? 30.950 -10.678 18.362  1.00 22.26 ? 186 ARG A CG   1 
ATOM   1450 C CD   . ARG A 1 186 ? 30.751 -9.165  18.340  1.00 18.35 ? 186 ARG A CD   1 
ATOM   1451 N NE   . ARG A 1 186 ? 31.630 -8.475  19.278  1.00 13.60 ? 186 ARG A NE   1 
ATOM   1452 C CZ   . ARG A 1 186 ? 32.867 -8.070  19.000  1.00 16.80 ? 186 ARG A CZ   1 
ATOM   1453 N NH1  . ARG A 1 186 ? 33.390 -8.268  17.797  1.00 14.21 ? 186 ARG A NH1  1 
ATOM   1454 N NH2  . ARG A 1 186 ? 33.580 -7.452  19.929  1.00 12.32 ? 186 ARG A NH2  1 
ATOM   1455 N N    . PRO A 1 187 ? 31.467 -14.067 21.668  1.00 24.49 ? 187 PRO A N    1 
ATOM   1456 C CA   . PRO A 1 187 ? 31.462 -14.723 22.984  1.00 25.34 ? 187 PRO A CA   1 
ATOM   1457 C C    . PRO A 1 187 ? 30.621 -14.082 24.097  1.00 25.65 ? 187 PRO A C    1 
ATOM   1458 O O    . PRO A 1 187 ? 29.605 -14.650 24.519  1.00 21.08 ? 187 PRO A O    1 
ATOM   1459 C CB   . PRO A 1 187 ? 32.944 -14.761 23.339  1.00 26.35 ? 187 PRO A CB   1 
ATOM   1460 C CG   . PRO A 1 187 ? 33.573 -15.001 22.018  1.00 27.47 ? 187 PRO A CG   1 
ATOM   1461 C CD   . PRO A 1 187 ? 32.836 -14.028 21.121  1.00 23.82 ? 187 PRO A CD   1 
ATOM   1462 N N    . LYS A 1 188 ? 31.047 -12.910 24.567  1.00 24.65 ? 188 LYS A N    1 
ATOM   1463 C CA   . LYS A 1 188 ? 30.346 -12.198 25.636  1.00 23.53 ? 188 LYS A CA   1 
ATOM   1464 C C    . LYS A 1 188 ? 28.930 -11.764 25.267  1.00 22.47 ? 188 LYS A C    1 
ATOM   1465 O O    . LYS A 1 188 ? 28.028 -11.812 26.105  1.00 27.00 ? 188 LYS A O    1 
ATOM   1466 C CB   . LYS A 1 188 ? 31.165 -10.994 26.095  1.00 23.44 ? 188 LYS A CB   1 
ATOM   1467 C CG   . LYS A 1 188 ? 32.523 -11.372 26.653  1.00 25.87 ? 188 LYS A CG   1 
ATOM   1468 C CD   . LYS A 1 188 ? 33.392 -10.154 26.897  1.00 36.57 ? 188 LYS A CD   1 
ATOM   1469 C CE   . LYS A 1 188 ? 34.796 -10.565 27.302  1.00 42.81 ? 188 LYS A CE   1 
ATOM   1470 N NZ   . LYS A 1 188 ? 34.766 -11.441 28.509  1.00 55.19 ? 188 LYS A NZ   1 
ATOM   1471 N N    . LEU A 1 189 ? 28.733 -11.367 24.012  1.00 24.60 ? 189 LEU A N    1 
ATOM   1472 C CA   . LEU A 1 189 ? 27.420 -10.930 23.537  1.00 21.70 ? 189 LEU A CA   1 
ATOM   1473 C C    . LEU A 1 189 ? 26.445 -12.096 23.449  1.00 20.13 ? 189 LEU A C    1 
ATOM   1474 O O    . LEU A 1 189 ? 25.268 -11.956 23.786  1.00 25.43 ? 189 LEU A O    1 
ATOM   1475 C CB   . LEU A 1 189 ? 27.535 -10.271 22.160  1.00 23.48 ? 189 LEU A CB   1 
ATOM   1476 C CG   . LEU A 1 189 ? 26.811 -8.942  21.938  1.00 24.03 ? 189 LEU A CG   1 
ATOM   1477 C CD1  . LEU A 1 189 ? 26.780 -8.646  20.451  1.00 23.32 ? 189 LEU A CD1  1 
ATOM   1478 C CD2  . LEU A 1 189 ? 25.402 -8.982  22.493  1.00 22.64 ? 189 LEU A CD2  1 
ATOM   1479 N N    . LYS A 1 190 ? 26.941 -13.238 22.976  1.00 19.82 ? 190 LYS A N    1 
ATOM   1480 C CA   . LYS A 1 190 ? 26.128 -14.445 22.838  1.00 23.37 ? 190 LYS A CA   1 
ATOM   1481 C C    . LYS A 1 190 ? 25.623 -14.899 24.203  1.00 19.46 ? 190 LYS A C    1 
ATOM   1482 O O    . LYS A 1 190 ? 24.449 -15.241 24.355  1.00 20.67 ? 190 LYS A O    1 
ATOM   1483 C CB   . LYS A 1 190 ? 26.936 -15.569 22.187  1.00 22.74 ? 190 LYS A CB   1 
ATOM   1484 C CG   . LYS A 1 190 ? 26.124 -16.825 21.959  1.00 27.44 ? 190 LYS A CG   1 
ATOM   1485 C CD   . LYS A 1 190 ? 26.974 -17.943 21.419  1.00 35.89 ? 190 LYS A CD   1 
ATOM   1486 C CE   . LYS A 1 190 ? 26.130 -19.186 21.199  1.00 44.62 ? 190 LYS A CE   1 
ATOM   1487 N NZ   . LYS A 1 190 ? 26.952 -20.310 20.677  1.00 50.83 ? 190 LYS A NZ   1 
ATOM   1488 N N    . ALA A 1 191 ? 26.522 -14.886 25.187  1.00 18.54 ? 191 ALA A N    1 
ATOM   1489 C CA   . ALA A 1 191 ? 26.197 -15.275 26.558  1.00 21.86 ? 191 ALA A CA   1 
ATOM   1490 C C    . ALA A 1 191 ? 25.126 -14.342 27.125  1.00 23.54 ? 191 ALA A C    1 
ATOM   1491 O O    . ALA A 1 191 ? 24.137 -14.797 27.704  1.00 28.98 ? 191 ALA A O    1 
ATOM   1492 C CB   . ALA A 1 191 ? 27.451 -15.229 27.418  1.00 14.77 ? 191 ALA A CB   1 
ATOM   1493 N N    . PHE A 1 192 ? 25.310 -13.040 26.913  1.00 25.87 ? 192 PHE A N    1 
ATOM   1494 C CA   . PHE A 1 192 ? 24.362 -12.033 27.392  1.00 23.23 ? 192 PHE A CA   1 
ATOM   1495 C C    . PHE A 1 192 ? 22.983 -12.159 26.746  1.00 18.39 ? 192 PHE A C    1 
ATOM   1496 O O    . PHE A 1 192 ? 21.969 -12.084 27.434  1.00 20.40 ? 192 PHE A O    1 
ATOM   1497 C CB   . PHE A 1 192 ? 24.919 -10.616 27.172  1.00 24.89 ? 192 PHE A CB   1 
ATOM   1498 C CG   . PHE A 1 192 ? 23.961 -9.517  27.558  1.00 22.37 ? 192 PHE A CG   1 
ATOM   1499 C CD1  . PHE A 1 192 ? 23.748 -9.200  28.897  1.00 20.87 ? 192 PHE A CD1  1 
ATOM   1500 C CD2  . PHE A 1 192 ? 23.250 -8.820  26.584  1.00 20.65 ? 192 PHE A CD2  1 
ATOM   1501 C CE1  . PHE A 1 192 ? 22.840 -8.208  29.261  1.00 20.15 ? 192 PHE A CE1  1 
ATOM   1502 C CE2  . PHE A 1 192 ? 22.339 -7.826  26.937  1.00 21.20 ? 192 PHE A CE2  1 
ATOM   1503 C CZ   . PHE A 1 192 ? 22.133 -7.520  28.280  1.00 20.41 ? 192 PHE A CZ   1 
ATOM   1504 N N    . LEU A 1 193 ? 22.946 -12.350 25.430  1.00 20.75 ? 193 LEU A N    1 
ATOM   1505 C CA   . LEU A 1 193 ? 21.676 -12.472 24.714  1.00 20.80 ? 193 LEU A CA   1 
ATOM   1506 C C    . LEU A 1 193 ? 20.875 -13.703 25.121  1.00 19.55 ? 193 LEU A C    1 
ATOM   1507 O O    . LEU A 1 193 ? 19.658 -13.741 24.947  1.00 18.50 ? 193 LEU A O    1 
ATOM   1508 C CB   . LEU A 1 193 ? 21.903 -12.477 23.198  1.00 21.35 ? 193 LEU A CB   1 
ATOM   1509 C CG   . LEU A 1 193 ? 22.401 -11.172 22.576  1.00 22.49 ? 193 LEU A CG   1 
ATOM   1510 C CD1  . LEU A 1 193 ? 22.690 -11.381 21.100  1.00 24.89 ? 193 LEU A CD1  1 
ATOM   1511 C CD2  . LEU A 1 193 ? 21.369 -10.074 22.768  1.00 20.59 ? 193 LEU A CD2  1 
ATOM   1512 N N    . ALA A 1 194 ? 21.557 -14.699 25.676  1.00 21.46 ? 194 ALA A N    1 
ATOM   1513 C CA   . ALA A 1 194 ? 20.897 -15.928 26.099  1.00 24.95 ? 194 ALA A CA   1 
ATOM   1514 C C    . ALA A 1 194 ? 20.485 -15.922 27.572  1.00 25.86 ? 194 ALA A C    1 
ATOM   1515 O O    . ALA A 1 194 ? 19.689 -16.761 27.993  1.00 26.94 ? 194 ALA A O    1 
ATOM   1516 C CB   . ALA A 1 194 ? 21.795 -17.124 25.811  1.00 19.38 ? 194 ALA A CB   1 
ATOM   1517 N N    . SER A 1 195 ? 21.010 -14.967 28.339  1.00 27.60 ? 195 SER A N    1 
ATOM   1518 C CA   . SER A 1 195 ? 20.725 -14.857 29.776  1.00 24.45 ? 195 SER A CA   1 
ATOM   1519 C C    . SER A 1 195 ? 19.299 -14.406 30.112  1.00 26.28 ? 195 SER A C    1 
ATOM   1520 O O    . SER A 1 195 ? 18.633 -13.767 29.298  1.00 30.32 ? 195 SER A O    1 
ATOM   1521 C CB   . SER A 1 195 ? 21.724 -13.899 30.429  1.00 26.01 ? 195 SER A CB   1 
ATOM   1522 O OG   . SER A 1 195 ? 21.421 -12.548 30.115  1.00 25.65 ? 195 SER A OG   1 
ATOM   1523 N N    . PRO A 1 196 ? 18.820 -14.733 31.332  1.00 24.59 ? 196 PRO A N    1 
ATOM   1524 C CA   . PRO A 1 196 ? 17.472 -14.362 31.795  1.00 24.19 ? 196 PRO A CA   1 
ATOM   1525 C C    . PRO A 1 196 ? 17.343 -12.843 31.883  1.00 24.62 ? 196 PRO A C    1 
ATOM   1526 O O    . PRO A 1 196 ? 16.266 -12.277 31.687  1.00 26.10 ? 196 PRO A O    1 
ATOM   1527 C CB   . PRO A 1 196 ? 17.414 -14.980 33.196  1.00 24.24 ? 196 PRO A CB   1 
ATOM   1528 C CG   . PRO A 1 196 ? 18.372 -16.125 33.115  1.00 27.98 ? 196 PRO A CG   1 
ATOM   1529 C CD   . PRO A 1 196 ? 19.517 -15.528 32.353  1.00 24.65 ? 196 PRO A CD   1 
ATOM   1530 N N    . GLU A 1 197 ? 18.467 -12.206 32.196  1.00 19.70 ? 197 GLU A N    1 
ATOM   1531 C CA   . GLU A 1 197 ? 18.591 -10.759 32.328  1.00 23.50 ? 197 GLU A CA   1 
ATOM   1532 C C    . GLU A 1 197 ? 18.065 -10.048 31.080  1.00 24.13 ? 197 GLU A C    1 
ATOM   1533 O O    . GLU A 1 197 ? 17.408 -9.007  31.169  1.00 26.91 ? 197 GLU A O    1 
ATOM   1534 C CB   . GLU A 1 197 ? 20.067 -10.439 32.517  1.00 22.94 ? 197 GLU A CB   1 
ATOM   1535 C CG   . GLU A 1 197 ? 20.387 -9.061  33.008  1.00 31.92 ? 197 GLU A CG   1 
ATOM   1536 C CD   . GLU A 1 197 ? 21.879 -8.869  33.215  1.00 31.00 ? 197 GLU A CD   1 
ATOM   1537 O OE1  . GLU A 1 197 ? 22.582 -9.848  33.558  1.00 33.33 ? 197 GLU A OE1  1 
ATOM   1538 O OE2  . GLU A 1 197 ? 22.359 -7.736  33.025  1.00 37.43 ? 197 GLU A OE2  1 
ATOM   1539 N N    . TYR A 1 198 ? 18.368 -10.627 29.921  1.00 25.29 ? 198 TYR A N    1 
ATOM   1540 C CA   . TYR A 1 198 ? 17.945 -10.092 28.634  1.00 18.96 ? 198 TYR A CA   1 
ATOM   1541 C C    . TYR A 1 198 ? 16.641 -10.738 28.163  1.00 20.57 ? 198 TYR A C    1 
ATOM   1542 O O    . TYR A 1 198 ? 15.644 -10.053 27.929  1.00 22.66 ? 198 TYR A O    1 
ATOM   1543 C CB   . TYR A 1 198 ? 19.059 -10.318 27.595  1.00 22.12 ? 198 TYR A CB   1 
ATOM   1544 C CG   . TYR A 1 198 ? 18.697 -9.913  26.178  1.00 26.53 ? 198 TYR A CG   1 
ATOM   1545 C CD1  . TYR A 1 198 ? 18.924 -8.613  25.720  1.00 28.57 ? 198 TYR A CD1  1 
ATOM   1546 C CD2  . TYR A 1 198 ? 18.109 -10.826 25.300  1.00 25.80 ? 198 TYR A CD2  1 
ATOM   1547 C CE1  . TYR A 1 198 ? 18.567 -8.233  24.423  1.00 29.22 ? 198 TYR A CE1  1 
ATOM   1548 C CE2  . TYR A 1 198 ? 17.752 -10.459 24.010  1.00 28.53 ? 198 TYR A CE2  1 
ATOM   1549 C CZ   . TYR A 1 198 ? 17.981 -9.163  23.577  1.00 29.40 ? 198 TYR A CZ   1 
ATOM   1550 O OH   . TYR A 1 198 ? 17.608 -8.801  22.305  1.00 31.79 ? 198 TYR A OH   1 
ATOM   1551 N N    . VAL A 1 199 ? 16.660 -12.063 28.048  1.00 24.03 ? 199 VAL A N    1 
ATOM   1552 C CA   . VAL A 1 199 ? 15.518 -12.845 27.577  1.00 17.51 ? 199 VAL A CA   1 
ATOM   1553 C C    . VAL A 1 199 ? 14.191 -12.642 28.301  1.00 16.40 ? 199 VAL A C    1 
ATOM   1554 O O    . VAL A 1 199 ? 13.144 -12.566 27.661  1.00 20.26 ? 199 VAL A O    1 
ATOM   1555 C CB   . VAL A 1 199 ? 15.863 -14.360 27.559  1.00 18.17 ? 199 VAL A CB   1 
ATOM   1556 C CG1  . VAL A 1 199 ? 14.647 -15.186 27.192  1.00 13.57 ? 199 VAL A CG1  1 
ATOM   1557 C CG2  . VAL A 1 199 ? 16.992 -14.625 26.577  1.00 13.24 ? 199 VAL A CG2  1 
ATOM   1558 N N    . ASN A 1 200 ? 14.224 -12.534 29.626  1.00 20.36 ? 200 ASN A N    1 
ATOM   1559 C CA   . ASN A 1 200 ? 12.987 -12.388 30.396  1.00 24.71 ? 200 ASN A CA   1 
ATOM   1560 C C    . ASN A 1 200 ? 12.413 -10.980 30.533  1.00 24.30 ? 200 ASN A C    1 
ATOM   1561 O O    . ASN A 1 200 ? 11.457 -10.756 31.277  1.00 26.01 ? 200 ASN A O    1 
ATOM   1562 C CB   . ASN A 1 200 ? 13.130 -13.064 31.760  1.00 23.91 ? 200 ASN A CB   1 
ATOM   1563 C CG   . ASN A 1 200 ? 13.303 -14.563 31.640  1.00 24.69 ? 200 ASN A CG   1 
ATOM   1564 O OD1  . ASN A 1 200 ? 12.738 -15.191 30.744  1.00 27.46 ? 200 ASN A OD1  1 
ATOM   1565 N ND2  . ASN A 1 200 ? 14.106 -15.140 32.523  1.00 19.32 ? 200 ASN A ND2  1 
ATOM   1566 N N    . LEU A 1 201 ? 12.986 -10.043 29.790  1.00 25.32 ? 201 LEU A N    1 
ATOM   1567 C CA   . LEU A 1 201 ? 12.527 -8.663  29.793  1.00 21.92 ? 201 LEU A CA   1 
ATOM   1568 C C    . LEU A 1 201 ? 11.732 -8.437  28.512  1.00 19.52 ? 201 LEU A C    1 
ATOM   1569 O O    . LEU A 1 201 ? 12.146 -8.880  27.439  1.00 19.36 ? 201 LEU A O    1 
ATOM   1570 C CB   . LEU A 1 201 ? 13.734 -7.730  29.805  1.00 19.53 ? 201 LEU A CB   1 
ATOM   1571 C CG   . LEU A 1 201 ? 13.899 -6.754  30.964  1.00 23.03 ? 201 LEU A CG   1 
ATOM   1572 C CD1  . LEU A 1 201 ? 13.669 -7.450  32.294  1.00 12.43 ? 201 LEU A CD1  1 
ATOM   1573 C CD2  . LEU A 1 201 ? 15.289 -6.146  30.895  1.00 20.31 ? 201 LEU A CD2  1 
ATOM   1574 N N    . PRO A 1 202 ? 10.548 -7.811  28.609  1.00 20.25 ? 202 PRO A N    1 
ATOM   1575 C CA   . PRO A 1 202 ? 9.763  -7.568  27.393  1.00 20.74 ? 202 PRO A CA   1 
ATOM   1576 C C    . PRO A 1 202 ? 10.473 -6.499  26.554  1.00 21.47 ? 202 PRO A C    1 
ATOM   1577 O O    . PRO A 1 202 ? 11.210 -5.676  27.097  1.00 19.63 ? 202 PRO A O    1 
ATOM   1578 C CB   . PRO A 1 202 ? 8.428  -7.063  27.944  1.00 19.86 ? 202 PRO A CB   1 
ATOM   1579 C CG   . PRO A 1 202 ? 8.824  -6.373  29.207  1.00 18.81 ? 202 PRO A CG   1 
ATOM   1580 C CD   . PRO A 1 202 ? 9.831  -7.328  29.804  1.00 16.60 ? 202 PRO A CD   1 
ATOM   1581 N N    . ILE A 1 203 ? 10.291 -6.535  25.238  1.00 22.14 ? 203 ILE A N    1 
ATOM   1582 C CA   . ILE A 1 203 ? 10.942 -5.559  24.363  1.00 21.07 ? 203 ILE A CA   1 
ATOM   1583 C C    . ILE A 1 203 ? 10.426 -4.145  24.631  1.00 20.67 ? 203 ILE A C    1 
ATOM   1584 O O    . ILE A 1 203 ? 11.210 -3.218  24.854  1.00 20.99 ? 203 ILE A O    1 
ATOM   1585 C CB   . ILE A 1 203 ? 10.748 -5.911  22.858  1.00 19.42 ? 203 ILE A CB   1 
ATOM   1586 C CG1  . ILE A 1 203 ? 11.470 -7.222  22.533  1.00 21.91 ? 203 ILE A CG1  1 
ATOM   1587 C CG2  . ILE A 1 203 ? 11.290 -4.792  21.975  1.00 16.48 ? 203 ILE A CG2  1 
ATOM   1588 C CD1  . ILE A 1 203 ? 11.310 -7.677  21.095  1.00 23.11 ? 203 ILE A CD1  1 
ATOM   1589 N N    . ASN A 1 204 ? 9.104  -4.005  24.642  1.00 18.80 ? 204 ASN A N    1 
ATOM   1590 C CA   . ASN A 1 204 ? 8.464  -2.718  24.868  1.00 22.71 ? 204 ASN A CA   1 
ATOM   1591 C C    . ASN A 1 204 ? 7.588  -2.685  26.121  1.00 24.23 ? 204 ASN A C    1 
ATOM   1592 O O    . ASN A 1 204 ? 7.205  -3.725  26.660  1.00 21.79 ? 204 ASN A O    1 
ATOM   1593 C CB   . ASN A 1 204 ? 7.649  -2.329  23.628  1.00 24.47 ? 204 ASN A CB   1 
ATOM   1594 C CG   . ASN A 1 204 ? 8.483  -2.377  22.354  1.00 24.50 ? 204 ASN A CG   1 
ATOM   1595 O OD1  . ASN A 1 204 ? 9.494  -1.685  22.239  1.00 18.23 ? 204 ASN A OD1  1 
ATOM   1596 N ND2  . ASN A 1 204 ? 8.087  -3.225  21.414  1.00 21.47 ? 204 ASN A ND2  1 
ATOM   1597 N N    . GLY A 1 205 ? 7.276  -1.473  26.569  1.00 26.71 ? 205 GLY A N    1 
ATOM   1598 C CA   . GLY A 1 205 ? 6.467  -1.289  27.758  1.00 25.69 ? 205 GLY A CA   1 
ATOM   1599 C C    . GLY A 1 205 ? 4.988  -1.609  27.656  1.00 29.15 ? 205 GLY A C    1 
ATOM   1600 O O    . GLY A 1 205 ? 4.303  -1.633  28.676  1.00 34.75 ? 205 GLY A O    1 
ATOM   1601 N N    . ASN A 1 206 ? 4.477  -1.855  26.453  1.00 27.42 ? 206 ASN A N    1 
ATOM   1602 C CA   . ASN A 1 206 ? 3.057  -2.164  26.303  1.00 27.33 ? 206 ASN A CA   1 
ATOM   1603 C C    . ASN A 1 206 ? 2.778  -3.617  25.911  1.00 31.61 ? 206 ASN A C    1 
ATOM   1604 O O    . ASN A 1 206 ? 1.663  -3.958  25.508  1.00 32.48 ? 206 ASN A O    1 
ATOM   1605 C CB   . ASN A 1 206 ? 2.381  -1.197  25.319  1.00 27.41 ? 206 ASN A CB   1 
ATOM   1606 C CG   . ASN A 1 206 ? 2.868  -1.369  23.887  1.00 26.48 ? 206 ASN A CG   1 
ATOM   1607 O OD1  . ASN A 1 206 ? 3.888  -2.011  23.635  1.00 25.11 ? 206 ASN A OD1  1 
ATOM   1608 N ND2  . ASN A 1 206 ? 2.133  -0.798  22.943  1.00 22.41 ? 206 ASN A ND2  1 
ATOM   1609 N N    . GLY A 1 207 ? 3.797  -4.466  26.018  1.00 33.03 ? 207 GLY A N    1 
ATOM   1610 C CA   . GLY A 1 207 ? 3.631  -5.870  25.685  1.00 37.73 ? 207 GLY A CA   1 
ATOM   1611 C C    . GLY A 1 207 ? 3.508  -6.198  24.208  1.00 40.19 ? 207 GLY A C    1 
ATOM   1612 O O    . GLY A 1 207 ? 3.250  -7.348  23.847  1.00 44.39 ? 207 GLY A O    1 
ATOM   1613 N N    . LYS A 1 208 ? 3.653  -5.195  23.349  1.00 38.77 ? 208 LYS A N    1 
ATOM   1614 C CA   . LYS A 1 208 ? 3.575  -5.423  21.910  1.00 32.12 ? 208 LYS A CA   1 
ATOM   1615 C C    . LYS A 1 208 ? 4.988  -5.553  21.353  1.00 28.26 ? 208 LYS A C    1 
ATOM   1616 O O    . LYS A 1 208 ? 5.931  -5.001  21.911  1.00 30.78 ? 208 LYS A O    1 
ATOM   1617 C CB   . LYS A 1 208 ? 2.811  -4.289  21.225  1.00 31.16 ? 208 LYS A CB   1 
ATOM   1618 C CG   . LYS A 1 208 ? 1.361  -4.209  21.667  1.00 32.20 ? 208 LYS A CG   1 
ATOM   1619 C CD   . LYS A 1 208 ? 0.615  -3.101  20.964  1.00 32.83 ? 208 LYS A CD   1 
ATOM   1620 C CE   . LYS A 1 208 ? -0.821 -3.047  21.443  1.00 39.68 ? 208 LYS A CE   1 
ATOM   1621 N NZ   . LYS A 1 208 ? -1.594 -1.975  20.764  1.00 46.46 ? 208 LYS A NZ   1 
ATOM   1622 N N    . GLN A 1 209 ? 5.132  -6.327  20.283  1.00 28.94 ? 209 GLN A N    1 
ATOM   1623 C CA   . GLN A 1 209 ? 6.428  -6.558  19.650  1.00 28.11 ? 209 GLN A CA   1 
ATOM   1624 C C    . GLN A 1 209 ? 6.266  -7.178  18.260  1.00 30.09 ? 209 GLN A C    1 
ATOM   1625 O O    . GLN A 1 209 ? 7.299  -7.477  17.618  1.00 30.42 ? 209 GLN A O    1 
ATOM   1626 C CB   . GLN A 1 209 ? 7.263  -7.493  20.517  1.00 30.55 ? 209 GLN A CB   1 
ATOM   1627 C CG   . GLN A 1 209 ? 6.518  -8.755  20.919  1.00 32.09 ? 209 GLN A CG   1 
ATOM   1628 C CD   . GLN A 1 209 ? 7.415  -9.783  21.547  1.00 37.68 ? 209 GLN A CD   1 
ATOM   1629 O OE1  . GLN A 1 209 ? 8.145  -9.501  22.493  1.00 40.65 ? 209 GLN A OE1  1 
ATOM   1630 N NE2  . GLN A 1 209 ? 7.366  -11.004 21.011  1.00 36.70 ? 209 GLN A NE2  1 
ATOM   1631 O OXT  . GLN A 1 209 ? 5.111  -7.365  17.827  1.00 28.35 ? 209 GLN A OXT  1 
ATOM   1632 N N    . PRO B 1 2   ? 36.456 22.522  0.112   1.00 44.99 ? 2   PRO B N    1 
ATOM   1633 C CA   . PRO B 1 2   ? 35.928 23.163  1.346   1.00 38.33 ? 2   PRO B CA   1 
ATOM   1634 C C    . PRO B 1 2   ? 34.592 22.500  1.704   1.00 31.55 ? 2   PRO B C    1 
ATOM   1635 O O    . PRO B 1 2   ? 34.476 21.270  1.661   1.00 27.29 ? 2   PRO B O    1 
ATOM   1636 C CB   . PRO B 1 2   ? 35.742 24.637  1.013   1.00 39.93 ? 2   PRO B CB   1 
ATOM   1637 C CG   . PRO B 1 2   ? 35.408 24.539  -0.468  1.00 41.50 ? 2   PRO B CG   1 
ATOM   1638 C CD   . PRO B 1 2   ? 36.297 23.435  -1.037  1.00 46.22 ? 2   PRO B CD   1 
ATOM   1639 N N    . TYR B 1 3   ? 33.580 23.312  2.002   1.00 23.35 ? 3   TYR B N    1 
ATOM   1640 C CA   . TYR B 1 3   ? 32.265 22.800  2.366   1.00 21.38 ? 3   TYR B CA   1 
ATOM   1641 C C    . TYR B 1 3   ? 31.201 23.090  1.321   1.00 22.19 ? 3   TYR B C    1 
ATOM   1642 O O    . TYR B 1 3   ? 31.216 24.134  0.668   1.00 22.43 ? 3   TYR B O    1 
ATOM   1643 C CB   . TYR B 1 3   ? 31.815 23.414  3.689   1.00 21.29 ? 3   TYR B CB   1 
ATOM   1644 C CG   . TYR B 1 3   ? 32.793 23.230  4.822   1.00 20.74 ? 3   TYR B CG   1 
ATOM   1645 C CD1  . TYR B 1 3   ? 33.159 21.957  5.265   1.00 21.60 ? 3   TYR B CD1  1 
ATOM   1646 C CD2  . TYR B 1 3   ? 33.345 24.335  5.464   1.00 19.73 ? 3   TYR B CD2  1 
ATOM   1647 C CE1  . TYR B 1 3   ? 34.056 21.799  6.325   1.00 20.76 ? 3   TYR B CE1  1 
ATOM   1648 C CE2  . TYR B 1 3   ? 34.236 24.189  6.519   1.00 21.65 ? 3   TYR B CE2  1 
ATOM   1649 C CZ   . TYR B 1 3   ? 34.590 22.926  6.945   1.00 21.17 ? 3   TYR B CZ   1 
ATOM   1650 O OH   . TYR B 1 3   ? 35.492 22.800  7.974   1.00 24.95 ? 3   TYR B OH   1 
ATOM   1651 N N    . THR B 1 4   ? 30.243 22.177  1.221   1.00 19.47 ? 4   THR B N    1 
ATOM   1652 C CA   . THR B 1 4   ? 29.132 22.312  0.292   1.00 20.33 ? 4   THR B CA   1 
ATOM   1653 C C    . THR B 1 4   ? 27.886 21.755  0.964   1.00 21.18 ? 4   THR B C    1 
ATOM   1654 O O    . THR B 1 4   ? 27.889 20.616  1.428   1.00 27.50 ? 4   THR B O    1 
ATOM   1655 C CB   . THR B 1 4   ? 29.367 21.502  -1.009  1.00 17.61 ? 4   THR B CB   1 
ATOM   1656 O OG1  . THR B 1 4   ? 30.582 21.927  -1.632  1.00 19.50 ? 4   THR B OG1  1 
ATOM   1657 C CG2  . THR B 1 4   ? 28.206 21.693  -1.981  1.00 10.34 ? 4   THR B CG2  1 
ATOM   1658 N N    . VAL B 1 5   ? 26.843 22.569  1.075   1.00 16.83 ? 5   VAL B N    1 
ATOM   1659 C CA   . VAL B 1 5   ? 25.602 22.085  1.658   1.00 18.93 ? 5   VAL B CA   1 
ATOM   1660 C C    . VAL B 1 5   ? 24.546 22.032  0.554   1.00 22.66 ? 5   VAL B C    1 
ATOM   1661 O O    . VAL B 1 5   ? 24.322 23.009  -0.162  1.00 23.75 ? 5   VAL B O    1 
ATOM   1662 C CB   . VAL B 1 5   ? 25.117 22.916  2.909   1.00 19.36 ? 5   VAL B CB   1 
ATOM   1663 C CG1  . VAL B 1 5   ? 26.209 23.841  3.418   1.00 16.06 ? 5   VAL B CG1  1 
ATOM   1664 C CG2  . VAL B 1 5   ? 23.828 23.664  2.633   1.00 20.46 ? 5   VAL B CG2  1 
ATOM   1665 N N    . VAL B 1 6   ? 23.985 20.847  0.357   1.00 21.03 ? 6   VAL B N    1 
ATOM   1666 C CA   . VAL B 1 6   ? 22.953 20.631  -0.646  1.00 16.98 ? 6   VAL B CA   1 
ATOM   1667 C C    . VAL B 1 6   ? 21.639 20.575  0.123   1.00 20.71 ? 6   VAL B C    1 
ATOM   1668 O O    . VAL B 1 6   ? 21.448 19.706  0.982   1.00 20.99 ? 6   VAL B O    1 
ATOM   1669 C CB   . VAL B 1 6   ? 23.181 19.306  -1.404  1.00 19.05 ? 6   VAL B CB   1 
ATOM   1670 C CG1  . VAL B 1 6   ? 22.174 19.168  -2.528  1.00 15.74 ? 6   VAL B CG1  1 
ATOM   1671 C CG2  . VAL B 1 6   ? 24.608 19.241  -1.941  1.00 12.93 ? 6   VAL B CG2  1 
ATOM   1672 N N    . TYR B 1 7   ? 20.735 21.503  -0.175  1.00 18.95 ? 7   TYR B N    1 
ATOM   1673 C CA   . TYR B 1 7   ? 19.470 21.558  0.543   1.00 17.11 ? 7   TYR B CA   1 
ATOM   1674 C C    . TYR B 1 7   ? 18.410 22.353  -0.216  1.00 20.00 ? 7   TYR B C    1 
ATOM   1675 O O    . TYR B 1 7   ? 18.700 23.009  -1.215  1.00 28.30 ? 7   TYR B O    1 
ATOM   1676 C CB   . TYR B 1 7   ? 19.725 22.197  1.918   1.00 15.53 ? 7   TYR B CB   1 
ATOM   1677 C CG   . TYR B 1 7   ? 18.614 22.036  2.927   1.00 15.81 ? 7   TYR B CG   1 
ATOM   1678 C CD1  . TYR B 1 7   ? 18.124 20.773  3.254   1.00 20.70 ? 7   TYR B CD1  1 
ATOM   1679 C CD2  . TYR B 1 7   ? 18.064 23.143  3.573   1.00 17.41 ? 7   TYR B CD2  1 
ATOM   1680 C CE1  . TYR B 1 7   ? 17.114 20.610  4.195   1.00 15.62 ? 7   TYR B CE1  1 
ATOM   1681 C CE2  . TYR B 1 7   ? 17.053 22.993  4.520   1.00 13.96 ? 7   TYR B CE2  1 
ATOM   1682 C CZ   . TYR B 1 7   ? 16.583 21.719  4.826   1.00 19.69 ? 7   TYR B CZ   1 
ATOM   1683 O OH   . TYR B 1 7   ? 15.580 21.549  5.754   1.00 16.01 ? 7   TYR B OH   1 
ATOM   1684 N N    . PHE B 1 8   ? 17.173 22.278  0.265   1.00 21.14 ? 8   PHE B N    1 
ATOM   1685 C CA   . PHE B 1 8   ? 16.055 22.997  -0.330  1.00 23.27 ? 8   PHE B CA   1 
ATOM   1686 C C    . PHE B 1 8   ? 16.196 24.474  0.033   1.00 24.52 ? 8   PHE B C    1 
ATOM   1687 O O    . PHE B 1 8   ? 16.954 24.816  0.937   1.00 23.06 ? 8   PHE B O    1 
ATOM   1688 C CB   . PHE B 1 8   ? 14.742 22.431  0.206   1.00 20.81 ? 8   PHE B CB   1 
ATOM   1689 C CG   . PHE B 1 8   ? 14.568 20.966  -0.067  1.00 28.53 ? 8   PHE B CG   1 
ATOM   1690 C CD1  . PHE B 1 8   ? 14.313 20.511  -1.363  1.00 27.87 ? 8   PHE B CD1  1 
ATOM   1691 C CD2  . PHE B 1 8   ? 14.682 20.033  0.961   1.00 24.47 ? 8   PHE B CD2  1 
ATOM   1692 C CE1  . PHE B 1 8   ? 14.175 19.149  -1.630  1.00 26.60 ? 8   PHE B CE1  1 
ATOM   1693 C CE2  . PHE B 1 8   ? 14.546 18.664  0.705   1.00 28.36 ? 8   PHE B CE2  1 
ATOM   1694 C CZ   . PHE B 1 8   ? 14.293 18.222  -0.594  1.00 30.39 ? 8   PHE B CZ   1 
ATOM   1695 N N    . PRO B 1 9   ? 15.506 25.373  -0.688  1.00 26.31 ? 9   PRO B N    1 
ATOM   1696 C CA   . PRO B 1 9   ? 15.608 26.806  -0.384  1.00 25.99 ? 9   PRO B CA   1 
ATOM   1697 C C    . PRO B 1 9   ? 14.846 27.247  0.875   1.00 23.56 ? 9   PRO B C    1 
ATOM   1698 O O    . PRO B 1 9   ? 13.976 28.112  0.811   1.00 23.36 ? 9   PRO B O    1 
ATOM   1699 C CB   . PRO B 1 9   ? 15.055 27.456  -1.650  1.00 24.89 ? 9   PRO B CB   1 
ATOM   1700 C CG   . PRO B 1 9   ? 13.996 26.473  -2.082  1.00 23.72 ? 9   PRO B CG   1 
ATOM   1701 C CD   . PRO B 1 9   ? 14.698 25.148  -1.904  1.00 26.50 ? 9   PRO B CD   1 
ATOM   1702 N N    . VAL B 1 10  ? 15.171 26.631  2.009   1.00 25.41 ? 10  VAL B N    1 
ATOM   1703 C CA   . VAL B 1 10  ? 14.550 26.952  3.295   1.00 21.42 ? 10  VAL B CA   1 
ATOM   1704 C C    . VAL B 1 10  ? 15.627 26.876  4.372   1.00 21.85 ? 10  VAL B C    1 
ATOM   1705 O O    . VAL B 1 10  ? 16.718 26.351  4.129   1.00 24.62 ? 10  VAL B O    1 
ATOM   1706 C CB   . VAL B 1 10  ? 13.411 25.962  3.669   1.00 18.04 ? 10  VAL B CB   1 
ATOM   1707 C CG1  . VAL B 1 10  ? 12.331 25.954  2.601   1.00 24.91 ? 10  VAL B CG1  1 
ATOM   1708 C CG2  . VAL B 1 10  ? 13.962 24.564  3.887   1.00 22.55 ? 10  VAL B CG2  1 
ATOM   1709 N N    . ARG B 1 11  ? 15.338 27.424  5.548   1.00 19.09 ? 11  ARG B N    1 
ATOM   1710 C CA   . ARG B 1 11  ? 16.292 27.384  6.653   1.00 22.10 ? 11  ARG B CA   1 
ATOM   1711 C C    . ARG B 1 11  ? 16.294 25.967  7.214   1.00 20.11 ? 11  ARG B C    1 
ATOM   1712 O O    . ARG B 1 11  ? 17.339 25.313  7.264   1.00 17.99 ? 11  ARG B O    1 
ATOM   1713 C CB   . ARG B 1 11  ? 15.905 28.386  7.740   1.00 21.02 ? 11  ARG B CB   1 
ATOM   1714 C CG   . ARG B 1 11  ? 15.934 29.825  7.269   1.00 24.47 ? 11  ARG B CG   1 
ATOM   1715 C CD   . ARG B 1 11  ? 15.615 30.782  8.394   1.00 27.24 ? 11  ARG B CD   1 
ATOM   1716 N NE   . ARG B 1 11  ? 15.297 32.107  7.876   1.00 35.99 ? 11  ARG B NE   1 
ATOM   1717 C CZ   . ARG B 1 11  ? 14.600 33.022  8.539   1.00 35.08 ? 11  ARG B CZ   1 
ATOM   1718 N NH1  . ARG B 1 11  ? 14.150 32.762  9.762   1.00 34.23 ? 11  ARG B NH1  1 
ATOM   1719 N NH2  . ARG B 1 11  ? 14.322 34.185  7.961   1.00 33.00 ? 11  ARG B NH2  1 
ATOM   1720 N N    . GLY B 1 12  ? 15.107 25.510  7.614   1.00 17.29 ? 12  GLY B N    1 
ATOM   1721 C CA   . GLY B 1 12  ? 14.919 24.170  8.147   1.00 19.03 ? 12  GLY B CA   1 
ATOM   1722 C C    . GLY B 1 12  ? 16.043 23.580  8.979   1.00 21.68 ? 12  GLY B C    1 
ATOM   1723 O O    . GLY B 1 12  ? 16.525 24.201  9.930   1.00 19.53 ? 12  GLY B O    1 
ATOM   1724 N N    . ARG B 1 13  ? 16.494 22.393  8.587   1.00 18.60 ? 13  ARG B N    1 
ATOM   1725 C CA   . ARG B 1 13  ? 17.557 21.700  9.303   1.00 16.78 ? 13  ARG B CA   1 
ATOM   1726 C C    . ARG B 1 13  ? 18.984 22.143  8.997   1.00 17.85 ? 13  ARG B C    1 
ATOM   1727 O O    . ARG B 1 13  ? 19.941 21.511  9.453   1.00 14.77 ? 13  ARG B O    1 
ATOM   1728 C CB   . ARG B 1 13  ? 17.419 20.189  9.123   1.00 17.91 ? 13  ARG B CB   1 
ATOM   1729 C CG   . ARG B 1 13  ? 16.250 19.595  9.896   1.00 16.36 ? 13  ARG B CG   1 
ATOM   1730 C CD   . ARG B 1 13  ? 16.233 18.086  9.786   1.00 17.76 ? 13  ARG B CD   1 
ATOM   1731 N NE   . ARG B 1 13  ? 15.255 17.479  10.688  1.00 16.09 ? 13  ARG B NE   1 
ATOM   1732 C CZ   . ARG B 1 13  ? 15.511 17.133  11.947  1.00 14.76 ? 13  ARG B CZ   1 
ATOM   1733 N NH1  . ARG B 1 13  ? 16.715 17.344  12.474  1.00 9.54  ? 13  ARG B NH1  1 
ATOM   1734 N NH2  . ARG B 1 13  ? 14.558 16.583  12.686  1.00 12.19 ? 13  ARG B NH2  1 
ATOM   1735 N N    . CYS B 1 14  ? 19.137 23.223  8.234   1.00 13.59 ? 14  CYS B N    1 
ATOM   1736 C CA   . CYS B 1 14  ? 20.473 23.722  7.915   1.00 12.78 ? 14  CYS B CA   1 
ATOM   1737 C C    . CYS B 1 14  ? 20.777 25.056  8.583   1.00 14.39 ? 14  CYS B C    1 
ATOM   1738 O O    . CYS B 1 14  ? 21.923 25.518  8.566   1.00 17.05 ? 14  CYS B O    1 
ATOM   1739 C CB   . CYS B 1 14  ? 20.666 23.837  6.404   1.00 11.20 ? 14  CYS B CB   1 
ATOM   1740 S SG   . CYS B 1 14  ? 20.802 22.248  5.584   1.00 18.79 ? 14  CYS B SG   1 
ATOM   1741 N N    . ALA B 1 15  ? 19.754 25.658  9.187   1.00 12.33 ? 15  ALA B N    1 
ATOM   1742 C CA   . ALA B 1 15  ? 19.894 26.944  9.860   1.00 11.57 ? 15  ALA B CA   1 
ATOM   1743 C C    . ALA B 1 15  ? 21.024 26.948  10.892  1.00 15.07 ? 15  ALA B C    1 
ATOM   1744 O O    . ALA B 1 15  ? 21.909 27.802  10.851  1.00 19.37 ? 15  ALA B O    1 
ATOM   1745 C CB   . ALA B 1 15  ? 18.577 27.330  10.509  1.00 12.32 ? 15  ALA B CB   1 
ATOM   1746 N N    . ALA B 1 16  ? 21.022 25.956  11.777  1.00 18.57 ? 16  ALA B N    1 
ATOM   1747 C CA   . ALA B 1 16  ? 22.038 25.856  12.816  1.00 12.94 ? 16  ALA B CA   1 
ATOM   1748 C C    . ALA B 1 16  ? 23.447 25.658  12.272  1.00 14.92 ? 16  ALA B C    1 
ATOM   1749 O O    . ALA B 1 16  ? 24.385 26.332  12.714  1.00 20.76 ? 16  ALA B O    1 
ATOM   1750 C CB   . ALA B 1 16  ? 21.683 24.747  13.791  1.00 14.79 ? 16  ALA B CB   1 
ATOM   1751 N N    . LEU B 1 17  ? 23.600 24.755  11.305  1.00 14.18 ? 17  LEU B N    1 
ATOM   1752 C CA   . LEU B 1 17  ? 24.920 24.494  10.730  1.00 16.72 ? 17  LEU B CA   1 
ATOM   1753 C C    . LEU B 1 17  ? 25.433 25.696  9.934   1.00 12.67 ? 17  LEU B C    1 
ATOM   1754 O O    . LEU B 1 17  ? 26.639 25.927  9.860   1.00 16.54 ? 17  LEU B O    1 
ATOM   1755 C CB   . LEU B 1 17  ? 24.928 23.195  9.900   1.00 18.29 ? 17  LEU B CB   1 
ATOM   1756 C CG   . LEU B 1 17  ? 24.156 23.036  8.588   1.00 21.35 ? 17  LEU B CG   1 
ATOM   1757 C CD1  . LEU B 1 17  ? 25.082 23.325  7.424   1.00 16.63 ? 17  LEU B CD1  1 
ATOM   1758 C CD2  . LEU B 1 17  ? 23.615 21.612  8.473   1.00 20.25 ? 17  LEU B CD2  1 
ATOM   1759 N N    . ARG B 1 18  ? 24.515 26.476  9.367   1.00 12.74 ? 18  ARG B N    1 
ATOM   1760 C CA   . ARG B 1 18  ? 24.891 27.674  8.618   1.00 18.88 ? 18  ARG B CA   1 
ATOM   1761 C C    . ARG B 1 18  ? 25.375 28.751  9.588   1.00 16.51 ? 18  ARG B C    1 
ATOM   1762 O O    . ARG B 1 18  ? 26.380 29.416  9.331   1.00 13.17 ? 18  ARG B O    1 
ATOM   1763 C CB   . ARG B 1 18  ? 23.710 28.195  7.804   1.00 15.29 ? 18  ARG B CB   1 
ATOM   1764 C CG   . ARG B 1 18  ? 23.418 27.381  6.566   1.00 8.72  ? 18  ARG B CG   1 
ATOM   1765 C CD   . ARG B 1 18  ? 22.061 27.743  6.005   1.00 15.71 ? 18  ARG B CD   1 
ATOM   1766 N NE   . ARG B 1 18  ? 21.810 27.073  4.734   1.00 15.01 ? 18  ARG B NE   1 
ATOM   1767 C CZ   . ARG B 1 18  ? 20.604 26.797  4.254   1.00 12.98 ? 18  ARG B CZ   1 
ATOM   1768 N NH1  . ARG B 1 18  ? 19.517 27.128  4.940   1.00 13.28 ? 18  ARG B NH1  1 
ATOM   1769 N NH2  . ARG B 1 18  ? 20.486 26.195  3.078   1.00 20.09 ? 18  ARG B NH2  1 
ATOM   1770 N N    . MET B 1 19  ? 24.661 28.905  10.706  1.00 15.95 ? 19  MET B N    1 
ATOM   1771 C CA   . MET B 1 19  ? 25.034 29.882  11.728  1.00 15.28 ? 19  MET B CA   1 
ATOM   1772 C C    . MET B 1 19  ? 26.402 29.532  12.294  1.00 17.96 ? 19  MET B C    1 
ATOM   1773 O O    . MET B 1 19  ? 27.211 30.411  12.574  1.00 19.34 ? 19  MET B O    1 
ATOM   1774 C CB   . MET B 1 19  ? 24.021 29.901  12.870  1.00 18.95 ? 19  MET B CB   1 
ATOM   1775 C CG   . MET B 1 19  ? 22.626 30.337  12.477  1.00 24.87 ? 19  MET B CG   1 
ATOM   1776 S SD   . MET B 1 19  ? 21.554 30.545  13.921  1.00 34.59 ? 19  MET B SD   1 
ATOM   1777 C CE   . MET B 1 19  ? 21.340 28.900  14.412  1.00 33.63 ? 19  MET B CE   1 
ATOM   1778 N N    . LEU B 1 20  ? 26.648 28.236  12.459  1.00 18.78 ? 20  LEU B N    1 
ATOM   1779 C CA   . LEU B 1 20  ? 27.916 27.744  12.985  1.00 17.18 ? 20  LEU B CA   1 
ATOM   1780 C C    . LEU B 1 20  ? 29.064 28.113  12.046  1.00 20.02 ? 20  LEU B C    1 
ATOM   1781 O O    . LEU B 1 20  ? 30.083 28.655  12.485  1.00 16.87 ? 20  LEU B O    1 
ATOM   1782 C CB   . LEU B 1 20  ? 27.842 26.223  13.179  1.00 13.92 ? 20  LEU B CB   1 
ATOM   1783 C CG   . LEU B 1 20  ? 28.971 25.482  13.907  1.00 19.86 ? 20  LEU B CG   1 
ATOM   1784 C CD1  . LEU B 1 20  ? 28.451 24.135  14.389  1.00 18.43 ? 20  LEU B CD1  1 
ATOM   1785 C CD2  . LEU B 1 20  ? 30.198 25.303  13.017  1.00 13.99 ? 20  LEU B CD2  1 
ATOM   1786 N N    . LEU B 1 21  ? 28.897 27.801  10.760  1.00 19.50 ? 21  LEU B N    1 
ATOM   1787 C CA   . LEU B 1 21  ? 29.910 28.096  9.752   1.00 19.18 ? 21  LEU B CA   1 
ATOM   1788 C C    . LEU B 1 21  ? 30.167 29.596  9.656   1.00 17.53 ? 21  LEU B C    1 
ATOM   1789 O O    . LEU B 1 21  ? 31.316 30.031  9.662   1.00 15.83 ? 21  LEU B O    1 
ATOM   1790 C CB   . LEU B 1 21  ? 29.484 27.549  8.389   1.00 15.49 ? 21  LEU B CB   1 
ATOM   1791 C CG   . LEU B 1 21  ? 29.547 26.030  8.229   1.00 15.85 ? 21  LEU B CG   1 
ATOM   1792 C CD1  . LEU B 1 21  ? 28.894 25.612  6.926   1.00 13.39 ? 21  LEU B CD1  1 
ATOM   1793 C CD2  . LEU B 1 21  ? 30.993 25.564  8.281   1.00 12.67 ? 21  LEU B CD2  1 
ATOM   1794 N N    . ALA B 1 22  ? 29.092 30.378  9.604   1.00 15.69 ? 22  ALA B N    1 
ATOM   1795 C CA   . ALA B 1 22  ? 29.191 31.831  9.515   1.00 16.05 ? 22  ALA B CA   1 
ATOM   1796 C C    . ALA B 1 22  ? 29.941 32.414  10.711  1.00 19.44 ? 22  ALA B C    1 
ATOM   1797 O O    . ALA B 1 22  ? 30.927 33.135  10.548  1.00 23.53 ? 22  ALA B O    1 
ATOM   1798 C CB   . ALA B 1 22  ? 27.809 32.436  9.426   1.00 13.27 ? 22  ALA B CB   1 
ATOM   1799 N N    . ASP B 1 23  ? 29.500 32.051  11.912  1.00 19.70 ? 23  ASP B N    1 
ATOM   1800 C CA   . ASP B 1 23  ? 30.104 32.536  13.145  1.00 16.42 ? 23  ASP B CA   1 
ATOM   1801 C C    . ASP B 1 23  ? 31.563 32.119  13.318  1.00 20.57 ? 23  ASP B C    1 
ATOM   1802 O O    . ASP B 1 23  ? 32.342 32.832  13.950  1.00 27.27 ? 23  ASP B O    1 
ATOM   1803 C CB   . ASP B 1 23  ? 29.277 32.073  14.346  1.00 26.04 ? 23  ASP B CB   1 
ATOM   1804 C CG   . ASP B 1 23  ? 29.571 32.867  15.601  1.00 27.38 ? 23  ASP B CG   1 
ATOM   1805 O OD1  . ASP B 1 23  ? 29.380 34.102  15.590  1.00 28.68 ? 23  ASP B OD1  1 
ATOM   1806 O OD2  . ASP B 1 23  ? 29.966 32.245  16.603  1.00 29.14 ? 23  ASP B OD2  1 
ATOM   1807 N N    . GLN B 1 24  ? 31.932 30.967  12.767  1.00 22.55 ? 24  GLN B N    1 
ATOM   1808 C CA   . GLN B 1 24  ? 33.307 30.478  12.868  1.00 19.78 ? 24  GLN B CA   1 
ATOM   1809 C C    . GLN B 1 24  ? 34.195 31.012  11.754  1.00 23.29 ? 24  GLN B C    1 
ATOM   1810 O O    . GLN B 1 24  ? 35.357 30.622  11.644  1.00 26.51 ? 24  GLN B O    1 
ATOM   1811 C CB   . GLN B 1 24  ? 33.336 28.948  12.871  1.00 21.07 ? 24  GLN B CB   1 
ATOM   1812 C CG   . GLN B 1 24  ? 32.766 28.331  14.147  1.00 17.57 ? 24  GLN B CG   1 
ATOM   1813 C CD   . GLN B 1 24  ? 33.505 28.794  15.389  1.00 22.26 ? 24  GLN B CD   1 
ATOM   1814 O OE1  . GLN B 1 24  ? 34.736 28.741  15.443  1.00 23.87 ? 24  GLN B OE1  1 
ATOM   1815 N NE2  . GLN B 1 24  ? 32.764 29.221  16.399  1.00 22.26 ? 24  GLN B NE2  1 
ATOM   1816 N N    . GLY B 1 25  ? 33.635 31.896  10.930  1.00 23.55 ? 25  GLY B N    1 
ATOM   1817 C CA   . GLY B 1 25  ? 34.382 32.486  9.833   1.00 26.33 ? 25  GLY B CA   1 
ATOM   1818 C C    . GLY B 1 25  ? 34.715 31.517  8.716   1.00 25.96 ? 25  GLY B C    1 
ATOM   1819 O O    . GLY B 1 25  ? 35.752 31.648  8.071   1.00 32.53 ? 25  GLY B O    1 
ATOM   1820 N N    . GLN B 1 26  ? 33.841 30.542  8.488   1.00 27.12 ? 26  GLN B N    1 
ATOM   1821 C CA   . GLN B 1 26  ? 34.048 29.544  7.443   1.00 30.01 ? 26  GLN B CA   1 
ATOM   1822 C C    . GLN B 1 26  ? 33.286 29.887  6.169   1.00 29.99 ? 26  GLN B C    1 
ATOM   1823 O O    . GLN B 1 26  ? 32.208 30.479  6.217   1.00 31.54 ? 26  GLN B O    1 
ATOM   1824 C CB   . GLN B 1 26  ? 33.609 28.161  7.928   1.00 32.12 ? 26  GLN B CB   1 
ATOM   1825 C CG   . GLN B 1 26  ? 34.300 27.689  9.194   1.00 31.02 ? 26  GLN B CG   1 
ATOM   1826 C CD   . GLN B 1 26  ? 35.796 27.590  9.039   1.00 30.45 ? 26  GLN B CD   1 
ATOM   1827 O OE1  . GLN B 1 26  ? 36.293 27.116  8.021   1.00 33.98 ? 26  GLN B OE1  1 
ATOM   1828 N NE2  . GLN B 1 26  ? 36.525 28.013  10.064  1.00 34.96 ? 26  GLN B NE2  1 
ATOM   1829 N N    . SER B 1 27  ? 33.853 29.491  5.033   1.00 29.11 ? 27  SER B N    1 
ATOM   1830 C CA   . SER B 1 27  ? 33.250 29.730  3.726   1.00 28.11 ? 27  SER B CA   1 
ATOM   1831 C C    . SER B 1 27  ? 32.634 28.421  3.262   1.00 26.42 ? 27  SER B C    1 
ATOM   1832 O O    . SER B 1 27  ? 33.189 27.350  3.506   1.00 28.32 ? 27  SER B O    1 
ATOM   1833 C CB   . SER B 1 27  ? 34.319 30.144  2.709   1.00 29.93 ? 27  SER B CB   1 
ATOM   1834 O OG   . SER B 1 27  ? 35.229 31.082  3.255   1.00 40.28 ? 27  SER B OG   1 
ATOM   1835 N N    . TRP B 1 28  ? 31.494 28.501  2.591   1.00 22.19 ? 28  TRP B N    1 
ATOM   1836 C CA   . TRP B 1 28  ? 30.849 27.300  2.083   1.00 24.92 ? 28  TRP B CA   1 
ATOM   1837 C C    . TRP B 1 28  ? 30.034 27.599  0.834   1.00 25.73 ? 28  TRP B C    1 
ATOM   1838 O O    . TRP B 1 28  ? 29.657 28.740  0.582   1.00 25.19 ? 28  TRP B O    1 
ATOM   1839 C CB   . TRP B 1 28  ? 29.971 26.643  3.156   1.00 22.29 ? 28  TRP B CB   1 
ATOM   1840 C CG   . TRP B 1 28  ? 28.704 27.382  3.489   1.00 15.52 ? 28  TRP B CG   1 
ATOM   1841 C CD1  . TRP B 1 28  ? 27.455 27.126  3.001   1.00 13.84 ? 28  TRP B CD1  1 
ATOM   1842 C CD2  . TRP B 1 28  ? 28.560 28.458  4.431   1.00 10.54 ? 28  TRP B CD2  1 
ATOM   1843 N NE1  . TRP B 1 28  ? 26.539 27.967  3.587   1.00 15.10 ? 28  TRP B NE1  1 
ATOM   1844 C CE2  . TRP B 1 28  ? 27.186 28.790  4.467   1.00 12.21 ? 28  TRP B CE2  1 
ATOM   1845 C CE3  . TRP B 1 28  ? 29.449 29.163  5.250   1.00 14.96 ? 28  TRP B CE3  1 
ATOM   1846 C CZ2  . TRP B 1 28  ? 26.685 29.803  5.294   1.00 14.12 ? 28  TRP B CZ2  1 
ATOM   1847 C CZ3  . TRP B 1 28  ? 28.949 30.168  6.071   1.00 12.06 ? 28  TRP B CZ3  1 
ATOM   1848 C CH2  . TRP B 1 28  ? 27.577 30.476  6.086   1.00 11.62 ? 28  TRP B CH2  1 
ATOM   1849 N N    . LYS B 1 29  ? 29.774 26.556  0.057   1.00 29.57 ? 29  LYS B N    1 
ATOM   1850 C CA   . LYS B 1 29  ? 29.012 26.663  -1.175  1.00 25.01 ? 29  LYS B CA   1 
ATOM   1851 C C    . LYS B 1 29  ? 27.614 26.114  -0.941  1.00 26.43 ? 29  LYS B C    1 
ATOM   1852 O O    . LYS B 1 29  ? 27.443 25.087  -0.286  1.00 27.83 ? 29  LYS B O    1 
ATOM   1853 C CB   . LYS B 1 29  ? 29.717 25.869  -2.280  1.00 29.33 ? 29  LYS B CB   1 
ATOM   1854 C CG   . LYS B 1 29  ? 28.887 25.607  -3.523  1.00 38.61 ? 29  LYS B CG   1 
ATOM   1855 C CD   . LYS B 1 29  ? 28.694 26.854  -4.373  1.00 50.41 ? 29  LYS B CD   1 
ATOM   1856 C CE   . LYS B 1 29  ? 27.795 26.555  -5.569  1.00 57.90 ? 29  LYS B CE   1 
ATOM   1857 N NZ   . LYS B 1 29  ? 28.278 25.361  -6.331  1.00 62.68 ? 29  LYS B NZ   1 
ATOM   1858 N N    . GLU B 1 30  ? 26.614 26.825  -1.446  1.00 26.92 ? 30  GLU B N    1 
ATOM   1859 C CA   . GLU B 1 30  ? 25.232 26.397  -1.314  1.00 27.01 ? 30  GLU B CA   1 
ATOM   1860 C C    . GLU B 1 30  ? 24.750 25.834  -2.643  1.00 27.72 ? 30  GLU B C    1 
ATOM   1861 O O    . GLU B 1 30  ? 24.811 26.508  -3.671  1.00 34.02 ? 30  GLU B O    1 
ATOM   1862 C CB   . GLU B 1 30  ? 24.338 27.570  -0.905  1.00 25.94 ? 30  GLU B CB   1 
ATOM   1863 C CG   . GLU B 1 30  ? 24.514 28.050  0.532   1.00 29.24 ? 30  GLU B CG   1 
ATOM   1864 C CD   . GLU B 1 30  ? 23.715 27.251  1.555   1.00 30.58 ? 30  GLU B CD   1 
ATOM   1865 O OE1  . GLU B 1 30  ? 22.968 26.320  1.174   1.00 25.23 ? 30  GLU B OE1  1 
ATOM   1866 O OE2  . GLU B 1 30  ? 23.838 27.564  2.757   1.00 29.25 ? 30  GLU B OE2  1 
ATOM   1867 N N    . GLU B 1 31  ? 24.337 24.574  -2.623  1.00 28.52 ? 31  GLU B N    1 
ATOM   1868 C CA   . GLU B 1 31  ? 23.813 23.905  -3.803  1.00 25.72 ? 31  GLU B CA   1 
ATOM   1869 C C    . GLU B 1 31  ? 22.324 23.805  -3.558  1.00 25.94 ? 31  GLU B C    1 
ATOM   1870 O O    . GLU B 1 31  ? 21.868 22.946  -2.809  1.00 29.29 ? 31  GLU B O    1 
ATOM   1871 C CB   . GLU B 1 31  ? 24.419 22.511  -3.949  1.00 33.03 ? 31  GLU B CB   1 
ATOM   1872 C CG   . GLU B 1 31  ? 25.774 22.493  -4.623  1.00 50.55 ? 31  GLU B CG   1 
ATOM   1873 C CD   . GLU B 1 31  ? 25.678 22.761  -6.113  1.00 60.19 ? 31  GLU B CD   1 
ATOM   1874 O OE1  . GLU B 1 31  ? 25.642 23.946  -6.515  1.00 63.47 ? 31  GLU B OE1  1 
ATOM   1875 O OE2  . GLU B 1 31  ? 25.625 21.779  -6.883  1.00 67.54 ? 31  GLU B OE2  1 
ATOM   1876 N N    . VAL B 1 32  ? 21.572 24.725  -4.146  1.00 24.92 ? 32  VAL B N    1 
ATOM   1877 C CA   . VAL B 1 32  ? 20.132 24.751  -3.963  1.00 20.60 ? 32  VAL B CA   1 
ATOM   1878 C C    . VAL B 1 32  ? 19.401 23.743  -4.828  1.00 22.29 ? 32  VAL B C    1 
ATOM   1879 O O    . VAL B 1 32  ? 19.620 23.663  -6.033  1.00 29.25 ? 32  VAL B O    1 
ATOM   1880 C CB   . VAL B 1 32  ? 19.562 26.158  -4.219  1.00 19.92 ? 32  VAL B CB   1 
ATOM   1881 C CG1  . VAL B 1 32  ? 18.067 26.176  -3.945  1.00 12.11 ? 32  VAL B CG1  1 
ATOM   1882 C CG2  . VAL B 1 32  ? 20.279 27.174  -3.342  1.00 14.39 ? 32  VAL B CG2  1 
ATOM   1883 N N    . VAL B 1 33  ? 18.544 22.962  -4.185  1.00 24.44 ? 33  VAL B N    1 
ATOM   1884 C CA   . VAL B 1 33  ? 17.747 21.954  -4.859  1.00 21.44 ? 33  VAL B CA   1 
ATOM   1885 C C    . VAL B 1 33  ? 16.300 22.392  -4.727  1.00 28.87 ? 33  VAL B C    1 
ATOM   1886 O O    . VAL B 1 33  ? 15.805 22.594  -3.617  1.00 27.88 ? 33  VAL B O    1 
ATOM   1887 C CB   . VAL B 1 33  ? 17.915 20.563  -4.207  1.00 17.46 ? 33  VAL B CB   1 
ATOM   1888 C CG1  . VAL B 1 33  ? 16.964 19.562  -4.845  1.00 16.26 ? 33  VAL B CG1  1 
ATOM   1889 C CG2  . VAL B 1 33  ? 19.350 20.087  -4.348  1.00 17.19 ? 33  VAL B CG2  1 
ATOM   1890 N N    . THR B 1 34  ? 15.637 22.574  -5.864  1.00 32.86 ? 34  THR B N    1 
ATOM   1891 C CA   . THR B 1 34  ? 14.240 22.988  -5.875  1.00 37.55 ? 34  THR B CA   1 
ATOM   1892 C C    . THR B 1 34  ? 13.335 21.766  -5.754  1.00 40.42 ? 34  THR B C    1 
ATOM   1893 O O    . THR B 1 34  ? 13.777 20.635  -5.960  1.00 43.21 ? 34  THR B O    1 
ATOM   1894 C CB   . THR B 1 34  ? 13.892 23.739  -7.174  1.00 39.12 ? 34  THR B CB   1 
ATOM   1895 O OG1  . THR B 1 34  ? 14.013 22.845  -8.287  1.00 42.63 ? 34  THR B OG1  1 
ATOM   1896 C CG2  . THR B 1 34  ? 14.838 24.914  -7.378  1.00 36.51 ? 34  THR B CG2  1 
ATOM   1897 N N    . VAL B 1 35  ? 12.069 22.001  -5.418  1.00 47.06 ? 35  VAL B N    1 
ATOM   1898 C CA   . VAL B 1 35  ? 11.088 20.925  -5.277  1.00 51.36 ? 35  VAL B CA   1 
ATOM   1899 C C    . VAL B 1 35  ? 10.899 20.185  -6.607  1.00 52.28 ? 35  VAL B C    1 
ATOM   1900 O O    . VAL B 1 35  ? 10.598 18.991  -6.625  1.00 51.27 ? 35  VAL B O    1 
ATOM   1901 C CB   . VAL B 1 35  ? 9.719  21.477  -4.786  1.00 56.08 ? 35  VAL B CB   1 
ATOM   1902 C CG1  . VAL B 1 35  ? 9.053  22.331  -5.876  1.00 61.15 ? 35  VAL B CG1  1 
ATOM   1903 C CG2  . VAL B 1 35  ? 8.809  20.338  -4.349  1.00 56.80 ? 35  VAL B CG2  1 
ATOM   1904 N N    . GLU B 1 36  ? 11.097 20.901  -7.712  1.00 53.52 ? 36  GLU B N    1 
ATOM   1905 C CA   . GLU B 1 36  ? 10.962 20.330  -9.049  1.00 54.84 ? 36  GLU B CA   1 
ATOM   1906 C C    . GLU B 1 36  ? 12.079 19.323  -9.294  1.00 50.67 ? 36  GLU B C    1 
ATOM   1907 O O    . GLU B 1 36  ? 11.821 18.167  -9.636  1.00 53.55 ? 36  GLU B O    1 
ATOM   1908 C CB   . GLU B 1 36  ? 11.057 21.429  -10.105 1.00 63.16 ? 36  GLU B CB   1 
ATOM   1909 C CG   . GLU B 1 36  ? 10.280 22.693  -9.779  1.00 69.82 ? 36  GLU B CG   1 
ATOM   1910 C CD   . GLU B 1 36  ? 11.060 23.952  -10.125 1.00 76.70 ? 36  GLU B CD   1 
ATOM   1911 O OE1  . GLU B 1 36  ? 11.947 23.895  -11.012 1.00 77.80 ? 36  GLU B OE1  1 
ATOM   1912 O OE2  . GLU B 1 36  ? 10.796 24.996  -9.492  1.00 77.93 ? 36  GLU B OE2  1 
ATOM   1913 N N    . THR B 1 37  ? 13.319 19.778  -9.119  1.00 45.47 ? 37  THR B N    1 
ATOM   1914 C CA   . THR B 1 37  ? 14.498 18.940  -9.312  1.00 44.03 ? 37  THR B CA   1 
ATOM   1915 C C    . THR B 1 37  ? 14.421 17.681  -8.440  1.00 44.83 ? 37  THR B C    1 
ATOM   1916 O O    . THR B 1 37  ? 14.750 16.582  -8.892  1.00 45.66 ? 37  THR B O    1 
ATOM   1917 C CB   . THR B 1 37  ? 15.797 19.711  -8.961  1.00 45.59 ? 37  THR B CB   1 
ATOM   1918 O OG1  . THR B 1 37  ? 15.770 21.007  -9.571  1.00 44.60 ? 37  THR B OG1  1 
ATOM   1919 C CG2  . THR B 1 37  ? 17.022 18.958  -9.462  1.00 41.13 ? 37  THR B CG2  1 
ATOM   1920 N N    . TRP B 1 38  ? 13.957 17.852  -7.202  1.00 42.46 ? 38  TRP B N    1 
ATOM   1921 C CA   . TRP B 1 38  ? 13.827 16.750  -6.247  1.00 37.33 ? 38  TRP B CA   1 
ATOM   1922 C C    . TRP B 1 38  ? 12.808 15.704  -6.702  1.00 39.59 ? 38  TRP B C    1 
ATOM   1923 O O    . TRP B 1 38  ? 13.067 14.502  -6.616  1.00 39.62 ? 38  TRP B O    1 
ATOM   1924 C CB   . TRP B 1 38  ? 13.447 17.297  -4.864  1.00 33.40 ? 38  TRP B CB   1 
ATOM   1925 C CG   . TRP B 1 38  ? 13.438 16.274  -3.751  1.00 25.44 ? 38  TRP B CG   1 
ATOM   1926 C CD1  . TRP B 1 38  ? 12.344 15.804  -3.081  1.00 26.44 ? 38  TRP B CD1  1 
ATOM   1927 C CD2  . TRP B 1 38  ? 14.578 15.630  -3.163  1.00 19.69 ? 38  TRP B CD2  1 
ATOM   1928 N NE1  . TRP B 1 38  ? 12.732 14.912  -2.109  1.00 26.62 ? 38  TRP B NE1  1 
ATOM   1929 C CE2  . TRP B 1 38  ? 14.092 14.785  -2.135  1.00 23.60 ? 38  TRP B CE2  1 
ATOM   1930 C CE3  . TRP B 1 38  ? 15.958 15.685  -3.397  1.00 22.42 ? 38  TRP B CE3  1 
ATOM   1931 C CZ2  . TRP B 1 38  ? 14.945 14.002  -1.344  1.00 18.02 ? 38  TRP B CZ2  1 
ATOM   1932 C CZ3  . TRP B 1 38  ? 16.804 14.907  -2.610  1.00 18.65 ? 38  TRP B CZ3  1 
ATOM   1933 C CH2  . TRP B 1 38  ? 16.291 14.076  -1.595  1.00 16.32 ? 38  TRP B CH2  1 
ATOM   1934 N N    . GLN B 1 39  ? 11.661 16.164  -7.198  1.00 41.02 ? 39  GLN B N    1 
ATOM   1935 C CA   . GLN B 1 39  ? 10.611 15.261  -7.665  1.00 43.87 ? 39  GLN B CA   1 
ATOM   1936 C C    . GLN B 1 39  ? 10.977 14.507  -8.939  1.00 45.67 ? 39  GLN B C    1 
ATOM   1937 O O    . GLN B 1 39  ? 10.292 13.557  -9.322  1.00 46.37 ? 39  GLN B O    1 
ATOM   1938 C CB   . GLN B 1 39  ? 9.294  16.015  -7.833  1.00 43.05 ? 39  GLN B CB   1 
ATOM   1939 C CG   . GLN B 1 39  ? 8.703  16.459  -6.503  1.00 53.12 ? 39  GLN B CG   1 
ATOM   1940 C CD   . GLN B 1 39  ? 7.534  17.409  -6.652  1.00 59.71 ? 39  GLN B CD   1 
ATOM   1941 O OE1  . GLN B 1 39  ? 7.303  17.975  -7.724  1.00 67.77 ? 39  GLN B OE1  1 
ATOM   1942 N NE2  . GLN B 1 39  ? 6.802  17.611  -5.565  1.00 58.04 ? 39  GLN B NE2  1 
ATOM   1943 N N    . GLU B 1 40  ? 12.064 14.924  -9.586  1.00 49.44 ? 40  GLU B N    1 
ATOM   1944 C CA   . GLU B 1 40  ? 12.539 14.261  -10.795 1.00 52.01 ? 40  GLU B CA   1 
ATOM   1945 C C    . GLU B 1 40  ? 13.010 12.849  -10.408 1.00 53.92 ? 40  GLU B C    1 
ATOM   1946 O O    . GLU B 1 40  ? 12.970 11.927  -11.224 1.00 56.56 ? 40  GLU B O    1 
ATOM   1947 C CB   . GLU B 1 40  ? 13.664 15.079  -11.435 1.00 52.61 ? 40  GLU B CB   1 
ATOM   1948 C CG   . GLU B 1 40  ? 14.194 14.525  -12.744 1.00 60.77 ? 40  GLU B CG   1 
ATOM   1949 C CD   . GLU B 1 40  ? 15.502 13.778  -12.572 1.00 65.52 ? 40  GLU B CD   1 
ATOM   1950 O OE1  . GLU B 1 40  ? 16.568 14.429  -12.577 1.00 70.14 ? 40  GLU B OE1  1 
ATOM   1951 O OE2  . GLU B 1 40  ? 15.471 12.538  -12.443 1.00 68.28 ? 40  GLU B OE2  1 
ATOM   1952 N N    . GLY B 1 41  ? 13.457 12.695  -9.160  1.00 53.26 ? 41  GLY B N    1 
ATOM   1953 C CA   . GLY B 1 41  ? 13.873 11.392  -8.661  1.00 47.13 ? 41  GLY B CA   1 
ATOM   1954 C C    . GLY B 1 41  ? 15.333 10.985  -8.568  1.00 45.40 ? 41  GLY B C    1 
ATOM   1955 O O    . GLY B 1 41  ? 15.712 10.304  -7.613  1.00 45.80 ? 41  GLY B O    1 
ATOM   1956 N N    . SER B 1 42  ? 16.152 11.382  -9.537  1.00 43.84 ? 42  SER B N    1 
ATOM   1957 C CA   . SER B 1 42  ? 17.565 11.000  -9.556  1.00 45.07 ? 42  SER B CA   1 
ATOM   1958 C C    . SER B 1 42  ? 18.397 11.318  -8.310  1.00 42.77 ? 42  SER B C    1 
ATOM   1959 O O    . SER B 1 42  ? 19.101 10.443  -7.802  1.00 44.63 ? 42  SER B O    1 
ATOM   1960 C CB   . SER B 1 42  ? 18.254 11.561  -10.802 1.00 45.52 ? 42  SER B CB   1 
ATOM   1961 O OG   . SER B 1 42  ? 18.192 12.975  -10.822 1.00 56.12 ? 42  SER B OG   1 
ATOM   1962 N N    . LEU B 1 43  ? 18.326 12.559  -7.825  1.00 41.45 ? 43  LEU B N    1 
ATOM   1963 C CA   . LEU B 1 43  ? 19.088 12.968  -6.640  1.00 35.47 ? 43  LEU B CA   1 
ATOM   1964 C C    . LEU B 1 43  ? 18.646 12.201  -5.389  1.00 33.32 ? 43  LEU B C    1 
ATOM   1965 O O    . LEU B 1 43  ? 19.483 11.691  -4.642  1.00 28.91 ? 43  LEU B O    1 
ATOM   1966 C CB   . LEU B 1 43  ? 18.941 14.473  -6.389  1.00 34.88 ? 43  LEU B CB   1 
ATOM   1967 C CG   . LEU B 1 43  ? 20.116 15.266  -5.791  1.00 33.78 ? 43  LEU B CG   1 
ATOM   1968 C CD1  . LEU B 1 43  ? 19.560 16.342  -4.879  1.00 30.86 ? 43  LEU B CD1  1 
ATOM   1969 C CD2  . LEU B 1 43  ? 21.086 14.386  -5.015  1.00 31.60 ? 43  LEU B CD2  1 
ATOM   1970 N N    . LYS B 1 44  ? 17.333 12.136  -5.166  1.00 27.83 ? 44  LYS B N    1 
ATOM   1971 C CA   . LYS B 1 44  ? 16.767 11.434  -4.014  1.00 28.21 ? 44  LYS B CA   1 
ATOM   1972 C C    . LYS B 1 44  ? 17.281 10.002  -3.946  1.00 31.60 ? 44  LYS B C    1 
ATOM   1973 O O    . LYS B 1 44  ? 17.657 9.518   -2.880  1.00 32.06 ? 44  LYS B O    1 
ATOM   1974 C CB   . LYS B 1 44  ? 15.241 11.409  -4.106  1.00 26.24 ? 44  LYS B CB   1 
ATOM   1975 C CG   . LYS B 1 44  ? 14.554 10.883  -2.859  1.00 22.27 ? 44  LYS B CG   1 
ATOM   1976 C CD   . LYS B 1 44  ? 13.084 10.584  -3.116  1.00 23.13 ? 44  LYS B CD   1 
ATOM   1977 C CE   . LYS B 1 44  ? 12.238 10.808  -1.871  1.00 28.25 ? 44  LYS B CE   1 
ATOM   1978 N NZ   . LYS B 1 44  ? 12.829 10.214  -0.639  1.00 25.33 ? 44  LYS B NZ   1 
ATOM   1979 N N    . ALA B 1 45  ? 17.320 9.348   -5.105  1.00 35.21 ? 45  ALA B N    1 
ATOM   1980 C CA   . ALA B 1 45  ? 17.777 7.968   -5.217  1.00 32.44 ? 45  ALA B CA   1 
ATOM   1981 C C    . ALA B 1 45  ? 19.243 7.792   -4.834  1.00 29.63 ? 45  ALA B C    1 
ATOM   1982 O O    . ALA B 1 45  ? 19.628 6.735   -4.339  1.00 33.70 ? 45  ALA B O    1 
ATOM   1983 C CB   . ALA B 1 45  ? 17.535 7.454   -6.629  1.00 33.51 ? 45  ALA B CB   1 
ATOM   1984 N N    . SER B 1 46  ? 20.057 8.818   -5.064  1.00 25.77 ? 46  SER B N    1 
ATOM   1985 C CA   . SER B 1 46  ? 21.479 8.750   -4.731  1.00 27.32 ? 46  SER B CA   1 
ATOM   1986 C C    . SER B 1 46  ? 21.775 9.115   -3.277  1.00 28.24 ? 46  SER B C    1 
ATOM   1987 O O    . SER B 1 46  ? 22.907 8.956   -2.817  1.00 29.38 ? 46  SER B O    1 
ATOM   1988 C CB   . SER B 1 46  ? 22.293 9.644   -5.664  1.00 28.96 ? 46  SER B CB   1 
ATOM   1989 O OG   . SER B 1 46  ? 21.881 10.995  -5.558  1.00 42.89 ? 46  SER B OG   1 
ATOM   1990 N N    . CYS B 1 47  ? 20.774 9.645   -2.575  1.00 26.04 ? 47  CYS B N    1 
ATOM   1991 C CA   . CYS B 1 47  ? 20.923 10.015  -1.166  1.00 24.21 ? 47  CYS B CA   1 
ATOM   1992 C C    . CYS B 1 47  ? 20.761 8.769   -0.303  1.00 24.57 ? 47  CYS B C    1 
ATOM   1993 O O    . CYS B 1 47  ? 19.778 8.038   -0.453  1.00 25.43 ? 47  CYS B O    1 
ATOM   1994 C CB   . CYS B 1 47  ? 19.871 11.050  -0.761  1.00 23.70 ? 47  CYS B CB   1 
ATOM   1995 S SG   . CYS B 1 47  ? 20.106 12.681  -1.487  1.00 27.60 ? 47  CYS B SG   1 
ATOM   1996 N N    . LEU B 1 48  ? 21.702 8.558   0.619   1.00 21.07 ? 48  LEU B N    1 
ATOM   1997 C CA   . LEU B 1 48  ? 21.693 7.396   1.510   1.00 20.15 ? 48  LEU B CA   1 
ATOM   1998 C C    . LEU B 1 48  ? 20.336 7.054   2.132   1.00 22.33 ? 48  LEU B C    1 
ATOM   1999 O O    . LEU B 1 48  ? 19.904 5.906   2.072   1.00 28.05 ? 48  LEU B O    1 
ATOM   2000 C CB   . LEU B 1 48  ? 22.740 7.565   2.609   1.00 23.63 ? 48  LEU B CB   1 
ATOM   2001 C CG   . LEU B 1 48  ? 22.899 6.392   3.580   1.00 26.35 ? 48  LEU B CG   1 
ATOM   2002 C CD1  . LEU B 1 48  ? 23.265 5.123   2.818   1.00 23.75 ? 48  LEU B CD1  1 
ATOM   2003 C CD2  . LEU B 1 48  ? 23.967 6.724   4.606   1.00 23.99 ? 48  LEU B CD2  1 
ATOM   2004 N N    . TYR B 1 49  ? 19.674 8.041   2.730   1.00 20.96 ? 49  TYR B N    1 
ATOM   2005 C CA   . TYR B 1 49  ? 18.364 7.817   3.347   1.00 19.04 ? 49  TYR B CA   1 
ATOM   2006 C C    . TYR B 1 49  ? 17.243 8.473   2.536   1.00 23.06 ? 49  TYR B C    1 
ATOM   2007 O O    . TYR B 1 49  ? 16.103 8.592   3.013   1.00 14.83 ? 49  TYR B O    1 
ATOM   2008 C CB   . TYR B 1 49  ? 18.346 8.338   4.789   1.00 16.45 ? 49  TYR B CB   1 
ATOM   2009 C CG   . TYR B 1 49  ? 19.391 7.708   5.687   1.00 15.57 ? 49  TYR B CG   1 
ATOM   2010 C CD1  . TYR B 1 49  ? 19.335 6.349   6.006   1.00 15.62 ? 49  TYR B CD1  1 
ATOM   2011 C CD2  . TYR B 1 49  ? 20.433 8.468   6.223   1.00 12.65 ? 49  TYR B CD2  1 
ATOM   2012 C CE1  . TYR B 1 49  ? 20.289 5.758   6.835   1.00 9.71  ? 49  TYR B CE1  1 
ATOM   2013 C CE2  . TYR B 1 49  ? 21.394 7.887   7.058   1.00 12.31 ? 49  TYR B CE2  1 
ATOM   2014 C CZ   . TYR B 1 49  ? 21.314 6.531   7.360   1.00 17.11 ? 49  TYR B CZ   1 
ATOM   2015 O OH   . TYR B 1 49  ? 22.253 5.951   8.189   1.00 16.72 ? 49  TYR B OH   1 
ATOM   2016 N N    . GLY B 1 50  ? 17.576 8.877   1.306   1.00 20.59 ? 50  GLY B N    1 
ATOM   2017 C CA   . GLY B 1 50  ? 16.614 9.512   0.418   1.00 15.71 ? 50  GLY B CA   1 
ATOM   2018 C C    . GLY B 1 50  ? 16.169 10.891  0.867   1.00 18.57 ? 50  GLY B C    1 
ATOM   2019 O O    . GLY B 1 50  ? 15.067 11.329  0.532   1.00 21.67 ? 50  GLY B O    1 
ATOM   2020 N N    . GLN B 1 51  ? 17.017 11.577  1.633   1.00 20.16 ? 51  GLN B N    1 
ATOM   2021 C CA   . GLN B 1 51  ? 16.677 12.905  2.129   1.00 19.25 ? 51  GLN B CA   1 
ATOM   2022 C C    . GLN B 1 51  ? 17.852 13.870  2.166   1.00 20.17 ? 51  GLN B C    1 
ATOM   2023 O O    . GLN B 1 51  ? 19.008 13.467  2.050   1.00 18.88 ? 51  GLN B O    1 
ATOM   2024 C CB   . GLN B 1 51  ? 16.081 12.810  3.538   1.00 14.87 ? 51  GLN B CB   1 
ATOM   2025 C CG   . GLN B 1 51  ? 14.756 12.076  3.632   1.00 14.61 ? 51  GLN B CG   1 
ATOM   2026 C CD   . GLN B 1 51  ? 14.127 12.226  4.994   1.00 14.77 ? 51  GLN B CD   1 
ATOM   2027 O OE1  . GLN B 1 51  ? 14.752 11.954  6.012   1.00 22.93 ? 51  GLN B OE1  1 
ATOM   2028 N NE2  . GLN B 1 51  ? 12.881 12.684  5.021   1.00 16.66 ? 51  GLN B NE2  1 
ATOM   2029 N N    . LEU B 1 52  ? 17.528 15.153  2.307   1.00 22.03 ? 52  LEU B N    1 
ATOM   2030 C CA   . LEU B 1 52  ? 18.520 16.219  2.414   1.00 22.08 ? 52  LEU B CA   1 
ATOM   2031 C C    . LEU B 1 52  ? 18.382 16.774  3.844   1.00 21.71 ? 52  LEU B C    1 
ATOM   2032 O O    . LEU B 1 52  ? 17.341 16.601  4.477   1.00 20.23 ? 52  LEU B O    1 
ATOM   2033 C CB   . LEU B 1 52  ? 18.251 17.310  1.368   1.00 18.06 ? 52  LEU B CB   1 
ATOM   2034 C CG   . LEU B 1 52  ? 18.409 16.899  -0.100  1.00 16.20 ? 52  LEU B CG   1 
ATOM   2035 C CD1  . LEU B 1 52  ? 18.006 18.047  -1.017  1.00 13.53 ? 52  LEU B CD1  1 
ATOM   2036 C CD2  . LEU B 1 52  ? 19.846 16.468  -0.376  1.00 12.65 ? 52  LEU B CD2  1 
ATOM   2037 N N    . PRO B 1 53  ? 19.382 17.522  4.340   1.00 20.71 ? 53  PRO B N    1 
ATOM   2038 C CA   . PRO B 1 53  ? 20.643 17.930  3.718   1.00 18.98 ? 53  PRO B CA   1 
ATOM   2039 C C    . PRO B 1 53  ? 21.683 16.862  3.415   1.00 21.39 ? 53  PRO B C    1 
ATOM   2040 O O    . PRO B 1 53  ? 21.692 15.771  3.989   1.00 24.37 ? 53  PRO B O    1 
ATOM   2041 C CB   . PRO B 1 53  ? 21.200 18.936  4.724   1.00 17.12 ? 53  PRO B CB   1 
ATOM   2042 C CG   . PRO B 1 53  ? 20.752 18.362  6.035   1.00 14.53 ? 53  PRO B CG   1 
ATOM   2043 C CD   . PRO B 1 53  ? 19.311 18.013  5.731   1.00 17.11 ? 53  PRO B CD   1 
ATOM   2044 N N    . LYS B 1 54  ? 22.544 17.215  2.470   1.00 19.46 ? 54  LYS B N    1 
ATOM   2045 C CA   . LYS B 1 54  ? 23.671 16.408  2.048   1.00 18.15 ? 54  LYS B CA   1 
ATOM   2046 C C    . LYS B 1 54  ? 24.800 17.406  2.267   1.00 17.46 ? 54  LYS B C    1 
ATOM   2047 O O    . LYS B 1 54  ? 24.646 18.592  1.984   1.00 19.47 ? 54  LYS B O    1 
ATOM   2048 C CB   . LYS B 1 54  ? 23.562 16.044  0.568   1.00 25.72 ? 54  LYS B CB   1 
ATOM   2049 C CG   . LYS B 1 54  ? 24.774 15.291  0.037   1.00 25.89 ? 54  LYS B CG   1 
ATOM   2050 C CD   . LYS B 1 54  ? 24.657 15.058  -1.453  1.00 26.27 ? 54  LYS B CD   1 
ATOM   2051 C CE   . LYS B 1 54  ? 25.954 14.531  -2.029  1.00 28.22 ? 54  LYS B CE   1 
ATOM   2052 N NZ   . LYS B 1 54  ? 25.850 14.396  -3.504  1.00 30.93 ? 54  LYS B NZ   1 
ATOM   2053 N N    . PHE B 1 55  ? 25.926 16.941  2.780   1.00 17.93 ? 55  PHE B N    1 
ATOM   2054 C CA   . PHE B 1 55  ? 27.038 17.831  3.071   1.00 14.81 ? 55  PHE B CA   1 
ATOM   2055 C C    . PHE B 1 55  ? 28.334 17.255  2.542   1.00 16.42 ? 55  PHE B C    1 
ATOM   2056 O O    . PHE B 1 55  ? 28.500 16.045  2.471   1.00 23.75 ? 55  PHE B O    1 
ATOM   2057 C CB   . PHE B 1 55  ? 27.124 18.023  4.588   1.00 17.69 ? 55  PHE B CB   1 
ATOM   2058 C CG   . PHE B 1 55  ? 28.160 19.015  5.034   1.00 15.85 ? 55  PHE B CG   1 
ATOM   2059 C CD1  . PHE B 1 55  ? 27.916 20.383  4.952   1.00 13.56 ? 55  PHE B CD1  1 
ATOM   2060 C CD2  . PHE B 1 55  ? 29.357 18.578  5.599   1.00 16.92 ? 55  PHE B CD2  1 
ATOM   2061 C CE1  . PHE B 1 55  ? 28.848 21.307  5.433   1.00 16.41 ? 55  PHE B CE1  1 
ATOM   2062 C CE2  . PHE B 1 55  ? 30.297 19.495  6.085   1.00 23.68 ? 55  PHE B CE2  1 
ATOM   2063 C CZ   . PHE B 1 55  ? 30.039 20.863  6.001   1.00 18.10 ? 55  PHE B CZ   1 
ATOM   2064 N N    . GLN B 1 56  ? 29.243 18.132  2.140   1.00 20.41 ? 56  GLN B N    1 
ATOM   2065 C CA   . GLN B 1 56  ? 30.529 17.700  1.635   1.00 20.22 ? 56  GLN B CA   1 
ATOM   2066 C C    . GLN B 1 56  ? 31.664 18.498  2.251   1.00 21.92 ? 56  GLN B C    1 
ATOM   2067 O O    . GLN B 1 56  ? 31.611 19.723  2.347   1.00 26.13 ? 56  GLN B O    1 
ATOM   2068 C CB   . GLN B 1 56  ? 30.576 17.789  0.108   1.00 26.34 ? 56  GLN B CB   1 
ATOM   2069 C CG   . GLN B 1 56  ? 29.742 16.720  -0.584  1.00 35.71 ? 56  GLN B CG   1 
ATOM   2070 C CD   . GLN B 1 56  ? 29.643 16.915  -2.085  1.00 41.57 ? 56  GLN B CD   1 
ATOM   2071 O OE1  . GLN B 1 56  ? 29.760 18.034  -2.593  1.00 41.39 ? 56  GLN B OE1  1 
ATOM   2072 N NE2  . GLN B 1 56  ? 29.414 15.824  -2.807  1.00 46.42 ? 56  GLN B NE2  1 
ATOM   2073 N N    . ASP B 1 57  ? 32.649 17.764  2.746   1.00 19.80 ? 57  ASP B N    1 
ATOM   2074 C CA   . ASP B 1 57  ? 33.839 18.329  3.344   1.00 19.66 ? 57  ASP B CA   1 
ATOM   2075 C C    . ASP B 1 57  ? 34.932 17.612  2.565   1.00 24.38 ? 57  ASP B C    1 
ATOM   2076 O O    . ASP B 1 57  ? 35.308 16.486  2.898   1.00 23.76 ? 57  ASP B O    1 
ATOM   2077 C CB   . ASP B 1 57  ? 33.904 17.972  4.832   1.00 21.33 ? 57  ASP B CB   1 
ATOM   2078 C CG   . ASP B 1 57  ? 35.151 18.511  5.512   1.00 29.37 ? 57  ASP B CG   1 
ATOM   2079 O OD1  . ASP B 1 57  ? 35.960 19.213  4.863   1.00 31.13 ? 57  ASP B OD1  1 
ATOM   2080 O OD2  . ASP B 1 57  ? 35.323 18.240  6.716   1.00 31.27 ? 57  ASP B OD2  1 
ATOM   2081 N N    . GLY B 1 58  ? 35.412 18.252  1.502   1.00 23.00 ? 58  GLY B N    1 
ATOM   2082 C CA   . GLY B 1 58  ? 36.419 17.622  0.668   1.00 21.06 ? 58  GLY B CA   1 
ATOM   2083 C C    . GLY B 1 58  ? 35.688 16.504  -0.049  1.00 22.16 ? 58  GLY B C    1 
ATOM   2084 O O    . GLY B 1 58  ? 34.625 16.734  -0.627  1.00 27.12 ? 58  GLY B O    1 
ATOM   2085 N N    . ASP B 1 59  ? 36.210 15.285  0.025   1.00 28.11 ? 59  ASP B N    1 
ATOM   2086 C CA   . ASP B 1 59  ? 35.540 14.163  -0.624  1.00 35.77 ? 59  ASP B CA   1 
ATOM   2087 C C    . ASP B 1 59  ? 34.660 13.365  0.345   1.00 35.78 ? 59  ASP B C    1 
ATOM   2088 O O    . ASP B 1 59  ? 34.103 12.326  -0.021  1.00 37.51 ? 59  ASP B O    1 
ATOM   2089 C CB   . ASP B 1 59  ? 36.545 13.257  -1.356  1.00 42.69 ? 59  ASP B CB   1 
ATOM   2090 C CG   . ASP B 1 59  ? 37.405 12.430  -0.414  1.00 50.40 ? 59  ASP B CG   1 
ATOM   2091 O OD1  . ASP B 1 59  ? 37.603 12.835  0.758   1.00 53.57 ? 59  ASP B OD1  1 
ATOM   2092 O OD2  . ASP B 1 59  ? 37.898 11.372  -0.869  1.00 54.26 ? 59  ASP B OD2  1 
ATOM   2093 N N    . LEU B 1 60  ? 34.542 13.859  1.579   1.00 31.06 ? 60  LEU B N    1 
ATOM   2094 C CA   . LEU B 1 60  ? 33.711 13.213  2.591   1.00 25.13 ? 60  LEU B CA   1 
ATOM   2095 C C    . LEU B 1 60  ? 32.281 13.697  2.385   1.00 23.57 ? 60  LEU B C    1 
ATOM   2096 O O    . LEU B 1 60  ? 32.010 14.895  2.466   1.00 24.18 ? 60  LEU B O    1 
ATOM   2097 C CB   . LEU B 1 60  ? 34.175 13.600  3.999   1.00 23.83 ? 60  LEU B CB   1 
ATOM   2098 C CG   . LEU B 1 60  ? 33.950 12.636  5.174   1.00 23.92 ? 60  LEU B CG   1 
ATOM   2099 C CD1  . LEU B 1 60  ? 33.643 13.432  6.425   1.00 18.58 ? 60  LEU B CD1  1 
ATOM   2100 C CD2  . LEU B 1 60  ? 32.828 11.654  4.896   1.00 24.36 ? 60  LEU B CD2  1 
ATOM   2101 N N    . THR B 1 61  ? 31.378 12.767  2.094   1.00 22.69 ? 61  THR B N    1 
ATOM   2102 C CA   . THR B 1 61  ? 29.975 13.092  1.882   1.00 19.72 ? 61  THR B CA   1 
ATOM   2103 C C    . THR B 1 61  ? 29.190 12.613  3.100   1.00 25.74 ? 61  THR B C    1 
ATOM   2104 O O    . THR B 1 61  ? 29.277 11.445  3.483   1.00 28.39 ? 61  THR B O    1 
ATOM   2105 C CB   . THR B 1 61  ? 29.432 12.417  0.606   1.00 23.67 ? 61  THR B CB   1 
ATOM   2106 O OG1  . THR B 1 61  ? 30.171 12.885  -0.530  1.00 26.64 ? 61  THR B OG1  1 
ATOM   2107 C CG2  . THR B 1 61  ? 27.949 12.727  0.413   1.00 17.60 ? 61  THR B CG2  1 
ATOM   2108 N N    . LEU B 1 62  ? 28.434 13.525  3.704   1.00 22.33 ? 62  LEU B N    1 
ATOM   2109 C CA   . LEU B 1 62  ? 27.642 13.230  4.891   1.00 19.91 ? 62  LEU B CA   1 
ATOM   2110 C C    . LEU B 1 62  ? 26.154 13.511  4.715   1.00 18.73 ? 62  LEU B C    1 
ATOM   2111 O O    . LEU B 1 62  ? 25.751 14.300  3.862   1.00 20.87 ? 62  LEU B O    1 
ATOM   2112 C CB   . LEU B 1 62  ? 28.156 14.069  6.068   1.00 16.70 ? 62  LEU B CB   1 
ATOM   2113 C CG   . LEU B 1 62  ? 29.161 13.533  7.094   1.00 21.49 ? 62  LEU B CG   1 
ATOM   2114 C CD1  . LEU B 1 62  ? 29.833 12.251  6.641   1.00 17.38 ? 62  LEU B CD1  1 
ATOM   2115 C CD2  . LEU B 1 62  ? 30.181 14.617  7.399   1.00 15.96 ? 62  LEU B CD2  1 
ATOM   2116 N N    . TYR B 1 63  ? 25.348 12.821  5.513   1.00 16.77 ? 63  TYR B N    1 
ATOM   2117 C CA   . TYR B 1 63  ? 23.902 13.007  5.536   1.00 18.08 ? 63  TYR B CA   1 
ATOM   2118 C C    . TYR B 1 63  ? 23.547 13.126  7.016   1.00 14.44 ? 63  TYR B C    1 
ATOM   2119 O O    . TYR B 1 63  ? 24.398 12.882  7.872   1.00 19.30 ? 63  TYR B O    1 
ATOM   2120 C CB   . TYR B 1 63  ? 23.171 11.825  4.889   1.00 19.38 ? 63  TYR B CB   1 
ATOM   2121 C CG   . TYR B 1 63  ? 23.450 11.685  3.412   1.00 26.32 ? 63  TYR B CG   1 
ATOM   2122 C CD1  . TYR B 1 63  ? 22.657 12.343  2.471   1.00 28.89 ? 63  TYR B CD1  1 
ATOM   2123 C CD2  . TYR B 1 63  ? 24.521 10.918  2.952   1.00 23.96 ? 63  TYR B CD2  1 
ATOM   2124 C CE1  . TYR B 1 63  ? 22.923 12.250  1.110   1.00 27.77 ? 63  TYR B CE1  1 
ATOM   2125 C CE2  . TYR B 1 63  ? 24.797 10.818  1.590   1.00 27.29 ? 63  TYR B CE2  1 
ATOM   2126 C CZ   . TYR B 1 63  ? 23.994 11.488  0.674   1.00 30.44 ? 63  TYR B CZ   1 
ATOM   2127 O OH   . TYR B 1 63  ? 24.276 11.412  -0.670  1.00 28.82 ? 63  TYR B OH   1 
ATOM   2128 N N    . GLN B 1 64  ? 22.310 13.522  7.310   1.00 14.04 ? 64  GLN B N    1 
ATOM   2129 C CA   . GLN B 1 64  ? 21.836 13.696  8.685   1.00 15.23 ? 64  GLN B CA   1 
ATOM   2130 C C    . GLN B 1 64  ? 22.383 15.003  9.270   1.00 12.16 ? 64  GLN B C    1 
ATOM   2131 O O    . GLN B 1 64  ? 23.583 15.137  9.514   1.00 12.06 ? 64  GLN B O    1 
ATOM   2132 C CB   . GLN B 1 64  ? 22.230 12.490  9.551   1.00 16.44 ? 64  GLN B CB   1 
ATOM   2133 C CG   . GLN B 1 64  ? 21.594 11.170  9.112   1.00 16.05 ? 64  GLN B CG   1 
ATOM   2134 C CD   . GLN B 1 64  ? 20.127 11.068  9.493   1.00 17.17 ? 64  GLN B CD   1 
ATOM   2135 O OE1  . GLN B 1 64  ? 19.565 11.983  10.087  1.00 17.01 ? 64  GLN B OE1  1 
ATOM   2136 N NE2  . GLN B 1 64  ? 19.499 9.946   9.151   1.00 17.18 ? 64  GLN B NE2  1 
ATOM   2137 N N    . SER B 1 65  ? 21.486 15.962  9.485   1.00 11.92 ? 65  SER B N    1 
ATOM   2138 C CA   . SER B 1 65  ? 21.850 17.276  10.004  1.00 12.45 ? 65  SER B CA   1 
ATOM   2139 C C    . SER B 1 65  ? 22.703 17.242  11.274  1.00 14.60 ? 65  SER B C    1 
ATOM   2140 O O    . SER B 1 65  ? 23.700 17.964  11.365  1.00 16.80 ? 65  SER B O    1 
ATOM   2141 C CB   . SER B 1 65  ? 20.598 18.118  10.231  1.00 11.86 ? 65  SER B CB   1 
ATOM   2142 O OG   . SER B 1 65  ? 19.717 17.484  11.140  1.00 15.75 ? 65  SER B OG   1 
ATOM   2143 N N    . ASN B 1 66  ? 22.332 16.392  12.232  1.00 12.08 ? 66  ASN B N    1 
ATOM   2144 C CA   . ASN B 1 66  ? 23.085 16.286  13.484  1.00 12.31 ? 66  ASN B CA   1 
ATOM   2145 C C    . ASN B 1 66  ? 24.467 15.659  13.316  1.00 12.87 ? 66  ASN B C    1 
ATOM   2146 O O    . ASN B 1 66  ? 25.384 15.963  14.080  1.00 14.94 ? 66  ASN B O    1 
ATOM   2147 C CB   . ASN B 1 66  ? 22.277 15.536  14.550  1.00 14.74 ? 66  ASN B CB   1 
ATOM   2148 C CG   . ASN B 1 66  ? 21.072 16.325  15.011  1.00 15.06 ? 66  ASN B CG   1 
ATOM   2149 O OD1  . ASN B 1 66  ? 21.211 17.435  15.525  1.00 15.55 ? 66  ASN B OD1  1 
ATOM   2150 N ND2  . ASN B 1 66  ? 19.884 15.766  14.821  1.00 9.00  ? 66  ASN B ND2  1 
ATOM   2151 N N    . THR B 1 67  ? 24.619 14.775  12.331  1.00 14.29 ? 67  THR B N    1 
ATOM   2152 C CA   . THR B 1 67  ? 25.917 14.162  12.058  1.00 11.84 ? 67  THR B CA   1 
ATOM   2153 C C    . THR B 1 67  ? 26.813 15.281  11.531  1.00 13.44 ? 67  THR B C    1 
ATOM   2154 O O    . THR B 1 67  ? 27.978 15.382  11.898  1.00 13.87 ? 67  THR B O    1 
ATOM   2155 C CB   . THR B 1 67  ? 25.813 13.043  11.010  1.00 10.79 ? 67  THR B CB   1 
ATOM   2156 O OG1  . THR B 1 67  ? 25.137 11.924  11.586  1.00 11.75 ? 67  THR B OG1  1 
ATOM   2157 C CG2  . THR B 1 67  ? 27.182 12.605  10.546  1.00 8.81  ? 67  THR B CG2  1 
ATOM   2158 N N    . ILE B 1 68  ? 26.239 16.141  10.693  1.00 13.29 ? 68  ILE B N    1 
ATOM   2159 C CA   . ILE B 1 68  ? 26.965 17.275  10.130  1.00 15.73 ? 68  ILE B CA   1 
ATOM   2160 C C    . ILE B 1 68  ? 27.392 18.204  11.272  1.00 15.23 ? 68  ILE B C    1 
ATOM   2161 O O    . ILE B 1 68  ? 28.549 18.622  11.333  1.00 14.20 ? 68  ILE B O    1 
ATOM   2162 C CB   . ILE B 1 68  ? 26.089 18.036  9.109   1.00 18.12 ? 68  ILE B CB   1 
ATOM   2163 C CG1  . ILE B 1 68  ? 25.690 17.090  7.972   1.00 12.03 ? 68  ILE B CG1  1 
ATOM   2164 C CG2  . ILE B 1 68  ? 26.846 19.242  8.554   1.00 12.44 ? 68  ILE B CG2  1 
ATOM   2165 C CD1  . ILE B 1 68  ? 24.511 17.563  7.158   1.00 10.03 ? 68  ILE B CD1  1 
ATOM   2166 N N    . LEU B 1 69  ? 26.470 18.492  12.192  1.00 10.94 ? 69  LEU B N    1 
ATOM   2167 C CA   . LEU B 1 69  ? 26.774 19.346  13.342  1.00 14.30 ? 69  LEU B CA   1 
ATOM   2168 C C    . LEU B 1 69  ? 27.904 18.758  14.187  1.00 16.71 ? 69  LEU B C    1 
ATOM   2169 O O    . LEU B 1 69  ? 28.863 19.456  14.527  1.00 18.11 ? 69  LEU B O    1 
ATOM   2170 C CB   . LEU B 1 69  ? 25.532 19.556  14.215  1.00 10.62 ? 69  LEU B CB   1 
ATOM   2171 C CG   . LEU B 1 69  ? 24.531 20.606  13.735  1.00 13.60 ? 69  LEU B CG   1 
ATOM   2172 C CD1  . LEU B 1 69  ? 23.316 20.609  14.632  1.00 17.41 ? 69  LEU B CD1  1 
ATOM   2173 C CD2  . LEU B 1 69  ? 25.189 21.984  13.736  1.00 14.10 ? 69  LEU B CD2  1 
ATOM   2174 N N    . ARG B 1 70  ? 27.813 17.462  14.483  1.00 17.46 ? 70  ARG B N    1 
ATOM   2175 C CA   . ARG B 1 70  ? 28.833 16.794  15.287  1.00 14.70 ? 70  ARG B CA   1 
ATOM   2176 C C    . ARG B 1 70  ? 30.183 16.747  14.589  1.00 16.69 ? 70  ARG B C    1 
ATOM   2177 O O    . ARG B 1 70  ? 31.228 16.885  15.230  1.00 15.84 ? 70  ARG B O    1 
ATOM   2178 C CB   . ARG B 1 70  ? 28.378 15.391  15.690  1.00 16.11 ? 70  ARG B CB   1 
ATOM   2179 C CG   . ARG B 1 70  ? 27.299 15.417  16.749  1.00 17.77 ? 70  ARG B CG   1 
ATOM   2180 C CD   . ARG B 1 70  ? 26.967 14.039  17.299  1.00 17.69 ? 70  ARG B CD   1 
ATOM   2181 N NE   . ARG B 1 70  ? 26.195 14.177  18.530  1.00 16.07 ? 70  ARG B NE   1 
ATOM   2182 C CZ   . ARG B 1 70  ? 24.867 14.161  18.600  1.00 18.45 ? 70  ARG B CZ   1 
ATOM   2183 N NH1  . ARG B 1 70  ? 24.140 13.991  17.503  1.00 16.73 ? 70  ARG B NH1  1 
ATOM   2184 N NH2  . ARG B 1 70  ? 24.264 14.389  19.760  1.00 13.69 ? 70  ARG B NH2  1 
ATOM   2185 N N    . HIS B 1 71  ? 30.154 16.584  13.270  1.00 16.68 ? 71  HIS B N    1 
ATOM   2186 C CA   . HIS B 1 71  ? 31.377 16.538  12.484  1.00 16.33 ? 71  HIS B CA   1 
ATOM   2187 C C    . HIS B 1 71  ? 32.098 17.883  12.556  1.00 16.31 ? 71  HIS B C    1 
ATOM   2188 O O    . HIS B 1 71  ? 33.309 17.940  12.777  1.00 23.11 ? 71  HIS B O    1 
ATOM   2189 C CB   . HIS B 1 71  ? 31.061 16.192  11.029  1.00 19.10 ? 71  HIS B CB   1 
ATOM   2190 C CG   . HIS B 1 71  ? 32.245 16.289  10.127  1.00 14.31 ? 71  HIS B CG   1 
ATOM   2191 N ND1  . HIS B 1 71  ? 33.357 15.491  10.279  1.00 16.91 ? 71  HIS B ND1  1 
ATOM   2192 C CD2  . HIS B 1 71  ? 32.519 17.127  9.101   1.00 19.97 ? 71  HIS B CD2  1 
ATOM   2193 C CE1  . HIS B 1 71  ? 34.270 15.836  9.388   1.00 17.30 ? 71  HIS B CE1  1 
ATOM   2194 N NE2  . HIS B 1 71  ? 33.786 16.828  8.662   1.00 21.25 ? 71  HIS B NE2  1 
ATOM   2195 N N    . LEU B 1 72  ? 31.345 18.959  12.349  1.00 19.96 ? 72  LEU B N    1 
ATOM   2196 C CA   . LEU B 1 72  ? 31.890 20.314  12.404  1.00 18.68 ? 72  LEU B CA   1 
ATOM   2197 C C    . LEU B 1 72  ? 32.360 20.642  13.825  1.00 20.71 ? 72  LEU B C    1 
ATOM   2198 O O    . LEU B 1 72  ? 33.411 21.261  14.010  1.00 19.88 ? 72  LEU B O    1 
ATOM   2199 C CB   . LEU B 1 72  ? 30.833 21.325  11.944  1.00 15.33 ? 72  LEU B CB   1 
ATOM   2200 C CG   . LEU B 1 72  ? 30.828 21.810  10.486  1.00 19.43 ? 72  LEU B CG   1 
ATOM   2201 C CD1  . LEU B 1 72  ? 31.622 20.888  9.583   1.00 25.39 ? 72  LEU B CD1  1 
ATOM   2202 C CD2  . LEU B 1 72  ? 29.393 21.953  9.991   1.00 11.24 ? 72  LEU B CD2  1 
ATOM   2203 N N    . GLY B 1 73  ? 31.594 20.197  14.821  1.00 14.96 ? 73  GLY B N    1 
ATOM   2204 C CA   . GLY B 1 73  ? 31.957 20.446  16.206  1.00 14.21 ? 73  GLY B CA   1 
ATOM   2205 C C    . GLY B 1 73  ? 33.255 19.749  16.563  1.00 19.62 ? 73  GLY B C    1 
ATOM   2206 O O    . GLY B 1 73  ? 34.080 20.275  17.301  1.00 25.40 ? 73  GLY B O    1 
ATOM   2207 N N    . ARG B 1 74  ? 33.459 18.575  15.984  1.00 20.36 ? 74  ARG B N    1 
ATOM   2208 C CA   . ARG B 1 74  ? 34.656 17.789  16.232  1.00 22.21 ? 74  ARG B CA   1 
ATOM   2209 C C    . ARG B 1 74  ? 35.887 18.368  15.528  1.00 24.14 ? 74  ARG B C    1 
ATOM   2210 O O    . ARG B 1 74  ? 36.944 18.524  16.140  1.00 23.68 ? 74  ARG B O    1 
ATOM   2211 C CB   . ARG B 1 74  ? 34.399 16.351  15.776  1.00 23.20 ? 74  ARG B CB   1 
ATOM   2212 C CG   . ARG B 1 74  ? 35.316 15.295  16.361  1.00 25.97 ? 74  ARG B CG   1 
ATOM   2213 C CD   . ARG B 1 74  ? 34.562 13.971  16.477  1.00 18.40 ? 74  ARG B CD   1 
ATOM   2214 N NE   . ARG B 1 74  ? 33.709 13.769  15.313  1.00 19.99 ? 74  ARG B NE   1 
ATOM   2215 C CZ   . ARG B 1 74  ? 32.470 13.288  15.352  1.00 19.18 ? 74  ARG B CZ   1 
ATOM   2216 N NH1  . ARG B 1 74  ? 31.919 12.931  16.502  1.00 16.06 ? 74  ARG B NH1  1 
ATOM   2217 N NH2  . ARG B 1 74  ? 31.748 13.248  14.242  1.00 14.93 ? 74  ARG B NH2  1 
ATOM   2218 N N    . THR B 1 75  ? 35.740 18.711  14.250  1.00 24.37 ? 75  THR B N    1 
ATOM   2219 C CA   . THR B 1 75  ? 36.852 19.252  13.466  1.00 22.93 ? 75  THR B CA   1 
ATOM   2220 C C    . THR B 1 75  ? 37.203 20.705  13.780  1.00 23.45 ? 75  THR B C    1 
ATOM   2221 O O    . THR B 1 75  ? 38.362 21.099  13.670  1.00 26.31 ? 75  THR B O    1 
ATOM   2222 C CB   . THR B 1 75  ? 36.596 19.118  11.949  1.00 22.94 ? 75  THR B CB   1 
ATOM   2223 O OG1  . THR B 1 75  ? 35.351 19.744  11.617  1.00 24.40 ? 75  THR B OG1  1 
ATOM   2224 C CG2  . THR B 1 75  ? 36.543 17.648  11.536  1.00 17.38 ? 75  THR B CG2  1 
ATOM   2225 N N    . LEU B 1 76  ? 36.206 21.494  14.171  1.00 21.16 ? 76  LEU B N    1 
ATOM   2226 C CA   . LEU B 1 76  ? 36.416 22.904  14.497  1.00 21.72 ? 76  LEU B CA   1 
ATOM   2227 C C    . LEU B 1 76  ? 36.640 23.192  15.986  1.00 22.20 ? 76  LEU B C    1 
ATOM   2228 O O    . LEU B 1 76  ? 36.898 24.333  16.366  1.00 19.86 ? 76  LEU B O    1 
ATOM   2229 C CB   . LEU B 1 76  ? 35.251 23.743  13.971  1.00 21.04 ? 76  LEU B CB   1 
ATOM   2230 C CG   . LEU B 1 76  ? 35.359 24.339  12.566  1.00 23.96 ? 76  LEU B CG   1 
ATOM   2231 C CD1  . LEU B 1 76  ? 36.216 23.475  11.659  1.00 23.60 ? 76  LEU B CD1  1 
ATOM   2232 C CD2  . LEU B 1 76  ? 33.962 24.527  11.995  1.00 18.34 ? 76  LEU B CD2  1 
ATOM   2233 N N    . GLY B 1 77  ? 36.537 22.160  16.822  1.00 25.08 ? 77  GLY B N    1 
ATOM   2234 C CA   . GLY B 1 77  ? 36.747 22.332  18.252  1.00 21.49 ? 77  GLY B CA   1 
ATOM   2235 C C    . GLY B 1 77  ? 35.595 22.964  19.020  1.00 22.81 ? 77  GLY B C    1 
ATOM   2236 O O    . GLY B 1 77  ? 35.814 23.785  19.912  1.00 26.73 ? 77  GLY B O    1 
ATOM   2237 N N    . LEU B 1 78  ? 34.369 22.585  18.670  1.00 19.13 ? 78  LEU B N    1 
ATOM   2238 C CA   . LEU B 1 78  ? 33.165 23.092  19.325  1.00 17.81 ? 78  LEU B CA   1 
ATOM   2239 C C    . LEU B 1 78  ? 32.432 21.911  19.972  1.00 19.78 ? 78  LEU B C    1 
ATOM   2240 O O    . LEU B 1 78  ? 31.208 21.791  19.861  1.00 17.32 ? 78  LEU B O    1 
ATOM   2241 C CB   . LEU B 1 78  ? 32.247 23.751  18.288  1.00 19.37 ? 78  LEU B CB   1 
ATOM   2242 C CG   . LEU B 1 78  ? 32.854 24.715  17.265  1.00 21.63 ? 78  LEU B CG   1 
ATOM   2243 C CD1  . LEU B 1 78  ? 31.762 25.193  16.324  1.00 24.18 ? 78  LEU B CD1  1 
ATOM   2244 C CD2  . LEU B 1 78  ? 33.512 25.889  17.962  1.00 15.44 ? 78  LEU B CD2  1 
ATOM   2245 N N    . TYR B 1 79  ? 33.180 21.071  20.686  1.00 19.64 ? 79  TYR B N    1 
ATOM   2246 C CA   . TYR B 1 79  ? 32.618 19.874  21.312  1.00 20.25 ? 79  TYR B CA   1 
ATOM   2247 C C    . TYR B 1 79  ? 33.033 19.698  22.782  1.00 21.38 ? 79  TYR B C    1 
ATOM   2248 O O    . TYR B 1 79  ? 33.209 18.571  23.251  1.00 26.49 ? 79  TYR B O    1 
ATOM   2249 C CB   . TYR B 1 79  ? 33.076 18.653  20.502  1.00 22.97 ? 79  TYR B CB   1 
ATOM   2250 C CG   . TYR B 1 79  ? 32.037 17.573  20.309  1.00 18.41 ? 79  TYR B CG   1 
ATOM   2251 C CD1  . TYR B 1 79  ? 31.193 17.188  21.353  1.00 13.93 ? 79  TYR B CD1  1 
ATOM   2252 C CD2  . TYR B 1 79  ? 31.906 16.929  19.079  1.00 15.23 ? 79  TYR B CD2  1 
ATOM   2253 C CE1  . TYR B 1 79  ? 30.243 16.189  21.177  1.00 13.05 ? 79  TYR B CE1  1 
ATOM   2254 C CE2  . TYR B 1 79  ? 30.960 15.927  18.891  1.00 17.16 ? 79  TYR B CE2  1 
ATOM   2255 C CZ   . TYR B 1 79  ? 30.129 15.563  19.946  1.00 19.13 ? 79  TYR B CZ   1 
ATOM   2256 O OH   . TYR B 1 79  ? 29.176 14.589  19.760  1.00 14.15 ? 79  TYR B OH   1 
ATOM   2257 N N    . GLY B 1 80  ? 33.160 20.807  23.508  1.00 19.91 ? 80  GLY B N    1 
ATOM   2258 C CA   . GLY B 1 80  ? 33.561 20.748  24.908  1.00 13.93 ? 80  GLY B CA   1 
ATOM   2259 C C    . GLY B 1 80  ? 35.066 20.664  25.082  1.00 18.01 ? 80  GLY B C    1 
ATOM   2260 O O    . GLY B 1 80  ? 35.788 20.366  24.130  1.00 18.02 ? 80  GLY B O    1 
ATOM   2261 N N    . LYS B 1 81  ? 35.547 20.902  26.299  1.00 20.25 ? 81  LYS B N    1 
ATOM   2262 C CA   . LYS B 1 81  ? 36.982 20.858  26.564  1.00 24.80 ? 81  LYS B CA   1 
ATOM   2263 C C    . LYS B 1 81  ? 37.467 19.447  26.886  1.00 22.49 ? 81  LYS B C    1 
ATOM   2264 O O    . LYS B 1 81  ? 38.660 19.159  26.798  1.00 26.88 ? 81  LYS B O    1 
ATOM   2265 C CB   . LYS B 1 81  ? 37.359 21.824  27.693  1.00 29.28 ? 81  LYS B CB   1 
ATOM   2266 C CG   . LYS B 1 81  ? 36.887 21.391  29.062  1.00 40.93 ? 81  LYS B CG   1 
ATOM   2267 C CD   . LYS B 1 81  ? 37.378 22.337  30.143  1.00 46.44 ? 81  LYS B CD   1 
ATOM   2268 C CE   . LYS B 1 81  ? 37.171 21.740  31.527  1.00 47.73 ? 81  LYS B CE   1 
ATOM   2269 N NZ   . LYS B 1 81  ? 35.744 21.403  31.797  1.00 53.48 ? 81  LYS B NZ   1 
ATOM   2270 N N    . ASP B 1 82  ? 36.541 18.570  27.260  1.00 19.00 ? 82  ASP B N    1 
ATOM   2271 C CA   . ASP B 1 82  ? 36.883 17.188  27.580  1.00 21.26 ? 82  ASP B CA   1 
ATOM   2272 C C    . ASP B 1 82  ? 35.704 16.241  27.343  1.00 16.97 ? 82  ASP B C    1 
ATOM   2273 O O    . ASP B 1 82  ? 34.642 16.671  26.892  1.00 18.12 ? 82  ASP B O    1 
ATOM   2274 C CB   . ASP B 1 82  ? 37.418 17.072  29.019  1.00 23.12 ? 82  ASP B CB   1 
ATOM   2275 C CG   . ASP B 1 82  ? 36.453 17.617  30.071  1.00 26.23 ? 82  ASP B CG   1 
ATOM   2276 O OD1  . ASP B 1 82  ? 35.220 17.546  29.888  1.00 28.04 ? 82  ASP B OD1  1 
ATOM   2277 O OD2  . ASP B 1 82  ? 36.942 18.108  31.108  1.00 32.29 ? 82  ASP B OD2  1 
ATOM   2278 N N    . GLN B 1 83  ? 35.884 14.960  27.665  1.00 17.70 ? 83  GLN B N    1 
ATOM   2279 C CA   . GLN B 1 83  ? 34.834 13.962  27.465  1.00 21.24 ? 83  GLN B CA   1 
ATOM   2280 C C    . GLN B 1 83  ? 33.572 14.230  28.261  1.00 18.81 ? 83  GLN B C    1 
ATOM   2281 O O    . GLN B 1 83  ? 32.466 14.012  27.765  1.00 21.48 ? 83  GLN B O    1 
ATOM   2282 C CB   . GLN B 1 83  ? 35.340 12.555  27.766  1.00 23.61 ? 83  GLN B CB   1 
ATOM   2283 C CG   . GLN B 1 83  ? 36.347 12.027  26.760  1.00 30.28 ? 83  GLN B CG   1 
ATOM   2284 C CD   . GLN B 1 83  ? 36.828 10.626  27.100  1.00 34.94 ? 83  GLN B CD   1 
ATOM   2285 O OE1  . GLN B 1 83  ? 37.203 9.861   26.217  1.00 35.76 ? 83  GLN B OE1  1 
ATOM   2286 N NE2  . GLN B 1 83  ? 36.837 10.292  28.390  1.00 32.08 ? 83  GLN B NE2  1 
ATOM   2287 N N    . GLN B 1 84  ? 33.729 14.703  29.492  1.00 20.99 ? 84  GLN B N    1 
ATOM   2288 C CA   . GLN B 1 84  ? 32.572 15.001  30.328  1.00 25.50 ? 84  GLN B CA   1 
ATOM   2289 C C    . GLN B 1 84  ? 31.706 16.068  29.664  1.00 21.51 ? 84  GLN B C    1 
ATOM   2290 O O    . GLN B 1 84  ? 30.487 15.904  29.555  1.00 19.93 ? 84  GLN B O    1 
ATOM   2291 C CB   . GLN B 1 84  ? 33.003 15.462  31.721  1.00 33.46 ? 84  GLN B CB   1 
ATOM   2292 C CG   . GLN B 1 84  ? 31.832 15.842  32.616  1.00 45.68 ? 84  GLN B CG   1 
ATOM   2293 C CD   . GLN B 1 84  ? 32.243 16.103  34.049  1.00 53.55 ? 84  GLN B CD   1 
ATOM   2294 O OE1  . GLN B 1 84  ? 33.021 15.347  34.629  1.00 49.34 ? 84  GLN B OE1  1 
ATOM   2295 N NE2  . GLN B 1 84  ? 31.713 17.174  34.631  1.00 62.37 ? 84  GLN B NE2  1 
ATOM   2296 N N    . GLU B 1 85  ? 32.346 17.141  29.197  1.00 17.09 ? 85  GLU B N    1 
ATOM   2297 C CA   . GLU B 1 85  ? 31.629 18.223  28.526  1.00 21.44 ? 85  GLU B CA   1 
ATOM   2298 C C    . GLU B 1 85  ? 31.038 17.732  27.213  1.00 19.55 ? 85  GLU B C    1 
ATOM   2299 O O    . GLU B 1 85  ? 29.926 18.118  26.856  1.00 15.23 ? 85  GLU B O    1 
ATOM   2300 C CB   . GLU B 1 85  ? 32.541 19.426  28.269  1.00 21.97 ? 85  GLU B CB   1 
ATOM   2301 C CG   . GLU B 1 85  ? 33.034 20.106  29.532  1.00 22.81 ? 85  GLU B CG   1 
ATOM   2302 C CD   . GLU B 1 85  ? 33.398 21.567  29.325  1.00 30.73 ? 85  GLU B CD   1 
ATOM   2303 O OE1  . GLU B 1 85  ? 33.661 21.982  28.173  1.00 27.65 ? 85  GLU B OE1  1 
ATOM   2304 O OE2  . GLU B 1 85  ? 33.404 22.308  30.332  1.00 32.23 ? 85  GLU B OE2  1 
ATOM   2305 N N    . ALA B 1 86  ? 31.776 16.866  26.514  1.00 16.11 ? 86  ALA B N    1 
ATOM   2306 C CA   . ALA B 1 86  ? 31.319 16.303  25.245  1.00 13.70 ? 86  ALA B CA   1 
ATOM   2307 C C    . ALA B 1 86  ? 30.008 15.557  25.452  1.00 16.13 ? 86  ALA B C    1 
ATOM   2308 O O    . ALA B 1 86  ? 29.086 15.662  24.636  1.00 18.51 ? 86  ALA B O    1 
ATOM   2309 C CB   . ALA B 1 86  ? 32.370 15.372  24.672  1.00 10.98 ? 86  ALA B CB   1 
ATOM   2310 N N    . ALA B 1 87  ? 29.919 14.829  26.565  1.00 16.89 ? 87  ALA B N    1 
ATOM   2311 C CA   . ALA B 1 87  ? 28.711 14.078  26.897  1.00 16.48 ? 87  ALA B CA   1 
ATOM   2312 C C    . ALA B 1 87  ? 27.547 15.033  27.175  1.00 16.98 ? 87  ALA B C    1 
ATOM   2313 O O    . ALA B 1 87  ? 26.414 14.784  26.757  1.00 15.22 ? 87  ALA B O    1 
ATOM   2314 C CB   . ALA B 1 87  ? 28.963 13.181  28.101  1.00 16.88 ? 87  ALA B CB   1 
ATOM   2315 N N    . LEU B 1 88  ? 27.836 16.138  27.862  1.00 19.94 ? 88  LEU B N    1 
ATOM   2316 C CA   . LEU B 1 88  ? 26.813 17.132  28.189  1.00 17.75 ? 88  LEU B CA   1 
ATOM   2317 C C    . LEU B 1 88  ? 26.309 17.856  26.939  1.00 15.35 ? 88  LEU B C    1 
ATOM   2318 O O    . LEU B 1 88  ? 25.115 18.135  26.813  1.00 14.44 ? 88  LEU B O    1 
ATOM   2319 C CB   . LEU B 1 88  ? 27.346 18.130  29.221  1.00 17.60 ? 88  LEU B CB   1 
ATOM   2320 C CG   . LEU B 1 88  ? 27.814 17.500  30.538  1.00 23.29 ? 88  LEU B CG   1 
ATOM   2321 C CD1  . LEU B 1 88  ? 28.291 18.577  31.499  1.00 18.27 ? 88  LEU B CD1  1 
ATOM   2322 C CD2  . LEU B 1 88  ? 26.685 16.686  31.159  1.00 17.93 ? 88  LEU B CD2  1 
ATOM   2323 N N    . VAL B 1 89  ? 27.222 18.129  26.006  1.00 15.34 ? 89  VAL B N    1 
ATOM   2324 C CA   . VAL B 1 89  ? 26.884 18.790  24.745  1.00 15.99 ? 89  VAL B CA   1 
ATOM   2325 C C    . VAL B 1 89  ? 25.902 17.905  23.963  1.00 18.47 ? 89  VAL B C    1 
ATOM   2326 O O    . VAL B 1 89  ? 24.910 18.398  23.412  1.00 14.65 ? 89  VAL B O    1 
ATOM   2327 C CB   . VAL B 1 89  ? 28.152 19.048  23.890  1.00 17.28 ? 89  VAL B CB   1 
ATOM   2328 C CG1  . VAL B 1 89  ? 27.769 19.597  22.529  1.00 18.91 ? 89  VAL B CG1  1 
ATOM   2329 C CG2  . VAL B 1 89  ? 29.079 20.024  24.603  1.00 14.77 ? 89  VAL B CG2  1 
ATOM   2330 N N    . ASP B 1 90  ? 26.182 16.598  23.937  1.00 15.26 ? 90  ASP B N    1 
ATOM   2331 C CA   . ASP B 1 90  ? 25.326 15.624  23.261  1.00 12.80 ? 90  ASP B CA   1 
ATOM   2332 C C    . ASP B 1 90  ? 23.949 15.585  23.907  1.00 13.24 ? 90  ASP B C    1 
ATOM   2333 O O    . ASP B 1 90  ? 22.933 15.535  23.218  1.00 13.97 ? 90  ASP B O    1 
ATOM   2334 C CB   . ASP B 1 90  ? 25.940 14.218  23.323  1.00 14.48 ? 90  ASP B CB   1 
ATOM   2335 C CG   . ASP B 1 90  ? 27.019 14.002  22.289  1.00 15.65 ? 90  ASP B CG   1 
ATOM   2336 O OD1  . ASP B 1 90  ? 26.959 14.637  21.213  1.00 14.40 ? 90  ASP B OD1  1 
ATOM   2337 O OD2  . ASP B 1 90  ? 27.936 13.204  22.566  1.00 17.26 ? 90  ASP B OD2  1 
ATOM   2338 N N    . MET B 1 91  ? 23.924 15.588  25.238  1.00 14.36 ? 91  MET B N    1 
ATOM   2339 C CA   . MET B 1 91  ? 22.672 15.555  25.986  1.00 12.69 ? 91  MET B CA   1 
ATOM   2340 C C    . MET B 1 91  ? 21.813 16.771  25.659  1.00 11.09 ? 91  MET B C    1 
ATOM   2341 O O    . MET B 1 91  ? 20.588 16.663  25.543  1.00 10.93 ? 91  MET B O    1 
ATOM   2342 C CB   . MET B 1 91  ? 22.956 15.477  27.488  1.00 14.64 ? 91  MET B CB   1 
ATOM   2343 C CG   . MET B 1 91  ? 21.707 15.396  28.351  1.00 19.85 ? 91  MET B CG   1 
ATOM   2344 S SD   . MET B 1 91  ? 22.102 15.155  30.091  1.00 18.21 ? 91  MET B SD   1 
ATOM   2345 C CE   . MET B 1 91  ? 23.017 16.647  30.464  1.00 23.76 ? 91  MET B CE   1 
ATOM   2346 N N    . VAL B 1 92  ? 22.458 17.927  25.515  1.00 10.63 ? 92  VAL B N    1 
ATOM   2347 C CA   . VAL B 1 92  ? 21.746 19.157  25.170  1.00 10.30 ? 92  VAL B CA   1 
ATOM   2348 C C    . VAL B 1 92  ? 21.214 19.040  23.741  1.00 11.62 ? 92  VAL B C    1 
ATOM   2349 O O    . VAL B 1 92  ? 20.031 19.262  23.500  1.00 10.63 ? 92  VAL B O    1 
ATOM   2350 C CB   . VAL B 1 92  ? 22.671 20.407  25.281  1.00 14.19 ? 92  VAL B CB   1 
ATOM   2351 C CG1  . VAL B 1 92  ? 21.952 21.644  24.752  1.00 10.37 ? 92  VAL B CG1  1 
ATOM   2352 C CG2  . VAL B 1 92  ? 23.086 20.631  26.732  1.00 7.97  ? 92  VAL B CG2  1 
ATOM   2353 N N    . ASN B 1 93  ? 22.072 18.629  22.808  1.00 14.15 ? 93  ASN B N    1 
ATOM   2354 C CA   . ASN B 1 93  ? 21.668 18.489  21.410  1.00 13.30 ? 93  ASN B CA   1 
ATOM   2355 C C    . ASN B 1 93  ? 20.535 17.488  21.208  1.00 13.41 ? 93  ASN B C    1 
ATOM   2356 O O    . ASN B 1 93  ? 19.615 17.745  20.426  1.00 12.03 ? 93  ASN B O    1 
ATOM   2357 C CB   . ASN B 1 93  ? 22.855 18.117  20.516  1.00 14.30 ? 93  ASN B CB   1 
ATOM   2358 C CG   . ASN B 1 93  ? 22.628 18.539  19.071  1.00 22.01 ? 93  ASN B CG   1 
ATOM   2359 O OD1  . ASN B 1 93  ? 22.579 19.731  18.777  1.00 19.95 ? 93  ASN B OD1  1 
ATOM   2360 N ND2  . ASN B 1 93  ? 22.480 17.570  18.173  1.00 15.93 ? 93  ASN B ND2  1 
ATOM   2361 N N    . ASP B 1 94  ? 20.599 16.355  21.910  1.00 11.97 ? 94  ASP B N    1 
ATOM   2362 C CA   . ASP B 1 94  ? 19.549 15.339  21.806  1.00 9.81  ? 94  ASP B CA   1 
ATOM   2363 C C    . ASP B 1 94  ? 18.238 15.923  22.316  1.00 12.96 ? 94  ASP B C    1 
ATOM   2364 O O    . ASP B 1 94  ? 17.166 15.611  21.793  1.00 17.36 ? 94  ASP B O    1 
ATOM   2365 C CB   . ASP B 1 94  ? 19.918 14.083  22.604  1.00 14.72 ? 94  ASP B CB   1 
ATOM   2366 C CG   . ASP B 1 94  ? 21.011 13.259  21.939  1.00 18.65 ? 94  ASP B CG   1 
ATOM   2367 O OD1  . ASP B 1 94  ? 21.498 13.644  20.856  1.00 22.92 ? 94  ASP B OD1  1 
ATOM   2368 O OD2  . ASP B 1 94  ? 21.404 12.224  22.509  1.00 24.15 ? 94  ASP B OD2  1 
ATOM   2369 N N    . GLY B 1 95  ? 18.336 16.778  23.333  1.00 12.02 ? 95  GLY B N    1 
ATOM   2370 C CA   . GLY B 1 95  ? 17.158 17.425  23.879  1.00 9.93  ? 95  GLY B CA   1 
ATOM   2371 C C    . GLY B 1 95  ? 16.588 18.374  22.842  1.00 14.76 ? 95  GLY B C    1 
ATOM   2372 O O    . GLY B 1 95  ? 15.378 18.397  22.616  1.00 14.61 ? 95  GLY B O    1 
ATOM   2373 N N    . VAL B 1 96  ? 17.463 19.141  22.190  1.00 14.66 ? 96  VAL B N    1 
ATOM   2374 C CA   . VAL B 1 96  ? 17.038 20.080  21.154  1.00 15.34 ? 96  VAL B CA   1 
ATOM   2375 C C    . VAL B 1 96  ? 16.352 19.311  20.018  1.00 20.89 ? 96  VAL B C    1 
ATOM   2376 O O    . VAL B 1 96  ? 15.270 19.694  19.564  1.00 15.99 ? 96  VAL B O    1 
ATOM   2377 C CB   . VAL B 1 96  ? 18.241 20.868  20.583  1.00 16.44 ? 96  VAL B CB   1 
ATOM   2378 C CG1  . VAL B 1 96  ? 17.815 21.698  19.370  1.00 12.22 ? 96  VAL B CG1  1 
ATOM   2379 C CG2  . VAL B 1 96  ? 18.839 21.762  21.660  1.00 14.38 ? 96  VAL B CG2  1 
ATOM   2380 N N    . GLU B 1 97  ? 16.970 18.204  19.602  1.00 22.54 ? 97  GLU B N    1 
ATOM   2381 C CA   . GLU B 1 97  ? 16.447 17.363  18.527  1.00 19.29 ? 97  GLU B CA   1 
ATOM   2382 C C    . GLU B 1 97  ? 15.045 16.827  18.829  1.00 17.91 ? 97  GLU B C    1 
ATOM   2383 O O    . GLU B 1 97  ? 14.189 16.795  17.943  1.00 17.10 ? 97  GLU B O    1 
ATOM   2384 C CB   . GLU B 1 97  ? 17.425 16.217  18.231  1.00 16.07 ? 97  GLU B CB   1 
ATOM   2385 C CG   . GLU B 1 97  ? 16.930 15.182  17.217  1.00 21.39 ? 97  GLU B CG   1 
ATOM   2386 C CD   . GLU B 1 97  ? 16.542 15.782  15.868  1.00 26.63 ? 97  GLU B CD   1 
ATOM   2387 O OE1  . GLU B 1 97  ? 17.213 16.728  15.403  1.00 26.23 ? 97  GLU B OE1  1 
ATOM   2388 O OE2  . GLU B 1 97  ? 15.558 15.300  15.270  1.00 26.95 ? 97  GLU B OE2  1 
ATOM   2389 N N    . ASP B 1 98  ? 14.811 16.422  20.078  1.00 17.96 ? 98  ASP B N    1 
ATOM   2390 C CA   . ASP B 1 98  ? 13.501 15.916  20.485  1.00 14.82 ? 98  ASP B CA   1 
ATOM   2391 C C    . ASP B 1 98  ? 12.428 16.985  20.324  1.00 14.91 ? 98  ASP B C    1 
ATOM   2392 O O    . ASP B 1 98  ? 11.354 16.722  19.773  1.00 16.61 ? 98  ASP B O    1 
ATOM   2393 C CB   . ASP B 1 98  ? 13.523 15.428  21.941  1.00 21.11 ? 98  ASP B CB   1 
ATOM   2394 C CG   . ASP B 1 98  ? 14.125 14.036  22.094  1.00 25.97 ? 98  ASP B CG   1 
ATOM   2395 O OD1  . ASP B 1 98  ? 14.294 13.323  21.080  1.00 26.80 ? 98  ASP B OD1  1 
ATOM   2396 O OD2  . ASP B 1 98  ? 14.436 13.658  23.242  1.00 26.63 ? 98  ASP B OD2  1 
ATOM   2397 N N    . LEU B 1 99  ? 12.712 18.192  20.808  1.00 16.65 ? 99  LEU B N    1 
ATOM   2398 C CA   . LEU B 1 99  ? 11.748 19.283  20.691  1.00 16.06 ? 99  LEU B CA   1 
ATOM   2399 C C    . LEU B 1 99  ? 11.590 19.711  19.229  1.00 12.76 ? 99  LEU B C    1 
ATOM   2400 O O    . LEU B 1 99  ? 10.497 20.071  18.801  1.00 21.60 ? 99  LEU B O    1 
ATOM   2401 C CB   . LEU B 1 99  ? 12.147 20.466  21.576  1.00 18.00 ? 99  LEU B CB   1 
ATOM   2402 C CG   . LEU B 1 99  ? 11.181 21.659  21.589  1.00 21.48 ? 99  LEU B CG   1 
ATOM   2403 C CD1  . LEU B 1 99  ? 9.746  21.199  21.787  1.00 15.93 ? 99  LEU B CD1  1 
ATOM   2404 C CD2  . LEU B 1 99  ? 11.587 22.628  22.685  1.00 17.55 ? 99  LEU B CD2  1 
ATOM   2405 N N    . ARG B 1 100 ? 12.669 19.625  18.457  1.00 13.56 ? 100 ARG B N    1 
ATOM   2406 C CA   . ARG B 1 100 ? 12.616 19.991  17.044  1.00 16.04 ? 100 ARG B CA   1 
ATOM   2407 C C    . ARG B 1 100 ? 11.662 19.064  16.289  1.00 16.92 ? 100 ARG B C    1 
ATOM   2408 O O    . ARG B 1 100 ? 10.905 19.522  15.438  1.00 19.33 ? 100 ARG B O    1 
ATOM   2409 C CB   . ARG B 1 100 ? 14.010 19.963  16.409  1.00 7.52  ? 100 ARG B CB   1 
ATOM   2410 C CG   . ARG B 1 100 ? 14.030 20.509  14.987  1.00 12.34 ? 100 ARG B CG   1 
ATOM   2411 C CD   . ARG B 1 100 ? 15.426 20.507  14.384  1.00 10.97 ? 100 ARG B CD   1 
ATOM   2412 N NE   . ARG B 1 100 ? 16.329 21.450  15.044  1.00 16.90 ? 100 ARG B NE   1 
ATOM   2413 C CZ   . ARG B 1 100 ? 16.341 22.765  14.831  1.00 19.86 ? 100 ARG B CZ   1 
ATOM   2414 N NH1  . ARG B 1 100 ? 15.489 23.318  13.972  1.00 16.38 ? 100 ARG B NH1  1 
ATOM   2415 N NH2  . ARG B 1 100 ? 17.218 23.530  15.469  1.00 13.57 ? 100 ARG B NH2  1 
ATOM   2416 N N    . CYS B 1 101 ? 11.678 17.770  16.622  1.00 16.14 ? 101 CYS B N    1 
ATOM   2417 C CA   . CYS B 1 101 ? 10.790 16.800  15.979  1.00 16.98 ? 101 CYS B CA   1 
ATOM   2418 C C    . CYS B 1 101 ? 9.335  17.124  16.262  1.00 20.79 ? 101 CYS B C    1 
ATOM   2419 O O    . CYS B 1 101 ? 8.483  16.982  15.386  1.00 25.84 ? 101 CYS B O    1 
ATOM   2420 C CB   . CYS B 1 101 ? 11.092 15.375  16.441  1.00 16.22 ? 101 CYS B CB   1 
ATOM   2421 S SG   . CYS B 1 101 ? 12.566 14.679  15.689  1.00 31.13 ? 101 CYS B SG   1 
ATOM   2422 N N    . LYS B 1 102 ? 9.052  17.550  17.489  1.00 16.81 ? 102 LYS B N    1 
ATOM   2423 C CA   . LYS B 1 102 ? 7.690  17.910  17.868  1.00 18.43 ? 102 LYS B CA   1 
ATOM   2424 C C    . LYS B 1 102 ? 7.270  19.145  17.081  1.00 19.03 ? 102 LYS B C    1 
ATOM   2425 O O    . LYS B 1 102 ? 6.141  19.227  16.605  1.00 20.26 ? 102 LYS B O    1 
ATOM   2426 C CB   . LYS B 1 102 ? 7.607  18.191  19.366  1.00 20.91 ? 102 LYS B CB   1 
ATOM   2427 C CG   . LYS B 1 102 ? 7.880  16.969  20.214  1.00 27.44 ? 102 LYS B CG   1 
ATOM   2428 C CD   . LYS B 1 102 ? 7.819  17.294  21.684  1.00 32.63 ? 102 LYS B CD   1 
ATOM   2429 C CE   . LYS B 1 102 ? 8.025  16.044  22.512  1.00 36.78 ? 102 LYS B CE   1 
ATOM   2430 N NZ   . LYS B 1 102 ? 8.034  16.358  23.964  1.00 42.67 ? 102 LYS B NZ   1 
ATOM   2431 N N    . TYR B 1 103 ? 8.198  20.090  16.935  1.00 19.86 ? 103 TYR B N    1 
ATOM   2432 C CA   . TYR B 1 103 ? 7.954  21.321  16.190  1.00 21.42 ? 103 TYR B CA   1 
ATOM   2433 C C    . TYR B 1 103 ? 7.651  20.977  14.733  1.00 22.22 ? 103 TYR B C    1 
ATOM   2434 O O    . TYR B 1 103 ? 6.667  21.450  14.167  1.00 19.68 ? 103 TYR B O    1 
ATOM   2435 C CB   . TYR B 1 103 ? 9.184  22.241  16.271  1.00 26.62 ? 103 TYR B CB   1 
ATOM   2436 C CG   . TYR B 1 103 ? 9.153  23.430  15.325  1.00 28.17 ? 103 TYR B CG   1 
ATOM   2437 C CD1  . TYR B 1 103 ? 8.483  24.602  15.671  1.00 26.88 ? 103 TYR B CD1  1 
ATOM   2438 C CD2  . TYR B 1 103 ? 9.793  23.384  14.084  1.00 29.97 ? 103 TYR B CD2  1 
ATOM   2439 C CE1  . TYR B 1 103 ? 8.447  25.700  14.812  1.00 27.40 ? 103 TYR B CE1  1 
ATOM   2440 C CE2  . TYR B 1 103 ? 9.761  24.482  13.213  1.00 27.93 ? 103 TYR B CE2  1 
ATOM   2441 C CZ   . TYR B 1 103 ? 9.086  25.636  13.587  1.00 29.94 ? 103 TYR B CZ   1 
ATOM   2442 O OH   . TYR B 1 103 ? 9.052  26.724  12.741  1.00 30.50 ? 103 TYR B OH   1 
ATOM   2443 N N    . ILE B 1 104 ? 8.495  20.132  14.145  1.00 24.07 ? 104 ILE B N    1 
ATOM   2444 C CA   . ILE B 1 104 ? 8.338  19.704  12.761  1.00 23.97 ? 104 ILE B CA   1 
ATOM   2445 C C    . ILE B 1 104 ? 7.009  18.978  12.564  1.00 26.57 ? 104 ILE B C    1 
ATOM   2446 O O    . ILE B 1 104 ? 6.310  19.200  11.577  1.00 28.55 ? 104 ILE B O    1 
ATOM   2447 C CB   . ILE B 1 104 ? 9.524  18.809  12.332  1.00 22.07 ? 104 ILE B CB   1 
ATOM   2448 C CG1  . ILE B 1 104 ? 10.794 19.659  12.248  1.00 16.09 ? 104 ILE B CG1  1 
ATOM   2449 C CG2  . ILE B 1 104 ? 9.239  18.129  10.989  1.00 21.11 ? 104 ILE B CG2  1 
ATOM   2450 C CD1  . ILE B 1 104 ? 12.059 18.852  12.096  1.00 18.34 ? 104 ILE B CD1  1 
ATOM   2451 N N    . SER B 1 105 ? 6.647  18.138  13.528  1.00 27.61 ? 105 SER B N    1 
ATOM   2452 C CA   . SER B 1 105 ? 5.395  17.401  13.455  1.00 26.28 ? 105 SER B CA   1 
ATOM   2453 C C    . SER B 1 105 ? 4.225  18.376  13.427  1.00 28.13 ? 105 SER B C    1 
ATOM   2454 O O    . SER B 1 105 ? 3.277  18.187  12.676  1.00 26.69 ? 105 SER B O    1 
ATOM   2455 C CB   . SER B 1 105 ? 5.260  16.454  14.646  1.00 28.21 ? 105 SER B CB   1 
ATOM   2456 O OG   . SER B 1 105 ? 4.076  15.684  14.542  1.00 37.44 ? 105 SER B OG   1 
ATOM   2457 N N    . LEU B 1 106 ? 4.302  19.428  14.238  1.00 27.67 ? 106 LEU B N    1 
ATOM   2458 C CA   . LEU B 1 106 ? 3.243  20.435  14.283  1.00 27.62 ? 106 LEU B CA   1 
ATOM   2459 C C    . LEU B 1 106 ? 3.116  21.168  12.946  1.00 27.00 ? 106 LEU B C    1 
ATOM   2460 O O    . LEU B 1 106 ? 2.035  21.234  12.363  1.00 25.81 ? 106 LEU B O    1 
ATOM   2461 C CB   . LEU B 1 106 ? 3.521  21.456  15.390  1.00 25.45 ? 106 LEU B CB   1 
ATOM   2462 C CG   . LEU B 1 106 ? 2.609  22.690  15.396  1.00 24.87 ? 106 LEU B CG   1 
ATOM   2463 C CD1  . LEU B 1 106 ? 1.190  22.296  15.764  1.00 27.15 ? 106 LEU B CD1  1 
ATOM   2464 C CD2  . LEU B 1 106 ? 3.136  23.722  16.366  1.00 23.56 ? 106 LEU B CD2  1 
ATOM   2465 N N    . ILE B 1 107 ? 4.238  21.706  12.475  1.00 25.14 ? 107 ILE B N    1 
ATOM   2466 C CA   . ILE B 1 107 ? 4.301  22.455  11.222  1.00 27.04 ? 107 ILE B CA   1 
ATOM   2467 C C    . ILE B 1 107 ? 3.781  21.697  9.996   1.00 28.00 ? 107 ILE B C    1 
ATOM   2468 O O    . ILE B 1 107 ? 2.953  22.214  9.241   1.00 27.57 ? 107 ILE B O    1 
ATOM   2469 C CB   . ILE B 1 107 ? 5.750  22.927  10.947  1.00 23.95 ? 107 ILE B CB   1 
ATOM   2470 C CG1  . ILE B 1 107 ? 6.208  23.887  12.046  1.00 23.85 ? 107 ILE B CG1  1 
ATOM   2471 C CG2  . ILE B 1 107 ? 5.851  23.592  9.585   1.00 23.65 ? 107 ILE B CG2  1 
ATOM   2472 C CD1  . ILE B 1 107 ? 5.366  25.145  12.168  1.00 24.91 ? 107 ILE B CD1  1 
ATOM   2473 N N    . TYR B 1 108 ? 4.242  20.464  9.824   1.00 27.63 ? 108 TYR B N    1 
ATOM   2474 C CA   . TYR B 1 108 ? 3.856  19.651  8.679   1.00 29.34 ? 108 TYR B CA   1 
ATOM   2475 C C    . TYR B 1 108 ? 2.638  18.741  8.828   1.00 30.46 ? 108 TYR B C    1 
ATOM   2476 O O    . TYR B 1 108 ? 2.021  18.380  7.832   1.00 34.36 ? 108 TYR B O    1 
ATOM   2477 C CB   . TYR B 1 108 ? 5.061  18.830  8.210   1.00 26.16 ? 108 TYR B CB   1 
ATOM   2478 C CG   . TYR B 1 108 ? 6.208  19.676  7.688   1.00 26.41 ? 108 TYR B CG   1 
ATOM   2479 C CD1  . TYR B 1 108 ? 6.221  20.125  6.366   1.00 27.77 ? 108 TYR B CD1  1 
ATOM   2480 C CD2  . TYR B 1 108 ? 7.282  20.026  8.508   1.00 23.76 ? 108 TYR B CD2  1 
ATOM   2481 C CE1  . TYR B 1 108 ? 7.282  20.904  5.867   1.00 28.56 ? 108 TYR B CE1  1 
ATOM   2482 C CE2  . TYR B 1 108 ? 8.347  20.806  8.020   1.00 26.85 ? 108 TYR B CE2  1 
ATOM   2483 C CZ   . TYR B 1 108 ? 8.341  21.240  6.698   1.00 29.26 ? 108 TYR B CZ   1 
ATOM   2484 O OH   . TYR B 1 108 ? 9.388  22.002  6.214   1.00 25.57 ? 108 TYR B OH   1 
ATOM   2485 N N    . THR B 1 109 ? 2.273  18.393  10.056  1.00 36.41 ? 109 THR B N    1 
ATOM   2486 C CA   . THR B 1 109 ? 1.141  17.493  10.283  1.00 36.88 ? 109 THR B CA   1 
ATOM   2487 C C    . THR B 1 109 ? -0.188 18.145  10.656  1.00 39.16 ? 109 THR B C    1 
ATOM   2488 O O    . THR B 1 109 ? -1.214 17.829  10.052  1.00 45.62 ? 109 THR B O    1 
ATOM   2489 C CB   . THR B 1 109 ? 1.513  16.391  11.303  1.00 38.45 ? 109 THR B CB   1 
ATOM   2490 O OG1  . THR B 1 109 ? 2.545  15.570  10.741  1.00 39.55 ? 109 THR B OG1  1 
ATOM   2491 C CG2  . THR B 1 109 ? 0.307  15.529  11.661  1.00 40.13 ? 109 THR B CG2  1 
ATOM   2492 N N    . ASN B 1 110 ? -0.187 19.046  11.634  1.00 37.69 ? 110 ASN B N    1 
ATOM   2493 C CA   . ASN B 1 110 ? -1.432 19.699  12.038  1.00 39.05 ? 110 ASN B CA   1 
ATOM   2494 C C    . ASN B 1 110 ? -1.225 21.057  12.703  1.00 38.04 ? 110 ASN B C    1 
ATOM   2495 O O    . ASN B 1 110 ? -1.492 21.239  13.894  1.00 33.79 ? 110 ASN B O    1 
ATOM   2496 C CB   . ASN B 1 110 ? -2.274 18.769  12.929  1.00 43.62 ? 110 ASN B CB   1 
ATOM   2497 C CG   . ASN B 1 110 ? -1.624 18.477  14.272  1.00 48.97 ? 110 ASN B CG   1 
ATOM   2498 O OD1  . ASN B 1 110 ? -2.316 18.297  15.273  1.00 47.92 ? 110 ASN B OD1  1 
ATOM   2499 N ND2  . ASN B 1 110 ? -0.291 18.437  14.304  1.00 51.09 ? 110 ASN B ND2  1 
ATOM   2500 N N    . TYR B 1 111 ? -0.765 22.016  11.905  1.00 34.78 ? 111 TYR B N    1 
ATOM   2501 C CA   . TYR B 1 111 ? -0.513 23.365  12.382  1.00 35.81 ? 111 TYR B CA   1 
ATOM   2502 C C    . TYR B 1 111 ? -1.771 24.047  12.921  1.00 38.74 ? 111 TYR B C    1 
ATOM   2503 O O    . TYR B 1 111 ? -1.804 24.479  14.073  1.00 38.42 ? 111 TYR B O    1 
ATOM   2504 C CB   . TYR B 1 111 ? 0.096  24.206  11.261  1.00 32.89 ? 111 TYR B CB   1 
ATOM   2505 C CG   . TYR B 1 111 ? 0.426  25.621  11.673  1.00 36.04 ? 111 TYR B CG   1 
ATOM   2506 C CD1  . TYR B 1 111 ? 1.664  25.932  12.233  1.00 35.00 ? 111 TYR B CD1  1 
ATOM   2507 C CD2  . TYR B 1 111 ? -0.505 26.647  11.520  1.00 35.41 ? 111 TYR B CD2  1 
ATOM   2508 C CE1  . TYR B 1 111 ? 1.966  27.231  12.632  1.00 38.24 ? 111 TYR B CE1  1 
ATOM   2509 C CE2  . TYR B 1 111 ? -0.215 27.947  11.918  1.00 37.46 ? 111 TYR B CE2  1 
ATOM   2510 C CZ   . TYR B 1 111 ? 1.021  28.232  12.473  1.00 40.15 ? 111 TYR B CZ   1 
ATOM   2511 O OH   . TYR B 1 111 ? 1.304  29.514  12.883  1.00 45.15 ? 111 TYR B OH   1 
ATOM   2512 N N    . GLU B 1 112 ? -2.799 24.128  12.081  1.00 42.24 ? 112 GLU B N    1 
ATOM   2513 C CA   . GLU B 1 112 ? -4.061 24.774  12.438  1.00 42.80 ? 112 GLU B CA   1 
ATOM   2514 C C    . GLU B 1 112 ? -4.682 24.216  13.704  1.00 39.71 ? 112 GLU B C    1 
ATOM   2515 O O    . GLU B 1 112 ? -4.957 24.955  14.646  1.00 39.18 ? 112 GLU B O    1 
ATOM   2516 C CB   . GLU B 1 112 ? -5.072 24.656  11.293  1.00 46.31 ? 112 GLU B CB   1 
ATOM   2517 C CG   . GLU B 1 112 ? -4.747 25.487  10.056  1.00 51.95 ? 112 GLU B CG   1 
ATOM   2518 C CD   . GLU B 1 112 ? -3.492 25.022  9.329   1.00 57.89 ? 112 GLU B CD   1 
ATOM   2519 O OE1  . GLU B 1 112 ? -3.303 23.796  9.158   1.00 56.58 ? 112 GLU B OE1  1 
ATOM   2520 O OE2  . GLU B 1 112 ? -2.683 25.888  8.932   1.00 59.52 ? 112 GLU B OE2  1 
ATOM   2521 N N    . ALA B 1 113 ? -4.875 22.902  13.721  1.00 39.33 ? 113 ALA B N    1 
ATOM   2522 C CA   . ALA B 1 113 ? -5.482 22.224  14.855  1.00 40.35 ? 113 ALA B CA   1 
ATOM   2523 C C    . ALA B 1 113 ? -4.635 22.194  16.128  1.00 43.21 ? 113 ALA B C    1 
ATOM   2524 O O    . ALA B 1 113 ? -5.099 22.605  17.190  1.00 49.97 ? 113 ALA B O    1 
ATOM   2525 C CB   . ALA B 1 113 ? -5.876 20.808  14.455  1.00 37.80 ? 113 ALA B CB   1 
ATOM   2526 N N    . GLY B 1 114 ? -3.386 21.751  16.011  1.00 45.06 ? 114 GLY B N    1 
ATOM   2527 C CA   . GLY B 1 114 ? -2.527 21.636  17.180  1.00 39.93 ? 114 GLY B CA   1 
ATOM   2528 C C    . GLY B 1 114 ? -1.730 22.819  17.700  1.00 37.84 ? 114 GLY B C    1 
ATOM   2529 O O    . GLY B 1 114 ? -1.086 22.692  18.743  1.00 38.69 ? 114 GLY B O    1 
ATOM   2530 N N    . LYS B 1 115 ? -1.782 23.963  17.023  1.00 34.92 ? 115 LYS B N    1 
ATOM   2531 C CA   . LYS B 1 115 ? -1.015 25.137  17.447  1.00 35.21 ? 115 LYS B CA   1 
ATOM   2532 C C    . LYS B 1 115 ? -1.252 25.599  18.888  1.00 37.65 ? 115 LYS B C    1 
ATOM   2533 O O    . LYS B 1 115 ? -0.306 25.962  19.589  1.00 33.26 ? 115 LYS B O    1 
ATOM   2534 C CB   . LYS B 1 115 ? -1.237 26.306  16.482  1.00 33.28 ? 115 LYS B CB   1 
ATOM   2535 C CG   . LYS B 1 115 ? -0.333 27.505  16.738  1.00 34.59 ? 115 LYS B CG   1 
ATOM   2536 C CD   . LYS B 1 115 ? -0.692 28.675  15.835  1.00 42.26 ? 115 LYS B CD   1 
ATOM   2537 C CE   . LYS B 1 115 ? 0.090  29.931  16.202  1.00 42.85 ? 115 LYS B CE   1 
ATOM   2538 N NZ   . LYS B 1 115 ? 1.560  29.765  16.014  1.00 50.95 ? 115 LYS B NZ   1 
ATOM   2539 N N    . ASP B 1 116 ? -2.505 25.568  19.335  1.00 40.00 ? 116 ASP B N    1 
ATOM   2540 C CA   . ASP B 1 116 ? -2.839 26.006  20.690  1.00 40.24 ? 116 ASP B CA   1 
ATOM   2541 C C    . ASP B 1 116 ? -2.306 25.108  21.802  1.00 39.40 ? 116 ASP B C    1 
ATOM   2542 O O    . ASP B 1 116 ? -1.699 25.596  22.757  1.00 39.07 ? 116 ASP B O    1 
ATOM   2543 C CB   . ASP B 1 116 ? -4.348 26.207  20.830  1.00 45.37 ? 116 ASP B CB   1 
ATOM   2544 C CG   . ASP B 1 116 ? -4.876 27.310  19.919  1.00 52.94 ? 116 ASP B CG   1 
ATOM   2545 O OD1  . ASP B 1 116 ? -4.157 28.310  19.689  1.00 51.62 ? 116 ASP B OD1  1 
ATOM   2546 O OD2  . ASP B 1 116 ? -6.009 27.171  19.413  1.00 57.21 ? 116 ASP B OD2  1 
ATOM   2547 N N    . ASP B 1 117 ? -2.517 23.801  21.672  1.00 39.40 ? 117 ASP B N    1 
ATOM   2548 C CA   . ASP B 1 117 ? -2.039 22.850  22.672  1.00 39.34 ? 117 ASP B CA   1 
ATOM   2549 C C    . ASP B 1 117 ? -0.516 22.871  22.767  1.00 39.16 ? 117 ASP B C    1 
ATOM   2550 O O    . ASP B 1 117 ? 0.047  22.817  23.864  1.00 37.90 ? 117 ASP B O    1 
ATOM   2551 C CB   . ASP B 1 117 ? -2.518 21.435  22.340  1.00 39.80 ? 117 ASP B CB   1 
ATOM   2552 C CG   . ASP B 1 117 ? -4.015 21.254  22.543  1.00 44.62 ? 117 ASP B CG   1 
ATOM   2553 O OD1  . ASP B 1 117 ? -4.667 22.136  23.149  1.00 41.27 ? 117 ASP B OD1  1 
ATOM   2554 O OD2  . ASP B 1 117 ? -4.538 20.205  22.115  1.00 46.63 ? 117 ASP B OD2  1 
ATOM   2555 N N    . TYR B 1 118 ? 0.137  22.965  21.609  1.00 36.72 ? 118 TYR B N    1 
ATOM   2556 C CA   . TYR B 1 118 ? 1.595  23.001  21.529  1.00 33.77 ? 118 TYR B CA   1 
ATOM   2557 C C    . TYR B 1 118 ? 2.170  24.200  22.286  1.00 31.74 ? 118 TYR B C    1 
ATOM   2558 O O    . TYR B 1 118 ? 3.147  24.064  23.025  1.00 29.32 ? 118 TYR B O    1 
ATOM   2559 C CB   . TYR B 1 118 ? 2.042  23.040  20.060  1.00 26.76 ? 118 TYR B CB   1 
ATOM   2560 C CG   . TYR B 1 118 ? 3.539  22.929  19.861  1.00 27.02 ? 118 TYR B CG   1 
ATOM   2561 C CD1  . TYR B 1 118 ? 4.360  24.052  19.956  1.00 22.08 ? 118 TYR B CD1  1 
ATOM   2562 C CD2  . TYR B 1 118 ? 4.137  21.701  19.584  1.00 25.26 ? 118 TYR B CD2  1 
ATOM   2563 C CE1  . TYR B 1 118 ? 5.732  23.955  19.784  1.00 21.48 ? 118 TYR B CE1  1 
ATOM   2564 C CE2  . TYR B 1 118 ? 5.512  21.594  19.408  1.00 23.74 ? 118 TYR B CE2  1 
ATOM   2565 C CZ   . TYR B 1 118 ? 6.301  22.725  19.511  1.00 22.53 ? 118 TYR B CZ   1 
ATOM   2566 O OH   . TYR B 1 118 ? 7.658  22.634  19.341  1.00 22.91 ? 118 TYR B OH   1 
ATOM   2567 N N    . VAL B 1 119 ? 1.577  25.374  22.085  1.00 33.54 ? 119 VAL B N    1 
ATOM   2568 C CA   . VAL B 1 119 ? 2.038  26.587  22.758  1.00 34.40 ? 119 VAL B CA   1 
ATOM   2569 C C    . VAL B 1 119 ? 1.817  26.511  24.277  1.00 34.73 ? 119 VAL B C    1 
ATOM   2570 O O    . VAL B 1 119 ? 2.627  27.029  25.046  1.00 36.01 ? 119 VAL B O    1 
ATOM   2571 C CB   . VAL B 1 119 ? 1.365  27.853  22.165  1.00 34.26 ? 119 VAL B CB   1 
ATOM   2572 C CG1  . VAL B 1 119 ? 1.844  29.106  22.885  1.00 30.64 ? 119 VAL B CG1  1 
ATOM   2573 C CG2  . VAL B 1 119 ? 1.691  27.963  20.684  1.00 32.59 ? 119 VAL B CG2  1 
ATOM   2574 N N    . LYS B 1 120 ? 0.740  25.844  24.700  1.00 35.93 ? 120 LYS B N    1 
ATOM   2575 C CA   . LYS B 1 120 ? 0.435  25.679  26.125  1.00 36.66 ? 120 LYS B CA   1 
ATOM   2576 C C    . LYS B 1 120 ? 1.476  24.785  26.796  1.00 34.60 ? 120 LYS B C    1 
ATOM   2577 O O    . LYS B 1 120 ? 1.872  25.029  27.934  1.00 33.78 ? 120 LYS B O    1 
ATOM   2578 C CB   . LYS B 1 120 ? -0.946 25.048  26.318  1.00 42.16 ? 120 LYS B CB   1 
ATOM   2579 C CG   . LYS B 1 120 ? -2.102 25.896  25.826  1.00 52.65 ? 120 LYS B CG   1 
ATOM   2580 C CD   . LYS B 1 120 ? -3.379 25.074  25.754  1.00 59.12 ? 120 LYS B CD   1 
ATOM   2581 C CE   . LYS B 1 120 ? -4.491 25.833  25.036  1.00 64.44 ? 120 LYS B CE   1 
ATOM   2582 N NZ   . LYS B 1 120 ? -5.667 24.959  24.755  1.00 66.81 ? 120 LYS B NZ   1 
ATOM   2583 N N    . ALA B 1 121 ? 1.914  23.754  26.077  1.00 32.64 ? 121 ALA B N    1 
ATOM   2584 C CA   . ALA B 1 121 ? 2.905  22.807  26.586  1.00 29.72 ? 121 ALA B CA   1 
ATOM   2585 C C    . ALA B 1 121 ? 4.346  23.304  26.472  1.00 24.52 ? 121 ALA B C    1 
ATOM   2586 O O    . ALA B 1 121 ? 5.249  22.747  27.094  1.00 26.35 ? 121 ALA B O    1 
ATOM   2587 C CB   . ALA B 1 121 ? 2.759  21.470  25.869  1.00 28.02 ? 121 ALA B CB   1 
ATOM   2588 N N    . LEU B 1 122 ? 4.552  24.358  25.687  1.00 22.27 ? 122 LEU B N    1 
ATOM   2589 C CA   . LEU B 1 122 ? 5.882  24.921  25.479  1.00 23.68 ? 122 LEU B CA   1 
ATOM   2590 C C    . LEU B 1 122 ? 6.729  25.192  26.726  1.00 23.00 ? 122 LEU B C    1 
ATOM   2591 O O    . LEU B 1 122 ? 7.901  24.812  26.762  1.00 27.31 ? 122 LEU B O    1 
ATOM   2592 C CB   . LEU B 1 122 ? 5.803  26.194  24.635  1.00 21.41 ? 122 LEU B CB   1 
ATOM   2593 C CG   . LEU B 1 122 ? 6.473  26.159  23.264  1.00 24.97 ? 122 LEU B CG   1 
ATOM   2594 C CD1  . LEU B 1 122 ? 6.605  27.586  22.754  1.00 20.98 ? 122 LEU B CD1  1 
ATOM   2595 C CD2  . LEU B 1 122 ? 7.844  25.500  23.355  1.00 12.67 ? 122 LEU B CD2  1 
ATOM   2596 N N    . PRO B 1 123 ? 6.167  25.863  27.752  1.00 22.31 ? 123 PRO B N    1 
ATOM   2597 C CA   . PRO B 1 123 ? 6.929  26.156  28.972  1.00 21.71 ? 123 PRO B CA   1 
ATOM   2598 C C    . PRO B 1 123 ? 7.599  24.929  29.583  1.00 17.26 ? 123 PRO B C    1 
ATOM   2599 O O    . PRO B 1 123 ? 8.756  24.985  29.994  1.00 19.83 ? 123 PRO B O    1 
ATOM   2600 C CB   . PRO B 1 123 ? 5.867  26.739  29.902  1.00 20.24 ? 123 PRO B CB   1 
ATOM   2601 C CG   . PRO B 1 123 ? 4.959  27.445  28.956  1.00 16.94 ? 123 PRO B CG   1 
ATOM   2602 C CD   . PRO B 1 123 ? 4.808  26.436  27.845  1.00 19.69 ? 123 PRO B CD   1 
ATOM   2603 N N    . GLY B 1 124 ? 6.875  23.815  29.603  1.00 22.52 ? 124 GLY B N    1 
ATOM   2604 C CA   . GLY B 1 124 ? 7.418  22.587  30.155  1.00 18.70 ? 124 GLY B CA   1 
ATOM   2605 C C    . GLY B 1 124 ? 8.564  22.068  29.314  1.00 19.03 ? 124 GLY B C    1 
ATOM   2606 O O    . GLY B 1 124 ? 9.505  21.477  29.841  1.00 21.95 ? 124 GLY B O    1 
ATOM   2607 N N    . GLN B 1 125 ? 8.479  22.294  28.004  1.00 20.58 ? 125 GLN B N    1 
ATOM   2608 C CA   . GLN B 1 125 ? 9.508  21.868  27.057  1.00 19.34 ? 125 GLN B CA   1 
ATOM   2609 C C    . GLN B 1 125 ? 10.764 22.730  27.133  1.00 20.61 ? 125 GLN B C    1 
ATOM   2610 O O    . GLN B 1 125 ? 11.866 22.246  26.898  1.00 22.56 ? 125 GLN B O    1 
ATOM   2611 C CB   . GLN B 1 125 ? 8.965  21.915  25.630  1.00 16.50 ? 125 GLN B CB   1 
ATOM   2612 C CG   . GLN B 1 125 ? 7.808  20.974  25.369  1.00 26.69 ? 125 GLN B CG   1 
ATOM   2613 C CD   . GLN B 1 125 ? 8.168  19.542  25.677  1.00 32.99 ? 125 GLN B CD   1 
ATOM   2614 O OE1  . GLN B 1 125 ? 9.177  19.035  25.196  1.00 37.77 ? 125 GLN B OE1  1 
ATOM   2615 N NE2  . GLN B 1 125 ? 7.359  18.890  26.494  1.00 40.20 ? 125 GLN B NE2  1 
ATOM   2616 N N    . LEU B 1 126 ? 10.593 24.010  27.454  1.00 20.58 ? 126 LEU B N    1 
ATOM   2617 C CA   . LEU B 1 126 ? 11.720 24.936  27.544  1.00 20.33 ? 126 LEU B CA   1 
ATOM   2618 C C    . LEU B 1 126 ? 12.449 24.947  28.888  1.00 22.06 ? 126 LEU B C    1 
ATOM   2619 O O    . LEU B 1 126 ? 13.640 25.263  28.939  1.00 21.85 ? 126 LEU B O    1 
ATOM   2620 C CB   . LEU B 1 126 ? 11.266 26.354  27.186  1.00 23.94 ? 126 LEU B CB   1 
ATOM   2621 C CG   . LEU B 1 126 ? 10.754 26.529  25.755  1.00 23.82 ? 126 LEU B CG   1 
ATOM   2622 C CD1  . LEU B 1 126 ? 10.208 27.935  25.556  1.00 22.77 ? 126 LEU B CD1  1 
ATOM   2623 C CD2  . LEU B 1 126 ? 11.876 26.229  24.770  1.00 18.90 ? 126 LEU B CD2  1 
ATOM   2624 N N    . LYS B 1 127 ? 11.745 24.601  29.968  1.00 22.88 ? 127 LYS B N    1 
ATOM   2625 C CA   . LYS B 1 127 ? 12.349 24.580  31.305  1.00 23.56 ? 127 LYS B CA   1 
ATOM   2626 C C    . LYS B 1 127 ? 13.688 23.855  31.419  1.00 19.01 ? 127 LYS B C    1 
ATOM   2627 O O    . LYS B 1 127 ? 14.613 24.371  32.047  1.00 18.84 ? 127 LYS B O    1 
ATOM   2628 C CB   . LYS B 1 127 ? 11.369 24.041  32.351  1.00 31.39 ? 127 LYS B CB   1 
ATOM   2629 C CG   . LYS B 1 127 ? 10.523 25.123  32.980  1.00 46.72 ? 127 LYS B CG   1 
ATOM   2630 C CD   . LYS B 1 127 ? 9.385  24.558  33.803  1.00 55.29 ? 127 LYS B CD   1 
ATOM   2631 C CE   . LYS B 1 127 ? 8.489  25.682  34.305  1.00 58.65 ? 127 LYS B CE   1 
ATOM   2632 N NZ   . LYS B 1 127 ? 7.241  25.172  34.936  1.00 64.54 ? 127 LYS B NZ   1 
ATOM   2633 N N    . PRO B 1 128 ? 13.818 22.654  30.814  1.00 18.13 ? 128 PRO B N    1 
ATOM   2634 C CA   . PRO B 1 128 ? 15.087 21.923  30.896  1.00 14.61 ? 128 PRO B CA   1 
ATOM   2635 C C    . PRO B 1 128 ? 16.317 22.741  30.488  1.00 18.54 ? 128 PRO B C    1 
ATOM   2636 O O    . PRO B 1 128 ? 17.377 22.628  31.112  1.00 17.61 ? 128 PRO B O    1 
ATOM   2637 C CB   . PRO B 1 128 ? 14.857 20.750  29.950  1.00 10.90 ? 128 PRO B CB   1 
ATOM   2638 C CG   . PRO B 1 128 ? 13.409 20.457  30.156  1.00 14.28 ? 128 PRO B CG   1 
ATOM   2639 C CD   . PRO B 1 128 ? 12.796 21.837  30.130  1.00 14.32 ? 128 PRO B CD   1 
ATOM   2640 N N    . PHE B 1 129 ? 16.171 23.580  29.462  1.00 17.24 ? 129 PHE B N    1 
ATOM   2641 C CA   . PHE B 1 129 ? 17.288 24.398  28.983  1.00 19.39 ? 129 PHE B CA   1 
ATOM   2642 C C    . PHE B 1 129 ? 17.600 25.577  29.910  1.00 19.51 ? 129 PHE B C    1 
ATOM   2643 O O    . PHE B 1 129 ? 18.758 25.980  30.047  1.00 17.23 ? 129 PHE B O    1 
ATOM   2644 C CB   . PHE B 1 129 ? 17.031 24.845  27.543  1.00 19.80 ? 129 PHE B CB   1 
ATOM   2645 C CG   . PHE B 1 129 ? 16.763 23.697  26.602  1.00 19.75 ? 129 PHE B CG   1 
ATOM   2646 C CD1  . PHE B 1 129 ? 17.783 22.815  26.249  1.00 25.75 ? 129 PHE B CD1  1 
ATOM   2647 C CD2  . PHE B 1 129 ? 15.482 23.466  26.109  1.00 21.30 ? 129 PHE B CD2  1 
ATOM   2648 C CE1  . PHE B 1 129 ? 17.528 21.716  25.420  1.00 20.32 ? 129 PHE B CE1  1 
ATOM   2649 C CE2  . PHE B 1 129 ? 15.218 22.371  25.280  1.00 18.54 ? 129 PHE B CE2  1 
ATOM   2650 C CZ   . PHE B 1 129 ? 16.242 21.497  24.938  1.00 17.85 ? 129 PHE B CZ   1 
ATOM   2651 N N    . GLU B 1 130 ? 16.561 26.112  30.552  1.00 19.92 ? 130 GLU B N    1 
ATOM   2652 C CA   . GLU B 1 130 ? 16.712 27.204  31.513  1.00 22.08 ? 130 GLU B CA   1 
ATOM   2653 C C    . GLU B 1 130 ? 17.490 26.636  32.711  1.00 25.40 ? 130 GLU B C    1 
ATOM   2654 O O    . GLU B 1 130 ? 18.383 27.287  33.260  1.00 24.97 ? 130 GLU B O    1 
ATOM   2655 C CB   . GLU B 1 130 ? 15.330 27.693  31.965  1.00 20.31 ? 130 GLU B CB   1 
ATOM   2656 C CG   . GLU B 1 130 ? 15.334 28.820  33.008  1.00 30.10 ? 130 GLU B CG   1 
ATOM   2657 C CD   . GLU B 1 130 ? 15.671 30.204  32.442  1.00 32.54 ? 130 GLU B CD   1 
ATOM   2658 O OE1  . GLU B 1 130 ? 15.761 30.370  31.208  1.00 32.45 ? 130 GLU B OE1  1 
ATOM   2659 O OE2  . GLU B 1 130 ? 15.837 31.147  33.245  1.00 31.25 ? 130 GLU B OE2  1 
ATOM   2660 N N    . THR B 1 131 ? 17.167 25.392  33.066  1.00 23.53 ? 131 THR B N    1 
ATOM   2661 C CA   . THR B 1 131 ? 17.807 24.682  34.169  1.00 19.38 ? 131 THR B CA   1 
ATOM   2662 C C    . THR B 1 131 ? 19.283 24.438  33.876  1.00 22.04 ? 131 THR B C    1 
ATOM   2663 O O    . THR B 1 131 ? 20.140 24.674  34.730  1.00 25.02 ? 131 THR B O    1 
ATOM   2664 C CB   . THR B 1 131 ? 17.126 23.323  34.411  1.00 24.86 ? 131 THR B CB   1 
ATOM   2665 O OG1  . THR B 1 131 ? 15.725 23.525  34.636  1.00 21.83 ? 131 THR B OG1  1 
ATOM   2666 C CG2  . THR B 1 131 ? 17.738 22.622  35.618  1.00 21.09 ? 131 THR B CG2  1 
ATOM   2667 N N    . LEU B 1 132 ? 19.571 23.933  32.679  1.00 22.06 ? 132 LEU B N    1 
ATOM   2668 C CA   . LEU B 1 132 ? 20.947 23.664  32.268  1.00 22.51 ? 132 LEU B CA   1 
ATOM   2669 C C    . LEU B 1 132 ? 21.768 24.944  32.373  1.00 21.76 ? 132 LEU B C    1 
ATOM   2670 O O    . LEU B 1 132 ? 22.879 24.943  32.904  1.00 26.98 ? 132 LEU B O    1 
ATOM   2671 C CB   . LEU B 1 132 ? 20.975 23.139  30.830  1.00 25.09 ? 132 LEU B CB   1 
ATOM   2672 C CG   . LEU B 1 132 ? 20.498 21.699  30.626  1.00 27.71 ? 132 LEU B CG   1 
ATOM   2673 C CD1  . LEU B 1 132 ? 20.190 21.434  29.163  1.00 27.30 ? 132 LEU B CD1  1 
ATOM   2674 C CD2  . LEU B 1 132 ? 21.558 20.739  31.138  1.00 20.21 ? 132 LEU B CD2  1 
ATOM   2675 N N    . LEU B 1 133 ? 21.183 26.040  31.902  1.00 22.36 ? 133 LEU B N    1 
ATOM   2676 C CA   . LEU B 1 133 ? 21.818 27.349  31.926  1.00 21.87 ? 133 LEU B CA   1 
ATOM   2677 C C    . LEU B 1 133 ? 22.087 27.796  33.364  1.00 23.92 ? 133 LEU B C    1 
ATOM   2678 O O    . LEU B 1 133 ? 23.195 28.224  33.686  1.00 22.09 ? 133 LEU B O    1 
ATOM   2679 C CB   . LEU B 1 133 ? 20.918 28.357  31.203  1.00 22.24 ? 133 LEU B CB   1 
ATOM   2680 C CG   . LEU B 1 133 ? 21.485 29.226  30.073  1.00 24.50 ? 133 LEU B CG   1 
ATOM   2681 C CD1  . LEU B 1 133 ? 22.629 28.548  29.351  1.00 17.89 ? 133 LEU B CD1  1 
ATOM   2682 C CD2  . LEU B 1 133 ? 20.365 29.566  29.107  1.00 20.75 ? 133 LEU B CD2  1 
ATOM   2683 N N    . SER B 1 134 ? 21.095 27.641  34.239  1.00 23.80 ? 134 SER B N    1 
ATOM   2684 C CA   . SER B 1 134 ? 21.242 28.038  35.640  1.00 29.27 ? 134 SER B CA   1 
ATOM   2685 C C    . SER B 1 134 ? 22.329 27.268  36.393  1.00 29.55 ? 134 SER B C    1 
ATOM   2686 O O    . SER B 1 134 ? 22.887 27.773  37.368  1.00 36.82 ? 134 SER B O    1 
ATOM   2687 C CB   . SER B 1 134 ? 19.904 27.928  36.387  1.00 27.85 ? 134 SER B CB   1 
ATOM   2688 O OG   . SER B 1 134 ? 19.504 26.580  36.554  1.00 36.33 ? 134 SER B OG   1 
ATOM   2689 N N    . GLN B 1 135 ? 22.641 26.059  35.935  1.00 28.71 ? 135 GLN B N    1 
ATOM   2690 C CA   . GLN B 1 135 ? 23.675 25.245  36.573  1.00 29.09 ? 135 GLN B CA   1 
ATOM   2691 C C    . GLN B 1 135 ? 25.072 25.482  36.007  1.00 31.52 ? 135 GLN B C    1 
ATOM   2692 O O    . GLN B 1 135 ? 26.046 24.908  36.492  1.00 32.56 ? 135 GLN B O    1 
ATOM   2693 C CB   . GLN B 1 135 ? 23.319 23.768  36.458  1.00 29.48 ? 135 GLN B CB   1 
ATOM   2694 C CG   . GLN B 1 135 ? 22.042 23.406  37.169  1.00 36.83 ? 135 GLN B CG   1 
ATOM   2695 C CD   . GLN B 1 135 ? 21.561 22.029  36.797  1.00 42.33 ? 135 GLN B CD   1 
ATOM   2696 O OE1  . GLN B 1 135 ? 22.153 21.359  35.951  1.00 46.11 ? 135 GLN B OE1  1 
ATOM   2697 N NE2  . GLN B 1 135 ? 20.480 21.596  37.421  1.00 46.26 ? 135 GLN B NE2  1 
ATOM   2698 N N    . ASN B 1 136 ? 25.172 26.301  34.967  1.00 30.31 ? 136 ASN B N    1 
ATOM   2699 C CA   . ASN B 1 136 ? 26.457 26.599  34.355  1.00 32.37 ? 136 ASN B CA   1 
ATOM   2700 C C    . ASN B 1 136 ? 26.792 28.081  34.523  1.00 34.88 ? 136 ASN B C    1 
ATOM   2701 O O    . ASN B 1 136 ? 26.325 28.919  33.754  1.00 39.57 ? 136 ASN B O    1 
ATOM   2702 C CB   . ASN B 1 136 ? 26.450 26.217  32.867  1.00 28.03 ? 136 ASN B CB   1 
ATOM   2703 C CG   . ASN B 1 136 ? 27.793 26.461  32.195  1.00 27.27 ? 136 ASN B CG   1 
ATOM   2704 O OD1  . ASN B 1 136 ? 28.839 26.364  32.835  1.00 32.21 ? 136 ASN B OD1  1 
ATOM   2705 N ND2  . ASN B 1 136 ? 27.767 26.728  30.901  1.00 24.89 ? 136 ASN B ND2  1 
ATOM   2706 N N    . GLN B 1 137 ? 27.587 28.395  35.550  1.00 38.39 ? 137 GLN B N    1 
ATOM   2707 C CA   . GLN B 1 137 ? 27.997 29.774  35.843  1.00 38.87 ? 137 GLN B CA   1 
ATOM   2708 C C    . GLN B 1 137 ? 26.836 30.769  35.834  1.00 37.46 ? 137 GLN B C    1 
ATOM   2709 O O    . GLN B 1 137 ? 26.969 31.886  35.325  1.00 38.66 ? 137 GLN B O    1 
ATOM   2710 C CB   . GLN B 1 137 ? 29.068 30.230  34.854  1.00 42.50 ? 137 GLN B CB   1 
ATOM   2711 C CG   . GLN B 1 137 ? 30.373 29.467  34.937  1.00 49.41 ? 137 GLN B CG   1 
ATOM   2712 C CD   . GLN B 1 137 ? 31.245 29.696  33.716  1.00 59.06 ? 137 GLN B CD   1 
ATOM   2713 O OE1  . GLN B 1 137 ? 31.892 30.742  33.593  1.00 59.66 ? 137 GLN B OE1  1 
ATOM   2714 N NE2  . GLN B 1 137 ? 31.247 28.736  32.796  1.00 60.93 ? 137 GLN B NE2  1 
ATOM   2715 N N    . GLY B 1 138 ? 25.692 30.340  36.365  1.00 33.21 ? 138 GLY B N    1 
ATOM   2716 C CA   . GLY B 1 138 ? 24.521 31.201  36.424  1.00 33.94 ? 138 GLY B CA   1 
ATOM   2717 C C    . GLY B 1 138 ? 23.967 31.671  35.089  1.00 33.48 ? 138 GLY B C    1 
ATOM   2718 O O    . GLY B 1 138 ? 23.312 32.710  35.024  1.00 33.52 ? 138 GLY B O    1 
ATOM   2719 N N    . GLY B 1 139 ? 24.219 30.904  34.031  1.00 33.09 ? 139 GLY B N    1 
ATOM   2720 C CA   . GLY B 1 139 ? 23.731 31.260  32.708  1.00 35.23 ? 139 GLY B CA   1 
ATOM   2721 C C    . GLY B 1 139 ? 24.418 32.467  32.093  1.00 35.89 ? 139 GLY B C    1 
ATOM   2722 O O    . GLY B 1 139 ? 23.871 33.095  31.189  1.00 38.32 ? 139 GLY B O    1 
ATOM   2723 N N    . LYS B 1 140 ? 25.626 32.768  32.560  1.00 34.34 ? 140 LYS B N    1 
ATOM   2724 C CA   . LYS B 1 140 ? 26.386 33.916  32.068  1.00 38.71 ? 140 LYS B CA   1 
ATOM   2725 C C    . LYS B 1 140 ? 27.160 33.641  30.781  1.00 35.47 ? 140 LYS B C    1 
ATOM   2726 O O    . LYS B 1 140 ? 27.484 34.575  30.048  1.00 37.05 ? 140 LYS B O    1 
ATOM   2727 C CB   . LYS B 1 140 ? 27.346 34.427  33.154  1.00 38.79 ? 140 LYS B CB   1 
ATOM   2728 C CG   . LYS B 1 140 ? 26.660 34.918  34.427  1.00 48.49 ? 140 LYS B CG   1 
ATOM   2729 C CD   . LYS B 1 140 ? 25.961 36.260  34.233  1.00 56.54 ? 140 LYS B CD   1 
ATOM   2730 C CE   . LYS B 1 140 ? 26.952 37.417  34.311  1.00 64.72 ? 140 LYS B CE   1 
ATOM   2731 N NZ   . LYS B 1 140 ? 26.304 38.745  34.084  1.00 65.93 ? 140 LYS B NZ   1 
ATOM   2732 N N    . THR B 1 141 ? 27.446 32.369  30.503  1.00 34.07 ? 141 THR B N    1 
ATOM   2733 C CA   . THR B 1 141 ? 28.197 31.993  29.304  1.00 29.17 ? 141 THR B CA   1 
ATOM   2734 C C    . THR B 1 141 ? 27.407 31.185  28.262  1.00 29.06 ? 141 THR B C    1 
ATOM   2735 O O    . THR B 1 141 ? 26.446 31.689  27.684  1.00 28.74 ? 141 THR B O    1 
ATOM   2736 C CB   . THR B 1 141 ? 29.500 31.247  29.665  1.00 26.45 ? 141 THR B CB   1 
ATOM   2737 O OG1  . THR B 1 141 ? 29.203 30.165  30.556  1.00 31.76 ? 141 THR B OG1  1 
ATOM   2738 C CG2  . THR B 1 141 ? 30.499 32.190  30.318  1.00 31.11 ? 141 THR B CG2  1 
ATOM   2739 N N    . PHE B 1 142 ? 27.812 29.937  28.030  1.00 25.37 ? 142 PHE B N    1 
ATOM   2740 C CA   . PHE B 1 142 ? 27.169 29.076  27.046  1.00 21.42 ? 142 PHE B CA   1 
ATOM   2741 C C    . PHE B 1 142 ? 26.368 27.947  27.688  1.00 19.43 ? 142 PHE B C    1 
ATOM   2742 O O    . PHE B 1 142 ? 26.341 27.826  28.906  1.00 22.06 ? 142 PHE B O    1 
ATOM   2743 C CB   . PHE B 1 142 ? 28.228 28.548  26.083  1.00 20.30 ? 142 PHE B CB   1 
ATOM   2744 C CG   . PHE B 1 142 ? 29.040 29.643  25.436  1.00 17.19 ? 142 PHE B CG   1 
ATOM   2745 C CD1  . PHE B 1 142 ? 28.533 30.359  24.353  1.00 16.59 ? 142 PHE B CD1  1 
ATOM   2746 C CD2  . PHE B 1 142 ? 30.294 29.981  25.931  1.00 17.17 ? 142 PHE B CD2  1 
ATOM   2747 C CE1  . PHE B 1 142 ? 29.261 31.395  23.778  1.00 16.36 ? 142 PHE B CE1  1 
ATOM   2748 C CE2  . PHE B 1 142 ? 31.032 31.016  25.363  1.00 13.88 ? 142 PHE B CE2  1 
ATOM   2749 C CZ   . PHE B 1 142 ? 30.516 31.723  24.285  1.00 16.14 ? 142 PHE B CZ   1 
ATOM   2750 N N    . ILE B 1 143 ? 25.698 27.134  26.877  1.00 19.33 ? 143 ILE B N    1 
ATOM   2751 C CA   . ILE B 1 143 ? 24.872 26.056  27.414  1.00 23.03 ? 143 ILE B CA   1 
ATOM   2752 C C    . ILE B 1 143 ? 25.676 24.999  28.182  1.00 21.83 ? 143 ILE B C    1 
ATOM   2753 O O    . ILE B 1 143 ? 25.188 24.439  29.164  1.00 25.30 ? 143 ILE B O    1 
ATOM   2754 C CB   . ILE B 1 143 ? 23.978 25.410  26.314  1.00 20.01 ? 143 ILE B CB   1 
ATOM   2755 C CG1  . ILE B 1 143 ? 22.872 24.569  26.957  1.00 19.19 ? 143 ILE B CG1  1 
ATOM   2756 C CG2  . ILE B 1 143 ? 24.813 24.566  25.352  1.00 18.10 ? 143 ILE B CG2  1 
ATOM   2757 C CD1  . ILE B 1 143 ? 21.853 25.373  27.737  1.00 13.87 ? 143 ILE B CD1  1 
ATOM   2758 N N    . VAL B 1 144 ? 26.912 24.763  27.751  1.00 17.84 ? 144 VAL B N    1 
ATOM   2759 C CA   . VAL B 1 144 ? 27.804 23.798  28.396  1.00 18.31 ? 144 VAL B CA   1 
ATOM   2760 C C    . VAL B 1 144 ? 29.220 24.366  28.418  1.00 21.53 ? 144 VAL B C    1 
ATOM   2761 O O    . VAL B 1 144 ? 29.767 24.714  27.373  1.00 23.94 ? 144 VAL B O    1 
ATOM   2762 C CB   . VAL B 1 144 ? 27.842 22.443  27.643  1.00 15.76 ? 144 VAL B CB   1 
ATOM   2763 C CG1  . VAL B 1 144 ? 28.931 21.547  28.228  1.00 12.79 ? 144 VAL B CG1  1 
ATOM   2764 C CG2  . VAL B 1 144 ? 26.496 21.745  27.729  1.00 11.21 ? 144 VAL B CG2  1 
ATOM   2765 N N    . GLY B 1 145 ? 29.805 24.463  29.609  1.00 21.97 ? 145 GLY B N    1 
ATOM   2766 C CA   . GLY B 1 145 ? 31.159 24.983  29.733  1.00 21.16 ? 145 GLY B CA   1 
ATOM   2767 C C    . GLY B 1 145 ? 31.284 26.482  29.523  1.00 25.36 ? 145 GLY B C    1 
ATOM   2768 O O    . GLY B 1 145 ? 30.295 27.212  29.599  1.00 24.11 ? 145 GLY B O    1 
ATOM   2769 N N    . ASP B 1 146 ? 32.502 26.938  29.240  1.00 28.44 ? 146 ASP B N    1 
ATOM   2770 C CA   . ASP B 1 146 ? 32.760 28.361  29.029  1.00 35.74 ? 146 ASP B CA   1 
ATOM   2771 C C    . ASP B 1 146 ? 33.186 28.702  27.600  1.00 32.93 ? 146 ASP B C    1 
ATOM   2772 O O    . ASP B 1 146 ? 33.714 29.780  27.342  1.00 34.73 ? 146 ASP B O    1 
ATOM   2773 C CB   . ASP B 1 146 ? 33.797 28.872  30.041  1.00 41.62 ? 146 ASP B CB   1 
ATOM   2774 C CG   . ASP B 1 146 ? 35.150 28.181  29.909  1.00 50.06 ? 146 ASP B CG   1 
ATOM   2775 O OD1  . ASP B 1 146 ? 35.261 27.160  29.193  1.00 52.39 ? 146 ASP B OD1  1 
ATOM   2776 O OD2  . ASP B 1 146 ? 36.118 28.670  30.528  1.00 58.74 ? 146 ASP B OD2  1 
ATOM   2777 N N    . GLN B 1 147 ? 32.957 27.769  26.682  1.00 34.08 ? 147 GLN B N    1 
ATOM   2778 C CA   . GLN B 1 147 ? 33.286 27.950  25.271  1.00 30.76 ? 147 GLN B CA   1 
ATOM   2779 C C    . GLN B 1 147 ? 32.075 27.471  24.470  1.00 27.26 ? 147 GLN B C    1 
ATOM   2780 O O    . GLN B 1 147 ? 31.377 26.544  24.886  1.00 27.27 ? 147 GLN B O    1 
ATOM   2781 C CB   . GLN B 1 147 ? 34.542 27.154  24.896  1.00 35.52 ? 147 GLN B CB   1 
ATOM   2782 C CG   . GLN B 1 147 ? 34.436 25.662  25.188  1.00 51.57 ? 147 GLN B CG   1 
ATOM   2783 C CD   . GLN B 1 147 ? 35.614 24.854  24.669  1.00 56.61 ? 147 GLN B CD   1 
ATOM   2784 O OE1  . GLN B 1 147 ? 36.563 24.579  25.410  1.00 59.20 ? 147 GLN B OE1  1 
ATOM   2785 N NE2  . GLN B 1 147 ? 35.543 24.436  23.402  1.00 54.77 ? 147 GLN B NE2  1 
ATOM   2786 N N    . ILE B 1 148 ? 31.802 28.130  23.346  1.00 22.04 ? 148 ILE B N    1 
ATOM   2787 C CA   . ILE B 1 148 ? 30.659 27.783  22.506  1.00 20.51 ? 148 ILE B CA   1 
ATOM   2788 C C    . ILE B 1 148 ? 30.803 26.389  21.873  1.00 19.28 ? 148 ILE B C    1 
ATOM   2789 O O    . ILE B 1 148 ? 31.912 25.944  21.571  1.00 12.08 ? 148 ILE B O    1 
ATOM   2790 C CB   . ILE B 1 148 ? 30.427 28.874  21.420  1.00 17.72 ? 148 ILE B CB   1 
ATOM   2791 C CG1  . ILE B 1 148 ? 28.986 28.822  20.916  1.00 17.02 ? 148 ILE B CG1  1 
ATOM   2792 C CG2  . ILE B 1 148 ? 31.411 28.706  20.270  1.00 16.29 ? 148 ILE B CG2  1 
ATOM   2793 C CD1  . ILE B 1 148 ? 28.544 30.080  20.207  1.00 10.84 ? 148 ILE B CD1  1 
ATOM   2794 N N    . SER B 1 149 ? 29.682 25.690  21.717  1.00 10.71 ? 149 SER B N    1 
ATOM   2795 C CA   . SER B 1 149 ? 29.687 24.356  21.129  1.00 15.30 ? 149 SER B CA   1 
ATOM   2796 C C    . SER B 1 149 ? 28.632 24.307  20.034  1.00 15.09 ? 149 SER B C    1 
ATOM   2797 O O    . SER B 1 149 ? 27.846 25.246  19.893  1.00 16.35 ? 149 SER B O    1 
ATOM   2798 C CB   . SER B 1 149 ? 29.375 23.300  22.194  1.00 11.53 ? 149 SER B CB   1 
ATOM   2799 O OG   . SER B 1 149 ? 28.020 23.373  22.609  1.00 11.96 ? 149 SER B OG   1 
ATOM   2800 N N    . PHE B 1 150 ? 28.598 23.211  19.274  1.00 14.93 ? 150 PHE B N    1 
ATOM   2801 C CA   . PHE B 1 150 ? 27.614 23.076  18.201  1.00 15.07 ? 150 PHE B CA   1 
ATOM   2802 C C    . PHE B 1 150 ? 26.188 23.041  18.748  1.00 13.71 ? 150 PHE B C    1 
ATOM   2803 O O    . PHE B 1 150 ? 25.241 23.424  18.059  1.00 21.42 ? 150 PHE B O    1 
ATOM   2804 C CB   . PHE B 1 150 ? 27.908 21.848  17.315  1.00 13.85 ? 150 PHE B CB   1 
ATOM   2805 C CG   . PHE B 1 150 ? 27.701 20.518  18.001  1.00 10.83 ? 150 PHE B CG   1 
ATOM   2806 C CD1  . PHE B 1 150 ? 26.448 19.907  18.007  1.00 9.79  ? 150 PHE B CD1  1 
ATOM   2807 C CD2  . PHE B 1 150 ? 28.759 19.875  18.632  1.00 9.69  ? 150 PHE B CD2  1 
ATOM   2808 C CE1  . PHE B 1 150 ? 26.254 18.678  18.633  1.00 13.21 ? 150 PHE B CE1  1 
ATOM   2809 C CE2  . PHE B 1 150 ? 28.576 18.644  19.263  1.00 10.53 ? 150 PHE B CE2  1 
ATOM   2810 C CZ   . PHE B 1 150 ? 27.321 18.044  19.263  1.00 11.95 ? 150 PHE B CZ   1 
ATOM   2811 N N    . ALA B 1 151 ? 26.044 22.603  19.998  1.00 16.31 ? 151 ALA B N    1 
ATOM   2812 C CA   . ALA B 1 151 ? 24.736 22.533  20.646  1.00 14.50 ? 151 ALA B CA   1 
ATOM   2813 C C    . ALA B 1 151 ? 24.168 23.939  20.838  1.00 12.67 ? 151 ALA B C    1 
ATOM   2814 O O    . ALA B 1 151 ? 22.953 24.136  20.792  1.00 16.19 ? 151 ALA B O    1 
ATOM   2815 C CB   . ALA B 1 151 ? 24.845 21.807  21.992  1.00 16.55 ? 151 ALA B CB   1 
ATOM   2816 N N    . ASP B 1 152 ? 25.053 24.911  21.047  1.00 10.04 ? 152 ASP B N    1 
ATOM   2817 C CA   . ASP B 1 152 ? 24.640 26.297  21.227  1.00 13.99 ? 152 ASP B CA   1 
ATOM   2818 C C    . ASP B 1 152 ? 23.923 26.818  19.991  1.00 16.09 ? 152 ASP B C    1 
ATOM   2819 O O    . ASP B 1 152 ? 22.832 27.390  20.096  1.00 13.49 ? 152 ASP B O    1 
ATOM   2820 C CB   . ASP B 1 152 ? 25.851 27.184  21.527  1.00 14.41 ? 152 ASP B CB   1 
ATOM   2821 C CG   . ASP B 1 152 ? 26.304 27.086  22.967  1.00 14.53 ? 152 ASP B CG   1 
ATOM   2822 O OD1  . ASP B 1 152 ? 25.525 27.460  23.862  1.00 12.69 ? 152 ASP B OD1  1 
ATOM   2823 O OD2  . ASP B 1 152 ? 27.447 26.661  23.205  1.00 15.26 ? 152 ASP B OD2  1 
ATOM   2824 N N    . TYR B 1 153 ? 24.520 26.588  18.819  1.00 13.47 ? 153 TYR B N    1 
ATOM   2825 C CA   . TYR B 1 153 ? 23.932 27.041  17.555  1.00 17.07 ? 153 TYR B CA   1 
ATOM   2826 C C    . TYR B 1 153 ? 22.590 26.376  17.306  1.00 12.24 ? 153 TYR B C    1 
ATOM   2827 O O    . TYR B 1 153 ? 21.647 27.022  16.873  1.00 15.63 ? 153 TYR B O    1 
ATOM   2828 C CB   . TYR B 1 153 ? 24.880 26.766  16.377  1.00 11.50 ? 153 TYR B CB   1 
ATOM   2829 C CG   . TYR B 1 153 ? 26.180 27.517  16.484  1.00 9.35  ? 153 TYR B CG   1 
ATOM   2830 C CD1  . TYR B 1 153 ? 26.234 28.896  16.252  1.00 10.53 ? 153 TYR B CD1  1 
ATOM   2831 C CD2  . TYR B 1 153 ? 27.348 26.864  16.867  1.00 10.73 ? 153 TYR B CD2  1 
ATOM   2832 C CE1  . TYR B 1 153 ? 27.424 29.603  16.405  1.00 9.45  ? 153 TYR B CE1  1 
ATOM   2833 C CE2  . TYR B 1 153 ? 28.538 27.556  17.024  1.00 10.44 ? 153 TYR B CE2  1 
ATOM   2834 C CZ   . TYR B 1 153 ? 28.570 28.925  16.793  1.00 14.51 ? 153 TYR B CZ   1 
ATOM   2835 O OH   . TYR B 1 153 ? 29.750 29.609  16.961  1.00 18.39 ? 153 TYR B OH   1 
ATOM   2836 N N    . ASN B 1 154 ? 22.495 25.088  17.612  1.00 14.67 ? 154 ASN B N    1 
ATOM   2837 C CA   . ASN B 1 154 ? 21.266 24.342  17.407  1.00 13.67 ? 154 ASN B CA   1 
ATOM   2838 C C    . ASN B 1 154 ? 20.177 24.800  18.383  1.00 12.76 ? 154 ASN B C    1 
ATOM   2839 O O    . ASN B 1 154 ? 19.012 24.933  18.005  1.00 15.87 ? 154 ASN B O    1 
ATOM   2840 C CB   . ASN B 1 154 ? 21.522 22.838  17.535  1.00 9.31  ? 154 ASN B CB   1 
ATOM   2841 C CG   . ASN B 1 154 ? 20.439 22.013  16.872  1.00 16.45 ? 154 ASN B CG   1 
ATOM   2842 O OD1  . ASN B 1 154 ? 19.547 22.556  16.218  1.00 18.35 ? 154 ASN B OD1  1 
ATOM   2843 N ND2  . ASN B 1 154 ? 20.524 20.701  17.022  1.00 15.86 ? 154 ASN B ND2  1 
ATOM   2844 N N    . LEU B 1 155 ? 20.563 25.052  19.632  1.00 14.49 ? 155 LEU B N    1 
ATOM   2845 C CA   . LEU B 1 155 ? 19.601 25.502  20.636  1.00 12.89 ? 155 LEU B CA   1 
ATOM   2846 C C    . LEU B 1 155 ? 19.122 26.904  20.259  1.00 12.96 ? 155 LEU B C    1 
ATOM   2847 O O    . LEU B 1 155 ? 17.923 27.188  20.308  1.00 14.73 ? 155 LEU B O    1 
ATOM   2848 C CB   . LEU B 1 155 ? 20.234 25.507  22.034  1.00 12.24 ? 155 LEU B CB   1 
ATOM   2849 C CG   . LEU B 1 155 ? 19.373 26.105  23.158  1.00 15.93 ? 155 LEU B CG   1 
ATOM   2850 C CD1  . LEU B 1 155 ? 18.026 25.406  23.245  1.00 9.78  ? 155 LEU B CD1  1 
ATOM   2851 C CD2  . LEU B 1 155 ? 20.113 26.008  24.481  1.00 17.15 ? 155 LEU B CD2  1 
ATOM   2852 N N    . LEU B 1 156 ? 20.059 27.758  19.846  1.00 11.38 ? 156 LEU B N    1 
ATOM   2853 C CA   . LEU B 1 156 ? 19.735 29.127  19.442  1.00 14.38 ? 156 LEU B CA   1 
ATOM   2854 C C    . LEU B 1 156 ? 18.696 29.113  18.328  1.00 17.22 ? 156 LEU B C    1 
ATOM   2855 O O    . LEU B 1 156 ? 17.695 29.829  18.398  1.00 17.34 ? 156 LEU B O    1 
ATOM   2856 C CB   . LEU B 1 156 ? 20.990 29.861  18.962  1.00 17.64 ? 156 LEU B CB   1 
ATOM   2857 C CG   . LEU B 1 156 ? 20.768 31.321  18.555  1.00 19.65 ? 156 LEU B CG   1 
ATOM   2858 C CD1  . LEU B 1 156 ? 20.232 32.127  19.737  1.00 20.09 ? 156 LEU B CD1  1 
ATOM   2859 C CD2  . LEU B 1 156 ? 22.068 31.920  18.056  1.00 16.71 ? 156 LEU B CD2  1 
ATOM   2860 N N    . ASP B 1 157 ? 18.929 28.286  17.308  1.00 12.93 ? 157 ASP B N    1 
ATOM   2861 C CA   . ASP B 1 157 ? 17.987 28.182  16.200  1.00 12.10 ? 157 ASP B CA   1 
ATOM   2862 C C    . ASP B 1 157 ? 16.618 27.749  16.712  1.00 15.07 ? 157 ASP B C    1 
ATOM   2863 O O    . ASP B 1 157 ? 15.595 28.339  16.351  1.00 15.21 ? 157 ASP B O    1 
ATOM   2864 C CB   . ASP B 1 157 ? 18.482 27.186  15.150  1.00 13.31 ? 157 ASP B CB   1 
ATOM   2865 C CG   . ASP B 1 157 ? 17.480 26.978  14.029  1.00 18.22 ? 157 ASP B CG   1 
ATOM   2866 O OD1  . ASP B 1 157 ? 17.115 27.969  13.360  1.00 16.95 ? 157 ASP B OD1  1 
ATOM   2867 O OD2  . ASP B 1 157 ? 17.064 25.823  13.813  1.00 18.97 ? 157 ASP B OD2  1 
ATOM   2868 N N    . LEU B 1 158 ? 16.605 26.723  17.562  1.00 16.38 ? 158 LEU B N    1 
ATOM   2869 C CA   . LEU B 1 158 ? 15.353 26.222  18.124  1.00 18.41 ? 158 LEU B CA   1 
ATOM   2870 C C    . LEU B 1 158 ? 14.596 27.345  18.849  1.00 15.26 ? 158 LEU B C    1 
ATOM   2871 O O    . LEU B 1 158 ? 13.394 27.518  18.658  1.00 17.12 ? 158 LEU B O    1 
ATOM   2872 C CB   . LEU B 1 158 ? 15.622 25.057  19.084  1.00 15.64 ? 158 LEU B CB   1 
ATOM   2873 C CG   . LEU B 1 158 ? 14.379 24.318  19.605  1.00 19.50 ? 158 LEU B CG   1 
ATOM   2874 C CD1  . LEU B 1 158 ? 13.689 23.577  18.466  1.00 17.37 ? 158 LEU B CD1  1 
ATOM   2875 C CD2  . LEU B 1 158 ? 14.768 23.344  20.698  1.00 16.11 ? 158 LEU B CD2  1 
ATOM   2876 N N    . LEU B 1 159 ? 15.316 28.139  19.635  1.00 14.85 ? 159 LEU B N    1 
ATOM   2877 C CA   . LEU B 1 159 ? 14.698 29.241  20.375  1.00 15.96 ? 159 LEU B CA   1 
ATOM   2878 C C    . LEU B 1 159 ? 14.142 30.323  19.446  1.00 15.59 ? 159 LEU B C    1 
ATOM   2879 O O    . LEU B 1 159 ? 13.007 30.769  19.615  1.00 17.40 ? 159 LEU B O    1 
ATOM   2880 C CB   . LEU B 1 159 ? 15.702 29.839  21.364  1.00 16.12 ? 159 LEU B CB   1 
ATOM   2881 C CG   . LEU B 1 159 ? 16.201 28.856  22.431  1.00 16.52 ? 159 LEU B CG   1 
ATOM   2882 C CD1  . LEU B 1 159 ? 17.284 29.483  23.291  1.00 13.09 ? 159 LEU B CD1  1 
ATOM   2883 C CD2  . LEU B 1 159 ? 15.033 28.394  23.284  1.00 11.26 ? 159 LEU B CD2  1 
ATOM   2884 N N    . LEU B 1 160 ? 14.929 30.707  18.443  1.00 20.00 ? 160 LEU B N    1 
ATOM   2885 C CA   . LEU B 1 160 ? 14.516 31.723  17.477  1.00 16.53 ? 160 LEU B CA   1 
ATOM   2886 C C    . LEU B 1 160 ? 13.251 31.351  16.709  1.00 18.82 ? 160 LEU B C    1 
ATOM   2887 O O    . LEU B 1 160 ? 12.353 32.186  16.562  1.00 23.62 ? 160 LEU B O    1 
ATOM   2888 C CB   . LEU B 1 160 ? 15.648 32.025  16.493  1.00 10.59 ? 160 LEU B CB   1 
ATOM   2889 C CG   . LEU B 1 160 ? 16.904 32.675  17.080  1.00 9.52  ? 160 LEU B CG   1 
ATOM   2890 C CD1  . LEU B 1 160 ? 17.960 32.798  16.002  1.00 11.92 ? 160 LEU B CD1  1 
ATOM   2891 C CD2  . LEU B 1 160 ? 16.577 34.042  17.657  1.00 13.66 ? 160 LEU B CD2  1 
ATOM   2892 N N    . ILE B 1 161 ? 13.153 30.108  16.236  1.00 16.27 ? 161 ILE B N    1 
ATOM   2893 C CA   . ILE B 1 161 ? 11.962 29.704  15.484  1.00 16.31 ? 161 ILE B CA   1 
ATOM   2894 C C    . ILE B 1 161 ? 10.726 29.613  16.370  1.00 20.48 ? 161 ILE B C    1 
ATOM   2895 O O    . ILE B 1 161 ? 9.599  29.691  15.876  1.00 17.32 ? 161 ILE B O    1 
ATOM   2896 C CB   . ILE B 1 161 ? 12.159 28.382  14.692  1.00 20.84 ? 161 ILE B CB   1 
ATOM   2897 C CG1  . ILE B 1 161 ? 12.388 27.200  15.636  1.00 20.14 ? 161 ILE B CG1  1 
ATOM   2898 C CG2  . ILE B 1 161 ? 13.312 28.530  13.712  1.00 17.48 ? 161 ILE B CG2  1 
ATOM   2899 C CD1  . ILE B 1 161 ? 12.634 25.887  14.913  1.00 22.07 ? 161 ILE B CD1  1 
ATOM   2900 N N    . HIS B 1 162 ? 10.935 29.438  17.676  1.00 20.52 ? 162 HIS B N    1 
ATOM   2901 C CA   . HIS B 1 162 ? 9.816  29.376  18.612  1.00 21.87 ? 162 HIS B CA   1 
ATOM   2902 C C    . HIS B 1 162 ? 9.335  30.778  18.957  1.00 21.47 ? 162 HIS B C    1 
ATOM   2903 O O    . HIS B 1 162 ? 8.171  30.970  19.300  1.00 19.89 ? 162 HIS B O    1 
ATOM   2904 C CB   . HIS B 1 162 ? 10.176 28.583  19.871  1.00 20.72 ? 162 HIS B CB   1 
ATOM   2905 C CG   . HIS B 1 162 ? 10.007 27.104  19.709  1.00 19.31 ? 162 HIS B CG   1 
ATOM   2906 N ND1  . HIS B 1 162 ? 11.021 26.287  19.255  1.00 17.48 ? 162 HIS B ND1  1 
ATOM   2907 C CD2  . HIS B 1 162 ? 8.932  26.305  19.886  1.00 18.21 ? 162 HIS B CD2  1 
ATOM   2908 C CE1  . HIS B 1 162 ? 10.573 25.049  19.153  1.00 14.12 ? 162 HIS B CE1  1 
ATOM   2909 N NE2  . HIS B 1 162 ? 9.309  25.031  19.529  1.00 15.10 ? 162 HIS B NE2  1 
ATOM   2910 N N    . GLU B 1 163 ? 10.245 31.749  18.880  1.00 22.78 ? 163 GLU B N    1 
ATOM   2911 C CA   . GLU B 1 163 ? 9.905  33.148  19.121  1.00 24.84 ? 163 GLU B CA   1 
ATOM   2912 C C    . GLU B 1 163 ? 8.949  33.560  18.006  1.00 23.79 ? 163 GLU B C    1 
ATOM   2913 O O    . GLU B 1 163 ? 8.013  34.322  18.223  1.00 30.64 ? 163 GLU B O    1 
ATOM   2914 C CB   . GLU B 1 163 ? 11.157 34.021  19.066  1.00 30.78 ? 163 GLU B CB   1 
ATOM   2915 C CG   . GLU B 1 163 ? 11.764 34.343  20.422  1.00 43.50 ? 163 GLU B CG   1 
ATOM   2916 C CD   . GLU B 1 163 ? 10.884 35.262  21.257  1.00 55.98 ? 163 GLU B CD   1 
ATOM   2917 O OE1  . GLU B 1 163 ? 10.274 36.192  20.684  1.00 60.36 ? 163 GLU B OE1  1 
ATOM   2918 O OE2  . GLU B 1 163 ? 10.814 35.064  22.491  1.00 61.63 ? 163 GLU B OE2  1 
ATOM   2919 N N    . VAL B 1 164 ? 9.188  33.024  16.812  1.00 25.34 ? 164 VAL B N    1 
ATOM   2920 C CA   . VAL B 1 164 ? 8.352  33.307  15.651  1.00 24.08 ? 164 VAL B CA   1 
ATOM   2921 C C    . VAL B 1 164 ? 7.006  32.593  15.788  1.00 29.96 ? 164 VAL B C    1 
ATOM   2922 O O    . VAL B 1 164 ? 5.963  33.160  15.465  1.00 34.15 ? 164 VAL B O    1 
ATOM   2923 C CB   . VAL B 1 164 ? 9.043  32.854  14.337  1.00 22.81 ? 164 VAL B CB   1 
ATOM   2924 C CG1  . VAL B 1 164 ? 8.125  33.090  13.140  1.00 20.40 ? 164 VAL B CG1  1 
ATOM   2925 C CG2  . VAL B 1 164 ? 10.359 33.598  14.150  1.00 17.22 ? 164 VAL B CG2  1 
ATOM   2926 N N    . LEU B 1 165 ? 7.035  31.355  16.276  1.00 29.54 ? 165 LEU B N    1 
ATOM   2927 C CA   . LEU B 1 165 ? 5.817  30.565  16.453  1.00 27.52 ? 165 LEU B CA   1 
ATOM   2928 C C    . LEU B 1 165 ? 4.922  31.116  17.560  1.00 31.18 ? 165 LEU B C    1 
ATOM   2929 O O    . LEU B 1 165 ? 3.726  31.327  17.360  1.00 30.02 ? 165 LEU B O    1 
ATOM   2930 C CB   . LEU B 1 165 ? 6.174  29.111  16.768  1.00 27.36 ? 165 LEU B CB   1 
ATOM   2931 C CG   . LEU B 1 165 ? 5.005  28.153  17.012  1.00 24.81 ? 165 LEU B CG   1 
ATOM   2932 C CD1  . LEU B 1 165 ? 4.270  27.880  15.707  1.00 28.26 ? 165 LEU B CD1  1 
ATOM   2933 C CD2  . LEU B 1 165 ? 5.521  26.859  17.605  1.00 25.85 ? 165 LEU B CD2  1 
ATOM   2934 N N    . ALA B 1 166 ? 5.516  31.325  18.731  1.00 32.61 ? 166 ALA B N    1 
ATOM   2935 C CA   . ALA B 1 166 ? 4.808  31.837  19.896  1.00 28.03 ? 166 ALA B CA   1 
ATOM   2936 C C    . ALA B 1 166 ? 5.573  33.037  20.436  1.00 29.47 ? 166 ALA B C    1 
ATOM   2937 O O    . ALA B 1 166 ? 6.410  32.898  21.328  1.00 27.43 ? 166 ALA B O    1 
ATOM   2938 C CB   . ALA B 1 166 ? 4.706  30.753  20.961  1.00 24.54 ? 166 ALA B CB   1 
ATOM   2939 N N    . PRO B 1 167 ? 5.316  34.232  19.875  1.00 29.66 ? 167 PRO B N    1 
ATOM   2940 C CA   . PRO B 1 167 ? 5.978  35.472  20.294  1.00 26.74 ? 167 PRO B CA   1 
ATOM   2941 C C    . PRO B 1 167 ? 5.890  35.695  21.801  1.00 26.93 ? 167 PRO B C    1 
ATOM   2942 O O    . PRO B 1 167 ? 4.812  35.612  22.392  1.00 28.15 ? 167 PRO B O    1 
ATOM   2943 C CB   . PRO B 1 167 ? 5.208  36.542  19.521  1.00 27.68 ? 167 PRO B CB   1 
ATOM   2944 C CG   . PRO B 1 167 ? 4.843  35.834  18.259  1.00 27.80 ? 167 PRO B CG   1 
ATOM   2945 C CD   . PRO B 1 167 ? 4.365  34.497  18.778  1.00 27.30 ? 167 PRO B CD   1 
ATOM   2946 N N    . GLY B 1 168 ? 7.040  35.938  22.419  1.00 28.32 ? 168 GLY B N    1 
ATOM   2947 C CA   . GLY B 1 168 ? 7.082  36.167  23.850  1.00 28.39 ? 168 GLY B CA   1 
ATOM   2948 C C    . GLY B 1 168 ? 7.144  34.914  24.707  1.00 31.42 ? 168 GLY B C    1 
ATOM   2949 O O    . GLY B 1 168 ? 7.100  35.012  25.931  1.00 32.53 ? 168 GLY B O    1 
ATOM   2950 N N    . CYS B 1 169 ? 7.250  33.741  24.083  1.00 27.03 ? 169 CYS B N    1 
ATOM   2951 C CA   . CYS B 1 169 ? 7.323  32.484  24.830  1.00 26.35 ? 169 CYS B CA   1 
ATOM   2952 C C    . CYS B 1 169 ? 8.541  32.426  25.758  1.00 26.61 ? 169 CYS B C    1 
ATOM   2953 O O    . CYS B 1 169 ? 8.551  31.667  26.724  1.00 34.29 ? 169 CYS B O    1 
ATOM   2954 C CB   . CYS B 1 169 ? 7.335  31.282  23.877  1.00 25.43 ? 169 CYS B CB   1 
ATOM   2955 S SG   . CYS B 1 169 ? 8.792  31.171  22.808  1.00 25.37 ? 169 CYS B SG   1 
ATOM   2956 N N    . LEU B 1 170 ? 9.561  33.229  25.461  1.00 28.46 ? 170 LEU B N    1 
ATOM   2957 C CA   . LEU B 1 170 ? 10.781 33.282  26.271  1.00 26.87 ? 170 LEU B CA   1 
ATOM   2958 C C    . LEU B 1 170 ? 10.742 34.301  27.416  1.00 29.62 ? 170 LEU B C    1 
ATOM   2959 O O    . LEU B 1 170 ? 11.709 34.420  28.173  1.00 25.36 ? 170 LEU B O    1 
ATOM   2960 C CB   . LEU B 1 170 ? 11.992 33.575  25.384  1.00 25.97 ? 170 LEU B CB   1 
ATOM   2961 C CG   . LEU B 1 170 ? 12.803 32.394  24.848  1.00 28.21 ? 170 LEU B CG   1 
ATOM   2962 C CD1  . LEU B 1 170 ? 11.902 31.383  24.160  1.00 26.98 ? 170 LEU B CD1  1 
ATOM   2963 C CD2  . LEU B 1 170 ? 13.872 32.913  23.900  1.00 22.98 ? 170 LEU B CD2  1 
ATOM   2964 N N    . ASP B 1 171 ? 9.640  35.040  27.532  1.00 30.40 ? 171 ASP B N    1 
ATOM   2965 C CA   . ASP B 1 171 ? 9.488  36.048  28.585  1.00 32.42 ? 171 ASP B CA   1 
ATOM   2966 C C    . ASP B 1 171 ? 9.623  35.456  29.982  1.00 31.61 ? 171 ASP B C    1 
ATOM   2967 O O    . ASP B 1 171 ? 10.257 36.049  30.855  1.00 29.65 ? 171 ASP B O    1 
ATOM   2968 C CB   . ASP B 1 171 ? 8.133  36.755  28.467  1.00 33.03 ? 171 ASP B CB   1 
ATOM   2969 C CG   . ASP B 1 171 ? 8.071  37.724  27.298  1.00 37.32 ? 171 ASP B CG   1 
ATOM   2970 O OD1  . ASP B 1 171 ? 9.138  38.086  26.753  1.00 34.25 ? 171 ASP B OD1  1 
ATOM   2971 O OD2  . ASP B 1 171 ? 6.946  38.132  26.930  1.00 34.04 ? 171 ASP B OD2  1 
ATOM   2972 N N    . ALA B 1 172 ? 9.037  34.277  30.175  1.00 29.44 ? 172 ALA B N    1 
ATOM   2973 C CA   . ALA B 1 172 ? 9.076  33.582  31.458  1.00 26.95 ? 172 ALA B CA   1 
ATOM   2974 C C    . ALA B 1 172 ? 10.435 32.960  31.791  1.00 25.40 ? 172 ALA B C    1 
ATOM   2975 O O    . ALA B 1 172 ? 10.623 32.432  32.886  1.00 28.29 ? 172 ALA B O    1 
ATOM   2976 C CB   . ALA B 1 172 ? 7.992  32.508  31.491  1.00 29.79 ? 172 ALA B CB   1 
ATOM   2977 N N    . PHE B 1 173 ? 11.381 33.032  30.859  1.00 24.25 ? 173 PHE B N    1 
ATOM   2978 C CA   . PHE B 1 173 ? 12.701 32.443  31.066  1.00 21.71 ? 173 PHE B CA   1 
ATOM   2979 C C    . PHE B 1 173 ? 13.825 33.463  30.910  1.00 23.67 ? 173 PHE B C    1 
ATOM   2980 O O    . PHE B 1 173 ? 14.427 33.581  29.844  1.00 30.17 ? 173 PHE B O    1 
ATOM   2981 C CB   . PHE B 1 173 ? 12.902 31.277  30.094  1.00 24.75 ? 173 PHE B CB   1 
ATOM   2982 C CG   . PHE B 1 173 ? 11.837 30.219  30.191  1.00 22.15 ? 173 PHE B CG   1 
ATOM   2983 C CD1  . PHE B 1 173 ? 11.906 29.234  31.171  1.00 20.75 ? 173 PHE B CD1  1 
ATOM   2984 C CD2  . PHE B 1 173 ? 10.749 30.229  29.323  1.00 18.88 ? 173 PHE B CD2  1 
ATOM   2985 C CE1  . PHE B 1 173 ? 10.904 28.276  31.290  1.00 21.32 ? 173 PHE B CE1  1 
ATOM   2986 C CE2  . PHE B 1 173 ? 9.740  29.275  29.432  1.00 22.97 ? 173 PHE B CE2  1 
ATOM   2987 C CZ   . PHE B 1 173 ? 9.818  28.296  30.419  1.00 22.28 ? 173 PHE B CZ   1 
ATOM   2988 N N    . PRO B 1 174 ? 14.159 34.175  31.998  1.00 26.80 ? 174 PRO B N    1 
ATOM   2989 C CA   . PRO B 1 174 ? 15.211 35.196  32.015  1.00 25.62 ? 174 PRO B CA   1 
ATOM   2990 C C    . PRO B 1 174 ? 16.584 34.781  31.492  1.00 25.00 ? 174 PRO B C    1 
ATOM   2991 O O    . PRO B 1 174 ? 17.246 35.562  30.809  1.00 31.27 ? 174 PRO B O    1 
ATOM   2992 C CB   . PRO B 1 174 ? 15.255 35.625  33.487  1.00 22.08 ? 174 PRO B CB   1 
ATOM   2993 C CG   . PRO B 1 174 ? 14.677 34.453  34.223  1.00 22.18 ? 174 PRO B CG   1 
ATOM   2994 C CD   . PRO B 1 174 ? 13.551 34.038  33.333  1.00 24.14 ? 174 PRO B CD   1 
ATOM   2995 N N    . LEU B 1 175 ? 17.018 33.566  31.814  1.00 24.34 ? 175 LEU B N    1 
ATOM   2996 C CA   . LEU B 1 175 ? 18.320 33.078  31.359  1.00 20.62 ? 175 LEU B CA   1 
ATOM   2997 C C    . LEU B 1 175 ? 18.340 32.767  29.861  1.00 22.51 ? 175 LEU B C    1 
ATOM   2998 O O    . LEU B 1 175 ? 19.303 33.096  29.170  1.00 17.17 ? 175 LEU B O    1 
ATOM   2999 C CB   . LEU B 1 175 ? 18.747 31.853  32.170  1.00 23.80 ? 175 LEU B CB   1 
ATOM   3000 C CG   . LEU B 1 175 ? 19.588 32.073  33.435  1.00 23.93 ? 175 LEU B CG   1 
ATOM   3001 C CD1  . LEU B 1 175 ? 19.345 33.431  34.057  1.00 21.68 ? 175 LEU B CD1  1 
ATOM   3002 C CD2  . LEU B 1 175 ? 19.298 30.969  34.420  1.00 20.50 ? 175 LEU B CD2  1 
ATOM   3003 N N    . LEU B 1 176 ? 17.277 32.143  29.359  1.00 20.38 ? 176 LEU B N    1 
ATOM   3004 C CA   . LEU B 1 176 ? 17.193 31.824  27.939  1.00 22.75 ? 176 LEU B CA   1 
ATOM   3005 C C    . LEU B 1 176 ? 17.136 33.113  27.117  1.00 27.36 ? 176 LEU B C    1 
ATOM   3006 O O    . LEU B 1 176 ? 17.803 33.221  26.087  1.00 26.22 ? 176 LEU B O    1 
ATOM   3007 C CB   . LEU B 1 176 ? 15.972 30.946  27.643  1.00 17.98 ? 176 LEU B CB   1 
ATOM   3008 C CG   . LEU B 1 176 ? 16.059 29.481  28.085  1.00 19.14 ? 176 LEU B CG   1 
ATOM   3009 C CD1  . LEU B 1 176 ? 14.751 28.769  27.786  1.00 13.79 ? 176 LEU B CD1  1 
ATOM   3010 C CD2  . LEU B 1 176 ? 17.216 28.783  27.379  1.00 20.71 ? 176 LEU B CD2  1 
ATOM   3011 N N    . SER B 1 177 ? 16.373 34.095  27.598  1.00 22.20 ? 177 SER B N    1 
ATOM   3012 C CA   . SER B 1 177 ? 16.242 35.385  26.919  1.00 22.70 ? 177 SER B CA   1 
ATOM   3013 C C    . SER B 1 177 ? 17.585 36.099  26.816  1.00 20.12 ? 177 SER B C    1 
ATOM   3014 O O    . SER B 1 177 ? 17.950 36.600  25.751  1.00 16.16 ? 177 SER B O    1 
ATOM   3015 C CB   . SER B 1 177 ? 15.242 36.279  27.653  1.00 25.67 ? 177 SER B CB   1 
ATOM   3016 O OG   . SER B 1 177 ? 13.941 35.722  27.614  1.00 27.61 ? 177 SER B OG   1 
ATOM   3017 N N    . ALA B 1 178 ? 18.318 36.141  27.924  1.00 12.08 ? 178 ALA B N    1 
ATOM   3018 C CA   . ALA B 1 178 ? 19.623 36.786  27.942  1.00 12.63 ? 178 ALA B CA   1 
ATOM   3019 C C    . ALA B 1 178 ? 20.579 36.019  27.036  1.00 20.42 ? 178 ALA B C    1 
ATOM   3020 O O    . ALA B 1 178 ? 21.392 36.614  26.325  1.00 24.13 ? 178 ALA B O    1 
ATOM   3021 C CB   . ALA B 1 178 ? 20.168 36.831  29.363  1.00 10.47 ? 178 ALA B CB   1 
ATOM   3022 N N    . TYR B 1 179 ? 20.468 34.693  27.079  1.00 26.21 ? 179 TYR B N    1 
ATOM   3023 C CA   . TYR B 1 179 ? 21.291 33.784  26.279  1.00 21.36 ? 179 TYR B CA   1 
ATOM   3024 C C    . TYR B 1 179 ? 21.106 34.087  24.790  1.00 16.25 ? 179 TYR B C    1 
ATOM   3025 O O    . TYR B 1 179 ? 22.082 34.258  24.061  1.00 17.66 ? 179 TYR B O    1 
ATOM   3026 C CB   . TYR B 1 179 ? 20.892 32.339  26.609  1.00 22.39 ? 179 TYR B CB   1 
ATOM   3027 C CG   . TYR B 1 179 ? 21.514 31.257  25.759  1.00 17.96 ? 179 TYR B CG   1 
ATOM   3028 C CD1  . TYR B 1 179 ? 22.831 30.842  25.963  1.00 16.55 ? 179 TYR B CD1  1 
ATOM   3029 C CD2  . TYR B 1 179 ? 20.759 30.598  24.786  1.00 22.96 ? 179 TYR B CD2  1 
ATOM   3030 C CE1  . TYR B 1 179 ? 23.378 29.792  25.222  1.00 13.49 ? 179 TYR B CE1  1 
ATOM   3031 C CE2  . TYR B 1 179 ? 21.295 29.549  24.041  1.00 16.87 ? 179 TYR B CE2  1 
ATOM   3032 C CZ   . TYR B 1 179 ? 22.598 29.151  24.264  1.00 19.04 ? 179 TYR B CZ   1 
ATOM   3033 O OH   . TYR B 1 179 ? 23.110 28.108  23.527  1.00 22.39 ? 179 TYR B OH   1 
ATOM   3034 N N    . VAL B 1 180 ? 19.850 34.194  24.362  1.00 14.69 ? 180 VAL B N    1 
ATOM   3035 C CA   . VAL B 1 180 ? 19.513 34.500  22.973  1.00 19.93 ? 180 VAL B CA   1 
ATOM   3036 C C    . VAL B 1 180 ? 20.072 35.863  22.559  1.00 23.03 ? 180 VAL B C    1 
ATOM   3037 O O    . VAL B 1 180 ? 20.697 35.980  21.510  1.00 27.98 ? 180 VAL B O    1 
ATOM   3038 C CB   . VAL B 1 180 ? 17.978 34.484  22.745  1.00 20.59 ? 180 VAL B CB   1 
ATOM   3039 C CG1  . VAL B 1 180 ? 17.625 35.055  21.374  1.00 17.36 ? 180 VAL B CG1  1 
ATOM   3040 C CG2  . VAL B 1 180 ? 17.452 33.068  22.856  1.00 24.86 ? 180 VAL B CG2  1 
ATOM   3041 N N    . GLY B 1 181 ? 19.865 36.879  23.395  1.00 25.76 ? 181 GLY B N    1 
ATOM   3042 C CA   . GLY B 1 181 ? 20.361 38.210  23.083  1.00 19.47 ? 181 GLY B CA   1 
ATOM   3043 C C    . GLY B 1 181 ? 21.875 38.254  22.999  1.00 23.23 ? 181 GLY B C    1 
ATOM   3044 O O    . GLY B 1 181 ? 22.445 38.877  22.102  1.00 25.56 ? 181 GLY B O    1 
ATOM   3045 N N    . ARG B 1 182 ? 22.522 37.554  23.923  1.00 20.89 ? 182 ARG B N    1 
ATOM   3046 C CA   . ARG B 1 182 ? 23.978 37.496  23.994  1.00 21.36 ? 182 ARG B CA   1 
ATOM   3047 C C    . ARG B 1 182 ? 24.591 36.826  22.759  1.00 25.10 ? 182 ARG B C    1 
ATOM   3048 O O    . ARG B 1 182 ? 25.530 37.356  22.162  1.00 25.87 ? 182 ARG B O    1 
ATOM   3049 C CB   . ARG B 1 182 ? 24.393 36.743  25.260  1.00 16.90 ? 182 ARG B CB   1 
ATOM   3050 C CG   . ARG B 1 182 ? 25.872 36.818  25.602  1.00 24.25 ? 182 ARG B CG   1 
ATOM   3051 C CD   . ARG B 1 182 ? 26.198 35.901  26.779  1.00 25.43 ? 182 ARG B CD   1 
ATOM   3052 N NE   . ARG B 1 182 ? 25.217 36.053  27.848  1.00 33.34 ? 182 ARG B NE   1 
ATOM   3053 C CZ   . ARG B 1 182 ? 24.516 35.055  28.377  1.00 33.74 ? 182 ARG B CZ   1 
ATOM   3054 N NH1  . ARG B 1 182 ? 24.685 33.808  27.956  1.00 30.68 ? 182 ARG B NH1  1 
ATOM   3055 N NH2  . ARG B 1 182 ? 23.594 35.315  29.291  1.00 33.52 ? 182 ARG B NH2  1 
ATOM   3056 N N    . LEU B 1 183 ? 24.069 35.659  22.384  1.00 24.67 ? 183 LEU B N    1 
ATOM   3057 C CA   . LEU B 1 183 ? 24.586 34.942  21.220  1.00 25.51 ? 183 LEU B CA   1 
ATOM   3058 C C    . LEU B 1 183 ? 24.290 35.679  19.910  1.00 25.86 ? 183 LEU B C    1 
ATOM   3059 O O    . LEU B 1 183 ? 25.139 35.736  19.024  1.00 21.11 ? 183 LEU B O    1 
ATOM   3060 C CB   . LEU B 1 183 ? 24.045 33.510  21.165  1.00 19.82 ? 183 LEU B CB   1 
ATOM   3061 C CG   . LEU B 1 183 ? 24.545 32.516  22.220  1.00 22.88 ? 183 LEU B CG   1 
ATOM   3062 C CD1  . LEU B 1 183 ? 24.214 31.104  21.769  1.00 23.82 ? 183 LEU B CD1  1 
ATOM   3063 C CD2  . LEU B 1 183 ? 26.046 32.644  22.408  1.00 23.87 ? 183 LEU B CD2  1 
ATOM   3064 N N    . SER B 1 184 ? 23.088 36.246  19.806  1.00 25.81 ? 184 SER B N    1 
ATOM   3065 C CA   . SER B 1 184 ? 22.673 37.002  18.627  1.00 23.93 ? 184 SER B CA   1 
ATOM   3066 C C    . SER B 1 184 ? 23.539 38.243  18.419  1.00 28.11 ? 184 SER B C    1 
ATOM   3067 O O    . SER B 1 184 ? 23.526 38.835  17.337  1.00 31.16 ? 184 SER B O    1 
ATOM   3068 C CB   . SER B 1 184 ? 21.222 37.457  18.768  1.00 14.90 ? 184 SER B CB   1 
ATOM   3069 O OG   . SER B 1 184 ? 20.335 36.362  18.844  1.00 30.76 ? 184 SER B OG   1 
ATOM   3070 N N    . ALA B 1 185 ? 24.266 38.642  19.462  1.00 26.80 ? 185 ALA B N    1 
ATOM   3071 C CA   . ALA B 1 185 ? 25.122 39.823  19.411  1.00 27.09 ? 185 ALA B CA   1 
ATOM   3072 C C    . ALA B 1 185 ? 26.542 39.550  18.918  1.00 28.52 ? 185 ALA B C    1 
ATOM   3073 O O    . ALA B 1 185 ? 27.303 40.486  18.666  1.00 30.61 ? 185 ALA B O    1 
ATOM   3074 C CB   . ALA B 1 185 ? 25.160 40.503  20.777  1.00 21.64 ? 185 ALA B CB   1 
ATOM   3075 N N    . ARG B 1 186 ? 26.911 38.278  18.801  1.00 25.71 ? 186 ARG B N    1 
ATOM   3076 C CA   . ARG B 1 186 ? 28.247 37.925  18.324  1.00 23.55 ? 186 ARG B CA   1 
ATOM   3077 C C    . ARG B 1 186 ? 28.400 38.520  16.923  1.00 22.21 ? 186 ARG B C    1 
ATOM   3078 O O    . ARG B 1 186 ? 27.537 38.330  16.069  1.00 23.51 ? 186 ARG B O    1 
ATOM   3079 C CB   . ARG B 1 186 ? 28.419 36.402  18.319  1.00 19.99 ? 186 ARG B CB   1 
ATOM   3080 C CG   . ARG B 1 186 ? 28.309 35.792  19.719  1.00 21.64 ? 186 ARG B CG   1 
ATOM   3081 C CD   . ARG B 1 186 ? 28.265 34.267  19.701  1.00 16.75 ? 186 ARG B CD   1 
ATOM   3082 N NE   . ARG B 1 186 ? 29.456 33.685  19.091  1.00 11.01 ? 186 ARG B NE   1 
ATOM   3083 C CZ   . ARG B 1 186 ? 30.578 33.396  19.744  1.00 17.73 ? 186 ARG B CZ   1 
ATOM   3084 N NH1  . ARG B 1 186 ? 30.676 33.621  21.050  1.00 17.95 ? 186 ARG B NH1  1 
ATOM   3085 N NH2  . ARG B 1 186 ? 31.604 32.869  19.090  1.00 10.28 ? 186 ARG B NH2  1 
ATOM   3086 N N    . PRO B 1 187 ? 29.488 39.274  16.686  1.00 22.42 ? 187 PRO B N    1 
ATOM   3087 C CA   . PRO B 1 187 ? 29.827 39.950  15.425  1.00 24.57 ? 187 PRO B CA   1 
ATOM   3088 C C    . PRO B 1 187 ? 29.441 39.247  14.115  1.00 26.00 ? 187 PRO B C    1 
ATOM   3089 O O    . PRO B 1 187 ? 28.553 39.717  13.390  1.00 25.25 ? 187 PRO B O    1 
ATOM   3090 C CB   . PRO B 1 187 ? 31.335 40.139  15.548  1.00 24.22 ? 187 PRO B CB   1 
ATOM   3091 C CG   . PRO B 1 187 ? 31.496 40.416  16.994  1.00 27.95 ? 187 PRO B CG   1 
ATOM   3092 C CD   . PRO B 1 187 ? 30.617 39.361  17.630  1.00 23.17 ? 187 PRO B CD   1 
ATOM   3093 N N    . LYS B 1 188 ? 30.106 38.132  13.817  1.00 23.67 ? 188 LYS B N    1 
ATOM   3094 C CA   . LYS B 1 188 ? 29.845 37.374  12.593  1.00 23.78 ? 188 LYS B CA   1 
ATOM   3095 C C    . LYS B 1 188 ? 28.436 36.797  12.510  1.00 20.64 ? 188 LYS B C    1 
ATOM   3096 O O    . LYS B 1 188 ? 27.838 36.774  11.434  1.00 25.30 ? 188 LYS B O    1 
ATOM   3097 C CB   . LYS B 1 188 ? 30.881 36.265  12.427  1.00 20.40 ? 188 LYS B CB   1 
ATOM   3098 C CG   . LYS B 1 188 ? 32.297 36.785  12.316  1.00 24.48 ? 188 LYS B CG   1 
ATOM   3099 C CD   . LYS B 1 188 ? 33.317 35.663  12.365  1.00 36.35 ? 188 LYS B CD   1 
ATOM   3100 C CE   . LYS B 1 188 ? 34.731 36.219  12.413  1.00 43.75 ? 188 LYS B CE   1 
ATOM   3101 N NZ   . LYS B 1 188 ? 34.991 37.115  11.248  1.00 55.43 ? 188 LYS B NZ   1 
ATOM   3102 N N    . LEU B 1 189 ? 27.900 36.357  13.647  1.00 23.46 ? 189 LEU B N    1 
ATOM   3103 C CA   . LEU B 1 189 ? 26.554 35.785  13.697  1.00 21.09 ? 189 LEU B CA   1 
ATOM   3104 C C    . LEU B 1 189 ? 25.487 36.847  13.462  1.00 21.58 ? 189 LEU B C    1 
ATOM   3105 O O    . LEU B 1 189 ? 24.491 36.594  12.780  1.00 23.91 ? 189 LEU B O    1 
ATOM   3106 C CB   . LEU B 1 189 ? 26.301 35.116  15.050  1.00 22.39 ? 189 LEU B CB   1 
ATOM   3107 C CG   . LEU B 1 189 ? 25.680 33.717  15.053  1.00 21.83 ? 189 LEU B CG   1 
ATOM   3108 C CD1  . LEU B 1 189 ? 25.217 33.395  16.463  1.00 25.64 ? 189 LEU B CD1  1 
ATOM   3109 C CD2  . LEU B 1 189 ? 24.513 33.625  14.092  1.00 18.77 ? 189 LEU B CD2  1 
ATOM   3110 N N    . LYS B 1 190 ? 25.695 38.025  14.049  1.00 21.42 ? 190 LYS B N    1 
ATOM   3111 C CA   . LYS B 1 190 ? 24.762 39.142  13.912  1.00 24.54 ? 190 LYS B CA   1 
ATOM   3112 C C    . LYS B 1 190 ? 24.663 39.571  12.448  1.00 22.51 ? 190 LYS B C    1 
ATOM   3113 O O    . LYS B 1 190 ? 23.568 39.802  11.932  1.00 18.33 ? 190 LYS B O    1 
ATOM   3114 C CB   . LYS B 1 190 ? 25.213 40.329  14.764  1.00 23.82 ? 190 LYS B CB   1 
ATOM   3115 C CG   . LYS B 1 190 ? 24.250 41.493  14.713  1.00 30.28 ? 190 LYS B CG   1 
ATOM   3116 C CD   . LYS B 1 190 ? 24.779 42.685  15.469  1.00 34.82 ? 190 LYS B CD   1 
ATOM   3117 C CE   . LYS B 1 190 ? 23.784 43.830  15.405  1.00 40.28 ? 190 LYS B CE   1 
ATOM   3118 N NZ   . LYS B 1 190 ? 24.286 45.018  16.141  1.00 49.70 ? 190 LYS B NZ   1 
ATOM   3119 N N    . ALA B 1 191 ? 25.819 39.665  11.794  1.00 19.36 ? 191 ALA B N    1 
ATOM   3120 C CA   . ALA B 1 191 ? 25.898 40.042  10.385  1.00 23.33 ? 191 ALA B CA   1 
ATOM   3121 C C    . ALA B 1 191 ? 25.154 39.015  9.527   1.00 24.35 ? 191 ALA B C    1 
ATOM   3122 O O    . ALA B 1 191 ? 24.355 39.377  8.661   1.00 27.15 ? 191 ALA B O    1 
ATOM   3123 C CB   . ALA B 1 191 ? 27.357 40.133  9.957   1.00 16.25 ? 191 ALA B CB   1 
ATOM   3124 N N    . PHE B 1 192 ? 25.393 37.733  9.803   1.00 26.56 ? 192 PHE B N    1 
ATOM   3125 C CA   . PHE B 1 192 ? 24.747 36.647  9.071   1.00 23.56 ? 192 PHE B CA   1 
ATOM   3126 C C    . PHE B 1 192 ? 23.232 36.623  9.256   1.00 20.20 ? 192 PHE B C    1 
ATOM   3127 O O    . PHE B 1 192 ? 22.489 36.459  8.290   1.00 22.15 ? 192 PHE B O    1 
ATOM   3128 C CB   . PHE B 1 192 ? 25.346 35.292  9.473   1.00 24.14 ? 192 PHE B CB   1 
ATOM   3129 C CG   . PHE B 1 192 ? 24.670 34.111  8.822   1.00 24.70 ? 192 PHE B CG   1 
ATOM   3130 C CD1  . PHE B 1 192 ? 24.921 33.794  7.488   1.00 25.11 ? 192 PHE B CD1  1 
ATOM   3131 C CD2  . PHE B 1 192 ? 23.762 33.329  9.536   1.00 20.51 ? 192 PHE B CD2  1 
ATOM   3132 C CE1  . PHE B 1 192 ? 24.274 32.721  6.871   1.00 22.20 ? 192 PHE B CE1  1 
ATOM   3133 C CE2  . PHE B 1 192 ? 23.110 32.256  8.930   1.00 22.34 ? 192 PHE B CE2  1 
ATOM   3134 C CZ   . PHE B 1 192 ? 23.367 31.951  7.593   1.00 19.70 ? 192 PHE B CZ   1 
ATOM   3135 N N    . LEU B 1 193 ? 22.773 36.789  10.492  1.00 19.04 ? 193 LEU B N    1 
ATOM   3136 C CA   . LEU B 1 193 ? 21.336 36.771  10.775  1.00 21.91 ? 193 LEU B CA   1 
ATOM   3137 C C    . LEU B 1 193 ? 20.581 37.923  10.123  1.00 23.67 ? 193 LEU B C    1 
ATOM   3138 O O    . LEU B 1 193 ? 19.370 37.834  9.914   1.00 24.03 ? 193 LEU B O    1 
ATOM   3139 C CB   . LEU B 1 193 ? 21.076 36.772  12.286  1.00 17.76 ? 193 LEU B CB   1 
ATOM   3140 C CG   . LEU B 1 193 ? 21.483 35.511  13.052  1.00 24.07 ? 193 LEU B CG   1 
ATOM   3141 C CD1  . LEU B 1 193 ? 21.284 35.724  14.541  1.00 23.33 ? 193 LEU B CD1  1 
ATOM   3142 C CD2  . LEU B 1 193 ? 20.676 34.320  12.567  1.00 19.04 ? 193 LEU B CD2  1 
ATOM   3143 N N    . ALA B 1 194 ? 21.300 38.993  9.790   1.00 22.81 ? 194 ALA B N    1 
ATOM   3144 C CA   . ALA B 1 194 ? 20.686 40.157  9.166   1.00 22.80 ? 194 ALA B CA   1 
ATOM   3145 C C    . ALA B 1 194 ? 20.754 40.134  7.639   1.00 25.52 ? 194 ALA B C    1 
ATOM   3146 O O    . ALA B 1 194 ? 20.049 40.896  6.977   1.00 29.76 ? 194 ALA B O    1 
ATOM   3147 C CB   . ALA B 1 194 ? 21.328 41.430  9.699   1.00 19.44 ? 194 ALA B CB   1 
ATOM   3148 N N    . SER B 1 195 ? 21.581 39.247  7.087   1.00 26.56 ? 195 SER B N    1 
ATOM   3149 C CA   . SER B 1 195 ? 21.767 39.134  5.634   1.00 25.66 ? 195 SER B CA   1 
ATOM   3150 C C    . SER B 1 195 ? 20.570 38.551  4.875   1.00 26.69 ? 195 SER B C    1 
ATOM   3151 O O    . SER B 1 195 ? 19.751 37.834  5.450   1.00 28.26 ? 195 SER B O    1 
ATOM   3152 C CB   . SER B 1 195 ? 23.009 38.296  5.336   1.00 23.10 ? 195 SER B CB   1 
ATOM   3153 O OG   . SER B 1 195 ? 22.754 36.920  5.553   1.00 29.46 ? 195 SER B OG   1 
ATOM   3154 N N    . PRO B 1 196 ? 20.459 38.850  3.566   1.00 26.01 ? 196 PRO B N    1 
ATOM   3155 C CA   . PRO B 1 196 ? 19.368 38.363  2.712   1.00 24.55 ? 196 PRO B CA   1 
ATOM   3156 C C    . PRO B 1 196 ? 19.424 36.837  2.613   1.00 24.15 ? 196 PRO B C    1 
ATOM   3157 O O    . PRO B 1 196 ? 18.404 36.167  2.472   1.00 22.73 ? 196 PRO B O    1 
ATOM   3158 C CB   . PRO B 1 196 ? 19.684 38.997  1.354   1.00 23.65 ? 196 PRO B CB   1 
ATOM   3159 C CG   . PRO B 1 196 ? 20.451 40.225  1.711   1.00 26.05 ? 196 PRO B CG   1 
ATOM   3160 C CD   . PRO B 1 196 ? 21.359 39.731  2.794   1.00 24.65 ? 196 PRO B CD   1 
ATOM   3161 N N    . GLU B 1 197 ? 20.648 36.319  2.669   1.00 20.70 ? 197 GLU B N    1 
ATOM   3162 C CA   . GLU B 1 197 ? 20.949 34.893  2.601   1.00 22.38 ? 197 GLU B CA   1 
ATOM   3163 C C    . GLU B 1 197 ? 20.135 34.114  3.635   1.00 26.67 ? 197 GLU B C    1 
ATOM   3164 O O    . GLU B 1 197 ? 19.642 33.013  3.363   1.00 25.57 ? 197 GLU B O    1 
ATOM   3165 C CB   . GLU B 1 197 ? 22.436 34.720  2.888   1.00 26.03 ? 197 GLU B CB   1 
ATOM   3166 C CG   . GLU B 1 197 ? 23.027 33.392  2.540   1.00 28.07 ? 197 GLU B CG   1 
ATOM   3167 C CD   . GLU B 1 197 ? 24.517 33.359  2.798   1.00 31.05 ? 197 GLU B CD   1 
ATOM   3168 O OE1  . GLU B 1 197 ? 25.173 34.412  2.628   1.00 34.49 ? 197 GLU B OE1  1 
ATOM   3169 O OE2  . GLU B 1 197 ? 25.031 32.280  3.159   1.00 38.12 ? 197 GLU B OE2  1 
ATOM   3170 N N    . TYR B 1 198 ? 20.005 34.702  4.823   1.00 25.70 ? 198 TYR B N    1 
ATOM   3171 C CA   . TYR B 1 198 ? 19.261 34.105  5.923   1.00 19.98 ? 198 TYR B CA   1 
ATOM   3172 C C    . TYR B 1 198 ? 17.818 34.610  5.957   1.00 21.34 ? 198 TYR B C    1 
ATOM   3173 O O    . TYR B 1 198 ? 16.867 33.826  5.883   1.00 24.11 ? 198 TYR B O    1 
ATOM   3174 C CB   . TYR B 1 198 ? 19.967 34.420  7.254   1.00 19.33 ? 198 TYR B CB   1 
ATOM   3175 C CG   . TYR B 1 198 ? 19.226 33.955  8.490   1.00 24.19 ? 198 TYR B CG   1 
ATOM   3176 C CD1  . TYR B 1 198 ? 19.427 32.677  9.012   1.00 28.61 ? 198 TYR B CD1  1 
ATOM   3177 C CD2  . TYR B 1 198 ? 18.309 34.789  9.127   1.00 22.65 ? 198 TYR B CD2  1 
ATOM   3178 C CE1  . TYR B 1 198 ? 18.727 32.239  10.140  1.00 29.02 ? 198 TYR B CE1  1 
ATOM   3179 C CE2  . TYR B 1 198 ? 17.608 34.367  10.249  1.00 28.33 ? 198 TYR B CE2  1 
ATOM   3180 C CZ   . TYR B 1 198 ? 17.817 33.092  10.750  1.00 30.29 ? 198 TYR B CZ   1 
ATOM   3181 O OH   . TYR B 1 198 ? 17.103 32.675  11.849  1.00 29.25 ? 198 TYR B OH   1 
ATOM   3182 N N    . VAL B 1 199 ? 17.670 35.927  6.049   1.00 20.52 ? 199 VAL B N    1 
ATOM   3183 C CA   . VAL B 1 199 ? 16.366 36.582  6.134   1.00 18.57 ? 199 VAL B CA   1 
ATOM   3184 C C    . VAL B 1 199 ? 15.352 36.264  5.038   1.00 19.49 ? 199 VAL B C    1 
ATOM   3185 O O    . VAL B 1 199 ? 14.171 36.078  5.326   1.00 20.62 ? 199 VAL B O    1 
ATOM   3186 C CB   . VAL B 1 199 ? 16.534 38.123  6.238   1.00 20.57 ? 199 VAL B CB   1 
ATOM   3187 C CG1  . VAL B 1 199 ? 15.184 38.817  6.206   1.00 16.74 ? 199 VAL B CG1  1 
ATOM   3188 C CG2  . VAL B 1 199 ? 17.271 38.484  7.512   1.00 15.97 ? 199 VAL B CG2  1 
ATOM   3189 N N    . ASN B 1 200 ? 15.803 36.184  3.790   1.00 22.85 ? 200 ASN B N    1 
ATOM   3190 C CA   . ASN B 1 200 ? 14.886 35.928  2.675   1.00 24.75 ? 200 ASN B CA   1 
ATOM   3191 C C    . ASN B 1 200 ? 14.529 34.473  2.387   1.00 24.89 ? 200 ASN B C    1 
ATOM   3192 O O    . ASN B 1 200 ? 13.881 34.168  1.385   1.00 27.66 ? 200 ASN B O    1 
ATOM   3193 C CB   . ASN B 1 200 ? 15.377 36.642  1.412   1.00 25.85 ? 200 ASN B CB   1 
ATOM   3194 C CG   . ASN B 1 200 ? 15.353 38.154  1.561   1.00 27.06 ? 200 ASN B CG   1 
ATOM   3195 O OD1  . ASN B 1 200 ? 14.457 38.706  2.201   1.00 25.98 ? 200 ASN B OD1  1 
ATOM   3196 N ND2  . ASN B 1 200 ? 16.351 38.828  1.000   1.00 24.47 ? 200 ASN B ND2  1 
ATOM   3197 N N    . LEU B 1 201 ? 14.936 33.584  3.283   1.00 24.34 ? 201 LEU B N    1 
ATOM   3198 C CA   . LEU B 1 201 ? 14.641 32.164  3.155   1.00 25.53 ? 201 LEU B CA   1 
ATOM   3199 C C    . LEU B 1 201 ? 13.515 31.839  4.129   1.00 23.67 ? 201 LEU B C    1 
ATOM   3200 O O    . LEU B 1 201 ? 13.528 32.304  5.271   1.00 24.51 ? 201 LEU B O    1 
ATOM   3201 C CB   . LEU B 1 201 ? 15.881 31.355  3.532   1.00 23.76 ? 201 LEU B CB   1 
ATOM   3202 C CG   . LEU B 1 201 ? 16.493 30.419  2.496   1.00 25.37 ? 201 LEU B CG   1 
ATOM   3203 C CD1  . LEU B 1 201 ? 16.619 31.110  1.151   1.00 14.82 ? 201 LEU B CD1  1 
ATOM   3204 C CD2  . LEU B 1 201 ? 17.848 29.953  3.002   1.00 24.74 ? 201 LEU B CD2  1 
ATOM   3205 N N    . PRO B 1 202 ? 12.488 31.097  3.676   1.00 24.64 ? 202 PRO B N    1 
ATOM   3206 C CA   . PRO B 1 202 ? 11.390 30.756  4.594   1.00 24.48 ? 202 PRO B CA   1 
ATOM   3207 C C    . PRO B 1 202 ? 11.907 29.747  5.625   1.00 25.08 ? 202 PRO B C    1 
ATOM   3208 O O    . PRO B 1 202 ? 12.851 29.003  5.345   1.00 24.30 ? 202 PRO B O    1 
ATOM   3209 C CB   . PRO B 1 202 ? 10.350 30.134  3.662   1.00 19.43 ? 202 PRO B CB   1 
ATOM   3210 C CG   . PRO B 1 202 ? 11.187 29.505  2.596   1.00 18.26 ? 202 PRO B CG   1 
ATOM   3211 C CD   . PRO B 1 202 ? 12.232 30.566  2.328   1.00 19.55 ? 202 PRO B CD   1 
ATOM   3212 N N    . ILE B 1 203 ? 11.325 29.746  6.822   1.00 21.21 ? 203 ILE B N    1 
ATOM   3213 C CA   . ILE B 1 203 ? 11.769 28.824  7.865   1.00 25.05 ? 203 ILE B CA   1 
ATOM   3214 C C    . ILE B 1 203 ? 11.506 27.368  7.468   1.00 23.81 ? 203 ILE B C    1 
ATOM   3215 O O    . ILE B 1 203 ? 12.410 26.528  7.505   1.00 19.68 ? 203 ILE B O    1 
ATOM   3216 C CB   . ILE B 1 203 ? 11.087 29.126  9.234   1.00 24.97 ? 203 ILE B CB   1 
ATOM   3217 C CG1  . ILE B 1 203 ? 11.539 30.496  9.751   1.00 21.90 ? 203 ILE B CG1  1 
ATOM   3218 C CG2  . ILE B 1 203 ? 11.443 28.047  10.257  1.00 17.71 ? 203 ILE B CG2  1 
ATOM   3219 C CD1  . ILE B 1 203 ? 10.893 30.904  11.060  1.00 28.08 ? 203 ILE B CD1  1 
ATOM   3220 N N    . ASN B 1 204 ? 10.273 27.098  7.053   1.00 21.16 ? 204 ASN B N    1 
ATOM   3221 C CA   . ASN B 1 204 ? 9.868  25.757  6.658   1.00 25.06 ? 204 ASN B CA   1 
ATOM   3222 C C    . ASN B 1 204 ? 9.429  25.659  5.195   1.00 27.97 ? 204 ASN B C    1 
ATOM   3223 O O    . ASN B 1 204 ? 9.132  26.666  4.548   1.00 23.05 ? 204 ASN B O    1 
ATOM   3224 C CB   . ASN B 1 204 ? 8.749  25.268  7.586   1.00 23.58 ? 204 ASN B CB   1 
ATOM   3225 C CG   . ASN B 1 204 ? 9.135  25.365  9.053   1.00 25.14 ? 204 ASN B CG   1 
ATOM   3226 O OD1  . ASN B 1 204 ? 10.094 24.730  9.492   1.00 17.03 ? 204 ASN B OD1  1 
ATOM   3227 N ND2  . ASN B 1 204 ? 8.392  26.159  9.813   1.00 23.78 ? 204 ASN B ND2  1 
ATOM   3228 N N    . GLY B 1 205 ? 9.396  24.430  4.688   1.00 30.19 ? 205 GLY B N    1 
ATOM   3229 C CA   . GLY B 1 205 ? 9.018  24.184  3.311   1.00 26.72 ? 205 GLY B CA   1 
ATOM   3230 C C    . GLY B 1 205 ? 7.556  24.355  2.944   1.00 30.67 ? 205 GLY B C    1 
ATOM   3231 O O    . GLY B 1 205 ? 7.223  24.334  1.761   1.00 36.72 ? 205 GLY B O    1 
ATOM   3232 N N    . ASN B 1 206 ? 6.676  24.527  3.925   1.00 28.40 ? 206 ASN B N    1 
ATOM   3233 C CA   . ASN B 1 206 ? 5.256  24.695  3.624   1.00 26.69 ? 206 ASN B CA   1 
ATOM   3234 C C    . ASN B 1 206 ? 4.724  26.105  3.889   1.00 31.27 ? 206 ASN B C    1 
ATOM   3235 O O    . ASN B 1 206 ? 3.511  26.327  3.918   1.00 30.68 ? 206 ASN B O    1 
ATOM   3236 C CB   . ASN B 1 206 ? 4.406  23.646  4.359   1.00 27.24 ? 206 ASN B CB   1 
ATOM   3237 C CG   . ASN B 1 206 ? 4.395  23.837  5.869   1.00 30.67 ? 206 ASN B CG   1 
ATOM   3238 O OD1  . ASN B 1 206 ? 5.209  24.572  6.426   1.00 30.77 ? 206 ASN B OD1  1 
ATOM   3239 N ND2  . ASN B 1 206 ? 3.457  23.173  6.537   1.00 27.18 ? 206 ASN B ND2  1 
ATOM   3240 N N    . GLY B 1 207 ? 5.634  27.054  4.089   1.00 33.79 ? 207 GLY B N    1 
ATOM   3241 C CA   . GLY B 1 207 ? 5.230  28.428  4.331   1.00 39.51 ? 207 GLY B CA   1 
ATOM   3242 C C    . GLY B 1 207 ? 4.623  28.715  5.693   1.00 42.29 ? 207 GLY B C    1 
ATOM   3243 O O    . GLY B 1 207 ? 4.155  29.828  5.936   1.00 45.87 ? 207 GLY B O    1 
ATOM   3244 N N    . LYS B 1 208 ? 4.597  27.717  6.571   1.00 38.26 ? 208 LYS B N    1 
ATOM   3245 C CA   . LYS B 1 208 ? 4.056  27.909  7.911   1.00 33.75 ? 208 LYS B CA   1 
ATOM   3246 C C    . LYS B 1 208 ? 5.206  28.170  8.878   1.00 32.71 ? 208 LYS B C    1 
ATOM   3247 O O    . LYS B 1 208 ? 6.328  27.720  8.647   1.00 30.30 ? 208 LYS B O    1 
ATOM   3248 C CB   . LYS B 1 208 ? 3.233  26.695  8.341   1.00 34.70 ? 208 LYS B CB   1 
ATOM   3249 C CG   . LYS B 1 208 ? 2.007  26.480  7.474   1.00 34.73 ? 208 LYS B CG   1 
ATOM   3250 C CD   . LYS B 1 208 ? 1.195  25.291  7.926   1.00 36.87 ? 208 LYS B CD   1 
ATOM   3251 C CE   . LYS B 1 208 ? -0.012 25.107  7.027   1.00 37.22 ? 208 LYS B CE   1 
ATOM   3252 N NZ   . LYS B 1 208 ? -0.843 23.951  7.447   1.00 41.92 ? 208 LYS B NZ   1 
ATOM   3253 N N    . GLN B 1 209 ? 4.930  28.935  9.932   1.00 31.28 ? 209 GLN B N    1 
ATOM   3254 C CA   . GLN B 1 209 ? 5.937  29.288  10.932  1.00 30.34 ? 209 GLN B CA   1 
ATOM   3255 C C    . GLN B 1 209 ? 5.293  29.857  12.198  1.00 32.42 ? 209 GLN B C    1 
ATOM   3256 O O    . GLN B 1 209 ? 6.039  30.248  13.126  1.00 30.09 ? 209 GLN B O    1 
ATOM   3257 C CB   . GLN B 1 209 ? 6.903  30.317  10.352  1.00 29.10 ? 209 GLN B CB   1 
ATOM   3258 C CG   . GLN B 1 209 ? 6.206  31.505  9.726   1.00 31.66 ? 209 GLN B CG   1 
ATOM   3259 C CD   . GLN B 1 209 ? 7.146  32.636  9.396   1.00 37.34 ? 209 GLN B CD   1 
ATOM   3260 O OE1  . GLN B 1 209 ? 6.914  33.780  9.783   1.00 42.45 ? 209 GLN B OE1  1 
ATOM   3261 N NE2  . GLN B 1 209 ? 8.237  32.319  8.697   1.00 35.16 ? 209 GLN B NE2  1 
ATOM   3262 O OXT  . GLN B 1 209 ? 4.045  29.916  12.245  1.00 32.94 ? 209 GLN B OXT  1 
HETATM 3263 N N    . VWW C 2 .   ? 15.088 10.798  23.547  1.00 14.90 ? 210 VWW A N    1 
HETATM 3264 C CA   . VWW C 2 .   ? 15.010 9.987   24.792  1.00 20.92 ? 210 VWW A CA   1 
HETATM 3265 C C    . VWW C 2 .   ? 16.115 8.924   24.830  1.00 21.55 ? 210 VWW A C    1 
HETATM 3266 O O    . VWW C 2 .   ? 16.520 8.515   25.940  1.00 17.16 ? 210 VWW A O    1 
HETATM 3267 C CB   . VWW C 2 .   ? 13.635 9.327   24.908  1.00 14.23 ? 210 VWW A CB   1 
HETATM 3268 C CG   . VWW C 2 .   ? 13.394 8.708   26.271  1.00 18.34 ? 210 VWW A CG   1 
HETATM 3269 C CD   . VWW C 2 .   ? 12.045 8.046   26.402  1.00 18.27 ? 210 VWW A CD   1 
HETATM 3270 O OE1  . VWW C 2 .   ? 11.293 7.936   25.435  1.00 19.98 ? 210 VWW A OE1  1 
HETATM 3271 O OXT  . VWW C 2 .   ? 16.578 8.524   23.744  1.00 21.48 ? 210 VWW A OXT  1 
HETATM 3272 N N1   . VWW C 2 .   ? 11.726 7.642   27.628  1.00 23.67 ? 210 VWW A N1   1 
HETATM 3273 C CA1  . VWW C 2 .   ? 10.472 6.967   27.934  1.00 24.20 ? 210 VWW A CA1  1 
HETATM 3274 C CB1  . VWW C 2 .   ? 10.726 5.484   28.206  1.00 26.79 ? 210 VWW A CB1  1 
HETATM 3275 S SG   . VWW C 2 .   ? 11.291 4.524   26.810  1.00 31.02 ? 210 VWW A SG   1 
HETATM 3276 C CD1  . VWW C 2 .   ? 9.729  3.804   26.262  1.00 32.02 ? 210 VWW A CD1  1 
HETATM 3277 C CE   . VWW C 2 .   ? 8.930  3.171   27.370  1.00 33.22 ? 210 VWW A CE   1 
HETATM 3278 C CZ1  . VWW C 2 .   ? 7.640  3.614   27.650  1.00 35.26 ? 210 VWW A CZ1  1 
HETATM 3279 C CZ2  . VWW C 2 .   ? 9.464  2.135   28.133  1.00 31.51 ? 210 VWW A CZ2  1 
HETATM 3280 C CT1  . VWW C 2 .   ? 6.893  3.037   28.673  1.00 35.56 ? 210 VWW A CT1  1 
HETATM 3281 C CT2  . VWW C 2 .   ? 8.723  1.550   29.161  1.00 27.28 ? 210 VWW A CT2  1 
HETATM 3282 C CH   . VWW C 2 .   ? 7.437  2.001   29.430  1.00 30.54 ? 210 VWW A CH   1 
HETATM 3283 C C1   . VWW C 2 .   ? 9.834  7.550   29.180  1.00 22.41 ? 210 VWW A C1   1 
HETATM 3284 O O1   . VWW C 2 .   ? 10.522 8.023   30.084  1.00 21.77 ? 210 VWW A O1   1 
HETATM 3285 N N2   . VWW C 2 .   ? 8.512  7.468   29.229  1.00 21.35 ? 210 VWW A N2   1 
HETATM 3286 C CA2  . VWW C 2 .   ? 7.740  7.933   30.366  1.00 24.25 ? 210 VWW A CA2  1 
HETATM 3287 C CB2  . VWW C 2 .   ? 6.555  7.062   30.633  1.00 24.94 ? 210 VWW A CB2  1 
HETATM 3288 C CG1  . VWW C 2 .   ? 5.330  7.315   30.027  1.00 25.47 ? 210 VWW A CG1  1 
HETATM 3289 C CD11 . VWW C 2 .   ? 4.250  6.459   30.220  1.00 26.21 ? 210 VWW A CD11 1 
HETATM 3290 C CE1  . VWW C 2 .   ? 4.392  5.339   31.027  1.00 24.08 ? 210 VWW A CE1  1 
HETATM 3291 C CD2  . VWW C 2 .   ? 5.611  5.081   31.640  1.00 25.33 ? 210 VWW A CD2  1 
HETATM 3292 C CG2  . VWW C 2 .   ? 6.683  5.941   31.441  1.00 26.11 ? 210 VWW A CG2  1 
HETATM 3293 C C2   . VWW C 2 .   ? 7.452  9.433   30.354  1.00 29.42 ? 210 VWW A C2   1 
HETATM 3294 O O2   . VWW C 2 .   ? 7.116  9.957   31.433  1.00 30.71 ? 210 VWW A O2   1 
HETATM 3295 O OXT1 . VWW C 2 .   ? 7.569  10.068  29.284  1.00 29.96 ? 210 VWW A OXT1 1 
HETATM 3296 O O1   . MES D 3 .   ? 22.426 -6.667  36.176  1.00 47.79 ? 211 MES A O1   1 
HETATM 3297 C C2   . MES D 3 .   ? 22.801 -7.743  37.079  1.00 46.49 ? 211 MES A C2   1 
HETATM 3298 C C3   . MES D 3 .   ? 23.908 -8.618  36.449  1.00 45.47 ? 211 MES A C3   1 
HETATM 3299 N N4   . MES D 3 .   ? 24.406 -8.004  35.114  1.00 49.73 ? 211 MES A N4   1 
HETATM 3300 C C5   . MES D 3 .   ? 24.696 -6.484  35.214  1.00 41.90 ? 211 MES A C5   1 
HETATM 3301 C C6   . MES D 3 .   ? 23.492 -5.734  35.827  1.00 45.08 ? 211 MES A C6   1 
HETATM 3302 C C7   . MES D 3 .   ? 25.584 -8.790  34.500  1.00 49.89 ? 211 MES A C7   1 
HETATM 3303 C C8   . MES D 3 .   ? 25.740 -8.580  32.981  1.00 55.35 ? 211 MES A C8   1 
HETATM 3304 S S    . MES D 3 .   ? 26.952 -9.695  32.274  1.00 57.16 ? 211 MES A S    1 
HETATM 3305 O O1S  . MES D 3 .   ? 27.719 -9.006  31.068  1.00 60.43 ? 211 MES A O1S  1 
HETATM 3306 O O2S  . MES D 3 .   ? 26.255 -11.032 31.776  1.00 58.34 ? 211 MES A O2S  1 
HETATM 3307 O O3S  . MES D 3 .   ? 28.102 -10.124 33.414  1.00 56.85 ? 211 MES A O3S  1 
HETATM 3308 N N    . VWW E 2 .   ? 17.077 12.945  10.162  1.00 16.89 ? 210 VWW B N    1 
HETATM 3309 C CA   . VWW E 2 .   ? 17.306 13.763  8.940   1.00 21.84 ? 210 VWW B CA   1 
HETATM 3310 C C    . VWW E 2 .   ? 18.253 14.931  9.229   1.00 24.69 ? 210 VWW B C    1 
HETATM 3311 O O    . VWW E 2 .   ? 18.940 15.391  8.288   1.00 19.58 ? 210 VWW B O    1 
HETATM 3312 C CB   . VWW E 2 .   ? 15.973 14.285  8.391   1.00 21.52 ? 210 VWW B CB   1 
HETATM 3313 C CG   . VWW E 2 .   ? 16.106 14.903  7.011   1.00 21.74 ? 210 VWW B CG   1 
HETATM 3314 C CD   . VWW E 2 .   ? 14.805 15.431  6.460   1.00 19.99 ? 210 VWW B CD   1 
HETATM 3315 O OE1  . VWW E 2 .   ? 13.783 15.449  7.146   1.00 22.91 ? 210 VWW B OE1  1 
HETATM 3316 O OXT  . VWW E 2 .   ? 18.308 15.365  10.399  1.00 24.44 ? 210 VWW B OXT  1 
HETATM 3317 N N1   . VWW E 2 .   ? 14.842 15.822  5.191   1.00 19.67 ? 210 VWW B N1   1 
HETATM 3318 C CA1  . VWW E 2 .   ? 13.684 16.374  4.504   1.00 22.40 ? 210 VWW B CA1  1 
HETATM 3319 C CB1  . VWW E 2 .   ? 13.860 17.880  4.304   1.00 25.98 ? 210 VWW B CB1  1 
HETATM 3320 S SG   . VWW E 2 .   ? 13.864 18.870  5.795   1.00 35.19 ? 210 VWW B SG   1 
HETATM 3321 C CD1  . VWW E 2 .   ? 12.146 19.418  5.816   1.00 31.95 ? 210 VWW B CD1  1 
HETATM 3322 C CE   . VWW E 2 .   ? 11.671 19.986  4.505   1.00 31.48 ? 210 VWW B CE   1 
HETATM 3323 C CZ1  . VWW E 2 .   ? 10.584 19.426  3.847   1.00 31.71 ? 210 VWW B CZ1  1 
HETATM 3324 C CZ2  . VWW E 2 .   ? 12.309 21.081  3.929   1.00 30.47 ? 210 VWW B CZ2  1 
HETATM 3325 C CT1  . VWW E 2 .   ? 10.137 19.946  2.637   1.00 34.94 ? 210 VWW B CT1  1 
HETATM 3326 C CT2  . VWW E 2 .   ? 11.868 21.609  2.717   1.00 29.43 ? 210 VWW B CT2  1 
HETATM 3327 C CH   . VWW E 2 .   ? 10.781 21.040  2.071   1.00 29.23 ? 210 VWW B CH   1 
HETATM 3328 C C1   . VWW E 2 .   ? 13.527 15.754  3.130   1.00 22.49 ? 210 VWW B C1   1 
HETATM 3329 O O1   . VWW E 2 .   ? 14.506 15.367  2.491   1.00 21.23 ? 210 VWW B O1   1 
HETATM 3330 N N2   . VWW E 2 .   ? 12.284 15.705  2.672   1.00 24.26 ? 210 VWW B N2   1 
HETATM 3331 C CA2  . VWW E 2 .   ? 11.953 15.187  1.357   1.00 26.47 ? 210 VWW B CA2  1 
HETATM 3332 C CB2  . VWW E 2 .   ? 10.828 15.943  0.724   1.00 27.64 ? 210 VWW B CB2  1 
HETATM 3333 C CG1  . VWW E 2 .   ? 9.506  15.556  0.922   1.00 28.67 ? 210 VWW B CG1  1 
HETATM 3334 C CD11 . VWW E 2 .   ? 8.460  16.304  0.392   1.00 26.56 ? 210 VWW B CD11 1 
HETATM 3335 C CE1  . VWW E 2 .   ? 8.734  17.449  -0.345  1.00 24.74 ? 210 VWW B CE1  1 
HETATM 3336 C CD2  . VWW E 2 .   ? 10.051 17.840  -0.551  1.00 27.11 ? 210 VWW B CD2  1 
HETATM 3337 C CG2  . VWW E 2 .   ? 11.088 17.086  -0.019  1.00 27.10 ? 210 VWW B CG2  1 
HETATM 3338 C C2   . VWW E 2 .   ? 11.827 13.665  1.299   1.00 32.59 ? 210 VWW B C2   1 
HETATM 3339 O O2   . VWW E 2 .   ? 11.904 13.131  0.176   1.00 37.14 ? 210 VWW B O2   1 
HETATM 3340 O OXT1 . VWW E 2 .   ? 11.666 13.022  2.358   1.00 31.09 ? 210 VWW B OXT1 1 
HETATM 3341 O O1   . MES F 3 .   ? 26.183 31.272  0.193   1.00 47.12 ? 211 MES B O1   1 
HETATM 3342 C C2   . MES F 3 .   ? 26.710 32.396  -0.566  1.00 47.61 ? 211 MES B C2   1 
HETATM 3343 C C3   . MES F 3 .   ? 27.473 33.366  0.366   1.00 47.56 ? 211 MES B C3   1 
HETATM 3344 N N4   . MES F 3 .   ? 27.589 32.781  1.797   1.00 49.71 ? 211 MES B N4   1 
HETATM 3345 C C5   . MES F 3 .   ? 28.048 31.299  1.811   1.00 44.05 ? 211 MES B C5   1 
HETATM 3346 C C6   . MES F 3 .   ? 27.174 30.444  0.869   1.00 43.80 ? 211 MES B C6   1 
HETATM 3347 C C7   . MES F 3 .   ? 28.433 33.671  2.737   1.00 50.84 ? 211 MES B C7   1 
HETATM 3348 C C8   . MES F 3 .   ? 28.128 33.451  4.233   1.00 55.09 ? 211 MES B C8   1 
HETATM 3349 S S    . MES F 3 .   ? 28.942 34.670  5.266   1.00 57.55 ? 211 MES B S    1 
HETATM 3350 O O1S  . MES F 3 .   ? 29.363 34.038  6.659   1.00 62.19 ? 211 MES B O1S  1 
HETATM 3351 O O2S  . MES F 3 .   ? 28.000 35.922  5.502   1.00 57.67 ? 211 MES B O2S  1 
HETATM 3352 O O3S  . MES F 3 .   ? 30.342 35.231  4.534   1.00 60.73 ? 211 MES B O3S  1 
HETATM 3353 O O    . HOH G 4 .   ? 16.856 5.713   8.800   1.00 16.93 ? 212 HOH A O    1 
HETATM 3354 O O    . HOH G 4 .   ? 24.864 12.790  14.954  1.00 15.27 ? 213 HOH A O    1 
HETATM 3355 O O    . HOH G 4 .   ? 19.222 10.125  22.641  1.00 14.60 ? 214 HOH A O    1 
HETATM 3356 O O    . HOH G 4 .   ? 17.994 -5.269  27.742  1.00 26.25 ? 215 HOH A O    1 
HETATM 3357 O O    . HOH G 4 .   ? 14.836 11.499  17.763  1.00 45.60 ? 216 HOH A O    1 
HETATM 3358 O O    . HOH G 4 .   ? 12.296 -1.485  21.696  1.00 22.48 ? 217 HOH A O    1 
HETATM 3359 O O    . HOH G 4 .   ? 18.264 -0.347  22.604  1.00 24.01 ? 218 HOH A O    1 
HETATM 3360 O O    . HOH G 4 .   ? 18.984 -6.819  30.132  1.00 24.49 ? 219 HOH A O    1 
HETATM 3361 O O    . HOH G 4 .   ? 8.846  0.722   7.703   1.00 38.31 ? 220 HOH A O    1 
HETATM 3362 O O    . HOH G 4 .   ? 15.392 13.020  31.056  1.00 15.92 ? 221 HOH A O    1 
HETATM 3363 O O    . HOH G 4 .   ? 32.502 -9.851  15.386  1.00 39.94 ? 222 HOH A O    1 
HETATM 3364 O O    . HOH G 4 .   ? 15.654 -5.183  22.314  1.00 19.30 ? 223 HOH A O    1 
HETATM 3365 O O    . HOH G 4 .   ? 20.867 1.758   24.123  1.00 14.59 ? 224 HOH A O    1 
HETATM 3366 O O    . HOH G 4 .   ? 15.898 12.316  28.420  1.00 22.41 ? 225 HOH A O    1 
HETATM 3367 O O    . HOH G 4 .   ? 20.408 -5.887  32.343  1.00 22.92 ? 226 HOH A O    1 
HETATM 3368 O O    . HOH G 4 .   ? 27.482 -9.504  6.105   1.00 28.92 ? 227 HOH A O    1 
HETATM 3369 O O    . HOH G 4 .   ? 20.742 13.852  12.295  1.00 9.82  ? 228 HOH A O    1 
HETATM 3370 O O    . HOH G 4 .   ? 11.227 5.784   23.411  1.00 34.16 ? 229 HOH A O    1 
HETATM 3371 O O    . HOH G 4 .   ? 32.290 -8.743  12.401  1.00 27.08 ? 230 HOH A O    1 
HETATM 3372 O O    . HOH G 4 .   ? 31.990 11.506  26.647  1.00 12.76 ? 231 HOH A O    1 
HETATM 3373 O O    . HOH G 4 .   ? 14.962 -2.529  21.860  1.00 18.34 ? 232 HOH A O    1 
HETATM 3374 O O    . HOH G 4 .   ? 16.967 8.325   7.992   1.00 24.06 ? 233 HOH A O    1 
HETATM 3375 O O    . HOH G 4 .   ? 15.543 -2.258  33.685  1.00 25.16 ? 234 HOH A O    1 
HETATM 3376 O O    . HOH G 4 .   ? 17.114 -0.678  35.263  1.00 19.58 ? 235 HOH A O    1 
HETATM 3377 O O    . HOH G 4 .   ? 8.791  9.465   39.334  1.00 37.60 ? 236 HOH A O    1 
HETATM 3378 O O    . HOH G 4 .   ? 34.310 14.016  12.452  1.00 12.67 ? 237 HOH A O    1 
HETATM 3379 O O    . HOH G 4 .   ? 13.969 12.616  26.601  1.00 21.95 ? 238 HOH A O    1 
HETATM 3380 O O    . HOH G 4 .   ? 10.160 0.310   24.282  1.00 20.56 ? 239 HOH A O    1 
HETATM 3381 O O    . HOH G 4 .   ? 19.312 2.039   21.582  1.00 18.05 ? 240 HOH A O    1 
HETATM 3382 O O    . HOH G 4 .   ? 10.029 -8.816  33.060  1.00 39.55 ? 241 HOH A O    1 
HETATM 3383 O O    . HOH G 4 .   ? 35.056 1.807   16.312  1.00 32.72 ? 242 HOH A O    1 
HETATM 3384 O O    . HOH G 4 .   ? 13.779 5.993   9.092   1.00 28.71 ? 243 HOH A O    1 
HETATM 3385 O O    . HOH G 4 .   ? 18.411 4.734   18.522  1.00 18.23 ? 244 HOH A O    1 
HETATM 3386 O O    . HOH G 4 .   ? 18.955 4.897   21.430  1.00 34.55 ? 245 HOH A O    1 
HETATM 3387 O O    . HOH G 4 .   ? 12.692 -15.663 2.165   1.00 27.14 ? 246 HOH A O    1 
HETATM 3388 O O    . HOH G 4 .   ? 9.528  -6.057  17.702  1.00 30.61 ? 247 HOH A O    1 
HETATM 3389 O O    . HOH G 4 .   ? 27.848 11.658  24.970  1.00 22.35 ? 248 HOH A O    1 
HETATM 3390 O O    . HOH G 4 .   ? 7.063  -5.964  24.445  1.00 25.56 ? 249 HOH A O    1 
HETATM 3391 O O    . HOH G 4 .   ? 31.718 -4.759  6.672   1.00 25.20 ? 250 HOH A O    1 
HETATM 3392 O O    . HOH G 4 .   ? 37.235 5.300   19.246  1.00 28.68 ? 251 HOH A O    1 
HETATM 3393 O O    . HOH G 4 .   ? 22.335 -4.853  39.078  1.00 31.25 ? 252 HOH A O    1 
HETATM 3394 O O    . HOH G 4 .   ? 11.924 9.200   12.190  1.00 27.02 ? 253 HOH A O    1 
HETATM 3395 O O    . HOH G 4 .   ? 22.634 -16.179 22.533  1.00 23.30 ? 254 HOH A O    1 
HETATM 3396 O O    . HOH G 4 .   ? 23.228 -14.875 19.924  1.00 29.84 ? 255 HOH A O    1 
HETATM 3397 O O    . HOH G 4 .   ? 16.518 4.011   6.773   1.00 26.05 ? 256 HOH A O    1 
HETATM 3398 O O    . HOH G 4 .   ? 17.155 11.725  38.434  1.00 29.61 ? 257 HOH A O    1 
HETATM 3399 O O    . HOH G 4 .   ? 19.367 -6.248  21.908  1.00 41.40 ? 258 HOH A O    1 
HETATM 3400 O O    . HOH G 4 .   ? 13.105 11.178  13.974  1.00 35.34 ? 259 HOH A O    1 
HETATM 3401 O O    . HOH G 4 .   ? 23.943 -14.188 3.426   1.00 35.78 ? 260 HOH A O    1 
HETATM 3402 O O    . HOH G 4 .   ? 18.267 11.003  14.044  1.00 24.26 ? 261 HOH A O    1 
HETATM 3403 O O    . HOH G 4 .   ? 32.513 -10.999 23.068  1.00 30.58 ? 262 HOH A O    1 
HETATM 3404 O O    . HOH G 4 .   ? 16.471 -1.866  41.441  1.00 32.83 ? 263 HOH A O    1 
HETATM 3405 O O    . HOH G 4 .   ? 10.393 2.476   2.672   1.00 43.77 ? 264 HOH A O    1 
HETATM 3406 O O    . HOH G 4 .   ? 26.084 15.089  36.221  1.00 33.85 ? 265 HOH A O    1 
HETATM 3407 O O    . HOH G 4 .   ? 11.074 16.591  34.671  1.00 26.74 ? 266 HOH A O    1 
HETATM 3408 O O    . HOH G 4 .   ? 16.029 -5.074  34.430  1.00 29.28 ? 267 HOH A O    1 
HETATM 3409 O O    . HOH G 4 .   ? 33.504 14.579  37.879  1.00 37.22 ? 268 HOH A O    1 
HETATM 3410 O O    . HOH G 4 .   ? 20.015 14.786  37.509  1.00 31.57 ? 269 HOH A O    1 
HETATM 3411 O O    . HOH G 4 .   ? 9.850  -0.734  0.799   1.00 44.55 ? 270 HOH A O    1 
HETATM 3412 O O    . HOH G 4 .   ? 18.006 7.436   40.198  1.00 40.60 ? 271 HOH A O    1 
HETATM 3413 O O    . HOH G 4 .   ? 5.802  14.337  37.928  1.00 47.63 ? 272 HOH A O    1 
HETATM 3414 O O    . HOH G 4 .   ? 17.859 -6.963  33.405  1.00 37.00 ? 273 HOH A O    1 
HETATM 3415 O O    . HOH G 4 .   ? 6.322  16.122  35.511  1.00 28.36 ? 274 HOH A O    1 
HETATM 3416 O O    . HOH G 4 .   ? 11.584 2.588   23.272  1.00 23.29 ? 275 HOH A O    1 
HETATM 3417 O O    . HOH G 4 .   ? 9.668  -6.831  4.979   1.00 37.46 ? 276 HOH A O    1 
HETATM 3418 O O    . HOH G 4 .   ? 15.345 -11.632 16.617  1.00 35.47 ? 277 HOH A O    1 
HETATM 3419 O O    . HOH G 4 .   ? 21.967 9.383   17.161  1.00 11.59 ? 278 HOH A O    1 
HETATM 3420 O O    . HOH G 4 .   ? 33.769 2.278   6.604   1.00 31.81 ? 279 HOH A O    1 
HETATM 3421 O O    . HOH G 4 .   ? 12.853 1.052   20.658  1.00 33.35 ? 280 HOH A O    1 
HETATM 3422 O O    . HOH G 4 .   ? 27.322 -14.924 9.874   1.00 39.84 ? 281 HOH A O    1 
HETATM 3423 O O    . HOH G 4 .   ? 5.859  4.345   12.095  1.00 46.01 ? 282 HOH A O    1 
HETATM 3424 O O    . HOH G 4 .   ? 36.569 -0.737  18.630  1.00 34.35 ? 283 HOH A O    1 
HETATM 3425 O O    . HOH G 4 .   ? 10.770 15.081  27.119  1.00 36.53 ? 284 HOH A O    1 
HETATM 3426 O O    . HOH G 4 .   ? -1.304 -1.156  7.791   1.00 42.24 ? 285 HOH A O    1 
HETATM 3427 O O    . HOH G 4 .   ? 12.014 18.258  32.649  1.00 30.71 ? 286 HOH A O    1 
HETATM 3428 O O    . HOH G 4 .   ? 35.197 -9.125  12.192  1.00 44.56 ? 287 HOH A O    1 
HETATM 3429 O O    . HOH G 4 .   ? 5.317  -9.782  15.687  1.00 42.83 ? 288 HOH A O    1 
HETATM 3430 O O    . HOH G 4 .   ? 17.900 -13.931 22.827  1.00 31.70 ? 289 HOH A O    1 
HETATM 3431 O O    . HOH G 4 .   ? 30.457 1.930   5.937   1.00 34.51 ? 290 HOH A O    1 
HETATM 3432 O O    . HOH G 4 .   ? 0.159  1.325   24.052  1.00 33.35 ? 291 HOH A O    1 
HETATM 3433 O O    . HOH G 4 .   ? 27.422 4.747   39.020  1.00 28.33 ? 292 HOH A O    1 
HETATM 3434 O O    . HOH G 4 .   ? 8.527  -6.033  32.765  1.00 28.41 ? 293 HOH A O    1 
HETATM 3435 O O    . HOH G 4 .   ? 12.675 -10.466 3.337   1.00 33.14 ? 294 HOH A O    1 
HETATM 3436 O O    . HOH G 4 .   ? 33.330 5.562   30.933  1.00 28.38 ? 295 HOH A O    1 
HETATM 3437 O O    . HOH G 4 .   ? 11.028 12.083  23.872  1.00 38.22 ? 296 HOH A O    1 
HETATM 3438 O O    . HOH G 4 .   ? 37.257 -1.627  32.977  1.00 49.09 ? 297 HOH A O    1 
HETATM 3439 O O    . HOH G 4 .   ? 36.471 -4.552  17.071  1.00 24.34 ? 298 HOH A O    1 
HETATM 3440 O O    . HOH G 4 .   ? 3.874  1.565   28.811  1.00 42.87 ? 299 HOH A O    1 
HETATM 3441 O O    . HOH G 4 .   ? 8.600  7.749   17.971  1.00 29.12 ? 300 HOH A O    1 
HETATM 3442 O O    . HOH G 4 .   ? 41.584 12.051  12.322  1.00 33.56 ? 301 HOH A O    1 
HETATM 3443 O O    . HOH G 4 .   ? 31.419 0.293   13.055  1.00 23.07 ? 302 HOH A O    1 
HETATM 3444 O O    . HOH G 4 .   ? 16.415 9.458   28.524  1.00 17.32 ? 303 HOH A O    1 
HETATM 3445 O O    . HOH G 4 .   ? 7.037  7.219   26.157  1.00 22.76 ? 304 HOH A O    1 
HETATM 3446 O O    . HOH H 4 .   ? 13.454 17.756  24.597  1.00 11.01 ? 212 HOH B O    1 
HETATM 3447 O O    . HOH H 4 .   ? 18.085 19.167  15.835  1.00 20.98 ? 213 HOH B O    1 
HETATM 3448 O O    . HOH H 4 .   ? 28.073 24.985  25.071  1.00 20.71 ? 214 HOH B O    1 
HETATM 3449 O O    . HOH H 4 .   ? 8.484  29.206  13.621  1.00 22.56 ? 215 HOH B O    1 
HETATM 3450 O O    . HOH H 4 .   ? 21.680 22.641  11.177  1.00 20.63 ? 216 HOH B O    1 
HETATM 3451 O O    . HOH H 4 .   ? 12.796 19.616  26.586  1.00 22.96 ? 217 HOH B O    1 
HETATM 3452 O O    . HOH H 4 .   ? 23.867 11.810  21.308  1.00 14.20 ? 218 HOH B O    1 
HETATM 3453 O O    . HOH H 4 .   ? 28.411 23.073  31.892  1.00 38.20 ? 219 HOH B O    1 
HETATM 3454 O O    . HOH H 4 .   ? 13.508 15.158  25.523  1.00 21.69 ? 220 HOH B O    1 
HETATM 3455 O O    . HOH H 4 .   ? 32.876 23.696  23.150  1.00 31.35 ? 221 HOH B O    1 
HETATM 3456 O O    . HOH H 4 .   ? 19.426 29.201  7.021   1.00 29.18 ? 222 HOH B O    1 
HETATM 3457 O O    . HOH H 4 .   ? 21.360 24.690  -0.419  1.00 18.00 ? 223 HOH B O    1 
HETATM 3458 O O    . HOH H 4 .   ? 20.012 14.460  5.832   1.00 16.04 ? 224 HOH B O    1 
HETATM 3459 O O    . HOH H 4 .   ? 36.423 28.055  4.818   1.00 43.31 ? 225 HOH B O    1 
HETATM 3460 O O    . HOH H 4 .   ? 19.814 10.908  2.980   1.00 28.43 ? 226 HOH B O    1 
HETATM 3461 O O    . HOH H 4 .   ? 12.712 24.833  10.939  1.00 23.65 ? 227 HOH B O    1 
HETATM 3462 O O    . HOH H 4 .   ? 19.813 21.921  13.343  1.00 14.31 ? 228 HOH B O    1 
HETATM 3463 O O    . HOH H 4 .   ? 17.244 11.061  6.881   1.00 12.39 ? 229 HOH B O    1 
HETATM 3464 O O    . HOH H 4 .   ? 15.170 26.190  11.302  1.00 13.73 ? 230 HOH B O    1 
HETATM 3465 O O    . HOH H 4 .   ? 11.046 18.004  27.978  1.00 30.85 ? 231 HOH B O    1 
HETATM 3466 O O    . HOH H 4 .   ? 20.516 31.037  5.021   1.00 25.86 ? 232 HOH B O    1 
HETATM 3467 O O    . HOH H 4 .   ? 5.351  22.274  23.007  1.00 30.70 ? 233 HOH B O    1 
HETATM 3468 O O    . HOH H 4 .   ? 21.403 33.860  30.311  1.00 25.27 ? 234 HOH B O    1 
HETATM 3469 O O    . HOH H 4 .   ? 18.828 24.080  11.817  1.00 23.57 ? 235 HOH B O    1 
HETATM 3470 O O    . HOH H 4 .   ? 15.756 29.068  11.383  1.00 32.38 ? 236 HOH B O    1 
HETATM 3471 O O    . HOH H 4 .   ? 4.305  23.672  30.142  1.00 33.02 ? 237 HOH B O    1 
HETATM 3472 O O    . HOH H 4 .   ? 35.926 20.607  21.381  1.00 34.53 ? 238 HOH B O    1 
HETATM 3473 O O    . HOH H 4 .   ? 13.712 22.115  11.957  1.00 32.52 ? 239 HOH B O    1 
HETATM 3474 O O    . HOH H 4 .   ? 35.901 20.117  8.789   1.00 28.22 ? 240 HOH B O    1 
HETATM 3475 O O    . HOH H 4 .   ? 21.023 40.639  20.260  1.00 39.76 ? 241 HOH B O    1 
HETATM 3476 O O    . HOH H 4 .   ? 26.051 29.906  31.091  1.00 19.51 ? 242 HOH B O    1 
HETATM 3477 O O    . HOH H 4 .   ? 5.040  20.399  28.595  1.00 30.69 ? 243 HOH B O    1 
HETATM 3478 O O    . HOH H 4 .   ? 12.948 20.736  9.025   1.00 32.24 ? 244 HOH B O    1 
HETATM 3479 O O    . HOH H 4 .   ? 19.519 11.655  5.700   1.00 13.35 ? 245 HOH B O    1 
HETATM 3480 O O    . HOH H 4 .   ? 21.185 40.432  13.086  1.00 24.15 ? 246 HOH B O    1 
HETATM 3481 O O    . HOH H 4 .   ? 15.496 27.009  36.045  1.00 38.12 ? 247 HOH B O    1 
HETATM 3482 O O    . HOH H 4 .   ? 8.232  29.139  7.075   1.00 37.92 ? 248 HOH B O    1 
HETATM 3483 O O    . HOH H 4 .   ? 23.635 37.390  2.269   1.00 27.76 ? 249 HOH B O    1 
HETATM 3484 O O    . HOH H 4 .   ? 28.841 37.090  8.825   1.00 33.25 ? 250 HOH B O    1 
HETATM 3485 O O    . HOH H 4 .   ? 17.405 12.665  20.396  1.00 36.33 ? 251 HOH B O    1 
HETATM 3486 O O    . HOH H 4 .   ? 21.360 39.448  26.486  1.00 35.67 ? 252 HOH B O    1 
HETATM 3487 O O    . HOH H 4 .   ? 15.307 5.358   4.523   1.00 41.74 ? 253 HOH B O    1 
HETATM 3488 O O    . HOH H 4 .   ? 19.157 26.110  0.532   1.00 20.88 ? 254 HOH B O    1 
HETATM 3489 O O    . HOH H 4 .   ? 29.444 13.529  12.853  1.00 27.96 ? 255 HOH B O    1 
HETATM 3490 O O    . HOH H 4 .   ? 33.907 30.157  22.715  1.00 35.59 ? 256 HOH B O    1 
HETATM 3491 O O    . HOH H 4 .   ? 18.367 30.578  13.288  1.00 40.73 ? 257 HOH B O    1 
HETATM 3492 O O    . HOH H 4 .   ? 10.744 17.520  23.522  1.00 30.43 ? 258 HOH B O    1 
HETATM 3493 O O    . HOH H 4 .   ? 23.552 12.315  -3.486  1.00 32.43 ? 259 HOH B O    1 
HETATM 3494 O O    . HOH H 4 .   ? 7.831  27.765  2.466   1.00 57.19 ? 260 HOH B O    1 
HETATM 3495 O O    . HOH H 4 .   ? -0.154 21.656  8.944   1.00 29.55 ? 261 HOH B O    1 
HETATM 3496 O O    . HOH H 4 .   ? 32.082 14.883  -1.225  1.00 39.42 ? 262 HOH B O    1 
HETATM 3497 O O    . HOH H 4 .   ? 15.054 7.963   5.666   1.00 37.56 ? 263 HOH B O    1 
HETATM 3498 O O    . HOH H 4 .   ? 20.953 39.600  15.834  1.00 42.54 ? 264 HOH B O    1 
HETATM 3499 O O    . HOH H 4 .   ? 12.952 32.530  -0.873  1.00 26.67 ? 265 HOH B O    1 
HETATM 3500 O O    . HOH H 4 .   ? 12.340 15.041  11.905  1.00 41.80 ? 266 HOH B O    1 
HETATM 3501 O O    . HOH H 4 .   ? 19.239 28.961  -0.427  1.00 38.64 ? 267 HOH B O    1 
HETATM 3502 O O    . HOH H 4 .   ? 32.271 23.932  26.288  1.00 32.90 ? 268 HOH B O    1 
HETATM 3503 O O    . HOH H 4 .   ? 31.221 36.442  15.893  1.00 36.29 ? 269 HOH B O    1 
HETATM 3504 O O    . HOH H 4 .   ? 8.747  32.091  35.052  1.00 28.20 ? 270 HOH B O    1 
HETATM 3505 O O    . HOH H 4 .   ? 17.008 6.889   -1.756  1.00 30.88 ? 271 HOH B O    1 
HETATM 3506 O O    . HOH H 4 .   ? 22.759 30.393  3.495   1.00 20.28 ? 272 HOH B O    1 
HETATM 3507 O O    . HOH H 4 .   ? 34.578 26.557  21.290  1.00 34.08 ? 273 HOH B O    1 
HETATM 3508 O O    . HOH H 4 .   ? 3.412  32.437  13.821  1.00 51.39 ? 274 HOH B O    1 
HETATM 3509 O O    . HOH H 4 .   ? 11.493 22.916  7.603   1.00 35.42 ? 275 HOH B O    1 
HETATM 3510 O O    . HOH H 4 .   ? 27.933 38.505  22.492  1.00 34.14 ? 276 HOH B O    1 
HETATM 3511 O O    . HOH H 4 .   ? 16.161 35.587  13.217  1.00 45.32 ? 277 HOH B O    1 
HETATM 3512 O O    . HOH H 4 .   ? 38.124 18.161  7.834   1.00 37.78 ? 278 HOH B O    1 
HETATM 3513 O O    . HOH H 4 .   ? 34.808 11.002  19.084  1.00 46.41 ? 279 HOH B O    1 
HETATM 3514 O O    . HOH H 4 .   ? 12.943 34.982  16.348  1.00 31.71 ? 280 HOH B O    1 
HETATM 3515 O O    . HOH H 4 .   ? 33.453 33.293  22.322  1.00 38.86 ? 281 HOH B O    1 
HETATM 3516 O O    . HOH H 4 .   ? 11.583 34.856  4.214   1.00 45.28 ? 282 HOH B O    1 
HETATM 3517 O O    . HOH H 4 .   ? 37.564 10.772  22.960  1.00 45.16 ? 283 HOH B O    1 
HETATM 3518 O O    . HOH H 4 .   ? 26.947 9.801   -1.180  1.00 33.54 ? 284 HOH B O    1 
HETATM 3519 O O    . HOH H 4 .   ? 28.871 12.308  -3.005  1.00 33.00 ? 285 HOH B O    1 
HETATM 3520 O O    . HOH H 4 .   ? 21.585 14.640  18.240  1.00 14.49 ? 286 HOH B O    1 
HETATM 3521 O O    . HOH H 4 .   ? 12.893 16.815  9.297   1.00 40.60 ? 287 HOH B O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   THR 4   4   4   THR THR A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  CYS 14  14  14  CYS CYS A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  MET 19  19  19  MET MET A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ALA 22  22  22  ALA ALA A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  GLN 24  24  24  GLN GLN A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  TRP 28  28  28  TRP TRP A . n 
A 1 29  LYS 29  29  29  LYS LYS A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  GLU 31  31  31  GLU GLU A . n 
A 1 32  VAL 32  32  32  VAL VAL A . n 
A 1 33  VAL 33  33  33  VAL VAL A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  GLU 36  36  36  GLU GLU A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  TRP 38  38  38  TRP TRP A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  TYR 49  49  49  TYR TYR A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  LYS 54  54  54  LYS LYS A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  GLN 56  56  56  GLN GLN A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  THR 61  61  61  THR THR A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  THR 67  67  67  THR THR A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  ARG 70  70  70  ARG ARG A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLN 83  83  83  GLN GLN A . n 
A 1 84  GLN 84  84  84  GLN GLN A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ARG 100 100 100 ARG ARG A . n 
A 1 101 CYS 101 101 101 CYS CYS A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 SER 105 105 105 SER SER A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 TYR 108 108 108 TYR TYR A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ASN 110 110 110 ASN ASN A . n 
A 1 111 TYR 111 111 111 TYR TYR A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 TYR 118 118 118 TYR TYR A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 LYS 127 127 127 LYS LYS A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 GLN 147 147 147 GLN GLN A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 SER 149 149 149 SER SER A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 LEU 155 155 155 LEU LEU A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 CYS 169 169 169 CYS CYS A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 PRO 174 174 174 PRO PRO A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 GLY 181 181 181 GLY GLY A . n 
A 1 182 ARG 182 182 182 ARG ARG A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 SER 184 184 184 SER SER A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 LYS 190 190 190 LYS LYS A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 PHE 192 192 192 PHE PHE A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 ASN 204 204 204 ASN ASN A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ASN 206 206 206 ASN ASN A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 LYS 208 208 208 LYS LYS A . n 
A 1 209 GLN 209 209 209 GLN GLN A . n 
B 1 1   PRO 1   1   ?   ?   ?   B . n 
B 1 2   PRO 2   2   2   PRO PRO B . n 
B 1 3   TYR 3   3   3   TYR TYR B . n 
B 1 4   THR 4   4   4   THR THR B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   TYR 7   7   7   TYR TYR B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  CYS 14  14  14  CYS CYS B . n 
B 1 15  ALA 15  15  15  ALA ALA B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  MET 19  19  19  MET MET B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  LEU 21  21  21  LEU LEU B . n 
B 1 22  ALA 22  22  22  ALA ALA B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  GLN 24  24  24  GLN GLN B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  GLN 26  26  26  GLN GLN B . n 
B 1 27  SER 27  27  27  SER SER B . n 
B 1 28  TRP 28  28  28  TRP TRP B . n 
B 1 29  LYS 29  29  29  LYS LYS B . n 
B 1 30  GLU 30  30  30  GLU GLU B . n 
B 1 31  GLU 31  31  31  GLU GLU B . n 
B 1 32  VAL 32  32  32  VAL VAL B . n 
B 1 33  VAL 33  33  33  VAL VAL B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  VAL 35  35  35  VAL VAL B . n 
B 1 36  GLU 36  36  36  GLU GLU B . n 
B 1 37  THR 37  37  37  THR THR B . n 
B 1 38  TRP 38  38  38  TRP TRP B . n 
B 1 39  GLN 39  39  39  GLN GLN B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  SER 42  42  42  SER SER B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  ALA 45  45  45  ALA ALA B . n 
B 1 46  SER 46  46  46  SER SER B . n 
B 1 47  CYS 47  47  47  CYS CYS B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  TYR 49  49  49  TYR TYR B . n 
B 1 50  GLY 50  50  50  GLY GLY B . n 
B 1 51  GLN 51  51  51  GLN GLN B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  PRO 53  53  53  PRO PRO B . n 
B 1 54  LYS 54  54  54  LYS LYS B . n 
B 1 55  PHE 55  55  55  PHE PHE B . n 
B 1 56  GLN 56  56  56  GLN GLN B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  ASP 59  59  59  ASP ASP B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  THR 61  61  61  THR THR B . n 
B 1 62  LEU 62  62  62  LEU LEU B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  GLN 64  64  64  GLN GLN B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  THR 67  67  67  THR THR B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  ARG 70  70  70  ARG ARG B . n 
B 1 71  HIS 71  71  71  HIS HIS B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LEU 78  78  78  LEU LEU B . n 
B 1 79  TYR 79  79  79  TYR TYR B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  GLN 83  83  83  GLN GLN B . n 
B 1 84  GLN 84  84  84  GLN GLN B . n 
B 1 85  GLU 85  85  85  GLU GLU B . n 
B 1 86  ALA 86  86  86  ALA ALA B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  ASP 90  90  90  ASP ASP B . n 
B 1 91  MET 91  91  91  MET MET B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  ASP 94  94  94  ASP ASP B . n 
B 1 95  GLY 95  95  95  GLY GLY B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  GLU 97  97  97  GLU GLU B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ARG 100 100 100 ARG ARG B . n 
B 1 101 CYS 101 101 101 CYS CYS B . n 
B 1 102 LYS 102 102 102 LYS LYS B . n 
B 1 103 TYR 103 103 103 TYR TYR B . n 
B 1 104 ILE 104 104 104 ILE ILE B . n 
B 1 105 SER 105 105 105 SER SER B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 TYR 108 108 108 TYR TYR B . n 
B 1 109 THR 109 109 109 THR THR B . n 
B 1 110 ASN 110 110 110 ASN ASN B . n 
B 1 111 TYR 111 111 111 TYR TYR B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 ALA 113 113 113 ALA ALA B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 TYR 118 118 118 TYR TYR B . n 
B 1 119 VAL 119 119 119 VAL VAL B . n 
B 1 120 LYS 120 120 120 LYS LYS B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 LEU 122 122 122 LEU LEU B . n 
B 1 123 PRO 123 123 123 PRO PRO B . n 
B 1 124 GLY 124 124 124 GLY GLY B . n 
B 1 125 GLN 125 125 125 GLN GLN B . n 
B 1 126 LEU 126 126 126 LEU LEU B . n 
B 1 127 LYS 127 127 127 LYS LYS B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 GLU 130 130 130 GLU GLU B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 SER 134 134 134 SER SER B . n 
B 1 135 GLN 135 135 135 GLN GLN B . n 
B 1 136 ASN 136 136 136 ASN ASN B . n 
B 1 137 GLN 137 137 137 GLN GLN B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 GLY 139 139 139 GLY GLY B . n 
B 1 140 LYS 140 140 140 LYS LYS B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 PHE 142 142 142 PHE PHE B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 VAL 144 144 144 VAL VAL B . n 
B 1 145 GLY 145 145 145 GLY GLY B . n 
B 1 146 ASP 146 146 146 ASP ASP B . n 
B 1 147 GLN 147 147 147 GLN GLN B . n 
B 1 148 ILE 148 148 148 ILE ILE B . n 
B 1 149 SER 149 149 149 SER SER B . n 
B 1 150 PHE 150 150 150 PHE PHE B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 ASP 152 152 152 ASP ASP B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 ASN 154 154 154 ASN ASN B . n 
B 1 155 LEU 155 155 155 LEU LEU B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 ASP 157 157 157 ASP ASP B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 LEU 160 160 160 LEU LEU B . n 
B 1 161 ILE 161 161 161 ILE ILE B . n 
B 1 162 HIS 162 162 162 HIS HIS B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 LEU 165 165 165 LEU LEU B . n 
B 1 166 ALA 166 166 166 ALA ALA B . n 
B 1 167 PRO 167 167 167 PRO PRO B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 CYS 169 169 169 CYS CYS B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 PHE 173 173 173 PHE PHE B . n 
B 1 174 PRO 174 174 174 PRO PRO B . n 
B 1 175 LEU 175 175 175 LEU LEU B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 TYR 179 179 179 TYR TYR B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 GLY 181 181 181 GLY GLY B . n 
B 1 182 ARG 182 182 182 ARG ARG B . n 
B 1 183 LEU 183 183 183 LEU LEU B . n 
B 1 184 SER 184 184 184 SER SER B . n 
B 1 185 ALA 185 185 185 ALA ALA B . n 
B 1 186 ARG 186 186 186 ARG ARG B . n 
B 1 187 PRO 187 187 187 PRO PRO B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 LEU 189 189 189 LEU LEU B . n 
B 1 190 LYS 190 190 190 LYS LYS B . n 
B 1 191 ALA 191 191 191 ALA ALA B . n 
B 1 192 PHE 192 192 192 PHE PHE B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 ALA 194 194 194 ALA ALA B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 PRO 196 196 196 PRO PRO B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 TYR 198 198 198 TYR TYR B . n 
B 1 199 VAL 199 199 199 VAL VAL B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 PRO 202 202 202 PRO PRO B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 ASN 204 204 204 ASN ASN B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ASN 206 206 206 ASN ASN B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 LYS 208 208 208 LYS LYS B . n 
B 1 209 GLN 209 209 209 GLN GLN B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 VWW 1  210 1   VWW GLU A . 
D 3 MES 1  211 1   MES MES A . 
E 2 VWW 1  210 1   VWW GLU B . 
F 3 MES 1  211 1   MES MES B . 
G 4 HOH 1  212 3   HOH HOH A . 
G 4 HOH 2  213 6   HOH HOH A . 
G 4 HOH 3  214 7   HOH HOH A . 
G 4 HOH 4  215 8   HOH HOH A . 
G 4 HOH 5  216 9   HOH HOH A . 
G 4 HOH 6  217 11  HOH HOH A . 
G 4 HOH 7  218 12  HOH HOH A . 
G 4 HOH 8  219 14  HOH HOH A . 
G 4 HOH 9  220 18  HOH HOH A . 
G 4 HOH 10 221 20  HOH HOH A . 
G 4 HOH 11 222 21  HOH HOH A . 
G 4 HOH 12 223 23  HOH HOH A . 
G 4 HOH 13 224 25  HOH HOH A . 
G 4 HOH 14 225 26  HOH HOH A . 
G 4 HOH 15 226 27  HOH HOH A . 
G 4 HOH 16 227 28  HOH HOH A . 
G 4 HOH 17 228 29  HOH HOH A . 
G 4 HOH 18 229 31  HOH HOH A . 
G 4 HOH 19 230 32  HOH HOH A . 
G 4 HOH 20 231 35  HOH HOH A . 
G 4 HOH 21 232 37  HOH HOH A . 
G 4 HOH 22 233 39  HOH HOH A . 
G 4 HOH 23 234 40  HOH HOH A . 
G 4 HOH 24 235 43  HOH HOH A . 
G 4 HOH 25 236 44  HOH HOH A . 
G 4 HOH 26 237 45  HOH HOH A . 
G 4 HOH 27 238 46  HOH HOH A . 
G 4 HOH 28 239 47  HOH HOH A . 
G 4 HOH 29 240 48  HOH HOH A . 
G 4 HOH 30 241 49  HOH HOH A . 
G 4 HOH 31 242 50  HOH HOH A . 
G 4 HOH 32 243 51  HOH HOH A . 
G 4 HOH 33 244 52  HOH HOH A . 
G 4 HOH 34 245 53  HOH HOH A . 
G 4 HOH 35 246 59  HOH HOH A . 
G 4 HOH 36 247 62  HOH HOH A . 
G 4 HOH 37 248 63  HOH HOH A . 
G 4 HOH 38 249 65  HOH HOH A . 
G 4 HOH 39 250 66  HOH HOH A . 
G 4 HOH 40 251 68  HOH HOH A . 
G 4 HOH 41 252 74  HOH HOH A . 
G 4 HOH 42 253 76  HOH HOH A . 
G 4 HOH 43 254 81  HOH HOH A . 
G 4 HOH 44 255 82  HOH HOH A . 
G 4 HOH 45 256 83  HOH HOH A . 
G 4 HOH 46 257 85  HOH HOH A . 
G 4 HOH 47 258 86  HOH HOH A . 
G 4 HOH 48 259 89  HOH HOH A . 
G 4 HOH 49 260 91  HOH HOH A . 
G 4 HOH 50 261 92  HOH HOH A . 
G 4 HOH 51 262 94  HOH HOH A . 
G 4 HOH 52 263 96  HOH HOH A . 
G 4 HOH 53 264 98  HOH HOH A . 
G 4 HOH 54 265 100 HOH HOH A . 
G 4 HOH 55 266 104 HOH HOH A . 
G 4 HOH 56 267 105 HOH HOH A . 
G 4 HOH 57 268 106 HOH HOH A . 
G 4 HOH 58 269 108 HOH HOH A . 
G 4 HOH 59 270 109 HOH HOH A . 
G 4 HOH 60 271 110 HOH HOH A . 
G 4 HOH 61 272 112 HOH HOH A . 
G 4 HOH 62 273 117 HOH HOH A . 
G 4 HOH 63 274 119 HOH HOH A . 
G 4 HOH 64 275 120 HOH HOH A . 
G 4 HOH 65 276 123 HOH HOH A . 
G 4 HOH 66 277 125 HOH HOH A . 
G 4 HOH 67 278 126 HOH HOH A . 
G 4 HOH 68 279 130 HOH HOH A . 
G 4 HOH 69 280 131 HOH HOH A . 
G 4 HOH 70 281 133 HOH HOH A . 
G 4 HOH 71 282 134 HOH HOH A . 
G 4 HOH 72 283 138 HOH HOH A . 
G 4 HOH 73 284 139 HOH HOH A . 
G 4 HOH 74 285 140 HOH HOH A . 
G 4 HOH 75 286 142 HOH HOH A . 
G 4 HOH 76 287 144 HOH HOH A . 
G 4 HOH 77 288 145 HOH HOH A . 
G 4 HOH 78 289 146 HOH HOH A . 
G 4 HOH 79 290 148 HOH HOH A . 
G 4 HOH 80 291 149 HOH HOH A . 
G 4 HOH 81 292 150 HOH HOH A . 
G 4 HOH 82 293 151 HOH HOH A . 
G 4 HOH 83 294 152 HOH HOH A . 
G 4 HOH 84 295 153 HOH HOH A . 
G 4 HOH 85 296 155 HOH HOH A . 
G 4 HOH 86 297 158 HOH HOH A . 
G 4 HOH 87 298 160 HOH HOH A . 
G 4 HOH 88 299 162 HOH HOH A . 
G 4 HOH 89 300 163 HOH HOH A . 
G 4 HOH 90 301 164 HOH HOH A . 
G 4 HOH 91 302 1   HOH HOH A . 
G 4 HOH 92 303 19  HOH HOH A . 
G 4 HOH 93 304 156 HOH HOH A . 
H 4 HOH 1  212 4   HOH HOH B . 
H 4 HOH 2  213 5   HOH HOH B . 
H 4 HOH 3  214 10  HOH HOH B . 
H 4 HOH 4  215 13  HOH HOH B . 
H 4 HOH 5  216 15  HOH HOH B . 
H 4 HOH 6  217 16  HOH HOH B . 
H 4 HOH 7  218 17  HOH HOH B . 
H 4 HOH 8  219 22  HOH HOH B . 
H 4 HOH 9  220 24  HOH HOH B . 
H 4 HOH 10 221 30  HOH HOH B . 
H 4 HOH 11 222 33  HOH HOH B . 
H 4 HOH 12 223 34  HOH HOH B . 
H 4 HOH 13 224 36  HOH HOH B . 
H 4 HOH 14 225 38  HOH HOH B . 
H 4 HOH 15 226 41  HOH HOH B . 
H 4 HOH 16 227 42  HOH HOH B . 
H 4 HOH 17 228 54  HOH HOH B . 
H 4 HOH 18 229 55  HOH HOH B . 
H 4 HOH 19 230 56  HOH HOH B . 
H 4 HOH 20 231 57  HOH HOH B . 
H 4 HOH 21 232 58  HOH HOH B . 
H 4 HOH 22 233 60  HOH HOH B . 
H 4 HOH 23 234 64  HOH HOH B . 
H 4 HOH 24 235 67  HOH HOH B . 
H 4 HOH 25 236 69  HOH HOH B . 
H 4 HOH 26 237 70  HOH HOH B . 
H 4 HOH 27 238 71  HOH HOH B . 
H 4 HOH 28 239 72  HOH HOH B . 
H 4 HOH 29 240 73  HOH HOH B . 
H 4 HOH 30 241 75  HOH HOH B . 
H 4 HOH 31 242 77  HOH HOH B . 
H 4 HOH 32 243 78  HOH HOH B . 
H 4 HOH 33 244 79  HOH HOH B . 
H 4 HOH 34 245 80  HOH HOH B . 
H 4 HOH 35 246 84  HOH HOH B . 
H 4 HOH 36 247 87  HOH HOH B . 
H 4 HOH 37 248 88  HOH HOH B . 
H 4 HOH 38 249 90  HOH HOH B . 
H 4 HOH 39 250 93  HOH HOH B . 
H 4 HOH 40 251 95  HOH HOH B . 
H 4 HOH 41 252 97  HOH HOH B . 
H 4 HOH 42 253 99  HOH HOH B . 
H 4 HOH 43 254 101 HOH HOH B . 
H 4 HOH 44 255 102 HOH HOH B . 
H 4 HOH 45 256 103 HOH HOH B . 
H 4 HOH 46 257 107 HOH HOH B . 
H 4 HOH 47 258 111 HOH HOH B . 
H 4 HOH 48 259 113 HOH HOH B . 
H 4 HOH 49 260 114 HOH HOH B . 
H 4 HOH 50 261 115 HOH HOH B . 
H 4 HOH 51 262 116 HOH HOH B . 
H 4 HOH 52 263 118 HOH HOH B . 
H 4 HOH 53 264 121 HOH HOH B . 
H 4 HOH 54 265 122 HOH HOH B . 
H 4 HOH 55 266 124 HOH HOH B . 
H 4 HOH 56 267 127 HOH HOH B . 
H 4 HOH 57 268 128 HOH HOH B . 
H 4 HOH 58 269 129 HOH HOH B . 
H 4 HOH 59 270 132 HOH HOH B . 
H 4 HOH 60 271 135 HOH HOH B . 
H 4 HOH 61 272 136 HOH HOH B . 
H 4 HOH 62 273 137 HOH HOH B . 
H 4 HOH 63 274 141 HOH HOH B . 
H 4 HOH 64 275 143 HOH HOH B . 
H 4 HOH 65 276 147 HOH HOH B . 
H 4 HOH 66 277 154 HOH HOH B . 
H 4 HOH 67 278 157 HOH HOH B . 
H 4 HOH 68 279 159 HOH HOH B . 
H 4 HOH 69 280 161 HOH HOH B . 
H 4 HOH 70 281 165 HOH HOH B . 
H 4 HOH 71 282 166 HOH HOH B . 
H 4 HOH 72 283 167 HOH HOH B . 
H 4 HOH 73 284 168 HOH HOH B . 
H 4 HOH 74 285 169 HOH HOH B . 
H 4 HOH 75 286 2   HOH HOH B . 
H 4 HOH 76 287 61  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4410  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  17730 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-09-16 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2013-02-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' 'Structure summary'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.1 ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 64  ? ? 76.75   111.49  
2 1 ASN A 110 ? ? -155.80 67.97   
3 1 THR A 141 ? ? -113.73 -115.50 
4 1 GLN B 64  ? ? 76.76   111.19  
5 1 ASN B 110 ? ? -155.72 68.01   
6 1 THR B 141 ? ? -113.63 -115.38 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A PRO 1 ? A PRO 1 
2 1 Y 1 B PRO 1 ? B PRO 1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'L-gamma-glutamyl-S-benzyl-N-[(S)-carboxy(phenyl)methyl]-L-cysteinamide' VWW 
3 '2-(N-MORPHOLINO)-ETHANESULFONIC ACID'                                   MES 
4 water                                                                    HOH 
#