data_183L
# 
_entry.id   183L 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   183L         
WWPDB D_1000170186 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        183L 
_pdbx_database_status.recvd_initial_deposition_date   1995-04-19 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Morton, A.'     1 
'Matthews, B.W.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Specificity of ligand binding in a buried nonpolar cavity of T4 lysozyme: linkage of dynamics and structural plasticity.' 
Biochemistry      34  8576 8588 1995 BICHAW US 0006-2960 0033 ? 7612599 10.1021/bi00027a007 
1       'Energetic Origins of Specificity of Ligand Binding in an Interior Cavity of T4 Lysozyme'                                  
'To be Published' ?   ?    ?    ?    ?      ?  ?         0353 ? ?       ?                   
2       'Structure of Bacteriophage T4 Lysozyme Refined at 1.7 Angstroms Resolution'                                               
J.Mol.Biol.       193 189  ?    1987 JMOBAK UK 0022-2836 0070 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Morton, A.'     1 
primary 'Matthews, B.W.' 2 
1       'Morton, A.'     3 
1       'Baase, W.A.'    4 
1       'Matthews, B.W.' 5 
2       'Weaver, L.H.'   6 
2       'Matthews, B.W.' 7 
# 
_cell.entry_id           183L 
_cell.length_a           60.700 
_cell.length_b           60.700 
_cell.length_c           97.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         183L 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                154 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'T4 LYSOZYME'              18586.283 1   3.2.1.17 ? ? ? 
2 non-polymer syn 'CHLORIDE ION'             35.453    2   ?        ? ? ? 
3 non-polymer syn '2-HYDROXYETHYL DISULFIDE' 154.251   1   ?        ? ? ? 
4 non-polymer syn INDENE                     116.160   1   ?        ? ? ? 
5 water       nat water                      18.015    116 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASN n 
1 3   ILE n 
1 4   PHE n 
1 5   GLU n 
1 6   MET n 
1 7   LEU n 
1 8   ARG n 
1 9   ILE n 
1 10  ASP n 
1 11  GLU n 
1 12  GLY n 
1 13  LEU n 
1 14  ARG n 
1 15  LEU n 
1 16  LYS n 
1 17  ILE n 
1 18  TYR n 
1 19  LYS n 
1 20  ASP n 
1 21  THR n 
1 22  GLU n 
1 23  GLY n 
1 24  TYR n 
1 25  TYR n 
1 26  THR n 
1 27  ILE n 
1 28  GLY n 
1 29  ILE n 
1 30  GLY n 
1 31  HIS n 
1 32  LEU n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  SER n 
1 37  PRO n 
1 38  SER n 
1 39  LEU n 
1 40  ASN n 
1 41  ALA n 
1 42  ALA n 
1 43  LYS n 
1 44  SER n 
1 45  GLU n 
1 46  LEU n 
1 47  ASP n 
1 48  LYS n 
1 49  ALA n 
1 50  ILE n 
1 51  GLY n 
1 52  ARG n 
1 53  ASN n 
1 54  THR n 
1 55  ASN n 
1 56  GLY n 
1 57  VAL n 
1 58  ILE n 
1 59  THR n 
1 60  LYS n 
1 61  ASP n 
1 62  GLU n 
1 63  ALA n 
1 64  GLU n 
1 65  LYS n 
1 66  LEU n 
1 67  PHE n 
1 68  ASN n 
1 69  GLN n 
1 70  ASP n 
1 71  VAL n 
1 72  ASP n 
1 73  ALA n 
1 74  ALA n 
1 75  VAL n 
1 76  ARG n 
1 77  GLY n 
1 78  ILE n 
1 79  LEU n 
1 80  ARG n 
1 81  ASN n 
1 82  ALA n 
1 83  LYS n 
1 84  LEU n 
1 85  LYS n 
1 86  PRO n 
1 87  VAL n 
1 88  TYR n 
1 89  ASP n 
1 90  SER n 
1 91  LEU n 
1 92  ASP n 
1 93  ALA n 
1 94  VAL n 
1 95  ARG n 
1 96  ARG n 
1 97  ALA n 
1 98  ALA n 
1 99  ALA n 
1 100 ILE n 
1 101 ASN n 
1 102 MET n 
1 103 VAL n 
1 104 PHE n 
1 105 GLN n 
1 106 MET n 
1 107 GLY n 
1 108 GLU n 
1 109 THR n 
1 110 GLY n 
1 111 VAL n 
1 112 ALA n 
1 113 GLY n 
1 114 PHE n 
1 115 THR n 
1 116 ASN n 
1 117 SER n 
1 118 LEU n 
1 119 ARG n 
1 120 MET n 
1 121 LEU n 
1 122 GLN n 
1 123 GLN n 
1 124 LYS n 
1 125 ARG n 
1 126 TRP n 
1 127 ASP n 
1 128 GLU n 
1 129 ALA n 
1 130 ALA n 
1 131 VAL n 
1 132 ASN n 
1 133 LEU n 
1 134 ALA n 
1 135 LYS n 
1 136 SER n 
1 137 ARG n 
1 138 TRP n 
1 139 TYR n 
1 140 ASN n 
1 141 GLN n 
1 142 THR n 
1 143 PRO n 
1 144 ASN n 
1 145 ARG n 
1 146 ALA n 
1 147 LYS n 
1 148 ARG n 
1 149 VAL n 
1 150 ILE n 
1 151 THR n 
1 152 THR n 
1 153 PHE n 
1 154 ARG n 
1 155 THR n 
1 156 GLY n 
1 157 THR n 
1 158 TRP n 
1 159 ASP n 
1 160 ALA n 
1 161 TYR n 
1 162 LYS n 
1 163 ASN n 
1 164 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     'T4-like viruses' 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Enterobacteria phage T4 sensu lato' 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Enterobacteria phage T4' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10665 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       M13 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LYS_BPT4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00720 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              183L 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 164 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00720 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  164 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       164 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 183L THR A 54 ? UNP P00720 CYS 54 CONFLICT 54 1 
1 183L ALA A 97 ? UNP P00720 CYS 97 CONFLICT 97 2 
1 183L ALA A 99 ? UNP P00720 LEU 99 CONFLICT 99 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'             ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'   121.158 
DEN non-polymer         . INDENE                     ? 'C9 H8'          116.160 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'     75.067  
HED non-polymer         . '2-HYDROXYETHYL DISULFIDE' ? 'C4 H10 O2 S2'   154.251 
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                      ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          183L 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.78 
_exptl_crystal.density_percent_sol   55.77 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 183L 
_refine.ls_number_reflns_obs                     13459 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1770000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1289 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             116 
_refine_hist.number_atoms_total               1424 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.3   ? ? ? 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_trig_c_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_gen_planes       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_it               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
t_nbd              ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  183L 
_struct.title                     
'SPECIFICITY OF LIGAND BINDING IN A BURIED NON-POLAR CAVITY OF T4 LYSOZYME: LINKAGE OF DYNAMICS AND STRUCTURAL PLASTICITY' 
_struct.pdbx_descriptor           
;LYSOZYME (E.C.3.2.1.17) MUTANT WITH CYS 54 REPLACED BY THR, CYS 97 REPLACED BY ALA, LEU 99 REPLACED BY ALA (C54T,C97A,L99A) COMPLEXED WITH INDENE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        183L 
_struct_keywords.pdbx_keywords   'HYDROLASE (O-GLYCOSYL)' 
_struct_keywords.text            'HYDROLASE (O-GLYCOSYL)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  ILE A 3   ? GLU A 11  ? ILE A 3   GLU A 11  1 ?                        9  
HELX_P HELX_P2  H2  LEU A 39  ? ILE A 50  ? LEU A 39  ILE A 50  1 ?                        12 
HELX_P HELX_P3  H3  LYS A 60  ? ARG A 80  ? LYS A 60  ARG A 80  1 ?                        21 
HELX_P HELX_P4  H4  ALA A 82  ? SER A 90  ? ALA A 82  SER A 90  1 ?                        9  
HELX_P HELX_P5  H5  ALA A 93  ? MET A 106 ? ALA A 93  MET A 106 1 ?                        14 
HELX_P HELX_P6  H6  GLU A 108 ? GLY A 113 ? GLU A 108 GLY A 113 1 'SEE REF. 1 FOR DETAILS' 6  
HELX_P HELX_P7  H7  THR A 115 ? GLN A 123 ? THR A 115 GLN A 123 1 ?                        9  
HELX_P HELX_P8  H8  TRP A 126 ? ALA A 134 ? TRP A 126 ALA A 134 1 ?                        9  
HELX_P HELX_P9  H9  ARG A 137 ? GLN A 141 ? ARG A 137 GLN A 141 1 ?                        5  
HELX_P HELX_P10 H10 PRO A 143 ? THR A 155 ? PRO A 143 THR A 155 1 ?                        13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 25 ? ILE A 27 ? TYR A 25 ILE A 27 
A 2 HIS A 31 ? THR A 34 ? HIS A 31 THR A 34 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    25 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     25 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    34 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     34 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
99A Unknown  ? ? ? ? 17 ?                                    
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE CL A 173'  
AC2 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE CL A 178'  
AC3 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE HED A 170' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DEN A 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  99A 17 ILE A 78  ? ILE A 78  . ? 1_555 ? 
2  99A 17 LEU A 84  ? LEU A 84  . ? 1_555 ? 
3  99A 17 VAL A 87  ? VAL A 87  . ? 1_555 ? 
4  99A 17 TYR A 88  ? TYR A 88  . ? 1_555 ? 
5  99A 17 ALA A 99  ? ALA A 99  . ? 1_555 ? 
6  99A 17 MET A 102 ? MET A 102 . ? 1_555 ? 
7  99A 17 VAL A 103 ? VAL A 103 . ? 1_555 ? 
8  99A 17 THR A 109 ? THR A 109 . ? 1_555 ? 
9  99A 17 GLY A 110 ? GLY A 110 . ? 1_555 ? 
10 99A 17 VAL A 111 ? VAL A 111 . ? 1_555 ? 
11 99A 17 ALA A 112 ? ALA A 112 . ? 1_555 ? 
12 99A 17 GLY A 113 ? GLY A 113 . ? 1_555 ? 
13 99A 17 PHE A 114 ? PHE A 114 . ? 1_555 ? 
14 99A 17 LEU A 118 ? LEU A 118 . ? 1_555 ? 
15 99A 17 LEU A 121 ? LEU A 121 . ? 1_555 ? 
16 99A 17 LEU A 133 ? LEU A 133 . ? 1_555 ? 
17 99A 17 PHE A 153 ? PHE A 153 . ? 1_555 ? 
18 AC1 5  LYS A 124 ? LYS A 124 . ? 4_655 ? 
19 AC1 5  THR A 142 ? THR A 142 . ? 1_555 ? 
20 AC1 5  ASN A 144 ? ASN A 144 . ? 1_555 ? 
21 AC1 5  ARG A 145 ? ARG A 145 . ? 1_555 ? 
22 AC1 5  HOH F .   ? HOH A 209 . ? 1_555 ? 
23 AC2 1  HOH F .   ? HOH A 215 . ? 1_555 ? 
24 AC3 2  ASP A 72  ? ASP A 72  . ? 5_555 ? 
25 AC3 2  ALA A 93  ? ALA A 93  . ? 1_555 ? 
26 AC4 6  LEU A 84  ? LEU A 84  . ? 1_555 ? 
27 AC4 6  VAL A 87  ? VAL A 87  . ? 1_555 ? 
28 AC4 6  TYR A 88  ? TYR A 88  . ? 1_555 ? 
29 AC4 6  ALA A 99  ? ALA A 99  . ? 1_555 ? 
30 AC4 6  VAL A 111 ? VAL A 111 . ? 1_555 ? 
31 AC4 6  LEU A 118 ? LEU A 118 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          183L 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    183L 
_atom_sites.fract_transf_matrix[1][1]   0.016474 
_atom_sites.fract_transf_matrix[1][2]   0.009512 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019023 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010288 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 44.021 -3.158 9.032   1.00 27.67  ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 43.371 -1.868 9.065   1.00 15.18  ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 41.966 -1.878 9.682   1.00 27.14  ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 41.252 -2.852 9.648   1.00 14.83  ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 43.384 -1.203 7.680   1.00 21.07  ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 42.663 0.133  7.717   1.00 46.22  ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 43.875 1.421  8.007   1.00 32.48  ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 45.181 0.508  7.178   1.00 20.64  ? 1   MET A CE  1 
ATOM   9    N  N   . ASN A 1 2   ? 41.573 -0.766 10.277  1.00 15.99  ? 2   ASN A N   1 
ATOM   10   C  CA  . ASN A 1 2   ? 40.263 -0.642 10.816  1.00 8.42   ? 2   ASN A CA  1 
ATOM   11   C  C   . ASN A 1 2   ? 39.793 0.816  10.859  1.00 7.45   ? 2   ASN A C   1 
ATOM   12   O  O   . ASN A 1 2   ? 40.552 1.721  10.529  1.00 15.63  ? 2   ASN A O   1 
ATOM   13   C  CB  . ASN A 1 2   ? 40.104 -1.375 12.154  1.00 19.42  ? 2   ASN A CB  1 
ATOM   14   C  CG  . ASN A 1 2   ? 40.934 -0.816 13.275  1.00 9.26   ? 2   ASN A CG  1 
ATOM   15   O  OD1 . ASN A 1 2   ? 40.770 0.357  13.673  1.00 14.74  ? 2   ASN A OD1 1 
ATOM   16   N  ND2 . ASN A 1 2   ? 41.747 -1.697 13.872  1.00 11.27  ? 2   ASN A ND2 1 
ATOM   17   N  N   . ILE A 1 3   ? 38.537 1.021  11.275  1.00 6.83   ? 3   ILE A N   1 
ATOM   18   C  CA  . ILE A 1 3   ? 37.991 2.373  11.342  1.00 18.09  ? 3   ILE A CA  1 
ATOM   19   C  C   . ILE A 1 3   ? 38.859 3.313  12.193  1.00 8.98   ? 3   ILE A C   1 
ATOM   20   O  O   . ILE A 1 3   ? 39.111 4.479  11.864  1.00 18.02  ? 3   ILE A O   1 
ATOM   21   C  CB  . ILE A 1 3   ? 36.474 2.378  11.705  1.00 10.95  ? 3   ILE A CB  1 
ATOM   22   C  CG1 . ILE A 1 3   ? 35.777 3.746  11.546  1.00 12.56  ? 3   ILE A CG1 1 
ATOM   23   C  CG2 . ILE A 1 3   ? 36.218 1.836  13.120  1.00 4.39   ? 3   ILE A CG2 1 
ATOM   24   C  CD1 . ILE A 1 3   ? 36.135 4.566  10.287  1.00 6.69   ? 3   ILE A CD1 1 
ATOM   25   N  N   . PHE A 1 4   ? 39.295 2.822  13.346  1.00 11.59  ? 4   PHE A N   1 
ATOM   26   C  CA  . PHE A 1 4   ? 40.089 3.664  14.214  1.00 8.71   ? 4   PHE A CA  1 
ATOM   27   C  C   . PHE A 1 4   ? 41.431 4.066  13.598  1.00 13.71  ? 4   PHE A C   1 
ATOM   28   O  O   . PHE A 1 4   ? 41.880 5.194  13.675  1.00 16.01  ? 4   PHE A O   1 
ATOM   29   C  CB  . PHE A 1 4   ? 40.343 2.998  15.588  1.00 12.91  ? 4   PHE A CB  1 
ATOM   30   C  CG  . PHE A 1 4   ? 39.072 2.861  16.349  1.00 6.03   ? 4   PHE A CG  1 
ATOM   31   C  CD1 . PHE A 1 4   ? 38.596 3.925  17.130  1.00 20.25  ? 4   PHE A CD1 1 
ATOM   32   C  CD2 . PHE A 1 4   ? 38.334 1.686  16.290  1.00 11.90  ? 4   PHE A CD2 1 
ATOM   33   C  CE1 . PHE A 1 4   ? 37.412 3.836  17.867  1.00 14.54  ? 4   PHE A CE1 1 
ATOM   34   C  CE2 . PHE A 1 4   ? 37.118 1.598  16.978  1.00 22.28  ? 4   PHE A CE2 1 
ATOM   35   C  CZ  . PHE A 1 4   ? 36.665 2.665  17.759  1.00 11.43  ? 4   PHE A CZ  1 
ATOM   36   N  N   . GLU A 1 5   ? 42.073 3.132  12.970  1.00 10.90  ? 5   GLU A N   1 
ATOM   37   C  CA  . GLU A 1 5   ? 43.349 3.398  12.354  1.00 22.16  ? 5   GLU A CA  1 
ATOM   38   C  C   . GLU A 1 5   ? 43.159 4.235  11.138  1.00 14.81  ? 5   GLU A C   1 
ATOM   39   O  O   . GLU A 1 5   ? 44.000 5.058  10.804  1.00 19.17  ? 5   GLU A O   1 
ATOM   40   C  CB  . GLU A 1 5   ? 43.984 2.085  11.850  1.00 6.21   ? 5   GLU A CB  1 
ATOM   41   C  CG  . GLU A 1 5   ? 44.292 1.073  12.944  1.00 12.81  ? 5   GLU A CG  1 
ATOM   42   C  CD  . GLU A 1 5   ? 45.088 -0.116 12.424  1.00 39.63  ? 5   GLU A CD  1 
ATOM   43   O  OE1 . GLU A 1 5   ? 45.871 -0.073 11.478  1.00 100.00 ? 5   GLU A OE1 1 
ATOM   44   O  OE2 . GLU A 1 5   ? 44.904 -1.184 13.134  1.00 48.90  ? 5   GLU A OE2 1 
ATOM   45   N  N   . MET A 1 6   ? 42.052 3.969  10.453  1.00 15.61  ? 6   MET A N   1 
ATOM   46   C  CA  . MET A 1 6   ? 41.768 4.708  9.252   1.00 12.39  ? 6   MET A CA  1 
ATOM   47   C  C   . MET A 1 6   ? 41.512 6.153  9.604   1.00 11.35  ? 6   MET A C   1 
ATOM   48   O  O   . MET A 1 6   ? 42.021 7.073  9.016   1.00 17.45  ? 6   MET A O   1 
ATOM   49   C  CB  . MET A 1 6   ? 40.553 4.121  8.592   1.00 7.40   ? 6   MET A CB  1 
ATOM   50   C  CG  . MET A 1 6   ? 40.097 4.931  7.416   1.00 6.09   ? 6   MET A CG  1 
ATOM   51   S  SD  . MET A 1 6   ? 38.382 4.557  6.942   1.00 12.36  ? 6   MET A SD  1 
ATOM   52   C  CE  . MET A 1 6   ? 38.321 4.750  5.145   1.00 14.37  ? 6   MET A CE  1 
ATOM   53   N  N   . LEU A 1 7   ? 40.693 6.394  10.586  1.00 9.98   ? 7   LEU A N   1 
ATOM   54   C  CA  . LEU A 1 7   ? 40.463 7.806  10.922  1.00 9.82   ? 7   LEU A CA  1 
ATOM   55   C  C   . LEU A 1 7   ? 41.686 8.432  11.541  1.00 12.76  ? 7   LEU A C   1 
ATOM   56   O  O   . LEU A 1 7   ? 41.920 9.606  11.364  1.00 25.55  ? 7   LEU A O   1 
ATOM   57   C  CB  . LEU A 1 7   ? 39.295 7.952  11.912  1.00 9.06   ? 7   LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 7   ? 37.948 7.933  11.202  1.00 6.27   ? 7   LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 7   ? 36.853 7.492  12.125  1.00 23.60  ? 7   LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 7   ? 37.645 9.283  10.534  1.00 13.30  ? 7   LEU A CD2 1 
ATOM   61   N  N   . ARG A 1 8   ? 42.465 7.665  12.322  1.00 5.48   ? 8   ARG A N   1 
ATOM   62   C  CA  . ARG A 1 8   ? 43.629 8.285  12.901  1.00 4.27   ? 8   ARG A CA  1 
ATOM   63   C  C   . ARG A 1 8   ? 44.562 8.805  11.826  1.00 21.83  ? 8   ARG A C   1 
ATOM   64   O  O   . ARG A 1 8   ? 45.229 9.772  12.013  1.00 14.63  ? 8   ARG A O   1 
ATOM   65   C  CB  . ARG A 1 8   ? 44.412 7.395  13.865  1.00 12.46  ? 8   ARG A CB  1 
ATOM   66   C  CG  . ARG A 1 8   ? 45.781 7.998  14.180  1.00 47.47  ? 8   ARG A CG  1 
ATOM   67   C  CD  . ARG A 1 8   ? 45.963 8.326  15.666  1.00 49.11  ? 8   ARG A CD  1 
ATOM   68   N  NE  . ARG A 1 8   ? 47.252 8.935  16.053  1.00 60.44  ? 8   ARG A NE  1 
ATOM   69   C  CZ  . ARG A 1 8   ? 48.026 9.711  15.285  1.00 60.36  ? 8   ARG A CZ  1 
ATOM   70   N  NH1 . ARG A 1 8   ? 47.697 10.040 14.021  1.00 61.76  ? 8   ARG A NH1 1 
ATOM   71   N  NH2 . ARG A 1 8   ? 49.171 10.182 15.787  1.00 100.00 ? 8   ARG A NH2 1 
ATOM   72   N  N   . ILE A 1 9   ? 44.658 8.124  10.715  1.00 15.52  ? 9   ILE A N   1 
ATOM   73   C  CA  . ILE A 1 9   ? 45.495 8.592  9.636   1.00 14.44  ? 9   ILE A CA  1 
ATOM   74   C  C   . ILE A 1 9   ? 44.872 9.810  8.979   1.00 19.48  ? 9   ILE A C   1 
ATOM   75   O  O   . ILE A 1 9   ? 45.559 10.764 8.612   1.00 22.45  ? 9   ILE A O   1 
ATOM   76   C  CB  . ILE A 1 9   ? 45.580 7.508  8.542   1.00 14.51  ? 9   ILE A CB  1 
ATOM   77   C  CG1 . ILE A 1 9   ? 46.565 6.443  8.883   1.00 17.22  ? 9   ILE A CG1 1 
ATOM   78   C  CG2 . ILE A 1 9   ? 45.848 8.034  7.099   1.00 8.81   ? 9   ILE A CG2 1 
ATOM   79   C  CD1 . ILE A 1 9   ? 46.136 5.122  8.267   1.00 18.74  ? 9   ILE A CD1 1 
ATOM   80   N  N   . ASP A 1 10  ? 43.572 9.777  8.728   1.00 5.29   ? 10  ASP A N   1 
ATOM   81   C  CA  . ASP A 1 10  ? 42.959 10.923 8.059   1.00 11.22  ? 10  ASP A CA  1 
ATOM   82   C  C   . ASP A 1 10  ? 42.901 12.196 8.927   1.00 17.57  ? 10  ASP A C   1 
ATOM   83   O  O   . ASP A 1 10  ? 42.956 13.357 8.469   1.00 15.15  ? 10  ASP A O   1 
ATOM   84   C  CB  . ASP A 1 10  ? 41.538 10.534 7.678   1.00 11.19  ? 10  ASP A CB  1 
ATOM   85   C  CG  . ASP A 1 10  ? 41.614 9.741  6.432   1.00 11.13  ? 10  ASP A CG  1 
ATOM   86   O  OD1 . ASP A 1 10  ? 42.518 9.868  5.624   1.00 14.59  ? 10  ASP A OD1 1 
ATOM   87   O  OD2 . ASP A 1 10  ? 40.672 8.891  6.337   1.00 15.67  ? 10  ASP A OD2 1 
ATOM   88   N  N   . GLU A 1 11  ? 42.725 11.986 10.202  1.00 13.03  ? 11  GLU A N   1 
ATOM   89   C  CA  . GLU A 1 11  ? 42.574 13.119 11.137  1.00 6.68   ? 11  GLU A CA  1 
ATOM   90   C  C   . GLU A 1 11  ? 43.863 13.552 11.849  1.00 14.46  ? 11  GLU A C   1 
ATOM   91   O  O   . GLU A 1 11  ? 43.987 14.703 12.221  1.00 19.91  ? 11  GLU A O   1 
ATOM   92   C  CB  . GLU A 1 11  ? 41.455 12.823 12.176  1.00 8.13   ? 11  GLU A CB  1 
ATOM   93   C  CG  . GLU A 1 11  ? 40.113 12.563 11.483  1.00 18.62  ? 11  GLU A CG  1 
ATOM   94   C  CD  . GLU A 1 11  ? 39.418 13.805 10.938  1.00 11.93  ? 11  GLU A CD  1 
ATOM   95   O  OE1 . GLU A 1 11  ? 39.978 14.926 11.251  1.00 17.03  ? 11  GLU A OE1 1 
ATOM   96   O  OE2 . GLU A 1 11  ? 38.402 13.763 10.292  1.00 26.54  ? 11  GLU A OE2 1 
ATOM   97   N  N   . GLY A 1 12  ? 44.785 12.650 12.100  1.00 13.19  ? 12  GLY A N   1 
ATOM   98   C  CA  . GLY A 1 12  ? 46.005 13.019 12.820  1.00 12.90  ? 12  GLY A CA  1 
ATOM   99   C  C   . GLY A 1 12  ? 45.704 13.125 14.285  1.00 9.93   ? 12  GLY A C   1 
ATOM   100  O  O   . GLY A 1 12  ? 44.569 12.851 14.672  1.00 23.28  ? 12  GLY A O   1 
ATOM   101  N  N   . LEU A 1 13  ? 46.692 13.516 15.114  1.00 16.04  ? 13  LEU A N   1 
ATOM   102  C  CA  . LEU A 1 13  ? 46.469 13.662 16.552  1.00 19.31  ? 13  LEU A CA  1 
ATOM   103  C  C   . LEU A 1 13  ? 47.186 14.874 17.088  1.00 24.47  ? 13  LEU A C   1 
ATOM   104  O  O   . LEU A 1 13  ? 48.409 14.914 16.981  1.00 24.36  ? 13  LEU A O   1 
ATOM   105  C  CB  . LEU A 1 13  ? 47.027 12.475 17.338  1.00 18.38  ? 13  LEU A CB  1 
ATOM   106  C  CG  . LEU A 1 13  ? 47.121 12.798 18.857  1.00 35.56  ? 13  LEU A CG  1 
ATOM   107  C  CD1 . LEU A 1 13  ? 45.793 12.627 19.620  1.00 17.76  ? 13  LEU A CD1 1 
ATOM   108  C  CD2 . LEU A 1 13  ? 48.182 11.951 19.528  1.00 28.97  ? 13  LEU A CD2 1 
ATOM   109  N  N   . ARG A 1 14  ? 46.439 15.822 17.680  1.00 14.01  ? 14  ARG A N   1 
ATOM   110  C  CA  . ARG A 1 14  ? 46.956 17.051 18.284  1.00 14.66  ? 14  ARG A CA  1 
ATOM   111  C  C   . ARG A 1 14  ? 46.385 17.231 19.634  1.00 24.23  ? 14  ARG A C   1 
ATOM   112  O  O   . ARG A 1 14  ? 45.210 17.026 19.812  1.00 16.22  ? 14  ARG A O   1 
ATOM   113  C  CB  . ARG A 1 14  ? 46.663 18.264 17.446  1.00 16.62  ? 14  ARG A CB  1 
ATOM   114  C  CG  . ARG A 1 14  ? 47.496 18.065 16.173  1.00 30.71  ? 14  ARG A CG  1 
ATOM   115  C  CD  . ARG A 1 14  ? 47.415 19.214 15.184  1.00 28.61  ? 14  ARG A CD  1 
ATOM   116  N  NE  . ARG A 1 14  ? 48.132 20.398 15.645  1.00 100.00 ? 14  ARG A NE  1 
ATOM   117  C  CZ  . ARG A 1 14  ? 48.039 21.580 15.041  1.00 100.00 ? 14  ARG A CZ  1 
ATOM   118  N  NH1 . ARG A 1 14  ? 47.274 21.740 13.954  1.00 58.13  ? 14  ARG A NH1 1 
ATOM   119  N  NH2 . ARG A 1 14  ? 48.722 22.626 15.536  1.00 100.00 ? 14  ARG A NH2 1 
ATOM   120  N  N   . LEU A 1 15  ? 47.263 17.523 20.570  1.00 24.26  ? 15  LEU A N   1 
ATOM   121  C  CA  . LEU A 1 15  ? 46.943 17.663 21.968  1.00 17.16  ? 15  LEU A CA  1 
ATOM   122  C  C   . LEU A 1 15  ? 46.647 19.099 22.439  1.00 16.90  ? 15  LEU A C   1 
ATOM   123  O  O   . LEU A 1 15  ? 46.297 19.344 23.606  1.00 19.98  ? 15  LEU A O   1 
ATOM   124  C  CB  . LEU A 1 15  ? 47.952 16.930 22.892  1.00 27.78  ? 15  LEU A CB  1 
ATOM   125  C  CG  . LEU A 1 15  ? 48.121 15.425 22.608  1.00 14.09  ? 15  LEU A CG  1 
ATOM   126  C  CD1 . LEU A 1 15  ? 49.060 14.829 23.648  1.00 35.67  ? 15  LEU A CD1 1 
ATOM   127  C  CD2 . LEU A 1 15  ? 46.774 14.689 22.673  1.00 30.00  ? 15  LEU A CD2 1 
ATOM   128  N  N   . LYS A 1 16  ? 46.749 20.048 21.532  1.00 21.72  ? 16  LYS A N   1 
ATOM   129  C  CA  . LYS A 1 16  ? 46.476 21.415 21.885  1.00 14.78  ? 16  LYS A CA  1 
ATOM   130  C  C   . LYS A 1 16  ? 45.452 21.908 20.891  1.00 17.81  ? 16  LYS A C   1 
ATOM   131  O  O   . LYS A 1 16  ? 45.501 21.475 19.727  1.00 19.32  ? 16  LYS A O   1 
ATOM   132  C  CB  . LYS A 1 16  ? 47.805 22.166 21.831  1.00 34.24  ? 16  LYS A CB  1 
ATOM   133  C  CG  . LYS A 1 16  ? 47.690 23.651 21.642  1.00 54.23  ? 16  LYS A CG  1 
ATOM   134  C  CD  . LYS A 1 16  ? 47.207 24.348 22.905  1.00 100.00 ? 16  LYS A CD  1 
ATOM   135  C  CE  . LYS A 1 16  ? 45.911 25.133 22.700  1.00 100.00 ? 16  LYS A CE  1 
ATOM   136  N  NZ  . LYS A 1 16  ? 45.276 25.568 23.952  1.00 100.00 ? 16  LYS A NZ  1 
ATOM   137  N  N   . ILE A 1 17  ? 44.489 22.762 21.343  1.00 20.21  ? 17  ILE A N   1 
ATOM   138  C  CA  . ILE A 1 17  ? 43.425 23.285 20.451  1.00 9.45   ? 17  ILE A CA  1 
ATOM   139  C  C   . ILE A 1 17  ? 44.006 23.736 19.135  1.00 30.29  ? 17  ILE A C   1 
ATOM   140  O  O   . ILE A 1 17  ? 45.010 24.440 19.085  1.00 18.86  ? 17  ILE A O   1 
ATOM   141  C  CB  . ILE A 1 17  ? 42.526 24.430 21.062  1.00 15.54  ? 17  ILE A CB  1 
ATOM   142  C  CG1 . ILE A 1 17  ? 41.688 23.891 22.201  1.00 26.22  ? 17  ILE A CG1 1 
ATOM   143  C  CG2 . ILE A 1 17  ? 41.553 25.012 20.028  1.00 13.17  ? 17  ILE A CG2 1 
ATOM   144  C  CD1 . ILE A 1 17  ? 41.061 24.943 23.096  1.00 14.07  ? 17  ILE A CD1 1 
ATOM   145  N  N   . TYR A 1 18  ? 43.369 23.384 18.055  1.00 17.45  ? 18  TYR A N   1 
ATOM   146  C  CA  . TYR A 1 18  ? 43.883 23.875 16.789  1.00 7.96   ? 18  TYR A CA  1 
ATOM   147  C  C   . TYR A 1 18  ? 42.720 24.229 15.861  1.00 12.86  ? 18  TYR A C   1 
ATOM   148  O  O   . TYR A 1 18  ? 41.553 23.950 16.151  1.00 20.49  ? 18  TYR A O   1 
ATOM   149  C  CB  . TYR A 1 18  ? 44.886 22.826 16.170  1.00 16.20  ? 18  TYR A CB  1 
ATOM   150  C  CG  . TYR A 1 18  ? 44.247 21.496 15.761  1.00 32.40  ? 18  TYR A CG  1 
ATOM   151  C  CD1 . TYR A 1 18  ? 44.039 20.475 16.688  1.00 23.74  ? 18  TYR A CD1 1 
ATOM   152  C  CD2 . TYR A 1 18  ? 43.822 21.272 14.450  1.00 23.87  ? 18  TYR A CD2 1 
ATOM   153  C  CE1 . TYR A 1 18  ? 43.436 19.275 16.309  1.00 19.50  ? 18  TYR A CE1 1 
ATOM   154  C  CE2 . TYR A 1 18  ? 43.183 20.091 14.055  1.00 15.10  ? 18  TYR A CE2 1 
ATOM   155  C  CZ  . TYR A 1 18  ? 42.976 19.086 15.001  1.00 39.83  ? 18  TYR A CZ  1 
ATOM   156  O  OH  . TYR A 1 18  ? 42.369 17.870 14.626  1.00 22.77  ? 18  TYR A OH  1 
ATOM   157  N  N   . LYS A 1 19  ? 43.029 24.692 14.663  1.00 18.38  ? 19  LYS A N   1 
ATOM   158  C  CA  . LYS A 1 19  ? 41.949 24.948 13.734  1.00 10.67  ? 19  LYS A CA  1 
ATOM   159  C  C   . LYS A 1 19  ? 41.895 23.915 12.637  1.00 21.01  ? 19  LYS A C   1 
ATOM   160  O  O   . LYS A 1 19  ? 42.887 23.564 11.995  1.00 28.23  ? 19  LYS A O   1 
ATOM   161  C  CB  . LYS A 1 19  ? 41.942 26.304 13.107  1.00 18.77  ? 19  LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 19  ? 41.698 27.385 14.082  1.00 14.53  ? 19  LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 19  ? 41.216 28.625 13.353  1.00 41.27  ? 19  LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 19  ? 41.715 29.904 14.000  1.00 25.48  ? 19  LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 19  ? 41.063 31.111 13.483  1.00 52.99  ? 19  LYS A NZ  1 
ATOM   166  N  N   . ASP A 1 20  ? 40.716 23.429 12.402  1.00 16.33  ? 20  ASP A N   1 
ATOM   167  C  CA  . ASP A 1 20  ? 40.592 22.442 11.366  1.00 10.67  ? 20  ASP A CA  1 
ATOM   168  C  C   . ASP A 1 20  ? 40.727 23.039 9.955   1.00 24.61  ? 20  ASP A C   1 
ATOM   169  O  O   . ASP A 1 20  ? 40.957 24.240 9.794   1.00 13.82  ? 20  ASP A O   1 
ATOM   170  C  CB  . ASP A 1 20  ? 39.436 21.427 11.583  1.00 13.07  ? 20  ASP A CB  1 
ATOM   171  C  CG  . ASP A 1 20  ? 38.106 21.986 11.160  1.00 13.14  ? 20  ASP A CG  1 
ATOM   172  O  OD1 . ASP A 1 20  ? 38.168 23.234 10.869  1.00 21.26  ? 20  ASP A OD1 1 
ATOM   173  O  OD2 . ASP A 1 20  ? 37.074 21.356 11.188  1.00 35.05  ? 20  ASP A OD2 1 
ATOM   174  N  N   . THR A 1 21  ? 40.475 22.202 8.933   1.00 22.51  ? 21  THR A N   1 
ATOM   175  C  CA  . THR A 1 21  ? 40.611 22.646 7.548   1.00 34.33  ? 21  THR A CA  1 
ATOM   176  C  C   . THR A 1 21  ? 39.600 23.689 7.164   1.00 14.04  ? 21  THR A C   1 
ATOM   177  O  O   . THR A 1 21  ? 39.696 24.319 6.071   1.00 16.90  ? 21  THR A O   1 
ATOM   178  C  CB  . THR A 1 21  ? 40.535 21.482 6.569   1.00 34.56  ? 21  THR A CB  1 
ATOM   179  O  OG1 . THR A 1 21  ? 39.191 21.062 6.535   1.00 21.85  ? 21  THR A OG1 1 
ATOM   180  C  CG2 . THR A 1 21  ? 41.431 20.327 7.054   1.00 27.51  ? 21  THR A CG2 1 
ATOM   181  N  N   . GLU A 1 22  ? 38.589 23.824 8.010   1.00 18.10  ? 22  GLU A N   1 
ATOM   182  C  CA  . GLU A 1 22  ? 37.505 24.806 7.752   1.00 15.96  ? 22  GLU A CA  1 
ATOM   183  C  C   . GLU A 1 22  ? 37.672 25.995 8.689   1.00 21.81  ? 22  GLU A C   1 
ATOM   184  O  O   . GLU A 1 22  ? 36.895 26.930 8.639   1.00 26.36  ? 22  GLU A O   1 
ATOM   185  C  CB  . GLU A 1 22  ? 36.086 24.197 7.934   1.00 17.45  ? 22  GLU A CB  1 
ATOM   186  C  CG  . GLU A 1 22  ? 35.762 22.927 7.127   1.00 29.71  ? 22  GLU A CG  1 
ATOM   187  C  CD  . GLU A 1 22  ? 35.241 23.172 5.721   1.00 25.63  ? 22  GLU A CD  1 
ATOM   188  O  OE1 . GLU A 1 22  ? 34.650 24.336 5.582   1.00 64.51  ? 22  GLU A OE1 1 
ATOM   189  O  OE2 . GLU A 1 22  ? 35.374 22.362 4.816   1.00 100.00 ? 22  GLU A OE2 1 
ATOM   190  N  N   . GLY A 1 23  ? 38.712 25.914 9.555   1.00 19.48  ? 23  GLY A N   1 
ATOM   191  C  CA  . GLY A 1 23  ? 39.038 26.970 10.532  1.00 9.80   ? 23  GLY A CA  1 
ATOM   192  C  C   . GLY A 1 23  ? 38.314 26.870 11.868  1.00 30.25  ? 23  GLY A C   1 
ATOM   193  O  O   . GLY A 1 23  ? 38.273 27.830 12.595  1.00 21.26  ? 23  GLY A O   1 
ATOM   194  N  N   . TYR A 1 24  ? 37.757 25.709 12.198  1.00 18.48  ? 24  TYR A N   1 
ATOM   195  C  CA  . TYR A 1 24  ? 37.019 25.534 13.436  1.00 19.98  ? 24  TYR A CA  1 
ATOM   196  C  C   . TYR A 1 24  ? 37.890 24.932 14.479  1.00 6.97   ? 24  TYR A C   1 
ATOM   197  O  O   . TYR A 1 24  ? 38.736 24.090 14.165  1.00 19.42  ? 24  TYR A O   1 
ATOM   198  C  CB  . TYR A 1 24  ? 35.862 24.601 13.235  1.00 22.17  ? 24  TYR A CB  1 
ATOM   199  C  CG  . TYR A 1 24  ? 34.849 25.120 12.250  1.00 15.39  ? 24  TYR A CG  1 
ATOM   200  C  CD1 . TYR A 1 24  ? 34.295 26.387 12.423  1.00 34.93  ? 24  TYR A CD1 1 
ATOM   201  C  CD2 . TYR A 1 24  ? 34.370 24.314 11.207  1.00 21.14  ? 24  TYR A CD2 1 
ATOM   202  C  CE1 . TYR A 1 24  ? 33.319 26.856 11.547  1.00 46.11  ? 24  TYR A CE1 1 
ATOM   203  C  CE2 . TYR A 1 24  ? 33.397 24.772 10.317  1.00 35.89  ? 24  TYR A CE2 1 
ATOM   204  C  CZ  . TYR A 1 24  ? 32.854 26.050 10.497  1.00 26.42  ? 24  TYR A CZ  1 
ATOM   205  O  OH  . TYR A 1 24  ? 31.873 26.533 9.643   1.00 49.93  ? 24  TYR A OH  1 
ATOM   206  N  N   . TYR A 1 25  ? 37.664 25.395 15.709  1.00 14.05  ? 25  TYR A N   1 
ATOM   207  C  CA  . TYR A 1 25  ? 38.464 24.910 16.811  1.00 6.98   ? 25  TYR A CA  1 
ATOM   208  C  C   . TYR A 1 25  ? 38.189 23.430 17.051  1.00 2.95   ? 25  TYR A C   1 
ATOM   209  O  O   . TYR A 1 25  ? 37.018 23.053 17.268  1.00 9.05   ? 25  TYR A O   1 
ATOM   210  C  CB  . TYR A 1 25  ? 38.195 25.733 18.072  1.00 14.35  ? 25  TYR A CB  1 
ATOM   211  C  CG  . TYR A 1 25  ? 38.809 27.074 17.977  1.00 25.32  ? 25  TYR A CG  1 
ATOM   212  C  CD1 . TYR A 1 25  ? 40.184 27.231 17.827  1.00 23.76  ? 25  TYR A CD1 1 
ATOM   213  C  CD2 . TYR A 1 25  ? 37.993 28.201 18.026  1.00 22.60  ? 25  TYR A CD2 1 
ATOM   214  C  CE1 . TYR A 1 25  ? 40.741 28.510 17.748  1.00 30.86  ? 25  TYR A CE1 1 
ATOM   215  C  CE2 . TYR A 1 25  ? 38.534 29.481 17.929  1.00 23.64  ? 25  TYR A CE2 1 
ATOM   216  C  CZ  . TYR A 1 25  ? 39.910 29.640 17.841  1.00 52.75  ? 25  TYR A CZ  1 
ATOM   217  O  OH  . TYR A 1 25  ? 40.412 30.928 17.770  1.00 42.95  ? 25  TYR A OH  1 
ATOM   218  N  N   . THR A 1 26  ? 39.270 22.677 17.021  1.00 11.56  ? 26  THR A N   1 
ATOM   219  C  CA  . THR A 1 26  ? 39.278 21.259 17.156  1.00 12.95  ? 26  THR A CA  1 
ATOM   220  C  C   . THR A 1 26  ? 40.380 20.938 18.070  1.00 20.57  ? 26  THR A C   1 
ATOM   221  O  O   . THR A 1 26  ? 41.181 21.827 18.303  1.00 20.23  ? 26  THR A O   1 
ATOM   222  C  CB  . THR A 1 26  ? 39.641 20.672 15.756  1.00 16.51  ? 26  THR A CB  1 
ATOM   223  O  OG1 . THR A 1 26  ? 38.693 21.071 14.807  1.00 22.08  ? 26  THR A OG1 1 
ATOM   224  C  CG2 . THR A 1 26  ? 39.747 19.146 15.691  1.00 1.23   ? 26  THR A CG2 1 
ATOM   225  N  N   . ILE A 1 27  ? 40.415 19.670 18.523  1.00 11.02  ? 27  ILE A N   1 
ATOM   226  C  CA  . ILE A 1 27  ? 41.504 19.103 19.333  1.00 11.99  ? 27  ILE A CA  1 
ATOM   227  C  C   . ILE A 1 27  ? 41.489 17.547 19.159  1.00 14.25  ? 27  ILE A C   1 
ATOM   228  O  O   . ILE A 1 27  ? 40.536 16.980 18.711  1.00 11.87  ? 27  ILE A O   1 
ATOM   229  C  CB  . ILE A 1 27  ? 41.348 19.478 20.826  1.00 18.57  ? 27  ILE A CB  1 
ATOM   230  C  CG1 . ILE A 1 27  ? 42.588 19.096 21.677  1.00 14.79  ? 27  ILE A CG1 1 
ATOM   231  C  CG2 . ILE A 1 27  ? 40.113 18.732 21.379  1.00 10.85  ? 27  ILE A CG2 1 
ATOM   232  C  CD1 . ILE A 1 27  ? 42.980 20.056 22.804  1.00 7.71   ? 27  ILE A CD1 1 
ATOM   233  N  N   . GLY A 1 28  ? 42.522 16.862 19.573  1.00 10.37  ? 28  GLY A N   1 
ATOM   234  C  CA  . GLY A 1 28  ? 42.592 15.394 19.566  1.00 14.20  ? 28  GLY A CA  1 
ATOM   235  C  C   . GLY A 1 28  ? 42.671 14.828 18.178  1.00 37.89  ? 28  GLY A C   1 
ATOM   236  O  O   . GLY A 1 28  ? 43.446 15.266 17.327  1.00 15.87  ? 28  GLY A O   1 
ATOM   237  N  N   . ILE A 1 29  ? 41.841 13.843 17.981  1.00 13.36  ? 29  ILE A N   1 
ATOM   238  C  CA  . ILE A 1 29  ? 41.706 13.177 16.685  1.00 13.85  ? 29  ILE A CA  1 
ATOM   239  C  C   . ILE A 1 29  ? 40.446 13.656 15.968  1.00 14.67  ? 29  ILE A C   1 
ATOM   240  O  O   . ILE A 1 29  ? 39.431 12.971 15.856  1.00 16.61  ? 29  ILE A O   1 
ATOM   241  C  CB  . ILE A 1 29  ? 41.764 11.646 16.868  1.00 11.86  ? 29  ILE A CB  1 
ATOM   242  C  CG1 . ILE A 1 29  ? 43.077 11.347 17.622  1.00 20.30  ? 29  ILE A CG1 1 
ATOM   243  C  CG2 . ILE A 1 29  ? 41.725 10.947 15.509  1.00 17.81  ? 29  ILE A CG2 1 
ATOM   244  C  CD1 . ILE A 1 29  ? 43.183 9.986  18.281  1.00 11.58  ? 29  ILE A CD1 1 
ATOM   245  N  N   . GLY A 1 30  ? 40.520 14.871 15.485  1.00 10.65  ? 30  GLY A N   1 
ATOM   246  C  CA  . GLY A 1 30  ? 39.359 15.436 14.770  1.00 6.79   ? 30  GLY A CA  1 
ATOM   247  C  C   . GLY A 1 30  ? 38.139 15.770 15.574  1.00 12.29  ? 30  GLY A C   1 
ATOM   248  O  O   . GLY A 1 30  ? 37.055 15.879 15.016  1.00 16.55  ? 30  GLY A O   1 
ATOM   249  N  N   . HIS A 1 31  ? 38.277 15.965 16.885  1.00 8.51   ? 31  HIS A N   1 
ATOM   250  C  CA  . HIS A 1 31  ? 37.097 16.292 17.623  1.00 4.87   ? 31  HIS A CA  1 
ATOM   251  C  C   . HIS A 1 31  ? 36.777 17.815 17.576  1.00 8.31   ? 31  HIS A C   1 
ATOM   252  O  O   . HIS A 1 31  ? 37.470 18.669 18.157  1.00 12.63  ? 31  HIS A O   1 
ATOM   253  C  CB  . HIS A 1 31  ? 37.381 15.850 19.086  1.00 2.28   ? 31  HIS A CB  1 
ATOM   254  C  CG  . HIS A 1 31  ? 36.236 16.202 19.953  1.00 14.20  ? 31  HIS A CG  1 
ATOM   255  N  ND1 . HIS A 1 31  ? 35.189 15.331 20.145  1.00 8.03   ? 31  HIS A ND1 1 
ATOM   256  C  CD2 . HIS A 1 31  ? 35.993 17.327 20.691  1.00 19.85  ? 31  HIS A CD2 1 
ATOM   257  C  CE1 . HIS A 1 31  ? 34.282 15.951 20.860  1.00 7.95   ? 31  HIS A CE1 1 
ATOM   258  N  NE2 . HIS A 1 31  ? 34.743 17.149 21.234  1.00 16.74  ? 31  HIS A NE2 1 
ATOM   259  N  N   . LEU A 1 32  ? 35.703 18.168 16.800  1.00 11.16  ? 32  LEU A N   1 
ATOM   260  C  CA  . LEU A 1 32  ? 35.306 19.535 16.636  1.00 12.05  ? 32  LEU A CA  1 
ATOM   261  C  C   . LEU A 1 32  ? 34.811 20.082 17.906  1.00 10.62  ? 32  LEU A C   1 
ATOM   262  O  O   . LEU A 1 32  ? 33.977 19.490 18.570  1.00 16.56  ? 32  LEU A O   1 
ATOM   263  C  CB  . LEU A 1 32  ? 34.193 19.672 15.599  1.00 15.84  ? 32  LEU A CB  1 
ATOM   264  C  CG  . LEU A 1 32  ? 33.581 21.066 15.602  1.00 40.53  ? 32  LEU A CG  1 
ATOM   265  C  CD1 . LEU A 1 32  ? 34.559 21.982 14.911  1.00 14.25  ? 32  LEU A CD1 1 
ATOM   266  C  CD2 . LEU A 1 32  ? 32.328 21.033 14.760  1.00 17.92  ? 32  LEU A CD2 1 
ATOM   267  N  N   . LEU A 1 33  ? 35.330 21.191 18.327  1.00 11.16  ? 33  LEU A N   1 
ATOM   268  C  CA  . LEU A 1 33  ? 34.809 21.621 19.593  1.00 14.48  ? 33  LEU A CA  1 
ATOM   269  C  C   . LEU A 1 33  ? 33.662 22.614 19.402  1.00 14.67  ? 33  LEU A C   1 
ATOM   270  O  O   . LEU A 1 33  ? 32.727 22.685 20.197  1.00 16.81  ? 33  LEU A O   1 
ATOM   271  C  CB  . LEU A 1 33  ? 35.883 22.355 20.372  1.00 16.63  ? 33  LEU A CB  1 
ATOM   272  C  CG  . LEU A 1 33  ? 36.946 21.463 20.921  1.00 23.48  ? 33  LEU A CG  1 
ATOM   273  C  CD1 . LEU A 1 33  ? 38.075 22.381 21.227  1.00 10.87  ? 33  LEU A CD1 1 
ATOM   274  C  CD2 . LEU A 1 33  ? 36.448 20.852 22.220  1.00 3.53   ? 33  LEU A CD2 1 
ATOM   275  N  N   . THR A 1 34  ? 33.827 23.467 18.402  1.00 23.64  ? 34  THR A N   1 
ATOM   276  C  CA  . THR A 1 34  ? 32.898 24.531 18.135  1.00 39.56  ? 34  THR A CA  1 
ATOM   277  C  C   . THR A 1 34  ? 33.198 25.215 16.844  1.00 27.00  ? 34  THR A C   1 
ATOM   278  O  O   . THR A 1 34  ? 34.364 25.315 16.424  1.00 26.69  ? 34  THR A O   1 
ATOM   279  C  CB  . THR A 1 34  ? 32.835 25.645 19.241  1.00 34.33  ? 34  THR A CB  1 
ATOM   280  O  OG1 . THR A 1 34  ? 31.802 26.534 18.891  1.00 31.23  ? 34  THR A OG1 1 
ATOM   281  C  CG2 . THR A 1 34  ? 34.104 26.490 19.400  1.00 17.30  ? 34  THR A CG2 1 
ATOM   282  N  N   . LYS A 1 35  ? 32.094 25.741 16.310  1.00 19.26  ? 35  LYS A N   1 
ATOM   283  C  CA  . LYS A 1 35  ? 32.084 26.526 15.113  1.00 24.52  ? 35  LYS A CA  1 
ATOM   284  C  C   . LYS A 1 35  ? 32.298 27.999 15.350  1.00 40.22  ? 35  LYS A C   1 
ATOM   285  O  O   . LYS A 1 35  ? 32.710 28.743 14.466  1.00 42.02  ? 35  LYS A O   1 
ATOM   286  C  CB  . LYS A 1 35  ? 30.875 26.261 14.301  1.00 31.17  ? 35  LYS A CB  1 
ATOM   287  C  CG  . LYS A 1 35  ? 31.079 24.946 13.577  1.00 43.63  ? 35  LYS A CG  1 
ATOM   288  C  CD  . LYS A 1 35  ? 29.816 24.322 13.034  1.00 32.46  ? 35  LYS A CD  1 
ATOM   289  C  CE  . LYS A 1 35  ? 30.118 23.263 11.965  1.00 29.41  ? 35  LYS A CE  1 
ATOM   290  N  NZ  . LYS A 1 35  ? 28.896 22.709 11.331  1.00 100.00 ? 35  LYS A NZ  1 
ATOM   291  N  N   . SER A 1 36  ? 32.069 28.391 16.569  1.00 33.10  ? 36  SER A N   1 
ATOM   292  C  CA  . SER A 1 36  ? 32.234 29.757 16.920  1.00 31.12  ? 36  SER A CA  1 
ATOM   293  C  C   . SER A 1 36  ? 33.696 30.140 16.880  1.00 29.87  ? 36  SER A C   1 
ATOM   294  O  O   . SER A 1 36  ? 34.601 29.310 17.133  1.00 28.34  ? 36  SER A O   1 
ATOM   295  C  CB  . SER A 1 36  ? 31.538 30.070 18.235  1.00 63.78  ? 36  SER A CB  1 
ATOM   296  O  OG  . SER A 1 36  ? 32.382 30.827 19.070  1.00 29.33  ? 36  SER A OG  1 
ATOM   297  N  N   . PRO A 1 37  ? 33.908 31.428 16.568  1.00 32.69  ? 37  PRO A N   1 
ATOM   298  C  CA  . PRO A 1 37  ? 35.235 32.018 16.429  1.00 22.03  ? 37  PRO A CA  1 
ATOM   299  C  C   . PRO A 1 37  ? 36.020 32.284 17.725  1.00 33.79  ? 37  PRO A C   1 
ATOM   300  O  O   . PRO A 1 37  ? 37.232 32.557 17.697  1.00 76.98  ? 37  PRO A O   1 
ATOM   301  C  CB  . PRO A 1 37  ? 35.037 33.284 15.599  1.00 29.17  ? 37  PRO A CB  1 
ATOM   302  C  CG  . PRO A 1 37  ? 33.547 33.491 15.417  1.00 24.00  ? 37  PRO A CG  1 
ATOM   303  C  CD  . PRO A 1 37  ? 32.851 32.230 15.900  1.00 27.75  ? 37  PRO A CD  1 
ATOM   304  N  N   . SER A 1 38  ? 35.319 32.157 18.865  1.00 38.37  ? 38  SER A N   1 
ATOM   305  C  CA  . SER A 1 38  ? 35.829 32.392 20.224  1.00 61.41  ? 38  SER A CA  1 
ATOM   306  C  C   . SER A 1 38  ? 36.646 31.236 20.747  1.00 46.34  ? 38  SER A C   1 
ATOM   307  O  O   . SER A 1 38  ? 36.113 30.133 20.936  1.00 33.96  ? 38  SER A O   1 
ATOM   308  C  CB  . SER A 1 38  ? 34.710 32.757 21.265  1.00 23.50  ? 38  SER A CB  1 
ATOM   309  O  OG  . SER A 1 38  ? 35.250 33.408 22.409  1.00 100.00 ? 38  SER A OG  1 
ATOM   310  N  N   . LEU A 1 39  ? 37.931 31.504 20.998  1.00 18.85  ? 39  LEU A N   1 
ATOM   311  C  CA  . LEU A 1 39  ? 38.811 30.494 21.551  1.00 29.54  ? 39  LEU A CA  1 
ATOM   312  C  C   . LEU A 1 39  ? 38.362 30.161 22.957  1.00 27.57  ? 39  LEU A C   1 
ATOM   313  O  O   . LEU A 1 39  ? 38.686 29.108 23.508  1.00 25.12  ? 39  LEU A O   1 
ATOM   314  C  CB  . LEU A 1 39  ? 40.272 31.010 21.598  1.00 27.49  ? 39  LEU A CB  1 
ATOM   315  C  CG  . LEU A 1 39  ? 41.281 30.055 22.251  1.00 54.59  ? 39  LEU A CG  1 
ATOM   316  C  CD1 . LEU A 1 39  ? 41.243 28.677 21.583  1.00 25.39  ? 39  LEU A CD1 1 
ATOM   317  C  CD2 . LEU A 1 39  ? 42.698 30.622 22.154  1.00 28.12  ? 39  LEU A CD2 1 
ATOM   318  N  N   . ASN A 1 40  ? 37.652 31.114 23.565  1.00 19.92  ? 40  ASN A N   1 
ATOM   319  C  CA  . ASN A 1 40  ? 37.274 30.911 24.942  1.00 16.52  ? 40  ASN A CA  1 
ATOM   320  C  C   . ASN A 1 40  ? 36.133 29.967 25.003  1.00 18.48  ? 40  ASN A C   1 
ATOM   321  O  O   . ASN A 1 40  ? 36.073 29.152 25.891  1.00 26.45  ? 40  ASN A O   1 
ATOM   322  C  CB  . ASN A 1 40  ? 36.998 32.227 25.666  1.00 33.88  ? 40  ASN A CB  1 
ATOM   323  C  CG  . ASN A 1 40  ? 38.281 33.026 25.855  1.00 100.00 ? 40  ASN A CG  1 
ATOM   324  O  OD1 . ASN A 1 40  ? 39.335 32.473 26.237  1.00 53.36  ? 40  ASN A OD1 1 
ATOM   325  N  ND2 . ASN A 1 40  ? 38.211 34.324 25.552  1.00 100.00 ? 40  ASN A ND2 1 
ATOM   326  N  N   . ALA A 1 41  ? 35.233 30.135 24.030  1.00 9.84   ? 41  ALA A N   1 
ATOM   327  C  CA  . ALA A 1 41  ? 34.086 29.271 23.859  1.00 27.48  ? 41  ALA A CA  1 
ATOM   328  C  C   . ALA A 1 41  ? 34.599 27.864 23.604  1.00 29.84  ? 41  ALA A C   1 
ATOM   329  O  O   . ALA A 1 41  ? 34.053 26.888 24.070  1.00 29.94  ? 41  ALA A O   1 
ATOM   330  C  CB  . ALA A 1 41  ? 33.305 29.716 22.636  1.00 19.73  ? 41  ALA A CB  1 
ATOM   331  N  N   . ALA A 1 42  ? 35.659 27.791 22.835  1.00 22.34  ? 42  ALA A N   1 
ATOM   332  C  CA  . ALA A 1 42  ? 36.324 26.568 22.505  1.00 19.05  ? 42  ALA A CA  1 
ATOM   333  C  C   . ALA A 1 42  ? 36.998 26.005 23.734  1.00 19.58  ? 42  ALA A C   1 
ATOM   334  O  O   . ALA A 1 42  ? 36.865 24.817 23.997  1.00 17.45  ? 42  ALA A O   1 
ATOM   335  C  CB  . ALA A 1 42  ? 37.312 26.795 21.391  1.00 31.16  ? 42  ALA A CB  1 
ATOM   336  N  N   . LYS A 1 43  ? 37.661 26.831 24.544  1.00 18.40  ? 43  LYS A N   1 
ATOM   337  C  CA  . LYS A 1 43  ? 38.252 26.275 25.749  1.00 9.30   ? 43  LYS A CA  1 
ATOM   338  C  C   . LYS A 1 43  ? 37.195 25.798 26.760  1.00 19.69  ? 43  LYS A C   1 
ATOM   339  O  O   . LYS A 1 43  ? 37.419 24.856 27.478  1.00 25.19  ? 43  LYS A O   1 
ATOM   340  C  CB  . LYS A 1 43  ? 39.147 27.233 26.454  1.00 19.71  ? 43  LYS A CB  1 
ATOM   341  C  CG  . LYS A 1 43  ? 40.546 27.209 25.912  1.00 33.20  ? 43  LYS A CG  1 
ATOM   342  C  CD  . LYS A 1 43  ? 41.196 28.580 26.013  1.00 41.07  ? 43  LYS A CD  1 
ATOM   343  C  CE  . LYS A 1 43  ? 42.717 28.548 26.141  1.00 66.13  ? 43  LYS A CE  1 
ATOM   344  N  NZ  . LYS A 1 43  ? 43.209 29.217 27.362  1.00 100.00 ? 43  LYS A NZ  1 
ATOM   345  N  N   . SER A 1 44  ? 36.026 26.440 26.797  1.00 17.79  ? 44  SER A N   1 
ATOM   346  C  CA  . SER A 1 44  ? 34.961 26.060 27.728  1.00 30.09  ? 44  SER A CA  1 
ATOM   347  C  C   . SER A 1 44  ? 34.341 24.709 27.305  1.00 17.00  ? 44  SER A C   1 
ATOM   348  O  O   . SER A 1 44  ? 34.075 23.788 28.116  1.00 23.68  ? 44  SER A O   1 
ATOM   349  C  CB  . SER A 1 44  ? 33.968 27.252 27.946  1.00 18.41  ? 44  SER A CB  1 
ATOM   350  O  OG  . SER A 1 44  ? 32.616 26.828 28.031  1.00 63.71  ? 44  SER A OG  1 
ATOM   351  N  N   . GLU A 1 45  ? 34.158 24.578 25.979  1.00 17.67  ? 45  GLU A N   1 
ATOM   352  C  CA  . GLU A 1 45  ? 33.640 23.352 25.368  1.00 10.35  ? 45  GLU A CA  1 
ATOM   353  C  C   . GLU A 1 45  ? 34.629 22.259 25.722  1.00 17.15  ? 45  GLU A C   1 
ATOM   354  O  O   . GLU A 1 45  ? 34.284 21.191 26.208  1.00 16.12  ? 45  GLU A O   1 
ATOM   355  C  CB  . GLU A 1 45  ? 33.668 23.533 23.845  1.00 8.38   ? 45  GLU A CB  1 
ATOM   356  C  CG  . GLU A 1 45  ? 32.400 24.128 23.241  1.00 14.12  ? 45  GLU A CG  1 
ATOM   357  C  CD  . GLU A 1 45  ? 31.148 23.572 23.833  1.00 18.87  ? 45  GLU A CD  1 
ATOM   358  O  OE1 . GLU A 1 45  ? 30.786 22.404 23.728  1.00 18.82  ? 45  GLU A OE1 1 
ATOM   359  O  OE2 . GLU A 1 45  ? 30.445 24.497 24.400  1.00 28.07  ? 45  GLU A OE2 1 
ATOM   360  N  N   . LEU A 1 46  ? 35.894 22.545 25.512  1.00 14.12  ? 46  LEU A N   1 
ATOM   361  C  CA  . LEU A 1 46  ? 36.921 21.595 25.892  1.00 8.63   ? 46  LEU A CA  1 
ATOM   362  C  C   . LEU A 1 46  ? 36.822 21.080 27.351  1.00 29.68  ? 46  LEU A C   1 
ATOM   363  O  O   . LEU A 1 46  ? 36.877 19.870 27.634  1.00 17.38  ? 46  LEU A O   1 
ATOM   364  C  CB  . LEU A 1 46  ? 38.350 22.143 25.612  1.00 12.40  ? 46  LEU A CB  1 
ATOM   365  C  CG  . LEU A 1 46  ? 39.426 21.060 25.847  1.00 29.75  ? 46  LEU A CG  1 
ATOM   366  C  CD1 . LEU A 1 46  ? 39.108 19.759 25.065  1.00 5.19   ? 46  LEU A CD1 1 
ATOM   367  C  CD2 . LEU A 1 46  ? 40.810 21.584 25.457  1.00 12.16  ? 46  LEU A CD2 1 
ATOM   368  N  N   . ASP A 1 47  ? 36.683 21.991 28.305  1.00 16.08  ? 47  ASP A N   1 
ATOM   369  C  CA  . ASP A 1 47  ? 36.636 21.581 29.705  1.00 25.93  ? 47  ASP A CA  1 
ATOM   370  C  C   . ASP A 1 47  ? 35.408 20.793 30.017  1.00 18.04  ? 47  ASP A C   1 
ATOM   371  O  O   . ASP A 1 47  ? 35.403 19.864 30.837  1.00 19.73  ? 47  ASP A O   1 
ATOM   372  C  CB  . ASP A 1 47  ? 36.710 22.779 30.632  1.00 16.22  ? 47  ASP A CB  1 
ATOM   373  C  CG  . ASP A 1 47  ? 37.942 23.667 30.543  1.00 50.28  ? 47  ASP A CG  1 
ATOM   374  O  OD1 . ASP A 1 47  ? 39.079 23.305 30.300  1.00 25.13  ? 47  ASP A OD1 1 
ATOM   375  O  OD2 . ASP A 1 47  ? 37.658 24.909 30.806  1.00 39.29  ? 47  ASP A OD2 1 
ATOM   376  N  N   . LYS A 1 48  ? 34.331 21.207 29.381  1.00 19.94  ? 48  LYS A N   1 
ATOM   377  C  CA  . LYS A 1 48  ? 33.069 20.517 29.542  1.00 13.54  ? 48  LYS A CA  1 
ATOM   378  C  C   . LYS A 1 48  ? 33.181 19.054 29.009  1.00 20.60  ? 48  LYS A C   1 
ATOM   379  O  O   . LYS A 1 48  ? 32.709 18.083 29.584  1.00 13.13  ? 48  LYS A O   1 
ATOM   380  C  CB  . LYS A 1 48  ? 32.037 21.300 28.764  1.00 17.23  ? 48  LYS A CB  1 
ATOM   381  C  CG  . LYS A 1 48  ? 30.681 20.604 28.668  1.00 11.62  ? 48  LYS A CG  1 
ATOM   382  C  CD  . LYS A 1 48  ? 29.553 21.595 28.401  1.00 11.77  ? 48  LYS A CD  1 
ATOM   383  C  CE  . LYS A 1 48  ? 29.619 22.304 27.087  1.00 16.43  ? 48  LYS A CE  1 
ATOM   384  N  NZ  . LYS A 1 48  ? 29.349 21.366 25.993  1.00 23.88  ? 48  LYS A NZ  1 
ATOM   385  N  N   . ALA A 1 49  ? 33.864 18.871 27.896  1.00 13.71  ? 49  ALA A N   1 
ATOM   386  C  CA  . ALA A 1 49  ? 34.028 17.534 27.312  1.00 21.66  ? 49  ALA A CA  1 
ATOM   387  C  C   . ALA A 1 49  ? 34.920 16.601 28.143  1.00 21.89  ? 49  ALA A C   1 
ATOM   388  O  O   . ALA A 1 49  ? 34.610 15.438 28.338  1.00 16.51  ? 49  ALA A O   1 
ATOM   389  C  CB  . ALA A 1 49  ? 34.489 17.667 25.854  1.00 20.01  ? 49  ALA A CB  1 
ATOM   390  N  N   . ILE A 1 50  ? 36.017 17.144 28.628  1.00 16.99  ? 50  ILE A N   1 
ATOM   391  C  CA  . ILE A 1 50  ? 37.003 16.450 29.409  1.00 24.01  ? 50  ILE A CA  1 
ATOM   392  C  C   . ILE A 1 50  ? 36.633 16.298 30.860  1.00 21.53  ? 50  ILE A C   1 
ATOM   393  O  O   . ILE A 1 50  ? 37.110 15.384 31.558  1.00 39.86  ? 50  ILE A O   1 
ATOM   394  C  CB  . ILE A 1 50  ? 38.346 17.196 29.344  1.00 15.55  ? 50  ILE A CB  1 
ATOM   395  C  CG1 . ILE A 1 50  ? 38.793 17.241 27.886  1.00 8.33   ? 50  ILE A CG1 1 
ATOM   396  C  CG2 . ILE A 1 50  ? 39.357 16.378 30.126  1.00 14.34  ? 50  ILE A CG2 1 
ATOM   397  C  CD1 . ILE A 1 50  ? 38.793 15.859 27.277  1.00 10.31  ? 50  ILE A CD1 1 
ATOM   398  N  N   . GLY A 1 51  ? 35.839 17.215 31.336  1.00 24.13  ? 51  GLY A N   1 
ATOM   399  C  CA  . GLY A 1 51  ? 35.486 17.173 32.736  1.00 14.19  ? 51  GLY A CA  1 
ATOM   400  C  C   . GLY A 1 51  ? 36.588 17.796 33.655  1.00 25.69  ? 51  GLY A C   1 
ATOM   401  O  O   . GLY A 1 51  ? 36.744 17.433 34.818  1.00 26.91  ? 51  GLY A O   1 
ATOM   402  N  N   . ARG A 1 52  ? 37.352 18.756 33.157  1.00 48.94  ? 52  ARG A N   1 
ATOM   403  C  CA  . ARG A 1 52  ? 38.361 19.389 33.992  1.00 15.95  ? 52  ARG A CA  1 
ATOM   404  C  C   . ARG A 1 52  ? 38.806 20.685 33.362  1.00 34.68  ? 52  ARG A C   1 
ATOM   405  O  O   . ARG A 1 52  ? 38.463 20.958 32.212  1.00 25.16  ? 52  ARG A O   1 
ATOM   406  C  CB  . ARG A 1 52  ? 39.535 18.455 34.378  1.00 9.99   ? 52  ARG A CB  1 
ATOM   407  C  CG  . ARG A 1 52  ? 40.723 18.500 33.457  1.00 15.96  ? 52  ARG A CG  1 
ATOM   408  C  CD  . ARG A 1 52  ? 41.479 17.162 33.418  1.00 27.45  ? 52  ARG A CD  1 
ATOM   409  N  NE  . ARG A 1 52  ? 42.290 17.003 32.228  1.00 20.77  ? 52  ARG A NE  1 
ATOM   410  C  CZ  . ARG A 1 52  ? 43.233 17.903 31.879  1.00 39.05  ? 52  ARG A CZ  1 
ATOM   411  N  NH1 . ARG A 1 52  ? 43.488 18.942 32.643  1.00 43.69  ? 52  ARG A NH1 1 
ATOM   412  N  NH2 . ARG A 1 52  ? 43.974 17.768 30.783  1.00 38.71  ? 52  ARG A NH2 1 
ATOM   413  N  N   . ASN A 1 53  ? 39.490 21.489 34.150  1.00 21.24  ? 53  ASN A N   1 
ATOM   414  C  CA  . ASN A 1 53  ? 40.057 22.721 33.663  1.00 43.50  ? 53  ASN A CA  1 
ATOM   415  C  C   . ASN A 1 53  ? 41.327 22.309 32.927  1.00 17.39  ? 53  ASN A C   1 
ATOM   416  O  O   . ASN A 1 53  ? 42.304 21.961 33.566  1.00 33.41  ? 53  ASN A O   1 
ATOM   417  C  CB  . ASN A 1 53  ? 40.413 23.616 34.851  1.00 58.33  ? 53  ASN A CB  1 
ATOM   418  C  CG  . ASN A 1 53  ? 39.883 25.007 34.666  1.00 47.69  ? 53  ASN A CG  1 
ATOM   419  O  OD1 . ASN A 1 53  ? 38.767 25.332 35.123  1.00 100.00 ? 53  ASN A OD1 1 
ATOM   420  N  ND2 . ASN A 1 53  ? 40.647 25.815 33.922  1.00 39.86  ? 53  ASN A ND2 1 
ATOM   421  N  N   . THR A 1 54  ? 41.249 22.244 31.582  1.00 16.85  ? 54  THR A N   1 
ATOM   422  C  CA  . THR A 1 54  ? 42.299 21.768 30.725  1.00 14.32  ? 54  THR A CA  1 
ATOM   423  C  C   . THR A 1 54  ? 43.254 22.836 30.300  1.00 16.55  ? 54  THR A C   1 
ATOM   424  O  O   . THR A 1 54  ? 44.415 22.569 29.990  1.00 44.08  ? 54  THR A O   1 
ATOM   425  C  CB  . THR A 1 54  ? 41.696 21.139 29.469  1.00 23.23  ? 54  THR A CB  1 
ATOM   426  O  OG1 . THR A 1 54  ? 41.189 22.152 28.610  1.00 16.70  ? 54  THR A OG1 1 
ATOM   427  C  CG2 . THR A 1 54  ? 40.581 20.183 29.869  1.00 22.61  ? 54  THR A CG2 1 
ATOM   428  N  N   . ASN A 1 55  ? 42.725 24.028 30.212  1.00 21.26  ? 55  ASN A N   1 
ATOM   429  C  CA  . ASN A 1 55  ? 43.541 25.113 29.740  1.00 47.06  ? 55  ASN A CA  1 
ATOM   430  C  C   . ASN A 1 55  ? 43.877 24.953 28.245  1.00 43.55  ? 55  ASN A C   1 
ATOM   431  O  O   . ASN A 1 55  ? 44.857 25.494 27.764  1.00 42.32  ? 55  ASN A O   1 
ATOM   432  C  CB  . ASN A 1 55  ? 44.803 25.245 30.618  1.00 31.68  ? 55  ASN A CB  1 
ATOM   433  C  CG  . ASN A 1 55  ? 45.586 26.546 30.505  1.00 100.00 ? 55  ASN A CG  1 
ATOM   434  O  OD1 . ASN A 1 55  ? 45.035 27.665 30.326  1.00 42.61  ? 55  ASN A OD1 1 
ATOM   435  N  ND2 . ASN A 1 55  ? 46.901 26.392 30.676  1.00 46.31  ? 55  ASN A ND2 1 
ATOM   436  N  N   . GLY A 1 56  ? 43.062 24.230 27.486  1.00 33.19  ? 56  GLY A N   1 
ATOM   437  C  CA  . GLY A 1 56  ? 43.328 24.090 26.055  1.00 31.59  ? 56  GLY A CA  1 
ATOM   438  C  C   . GLY A 1 56  ? 44.292 22.976 25.709  1.00 12.62  ? 56  GLY A C   1 
ATOM   439  O  O   . GLY A 1 56  ? 44.669 22.779 24.555  1.00 16.27  ? 56  GLY A O   1 
ATOM   440  N  N   . VAL A 1 57  ? 44.675 22.208 26.704  1.00 20.00  ? 57  VAL A N   1 
ATOM   441  C  CA  . VAL A 1 57  ? 45.594 21.092 26.483  1.00 16.43  ? 57  VAL A CA  1 
ATOM   442  C  C   . VAL A 1 57  ? 45.096 19.769 27.116  1.00 46.48  ? 57  VAL A C   1 
ATOM   443  O  O   . VAL A 1 57  ? 44.620 19.792 28.230  1.00 18.08  ? 57  VAL A O   1 
ATOM   444  C  CB  . VAL A 1 57  ? 46.896 21.523 27.111  1.00 26.28  ? 57  VAL A CB  1 
ATOM   445  C  CG1 . VAL A 1 57  ? 47.945 20.424 26.985  1.00 24.68  ? 57  VAL A CG1 1 
ATOM   446  C  CG2 . VAL A 1 57  ? 47.291 22.815 26.415  1.00 53.35  ? 57  VAL A CG2 1 
ATOM   447  N  N   . ILE A 1 58  ? 45.209 18.610 26.434  1.00 11.59  ? 58  ILE A N   1 
ATOM   448  C  CA  . ILE A 1 58  ? 44.737 17.357 26.992  1.00 26.69  ? 58  ILE A CA  1 
ATOM   449  C  C   . ILE A 1 58  ? 45.787 16.315 26.846  1.00 30.04  ? 58  ILE A C   1 
ATOM   450  O  O   . ILE A 1 58  ? 46.735 16.553 26.117  1.00 21.06  ? 58  ILE A O   1 
ATOM   451  C  CB  . ILE A 1 58  ? 43.460 16.869 26.289  1.00 12.37  ? 58  ILE A CB  1 
ATOM   452  C  CG1 . ILE A 1 58  ? 43.724 16.800 24.786  1.00 6.40   ? 58  ILE A CG1 1 
ATOM   453  C  CG2 . ILE A 1 58  ? 42.333 17.879 26.514  1.00 16.66  ? 58  ILE A CG2 1 
ATOM   454  C  CD1 . ILE A 1 58  ? 42.736 15.899 24.074  1.00 11.77  ? 58  ILE A CD1 1 
ATOM   455  N  N   . THR A 1 59  ? 45.590 15.162 27.487  1.00 16.05  ? 59  THR A N   1 
ATOM   456  C  CA  . THR A 1 59  ? 46.553 14.099 27.332  1.00 13.54  ? 59  THR A CA  1 
ATOM   457  C  C   . THR A 1 59  ? 46.156 13.174 26.190  1.00 24.06  ? 59  THR A C   1 
ATOM   458  O  O   . THR A 1 59  ? 45.032 13.163 25.702  1.00 21.77  ? 59  THR A O   1 
ATOM   459  C  CB  . THR A 1 59  ? 46.555 13.209 28.576  1.00 22.37  ? 59  THR A CB  1 
ATOM   460  O  OG1 . THR A 1 59  ? 45.259 12.709 28.626  1.00 27.76  ? 59  THR A OG1 1 
ATOM   461  C  CG2 . THR A 1 59  ? 46.846 13.997 29.862  1.00 19.00  ? 59  THR A CG2 1 
ATOM   462  N  N   . LYS A 1 60  ? 47.104 12.344 25.808  1.00 20.82  ? 60  LYS A N   1 
ATOM   463  C  CA  . LYS A 1 60  ? 46.909 11.370 24.770  1.00 12.37  ? 60  LYS A CA  1 
ATOM   464  C  C   . LYS A 1 60  ? 45.715 10.493 25.081  1.00 17.61  ? 60  LYS A C   1 
ATOM   465  O  O   . LYS A 1 60  ? 44.855 10.260 24.222  1.00 14.26  ? 60  LYS A O   1 
ATOM   466  C  CB  . LYS A 1 60  ? 48.166 10.538 24.560  1.00 26.67  ? 60  LYS A CB  1 
ATOM   467  C  CG  . LYS A 1 60  ? 47.980 9.531  23.420  1.00 35.75  ? 60  LYS A CG  1 
ATOM   468  C  CD  . LYS A 1 60  ? 49.105 9.546  22.398  1.00 52.59  ? 60  LYS A CD  1 
ATOM   469  C  CE  . LYS A 1 60  ? 49.316 8.199  21.708  1.00 100.00 ? 60  LYS A CE  1 
ATOM   470  N  NZ  . LYS A 1 60  ? 50.022 8.283  20.411  1.00 100.00 ? 60  LYS A NZ  1 
ATOM   471  N  N   . ASP A 1 61  ? 45.677 10.062 26.350  1.00 19.93  ? 61  ASP A N   1 
ATOM   472  C  CA  . ASP A 1 61  ? 44.595 9.233  26.872  1.00 20.44  ? 61  ASP A CA  1 
ATOM   473  C  C   . ASP A 1 61  ? 43.265 9.929  26.703  1.00 30.00  ? 61  ASP A C   1 
ATOM   474  O  O   . ASP A 1 61  ? 42.308 9.303  26.353  1.00 16.10  ? 61  ASP A O   1 
ATOM   475  C  CB  . ASP A 1 61  ? 44.721 8.878  28.381  1.00 19.95  ? 61  ASP A CB  1 
ATOM   476  C  CG  . ASP A 1 61  ? 45.904 8.022  28.698  1.00 63.41  ? 61  ASP A CG  1 
ATOM   477  O  OD1 . ASP A 1 61  ? 46.225 7.188  27.732  1.00 73.20  ? 61  ASP A OD1 1 
ATOM   478  O  OD2 . ASP A 1 61  ? 46.516 8.124  29.742  1.00 100.00 ? 61  ASP A OD2 1 
ATOM   479  N  N   . GLU A 1 62  ? 43.215 11.213 27.040  1.00 17.74  ? 62  GLU A N   1 
ATOM   480  C  CA  . GLU A 1 62  ? 42.035 11.976 26.953  1.00 8.39   ? 62  GLU A CA  1 
ATOM   481  C  C   . GLU A 1 62  ? 41.642 12.080 25.506  1.00 23.10  ? 62  GLU A C   1 
ATOM   482  O  O   . GLU A 1 62  ? 40.477 11.876 25.228  1.00 14.91  ? 62  GLU A O   1 
ATOM   483  C  CB  . GLU A 1 62  ? 42.298 13.354 27.505  1.00 11.38  ? 62  GLU A CB  1 
ATOM   484  C  CG  . GLU A 1 62  ? 42.307 13.335 29.016  1.00 28.31  ? 62  GLU A CG  1 
ATOM   485  C  CD  . GLU A 1 62  ? 42.756 14.639 29.613  1.00 30.07  ? 62  GLU A CD  1 
ATOM   486  O  OE1 . GLU A 1 62  ? 43.453 15.460 29.045  1.00 20.02  ? 62  GLU A OE1 1 
ATOM   487  O  OE2 . GLU A 1 62  ? 42.362 14.756 30.834  1.00 20.77  ? 62  GLU A OE2 1 
ATOM   488  N  N   . ALA A 1 63  ? 42.621 12.354 24.594  1.00 14.07  ? 63  ALA A N   1 
ATOM   489  C  CA  . ALA A 1 63  ? 42.324 12.425 23.169  1.00 18.69  ? 63  ALA A CA  1 
ATOM   490  C  C   . ALA A 1 63  ? 41.675 11.127 22.696  1.00 13.95  ? 63  ALA A C   1 
ATOM   491  O  O   . ALA A 1 63  ? 40.720 11.106 21.920  1.00 15.33  ? 63  ALA A O   1 
ATOM   492  C  CB  . ALA A 1 63  ? 43.554 12.765 22.279  1.00 4.30   ? 63  ALA A CB  1 
ATOM   493  N  N   . GLU A 1 64  ? 42.233 10.013 23.107  1.00 11.65  ? 64  GLU A N   1 
ATOM   494  C  CA  . GLU A 1 64  ? 41.719 8.750  22.685  1.00 3.02   ? 64  GLU A CA  1 
ATOM   495  C  C   . GLU A 1 64  ? 40.368 8.472  23.276  1.00 15.71  ? 64  GLU A C   1 
ATOM   496  O  O   . GLU A 1 64  ? 39.591 7.767  22.694  1.00 18.89  ? 64  GLU A O   1 
ATOM   497  C  CB  . GLU A 1 64  ? 42.646 7.622  23.053  1.00 13.97  ? 64  GLU A CB  1 
ATOM   498  C  CG  . GLU A 1 64  ? 43.651 7.537  21.926  1.00 43.64  ? 64  GLU A CG  1 
ATOM   499  C  CD  . GLU A 1 64  ? 44.856 6.828  22.352  1.00 62.09  ? 64  GLU A CD  1 
ATOM   500  O  OE1 . GLU A 1 64  ? 45.042 6.417  23.500  1.00 78.58  ? 64  GLU A OE1 1 
ATOM   501  O  OE2 . GLU A 1 64  ? 45.657 6.696  21.331  1.00 61.90  ? 64  GLU A OE2 1 
ATOM   502  N  N   . LYS A 1 65  ? 40.090 9.016  24.420  1.00 15.02  ? 65  LYS A N   1 
ATOM   503  C  CA  . LYS A 1 65  ? 38.781 8.752  24.991  1.00 8.77   ? 65  LYS A CA  1 
ATOM   504  C  C   . LYS A 1 65  ? 37.709 9.446  24.169  1.00 11.98  ? 65  LYS A C   1 
ATOM   505  O  O   . LYS A 1 65  ? 36.682 8.859  23.785  1.00 27.64  ? 65  LYS A O   1 
ATOM   506  C  CB  . LYS A 1 65  ? 38.677 9.114  26.446  1.00 8.73   ? 65  LYS A CB  1 
ATOM   507  C  CG  . LYS A 1 65  ? 37.265 8.835  26.926  1.00 29.13  ? 65  LYS A CG  1 
ATOM   508  C  CD  . LYS A 1 65  ? 37.035 9.212  28.376  1.00 100.00 ? 65  LYS A CD  1 
ATOM   509  C  CE  . LYS A 1 65  ? 35.914 8.391  28.992  1.00 100.00 ? 65  LYS A CE  1 
ATOM   510  N  NZ  . LYS A 1 65  ? 36.218 7.950  30.356  1.00 86.92  ? 65  LYS A NZ  1 
ATOM   511  N  N   . LEU A 1 66  ? 37.985 10.701 23.800  1.00 23.65  ? 66  LEU A N   1 
ATOM   512  C  CA  . LEU A 1 66  ? 37.105 11.454 22.913  1.00 6.89   ? 66  LEU A CA  1 
ATOM   513  C  C   . LEU A 1 66  ? 36.928 10.736 21.587  1.00 15.73  ? 66  LEU A C   1 
ATOM   514  O  O   . LEU A 1 66  ? 35.851 10.762 21.040  1.00 8.28   ? 66  LEU A O   1 
ATOM   515  C  CB  . LEU A 1 66  ? 37.630 12.862 22.557  1.00 13.30  ? 66  LEU A CB  1 
ATOM   516  C  CG  . LEU A 1 66  ? 37.756 13.758 23.793  1.00 21.16  ? 66  LEU A CG  1 
ATOM   517  C  CD1 . LEU A 1 66  ? 38.194 15.162 23.412  1.00 8.66   ? 66  LEU A CD1 1 
ATOM   518  C  CD2 . LEU A 1 66  ? 36.404 13.831 24.491  1.00 13.78  ? 66  LEU A CD2 1 
ATOM   519  N  N   . PHE A 1 67  ? 37.994 10.143 21.069  1.00 13.05  ? 67  PHE A N   1 
ATOM   520  C  CA  . PHE A 1 67  ? 37.945 9.488  19.747  1.00 14.02  ? 67  PHE A CA  1 
ATOM   521  C  C   . PHE A 1 67  ? 36.922 8.337  19.775  1.00 10.58  ? 67  PHE A C   1 
ATOM   522  O  O   . PHE A 1 67  ? 36.014 8.267  18.952  1.00 16.75  ? 67  PHE A O   1 
ATOM   523  C  CB  . PHE A 1 67  ? 39.327 8.945  19.448  1.00 4.08   ? 67  PHE A CB  1 
ATOM   524  C  CG  . PHE A 1 67  ? 39.573 8.438  18.042  1.00 11.57  ? 67  PHE A CG  1 
ATOM   525  C  CD1 . PHE A 1 67  ? 38.885 8.956  16.944  1.00 10.18  ? 67  PHE A CD1 1 
ATOM   526  C  CD2 . PHE A 1 67  ? 40.527 7.440  17.847  1.00 7.84   ? 67  PHE A CD2 1 
ATOM   527  C  CE1 . PHE A 1 67  ? 39.111 8.457  15.662  1.00 14.36  ? 67  PHE A CE1 1 
ATOM   528  C  CE2 . PHE A 1 67  ? 40.794 6.953  16.570  1.00 11.51  ? 67  PHE A CE2 1 
ATOM   529  C  CZ  . PHE A 1 67  ? 40.087 7.474  15.487  1.00 13.53  ? 67  PHE A CZ  1 
ATOM   530  N  N   . ASN A 1 68  ? 37.080 7.473  20.761  1.00 11.94  ? 68  ASN A N   1 
ATOM   531  C  CA  . ASN A 1 68  ? 36.141 6.355  21.029  1.00 8.64   ? 68  ASN A CA  1 
ATOM   532  C  C   . ASN A 1 68  ? 34.709 6.856  21.143  1.00 22.07  ? 68  ASN A C   1 
ATOM   533  O  O   . ASN A 1 68  ? 33.751 6.320  20.518  1.00 12.78  ? 68  ASN A O   1 
ATOM   534  C  CB  . ASN A 1 68  ? 36.578 5.663  22.325  1.00 16.81  ? 68  ASN A CB  1 
ATOM   535  C  CG  . ASN A 1 68  ? 37.749 4.717  22.080  1.00 26.67  ? 68  ASN A CG  1 
ATOM   536  O  OD1 . ASN A 1 68  ? 37.633 3.813  21.241  1.00 59.84  ? 68  ASN A OD1 1 
ATOM   537  N  ND2 . ASN A 1 68  ? 38.879 4.933  22.770  1.00 37.54  ? 68  ASN A ND2 1 
ATOM   538  N  N   . GLN A 1 69  ? 34.542 7.960  21.874  1.00 10.09  ? 69  GLN A N   1 
ATOM   539  C  CA  . GLN A 1 69  ? 33.174 8.397  22.005  1.00 10.19  ? 69  GLN A CA  1 
ATOM   540  C  C   . GLN A 1 69  ? 32.647 8.854  20.688  1.00 3.87   ? 69  GLN A C   1 
ATOM   541  O  O   . GLN A 1 69  ? 31.485 8.705  20.406  1.00 18.36  ? 69  GLN A O   1 
ATOM   542  C  CB  . GLN A 1 69  ? 33.041 9.534  23.051  1.00 15.40  ? 69  GLN A CB  1 
ATOM   543  C  CG  . GLN A 1 69  ? 33.518 9.095  24.455  1.00 19.67  ? 69  GLN A CG  1 
ATOM   544  C  CD  . GLN A 1 69  ? 33.536 10.247 25.473  1.00 22.47  ? 69  GLN A CD  1 
ATOM   545  O  OE1 . GLN A 1 69  ? 33.531 10.012 26.672  1.00 19.88  ? 69  GLN A OE1 1 
ATOM   546  N  NE2 . GLN A 1 69  ? 33.585 11.491 25.002  1.00 12.75  ? 69  GLN A NE2 1 
ATOM   547  N  N   . ASP A 1 70  ? 33.496 9.519  19.909  1.00 17.61  ? 70  ASP A N   1 
ATOM   548  C  CA  . ASP A 1 70  ? 33.073 10.025 18.634  1.00 10.67  ? 70  ASP A CA  1 
ATOM   549  C  C   . ASP A 1 70  ? 32.865 8.884  17.644  1.00 9.75   ? 70  ASP A C   1 
ATOM   550  O  O   . ASP A 1 70  ? 32.015 8.971  16.806  1.00 11.96  ? 70  ASP A O   1 
ATOM   551  C  CB  . ASP A 1 70  ? 34.100 11.072 18.056  1.00 6.50   ? 70  ASP A CB  1 
ATOM   552  C  CG  . ASP A 1 70  ? 34.055 12.339 18.847  1.00 16.65  ? 70  ASP A CG  1 
ATOM   553  O  OD1 . ASP A 1 70  ? 33.109 12.639 19.564  1.00 17.78  ? 70  ASP A OD1 1 
ATOM   554  O  OD2 . ASP A 1 70  ? 35.168 13.014 18.740  1.00 16.85  ? 70  ASP A OD2 1 
ATOM   555  N  N   . VAL A 1 71  ? 33.667 7.796  17.720  1.00 7.75   ? 71  VAL A N   1 
ATOM   556  C  CA  . VAL A 1 71  ? 33.472 6.741  16.760  1.00 7.32   ? 71  VAL A CA  1 
ATOM   557  C  C   . VAL A 1 71  ? 32.116 6.101  17.003  1.00 12.94  ? 71  VAL A C   1 
ATOM   558  O  O   . VAL A 1 71  ? 31.285 5.972  16.120  1.00 15.70  ? 71  VAL A O   1 
ATOM   559  C  CB  . VAL A 1 71  ? 34.672 5.800  16.591  1.00 18.16  ? 71  VAL A CB  1 
ATOM   560  C  CG1 . VAL A 1 71  ? 34.332 4.548  15.785  1.00 16.20  ? 71  VAL A CG1 1 
ATOM   561  C  CG2 . VAL A 1 71  ? 35.860 6.482  15.913  1.00 9.27   ? 71  VAL A CG2 1 
ATOM   562  N  N   . ASP A 1 72  ? 31.868 5.790  18.253  1.00 9.54   ? 72  ASP A N   1 
ATOM   563  C  CA  . ASP A 1 72  ? 30.607 5.222  18.671  1.00 18.08  ? 72  ASP A CA  1 
ATOM   564  C  C   . ASP A 1 72  ? 29.404 6.083  18.256  1.00 11.32  ? 72  ASP A C   1 
ATOM   565  O  O   . ASP A 1 72  ? 28.425 5.635  17.690  1.00 13.90  ? 72  ASP A O   1 
ATOM   566  C  CB  . ASP A 1 72  ? 30.671 5.159  20.196  1.00 22.41  ? 72  ASP A CB  1 
ATOM   567  C  CG  . ASP A 1 72  ? 29.696 4.173  20.676  1.00 18.55  ? 72  ASP A CG  1 
ATOM   568  O  OD1 . ASP A 1 72  ? 29.282 3.461  19.680  1.00 74.18  ? 72  ASP A OD1 1 
ATOM   569  O  OD2 . ASP A 1 72  ? 29.363 4.063  21.826  1.00 33.02  ? 72  ASP A OD2 1 
ATOM   570  N  N   . ALA A 1 73  ? 29.482 7.353  18.549  1.00 11.09  ? 73  ALA A N   1 
ATOM   571  C  CA  . ALA A 1 73  ? 28.421 8.266  18.233  1.00 8.98   ? 73  ALA A CA  1 
ATOM   572  C  C   . ALA A 1 73  ? 28.056 8.250  16.769  1.00 19.20  ? 73  ALA A C   1 
ATOM   573  O  O   . ALA A 1 73  ? 26.905 8.362  16.354  1.00 27.65  ? 73  ALA A O   1 
ATOM   574  C  CB  . ALA A 1 73  ? 28.807 9.706  18.621  1.00 13.68  ? 73  ALA A CB  1 
ATOM   575  N  N   . ALA A 1 74  ? 29.059 8.188  15.957  1.00 12.67  ? 74  ALA A N   1 
ATOM   576  C  CA  . ALA A 1 74  ? 28.847 8.210  14.506  1.00 32.27  ? 74  ALA A CA  1 
ATOM   577  C  C   . ALA A 1 74  ? 28.074 7.013  13.995  1.00 16.12  ? 74  ALA A C   1 
ATOM   578  O  O   . ALA A 1 74  ? 27.102 7.177  13.248  1.00 27.23  ? 74  ALA A O   1 
ATOM   579  C  CB  . ALA A 1 74  ? 30.143 8.364  13.740  1.00 13.15  ? 74  ALA A CB  1 
ATOM   580  N  N   . VAL A 1 75  ? 28.517 5.823  14.424  1.00 27.26  ? 75  VAL A N   1 
ATOM   581  C  CA  . VAL A 1 75  ? 27.893 4.582  14.040  1.00 26.42  ? 75  VAL A CA  1 
ATOM   582  C  C   . VAL A 1 75  ? 26.461 4.628  14.522  1.00 24.45  ? 75  VAL A C   1 
ATOM   583  O  O   . VAL A 1 75  ? 25.490 4.408  13.759  1.00 33.34  ? 75  VAL A O   1 
ATOM   584  C  CB  . VAL A 1 75  ? 28.599 3.414  14.723  1.00 23.38  ? 75  VAL A CB  1 
ATOM   585  C  CG1 . VAL A 1 75  ? 27.953 2.099  14.294  1.00 29.07  ? 75  VAL A CG1 1 
ATOM   586  C  CG2 . VAL A 1 75  ? 30.083 3.422  14.322  1.00 14.54  ? 75  VAL A CG2 1 
ATOM   587  N  N   . ARG A 1 76  ? 26.351 4.925  15.811  1.00 17.98  ? 76  ARG A N   1 
ATOM   588  C  CA  . ARG A 1 76  ? 25.049 5.008  16.382  1.00 16.07  ? 76  ARG A CA  1 
ATOM   589  C  C   . ARG A 1 76  ? 24.168 5.997  15.603  1.00 20.86  ? 76  ARG A C   1 
ATOM   590  O  O   . ARG A 1 76  ? 23.029 5.696  15.274  1.00 50.15  ? 76  ARG A O   1 
ATOM   591  C  CB  . ARG A 1 76  ? 25.094 5.143  17.888  1.00 16.43  ? 76  ARG A CB  1 
ATOM   592  C  CG  . ARG A 1 76  ? 24.950 3.777  18.555  1.00 39.03  ? 76  ARG A CG  1 
ATOM   593  C  CD  . ARG A 1 76  ? 25.342 3.796  20.026  1.00 46.62  ? 76  ARG A CD  1 
ATOM   594  N  NE  . ARG A 1 76  ? 26.527 4.618  20.223  1.00 100.00 ? 76  ARG A NE  1 
ATOM   595  C  CZ  . ARG A 1 76  ? 26.587 5.769  20.911  1.00 100.00 ? 76  ARG A CZ  1 
ATOM   596  N  NH1 . ARG A 1 76  ? 25.541 6.301  21.536  1.00 100.00 ? 76  ARG A NH1 1 
ATOM   597  N  NH2 . ARG A 1 76  ? 27.765 6.394  20.955  1.00 100.00 ? 76  ARG A NH2 1 
ATOM   598  N  N   . GLY A 1 77  ? 24.725 7.127  15.176  1.00 21.94  ? 77  GLY A N   1 
ATOM   599  C  CA  . GLY A 1 77  ? 23.972 8.080  14.338  1.00 18.60  ? 77  GLY A CA  1 
ATOM   600  C  C   . GLY A 1 77  ? 23.486 7.519  12.987  1.00 27.95  ? 77  GLY A C   1 
ATOM   601  O  O   . GLY A 1 77  ? 22.353 7.716  12.571  1.00 31.75  ? 77  GLY A O   1 
ATOM   602  N  N   . ILE A 1 78  ? 24.378 6.873  12.259  1.00 18.89  ? 78  ILE A N   1 
ATOM   603  C  CA  . ILE A 1 78  ? 24.064 6.216  10.995  1.00 16.11  ? 78  ILE A CA  1 
ATOM   604  C  C   . ILE A 1 78  ? 22.898 5.237  11.229  1.00 39.87  ? 78  ILE A C   1 
ATOM   605  O  O   . ILE A 1 78  ? 21.897 5.182  10.494  1.00 24.07  ? 78  ILE A O   1 
ATOM   606  C  CB  . ILE A 1 78  ? 25.318 5.421  10.485  1.00 12.82  ? 78  ILE A CB  1 
ATOM   607  C  CG1 . ILE A 1 78  ? 26.391 6.342  9.862   1.00 13.77  ? 78  ILE A CG1 1 
ATOM   608  C  CG2 . ILE A 1 78  ? 24.893 4.378  9.433   1.00 15.30  ? 78  ILE A CG2 1 
ATOM   609  C  CD1 . ILE A 1 78  ? 27.745 5.624  9.546   1.00 13.55  ? 78  ILE A CD1 1 
ATOM   610  N  N   . LEU A 1 79  ? 23.012 4.455  12.303  1.00 17.78  ? 79  LEU A N   1 
ATOM   611  C  CA  . LEU A 1 79  ? 21.991 3.460  12.596  1.00 11.64  ? 79  LEU A CA  1 
ATOM   612  C  C   . LEU A 1 79  ? 20.631 3.975  12.920  1.00 30.01  ? 79  LEU A C   1 
ATOM   613  O  O   . LEU A 1 79  ? 19.671 3.244  12.813  1.00 31.56  ? 79  LEU A O   1 
ATOM   614  C  CB  . LEU A 1 79  ? 22.416 2.502  13.687  1.00 14.08  ? 79  LEU A CB  1 
ATOM   615  C  CG  . LEU A 1 79  ? 23.608 1.702  13.234  1.00 29.46  ? 79  LEU A CG  1 
ATOM   616  C  CD1 . LEU A 1 79  ? 23.945 0.758  14.341  1.00 13.12  ? 79  LEU A CD1 1 
ATOM   617  C  CD2 . LEU A 1 79  ? 23.331 0.929  11.963  1.00 15.34  ? 79  LEU A CD2 1 
ATOM   618  N  N   . ARG A 1 80  ? 20.555 5.213  13.348  1.00 37.13  ? 80  ARG A N   1 
ATOM   619  C  CA  . ARG A 1 80  ? 19.290 5.878  13.705  1.00 29.52  ? 80  ARG A CA  1 
ATOM   620  C  C   . ARG A 1 80  ? 18.791 6.719  12.541  1.00 37.24  ? 80  ARG A C   1 
ATOM   621  O  O   . ARG A 1 80  ? 17.709 7.294  12.533  1.00 55.15  ? 80  ARG A O   1 
ATOM   622  C  CB  . ARG A 1 80  ? 19.446 6.858  14.869  1.00 40.98  ? 80  ARG A CB  1 
ATOM   623  C  CG  . ARG A 1 80  ? 20.129 6.378  16.153  1.00 100.00 ? 80  ARG A CG  1 
ATOM   624  C  CD  . ARG A 1 80  ? 19.899 7.372  17.305  1.00 100.00 ? 80  ARG A CD  1 
ATOM   625  N  NE  . ARG A 1 80  ? 21.089 8.100  17.798  1.00 100.00 ? 80  ARG A NE  1 
ATOM   626  C  CZ  . ARG A 1 80  ? 21.607 9.277  17.341  1.00 100.00 ? 80  ARG A CZ  1 
ATOM   627  N  NH1 . ARG A 1 80  ? 21.115 9.982  16.299  1.00 100.00 ? 80  ARG A NH1 1 
ATOM   628  N  NH2 . ARG A 1 80  ? 22.679 9.764  17.960  1.00 100.00 ? 80  ARG A NH2 1 
ATOM   629  N  N   . ASN A 1 81  ? 19.637 6.861  11.576  1.00 23.90  ? 81  ASN A N   1 
ATOM   630  C  CA  . ASN A 1 81  ? 19.214 7.603  10.472  1.00 15.70  ? 81  ASN A CA  1 
ATOM   631  C  C   . ASN A 1 81  ? 18.523 6.687  9.461   1.00 40.33  ? 81  ASN A C   1 
ATOM   632  O  O   . ASN A 1 81  ? 19.046 5.681  8.978   1.00 47.23  ? 81  ASN A O   1 
ATOM   633  C  CB  . ASN A 1 81  ? 20.326 8.488  9.944   1.00 24.47  ? 81  ASN A CB  1 
ATOM   634  C  CG  . ASN A 1 81  ? 19.817 9.485  8.951   1.00 28.06  ? 81  ASN A CG  1 
ATOM   635  O  OD1 . ASN A 1 81  ? 18.940 9.187  8.135   1.00 41.24  ? 81  ASN A OD1 1 
ATOM   636  N  ND2 . ASN A 1 81  ? 20.373 10.676 8.998   1.00 33.15  ? 81  ASN A ND2 1 
ATOM   637  N  N   . ALA A 1 82  ? 17.278 7.015  9.197   1.00 23.95  ? 82  ALA A N   1 
ATOM   638  C  CA  . ALA A 1 82  ? 16.483 6.216  8.272   1.00 47.05  ? 82  ALA A CA  1 
ATOM   639  C  C   . ALA A 1 82  ? 16.953 6.267  6.824   1.00 38.67  ? 82  ALA A C   1 
ATOM   640  O  O   . ALA A 1 82  ? 16.701 5.370  6.014   1.00 42.65  ? 82  ALA A O   1 
ATOM   641  C  CB  . ALA A 1 82  ? 15.027 6.603  8.378   1.00 29.69  ? 82  ALA A CB  1 
ATOM   642  N  N   . LYS A 1 83  ? 17.601 7.357  6.486   1.00 24.85  ? 83  LYS A N   1 
ATOM   643  C  CA  . LYS A 1 83  ? 18.130 7.524  5.146   1.00 31.94  ? 83  LYS A CA  1 
ATOM   644  C  C   . LYS A 1 83  ? 19.474 6.826  5.038   1.00 27.41  ? 83  LYS A C   1 
ATOM   645  O  O   . LYS A 1 83  ? 19.924 6.452  3.966   1.00 35.48  ? 83  LYS A O   1 
ATOM   646  C  CB  . LYS A 1 83  ? 18.295 9.005  4.802   1.00 48.35  ? 83  LYS A CB  1 
ATOM   647  C  CG  . LYS A 1 83  ? 17.395 9.514  3.674   1.00 100.00 ? 83  LYS A CG  1 
ATOM   648  C  CD  . LYS A 1 83  ? 15.951 9.792  4.113   1.00 100.00 ? 83  LYS A CD  1 
ATOM   649  C  CE  . LYS A 1 83  ? 14.959 10.019 2.961   1.00 100.00 ? 83  LYS A CE  1 
ATOM   650  N  NZ  . LYS A 1 83  ? 14.090 8.858  2.653   1.00 100.00 ? 83  LYS A NZ  1 
ATOM   651  N  N   . LEU A 1 84  ? 20.112 6.658  6.162   1.00 24.01  ? 84  LEU A N   1 
ATOM   652  C  CA  . LEU A 1 84  ? 21.440 6.106  6.163   1.00 8.39   ? 84  LEU A CA  1 
ATOM   653  C  C   . LEU A 1 84  ? 21.553 4.637  6.446   1.00 15.37  ? 84  LEU A C   1 
ATOM   654  O  O   . LEU A 1 84  ? 22.289 3.914  5.832   1.00 12.71  ? 84  LEU A O   1 
ATOM   655  C  CB  . LEU A 1 84  ? 22.255 6.940  7.165   1.00 24.62  ? 84  LEU A CB  1 
ATOM   656  C  CG  . LEU A 1 84  ? 22.509 8.376  6.656   1.00 27.10  ? 84  LEU A CG  1 
ATOM   657  C  CD1 . LEU A 1 84  ? 23.497 9.151  7.531   1.00 29.51  ? 84  LEU A CD1 1 
ATOM   658  C  CD2 . LEU A 1 84  ? 22.940 8.407  5.187   1.00 25.45  ? 84  LEU A CD2 1 
ATOM   659  N  N   . LYS A 1 85  ? 20.811 4.236  7.431   1.00 17.39  ? 85  LYS A N   1 
ATOM   660  C  CA  . LYS A 1 85  ? 20.807 2.901  7.905   1.00 18.61  ? 85  LYS A CA  1 
ATOM   661  C  C   . LYS A 1 85  ? 20.696 1.857  6.840   1.00 8.49   ? 85  LYS A C   1 
ATOM   662  O  O   . LYS A 1 85  ? 21.419 0.875  6.795   1.00 12.88  ? 85  LYS A O   1 
ATOM   663  C  CB  . LYS A 1 85  ? 19.671 2.716  8.877   1.00 9.50   ? 85  LYS A CB  1 
ATOM   664  C  CG  . LYS A 1 85  ? 19.985 1.492  9.685   1.00 20.68  ? 85  LYS A CG  1 
ATOM   665  C  CD  . LYS A 1 85  ? 18.835 1.084  10.549  1.00 33.71  ? 85  LYS A CD  1 
ATOM   666  C  CE  . LYS A 1 85  ? 19.151 -0.207 11.276  1.00 31.15  ? 85  LYS A CE  1 
ATOM   667  N  NZ  . LYS A 1 85  ? 18.474 -1.331 10.656  1.00 37.10  ? 85  LYS A NZ  1 
ATOM   668  N  N   . PRO A 1 86  ? 19.740 2.029  5.991   1.00 15.06  ? 86  PRO A N   1 
ATOM   669  C  CA  . PRO A 1 86  ? 19.582 1.046  4.979   1.00 34.50  ? 86  PRO A CA  1 
ATOM   670  C  C   . PRO A 1 86  ? 20.788 0.999  4.064   1.00 22.20  ? 86  PRO A C   1 
ATOM   671  O  O   . PRO A 1 86  ? 21.136 -0.037 3.518   1.00 14.86  ? 86  PRO A O   1 
ATOM   672  C  CB  . PRO A 1 86  ? 18.341 1.439  4.186   1.00 24.12  ? 86  PRO A CB  1 
ATOM   673  C  CG  . PRO A 1 86  ? 17.873 2.788  4.702   1.00 31.65  ? 86  PRO A CG  1 
ATOM   674  C  CD  . PRO A 1 86  ? 18.763 3.138  5.876   1.00 24.30  ? 86  PRO A CD  1 
ATOM   675  N  N   . VAL A 1 87  ? 21.410 2.116  3.799   1.00 18.97  ? 87  VAL A N   1 
ATOM   676  C  CA  . VAL A 1 87  ? 22.528 2.006  2.900   1.00 11.03  ? 87  VAL A CA  1 
ATOM   677  C  C   . VAL A 1 87  ? 23.662 1.289  3.563   1.00 13.20  ? 87  VAL A C   1 
ATOM   678  O  O   . VAL A 1 87  ? 24.310 0.402  3.031   1.00 19.99  ? 87  VAL A O   1 
ATOM   679  C  CB  . VAL A 1 87  ? 22.991 3.352  2.323   1.00 16.89  ? 87  VAL A CB  1 
ATOM   680  C  CG1 . VAL A 1 87  ? 24.151 3.096  1.318   1.00 16.34  ? 87  VAL A CG1 1 
ATOM   681  C  CG2 . VAL A 1 87  ? 21.822 4.035  1.586   1.00 10.91  ? 87  VAL A CG2 1 
ATOM   682  N  N   . TYR A 1 88  ? 23.894 1.700  4.757   1.00 13.62  ? 88  TYR A N   1 
ATOM   683  C  CA  . TYR A 1 88  ? 24.972 1.182  5.550   1.00 12.67  ? 88  TYR A CA  1 
ATOM   684  C  C   . TYR A 1 88  ? 24.842 -0.313 5.764   1.00 9.73   ? 88  TYR A C   1 
ATOM   685  O  O   . TYR A 1 88  ? 25.805 -1.082 5.767   1.00 14.51  ? 88  TYR A O   1 
ATOM   686  C  CB  . TYR A 1 88  ? 24.889 1.999  6.848   1.00 5.50   ? 88  TYR A CB  1 
ATOM   687  C  CG  . TYR A 1 88  ? 25.934 1.575  7.812   1.00 21.43  ? 88  TYR A CG  1 
ATOM   688  C  CD1 . TYR A 1 88  ? 27.221 2.112  7.757   1.00 12.07  ? 88  TYR A CD1 1 
ATOM   689  C  CD2 . TYR A 1 88  ? 25.646 0.599  8.760   1.00 19.20  ? 88  TYR A CD2 1 
ATOM   690  C  CE1 . TYR A 1 88  ? 28.230 1.712  8.637   1.00 14.86  ? 88  TYR A CE1 1 
ATOM   691  C  CE2 . TYR A 1 88  ? 26.628 0.212  9.671   1.00 14.19  ? 88  TYR A CE2 1 
ATOM   692  C  CZ  . TYR A 1 88  ? 27.906 0.783  9.622   1.00 17.71  ? 88  TYR A CZ  1 
ATOM   693  O  OH  . TYR A 1 88  ? 28.860 0.373  10.491  1.00 23.07  ? 88  TYR A OH  1 
ATOM   694  N  N   . ASP A 1 89  ? 23.618 -0.763 5.957   1.00 19.32  ? 89  ASP A N   1 
ATOM   695  C  CA  . ASP A 1 89  ? 23.373 -2.194 6.183   1.00 6.50   ? 89  ASP A CA  1 
ATOM   696  C  C   . ASP A 1 89  ? 23.646 -3.022 4.949   1.00 10.70  ? 89  ASP A C   1 
ATOM   697  O  O   . ASP A 1 89  ? 23.973 -4.168 5.080   1.00 23.31  ? 89  ASP A O   1 
ATOM   698  C  CB  . ASP A 1 89  ? 21.957 -2.496 6.648   1.00 14.01  ? 89  ASP A CB  1 
ATOM   699  C  CG  . ASP A 1 89  ? 21.631 -2.208 8.079   1.00 34.54  ? 89  ASP A CG  1 
ATOM   700  O  OD1 . ASP A 1 89  ? 22.644 -2.066 8.864   1.00 13.95  ? 89  ASP A OD1 1 
ATOM   701  O  OD2 . ASP A 1 89  ? 20.508 -2.187 8.457   1.00 18.64  ? 89  ASP A OD2 1 
ATOM   702  N  N   . SER A 1 90  ? 23.490 -2.426 3.750   1.00 11.27  ? 90  SER A N   1 
ATOM   703  C  CA  . SER A 1 90  ? 23.776 -3.146 2.509   1.00 5.47   ? 90  SER A CA  1 
ATOM   704  C  C   . SER A 1 90  ? 25.240 -3.365 2.241   1.00 10.03  ? 90  SER A C   1 
ATOM   705  O  O   . SER A 1 90  ? 25.598 -4.222 1.437   1.00 24.35  ? 90  SER A O   1 
ATOM   706  C  CB  . SER A 1 90  ? 23.195 -2.510 1.256   1.00 11.79  ? 90  SER A CB  1 
ATOM   707  O  OG  . SER A 1 90  ? 23.642 -1.180 1.146   1.00 10.07  ? 90  SER A OG  1 
ATOM   708  N  N   . LEU A 1 91  ? 26.078 -2.547 2.863   1.00 12.49  ? 91  LEU A N   1 
ATOM   709  C  CA  . LEU A 1 91  ? 27.518 -2.586 2.616   1.00 13.46  ? 91  LEU A CA  1 
ATOM   710  C  C   . LEU A 1 91  ? 28.287 -3.692 3.339   1.00 23.33  ? 91  LEU A C   1 
ATOM   711  O  O   . LEU A 1 91  ? 27.862 -4.174 4.398   1.00 14.38  ? 91  LEU A O   1 
ATOM   712  C  CB  . LEU A 1 91  ? 28.149 -1.220 2.973   1.00 14.32  ? 91  LEU A CB  1 
ATOM   713  C  CG  . LEU A 1 91  ? 27.470 -0.001 2.331   1.00 17.18  ? 91  LEU A CG  1 
ATOM   714  C  CD1 . LEU A 1 91  ? 27.951 1.301  2.995   1.00 14.70  ? 91  LEU A CD1 1 
ATOM   715  C  CD2 . LEU A 1 91  ? 27.781 0.057  0.849   1.00 16.71  ? 91  LEU A CD2 1 
ATOM   716  N  N   . ASP A 1 92  ? 29.462 -4.014 2.776   1.00 8.52   ? 92  ASP A N   1 
ATOM   717  C  CA  . ASP A 1 92  ? 30.417 -4.971 3.344   1.00 10.11  ? 92  ASP A CA  1 
ATOM   718  C  C   . ASP A 1 92  ? 31.229 -4.201 4.407   1.00 20.71  ? 92  ASP A C   1 
ATOM   719  O  O   . ASP A 1 92  ? 31.148 -2.965 4.501   1.00 12.14  ? 92  ASP A O   1 
ATOM   720  C  CB  . ASP A 1 92  ? 31.343 -5.501 2.271   1.00 16.16  ? 92  ASP A CB  1 
ATOM   721  C  CG  . ASP A 1 92  ? 32.055 -4.348 1.635   1.00 24.28  ? 92  ASP A CG  1 
ATOM   722  O  OD1 . ASP A 1 92  ? 31.376 -3.839 0.632   1.00 27.02  ? 92  ASP A OD1 1 
ATOM   723  O  OD2 . ASP A 1 92  ? 33.125 -3.915 2.037   1.00 13.99  ? 92  ASP A OD2 1 
ATOM   724  N  N   . ALA A 1 93  ? 31.989 -4.894 5.224   1.00 19.74  ? 93  ALA A N   1 
ATOM   725  C  CA  . ALA A 1 93  ? 32.690 -4.278 6.305   1.00 12.13  ? 93  ALA A CA  1 
ATOM   726  C  C   . ALA A 1 93  ? 33.700 -3.158 5.933   1.00 21.17  ? 93  ALA A C   1 
ATOM   727  O  O   . ALA A 1 93  ? 33.823 -2.135 6.627   1.00 12.74  ? 93  ALA A O   1 
ATOM   728  C  CB  . ALA A 1 93  ? 33.186 -5.317 7.308   1.00 18.02  ? 93  ALA A CB  1 
ATOM   729  N  N   . VAL A 1 94  ? 34.420 -3.314 4.835   1.00 23.92  ? 94  VAL A N   1 
ATOM   730  C  CA  . VAL A 1 94  ? 35.345 -2.270 4.464   1.00 6.02   ? 94  VAL A CA  1 
ATOM   731  C  C   . VAL A 1 94  ? 34.593 -1.014 4.085   1.00 3.50   ? 94  VAL A C   1 
ATOM   732  O  O   . VAL A 1 94  ? 34.877 0.105  4.529   1.00 12.80  ? 94  VAL A O   1 
ATOM   733  C  CB  . VAL A 1 94  ? 36.273 -2.725 3.357   1.00 15.72  ? 94  VAL A CB  1 
ATOM   734  C  CG1 . VAL A 1 94  ? 37.319 -1.670 3.053   1.00 16.18  ? 94  VAL A CG1 1 
ATOM   735  C  CG2 . VAL A 1 94  ? 37.017 -3.930 3.904   1.00 29.32  ? 94  VAL A CG2 1 
ATOM   736  N  N   . ARG A 1 95  ? 33.608 -1.168 3.227   1.00 8.30   ? 95  ARG A N   1 
ATOM   737  C  CA  . ARG A 1 95  ? 32.899 0.054  2.849   1.00 8.63   ? 95  ARG A CA  1 
ATOM   738  C  C   . ARG A 1 95  ? 32.208 0.752  3.984   1.00 6.95   ? 95  ARG A C   1 
ATOM   739  O  O   . ARG A 1 95  ? 32.047 1.929  3.934   1.00 15.54  ? 95  ARG A O   1 
ATOM   740  C  CB  . ARG A 1 95  ? 32.024 -0.072 1.626   1.00 6.29   ? 95  ARG A CB  1 
ATOM   741  C  CG  . ARG A 1 95  ? 32.759 -0.725 0.437   1.00 6.33   ? 95  ARG A CG  1 
ATOM   742  C  CD  . ARG A 1 95  ? 31.851 -0.899 -0.759  1.00 14.76  ? 95  ARG A CD  1 
ATOM   743  N  NE  . ARG A 1 95  ? 32.562 -1.018 -2.039  1.00 10.28  ? 95  ARG A NE  1 
ATOM   744  C  CZ  . ARG A 1 95  ? 32.982 -2.174 -2.551  1.00 25.13  ? 95  ARG A CZ  1 
ATOM   745  N  NH1 . ARG A 1 95  ? 32.824 -3.295 -1.885  1.00 11.78  ? 95  ARG A NH1 1 
ATOM   746  N  NH2 . ARG A 1 95  ? 33.618 -2.194 -3.726  1.00 12.78  ? 95  ARG A NH2 1 
ATOM   747  N  N   . ARG A 1 96  ? 31.700 0.007  4.999   1.00 11.98  ? 96  ARG A N   1 
ATOM   748  C  CA  . ARG A 1 96  ? 31.076 0.590  6.155   1.00 14.98  ? 96  ARG A CA  1 
ATOM   749  C  C   . ARG A 1 96  ? 32.060 1.527  6.843   1.00 5.90   ? 96  ARG A C   1 
ATOM   750  O  O   . ARG A 1 96  ? 31.665 2.565  7.277   1.00 15.30  ? 96  ARG A O   1 
ATOM   751  C  CB  . ARG A 1 96  ? 30.637 -0.436 7.162   1.00 10.21  ? 96  ARG A CB  1 
ATOM   752  C  CG  . ARG A 1 96  ? 29.457 -1.183 6.637   1.00 9.14   ? 96  ARG A CG  1 
ATOM   753  C  CD  . ARG A 1 96  ? 28.947 -2.116 7.717   1.00 14.25  ? 96  ARG A CD  1 
ATOM   754  N  NE  . ARG A 1 96  ? 27.770 -2.804 7.183   1.00 18.88  ? 96  ARG A NE  1 
ATOM   755  C  CZ  . ARG A 1 96  ? 27.253 -3.896 7.689   1.00 46.05  ? 96  ARG A CZ  1 
ATOM   756  N  NH1 . ARG A 1 96  ? 27.791 -4.432 8.773   1.00 44.71  ? 96  ARG A NH1 1 
ATOM   757  N  NH2 . ARG A 1 96  ? 26.179 -4.455 7.102   1.00 13.22  ? 96  ARG A NH2 1 
ATOM   758  N  N   . ALA A 1 97  ? 33.359 1.116  6.909   1.00 9.56   ? 97  ALA A N   1 
ATOM   759  C  CA  . ALA A 1 97  ? 34.342 1.954  7.476   1.00 8.61   ? 97  ALA A CA  1 
ATOM   760  C  C   . ALA A 1 97  ? 34.371 3.260  6.715   1.00 19.84  ? 97  ALA A C   1 
ATOM   761  O  O   . ALA A 1 97  ? 34.397 4.297  7.340   1.00 13.23  ? 97  ALA A O   1 
ATOM   762  C  CB  . ALA A 1 97  ? 35.750 1.364  7.557   1.00 8.10   ? 97  ALA A CB  1 
ATOM   763  N  N   . ALA A 1 98  ? 34.317 3.203  5.382   1.00 18.63  ? 98  ALA A N   1 
ATOM   764  C  CA  . ALA A 1 98  ? 34.313 4.404  4.597   1.00 8.79   ? 98  ALA A CA  1 
ATOM   765  C  C   . ALA A 1 98  ? 33.130 5.301  4.887   1.00 19.01  ? 98  ALA A C   1 
ATOM   766  O  O   . ALA A 1 98  ? 33.257 6.517  4.908   1.00 11.61  ? 98  ALA A O   1 
ATOM   767  C  CB  . ALA A 1 98  ? 34.448 4.193  3.106   1.00 1.89   ? 98  ALA A CB  1 
ATOM   768  N  N   . ALA A 1 99  ? 31.961 4.711  5.052   1.00 9.84   ? 99  ALA A N   1 
ATOM   769  C  CA  . ALA A 1 99  ? 30.754 5.466  5.376   1.00 9.84   ? 99  ALA A CA  1 
ATOM   770  C  C   . ALA A 1 99  ? 30.874 6.127  6.759   1.00 18.78  ? 99  ALA A C   1 
ATOM   771  O  O   . ALA A 1 99  ? 30.328 7.154  6.952   1.00 8.07   ? 99  ALA A O   1 
ATOM   772  C  CB  . ALA A 1 99  ? 29.530 4.505  5.379   1.00 7.94   ? 99  ALA A CB  1 
ATOM   773  N  N   . ILE A 1 100 ? 31.574 5.538  7.740   1.00 16.27  ? 100 ILE A N   1 
ATOM   774  C  CA  . ILE A 1 100 ? 31.702 6.155  9.056   1.00 9.28   ? 100 ILE A CA  1 
ATOM   775  C  C   . ILE A 1 100 ? 32.680 7.358  8.997   1.00 16.00  ? 100 ILE A C   1 
ATOM   776  O  O   . ILE A 1 100 ? 32.478 8.439  9.607   1.00 20.88  ? 100 ILE A O   1 
ATOM   777  C  CB  . ILE A 1 100 ? 32.162 5.163  10.116  1.00 18.18  ? 100 ILE A CB  1 
ATOM   778  C  CG1 . ILE A 1 100 ? 31.193 3.965  10.279  1.00 14.76  ? 100 ILE A CG1 1 
ATOM   779  C  CG2 . ILE A 1 100 ? 32.368 5.894  11.451  1.00 6.47   ? 100 ILE A CG2 1 
ATOM   780  C  CD1 . ILE A 1 100 ? 31.895 2.757  10.891  1.00 5.76   ? 100 ILE A CD1 1 
ATOM   781  N  N   . ASN A 1 101 ? 33.741 7.172  8.219   1.00 16.93  ? 101 ASN A N   1 
ATOM   782  C  CA  . ASN A 1 101 ? 34.724 8.238  8.003   1.00 3.30   ? 101 ASN A CA  1 
ATOM   783  C  C   . ASN A 1 101 ? 34.030 9.518  7.526   1.00 17.09  ? 101 ASN A C   1 
ATOM   784  O  O   . ASN A 1 101 ? 34.230 10.589 8.056   1.00 13.20  ? 101 ASN A O   1 
ATOM   785  C  CB  . ASN A 1 101 ? 35.682 7.799  6.911   1.00 8.48   ? 101 ASN A CB  1 
ATOM   786  C  CG  . ASN A 1 101 ? 36.885 8.672  6.847   1.00 10.88  ? 101 ASN A CG  1 
ATOM   787  O  OD1 . ASN A 1 101 ? 36.718 9.896  6.858   1.00 19.23  ? 101 ASN A OD1 1 
ATOM   788  N  ND2 . ASN A 1 101 ? 38.078 8.063  6.898   1.00 13.11  ? 101 ASN A ND2 1 
ATOM   789  N  N   . MET A 1 102 ? 33.161 9.380  6.533   1.00 5.74   ? 102 MET A N   1 
ATOM   790  C  CA  . MET A 1 102 ? 32.408 10.515 5.997   1.00 9.49   ? 102 MET A CA  1 
ATOM   791  C  C   . MET A 1 102 ? 31.561 11.183 7.042   1.00 16.26  ? 102 MET A C   1 
ATOM   792  O  O   . MET A 1 102 ? 31.608 12.369 7.141   1.00 14.36  ? 102 MET A O   1 
ATOM   793  C  CB  . MET A 1 102 ? 31.538 10.156 4.770   1.00 12.93  ? 102 MET A CB  1 
ATOM   794  C  CG  . MET A 1 102 ? 32.359 9.817  3.509   1.00 11.27  ? 102 MET A CG  1 
ATOM   795  S  SD  . MET A 1 102 ? 31.482 9.697  1.932   1.00 17.26  ? 102 MET A SD  1 
ATOM   796  C  CE  . MET A 1 102 ? 30.683 11.314 1.819   1.00 10.86  ? 102 MET A CE  1 
ATOM   797  N  N   . VAL A 1 103 ? 30.755 10.409 7.800   1.00 13.41  ? 103 VAL A N   1 
ATOM   798  C  CA  . VAL A 1 103 ? 29.894 10.965 8.836   1.00 21.12  ? 103 VAL A CA  1 
ATOM   799  C  C   . VAL A 1 103 ? 30.694 11.632 9.934   1.00 12.92  ? 103 VAL A C   1 
ATOM   800  O  O   . VAL A 1 103 ? 30.280 12.665 10.470  1.00 26.78  ? 103 VAL A O   1 
ATOM   801  C  CB  . VAL A 1 103 ? 28.926 9.948  9.433   1.00 3.66   ? 103 VAL A CB  1 
ATOM   802  C  CG1 . VAL A 1 103 ? 28.281 10.515 10.693  1.00 19.26  ? 103 VAL A CG1 1 
ATOM   803  C  CG2 . VAL A 1 103 ? 27.808 9.836  8.434   1.00 15.87  ? 103 VAL A CG2 1 
ATOM   804  N  N   . PHE A 1 104 ? 31.841 11.014 10.259  1.00 10.71  ? 104 PHE A N   1 
ATOM   805  C  CA  . PHE A 1 104 ? 32.705 11.510 11.274  1.00 14.05  ? 104 PHE A CA  1 
ATOM   806  C  C   . PHE A 1 104 ? 33.211 12.864 10.857  1.00 21.71  ? 104 PHE A C   1 
ATOM   807  O  O   . PHE A 1 104 ? 33.196 13.779 11.630  1.00 16.28  ? 104 PHE A O   1 
ATOM   808  C  CB  . PHE A 1 104 ? 33.882 10.541 11.490  1.00 18.66  ? 104 PHE A CB  1 
ATOM   809  C  CG  . PHE A 1 104 ? 34.818 10.888 12.621  1.00 14.04  ? 104 PHE A CG  1 
ATOM   810  C  CD1 . PHE A 1 104 ? 35.842 11.819 12.437  1.00 10.03  ? 104 PHE A CD1 1 
ATOM   811  C  CD2 . PHE A 1 104 ? 34.753 10.220 13.845  1.00 9.72   ? 104 PHE A CD2 1 
ATOM   812  C  CE1 . PHE A 1 104 ? 36.727 12.137 13.468  1.00 16.01  ? 104 PHE A CE1 1 
ATOM   813  C  CE2 . PHE A 1 104 ? 35.661 10.481 14.870  1.00 10.86  ? 104 PHE A CE2 1 
ATOM   814  C  CZ  . PHE A 1 104 ? 36.641 11.466 14.684  1.00 6.88   ? 104 PHE A CZ  1 
ATOM   815  N  N   . GLN A 1 105 ? 33.563 13.003 9.590   1.00 14.73  ? 105 GLN A N   1 
ATOM   816  C  CA  . GLN A 1 105 ? 34.102 14.237 9.099   1.00 14.19  ? 105 GLN A CA  1 
ATOM   817  C  C   . GLN A 1 105 ? 33.072 15.334 8.872   1.00 19.02  ? 105 GLN A C   1 
ATOM   818  O  O   . GLN A 1 105 ? 33.325 16.534 9.059   1.00 26.89  ? 105 GLN A O   1 
ATOM   819  C  CB  . GLN A 1 105 ? 34.885 13.961 7.774   1.00 19.90  ? 105 GLN A CB  1 
ATOM   820  C  CG  . GLN A 1 105 ? 35.557 15.250 7.219   1.00 14.25  ? 105 GLN A CG  1 
ATOM   821  C  CD  . GLN A 1 105 ? 36.114 15.162 5.802   1.00 17.64  ? 105 GLN A CD  1 
ATOM   822  O  OE1 . GLN A 1 105 ? 36.033 14.111 5.120   1.00 25.81  ? 105 GLN A OE1 1 
ATOM   823  N  NE2 . GLN A 1 105 ? 36.631 16.291 5.330   1.00 17.25  ? 105 GLN A NE2 1 
ATOM   824  N  N   . MET A 1 106 ? 31.932 14.948 8.338   1.00 16.38  ? 106 MET A N   1 
ATOM   825  C  CA  . MET A 1 106 ? 30.972 15.947 7.999   1.00 4.61   ? 106 MET A CA  1 
ATOM   826  C  C   . MET A 1 106 ? 29.618 15.887 8.675   1.00 21.67  ? 106 MET A C   1 
ATOM   827  O  O   . MET A 1 106 ? 28.758 16.675 8.362   1.00 25.34  ? 106 MET A O   1 
ATOM   828  C  CB  . MET A 1 106 ? 30.873 16.009 6.452   1.00 8.33   ? 106 MET A CB  1 
ATOM   829  C  CG  . MET A 1 106 ? 30.370 14.819 5.696   1.00 58.37  ? 106 MET A CG  1 
ATOM   830  S  SD  . MET A 1 106 ? 30.622 15.238 3.955   1.00 44.66  ? 106 MET A SD  1 
ATOM   831  C  CE  . MET A 1 106 ? 31.986 14.161 3.487   1.00 36.29  ? 106 MET A CE  1 
ATOM   832  N  N   . GLY A 1 107 ? 29.395 14.945 9.554   1.00 19.88  ? 107 GLY A N   1 
ATOM   833  C  CA  . GLY A 1 107 ? 28.110 14.881 10.187  1.00 19.13  ? 107 GLY A CA  1 
ATOM   834  C  C   . GLY A 1 107 ? 27.043 14.267 9.291   1.00 11.75  ? 107 GLY A C   1 
ATOM   835  O  O   . GLY A 1 107 ? 27.152 14.176 8.078   1.00 24.13  ? 107 GLY A O   1 
ATOM   836  N  N   . GLU A 1 108 ? 25.986 13.857 9.947   1.00 21.06  ? 108 GLU A N   1 
ATOM   837  C  CA  . GLU A 1 108 ? 24.827 13.242 9.306   1.00 40.80  ? 108 GLU A CA  1 
ATOM   838  C  C   . GLU A 1 108 ? 24.224 14.157 8.275   1.00 40.85  ? 108 GLU A C   1 
ATOM   839  O  O   . GLU A 1 108 ? 23.700 13.737 7.237   1.00 41.17  ? 108 GLU A O   1 
ATOM   840  C  CB  . GLU A 1 108 ? 23.713 13.018 10.360  1.00 42.85  ? 108 GLU A CB  1 
ATOM   841  C  CG  . GLU A 1 108 ? 23.694 11.602 10.967  1.00 64.26  ? 108 GLU A CG  1 
ATOM   842  C  CD  . GLU A 1 108 ? 22.850 11.491 12.202  1.00 57.92  ? 108 GLU A CD  1 
ATOM   843  O  OE1 . GLU A 1 108 ? 21.588 11.241 11.940  1.00 78.07  ? 108 GLU A OE1 1 
ATOM   844  O  OE2 . GLU A 1 108 ? 23.294 11.634 13.330  1.00 100.00 ? 108 GLU A OE2 1 
ATOM   845  N  N   . THR A 1 109 ? 24.251 15.415 8.673   1.00 29.04  ? 109 THR A N   1 
ATOM   846  C  CA  . THR A 1 109 ? 23.734 16.544 7.934   1.00 87.18  ? 109 THR A CA  1 
ATOM   847  C  C   . THR A 1 109 ? 24.598 16.919 6.744   1.00 64.32  ? 109 THR A C   1 
ATOM   848  O  O   . THR A 1 109 ? 24.124 17.462 5.738   1.00 88.30  ? 109 THR A O   1 
ATOM   849  C  CB  . THR A 1 109 ? 23.621 17.735 8.902   1.00 100.00 ? 109 THR A CB  1 
ATOM   850  O  OG1 . THR A 1 109 ? 22.280 17.899 9.292   1.00 100.00 ? 109 THR A OG1 1 
ATOM   851  C  CG2 . THR A 1 109 ? 24.175 19.016 8.285   1.00 100.00 ? 109 THR A CG2 1 
ATOM   852  N  N   . GLY A 1 110 ? 25.892 16.647 6.875   1.00 43.28  ? 110 GLY A N   1 
ATOM   853  C  CA  . GLY A 1 110 ? 26.815 16.968 5.819   1.00 37.46  ? 110 GLY A CA  1 
ATOM   854  C  C   . GLY A 1 110 ? 26.649 15.993 4.713   1.00 35.83  ? 110 GLY A C   1 
ATOM   855  O  O   . GLY A 1 110 ? 26.730 16.348 3.546   1.00 35.34  ? 110 GLY A O   1 
ATOM   856  N  N   . VAL A 1 111 ? 26.364 14.755 5.121   1.00 40.49  ? 111 VAL A N   1 
ATOM   857  C  CA  . VAL A 1 111 ? 26.198 13.599 4.245   1.00 51.53  ? 111 VAL A CA  1 
ATOM   858  C  C   . VAL A 1 111 ? 24.797 13.530 3.635   1.00 78.97  ? 111 VAL A C   1 
ATOM   859  O  O   . VAL A 1 111 ? 24.460 12.608 2.893   1.00 53.10  ? 111 VAL A O   1 
ATOM   860  C  CB  . VAL A 1 111 ? 26.551 12.393 5.066   1.00 35.88  ? 111 VAL A CB  1 
ATOM   861  C  CG1 . VAL A 1 111 ? 26.227 11.108 4.352   1.00 74.64  ? 111 VAL A CG1 1 
ATOM   862  C  CG2 . VAL A 1 111 ? 28.049 12.486 5.309   1.00 45.54  ? 111 VAL A CG2 1 
ATOM   863  N  N   . ALA A 1 112 ? 24.017 14.562 3.895   1.00 66.28  ? 112 ALA A N   1 
ATOM   864  C  CA  . ALA A 1 112 ? 22.650 14.676 3.395   1.00 100.00 ? 112 ALA A CA  1 
ATOM   865  C  C   . ALA A 1 112 ? 22.497 14.815 1.866   1.00 100.00 ? 112 ALA A C   1 
ATOM   866  O  O   . ALA A 1 112 ? 21.720 14.065 1.255   1.00 99.82  ? 112 ALA A O   1 
ATOM   867  C  CB  . ALA A 1 112 ? 21.878 15.770 4.137   1.00 100.00 ? 112 ALA A CB  1 
ATOM   868  N  N   . GLY A 1 113 ? 23.232 15.772 1.263   1.00 100.00 ? 113 GLY A N   1 
ATOM   869  C  CA  . GLY A 1 113 ? 23.200 16.080 -0.175  1.00 35.53  ? 113 GLY A CA  1 
ATOM   870  C  C   . GLY A 1 113 ? 23.836 15.020 -1.060  1.00 43.03  ? 113 GLY A C   1 
ATOM   871  O  O   . GLY A 1 113 ? 24.025 15.196 -2.271  1.00 50.72  ? 113 GLY A O   1 
ATOM   872  N  N   . PHE A 1 114 ? 24.115 13.894 -0.426  1.00 31.86  ? 114 PHE A N   1 
ATOM   873  C  CA  . PHE A 1 114 ? 24.696 12.795 -1.088  1.00 23.98  ? 114 PHE A CA  1 
ATOM   874  C  C   . PHE A 1 114 ? 23.695 11.774 -1.529  1.00 20.59  ? 114 PHE A C   1 
ATOM   875  O  O   . PHE A 1 114 ? 24.089 10.682 -1.876  1.00 23.98  ? 114 PHE A O   1 
ATOM   876  C  CB  . PHE A 1 114 ? 25.775 12.166 -0.226  1.00 19.10  ? 114 PHE A CB  1 
ATOM   877  C  CG  . PHE A 1 114 ? 27.021 13.005 -0.235  1.00 29.64  ? 114 PHE A CG  1 
ATOM   878  C  CD1 . PHE A 1 114 ? 27.162 14.112 0.590   1.00 48.58  ? 114 PHE A CD1 1 
ATOM   879  C  CD2 . PHE A 1 114 ? 28.048 12.723 -1.133  1.00 26.48  ? 114 PHE A CD2 1 
ATOM   880  C  CE1 . PHE A 1 114 ? 28.314 14.897 0.568   1.00 28.60  ? 114 PHE A CE1 1 
ATOM   881  C  CE2 . PHE A 1 114 ? 29.220 13.478 -1.158  1.00 31.78  ? 114 PHE A CE2 1 
ATOM   882  C  CZ  . PHE A 1 114 ? 29.348 14.572 -0.317  1.00 23.06  ? 114 PHE A CZ  1 
ATOM   883  N  N   . THR A 1 115 ? 22.436 12.117 -1.534  1.00 13.36  ? 115 THR A N   1 
ATOM   884  C  CA  . THR A 1 115 ? 21.392 11.183 -1.993  1.00 6.88   ? 115 THR A CA  1 
ATOM   885  C  C   . THR A 1 115 ? 21.655 10.380 -3.234  1.00 13.59  ? 115 THR A C   1 
ATOM   886  O  O   . THR A 1 115 ? 21.396 9.181  -3.338  1.00 20.28  ? 115 THR A O   1 
ATOM   887  C  CB  . THR A 1 115 ? 20.177 11.970 -2.353  1.00 22.40  ? 115 THR A CB  1 
ATOM   888  O  OG1 . THR A 1 115 ? 19.958 12.842 -1.309  1.00 45.54  ? 115 THR A OG1 1 
ATOM   889  C  CG2 . THR A 1 115 ? 19.015 11.023 -2.567  1.00 77.82  ? 115 THR A CG2 1 
ATOM   890  N  N   . ASN A 1 116 ? 22.073 11.039 -4.255  1.00 20.71  ? 116 ASN A N   1 
ATOM   891  C  CA  . ASN A 1 116 ? 22.324 10.277 -5.464  1.00 18.03  ? 116 ASN A CA  1 
ATOM   892  C  C   . ASN A 1 116 ? 23.500 9.330  -5.312  1.00 19.01  ? 116 ASN A C   1 
ATOM   893  O  O   . ASN A 1 116 ? 23.517 8.296  -5.897  1.00 24.23  ? 116 ASN A O   1 
ATOM   894  C  CB  . ASN A 1 116 ? 22.501 11.165 -6.733  1.00 17.58  ? 116 ASN A CB  1 
ATOM   895  C  CG  . ASN A 1 116 ? 21.367 12.166 -6.941  1.00 30.24  ? 116 ASN A CG  1 
ATOM   896  O  OD1 . ASN A 1 116 ? 20.188 11.824 -6.747  1.00 35.66  ? 116 ASN A OD1 1 
ATOM   897  N  ND2 . ASN A 1 116 ? 21.700 13.396 -7.365  1.00 16.36  ? 116 ASN A ND2 1 
ATOM   898  N  N   . SER A 1 117 ? 24.516 9.691  -4.546  1.00 18.68  ? 117 SER A N   1 
ATOM   899  C  CA  . SER A 1 117 ? 25.615 8.770  -4.372  1.00 22.55  ? 117 SER A CA  1 
ATOM   900  C  C   . SER A 1 117 ? 25.160 7.587  -3.498  1.00 12.87  ? 117 SER A C   1 
ATOM   901  O  O   . SER A 1 117 ? 25.526 6.444  -3.694  1.00 16.94  ? 117 SER A O   1 
ATOM   902  C  CB  . SER A 1 117 ? 26.751 9.477  -3.679  1.00 8.13   ? 117 SER A CB  1 
ATOM   903  O  OG  . SER A 1 117 ? 27.090 10.686 -4.338  1.00 43.58  ? 117 SER A OG  1 
ATOM   904  N  N   . LEU A 1 118 ? 24.347 7.884  -2.510  1.00 19.30  ? 118 LEU A N   1 
ATOM   905  C  CA  . LEU A 1 118 ? 23.803 6.876  -1.610  1.00 15.13  ? 118 LEU A CA  1 
ATOM   906  C  C   . LEU A 1 118 ? 23.096 5.833  -2.395  1.00 14.60  ? 118 LEU A C   1 
ATOM   907  O  O   . LEU A 1 118 ? 23.241 4.645  -2.204  1.00 17.09  ? 118 LEU A O   1 
ATOM   908  C  CB  . LEU A 1 118 ? 22.823 7.429  -0.548  1.00 22.74  ? 118 LEU A CB  1 
ATOM   909  C  CG  . LEU A 1 118 ? 23.452 8.359  0.523   1.00 15.05  ? 118 LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1 118 ? 22.391 8.769  1.522   1.00 27.86  ? 118 LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1 118 ? 24.653 7.763  1.264   1.00 19.27  ? 118 LEU A CD2 1 
ATOM   912  N  N   . ARG A 1 119 ? 22.256 6.284  -3.268  1.00 14.00  ? 119 ARG A N   1 
ATOM   913  C  CA  . ARG A 1 119 ? 21.517 5.351  -4.053  1.00 16.71  ? 119 ARG A CA  1 
ATOM   914  C  C   . ARG A 1 119 ? 22.407 4.458  -4.922  1.00 15.64  ? 119 ARG A C   1 
ATOM   915  O  O   . ARG A 1 119 ? 22.184 3.237  -5.073  1.00 22.59  ? 119 ARG A O   1 
ATOM   916  C  CB  . ARG A 1 119 ? 20.521 6.143  -4.839  1.00 13.46  ? 119 ARG A CB  1 
ATOM   917  C  CG  . ARG A 1 119 ? 19.798 5.316  -5.890  1.00 22.64  ? 119 ARG A CG  1 
ATOM   918  C  CD  . ARG A 1 119 ? 18.847 6.178  -6.745  1.00 100.00 ? 119 ARG A CD  1 
ATOM   919  N  NE  . ARG A 1 119 ? 19.406 6.652  -8.030  1.00 100.00 ? 119 ARG A NE  1 
ATOM   920  C  CZ  . ARG A 1 119 ? 19.562 7.950  -8.378  1.00 100.00 ? 119 ARG A CZ  1 
ATOM   921  N  NH1 . ARG A 1 119 ? 19.199 8.954  -7.564  1.00 100.00 ? 119 ARG A NH1 1 
ATOM   922  N  NH2 . ARG A 1 119 ? 20.090 8.253  -9.580  1.00 100.00 ? 119 ARG A NH2 1 
ATOM   923  N  N   . MET A 1 120 ? 23.445 5.046  -5.526  1.00 23.01  ? 120 MET A N   1 
ATOM   924  C  CA  . MET A 1 120 ? 24.341 4.251  -6.336  1.00 5.78   ? 120 MET A CA  1 
ATOM   925  C  C   . MET A 1 120 ? 25.090 3.286  -5.461  1.00 15.66  ? 120 MET A C   1 
ATOM   926  O  O   . MET A 1 120 ? 25.453 2.214  -5.838  1.00 12.72  ? 120 MET A O   1 
ATOM   927  C  CB  . MET A 1 120 ? 25.420 5.113  -7.035  1.00 14.98  ? 120 MET A CB  1 
ATOM   928  C  CG  . MET A 1 120 ? 24.867 5.758  -8.288  1.00 24.99  ? 120 MET A CG  1 
ATOM   929  S  SD  . MET A 1 120 ? 25.922 7.097  -8.846  1.00 26.91  ? 120 MET A SD  1 
ATOM   930  C  CE  . MET A 1 120 ? 24.777 8.144  -9.775  1.00 37.39  ? 120 MET A CE  1 
ATOM   931  N  N   . LEU A 1 121 ? 25.427 3.701  -4.291  1.00 8.80   ? 121 LEU A N   1 
ATOM   932  C  CA  . LEU A 1 121 ? 26.152 2.784  -3.449  1.00 20.72  ? 121 LEU A CA  1 
ATOM   933  C  C   . LEU A 1 121 ? 25.249 1.567  -3.103  1.00 16.09  ? 121 LEU A C   1 
ATOM   934  O  O   . LEU A 1 121 ? 25.639 0.390  -3.116  1.00 16.40  ? 121 LEU A O   1 
ATOM   935  C  CB  . LEU A 1 121 ? 26.583 3.541  -2.185  1.00 27.08  ? 121 LEU A CB  1 
ATOM   936  C  CG  . LEU A 1 121 ? 27.859 4.350  -2.377  1.00 10.96  ? 121 LEU A CG  1 
ATOM   937  C  CD1 . LEU A 1 121 ? 28.119 5.171  -1.112  1.00 24.92  ? 121 LEU A CD1 1 
ATOM   938  C  CD2 . LEU A 1 121 ? 29.026 3.398  -2.595  1.00 13.89  ? 121 LEU A CD2 1 
ATOM   939  N  N   . GLN A 1 122 ? 24.051 1.888  -2.695  1.00 12.82  ? 122 GLN A N   1 
ATOM   940  C  CA  . GLN A 1 122 ? 23.123 0.881  -2.341  1.00 16.26  ? 122 GLN A CA  1 
ATOM   941  C  C   . GLN A 1 122 ? 22.953 -0.078 -3.502  1.00 29.26  ? 122 GLN A C   1 
ATOM   942  O  O   . GLN A 1 122 ? 22.822 -1.280 -3.319  1.00 22.01  ? 122 GLN A O   1 
ATOM   943  C  CB  . GLN A 1 122 ? 21.784 1.512  -1.934  1.00 10.85  ? 122 GLN A CB  1 
ATOM   944  C  CG  . GLN A 1 122 ? 20.788 0.434  -1.554  1.00 22.17  ? 122 GLN A CG  1 
ATOM   945  C  CD  . GLN A 1 122 ? 19.616 1.011  -0.818  1.00 95.82  ? 122 GLN A CD  1 
ATOM   946  O  OE1 . GLN A 1 122 ? 19.502 2.242  -0.742  1.00 100.00 ? 122 GLN A OE1 1 
ATOM   947  N  NE2 . GLN A 1 122 ? 18.757 0.146  -0.267  1.00 50.65  ? 122 GLN A NE2 1 
ATOM   948  N  N   . GLN A 1 123 ? 23.001 0.466  -4.714  1.00 15.19  ? 123 GLN A N   1 
ATOM   949  C  CA  . GLN A 1 123 ? 22.828 -0.371 -5.876  1.00 15.58  ? 123 GLN A CA  1 
ATOM   950  C  C   . GLN A 1 123 ? 24.041 -1.166 -6.219  1.00 19.98  ? 123 GLN A C   1 
ATOM   951  O  O   . GLN A 1 123 ? 23.947 -1.971 -7.148  1.00 24.36  ? 123 GLN A O   1 
ATOM   952  C  CB  . GLN A 1 123 ? 22.486 0.489  -7.111  1.00 12.71  ? 123 GLN A CB  1 
ATOM   953  C  CG  . GLN A 1 123 ? 21.019 0.882  -7.008  1.00 17.84  ? 123 GLN A CG  1 
ATOM   954  C  CD  . GLN A 1 123 ? 20.524 1.398  -8.342  1.00 35.97  ? 123 GLN A CD  1 
ATOM   955  O  OE1 . GLN A 1 123 ? 20.113 0.614  -9.221  1.00 100.00 ? 123 GLN A OE1 1 
ATOM   956  N  NE2 . GLN A 1 123 ? 20.624 2.713  -8.504  1.00 52.05  ? 123 GLN A NE2 1 
ATOM   957  N  N   . LYS A 1 124 ? 25.156 -0.926 -5.479  1.00 12.18  ? 124 LYS A N   1 
ATOM   958  C  CA  . LYS A 1 124 ? 26.462 -1.565 -5.691  1.00 7.15   ? 124 LYS A CA  1 
ATOM   959  C  C   . LYS A 1 124 ? 27.137 -1.136 -7.012  1.00 13.67  ? 124 LYS A C   1 
ATOM   960  O  O   . LYS A 1 124 ? 27.941 -1.853 -7.639  1.00 16.16  ? 124 LYS A O   1 
ATOM   961  C  CB  . LYS A 1 124 ? 26.531 -3.081 -5.440  1.00 24.21  ? 124 LYS A CB  1 
ATOM   962  C  CG  . LYS A 1 124 ? 26.005 -3.427 -4.052  1.00 15.17  ? 124 LYS A CG  1 
ATOM   963  C  CD  . LYS A 1 124 ? 26.465 -4.757 -3.488  1.00 12.89  ? 124 LYS A CD  1 
ATOM   964  C  CE  . LYS A 1 124 ? 25.958 -4.922 -2.050  1.00 8.20   ? 124 LYS A CE  1 
ATOM   965  N  NZ  . LYS A 1 124 ? 26.559 -3.964 -1.147  1.00 25.39  ? 124 LYS A NZ  1 
ATOM   966  N  N   . ARG A 1 125 ? 26.763 0.039  -7.483  1.00 15.82  ? 125 ARG A N   1 
ATOM   967  C  CA  . ARG A 1 125 ? 27.379 0.530  -8.715  1.00 14.27  ? 125 ARG A CA  1 
ATOM   968  C  C   . ARG A 1 125 ? 28.604 1.368  -8.299  1.00 12.28  ? 125 ARG A C   1 
ATOM   969  O  O   . ARG A 1 125 ? 28.557 2.609  -8.262  1.00 12.45  ? 125 ARG A O   1 
ATOM   970  C  CB  . ARG A 1 125 ? 26.390 1.388  -9.498  1.00 12.57  ? 125 ARG A CB  1 
ATOM   971  C  CG  . ARG A 1 125 ? 25.071 0.708  -9.834  1.00 15.92  ? 125 ARG A CG  1 
ATOM   972  C  CD  . ARG A 1 125 ? 24.006 1.728  -10.219 1.00 36.07  ? 125 ARG A CD  1 
ATOM   973  N  NE  . ARG A 1 125 ? 23.198 1.402  -11.414 1.00 100.00 ? 125 ARG A NE  1 
ATOM   974  C  CZ  . ARG A 1 125 ? 22.309 0.374  -11.550 1.00 100.00 ? 125 ARG A CZ  1 
ATOM   975  N  NH1 . ARG A 1 125 ? 22.054 -0.513 -10.599 1.00 100.00 ? 125 ARG A NH1 1 
ATOM   976  N  NH2 . ARG A 1 125 ? 21.643 0.252  -12.701 1.00 100.00 ? 125 ARG A NH2 1 
ATOM   977  N  N   . TRP A 1 126 ? 29.680 0.664  -7.970  1.00 20.71  ? 126 TRP A N   1 
ATOM   978  C  CA  . TRP A 1 126 ? 30.911 1.268  -7.477  1.00 18.66  ? 126 TRP A CA  1 
ATOM   979  C  C   . TRP A 1 126 ? 31.590 2.325  -8.304  1.00 25.31  ? 126 TRP A C   1 
ATOM   980  O  O   . TRP A 1 126 ? 31.939 3.400  -7.805  1.00 16.57  ? 126 TRP A O   1 
ATOM   981  C  CB  . TRP A 1 126 ? 31.911 0.248  -6.942  1.00 9.64   ? 126 TRP A CB  1 
ATOM   982  C  CG  . TRP A 1 126 ? 31.277 -0.897 -6.184  1.00 9.20   ? 126 TRP A CG  1 
ATOM   983  C  CD1 . TRP A 1 126 ? 31.379 -2.214 -6.523  1.00 10.38  ? 126 TRP A CD1 1 
ATOM   984  C  CD2 . TRP A 1 126 ? 30.511 -0.842 -4.989  1.00 19.33  ? 126 TRP A CD2 1 
ATOM   985  N  NE1 . TRP A 1 126 ? 30.725 -2.989 -5.621  1.00 14.75  ? 126 TRP A NE1 1 
ATOM   986  C  CE2 . TRP A 1 126 ? 30.149 -2.180 -4.667  1.00 8.41   ? 126 TRP A CE2 1 
ATOM   987  C  CE3 . TRP A 1 126 ? 30.035 0.202  -4.201  1.00 12.36  ? 126 TRP A CE3 1 
ATOM   988  C  CZ2 . TRP A 1 126 ? 29.375 -2.486 -3.538  1.00 12.48  ? 126 TRP A CZ2 1 
ATOM   989  C  CZ3 . TRP A 1 126 ? 29.311 -0.096 -3.073  1.00 11.43  ? 126 TRP A CZ3 1 
ATOM   990  C  CH2 . TRP A 1 126 ? 28.972 -1.430 -2.740  1.00 21.05  ? 126 TRP A CH2 1 
ATOM   991  N  N   . ASP A 1 127 ? 31.862 2.016  -9.542  1.00 24.05  ? 127 ASP A N   1 
ATOM   992  C  CA  . ASP A 1 127 ? 32.550 2.999  -10.335 1.00 13.02  ? 127 ASP A CA  1 
ATOM   993  C  C   . ASP A 1 127 ? 31.733 4.277  -10.520 1.00 7.42   ? 127 ASP A C   1 
ATOM   994  O  O   . ASP A 1 127 ? 32.213 5.413  -10.359 1.00 16.16  ? 127 ASP A O   1 
ATOM   995  C  CB  . ASP A 1 127 ? 33.066 2.397  -11.633 1.00 22.02  ? 127 ASP A CB  1 
ATOM   996  C  CG  . ASP A 1 127 ? 34.298 1.500  -11.479 1.00 32.34  ? 127 ASP A CG  1 
ATOM   997  O  OD1 . ASP A 1 127 ? 34.641 0.907  -10.469 1.00 31.22  ? 127 ASP A OD1 1 
ATOM   998  O  OD2 . ASP A 1 127 ? 34.976 1.404  -12.580 1.00 38.30  ? 127 ASP A OD2 1 
ATOM   999  N  N   . GLU A 1 128 ? 30.438 4.102  -10.806 1.00 13.90  ? 128 GLU A N   1 
ATOM   1000 C  CA  . GLU A 1 128 ? 29.579 5.276  -10.949 1.00 12.11  ? 128 GLU A CA  1 
ATOM   1001 C  C   . GLU A 1 128 ? 29.484 6.075  -9.662  1.00 16.75  ? 128 GLU A C   1 
ATOM   1002 O  O   . GLU A 1 128 ? 29.442 7.285  -9.665  1.00 18.80  ? 128 GLU A O   1 
ATOM   1003 C  CB  . GLU A 1 128 ? 28.142 4.912  -11.348 1.00 17.23  ? 128 GLU A CB  1 
ATOM   1004 C  CG  . GLU A 1 128 ? 28.082 4.377  -12.778 1.00 35.14  ? 128 GLU A CG  1 
ATOM   1005 C  CD  . GLU A 1 128 ? 27.115 3.228  -12.941 1.00 100.00 ? 128 GLU A CD  1 
ATOM   1006 O  OE1 . GLU A 1 128 ? 25.887 3.615  -13.227 1.00 100.00 ? 128 GLU A OE1 1 
ATOM   1007 O  OE2 . GLU A 1 128 ? 27.437 2.056  -12.813 1.00 87.24  ? 128 GLU A OE2 1 
ATOM   1008 N  N   . ALA A 1 129 ? 29.405 5.391  -8.541  1.00 13.84  ? 129 ALA A N   1 
ATOM   1009 C  CA  . ALA A 1 129 ? 29.308 6.129  -7.292  1.00 1.94   ? 129 ALA A CA  1 
ATOM   1010 C  C   . ALA A 1 129 ? 30.583 6.940  -7.052  1.00 8.36   ? 129 ALA A C   1 
ATOM   1011 O  O   . ALA A 1 129 ? 30.562 8.055  -6.543  1.00 14.44  ? 129 ALA A O   1 
ATOM   1012 C  CB  . ALA A 1 129 ? 29.128 5.149  -6.175  1.00 11.57  ? 129 ALA A CB  1 
ATOM   1013 N  N   . ALA A 1 130 ? 31.706 6.327  -7.402  1.00 10.48  ? 130 ALA A N   1 
ATOM   1014 C  CA  . ALA A 1 130 ? 33.029 6.910  -7.218  1.00 14.06  ? 130 ALA A CA  1 
ATOM   1015 C  C   . ALA A 1 130 ? 33.089 8.208  -7.947  1.00 29.19  ? 130 ALA A C   1 
ATOM   1016 O  O   . ALA A 1 130 ? 33.507 9.215  -7.443  1.00 27.27  ? 130 ALA A O   1 
ATOM   1017 C  CB  . ALA A 1 130 ? 34.141 5.942  -7.573  1.00 8.05   ? 130 ALA A CB  1 
ATOM   1018 N  N   . VAL A 1 131 ? 32.562 8.181  -9.133  1.00 10.46  ? 131 VAL A N   1 
ATOM   1019 C  CA  . VAL A 1 131 ? 32.502 9.375  -9.892  1.00 12.81  ? 131 VAL A CA  1 
ATOM   1020 C  C   . VAL A 1 131 ? 31.562 10.409 -9.271  1.00 23.30  ? 131 VAL A C   1 
ATOM   1021 O  O   . VAL A 1 131 ? 31.857 11.568 -9.186  1.00 18.78  ? 131 VAL A O   1 
ATOM   1022 C  CB  . VAL A 1 131 ? 32.030 8.972  -11.287 1.00 22.55  ? 131 VAL A CB  1 
ATOM   1023 C  CG1 . VAL A 1 131 ? 31.467 10.170 -11.994 1.00 17.63  ? 131 VAL A CG1 1 
ATOM   1024 C  CG2 . VAL A 1 131 ? 33.206 8.456  -12.097 1.00 20.38  ? 131 VAL A CG2 1 
ATOM   1025 N  N   . ASN A 1 132 ? 30.376 10.009 -8.902  1.00 20.90  ? 132 ASN A N   1 
ATOM   1026 C  CA  . ASN A 1 132 ? 29.438 10.928 -8.315  1.00 10.22  ? 132 ASN A CA  1 
ATOM   1027 C  C   . ASN A 1 132 ? 29.934 11.557 -7.006  1.00 15.41  ? 132 ASN A C   1 
ATOM   1028 O  O   . ASN A 1 132 ? 29.633 12.692 -6.630  1.00 18.32  ? 132 ASN A O   1 
ATOM   1029 C  CB  . ASN A 1 132 ? 28.134 10.156 -8.040  1.00 13.95  ? 132 ASN A CB  1 
ATOM   1030 C  CG  . ASN A 1 132 ? 27.002 11.119 -7.727  1.00 14.38  ? 132 ASN A CG  1 
ATOM   1031 O  OD1 . ASN A 1 132 ? 26.693 11.460 -6.553  1.00 23.75  ? 132 ASN A OD1 1 
ATOM   1032 N  ND2 . ASN A 1 132 ? 26.515 11.711 -8.800  1.00 18.30  ? 132 ASN A ND2 1 
ATOM   1033 N  N   . LEU A 1 133 ? 30.646 10.784 -6.223  1.00 10.01  ? 133 LEU A N   1 
ATOM   1034 C  CA  . LEU A 1 133 ? 31.097 11.330 -4.929  1.00 11.34  ? 133 LEU A CA  1 
ATOM   1035 C  C   . LEU A 1 133 ? 32.084 12.475 -5.093  1.00 8.05   ? 133 LEU A C   1 
ATOM   1036 O  O   . LEU A 1 133 ? 32.126 13.421 -4.265  1.00 13.59  ? 133 LEU A O   1 
ATOM   1037 C  CB  . LEU A 1 133 ? 31.765 10.209 -4.088  1.00 17.52  ? 133 LEU A CB  1 
ATOM   1038 C  CG  . LEU A 1 133 ? 30.785 9.183  -3.475  1.00 15.24  ? 133 LEU A CG  1 
ATOM   1039 C  CD1 . LEU A 1 133 ? 31.569 7.952  -2.952  1.00 2.61   ? 133 LEU A CD1 1 
ATOM   1040 C  CD2 . LEU A 1 133 ? 30.040 9.807  -2.316  1.00 13.59  ? 133 LEU A CD2 1 
ATOM   1041 N  N   . ALA A 1 134 ? 32.841 12.395 -6.193  1.00 9.43   ? 134 ALA A N   1 
ATOM   1042 C  CA  . ALA A 1 134 ? 33.907 13.372 -6.514  1.00 10.29  ? 134 ALA A CA  1 
ATOM   1043 C  C   . ALA A 1 134 ? 33.381 14.724 -6.937  1.00 17.20  ? 134 ALA A C   1 
ATOM   1044 O  O   . ALA A 1 134 ? 34.089 15.712 -6.923  1.00 24.68  ? 134 ALA A O   1 
ATOM   1045 C  CB  . ALA A 1 134 ? 34.814 12.802 -7.571  1.00 9.74   ? 134 ALA A CB  1 
ATOM   1046 N  N   . LYS A 1 135 ? 32.117 14.749 -7.332  1.00 15.19  ? 135 LYS A N   1 
ATOM   1047 C  CA  . LYS A 1 135 ? 31.506 15.965 -7.732  1.00 10.20  ? 135 LYS A CA  1 
ATOM   1048 C  C   . LYS A 1 135 ? 30.935 16.624 -6.546  1.00 16.97  ? 135 LYS A C   1 
ATOM   1049 O  O   . LYS A 1 135 ? 29.716 16.677 -6.404  1.00 13.41  ? 135 LYS A O   1 
ATOM   1050 C  CB  . LYS A 1 135 ? 30.351 15.714 -8.671  1.00 20.06  ? 135 LYS A CB  1 
ATOM   1051 C  CG  . LYS A 1 135 ? 30.814 15.116 -9.976  1.00 20.61  ? 135 LYS A CG  1 
ATOM   1052 C  CD  . LYS A 1 135 ? 29.751 15.286 -11.014 1.00 48.50  ? 135 LYS A CD  1 
ATOM   1053 C  CE  . LYS A 1 135 ? 29.844 14.302 -12.164 1.00 40.48  ? 135 LYS A CE  1 
ATOM   1054 N  NZ  . LYS A 1 135 ? 28.699 14.432 -13.064 1.00 100.00 ? 135 LYS A NZ  1 
ATOM   1055 N  N   . SER A 1 136 ? 31.794 17.069 -5.659  1.00 5.34   ? 136 SER A N   1 
ATOM   1056 C  CA  . SER A 1 136 ? 31.211 17.620 -4.452  1.00 7.08   ? 136 SER A CA  1 
ATOM   1057 C  C   . SER A 1 136 ? 32.135 18.650 -3.836  1.00 14.70  ? 136 SER A C   1 
ATOM   1058 O  O   . SER A 1 136 ? 33.307 18.679 -4.154  1.00 17.80  ? 136 SER A O   1 
ATOM   1059 C  CB  . SER A 1 136 ? 30.986 16.446 -3.476  1.00 10.96  ? 136 SER A CB  1 
ATOM   1060 O  OG  . SER A 1 136 ? 32.278 15.845 -3.214  1.00 10.60  ? 136 SER A OG  1 
ATOM   1061 N  N   . ARG A 1 137 ? 31.616 19.507 -2.955  1.00 6.64   ? 137 ARG A N   1 
ATOM   1062 C  CA  . ARG A 1 137 ? 32.496 20.450 -2.303  1.00 11.88  ? 137 ARG A CA  1 
ATOM   1063 C  C   . ARG A 1 137 ? 33.598 19.733 -1.508  1.00 13.54  ? 137 ARG A C   1 
ATOM   1064 O  O   . ARG A 1 137 ? 34.758 20.128 -1.482  1.00 18.98  ? 137 ARG A O   1 
ATOM   1065 C  CB  . ARG A 1 137 ? 31.693 21.313 -1.375  1.00 16.61  ? 137 ARG A CB  1 
ATOM   1066 C  CG  . ARG A 1 137 ? 32.633 22.165 -0.538  1.00 21.26  ? 137 ARG A CG  1 
ATOM   1067 C  CD  . ARG A 1 137 ? 31.887 23.189 0.319   1.00 23.02  ? 137 ARG A CD  1 
ATOM   1068 N  NE  . ARG A 1 137 ? 32.794 24.104 0.992   1.00 30.52  ? 137 ARG A NE  1 
ATOM   1069 C  CZ  . ARG A 1 137 ? 33.449 23.818 2.107   1.00 100.00 ? 137 ARG A CZ  1 
ATOM   1070 N  NH1 . ARG A 1 137 ? 33.300 22.643 2.709   1.00 24.17  ? 137 ARG A NH1 1 
ATOM   1071 N  NH2 . ARG A 1 137 ? 34.273 24.732 2.627   1.00 69.04  ? 137 ARG A NH2 1 
ATOM   1072 N  N   . TRP A 1 138 ? 33.180 18.689 -0.779  1.00 13.73  ? 138 TRP A N   1 
ATOM   1073 C  CA  . TRP A 1 138 ? 34.028 17.830 0.023   1.00 17.58  ? 138 TRP A CA  1 
ATOM   1074 C  C   . TRP A 1 138 ? 35.289 17.418 -0.756  1.00 21.18  ? 138 TRP A C   1 
ATOM   1075 O  O   . TRP A 1 138 ? 36.416 17.609 -0.319  1.00 16.13  ? 138 TRP A O   1 
ATOM   1076 C  CB  . TRP A 1 138 ? 33.201 16.576 0.409   1.00 17.95  ? 138 TRP A CB  1 
ATOM   1077 C  CG  . TRP A 1 138 ? 33.995 15.417 0.952   1.00 17.60  ? 138 TRP A CG  1 
ATOM   1078 C  CD1 . TRP A 1 138 ? 34.723 15.418 2.110   1.00 22.79  ? 138 TRP A CD1 1 
ATOM   1079 C  CD2 . TRP A 1 138 ? 34.023 14.034 0.441   1.00 10.42  ? 138 TRP A CD2 1 
ATOM   1080 N  NE1 . TRP A 1 138 ? 35.235 14.141 2.321   1.00 11.77  ? 138 TRP A NE1 1 
ATOM   1081 C  CE2 . TRP A 1 138 ? 34.862 13.286 1.304   1.00 7.67   ? 138 TRP A CE2 1 
ATOM   1082 C  CE3 . TRP A 1 138 ? 33.447 13.387 -0.668  1.00 15.20  ? 138 TRP A CE3 1 
ATOM   1083 C  CZ2 . TRP A 1 138 ? 35.079 11.904 1.162   1.00 5.83   ? 138 TRP A CZ2 1 
ATOM   1084 C  CZ3 . TRP A 1 138 ? 33.738 12.059 -0.848  1.00 15.88  ? 138 TRP A CZ3 1 
ATOM   1085 C  CH2 . TRP A 1 138 ? 34.521 11.326 0.048   1.00 24.00  ? 138 TRP A CH2 1 
ATOM   1086 N  N   . TYR A 1 139 ? 35.085 16.874 -1.947  1.00 12.68  ? 139 TYR A N   1 
ATOM   1087 C  CA  . TYR A 1 139 ? 36.191 16.452 -2.783  1.00 4.40   ? 139 TYR A CA  1 
ATOM   1088 C  C   . TYR A 1 139 ? 37.102 17.613 -3.140  1.00 27.39  ? 139 TYR A C   1 
ATOM   1089 O  O   . TYR A 1 139 ? 38.316 17.498 -3.124  1.00 18.40  ? 139 TYR A O   1 
ATOM   1090 C  CB  . TYR A 1 139 ? 35.688 15.846 -4.085  1.00 7.57   ? 139 TYR A CB  1 
ATOM   1091 C  CG  . TYR A 1 139 ? 36.773 15.390 -4.983  1.00 15.09  ? 139 TYR A CG  1 
ATOM   1092 C  CD1 . TYR A 1 139 ? 37.306 14.122 -4.760  1.00 23.13  ? 139 TYR A CD1 1 
ATOM   1093 C  CD2 . TYR A 1 139 ? 37.224 16.156 -6.054  1.00 22.02  ? 139 TYR A CD2 1 
ATOM   1094 C  CE1 . TYR A 1 139 ? 38.296 13.600 -5.587  1.00 17.42  ? 139 TYR A CE1 1 
ATOM   1095 C  CE2 . TYR A 1 139 ? 38.235 15.660 -6.881  1.00 30.18  ? 139 TYR A CE2 1 
ATOM   1096 C  CZ  . TYR A 1 139 ? 38.758 14.388 -6.632  1.00 67.72  ? 139 TYR A CZ  1 
ATOM   1097 O  OH  . TYR A 1 139 ? 39.754 13.887 -7.408  1.00 51.28  ? 139 TYR A OH  1 
ATOM   1098 N  N   . ASN A 1 140 ? 36.510 18.722 -3.526  1.00 20.58  ? 140 ASN A N   1 
ATOM   1099 C  CA  . ASN A 1 140 ? 37.306 19.903 -3.924  1.00 12.20  ? 140 ASN A CA  1 
ATOM   1100 C  C   . ASN A 1 140 ? 38.105 20.503 -2.790  1.00 17.84  ? 140 ASN A C   1 
ATOM   1101 O  O   . ASN A 1 140 ? 39.262 20.927 -2.958  1.00 21.92  ? 140 ASN A O   1 
ATOM   1102 C  CB  . ASN A 1 140 ? 36.472 20.972 -4.650  1.00 21.01  ? 140 ASN A CB  1 
ATOM   1103 C  CG  . ASN A 1 140 ? 35.954 20.469 -5.965  1.00 34.31  ? 140 ASN A CG  1 
ATOM   1104 O  OD1 . ASN A 1 140 ? 34.734 20.320 -6.140  1.00 39.39  ? 140 ASN A OD1 1 
ATOM   1105 N  ND2 . ASN A 1 140 ? 36.879 20.250 -6.895  1.00 23.57  ? 140 ASN A ND2 1 
ATOM   1106 N  N   . GLN A 1 141 ? 37.494 20.496 -1.624  1.00 9.72   ? 141 GLN A N   1 
ATOM   1107 C  CA  . GLN A 1 141 ? 38.164 21.036 -0.466  1.00 12.53  ? 141 GLN A CA  1 
ATOM   1108 C  C   . GLN A 1 141 ? 39.252 20.126 0.136   1.00 14.34  ? 141 GLN A C   1 
ATOM   1109 O  O   . GLN A 1 141 ? 40.323 20.605 0.501   1.00 23.57  ? 141 GLN A O   1 
ATOM   1110 C  CB  . GLN A 1 141 ? 37.141 21.312 0.622   1.00 11.85  ? 141 GLN A CB  1 
ATOM   1111 C  CG  . GLN A 1 141 ? 36.282 22.470 0.213   1.00 19.65  ? 141 GLN A CG  1 
ATOM   1112 C  CD  . GLN A 1 141 ? 37.100 23.589 -0.360  1.00 68.21  ? 141 GLN A CD  1 
ATOM   1113 O  OE1 . GLN A 1 141 ? 36.779 24.097 -1.446  1.00 25.53  ? 141 GLN A OE1 1 
ATOM   1114 N  NE2 . GLN A 1 141 ? 38.106 24.014 0.412   1.00 28.71  ? 141 GLN A NE2 1 
ATOM   1115 N  N   . THR A 1 142 ? 38.960 18.831 0.324   1.00 21.59  ? 142 THR A N   1 
ATOM   1116 C  CA  . THR A 1 142 ? 39.920 17.902 0.932   1.00 8.11   ? 142 THR A CA  1 
ATOM   1117 C  C   . THR A 1 142 ? 40.058 16.769 -0.012  1.00 20.43  ? 142 THR A C   1 
ATOM   1118 O  O   . THR A 1 142 ? 39.553 15.693 0.215   1.00 11.64  ? 142 THR A O   1 
ATOM   1119 C  CB  . THR A 1 142 ? 39.425 17.415 2.320   1.00 15.85  ? 142 THR A CB  1 
ATOM   1120 O  OG1 . THR A 1 142 ? 38.126 16.755 2.264   1.00 11.03  ? 142 THR A OG1 1 
ATOM   1121 C  CG2 . THR A 1 142 ? 39.283 18.609 3.268   1.00 4.20   ? 142 THR A CG2 1 
ATOM   1122 N  N   . PRO A 1 143 ? 40.719 17.064 -1.081  1.00 17.01  ? 143 PRO A N   1 
ATOM   1123 C  CA  . PRO A 1 143 ? 40.918 16.121 -2.155  1.00 16.73  ? 143 PRO A CA  1 
ATOM   1124 C  C   . PRO A 1 143 ? 41.692 14.871 -1.805  1.00 10.00  ? 143 PRO A C   1 
ATOM   1125 O  O   . PRO A 1 143 ? 41.345 13.796 -2.266  1.00 14.34  ? 143 PRO A O   1 
ATOM   1126 C  CB  . PRO A 1 143 ? 41.723 16.864 -3.222  1.00 15.36  ? 143 PRO A CB  1 
ATOM   1127 C  CG  . PRO A 1 143 ? 42.060 18.252 -2.646  1.00 13.88  ? 143 PRO A CG  1 
ATOM   1128 C  CD  . PRO A 1 143 ? 41.356 18.387 -1.323  1.00 18.34  ? 143 PRO A CD  1 
ATOM   1129 N  N   . ASN A 1 144 ? 42.798 14.972 -1.059  1.00 16.14  ? 144 ASN A N   1 
ATOM   1130 C  CA  . ASN A 1 144 ? 43.569 13.733 -0.788  1.00 18.66  ? 144 ASN A CA  1 
ATOM   1131 C  C   . ASN A 1 144 ? 42.834 12.724 0.065   1.00 19.39  ? 144 ASN A C   1 
ATOM   1132 O  O   . ASN A 1 144 ? 42.821 11.515 -0.167  1.00 13.50  ? 144 ASN A O   1 
ATOM   1133 C  CB  . ASN A 1 144 ? 44.915 14.012 -0.151  1.00 24.12  ? 144 ASN A CB  1 
ATOM   1134 C  CG  . ASN A 1 144 ? 45.889 14.764 -1.020  1.00 22.24  ? 144 ASN A CG  1 
ATOM   1135 O  OD1 . ASN A 1 144 ? 45.986 14.522 -2.230  1.00 31.54  ? 144 ASN A OD1 1 
ATOM   1136 N  ND2 . ASN A 1 144 ? 46.613 15.682 -0.390  1.00 71.70  ? 144 ASN A ND2 1 
ATOM   1137 N  N   . ARG A 1 145 ? 42.202 13.254 1.067   1.00 13.37  ? 145 ARG A N   1 
ATOM   1138 C  CA  . ARG A 1 145 ? 41.392 12.439 1.945   1.00 12.02  ? 145 ARG A CA  1 
ATOM   1139 C  C   . ARG A 1 145 ? 40.195 11.889 1.160   1.00 19.30  ? 145 ARG A C   1 
ATOM   1140 O  O   . ARG A 1 145 ? 39.892 10.706 1.206   1.00 16.44  ? 145 ARG A O   1 
ATOM   1141 C  CB  . ARG A 1 145 ? 40.941 13.279 3.139   1.00 14.19  ? 145 ARG A CB  1 
ATOM   1142 C  CG  . ARG A 1 145 ? 40.417 12.415 4.286   1.00 24.77  ? 145 ARG A CG  1 
ATOM   1143 C  CD  . ARG A 1 145 ? 39.278 13.041 5.017   1.00 12.78  ? 145 ARG A CD  1 
ATOM   1144 N  NE  . ARG A 1 145 ? 38.664 12.140 5.994   1.00 9.87   ? 145 ARG A NE  1 
ATOM   1145 C  CZ  . ARG A 1 145 ? 38.566 12.540 7.248   1.00 7.68   ? 145 ARG A CZ  1 
ATOM   1146 N  NH1 . ARG A 1 145 ? 39.063 13.723 7.568   1.00 15.96  ? 145 ARG A NH1 1 
ATOM   1147 N  NH2 . ARG A 1 145 ? 37.948 11.798 8.168   1.00 15.55  ? 145 ARG A NH2 1 
ATOM   1148 N  N   . ALA A 1 146 ? 39.509 12.756 0.405   1.00 26.00  ? 146 ALA A N   1 
ATOM   1149 C  CA  . ALA A 1 146 ? 38.387 12.295 -0.377  1.00 7.03   ? 146 ALA A CA  1 
ATOM   1150 C  C   . ALA A 1 146 ? 38.777 11.171 -1.331  1.00 19.28  ? 146 ALA A C   1 
ATOM   1151 O  O   . ALA A 1 146 ? 38.033 10.207 -1.475  1.00 15.43  ? 146 ALA A O   1 
ATOM   1152 C  CB  . ALA A 1 146 ? 37.658 13.414 -1.126  1.00 12.49  ? 146 ALA A CB  1 
ATOM   1153 N  N   . LYS A 1 147 ? 39.941 11.261 -1.978  1.00 16.41  ? 147 LYS A N   1 
ATOM   1154 C  CA  . LYS A 1 147 ? 40.368 10.193 -2.896  1.00 13.19  ? 147 LYS A CA  1 
ATOM   1155 C  C   . LYS A 1 147 ? 40.530 8.858  -2.173  1.00 24.27  ? 147 LYS A C   1 
ATOM   1156 O  O   . LYS A 1 147 ? 40.130 7.814  -2.683  1.00 11.51  ? 147 LYS A O   1 
ATOM   1157 C  CB  . LYS A 1 147 ? 41.624 10.548 -3.668  1.00 20.65  ? 147 LYS A CB  1 
ATOM   1158 C  CG  . LYS A 1 147 ? 41.463 11.877 -4.384  1.00 49.41  ? 147 LYS A CG  1 
ATOM   1159 C  CD  . LYS A 1 147 ? 42.551 12.189 -5.410  1.00 29.95  ? 147 LYS A CD  1 
ATOM   1160 C  CE  . LYS A 1 147 ? 42.679 13.681 -5.770  1.00 56.32  ? 147 LYS A CE  1 
ATOM   1161 N  NZ  . LYS A 1 147 ? 42.796 13.968 -7.221  1.00 100.00 ? 147 LYS A NZ  1 
ATOM   1162 N  N   . ARG A 1 148 ? 41.063 8.898  -0.952  1.00 10.47  ? 148 ARG A N   1 
ATOM   1163 C  CA  . ARG A 1 148 ? 41.197 7.699  -0.183  1.00 17.01  ? 148 ARG A CA  1 
ATOM   1164 C  C   . ARG A 1 148 ? 39.847 7.036  0.108   1.00 11.02  ? 148 ARG A C   1 
ATOM   1165 O  O   . ARG A 1 148 ? 39.717 5.805  0.011   1.00 16.37  ? 148 ARG A O   1 
ATOM   1166 C  CB  . ARG A 1 148 ? 41.857 7.981  1.144   1.00 7.16   ? 148 ARG A CB  1 
ATOM   1167 C  CG  . ARG A 1 148 ? 43.336 8.237  0.995   1.00 4.38   ? 148 ARG A CG  1 
ATOM   1168 C  CD  . ARG A 1 148 ? 44.167 8.173  2.261   1.00 11.34  ? 148 ARG A CD  1 
ATOM   1169 N  NE  . ARG A 1 148 ? 43.910 9.291  3.189   1.00 16.94  ? 148 ARG A NE  1 
ATOM   1170 C  CZ  . ARG A 1 148 ? 44.544 10.488 3.155   1.00 17.47  ? 148 ARG A CZ  1 
ATOM   1171 N  NH1 . ARG A 1 148 ? 45.458 10.777 2.219   1.00 16.71  ? 148 ARG A NH1 1 
ATOM   1172 N  NH2 . ARG A 1 148 ? 44.213 11.438 4.036   1.00 21.01  ? 148 ARG A NH2 1 
ATOM   1173 N  N   . VAL A 1 149 ? 38.877 7.835  0.562   1.00 8.90   ? 149 VAL A N   1 
ATOM   1174 C  CA  . VAL A 1 149 ? 37.575 7.304  0.978   1.00 10.71  ? 149 VAL A CA  1 
ATOM   1175 C  C   . VAL A 1 149 ? 36.832 6.743  -0.232  1.00 3.94   ? 149 VAL A C   1 
ATOM   1176 O  O   . VAL A 1 149 ? 36.256 5.647  -0.161  1.00 14.47  ? 149 VAL A O   1 
ATOM   1177 C  CB  . VAL A 1 149 ? 36.750 8.342  1.705   1.00 18.19  ? 149 VAL A CB  1 
ATOM   1178 C  CG1 . VAL A 1 149 ? 35.304 7.875  1.906   1.00 12.20  ? 149 VAL A CG1 1 
ATOM   1179 C  CG2 . VAL A 1 149 ? 37.405 8.618  3.043   1.00 12.47  ? 149 VAL A CG2 1 
ATOM   1180 N  N   . ILE A 1 150 ? 36.992 7.460  -1.349  1.00 15.47  ? 150 ILE A N   1 
ATOM   1181 C  CA  . ILE A 1 150 ? 36.437 7.098  -2.637  1.00 9.56   ? 150 ILE A CA  1 
ATOM   1182 C  C   . ILE A 1 150 ? 37.036 5.812  -3.147  1.00 24.12  ? 150 ILE A C   1 
ATOM   1183 O  O   . ILE A 1 150 ? 36.335 4.887  -3.563  1.00 18.54  ? 150 ILE A O   1 
ATOM   1184 C  CB  . ILE A 1 150 ? 36.480 8.220  -3.676  1.00 19.92  ? 150 ILE A CB  1 
ATOM   1185 C  CG1 . ILE A 1 150 ? 35.479 9.296  -3.244  1.00 17.59  ? 150 ILE A CG1 1 
ATOM   1186 C  CG2 . ILE A 1 150 ? 36.107 7.640  -5.078  1.00 10.41  ? 150 ILE A CG2 1 
ATOM   1187 C  CD1 . ILE A 1 150 ? 35.599 10.566 -4.075  1.00 11.39  ? 150 ILE A CD1 1 
ATOM   1188 N  N   . THR A 1 151 ? 38.354 5.717  -3.084  1.00 9.75   ? 151 THR A N   1 
ATOM   1189 C  CA  . THR A 1 151 ? 38.968 4.439  -3.505  1.00 20.55  ? 151 THR A CA  1 
ATOM   1190 C  C   . THR A 1 151 ? 38.454 3.315  -2.651  1.00 19.10  ? 151 THR A C   1 
ATOM   1191 O  O   . THR A 1 151 ? 38.249 2.204  -3.079  1.00 9.02   ? 151 THR A O   1 
ATOM   1192 C  CB  . THR A 1 151 ? 40.448 4.515  -3.249  1.00 19.57  ? 151 THR A CB  1 
ATOM   1193 O  OG1 . THR A 1 151 ? 40.922 5.512  -4.100  1.00 20.10  ? 151 THR A OG1 1 
ATOM   1194 C  CG2 . THR A 1 151 ? 41.123 3.195  -3.564  1.00 28.96  ? 151 THR A CG2 1 
ATOM   1195 N  N   . THR A 1 152 ? 38.272 3.604  -1.390  1.00 11.16  ? 152 THR A N   1 
ATOM   1196 C  CA  . THR A 1 152 ? 37.788 2.571  -0.509  1.00 14.93  ? 152 THR A CA  1 
ATOM   1197 C  C   . THR A 1 152 ? 36.376 2.090  -0.913  1.00 12.41  ? 152 THR A C   1 
ATOM   1198 O  O   . THR A 1 152 ? 36.030 0.900  -0.894  1.00 15.92  ? 152 THR A O   1 
ATOM   1199 C  CB  . THR A 1 152 ? 37.860 3.139  0.934   1.00 4.80   ? 152 THR A CB  1 
ATOM   1200 O  OG1 . THR A 1 152 ? 39.164 3.563  1.196   1.00 10.52  ? 152 THR A OG1 1 
ATOM   1201 C  CG2 . THR A 1 152 ? 37.451 2.122  1.978   1.00 12.12  ? 152 THR A CG2 1 
ATOM   1202 N  N   . PHE A 1 153 ? 35.521 3.014  -1.320  1.00 6.56   ? 153 PHE A N   1 
ATOM   1203 C  CA  . PHE A 1 153 ? 34.179 2.607  -1.729  1.00 8.29   ? 153 PHE A CA  1 
ATOM   1204 C  C   . PHE A 1 153 ? 34.176 1.892  -3.069  1.00 10.22  ? 153 PHE A C   1 
ATOM   1205 O  O   . PHE A 1 153 ? 33.495 0.889  -3.273  1.00 14.65  ? 153 PHE A O   1 
ATOM   1206 C  CB  . PHE A 1 153 ? 33.275 3.836  -1.874  1.00 13.31  ? 153 PHE A CB  1 
ATOM   1207 C  CG  . PHE A 1 153 ? 32.643 4.342  -0.587  1.00 9.72   ? 153 PHE A CG  1 
ATOM   1208 C  CD1 . PHE A 1 153 ? 31.846 3.520  0.215   1.00 13.37  ? 153 PHE A CD1 1 
ATOM   1209 C  CD2 . PHE A 1 153 ? 32.749 5.689  -0.231  1.00 22.61  ? 153 PHE A CD2 1 
ATOM   1210 C  CE1 . PHE A 1 153 ? 31.169 4.008  1.338   1.00 20.87  ? 153 PHE A CE1 1 
ATOM   1211 C  CE2 . PHE A 1 153 ? 32.078 6.179  0.894   1.00 10.28  ? 153 PHE A CE2 1 
ATOM   1212 C  CZ  . PHE A 1 153 ? 31.297 5.344  1.696   1.00 10.01  ? 153 PHE A CZ  1 
ATOM   1213 N  N   . ARG A 1 154 ? 34.968 2.424  -3.963  1.00 13.57  ? 154 ARG A N   1 
ATOM   1214 C  CA  . ARG A 1 154 ? 35.149 1.853  -5.281  1.00 15.07  ? 154 ARG A CA  1 
ATOM   1215 C  C   . ARG A 1 154 ? 35.631 0.421  -5.273  1.00 23.34  ? 154 ARG A C   1 
ATOM   1216 O  O   . ARG A 1 154 ? 35.064 -0.449 -5.941  1.00 27.52  ? 154 ARG A O   1 
ATOM   1217 C  CB  . ARG A 1 154 ? 36.121 2.657  -6.129  1.00 19.64  ? 154 ARG A CB  1 
ATOM   1218 C  CG  . ARG A 1 154 ? 35.725 2.591  -7.603  1.00 14.05  ? 154 ARG A CG  1 
ATOM   1219 C  CD  . ARG A 1 154 ? 36.714 3.133  -8.641  1.00 20.17  ? 154 ARG A CD  1 
ATOM   1220 N  NE  . ARG A 1 154 ? 38.034 3.444  -8.150  1.00 56.50  ? 154 ARG A NE  1 
ATOM   1221 C  CZ  . ARG A 1 154 ? 39.021 2.557  -8.163  1.00 100.00 ? 154 ARG A CZ  1 
ATOM   1222 N  NH1 . ARG A 1 154 ? 38.820 1.320  -8.615  1.00 100.00 ? 154 ARG A NH1 1 
ATOM   1223 N  NH2 . ARG A 1 154 ? 40.230 2.909  -7.714  1.00 100.00 ? 154 ARG A NH2 1 
ATOM   1224 N  N   . THR A 1 155 ? 36.711 0.195  -4.508  1.00 18.29  ? 155 THR A N   1 
ATOM   1225 C  CA  . THR A 1 155 ? 37.364 -1.110 -4.411  1.00 15.99  ? 155 THR A CA  1 
ATOM   1226 C  C   . THR A 1 155 ? 36.926 -2.016 -3.293  1.00 26.26  ? 155 THR A C   1 
ATOM   1227 O  O   . THR A 1 155 ? 37.184 -3.193 -3.329  1.00 34.57  ? 155 THR A O   1 
ATOM   1228 C  CB  . THR A 1 155 ? 38.909 -1.005 -4.341  1.00 12.86  ? 155 THR A CB  1 
ATOM   1229 O  OG1 . THR A 1 155 ? 39.359 -0.485 -3.103  1.00 19.75  ? 155 THR A OG1 1 
ATOM   1230 C  CG2 . THR A 1 155 ? 39.470 -0.183 -5.450  1.00 5.24   ? 155 THR A CG2 1 
ATOM   1231 N  N   . GLY A 1 156 ? 36.356 -1.501 -2.227  1.00 19.27  ? 156 GLY A N   1 
ATOM   1232 C  CA  . GLY A 1 156 ? 36.103 -2.403 -1.163  1.00 10.75  ? 156 GLY A CA  1 
ATOM   1233 C  C   . GLY A 1 156 ? 37.392 -2.942 -0.518  1.00 43.85  ? 156 GLY A C   1 
ATOM   1234 O  O   . GLY A 1 156 ? 37.318 -3.924 0.197   1.00 19.80  ? 156 GLY A O   1 
ATOM   1235 N  N   . THR A 1 157 ? 38.577 -2.308 -0.707  1.00 21.25  ? 157 THR A N   1 
ATOM   1236 C  CA  . THR A 1 157 ? 39.827 -2.776 -0.059  1.00 13.25  ? 157 THR A CA  1 
ATOM   1237 C  C   . THR A 1 157 ? 40.478 -1.641 0.700   1.00 21.47  ? 157 THR A C   1 
ATOM   1238 O  O   . THR A 1 157 ? 40.024 -0.540 0.591   1.00 15.23  ? 157 THR A O   1 
ATOM   1239 C  CB  . THR A 1 157 ? 40.856 -3.169 -1.113  1.00 36.01  ? 157 THR A CB  1 
ATOM   1240 O  OG1 . THR A 1 157 ? 41.188 -1.981 -1.774  1.00 16.22  ? 157 THR A OG1 1 
ATOM   1241 C  CG2 . THR A 1 157 ? 40.314 -4.206 -2.089  1.00 17.17  ? 157 THR A CG2 1 
ATOM   1242 N  N   . TRP A 1 158 ? 41.583 -1.879 1.439   1.00 14.49  ? 158 TRP A N   1 
ATOM   1243 C  CA  . TRP A 1 158 ? 42.215 -0.796 2.171   1.00 9.17   ? 158 TRP A CA  1 
ATOM   1244 C  C   . TRP A 1 158 ? 43.402 -0.238 1.421   1.00 19.35  ? 158 TRP A C   1 
ATOM   1245 O  O   . TRP A 1 158 ? 44.214 0.434  2.018   1.00 20.44  ? 158 TRP A O   1 
ATOM   1246 C  CB  . TRP A 1 158 ? 42.760 -1.300 3.525   1.00 8.74   ? 158 TRP A CB  1 
ATOM   1247 C  CG  . TRP A 1 158 ? 41.637 -1.650 4.491   1.00 14.56  ? 158 TRP A CG  1 
ATOM   1248 C  CD1 . TRP A 1 158 ? 41.212 -2.901 4.823   1.00 9.79   ? 158 TRP A CD1 1 
ATOM   1249 C  CD2 . TRP A 1 158 ? 40.790 -0.743 5.255   1.00 21.82  ? 158 TRP A CD2 1 
ATOM   1250 N  NE1 . TRP A 1 158 ? 40.187 -2.853 5.755   1.00 18.61  ? 158 TRP A NE1 1 
ATOM   1251 C  CE2 . TRP A 1 158 ? 39.913 -1.533 6.051   1.00 20.36  ? 158 TRP A CE2 1 
ATOM   1252 C  CE3 . TRP A 1 158 ? 40.736 0.632  5.392   1.00 17.72  ? 158 TRP A CE3 1 
ATOM   1253 C  CZ2 . TRP A 1 158 ? 38.924 -0.970 6.861   1.00 8.32   ? 158 TRP A CZ2 1 
ATOM   1254 C  CZ3 . TRP A 1 158 ? 39.810 1.162  6.238   1.00 17.46  ? 158 TRP A CZ3 1 
ATOM   1255 C  CH2 . TRP A 1 158 ? 38.928 0.374  6.982   1.00 15.24  ? 158 TRP A CH2 1 
ATOM   1256 N  N   . ASP A 1 159 ? 43.507 -0.548 0.138   1.00 21.29  ? 159 ASP A N   1 
ATOM   1257 C  CA  . ASP A 1 159 ? 44.669 -0.121 -0.608  1.00 15.22  ? 159 ASP A CA  1 
ATOM   1258 C  C   . ASP A 1 159 ? 45.082 1.319  -0.441  1.00 15.41  ? 159 ASP A C   1 
ATOM   1259 O  O   . ASP A 1 159 ? 46.261 1.577  -0.348  1.00 21.15  ? 159 ASP A O   1 
ATOM   1260 C  CB  . ASP A 1 159 ? 44.636 -0.514 -2.072  1.00 25.33  ? 159 ASP A CB  1 
ATOM   1261 C  CG  . ASP A 1 159 ? 44.504 -1.998 -2.335  1.00 60.99  ? 159 ASP A CG  1 
ATOM   1262 O  OD1 . ASP A 1 159 ? 44.931 -2.753 -1.357  1.00 54.23  ? 159 ASP A OD1 1 
ATOM   1263 O  OD2 . ASP A 1 159 ? 44.054 -2.450 -3.374  1.00 65.18  ? 159 ASP A OD2 1 
ATOM   1264 N  N   . ALA A 1 160 ? 44.108 2.260  -0.502  1.00 9.66   ? 160 ALA A N   1 
ATOM   1265 C  CA  . ALA A 1 160 ? 44.419 3.700  -0.402  1.00 14.56  ? 160 ALA A CA  1 
ATOM   1266 C  C   . ALA A 1 160 ? 45.104 3.996  0.912   1.00 19.87  ? 160 ALA A C   1 
ATOM   1267 O  O   . ALA A 1 160 ? 45.806 4.979  1.090   1.00 25.06  ? 160 ALA A O   1 
ATOM   1268 C  CB  . ALA A 1 160 ? 43.129 4.515  -0.477  1.00 16.85  ? 160 ALA A CB  1 
ATOM   1269 N  N   . TYR A 1 161 ? 44.842 3.163  1.881   1.00 18.46  ? 161 TYR A N   1 
ATOM   1270 C  CA  . TYR A 1 161 ? 45.449 3.418  3.173   1.00 15.43  ? 161 TYR A CA  1 
ATOM   1271 C  C   . TYR A 1 161 ? 46.740 2.657  3.360   1.00 55.84  ? 161 TYR A C   1 
ATOM   1272 O  O   . TYR A 1 161 ? 47.378 2.809  4.361   1.00 20.84  ? 161 TYR A O   1 
ATOM   1273 C  CB  . TYR A 1 161 ? 44.472 3.192  4.349   1.00 10.48  ? 161 TYR A CB  1 
ATOM   1274 C  CG  . TYR A 1 161 ? 43.424 4.264  4.356   1.00 19.68  ? 161 TYR A CG  1 
ATOM   1275 C  CD1 . TYR A 1 161 ? 42.355 4.180  3.478   1.00 13.09  ? 161 TYR A CD1 1 
ATOM   1276 C  CD2 . TYR A 1 161 ? 43.533 5.385  5.176   1.00 5.67   ? 161 TYR A CD2 1 
ATOM   1277 C  CE1 . TYR A 1 161 ? 41.381 5.173  3.453   1.00 5.49   ? 161 TYR A CE1 1 
ATOM   1278 C  CE2 . TYR A 1 161 ? 42.556 6.371  5.181   1.00 16.92  ? 161 TYR A CE2 1 
ATOM   1279 C  CZ  . TYR A 1 161 ? 41.486 6.277  4.293   1.00 8.60   ? 161 TYR A CZ  1 
ATOM   1280 O  OH  . TYR A 1 161 ? 40.489 7.270  4.282   1.00 11.34  ? 161 TYR A OH  1 
ATOM   1281 N  N   . LYS A 1 162 ? 47.155 1.845  2.409   1.00 28.49  ? 162 LYS A N   1 
ATOM   1282 C  CA  . LYS A 1 162 ? 48.394 1.126  2.622   1.00 48.05  ? 162 LYS A CA  1 
ATOM   1283 C  C   . LYS A 1 162 ? 49.541 1.750  1.830   1.00 24.52  ? 162 LYS A C   1 
ATOM   1284 O  O   . LYS A 1 162 ? 50.577 2.095  2.411   1.00 50.39  ? 162 LYS A O   1 
ATOM   1285 C  CB  . LYS A 1 162 ? 48.248 -0.380 2.445   1.00 40.00  ? 162 LYS A CB  1 
ATOM   1286 C  CG  . LYS A 1 162 ? 46.987 -0.973 3.098   1.00 89.88  ? 162 LYS A CG  1 
ATOM   1287 C  CD  . LYS A 1 162 ? 46.707 -2.461 2.780   1.00 100.00 ? 162 LYS A CD  1 
ATOM   1288 C  CE  . LYS A 1 162 ? 46.580 -2.795 1.277   1.00 100.00 ? 162 LYS A CE  1 
ATOM   1289 N  NZ  . LYS A 1 162 ? 45.730 -3.966 0.941   1.00 100.00 ? 162 LYS A NZ  1 
HETATM 1290 CL CL  . CL  B 2 .   ? 43.102 16.452 1.826   1.00 25.47  ? 173 CL  A CL  1 
HETATM 1291 CL CL  . CL  C 2 .   ? 31.593 15.179 23.986  0.50 30.12  ? 178 CL  A CL  1 
HETATM 1292 C  C1  . HED D 3 .   ? 31.882 -1.209 15.205  1.00 32.41  ? 170 HED A C1  1 
HETATM 1293 O  O1  . HED D 3 .   ? 33.089 -0.811 15.845  1.00 34.88  ? 170 HED A O1  1 
HETATM 1294 C  C2  . HED D 3 .   ? 31.957 -0.580 13.855  1.00 25.80  ? 170 HED A C2  1 
HETATM 1295 S  S3  . HED D 3 .   ? 33.134 -1.531 12.896  1.00 91.91  ? 170 HED A S3  1 
HETATM 1296 S  S4  . HED D 3 .   ? 32.505 -1.245 10.956  1.00 100.00 ? 170 HED A S4  1 
HETATM 1297 C  C5  . HED D 3 .   ? 32.392 -2.913 10.246  1.00 100.00 ? 170 HED A C5  1 
HETATM 1298 C  C6  . HED D 3 .   ? 33.692 -3.379 9.549   1.00 100.00 ? 170 HED A C6  1 
HETATM 1299 O  O6  . HED D 3 .   ? 34.311 -2.300 8.861   1.00 53.84  ? 170 HED A O6  1 
HETATM 1300 C  C1  . DEN E 4 .   ? 27.860 8.128  4.277   1.00 16.65  ? 400 DEN A C1  1 
HETATM 1301 C  C2  . DEN E 4 .   ? 28.328 8.019  2.898   1.00 18.63  ? 400 DEN A C2  1 
HETATM 1302 C  C3  . DEN E 4 .   ? 27.809 6.754  2.339   1.00 29.41  ? 400 DEN A C3  1 
HETATM 1303 C  C4  . DEN E 4 .   ? 26.331 4.967  3.468   1.00 17.30  ? 400 DEN A C4  1 
HETATM 1304 C  C5  . DEN E 4 .   ? 25.690 4.614  4.635   1.00 16.08  ? 400 DEN A C5  1 
HETATM 1305 C  C6  . DEN E 4 .   ? 25.755 5.385  5.766   1.00 16.62  ? 400 DEN A C6  1 
HETATM 1306 C  C7  . DEN E 4 .   ? 26.440 6.571  5.740   1.00 11.09  ? 400 DEN A C7  1 
HETATM 1307 C  C8  . DEN E 4 .   ? 27.095 6.930  4.569   1.00 17.03  ? 400 DEN A C8  1 
HETATM 1308 C  C9  . DEN E 4 .   ? 27.007 6.143  3.433   1.00 24.14  ? 400 DEN A C9  1 
HETATM 1309 O  O   . HOH F 5 .   ? 37.925 12.491 18.293  1.00 10.82  ? 171 HOH A O   1 
HETATM 1310 O  O   . HOH F 5 .   ? 35.912 18.916 2.727   1.00 19.45  ? 172 HOH A O   1 
HETATM 1311 O  O   . HOH F 5 .   ? 41.803 22.955 1.145   1.00 17.23  ? 174 HOH A O   1 
HETATM 1312 O  O   . HOH F 5 .   ? 41.200 1.977  0.309   1.00 29.42  ? 175 HOH A O   1 
HETATM 1313 O  O   . HOH F 5 .   ? 40.521 26.242 28.681  1.00 53.36  ? 176 HOH A O   1 
HETATM 1314 O  O   . HOH F 5 .   ? 32.782 -7.737 4.534   1.00 35.46  ? 177 HOH A O   1 
HETATM 1315 O  O   . HOH F 5 .   ? 39.968 13.227 19.990  1.00 14.60  ? 179 HOH A O   1 
HETATM 1316 O  O   . HOH F 5 .   ? 44.687 10.583 -1.969  1.00 47.34  ? 180 HOH A O   1 
HETATM 1317 O  O   . HOH F 5 .   ? 27.678 -6.720 4.882   1.00 21.42  ? 181 HOH A O   1 
HETATM 1318 O  O   . HOH F 5 .   ? 32.798 12.821 22.289  1.00 23.55  ? 182 HOH A O   1 
HETATM 1319 O  O   . HOH F 5 .   ? 33.540 11.265 28.925  1.00 26.69  ? 183 HOH A O   1 
HETATM 1320 O  O   . HOH F 5 .   ? 48.141 10.084 28.594  1.00 65.51  ? 184 HOH A O   1 
HETATM 1321 O  O   . HOH F 5 .   ? 30.710 5.458  23.583  1.00 40.15  ? 185 HOH A O   1 
HETATM 1322 O  O   . HOH F 5 .   ? 40.202 5.453  20.704  1.00 40.89  ? 186 HOH A O   1 
HETATM 1323 O  O   . HOH F 5 .   ? 44.863 -3.684 11.583  1.00 50.37  ? 187 HOH A O   1 
HETATM 1324 O  O   . HOH F 5 .   ? 38.915 22.454 -6.999  1.00 35.26  ? 188 HOH A O   1 
HETATM 1325 O  O   . HOH F 5 .   ? 50.218 18.087 19.704  1.00 37.36  ? 189 HOH A O   1 
HETATM 1326 O  O   . HOH F 5 .   ? 35.839 27.429 15.856  1.00 26.17  ? 190 HOH A O   1 
HETATM 1327 O  O   . HOH F 5 .   ? 36.698 29.581 14.096  1.00 34.66  ? 191 HOH A O   1 
HETATM 1328 O  O   . HOH F 5 .   ? 43.715 25.797 9.682   1.00 30.24  ? 192 HOH A O   1 
HETATM 1329 O  O   . HOH F 5 .   ? 19.609 -2.276 3.052   1.00 28.53  ? 193 HOH A O   1 
HETATM 1330 O  O   . HOH F 5 .   ? 35.117 5.097  -11.178 1.00 52.62  ? 194 HOH A O   1 
HETATM 1331 O  O   . HOH F 5 .   ? 36.633 -1.126 10.878  1.00 10.40  ? 195 HOH A O   1 
HETATM 1332 O  O   . HOH F 5 .   ? 45.923 20.497 30.635  1.00 43.71  ? 196 HOH A O   1 
HETATM 1333 O  O   . HOH F 5 .   ? 30.171 25.287 28.108  1.00 26.10  ? 198 HOH A O   1 
HETATM 1334 O  O   . HOH F 5 .   ? 32.386 18.056 22.666  1.00 38.08  ? 200 HOH A O   1 
HETATM 1335 O  O   . HOH F 5 .   ? 29.483 7.858  22.347  1.00 23.49  ? 201 HOH A O   1 
HETATM 1336 O  O   . HOH F 5 .   ? 30.222 12.711 21.165  1.00 59.17  ? 202 HOH A O   1 
HETATM 1337 O  O   . HOH F 5 .   ? 37.215 19.350 13.289  1.00 23.85  ? 203 HOH A O   1 
HETATM 1338 O  O   . HOH F 5 .   ? 39.171 17.694 11.728  1.00 25.71  ? 204 HOH A O   1 
HETATM 1339 O  O   . HOH F 5 .   ? 41.055 16.840 9.387   1.00 74.02  ? 207 HOH A O   1 
HETATM 1340 O  O   . HOH F 5 .   ? 35.592 11.420 4.809   1.00 9.77   ? 208 HOH A O   1 
HETATM 1341 O  O   . HOH F 5 .   ? 42.681 16.562 4.865   1.00 40.81  ? 209 HOH A O   1 
HETATM 1342 O  O   . HOH F 5 .   ? 34.910 -5.568 0.807   1.00 29.95  ? 210 HOH A O   1 
HETATM 1343 O  O   . HOH F 5 .   ? 46.659 9.799  0.108   1.00 31.99  ? 211 HOH A O   1 
HETATM 1344 O  O   . HOH F 5 .   ? 25.542 -1.692 -1.324  1.00 21.86  ? 213 HOH A O   1 
HETATM 1345 O  O   . HOH F 5 .   ? 22.132 -3.484 -1.898  1.00 52.79  ? 214 HOH A O   1 
HETATM 1346 O  O   . HOH F 5 .   ? 32.922 14.074 26.427  1.00 17.29  ? 215 HOH A O   1 
HETATM 1347 O  O   . HOH F 5 .   ? 36.511 9.697  -8.555  1.00 31.19  ? 216 HOH A O   1 
HETATM 1348 O  O   . HOH F 5 .   ? 34.069 -1.866 -9.643  1.00 39.36  ? 217 HOH A O   1 
HETATM 1349 O  O   . HOH F 5 .   ? 28.106 8.403  -12.201 1.00 54.23  ? 218 HOH A O   1 
HETATM 1350 O  O   . HOH F 5 .   ? 27.379 11.592 -11.550 1.00 20.28  ? 219 HOH A O   1 
HETATM 1351 O  O   . HOH F 5 .   ? 34.758 17.612 -8.875  1.00 35.47  ? 220 HOH A O   1 
HETATM 1352 O  O   . HOH F 5 .   ? 44.841 6.318  18.385  1.00 52.98  ? 221 HOH A O   1 
HETATM 1353 O  O   . HOH F 5 .   ? 28.646 25.487 18.226  1.00 56.59  ? 222 HOH A O   1 
HETATM 1354 O  O   . HOH F 5 .   ? 42.156 -4.611 12.717  1.00 25.56  ? 223 HOH A O   1 
HETATM 1355 O  O   . HOH F 5 .   ? 36.324 16.787 12.767  1.00 23.53  ? 224 HOH A O   1 
HETATM 1356 O  O   . HOH F 5 .   ? 34.216 17.609 11.858  1.00 63.37  ? 225 HOH A O   1 
HETATM 1357 O  O   . HOH F 5 .   ? 22.944 -2.850 11.331  1.00 32.82  ? 226 HOH A O   1 
HETATM 1358 O  O   . HOH F 5 .   ? 49.086 7.258  11.631  1.00 57.08  ? 227 HOH A O   1 
HETATM 1359 O  O   . HOH F 5 .   ? 41.910 17.091 11.827  1.00 28.12  ? 229 HOH A O   1 
HETATM 1360 O  O   . HOH F 5 .   ? 43.295 14.073 6.093   1.00 22.52  ? 230 HOH A O   1 
HETATM 1361 O  O   . HOH F 5 .   ? 42.555 -4.631 1.542   1.00 29.37  ? 231 HOH A O   1 
HETATM 1362 O  O   . HOH F 5 .   ? 46.620 6.744  -1.054  1.00 34.67  ? 232 HOH A O   1 
HETATM 1363 O  O   . HOH F 5 .   ? 44.454 7.069  -3.011  1.00 54.62  ? 233 HOH A O   1 
HETATM 1364 O  O   . HOH F 5 .   ? 31.022 -0.113 -11.212 1.00 27.79  ? 235 HOH A O   1 
HETATM 1365 O  O   . HOH F 5 .   ? 45.676 19.611 11.154  1.00 60.78  ? 236 HOH A O   1 
HETATM 1366 O  O   . HOH F 5 .   ? 40.341 16.301 6.683   1.00 34.80  ? 237 HOH A O   1 
HETATM 1367 O  O   . HOH F 5 .   ? 34.897 -2.402 -7.572  1.00 17.84  ? 238 HOH A O   1 
HETATM 1368 O  O   . HOH F 5 .   ? 35.727 12.294 28.666  1.00 39.15  ? 239 HOH A O   1 
HETATM 1369 O  O   . HOH F 5 .   ? 43.568 5.232  25.418  1.00 29.53  ? 240 HOH A O   1 
HETATM 1370 O  O   . HOH F 5 .   ? 24.885 9.262  17.693  1.00 32.01  ? 242 HOH A O   1 
HETATM 1371 O  O   . HOH F 5 .   ? 46.518 4.463  11.919  1.00 37.27  ? 244 HOH A O   1 
HETATM 1372 O  O   . HOH F 5 .   ? 47.453 13.662 2.599   1.00 44.09  ? 245 HOH A O   1 
HETATM 1373 O  O   . HOH F 5 .   ? 29.807 15.593 20.555  1.00 70.28  ? 246 HOH A O   1 
HETATM 1374 O  O   . HOH F 5 .   ? 45.747 25.827 13.482  1.00 51.98  ? 247 HOH A O   1 
HETATM 1375 O  O   . HOH F 5 .   ? 39.414 -5.691 6.661   1.00 36.68  ? 248 HOH A O   1 
HETATM 1376 O  O   . HOH F 5 .   ? 38.830 9.822  -7.366  1.00 49.84  ? 249 HOH A O   1 
HETATM 1377 O  O   . HOH F 5 .   ? 36.103 11.167 -11.034 1.00 48.16  ? 250 HOH A O   1 
HETATM 1378 O  O   . HOH F 5 .   ? 34.013 13.078 -11.366 1.00 33.49  ? 251 HOH A O   1 
HETATM 1379 O  O   . HOH F 5 .   ? 18.298 5.786  1.650   1.00 38.87  ? 253 HOH A O   1 
HETATM 1380 O  O   . HOH F 5 .   ? 36.583 15.975 10.616  1.00 37.32  ? 256 HOH A O   1 
HETATM 1381 O  O   . HOH F 5 .   ? 48.770 26.733 20.791  1.00 71.65  ? 258 HOH A O   1 
HETATM 1382 O  O   . HOH F 5 .   ? 40.954 13.330 32.374  1.00 40.35  ? 259 HOH A O   1 
HETATM 1383 O  O   . HOH F 5 .   ? 39.365 5.416  -6.677  1.00 70.73  ? 261 HOH A O   1 
HETATM 1384 O  O   . HOH F 5 .   ? 34.102 15.498 16.153  1.00 36.01  ? 266 HOH A O   1 
HETATM 1385 O  O   . HOH F 5 .   ? 34.803 15.341 13.669  1.00 32.65  ? 267 HOH A O   1 
HETATM 1386 O  O   . HOH F 5 .   ? 15.953 9.490  10.406  1.00 56.37  ? 268 HOH A O   1 
HETATM 1387 O  O   . HOH F 5 .   ? 44.199 21.770 9.990   1.00 27.07  ? 269 HOH A O   1 
HETATM 1388 O  O   . HOH F 5 .   ? 30.027 18.359 -0.346  1.00 19.35  ? 270 HOH A O   1 
HETATM 1389 O  O   . HOH F 5 .   ? 36.646 7.451  -9.854  1.00 64.01  ? 271 HOH A O   1 
HETATM 1390 O  O   . HOH F 5 .   ? 17.046 13.090 -5.583  1.00 44.29  ? 272 HOH A O   1 
HETATM 1391 O  O   . HOH F 5 .   ? 38.281 -6.767 1.210   1.00 54.77  ? 273 HOH A O   1 
HETATM 1392 O  O   . HOH F 5 .   ? 30.961 11.885 15.736  1.00 41.14  ? 274 HOH A O   1 
HETATM 1393 O  O   . HOH F 5 .   ? 34.030 -4.788 -5.318  1.00 33.20  ? 277 HOH A O   1 
HETATM 1394 O  O   . HOH F 5 .   ? 40.708 26.095 31.533  1.00 50.00  ? 278 HOH A O   1 
HETATM 1395 O  O   . HOH F 5 .   ? 19.718 16.091 -1.535  1.00 69.13  ? 279 HOH A O   1 
HETATM 1396 O  O   . HOH F 5 .   ? 32.487 17.477 18.394  1.00 43.43  ? 280 HOH A O   1 
HETATM 1397 O  O   . HOH F 5 .   ? 31.673 20.772 21.688  1.00 29.95  ? 281 HOH A O   1 
HETATM 1398 O  O   . HOH F 5 .   ? 32.183 19.817 24.626  1.00 37.37  ? 282 HOH A O   1 
HETATM 1399 O  O   . HOH F 5 .   ? 44.302 4.843  16.384  1.00 47.73  ? 283 HOH A O   1 
HETATM 1400 O  O   . HOH F 5 .   ? 49.855 12.851 26.743  1.00 54.69  ? 284 HOH A O   1 
HETATM 1401 O  O   . HOH F 5 .   ? 49.438 16.427 27.522  1.00 63.41  ? 286 HOH A O   1 
HETATM 1402 O  O   . HOH F 5 .   ? 44.103 -1.096 15.830  1.00 31.74  ? 288 HOH A O   1 
HETATM 1403 O  O   . HOH F 5 .   ? 17.461 8.395  -0.840  1.00 72.30  ? 292 HOH A O   1 
HETATM 1404 O  O   . HOH F 5 .   ? 28.723 -1.127 -11.682 1.00 55.29  ? 293 HOH A O   1 
HETATM 1405 O  O   . HOH F 5 .   ? 47.043 3.556  14.493  1.00 52.50  ? 295 HOH A O   1 
HETATM 1406 O  O   . HOH F 5 .   ? 41.625 -6.589 6.008   1.00 32.35  ? 296 HOH A O   1 
HETATM 1407 O  O   . HOH F 5 .   ? 44.188 15.956 14.848  1.00 54.36  ? 298 HOH A O   1 
HETATM 1408 O  O   . HOH F 5 .   ? 32.582 13.829 14.741  1.00 35.00  ? 299 HOH A O   1 
HETATM 1409 O  O   . HOH F 5 .   ? 37.401 19.172 -9.636  1.00 46.08  ? 300 HOH A O   1 
HETATM 1410 O  O   . HOH F 5 .   ? 19.516 6.015  -1.569  1.00 70.81  ? 301 HOH A O   1 
HETATM 1411 O  O   . HOH F 5 .   ? 33.090 19.201 3.075   1.00 56.17  ? 303 HOH A O   1 
HETATM 1412 O  O   . HOH F 5 .   ? 34.669 20.790 10.095  1.00 31.21  ? 306 HOH A O   1 
HETATM 1413 O  O   . HOH F 5 .   ? 38.647 14.698 34.288  1.00 54.50  ? 308 HOH A O   1 
HETATM 1414 O  O   . HOH F 5 .   ? 29.427 1.389  -11.759 1.00 16.04  ? 311 HOH A O   1 
HETATM 1415 O  O   . HOH F 5 .   ? 39.556 11.890 -9.003  1.00 48.36  ? 312 HOH A O   1 
HETATM 1416 O  O   . HOH F 5 .   ? 39.953 8.275  -5.051  1.00 54.82  ? 313 HOH A O   1 
HETATM 1417 O  O   . HOH F 5 .   ? 34.075 19.256 5.352   1.00 65.73  ? 314 HOH A O   1 
HETATM 1418 O  O   . HOH F 5 .   ? 47.032 17.386 30.884  1.00 68.75  ? 317 HOH A O   1 
HETATM 1419 O  O   . HOH F 5 .   ? 38.095 18.550 7.636   1.00 47.39  ? 321 HOH A O   1 
HETATM 1420 O  O   . HOH F 5 .   ? 46.113 17.443 12.620  1.00 36.64  ? 323 HOH A O   1 
HETATM 1421 O  O   . HOH F 5 .   ? 28.196 1.624  20.407  1.00 63.91  ? 324 HOH A O   1 
HETATM 1422 O  O   . HOH F 5 .   ? 39.031 23.878 3.384   1.00 45.40  ? 325 HOH A O   1 
HETATM 1423 O  O   . HOH F 5 .   ? 38.862 30.445 11.401  1.00 39.42  ? 326 HOH A O   1 
HETATM 1424 O  O   . HOH F 5 .   ? 38.478 31.723 15.273  1.00 63.17  ? 328 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ILE 3   3   3   ILE ILE A . n 
A 1 4   PHE 4   4   4   PHE PHE A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   MET 6   6   6   MET MET A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  LEU 13  13  13  LEU LEU A . n 
A 1 14  ARG 14  14  14  ARG ARG A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  TYR 18  18  18  TYR TYR A . n 
A 1 19  LYS 19  19  19  LYS LYS A . n 
A 1 20  ASP 20  20  20  ASP ASP A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  THR 26  26  26  THR THR A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  HIS 31  31  31  HIS HIS A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASP 47  47  47  ASP ASP A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ARG 52  52  52  ARG ARG A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  LEU 66  66  66  LEU LEU A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  ARG 80  80  80  ARG ARG A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  ASP 89  89  89  ASP ASP A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  LEU 91  91  91  LEU LEU A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 MET 102 102 102 MET MET A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 GLN 105 105 105 GLN GLN A . n 
A 1 106 MET 106 106 106 MET MET A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 GLY 113 113 113 GLY GLY A . n 
A 1 114 PHE 114 114 114 PHE PHE A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 MET 120 120 120 MET MET A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ARG 125 125 125 ARG ARG A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 ASN 132 132 132 ASN ASN A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 LYS 135 135 135 LYS LYS A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 TRP 138 138 138 TRP TRP A . n 
A 1 139 TYR 139 139 139 TYR TYR A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ARG 145 145 145 ARG ARG A . n 
A 1 146 ALA 146 146 146 ALA ALA A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 ASN 163 163 ?   ?   ?   A . n 
A 1 164 LEU 164 164 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   173 173 CL  CL  A . 
C 2 CL  1   178 178 CL  CL  A . 
D 3 HED 1   170 170 HED HED A . 
E 4 DEN 1   400 400 DEN DEN A . 
F 5 HOH 1   171 171 HOH HOH A . 
F 5 HOH 2   172 172 HOH HOH A . 
F 5 HOH 3   174 174 HOH HOH A . 
F 5 HOH 4   175 175 HOH HOH A . 
F 5 HOH 5   176 176 HOH HOH A . 
F 5 HOH 6   177 177 HOH HOH A . 
F 5 HOH 7   179 179 HOH HOH A . 
F 5 HOH 8   180 180 HOH HOH A . 
F 5 HOH 9   181 181 HOH HOH A . 
F 5 HOH 10  182 182 HOH HOH A . 
F 5 HOH 11  183 183 HOH HOH A . 
F 5 HOH 12  184 184 HOH HOH A . 
F 5 HOH 13  185 185 HOH HOH A . 
F 5 HOH 14  186 186 HOH HOH A . 
F 5 HOH 15  187 187 HOH HOH A . 
F 5 HOH 16  188 188 HOH HOH A . 
F 5 HOH 17  189 189 HOH HOH A . 
F 5 HOH 18  190 190 HOH HOH A . 
F 5 HOH 19  191 191 HOH HOH A . 
F 5 HOH 20  192 192 HOH HOH A . 
F 5 HOH 21  193 193 HOH HOH A . 
F 5 HOH 22  194 194 HOH HOH A . 
F 5 HOH 23  195 195 HOH HOH A . 
F 5 HOH 24  196 196 HOH HOH A . 
F 5 HOH 25  198 198 HOH HOH A . 
F 5 HOH 26  200 200 HOH HOH A . 
F 5 HOH 27  201 201 HOH HOH A . 
F 5 HOH 28  202 202 HOH HOH A . 
F 5 HOH 29  203 203 HOH HOH A . 
F 5 HOH 30  204 204 HOH HOH A . 
F 5 HOH 31  207 207 HOH HOH A . 
F 5 HOH 32  208 208 HOH HOH A . 
F 5 HOH 33  209 209 HOH HOH A . 
F 5 HOH 34  210 210 HOH HOH A . 
F 5 HOH 35  211 211 HOH HOH A . 
F 5 HOH 36  213 213 HOH HOH A . 
F 5 HOH 37  214 214 HOH HOH A . 
F 5 HOH 38  215 215 HOH HOH A . 
F 5 HOH 39  216 216 HOH HOH A . 
F 5 HOH 40  217 217 HOH HOH A . 
F 5 HOH 41  218 218 HOH HOH A . 
F 5 HOH 42  219 219 HOH HOH A . 
F 5 HOH 43  220 220 HOH HOH A . 
F 5 HOH 44  221 221 HOH HOH A . 
F 5 HOH 45  222 222 HOH HOH A . 
F 5 HOH 46  223 223 HOH HOH A . 
F 5 HOH 47  224 224 HOH HOH A . 
F 5 HOH 48  225 225 HOH HOH A . 
F 5 HOH 49  226 226 HOH HOH A . 
F 5 HOH 50  227 227 HOH HOH A . 
F 5 HOH 51  229 229 HOH HOH A . 
F 5 HOH 52  230 230 HOH HOH A . 
F 5 HOH 53  231 231 HOH HOH A . 
F 5 HOH 54  232 232 HOH HOH A . 
F 5 HOH 55  233 233 HOH HOH A . 
F 5 HOH 56  235 235 HOH HOH A . 
F 5 HOH 57  236 236 HOH HOH A . 
F 5 HOH 58  237 237 HOH HOH A . 
F 5 HOH 59  238 238 HOH HOH A . 
F 5 HOH 60  239 239 HOH HOH A . 
F 5 HOH 61  240 240 HOH HOH A . 
F 5 HOH 62  242 242 HOH HOH A . 
F 5 HOH 63  244 244 HOH HOH A . 
F 5 HOH 64  245 245 HOH HOH A . 
F 5 HOH 65  246 246 HOH HOH A . 
F 5 HOH 66  247 247 HOH HOH A . 
F 5 HOH 67  248 248 HOH HOH A . 
F 5 HOH 68  249 249 HOH HOH A . 
F 5 HOH 69  250 250 HOH HOH A . 
F 5 HOH 70  251 251 HOH HOH A . 
F 5 HOH 71  253 253 HOH HOH A . 
F 5 HOH 72  256 256 HOH HOH A . 
F 5 HOH 73  258 258 HOH HOH A . 
F 5 HOH 74  259 259 HOH HOH A . 
F 5 HOH 75  261 261 HOH HOH A . 
F 5 HOH 76  266 266 HOH HOH A . 
F 5 HOH 77  267 267 HOH HOH A . 
F 5 HOH 78  268 268 HOH HOH A . 
F 5 HOH 79  269 269 HOH HOH A . 
F 5 HOH 80  270 270 HOH HOH A . 
F 5 HOH 81  271 271 HOH HOH A . 
F 5 HOH 82  272 272 HOH HOH A . 
F 5 HOH 83  273 273 HOH HOH A . 
F 5 HOH 84  274 274 HOH HOH A . 
F 5 HOH 85  277 277 HOH HOH A . 
F 5 HOH 86  278 278 HOH HOH A . 
F 5 HOH 87  279 279 HOH HOH A . 
F 5 HOH 88  280 280 HOH HOH A . 
F 5 HOH 89  281 281 HOH HOH A . 
F 5 HOH 90  282 282 HOH HOH A . 
F 5 HOH 91  283 283 HOH HOH A . 
F 5 HOH 92  284 284 HOH HOH A . 
F 5 HOH 93  286 286 HOH HOH A . 
F 5 HOH 94  288 288 HOH HOH A . 
F 5 HOH 95  292 292 HOH HOH A . 
F 5 HOH 96  293 293 HOH HOH A . 
F 5 HOH 97  295 295 HOH HOH A . 
F 5 HOH 98  296 296 HOH HOH A . 
F 5 HOH 99  298 298 HOH HOH A . 
F 5 HOH 100 299 299 HOH HOH A . 
F 5 HOH 101 300 300 HOH HOH A . 
F 5 HOH 102 301 301 HOH HOH A . 
F 5 HOH 103 303 303 HOH HOH A . 
F 5 HOH 104 306 306 HOH HOH A . 
F 5 HOH 105 308 308 HOH HOH A . 
F 5 HOH 106 311 311 HOH HOH A . 
F 5 HOH 107 312 312 HOH HOH A . 
F 5 HOH 108 313 313 HOH HOH A . 
F 5 HOH 109 314 314 HOH HOH A . 
F 5 HOH 110 317 317 HOH HOH A . 
F 5 HOH 111 321 321 HOH HOH A . 
F 5 HOH 112 323 323 HOH HOH A . 
F 5 HOH 113 324 324 HOH HOH A . 
F 5 HOH 114 325 325 HOH HOH A . 
F 5 HOH 115 326 326 HOH HOH A . 
F 5 HOH 116 328 328 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-07-10 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
_software.name             TNT 
_software.classification   refinement 
_software.version          . 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HED 
_pdbx_validate_symm_contact.auth_seq_id_1     170 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O1 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HED 
_pdbx_validate_symm_contact.auth_seq_id_2     170 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_555 
_pdbx_validate_symm_contact.dist              1.77 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             128 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             128 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.319 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.067 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A ASP 10  ? ? CG A ASP 10  ? ? OD2 A ASP 10  ? ? 112.52 118.30 -5.78 0.90 N 
2  1 CB A ASP 20  ? ? CG A ASP 20  ? ? OD1 A ASP 20  ? ? 112.50 118.30 -5.80 0.90 N 
3  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD1 A ASP 47  ? ? 126.46 118.30 8.16  0.90 N 
4  1 CB A ASP 47  ? ? CG A ASP 47  ? ? OD2 A ASP 47  ? ? 111.63 118.30 -6.67 0.90 N 
5  1 CB A ASP 70  ? ? CG A ASP 70  ? ? OD2 A ASP 70  ? ? 111.66 118.30 -6.64 0.90 N 
6  1 CB A ASP 72  ? ? CG A ASP 72  ? ? OD1 A ASP 72  ? ? 109.33 118.30 -8.97 0.90 N 
7  1 CB A ASP 72  ? ? CG A ASP 72  ? ? OD2 A ASP 72  ? ? 123.95 118.30 5.65  0.90 N 
8  1 NE A ARG 76  ? ? CZ A ARG 76  ? ? NH2 A ARG 76  ? ? 117.26 120.30 -3.04 0.50 N 
9  1 NE A ARG 80  ? ? CZ A ARG 80  ? ? NH1 A ARG 80  ? ? 124.76 120.30 4.46  0.50 N 
10 1 CB A ASP 92  ? ? CG A ASP 92  ? ? OD1 A ASP 92  ? ? 112.14 118.30 -6.16 0.90 N 
11 1 NE A ARG 125 ? ? CZ A ARG 125 ? ? NH1 A ARG 125 ? ? 123.89 120.30 3.59  0.50 N 
12 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD1 A ASP 127 ? ? 126.43 118.30 8.13  0.90 N 
13 1 CB A ASP 127 ? ? CG A ASP 127 ? ? OD2 A ASP 127 ? ? 112.25 118.30 -6.05 0.90 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ILE 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     29 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -102.57 
_pdbx_validate_torsion.psi             73.16 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASN 163 ? A ASN 163 
2 1 Y 1 A LEU 164 ? A LEU 164 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'             CL  
3 '2-HYDROXYETHYL DISULFIDE' HED 
4 INDENE                     DEN 
5 water                      HOH 
#