data_1A07
# 
_entry.id   1A07 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A07         
WWPDB D_1000170229 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A07 
_pdbx_database_status.recvd_initial_deposition_date   1997-12-09 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shewchuk, L.' 1 
'Jordan, S.'   2 
# 
_citation.id                        primary 
_citation.title                     'Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            36 
_citation.page_first                6283 
_citation.page_last                 6293 
_citation.year                      1997 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9174343 
_citation.pdbx_database_id_DOI      10.1021/bi970019n 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charifson, P.S.' 1  
primary 'Shewchuk, L.M.'  2  
primary 'Rocque, W.'      3  
primary 'Hummel, C.W.'    4  
primary 'Jordan, S.R.'    5  
primary 'Mohr, C.'        6  
primary 'Pacofsky, G.J.'  7  
primary 'Peel, M.R.'      8  
primary 'Rodriguez, M.'   9  
primary 'Sternbach, D.D.' 10 
primary 'Consler, T.G.'   11 
# 
_cell.entry_id           1A07 
_cell.length_a           52.500 
_cell.length_b           67.200 
_cell.length_c           74.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1A07 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'C-SRC TYROSINE KINASE'                    12303.886 2  2.7.1.112 ? 'SH2 DOMAIN' ? 
2 polymer man 'ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)' 555.600   2  ?         ? ?            ? 
3 water   nat water                                      18.015    50 ?         ? ?            ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
;
;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
;
A,B ? 
2 'polypeptide(L)' no yes '(ACE)(PTR)E(DIP)' XYEX C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   SER n 
1 4   ILE n 
1 5   GLN n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   TRP n 
1 10  TYR n 
1 11  PHE n 
1 12  GLY n 
1 13  LYS n 
1 14  ILE n 
1 15  THR n 
1 16  ARG n 
1 17  ARG n 
1 18  GLU n 
1 19  SER n 
1 20  GLU n 
1 21  ARG n 
1 22  LEU n 
1 23  LEU n 
1 24  LEU n 
1 25  ASN n 
1 26  ALA n 
1 27  GLU n 
1 28  ASN n 
1 29  PRO n 
1 30  ARG n 
1 31  GLY n 
1 32  THR n 
1 33  PHE n 
1 34  LEU n 
1 35  VAL n 
1 36  ARG n 
1 37  GLU n 
1 38  SER n 
1 39  GLU n 
1 40  THR n 
1 41  THR n 
1 42  LYS n 
1 43  GLY n 
1 44  ALA n 
1 45  TYR n 
1 46  CYS n 
1 47  LEU n 
1 48  SER n 
1 49  VAL n 
1 50  SER n 
1 51  ASP n 
1 52  PHE n 
1 53  ASP n 
1 54  ASN n 
1 55  ALA n 
1 56  LYS n 
1 57  GLY n 
1 58  LEU n 
1 59  ASN n 
1 60  VAL n 
1 61  LYS n 
1 62  HIS n 
1 63  TYR n 
1 64  LYS n 
1 65  ILE n 
1 66  ARG n 
1 67  LYS n 
1 68  LEU n 
1 69  ASP n 
1 70  SER n 
1 71  GLY n 
1 72  GLY n 
1 73  PHE n 
1 74  TYR n 
1 75  ILE n 
1 76  THR n 
1 77  SER n 
1 78  ARG n 
1 79  THR n 
1 80  GLN n 
1 81  PHE n 
1 82  ASN n 
1 83  SER n 
1 84  LEU n 
1 85  GLN n 
1 86  GLN n 
1 87  LEU n 
1 88  VAL n 
1 89  ALA n 
1 90  TYR n 
1 91  TYR n 
1 92  SER n 
1 93  LYS n 
1 94  HIS n 
1 95  ALA n 
1 96  ASP n 
1 97  GLY n 
1 98  LEU n 
1 99  CYS n 
1 100 HIS n 
1 101 ARG n 
1 102 LEU n 
1 103 THR n 
1 104 THR n 
1 105 VAL n 
1 106 CYS n 
1 107 PRO n 
2 1   ACE n 
2 2   PTR n 
2 3   GLU n 
2 4   DIP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 SRC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 SRC 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP SRC_HUMAN 1 P12931 1 
;GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGP
LAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRES
ERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLC
HRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLR
HEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENL
VCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERG
YRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
;
? 
2 PDB 1A07      2 1A07   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A07 A 2 ? 107 ? P12931 143 ? 248 ? 144 249 
2 1 1A07 B 2 ? 107 ? P12931 143 ? 248 ? 144 249 
3 2 1A07 C 1 ? 4   ? 1A07   100 ? 103 ? 100 103 
4 2 1A07 D 1 ? 4   ? 1A07   100 ? 103 ? 100 103 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'    ?                 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
DIP non-polymer         . DIPENTYLAMINE     ?                 'C10 H23 N'      157.296 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1A07 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   43. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PROTEIN WAS CRYSTALLIZED FROM 0.1 M MES, PH 6.5, 0.05 M CSCL, 30% JEFFAMINE M-600 AT 4 DEGREES C., pH 8.0, temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1993-11 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A07 
_reflns.observed_criterion_sigma_I   1. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             41.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   12012 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         86.2 
_reflns.pdbx_Rmerge_I_obs            0.0930000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17. 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   83. 
_reflns_shell.Rmerge_I_obs           0.1200000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.3 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A07 
_refine.ls_number_reflns_obs                     11141 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               100000. 
_refine.pdbx_data_cutoff_low_absF                0. 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    85. 
_refine.ls_R_factor_obs                          0.1920000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1920000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'PARTIALLY REFINED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1SHD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1639 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               1759 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.128 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.09 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   UNRESTRAINED 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.3 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               79. 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.MTY  TOPH19.MTY  'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.773100 
_struct_ncs_oper.matrix[1][2]   0.287200 
_struct_ncs_oper.matrix[1][3]   -0.565500 
_struct_ncs_oper.matrix[2][1]   0.288900 
_struct_ncs_oper.matrix[2][2]   0.953200 
_struct_ncs_oper.matrix[2][3]   0.089100 
_struct_ncs_oper.matrix[3][1]   0.564700 
_struct_ncs_oper.matrix[3][2]   -0.094500 
_struct_ncs_oper.matrix[3][3]   -0.819900 
_struct_ncs_oper.vector[1]      99.89480 
_struct_ncs_oper.vector[2]      -0.59030 
_struct_ncs_oper.vector[3]      29.96440 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1A07 
_struct.title                     'C-SRC (SH2 DOMAIN) COMPLEXED WITH ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)' 
_struct.pdbx_descriptor           'C-SRC TYROSINE KINASE, ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A07 
_struct_keywords.pdbx_keywords   'COMPLEX (TRANSFERASE/PEPTIDE)' 
_struct_keywords.text            'COMPLEX (TRANSFERASE-PEPTIDE), COMPLEX (TRANSFERASE-PEPTIDE) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 4  ? ALA A 6  ? ILE A 146 ALA A 148 5 ? 3  
HELX_P HELX_P2 2 ARG A 16 ? LEU A 23 ? ARG A 158 LEU A 165 1 ? 8  
HELX_P HELX_P3 3 LEU A 84 ? LYS A 93 ? LEU A 226 LYS A 235 1 ? 10 
HELX_P HELX_P4 4 ARG C 16 ? LEU C 23 ? ARG B 158 LEU B 165 1 ? 8  
HELX_P HELX_P5 5 LEU C 84 ? LYS C 93 ? LEU B 226 LYS B 235 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B ACE 1 C ? ? ? 1_555 B PTR 2 N ? ? C ACE 100 C PTR 101 1_555 ? ? ? ? ? ? ? 1.313 ? 
covale2 covale ? ? B PTR 2 C ? ? ? 1_555 B GLU 3 N ? ? C PTR 101 C GLU 102 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale3 covale ? ? B DIP 4 N ? ? ? 1_555 B GLU 3 C ? ? C DIP 103 C GLU 102 1_555 ? ? ? ? ? ? ? 1.358 ? 
covale4 covale ? ? D ACE 1 C ? ? ? 1_555 D PTR 2 N ? ? D ACE 100 D PTR 101 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale5 covale ? ? D PTR 2 C ? ? ? 1_555 D GLU 3 N ? ? D PTR 101 D GLU 102 1_555 ? ? ? ? ? ? ? 1.308 ? 
covale6 covale ? ? D DIP 4 N ? ? ? 1_555 D GLU 3 C ? ? D DIP 103 D GLU 102 1_555 ? ? ? ? ? ? ? 1.359 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 33 ? GLU A 37 ? PHE A 175 GLU A 179 
A 2 TYR A 45 ? ASP A 53 ? TYR A 187 ASP A 195 
A 3 GLY A 57 ? ILE A 65 ? GLY A 199 ILE A 207 
B 1 PHE A 73 ? THR A 76 ? PHE A 215 THR A 218 
B 2 THR A 79 ? PHE A 81 ? THR A 221 PHE A 223 
C 1 PHE C 33 ? GLU C 37 ? PHE B 175 GLU B 179 
C 2 TYR C 45 ? ASP C 53 ? TYR B 187 ASP B 195 
C 3 GLY C 57 ? ILE C 65 ? GLY B 199 ILE B 207 
D 1 PHE C 73 ? THR C 76 ? PHE B 215 THR B 218 
D 2 THR C 79 ? PHE C 81 ? THR B 221 PHE B 223 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 34 ? O LEU A 176 N SER A 48 ? N SER A 190 
A 2 3 O TYR A 45 ? O TYR A 187 N ILE A 65 ? N ILE A 207 
B 1 2 O PHE A 73 ? O PHE A 215 N PHE A 81 ? N PHE A 223 
C 1 2 O LEU C 34 ? O LEU B 176 N SER C 48 ? N SER B 190 
C 2 3 O TYR C 45 ? O TYR B 187 N ILE C 65 ? N ILE B 207 
D 1 2 O PHE C 73 ? O PHE B 215 N PHE C 81 ? N PHE B 223 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACE C 100' 
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE ACE D 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ARG A 16 ? ARG A 158 . ? 1_555 ? 
2 AC1 2 HOH F .  ? HOH C 501 . ? 1_555 ? 
3 AC2 1 HOH G .  ? HOH B 502 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1A07 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A07 
_atom_sites.fract_transf_matrix[1][1]   0.019048 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014881 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013423 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . SER A 1 3   ? 59.419 26.851  14.790 1.00 42.45 ? 145 SER A N     1 
ATOM   2    C CA    . SER A 1 3   ? 59.809 25.828  15.756 1.00 40.61 ? 145 SER A CA    1 
ATOM   3    C C     . SER A 1 3   ? 58.477 25.569  16.413 1.00 38.55 ? 145 SER A C     1 
ATOM   4    O O     . SER A 1 3   ? 57.853 26.575  16.779 1.00 40.35 ? 145 SER A O     1 
ATOM   5    C CB    . SER A 1 3   ? 60.772 26.331  16.874 1.00 38.66 ? 145 SER A CB    1 
ATOM   6    O OG    . SER A 1 3   ? 61.055 25.395  17.911 1.00 36.74 ? 145 SER A OG    1 
ATOM   7    H HG    . SER A 1 3   ? 61.465 24.613  17.534 1.00 0.00  ? 145 SER A HG    1 
ATOM   8    N N     . ILE A 1 4   ? 58.143 24.292  16.617 1.00 33.41 ? 146 ILE A N     1 
ATOM   9    C CA    . ILE A 1 4   ? 56.881 23.928  17.235 1.00 27.60 ? 146 ILE A CA    1 
ATOM   10   C C     . ILE A 1 4   ? 56.891 24.415  18.688 1.00 23.59 ? 146 ILE A C     1 
ATOM   11   O O     . ILE A 1 4   ? 55.854 24.833  19.173 1.00 22.39 ? 146 ILE A O     1 
ATOM   12   C CB    . ILE A 1 4   ? 56.734 22.333  16.946 1.00 30.14 ? 146 ILE A CB    1 
ATOM   13   C CG1   . ILE A 1 4   ? 55.279 22.032  17.084 1.00 30.95 ? 146 ILE A CG1   1 
ATOM   14   C CG2   . ILE A 1 4   ? 57.440 21.355  17.872 1.00 28.34 ? 146 ILE A CG2   1 
ATOM   15   C CD1   . ILE A 1 4   ? 54.580 22.453  15.804 1.00 32.76 ? 146 ILE A CD1   1 
ATOM   16   H H     . ILE A 1 4   ? 58.764 23.585  16.343 1.00 0.00  ? 146 ILE A H     1 
ATOM   17   N N     . GLN A 1 5   ? 58.053 24.532  19.364 1.00 20.48 ? 147 GLN A N     1 
ATOM   18   C CA    . GLN A 1 5   ? 58.129 24.993  20.746 1.00 21.11 ? 147 GLN A CA    1 
ATOM   19   C C     . GLN A 1 5   ? 57.485 26.340  21.004 1.00 21.02 ? 147 GLN A C     1 
ATOM   20   O O     . GLN A 1 5   ? 56.946 26.567  22.081 1.00 21.73 ? 147 GLN A O     1 
ATOM   21   C CB    . GLN A 1 5   ? 59.561 25.162  21.244 1.00 23.79 ? 147 GLN A CB    1 
ATOM   22   C CG    . GLN A 1 5   ? 60.478 23.951  21.132 1.00 23.76 ? 147 GLN A CG    1 
ATOM   23   C CD    . GLN A 1 5   ? 59.964 22.725  21.865 1.00 24.24 ? 147 GLN A CD    1 
ATOM   24   O OE1   . GLN A 1 5   ? 59.424 22.714  22.962 1.00 25.42 ? 147 GLN A OE1   1 
ATOM   25   N NE2   . GLN A 1 5   ? 60.137 21.578  21.273 1.00 26.37 ? 147 GLN A NE2   1 
ATOM   26   H H     . GLN A 1 5   ? 58.885 24.296  18.905 1.00 0.00  ? 147 GLN A H     1 
ATOM   27   H HE21  . GLN A 1 5   ? 59.811 20.778  21.733 1.00 0.00  ? 147 GLN A HE21  1 
ATOM   28   H HE22  . GLN A 1 5   ? 60.580 21.539  20.400 1.00 0.00  ? 147 GLN A HE22  1 
ATOM   29   N N     . ALA A 1 6   ? 57.585 27.233  20.026 1.00 20.25 ? 148 ALA A N     1 
ATOM   30   C CA    . ALA A 1 6   ? 57.036 28.546  20.162 1.00 19.34 ? 148 ALA A CA    1 
ATOM   31   C C     . ALA A 1 6   ? 55.642 28.622  19.559 1.00 20.48 ? 148 ALA A C     1 
ATOM   32   O O     . ALA A 1 6   ? 55.054 29.698  19.660 1.00 18.85 ? 148 ALA A O     1 
ATOM   33   C CB    . ALA A 1 6   ? 57.933 29.519  19.468 1.00 18.90 ? 148 ALA A CB    1 
ATOM   34   H H     . ALA A 1 6   ? 58.044 26.987  19.196 1.00 0.00  ? 148 ALA A H     1 
ATOM   35   N N     . GLU A 1 7   ? 55.046 27.567  18.971 1.00 20.84 ? 149 GLU A N     1 
ATOM   36   C CA    . GLU A 1 7   ? 53.697 27.671  18.424 1.00 21.16 ? 149 GLU A CA    1 
ATOM   37   C C     . GLU A 1 7   ? 52.673 27.927  19.483 1.00 21.17 ? 149 GLU A C     1 
ATOM   38   O O     . GLU A 1 7   ? 52.790 27.354  20.567 1.00 23.63 ? 149 GLU A O     1 
ATOM   39   C CB    . GLU A 1 7   ? 53.301 26.417  17.712 1.00 23.84 ? 149 GLU A CB    1 
ATOM   40   C CG    . GLU A 1 7   ? 54.220 26.160  16.541 1.00 29.54 ? 149 GLU A CG    1 
ATOM   41   C CD    . GLU A 1 7   ? 54.161 27.163  15.360 1.00 35.85 ? 149 GLU A CD    1 
ATOM   42   O OE1   . GLU A 1 7   ? 53.227 27.986  15.237 1.00 34.11 ? 149 GLU A OE1   1 
ATOM   43   O OE2   . GLU A 1 7   ? 55.062 27.083  14.500 1.00 39.60 ? 149 GLU A OE2   1 
ATOM   44   H H     . GLU A 1 7   ? 55.526 26.715  18.909 1.00 0.00  ? 149 GLU A H     1 
ATOM   45   N N     . GLU A 1 8   ? 51.620 28.703  19.269 1.00 21.47 ? 150 GLU A N     1 
ATOM   46   C CA    . GLU A 1 8   ? 50.749 29.001  20.402 1.00 22.75 ? 150 GLU A CA    1 
ATOM   47   C C     . GLU A 1 8   ? 49.843 27.864  20.810 1.00 19.80 ? 150 GLU A C     1 
ATOM   48   O O     . GLU A 1 8   ? 49.339 27.761  21.915 1.00 17.89 ? 150 GLU A O     1 
ATOM   49   C CB    . GLU A 1 8   ? 49.923 30.223  20.077 1.00 25.48 ? 150 GLU A CB    1 
ATOM   50   C CG    . GLU A 1 8   ? 49.107 30.058  18.810 1.00 36.96 ? 150 GLU A CG    1 
ATOM   51   C CD    . GLU A 1 8   ? 48.158 31.220  18.548 1.00 46.60 ? 150 GLU A CD    1 
ATOM   52   O OE1   . GLU A 1 8   ? 47.722 31.853  19.531 1.00 52.25 ? 150 GLU A OE1   1 
ATOM   53   O OE2   . GLU A 1 8   ? 47.850 31.471  17.370 1.00 49.97 ? 150 GLU A OE2   1 
ATOM   54   H H     . GLU A 1 8   ? 51.432 29.065  18.378 1.00 0.00  ? 150 GLU A H     1 
ATOM   55   N N     . TRP A 1 9   ? 49.599 26.974  19.864 1.00 20.20 ? 151 TRP A N     1 
ATOM   56   C CA    . TRP A 1 9   ? 48.790 25.828  20.155 1.00 17.51 ? 151 TRP A CA    1 
ATOM   57   C C     . TRP A 1 9   ? 49.669 24.674  20.577 1.00 17.83 ? 151 TRP A C     1 
ATOM   58   O O     . TRP A 1 9   ? 49.118 23.612  20.796 1.00 19.34 ? 151 TRP A O     1 
ATOM   59   C CB    . TRP A 1 9   ? 47.991 25.485  18.941 1.00 17.66 ? 151 TRP A CB    1 
ATOM   60   C CG    . TRP A 1 9   ? 48.754 25.570  17.638 1.00 18.97 ? 151 TRP A CG    1 
ATOM   61   C CD1   . TRP A 1 9   ? 48.596 26.674  16.854 1.00 20.87 ? 151 TRP A CD1   1 
ATOM   62   C CD2   . TRP A 1 9   ? 49.660 24.655  17.134 1.00 20.24 ? 151 TRP A CD2   1 
ATOM   63   N NE1   . TRP A 1 9   ? 49.413 26.471  15.847 1.00 21.35 ? 151 TRP A NE1   1 
ATOM   64   C CE2   . TRP A 1 9   ? 50.049 25.304  15.966 1.00 18.42 ? 151 TRP A CE2   1 
ATOM   65   C CE3   . TRP A 1 9   ? 50.200 23.397  17.466 1.00 20.74 ? 151 TRP A CE3   1 
ATOM   66   C CZ2   . TRP A 1 9   ? 50.993 24.724  15.138 1.00 19.27 ? 151 TRP A CZ2   1 
ATOM   67   C CZ3   . TRP A 1 9   ? 51.133 22.815  16.621 1.00 19.30 ? 151 TRP A CZ3   1 
ATOM   68   C CH2   . TRP A 1 9   ? 51.530 23.481  15.464 1.00 19.19 ? 151 TRP A CH2   1 
ATOM   69   H H     . TRP A 1 9   ? 49.971 27.098  18.966 1.00 0.00  ? 151 TRP A H     1 
ATOM   70   H HE1   . TRP A 1 9   ? 49.539 27.095  15.105 1.00 0.00  ? 151 TRP A HE1   1 
ATOM   71   N N     . TYR A 1 10  ? 50.993 24.744  20.685 1.00 15.53 ? 152 TYR A N     1 
ATOM   72   C CA    . TYR A 1 10  ? 51.804 23.632  21.145 1.00 13.43 ? 152 TYR A CA    1 
ATOM   73   C C     . TYR A 1 10  ? 52.105 23.799  22.614 1.00 15.47 ? 152 TYR A C     1 
ATOM   74   O O     . TYR A 1 10  ? 52.640 24.847  22.994 1.00 16.92 ? 152 TYR A O     1 
ATOM   75   C CB    . TYR A 1 10  ? 53.098 23.566  20.358 1.00 14.69 ? 152 TYR A CB    1 
ATOM   76   C CG    . TYR A 1 10  ? 53.900 22.306  20.642 1.00 16.17 ? 152 TYR A CG    1 
ATOM   77   C CD1   . TYR A 1 10  ? 53.394 21.097  20.179 1.00 16.84 ? 152 TYR A CD1   1 
ATOM   78   C CD2   . TYR A 1 10  ? 55.116 22.329  21.347 1.00 17.97 ? 152 TYR A CD2   1 
ATOM   79   C CE1   . TYR A 1 10  ? 54.089 19.928  20.423 1.00 16.13 ? 152 TYR A CE1   1 
ATOM   80   C CE2   . TYR A 1 10  ? 55.817 21.139  21.597 1.00 17.87 ? 152 TYR A CE2   1 
ATOM   81   C CZ    . TYR A 1 10  ? 55.286 19.943  21.116 1.00 18.13 ? 152 TYR A CZ    1 
ATOM   82   O OH    . TYR A 1 10  ? 55.900 18.715  21.255 1.00 19.31 ? 152 TYR A OH    1 
ATOM   83   H H     . TYR A 1 10  ? 51.440 25.582  20.444 1.00 0.00  ? 152 TYR A H     1 
ATOM   84   H HH    . TYR A 1 10  ? 56.730 18.823  21.725 1.00 0.00  ? 152 TYR A HH    1 
ATOM   85   N N     . PHE A 1 11  ? 51.759 22.763  23.436 1.00 14.76 ? 153 PHE A N     1 
ATOM   86   C CA    . PHE A 1 11  ? 51.924 22.761  24.894 1.00 12.81 ? 153 PHE A CA    1 
ATOM   87   C C     . PHE A 1 11  ? 52.890 21.735  25.465 1.00 12.55 ? 153 PHE A C     1 
ATOM   88   O O     . PHE A 1 11  ? 52.887 21.354  26.638 1.00 13.78 ? 153 PHE A O     1 
ATOM   89   C CB    . PHE A 1 11  ? 50.608 22.546  25.566 1.00 14.06 ? 153 PHE A CB    1 
ATOM   90   C CG    . PHE A 1 11  ? 49.689 23.744  25.525 1.00 15.24 ? 153 PHE A CG    1 
ATOM   91   C CD1   . PHE A 1 11  ? 49.143 24.194  24.321 1.00 17.29 ? 153 PHE A CD1   1 
ATOM   92   C CD2   . PHE A 1 11  ? 49.397 24.380  26.721 1.00 15.85 ? 153 PHE A CD2   1 
ATOM   93   C CE1   . PHE A 1 11  ? 48.284 25.294  24.309 1.00 12.98 ? 153 PHE A CE1   1 
ATOM   94   C CE2   . PHE A 1 11  ? 48.537 25.478  26.691 1.00 16.20 ? 153 PHE A CE2   1 
ATOM   95   C CZ    . PHE A 1 11  ? 47.988 25.941  25.500 1.00 13.48 ? 153 PHE A CZ    1 
ATOM   96   H H     . PHE A 1 11  ? 51.373 21.964  23.022 1.00 0.00  ? 153 PHE A H     1 
ATOM   97   N N     . GLY A 1 12  ? 53.789 21.349  24.580 1.00 13.11 ? 154 GLY A N     1 
ATOM   98   C CA    . GLY A 1 12  ? 54.911 20.496  24.871 1.00 15.82 ? 154 GLY A CA    1 
ATOM   99   C C     . GLY A 1 12  ? 54.583 19.183  25.566 1.00 17.59 ? 154 GLY A C     1 
ATOM   100  O O     . GLY A 1 12  ? 53.726 18.420  25.148 1.00 15.89 ? 154 GLY A O     1 
ATOM   101  H H     . GLY A 1 12  ? 53.685 21.666  23.659 1.00 0.00  ? 154 GLY A H     1 
ATOM   102  N N     . LYS A 1 13  ? 55.296 18.988  26.651 1.00 20.51 ? 155 LYS A N     1 
ATOM   103  C CA    . LYS A 1 13  ? 55.187 17.810  27.462 1.00 25.53 ? 155 LYS A CA    1 
ATOM   104  C C     . LYS A 1 13  ? 54.090 17.933  28.501 1.00 26.94 ? 155 LYS A C     1 
ATOM   105  O O     . LYS A 1 13  ? 54.304 17.351  29.569 1.00 28.65 ? 155 LYS A O     1 
ATOM   106  C CB    . LYS A 1 13  ? 56.507 17.574  28.160 1.00 29.64 ? 155 LYS A CB    1 
ATOM   107  C CG    . LYS A 1 13  ? 57.580 17.272  27.178 1.00 36.35 ? 155 LYS A CG    1 
ATOM   108  C CD    . LYS A 1 13  ? 58.952 17.208  27.811 1.00 40.01 ? 155 LYS A CD    1 
ATOM   109  C CE    . LYS A 1 13  ? 59.972 16.722  26.767 1.00 44.90 ? 155 LYS A CE    1 
ATOM   110  N NZ    . LYS A 1 13  ? 59.926 17.523  25.542 1.00 50.12 ? 155 LYS A NZ    1 
ATOM   111  H H     . LYS A 1 13  ? 55.934 19.681  26.920 1.00 0.00  ? 155 LYS A H     1 
ATOM   112  H HZ1   . LYS A 1 13  ? 60.140 18.515  25.768 1.00 0.00  ? 155 LYS A HZ1   1 
ATOM   113  H HZ2   . LYS A 1 13  ? 60.628 17.162  24.865 1.00 0.00  ? 155 LYS A HZ2   1 
ATOM   114  H HZ3   . LYS A 1 13  ? 58.977 17.460  25.122 1.00 0.00  ? 155 LYS A HZ3   1 
ATOM   115  N N     . ILE A 1 14  ? 52.974 18.686  28.408 1.00 26.33 ? 156 ILE A N     1 
ATOM   116  C CA    . ILE A 1 14  ? 52.025 18.588  29.514 1.00 22.63 ? 156 ILE A CA    1 
ATOM   117  C C     . ILE A 1 14  ? 51.308 17.215  29.525 1.00 22.48 ? 156 ILE A C     1 
ATOM   118  O O     . ILE A 1 14  ? 51.151 16.533  28.506 1.00 20.98 ? 156 ILE A O     1 
ATOM   119  C CB    . ILE A 1 14  ? 51.019 19.746  29.469 1.00 20.60 ? 156 ILE A CB    1 
ATOM   120  C CG1   . ILE A 1 14  ? 50.130 19.707  28.271 1.00 22.12 ? 156 ILE A CG1   1 
ATOM   121  C CG2   . ILE A 1 14  ? 51.829 21.036  29.497 1.00 25.97 ? 156 ILE A CG2   1 
ATOM   122  C CD1   . ILE A 1 14  ? 48.899 20.585  28.592 1.00 26.47 ? 156 ILE A CD1   1 
ATOM   123  H H     . ILE A 1 14  ? 52.809 19.269  27.638 1.00 0.00  ? 156 ILE A H     1 
ATOM   124  N N     . THR A 1 15  ? 50.861 16.785  30.710 1.00 19.99 ? 157 THR A N     1 
ATOM   125  C CA    . THR A 1 15  ? 50.274 15.465  30.860 1.00 20.26 ? 157 THR A CA    1 
ATOM   126  C C     . THR A 1 15  ? 48.885 15.410  30.251 1.00 20.86 ? 157 THR A C     1 
ATOM   127  O O     . THR A 1 15  ? 48.306 16.444  29.932 1.00 23.34 ? 157 THR A O     1 
ATOM   128  C CB    . THR A 1 15  ? 50.230 15.087  32.383 1.00 17.94 ? 157 THR A CB    1 
ATOM   129  O OG1   . THR A 1 15  ? 49.374 16.047  33.026 1.00 21.75 ? 157 THR A OG1   1 
ATOM   130  C CG2   . THR A 1 15  ? 51.606 15.036  33.014 1.00 10.88 ? 157 THR A CG2   1 
ATOM   131  H H     . THR A 1 15  ? 50.931 17.372  31.492 1.00 0.00  ? 157 THR A H     1 
ATOM   132  H HG1   . THR A 1 15  ? 49.733 16.929  32.905 1.00 0.00  ? 157 THR A HG1   1 
ATOM   133  N N     . ARG A 1 16  ? 48.300 14.244  30.006 1.00 20.61 ? 158 ARG A N     1 
ATOM   134  C CA    . ARG A 1 16  ? 46.921 14.080  29.592 1.00 19.28 ? 158 ARG A CA    1 
ATOM   135  C C     . ARG A 1 16  ? 46.052 14.741  30.634 1.00 19.33 ? 158 ARG A C     1 
ATOM   136  O O     . ARG A 1 16  ? 45.161 15.485  30.219 1.00 22.50 ? 158 ARG A O     1 
ATOM   137  C CB    . ARG A 1 16  ? 46.533 12.594  29.497 1.00 18.13 ? 158 ARG A CB    1 
ATOM   138  C CG    . ARG A 1 16  ? 45.036 12.350  29.435 1.00 16.05 ? 158 ARG A CG    1 
ATOM   139  C CD    . ARG A 1 16  ? 44.707 10.852  29.582 1.00 19.03 ? 158 ARG A CD    1 
ATOM   140  N NE    . ARG A 1 16  ? 45.031 10.349  28.279 1.00 24.90 ? 158 ARG A NE    1 
ATOM   141  C CZ    . ARG A 1 16  ? 44.099 9.976   27.414 1.00 24.01 ? 158 ARG A CZ    1 
ATOM   142  N NH1   . ARG A 1 16  ? 42.778 10.011  27.692 1.00 23.05 ? 158 ARG A NH1   1 
ATOM   143  N NH2   . ARG A 1 16  ? 44.553 9.641   26.222 1.00 27.34 ? 158 ARG A NH2   1 
ATOM   144  H H     . ARG A 1 16  ? 48.840 13.435  30.113 1.00 0.00  ? 158 ARG A H     1 
ATOM   145  H HE    . ARG A 1 16  ? 45.973 10.279  28.019 1.00 0.00  ? 158 ARG A HE    1 
ATOM   146  H HH11  . ARG A 1 16  ? 42.463 10.330  28.586 1.00 0.00  ? 158 ARG A HH11  1 
ATOM   147  H HH12  . ARG A 1 16  ? 42.114 9.718   27.004 1.00 0.00  ? 158 ARG A HH12  1 
ATOM   148  H HH21  . ARG A 1 16  ? 45.534 9.681   26.031 1.00 0.00  ? 158 ARG A HH21  1 
ATOM   149  H HH22  . ARG A 1 16  ? 43.916 9.347   25.509 1.00 0.00  ? 158 ARG A HH22  1 
ATOM   150  N N     . ARG A 1 17  ? 46.324 14.543  31.931 1.00 19.25 ? 159 ARG A N     1 
ATOM   151  C CA    . ARG A 1 17  ? 45.527 15.115  33.000 1.00 20.59 ? 159 ARG A CA    1 
ATOM   152  C C     . ARG A 1 17  ? 45.589 16.655  33.015 1.00 23.49 ? 159 ARG A C     1 
ATOM   153  O O     . ARG A 1 17  ? 44.563 17.351  33.068 1.00 23.09 ? 159 ARG A O     1 
ATOM   154  C CB    . ARG A 1 17  ? 46.030 14.527  34.304 1.00 18.44 ? 159 ARG A CB    1 
ATOM   155  C CG    . ARG A 1 17  ? 45.218 15.023  35.472 1.00 17.93 ? 159 ARG A CG    1 
ATOM   156  C CD    . ARG A 1 17  ? 45.841 14.773  36.803 1.00 22.11 ? 159 ARG A CD    1 
ATOM   157  N NE    . ARG A 1 17  ? 45.219 15.578  37.859 1.00 25.37 ? 159 ARG A NE    1 
ATOM   158  C CZ    . ARG A 1 17  ? 45.785 15.757  39.057 1.00 30.24 ? 159 ARG A CZ    1 
ATOM   159  N NH1   . ARG A 1 17  ? 46.963 15.162  39.287 1.00 29.99 ? 159 ARG A NH1   1 
ATOM   160  N NH2   . ARG A 1 17  ? 45.226 16.586  39.973 1.00 30.05 ? 159 ARG A NH2   1 
ATOM   161  H H     . ARG A 1 17  ? 47.095 13.987  32.168 1.00 0.00  ? 159 ARG A H     1 
ATOM   162  H HE    . ARG A 1 17  ? 44.354 16.002  37.680 1.00 0.00  ? 159 ARG A HE    1 
ATOM   163  H HH11  . ARG A 1 17  ? 47.390 14.606  38.574 1.00 0.00  ? 159 ARG A HH11  1 
ATOM   164  H HH12  . ARG A 1 17  ? 47.415 15.274  40.172 1.00 0.00  ? 159 ARG A HH12  1 
ATOM   165  H HH21  . ARG A 1 17  ? 44.380 17.073  39.756 1.00 0.00  ? 159 ARG A HH21  1 
ATOM   166  H HH22  . ARG A 1 17  ? 45.660 16.711  40.865 1.00 0.00  ? 159 ARG A HH22  1 
ATOM   167  N N     . GLU A 1 18  ? 46.775 17.234  32.875 1.00 25.14 ? 160 GLU A N     1 
ATOM   168  C CA    . GLU A 1 18  ? 46.859 18.695  32.848 1.00 27.36 ? 160 GLU A CA    1 
ATOM   169  C C     . GLU A 1 18  ? 46.228 19.274  31.587 1.00 23.92 ? 160 GLU A C     1 
ATOM   170  O O     . GLU A 1 18  ? 45.628 20.342  31.617 1.00 20.38 ? 160 GLU A O     1 
ATOM   171  C CB    . GLU A 1 18  ? 48.344 19.101  33.004 1.00 31.44 ? 160 GLU A CB    1 
ATOM   172  C CG    . GLU A 1 18  ? 48.635 20.593  33.101 1.00 42.48 ? 160 GLU A CG    1 
ATOM   173  C CD    . GLU A 1 18  ? 47.779 21.448  34.045 1.00 47.98 ? 160 GLU A CD    1 
ATOM   174  O OE1   . GLU A 1 18  ? 47.716 21.265  35.276 1.00 49.57 ? 160 GLU A OE1   1 
ATOM   175  O OE2   . GLU A 1 18  ? 47.171 22.382  33.523 1.00 52.22 ? 160 GLU A OE2   1 
ATOM   176  H H     . GLU A 1 18  ? 47.585 16.689  32.791 1.00 0.00  ? 160 GLU A H     1 
ATOM   177  N N     . SER A 1 19  ? 46.194 18.530  30.471 1.00 23.34 ? 161 SER A N     1 
ATOM   178  C CA    . SER A 1 19  ? 45.571 19.045  29.261 1.00 24.06 ? 161 SER A CA    1 
ATOM   179  C C     . SER A 1 19  ? 44.065 19.187  29.434 1.00 22.08 ? 161 SER A C     1 
ATOM   180  O O     . SER A 1 19  ? 43.423 20.168  29.025 1.00 20.57 ? 161 SER A O     1 
ATOM   181  C CB    . SER A 1 19  ? 45.889 18.124  28.034 1.00 24.94 ? 161 SER A CB    1 
ATOM   182  O OG    . SER A 1 19  ? 45.121 16.926  27.818 1.00 31.30 ? 161 SER A OG    1 
ATOM   183  H H     . SER A 1 19  ? 46.591 17.634  30.471 1.00 0.00  ? 161 SER A H     1 
ATOM   184  H HG    . SER A 1 19  ? 45.440 16.479  27.031 1.00 0.00  ? 161 SER A HG    1 
ATOM   185  N N     . GLU A 1 20  ? 43.488 18.184  30.080 1.00 22.26 ? 162 GLU A N     1 
ATOM   186  C CA    . GLU A 1 20  ? 42.075 18.255  30.337 1.00 22.14 ? 162 GLU A CA    1 
ATOM   187  C C     . GLU A 1 20  ? 41.801 19.380  31.302 1.00 22.14 ? 162 GLU A C     1 
ATOM   188  O O     . GLU A 1 20  ? 40.854 20.109  31.057 1.00 25.22 ? 162 GLU A O     1 
ATOM   189  C CB    . GLU A 1 20  ? 41.554 16.968  30.926 1.00 20.67 ? 162 GLU A CB    1 
ATOM   190  C CG    . GLU A 1 20  ? 41.762 15.829  29.958 1.00 24.39 ? 162 GLU A CG    1 
ATOM   191  C CD    . GLU A 1 20  ? 41.059 14.510  30.278 1.00 26.80 ? 162 GLU A CD    1 
ATOM   192  O OE1   . GLU A 1 20  ? 40.531 14.369  31.370 1.00 29.02 ? 162 GLU A OE1   1 
ATOM   193  O OE2   . GLU A 1 20  ? 41.047 13.599  29.439 1.00 25.18 ? 162 GLU A OE2   1 
ATOM   194  H H     . GLU A 1 20  ? 44.013 17.411  30.376 1.00 0.00  ? 162 GLU A H     1 
ATOM   195  N N     . ARG A 1 21  ? 42.621 19.646  32.317 1.00 24.38 ? 163 ARG A N     1 
ATOM   196  C CA    . ARG A 1 21  ? 42.354 20.709  33.241 1.00 25.79 ? 163 ARG A CA    1 
ATOM   197  C C     . ARG A 1 21  ? 42.343 22.026  32.516 1.00 27.10 ? 163 ARG A C     1 
ATOM   198  O O     . ARG A 1 21  ? 41.605 22.936  32.890 1.00 31.55 ? 163 ARG A O     1 
ATOM   199  C CB    . ARG A 1 21  ? 43.394 20.754  34.293 1.00 28.14 ? 163 ARG A CB    1 
ATOM   200  C CG    . ARG A 1 21  ? 42.867 21.615  35.438 1.00 37.47 ? 163 ARG A CG    1 
ATOM   201  C CD    . ARG A 1 21  ? 43.812 21.723  36.650 1.00 47.04 ? 163 ARG A CD    1 
ATOM   202  N NE    . ARG A 1 21  ? 45.139 22.252  36.310 1.00 55.23 ? 163 ARG A NE    1 
ATOM   203  C CZ    . ARG A 1 21  ? 45.371 23.507  35.883 1.00 59.41 ? 163 ARG A CZ    1 
ATOM   204  N NH1   . ARG A 1 21  ? 44.365 24.384  35.725 1.00 60.87 ? 163 ARG A NH1   1 
ATOM   205  N NH2   . ARG A 1 21  ? 46.628 23.844  35.602 1.00 60.66 ? 163 ARG A NH2   1 
ATOM   206  H H     . ARG A 1 21  ? 43.427 19.101  32.435 1.00 0.00  ? 163 ARG A H     1 
ATOM   207  H HE    . ARG A 1 21  ? 45.907 21.651  36.400 1.00 0.00  ? 163 ARG A HE    1 
ATOM   208  H HH11  . ARG A 1 21  ? 43.425 24.108  35.926 1.00 0.00  ? 163 ARG A HH11  1 
ATOM   209  H HH12  . ARG A 1 21  ? 44.556 25.312  35.407 1.00 0.00  ? 163 ARG A HH12  1 
ATOM   210  H HH21  . ARG A 1 21  ? 47.362 23.173  35.711 1.00 0.00  ? 163 ARG A HH21  1 
ATOM   211  H HH22  . ARG A 1 21  ? 46.838 24.768  35.282 1.00 0.00  ? 163 ARG A HH22  1 
ATOM   212  N N     . LEU A 1 22  ? 43.135 22.155  31.466 1.00 27.34 ? 164 LEU A N     1 
ATOM   213  C CA    . LEU A 1 22  ? 43.154 23.373  30.684 1.00 24.71 ? 164 LEU A CA    1 
ATOM   214  C C     . LEU A 1 22  ? 41.943 23.471  29.787 1.00 24.55 ? 164 LEU A C     1 
ATOM   215  O O     . LEU A 1 22  ? 41.271 24.506  29.765 1.00 22.75 ? 164 LEU A O     1 
ATOM   216  C CB    . LEU A 1 22  ? 44.440 23.416  29.849 1.00 25.51 ? 164 LEU A CB    1 
ATOM   217  C CG    . LEU A 1 22  ? 45.776 23.698  30.548 1.00 26.13 ? 164 LEU A CG    1 
ATOM   218  C CD1   . LEU A 1 22  ? 46.957 23.469  29.653 1.00 28.71 ? 164 LEU A CD1   1 
ATOM   219  C CD2   . LEU A 1 22  ? 45.829 25.145  30.879 1.00 28.09 ? 164 LEU A CD2   1 
ATOM   220  H H     . LEU A 1 22  ? 43.721 21.412  31.212 1.00 0.00  ? 164 LEU A H     1 
ATOM   221  N N     . LEU A 1 23  ? 41.591 22.400  29.068 1.00 25.13 ? 165 LEU A N     1 
ATOM   222  C CA    . LEU A 1 23  ? 40.524 22.500  28.091 1.00 21.58 ? 165 LEU A CA    1 
ATOM   223  C C     . LEU A 1 23  ? 39.122 22.485  28.600 1.00 23.62 ? 165 LEU A C     1 
ATOM   224  O O     . LEU A 1 23  ? 38.230 23.101  28.023 1.00 24.78 ? 165 LEU A O     1 
ATOM   225  C CB    . LEU A 1 23  ? 40.694 21.401  27.092 1.00 20.24 ? 165 LEU A CB    1 
ATOM   226  C CG    . LEU A 1 23  ? 41.918 21.456  26.267 1.00 15.77 ? 165 LEU A CG    1 
ATOM   227  C CD1   . LEU A 1 23  ? 42.047 20.220  25.488 1.00 16.87 ? 165 LEU A CD1   1 
ATOM   228  C CD2   . LEU A 1 23  ? 41.831 22.600  25.357 1.00 16.43 ? 165 LEU A CD2   1 
ATOM   229  H H     . LEU A 1 23  ? 42.054 21.547  29.201 1.00 0.00  ? 165 LEU A H     1 
ATOM   230  N N     . LEU A 1 24  ? 38.939 21.844  29.721 1.00 27.47 ? 166 LEU A N     1 
ATOM   231  C CA    . LEU A 1 24  ? 37.649 21.623  30.338 1.00 32.90 ? 166 LEU A CA    1 
ATOM   232  C C     . LEU A 1 24  ? 37.295 22.855  31.159 1.00 36.36 ? 166 LEU A C     1 
ATOM   233  O O     . LEU A 1 24  ? 37.445 22.923  32.370 1.00 39.61 ? 166 LEU A O     1 
ATOM   234  C CB    . LEU A 1 24  ? 37.860 20.358  31.144 1.00 32.90 ? 166 LEU A CB    1 
ATOM   235  C CG    . LEU A 1 24  ? 36.783 19.361  31.440 1.00 33.97 ? 166 LEU A CG    1 
ATOM   236  C CD1   . LEU A 1 24  ? 36.121 18.955  30.174 1.00 33.04 ? 166 LEU A CD1   1 
ATOM   237  C CD2   . LEU A 1 24  ? 37.395 18.124  32.052 1.00 34.84 ? 166 LEU A CD2   1 
ATOM   238  H H     . LEU A 1 24  ? 39.729 21.488  30.177 1.00 0.00  ? 166 LEU A H     1 
ATOM   239  N N     . ASN A 1 25  ? 36.819 23.898  30.535 1.00 40.51 ? 167 ASN A N     1 
ATOM   240  C CA    . ASN A 1 25  ? 36.569 25.138  31.238 1.00 41.57 ? 167 ASN A CA    1 
ATOM   241  C C     . ASN A 1 25  ? 35.540 25.857  30.413 1.00 41.04 ? 167 ASN A C     1 
ATOM   242  O O     . ASN A 1 25  ? 35.646 26.011  29.200 1.00 42.84 ? 167 ASN A O     1 
ATOM   243  C CB    . ASN A 1 25  ? 37.901 25.896  31.343 1.00 45.48 ? 167 ASN A CB    1 
ATOM   244  C CG    . ASN A 1 25  ? 37.798 27.359  31.700 1.00 49.98 ? 167 ASN A CG    1 
ATOM   245  O OD1   . ASN A 1 25  ? 36.725 27.903  31.924 1.00 55.11 ? 167 ASN A OD1   1 
ATOM   246  N ND2   . ASN A 1 25  ? 38.869 28.123  31.723 1.00 55.78 ? 167 ASN A ND2   1 
ATOM   247  H H     . ASN A 1 25  ? 36.628 23.840  29.576 1.00 0.00  ? 167 ASN A H     1 
ATOM   248  H HD21  . ASN A 1 25  ? 38.747 29.065  31.961 1.00 0.00  ? 167 ASN A HD21  1 
ATOM   249  H HD22  . ASN A 1 25  ? 39.746 27.744  31.507 1.00 0.00  ? 167 ASN A HD22  1 
ATOM   250  N N     . ALA A 1 26  ? 34.543 26.307  31.143 1.00 40.22 ? 168 ALA A N     1 
ATOM   251  C CA    . ALA A 1 26  ? 33.392 26.996  30.642 1.00 38.90 ? 168 ALA A CA    1 
ATOM   252  C C     . ALA A 1 26  ? 33.643 28.066  29.647 1.00 39.95 ? 168 ALA A C     1 
ATOM   253  O O     . ALA A 1 26  ? 32.782 28.302  28.806 1.00 42.88 ? 168 ALA A O     1 
ATOM   254  C CB    . ALA A 1 26  ? 32.668 27.647  31.753 1.00 42.31 ? 168 ALA A CB    1 
ATOM   255  H H     . ALA A 1 26  ? 34.592 26.159  32.109 1.00 0.00  ? 168 ALA A H     1 
ATOM   256  N N     . GLU A 1 27  ? 34.777 28.735  29.789 1.00 40.22 ? 169 GLU A N     1 
ATOM   257  C CA    . GLU A 1 27  ? 35.143 29.830  28.908 1.00 42.95 ? 169 GLU A CA    1 
ATOM   258  C C     . GLU A 1 27  ? 35.540 29.474  27.485 1.00 43.60 ? 169 GLU A C     1 
ATOM   259  O O     . GLU A 1 27  ? 35.649 30.317  26.584 1.00 46.15 ? 169 GLU A O     1 
ATOM   260  C CB    . GLU A 1 27  ? 36.274 30.564  29.491 1.00 45.04 ? 169 GLU A CB    1 
ATOM   261  C CG    . GLU A 1 27  ? 35.836 31.074  30.821 1.00 52.56 ? 169 GLU A CG    1 
ATOM   262  C CD    . GLU A 1 27  ? 36.736 32.120  31.441 1.00 57.16 ? 169 GLU A CD    1 
ATOM   263  O OE1   . GLU A 1 27  ? 37.581 32.679  30.741 1.00 60.60 ? 169 GLU A OE1   1 
ATOM   264  O OE2   . GLU A 1 27  ? 36.571 32.400  32.624 1.00 61.91 ? 169 GLU A OE2   1 
ATOM   265  H H     . GLU A 1 27  ? 35.389 28.483  30.512 1.00 0.00  ? 169 GLU A H     1 
ATOM   266  N N     . ASN A 1 28  ? 35.775 28.188  27.297 1.00 41.72 ? 170 ASN A N     1 
ATOM   267  C CA    . ASN A 1 28  ? 36.243 27.665  26.056 1.00 37.69 ? 170 ASN A CA    1 
ATOM   268  C C     . ASN A 1 28  ? 35.132 27.153  25.194 1.00 36.74 ? 170 ASN A C     1 
ATOM   269  O O     . ASN A 1 28  ? 34.284 26.391  25.663 1.00 36.01 ? 170 ASN A O     1 
ATOM   270  C CB    . ASN A 1 28  ? 37.194 26.504  26.266 1.00 37.42 ? 170 ASN A CB    1 
ATOM   271  C CG    . ASN A 1 28  ? 38.418 26.842  27.077 1.00 36.64 ? 170 ASN A CG    1 
ATOM   272  O OD1   . ASN A 1 28  ? 38.873 27.979  27.187 1.00 39.44 ? 170 ASN A OD1   1 
ATOM   273  N ND2   . ASN A 1 28  ? 38.987 25.835  27.708 1.00 37.16 ? 170 ASN A ND2   1 
ATOM   274  H H     . ASN A 1 28  ? 35.622 27.568  28.040 1.00 0.00  ? 170 ASN A H     1 
ATOM   275  H HD21  . ASN A 1 28  ? 39.784 26.029  28.242 1.00 0.00  ? 170 ASN A HD21  1 
ATOM   276  H HD22  . ASN A 1 28  ? 38.610 24.934  27.632 1.00 0.00  ? 170 ASN A HD22  1 
ATOM   277  N N     . PRO A 1 29  ? 35.095 27.542  23.920 1.00 36.68 ? 171 PRO A N     1 
ATOM   278  C CA    . PRO A 1 29  ? 34.113 27.077  22.942 1.00 37.52 ? 171 PRO A CA    1 
ATOM   279  C C     . PRO A 1 29  ? 34.358 25.558  22.669 1.00 38.67 ? 171 PRO A C     1 
ATOM   280  O O     . PRO A 1 29  ? 35.409 24.986  23.002 1.00 38.34 ? 171 PRO A O     1 
ATOM   281  C CB    . PRO A 1 29  ? 34.379 27.894  21.698 1.00 36.54 ? 171 PRO A CB    1 
ATOM   282  C CG    . PRO A 1 29  ? 35.152 29.083  22.193 1.00 36.65 ? 171 PRO A CG    1 
ATOM   283  C CD    . PRO A 1 29  ? 36.003 28.498  23.295 1.00 36.28 ? 171 PRO A CD    1 
ATOM   284  N N     . ARG A 1 30  ? 33.386 24.880  22.046 1.00 39.63 ? 172 ARG A N     1 
ATOM   285  C CA    . ARG A 1 30  ? 33.549 23.520  21.584 1.00 37.69 ? 172 ARG A CA    1 
ATOM   286  C C     . ARG A 1 30  ? 34.616 23.591  20.501 1.00 33.60 ? 172 ARG A C     1 
ATOM   287  O O     . ARG A 1 30  ? 34.498 24.419  19.586 1.00 33.17 ? 172 ARG A O     1 
ATOM   288  C CB    . ARG A 1 30  ? 32.269 22.984  20.961 1.00 42.92 ? 172 ARG A CB    1 
ATOM   289  C CG    . ARG A 1 30  ? 31.299 22.328  21.927 1.00 51.50 ? 172 ARG A CG    1 
ATOM   290  C CD    . ARG A 1 30  ? 30.369 21.420  21.129 1.00 60.06 ? 172 ARG A CD    1 
ATOM   291  N NE    . ARG A 1 30  ? 31.085 20.503  20.218 1.00 68.17 ? 172 ARG A NE    1 
ATOM   292  C CZ    . ARG A 1 30  ? 30.446 19.589  19.455 1.00 69.85 ? 172 ARG A CZ    1 
ATOM   293  N NH1   . ARG A 1 30  ? 29.101 19.526  19.477 1.00 72.29 ? 172 ARG A NH1   1 
ATOM   294  N NH2   . ARG A 1 30  ? 31.161 18.815  18.614 1.00 69.86 ? 172 ARG A NH2   1 
ATOM   295  H H     . ARG A 1 30  ? 32.526 25.325  21.897 1.00 0.00  ? 172 ARG A H     1 
ATOM   296  H HE    . ARG A 1 30  ? 32.062 20.560  20.165 1.00 0.00  ? 172 ARG A HE    1 
ATOM   297  H HH11  . ARG A 1 30  ? 28.580 20.154  20.056 1.00 0.00  ? 172 ARG A HH11  1 
ATOM   298  H HH12  . ARG A 1 30  ? 28.623 18.852  18.914 1.00 0.00  ? 172 ARG A HH12  1 
ATOM   299  H HH21  . ARG A 1 30  ? 32.154 18.921  18.560 1.00 0.00  ? 172 ARG A HH21  1 
ATOM   300  H HH22  . ARG A 1 30  ? 30.698 18.135  18.045 1.00 0.00  ? 172 ARG A HH22  1 
ATOM   301  N N     . GLY A 1 31  ? 35.622 22.726  20.537 1.00 29.30 ? 173 GLY A N     1 
ATOM   302  C CA    . GLY A 1 31  ? 36.676 22.809  19.538 1.00 25.71 ? 173 GLY A CA    1 
ATOM   303  C C     . GLY A 1 31  ? 37.910 23.600  19.982 1.00 23.08 ? 173 GLY A C     1 
ATOM   304  O O     . GLY A 1 31  ? 38.727 23.973  19.131 1.00 22.11 ? 173 GLY A O     1 
ATOM   305  H H     . GLY A 1 31  ? 35.654 22.036  21.232 1.00 0.00  ? 173 GLY A H     1 
ATOM   306  N N     . THR A 1 32  ? 38.054 23.938  21.267 1.00 20.29 ? 174 THR A N     1 
ATOM   307  C CA    . THR A 1 32  ? 39.260 24.558  21.793 1.00 20.88 ? 174 THR A CA    1 
ATOM   308  C C     . THR A 1 32  ? 40.229 23.374  21.761 1.00 20.74 ? 174 THR A C     1 
ATOM   309  O O     . THR A 1 32  ? 39.832 22.252  22.131 1.00 21.15 ? 174 THR A O     1 
ATOM   310  C CB    . THR A 1 32  ? 39.063 25.032  23.252 1.00 20.42 ? 174 THR A CB    1 
ATOM   311  O OG1   . THR A 1 32  ? 37.989 25.941  23.137 1.00 22.93 ? 174 THR A OG1   1 
ATOM   312  C CG2   . THR A 1 32  ? 40.246 25.693  23.917 1.00 16.75 ? 174 THR A CG2   1 
ATOM   313  H H     . THR A 1 32  ? 37.313 23.760  21.883 1.00 0.00  ? 174 THR A H     1 
ATOM   314  H HG1   . THR A 1 32  ? 37.220 25.486  22.787 1.00 0.00  ? 174 THR A HG1   1 
ATOM   315  N N     . PHE A 1 33  ? 41.484 23.564  21.366 1.00 17.05 ? 175 PHE A N     1 
ATOM   316  C CA    . PHE A 1 33  ? 42.413 22.464  21.273 1.00 18.36 ? 175 PHE A CA    1 
ATOM   317  C C     . PHE A 1 33  ? 43.829 22.869  21.662 1.00 19.64 ? 175 PHE A C     1 
ATOM   318  O O     . PHE A 1 33  ? 44.203 24.051  21.830 1.00 19.71 ? 175 PHE A O     1 
ATOM   319  C CB    . PHE A 1 33  ? 42.378 21.917  19.819 1.00 18.50 ? 175 PHE A CB    1 
ATOM   320  C CG    . PHE A 1 33  ? 43.078 22.888  18.881 1.00 20.80 ? 175 PHE A CG    1 
ATOM   321  C CD1   . PHE A 1 33  ? 42.470 24.103  18.545 1.00 21.10 ? 175 PHE A CD1   1 
ATOM   322  C CD2   . PHE A 1 33  ? 44.362 22.580  18.407 1.00 22.17 ? 175 PHE A CD2   1 
ATOM   323  C CE1   . PHE A 1 33  ? 43.155 25.005  17.760 1.00 20.46 ? 175 PHE A CE1   1 
ATOM   324  C CE2   . PHE A 1 33  ? 45.040 23.498  17.621 1.00 20.36 ? 175 PHE A CE2   1 
ATOM   325  C CZ    . PHE A 1 33  ? 44.436 24.704  17.312 1.00 19.49 ? 175 PHE A CZ    1 
ATOM   326  H H     . PHE A 1 33  ? 41.784 24.468  21.134 1.00 0.00  ? 175 PHE A H     1 
ATOM   327  N N     . LEU A 1 34  ? 44.656 21.846  21.802 1.00 17.58 ? 176 LEU A N     1 
ATOM   328  C CA    . LEU A 1 34  ? 46.058 22.057  21.971 1.00 14.45 ? 176 LEU A CA    1 
ATOM   329  C C     . LEU A 1 34  ? 46.747 20.824  21.369 1.00 15.64 ? 176 LEU A C     1 
ATOM   330  O O     . LEU A 1 34  ? 46.139 19.757  21.201 1.00 14.76 ? 176 LEU A O     1 
ATOM   331  C CB    . LEU A 1 34  ? 46.277 22.257  23.467 1.00 10.23 ? 176 LEU A CB    1 
ATOM   332  C CG    . LEU A 1 34  ? 45.935 21.273  24.588 1.00 13.89 ? 176 LEU A CG    1 
ATOM   333  C CD1   . LEU A 1 34  ? 46.884 20.058  24.534 1.00 12.20 ? 176 LEU A CD1   1 
ATOM   334  C CD2   . LEU A 1 34  ? 46.072 21.958  25.951 1.00 9.20  ? 176 LEU A CD2   1 
ATOM   335  H H     . LEU A 1 34  ? 44.302 20.932  21.790 1.00 0.00  ? 176 LEU A H     1 
ATOM   336  N N     . VAL A 1 35  ? 48.008 20.887  20.975 1.00 16.82 ? 177 VAL A N     1 
ATOM   337  C CA    . VAL A 1 35  ? 48.761 19.716  20.552 1.00 16.09 ? 177 VAL A CA    1 
ATOM   338  C C     . VAL A 1 35  ? 49.808 19.472  21.649 1.00 17.10 ? 177 VAL A C     1 
ATOM   339  O O     . VAL A 1 35  ? 50.283 20.393  22.336 1.00 19.22 ? 177 VAL A O     1 
ATOM   340  C CB    . VAL A 1 35  ? 49.406 19.971  19.152 1.00 16.65 ? 177 VAL A CB    1 
ATOM   341  C CG1   . VAL A 1 35  ? 50.328 18.817  18.762 1.00 15.27 ? 177 VAL A CG1   1 
ATOM   342  C CG2   . VAL A 1 35  ? 48.299 20.143  18.140 1.00 13.70 ? 177 VAL A CG2   1 
ATOM   343  H H     . VAL A 1 35  ? 48.454 21.759  20.968 1.00 0.00  ? 177 VAL A H     1 
ATOM   344  N N     . ARG A 1 36  ? 50.189 18.258  21.958 1.00 17.15 ? 178 ARG A N     1 
ATOM   345  C CA    . ARG A 1 36  ? 51.189 18.037  22.985 1.00 16.99 ? 178 ARG A CA    1 
ATOM   346  C C     . ARG A 1 36  ? 51.899 16.744  22.616 1.00 18.15 ? 178 ARG A C     1 
ATOM   347  O O     . ARG A 1 36  ? 51.492 16.091  21.662 1.00 19.37 ? 178 ARG A O     1 
ATOM   348  C CB    . ARG A 1 36  ? 50.471 17.955  24.346 1.00 17.51 ? 178 ARG A CB    1 
ATOM   349  C CG    . ARG A 1 36  ? 49.543 16.736  24.476 1.00 15.13 ? 178 ARG A CG    1 
ATOM   350  C CD    . ARG A 1 36  ? 48.776 16.794  25.748 1.00 16.21 ? 178 ARG A CD    1 
ATOM   351  N NE    . ARG A 1 36  ? 47.743 15.774  25.609 1.00 20.97 ? 178 ARG A NE    1 
ATOM   352  C CZ    . ARG A 1 36  ? 47.946 14.498  25.995 1.00 19.81 ? 178 ARG A CZ    1 
ATOM   353  N NH1   . ARG A 1 36  ? 49.116 14.081  26.524 1.00 18.22 ? 178 ARG A NH1   1 
ATOM   354  N NH2   . ARG A 1 36  ? 46.922 13.657  25.876 1.00 15.19 ? 178 ARG A NH2   1 
ATOM   355  H H     . ARG A 1 36  ? 49.795 17.492  21.491 1.00 0.00  ? 178 ARG A H     1 
ATOM   356  H HE    . ARG A 1 36  ? 46.877 16.023  25.224 1.00 0.00  ? 178 ARG A HE    1 
ATOM   357  H HH11  . ARG A 1 36  ? 49.870 14.727  26.641 1.00 0.00  ? 178 ARG A HH11  1 
ATOM   358  H HH12  . ARG A 1 36  ? 49.228 13.126  26.798 1.00 0.00  ? 178 ARG A HH12  1 
ATOM   359  H HH21  . ARG A 1 36  ? 46.048 13.981  25.513 1.00 0.00  ? 178 ARG A HH21  1 
ATOM   360  H HH22  . ARG A 1 36  ? 47.026 12.701  26.150 1.00 0.00  ? 178 ARG A HH22  1 
ATOM   361  N N     . GLU A 1 37  ? 52.956 16.349  23.279 1.00 19.00 ? 179 GLU A N     1 
ATOM   362  C CA    . GLU A 1 37  ? 53.635 15.101  23.040 1.00 20.85 ? 179 GLU A CA    1 
ATOM   363  C C     . GLU A 1 37  ? 52.797 14.026  23.718 1.00 21.39 ? 179 GLU A C     1 
ATOM   364  O O     . GLU A 1 37  ? 52.115 14.334  24.706 1.00 21.02 ? 179 GLU A O     1 
ATOM   365  C CB    . GLU A 1 37  ? 54.996 15.035  23.704 1.00 25.14 ? 179 GLU A CB    1 
ATOM   366  C CG    . GLU A 1 37  ? 56.262 15.648  23.081 1.00 31.58 ? 179 GLU A CG    1 
ATOM   367  C CD    . GLU A 1 37  ? 57.508 15.697  23.978 1.00 35.71 ? 179 GLU A CD    1 
ATOM   368  O OE1   . GLU A 1 37  ? 57.559 15.043  25.018 1.00 39.61 ? 179 GLU A OE1   1 
ATOM   369  O OE2   . GLU A 1 37  ? 58.452 16.450  23.701 1.00 39.61 ? 179 GLU A OE2   1 
ATOM   370  H H     . GLU A 1 37  ? 53.306 16.937  23.980 1.00 0.00  ? 179 GLU A H     1 
ATOM   371  N N     . SER A 1 38  ? 52.765 12.763  23.227 1.00 23.13 ? 180 SER A N     1 
ATOM   372  C CA    . SER A 1 38  ? 52.135 11.653  23.940 1.00 22.26 ? 180 SER A CA    1 
ATOM   373  C C     . SER A 1 38  ? 52.933 11.451  25.206 1.00 22.99 ? 180 SER A C     1 
ATOM   374  O O     . SER A 1 38  ? 54.157 11.589  25.205 1.00 24.66 ? 180 SER A O     1 
ATOM   375  C CB    . SER A 1 38  ? 52.221 10.334  23.203 1.00 22.42 ? 180 SER A CB    1 
ATOM   376  O OG    . SER A 1 38  ? 51.393 10.392  22.069 1.00 30.72 ? 180 SER A OG    1 
ATOM   377  H H     . SER A 1 38  ? 53.181 12.587  22.358 1.00 0.00  ? 180 SER A H     1 
ATOM   378  H HG    . SER A 1 38  ? 51.685 11.104  21.495 1.00 0.00  ? 180 SER A HG    1 
ATOM   379  N N     . GLU A 1 39  ? 52.306 11.183  26.333 1.00 25.13 ? 181 GLU A N     1 
ATOM   380  C CA    . GLU A 1 39  ? 53.094 10.926  27.515 1.00 27.72 ? 181 GLU A CA    1 
ATOM   381  C C     . GLU A 1 39  ? 53.785 9.577   27.413 1.00 29.67 ? 181 GLU A C     1 
ATOM   382  O O     . GLU A 1 39  ? 54.881 9.427   27.935 1.00 33.43 ? 181 GLU A O     1 
ATOM   383  C CB    . GLU A 1 39  ? 52.266 10.863  28.733 1.00 25.98 ? 181 GLU A CB    1 
ATOM   384  C CG    . GLU A 1 39  ? 51.523 12.135  29.075 1.00 24.71 ? 181 GLU A CG    1 
ATOM   385  C CD    . GLU A 1 39  ? 50.943 11.935  30.446 1.00 20.73 ? 181 GLU A CD    1 
ATOM   386  O OE1   . GLU A 1 39  ? 51.739 11.757  31.346 1.00 23.61 ? 181 GLU A OE1   1 
ATOM   387  O OE2   . GLU A 1 39  ? 49.735 11.921  30.620 1.00 19.09 ? 181 GLU A OE2   1 
ATOM   388  H H     . GLU A 1 39  ? 51.327 11.159  26.368 1.00 0.00  ? 181 GLU A H     1 
ATOM   389  N N     . THR A 1 40  ? 53.188 8.544   26.828 1.00 31.92 ? 182 THR A N     1 
ATOM   390  C CA    . THR A 1 40  ? 53.906 7.290   26.792 1.00 33.47 ? 182 THR A CA    1 
ATOM   391  C C     . THR A 1 40  ? 54.046 6.677   25.417 1.00 34.01 ? 182 THR A C     1 
ATOM   392  O O     . THR A 1 40  ? 54.697 5.633   25.328 1.00 36.81 ? 182 THR A O     1 
ATOM   393  C CB    . THR A 1 40  ? 53.242 6.299   27.777 1.00 32.53 ? 182 THR A CB    1 
ATOM   394  O OG1   . THR A 1 40  ? 51.920 6.021   27.368 1.00 32.13 ? 182 THR A OG1   1 
ATOM   395  C CG2   . THR A 1 40  ? 53.173 6.889   29.167 1.00 34.07 ? 182 THR A CG2   1 
ATOM   396  H H     . THR A 1 40  ? 52.294 8.629   26.436 1.00 0.00  ? 182 THR A H     1 
ATOM   397  H HG1   . THR A 1 40  ? 51.931 5.632   26.490 1.00 0.00  ? 182 THR A HG1   1 
ATOM   398  N N     . THR A 1 41  ? 53.403 7.162   24.338 1.00 33.57 ? 183 THR A N     1 
ATOM   399  C CA    . THR A 1 41  ? 53.698 6.634   23.016 1.00 31.33 ? 183 THR A CA    1 
ATOM   400  C C     . THR A 1 41  ? 54.825 7.520   22.466 1.00 33.12 ? 183 THR A C     1 
ATOM   401  O O     . THR A 1 41  ? 54.708 8.710   22.133 1.00 31.14 ? 183 THR A O     1 
ATOM   402  C CB    . THR A 1 41  ? 52.460 6.691   22.121 1.00 32.00 ? 183 THR A CB    1 
ATOM   403  O OG1   . THR A 1 41  ? 51.458 5.804   22.586 1.00 35.98 ? 183 THR A OG1   1 
ATOM   404  C CG2   . THR A 1 41  ? 52.777 6.154   20.782 1.00 33.86 ? 183 THR A CG2   1 
ATOM   405  H H     . THR A 1 41  ? 52.735 7.872   24.444 1.00 0.00  ? 183 THR A H     1 
ATOM   406  H HG1   . THR A 1 41  ? 50.692 5.856   22.010 1.00 0.00  ? 183 THR A HG1   1 
ATOM   407  N N     . LYS A 1 42  ? 56.006 6.930   22.395 1.00 36.53 ? 184 LYS A N     1 
ATOM   408  C CA    . LYS A 1 42  ? 57.181 7.631   21.871 1.00 39.93 ? 184 LYS A CA    1 
ATOM   409  C C     . LYS A 1 42  ? 56.940 7.988   20.410 1.00 39.70 ? 184 LYS A C     1 
ATOM   410  O O     . LYS A 1 42  ? 56.315 7.237   19.636 1.00 38.96 ? 184 LYS A O     1 
ATOM   411  C CB    . LYS A 1 42  ? 58.463 6.772   21.893 1.00 43.52 ? 184 LYS A CB    1 
ATOM   412  H H     . LYS A 1 42  ? 56.098 6.003   22.700 1.00 0.00  ? 184 LYS A H     1 
ATOM   413  N N     . GLY A 1 43  ? 57.387 9.203   20.076 1.00 39.12 ? 185 GLY A N     1 
ATOM   414  C CA    . GLY A 1 43  ? 57.259 9.734   18.727 1.00 35.79 ? 185 GLY A CA    1 
ATOM   415  C C     . GLY A 1 43  ? 55.877 10.263  18.356 1.00 33.99 ? 185 GLY A C     1 
ATOM   416  O O     . GLY A 1 43  ? 55.794 11.051  17.410 1.00 35.12 ? 185 GLY A O     1 
ATOM   417  H H     . GLY A 1 43  ? 57.815 9.755   20.763 1.00 0.00  ? 185 GLY A H     1 
ATOM   418  N N     . ALA A 1 44  ? 54.793 9.844   19.026 1.00 30.03 ? 186 ALA A N     1 
ATOM   419  C CA    . ALA A 1 44  ? 53.498 10.333  18.677 1.00 25.35 ? 186 ALA A CA    1 
ATOM   420  C C     . ALA A 1 44  ? 53.207 11.597  19.437 1.00 22.56 ? 186 ALA A C     1 
ATOM   421  O O     . ALA A 1 44  ? 53.804 11.908  20.470 1.00 21.18 ? 186 ALA A O     1 
ATOM   422  C CB    . ALA A 1 44  ? 52.463 9.321   19.014 1.00 23.19 ? 186 ALA A CB    1 
ATOM   423  H H     . ALA A 1 44  ? 54.890 9.200   19.758 1.00 0.00  ? 186 ALA A H     1 
ATOM   424  N N     . TYR A 1 45  ? 52.301 12.341  18.836 1.00 19.09 ? 187 TYR A N     1 
ATOM   425  C CA    . TYR A 1 45  ? 51.829 13.540  19.464 1.00 17.39 ? 187 TYR A CA    1 
ATOM   426  C C     . TYR A 1 45  ? 50.380 13.284  19.785 1.00 17.51 ? 187 TYR A C     1 
ATOM   427  O O     . TYR A 1 45  ? 49.839 12.227  19.467 1.00 16.60 ? 187 TYR A O     1 
ATOM   428  C CB    . TYR A 1 45  ? 51.881 14.705  18.521 1.00 17.33 ? 187 TYR A CB    1 
ATOM   429  C CG    . TYR A 1 45  ? 53.313 15.132  18.313 1.00 20.30 ? 187 TYR A CG    1 
ATOM   430  C CD1   . TYR A 1 45  ? 53.918 15.967  19.251 1.00 20.53 ? 187 TYR A CD1   1 
ATOM   431  C CD2   . TYR A 1 45  ? 53.992 14.667  17.175 1.00 25.08 ? 187 TYR A CD2   1 
ATOM   432  C CE1   . TYR A 1 45  ? 55.227 16.352  19.038 1.00 25.34 ? 187 TYR A CE1   1 
ATOM   433  C CE2   . TYR A 1 45  ? 55.312 15.049  16.953 1.00 27.45 ? 187 TYR A CE2   1 
ATOM   434  C CZ    . TYR A 1 45  ? 55.905 15.893  17.893 1.00 28.70 ? 187 TYR A CZ    1 
ATOM   435  O OH    . TYR A 1 45  ? 57.200 16.294  17.676 1.00 36.26 ? 187 TYR A OH    1 
ATOM   436  H H     . TYR A 1 45  ? 51.950 12.075  17.960 1.00 0.00  ? 187 TYR A H     1 
ATOM   437  H HH    . TYR A 1 45  ? 57.525 15.902  16.862 1.00 0.00  ? 187 TYR A HH    1 
ATOM   438  N N     . CYS A 1 46  ? 49.751 14.253  20.405 1.00 19.73 ? 188 CYS A N     1 
ATOM   439  C CA    . CYS A 1 46  ? 48.397 14.072  20.719 1.00 21.82 ? 188 CYS A CA    1 
ATOM   440  C C     . CYS A 1 46  ? 47.646 15.395  20.532 1.00 20.72 ? 188 CYS A C     1 
ATOM   441  O O     . CYS A 1 46  ? 48.205 16.473  20.751 1.00 21.06 ? 188 CYS A O     1 
ATOM   442  C CB    . CYS A 1 46  ? 48.627 13.492  22.085 1.00 28.00 ? 188 CYS A CB    1 
ATOM   443  S SG    . CYS A 1 46  ? 47.105 12.807  22.549 1.00 38.18 ? 188 CYS A SG    1 
ATOM   444  H H     . CYS A 1 46  ? 50.216 15.082  20.643 1.00 0.00  ? 188 CYS A H     1 
ATOM   445  N N     . LEU A 1 47  ? 46.414 15.390  19.999 1.00 20.93 ? 189 LEU A N     1 
ATOM   446  C CA    . LEU A 1 47  ? 45.537 16.558  19.754 1.00 18.70 ? 189 LEU A CA    1 
ATOM   447  C C     . LEU A 1 47  ? 44.444 16.415  20.793 1.00 20.47 ? 189 LEU A C     1 
ATOM   448  O O     . LEU A 1 47  ? 43.667 15.445  20.752 1.00 20.34 ? 189 LEU A O     1 
ATOM   449  C CB    . LEU A 1 47  ? 44.869 16.529  18.352 1.00 16.53 ? 189 LEU A CB    1 
ATOM   450  C CG    . LEU A 1 47  ? 43.930 17.640  17.912 1.00 17.75 ? 189 LEU A CG    1 
ATOM   451  C CD1   . LEU A 1 47  ? 44.681 18.975  17.873 1.00 16.16 ? 189 LEU A CD1   1 
ATOM   452  C CD2   . LEU A 1 47  ? 43.352 17.314  16.539 1.00 14.64 ? 189 LEU A CD2   1 
ATOM   453  H H     . LEU A 1 47  ? 46.055 14.517  19.744 1.00 0.00  ? 189 LEU A H     1 
ATOM   454  N N     . SER A 1 48  ? 44.313 17.356  21.727 1.00 18.40 ? 190 SER A N     1 
ATOM   455  C CA    . SER A 1 48  ? 43.266 17.282  22.725 1.00 17.85 ? 190 SER A CA    1 
ATOM   456  C C     . SER A 1 48  ? 42.251 18.358  22.370 1.00 17.86 ? 190 SER A C     1 
ATOM   457  O O     . SER A 1 48  ? 42.655 19.494  22.169 1.00 20.26 ? 190 SER A O     1 
ATOM   458  C CB    . SER A 1 48  ? 43.948 17.479  24.045 1.00 15.56 ? 190 SER A CB    1 
ATOM   459  O OG    . SER A 1 48  ? 44.880 16.429  24.305 1.00 15.51 ? 190 SER A OG    1 
ATOM   460  H H     . SER A 1 48  ? 44.936 18.112  21.739 1.00 0.00  ? 190 SER A H     1 
ATOM   461  H HG    . SER A 1 48  ? 44.418 15.587  24.321 1.00 0.00  ? 190 SER A HG    1 
ATOM   462  N N     . VAL A 1 49  ? 40.965 18.034  22.332 1.00 18.67 ? 191 VAL A N     1 
ATOM   463  C CA    . VAL A 1 49  ? 39.878 18.887  21.859 1.00 19.84 ? 191 VAL A CA    1 
ATOM   464  C C     . VAL A 1 49  ? 38.722 18.897  22.872 1.00 23.41 ? 191 VAL A C     1 
ATOM   465  O O     . VAL A 1 49  ? 38.314 17.813  23.328 1.00 23.53 ? 191 VAL A O     1 
ATOM   466  C CB    . VAL A 1 49  ? 39.297 18.343  20.481 1.00 19.81 ? 191 VAL A CB    1 
ATOM   467  C CG1   . VAL A 1 49  ? 38.458 19.393  19.786 1.00 19.96 ? 191 VAL A CG1   1 
ATOM   468  C CG2   . VAL A 1 49  ? 40.389 18.035  19.497 1.00 17.00 ? 191 VAL A CG2   1 
ATOM   469  H H     . VAL A 1 49  ? 40.722 17.141  22.650 1.00 0.00  ? 191 VAL A H     1 
ATOM   470  N N     . SER A 1 50  ? 38.159 20.053  23.272 1.00 24.79 ? 192 SER A N     1 
ATOM   471  C CA    . SER A 1 50  ? 36.958 20.075  24.117 1.00 24.80 ? 192 SER A CA    1 
ATOM   472  C C     . SER A 1 50  ? 35.708 19.877  23.262 1.00 26.67 ? 192 SER A C     1 
ATOM   473  O O     . SER A 1 50  ? 35.584 20.358  22.107 1.00 26.15 ? 192 SER A O     1 
ATOM   474  C CB    . SER A 1 50  ? 36.838 21.387  24.869 1.00 22.44 ? 192 SER A CB    1 
ATOM   475  O OG    . SER A 1 50  ? 36.935 22.480  23.983 1.00 23.67 ? 192 SER A OG    1 
ATOM   476  H H     . SER A 1 50  ? 38.561 20.902  22.992 1.00 0.00  ? 192 SER A H     1 
ATOM   477  H HG    . SER A 1 50  ? 36.230 22.429  23.333 1.00 0.00  ? 192 SER A HG    1 
ATOM   478  N N     . ASP A 1 51  ? 34.788 19.165  23.886 1.00 28.79 ? 193 ASP A N     1 
ATOM   479  C CA    . ASP A 1 51  ? 33.568 18.808  23.240 1.00 32.49 ? 193 ASP A CA    1 
ATOM   480  C C     . ASP A 1 51  ? 32.475 18.916  24.263 1.00 35.12 ? 193 ASP A C     1 
ATOM   481  O O     . ASP A 1 51  ? 32.753 18.973  25.470 1.00 34.30 ? 193 ASP A O     1 
ATOM   482  C CB    . ASP A 1 51  ? 33.707 17.396  22.754 1.00 35.74 ? 193 ASP A CB    1 
ATOM   483  C CG    . ASP A 1 51  ? 32.619 16.971  21.791 1.00 37.14 ? 193 ASP A CG    1 
ATOM   484  O OD1   . ASP A 1 51  ? 32.201 17.782  20.969 1.00 37.97 ? 193 ASP A OD1   1 
ATOM   485  O OD2   . ASP A 1 51  ? 32.199 15.817  21.871 1.00 42.07 ? 193 ASP A OD2   1 
ATOM   486  H H     . ASP A 1 51  ? 34.946 18.877  24.809 1.00 0.00  ? 193 ASP A H     1 
ATOM   487  N N     . PHE A 1 52  ? 31.230 18.979  23.818 1.00 39.58 ? 194 PHE A N     1 
ATOM   488  C CA    . PHE A 1 52  ? 30.120 19.042  24.738 1.00 44.64 ? 194 PHE A CA    1 
ATOM   489  C C     . PHE A 1 52  ? 29.067 18.110  24.202 1.00 47.68 ? 194 PHE A C     1 
ATOM   490  O O     . PHE A 1 52  ? 28.625 18.238  23.054 1.00 48.23 ? 194 PHE A O     1 
ATOM   491  C CB    . PHE A 1 52  ? 29.491 20.451  24.864 1.00 46.61 ? 194 PHE A CB    1 
ATOM   492  C CG    . PHE A 1 52  ? 28.407 20.402  25.933 1.00 48.60 ? 194 PHE A CG    1 
ATOM   493  C CD1   . PHE A 1 52  ? 28.765 20.223  27.277 1.00 48.89 ? 194 PHE A CD1   1 
ATOM   494  C CD2   . PHE A 1 52  ? 27.051 20.400  25.556 1.00 49.57 ? 194 PHE A CD2   1 
ATOM   495  C CE1   . PHE A 1 52  ? 27.761 20.024  28.233 1.00 49.74 ? 194 PHE A CE1   1 
ATOM   496  C CE2   . PHE A 1 52  ? 26.058 20.198  26.518 1.00 49.24 ? 194 PHE A CE2   1 
ATOM   497  C CZ    . PHE A 1 52  ? 26.414 20.007  27.854 1.00 49.82 ? 194 PHE A CZ    1 
ATOM   498  H H     . PHE A 1 52  ? 31.060 18.983  22.853 1.00 0.00  ? 194 PHE A H     1 
ATOM   499  N N     . ASP A 1 53  ? 28.695 17.227  25.135 1.00 53.19 ? 195 ASP A N     1 
ATOM   500  C CA    . ASP A 1 53  ? 27.704 16.154  24.998 1.00 58.15 ? 195 ASP A CA    1 
ATOM   501  C C     . ASP A 1 53  ? 26.794 16.344  26.198 1.00 60.99 ? 195 ASP A C     1 
ATOM   502  O O     . ASP A 1 53  ? 27.306 16.397  27.316 1.00 61.59 ? 195 ASP A O     1 
ATOM   503  C CB    . ASP A 1 53  ? 28.317 14.748  25.140 1.00 56.87 ? 195 ASP A CB    1 
ATOM   504  H H     . ASP A 1 53  ? 29.133 17.305  26.006 1.00 0.00  ? 195 ASP A H     1 
ATOM   505  N N     . ASN A 1 54  ? 25.469 16.379  26.073 1.00 65.18 ? 196 ASN A N     1 
ATOM   506  C CA    . ASN A 1 54  ? 24.612 16.618  27.235 1.00 68.33 ? 196 ASN A CA    1 
ATOM   507  C C     . ASN A 1 54  ? 24.725 15.583  28.356 1.00 69.38 ? 196 ASN A C     1 
ATOM   508  O O     . ASN A 1 54  ? 24.488 15.901  29.517 1.00 70.54 ? 196 ASN A O     1 
ATOM   509  C CB    . ASN A 1 54  ? 23.155 16.696  26.795 1.00 69.68 ? 196 ASN A CB    1 
ATOM   510  H H     . ASN A 1 54  ? 25.062 16.243  25.192 1.00 0.00  ? 196 ASN A H     1 
ATOM   511  N N     . ALA A 1 55  ? 25.118 14.340  28.064 1.00 70.23 ? 197 ALA A N     1 
ATOM   512  C CA    . ALA A 1 55  ? 25.276 13.335  29.116 1.00 71.01 ? 197 ALA A CA    1 
ATOM   513  C C     . ALA A 1 55  ? 26.636 13.335  29.810 1.00 71.01 ? 197 ALA A C     1 
ATOM   514  O O     . ALA A 1 55  ? 26.794 13.004  30.976 1.00 71.71 ? 197 ALA A O     1 
ATOM   515  C CB    . ALA A 1 55  ? 25.066 11.945  28.542 1.00 71.59 ? 197 ALA A CB    1 
ATOM   516  H H     . ALA A 1 55  ? 25.303 14.098  27.133 1.00 0.00  ? 197 ALA A H     1 
ATOM   517  N N     . LYS A 1 56  ? 27.668 13.630  29.044 1.00 70.57 ? 198 LYS A N     1 
ATOM   518  C CA    . LYS A 1 56  ? 29.018 13.644  29.563 1.00 69.91 ? 198 LYS A CA    1 
ATOM   519  C C     . LYS A 1 56  ? 29.377 14.912  30.312 1.00 68.02 ? 198 LYS A C     1 
ATOM   520  O O     . LYS A 1 56  ? 30.153 14.915  31.287 1.00 67.91 ? 198 LYS A O     1 
ATOM   521  C CB    . LYS A 1 56  ? 29.969 13.494  28.411 1.00 73.81 ? 198 LYS A CB    1 
ATOM   522  C CG    . LYS A 1 56  ? 29.691 12.226  27.682 1.00 80.39 ? 198 LYS A CG    1 
ATOM   523  C CD    . LYS A 1 56  ? 30.296 11.077  28.479 1.00 87.37 ? 198 LYS A CD    1 
ATOM   524  C CE    . LYS A 1 56  ? 31.803 11.027  28.223 1.00 91.58 ? 198 LYS A CE    1 
ATOM   525  N NZ    . LYS A 1 56  ? 32.052 10.843  26.800 1.00 95.12 ? 198 LYS A NZ    1 
ATOM   526  H H     . LYS A 1 56  ? 27.517 13.845  28.100 1.00 0.00  ? 198 LYS A H     1 
ATOM   527  H HZ1   . LYS A 1 56  ? 31.638 11.636  26.270 1.00 0.00  ? 198 LYS A HZ1   1 
ATOM   528  H HZ2   . LYS A 1 56  ? 33.077 10.809  26.629 1.00 0.00  ? 198 LYS A HZ2   1 
ATOM   529  H HZ3   . LYS A 1 56  ? 31.619 9.952   26.485 1.00 0.00  ? 198 LYS A HZ3   1 
ATOM   530  N N     . GLY A 1 57  ? 28.794 15.962  29.697 1.00 64.50 ? 199 GLY A N     1 
ATOM   531  C CA    . GLY A 1 57  ? 29.023 17.360  30.011 1.00 58.02 ? 199 GLY A CA    1 
ATOM   532  C C     . GLY A 1 57  ? 30.154 17.834  29.093 1.00 53.03 ? 199 GLY A C     1 
ATOM   533  O O     . GLY A 1 57  ? 30.344 17.347  27.964 1.00 52.57 ? 199 GLY A O     1 
ATOM   534  H H     . GLY A 1 57  ? 28.162 15.763  28.977 1.00 0.00  ? 199 GLY A H     1 
ATOM   535  N N     . LEU A 1 58  ? 30.868 18.866  29.512 1.00 48.42 ? 200 LEU A N     1 
ATOM   536  C CA    . LEU A 1 58  ? 32.043 19.307  28.785 1.00 44.35 ? 200 LEU A CA    1 
ATOM   537  C C     . LEU A 1 58  ? 33.011 18.123  28.877 1.00 40.11 ? 200 LEU A C     1 
ATOM   538  O O     . LEU A 1 58  ? 33.083 17.506  29.940 1.00 39.50 ? 200 LEU A O     1 
ATOM   539  C CB    . LEU A 1 58  ? 32.654 20.552  29.451 1.00 44.22 ? 200 LEU A CB    1 
ATOM   540  C CG    . LEU A 1 58  ? 32.021 21.924  29.235 1.00 43.51 ? 200 LEU A CG    1 
ATOM   541  C CD1   . LEU A 1 58  ? 32.790 22.923  30.090 1.00 44.22 ? 200 LEU A CD1   1 
ATOM   542  C CD2   . LEU A 1 58  ? 32.097 22.362  27.763 1.00 43.66 ? 200 LEU A CD2   1 
ATOM   543  H H     . LEU A 1 58  ? 30.599 19.340  30.326 1.00 0.00  ? 200 LEU A H     1 
ATOM   544  N N     . ASN A 1 59  ? 33.725 17.695  27.836 1.00 35.57 ? 201 ASN A N     1 
ATOM   545  C CA    . ASN A 1 59  ? 34.644 16.562  27.922 1.00 30.31 ? 201 ASN A CA    1 
ATOM   546  C C     . ASN A 1 59  ? 35.748 16.764  26.903 1.00 28.35 ? 201 ASN A C     1 
ATOM   547  O O     . ASN A 1 59  ? 35.584 17.571  25.982 1.00 29.06 ? 201 ASN A O     1 
ATOM   548  C CB    . ASN A 1 59  ? 33.915 15.242  27.651 1.00 27.36 ? 201 ASN A CB    1 
ATOM   549  C CG    . ASN A 1 59  ? 33.347 15.078  26.262 1.00 25.83 ? 201 ASN A CG    1 
ATOM   550  O OD1   . ASN A 1 59  ? 33.781 14.213  25.501 1.00 32.76 ? 201 ASN A OD1   1 
ATOM   551  N ND2   . ASN A 1 59  ? 32.283 15.750  25.875 1.00 27.46 ? 201 ASN A ND2   1 
ATOM   552  H H     . ASN A 1 59  ? 33.630 18.159  26.978 1.00 0.00  ? 201 ASN A H     1 
ATOM   553  H HD21  . ASN A 1 59  ? 31.962 15.601  24.962 1.00 0.00  ? 201 ASN A HD21  1 
ATOM   554  H HD22  . ASN A 1 59  ? 31.844 16.371  26.493 1.00 0.00  ? 201 ASN A HD22  1 
ATOM   555  N N     . VAL A 1 60  ? 36.900 16.126  27.082 1.00 25.09 ? 202 VAL A N     1 
ATOM   556  C CA    . VAL A 1 60  ? 37.999 16.297  26.180 1.00 23.35 ? 202 VAL A CA    1 
ATOM   557  C C     . VAL A 1 60  ? 38.143 15.037  25.364 1.00 23.18 ? 202 VAL A C     1 
ATOM   558  O O     . VAL A 1 60  ? 37.981 13.974  25.961 1.00 24.86 ? 202 VAL A O     1 
ATOM   559  C CB    . VAL A 1 60  ? 39.215 16.597  27.073 1.00 22.95 ? 202 VAL A CB    1 
ATOM   560  C CG1   . VAL A 1 60  ? 40.458 16.679  26.224 1.00 20.23 ? 202 VAL A CG1   1 
ATOM   561  C CG2   . VAL A 1 60  ? 39.042 17.953  27.779 1.00 22.16 ? 202 VAL A CG2   1 
ATOM   562  H H     . VAL A 1 60  ? 37.000 15.525  27.849 1.00 0.00  ? 202 VAL A H     1 
ATOM   563  N N     . LYS A 1 61  ? 38.380 15.064  24.056 1.00 22.24 ? 203 LYS A N     1 
ATOM   564  C CA    . LYS A 1 61  ? 38.674 13.858  23.277 1.00 22.49 ? 203 LYS A CA    1 
ATOM   565  C C     . LYS A 1 61  ? 40.157 13.912  22.965 1.00 20.42 ? 203 LYS A C     1 
ATOM   566  O O     . LYS A 1 61  ? 40.678 15.021  22.805 1.00 21.44 ? 203 LYS A O     1 
ATOM   567  C CB    . LYS A 1 61  ? 38.070 13.767  21.902 1.00 23.24 ? 203 LYS A CB    1 
ATOM   568  C CG    . LYS A 1 61  ? 36.591 13.928  21.777 1.00 26.45 ? 203 LYS A CG    1 
ATOM   569  C CD    . LYS A 1 61  ? 35.794 12.878  22.451 1.00 27.82 ? 203 LYS A CD    1 
ATOM   570  C CE    . LYS A 1 61  ? 34.475 13.530  22.251 1.00 30.30 ? 203 LYS A CE    1 
ATOM   571  N NZ    . LYS A 1 61  ? 33.518 12.862  23.084 1.00 31.33 ? 203 LYS A NZ    1 
ATOM   572  H H     . LYS A 1 61  ? 38.357 15.927  23.593 1.00 0.00  ? 203 LYS A H     1 
ATOM   573  H HZ1   . LYS A 1 61  ? 33.466 11.858  22.816 1.00 0.00  ? 203 LYS A HZ1   1 
ATOM   574  H HZ2   . LYS A 1 61  ? 33.809 12.941  24.079 1.00 0.00  ? 203 LYS A HZ2   1 
ATOM   575  H HZ3   . LYS A 1 61  ? 32.584 13.302  22.960 1.00 0.00  ? 203 LYS A HZ3   1 
ATOM   576  N N     . HIS A 1 62  ? 40.894 12.806  22.892 1.00 17.55 ? 204 HIS A N     1 
ATOM   577  C CA    . HIS A 1 62  ? 42.310 12.820  22.583 1.00 15.09 ? 204 HIS A CA    1 
ATOM   578  C C     . HIS A 1 62  ? 42.516 11.948  21.374 1.00 16.80 ? 204 HIS A C     1 
ATOM   579  O O     . HIS A 1 62  ? 42.065 10.819  21.347 1.00 16.61 ? 204 HIS A O     1 
ATOM   580  C CB    . HIS A 1 62  ? 43.158 12.280  23.712 1.00 13.98 ? 204 HIS A CB    1 
ATOM   581  C CG    . HIS A 1 62  ? 43.001 13.108  24.983 1.00 14.51 ? 204 HIS A CG    1 
ATOM   582  N ND1   . HIS A 1 62  ? 43.743 14.138  25.383 1.00 15.07 ? 204 HIS A ND1   1 
ATOM   583  C CD2   . HIS A 1 62  ? 42.030 12.894  25.942 1.00 14.75 ? 204 HIS A CD2   1 
ATOM   584  C CE1   . HIS A 1 62  ? 43.261 14.543  26.543 1.00 14.27 ? 204 HIS A CE1   1 
ATOM   585  N NE2   . HIS A 1 62  ? 42.245 13.788  26.863 1.00 13.56 ? 204 HIS A NE2   1 
ATOM   586  H H     . HIS A 1 62  ? 40.460 11.943  23.055 1.00 0.00  ? 204 HIS A H     1 
ATOM   587  H HD1   . HIS A 1 62  ? 44.501 14.522  24.908 1.00 0.00  ? 204 HIS A HD1   1 
ATOM   588  H HE2   . HIS A 1 62  ? 41.719 13.881  27.681 1.00 0.00  ? 204 HIS A HE2   1 
ATOM   589  N N     . TYR A 1 63  ? 43.185 12.465  20.352 1.00 16.83 ? 205 TYR A N     1 
ATOM   590  C CA    . TYR A 1 63  ? 43.437 11.760  19.118 1.00 16.83 ? 205 TYR A CA    1 
ATOM   591  C C     . TYR A 1 63  ? 44.940 11.657  19.032 1.00 18.87 ? 205 TYR A C     1 
ATOM   592  O O     . TYR A 1 63  ? 45.638 12.660  19.192 1.00 19.49 ? 205 TYR A O     1 
ATOM   593  C CB    . TYR A 1 63  ? 42.942 12.559  17.917 1.00 14.30 ? 205 TYR A CB    1 
ATOM   594  C CG    . TYR A 1 63  ? 41.466 12.893  18.002 1.00 14.28 ? 205 TYR A CG    1 
ATOM   595  C CD1   . TYR A 1 63  ? 40.978 13.991  18.732 1.00 13.68 ? 205 TYR A CD1   1 
ATOM   596  C CD2   . TYR A 1 63  ? 40.593 12.026  17.360 1.00 14.47 ? 205 TYR A CD2   1 
ATOM   597  C CE1   . TYR A 1 63  ? 39.604 14.203  18.824 1.00 16.16 ? 205 TYR A CE1   1 
ATOM   598  C CE2   . TYR A 1 63  ? 39.228 12.242  17.438 1.00 14.70 ? 205 TYR A CE2   1 
ATOM   599  C CZ    . TYR A 1 63  ? 38.744 13.322  18.168 1.00 17.68 ? 205 TYR A CZ    1 
ATOM   600  O OH    . TYR A 1 63  ? 37.387 13.489  18.176 1.00 22.66 ? 205 TYR A OH    1 
ATOM   601  H H     . TYR A 1 63  ? 43.528 13.378  20.440 1.00 0.00  ? 205 TYR A H     1 
ATOM   602  H HH    . TYR A 1 63  ? 36.976 12.799  17.650 1.00 0.00  ? 205 TYR A HH    1 
ATOM   603  N N     . LYS A 1 64  ? 45.506 10.486  18.814 1.00 18.57 ? 206 LYS A N     1 
ATOM   604  C CA    . LYS A 1 64  ? 46.925 10.374  18.713 1.00 17.44 ? 206 LYS A CA    1 
ATOM   605  C C     . LYS A 1 64  ? 47.352 10.874  17.347 1.00 16.01 ? 206 LYS A C     1 
ATOM   606  O O     . LYS A 1 64  ? 46.577 10.805  16.405 1.00 10.81 ? 206 LYS A O     1 
ATOM   607  C CB    . LYS A 1 64  ? 47.261 8.939   18.906 1.00 23.57 ? 206 LYS A CB    1 
ATOM   608  C CG    . LYS A 1 64  ? 48.753 8.721   19.028 1.00 30.56 ? 206 LYS A CG    1 
ATOM   609  C CD    . LYS A 1 64  ? 49.012 7.314   19.517 1.00 35.37 ? 206 LYS A CD    1 
ATOM   610  C CE    . LYS A 1 64  ? 48.286 7.029   20.811 1.00 36.86 ? 206 LYS A CE    1 
ATOM   611  N NZ    . LYS A 1 64  ? 48.707 5.750   21.359 1.00 43.83 ? 206 LYS A NZ    1 
ATOM   612  H H     . LYS A 1 64  ? 44.948 9.686   18.721 1.00 0.00  ? 206 LYS A H     1 
ATOM   613  H HZ1   . LYS A 1 64  ? 49.730 5.771   21.543 1.00 0.00  ? 206 LYS A HZ1   1 
ATOM   614  H HZ2   . LYS A 1 64  ? 48.198 5.569   22.248 1.00 0.00  ? 206 LYS A HZ2   1 
ATOM   615  H HZ3   . LYS A 1 64  ? 48.493 4.994   20.678 1.00 0.00  ? 206 LYS A HZ3   1 
ATOM   616  N N     . ILE A 1 65  ? 48.548 11.422  17.156 1.00 16.98 ? 207 ILE A N     1 
ATOM   617  C CA    . ILE A 1 65  ? 49.033 11.842  15.860 1.00 15.43 ? 207 ILE A CA    1 
ATOM   618  C C     . ILE A 1 65  ? 50.285 11.014  15.590 1.00 17.79 ? 207 ILE A C     1 
ATOM   619  O O     . ILE A 1 65  ? 51.287 11.046  16.312 1.00 16.43 ? 207 ILE A O     1 
ATOM   620  C CB    . ILE A 1 65  ? 49.381 13.368  15.848 1.00 16.27 ? 207 ILE A CB    1 
ATOM   621  C CG1   . ILE A 1 65  ? 48.209 14.288  16.274 1.00 14.86 ? 207 ILE A CG1   1 
ATOM   622  C CG2   . ILE A 1 65  ? 49.734 13.694  14.397 1.00 11.67 ? 207 ILE A CG2   1 
ATOM   623  C CD1   . ILE A 1 65  ? 48.491 15.788  16.540 1.00 13.73 ? 207 ILE A CD1   1 
ATOM   624  H H     . ILE A 1 65  ? 49.131 11.548  17.933 1.00 0.00  ? 207 ILE A H     1 
ATOM   625  N N     . ARG A 1 66  ? 50.291 10.223  14.530 1.00 21.11 ? 208 ARG A N     1 
ATOM   626  C CA    . ARG A 1 66  ? 51.471 9.425   14.287 1.00 25.15 ? 208 ARG A CA    1 
ATOM   627  C C     . ARG A 1 66  ? 52.326 10.142  13.285 1.00 26.31 ? 208 ARG A C     1 
ATOM   628  O O     . ARG A 1 66  ? 51.868 10.805  12.353 1.00 24.94 ? 208 ARG A O     1 
ATOM   629  C CB    . ARG A 1 66  ? 51.146 8.080   13.716 1.00 24.66 ? 208 ARG A CB    1 
ATOM   630  C CG    . ARG A 1 66  ? 50.346 7.344   14.669 1.00 27.35 ? 208 ARG A CG    1 
ATOM   631  C CD    . ARG A 1 66  ? 51.215 6.444   15.447 1.00 33.94 ? 208 ARG A CD    1 
ATOM   632  N NE    . ARG A 1 66  ? 50.268 5.646   16.210 1.00 42.86 ? 208 ARG A NE    1 
ATOM   633  C CZ    . ARG A 1 66  ? 50.600 4.742   17.144 1.00 47.35 ? 208 ARG A CZ    1 
ATOM   634  N NH1   . ARG A 1 66  ? 51.905 4.562   17.460 1.00 50.11 ? 208 ARG A NH1   1 
ATOM   635  N NH2   . ARG A 1 66  ? 49.600 4.102   17.803 1.00 48.48 ? 208 ARG A NH2   1 
ATOM   636  H H     . ARG A 1 66  ? 49.519 10.179  13.928 1.00 0.00  ? 208 ARG A H     1 
ATOM   637  H HE    . ARG A 1 66  ? 49.315 5.779   16.028 1.00 0.00  ? 208 ARG A HE    1 
ATOM   638  H HH11  . ARG A 1 66  ? 52.610 5.100   16.998 1.00 0.00  ? 208 ARG A HH11  1 
ATOM   639  H HH12  . ARG A 1 66  ? 52.163 3.891   18.155 1.00 0.00  ? 208 ARG A HH12  1 
ATOM   640  H HH21  . ARG A 1 66  ? 48.646 4.310   17.587 1.00 0.00  ? 208 ARG A HH21  1 
ATOM   641  H HH22  . ARG A 1 66  ? 49.818 3.423   18.504 1.00 0.00  ? 208 ARG A HH22  1 
ATOM   642  N N     . LYS A 1 67  ? 53.606 9.921   13.488 1.00 31.84 ? 209 LYS A N     1 
ATOM   643  C CA    . LYS A 1 67  ? 54.611 10.515  12.662 1.00 36.38 ? 209 LYS A CA    1 
ATOM   644  C C     . LYS A 1 67  ? 54.972 9.493   11.621 1.00 37.24 ? 209 LYS A C     1 
ATOM   645  O O     . LYS A 1 67  ? 55.461 8.425   11.963 1.00 36.96 ? 209 LYS A O     1 
ATOM   646  C CB    . LYS A 1 67  ? 55.812 10.865  13.520 1.00 40.03 ? 209 LYS A CB    1 
ATOM   647  C CG    . LYS A 1 67  ? 56.998 11.348  12.722 1.00 47.17 ? 209 LYS A CG    1 
ATOM   648  C CD    . LYS A 1 67  ? 56.630 12.574  11.898 1.00 54.31 ? 209 LYS A CD    1 
ATOM   649  C CE    . LYS A 1 67  ? 57.726 13.004  10.949 1.00 59.82 ? 209 LYS A CE    1 
ATOM   650  N NZ    . LYS A 1 67  ? 58.947 13.368  11.627 1.00 63.94 ? 209 LYS A NZ    1 
ATOM   651  H H     . LYS A 1 67  ? 53.878 9.334   14.224 1.00 0.00  ? 209 LYS A H     1 
ATOM   652  H HZ1   . LYS A 1 67  ? 58.761 14.160  12.275 1.00 0.00  ? 209 LYS A HZ1   1 
ATOM   653  H HZ2   . LYS A 1 67  ? 59.300 12.553  12.168 1.00 0.00  ? 209 LYS A HZ2   1 
ATOM   654  H HZ3   . LYS A 1 67  ? 59.661 13.654  10.926 1.00 0.00  ? 209 LYS A HZ3   1 
ATOM   655  N N     . LEU A 1 68  ? 54.694 9.713   10.355 1.00 40.28 ? 210 LEU A N     1 
ATOM   656  C CA    . LEU A 1 68  ? 55.141 8.752   9.371  1.00 44.94 ? 210 LEU A CA    1 
ATOM   657  C C     . LEU A 1 68  ? 56.675 8.809   9.316  1.00 49.48 ? 210 LEU A C     1 
ATOM   658  O O     . LEU A 1 68  ? 57.322 9.868   9.432  1.00 50.64 ? 210 LEU A O     1 
ATOM   659  C CB    . LEU A 1 68  ? 54.567 9.107   8.020  1.00 43.29 ? 210 LEU A CB    1 
ATOM   660  C CG    . LEU A 1 68  ? 53.106 8.907   7.835  1.00 43.00 ? 210 LEU A CG    1 
ATOM   661  C CD1   . LEU A 1 68  ? 52.647 9.754   6.665  1.00 39.38 ? 210 LEU A CD1   1 
ATOM   662  C CD2   . LEU A 1 68  ? 52.833 7.411   7.687  1.00 41.72 ? 210 LEU A CD2   1 
ATOM   663  H H     . LEU A 1 68  ? 54.194 10.511  10.084 1.00 0.00  ? 210 LEU A H     1 
ATOM   664  N N     . ASP A 1 69  ? 57.224 7.606   9.108  1.00 53.85 ? 211 ASP A N     1 
ATOM   665  C CA    . ASP A 1 69  ? 58.668 7.390   8.944  1.00 57.68 ? 211 ASP A CA    1 
ATOM   666  C C     . ASP A 1 69  ? 59.195 8.256   7.784  1.00 58.91 ? 211 ASP A C     1 
ATOM   667  O O     . ASP A 1 69  ? 60.231 8.925   7.832  1.00 58.64 ? 211 ASP A O     1 
ATOM   668  C CB    . ASP A 1 69  ? 58.889 5.888   8.663  1.00 58.91 ? 211 ASP A CB    1 
ATOM   669  H H     . ASP A 1 69  ? 56.631 6.828   9.063  1.00 0.00  ? 211 ASP A H     1 
ATOM   670  N N     . SER A 1 70  ? 58.389 8.269   6.730  1.00 60.44 ? 212 SER A N     1 
ATOM   671  C CA    . SER A 1 70  ? 58.694 9.058   5.564  1.00 61.49 ? 212 SER A CA    1 
ATOM   672  C C     . SER A 1 70  ? 58.532 10.573  5.819  1.00 61.85 ? 212 SER A C     1 
ATOM   673  O O     . SER A 1 70  ? 58.734 11.332  4.869  1.00 64.52 ? 212 SER A O     1 
ATOM   674  C CB    . SER A 1 70  ? 57.755 8.545   4.441  1.00 61.89 ? 212 SER A CB    1 
ATOM   675  H H     . SER A 1 70  ? 57.570 7.731   6.745  1.00 0.00  ? 212 SER A H     1 
ATOM   676  N N     . GLY A 1 71  ? 58.116 11.066  6.998  1.00 59.62 ? 213 GLY A N     1 
ATOM   677  C CA    . GLY A 1 71  ? 58.015 12.507  7.210  1.00 54.85 ? 213 GLY A CA    1 
ATOM   678  C C     . GLY A 1 71  ? 56.672 13.087  7.656  1.00 49.92 ? 213 GLY A C     1 
ATOM   679  O O     . GLY A 1 71  ? 56.617 13.938  8.531  1.00 49.62 ? 213 GLY A O     1 
ATOM   680  H H     . GLY A 1 71  ? 57.878 10.452  7.723  1.00 0.00  ? 213 GLY A H     1 
ATOM   681  N N     . GLY A 1 72  ? 55.588 12.625  7.102  1.00 44.28 ? 214 GLY A N     1 
ATOM   682  C CA    . GLY A 1 72  ? 54.310 13.153  7.468  1.00 35.65 ? 214 GLY A CA    1 
ATOM   683  C C     . GLY A 1 72  ? 53.795 12.881  8.875  1.00 30.94 ? 214 GLY A C     1 
ATOM   684  O O     . GLY A 1 72  ? 54.456 12.306  9.731  1.00 29.94 ? 214 GLY A O     1 
ATOM   685  H H     . GLY A 1 72  ? 55.648 11.913  6.432  1.00 0.00  ? 214 GLY A H     1 
ATOM   686  N N     . PHE A 1 73  ? 52.528 13.255  8.997  1.00 24.32 ? 215 PHE A N     1 
ATOM   687  C CA    . PHE A 1 73  ? 51.703 13.202  10.185 1.00 18.61 ? 215 PHE A CA    1 
ATOM   688  C C     . PHE A 1 73  ? 50.320 12.789  9.768  1.00 16.20 ? 215 PHE A C     1 
ATOM   689  O O     . PHE A 1 73  ? 49.912 13.036  8.645  1.00 14.98 ? 215 PHE A O     1 
ATOM   690  C CB    . PHE A 1 73  ? 51.541 14.541  10.842 1.00 16.30 ? 215 PHE A CB    1 
ATOM   691  C CG    . PHE A 1 73  ? 52.845 14.954  11.458 1.00 15.84 ? 215 PHE A CG    1 
ATOM   692  C CD1   . PHE A 1 73  ? 53.152 14.510  12.727 1.00 18.18 ? 215 PHE A CD1   1 
ATOM   693  C CD2   . PHE A 1 73  ? 53.743 15.729  10.754 1.00 16.84 ? 215 PHE A CD2   1 
ATOM   694  C CE1   . PHE A 1 73  ? 54.368 14.834  13.314 1.00 20.01 ? 215 PHE A CE1   1 
ATOM   695  C CE2   . PHE A 1 73  ? 54.954 16.052  11.349 1.00 20.16 ? 215 PHE A CE2   1 
ATOM   696  C CZ    . PHE A 1 73  ? 55.289 15.609  12.628 1.00 17.25 ? 215 PHE A CZ    1 
ATOM   697  H H     . PHE A 1 73  ? 52.102 13.607  8.190  1.00 0.00  ? 215 PHE A H     1 
ATOM   698  N N     . TYR A 1 74  ? 49.628 12.050  10.617 1.00 14.26 ? 216 TYR A N     1 
ATOM   699  C CA    . TYR A 1 74  ? 48.277 11.665  10.271 1.00 14.89 ? 216 TYR A CA    1 
ATOM   700  C C     . TYR A 1 74  ? 47.501 11.280  11.522 1.00 13.28 ? 216 TYR A C     1 
ATOM   701  O O     . TYR A 1 74  ? 48.076 10.877  12.533 1.00 16.18 ? 216 TYR A O     1 
ATOM   702  C CB    . TYR A 1 74  ? 48.272 10.438  9.285  1.00 15.84 ? 216 TYR A CB    1 
ATOM   703  C CG    . TYR A 1 74  ? 48.699 9.084   9.863  1.00 14.45 ? 216 TYR A CG    1 
ATOM   704  C CD1   . TYR A 1 74  ? 47.819 8.306   10.615 1.00 10.96 ? 216 TYR A CD1   1 
ATOM   705  C CD2   . TYR A 1 74  ? 50.004 8.655   9.672  1.00 15.14 ? 216 TYR A CD2   1 
ATOM   706  C CE1   . TYR A 1 74  ? 48.239 7.107   11.186 1.00 11.68 ? 216 TYR A CE1   1 
ATOM   707  C CE2   . TYR A 1 74  ? 50.433 7.451   10.252 1.00 14.35 ? 216 TYR A CE2   1 
ATOM   708  C CZ    . TYR A 1 74  ? 49.550 6.681   11.009 1.00 15.11 ? 216 TYR A CZ    1 
ATOM   709  O OH    . TYR A 1 74  ? 50.012 5.527   11.616 1.00 16.93 ? 216 TYR A OH    1 
ATOM   710  H H     . TYR A 1 74  ? 50.024 11.767  11.468 1.00 0.00  ? 216 TYR A H     1 
ATOM   711  H HH    . TYR A 1 74  ? 50.944 5.411   11.416 1.00 0.00  ? 216 TYR A HH    1 
ATOM   712  N N     . ILE A 1 75  ? 46.192 11.425  11.431 1.00 14.70 ? 217 ILE A N     1 
ATOM   713  C CA    . ILE A 1 75  ? 45.294 10.976  12.449 1.00 13.90 ? 217 ILE A CA    1 
ATOM   714  C C     . ILE A 1 75  ? 44.443 9.858   11.773 1.00 15.94 ? 217 ILE A C     1 
ATOM   715  O O     . ILE A 1 75  ? 44.184 8.824   12.410 1.00 15.66 ? 217 ILE A O     1 
ATOM   716  C CB    . ILE A 1 75  ? 44.429 12.146  12.964 1.00 13.97 ? 217 ILE A CB    1 
ATOM   717  C CG1   . ILE A 1 75  ? 45.309 13.148  13.712 1.00 11.08 ? 217 ILE A CG1   1 
ATOM   718  C CG2   . ILE A 1 75  ? 43.352 11.604  13.942 1.00 9.90  ? 217 ILE A CG2   1 
ATOM   719  C CD1   . ILE A 1 75  ? 44.492 14.311  14.287 1.00 10.73 ? 217 ILE A CD1   1 
ATOM   720  H H     . ILE A 1 75  ? 45.821 11.858  10.634 1.00 0.00  ? 217 ILE A H     1 
ATOM   721  N N     . THR A 1 76  ? 44.038 9.959   10.494 1.00 17.77 ? 218 THR A N     1 
ATOM   722  C CA    . THR A 1 76  ? 43.300 8.887   9.812  1.00 18.64 ? 218 THR A CA    1 
ATOM   723  C C     . THR A 1 76  ? 43.961 8.608   8.452  1.00 18.84 ? 218 THR A C     1 
ATOM   724  O O     . THR A 1 76  ? 44.755 9.436   7.981  1.00 20.10 ? 218 THR A O     1 
ATOM   725  C CB    . THR A 1 76  ? 41.824 9.293   9.595  1.00 17.68 ? 218 THR A CB    1 
ATOM   726  O OG1   . THR A 1 76  ? 41.812 10.321  8.624  1.00 21.12 ? 218 THR A OG1   1 
ATOM   727  C CG2   . THR A 1 76  ? 41.180 9.806   10.856 1.00 16.92 ? 218 THR A CG2   1 
ATOM   728  H H     . THR A 1 76  ? 44.243 10.779  9.998  1.00 0.00  ? 218 THR A H     1 
ATOM   729  H HG1   . THR A 1 76  ? 42.196 9.995   7.807  1.00 0.00  ? 218 THR A HG1   1 
ATOM   730  N N     . SER A 1 77  ? 43.639 7.510   7.761  1.00 17.42 ? 219 SER A N     1 
ATOM   731  C CA    . SER A 1 77  ? 44.147 7.175   6.438  1.00 16.76 ? 219 SER A CA    1 
ATOM   732  C C     . SER A 1 77  ? 43.669 8.129   5.367  1.00 19.46 ? 219 SER A C     1 
ATOM   733  O O     . SER A 1 77  ? 44.139 8.075   4.239  1.00 21.62 ? 219 SER A O     1 
ATOM   734  C CB    . SER A 1 77  ? 43.657 5.843   6.056  1.00 17.09 ? 219 SER A CB    1 
ATOM   735  O OG    . SER A 1 77  ? 42.230 5.851   6.226  1.00 14.45 ? 219 SER A OG    1 
ATOM   736  H H     . SER A 1 77  ? 43.013 6.882   8.177  1.00 0.00  ? 219 SER A H     1 
ATOM   737  H HG    . SER A 1 77  ? 41.844 6.527   5.664  1.00 0.00  ? 219 SER A HG    1 
ATOM   738  N N     . ARG A 1 78  ? 42.685 8.976   5.629  1.00 21.15 ? 220 ARG A N     1 
ATOM   739  C CA    . ARG A 1 78  ? 42.138 9.862   4.635  1.00 22.69 ? 220 ARG A CA    1 
ATOM   740  C C     . ARG A 1 78  ? 43.094 10.960  4.255  1.00 22.89 ? 220 ARG A C     1 
ATOM   741  O O     . ARG A 1 78  ? 43.275 11.143  3.061  1.00 23.45 ? 220 ARG A O     1 
ATOM   742  C CB    . ARG A 1 78  ? 40.817 10.376  5.201  1.00 25.79 ? 220 ARG A CB    1 
ATOM   743  C CG    . ARG A 1 78  ? 40.006 11.398  4.423  1.00 29.59 ? 220 ARG A CG    1 
ATOM   744  C CD    . ARG A 1 78  ? 38.663 11.468  5.093  1.00 35.71 ? 220 ARG A CD    1 
ATOM   745  N NE    . ARG A 1 78  ? 38.037 12.733  4.796  1.00 45.24 ? 220 ARG A NE    1 
ATOM   746  C CZ    . ARG A 1 78  ? 37.216 12.932  3.778  1.00 48.59 ? 220 ARG A CZ    1 
ATOM   747  N NH1   . ARG A 1 78  ? 36.900 11.922  2.953  1.00 52.20 ? 220 ARG A NH1   1 
ATOM   748  N NH2   . ARG A 1 78  ? 36.729 14.167  3.632  1.00 52.44 ? 220 ARG A NH2   1 
ATOM   749  H H     . ARG A 1 78  ? 42.315 9.001   6.536  1.00 0.00  ? 220 ARG A H     1 
ATOM   750  H HE    . ARG A 1 78  ? 38.232 13.491  5.384  1.00 0.00  ? 220 ARG A HE    1 
ATOM   751  H HH11  . ARG A 1 78  ? 37.286 11.012  3.106  1.00 0.00  ? 220 ARG A HH11  1 
ATOM   752  H HH12  . ARG A 1 78  ? 36.279 12.079  2.185  1.00 0.00  ? 220 ARG A HH12  1 
ATOM   753  H HH21  . ARG A 1 78  ? 36.989 14.887  4.276  1.00 0.00  ? 220 ARG A HH21  1 
ATOM   754  H HH22  . ARG A 1 78  ? 36.104 14.372  2.879  1.00 0.00  ? 220 ARG A HH22  1 
ATOM   755  N N     . THR A 1 79  ? 43.803 11.621  5.152  1.00 23.57 ? 221 THR A N     1 
ATOM   756  C CA    . THR A 1 79  ? 44.708 12.680  4.771  1.00 23.69 ? 221 THR A CA    1 
ATOM   757  C C     . THR A 1 79  ? 45.911 12.512  5.649  1.00 24.22 ? 221 THR A C     1 
ATOM   758  O O     . THR A 1 79  ? 45.836 12.073  6.809  1.00 25.25 ? 221 THR A O     1 
ATOM   759  C CB    . THR A 1 79  ? 44.146 14.085  5.063  1.00 26.36 ? 221 THR A CB    1 
ATOM   760  O OG1   . THR A 1 79  ? 42.747 14.158  4.817  1.00 31.37 ? 221 THR A OG1   1 
ATOM   761  C CG2   . THR A 1 79  ? 44.796 15.080  4.122  1.00 27.25 ? 221 THR A CG2   1 
ATOM   762  H H     . THR A 1 79  ? 43.713 11.387  6.099  1.00 0.00  ? 221 THR A H     1 
ATOM   763  H HG1   . THR A 1 79  ? 42.289 13.529  5.379  1.00 0.00  ? 221 THR A HG1   1 
ATOM   764  N N     . GLN A 1 80  ? 47.023 12.845  5.044  1.00 26.12 ? 222 GLN A N     1 
ATOM   765  C CA    . GLN A 1 80  ? 48.306 12.869  5.724  1.00 29.52 ? 222 GLN A CA    1 
ATOM   766  C C     . GLN A 1 80  ? 48.808 14.299  5.506  1.00 29.39 ? 222 GLN A C     1 
ATOM   767  O O     . GLN A 1 80  ? 48.407 14.986  4.549  1.00 28.68 ? 222 GLN A O     1 
ATOM   768  C CB    . GLN A 1 80  ? 49.271 11.884  5.102  1.00 32.20 ? 222 GLN A CB    1 
ATOM   769  C CG    . GLN A 1 80  ? 49.107 10.469  5.672  1.00 44.90 ? 222 GLN A CG    1 
ATOM   770  C CD    . GLN A 1 80  ? 47.859 9.655   5.283  1.00 48.10 ? 222 GLN A CD    1 
ATOM   771  O OE1   . GLN A 1 80  ? 47.630 9.569   4.074  1.00 50.42 ? 222 GLN A OE1   1 
ATOM   772  N NE2   . GLN A 1 80  ? 46.950 9.104   6.123  1.00 39.45 ? 222 GLN A NE2   1 
ATOM   773  H H     . GLN A 1 80  ? 46.988 13.088  4.095  1.00 0.00  ? 222 GLN A H     1 
ATOM   774  H HE21  . GLN A 1 80  ? 46.205 8.612   5.722  1.00 0.00  ? 222 GLN A HE21  1 
ATOM   775  H HE22  . GLN A 1 80  ? 47.053 9.206   7.092  1.00 0.00  ? 222 GLN A HE22  1 
ATOM   776  N N     . PHE A 1 81  ? 49.704 14.782  6.351  1.00 27.98 ? 223 PHE A N     1 
ATOM   777  C CA    . PHE A 1 81  ? 50.180 16.161  6.296  1.00 27.07 ? 223 PHE A CA    1 
ATOM   778  C C     . PHE A 1 81  ? 51.665 16.166  6.446  1.00 27.63 ? 223 PHE A C     1 
ATOM   779  O O     . PHE A 1 81  ? 52.244 15.284  7.052  1.00 27.67 ? 223 PHE A O     1 
ATOM   780  C CB    . PHE A 1 81  ? 49.639 16.996  7.434  1.00 23.62 ? 223 PHE A CB    1 
ATOM   781  C CG    . PHE A 1 81  ? 48.136 16.857  7.526  1.00 23.99 ? 223 PHE A CG    1 
ATOM   782  C CD1   . PHE A 1 81  ? 47.311 17.620  6.692  1.00 24.28 ? 223 PHE A CD1   1 
ATOM   783  C CD2   . PHE A 1 81  ? 47.594 15.954  8.439  1.00 18.81 ? 223 PHE A CD2   1 
ATOM   784  C CE1   . PHE A 1 81  ? 45.924 17.464  6.778  1.00 24.29 ? 223 PHE A CE1   1 
ATOM   785  C CE2   . PHE A 1 81  ? 46.208 15.817  8.508  1.00 23.58 ? 223 PHE A CE2   1 
ATOM   786  C CZ    . PHE A 1 81  ? 45.363 16.563  7.677  1.00 21.29 ? 223 PHE A CZ    1 
ATOM   787  H H     . PHE A 1 81  ? 50.063 14.189  7.043  1.00 0.00  ? 223 PHE A H     1 
ATOM   788  N N     . ASN A 1 82  ? 52.313 17.172  5.941  1.00 30.65 ? 224 ASN A N     1 
ATOM   789  C CA    . ASN A 1 82  ? 53.744 17.237  6.056  1.00 33.44 ? 224 ASN A CA    1 
ATOM   790  C C     . ASN A 1 82  ? 54.155 17.848  7.367  1.00 31.88 ? 224 ASN A C     1 
ATOM   791  O O     . ASN A 1 82  ? 55.314 17.686  7.742  1.00 34.97 ? 224 ASN A O     1 
ATOM   792  C CB    . ASN A 1 82  ? 54.276 18.040  4.867  1.00 40.19 ? 224 ASN A CB    1 
ATOM   793  C CG    . ASN A 1 82  ? 53.869 17.295  3.609  1.00 45.65 ? 224 ASN A CG    1 
ATOM   794  O OD1   . ASN A 1 82  ? 54.465 16.277  3.237  1.00 49.97 ? 224 ASN A OD1   1 
ATOM   795  N ND2   . ASN A 1 82  ? 52.742 17.642  2.990  1.00 49.28 ? 224 ASN A ND2   1 
ATOM   796  H H     . ASN A 1 82  ? 51.826 17.887  5.481  1.00 0.00  ? 224 ASN A H     1 
ATOM   797  H HD21  . ASN A 1 82  ? 52.500 17.147  2.181  1.00 0.00  ? 224 ASN A HD21  1 
ATOM   798  H HD22  . ASN A 1 82  ? 52.190 18.368  3.348  1.00 0.00  ? 224 ASN A HD22  1 
ATOM   799  N N     . SER A 1 83  ? 53.287 18.582  8.074  1.00 28.14 ? 225 SER A N     1 
ATOM   800  C CA    . SER A 1 83  ? 53.699 19.155  9.319  1.00 25.27 ? 225 SER A CA    1 
ATOM   801  C C     . SER A 1 83  ? 52.468 19.221  10.173 1.00 23.82 ? 225 SER A C     1 
ATOM   802  O O     . SER A 1 83  ? 51.334 19.092  9.700  1.00 23.55 ? 225 SER A O     1 
ATOM   803  C CB    . SER A 1 83  ? 54.279 20.540  9.053  1.00 25.26 ? 225 SER A CB    1 
ATOM   804  O OG    . SER A 1 83  ? 53.328 21.522  8.606  1.00 29.02 ? 225 SER A OG    1 
ATOM   805  H H     . SER A 1 83  ? 52.376 18.726  7.742  1.00 0.00  ? 225 SER A H     1 
ATOM   806  H HG    . SER A 1 83  ? 52.928 21.229  7.784  1.00 0.00  ? 225 SER A HG    1 
ATOM   807  N N     . LEU A 1 84  ? 52.740 19.416  11.455 1.00 21.48 ? 226 LEU A N     1 
ATOM   808  C CA    . LEU A 1 84  ? 51.735 19.665  12.457 1.00 23.41 ? 226 LEU A CA    1 
ATOM   809  C C     . LEU A 1 84  ? 51.008 20.986  12.150 1.00 24.09 ? 226 LEU A C     1 
ATOM   810  O O     . LEU A 1 84  ? 49.815 21.138  12.404 1.00 25.84 ? 226 LEU A O     1 
ATOM   811  C CB    . LEU A 1 84  ? 52.429 19.746  13.811 1.00 21.39 ? 226 LEU A CB    1 
ATOM   812  C CG    . LEU A 1 84  ? 52.948 18.489  14.402 1.00 22.62 ? 226 LEU A CG    1 
ATOM   813  C CD1   . LEU A 1 84  ? 53.642 18.828  15.703 1.00 20.13 ? 226 LEU A CD1   1 
ATOM   814  C CD2   . LEU A 1 84  ? 51.794 17.522  14.627 1.00 22.08 ? 226 LEU A CD2   1 
ATOM   815  H H     . LEU A 1 84  ? 53.677 19.389  11.738 1.00 0.00  ? 226 LEU A H     1 
ATOM   816  N N     . GLN A 1 85  ? 51.698 21.987  11.599 1.00 25.21 ? 227 GLN A N     1 
ATOM   817  C CA    . GLN A 1 85  ? 51.104 23.265  11.244 1.00 26.53 ? 227 GLN A CA    1 
ATOM   818  C C     . GLN A 1 85  ? 49.997 23.063  10.256 1.00 23.65 ? 227 GLN A C     1 
ATOM   819  O O     . GLN A 1 85  ? 48.871 23.533  10.379 1.00 25.13 ? 227 GLN A O     1 
ATOM   820  C CB    . GLN A 1 85  ? 52.174 24.170  10.637 1.00 33.56 ? 227 GLN A CB    1 
ATOM   821  C CG    . GLN A 1 85  ? 53.278 24.686  11.613 1.00 39.87 ? 227 GLN A CG    1 
ATOM   822  C CD    . GLN A 1 85  ? 54.393 23.749  12.123 1.00 44.42 ? 227 GLN A CD    1 
ATOM   823  O OE1   . GLN A 1 85  ? 54.579 22.606  11.677 1.00 45.97 ? 227 GLN A OE1   1 
ATOM   824  N NE2   . GLN A 1 85  ? 55.193 24.229  13.071 1.00 46.07 ? 227 GLN A NE2   1 
ATOM   825  H H     . GLN A 1 85  ? 52.653 21.853  11.425 1.00 0.00  ? 227 GLN A H     1 
ATOM   826  H HE21  . GLN A 1 85  ? 55.904 23.643  13.402 1.00 0.00  ? 227 GLN A HE21  1 
ATOM   827  H HE22  . GLN A 1 85  ? 55.059 25.138  13.412 1.00 0.00  ? 227 GLN A HE22  1 
ATOM   828  N N     . GLN A 1 86  ? 50.341 22.289  9.258  1.00 24.14 ? 228 GLN A N     1 
ATOM   829  C CA    . GLN A 1 86  ? 49.377 21.950  8.229  1.00 27.54 ? 228 GLN A CA    1 
ATOM   830  C C     . GLN A 1 86  ? 48.256 21.067  8.749  1.00 24.56 ? 228 GLN A C     1 
ATOM   831  O O     . GLN A 1 86  ? 47.125 21.162  8.263  1.00 23.96 ? 228 GLN A O     1 
ATOM   832  C CB    . GLN A 1 86  ? 50.101 21.260  7.085  1.00 33.15 ? 228 GLN A CB    1 
ATOM   833  C CG    . GLN A 1 86  ? 51.191 22.107  6.433  1.00 44.20 ? 228 GLN A CG    1 
ATOM   834  C CD    . GLN A 1 86  ? 51.954 21.340  5.360  1.00 50.48 ? 228 GLN A CD    1 
ATOM   835  O OE1   . GLN A 1 86  ? 52.042 20.109  5.366  1.00 55.91 ? 228 GLN A OE1   1 
ATOM   836  N NE2   . GLN A 1 86  ? 52.538 22.002  4.374  1.00 54.41 ? 228 GLN A NE2   1 
ATOM   837  H H     . GLN A 1 86  ? 51.254 21.937  9.206  1.00 0.00  ? 228 GLN A H     1 
ATOM   838  H HE21  . GLN A 1 86  ? 53.020 21.479  3.701  1.00 0.00  ? 228 GLN A HE21  1 
ATOM   839  H HE22  . GLN A 1 86  ? 52.478 22.979  4.337  1.00 0.00  ? 228 GLN A HE22  1 
ATOM   840  N N     . LEU A 1 87  ? 48.540 20.203  9.720  1.00 22.61 ? 229 LEU A N     1 
ATOM   841  C CA    . LEU A 1 87  ? 47.490 19.388  10.311 1.00 22.93 ? 229 LEU A CA    1 
ATOM   842  C C     . LEU A 1 87  ? 46.487 20.259  11.059 1.00 20.68 ? 229 LEU A C     1 
ATOM   843  O O     . LEU A 1 87  ? 45.268 20.126  10.883 1.00 21.64 ? 229 LEU A O     1 
ATOM   844  C CB    . LEU A 1 87  ? 48.132 18.304  11.252 1.00 22.42 ? 229 LEU A CB    1 
ATOM   845  C CG    . LEU A 1 87  ? 47.199 17.283  11.930 1.00 24.10 ? 229 LEU A CG    1 
ATOM   846  C CD1   . LEU A 1 87  ? 47.904 15.946  12.034 1.00 22.33 ? 229 LEU A CD1   1 
ATOM   847  C CD2   . LEU A 1 87  ? 46.736 17.805  13.301 1.00 22.60 ? 229 LEU A CD2   1 
ATOM   848  H H     . LEU A 1 87  ? 49.462 20.115  10.039 1.00 0.00  ? 229 LEU A H     1 
ATOM   849  N N     . VAL A 1 88  ? 46.948 21.203  11.880 1.00 21.62 ? 230 VAL A N     1 
ATOM   850  C CA    . VAL A 1 88  ? 46.063 22.079  12.656 1.00 20.78 ? 230 VAL A CA    1 
ATOM   851  C C     . VAL A 1 88  ? 45.204 22.911  11.708 1.00 22.00 ? 230 VAL A C     1 
ATOM   852  O O     . VAL A 1 88  ? 43.996 23.038  11.845 1.00 23.82 ? 230 VAL A O     1 
ATOM   853  C CB    . VAL A 1 88  ? 46.982 22.931  13.595 1.00 19.15 ? 230 VAL A CB    1 
ATOM   854  C CG1   . VAL A 1 88  ? 46.255 24.125  14.175 1.00 15.53 ? 230 VAL A CG1   1 
ATOM   855  C CG2   . VAL A 1 88  ? 47.447 22.032  14.737 1.00 16.81 ? 230 VAL A CG2   1 
ATOM   856  H H     . VAL A 1 88  ? 47.917 21.316  11.969 1.00 0.00  ? 230 VAL A H     1 
ATOM   857  N N     . ALA A 1 89  ? 45.810 23.427  10.653 1.00 24.53 ? 231 ALA A N     1 
ATOM   858  C CA    . ALA A 1 89  ? 45.115 24.249  9.682  1.00 23.83 ? 231 ALA A CA    1 
ATOM   859  C C     . ALA A 1 89  ? 44.013 23.476  8.978  1.00 25.17 ? 231 ALA A C     1 
ATOM   860  O O     . ALA A 1 89  ? 42.903 23.984  8.755  1.00 26.34 ? 231 ALA A O     1 
ATOM   861  C CB    . ALA A 1 89  ? 46.140 24.733  8.677  1.00 24.10 ? 231 ALA A CB    1 
ATOM   862  H H     . ALA A 1 89  ? 46.764 23.247  10.522 1.00 0.00  ? 231 ALA A H     1 
ATOM   863  N N     . TYR A 1 90  ? 44.320 22.258  8.517  1.00 25.23 ? 232 TYR A N     1 
ATOM   864  C CA    . TYR A 1 90  ? 43.320 21.476  7.855  1.00 24.56 ? 232 TYR A CA    1 
ATOM   865  C C     . TYR A 1 90  ? 42.112 21.223  8.741  1.00 23.96 ? 232 TYR A C     1 
ATOM   866  O O     . TYR A 1 90  ? 41.003 21.515  8.296  1.00 24.87 ? 232 TYR A O     1 
ATOM   867  C CB    . TYR A 1 90  ? 43.948 20.191  7.428  1.00 26.86 ? 232 TYR A CB    1 
ATOM   868  C CG    . TYR A 1 90  ? 42.928 19.349  6.687  1.00 30.95 ? 232 TYR A CG    1 
ATOM   869  C CD1   . TYR A 1 90  ? 42.735 19.585  5.336  1.00 32.40 ? 232 TYR A CD1   1 
ATOM   870  C CD2   . TYR A 1 90  ? 42.194 18.357  7.347  1.00 32.35 ? 232 TYR A CD2   1 
ATOM   871  C CE1   . TYR A 1 90  ? 41.810 18.820  4.638  1.00 36.32 ? 232 TYR A CE1   1 
ATOM   872  C CE2   . TYR A 1 90  ? 41.260 17.594  6.657  1.00 36.18 ? 232 TYR A CE2   1 
ATOM   873  C CZ    . TYR A 1 90  ? 41.077 17.831  5.293  1.00 37.74 ? 232 TYR A CZ    1 
ATOM   874  O OH    . TYR A 1 90  ? 40.142 17.119  4.571  1.00 39.68 ? 232 TYR A OH    1 
ATOM   875  H H     . TYR A 1 90  ? 45.226 21.903  8.632  1.00 0.00  ? 232 TYR A H     1 
ATOM   876  H HH    . TYR A 1 90  ? 39.697 16.496  5.150  1.00 0.00  ? 232 TYR A HH    1 
ATOM   877  N N     . TYR A 1 91  ? 42.301 20.687  9.936  1.00 22.97 ? 233 TYR A N     1 
ATOM   878  C CA    . TYR A 1 91  ? 41.186 20.379  10.811 1.00 22.56 ? 233 TYR A CA    1 
ATOM   879  C C     . TYR A 1 91  ? 40.552 21.603  11.428 1.00 23.98 ? 233 TYR A C     1 
ATOM   880  O O     . TYR A 1 91  ? 39.551 21.507  12.163 1.00 23.33 ? 233 TYR A O     1 
ATOM   881  C CB    . TYR A 1 91  ? 41.638 19.428  11.902 1.00 18.25 ? 233 TYR A CB    1 
ATOM   882  C CG    . TYR A 1 91  ? 41.903 17.990  11.412 1.00 21.30 ? 233 TYR A CG    1 
ATOM   883  C CD1   . TYR A 1 91  ? 40.841 17.171  10.991 1.00 19.43 ? 233 TYR A CD1   1 
ATOM   884  C CD2   . TYR A 1 91  ? 43.210 17.507  11.351 1.00 18.88 ? 233 TYR A CD2   1 
ATOM   885  C CE1   . TYR A 1 91  ? 41.083 15.900  10.509 1.00 16.89 ? 233 TYR A CE1   1 
ATOM   886  C CE2   . TYR A 1 91  ? 43.456 16.233  10.868 1.00 19.17 ? 233 TYR A CE2   1 
ATOM   887  C CZ    . TYR A 1 91  ? 42.386 15.451  10.452 1.00 19.10 ? 233 TYR A CZ    1 
ATOM   888  O OH    . TYR A 1 91  ? 42.596 14.183  9.967  1.00 23.57 ? 233 TYR A OH    1 
ATOM   889  H H     . TYR A 1 91  ? 43.214 20.494  10.236 1.00 0.00  ? 233 TYR A H     1 
ATOM   890  H HH    . TYR A 1 91  ? 43.536 13.988  9.977  1.00 0.00  ? 233 TYR A HH    1 
ATOM   891  N N     . SER A 1 92  ? 41.125 22.778  11.173 1.00 25.29 ? 234 SER A N     1 
ATOM   892  C CA    . SER A 1 92  ? 40.432 23.990  11.590 1.00 29.48 ? 234 SER A CA    1 
ATOM   893  C C     . SER A 1 92  ? 39.340 24.269  10.550 1.00 31.82 ? 234 SER A C     1 
ATOM   894  O O     . SER A 1 92  ? 38.314 24.908  10.827 1.00 32.71 ? 234 SER A O     1 
ATOM   895  C CB    . SER A 1 92  ? 41.427 25.155  11.689 1.00 29.73 ? 234 SER A CB    1 
ATOM   896  O OG    . SER A 1 92  ? 42.282 24.965  12.827 1.00 33.33 ? 234 SER A OG    1 
ATOM   897  H H     . SER A 1 92  ? 41.991 22.826  10.716 1.00 0.00  ? 234 SER A H     1 
ATOM   898  H HG    . SER A 1 92  ? 42.765 24.141  12.731 1.00 0.00  ? 234 SER A HG    1 
ATOM   899  N N     . LYS A 1 93  ? 39.483 23.728  9.340  1.00 32.76 ? 235 LYS A N     1 
ATOM   900  C CA    . LYS A 1 93  ? 38.497 23.925  8.314  1.00 35.25 ? 235 LYS A CA    1 
ATOM   901  C C     . LYS A 1 93  ? 37.527 22.781  8.262  1.00 34.92 ? 235 LYS A C     1 
ATOM   902  O O     . LYS A 1 93  ? 36.334 22.941  7.999  1.00 36.05 ? 235 LYS A O     1 
ATOM   903  C CB    . LYS A 1 93  ? 39.121 24.015  6.956  1.00 39.34 ? 235 LYS A CB    1 
ATOM   904  C CG    . LYS A 1 93  ? 40.175 25.093  6.792  1.00 49.00 ? 235 LYS A CG    1 
ATOM   905  C CD    . LYS A 1 93  ? 40.638 25.087  5.322  1.00 61.38 ? 235 LYS A CD    1 
ATOM   906  C CE    . LYS A 1 93  ? 41.344 23.795  4.752  1.00 67.94 ? 235 LYS A CE    1 
ATOM   907  N NZ    . LYS A 1 93  ? 42.762 23.659  5.070  1.00 71.52 ? 235 LYS A NZ    1 
ATOM   908  H H     . LYS A 1 93  ? 40.276 23.186  9.147  1.00 0.00  ? 235 LYS A H     1 
ATOM   909  H HZ1   . LYS A 1 93  ? 42.885 23.628  6.102  1.00 0.00  ? 235 LYS A HZ1   1 
ATOM   910  H HZ2   . LYS A 1 93  ? 43.129 22.781  4.650  1.00 0.00  ? 235 LYS A HZ2   1 
ATOM   911  H HZ3   . LYS A 1 93  ? 43.283 24.472  4.683  1.00 0.00  ? 235 LYS A HZ3   1 
ATOM   912  N N     . HIS A 1 94  ? 38.058 21.566  8.414  1.00 34.36 ? 236 HIS A N     1 
ATOM   913  C CA    . HIS A 1 94  ? 37.280 20.344  8.240  1.00 30.44 ? 236 HIS A CA    1 
ATOM   914  C C     . HIS A 1 94  ? 37.435 19.471  9.441  1.00 27.32 ? 236 HIS A C     1 
ATOM   915  O O     . HIS A 1 94  ? 38.577 19.162  9.747  1.00 29.29 ? 236 HIS A O     1 
ATOM   916  C CB    . HIS A 1 94  ? 37.767 19.535  7.062  1.00 33.15 ? 236 HIS A CB    1 
ATOM   917  C CG    . HIS A 1 94  ? 37.964 20.412  5.848  1.00 39.58 ? 236 HIS A CG    1 
ATOM   918  N ND1   . HIS A 1 94  ? 37.053 21.064  5.120  1.00 40.24 ? 236 HIS A ND1   1 
ATOM   919  C CD2   . HIS A 1 94  ? 39.206 20.727  5.355  1.00 41.76 ? 236 HIS A CD2   1 
ATOM   920  C CE1   . HIS A 1 94  ? 37.695 21.759  4.222  1.00 41.97 ? 236 HIS A CE1   1 
ATOM   921  N NE2   . HIS A 1 94  ? 38.988 21.551  4.365  1.00 43.31 ? 236 HIS A NE2   1 
ATOM   922  H H     . HIS A 1 94  ? 39.006 21.492  8.651  1.00 0.00  ? 236 HIS A H     1 
ATOM   923  H HD1   . HIS A 1 94  ? 36.087 21.027  5.238  1.00 0.00  ? 236 HIS A HD1   1 
ATOM   924  H HE2   . HIS A 1 94  ? 39.683 21.955  3.811  1.00 0.00  ? 236 HIS A HE2   1 
ATOM   925  N N     . ALA A 1 95  ? 36.365 19.091  10.136 1.00 23.08 ? 237 ALA A N     1 
ATOM   926  C CA    . ALA A 1 95  ? 36.493 18.193  11.259 1.00 22.89 ? 237 ALA A CA    1 
ATOM   927  C C     . ALA A 1 95  ? 36.858 16.782  10.808 1.00 24.35 ? 237 ALA A C     1 
ATOM   928  O O     . ALA A 1 95  ? 37.585 16.117  11.537 1.00 26.46 ? 237 ALA A O     1 
ATOM   929  C CB    . ALA A 1 95  ? 35.225 18.085  11.993 1.00 20.75 ? 237 ALA A CB    1 
ATOM   930  H H     . ALA A 1 95  ? 35.479 19.425  9.882  1.00 0.00  ? 237 ALA A H     1 
ATOM   931  N N     . ASP A 1 96  ? 36.320 16.308  9.664  1.00 24.85 ? 238 ASP A N     1 
ATOM   932  C CA    . ASP A 1 96  ? 36.625 15.046  9.024  1.00 24.58 ? 238 ASP A CA    1 
ATOM   933  C C     . ASP A 1 96  ? 36.888 13.868  9.925  1.00 24.75 ? 238 ASP A C     1 
ATOM   934  O O     . ASP A 1 96  ? 37.878 13.146  9.826  1.00 25.81 ? 238 ASP A O     1 
ATOM   935  C CB    . ASP A 1 96  ? 37.828 15.192  8.128  1.00 25.14 ? 238 ASP A CB    1 
ATOM   936  C CG    . ASP A 1 96  ? 37.674 15.727  6.741  1.00 27.30 ? 238 ASP A CG    1 
ATOM   937  O OD1   . ASP A 1 96  ? 36.728 16.442  6.423  1.00 28.46 ? 238 ASP A OD1   1 
ATOM   938  O OD2   . ASP A 1 96  ? 38.522 15.379  5.944  1.00 28.01 ? 238 ASP A OD2   1 
ATOM   939  H H     . ASP A 1 96  ? 35.656 16.875  9.223  1.00 0.00  ? 238 ASP A H     1 
ATOM   940  N N     . GLY A 1 97  ? 35.930 13.643  10.809 1.00 25.03 ? 239 GLY A N     1 
ATOM   941  C CA    . GLY A 1 97  ? 36.042 12.541  11.751 1.00 22.23 ? 239 GLY A CA    1 
ATOM   942  C C     . GLY A 1 97  ? 36.292 13.015  13.163 1.00 21.79 ? 239 GLY A C     1 
ATOM   943  O O     . GLY A 1 97  ? 35.959 12.312  14.116 1.00 21.81 ? 239 GLY A O     1 
ATOM   944  H H     . GLY A 1 97  ? 35.140 14.223  10.829 1.00 0.00  ? 239 GLY A H     1 
ATOM   945  N N     . LEU A 1 98  ? 36.890 14.186  13.358 1.00 21.21 ? 240 LEU A N     1 
ATOM   946  C CA    . LEU A 1 98  ? 37.077 14.691  14.691 1.00 20.13 ? 240 LEU A CA    1 
ATOM   947  C C     . LEU A 1 98  ? 35.718 15.047  15.263 1.00 21.35 ? 240 LEU A C     1 
ATOM   948  O O     . LEU A 1 98  ? 34.746 15.247  14.541 1.00 22.03 ? 240 LEU A O     1 
ATOM   949  C CB    . LEU A 1 98  ? 37.890 15.933  14.689 1.00 18.60 ? 240 LEU A CB    1 
ATOM   950  C CG    . LEU A 1 98  ? 39.243 15.871  14.087 1.00 17.81 ? 240 LEU A CG    1 
ATOM   951  C CD1   . LEU A 1 98  ? 39.877 17.154  14.528 1.00 18.38 ? 240 LEU A CD1   1 
ATOM   952  C CD2   . LEU A 1 98  ? 40.072 14.655  14.507 1.00 17.48 ? 240 LEU A CD2   1 
ATOM   953  H H     . LEU A 1 98  ? 37.205 14.707  12.590 1.00 0.00  ? 240 LEU A H     1 
ATOM   954  N N     . CYS A 1 99  ? 35.612 15.177  16.571 1.00 23.42 ? 241 CYS A N     1 
ATOM   955  C CA    . CYS A 1 99  ? 34.372 15.579  17.194 1.00 23.63 ? 241 CYS A CA    1 
ATOM   956  C C     . CYS A 1 99  ? 33.980 16.979  16.757 1.00 25.22 ? 241 CYS A C     1 
ATOM   957  O O     . CYS A 1 99  ? 32.801 17.333  16.687 1.00 27.29 ? 241 CYS A O     1 
ATOM   958  C CB    . CYS A 1 99  ? 34.543 15.550  18.695 1.00 25.17 ? 241 CYS A CB    1 
ATOM   959  S SG    . CYS A 1 99  ? 35.862 16.622  19.325 1.00 26.10 ? 241 CYS A SG    1 
ATOM   960  H H     . CYS A 1 99  ? 36.393 14.997  17.134 1.00 0.00  ? 241 CYS A H     1 
ATOM   961  N N     . HIS A 1 100 ? 34.930 17.850  16.452 1.00 25.51 ? 242 HIS A N     1 
ATOM   962  C CA    . HIS A 1 100 ? 34.615 19.183  16.071 1.00 26.03 ? 242 HIS A CA    1 
ATOM   963  C C     . HIS A 1 100 ? 35.841 19.720  15.381 1.00 26.96 ? 242 HIS A C     1 
ATOM   964  O O     . HIS A 1 100 ? 36.943 19.266  15.675 1.00 28.27 ? 242 HIS A O     1 
ATOM   965  C CB    . HIS A 1 100 ? 34.309 19.947  17.350 1.00 30.34 ? 242 HIS A CB    1 
ATOM   966  C CG    . HIS A 1 100 ? 33.634 21.279  17.145 1.00 34.68 ? 242 HIS A CG    1 
ATOM   967  N ND1   . HIS A 1 100 ? 32.350 21.557  17.320 1.00 36.94 ? 242 HIS A ND1   1 
ATOM   968  C CD2   . HIS A 1 100 ? 34.256 22.427  16.724 1.00 36.24 ? 242 HIS A CD2   1 
ATOM   969  C CE1   . HIS A 1 100 ? 32.196 22.838  17.023 1.00 38.75 ? 242 HIS A CE1   1 
ATOM   970  N NE2   . HIS A 1 100 ? 33.348 23.348  16.665 1.00 37.04 ? 242 HIS A NE2   1 
ATOM   971  H H     . HIS A 1 100 ? 35.868 17.570  16.490 1.00 0.00  ? 242 HIS A H     1 
ATOM   972  H HD1   . HIS A 1 100 ? 31.656 20.940  17.610 1.00 0.00  ? 242 HIS A HD1   1 
ATOM   973  H HE2   . HIS A 1 100 ? 33.498 24.274  16.397 1.00 0.00  ? 242 HIS A HE2   1 
ATOM   974  N N     . ARG A 1 101 ? 35.581 20.651  14.459 1.00 26.23 ? 243 ARG A N     1 
ATOM   975  C CA    . ARG A 1 101 ? 36.556 21.487  13.788 1.00 28.43 ? 243 ARG A CA    1 
ATOM   976  C C     . ARG A 1 101 ? 37.384 22.157  14.872 1.00 27.49 ? 243 ARG A C     1 
ATOM   977  O O     . ARG A 1 101 ? 36.823 22.491  15.923 1.00 24.94 ? 243 ARG A O     1 
ATOM   978  C CB    . ARG A 1 101 ? 35.866 22.593  13.044 1.00 34.67 ? 243 ARG A CB    1 
ATOM   979  C CG    . ARG A 1 101 ? 35.026 22.310  11.835 1.00 45.30 ? 243 ARG A CG    1 
ATOM   980  C CD    . ARG A 1 101 ? 34.228 23.547  11.485 1.00 52.44 ? 243 ARG A CD    1 
ATOM   981  N NE    . ARG A 1 101 ? 35.079 24.715  11.306 1.00 63.23 ? 243 ARG A NE    1 
ATOM   982  C CZ    . ARG A 1 101 ? 34.949 25.824  12.051 1.00 67.81 ? 243 ARG A CZ    1 
ATOM   983  N NH1   . ARG A 1 101 ? 34.007 25.869  13.014 1.00 70.76 ? 243 ARG A NH1   1 
ATOM   984  N NH2   . ARG A 1 101 ? 35.716 26.897  11.786 1.00 70.32 ? 243 ARG A NH2   1 
ATOM   985  H H     . ARG A 1 101 ? 34.643 20.781  14.213 1.00 0.00  ? 243 ARG A H     1 
ATOM   986  H HE    . ARG A 1 101 ? 35.773 24.690  10.615 1.00 0.00  ? 243 ARG A HE    1 
ATOM   987  H HH11  . ARG A 1 101 ? 33.412 25.080  13.169 1.00 0.00  ? 243 ARG A HH11  1 
ATOM   988  H HH12  . ARG A 1 101 ? 33.903 26.691  13.574 1.00 0.00  ? 243 ARG A HH12  1 
ATOM   989  H HH21  . ARG A 1 101 ? 36.378 26.866  11.038 1.00 0.00  ? 243 ARG A HH21  1 
ATOM   990  H HH22  . ARG A 1 101 ? 35.624 27.726  12.338 1.00 0.00  ? 243 ARG A HH22  1 
ATOM   991  N N     . LEU A 1 102 ? 38.662 22.445  14.649 1.00 25.62 ? 244 LEU A N     1 
ATOM   992  C CA    . LEU A 1 102 ? 39.487 23.082  15.639 1.00 22.64 ? 244 LEU A CA    1 
ATOM   993  C C     . LEU A 1 102 ? 39.098 24.539  15.480 1.00 26.38 ? 244 LEU A C     1 
ATOM   994  O O     . LEU A 1 102 ? 39.164 25.139  14.410 1.00 28.36 ? 244 LEU A O     1 
ATOM   995  C CB    . LEU A 1 102 ? 40.944 22.801  15.298 1.00 17.48 ? 244 LEU A CB    1 
ATOM   996  C CG    . LEU A 1 102 ? 41.362 21.334  15.177 1.00 14.43 ? 244 LEU A CG    1 
ATOM   997  C CD1   . LEU A 1 102 ? 42.845 21.244  14.848 1.00 13.44 ? 244 LEU A CD1   1 
ATOM   998  C CD2   . LEU A 1 102 ? 41.039 20.613  16.474 1.00 12.11 ? 244 LEU A CD2   1 
ATOM   999  H H     . LEU A 1 102 ? 39.055 22.216  13.781 1.00 0.00  ? 244 LEU A H     1 
ATOM   1000 N N     . THR A 1 103 ? 38.528 25.055  16.558 1.00 29.26 ? 245 THR A N     1 
ATOM   1001 C CA    . THR A 1 103 ? 38.076 26.424  16.573 1.00 30.84 ? 245 THR A CA    1 
ATOM   1002 C C     . THR A 1 103 ? 39.034 27.346  17.293 1.00 30.84 ? 245 THR A C     1 
ATOM   1003 O O     . THR A 1 103 ? 39.641 28.173  16.648 1.00 36.08 ? 245 THR A O     1 
ATOM   1004 C CB    . THR A 1 103 ? 36.659 26.556  17.237 1.00 27.43 ? 245 THR A CB    1 
ATOM   1005 O OG1   . THR A 1 103 ? 36.685 26.017  18.542 1.00 28.33 ? 245 THR A OG1   1 
ATOM   1006 C CG2   . THR A 1 103 ? 35.617 25.828  16.443 1.00 26.67 ? 245 THR A CG2   1 
ATOM   1007 H H     . THR A 1 103 ? 38.412 24.499  17.356 1.00 0.00  ? 245 THR A H     1 
ATOM   1008 H HG1   . THR A 1 103 ? 37.328 26.493  19.073 1.00 0.00  ? 245 THR A HG1   1 
ATOM   1009 N N     . THR A 1 104 ? 39.262 27.116  18.565 1.00 29.61 ? 246 THR A N     1 
ATOM   1010 C CA    . THR A 1 104 ? 39.990 27.991  19.435 1.00 30.48 ? 246 THR A CA    1 
ATOM   1011 C C     . THR A 1 104 ? 41.347 27.498  19.908 1.00 30.02 ? 246 THR A C     1 
ATOM   1012 O O     . THR A 1 104 ? 41.318 26.431  20.497 1.00 31.76 ? 246 THR A O     1 
ATOM   1013 C CB    . THR A 1 104 ? 39.039 28.226  20.645 1.00 32.35 ? 246 THR A CB    1 
ATOM   1014 O OG1   . THR A 1 104 ? 37.805 28.673  20.125 1.00 33.37 ? 246 THR A OG1   1 
ATOM   1015 C CG2   . THR A 1 104 ? 39.600 29.194  21.651 1.00 29.73 ? 246 THR A CG2   1 
ATOM   1016 H H     . THR A 1 104 ? 38.909 26.286  18.947 1.00 0.00  ? 246 THR A H     1 
ATOM   1017 H HG1   . THR A 1 104 ? 37.939 29.489  19.638 1.00 0.00  ? 246 THR A HG1   1 
ATOM   1018 N N     . VAL A 1 105 ? 42.526 28.120  19.735 1.00 29.71 ? 247 VAL A N     1 
ATOM   1019 C CA    . VAL A 1 105 ? 43.749 27.656  20.389 1.00 28.39 ? 247 VAL A CA    1 
ATOM   1020 C C     . VAL A 1 105 ? 43.547 27.747  21.915 1.00 29.18 ? 247 VAL A C     1 
ATOM   1021 O O     . VAL A 1 105 ? 42.975 28.710  22.420 1.00 29.48 ? 247 VAL A O     1 
ATOM   1022 C CB    . VAL A 1 105 ? 44.961 28.510  20.009 1.00 25.50 ? 247 VAL A CB    1 
ATOM   1023 C CG1   . VAL A 1 105 ? 46.171 28.119  20.848 1.00 24.52 ? 247 VAL A CG1   1 
ATOM   1024 C CG2   . VAL A 1 105 ? 45.256 28.295  18.541 1.00 23.57 ? 247 VAL A CG2   1 
ATOM   1025 H H     . VAL A 1 105 ? 42.567 28.908  19.154 1.00 0.00  ? 247 VAL A H     1 
ATOM   1026 N N     . CYS A 1 106 ? 43.891 26.701  22.654 1.00 27.14 ? 248 CYS A N     1 
ATOM   1027 C CA    . CYS A 1 106 ? 43.777 26.725  24.088 1.00 29.11 ? 248 CYS A CA    1 
ATOM   1028 C C     . CYS A 1 106 ? 44.666 27.858  24.618 1.00 32.37 ? 248 CYS A C     1 
ATOM   1029 O O     . CYS A 1 106 ? 45.743 28.065  24.061 1.00 30.94 ? 248 CYS A O     1 
ATOM   1030 C CB    . CYS A 1 106 ? 44.252 25.418  24.633 1.00 26.43 ? 248 CYS A CB    1 
ATOM   1031 S SG    . CYS A 1 106 ? 44.096 25.366  26.416 1.00 23.51 ? 248 CYS A SG    1 
ATOM   1032 H H     . CYS A 1 106 ? 44.230 25.894  22.214 1.00 0.00  ? 248 CYS A H     1 
ATOM   1033 N N     . PRO A 1 107 ? 44.250 28.708  25.562 1.00 36.36 ? 249 PRO A N     1 
ATOM   1034 C CA    . PRO A 1 107 ? 45.130 29.775  26.068 1.00 38.94 ? 249 PRO A CA    1 
ATOM   1035 C C     . PRO A 1 107 ? 46.101 29.410  27.202 1.00 40.31 ? 249 PRO A C     1 
ATOM   1036 O O     . PRO A 1 107 ? 45.720 28.766  28.194 1.00 39.42 ? 249 PRO A O     1 
ATOM   1037 C CB    . PRO A 1 107 ? 44.152 30.913  26.403 1.00 38.93 ? 249 PRO A CB    1 
ATOM   1038 C CG    . PRO A 1 107 ? 42.947 30.145  26.865 1.00 37.12 ? 249 PRO A CG    1 
ATOM   1039 C CD    . PRO A 1 107 ? 42.838 29.029  25.821 1.00 35.95 ? 249 PRO A CD    1 
ATOM   1040 O OXT   . PRO A 1 107 ? 47.264 29.785  27.029 1.00 42.05 ? 249 PRO A OXT   1 
HETATM 1041 C C     . ACE B 2 1   ? 41.858 7.688   24.757 1.00 23.55 ? 100 ACE C C     1 
HETATM 1042 O O     . ACE B 2 1   ? 41.794 8.906   24.854 1.00 21.37 ? 100 ACE C O     1 
HETATM 1043 C CH3   . ACE B 2 1   ? 41.806 6.775   25.963 1.00 23.69 ? 100 ACE C CH3   1 
HETATM 1044 N N     . PTR B 2 2   ? 42.111 7.042   23.642 1.00 26.51 ? 101 PTR C N     1 
HETATM 1045 C CA    . PTR B 2 2   ? 42.191 7.680   22.362 1.00 26.97 ? 101 PTR C CA    1 
HETATM 1046 C C     . PTR B 2 2   ? 41.047 7.296   21.464 1.00 27.48 ? 101 PTR C C     1 
HETATM 1047 O O     . PTR B 2 2   ? 40.640 6.120   21.387 1.00 27.75 ? 101 PTR C O     1 
HETATM 1048 C CB    . PTR B 2 2   ? 43.446 7.282   21.676 1.00 28.82 ? 101 PTR C CB    1 
HETATM 1049 C CG    . PTR B 2 2   ? 44.659 7.788   22.399 1.00 30.47 ? 101 PTR C CG    1 
HETATM 1050 C CD1   . PTR B 2 2   ? 45.301 6.953   23.288 1.00 31.93 ? 101 PTR C CD1   1 
HETATM 1051 C CD2   . PTR B 2 2   ? 45.137 9.042   22.124 1.00 31.31 ? 101 PTR C CD2   1 
HETATM 1052 C CE1   . PTR B 2 2   ? 46.443 7.384   23.929 1.00 34.25 ? 101 PTR C CE1   1 
HETATM 1053 C CE2   . PTR B 2 2   ? 46.272 9.464   22.754 1.00 33.47 ? 101 PTR C CE2   1 
HETATM 1054 C CZ    . PTR B 2 2   ? 46.949 8.640   23.644 1.00 35.27 ? 101 PTR C CZ    1 
HETATM 1055 H H     . PTR B 2 2   ? 42.252 6.074   23.688 1.00 0.00  ? 101 PTR C H     1 
ATOM   1056 N N     . GLU B 2 3   ? 40.640 8.328   20.757 1.00 26.09 ? 102 GLU C N     1 
ATOM   1057 C CA    . GLU B 2 3   ? 39.605 8.212   19.781 1.00 28.56 ? 102 GLU C CA    1 
ATOM   1058 C C     . GLU B 2 3   ? 40.059 7.482   18.504 1.00 28.58 ? 102 GLU C C     1 
ATOM   1059 O O     . GLU B 2 3   ? 41.262 7.508   18.232 1.00 30.70 ? 102 GLU C O     1 
ATOM   1060 C CB    . GLU B 2 3   ? 39.120 9.604   19.464 1.00 28.64 ? 102 GLU C CB    1 
ATOM   1061 C CG    . GLU B 2 3   ? 38.513 10.335  20.628 1.00 32.21 ? 102 GLU C CG    1 
ATOM   1062 C CD    . GLU B 2 3   ? 37.449 9.520   21.348 1.00 37.11 ? 102 GLU C CD    1 
ATOM   1063 O OE1   . GLU B 2 3   ? 36.388 9.286   20.744 1.00 37.28 ? 102 GLU C OE1   1 
ATOM   1064 O OE2   . GLU B 2 3   ? 37.704 9.127   22.494 1.00 38.46 ? 102 GLU C OE2   1 
ATOM   1065 H H     . GLU B 2 3   ? 41.059 9.201   20.905 1.00 0.00  ? 102 GLU C H     1 
HETATM 1066 N N     . DIP B 2 4   ? 39.221 6.747   17.728 1.00 28.36 ? 103 DIP C N     1 
HETATM 1067 C C1    . DIP B 2 4   ? 37.875 6.452   18.192 1.00 26.88 ? 103 DIP C C1    1 
HETATM 1068 C C2    . DIP B 2 4   ? 38.081 5.250   19.071 1.00 24.11 ? 103 DIP C C2    1 
HETATM 1069 C C3    . DIP B 2 4   ? 36.766 4.954   19.648 1.00 24.29 ? 103 DIP C C3    1 
HETATM 1070 C C4    . DIP B 2 4   ? 37.006 3.648   20.327 1.00 27.94 ? 103 DIP C C4    1 
HETATM 1071 C C5    . DIP B 2 4   ? 35.606 3.053   20.613 1.00 33.27 ? 103 DIP C C5    1 
HETATM 1072 C "C1'" . DIP B 2 4   ? 39.613 6.276   16.402 1.00 26.83 ? 103 DIP C "C1'" 1 
HETATM 1073 C "C2'" . DIP B 2 4   ? 38.926 7.128   15.318 1.00 28.85 ? 103 DIP C "C2'" 1 
HETATM 1074 C "C3'" . DIP B 2 4   ? 39.552 8.496   15.078 1.00 29.29 ? 103 DIP C "C3'" 1 
HETATM 1075 C "C4'" . DIP B 2 4   ? 38.777 9.179   13.987 1.00 28.12 ? 103 DIP C "C4'" 1 
HETATM 1076 C "C5'" . DIP B 2 4   ? 39.269 10.612  13.906 1.00 27.65 ? 103 DIP C "C5'" 1 
ATOM   1077 N N     . ILE C 1 4   ? 31.399 11.874  36.182 1.00 61.58 ? 146 ILE B N     1 
ATOM   1078 C CA    . ILE C 1 4   ? 32.646 11.819  36.934 1.00 59.86 ? 146 ILE B CA    1 
ATOM   1079 C C     . ILE C 1 4   ? 33.754 12.430  36.077 1.00 58.49 ? 146 ILE B C     1 
ATOM   1080 O O     . ILE C 1 4   ? 34.829 12.641  36.603 1.00 57.45 ? 146 ILE B O     1 
ATOM   1081 C CB    . ILE C 1 4   ? 32.979 10.346  37.273 1.00 60.79 ? 146 ILE B CB    1 
ATOM   1082 C CG1   . ILE C 1 4   ? 31.844 9.690   37.975 1.00 62.85 ? 146 ILE B CG1   1 
ATOM   1083 C CG2   . ILE C 1 4   ? 34.094 10.276  38.287 1.00 62.41 ? 146 ILE B CG2   1 
ATOM   1084 C CD1   . ILE C 1 4   ? 31.910 8.197   37.720 1.00 65.72 ? 146 ILE B CD1   1 
ATOM   1085 N N     . GLN C 1 5   ? 33.517 12.801  34.807 1.00 56.94 ? 147 GLN B N     1 
ATOM   1086 C CA    . GLN C 1 5   ? 34.507 13.307  33.858 1.00 56.64 ? 147 GLN B CA    1 
ATOM   1087 C C     . GLN C 1 5   ? 35.397 14.387  34.421 1.00 53.61 ? 147 GLN B C     1 
ATOM   1088 O O     . GLN C 1 5   ? 36.589 14.413  34.145 1.00 52.81 ? 147 GLN B O     1 
ATOM   1089 C CB    . GLN C 1 5   ? 33.766 13.829  32.581 1.00 62.48 ? 147 GLN B CB    1 
ATOM   1090 C CG    . GLN C 1 5   ? 33.147 12.831  31.557 1.00 69.76 ? 147 GLN B CG    1 
ATOM   1091 C CD    . GLN C 1 5   ? 32.240 11.703  32.102 1.00 75.51 ? 147 GLN B CD    1 
ATOM   1092 O OE1   . GLN C 1 5   ? 31.563 11.838  33.145 1.00 79.75 ? 147 GLN B OE1   1 
ATOM   1093 N NE2   . GLN C 1 5   ? 32.270 10.491  31.529 1.00 75.38 ? 147 GLN B NE2   1 
ATOM   1094 H H     . GLN C 1 5   ? 32.595 12.725  34.488 1.00 0.00  ? 147 GLN B H     1 
ATOM   1095 H HE21  . GLN C 1 5   ? 31.683 9.801   31.900 1.00 0.00  ? 147 GLN B HE21  1 
ATOM   1096 H HE22  . GLN C 1 5   ? 32.865 10.323  30.768 1.00 0.00  ? 147 GLN B HE22  1 
ATOM   1097 N N     . ALA C 1 6   ? 34.724 15.243  35.198 1.00 51.03 ? 148 ALA B N     1 
ATOM   1098 C CA    . ALA C 1 6   ? 35.321 16.368  35.896 1.00 48.80 ? 148 ALA B CA    1 
ATOM   1099 C C     . ALA C 1 6   ? 36.175 16.094  37.162 1.00 46.42 ? 148 ALA B C     1 
ATOM   1100 O O     . ALA C 1 6   ? 36.807 17.001  37.727 1.00 48.28 ? 148 ALA B O     1 
ATOM   1101 C CB    . ALA C 1 6   ? 34.169 17.308  36.221 1.00 49.75 ? 148 ALA B CB    1 
ATOM   1102 H H     . ALA C 1 6   ? 33.761 15.101  35.304 1.00 0.00  ? 148 ALA B H     1 
ATOM   1103 N N     . GLU C 1 7   ? 36.259 14.847  37.628 1.00 40.97 ? 149 GLU B N     1 
ATOM   1104 C CA    . GLU C 1 7   ? 37.071 14.487  38.764 1.00 33.66 ? 149 GLU B CA    1 
ATOM   1105 C C     . GLU C 1 7   ? 38.480 14.363  38.301 1.00 29.41 ? 149 GLU B C     1 
ATOM   1106 O O     . GLU C 1 7   ? 38.689 13.693  37.304 1.00 28.29 ? 149 GLU B O     1 
ATOM   1107 C CB    . GLU C 1 7   ? 36.605 13.186  39.312 1.00 33.82 ? 149 GLU B CB    1 
ATOM   1108 C CG    . GLU C 1 7   ? 35.264 13.396  39.959 1.00 36.02 ? 149 GLU B CG    1 
ATOM   1109 C CD    . GLU C 1 7   ? 35.278 14.212  41.259 1.00 38.49 ? 149 GLU B CD    1 
ATOM   1110 O OE1   . GLU C 1 7   ? 36.303 14.790  41.656 1.00 39.17 ? 149 GLU B OE1   1 
ATOM   1111 O OE2   . GLU C 1 7   ? 34.226 14.240  41.902 1.00 40.73 ? 149 GLU B OE2   1 
ATOM   1112 H H     . GLU C 1 7   ? 35.746 14.144  37.178 1.00 0.00  ? 149 GLU B H     1 
ATOM   1113 N N     . GLU C 1 8   ? 39.472 14.934  38.978 1.00 27.70 ? 150 GLU B N     1 
ATOM   1114 C CA    . GLU C 1 8   ? 40.863 14.856  38.532 1.00 28.50 ? 150 GLU B CA    1 
ATOM   1115 C C     . GLU C 1 8   ? 41.400 13.455  38.321 1.00 26.53 ? 150 GLU B C     1 
ATOM   1116 O O     . GLU C 1 8   ? 42.262 13.187  37.507 1.00 26.19 ? 150 GLU B O     1 
ATOM   1117 C CB    . GLU C 1 8   ? 41.819 15.498  39.531 1.00 33.14 ? 150 GLU B CB    1 
ATOM   1118 C CG    . GLU C 1 8   ? 41.704 16.982  39.803 1.00 44.44 ? 150 GLU B CG    1 
ATOM   1119 C CD    . GLU C 1 8   ? 42.623 17.855  38.967 1.00 50.83 ? 150 GLU B CD    1 
ATOM   1120 O OE1   . GLU C 1 8   ? 42.664 17.765  37.740 1.00 54.92 ? 150 GLU B OE1   1 
ATOM   1121 O OE2   . GLU C 1 8   ? 43.414 18.571  39.569 1.00 56.34 ? 150 GLU B OE2   1 
ATOM   1122 H H     . GLU C 1 8   ? 39.265 15.422  39.802 1.00 0.00  ? 150 GLU B H     1 
ATOM   1123 N N     . TRP C 1 9   ? 40.922 12.566  39.172 1.00 24.44 ? 151 TRP B N     1 
ATOM   1124 C CA    . TRP C 1 9   ? 41.393 11.206  39.206 1.00 22.23 ? 151 TRP B CA    1 
ATOM   1125 C C     . TRP C 1 9   ? 40.767 10.289  38.200 1.00 22.37 ? 151 TRP B C     1 
ATOM   1126 O O     . TRP C 1 9   ? 41.209 9.160   38.059 1.00 23.93 ? 151 TRP B O     1 
ATOM   1127 C CB    . TRP C 1 9   ? 41.195 10.676  40.640 1.00 22.08 ? 151 TRP B CB    1 
ATOM   1128 C CG    . TRP C 1 9   ? 39.840 10.911  41.348 1.00 20.06 ? 151 TRP B CG    1 
ATOM   1129 C CD1   . TRP C 1 9   ? 39.784 11.791  42.400 1.00 17.47 ? 151 TRP B CD1   1 
ATOM   1130 C CD2   . TRP C 1 9   ? 38.590 10.356  41.062 1.00 18.74 ? 151 TRP B CD2   1 
ATOM   1131 N NE1   . TRP C 1 9   ? 38.525 11.799  42.770 1.00 20.10 ? 151 TRP B NE1   1 
ATOM   1132 C CE2   . TRP C 1 9   ? 37.782 10.977  42.011 1.00 18.78 ? 151 TRP B CE2   1 
ATOM   1133 C CE3   . TRP C 1 9   ? 38.008 9.451   40.176 1.00 18.18 ? 151 TRP B CE3   1 
ATOM   1134 C CZ2   . TRP C 1 9   ? 36.420 10.709  42.103 1.00 16.85 ? 151 TRP B CZ2   1 
ATOM   1135 C CZ3   . TRP C 1 9   ? 36.634 9.188   40.249 1.00 17.53 ? 151 TRP B CZ3   1 
ATOM   1136 C CH2   . TRP C 1 9   ? 35.858 9.806   41.214 1.00 16.77 ? 151 TRP B CH2   1 
ATOM   1137 H H     . TRP C 1 9   ? 40.223 12.841  39.801 1.00 0.00  ? 151 TRP B H     1 
ATOM   1138 H HE1   . TRP C 1 9   ? 38.172 12.336  43.506 1.00 0.00  ? 151 TRP B HE1   1 
ATOM   1139 N N     . TYR C 1 10  ? 39.715 10.707  37.527 1.00 22.15 ? 152 TYR B N     1 
ATOM   1140 C CA    . TYR C 1 10  ? 39.048 9.885   36.550 1.00 22.25 ? 152 TYR B CA    1 
ATOM   1141 C C     . TYR C 1 10  ? 39.718 9.999   35.204 1.00 23.06 ? 152 TYR B C     1 
ATOM   1142 O O     . TYR C 1 10  ? 39.666 11.074  34.611 1.00 26.52 ? 152 TYR B O     1 
ATOM   1143 C CB    . TYR C 1 10  ? 37.594 10.322  36.439 1.00 23.40 ? 152 TYR B CB    1 
ATOM   1144 C CG    . TYR C 1 10  ? 36.799 9.373   35.554 1.00 25.65 ? 152 TYR B CG    1 
ATOM   1145 C CD1   . TYR C 1 10  ? 36.610 8.037   35.941 1.00 28.30 ? 152 TYR B CD1   1 
ATOM   1146 C CD2   . TYR C 1 10  ? 36.296 9.814   34.346 1.00 27.51 ? 152 TYR B CD2   1 
ATOM   1147 C CE1   . TYR C 1 10  ? 35.920 7.133   35.128 1.00 29.82 ? 152 TYR B CE1   1 
ATOM   1148 C CE2   . TYR C 1 10  ? 35.611 8.927   33.531 1.00 29.71 ? 152 TYR B CE2   1 
ATOM   1149 C CZ    . TYR C 1 10  ? 35.427 7.601   33.927 1.00 30.47 ? 152 TYR B CZ    1 
ATOM   1150 O OH    . TYR C 1 10  ? 34.726 6.809   33.057 1.00 34.94 ? 152 TYR B OH    1 
ATOM   1151 H H     . TYR C 1 10  ? 39.374 11.610  37.697 1.00 0.00  ? 152 TYR B H     1 
ATOM   1152 H HH    . TYR C 1 10  ? 34.654 5.922   33.418 1.00 0.00  ? 152 TYR B HH    1 
ATOM   1153 N N     . PHE C 1 11  ? 40.342 8.940   34.692 1.00 21.45 ? 153 PHE B N     1 
ATOM   1154 C CA    . PHE C 1 11  ? 40.982 8.965   33.397 1.00 19.00 ? 153 PHE B CA    1 
ATOM   1155 C C     . PHE C 1 11  ? 40.169 8.338   32.267 1.00 20.64 ? 153 PHE B C     1 
ATOM   1156 O O     . PHE C 1 11  ? 40.633 8.099   31.139 1.00 23.02 ? 153 PHE B O     1 
ATOM   1157 C CB    . PHE C 1 11  ? 42.322 8.291   33.499 1.00 17.95 ? 153 PHE B CB    1 
ATOM   1158 C CG    . PHE C 1 11  ? 43.374 9.201   34.103 1.00 17.87 ? 153 PHE B CG    1 
ATOM   1159 C CD1   . PHE C 1 11  ? 43.249 9.657   35.419 1.00 17.90 ? 153 PHE B CD1   1 
ATOM   1160 C CD2   . PHE C 1 11  ? 44.493 9.549   33.343 1.00 17.18 ? 153 PHE B CD2   1 
ATOM   1161 C CE1   . PHE C 1 11  ? 44.259 10.443  35.978 1.00 20.34 ? 153 PHE B CE1   1 
ATOM   1162 C CE2   . PHE C 1 11  ? 45.489 10.341  33.912 1.00 18.30 ? 153 PHE B CE2   1 
ATOM   1163 C CZ    . PHE C 1 11  ? 45.377 10.791  35.220 1.00 18.38 ? 153 PHE B CZ    1 
ATOM   1164 H H     . PHE C 1 11  ? 40.368 8.111   35.214 1.00 0.00  ? 153 PHE B H     1 
ATOM   1165 N N     . GLY C 1 12  ? 38.889 8.081   32.508 1.00 21.69 ? 154 GLY B N     1 
ATOM   1166 C CA    . GLY C 1 12  ? 38.042 7.588   31.439 1.00 23.27 ? 154 GLY B CA    1 
ATOM   1167 C C     . GLY C 1 12  ? 38.382 6.201   30.956 1.00 25.08 ? 154 GLY B C     1 
ATOM   1168 O O     . GLY C 1 12  ? 38.595 5.330   31.784 1.00 26.24 ? 154 GLY B O     1 
ATOM   1169 H H     . GLY C 1 12  ? 38.518 8.224   33.404 1.00 0.00  ? 154 GLY B H     1 
ATOM   1170 N N     . LYS C 1 13  ? 38.525 6.048   29.640 1.00 26.60 ? 155 LYS B N     1 
ATOM   1171 C CA    . LYS C 1 13  ? 38.723 4.750   29.040 1.00 26.54 ? 155 LYS B CA    1 
ATOM   1172 C C     . LYS C 1 13  ? 40.132 4.427   28.572 1.00 26.51 ? 155 LYS B C     1 
ATOM   1173 O O     . LYS C 1 13  ? 40.376 3.976   27.450 1.00 28.36 ? 155 LYS B O     1 
ATOM   1174 C CB    . LYS C 1 13  ? 37.724 4.643   27.890 1.00 24.35 ? 155 LYS B CB    1 
ATOM   1175 H H     . LYS C 1 13  ? 38.495 6.839   29.063 1.00 0.00  ? 155 LYS B H     1 
ATOM   1176 N N     . ILE C 1 14  ? 41.126 4.753   29.385 1.00 26.82 ? 156 ILE B N     1 
ATOM   1177 C CA    . ILE C 1 14  ? 42.491 4.338   29.070 1.00 24.37 ? 156 ILE B CA    1 
ATOM   1178 C C     . ILE C 1 14  ? 42.575 2.810   29.278 1.00 24.40 ? 156 ILE B C     1 
ATOM   1179 O O     . ILE C 1 14  ? 41.813 2.290   30.087 1.00 23.72 ? 156 ILE B O     1 
ATOM   1180 C CB    . ILE C 1 14  ? 43.504 5.069   29.977 1.00 21.33 ? 156 ILE B CB    1 
ATOM   1181 C CG1   . ILE C 1 14  ? 43.178 4.976   31.446 1.00 16.90 ? 156 ILE B CG1   1 
ATOM   1182 C CG2   . ILE C 1 14  ? 43.553 6.508   29.456 1.00 22.01 ? 156 ILE B CG2   1 
ATOM   1183 C CD1   . ILE C 1 14  ? 44.258 5.703   32.252 1.00 17.64 ? 156 ILE B CD1   1 
ATOM   1184 H H     . ILE C 1 14  ? 40.946 5.272   30.197 1.00 0.00  ? 156 ILE B H     1 
ATOM   1185 N N     . THR C 1 15  ? 43.422 2.066   28.572 1.00 22.63 ? 157 THR B N     1 
ATOM   1186 C CA    . THR C 1 15  ? 43.496 0.639   28.721 1.00 21.84 ? 157 THR B CA    1 
ATOM   1187 C C     . THR C 1 15  ? 44.302 0.314   29.953 1.00 22.63 ? 157 THR B C     1 
ATOM   1188 O O     . THR C 1 15  ? 45.007 1.190   30.484 1.00 24.81 ? 157 THR B O     1 
ATOM   1189 C CB    . THR C 1 15  ? 44.171 0.064   27.486 1.00 20.47 ? 157 THR B CB    1 
ATOM   1190 O OG1   . THR C 1 15  ? 45.511 0.534   27.498 1.00 19.54 ? 157 THR B OG1   1 
ATOM   1191 C CG2   . THR C 1 15  ? 43.500 0.461   26.205 1.00 20.44 ? 157 THR B CG2   1 
ATOM   1192 H H     . THR C 1 15  ? 44.016 2.506   27.929 1.00 0.00  ? 157 THR B H     1 
ATOM   1193 H HG1   . THR C 1 15  ? 45.514 1.494   27.473 1.00 0.00  ? 157 THR B HG1   1 
ATOM   1194 N N     . ARG C 1 16  ? 44.364 -0.994  30.288 1.00 21.74 ? 158 ARG B N     1 
ATOM   1195 C CA    . ARG C 1 16  ? 45.139 -1.358  31.481 1.00 22.77 ? 158 ARG B CA    1 
ATOM   1196 C C     . ARG C 1 16  ? 46.615 -1.023  31.285 1.00 23.00 ? 158 ARG B C     1 
ATOM   1197 O O     . ARG C 1 16  ? 47.291 -0.560  32.206 1.00 23.81 ? 158 ARG B O     1 
ATOM   1198 C CB    . ARG C 1 16  ? 45.048 -2.859  31.747 1.00 21.19 ? 158 ARG B CB    1 
ATOM   1199 C CG    . ARG C 1 16  ? 46.217 -3.372  32.590 1.00 25.27 ? 158 ARG B CG    1 
ATOM   1200 C CD    . ARG C 1 16  ? 46.161 -4.876  32.818 1.00 33.44 ? 158 ARG B CD    1 
ATOM   1201 N NE    . ARG C 1 16  ? 44.989 -5.271  33.590 1.00 35.88 ? 158 ARG B NE    1 
ATOM   1202 C CZ    . ARG C 1 16  ? 45.045 -5.918  34.748 1.00 36.53 ? 158 ARG B CZ    1 
ATOM   1203 N NH1   . ARG C 1 16  ? 46.220 -6.282  35.275 1.00 35.64 ? 158 ARG B NH1   1 
ATOM   1204 N NH2   . ARG C 1 16  ? 43.962 -6.230  35.465 1.00 37.43 ? 158 ARG B NH2   1 
ATOM   1205 H H     . ARG C 1 16  ? 43.907 -1.676  29.753 1.00 0.00  ? 158 ARG B H     1 
ATOM   1206 H HE    . ARG C 1 16  ? 44.106 -5.045  33.232 1.00 0.00  ? 158 ARG B HE    1 
ATOM   1207 H HH11  . ARG C 1 16  ? 47.071 -6.067  34.796 1.00 0.00  ? 158 ARG B HH11  1 
ATOM   1208 H HH12  . ARG C 1 16  ? 46.247 -6.769  36.148 1.00 0.00  ? 158 ARG B HH12  1 
ATOM   1209 H HH21  . ARG C 1 16  ? 43.053 -5.975  35.135 1.00 0.00  ? 158 ARG B HH21  1 
ATOM   1210 H HH22  . ARG C 1 16  ? 44.060 -6.719  36.332 1.00 0.00  ? 158 ARG B HH22  1 
ATOM   1211 N N     . ARG C 1 17  ? 47.093 -1.260  30.086 1.00 22.95 ? 159 ARG B N     1 
ATOM   1212 C CA    . ARG C 1 17  ? 48.504 -1.025  29.762 1.00 26.42 ? 159 ARG B CA    1 
ATOM   1213 C C     . ARG C 1 17  ? 48.853 0.469   29.873 1.00 25.97 ? 159 ARG B C     1 
ATOM   1214 O O     . ARG C 1 17  ? 49.888 0.853   30.437 1.00 25.40 ? 159 ARG B O     1 
ATOM   1215 C CB    . ARG C 1 17  ? 48.795 -1.512  28.356 1.00 31.11 ? 159 ARG B CB    1 
ATOM   1216 C CG    . ARG C 1 17  ? 49.987 -0.809  27.743 1.00 41.76 ? 159 ARG B CG    1 
ATOM   1217 C CD    . ARG C 1 17  ? 49.957 -0.820  26.228 1.00 47.24 ? 159 ARG B CD    1 
ATOM   1218 N NE    . ARG C 1 17  ? 48.935 0.061   25.647 1.00 49.18 ? 159 ARG B NE    1 
ATOM   1219 C CZ    . ARG C 1 17  ? 47.857 -0.423  25.045 1.00 53.35 ? 159 ARG B CZ    1 
ATOM   1220 N NH1   . ARG C 1 17  ? 47.627 -1.745  25.044 1.00 54.73 ? 159 ARG B NH1   1 
ATOM   1221 N NH2   . ARG C 1 17  ? 46.997 0.305   24.337 1.00 58.78 ? 159 ARG B NH2   1 
ATOM   1222 H H     . ARG C 1 17  ? 46.493 -1.602  29.391 1.00 0.00  ? 159 ARG B H     1 
ATOM   1223 H HE    . ARG C 1 17  ? 49.053 1.032   25.706 1.00 0.00  ? 159 ARG B HE    1 
ATOM   1224 H HH11  . ARG C 1 17  ? 48.268 -2.364  25.497 1.00 0.00  ? 159 ARG B HH11  1 
ATOM   1225 H HH12  . ARG C 1 17  ? 46.814 -2.111  24.590 1.00 0.00  ? 159 ARG B HH12  1 
ATOM   1226 H HH21  . ARG C 1 17  ? 47.143 1.289   24.231 1.00 0.00  ? 159 ARG B HH21  1 
ATOM   1227 H HH22  . ARG C 1 17  ? 46.205 -0.131  23.911 1.00 0.00  ? 159 ARG B HH22  1 
ATOM   1228 N N     . GLU C 1 18  ? 47.978 1.286   29.335 1.00 25.99 ? 160 GLU B N     1 
ATOM   1229 C CA    . GLU C 1 18  ? 48.151 2.742   29.337 1.00 26.71 ? 160 GLU B CA    1 
ATOM   1230 C C     . GLU C 1 18  ? 48.131 3.274   30.769 1.00 25.34 ? 160 GLU B C     1 
ATOM   1231 O O     . GLU C 1 18  ? 49.085 3.940   31.207 1.00 24.86 ? 160 GLU B O     1 
ATOM   1232 C CB    . GLU C 1 18  ? 47.051 3.361   28.491 1.00 26.86 ? 160 GLU B CB    1 
ATOM   1233 C CG    . GLU C 1 18  ? 47.310 3.065   27.025 1.00 35.68 ? 160 GLU B CG    1 
ATOM   1234 C CD    . GLU C 1 18  ? 46.150 3.348   26.085 1.00 38.64 ? 160 GLU B CD    1 
ATOM   1235 O OE1   . GLU C 1 18  ? 45.036 3.793   26.540 1.00 38.25 ? 160 GLU B OE1   1 
ATOM   1236 O OE2   . GLU C 1 18  ? 46.309 3.151   24.820 1.00 36.76 ? 160 GLU B OE2   1 
ATOM   1237 H H     . GLU C 1 18  ? 47.177 0.908   28.915 1.00 0.00  ? 160 GLU B H     1 
ATOM   1238 N N     . SER C 1 19  ? 47.316 2.716   31.638 1.00 25.24 ? 161 SER B N     1 
ATOM   1239 C CA    . SER C 1 19  ? 47.280 3.146   33.021 1.00 23.21 ? 161 SER B CA    1 
ATOM   1240 C C     . SER C 1 19  ? 48.584 2.729   33.658 1.00 21.60 ? 161 SER B C     1 
ATOM   1241 O O     . SER C 1 19  ? 49.061 3.411   34.562 1.00 21.75 ? 161 SER B O     1 
ATOM   1242 C CB    . SER C 1 19  ? 46.101 2.494   33.776 1.00 20.27 ? 161 SER B CB    1 
ATOM   1243 O OG    . SER C 1 19  ? 46.329 1.135   34.087 1.00 24.85 ? 161 SER B OG    1 
ATOM   1244 H H     . SER C 1 19  ? 46.721 1.995   31.344 1.00 0.00  ? 161 SER B H     1 
ATOM   1245 H HG    . SER C 1 19  ? 45.568 0.781   34.554 1.00 0.00  ? 161 SER B HG    1 
ATOM   1246 N N     . GLU C 1 20  ? 49.188 1.626   33.257 1.00 21.90 ? 162 GLU B N     1 
ATOM   1247 C CA    . GLU C 1 20  ? 50.444 1.262   33.866 1.00 22.77 ? 162 GLU B CA    1 
ATOM   1248 C C     . GLU C 1 20  ? 51.519 2.134   33.319 1.00 22.80 ? 162 GLU B C     1 
ATOM   1249 O O     . GLU C 1 20  ? 52.365 2.449   34.146 1.00 25.90 ? 162 GLU B O     1 
ATOM   1250 C CB    . GLU C 1 20  ? 50.896 -0.175  33.631 1.00 21.07 ? 162 GLU B CB    1 
ATOM   1251 C CG    . GLU C 1 20  ? 50.011 -1.093  34.432 1.00 25.23 ? 162 GLU B CG    1 
ATOM   1252 C CD    . GLU C 1 20  ? 50.137 -2.592  34.271 1.00 28.29 ? 162 GLU B CD    1 
ATOM   1253 O OE1   . GLU C 1 20  ? 50.835 -3.105  33.399 1.00 31.07 ? 162 GLU B OE1   1 
ATOM   1254 O OE2   . GLU C 1 20  ? 49.476 -3.252  35.056 1.00 30.84 ? 162 GLU B OE2   1 
ATOM   1255 H H     . GLU C 1 20  ? 48.791 1.065   32.559 1.00 0.00  ? 162 GLU B H     1 
ATOM   1256 N N     . ARG C 1 21  ? 51.527 2.587   32.074 1.00 23.30 ? 163 ARG B N     1 
ATOM   1257 C CA    . ARG C 1 21  ? 52.556 3.488   31.537 1.00 23.51 ? 163 ARG B CA    1 
ATOM   1258 C C     . ARG C 1 21  ? 52.453 4.844   32.230 1.00 23.25 ? 163 ARG B C     1 
ATOM   1259 O O     . ARG C 1 21  ? 53.451 5.461   32.533 1.00 23.75 ? 163 ARG B O     1 
ATOM   1260 C CB    . ARG C 1 21  ? 52.395 3.679   30.124 1.00 25.97 ? 163 ARG B CB    1 
ATOM   1261 C CG    . ARG C 1 21  ? 52.453 2.346   29.374 1.00 32.89 ? 163 ARG B CG    1 
ATOM   1262 C CD    . ARG C 1 21  ? 52.160 2.911   27.941 1.00 38.67 ? 163 ARG B CD    1 
ATOM   1263 N NE    . ARG C 1 21  ? 51.962 1.697   27.080 1.00 45.22 ? 163 ARG B NE    1 
ATOM   1264 C CZ    . ARG C 1 21  ? 51.596 2.075   25.825 1.00 51.25 ? 163 ARG B CZ    1 
ATOM   1265 N NH1   . ARG C 1 21  ? 51.440 3.493   25.524 1.00 52.02 ? 163 ARG B NH1   1 
ATOM   1266 N NH2   . ARG C 1 21  ? 51.605 1.137   24.767 1.00 53.90 ? 163 ARG B NH2   1 
ATOM   1267 H H     . ARG C 1 21  ? 50.804 2.305   31.476 1.00 0.00  ? 163 ARG B H     1 
ATOM   1268 H HE    . ARG C 1 21  ? 52.078 0.774   27.376 1.00 0.00  ? 163 ARG B HE    1 
ATOM   1269 H HH11  . ARG C 1 21  ? 51.602 4.176   26.236 1.00 0.00  ? 163 ARG B HH11  1 
ATOM   1270 H HH12  . ARG C 1 21  ? 51.171 3.783   24.605 1.00 0.00  ? 163 ARG B HH12  1 
ATOM   1271 H HH21  . ARG C 1 21  ? 51.881 0.191   24.939 1.00 0.00  ? 163 ARG B HH21  1 
ATOM   1272 H HH22  . ARG C 1 21  ? 51.335 1.419   23.846 1.00 0.00  ? 163 ARG B HH22  1 
ATOM   1273 N N     . LEU C 1 22  ? 51.266 5.323   32.526 1.00 21.49 ? 164 LEU B N     1 
ATOM   1274 C CA    . LEU C 1 22  ? 51.063 6.584   33.200 1.00 21.92 ? 164 LEU B CA    1 
ATOM   1275 C C     . LEU C 1 22  ? 51.528 6.537   34.623 1.00 25.74 ? 164 LEU B C     1 
ATOM   1276 O O     . LEU C 1 22  ? 52.310 7.370   35.052 1.00 30.67 ? 164 LEU B O     1 
ATOM   1277 C CB    . LEU C 1 22  ? 49.611 6.997   33.227 1.00 17.24 ? 164 LEU B CB    1 
ATOM   1278 C CG    . LEU C 1 22  ? 49.003 7.309   31.873 1.00 18.11 ? 164 LEU B CG    1 
ATOM   1279 C CD1   . LEU C 1 22  ? 47.536 7.644   32.038 1.00 13.89 ? 164 LEU B CD1   1 
ATOM   1280 C CD2   . LEU C 1 22  ? 49.771 8.445   31.217 1.00 18.23 ? 164 LEU B CD2   1 
ATOM   1281 H H     . LEU C 1 22  ? 50.478 4.798   32.277 1.00 0.00  ? 164 LEU B H     1 
ATOM   1282 N N     . LEU C 1 23  ? 51.121 5.514   35.363 1.00 28.11 ? 165 LEU B N     1 
ATOM   1283 C CA    . LEU C 1 23  ? 51.451 5.396   36.763 1.00 31.28 ? 165 LEU B CA    1 
ATOM   1284 C C     . LEU C 1 23  ? 52.882 5.051   37.046 1.00 37.99 ? 165 LEU B C     1 
ATOM   1285 O O     . LEU C 1 23  ? 53.452 5.650   37.958 1.00 37.85 ? 165 LEU B O     1 
ATOM   1286 C CB    . LEU C 1 23  ? 50.558 4.331   37.468 1.00 25.69 ? 165 LEU B CB    1 
ATOM   1287 C CG    . LEU C 1 23  ? 49.085 4.688   37.576 1.00 22.18 ? 165 LEU B CG    1 
ATOM   1288 C CD1   . LEU C 1 23  ? 48.258 3.571   38.075 1.00 18.88 ? 165 LEU B CD1   1 
ATOM   1289 C CD2   . LEU C 1 23  ? 48.943 5.739   38.585 1.00 14.97 ? 165 LEU B CD2   1 
ATOM   1290 H H     . LEU C 1 23  ? 50.578 4.814   34.945 1.00 0.00  ? 165 LEU B H     1 
ATOM   1291 N N     . LEU C 1 24  ? 53.484 4.157   36.257 1.00 46.13 ? 166 LEU B N     1 
ATOM   1292 C CA    . LEU C 1 24  ? 54.785 3.601   36.562 1.00 52.58 ? 166 LEU B CA    1 
ATOM   1293 C C     . LEU C 1 24  ? 55.902 4.470   36.065 1.00 56.81 ? 166 LEU B C     1 
ATOM   1294 O O     . LEU C 1 24  ? 56.559 4.381   35.028 1.00 59.28 ? 166 LEU B O     1 
ATOM   1295 C CB    . LEU C 1 24  ? 54.833 2.208   35.973 1.00 52.92 ? 166 LEU B CB    1 
ATOM   1296 C CG    . LEU C 1 24  ? 55.726 1.227   36.634 1.00 56.10 ? 166 LEU B CG    1 
ATOM   1297 C CD1   . LEU C 1 24  ? 55.293 1.051   38.067 1.00 56.68 ? 166 LEU B CD1   1 
ATOM   1298 C CD2   . LEU C 1 24  ? 55.694 -0.059  35.846 1.00 56.65 ? 166 LEU B CD2   1 
ATOM   1299 H H     . LEU C 1 24  ? 53.027 3.866   35.440 1.00 0.00  ? 166 LEU B H     1 
ATOM   1300 N N     . ASN C 1 25  ? 56.118 5.371   36.976 1.00 62.09 ? 167 ASN B N     1 
ATOM   1301 C CA    . ASN C 1 25  ? 57.088 6.409   36.768 1.00 65.50 ? 167 ASN B CA    1 
ATOM   1302 C C     . ASN C 1 25  ? 57.807 6.621   38.105 1.00 67.94 ? 167 ASN B C     1 
ATOM   1303 O O     . ASN C 1 25  ? 57.168 6.684   39.170 1.00 68.98 ? 167 ASN B O     1 
ATOM   1304 C CB    . ASN C 1 25  ? 56.280 7.605   36.291 1.00 64.55 ? 167 ASN B CB    1 
ATOM   1305 C CG    . ASN C 1 25  ? 57.146 8.788   35.985 1.00 63.29 ? 167 ASN B CG    1 
ATOM   1306 O OD1   . ASN C 1 25  ? 57.526 9.548   36.863 1.00 60.79 ? 167 ASN B OD1   1 
ATOM   1307 N ND2   . ASN C 1 25  ? 57.483 8.871   34.714 1.00 63.77 ? 167 ASN B ND2   1 
ATOM   1308 H H     . ASN C 1 25  ? 55.613 5.342   37.815 1.00 0.00  ? 167 ASN B H     1 
ATOM   1309 H HD21  . ASN C 1 25  ? 58.050 9.623   34.445 1.00 0.00  ? 167 ASN B HD21  1 
ATOM   1310 H HD22  . ASN C 1 25  ? 57.167 8.195   34.078 1.00 0.00  ? 167 ASN B HD22  1 
ATOM   1311 N N     . ALA C 1 26  ? 59.152 6.668   38.096 1.00 68.20 ? 168 ALA B N     1 
ATOM   1312 C CA    . ALA C 1 26  ? 59.898 6.891   39.333 1.00 66.46 ? 168 ALA B CA    1 
ATOM   1313 C C     . ALA C 1 26  ? 59.706 8.279   39.924 1.00 63.66 ? 168 ALA B C     1 
ATOM   1314 O O     . ALA C 1 26  ? 60.134 8.499   41.051 1.00 64.20 ? 168 ALA B O     1 
ATOM   1315 C CB    . ALA C 1 26  ? 61.397 6.710   39.159 1.00 67.20 ? 168 ALA B CB    1 
ATOM   1316 H H     . ALA C 1 26  ? 59.636 6.552   37.252 1.00 0.00  ? 168 ALA B H     1 
ATOM   1317 N N     . GLU C 1 27  ? 59.089 9.258   39.272 1.00 59.00 ? 169 GLU B N     1 
ATOM   1318 C CA    . GLU C 1 27  ? 58.858 10.492  39.966 1.00 56.00 ? 169 GLU B CA    1 
ATOM   1319 C C     . GLU C 1 27  ? 57.633 10.304  40.845 1.00 49.87 ? 169 GLU B C     1 
ATOM   1320 O O     . GLU C 1 27  ? 57.409 11.091  41.758 1.00 49.69 ? 169 GLU B O     1 
ATOM   1321 C CB    . GLU C 1 27  ? 58.593 11.608  38.992 1.00 61.63 ? 169 GLU B CB    1 
ATOM   1322 C CG    . GLU C 1 27  ? 59.708 11.864  37.994 1.00 70.01 ? 169 GLU B CG    1 
ATOM   1323 C CD    . GLU C 1 27  ? 59.368 12.958  36.970 1.00 76.55 ? 169 GLU B CD    1 
ATOM   1324 O OE1   . GLU C 1 27  ? 58.271 13.531  37.012 1.00 79.29 ? 169 GLU B OE1   1 
ATOM   1325 O OE2   . GLU C 1 27  ? 60.207 13.251  36.110 1.00 80.82 ? 169 GLU B OE2   1 
ATOM   1326 H H     . GLU C 1 27  ? 58.800 9.141   38.343 1.00 0.00  ? 169 GLU B H     1 
ATOM   1327 N N     . ASN C 1 28  ? 56.830 9.263   40.642 1.00 44.25 ? 170 ASN B N     1 
ATOM   1328 C CA    . ASN C 1 28  ? 55.560 9.107   41.345 1.00 38.93 ? 170 ASN B CA    1 
ATOM   1329 C C     . ASN C 1 28  ? 55.580 8.400   42.671 1.00 36.68 ? 170 ASN B C     1 
ATOM   1330 O O     . ASN C 1 28  ? 56.237 7.377   42.799 1.00 36.64 ? 170 ASN B O     1 
ATOM   1331 C CB    . ASN C 1 28  ? 54.558 8.378   40.473 1.00 35.77 ? 170 ASN B CB    1 
ATOM   1332 C CG    . ASN C 1 28  ? 53.972 9.273   39.410 1.00 33.41 ? 170 ASN B CG    1 
ATOM   1333 O OD1   . ASN C 1 28  ? 53.712 10.433  39.674 1.00 35.01 ? 170 ASN B OD1   1 
ATOM   1334 N ND2   . ASN C 1 28  ? 53.626 8.845   38.205 1.00 33.51 ? 170 ASN B ND2   1 
ATOM   1335 H H     . ASN C 1 28  ? 57.101 8.576   39.998 1.00 0.00  ? 170 ASN B H     1 
ATOM   1336 H HD21  . ASN C 1 28  ? 53.253 9.502   37.582 1.00 0.00  ? 170 ASN B HD21  1 
ATOM   1337 H HD22  . ASN C 1 28  ? 53.747 7.902   37.966 1.00 0.00  ? 170 ASN B HD22  1 
ATOM   1338 N N     . PRO C 1 29  ? 54.945 8.887   43.727 1.00 34.49 ? 171 PRO B N     1 
ATOM   1339 C CA    . PRO C 1 29  ? 54.949 8.203   45.006 1.00 34.86 ? 171 PRO B CA    1 
ATOM   1340 C C     . PRO C 1 29  ? 54.046 6.940   45.011 1.00 35.15 ? 171 PRO B C     1 
ATOM   1341 O O     . PRO C 1 29  ? 53.161 6.712   44.173 1.00 32.90 ? 171 PRO B O     1 
ATOM   1342 C CB    . PRO C 1 29  ? 54.505 9.291   45.989 1.00 31.68 ? 171 PRO B CB    1 
ATOM   1343 C CG    . PRO C 1 29  ? 53.476 10.023  45.162 1.00 34.50 ? 171 PRO B CG    1 
ATOM   1344 C CD    . PRO C 1 29  ? 54.165 10.128  43.790 1.00 33.86 ? 171 PRO B CD    1 
ATOM   1345 N N     . ARG C 1 30  ? 54.317 6.073   45.985 1.00 35.00 ? 172 ARG B N     1 
ATOM   1346 C CA    . ARG C 1 30  ? 53.507 4.909   46.252 1.00 31.96 ? 172 ARG B CA    1 
ATOM   1347 C C     . ARG C 1 30  ? 52.114 5.429   46.605 1.00 26.59 ? 172 ARG B C     1 
ATOM   1348 O O     . ARG C 1 30  ? 51.900 6.240   47.512 1.00 25.07 ? 172 ARG B O     1 
ATOM   1349 C CB    . ARG C 1 30  ? 54.020 4.089   47.468 1.00 36.35 ? 172 ARG B CB    1 
ATOM   1350 C CG    . ARG C 1 30  ? 55.319 3.328   47.356 1.00 43.65 ? 172 ARG B CG    1 
ATOM   1351 C CD    . ARG C 1 30  ? 55.456 2.416   48.572 1.00 50.48 ? 172 ARG B CD    1 
ATOM   1352 N NE    . ARG C 1 30  ? 54.416 1.376   48.703 1.00 56.90 ? 172 ARG B NE    1 
ATOM   1353 C CZ    . ARG C 1 30  ? 54.501 0.395   49.624 1.00 60.14 ? 172 ARG B CZ    1 
ATOM   1354 N NH1   . ARG C 1 30  ? 55.528 0.340   50.487 1.00 62.76 ? 172 ARG B NH1   1 
ATOM   1355 N NH2   . ARG C 1 30  ? 53.546 -0.521  49.698 1.00 61.25 ? 172 ARG B NH2   1 
ATOM   1356 H H     . ARG C 1 30  ? 55.103 6.233   46.547 1.00 0.00  ? 172 ARG B H     1 
ATOM   1357 H HE    . ARG C 1 30  ? 53.642 1.399   48.103 1.00 0.00  ? 172 ARG B HE    1 
ATOM   1358 H HH11  . ARG C 1 30  ? 56.247 1.034   50.454 1.00 0.00  ? 172 ARG B HH11  1 
ATOM   1359 H HH12  . ARG C 1 30  ? 55.574 -0.395  51.163 1.00 0.00  ? 172 ARG B HH12  1 
ATOM   1360 H HH21  . ARG C 1 30  ? 52.767 -0.483  49.072 1.00 0.00  ? 172 ARG B HH21  1 
ATOM   1361 H HH22  . ARG C 1 30  ? 53.605 -1.251  50.379 1.00 0.00  ? 172 ARG B HH22  1 
ATOM   1362 N N     . GLY C 1 31  ? 51.171 4.800   45.957 1.00 20.86 ? 173 GLY B N     1 
ATOM   1363 C CA    . GLY C 1 31  ? 49.814 5.151   46.179 1.00 19.20 ? 173 GLY B CA    1 
ATOM   1364 C C     . GLY C 1 31  ? 49.387 6.176   45.175 1.00 17.96 ? 173 GLY B C     1 
ATOM   1365 O O     . GLY C 1 31  ? 48.342 6.790   45.407 1.00 19.29 ? 173 GLY B O     1 
ATOM   1366 H H     . GLY C 1 31  ? 51.399 4.090   45.321 1.00 0.00  ? 173 GLY B H     1 
ATOM   1367 N N     . THR C 1 32  ? 50.147 6.436   44.105 1.00 16.08 ? 174 THR B N     1 
ATOM   1368 C CA    . THR C 1 32  ? 49.654 7.308   43.064 1.00 15.29 ? 174 THR B CA    1 
ATOM   1369 C C     . THR C 1 32  ? 48.577 6.441   42.415 1.00 16.48 ? 174 THR B C     1 
ATOM   1370 O O     . THR C 1 32  ? 48.765 5.224   42.236 1.00 16.29 ? 174 THR B O     1 
ATOM   1371 C CB    . THR C 1 32  ? 50.794 7.669   42.085 1.00 14.28 ? 174 THR B CB    1 
ATOM   1372 O OG1   . THR C 1 32  ? 51.686 8.496   42.812 1.00 18.40 ? 174 THR B OG1   1 
ATOM   1373 C CG2   . THR C 1 32  ? 50.356 8.413   40.881 1.00 13.10 ? 174 THR B CG2   1 
ATOM   1374 H H     . THR C 1 32  ? 51.038 6.035   44.027 1.00 0.00  ? 174 THR B H     1 
ATOM   1375 H HG1   . THR C 1 32  ? 52.021 8.015   43.572 1.00 0.00  ? 174 THR B HG1   1 
ATOM   1376 N N     . PHE C 1 33  ? 47.450 7.009   42.024 1.00 15.59 ? 175 PHE B N     1 
ATOM   1377 C CA    . PHE C 1 33  ? 46.350 6.241   41.542 1.00 16.01 ? 175 PHE B CA    1 
ATOM   1378 C C     . PHE C 1 33  ? 45.588 6.979   40.445 1.00 18.22 ? 175 PHE B C     1 
ATOM   1379 O O     . PHE C 1 33  ? 45.821 8.165   40.198 1.00 19.45 ? 175 PHE B O     1 
ATOM   1380 C CB    . PHE C 1 33  ? 45.462 5.968   42.765 1.00 16.84 ? 175 PHE B CB    1 
ATOM   1381 C CG    . PHE C 1 33  ? 44.658 7.169   43.247 1.00 14.69 ? 175 PHE B CG    1 
ATOM   1382 C CD1   . PHE C 1 33  ? 45.199 8.044   44.194 1.00 14.59 ? 175 PHE B CD1   1 
ATOM   1383 C CD2   . PHE C 1 33  ? 43.361 7.364   42.763 1.00 16.02 ? 175 PHE B CD2   1 
ATOM   1384 C CE1   . PHE C 1 33  ? 44.441 9.113   44.666 1.00 17.35 ? 175 PHE B CE1   1 
ATOM   1385 C CE2   . PHE C 1 33  ? 42.600 8.432   43.222 1.00 18.55 ? 175 PHE B CE2   1 
ATOM   1386 C CZ    . PHE C 1 33  ? 43.145 9.295   44.172 1.00 18.60 ? 175 PHE B CZ    1 
ATOM   1387 H H     . PHE C 1 33  ? 47.368 7.985   42.066 1.00 0.00  ? 175 PHE B H     1 
ATOM   1388 N N     . LEU C 1 34  ? 44.607 6.315   39.835 1.00 17.67 ? 176 LEU B N     1 
ATOM   1389 C CA    . LEU C 1 34  ? 43.664 6.853   38.864 1.00 16.85 ? 176 LEU B CA    1 
ATOM   1390 C C     . LEU C 1 34  ? 42.501 5.866   38.857 1.00 17.24 ? 176 LEU B C     1 
ATOM   1391 O O     . LEU C 1 34  ? 42.641 4.733   39.320 1.00 14.41 ? 176 LEU B O     1 
ATOM   1392 C CB    . LEU C 1 34  ? 44.274 6.928   37.457 1.00 19.60 ? 176 LEU B CB    1 
ATOM   1393 C CG    . LEU C 1 34  ? 44.879 5.701   36.763 1.00 18.63 ? 176 LEU B CG    1 
ATOM   1394 C CD1   . LEU C 1 34  ? 43.828 4.895   36.072 1.00 16.22 ? 176 LEU B CD1   1 
ATOM   1395 C CD2   . LEU C 1 34  ? 45.868 6.158   35.727 1.00 13.79 ? 176 LEU B CD2   1 
ATOM   1396 H H     . LEU C 1 34  ? 44.510 5.369   40.063 1.00 0.00  ? 176 LEU B H     1 
ATOM   1397 N N     . VAL C 1 35  ? 41.364 6.251   38.307 1.00 19.05 ? 177 VAL B N     1 
ATOM   1398 C CA    . VAL C 1 35  ? 40.186 5.412   38.191 1.00 19.64 ? 177 VAL B CA    1 
ATOM   1399 C C     . VAL C 1 35  ? 39.985 5.441   36.681 1.00 21.54 ? 177 VAL B C     1 
ATOM   1400 O O     . VAL C 1 35  ? 40.183 6.442   36.000 1.00 22.59 ? 177 VAL B O     1 
ATOM   1401 C CB    . VAL C 1 35  ? 38.931 6.023   38.954 1.00 19.07 ? 177 VAL B CB    1 
ATOM   1402 C CG1   . VAL C 1 35  ? 37.678 5.182   38.707 1.00 16.92 ? 177 VAL B CG1   1 
ATOM   1403 C CG2   . VAL C 1 35  ? 39.179 6.045   40.452 1.00 14.46 ? 177 VAL B CG2   1 
ATOM   1404 H H     . VAL C 1 35  ? 41.312 7.163   37.954 1.00 0.00  ? 177 VAL B H     1 
ATOM   1405 N N     . ARG C 1 36  ? 39.644 4.338   36.070 1.00 22.35 ? 178 ARG B N     1 
ATOM   1406 C CA    . ARG C 1 36  ? 39.417 4.293   34.653 1.00 23.12 ? 178 ARG B CA    1 
ATOM   1407 C C     . ARG C 1 36  ? 38.145 3.467   34.481 1.00 27.10 ? 178 ARG B C     1 
ATOM   1408 O O     . ARG C 1 36  ? 37.709 2.784   35.412 1.00 24.39 ? 178 ARG B O     1 
ATOM   1409 C CB    . ARG C 1 36  ? 40.641 3.658   33.989 1.00 19.33 ? 178 ARG B CB    1 
ATOM   1410 C CG    . ARG C 1 36  ? 41.148 2.366   34.604 1.00 15.32 ? 178 ARG B CG    1 
ATOM   1411 C CD    . ARG C 1 36  ? 42.270 1.885   33.736 1.00 16.31 ? 178 ARG B CD    1 
ATOM   1412 N NE    . ARG C 1 36  ? 42.792 0.710   34.378 1.00 21.20 ? 178 ARG B NE    1 
ATOM   1413 C CZ    . ARG C 1 36  ? 42.408 -0.511  33.959 1.00 21.16 ? 178 ARG B CZ    1 
ATOM   1414 N NH1   . ARG C 1 36  ? 41.556 -0.659  32.950 1.00 25.62 ? 178 ARG B NH1   1 
ATOM   1415 N NH2   . ARG C 1 36  ? 42.711 -1.610  34.649 1.00 22.63 ? 178 ARG B NH2   1 
ATOM   1416 H H     . ARG C 1 36  ? 39.540 3.517   36.594 1.00 0.00  ? 178 ARG B H     1 
ATOM   1417 H HE    . ARG C 1 36  ? 43.427 0.797   35.120 1.00 0.00  ? 178 ARG B HE    1 
ATOM   1418 H HH11  . ARG C 1 36  ? 41.186 0.146   32.485 1.00 0.00  ? 178 ARG B HH11  1 
ATOM   1419 H HH12  . ARG C 1 36  ? 41.284 -1.575  32.655 1.00 0.00  ? 178 ARG B HH12  1 
ATOM   1420 H HH21  . ARG C 1 36  ? 43.235 -1.539  35.498 1.00 0.00  ? 178 ARG B HH21  1 
ATOM   1421 H HH22  . ARG C 1 36  ? 42.415 -2.506  34.318 1.00 0.00  ? 178 ARG B HH22  1 
ATOM   1422 N N     . GLU C 1 37  ? 37.471 3.479   33.358 1.00 31.05 ? 179 GLU B N     1 
ATOM   1423 C CA    . GLU C 1 37  ? 36.269 2.703   33.146 1.00 39.88 ? 179 GLU B CA    1 
ATOM   1424 C C     . GLU C 1 37  ? 36.748 1.296   32.824 1.00 43.56 ? 179 GLU B C     1 
ATOM   1425 O O     . GLU C 1 37  ? 37.662 1.240   32.000 1.00 44.16 ? 179 GLU B O     1 
ATOM   1426 C CB    . GLU C 1 37  ? 35.587 3.339   32.010 1.00 42.15 ? 179 GLU B CB    1 
ATOM   1427 C CG    . GLU C 1 37  ? 34.100 3.223   32.126 1.00 48.78 ? 179 GLU B CG    1 
ATOM   1428 C CD    . GLU C 1 37  ? 33.561 3.999   30.962 1.00 53.74 ? 179 GLU B CD    1 
ATOM   1429 O OE1   . GLU C 1 37  ? 33.570 5.227   31.044 1.00 57.28 ? 179 GLU B OE1   1 
ATOM   1430 O OE2   . GLU C 1 37  ? 33.191 3.373   29.966 1.00 56.54 ? 179 GLU B OE2   1 
ATOM   1431 H H     . GLU C 1 37  ? 37.797 4.041   32.625 1.00 0.00  ? 179 GLU B H     1 
ATOM   1432 N N     . SER C 1 38  ? 36.275 0.154   33.357 1.00 47.93 ? 180 SER B N     1 
ATOM   1433 C CA    . SER C 1 38  ? 36.914 -1.115  33.023 1.00 54.32 ? 180 SER B CA    1 
ATOM   1434 C C     . SER C 1 38  ? 36.765 -1.453  31.569 1.00 57.69 ? 180 SER B C     1 
ATOM   1435 O O     . SER C 1 38  ? 35.710 -1.252  30.973 1.00 59.26 ? 180 SER B O     1 
ATOM   1436 C CB    . SER C 1 38  ? 36.358 -2.248  33.852 1.00 55.62 ? 180 SER B CB    1 
ATOM   1437 O OG    . SER C 1 38  ? 37.087 -2.132  35.077 1.00 58.55 ? 180 SER B OG    1 
ATOM   1438 H H     . SER C 1 38  ? 35.507 0.175   33.965 1.00 0.00  ? 180 SER B H     1 
ATOM   1439 H HG    . SER C 1 38  ? 36.921 -1.271  35.468 1.00 0.00  ? 180 SER B HG    1 
ATOM   1440 N N     . GLU C 1 39  ? 37.941 -1.811  31.040 1.00 61.14 ? 181 GLU B N     1 
ATOM   1441 C CA    . GLU C 1 39  ? 38.180 -2.118  29.633 1.00 64.18 ? 181 GLU B CA    1 
ATOM   1442 C C     . GLU C 1 39  ? 37.258 -3.175  29.035 1.00 67.01 ? 181 GLU B C     1 
ATOM   1443 O O     . GLU C 1 39  ? 36.892 -3.070  27.856 1.00 68.57 ? 181 GLU B O     1 
ATOM   1444 C CB    . GLU C 1 39  ? 39.649 -2.521  29.542 1.00 63.79 ? 181 GLU B CB    1 
ATOM   1445 C CG    . GLU C 1 39  ? 40.536 -2.386  28.281 1.00 63.79 ? 181 GLU B CG    1 
ATOM   1446 C CD    . GLU C 1 39  ? 42.008 -2.715  28.574 1.00 64.68 ? 181 GLU B CD    1 
ATOM   1447 O OE1   . GLU C 1 39  ? 42.389 -2.763  29.736 1.00 66.00 ? 181 GLU B OE1   1 
ATOM   1448 O OE2   . GLU C 1 39  ? 42.827 -2.880  27.670 1.00 64.84 ? 181 GLU B OE2   1 
ATOM   1449 H H     . GLU C 1 39  ? 38.706 -1.872  31.648 1.00 0.00  ? 181 GLU B H     1 
ATOM   1450 N N     . THR C 1 40  ? 36.871 -4.203  29.785 1.00 69.42 ? 182 THR B N     1 
ATOM   1451 C CA    . THR C 1 40  ? 35.988 -5.201  29.236 1.00 71.78 ? 182 THR B CA    1 
ATOM   1452 C C     . THR C 1 40  ? 34.682 -5.296  30.026 1.00 74.05 ? 182 THR B C     1 
ATOM   1453 O O     . THR C 1 40  ? 33.607 -5.367  29.429 1.00 74.62 ? 182 THR B O     1 
ATOM   1454 C CB    . THR C 1 40  ? 36.712 -6.591  29.196 1.00 72.52 ? 182 THR B CB    1 
ATOM   1455 O OG1   . THR C 1 40  ? 36.915 -6.988  30.532 1.00 74.54 ? 182 THR B OG1   1 
ATOM   1456 C CG2   . THR C 1 40  ? 38.053 -6.594  28.435 1.00 71.51 ? 182 THR B CG2   1 
ATOM   1457 H H     . THR C 1 40  ? 37.186 -4.282  30.710 1.00 0.00  ? 182 THR B H     1 
ATOM   1458 H HG1   . THR C 1 40  ? 37.458 -6.336  30.981 1.00 0.00  ? 182 THR B HG1   1 
ATOM   1459 N N     . THR C 1 41  ? 34.698 -5.301  31.366 1.00 76.64 ? 183 THR B N     1 
ATOM   1460 C CA    . THR C 1 41  ? 33.464 -5.397  32.143 1.00 77.29 ? 183 THR B CA    1 
ATOM   1461 C C     . THR C 1 41  ? 32.667 -4.110  31.958 1.00 77.22 ? 183 THR B C     1 
ATOM   1462 O O     . THR C 1 41  ? 33.153 -3.011  32.266 1.00 78.06 ? 183 THR B O     1 
ATOM   1463 C CB    . THR C 1 41  ? 33.747 -5.553  33.640 1.00 78.07 ? 183 THR B CB    1 
ATOM   1464 O OG1   . THR C 1 41  ? 34.672 -6.612  33.870 1.00 77.23 ? 183 THR B OG1   1 
ATOM   1465 C CG2   . THR C 1 41  ? 32.445 -5.871  34.391 1.00 77.93 ? 183 THR B CG2   1 
ATOM   1466 H H     . THR C 1 41  ? 35.556 -5.239  31.835 1.00 0.00  ? 183 THR B H     1 
ATOM   1467 H HG1   . THR C 1 41  ? 34.307 -7.435  33.536 1.00 0.00  ? 183 THR B HG1   1 
ATOM   1468 N N     . LYS C 1 42  ? 31.411 -4.227  31.549 1.00 76.03 ? 184 LYS B N     1 
ATOM   1469 C CA    . LYS C 1 42  ? 30.617 -3.040  31.278 1.00 74.69 ? 184 LYS B CA    1 
ATOM   1470 C C     . LYS C 1 42  ? 29.919 -2.506  32.516 1.00 72.40 ? 184 LYS B C     1 
ATOM   1471 O O     . LYS C 1 42  ? 29.241 -3.251  33.230 1.00 72.52 ? 184 LYS B O     1 
ATOM   1472 C CB    . LYS C 1 42  ? 29.560 -3.349  30.233 1.00 76.86 ? 184 LYS B CB    1 
ATOM   1473 H H     . LYS C 1 42  ? 31.017 -5.116  31.429 1.00 0.00  ? 184 LYS B H     1 
ATOM   1474 N N     . GLY C 1 43  ? 30.115 -1.209  32.777 1.00 69.24 ? 185 GLY B N     1 
ATOM   1475 C CA    . GLY C 1 43  ? 29.532 -0.549  33.946 1.00 63.16 ? 185 GLY B CA    1 
ATOM   1476 C C     . GLY C 1 43  ? 30.420 -0.581  35.201 1.00 57.71 ? 185 GLY B C     1 
ATOM   1477 O O     . GLY C 1 43  ? 30.057 -0.043  36.257 1.00 56.66 ? 185 GLY B O     1 
ATOM   1478 H H     . GLY C 1 43  ? 30.668 -0.682  32.164 1.00 0.00  ? 185 GLY B H     1 
ATOM   1479 N N     . ALA C 1 44  ? 31.595 -1.216  35.098 1.00 51.46 ? 186 ALA B N     1 
ATOM   1480 C CA    . ALA C 1 44  ? 32.519 -1.280  36.209 1.00 43.78 ? 186 ALA B CA    1 
ATOM   1481 C C     . ALA C 1 44  ? 33.617 -0.247  35.971 1.00 37.57 ? 186 ALA B C     1 
ATOM   1482 O O     . ALA C 1 44  ? 33.878 0.227   34.865 1.00 35.48 ? 186 ALA B O     1 
ATOM   1483 C CB    . ALA C 1 44  ? 33.178 -2.683  36.339 1.00 42.14 ? 186 ALA B CB    1 
ATOM   1484 H H     . ALA C 1 44  ? 31.834 -1.647  34.251 1.00 0.00  ? 186 ALA B H     1 
ATOM   1485 N N     . TYR C 1 45  ? 34.258 0.074   37.068 1.00 32.17 ? 187 TYR B N     1 
ATOM   1486 C CA    . TYR C 1 45  ? 35.379 0.974   37.122 1.00 27.07 ? 187 TYR B CA    1 
ATOM   1487 C C     . TYR C 1 45  ? 36.586 0.206   37.568 1.00 23.81 ? 187 TYR B C     1 
ATOM   1488 O O     . TYR C 1 45  ? 36.480 -0.947  37.977 1.00 20.25 ? 187 TYR B O     1 
ATOM   1489 C CB    . TYR C 1 45  ? 35.035 2.059   38.085 1.00 25.45 ? 187 TYR B CB    1 
ATOM   1490 C CG    . TYR C 1 45  ? 33.987 2.927   37.432 1.00 27.22 ? 187 TYR B CG    1 
ATOM   1491 C CD1   . TYR C 1 45  ? 34.363 3.769   36.375 1.00 29.79 ? 187 TYR B CD1   1 
ATOM   1492 C CD2   . TYR C 1 45  ? 32.665 2.884   37.859 1.00 27.75 ? 187 TYR B CD2   1 
ATOM   1493 C CE1   . TYR C 1 45  ? 33.416 4.564   35.742 1.00 31.70 ? 187 TYR B CE1   1 
ATOM   1494 C CE2   . TYR C 1 45  ? 31.703 3.684   37.226 1.00 31.12 ? 187 TYR B CE2   1 
ATOM   1495 C CZ    . TYR C 1 45  ? 32.095 4.519   36.177 1.00 31.69 ? 187 TYR B CZ    1 
ATOM   1496 O OH    . TYR C 1 45  ? 31.179 5.366   35.614 1.00 31.29 ? 187 TYR B OH    1 
ATOM   1497 H H     . TYR C 1 45  ? 33.953 -0.326  37.908 1.00 0.00  ? 187 TYR B H     1 
ATOM   1498 H HH    . TYR C 1 45  ? 31.611 5.910   34.951 1.00 0.00  ? 187 TYR B HH    1 
ATOM   1499 N N     . CYS C 1 46  ? 37.766 0.747   37.442 1.00 22.98 ? 188 CYS B N     1 
ATOM   1500 C CA    . CYS C 1 46  ? 38.896 0.032   37.985 1.00 24.80 ? 188 CYS B CA    1 
ATOM   1501 C C     . CYS C 1 46  ? 39.802 1.070   38.637 1.00 20.20 ? 188 CYS B C     1 
ATOM   1502 O O     . CYS C 1 46  ? 40.033 2.146   38.079 1.00 19.18 ? 188 CYS B O     1 
ATOM   1503 C CB    . CYS C 1 46  ? 39.578 -0.762  36.827 1.00 24.72 ? 188 CYS B CB    1 
ATOM   1504 S SG    . CYS C 1 46  ? 41.182 -1.400  37.370 1.00 36.48 ? 188 CYS B SG    1 
ATOM   1505 H H     . CYS C 1 46  ? 37.882 1.610   36.993 1.00 0.00  ? 188 CYS B H     1 
ATOM   1506 N N     . LEU C 1 47  ? 40.232 0.801   39.858 1.00 17.52 ? 189 LEU B N     1 
ATOM   1507 C CA    . LEU C 1 47  ? 41.171 1.607   40.591 1.00 17.32 ? 189 LEU B CA    1 
ATOM   1508 C C     . LEU C 1 47  ? 42.585 1.044   40.355 1.00 18.57 ? 189 LEU B C     1 
ATOM   1509 O O     . LEU C 1 47  ? 42.841 -0.136  40.662 1.00 19.73 ? 189 LEU B O     1 
ATOM   1510 C CB    . LEU C 1 47  ? 40.783 1.555   42.080 1.00 16.21 ? 189 LEU B CB    1 
ATOM   1511 C CG    . LEU C 1 47  ? 41.584 2.280   43.104 1.00 13.26 ? 189 LEU B CG    1 
ATOM   1512 C CD1   . LEU C 1 47  ? 41.425 3.761   42.872 1.00 15.05 ? 189 LEU B CD1   1 
ATOM   1513 C CD2   . LEU C 1 47  ? 41.086 1.977   44.485 1.00 13.99 ? 189 LEU B CD2   1 
ATOM   1514 H H     . LEU C 1 47  ? 39.886 -0.005  40.294 1.00 0.00  ? 189 LEU B H     1 
ATOM   1515 N N     . SER C 1 48  ? 43.512 1.809   39.762 1.00 17.53 ? 190 SER B N     1 
ATOM   1516 C CA    . SER C 1 48  ? 44.892 1.422   39.521 1.00 16.37 ? 190 SER B CA    1 
ATOM   1517 C C     . SER C 1 48  ? 45.778 2.176   40.485 1.00 17.93 ? 190 SER B C     1 
ATOM   1518 O O     . SER C 1 48  ? 45.734 3.401   40.459 1.00 16.34 ? 190 SER B O     1 
ATOM   1519 C CB    . SER C 1 48  ? 45.178 1.769   38.097 1.00 15.50 ? 190 SER B CB    1 
ATOM   1520 O OG    . SER C 1 48  ? 44.487 0.790   37.344 1.00 14.16 ? 190 SER B OG    1 
ATOM   1521 H H     . SER C 1 48  ? 43.237 2.701   39.467 1.00 0.00  ? 190 SER B H     1 
ATOM   1522 H HG    . SER C 1 48  ? 44.818 -0.082  37.572 1.00 0.00  ? 190 SER B HG    1 
ATOM   1523 N N     . VAL C 1 49  ? 46.636 1.516   41.277 1.00 21.29 ? 191 VAL B N     1 
ATOM   1524 C CA    . VAL C 1 49  ? 47.446 2.104   42.365 1.00 20.61 ? 191 VAL B CA    1 
ATOM   1525 C C     . VAL C 1 49  ? 48.872 1.674   42.168 1.00 21.51 ? 191 VAL B C     1 
ATOM   1526 O O     . VAL C 1 49  ? 49.040 0.502   41.897 1.00 20.93 ? 191 VAL B O     1 
ATOM   1527 C CB    . VAL C 1 49  ? 47.036 1.608   43.805 1.00 17.58 ? 191 VAL B CB    1 
ATOM   1528 C CG1   . VAL C 1 49  ? 47.693 2.363   44.959 1.00 14.09 ? 191 VAL B CG1   1 
ATOM   1529 C CG2   . VAL C 1 49  ? 45.549 1.832   43.929 1.00 16.28 ? 191 VAL B CG2   1 
ATOM   1530 H H     . VAL C 1 49  ? 46.735 0.555   41.120 1.00 0.00  ? 191 VAL B H     1 
ATOM   1531 N N     . SER C 1 50  ? 49.902 2.524   42.151 1.00 22.32 ? 192 SER B N     1 
ATOM   1532 C CA    . SER C 1 50  ? 51.251 2.007   42.088 1.00 25.02 ? 192 SER B CA    1 
ATOM   1533 C C     . SER C 1 50  ? 51.595 1.578   43.525 1.00 27.33 ? 192 SER B C     1 
ATOM   1534 O O     . SER C 1 50  ? 50.989 2.014   44.541 1.00 26.93 ? 192 SER B O     1 
ATOM   1535 C CB    . SER C 1 50  ? 52.234 3.065   41.585 1.00 23.45 ? 192 SER B CB    1 
ATOM   1536 O OG    . SER C 1 50  ? 52.272 4.171   42.446 1.00 27.00 ? 192 SER B OG    1 
ATOM   1537 H H     . SER C 1 50  ? 49.745 3.491   42.181 1.00 0.00  ? 192 SER B H     1 
ATOM   1538 H HG    . SER C 1 50  ? 52.895 4.819   42.108 1.00 0.00  ? 192 SER B HG    1 
ATOM   1539 N N     . ASP C 1 51  ? 52.590 0.700   43.606 1.00 29.48 ? 193 ASP B N     1 
ATOM   1540 C CA    . ASP C 1 51  ? 52.977 0.096   44.838 1.00 30.52 ? 193 ASP B CA    1 
ATOM   1541 C C     . ASP C 1 51  ? 54.415 -0.292  44.729 1.00 32.67 ? 193 ASP B C     1 
ATOM   1542 O O     . ASP C 1 51  ? 54.948 -0.416  43.633 1.00 31.90 ? 193 ASP B O     1 
ATOM   1543 C CB    . ASP C 1 51  ? 52.135 -1.116  45.012 1.00 33.36 ? 193 ASP B CB    1 
ATOM   1544 C CG    . ASP C 1 51  ? 52.276 -1.771  46.347 1.00 34.11 ? 193 ASP B CG    1 
ATOM   1545 O OD1   . ASP C 1 51  ? 52.552 -1.061  47.314 1.00 37.92 ? 193 ASP B OD1   1 
ATOM   1546 O OD2   . ASP C 1 51  ? 52.057 -2.980  46.409 1.00 35.07 ? 193 ASP B OD2   1 
ATOM   1547 H H     . ASP C 1 51  ? 53.075 0.459   42.789 1.00 0.00  ? 193 ASP B H     1 
ATOM   1548 N N     . PHE C 1 52  ? 55.085 -0.477  45.837 1.00 37.42 ? 194 PHE B N     1 
ATOM   1549 C CA    . PHE C 1 52  ? 56.449 -0.901  45.717 1.00 43.21 ? 194 PHE B CA    1 
ATOM   1550 C C     . PHE C 1 52  ? 56.640 -2.084  46.646 1.00 47.53 ? 194 PHE B C     1 
ATOM   1551 O O     . PHE C 1 52  ? 56.207 -2.042  47.805 1.00 46.96 ? 194 PHE B O     1 
ATOM   1552 C CB    . PHE C 1 52  ? 57.367 0.251   46.083 1.00 42.57 ? 194 PHE B CB    1 
ATOM   1553 C CG    . PHE C 1 52  ? 58.843 -0.156  46.111 1.00 45.93 ? 194 PHE B CG    1 
ATOM   1554 C CD1   . PHE C 1 52  ? 59.596 -0.191  44.934 1.00 45.18 ? 194 PHE B CD1   1 
ATOM   1555 C CD2   . PHE C 1 52  ? 59.439 -0.524  47.330 1.00 47.32 ? 194 PHE B CD2   1 
ATOM   1556 C CE1   . PHE C 1 52  ? 60.926 -0.598  44.970 1.00 44.93 ? 194 PHE B CE1   1 
ATOM   1557 C CE2   . PHE C 1 52  ? 60.768 -0.930  47.351 1.00 48.58 ? 194 PHE B CE2   1 
ATOM   1558 C CZ    . PHE C 1 52  ? 61.515 -0.968  46.171 1.00 47.50 ? 194 PHE B CZ    1 
ATOM   1559 H H     . PHE C 1 52  ? 54.671 -0.332  46.713 1.00 0.00  ? 194 PHE B H     1 
ATOM   1560 N N     . ASP C 1 53  ? 57.342 -3.098  46.113 1.00 53.72 ? 195 ASP B N     1 
ATOM   1561 C CA    . ASP C 1 53  ? 57.658 -4.335  46.817 1.00 59.63 ? 195 ASP B CA    1 
ATOM   1562 C C     . ASP C 1 53  ? 59.152 -4.493  46.551 1.00 63.36 ? 195 ASP B C     1 
ATOM   1563 O O     . ASP C 1 53  ? 59.552 -4.358  45.393 1.00 64.04 ? 195 ASP B O     1 
ATOM   1564 C CB    . ASP C 1 53  ? 56.929 -5.552  46.202 1.00 58.82 ? 195 ASP B CB    1 
ATOM   1565 H H     . ASP C 1 53  ? 57.662 -3.000  45.193 1.00 0.00  ? 195 ASP B H     1 
ATOM   1566 N N     . ASN C 1 54  ? 59.968 -4.818  47.584 1.00 65.95 ? 196 ASN B N     1 
ATOM   1567 C CA    . ASN C 1 54  ? 61.425 -4.990  47.484 1.00 66.67 ? 196 ASN B CA    1 
ATOM   1568 C C     . ASN C 1 54  ? 61.926 -5.648  46.205 1.00 67.95 ? 196 ASN B C     1 
ATOM   1569 O O     . ASN C 1 54  ? 62.782 -5.133  45.465 1.00 68.40 ? 196 ASN B O     1 
ATOM   1570 C CB    . ASN C 1 54  ? 61.935 -5.835  48.652 1.00 65.02 ? 196 ASN B CB    1 
ATOM   1571 H H     . ASN C 1 54  ? 59.556 -4.948  48.463 1.00 0.00  ? 196 ASN B H     1 
ATOM   1572 N N     . ALA C 1 55  ? 61.235 -6.785  46.030 1.00 67.51 ? 197 ALA B N     1 
ATOM   1573 C CA    . ALA C 1 55  ? 61.424 -7.686  44.911 1.00 67.30 ? 197 ALA B CA    1 
ATOM   1574 C C     . ALA C 1 55  ? 60.925 -7.187  43.553 1.00 66.03 ? 197 ALA B C     1 
ATOM   1575 O O     . ALA C 1 55  ? 61.721 -6.945  42.634 1.00 68.01 ? 197 ALA B O     1 
ATOM   1576 C CB    . ALA C 1 55  ? 60.727 -9.024  45.219 1.00 67.92 ? 197 ALA B CB    1 
ATOM   1577 H H     . ALA C 1 55  ? 60.561 -7.020  46.700 1.00 0.00  ? 197 ALA B H     1 
ATOM   1578 N N     . LYS C 1 56  ? 59.594 -7.026  43.416 1.00 62.49 ? 198 LYS B N     1 
ATOM   1579 C CA    . LYS C 1 56  ? 59.025 -6.647  42.127 1.00 57.84 ? 198 LYS B CA    1 
ATOM   1580 C C     . LYS C 1 56  ? 59.387 -5.228  41.772 1.00 54.56 ? 198 LYS B C     1 
ATOM   1581 O O     . LYS C 1 56  ? 59.362 -4.867  40.596 1.00 56.46 ? 198 LYS B O     1 
ATOM   1582 C CB    . LYS C 1 56  ? 57.502 -6.722  42.124 1.00 56.97 ? 198 LYS B CB    1 
ATOM   1583 H H     . LYS C 1 56  ? 59.005 -7.164  44.187 1.00 0.00  ? 198 LYS B H     1 
ATOM   1584 N N     . GLY C 1 57  ? 59.775 -4.450  42.784 1.00 49.88 ? 199 GLY B N     1 
ATOM   1585 C CA    . GLY C 1 57  ? 60.045 -3.056  42.572 1.00 45.62 ? 199 GLY B CA    1 
ATOM   1586 C C     . GLY C 1 57  ? 58.670 -2.417  42.472 1.00 41.77 ? 199 GLY B C     1 
ATOM   1587 O O     . GLY C 1 57  ? 57.707 -2.755  43.184 1.00 40.96 ? 199 GLY B O     1 
ATOM   1588 H H     . GLY C 1 57  ? 59.877 -4.834  43.680 1.00 0.00  ? 199 GLY B H     1 
ATOM   1589 N N     . LEU C 1 58  ? 58.602 -1.445  41.594 1.00 37.67 ? 200 LEU B N     1 
ATOM   1590 C CA    . LEU C 1 58  ? 57.375 -0.725  41.387 1.00 36.42 ? 200 LEU B CA    1 
ATOM   1591 C C     . LEU C 1 58  ? 56.442 -1.475  40.475 1.00 32.57 ? 200 LEU B C     1 
ATOM   1592 O O     . LEU C 1 58  ? 56.850 -1.996  39.442 1.00 33.86 ? 200 LEU B O     1 
ATOM   1593 C CB    . LEU C 1 58  ? 57.632 0.626   40.760 1.00 37.41 ? 200 LEU B CB    1 
ATOM   1594 C CG    . LEU C 1 58  ? 58.179 1.721   41.601 1.00 36.64 ? 200 LEU B CG    1 
ATOM   1595 C CD1   . LEU C 1 58  ? 58.639 2.725   40.571 1.00 39.57 ? 200 LEU B CD1   1 
ATOM   1596 C CD2   . LEU C 1 58  ? 57.199 2.236   42.668 1.00 37.17 ? 200 LEU B CD2   1 
ATOM   1597 H H     . LEU C 1 58  ? 59.397 -1.207  41.073 1.00 0.00  ? 200 LEU B H     1 
ATOM   1598 N N     . ASN C 1 59  ? 55.181 -1.511  40.843 1.00 28.70 ? 201 ASN B N     1 
ATOM   1599 C CA    . ASN C 1 59  ? 54.235 -2.222  40.036 1.00 26.83 ? 201 ASN B CA    1 
ATOM   1600 C C     . ASN C 1 59  ? 52.916 -1.555  40.310 1.00 23.46 ? 201 ASN B C     1 
ATOM   1601 O O     . ASN C 1 59  ? 52.827 -0.654  41.138 1.00 23.46 ? 201 ASN B O     1 
ATOM   1602 C CB    . ASN C 1 59  ? 54.254 -3.718  40.426 1.00 27.80 ? 201 ASN B CB    1 
ATOM   1603 C CG    . ASN C 1 59  ? 53.839 -4.010  41.848 1.00 31.10 ? 201 ASN B CG    1 
ATOM   1604 O OD1   . ASN C 1 59  ? 52.772 -4.611  42.054 1.00 33.95 ? 201 ASN B OD1   1 
ATOM   1605 N ND2   . ASN C 1 59  ? 54.676 -3.668  42.840 1.00 32.42 ? 201 ASN B ND2   1 
ATOM   1606 H H     . ASN C 1 59  ? 54.891 -1.056  41.661 1.00 0.00  ? 201 ASN B H     1 
ATOM   1607 H HD21  . ASN C 1 59  ? 54.394 -3.863  43.757 1.00 0.00  ? 201 ASN B HD21  1 
ATOM   1608 H HD22  . ASN C 1 59  ? 55.533 -3.240  42.633 1.00 0.00  ? 201 ASN B HD22  1 
ATOM   1609 N N     . VAL C 1 60  ? 51.929 -1.923  39.522 1.00 21.17 ? 202 VAL B N     1 
ATOM   1610 C CA    . VAL C 1 60  ? 50.616 -1.358  39.615 1.00 20.71 ? 202 VAL B CA    1 
ATOM   1611 C C     . VAL C 1 60  ? 49.647 -2.451  40.041 1.00 19.53 ? 202 VAL B C     1 
ATOM   1612 O O     . VAL C 1 60  ? 49.631 -3.507  39.425 1.00 19.74 ? 202 VAL B O     1 
ATOM   1613 C CB    . VAL C 1 60  ? 50.312 -0.742  38.186 1.00 20.41 ? 202 VAL B CB    1 
ATOM   1614 C CG1   . VAL C 1 60  ? 48.933 -0.130  38.152 1.00 17.21 ? 202 VAL B CG1   1 
ATOM   1615 C CG2   . VAL C 1 60  ? 51.291 0.403   37.856 1.00 22.33 ? 202 VAL B CG2   1 
ATOM   1616 H H     . VAL C 1 60  ? 52.099 -2.611  38.845 1.00 0.00  ? 202 VAL B H     1 
ATOM   1617 N N     . LYS C 1 61  ? 48.809 -2.264  41.037 1.00 19.50 ? 203 LYS B N     1 
ATOM   1618 C CA    . LYS C 1 61  ? 47.783 -3.230  41.414 1.00 19.79 ? 203 LYS B CA    1 
ATOM   1619 C C     . LYS C 1 61  ? 46.506 -2.713  40.783 1.00 21.24 ? 203 LYS B C     1 
ATOM   1620 O O     . LYS C 1 61  ? 46.366 -1.494  40.596 1.00 21.28 ? 203 LYS B O     1 
ATOM   1621 C CB    . LYS C 1 61  ? 47.544 -3.245  42.883 1.00 19.79 ? 203 LYS B CB    1 
ATOM   1622 C CG    . LYS C 1 61  ? 48.784 -3.519  43.699 1.00 24.96 ? 203 LYS B CG    1 
ATOM   1623 C CD    . LYS C 1 61  ? 49.226 -4.922  43.468 1.00 27.32 ? 203 LYS B CD    1 
ATOM   1624 C CE    . LYS C 1 61  ? 50.516 -5.284  44.177 1.00 31.37 ? 203 LYS B CE    1 
ATOM   1625 N NZ    . LYS C 1 61  ? 50.418 -4.944  45.567 1.00 36.29 ? 203 LYS B NZ    1 
ATOM   1626 H H     . LYS C 1 61  ? 48.877 -1.434  41.552 1.00 0.00  ? 203 LYS B H     1 
ATOM   1627 H HZ1   . LYS C 1 61  ? 49.630 -5.468  45.998 1.00 0.00  ? 203 LYS B HZ1   1 
ATOM   1628 H HZ2   . LYS C 1 61  ? 51.305 -5.194  46.048 1.00 0.00  ? 203 LYS B HZ2   1 
ATOM   1629 H HZ3   . LYS C 1 61  ? 50.248 -3.922  45.663 1.00 0.00  ? 203 LYS B HZ3   1 
ATOM   1630 N N     . HIS C 1 62  ? 45.518 -3.543  40.462 1.00 21.47 ? 204 HIS B N     1 
ATOM   1631 C CA    . HIS C 1 62  ? 44.284 -3.079  39.865 1.00 19.61 ? 204 HIS B CA    1 
ATOM   1632 C C     . HIS C 1 62  ? 43.174 -3.750  40.659 1.00 20.92 ? 204 HIS B C     1 
ATOM   1633 O O     . HIS C 1 62  ? 43.197 -4.954  40.933 1.00 20.44 ? 204 HIS B O     1 
ATOM   1634 C CB    . HIS C 1 62  ? 44.135 -3.470  38.381 1.00 15.74 ? 204 HIS B CB    1 
ATOM   1635 C CG    . HIS C 1 62  ? 45.174 -2.871  37.429 1.00 15.76 ? 204 HIS B CG    1 
ATOM   1636 N ND1   . HIS C 1 62  ? 45.179 -1.744  36.706 1.00 13.70 ? 204 HIS B ND1   1 
ATOM   1637 C CD2   . HIS C 1 62  ? 46.347 -3.516  37.131 1.00 13.43 ? 204 HIS B CD2   1 
ATOM   1638 C CE1   . HIS C 1 62  ? 46.280 -1.694  36.008 1.00 12.85 ? 204 HIS B CE1   1 
ATOM   1639 N NE2   . HIS C 1 62  ? 46.964 -2.764  36.275 1.00 16.48 ? 204 HIS B NE2   1 
ATOM   1640 H H     . HIS C 1 62  ? 45.629 -4.501  40.635 1.00 0.00  ? 204 HIS B H     1 
ATOM   1641 H HD1   . HIS C 1 62  ? 44.474 -1.070  36.702 1.00 0.00  ? 204 HIS B HD1   1 
ATOM   1642 H HE2   . HIS C 1 62  ? 47.833 -2.975  35.881 1.00 0.00  ? 204 HIS B HE2   1 
ATOM   1643 N N     . TYR C 1 63  ? 42.236 -2.923  41.097 1.00 20.73 ? 205 TYR B N     1 
ATOM   1644 C CA    . TYR C 1 63  ? 41.101 -3.344  41.870 1.00 20.98 ? 205 TYR B CA    1 
ATOM   1645 C C     . TYR C 1 63  ? 39.881 -2.935  41.059 1.00 21.78 ? 205 TYR B C     1 
ATOM   1646 O O     . TYR C 1 63  ? 39.733 -1.801  40.581 1.00 23.20 ? 205 TYR B O     1 
ATOM   1647 C CB    . TYR C 1 63  ? 41.050 -2.639  43.243 1.00 19.13 ? 205 TYR B CB    1 
ATOM   1648 C CG    . TYR C 1 63  ? 42.292 -2.907  44.092 1.00 22.27 ? 205 TYR B CG    1 
ATOM   1649 C CD1   . TYR C 1 63  ? 43.388 -2.060  43.892 1.00 22.10 ? 205 TYR B CD1   1 
ATOM   1650 C CD2   . TYR C 1 63  ? 42.364 -3.943  45.039 1.00 18.91 ? 205 TYR B CD2   1 
ATOM   1651 C CE1   . TYR C 1 63  ? 44.559 -2.242  44.630 1.00 20.95 ? 205 TYR B CE1   1 
ATOM   1652 C CE2   . TYR C 1 63  ? 43.549 -4.115  45.779 1.00 19.60 ? 205 TYR B CE2   1 
ATOM   1653 C CZ    . TYR C 1 63  ? 44.628 -3.260  45.561 1.00 18.34 ? 205 TYR B CZ    1 
ATOM   1654 O OH    . TYR C 1 63  ? 45.806 -3.316  46.265 1.00 20.80 ? 205 TYR B OH    1 
ATOM   1655 H H     . TYR C 1 63  ? 42.321 -1.971  40.882 1.00 0.00  ? 205 TYR B H     1 
ATOM   1656 H HH    . TYR C 1 63  ? 45.759 -4.023  46.912 1.00 0.00  ? 205 TYR B HH    1 
ATOM   1657 N N     . LYS C 1 64  ? 39.020 -3.933  40.853 1.00 20.32 ? 206 LYS B N     1 
ATOM   1658 C CA    . LYS C 1 64  ? 37.774 -3.760  40.141 1.00 18.20 ? 206 LYS B CA    1 
ATOM   1659 C C     . LYS C 1 64  ? 36.797 -3.053  41.109 1.00 19.63 ? 206 LYS B C     1 
ATOM   1660 O O     . LYS C 1 64  ? 36.795 -3.338  42.315 1.00 18.70 ? 206 LYS B O     1 
ATOM   1661 C CB    . LYS C 1 64  ? 37.336 -5.131  39.755 1.00 17.99 ? 206 LYS B CB    1 
ATOM   1662 C CG    . LYS C 1 64  ? 36.290 -5.141  38.706 1.00 25.54 ? 206 LYS B CG    1 
ATOM   1663 C CD    . LYS C 1 64  ? 35.797 -6.563  38.615 1.00 34.59 ? 206 LYS B CD    1 
ATOM   1664 C CE    . LYS C 1 64  ? 36.625 -7.538  37.742 1.00 41.78 ? 206 LYS B CE    1 
ATOM   1665 N NZ    . LYS C 1 64  ? 36.396 -7.318  36.307 1.00 47.05 ? 206 LYS B NZ    1 
ATOM   1666 H H     . LYS C 1 64  ? 39.242 -4.822  41.199 1.00 0.00  ? 206 LYS B H     1 
ATOM   1667 H HZ1   . LYS C 1 64  ? 36.668 -6.346  36.057 1.00 0.00  ? 206 LYS B HZ1   1 
ATOM   1668 H HZ2   . LYS C 1 64  ? 36.968 -7.991  35.758 1.00 0.00  ? 206 LYS B HZ2   1 
ATOM   1669 H HZ3   . LYS C 1 64  ? 35.389 -7.462  36.090 1.00 0.00  ? 206 LYS B HZ3   1 
ATOM   1670 N N     . ILE C 1 65  ? 35.993 -2.080  40.674 1.00 18.96 ? 207 ILE B N     1 
ATOM   1671 C CA    . ILE C 1 65  ? 35.026 -1.400  41.531 1.00 20.30 ? 207 ILE B CA    1 
ATOM   1672 C C     . ILE C 1 65  ? 33.683 -1.821  40.976 1.00 22.08 ? 207 ILE B C     1 
ATOM   1673 O O     . ILE C 1 65  ? 33.482 -1.652  39.776 1.00 23.14 ? 207 ILE B O     1 
ATOM   1674 C CB    . ILE C 1 65  ? 35.143 0.158   41.444 1.00 19.01 ? 207 ILE B CB    1 
ATOM   1675 C CG1   . ILE C 1 65  ? 36.530 0.636   41.863 1.00 14.84 ? 207 ILE B CG1   1 
ATOM   1676 C CG2   . ILE C 1 65  ? 34.054 0.767   42.327 1.00 19.26 ? 207 ILE B CG2   1 
ATOM   1677 C CD1   . ILE C 1 65  ? 36.777 2.120   41.677 1.00 13.31 ? 207 ILE B CD1   1 
ATOM   1678 H H     . ILE C 1 65  ? 36.055 -1.809  39.735 1.00 0.00  ? 207 ILE B H     1 
ATOM   1679 N N     . ARG C 1 66  ? 32.767 -2.405  41.741 1.00 24.28 ? 208 ARG B N     1 
ATOM   1680 C CA    . ARG C 1 66  ? 31.498 -2.768  41.152 1.00 27.55 ? 208 ARG B CA    1 
ATOM   1681 C C     . ARG C 1 66  ? 30.478 -1.784  41.635 1.00 29.32 ? 208 ARG B C     1 
ATOM   1682 O O     . ARG C 1 66  ? 30.582 -1.232  42.734 1.00 29.54 ? 208 ARG B O     1 
ATOM   1683 C CB    . ARG C 1 66  ? 30.967 -4.097  41.590 1.00 30.69 ? 208 ARG B CB    1 
ATOM   1684 C CG    . ARG C 1 66  ? 31.793 -5.302  41.342 1.00 38.09 ? 208 ARG B CG    1 
ATOM   1685 C CD    . ARG C 1 66  ? 31.416 -6.039  40.101 1.00 44.26 ? 208 ARG B CD    1 
ATOM   1686 N NE    . ARG C 1 66  ? 32.195 -7.267  40.159 1.00 51.45 ? 208 ARG B NE    1 
ATOM   1687 C CZ    . ARG C 1 66  ? 32.254 -8.197  39.191 1.00 55.82 ? 208 ARG B CZ    1 
ATOM   1688 N NH1   . ARG C 1 66  ? 31.617 -8.040  38.011 1.00 59.00 ? 208 ARG B NH1   1 
ATOM   1689 N NH2   . ARG C 1 66  ? 33.027 -9.266  39.442 1.00 57.05 ? 208 ARG B NH2   1 
ATOM   1690 H H     . ARG C 1 66  ? 32.948 -2.586  42.687 1.00 0.00  ? 208 ARG B H     1 
ATOM   1691 H HE    . ARG C 1 66  ? 32.719 -7.429  40.970 1.00 0.00  ? 208 ARG B HE    1 
ATOM   1692 H HH11  . ARG C 1 66  ? 31.082 -7.213  37.838 1.00 0.00  ? 208 ARG B HH11  1 
ATOM   1693 H HH12  . ARG C 1 66  ? 31.680 -8.751  37.310 1.00 0.00  ? 208 ARG B HH12  1 
ATOM   1694 H HH21  . ARG C 1 66  ? 33.518 -9.335  40.311 1.00 0.00  ? 208 ARG B HH21  1 
ATOM   1695 H HH22  . ARG C 1 66  ? 33.112 -9.993  38.760 1.00 0.00  ? 208 ARG B HH22  1 
ATOM   1696 N N     . LYS C 1 67  ? 29.449 -1.629  40.824 1.00 31.63 ? 209 LYS B N     1 
ATOM   1697 C CA    . LYS C 1 67  ? 28.343 -0.771  41.140 1.00 34.10 ? 209 LYS B CA    1 
ATOM   1698 C C     . LYS C 1 67  ? 27.167 -1.673  41.481 1.00 35.61 ? 209 LYS B C     1 
ATOM   1699 O O     . LYS C 1 67  ? 26.824 -2.580  40.736 1.00 37.33 ? 209 LYS B O     1 
ATOM   1700 C CB    . LYS C 1 67  ? 28.028 0.078   39.950 1.00 34.86 ? 209 LYS B CB    1 
ATOM   1701 C CG    . LYS C 1 67  ? 26.901 0.990   40.272 1.00 41.08 ? 209 LYS B CG    1 
ATOM   1702 C CD    . LYS C 1 67  ? 26.595 1.610   38.963 1.00 48.10 ? 209 LYS B CD    1 
ATOM   1703 C CE    . LYS C 1 67  ? 25.568 2.688   39.182 1.00 52.54 ? 209 LYS B CE    1 
ATOM   1704 N NZ    . LYS C 1 67  ? 25.376 3.329   37.894 1.00 57.63 ? 209 LYS B NZ    1 
ATOM   1705 H H     . LYS C 1 67  ? 29.440 -2.118  39.975 1.00 0.00  ? 209 LYS B H     1 
ATOM   1706 H HZ1   . LYS C 1 67  ? 25.041 2.627   37.203 1.00 0.00  ? 209 LYS B HZ1   1 
ATOM   1707 H HZ2   . LYS C 1 67  ? 24.671 4.088   37.986 1.00 0.00  ? 209 LYS B HZ2   1 
ATOM   1708 H HZ3   . LYS C 1 67  ? 26.278 3.732   37.569 1.00 0.00  ? 209 LYS B HZ3   1 
ATOM   1709 N N     . LEU C 1 68  ? 26.567 -1.505  42.645 1.00 36.58 ? 210 LEU B N     1 
ATOM   1710 C CA    . LEU C 1 68  ? 25.397 -2.225  43.049 1.00 37.61 ? 210 LEU B CA    1 
ATOM   1711 C C     . LEU C 1 68  ? 24.197 -1.610  42.342 1.00 40.75 ? 210 LEU B C     1 
ATOM   1712 O O     . LEU C 1 68  ? 24.137 -0.425  42.000 1.00 40.67 ? 210 LEU B O     1 
ATOM   1713 C CB    . LEU C 1 68  ? 25.218 -2.106  44.532 1.00 33.53 ? 210 LEU B CB    1 
ATOM   1714 C CG    . LEU C 1 68  ? 26.358 -2.661  45.322 1.00 34.74 ? 210 LEU B CG    1 
ATOM   1715 C CD1   . LEU C 1 68  ? 26.721 -1.678  46.438 1.00 35.48 ? 210 LEU B CD1   1 
ATOM   1716 C CD2   . LEU C 1 68  ? 26.004 -4.054  45.755 1.00 32.06 ? 210 LEU B CD2   1 
ATOM   1717 H H     . LEU C 1 68  ? 26.944 -0.850  43.268 1.00 0.00  ? 210 LEU B H     1 
ATOM   1718 N N     . ASP C 1 69  ? 23.164 -2.446  42.309 1.00 44.01 ? 211 ASP B N     1 
ATOM   1719 C CA    . ASP C 1 69  ? 21.895 -2.175  41.653 1.00 45.69 ? 211 ASP B CA    1 
ATOM   1720 C C     . ASP C 1 69  ? 21.185 -0.889  42.116 1.00 45.38 ? 211 ASP B C     1 
ATOM   1721 O O     . ASP C 1 69  ? 20.614 -0.131  41.288 1.00 45.19 ? 211 ASP B O     1 
ATOM   1722 C CB    . ASP C 1 69  ? 21.017 -3.408  41.883 1.00 49.55 ? 211 ASP B CB    1 
ATOM   1723 H H     . ASP C 1 69  ? 23.265 -3.309  42.760 1.00 0.00  ? 211 ASP B H     1 
ATOM   1724 N N     . SER C 1 70  ? 21.207 -0.680  43.443 1.00 43.85 ? 212 SER B N     1 
ATOM   1725 C CA    . SER C 1 70  ? 20.683 0.522   44.060 1.00 41.45 ? 212 SER B CA    1 
ATOM   1726 C C     . SER C 1 70  ? 21.534 1.722   43.722 1.00 40.39 ? 212 SER B C     1 
ATOM   1727 O O     . SER C 1 70  ? 21.036 2.817   43.890 1.00 41.60 ? 212 SER B O     1 
ATOM   1728 C CB    . SER C 1 70  ? 20.636 0.370   45.552 1.00 41.97 ? 212 SER B CB    1 
ATOM   1729 O OG    . SER C 1 70  ? 21.838 -0.253  46.024 1.00 44.87 ? 212 SER B OG    1 
ATOM   1730 H H     . SER C 1 70  ? 21.595 -1.371  44.019 1.00 0.00  ? 212 SER B H     1 
ATOM   1731 H HG    . SER C 1 70  ? 22.594 0.289   45.787 1.00 0.00  ? 212 SER B HG    1 
ATOM   1732 N N     . GLY C 1 71  ? 22.789 1.537   43.310 1.00 38.03 ? 213 GLY B N     1 
ATOM   1733 C CA    . GLY C 1 71  ? 23.584 2.678   42.915 1.00 36.77 ? 213 GLY B CA    1 
ATOM   1734 C C     . GLY C 1 71  ? 25.017 2.630   43.467 1.00 35.26 ? 213 GLY B C     1 
ATOM   1735 O O     . GLY C 1 71  ? 25.920 2.969   42.691 1.00 37.95 ? 213 GLY B O     1 
ATOM   1736 H H     . GLY C 1 71  ? 23.169 0.634   43.275 1.00 0.00  ? 213 GLY B H     1 
ATOM   1737 N N     . GLY C 1 72  ? 25.205 2.114   44.693 1.00 29.66 ? 214 GLY B N     1 
ATOM   1738 C CA    . GLY C 1 72  ? 26.465 2.134   45.403 1.00 26.58 ? 214 GLY B CA    1 
ATOM   1739 C C     . GLY C 1 72  ? 27.640 1.458   44.757 1.00 24.15 ? 214 GLY B C     1 
ATOM   1740 O O     . GLY C 1 72  ? 27.517 0.750   43.769 1.00 24.71 ? 214 GLY B O     1 
ATOM   1741 H H     . GLY C 1 72  ? 24.438 1.696   45.136 1.00 0.00  ? 214 GLY B H     1 
ATOM   1742 N N     . PHE C 1 73  ? 28.823 1.619   45.327 1.00 22.98 ? 215 PHE B N     1 
ATOM   1743 C CA    . PHE C 1 73  ? 30.072 1.087   44.794 1.00 19.74 ? 215 PHE B CA    1 
ATOM   1744 C C     . PHE C 1 73  ? 30.869 0.268   45.794 1.00 19.08 ? 215 PHE B C     1 
ATOM   1745 O O     . PHE C 1 73  ? 30.854 0.596   46.987 1.00 18.57 ? 215 PHE B O     1 
ATOM   1746 C CB    . PHE C 1 73  ? 30.994 2.190   44.342 1.00 19.12 ? 215 PHE B CB    1 
ATOM   1747 C CG    . PHE C 1 73  ? 30.478 2.861   43.114 1.00 18.45 ? 215 PHE B CG    1 
ATOM   1748 C CD1   . PHE C 1 73  ? 30.835 2.340   41.885 1.00 20.47 ? 215 PHE B CD1   1 
ATOM   1749 C CD2   . PHE C 1 73  ? 29.626 3.947   43.230 1.00 17.49 ? 215 PHE B CD2   1 
ATOM   1750 C CE1   . PHE C 1 73  ? 30.367 2.946   40.735 1.00 22.79 ? 215 PHE B CE1   1 
ATOM   1751 C CE2   . PHE C 1 73  ? 29.155 4.534   42.059 1.00 15.78 ? 215 PHE B CE2   1 
ATOM   1752 C CZ    . PHE C 1 73  ? 29.536 4.059   40.814 1.00 20.33 ? 215 PHE B CZ    1 
ATOM   1753 H H     . PHE C 1 73  ? 28.863 2.129   46.162 1.00 0.00  ? 215 PHE B H     1 
ATOM   1754 N N     . TYR C 1 74  ? 31.611 -0.782  45.446 1.00 17.87 ? 216 TYR B N     1 
ATOM   1755 C CA    . TYR C 1 74  ? 32.415 -1.447  46.451 1.00 16.75 ? 216 TYR B CA    1 
ATOM   1756 C C     . TYR C 1 74  ? 33.620 -2.089  45.799 1.00 15.54 ? 216 TYR B C     1 
ATOM   1757 O O     . TYR C 1 74  ? 33.658 -2.297  44.579 1.00 15.59 ? 216 TYR B O     1 
ATOM   1758 C CB    . TYR C 1 74  ? 31.567 -2.514  47.159 1.00 16.65 ? 216 TYR B CB    1 
ATOM   1759 C CG    . TYR C 1 74  ? 31.128 -3.686  46.282 1.00 17.88 ? 216 TYR B CG    1 
ATOM   1760 C CD1   . TYR C 1 74  ? 31.931 -4.814  46.162 1.00 15.89 ? 216 TYR B CD1   1 
ATOM   1761 C CD2   . TYR C 1 74  ? 29.916 -3.626  45.601 1.00 16.87 ? 216 TYR B CD2   1 
ATOM   1762 C CE1   . TYR C 1 74  ? 31.522 -5.878  45.364 1.00 17.14 ? 216 TYR B CE1   1 
ATOM   1763 C CE2   . TYR C 1 74  ? 29.502 -4.690  44.803 1.00 19.05 ? 216 TYR B CE2   1 
ATOM   1764 C CZ    . TYR C 1 74  ? 30.311 -5.810  44.698 1.00 17.24 ? 216 TYR B CZ    1 
ATOM   1765 O OH    . TYR C 1 74  ? 29.890 -6.867  43.947 1.00 18.37 ? 216 TYR B OH    1 
ATOM   1766 H H     . TYR C 1 74  ? 31.613 -1.101  44.520 1.00 0.00  ? 216 TYR B H     1 
ATOM   1767 H HH    . TYR C 1 74  ? 30.553 -7.561  43.971 1.00 0.00  ? 216 TYR B HH    1 
ATOM   1768 N N     . ILE C 1 75  ? 34.601 -2.375  46.648 1.00 17.55 ? 217 ILE B N     1 
ATOM   1769 C CA    . ILE C 1 75  ? 35.763 -3.172  46.269 1.00 14.74 ? 217 ILE B CA    1 
ATOM   1770 C C     . ILE C 1 75  ? 35.674 -4.371  47.244 1.00 16.45 ? 217 ILE B C     1 
ATOM   1771 O O     . ILE C 1 75  ? 35.892 -5.499  46.821 1.00 18.41 ? 217 ILE B O     1 
ATOM   1772 C CB    . ILE C 1 75  ? 37.082 -2.345  46.434 1.00 13.75 ? 217 ILE B CB    1 
ATOM   1773 C CG1   . ILE C 1 75  ? 37.122 -1.242  45.409 1.00 11.43 ? 217 ILE B CG1   1 
ATOM   1774 C CG2   . ILE C 1 75  ? 38.289 -3.235  46.246 1.00 14.43 ? 217 ILE B CG2   1 
ATOM   1775 C CD1   . ILE C 1 75  ? 38.188 -0.210  45.693 1.00 10.52 ? 217 ILE B CD1   1 
ATOM   1776 H H     . ILE C 1 75  ? 34.542 -2.037  47.566 1.00 0.00  ? 217 ILE B H     1 
ATOM   1777 N N     . THR C 1 76  ? 35.311 -4.292  48.524 1.00 15.87 ? 218 THR B N     1 
ATOM   1778 C CA    . THR C 1 76  ? 35.173 -5.432  49.419 1.00 18.07 ? 218 THR B CA    1 
ATOM   1779 C C     . THR C 1 76  ? 33.843 -5.450  50.156 1.00 20.08 ? 218 THR B C     1 
ATOM   1780 O O     . THR C 1 76  ? 33.087 -4.466  50.089 1.00 23.41 ? 218 THR B O     1 
ATOM   1781 C CB    . THR C 1 76  ? 36.303 -5.487  50.480 1.00 16.83 ? 218 THR B CB    1 
ATOM   1782 O OG1   . THR C 1 76  ? 36.094 -4.464  51.394 1.00 14.50 ? 218 THR B OG1   1 
ATOM   1783 C CG2   . THR C 1 76  ? 37.674 -5.202  49.915 1.00 19.83 ? 218 THR B CG2   1 
ATOM   1784 H H     . THR C 1 76  ? 35.124 -3.403  48.889 1.00 0.00  ? 218 THR B H     1 
ATOM   1785 H HG1   . THR C 1 76  ? 36.112 -3.619  50.939 1.00 0.00  ? 218 THR B HG1   1 
ATOM   1786 N N     . SER C 1 77  ? 33.528 -6.500  50.924 1.00 19.88 ? 219 SER B N     1 
ATOM   1787 C CA    . SER C 1 77  ? 32.275 -6.562  51.661 1.00 18.91 ? 219 SER B CA    1 
ATOM   1788 C C     . SER C 1 77  ? 32.297 -5.715  52.937 1.00 20.26 ? 219 SER B C     1 
ATOM   1789 O O     . SER C 1 77  ? 31.316 -5.596  53.695 1.00 21.72 ? 219 SER B O     1 
ATOM   1790 C CB    . SER C 1 77  ? 32.046 -7.963  52.017 1.00 15.29 ? 219 SER B CB    1 
ATOM   1791 O OG    . SER C 1 77  ? 33.229 -8.346  52.715 1.00 15.02 ? 219 SER B OG    1 
ATOM   1792 H H     . SER C 1 77  ? 34.158 -7.247  50.992 1.00 0.00  ? 219 SER B H     1 
ATOM   1793 H HG    . SER C 1 77  ? 33.337 -7.791  53.491 1.00 0.00  ? 219 SER B HG    1 
ATOM   1794 N N     . ARG C 1 78  ? 33.484 -5.186  53.240 1.00 19.44 ? 220 ARG B N     1 
ATOM   1795 C CA    . ARG C 1 78  ? 33.694 -4.360  54.403 1.00 19.06 ? 220 ARG B CA    1 
ATOM   1796 C C     . ARG C 1 78  ? 33.000 -3.006  54.323 1.00 18.48 ? 220 ARG B C     1 
ATOM   1797 O O     . ARG C 1 78  ? 32.412 -2.616  55.332 1.00 18.33 ? 220 ARG B O     1 
ATOM   1798 C CB    . ARG C 1 78  ? 35.193 -4.201  54.572 1.00 19.84 ? 220 ARG B CB    1 
ATOM   1799 C CG    . ARG C 1 78  ? 35.710 -3.906  55.958 1.00 22.99 ? 220 ARG B CG    1 
ATOM   1800 C CD    . ARG C 1 78  ? 37.216 -3.754  55.862 1.00 26.52 ? 220 ARG B CD    1 
ATOM   1801 N NE    . ARG C 1 78  ? 37.790 -3.756  57.192 1.00 33.72 ? 220 ARG B NE    1 
ATOM   1802 C CZ    . ARG C 1 78  ? 37.798 -2.703  58.012 1.00 34.36 ? 220 ARG B CZ    1 
ATOM   1803 N NH1   . ARG C 1 78  ? 37.273 -1.543  57.648 1.00 39.80 ? 220 ARG B NH1   1 
ATOM   1804 N NH2   . ARG C 1 78  ? 38.403 -2.812  59.181 1.00 37.14 ? 220 ARG B NH2   1 
ATOM   1805 H H     . ARG C 1 78  ? 34.244 -5.366  52.648 1.00 0.00  ? 220 ARG B H     1 
ATOM   1806 H HE    . ARG C 1 78  ? 38.200 -4.586  57.511 1.00 0.00  ? 220 ARG B HE    1 
ATOM   1807 H HH11  . ARG C 1 78  ? 36.860 -1.443  56.743 1.00 0.00  ? 220 ARG B HH11  1 
ATOM   1808 H HH12  . ARG C 1 78  ? 37.290 -0.767  58.278 1.00 0.00  ? 220 ARG B HH12  1 
ATOM   1809 H HH21  . ARG C 1 78  ? 38.844 -3.672  59.437 1.00 0.00  ? 220 ARG B HH21  1 
ATOM   1810 H HH22  . ARG C 1 78  ? 38.420 -2.034  59.810 1.00 0.00  ? 220 ARG B HH22  1 
ATOM   1811 N N     . THR C 1 79  ? 32.945 -2.339  53.172 1.00 17.11 ? 221 THR B N     1 
ATOM   1812 C CA    . THR C 1 79  ? 32.424 -0.999  53.101 1.00 19.10 ? 221 THR B CA    1 
ATOM   1813 C C     . THR C 1 79  ? 31.867 -0.830  51.720 1.00 18.73 ? 221 THR B C     1 
ATOM   1814 O O     . THR C 1 79  ? 32.499 -1.333  50.802 1.00 18.39 ? 221 THR B O     1 
ATOM   1815 C CB    . THR C 1 79  ? 33.569 0.036   53.274 1.00 20.79 ? 221 THR B CB    1 
ATOM   1816 O OG1   . THR C 1 79  ? 34.349 -0.241  54.409 1.00 25.20 ? 221 THR B OG1   1 
ATOM   1817 C CG2   . THR C 1 79  ? 33.052 1.355   53.625 1.00 24.23 ? 221 THR B CG2   1 
ATOM   1818 H H     . THR C 1 79  ? 33.267 -2.771  52.353 1.00 0.00  ? 221 THR B H     1 
ATOM   1819 H HG1   . THR C 1 79  ? 34.740 -1.114  54.324 1.00 0.00  ? 221 THR B HG1   1 
ATOM   1820 N N     . GLN C 1 80  ? 30.736 -0.193  51.516 1.00 20.45 ? 222 GLN B N     1 
ATOM   1821 C CA    . GLN C 1 80  ? 30.298 0.192   50.184 1.00 23.88 ? 222 GLN B CA    1 
ATOM   1822 C C     . GLN C 1 80  ? 30.018 1.696   50.224 1.00 20.90 ? 222 GLN B C     1 
ATOM   1823 O O     . GLN C 1 80  ? 29.827 2.255   51.295 1.00 17.43 ? 222 GLN B O     1 
ATOM   1824 C CB    . GLN C 1 80  ? 29.074 -0.575  49.791 1.00 31.36 ? 222 GLN B CB    1 
ATOM   1825 C CG    . GLN C 1 80  ? 27.926 -0.568  50.808 1.00 44.74 ? 222 GLN B CG    1 
ATOM   1826 C CD    . GLN C 1 80  ? 27.016 -1.755  50.521 1.00 54.93 ? 222 GLN B CD    1 
ATOM   1827 O OE1   . GLN C 1 80  ? 27.476 -2.778  49.972 1.00 63.03 ? 222 GLN B OE1   1 
ATOM   1828 N NE2   . GLN C 1 80  ? 25.724 -1.748  50.883 1.00 61.06 ? 222 GLN B NE2   1 
ATOM   1829 H H     . GLN C 1 80  ? 30.171 0.029   52.285 1.00 0.00  ? 222 GLN B H     1 
ATOM   1830 H HE21  . GLN C 1 80  ? 25.191 -2.541  50.671 1.00 0.00  ? 222 GLN B HE21  1 
ATOM   1831 H HE22  . GLN C 1 80  ? 25.348 -0.968  51.342 1.00 0.00  ? 222 GLN B HE22  1 
ATOM   1832 N N     . PHE C 1 81  ? 29.991 2.372   49.087 1.00 17.24 ? 223 PHE B N     1 
ATOM   1833 C CA    . PHE C 1 81  ? 29.913 3.812   49.046 1.00 16.68 ? 223 PHE B CA    1 
ATOM   1834 C C     . PHE C 1 81  ? 28.803 4.305   48.173 1.00 17.18 ? 223 PHE B C     1 
ATOM   1835 O O     . PHE C 1 81  ? 28.581 3.757   47.087 1.00 19.26 ? 223 PHE B O     1 
ATOM   1836 C CB    . PHE C 1 81  ? 31.188 4.370   48.503 1.00 12.09 ? 223 PHE B CB    1 
ATOM   1837 C CG    . PHE C 1 81  ? 32.309 3.952   49.427 1.00 13.88 ? 223 PHE B CG    1 
ATOM   1838 C CD1   . PHE C 1 81  ? 32.634 4.742   50.533 1.00 13.11 ? 223 PHE B CD1   1 
ATOM   1839 C CD2   . PHE C 1 81  ? 32.967 2.747   49.193 1.00 11.87 ? 223 PHE B CD2   1 
ATOM   1840 C CE1   . PHE C 1 81  ? 33.632 4.296   51.400 1.00 15.71 ? 223 PHE B CE1   1 
ATOM   1841 C CE2   . PHE C 1 81  ? 33.966 2.308   50.063 1.00 12.44 ? 223 PHE B CE2   1 
ATOM   1842 C CZ    . PHE C 1 81  ? 34.304 3.077   51.166 1.00 14.32 ? 223 PHE B CZ    1 
ATOM   1843 H H     . PHE C 1 81  ? 30.025 1.877   48.242 1.00 0.00  ? 223 PHE B H     1 
ATOM   1844 N N     . ASN C 1 82  ? 28.143 5.369   48.608 1.00 18.18 ? 224 ASN B N     1 
ATOM   1845 C CA    . ASN C 1 82  ? 27.090 5.907   47.787 1.00 17.65 ? 224 ASN B CA    1 
ATOM   1846 C C     . ASN C 1 82  ? 27.623 6.554   46.561 1.00 16.63 ? 224 ASN B C     1 
ATOM   1847 O O     . ASN C 1 82  ? 26.848 6.733   45.639 1.00 18.55 ? 224 ASN B O     1 
ATOM   1848 C CB    . ASN C 1 82  ? 26.260 6.888   48.548 1.00 18.71 ? 224 ASN B CB    1 
ATOM   1849 C CG    . ASN C 1 82  ? 25.243 6.132   49.363 1.00 20.84 ? 224 ASN B CG    1 
ATOM   1850 O OD1   . ASN C 1 82  ? 24.558 5.252   48.842 1.00 21.89 ? 224 ASN B OD1   1 
ATOM   1851 N ND2   . ASN C 1 82  ? 25.143 6.410   50.638 1.00 18.50 ? 224 ASN B ND2   1 
ATOM   1852 H H     . ASN C 1 82  ? 28.367 5.780   49.469 1.00 0.00  ? 224 ASN B H     1 
ATOM   1853 H HD21  . ASN C 1 82  ? 24.479 5.913   51.158 1.00 0.00  ? 224 ASN B HD21  1 
ATOM   1854 H HD22  . ASN C 1 82  ? 25.721 7.094   51.037 1.00 0.00  ? 224 ASN B HD22  1 
ATOM   1855 N N     . SER C 1 83  ? 28.889 6.909   46.451 1.00 15.87 ? 225 SER B N     1 
ATOM   1856 C CA    . SER C 1 83  ? 29.360 7.427   45.189 1.00 17.81 ? 225 SER B CA    1 
ATOM   1857 C C     . SER C 1 83  ? 30.825 7.064   45.019 1.00 18.39 ? 225 SER B C     1 
ATOM   1858 O O     . SER C 1 83  ? 31.464 6.687   46.004 1.00 18.35 ? 225 SER B O     1 
ATOM   1859 C CB    . SER C 1 83  ? 29.139 8.930   45.189 1.00 17.91 ? 225 SER B CB    1 
ATOM   1860 O OG    . SER C 1 83  ? 29.796 9.645   46.223 1.00 18.38 ? 225 SER B OG    1 
ATOM   1861 H H     . SER C 1 83  ? 29.499 6.822   47.213 1.00 0.00  ? 225 SER B H     1 
ATOM   1862 H HG    . SER C 1 83  ? 29.598 10.581  46.141 1.00 0.00  ? 225 SER B HG    1 
ATOM   1863 N N     . LEU C 1 84  ? 31.381 7.183   43.796 1.00 20.18 ? 226 LEU B N     1 
ATOM   1864 C CA    . LEU C 1 84  ? 32.790 6.902   43.533 1.00 21.23 ? 226 LEU B CA    1 
ATOM   1865 C C     . LEU C 1 84  ? 33.700 7.873   44.253 1.00 21.07 ? 226 LEU B C     1 
ATOM   1866 O O     . LEU C 1 84  ? 34.761 7.486   44.765 1.00 24.38 ? 226 LEU B O     1 
ATOM   1867 C CB    . LEU C 1 84  ? 33.163 7.009   42.063 1.00 21.68 ? 226 LEU B CB    1 
ATOM   1868 C CG    . LEU C 1 84  ? 33.039 5.846   41.137 1.00 23.93 ? 226 LEU B CG    1 
ATOM   1869 C CD1   . LEU C 1 84  ? 33.707 6.270   39.852 1.00 21.07 ? 226 LEU B CD1   1 
ATOM   1870 C CD2   . LEU C 1 84  ? 33.787 4.598   41.645 1.00 24.80 ? 226 LEU B CD2   1 
ATOM   1871 H H     . LEU C 1 84  ? 30.814 7.471   43.051 1.00 0.00  ? 226 LEU B H     1 
ATOM   1872 N N     . GLN C 1 85  ? 33.296 9.148   44.308 1.00 20.01 ? 227 GLN B N     1 
ATOM   1873 C CA    . GLN C 1 85  ? 34.081 10.122  45.021 1.00 18.49 ? 227 GLN B CA    1 
ATOM   1874 C C     . GLN C 1 85  ? 34.163 9.794   46.504 1.00 14.73 ? 227 GLN B C     1 
ATOM   1875 O O     . GLN C 1 85  ? 35.173 10.090  47.144 1.00 15.03 ? 227 GLN B O     1 
ATOM   1876 C CB    . GLN C 1 85  ? 33.470 11.488  44.785 1.00 22.77 ? 227 GLN B CB    1 
ATOM   1877 C CG    . GLN C 1 85  ? 34.295 12.599  45.443 1.00 28.33 ? 227 GLN B CG    1 
ATOM   1878 C CD    . GLN C 1 85  ? 33.892 12.943  46.885 1.00 33.94 ? 227 GLN B CD    1 
ATOM   1879 O OE1   . GLN C 1 85  ? 34.650 13.502  47.709 1.00 37.74 ? 227 GLN B OE1   1 
ATOM   1880 N NE2   . GLN C 1 85  ? 32.594 12.747  47.171 1.00 31.71 ? 227 GLN B NE2   1 
ATOM   1881 H H     . GLN C 1 85  ? 32.466 9.419   43.863 1.00 0.00  ? 227 GLN B H     1 
ATOM   1882 H HE21  . GLN C 1 85  ? 32.295 12.954  48.080 1.00 0.00  ? 227 GLN B HE21  1 
ATOM   1883 H HE22  . GLN C 1 85  ? 31.986 12.409  46.481 1.00 0.00  ? 227 GLN B HE22  1 
ATOM   1884 N N     . GLN C 1 86  ? 33.129 9.203   47.108 1.00 15.29 ? 228 GLN B N     1 
ATOM   1885 C CA    . GLN C 1 86  ? 33.218 8.825   48.507 1.00 15.73 ? 228 GLN B CA    1 
ATOM   1886 C C     . GLN C 1 86  ? 34.195 7.668   48.671 1.00 17.07 ? 228 GLN B C     1 
ATOM   1887 O O     . GLN C 1 86  ? 34.929 7.614   49.663 1.00 18.13 ? 228 GLN B O     1 
ATOM   1888 C CB    . GLN C 1 86  ? 31.864 8.394   49.010 1.00 18.71 ? 228 GLN B CB    1 
ATOM   1889 C CG    . GLN C 1 86  ? 30.969 9.576   49.199 1.00 16.02 ? 228 GLN B CG    1 
ATOM   1890 C CD    . GLN C 1 86  ? 29.539 9.210   49.454 1.00 14.24 ? 228 GLN B CD    1 
ATOM   1891 O OE1   . GLN C 1 86  ? 28.715 9.428   48.581 1.00 18.99 ? 228 GLN B OE1   1 
ATOM   1892 N NE2   . GLN C 1 86  ? 29.138 8.692   50.597 1.00 15.94 ? 228 GLN B NE2   1 
ATOM   1893 H H     . GLN C 1 86  ? 32.307 9.024   46.605 1.00 0.00  ? 228 GLN B H     1 
ATOM   1894 H HE21  . GLN C 1 86  ? 28.187 8.479   50.688 1.00 0.00  ? 228 GLN B HE21  1 
ATOM   1895 H HE22  . GLN C 1 86  ? 29.784 8.534   51.317 1.00 0.00  ? 228 GLN B HE22  1 
ATOM   1896 N N     . LEU C 1 87  ? 34.196 6.722   47.707 1.00 15.32 ? 229 LEU B N     1 
ATOM   1897 C CA    . LEU C 1 87  ? 35.110 5.604   47.783 1.00 16.82 ? 229 LEU B CA    1 
ATOM   1898 C C     . LEU C 1 87  ? 36.556 6.125   47.774 1.00 18.05 ? 229 LEU B C     1 
ATOM   1899 O O     . LEU C 1 87  ? 37.380 5.802   48.631 1.00 19.93 ? 229 LEU B O     1 
ATOM   1900 C CB    . LEU C 1 87  ? 34.786 4.674   46.579 1.00 13.78 ? 229 LEU B CB    1 
ATOM   1901 C CG    . LEU C 1 87  ? 35.543 3.339   46.350 1.00 14.37 ? 229 LEU B CG    1 
ATOM   1902 C CD1   . LEU C 1 87  ? 34.595 2.371   45.644 1.00 11.59 ? 229 LEU B CD1   1 
ATOM   1903 C CD2   . LEU C 1 87  ? 36.827 3.564   45.538 1.00 12.23 ? 229 LEU B CD2   1 
ATOM   1904 H H     . LEU C 1 87  ? 33.575 6.794   46.953 1.00 0.00  ? 229 LEU B H     1 
ATOM   1905 N N     . VAL C 1 88  ? 36.892 7.000   46.814 1.00 18.05 ? 230 VAL B N     1 
ATOM   1906 C CA    . VAL C 1 88  ? 38.217 7.563   46.676 1.00 18.06 ? 230 VAL B CA    1 
ATOM   1907 C C     . VAL C 1 88  ? 38.563 8.310   47.927 1.00 19.02 ? 230 VAL B C     1 
ATOM   1908 O O     . VAL C 1 88  ? 39.640 8.141   48.480 1.00 20.81 ? 230 VAL B O     1 
ATOM   1909 C CB    . VAL C 1 88  ? 38.248 8.491   45.429 1.00 18.59 ? 230 VAL B CB    1 
ATOM   1910 C CG1   . VAL C 1 88  ? 39.577 9.194   45.360 1.00 19.60 ? 230 VAL B CG1   1 
ATOM   1911 C CG2   . VAL C 1 88  ? 38.103 7.686   44.158 1.00 14.30 ? 230 VAL B CG2   1 
ATOM   1912 H H     . VAL C 1 88  ? 36.203 7.272   46.173 1.00 0.00  ? 230 VAL B H     1 
ATOM   1913 N N     . ALA C 1 89  ? 37.644 9.102   48.471 1.00 19.89 ? 231 ALA B N     1 
ATOM   1914 C CA    . ALA C 1 89  ? 37.911 9.840   49.705 1.00 17.81 ? 231 ALA B CA    1 
ATOM   1915 C C     . ALA C 1 89  ? 38.189 8.947   50.906 1.00 16.86 ? 231 ALA B C     1 
ATOM   1916 O O     . ALA C 1 89  ? 39.029 9.251   51.757 1.00 17.42 ? 231 ALA B O     1 
ATOM   1917 C CB    . ALA C 1 89  ? 36.716 10.744  50.045 1.00 19.06 ? 231 ALA B CB    1 
ATOM   1918 H H     . ALA C 1 89  ? 36.770 9.193   48.036 1.00 0.00  ? 231 ALA B H     1 
ATOM   1919 N N     . TYR C 1 90  ? 37.437 7.842   51.005 1.00 15.33 ? 232 TYR B N     1 
ATOM   1920 C CA    . TYR C 1 90  ? 37.621 6.852   52.045 1.00 13.96 ? 232 TYR B CA    1 
ATOM   1921 C C     . TYR C 1 90  ? 39.000 6.189   51.966 1.00 12.35 ? 232 TYR B C     1 
ATOM   1922 O O     . TYR C 1 90  ? 39.721 6.088   52.959 1.00 13.76 ? 232 TYR B O     1 
ATOM   1923 C CB    . TYR C 1 90  ? 36.546 5.804   51.891 1.00 15.34 ? 232 TYR B CB    1 
ATOM   1924 C CG    . TYR C 1 90  ? 36.596 4.839   53.038 1.00 15.67 ? 232 TYR B CG    1 
ATOM   1925 C CD1   . TYR C 1 90  ? 35.998 5.193   54.240 1.00 17.00 ? 232 TYR B CD1   1 
ATOM   1926 C CD2   . TYR C 1 90  ? 37.296 3.642   52.927 1.00 18.01 ? 232 TYR B CD2   1 
ATOM   1927 C CE1   . TYR C 1 90  ? 36.108 4.356   55.346 1.00 14.61 ? 232 TYR B CE1   1 
ATOM   1928 C CE2   . TYR C 1 90  ? 37.413 2.803   54.028 1.00 18.21 ? 232 TYR B CE2   1 
ATOM   1929 C CZ    . TYR C 1 90  ? 36.820 3.173   55.228 1.00 16.68 ? 232 TYR B CZ    1 
ATOM   1930 O OH    . TYR C 1 90  ? 36.969 2.370   56.337 1.00 21.50 ? 232 TYR B OH    1 
ATOM   1931 H H     . TYR C 1 90  ? 36.730 7.698   50.343 1.00 0.00  ? 232 TYR B H     1 
ATOM   1932 H HH    . TYR C 1 90  ? 36.504 2.760   57.080 1.00 0.00  ? 232 TYR B HH    1 
ATOM   1933 N N     . TYR C 1 91  ? 39.381 5.736   50.788 1.00 14.32 ? 233 TYR B N     1 
ATOM   1934 C CA    . TYR C 1 91  ? 40.624 5.008   50.650 1.00 17.13 ? 233 TYR B CA    1 
ATOM   1935 C C     . TYR C 1 91  ? 41.864 5.853   50.642 1.00 19.98 ? 233 TYR B C     1 
ATOM   1936 O O     . TYR C 1 91  ? 42.955 5.306   50.861 1.00 20.05 ? 233 TYR B O     1 
ATOM   1937 C CB    . TYR C 1 91  ? 40.582 4.118   49.404 1.00 13.15 ? 233 TYR B CB    1 
ATOM   1938 C CG    . TYR C 1 91  ? 39.716 2.893   49.677 1.00 12.82 ? 233 TYR B CG    1 
ATOM   1939 C CD1   . TYR C 1 91  ? 40.127 1.907   50.575 1.00 11.21 ? 233 TYR B CD1   1 
ATOM   1940 C CD2   . TYR C 1 91  ? 38.523 2.708   48.985 1.00 12.24 ? 233 TYR B CD2   1 
ATOM   1941 C CE1   . TYR C 1 91  ? 39.341 0.752   50.788 1.00 13.17 ? 233 TYR B CE1   1 
ATOM   1942 C CE2   . TYR C 1 91  ? 37.732 1.567   49.191 1.00 14.12 ? 233 TYR B CE2   1 
ATOM   1943 C CZ    . TYR C 1 91  ? 38.141 0.561   50.075 1.00 14.93 ? 233 TYR B CZ    1 
ATOM   1944 O OH    . TYR C 1 91  ? 37.337 -0.595  50.176 1.00 15.29 ? 233 TYR B OH    1 
ATOM   1945 H H     . TYR C 1 91  ? 38.819 5.893   50.001 1.00 0.00  ? 233 TYR B H     1 
ATOM   1946 H HH    . TYR C 1 91  ? 36.572 -0.505  49.602 1.00 0.00  ? 233 TYR B HH    1 
ATOM   1947 N N     . SER C 1 92  ? 41.679 7.180   50.479 1.00 20.59 ? 234 SER B N     1 
ATOM   1948 C CA    . SER C 1 92  ? 42.756 8.148   50.612 1.00 21.85 ? 234 SER B CA    1 
ATOM   1949 C C     . SER C 1 92  ? 43.170 8.247   52.076 1.00 21.68 ? 234 SER B C     1 
ATOM   1950 O O     . SER C 1 92  ? 44.276 8.640   52.445 1.00 24.96 ? 234 SER B O     1 
ATOM   1951 C CB    . SER C 1 92  ? 42.291 9.516   50.105 1.00 22.27 ? 234 SER B CB    1 
ATOM   1952 O OG    . SER C 1 92  ? 42.067 9.582   48.690 1.00 27.86 ? 234 SER B OG    1 
ATOM   1953 H H     . SER C 1 92  ? 40.781 7.505   50.262 1.00 0.00  ? 234 SER B H     1 
ATOM   1954 H HG    . SER C 1 92  ? 41.779 10.466  48.452 1.00 0.00  ? 234 SER B HG    1 
ATOM   1955 N N     . LYS C 1 93  ? 42.268 7.878   52.962 1.00 24.07 ? 235 LYS B N     1 
ATOM   1956 C CA    . LYS C 1 93  ? 42.566 7.874   54.368 1.00 27.03 ? 235 LYS B CA    1 
ATOM   1957 C C     . LYS C 1 93  ? 42.699 6.461   54.872 1.00 27.26 ? 235 LYS B C     1 
ATOM   1958 O O     . LYS C 1 93  ? 43.388 6.238   55.858 1.00 29.00 ? 235 LYS B O     1 
ATOM   1959 C CB    . LYS C 1 93  ? 41.473 8.530   55.219 1.00 31.60 ? 235 LYS B CB    1 
ATOM   1960 C CG    . LYS C 1 93  ? 41.080 9.964   54.867 1.00 38.42 ? 235 LYS B CG    1 
ATOM   1961 C CD    . LYS C 1 93  ? 40.770 10.724  56.148 1.00 49.47 ? 235 LYS B CD    1 
ATOM   1962 C CE    . LYS C 1 93  ? 39.756 10.017  57.095 1.00 56.99 ? 235 LYS B CE    1 
ATOM   1963 N NZ    . LYS C 1 93  ? 39.754 10.549  58.463 1.00 60.29 ? 235 LYS B NZ    1 
ATOM   1964 H H     . LYS C 1 93  ? 41.379 7.601   52.657 1.00 0.00  ? 235 LYS B H     1 
ATOM   1965 H HZ1   . LYS C 1 93  ? 40.699 10.434  58.881 1.00 0.00  ? 235 LYS B HZ1   1 
ATOM   1966 H HZ2   . LYS C 1 93  ? 39.505 11.559  58.443 1.00 0.00  ? 235 LYS B HZ2   1 
ATOM   1967 H HZ3   . LYS C 1 93  ? 39.057 10.031  59.035 1.00 0.00  ? 235 LYS B HZ3   1 
ATOM   1968 N N     . HIS C 1 94  ? 42.021 5.454   54.336 1.00 27.37 ? 236 HIS B N     1 
ATOM   1969 C CA    . HIS C 1 94  ? 42.099 4.135   54.909 1.00 25.12 ? 236 HIS B CA    1 
ATOM   1970 C C     . HIS C 1 94  ? 42.415 3.153   53.837 1.00 24.48 ? 236 HIS B C     1 
ATOM   1971 O O     . HIS C 1 94  ? 41.624 2.999   52.923 1.00 26.42 ? 236 HIS B O     1 
ATOM   1972 C CB    . HIS C 1 94  ? 40.784 3.771   55.509 1.00 25.83 ? 236 HIS B CB    1 
ATOM   1973 C CG    . HIS C 1 94  ? 40.345 4.832   56.496 1.00 30.26 ? 236 HIS B CG    1 
ATOM   1974 N ND1   . HIS C 1 94  ? 40.797 5.077   57.737 1.00 31.61 ? 236 HIS B ND1   1 
ATOM   1975 C CD2   . HIS C 1 94  ? 39.401 5.788   56.183 1.00 31.17 ? 236 HIS B CD2   1 
ATOM   1976 C CE1   . HIS C 1 94  ? 40.166 6.144   58.172 1.00 30.05 ? 236 HIS B CE1   1 
ATOM   1977 N NE2   . HIS C 1 94  ? 39.327 6.562   57.235 1.00 33.08 ? 236 HIS B NE2   1 
ATOM   1978 H H     . HIS C 1 94  ? 41.464 5.609   53.545 1.00 0.00  ? 236 HIS B H     1 
ATOM   1979 H HD1   . HIS C 1 94  ? 41.466 4.561   58.222 1.00 0.00  ? 236 HIS B HD1   1 
ATOM   1980 H HE2   . HIS C 1 94  ? 38.738 7.337   57.318 1.00 0.00  ? 236 HIS B HE2   1 
ATOM   1981 N N     . ALA C 1 95  ? 43.577 2.518   53.868 1.00 24.53 ? 237 ALA B N     1 
ATOM   1982 C CA    . ALA C 1 95  ? 43.814 1.497   52.879 1.00 23.21 ? 237 ALA B CA    1 
ATOM   1983 C C     . ALA C 1 95  ? 42.879 0.283   53.021 1.00 21.17 ? 237 ALA B C     1 
ATOM   1984 O O     . ALA C 1 95  ? 42.487 -0.235  51.988 1.00 19.82 ? 237 ALA B O     1 
ATOM   1985 C CB    . ALA C 1 95  ? 45.253 1.043   52.968 1.00 24.08 ? 237 ALA B CB    1 
ATOM   1986 H H     . ALA C 1 95  ? 44.254 2.736   54.542 1.00 0.00  ? 237 ALA B H     1 
ATOM   1987 N N     . ASP C 1 96  ? 42.493 -0.235  54.197 1.00 19.57 ? 238 ASP B N     1 
ATOM   1988 C CA    . ASP C 1 96  ? 41.591 -1.372  54.350 1.00 19.16 ? 238 ASP B CA    1 
ATOM   1989 C C     . ASP C 1 96  ? 41.726 -2.490  53.356 1.00 19.52 ? 238 ASP B C     1 
ATOM   1990 O O     . ASP C 1 96  ? 40.818 -2.815  52.604 1.00 21.58 ? 238 ASP B O     1 
ATOM   1991 C CB    . ASP C 1 96  ? 40.158 -0.914  54.306 1.00 20.55 ? 238 ASP B CB    1 
ATOM   1992 C CG    . ASP C 1 96  ? 39.681 -0.161  55.518 1.00 25.07 ? 238 ASP B CG    1 
ATOM   1993 O OD1   . ASP C 1 96  ? 40.469 0.344   56.333 1.00 26.89 ? 238 ASP B OD1   1 
ATOM   1994 O OD2   . ASP C 1 96  ? 38.463 -0.126  55.665 1.00 27.44 ? 238 ASP B OD2   1 
ATOM   1995 H H     . ASP C 1 96  ? 42.842 0.180   55.012 1.00 0.00  ? 238 ASP B H     1 
ATOM   1996 N N     . GLY C 1 97  ? 42.883 -3.070  53.231 1.00 19.16 ? 239 GLY B N     1 
ATOM   1997 C CA    . GLY C 1 97  ? 43.000 -4.143  52.264 1.00 20.33 ? 239 GLY B CA    1 
ATOM   1998 C C     . GLY C 1 97  ? 43.636 -3.721  50.963 1.00 22.89 ? 239 GLY B C     1 
ATOM   1999 O O     . GLY C 1 97  ? 44.116 -4.594  50.220 1.00 25.94 ? 239 GLY B O     1 
ATOM   2000 H H     . GLY C 1 97  ? 43.650 -2.791  53.773 1.00 0.00  ? 239 GLY B H     1 
ATOM   2001 N N     . LEU C 1 98  ? 43.623 -2.440  50.543 1.00 23.63 ? 240 LEU B N     1 
ATOM   2002 C CA    . LEU C 1 98  ? 44.321 -2.082  49.315 1.00 20.20 ? 240 LEU B CA    1 
ATOM   2003 C C     . LEU C 1 98  ? 45.796 -2.088  49.692 1.00 18.98 ? 240 LEU B C     1 
ATOM   2004 O O     . LEU C 1 98  ? 46.181 -2.042  50.859 1.00 17.85 ? 240 LEU B O     1 
ATOM   2005 C CB    . LEU C 1 98  ? 43.990 -0.690  48.785 1.00 18.41 ? 240 LEU B CB    1 
ATOM   2006 C CG    . LEU C 1 98  ? 42.573 -0.213  48.600 1.00 17.08 ? 240 LEU B CG    1 
ATOM   2007 C CD1   . LEU C 1 98  ? 42.745 1.054   47.853 1.00 13.52 ? 240 LEU B CD1   1 
ATOM   2008 C CD2   . LEU C 1 98  ? 41.654 -1.057  47.760 1.00 14.89 ? 240 LEU B CD2   1 
ATOM   2009 H H     . LEU C 1 98  ? 43.148 -1.755  51.059 1.00 0.00  ? 240 LEU B H     1 
ATOM   2010 N N     . CYS C 1 99  ? 46.645 -2.175  48.695 1.00 21.00 ? 241 CYS B N     1 
ATOM   2011 C CA    . CYS C 1 99  ? 48.083 -2.162  48.924 1.00 24.24 ? 241 CYS B CA    1 
ATOM   2012 C C     . CYS C 1 99  ? 48.682 -0.948  49.601 1.00 25.57 ? 241 CYS B C     1 
ATOM   2013 O O     . CYS C 1 99  ? 49.764 -1.019  50.182 1.00 27.94 ? 241 CYS B O     1 
ATOM   2014 C CB    . CYS C 1 99  ? 48.855 -2.326  47.617 1.00 23.05 ? 241 CYS B CB    1 
ATOM   2015 S SG    . CYS C 1 99  ? 48.452 -1.120  46.332 1.00 25.12 ? 241 CYS B SG    1 
ATOM   2016 H H     . CYS C 1 99  ? 46.305 -2.250  47.779 1.00 0.00  ? 241 CYS B H     1 
ATOM   2017 N N     . HIS C 1 100 ? 48.033 0.207   49.467 1.00 28.43 ? 242 HIS B N     1 
ATOM   2018 C CA    . HIS C 1 100 ? 48.505 1.457   49.997 1.00 26.07 ? 242 HIS B CA    1 
ATOM   2019 C C     . HIS C 1 100 ? 47.305 2.359   49.951 1.00 26.63 ? 242 HIS B C     1 
ATOM   2020 O O     . HIS C 1 100 ? 46.474 2.186   49.053 1.00 24.54 ? 242 HIS B O     1 
ATOM   2021 C CB    . HIS C 1 100 ? 49.570 1.994   49.089 1.00 24.90 ? 242 HIS B CB    1 
ATOM   2022 C CG    . HIS C 1 100 ? 50.371 3.042   49.794 1.00 29.40 ? 242 HIS B CG    1 
ATOM   2023 N ND1   . HIS C 1 100 ? 51.479 2.836   50.474 1.00 34.10 ? 242 HIS B ND1   1 
ATOM   2024 C CD2   . HIS C 1 100 ? 50.098 4.385   49.880 1.00 30.88 ? 242 HIS B CD2   1 
ATOM   2025 C CE1   . HIS C 1 100 ? 51.890 4.005   50.947 1.00 33.78 ? 242 HIS B CE1   1 
ATOM   2026 N NE2   . HIS C 1 100 ? 51.056 4.936   50.582 1.00 30.49 ? 242 HIS B NE2   1 
ATOM   2027 H H     . HIS C 1 100 ? 47.184 0.205   48.979 1.00 0.00  ? 242 HIS B H     1 
ATOM   2028 H HD1   . HIS C 1 100 ? 51.919 1.977   50.606 1.00 0.00  ? 242 HIS B HD1   1 
ATOM   2029 H HE2   . HIS C 1 100 ? 51.132 5.884   50.796 1.00 0.00  ? 242 HIS B HE2   1 
ATOM   2030 N N     . ARG C 1 101 ? 47.260 3.297   50.913 1.00 27.83 ? 243 ARG B N     1 
ATOM   2031 C CA    . ARG C 1 101 ? 46.282 4.404   50.908 1.00 28.91 ? 243 ARG B CA    1 
ATOM   2032 C C     . ARG C 1 101 ? 46.448 5.161   49.579 1.00 26.30 ? 243 ARG B C     1 
ATOM   2033 O O     . ARG C 1 101 ? 47.552 5.206   49.024 1.00 23.95 ? 243 ARG B O     1 
ATOM   2034 C CB    . ARG C 1 101 ? 46.502 5.481   51.969 1.00 32.32 ? 243 ARG B CB    1 
ATOM   2035 C CG    . ARG C 1 101 ? 46.380 5.127   53.427 1.00 43.86 ? 243 ARG B CG    1 
ATOM   2036 C CD    . ARG C 1 101 ? 46.654 6.382   54.275 1.00 51.89 ? 243 ARG B CD    1 
ATOM   2037 N NE    . ARG C 1 101 ? 47.912 7.049   53.925 1.00 60.98 ? 243 ARG B NE    1 
ATOM   2038 C CZ    . ARG C 1 101 ? 49.134 6.660   54.370 1.00 65.79 ? 243 ARG B CZ    1 
ATOM   2039 N NH1   . ARG C 1 101 ? 49.273 5.607   55.193 1.00 65.72 ? 243 ARG B NH1   1 
ATOM   2040 N NH2   . ARG C 1 101 ? 50.234 7.285   53.932 1.00 67.46 ? 243 ARG B NH2   1 
ATOM   2041 H H     . ARG C 1 101 ? 47.904 3.244   51.649 1.00 0.00  ? 243 ARG B H     1 
ATOM   2042 H HE    . ARG C 1 101 ? 47.868 7.826   53.331 1.00 0.00  ? 243 ARG B HE    1 
ATOM   2043 H HH11  . ARG C 1 101 ? 48.467 5.094   55.489 1.00 0.00  ? 243 ARG B HH11  1 
ATOM   2044 H HH12  . ARG C 1 101 ? 50.182 5.336   55.510 1.00 0.00  ? 243 ARG B HH12  1 
ATOM   2045 H HH21  . ARG C 1 101 ? 50.155 8.037   53.278 1.00 0.00  ? 243 ARG B HH21  1 
ATOM   2046 H HH22  . ARG C 1 101 ? 51.135 7.000   54.259 1.00 0.00  ? 243 ARG B HH22  1 
ATOM   2047 N N     . LEU C 1 102 ? 45.395 5.773   49.056 1.00 24.09 ? 244 LEU B N     1 
ATOM   2048 C CA    . LEU C 1 102 ? 45.498 6.500   47.805 1.00 24.44 ? 244 LEU B CA    1 
ATOM   2049 C C     . LEU C 1 102 ? 46.202 7.817   48.140 1.00 26.97 ? 244 LEU B C     1 
ATOM   2050 O O     . LEU C 1 102 ? 45.637 8.608   48.886 1.00 29.68 ? 244 LEU B O     1 
ATOM   2051 C CB    . LEU C 1 102 ? 44.063 6.684   47.266 1.00 20.14 ? 244 LEU B CB    1 
ATOM   2052 C CG    . LEU C 1 102 ? 43.282 5.399   47.026 1.00 16.28 ? 244 LEU B CG    1 
ATOM   2053 C CD1   . LEU C 1 102 ? 41.957 5.725   46.396 1.00 13.18 ? 244 LEU B CD1   1 
ATOM   2054 C CD2   . LEU C 1 102 ? 44.111 4.461   46.185 1.00 12.00 ? 244 LEU B CD2   1 
ATOM   2055 H H     . LEU C 1 102 ? 44.534 5.734   49.522 1.00 0.00  ? 244 LEU B H     1 
ATOM   2056 N N     . THR C 1 103 ? 47.451 8.070   47.742 1.00 28.48 ? 245 THR B N     1 
ATOM   2057 C CA    . THR C 1 103 ? 48.114 9.303   48.143 1.00 28.63 ? 245 THR B CA    1 
ATOM   2058 C C     . THR C 1 103 ? 48.018 10.372  47.060 1.00 26.98 ? 245 THR B C     1 
ATOM   2059 O O     . THR C 1 103 ? 47.572 11.466  47.332 1.00 26.59 ? 245 THR B O     1 
ATOM   2060 C CB    . THR C 1 103 ? 49.632 9.017   48.528 1.00 27.98 ? 245 THR B CB    1 
ATOM   2061 O OG1   . THR C 1 103 ? 50.427 8.626   47.412 1.00 31.26 ? 245 THR B OG1   1 
ATOM   2062 C CG2   . THR C 1 103 ? 49.669 7.890   49.528 1.00 25.80 ? 245 THR B CG2   1 
ATOM   2063 H H     . THR C 1 103 ? 47.924 7.423   47.178 1.00 0.00  ? 245 THR B H     1 
ATOM   2064 H HG1   . THR C 1 103 ? 50.421 9.325   46.754 1.00 0.00  ? 245 THR B HG1   1 
ATOM   2065 N N     . THR C 1 104 ? 48.341 10.127  45.816 1.00 27.20 ? 246 THR B N     1 
ATOM   2066 C CA    . THR C 1 104 ? 48.351 11.213  44.881 1.00 26.81 ? 246 THR B CA    1 
ATOM   2067 C C     . THR C 1 104 ? 47.634 10.830  43.639 1.00 25.13 ? 246 THR B C     1 
ATOM   2068 O O     . THR C 1 104 ? 47.843 9.702   43.231 1.00 25.82 ? 246 THR B O     1 
ATOM   2069 C CB    . THR C 1 104 ? 49.756 11.576  44.462 1.00 27.61 ? 246 THR B CB    1 
ATOM   2070 O OG1   . THR C 1 104 ? 50.635 11.499  45.562 1.00 34.75 ? 246 THR B OG1   1 
ATOM   2071 C CG2   . THR C 1 104 ? 49.764 13.001  43.970 1.00 29.93 ? 246 THR B CG2   1 
ATOM   2072 H H     . THR C 1 104 ? 48.572 9.219   45.529 1.00 0.00  ? 246 THR B H     1 
ATOM   2073 H HG1   . THR C 1 104 ? 50.635 10.604  45.910 1.00 0.00  ? 246 THR B HG1   1 
ATOM   2074 N N     . VAL C 1 105 ? 46.821 11.691  43.026 1.00 24.46 ? 247 VAL B N     1 
ATOM   2075 C CA    . VAL C 1 105 ? 46.237 11.394  41.729 1.00 23.63 ? 247 VAL B CA    1 
ATOM   2076 C C     . VAL C 1 105 ? 47.378 11.413  40.722 1.00 22.62 ? 247 VAL B C     1 
ATOM   2077 O O     . VAL C 1 105 ? 48.332 12.184  40.862 1.00 21.79 ? 247 VAL B O     1 
ATOM   2078 C CB    . VAL C 1 105 ? 45.197 12.431  41.260 1.00 23.07 ? 247 VAL B CB    1 
ATOM   2079 C CG1   . VAL C 1 105 ? 44.596 12.019  39.883 1.00 21.96 ? 247 VAL B CG1   1 
ATOM   2080 C CG2   . VAL C 1 105 ? 44.148 12.563  42.343 1.00 21.00 ? 247 VAL B CG2   1 
ATOM   2081 H H     . VAL C 1 105 ? 46.612 12.544  43.460 1.00 0.00  ? 247 VAL B H     1 
ATOM   2082 N N     . CYS C 1 106 ? 47.282 10.496  39.764 1.00 21.82 ? 248 CYS B N     1 
ATOM   2083 C CA    . CYS C 1 106 ? 48.199 10.384  38.649 1.00 22.08 ? 248 CYS B CA    1 
ATOM   2084 C C     . CYS C 1 106 ? 48.325 11.789  38.043 1.00 22.73 ? 248 CYS B C     1 
ATOM   2085 O O     . CYS C 1 106 ? 47.309 12.478  37.869 1.00 23.64 ? 248 CYS B O     1 
ATOM   2086 C CB    . CYS C 1 106 ? 47.608 9.425   37.645 1.00 18.51 ? 248 CYS B CB    1 
ATOM   2087 S SG    . CYS C 1 106 ? 48.823 9.206   36.354 1.00 19.62 ? 248 CYS B SG    1 
ATOM   2088 H H     . CYS C 1 106 ? 46.543 9.855   39.816 1.00 0.00  ? 248 CYS B H     1 
ATOM   2089 N N     . PRO C 1 107 ? 49.533 12.325  37.892 1.00 22.97 ? 249 PRO B N     1 
ATOM   2090 C CA    . PRO C 1 107 ? 49.747 13.656  37.322 1.00 24.27 ? 249 PRO B CA    1 
ATOM   2091 C C     . PRO C 1 107 ? 49.326 13.881  35.863 1.00 24.38 ? 249 PRO B C     1 
ATOM   2092 O O     . PRO C 1 107 ? 49.390 12.972  35.015 1.00 22.92 ? 249 PRO B O     1 
ATOM   2093 C CB    . PRO C 1 107 ? 51.224 13.893  37.593 1.00 23.66 ? 249 PRO B CB    1 
ATOM   2094 C CG    . PRO C 1 107 ? 51.824 12.495  37.508 1.00 24.13 ? 249 PRO B CG    1 
ATOM   2095 C CD    . PRO C 1 107 ? 50.797 11.691  38.300 1.00 22.35 ? 249 PRO B CD    1 
ATOM   2096 O OXT   . PRO C 1 107 ? 48.887 14.998  35.613 1.00 26.23 ? 249 PRO B OXT   1 
HETATM 2097 C C     . ACE D 2 1   ? 44.237 -8.212  37.735 1.00 30.78 ? 100 ACE D C     1 
HETATM 2098 O O     . ACE D 2 1   ? 44.733 -7.088  37.682 1.00 32.10 ? 100 ACE D O     1 
HETATM 2099 C CH3   . ACE D 2 1   ? 44.563 -9.231  36.660 1.00 28.86 ? 100 ACE D CH3   1 
HETATM 2100 N N     . PTR D 2 2   ? 43.245 -8.602  38.529 1.00 30.85 ? 101 PTR D N     1 
HETATM 2101 C CA    . PTR D 2 2   ? 42.718 -7.855  39.652 1.00 28.61 ? 101 PTR D CA    1 
HETATM 2102 C C     . PTR D 2 2   ? 43.031 -8.587  40.938 1.00 29.02 ? 101 PTR D C     1 
HETATM 2103 O O     . PTR D 2 2   ? 42.984 -9.830  41.035 1.00 27.32 ? 101 PTR D O     1 
HETATM 2104 C CB    . PTR D 2 2   ? 41.223 -7.733  39.577 1.00 27.39 ? 101 PTR D CB    1 
HETATM 2105 C CG    . PTR D 2 2   ? 40.787 -7.035  38.317 1.00 29.85 ? 101 PTR D CG    1 
HETATM 2106 C CD1   . PTR D 2 2   ? 40.155 -7.746  37.325 1.00 34.68 ? 101 PTR D CD1   1 
HETATM 2107 C CD2   . PTR D 2 2   ? 40.954 -5.682  38.171 1.00 31.82 ? 101 PTR D CD2   1 
HETATM 2108 C CE1   . PTR D 2 2   ? 39.675 -7.098  36.205 1.00 36.33 ? 101 PTR D CE1   1 
HETATM 2109 C CE2   . PTR D 2 2   ? 40.490 -5.023  37.066 1.00 33.02 ? 101 PTR D CE2   1 
HETATM 2110 C CZ    . PTR D 2 2   ? 39.838 -5.731  36.096 1.00 38.53 ? 101 PTR D CZ    1 
HETATM 2111 H H     . PTR D 2 2   ? 42.835 -9.470  38.338 1.00 0.00  ? 101 PTR D H     1 
ATOM   2112 N N     . GLU D 2 3   ? 43.261 -7.727  41.896 1.00 26.09 ? 102 GLU D N     1 
ATOM   2113 C CA    . GLU D 2 3   ? 43.532 -8.132  43.242 1.00 24.83 ? 102 GLU D CA    1 
ATOM   2114 C C     . GLU D 2 3   ? 42.222 -8.559  43.892 1.00 24.82 ? 102 GLU D C     1 
ATOM   2115 O O     . GLU D 2 3   ? 41.170 -8.120  43.408 1.00 24.81 ? 102 GLU D O     1 
ATOM   2116 C CB    . GLU D 2 3   ? 44.130 -6.969  43.991 1.00 22.91 ? 102 GLU D CB    1 
ATOM   2117 C CG    . GLU D 2 3   ? 45.375 -6.438  43.325 1.00 29.38 ? 102 GLU D CG    1 
ATOM   2118 C CD    . GLU D 2 3   ? 46.562 -7.388  43.288 1.00 32.28 ? 102 GLU D CD    1 
ATOM   2119 O OE1   . GLU D 2 3   ? 46.935 -7.921  44.335 1.00 34.96 ? 102 GLU D OE1   1 
ATOM   2120 O OE2   . GLU D 2 3   ? 47.152 -7.539  42.218 1.00 35.50 ? 102 GLU D OE2   1 
ATOM   2121 H H     . GLU D 2 3   ? 43.247 -6.770  41.685 1.00 0.00  ? 102 GLU D H     1 
HETATM 2122 N N     . DIP D 2 4   ? 42.175 -9.392  44.965 1.00 24.71 ? 103 DIP D N     1 
HETATM 2123 C C1    . DIP D 2 4   ? 43.359 -10.085 45.458 1.00 27.56 ? 103 DIP D C1    1 
HETATM 2124 C C2    . DIP D 2 4   ? 43.309 -11.370 44.662 1.00 32.90 ? 103 DIP D C2    1 
HETATM 2125 C C3    . DIP D 2 4   ? 44.640 -12.051 44.653 1.00 36.31 ? 103 DIP D C3    1 
HETATM 2126 C C4    . DIP D 2 4   ? 44.466 -12.877 43.405 1.00 42.69 ? 103 DIP D C4    1 
HETATM 2127 C C5    . DIP D 2 4   ? 45.674 -13.788 43.109 1.00 47.10 ? 103 DIP D C5    1 
HETATM 2128 C "C1'" . DIP D 2 4   ? 40.927 -9.598  45.695 1.00 20.10 ? 103 DIP D "C1'" 1 
HETATM 2129 C "C2'" . DIP D 2 4   ? 41.095 -8.938  47.043 1.00 19.05 ? 103 DIP D "C2'" 1 
HETATM 2130 C "C3'" . DIP D 2 4   ? 41.008 -7.433  47.000 1.00 20.83 ? 103 DIP D "C3'" 1 
HETATM 2131 C "C4'" . DIP D 2 4   ? 41.162 -6.971  48.419 1.00 19.54 ? 103 DIP D "C4'" 1 
HETATM 2132 C "C5'" . DIP D 2 4   ? 41.163 -5.448  48.479 1.00 17.14 ? 103 DIP D "C5'" 1 
HETATM 2133 O O     . HOH E 3 .   ? 54.532 27.453  22.893 1.00 18.26 ? 505 HOH A O     1 
HETATM 2134 H H1    . HOH E 3 .   ? 55.410 27.294  23.240 1.00 0.00  ? 505 HOH A H1    1 
HETATM 2135 H H2    . HOH E 3 .   ? 54.034 27.783  23.641 1.00 0.00  ? 505 HOH A H2    1 
HETATM 2136 O O     . HOH E 3 .   ? 56.311 21.121  28.112 1.00 31.58 ? 506 HOH A O     1 
HETATM 2137 H H1    . HOH E 3 .   ? 55.474 21.296  27.681 1.00 0.00  ? 506 HOH A H1    1 
HETATM 2138 H H2    . HOH E 3 .   ? 56.861 21.870  27.882 1.00 0.00  ? 506 HOH A H2    1 
HETATM 2139 O O     . HOH E 3 .   ? 51.752 18.815  32.949 1.00 23.91 ? 507 HOH A O     1 
HETATM 2140 H H1    . HOH E 3 .   ? 50.991 18.640  33.502 1.00 0.00  ? 507 HOH A H1    1 
HETATM 2141 H H2    . HOH E 3 .   ? 52.092 19.652  33.266 1.00 0.00  ? 507 HOH A H2    1 
HETATM 2142 O O     . HOH E 3 .   ? 44.823 12.594  9.353  1.00 14.38 ? 509 HOH A O     1 
HETATM 2143 H H1    . HOH E 3 .   ? 44.839 12.497  10.305 1.00 0.00  ? 509 HOH A H1    1 
HETATM 2144 H H2    . HOH E 3 .   ? 44.073 13.163  9.182  1.00 0.00  ? 509 HOH A H2    1 
HETATM 2145 O O     . HOH E 3 .   ? 51.943 10.979  34.447 1.00 49.44 ? 511 HOH A O     1 
HETATM 2146 H H1    . HOH E 3 .   ? 52.502 10.413  34.980 1.00 0.00  ? 511 HOH A H1    1 
HETATM 2147 H H2    . HOH E 3 .   ? 51.327 11.364  35.071 1.00 0.00  ? 511 HOH A H2    1 
HETATM 2148 O O     . HOH E 3 .   ? 48.493 4.103   13.373 1.00 22.73 ? 512 HOH A O     1 
HETATM 2149 H H1    . HOH E 3 .   ? 48.993 3.331   13.637 1.00 0.00  ? 512 HOH A H1    1 
HETATM 2150 H H2    . HOH E 3 .   ? 47.667 4.030   13.852 1.00 0.00  ? 512 HOH A H2    1 
HETATM 2151 O O     . HOH E 3 .   ? 48.720 37.044  17.006 1.00 83.05 ? 515 HOH A O     1 
HETATM 2152 H H1    . HOH E 3 .   ? 48.815 37.136  16.058 1.00 0.00  ? 515 HOH A H1    1 
HETATM 2153 H H2    . HOH E 3 .   ? 48.825 37.933  17.345 1.00 0.00  ? 515 HOH A H2    1 
HETATM 2154 O O     . HOH E 3 .   ? 52.785 14.913  27.397 1.00 27.44 ? 516 HOH A O     1 
HETATM 2155 H H1    . HOH E 3 .   ? 52.929 14.477  26.557 1.00 0.00  ? 516 HOH A H1    1 
HETATM 2156 H H2    . HOH E 3 .   ? 51.993 15.434  27.265 1.00 0.00  ? 516 HOH A H2    1 
HETATM 2157 O O     . HOH E 3 .   ? 56.244 10.718  23.341 1.00 57.91 ? 517 HOH A O     1 
HETATM 2158 H H1    . HOH E 3 .   ? 55.409 10.252  23.294 1.00 0.00  ? 517 HOH A H1    1 
HETATM 2159 H H2    . HOH E 3 .   ? 56.788 10.303  22.672 1.00 0.00  ? 517 HOH A H2    1 
HETATM 2160 O O     . HOH E 3 .   ? 48.561 5.765   27.851 1.00 31.44 ? 518 HOH A O     1 
HETATM 2161 H H1    . HOH E 3 .   ? 49.518 5.773   27.832 1.00 0.00  ? 518 HOH A H1    1 
HETATM 2162 H H2    . HOH E 3 .   ? 48.301 6.205   27.042 1.00 0.00  ? 518 HOH A H2    1 
HETATM 2163 O O     . HOH E 3 .   ? 58.179 18.938  22.740 1.00 28.34 ? 519 HOH A O     1 
HETATM 2164 H H1    . HOH E 3 .   ? 57.766 19.642  22.239 1.00 0.00  ? 519 HOH A H1    1 
HETATM 2165 H H2    . HOH E 3 .   ? 57.617 18.177  22.593 1.00 0.00  ? 519 HOH A H2    1 
HETATM 2166 O O     . HOH E 3 .   ? 57.727 7.046   14.257 1.00 67.89 ? 520 HOH A O     1 
HETATM 2167 H H1    . HOH E 3 .   ? 58.153 7.022   15.114 1.00 0.00  ? 520 HOH A H1    1 
HETATM 2168 H H2    . HOH E 3 .   ? 57.121 7.785   14.311 1.00 0.00  ? 520 HOH A H2    1 
HETATM 2169 O O     . HOH E 3 .   ? 40.476 13.843  6.660  1.00 35.28 ? 521 HOH A O     1 
HETATM 2170 H H1    . HOH E 3 .   ? 41.365 13.530  6.494  1.00 0.00  ? 521 HOH A H1    1 
HETATM 2171 H H2    . HOH E 3 .   ? 40.310 14.475  5.961  1.00 0.00  ? 521 HOH A H2    1 
HETATM 2172 O O     . HOH E 3 .   ? 45.940 19.285  36.849 1.00 35.99 ? 523 HOH A O     1 
HETATM 2173 H H1    . HOH E 3 .   ? 46.192 19.977  36.238 1.00 0.00  ? 523 HOH A H1    1 
HETATM 2174 H H2    . HOH E 3 .   ? 46.764 19.006  37.248 1.00 0.00  ? 523 HOH A H2    1 
HETATM 2175 O O     . HOH E 3 .   ? 36.937 14.947  29.703 1.00 43.33 ? 524 HOH A O     1 
HETATM 2176 H H1    . HOH E 3 .   ? 36.438 15.218  30.474 1.00 0.00  ? 524 HOH A H1    1 
HETATM 2177 H H2    . HOH E 3 .   ? 36.303 14.969  28.987 1.00 0.00  ? 524 HOH A H2    1 
HETATM 2178 O O     . HOH E 3 .   ? 55.522 19.785  12.365 1.00 35.69 ? 525 HOH A O     1 
HETATM 2179 H H1    . HOH E 3 .   ? 55.408 19.028  11.791 1.00 0.00  ? 525 HOH A H1    1 
HETATM 2180 H H2    . HOH E 3 .   ? 55.131 20.513  11.882 1.00 0.00  ? 525 HOH A H2    1 
HETATM 2181 O O     . HOH E 3 .   ? 48.831 3.954   23.303 1.00 34.52 ? 532 HOH A O     1 
HETATM 2182 H H1    . HOH E 3 .   ? 48.248 4.200   24.021 1.00 0.00  ? 532 HOH A H1    1 
HETATM 2183 H H2    . HOH E 3 .   ? 48.451 3.150   22.950 1.00 0.00  ? 532 HOH A H2    1 
HETATM 2184 O O     . HOH E 3 .   ? 52.618 5.005   12.033 1.00 37.44 ? 534 HOH A O     1 
HETATM 2185 H H1    . HOH E 3 .   ? 52.320 4.099   12.112 1.00 0.00  ? 534 HOH A H1    1 
HETATM 2186 H H2    . HOH E 3 .   ? 53.565 4.959   12.166 1.00 0.00  ? 534 HOH A H2    1 
HETATM 2187 O O     . HOH E 3 .   ? 40.619 12.633  9.117  1.00 22.83 ? 537 HOH A O     1 
HETATM 2188 H H1    . HOH E 3 .   ? 41.488 12.233  9.156  1.00 0.00  ? 537 HOH A H1    1 
HETATM 2189 H H2    . HOH E 3 .   ? 40.048 11.936  8.794  1.00 0.00  ? 537 HOH A H2    1 
HETATM 2190 O O     . HOH E 3 .   ? 58.839 20.543  24.584 1.00 27.20 ? 539 HOH A O     1 
HETATM 2191 H H1    . HOH E 3 .   ? 59.032 20.743  23.668 1.00 0.00  ? 539 HOH A H1    1 
HETATM 2192 H H2    . HOH E 3 .   ? 58.872 21.391  25.027 1.00 0.00  ? 539 HOH A H2    1 
HETATM 2193 O O     . HOH E 3 .   ? 55.426 14.081  28.156 1.00 45.55 ? 540 HOH A O     1 
HETATM 2194 H H1    . HOH E 3 .   ? 55.877 13.503  27.541 1.00 0.00  ? 540 HOH A H1    1 
HETATM 2195 H H2    . HOH E 3 .   ? 55.610 14.964  27.835 1.00 0.00  ? 540 HOH A H2    1 
HETATM 2196 O O     . HOH E 3 .   ? 32.809 21.023  13.827 1.00 49.94 ? 541 HOH A O     1 
HETATM 2197 H H1    . HOH E 3 .   ? 32.751 20.246  14.384 1.00 0.00  ? 541 HOH A H1    1 
HETATM 2198 H H2    . HOH E 3 .   ? 32.044 20.966  13.255 1.00 0.00  ? 541 HOH A H2    1 
HETATM 2199 O O     . HOH E 3 .   ? 48.197 29.690  23.539 1.00 45.84 ? 542 HOH A O     1 
HETATM 2200 H H1    . HOH E 3 .   ? 47.652 30.225  24.116 1.00 0.00  ? 542 HOH A H1    1 
HETATM 2201 H H2    . HOH E 3 .   ? 47.691 28.888  23.407 1.00 0.00  ? 542 HOH A H2    1 
HETATM 2202 O O     . HOH E 3 .   ? 54.570 8.366   16.080 1.00 34.79 ? 548 HOH A O     1 
HETATM 2203 H H1    . HOH E 3 .   ? 54.323 9.008   15.415 1.00 0.00  ? 548 HOH A H1    1 
HETATM 2204 H H2    . HOH E 3 .   ? 54.234 7.534   15.747 1.00 0.00  ? 548 HOH A H2    1 
HETATM 2205 O O     . HOH E 3 .   ? 51.719 29.915  16.451 1.00 40.56 ? 549 HOH A O     1 
HETATM 2206 H H1    . HOH E 3 .   ? 52.488 29.429  16.154 1.00 0.00  ? 549 HOH A H1    1 
HETATM 2207 H H2    . HOH E 3 .   ? 52.077 30.656  16.939 1.00 0.00  ? 549 HOH A H2    1 
HETATM 2208 O O     . HOH F 3 .   ? 39.754 10.446  24.131 1.00 21.85 ? 501 HOH C O     1 
HETATM 2209 H H1    . HOH F 3 .   ? 40.554 10.057  24.483 1.00 0.00  ? 501 HOH C H1    1 
HETATM 2210 H H2    . HOH F 3 .   ? 39.776 11.354  24.433 1.00 0.00  ? 501 HOH C H2    1 
HETATM 2211 O O     . HOH F 3 .   ? 38.376 5.506   23.674 1.00 62.19 ? 503 HOH C O     1 
HETATM 2212 H H1    . HOH F 3 .   ? 38.502 6.310   23.170 1.00 0.00  ? 503 HOH C H1    1 
HETATM 2213 H H2    . HOH F 3 .   ? 39.062 4.917   23.360 1.00 0.00  ? 503 HOH C H2    1 
HETATM 2214 O O     . HOH F 3 .   ? 43.867 8.328   18.139 1.00 20.07 ? 504 HOH C O     1 
HETATM 2215 H H1    . HOH F 3 .   ? 43.939 9.010   17.471 1.00 0.00  ? 504 HOH C H1    1 
HETATM 2216 H H2    . HOH F 3 .   ? 42.943 8.079   18.130 1.00 0.00  ? 504 HOH C H2    1 
HETATM 2217 O O     . HOH F 3 .   ? 42.785 3.687   23.879 1.00 29.07 ? 547 HOH C O     1 
HETATM 2218 H H1    . HOH F 3 .   ? 43.352 3.735   24.649 1.00 0.00  ? 547 HOH C H1    1 
HETATM 2219 H H2    . HOH F 3 .   ? 41.920 3.939   24.202 1.00 0.00  ? 547 HOH C H2    1 
HETATM 2220 O O     . HOH G 3 .   ? 31.597 10.091  42.261 1.00 34.56 ? 500 HOH B O     1 
HETATM 2221 H H1    . HOH G 3 .   ? 31.355 10.516  41.438 1.00 0.00  ? 500 HOH B H1    1 
HETATM 2222 H H2    . HOH G 3 .   ? 32.450 9.694   42.084 1.00 0.00  ? 500 HOH B H2    1 
HETATM 2223 O O     . HOH G 3 .   ? 46.061 -6.060  39.936 1.00 24.81 ? 502 HOH B O     1 
HETATM 2224 H H1    . HOH G 3 .   ? 45.637 -5.822  39.112 1.00 0.00  ? 502 HOH B H1    1 
HETATM 2225 H H2    . HOH G 3 .   ? 46.347 -5.226  40.308 1.00 0.00  ? 502 HOH B H2    1 
HETATM 2226 O O     . HOH G 3 .   ? 47.929 12.284  32.751 1.00 18.49 ? 508 HOH B O     1 
HETATM 2227 H H1    . HOH G 3 .   ? 47.004 12.150  32.543 1.00 0.00  ? 508 HOH B H1    1 
HETATM 2228 H H2    . HOH G 3 .   ? 48.387 12.122  31.926 1.00 0.00  ? 508 HOH B H2    1 
HETATM 2229 O O     . HOH G 3 .   ? 38.263 -2.768  52.161 1.00 15.54 ? 513 HOH B O     1 
HETATM 2230 H H1    . HOH G 3 .   ? 38.829 -2.042  52.425 1.00 0.00  ? 513 HOH B H1    1 
HETATM 2231 H H2    . HOH G 3 .   ? 37.391 -2.380  52.094 1.00 0.00  ? 513 HOH B H2    1 
HETATM 2232 O O     . HOH G 3 .   ? 34.821 -1.436  49.339 1.00 12.29 ? 514 HOH B O     1 
HETATM 2233 H H1    . HOH G 3 .   ? 34.745 -1.799  48.456 1.00 0.00  ? 514 HOH B H1    1 
HETATM 2234 H H2    . HOH G 3 .   ? 35.748 -1.213  49.428 1.00 0.00  ? 514 HOH B H2    1 
HETATM 2235 O O     . HOH G 3 .   ? 42.260 13.707  34.780 1.00 39.22 ? 522 HOH B O     1 
HETATM 2236 H H1    . HOH G 3 .   ? 41.587 13.033  34.686 1.00 0.00  ? 522 HOH B H1    1 
HETATM 2237 H H2    . HOH G 3 .   ? 42.452 13.725  35.718 1.00 0.00  ? 522 HOH B H2    1 
HETATM 2238 O O     . HOH G 3 .   ? 39.899 0.555   30.559 1.00 58.59 ? 526 HOH B O     1 
HETATM 2239 H H1    . HOH G 3 .   ? 40.361 -0.135  30.082 1.00 0.00  ? 526 HOH B H1    1 
HETATM 2240 H H2    . HOH G 3 .   ? 39.092 0.139   30.861 1.00 0.00  ? 526 HOH B H2    1 
HETATM 2241 O O     . HOH G 3 .   ? 29.742 -3.056  38.043 1.00 32.71 ? 527 HOH B O     1 
HETATM 2242 H H1    . HOH G 3 .   ? 30.279 -3.832  37.883 1.00 0.00  ? 527 HOH B H1    1 
HETATM 2243 H H2    . HOH G 3 .   ? 29.156 -3.313  38.755 1.00 0.00  ? 527 HOH B H2    1 
HETATM 2244 O O     . HOH G 3 .   ? 46.027 -5.485  47.892 1.00 39.42 ? 528 HOH B O     1 
HETATM 2245 H H1    . HOH G 3 .   ? 45.786 -4.640  47.513 1.00 0.00  ? 528 HOH B H1    1 
HETATM 2246 H H2    . HOH G 3 .   ? 46.629 -5.870  47.255 1.00 0.00  ? 528 HOH B H2    1 
HETATM 2247 O O     . HOH G 3 .   ? 49.026 3.175   53.270 1.00 41.91 ? 529 HOH B O     1 
HETATM 2248 H H1    . HOH G 3 .   ? 49.009 3.945   52.701 1.00 0.00  ? 529 HOH B H1    1 
HETATM 2249 H H2    . HOH G 3 .   ? 49.526 3.454   54.037 1.00 0.00  ? 529 HOH B H2    1 
HETATM 2250 O O     . HOH G 3 .   ? 41.892 16.961  34.923 1.00 30.90 ? 530 HOH B O     1 
HETATM 2251 H H1    . HOH G 3 .   ? 42.197 17.228  35.790 1.00 0.00  ? 530 HOH B H1    1 
HETATM 2252 H H2    . HOH G 3 .   ? 40.974 16.723  35.055 1.00 0.00  ? 530 HOH B H2    1 
HETATM 2253 O O     . HOH G 3 .   ? 55.164 4.984   40.408 1.00 45.55 ? 531 HOH B O     1 
HETATM 2254 H H1    . HOH G 3 .   ? 55.465 4.624   41.242 1.00 0.00  ? 531 HOH B H1    1 
HETATM 2255 H H2    . HOH G 3 .   ? 54.281 4.631   40.299 1.00 0.00  ? 531 HOH B H2    1 
HETATM 2256 O O     . HOH G 3 .   ? 36.873 -1.143  53.666 1.00 25.29 ? 533 HOH B O     1 
HETATM 2257 H H1    . HOH G 3 .   ? 36.616 -1.610  52.871 1.00 0.00  ? 533 HOH B H1    1 
HETATM 2258 H H2    . HOH G 3 .   ? 36.054 -0.785  54.009 1.00 0.00  ? 533 HOH B H2    1 
HETATM 2259 O O     . HOH G 3 .   ? 48.869 17.428  37.215 1.00 30.86 ? 535 HOH B O     1 
HETATM 2260 H H1    . HOH G 3 .   ? 49.034 17.801  36.349 1.00 0.00  ? 535 HOH B H1    1 
HETATM 2261 H H2    . HOH G 3 .   ? 48.805 16.485  37.062 1.00 0.00  ? 535 HOH B H2    1 
HETATM 2262 O O     . HOH G 3 .   ? 43.359 12.410  32.481 1.00 32.31 ? 536 HOH B O     1 
HETATM 2263 H H1    . HOH G 3 .   ? 42.688 12.994  32.834 1.00 0.00  ? 536 HOH B H1    1 
HETATM 2264 H H2    . HOH G 3 .   ? 43.881 12.156  33.242 1.00 0.00  ? 536 HOH B H2    1 
HETATM 2265 O O     . HOH G 3 .   ? 49.630 -5.018  37.085 1.00 42.51 ? 543 HOH B O     1 
HETATM 2266 H H1    . HOH G 3 .   ? 49.680 -5.482  37.921 1.00 0.00  ? 543 HOH B H1    1 
HETATM 2267 H H2    . HOH G 3 .   ? 49.592 -4.092  37.326 1.00 0.00  ? 543 HOH B H2    1 
HETATM 2268 O O     . HOH G 3 .   ? 53.035 -3.199  37.236 1.00 44.67 ? 544 HOH B O     1 
HETATM 2269 H H1    . HOH G 3 .   ? 52.406 -3.275  37.954 1.00 0.00  ? 544 HOH B H1    1 
HETATM 2270 H H2    . HOH G 3 .   ? 53.890 -3.181  37.666 1.00 0.00  ? 544 HOH B H2    1 
HETATM 2271 O O     . HOH G 3 .   ? 48.422 -6.864  38.575 1.00 49.40 ? 545 HOH B O     1 
HETATM 2272 H H1    . HOH G 3 .   ? 47.980 -6.016  38.617 1.00 0.00  ? 545 HOH B H1    1 
HETATM 2273 H H2    . HOH G 3 .   ? 49.329 -6.675  38.817 1.00 0.00  ? 545 HOH B H2    1 
HETATM 2274 O O     . HOH G 3 .   ? 23.535 4.445   46.109 1.00 42.74 ? 546 HOH B O     1 
HETATM 2275 H H1    . HOH G 3 .   ? 22.811 4.061   46.604 1.00 0.00  ? 546 HOH B H1    1 
HETATM 2276 H H2    . HOH G 3 .   ? 24.105 4.829   46.776 1.00 0.00  ? 546 HOH B H2    1 
HETATM 2277 O O     . HOH G 3 .   ? 24.088 1.013   47.056 1.00 43.14 ? 550 HOH B O     1 
HETATM 2278 H H1    . HOH G 3 .   ? 24.688 1.647   47.448 1.00 0.00  ? 550 HOH B H1    1 
HETATM 2279 H H2    . HOH G 3 .   ? 23.244 1.464   47.034 1.00 0.00  ? 550 HOH B H2    1 
HETATM 2280 O O     . HOH H 3 .   ? 39.410 -6.420  42.205 1.00 15.82 ? 510 HOH D O     1 
HETATM 2281 H H1    . HOH H 3 .   ? 38.856 -5.692  42.485 1.00 0.00  ? 510 HOH D H1    1 
HETATM 2282 H H2    . HOH H 3 .   ? 39.854 -6.704  43.004 1.00 0.00  ? 510 HOH D H2    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   143 ?   ?   ?   A . n 
A 1 2   ASP 2   144 ?   ?   ?   A . n 
A 1 3   SER 3   145 145 SER SER A . n 
A 1 4   ILE 4   146 146 ILE ILE A . n 
A 1 5   GLN 5   147 147 GLN GLN A . n 
A 1 6   ALA 6   148 148 ALA ALA A . n 
A 1 7   GLU 7   149 149 GLU GLU A . n 
A 1 8   GLU 8   150 150 GLU GLU A . n 
A 1 9   TRP 9   151 151 TRP TRP A . n 
A 1 10  TYR 10  152 152 TYR TYR A . n 
A 1 11  PHE 11  153 153 PHE PHE A . n 
A 1 12  GLY 12  154 154 GLY GLY A . n 
A 1 13  LYS 13  155 155 LYS LYS A . n 
A 1 14  ILE 14  156 156 ILE ILE A . n 
A 1 15  THR 15  157 157 THR THR A . n 
A 1 16  ARG 16  158 158 ARG ARG A . n 
A 1 17  ARG 17  159 159 ARG ARG A . n 
A 1 18  GLU 18  160 160 GLU GLU A . n 
A 1 19  SER 19  161 161 SER SER A . n 
A 1 20  GLU 20  162 162 GLU GLU A . n 
A 1 21  ARG 21  163 163 ARG ARG A . n 
A 1 22  LEU 22  164 164 LEU LEU A . n 
A 1 23  LEU 23  165 165 LEU LEU A . n 
A 1 24  LEU 24  166 166 LEU LEU A . n 
A 1 25  ASN 25  167 167 ASN ASN A . n 
A 1 26  ALA 26  168 168 ALA ALA A . n 
A 1 27  GLU 27  169 169 GLU GLU A . n 
A 1 28  ASN 28  170 170 ASN ASN A . n 
A 1 29  PRO 29  171 171 PRO PRO A . n 
A 1 30  ARG 30  172 172 ARG ARG A . n 
A 1 31  GLY 31  173 173 GLY GLY A . n 
A 1 32  THR 32  174 174 THR THR A . n 
A 1 33  PHE 33  175 175 PHE PHE A . n 
A 1 34  LEU 34  176 176 LEU LEU A . n 
A 1 35  VAL 35  177 177 VAL VAL A . n 
A 1 36  ARG 36  178 178 ARG ARG A . n 
A 1 37  GLU 37  179 179 GLU GLU A . n 
A 1 38  SER 38  180 180 SER SER A . n 
A 1 39  GLU 39  181 181 GLU GLU A . n 
A 1 40  THR 40  182 182 THR THR A . n 
A 1 41  THR 41  183 183 THR THR A . n 
A 1 42  LYS 42  184 184 LYS LYS A . n 
A 1 43  GLY 43  185 185 GLY GLY A . n 
A 1 44  ALA 44  186 186 ALA ALA A . n 
A 1 45  TYR 45  187 187 TYR TYR A . n 
A 1 46  CYS 46  188 188 CYS CYS A . n 
A 1 47  LEU 47  189 189 LEU LEU A . n 
A 1 48  SER 48  190 190 SER SER A . n 
A 1 49  VAL 49  191 191 VAL VAL A . n 
A 1 50  SER 50  192 192 SER SER A . n 
A 1 51  ASP 51  193 193 ASP ASP A . n 
A 1 52  PHE 52  194 194 PHE PHE A . n 
A 1 53  ASP 53  195 195 ASP ASP A . n 
A 1 54  ASN 54  196 196 ASN ASN A . n 
A 1 55  ALA 55  197 197 ALA ALA A . n 
A 1 56  LYS 56  198 198 LYS LYS A . n 
A 1 57  GLY 57  199 199 GLY GLY A . n 
A 1 58  LEU 58  200 200 LEU LEU A . n 
A 1 59  ASN 59  201 201 ASN ASN A . n 
A 1 60  VAL 60  202 202 VAL VAL A . n 
A 1 61  LYS 61  203 203 LYS LYS A . n 
A 1 62  HIS 62  204 204 HIS HIS A . n 
A 1 63  TYR 63  205 205 TYR TYR A . n 
A 1 64  LYS 64  206 206 LYS LYS A . n 
A 1 65  ILE 65  207 207 ILE ILE A . n 
A 1 66  ARG 66  208 208 ARG ARG A . n 
A 1 67  LYS 67  209 209 LYS LYS A . n 
A 1 68  LEU 68  210 210 LEU LEU A . n 
A 1 69  ASP 69  211 211 ASP ASP A . n 
A 1 70  SER 70  212 212 SER SER A . n 
A 1 71  GLY 71  213 213 GLY GLY A . n 
A 1 72  GLY 72  214 214 GLY GLY A . n 
A 1 73  PHE 73  215 215 PHE PHE A . n 
A 1 74  TYR 74  216 216 TYR TYR A . n 
A 1 75  ILE 75  217 217 ILE ILE A . n 
A 1 76  THR 76  218 218 THR THR A . n 
A 1 77  SER 77  219 219 SER SER A . n 
A 1 78  ARG 78  220 220 ARG ARG A . n 
A 1 79  THR 79  221 221 THR THR A . n 
A 1 80  GLN 80  222 222 GLN GLN A . n 
A 1 81  PHE 81  223 223 PHE PHE A . n 
A 1 82  ASN 82  224 224 ASN ASN A . n 
A 1 83  SER 83  225 225 SER SER A . n 
A 1 84  LEU 84  226 226 LEU LEU A . n 
A 1 85  GLN 85  227 227 GLN GLN A . n 
A 1 86  GLN 86  228 228 GLN GLN A . n 
A 1 87  LEU 87  229 229 LEU LEU A . n 
A 1 88  VAL 88  230 230 VAL VAL A . n 
A 1 89  ALA 89  231 231 ALA ALA A . n 
A 1 90  TYR 90  232 232 TYR TYR A . n 
A 1 91  TYR 91  233 233 TYR TYR A . n 
A 1 92  SER 92  234 234 SER SER A . n 
A 1 93  LYS 93  235 235 LYS LYS A . n 
A 1 94  HIS 94  236 236 HIS HIS A . n 
A 1 95  ALA 95  237 237 ALA ALA A . n 
A 1 96  ASP 96  238 238 ASP ASP A . n 
A 1 97  GLY 97  239 239 GLY GLY A . n 
A 1 98  LEU 98  240 240 LEU LEU A . n 
A 1 99  CYS 99  241 241 CYS CYS A . n 
A 1 100 HIS 100 242 242 HIS HIS A . n 
A 1 101 ARG 101 243 243 ARG ARG A . n 
A 1 102 LEU 102 244 244 LEU LEU A . n 
A 1 103 THR 103 245 245 THR THR A . n 
A 1 104 THR 104 246 246 THR THR A . n 
A 1 105 VAL 105 247 247 VAL VAL A . n 
A 1 106 CYS 106 248 248 CYS CYS A . n 
A 1 107 PRO 107 249 249 PRO PRO A . n 
B 2 1   ACE 1   100 100 ACE ACE C . n 
B 2 2   PTR 2   101 101 PTR PTR C . n 
B 2 3   GLU 3   102 102 GLU GLU C . n 
B 2 4   DIP 4   103 103 DIP DIP C . n 
C 1 1   MET 1   143 ?   ?   ?   B . n 
C 1 2   ASP 2   144 ?   ?   ?   B . n 
C 1 3   SER 3   145 ?   ?   ?   B . n 
C 1 4   ILE 4   146 146 ILE ILE B . n 
C 1 5   GLN 5   147 147 GLN GLN B . n 
C 1 6   ALA 6   148 148 ALA ALA B . n 
C 1 7   GLU 7   149 149 GLU GLU B . n 
C 1 8   GLU 8   150 150 GLU GLU B . n 
C 1 9   TRP 9   151 151 TRP TRP B . n 
C 1 10  TYR 10  152 152 TYR TYR B . n 
C 1 11  PHE 11  153 153 PHE PHE B . n 
C 1 12  GLY 12  154 154 GLY GLY B . n 
C 1 13  LYS 13  155 155 LYS LYS B . n 
C 1 14  ILE 14  156 156 ILE ILE B . n 
C 1 15  THR 15  157 157 THR THR B . n 
C 1 16  ARG 16  158 158 ARG ARG B . n 
C 1 17  ARG 17  159 159 ARG ARG B . n 
C 1 18  GLU 18  160 160 GLU GLU B . n 
C 1 19  SER 19  161 161 SER SER B . n 
C 1 20  GLU 20  162 162 GLU GLU B . n 
C 1 21  ARG 21  163 163 ARG ARG B . n 
C 1 22  LEU 22  164 164 LEU LEU B . n 
C 1 23  LEU 23  165 165 LEU LEU B . n 
C 1 24  LEU 24  166 166 LEU LEU B . n 
C 1 25  ASN 25  167 167 ASN ASN B . n 
C 1 26  ALA 26  168 168 ALA ALA B . n 
C 1 27  GLU 27  169 169 GLU GLU B . n 
C 1 28  ASN 28  170 170 ASN ASN B . n 
C 1 29  PRO 29  171 171 PRO PRO B . n 
C 1 30  ARG 30  172 172 ARG ARG B . n 
C 1 31  GLY 31  173 173 GLY GLY B . n 
C 1 32  THR 32  174 174 THR THR B . n 
C 1 33  PHE 33  175 175 PHE PHE B . n 
C 1 34  LEU 34  176 176 LEU LEU B . n 
C 1 35  VAL 35  177 177 VAL VAL B . n 
C 1 36  ARG 36  178 178 ARG ARG B . n 
C 1 37  GLU 37  179 179 GLU GLU B . n 
C 1 38  SER 38  180 180 SER SER B . n 
C 1 39  GLU 39  181 181 GLU GLU B . n 
C 1 40  THR 40  182 182 THR THR B . n 
C 1 41  THR 41  183 183 THR THR B . n 
C 1 42  LYS 42  184 184 LYS LYS B . n 
C 1 43  GLY 43  185 185 GLY GLY B . n 
C 1 44  ALA 44  186 186 ALA ALA B . n 
C 1 45  TYR 45  187 187 TYR TYR B . n 
C 1 46  CYS 46  188 188 CYS CYS B . n 
C 1 47  LEU 47  189 189 LEU LEU B . n 
C 1 48  SER 48  190 190 SER SER B . n 
C 1 49  VAL 49  191 191 VAL VAL B . n 
C 1 50  SER 50  192 192 SER SER B . n 
C 1 51  ASP 51  193 193 ASP ASP B . n 
C 1 52  PHE 52  194 194 PHE PHE B . n 
C 1 53  ASP 53  195 195 ASP ASP B . n 
C 1 54  ASN 54  196 196 ASN ASN B . n 
C 1 55  ALA 55  197 197 ALA ALA B . n 
C 1 56  LYS 56  198 198 LYS LYS B . n 
C 1 57  GLY 57  199 199 GLY GLY B . n 
C 1 58  LEU 58  200 200 LEU LEU B . n 
C 1 59  ASN 59  201 201 ASN ASN B . n 
C 1 60  VAL 60  202 202 VAL VAL B . n 
C 1 61  LYS 61  203 203 LYS LYS B . n 
C 1 62  HIS 62  204 204 HIS HIS B . n 
C 1 63  TYR 63  205 205 TYR TYR B . n 
C 1 64  LYS 64  206 206 LYS LYS B . n 
C 1 65  ILE 65  207 207 ILE ILE B . n 
C 1 66  ARG 66  208 208 ARG ARG B . n 
C 1 67  LYS 67  209 209 LYS LYS B . n 
C 1 68  LEU 68  210 210 LEU LEU B . n 
C 1 69  ASP 69  211 211 ASP ASP B . n 
C 1 70  SER 70  212 212 SER SER B . n 
C 1 71  GLY 71  213 213 GLY GLY B . n 
C 1 72  GLY 72  214 214 GLY GLY B . n 
C 1 73  PHE 73  215 215 PHE PHE B . n 
C 1 74  TYR 74  216 216 TYR TYR B . n 
C 1 75  ILE 75  217 217 ILE ILE B . n 
C 1 76  THR 76  218 218 THR THR B . n 
C 1 77  SER 77  219 219 SER SER B . n 
C 1 78  ARG 78  220 220 ARG ARG B . n 
C 1 79  THR 79  221 221 THR THR B . n 
C 1 80  GLN 80  222 222 GLN GLN B . n 
C 1 81  PHE 81  223 223 PHE PHE B . n 
C 1 82  ASN 82  224 224 ASN ASN B . n 
C 1 83  SER 83  225 225 SER SER B . n 
C 1 84  LEU 84  226 226 LEU LEU B . n 
C 1 85  GLN 85  227 227 GLN GLN B . n 
C 1 86  GLN 86  228 228 GLN GLN B . n 
C 1 87  LEU 87  229 229 LEU LEU B . n 
C 1 88  VAL 88  230 230 VAL VAL B . n 
C 1 89  ALA 89  231 231 ALA ALA B . n 
C 1 90  TYR 90  232 232 TYR TYR B . n 
C 1 91  TYR 91  233 233 TYR TYR B . n 
C 1 92  SER 92  234 234 SER SER B . n 
C 1 93  LYS 93  235 235 LYS LYS B . n 
C 1 94  HIS 94  236 236 HIS HIS B . n 
C 1 95  ALA 95  237 237 ALA ALA B . n 
C 1 96  ASP 96  238 238 ASP ASP B . n 
C 1 97  GLY 97  239 239 GLY GLY B . n 
C 1 98  LEU 98  240 240 LEU LEU B . n 
C 1 99  CYS 99  241 241 CYS CYS B . n 
C 1 100 HIS 100 242 242 HIS HIS B . n 
C 1 101 ARG 101 243 243 ARG ARG B . n 
C 1 102 LEU 102 244 244 LEU LEU B . n 
C 1 103 THR 103 245 245 THR THR B . n 
C 1 104 THR 104 246 246 THR THR B . n 
C 1 105 VAL 105 247 247 VAL VAL B . n 
C 1 106 CYS 106 248 248 CYS CYS B . n 
C 1 107 PRO 107 249 249 PRO PRO B . n 
D 2 1   ACE 1   100 100 ACE ACE D . n 
D 2 2   PTR 2   101 101 PTR PTR D . n 
D 2 3   GLU 3   102 102 GLU GLU D . n 
D 2 4   DIP 4   103 103 DIP DIP D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  505 505 HOH HOH A . 
E 3 HOH 2  506 506 HOH HOH A . 
E 3 HOH 3  507 507 HOH HOH A . 
E 3 HOH 4  509 509 HOH HOH A . 
E 3 HOH 5  511 511 HOH HOH A . 
E 3 HOH 6  512 512 HOH HOH A . 
E 3 HOH 7  515 515 HOH HOH A . 
E 3 HOH 8  516 516 HOH HOH A . 
E 3 HOH 9  517 517 HOH HOH A . 
E 3 HOH 10 518 518 HOH HOH A . 
E 3 HOH 11 519 519 HOH HOH A . 
E 3 HOH 12 520 520 HOH HOH A . 
E 3 HOH 13 521 521 HOH HOH A . 
E 3 HOH 14 523 523 HOH HOH A . 
E 3 HOH 15 524 524 HOH HOH A . 
E 3 HOH 16 525 525 HOH HOH A . 
E 3 HOH 17 532 532 HOH HOH A . 
E 3 HOH 18 534 534 HOH HOH A . 
E 3 HOH 19 537 537 HOH HOH A . 
E 3 HOH 20 539 539 HOH HOH A . 
E 3 HOH 21 540 540 HOH HOH A . 
E 3 HOH 22 541 541 HOH HOH A . 
E 3 HOH 23 542 542 HOH HOH A . 
E 3 HOH 24 548 548 HOH HOH A . 
E 3 HOH 25 549 549 HOH HOH A . 
F 3 HOH 1  501 501 HOH HOH C . 
F 3 HOH 2  503 503 HOH HOH C . 
F 3 HOH 3  504 504 HOH HOH C . 
F 3 HOH 4  547 547 HOH HOH C . 
G 3 HOH 1  500 500 HOH HOH B . 
G 3 HOH 2  502 502 HOH HOH B . 
G 3 HOH 3  508 508 HOH HOH B . 
G 3 HOH 4  513 513 HOH HOH B . 
G 3 HOH 5  514 514 HOH HOH B . 
G 3 HOH 6  522 522 HOH HOH B . 
G 3 HOH 7  526 526 HOH HOH B . 
G 3 HOH 8  527 527 HOH HOH B . 
G 3 HOH 9  528 528 HOH HOH B . 
G 3 HOH 10 529 529 HOH HOH B . 
G 3 HOH 11 530 530 HOH HOH B . 
G 3 HOH 12 531 531 HOH HOH B . 
G 3 HOH 13 533 533 HOH HOH B . 
G 3 HOH 14 535 535 HOH HOH B . 
G 3 HOH 15 536 536 HOH HOH B . 
G 3 HOH 16 543 543 HOH HOH B . 
G 3 HOH 17 544 544 HOH HOH B . 
G 3 HOH 18 545 545 HOH HOH B . 
G 3 HOH 19 546 546 HOH HOH B . 
G 3 HOH 20 550 550 HOH HOH B . 
H 3 HOH 1  510 510 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B PTR 2 C PTR 101 ? TYR O-PHOSPHOTYROSINE 
2 D PTR 2 D PTR 101 ? TYR O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-04-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source        
2 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.source'              
2 4 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
R-AXIS 'data reduction' .   ? 3 
R-AXIS 'data scaling'   .   ? 4 
X-PLOR phasing          3.1 ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HH   B TYR 205 ? ? H1  B HOH 528 ? ? 0.86 
2  1 H    B ILE 217 ? ? H1  B HOH 514 ? ? 0.94 
3  1 H    B HIS 204 ? ? H2  B HOH 502 ? ? 1.07 
4  1 HG1  A THR 183 ? ? HZ1 A LYS 206 ? ? 1.07 
5  1 HH   B TYR 233 ? ? H2  B HOH 514 ? ? 1.10 
6  1 H    B VAL 202 ? ? H1  B HOH 544 ? ? 1.15 
7  1 H    A ILE 217 ? ? H1  A HOH 509 ? ? 1.22 
8  1 HG   A SER 190 ? ? HD1 A HIS 204 ? ? 1.22 
9  1 HH   A TYR 233 ? ? H2  A HOH 509 ? ? 1.27 
10 1 H    A LYS 209 ? ? H1  A HOH 548 ? ? 1.31 
11 1 H2   B HOH 513 ? ? H1  B HOH 533 ? ? 1.34 
12 1 HH22 B ARG 158 ? ? O   D ACE 100 ? ? 1.55 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 A HIS 204 ? ? CD2 A HIS 204 ? ? 1.301 1.373 -0.072 0.011 N 
2 1 NE2 A HIS 236 ? ? CD2 A HIS 236 ? ? 1.306 1.373 -0.067 0.011 N 
3 1 NE2 A HIS 242 ? ? CD2 A HIS 242 ? ? 1.295 1.373 -0.078 0.011 N 
4 1 CZ  B ARG 163 ? ? NH1 B ARG 163 ? ? 1.458 1.326 0.132  0.013 N 
5 1 CZ  B ARG 163 ? ? NH2 B ARG 163 ? ? 1.414 1.326 0.088  0.013 N 
6 1 NE2 B HIS 204 ? ? CD2 B HIS 204 ? ? 1.296 1.373 -0.077 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD1 A TRP 151 ? ? CG  A TRP 151 ? ? CD2 A TRP 151 ? ? 113.72 106.30 7.42   0.80 N 
2  1 CB  A TRP 151 ? ? CG  A TRP 151 ? ? CD1 A TRP 151 ? ? 118.85 127.00 -8.15  1.30 N 
3  1 CE2 A TRP 151 ? ? CD2 A TRP 151 ? ? CG  A TRP 151 ? ? 100.40 107.30 -6.90  0.80 N 
4  1 NE  A ARG 158 ? ? CZ  A ARG 158 ? ? NH2 A ARG 158 ? ? 114.80 120.30 -5.50  0.50 N 
5  1 NE  A ARG 178 ? ? CZ  A ARG 178 ? ? NH2 A ARG 178 ? ? 117.17 120.30 -3.13  0.50 N 
6  1 CB  A CYS 188 ? ? CA  A CYS 188 ? ? C   A CYS 188 ? ? 121.29 111.50 9.79   1.20 N 
7  1 N   A CYS 188 ? ? CA  A CYS 188 ? ? CB  A CYS 188 ? ? 96.07  110.60 -14.53 1.80 N 
8  1 CB  A TYR 205 ? ? CG  A TYR 205 ? ? CD2 A TYR 205 ? ? 116.68 121.00 -4.32  0.60 N 
9  1 NE  A ARG 220 ? ? CZ  A ARG 220 ? ? NH2 A ARG 220 ? ? 116.71 120.30 -3.59  0.50 N 
10 1 CD1 B TRP 151 ? ? CG  B TRP 151 ? ? CD2 B TRP 151 ? ? 112.03 106.30 5.73   0.80 N 
11 1 CB  B TRP 151 ? ? CG  B TRP 151 ? ? CD1 B TRP 151 ? ? 118.94 127.00 -8.06  1.30 N 
12 1 CE2 B TRP 151 ? ? CD2 B TRP 151 ? ? CG  B TRP 151 ? ? 101.68 107.30 -5.62  0.80 N 
13 1 CG  B TRP 151 ? ? CD2 B TRP 151 ? ? CE3 B TRP 151 ? ? 139.60 133.90 5.70   0.90 N 
14 1 NE  B ARG 159 ? ? CZ  B ARG 159 ? ? NH2 B ARG 159 ? ? 124.55 120.30 4.25   0.50 N 
15 1 CD  B ARG 163 ? ? NE  B ARG 163 ? ? CZ  B ARG 163 ? ? 109.86 123.60 -13.74 1.40 N 
16 1 CB  B TYR 205 ? ? CG  B TYR 205 ? ? CD1 B TYR 205 ? ? 116.81 121.00 -4.19  0.60 N 
17 1 NE  B ARG 208 ? ? CZ  B ARG 208 ? ? NH2 B ARG 208 ? ? 116.21 120.30 -4.09  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 238 ? ? 36.74   53.49  
2 1 THR A 245 ? ? -101.27 -61.51 
3 1 LYS B 155 ? ? -104.66 43.71  
4 1 ASP B 238 ? ? 37.78   56.80  
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             GLU 
_pdbx_validate_main_chain_plane.auth_asym_id             B 
_pdbx_validate_main_chain_plane.auth_seq_id              160 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   -10.64 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 184 ? CG  ? A LYS 42 CG  
2  1 Y 1 A LYS 184 ? CD  ? A LYS 42 CD  
3  1 Y 1 A LYS 184 ? CE  ? A LYS 42 CE  
4  1 Y 1 A LYS 184 ? NZ  ? A LYS 42 NZ  
5  1 Y 1 A ASP 195 ? CG  ? A ASP 53 CG  
6  1 Y 1 A ASP 195 ? OD1 ? A ASP 53 OD1 
7  1 Y 1 A ASP 195 ? OD2 ? A ASP 53 OD2 
8  1 Y 1 A ASN 196 ? CG  ? A ASN 54 CG  
9  1 Y 1 A ASN 196 ? OD1 ? A ASN 54 OD1 
10 1 Y 1 A ASN 196 ? ND2 ? A ASN 54 ND2 
11 1 Y 1 A ASP 211 ? CG  ? A ASP 69 CG  
12 1 Y 1 A ASP 211 ? OD1 ? A ASP 69 OD1 
13 1 Y 1 A ASP 211 ? OD2 ? A ASP 69 OD2 
14 1 Y 1 A SER 212 ? OG  ? A SER 70 OG  
15 1 Y 1 C PTR 101 ? OH  ? B PTR 2  OH  
16 1 Y 1 C PTR 101 ? P   ? B PTR 2  P   
17 1 Y 1 C PTR 101 ? O1P ? B PTR 2  O1P 
18 1 Y 1 C PTR 101 ? O2P ? B PTR 2  O2P 
19 1 Y 1 C PTR 101 ? O3P ? B PTR 2  O3P 
20 1 Y 1 B LYS 155 ? CG  ? C LYS 13 CG  
21 1 Y 1 B LYS 155 ? CD  ? C LYS 13 CD  
22 1 Y 1 B LYS 155 ? CE  ? C LYS 13 CE  
23 1 Y 1 B LYS 155 ? NZ  ? C LYS 13 NZ  
24 1 Y 1 B LYS 184 ? CG  ? C LYS 42 CG  
25 1 Y 1 B LYS 184 ? CD  ? C LYS 42 CD  
26 1 Y 1 B LYS 184 ? CE  ? C LYS 42 CE  
27 1 Y 1 B LYS 184 ? NZ  ? C LYS 42 NZ  
28 1 Y 1 B ASP 195 ? CG  ? C ASP 53 CG  
29 1 Y 1 B ASP 195 ? OD1 ? C ASP 53 OD1 
30 1 Y 1 B ASP 195 ? OD2 ? C ASP 53 OD2 
31 1 Y 1 B ASN 196 ? CG  ? C ASN 54 CG  
32 1 Y 1 B ASN 196 ? OD1 ? C ASN 54 OD1 
33 1 Y 1 B ASN 196 ? ND2 ? C ASN 54 ND2 
34 1 Y 1 B LYS 198 ? CG  ? C LYS 56 CG  
35 1 Y 1 B LYS 198 ? CD  ? C LYS 56 CD  
36 1 Y 1 B LYS 198 ? CE  ? C LYS 56 CE  
37 1 Y 1 B LYS 198 ? NZ  ? C LYS 56 NZ  
38 1 Y 1 B ASP 211 ? CG  ? C ASP 69 CG  
39 1 Y 1 B ASP 211 ? OD1 ? C ASP 69 OD1 
40 1 Y 1 B ASP 211 ? OD2 ? C ASP 69 OD2 
41 1 Y 1 D PTR 101 ? OH  ? D PTR 2  OH  
42 1 Y 1 D PTR 101 ? P   ? D PTR 2  P   
43 1 Y 1 D PTR 101 ? O1P ? D PTR 2  O1P 
44 1 Y 1 D PTR 101 ? O2P ? D PTR 2  O2P 
45 1 Y 1 D PTR 101 ? O3P ? D PTR 2  O3P 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 143 ? A MET 1 
2 1 Y 1 A ASP 144 ? A ASP 2 
3 1 Y 1 B MET 143 ? C MET 1 
4 1 Y 1 B ASP 144 ? C ASP 2 
5 1 Y 1 B SER 145 ? C SER 3 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#