data_1A1A
# 
_entry.id   1A1A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A1A         
WWPDB D_1000170268 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A1A 
_pdbx_database_status.recvd_initial_deposition_date   1997-12-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shewchuk, L.' 1 
'Jordan, S.'   2 
# 
_citation.id                        primary 
_citation.title                     'Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            36 
_citation.page_first                6283 
_citation.page_last                 6293 
_citation.year                      1997 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9174343 
_citation.pdbx_database_id_DOI      10.1021/bi970019n 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charifson, P.S.' 1  
primary 'Shewchuk, L.M.'  2  
primary 'Rocque, W.'      3  
primary 'Hummel, C.W.'    4  
primary 'Jordan, S.R.'    5  
primary 'Mohr, C.'        6  
primary 'Pacofsky, G.J.'  7  
primary 'Peel, M.R.'      8  
primary 'Rodriguez, M.'   9  
primary 'Sternbach, D.D.' 10 
primary 'Consler, T.G.'   11 
# 
_cell.entry_id           1A1A 
_cell.length_a           51.400 
_cell.length_b           65.400 
_cell.length_c           74.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1A1A 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'C-SRC TYROSINE KINASE'                          12287.820 2   2.7.1.112 C188S 'SH2 DOMAIN' ? 
2 polymer man 'ACE-FORMYL PHOSPHOTYR-GLU-(N,N-DIPENTYL AMINE)' 585.626   2   ?         ?     ?            ? 
3 water   nat water                                            18.015    194 ?         ?     ?            ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
;
;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
;
A,B ? 
2 'polypeptide(L)' no yes '(ACE)(PTH)E(DIP)' XYEX C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   SER n 
1 4   ILE n 
1 5   GLN n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   TRP n 
1 10  TYR n 
1 11  PHE n 
1 12  GLY n 
1 13  LYS n 
1 14  ILE n 
1 15  THR n 
1 16  ARG n 
1 17  ARG n 
1 18  GLU n 
1 19  SER n 
1 20  GLU n 
1 21  ARG n 
1 22  LEU n 
1 23  LEU n 
1 24  LEU n 
1 25  ASN n 
1 26  ALA n 
1 27  GLU n 
1 28  ASN n 
1 29  PRO n 
1 30  ARG n 
1 31  GLY n 
1 32  THR n 
1 33  PHE n 
1 34  LEU n 
1 35  VAL n 
1 36  ARG n 
1 37  GLU n 
1 38  SER n 
1 39  GLU n 
1 40  THR n 
1 41  THR n 
1 42  LYS n 
1 43  GLY n 
1 44  ALA n 
1 45  TYR n 
1 46  SER n 
1 47  LEU n 
1 48  SER n 
1 49  VAL n 
1 50  SER n 
1 51  ASP n 
1 52  PHE n 
1 53  ASP n 
1 54  ASN n 
1 55  ALA n 
1 56  LYS n 
1 57  GLY n 
1 58  LEU n 
1 59  ASN n 
1 60  VAL n 
1 61  LYS n 
1 62  HIS n 
1 63  TYR n 
1 64  LYS n 
1 65  ILE n 
1 66  ARG n 
1 67  LYS n 
1 68  LEU n 
1 69  ASP n 
1 70  SER n 
1 71  GLY n 
1 72  GLY n 
1 73  PHE n 
1 74  TYR n 
1 75  ILE n 
1 76  THR n 
1 77  SER n 
1 78  ARG n 
1 79  THR n 
1 80  GLN n 
1 81  PHE n 
1 82  ASN n 
1 83  SER n 
1 84  LEU n 
1 85  GLN n 
1 86  GLN n 
1 87  LEU n 
1 88  VAL n 
1 89  ALA n 
1 90  TYR n 
1 91  TYR n 
1 92  SER n 
1 93  LYS n 
1 94  HIS n 
1 95  ALA n 
1 96  ASP n 
1 97  GLY n 
1 98  LEU n 
1 99  CYS n 
1 100 HIS n 
1 101 ARG n 
1 102 LEU n 
1 103 THR n 
1 104 THR n 
1 105 VAL n 
1 106 CYS n 
1 107 PRO n 
2 1   ACE n 
2 2   PTH n 
2 3   GLU n 
2 4   DIP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SRC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 SRC 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP SRC_HUMAN 1 P12931 1 
;GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGP
LAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRES
ERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLC
HRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLR
HEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENL
VCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERG
YRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
;
? 
2 PDB 1A1A      2 1A1A   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A1A A 2 ? 107 ? P12931 143 ? 248 ? 144 249 
2 1 1A1A B 2 ? 107 ? P12931 143 ? 248 ? 144 249 
3 2 1A1A C 1 ? 4   ? 1A1A   100 ? 103 ? 100 103 
4 2 1A1A D 1 ? 4   ? 1A1A   100 ? 103 ? 100 103 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1A1A SER A 46 ? UNP P12931 CYS 187 ENGINEERED 188 1 
2 1A1A SER B 46 ? UNP P12931 CYS 187 ENGINEERED 188 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'                        ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE                               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                       ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                              ? 'C3 H7 N O2 S'   121.158 
DIP non-polymer         . DIPENTYLAMINE                         ? 'C10 H23 N'      157.296 
GLN 'L-peptide linking' y GLUTAMINE                             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                 ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                            ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                               ? 'C5 H9 N O2'     115.130 
PTH 'L-peptide linking' n CE1-METHYLENE-HYDROXY-PHOSPHOTYROSINE ? 'C10 H14 N O7 P' 291.194 
SER 'L-peptide linking' y SERINE                                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1A1A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   52. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM 1.0 M LI2SO4, 2% PEG8000 AT 4C. THE CRYSTAL WAS SOAKED IN 25% GLYCEROL PRIOR TO DATA COLLECTION., pH 8.0, temperature 277K
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1994-09 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A1A 
_reflns.observed_criterion_sigma_I   1. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   18250 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            0.0640000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.68 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.0 
_reflns_shell.d_res_low              2.25 
_reflns_shell.percent_possible_all   90. 
_reflns_shell.Rmerge_I_obs           0.1320000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.5 
_reflns_shell.pdbx_redundancy        2.99 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1A1A 
_refine.ls_number_reflns_obs                     16781 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               100000. 
_refine.pdbx_data_cutoff_low_absF                0. 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    95. 
_refine.ls_R_factor_obs                          0.1980000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1980000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'PARTIALLY REFINED' 
_refine.pdbx_starting_model                      'PDB ENTRY 1SHD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1740 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             194 
_refine_hist.number_atoms_total               1934 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.017 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.440 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.06 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   UNRESTRAINED 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.0 
_refine_ls_shell.d_res_low                        2.1 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               89. 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.PTA  TOPH19.PTA  'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.786600 
_struct_ncs_oper.matrix[1][2]   0.290600 
_struct_ncs_oper.matrix[1][3]   -0.544800 
_struct_ncs_oper.matrix[2][1]   0.268200 
_struct_ncs_oper.matrix[2][2]   0.955600 
_struct_ncs_oper.matrix[2][3]   0.122400 
_struct_ncs_oper.matrix[3][1]   0.556100 
_struct_ncs_oper.matrix[3][2]   -0.049800 
_struct_ncs_oper.matrix[3][3]   -0.829600 
_struct_ncs_oper.vector[1]      98.50270 
_struct_ncs_oper.vector[2]      -0.33460 
_struct_ncs_oper.vector[3]      29.40450 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1A1A 
_struct.title                     
'C-SRC (SH2 DOMAIN WITH C188A MUTATION) COMPLEXED WITH ACE-FORMYL PHOSPHOTYR-GLU-(N,N-DIPENTYL AMINE)' 
_struct.pdbx_descriptor           'C-SRC TYROSINE KINASE, ACE-FORMYL PHOSPHOTYR-GLU-(N,N-DIPENTYL AMINE)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A1A 
_struct_keywords.pdbx_keywords   'COMPLEX (TRANSFERASE/PEPTIDE)' 
_struct_keywords.text            'COMPLEX (TRANSFERASE-PEPTIDE), COMPLEX (TRANSFERASE-PEPTIDE) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 3  ? ALA A 6  ? SER A 145 ALA A 148 5 ? 4  
HELX_P HELX_P2 2 ARG A 16 ? LEU A 23 ? ARG A 158 LEU A 165 1 ? 8  
HELX_P HELX_P3 3 LEU A 84 ? LYS A 93 ? LEU A 226 LYS A 235 1 ? 10 
HELX_P HELX_P4 4 ARG C 16 ? LEU C 23 ? ARG B 158 LEU B 165 1 ? 8  
HELX_P HELX_P5 5 LEU C 84 ? LYS C 93 ? LEU B 226 LYS B 235 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B ACE 1 C ? ? ? 1_555 B PTH 2 N ? ? C ACE 100 C PTH 101 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2 covale ? ? B PTH 2 C ? ? ? 1_555 B GLU 3 N ? ? C PTH 101 C GLU 102 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale3 covale ? ? B DIP 4 N ? ? ? 1_555 B GLU 3 C ? ? C DIP 103 C GLU 102 1_555 ? ? ? ? ? ? ? 1.383 ? 
covale4 covale ? ? D ACE 1 C ? ? ? 1_555 D PTH 2 N ? ? D ACE 100 D PTH 101 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale5 covale ? ? D PTH 2 C ? ? ? 1_555 D GLU 3 N ? ? D PTH 101 D GLU 102 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale6 covale ? ? D DIP 4 N ? ? ? 1_555 D GLU 3 C ? ? D DIP 103 D GLU 102 1_555 ? ? ? ? ? ? ? 1.350 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 33 ? GLU A 37 ? PHE A 175 GLU A 179 
A 2 TYR A 45 ? ASP A 53 ? TYR A 187 ASP A 195 
A 3 GLY A 57 ? ILE A 65 ? GLY A 199 ILE A 207 
B 1 PHE C 33 ? GLU C 37 ? PHE B 175 GLU B 179 
B 2 TYR C 45 ? ASP C 53 ? TYR B 187 ASP B 195 
B 3 GLY C 57 ? ILE C 65 ? GLY B 199 ILE B 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 34 ? O LEU A 176 N SER A 48 ? N SER A 190 
A 2 3 O TYR A 45 ? O TYR A 187 N ILE A 65 ? N ILE A 207 
B 1 2 O LEU C 34 ? O LEU B 176 N SER C 48 ? N SER B 190 
B 2 3 O TYR C 45 ? O TYR B 187 N ILE C 65 ? N ILE B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACE C 100' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACE D 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ARG A 16 ? ARG A 158 . ? 1_555 ? 
2 AC1 4 HOH F .  ? HOH C 500 . ? 1_555 ? 
3 AC1 4 HOH G .  ? HOH B 577 . ? 1_555 ? 
4 AC1 4 HOH G .  ? HOH B 669 . ? 1_555 ? 
5 AC2 5 ARG C 16 ? ARG B 158 . ? 1_555 ? 
6 AC2 5 HOH E .  ? HOH A 525 . ? 1_555 ? 
7 AC2 5 HOH G .  ? HOH B 534 . ? 1_555 ? 
8 AC2 5 HOH H .  ? HOH D 587 . ? 1_555 ? 
9 AC2 5 HOH G .  ? HOH B 588 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1A1A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A1A 
_atom_sites.fract_transf_matrix[1][1]   0.019455 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015291 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013405 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ASP A 1 2   ? 62.879 24.715  19.025 1.00 51.77  ? 144 ASP A N     1 
ATOM   2    C CA    . ASP A 1 2   ? 62.601 24.888  17.612 1.00 52.48  ? 144 ASP A CA    1 
ATOM   3    C C     . ASP A 1 2   ? 61.239 25.552  17.408 1.00 51.24  ? 144 ASP A C     1 
ATOM   4    O O     . ASP A 1 2   ? 60.516 25.690  18.380 1.00 47.78  ? 144 ASP A O     1 
ATOM   5    C CB    . ASP A 1 2   ? 62.608 23.542  16.921 1.00 50.36  ? 144 ASP A CB    1 
ATOM   6    N N     . SER A 1 3   ? 60.861 25.935  16.178 1.00 51.60  ? 145 SER A N     1 
ATOM   7    C CA    . SER A 1 3   ? 59.622 26.655  15.914 1.00 49.78  ? 145 SER A CA    1 
ATOM   8    C C     . SER A 1 3   ? 58.383 26.086  16.585 1.00 49.34  ? 145 SER A C     1 
ATOM   9    O O     . SER A 1 3   ? 57.672 26.838  17.263 1.00 49.58  ? 145 SER A O     1 
ATOM   10   C CB    . SER A 1 3   ? 59.372 26.703  14.414 1.00 52.38  ? 145 SER A CB    1 
ATOM   11   O OG    . SER A 1 3   ? 59.410 25.395  13.800 1.00 53.02  ? 145 SER A OG    1 
ATOM   12   H H     . SER A 1 3   ? 61.446 25.720  15.422 1.00 0.00   ? 145 SER A H     1 
ATOM   13   H HG    . SER A 1 3   ? 59.247 25.479  12.858 1.00 0.00   ? 145 SER A HG    1 
ATOM   14   N N     . ILE A 1 4   ? 58.204 24.747  16.479 1.00 44.20  ? 146 ILE A N     1 
ATOM   15   C CA    . ILE A 1 4   ? 57.056 24.069  17.091 1.00 39.21  ? 146 ILE A CA    1 
ATOM   16   C C     . ILE A 1 4   ? 56.875 24.456  18.585 1.00 34.02  ? 146 ILE A C     1 
ATOM   17   O O     . ILE A 1 4   ? 55.766 24.711  19.060 1.00 31.09  ? 146 ILE A O     1 
ATOM   18   C CB    . ILE A 1 4   ? 57.246 22.524  16.912 1.00 40.52  ? 146 ILE A CB    1 
ATOM   19   C CG1   . ILE A 1 4   ? 55.978 21.830  17.326 1.00 42.24  ? 146 ILE A CG1   1 
ATOM   20   C CG2   . ILE A 1 4   ? 58.490 22.006  17.701 1.00 41.04  ? 146 ILE A CG2   1 
ATOM   21   C CD1   . ILE A 1 4   ? 56.136 20.295  17.584 1.00 47.13  ? 146 ILE A CD1   1 
ATOM   22   H H     . ILE A 1 4   ? 58.860 24.217  15.980 1.00 0.00   ? 146 ILE A H     1 
ATOM   23   N N     . GLN A 1 5   ? 57.979 24.589  19.329 1.00 30.73  ? 147 GLN A N     1 
ATOM   24   C CA    . GLN A 1 5   ? 57.913 24.959  20.745 1.00 31.95  ? 147 GLN A CA    1 
ATOM   25   C C     . GLN A 1 5   ? 57.123 26.247  21.022 1.00 29.12  ? 147 GLN A C     1 
ATOM   26   O O     . GLN A 1 5   ? 56.384 26.374  22.010 1.00 24.99  ? 147 GLN A O     1 
ATOM   27   C CB    . GLN A 1 5   ? 59.347 25.082  21.300 1.00 28.51  ? 147 GLN A CB    1 
ATOM   28   C CG    . GLN A 1 5   ? 60.186 23.804  21.176 1.00 30.88  ? 147 GLN A CG    1 
ATOM   29   C CD    . GLN A 1 5   ? 59.619 22.614  21.932 1.00 31.89  ? 147 GLN A CD    1 
ATOM   30   O OE1   . GLN A 1 5   ? 58.613 22.694  22.620 1.00 33.70  ? 147 GLN A OE1   1 
ATOM   31   N NE2   . GLN A 1 5   ? 60.221 21.453  21.839 1.00 29.99  ? 147 GLN A NE2   1 
ATOM   32   H H     . GLN A 1 5   ? 58.854 24.435  18.916 1.00 0.00   ? 147 GLN A H     1 
ATOM   33   H HE21  . GLN A 1 5   ? 59.835 20.703  22.336 1.00 0.00   ? 147 GLN A HE21  1 
ATOM   34   H HE22  . GLN A 1 5   ? 61.026 21.361  21.287 1.00 0.00   ? 147 GLN A HE22  1 
ATOM   35   N N     . ALA A 1 6   ? 57.200 27.179  20.081 1.00 30.00  ? 148 ALA A N     1 
ATOM   36   C CA    . ALA A 1 6   ? 56.533 28.440  20.269 1.00 31.80  ? 148 ALA A CA    1 
ATOM   37   C C     . ALA A 1 6   ? 55.209 28.631  19.556 1.00 31.04  ? 148 ALA A C     1 
ATOM   38   O O     . ALA A 1 6   ? 54.695 29.760  19.514 1.00 31.57  ? 148 ALA A O     1 
ATOM   39   C CB    . ALA A 1 6   ? 57.501 29.542  19.855 1.00 36.45  ? 148 ALA A CB    1 
ATOM   40   H H     . ALA A 1 6   ? 57.709 27.009  19.261 1.00 0.00   ? 148 ALA A H     1 
ATOM   41   N N     . GLU A 1 7   ? 54.646 27.604  18.917 1.00 31.26  ? 149 GLU A N     1 
ATOM   42   C CA    . GLU A 1 7   ? 53.334 27.749  18.296 1.00 30.91  ? 149 GLU A CA    1 
ATOM   43   C C     . GLU A 1 7   ? 52.286 27.944  19.353 1.00 33.49  ? 149 GLU A C     1 
ATOM   44   O O     . GLU A 1 7   ? 52.232 27.195  20.327 1.00 29.63  ? 149 GLU A O     1 
ATOM   45   C CB    . GLU A 1 7   ? 52.934 26.517  17.496 1.00 30.52  ? 149 GLU A CB    1 
ATOM   46   C CG    . GLU A 1 7   ? 53.846 26.306  16.273 1.00 39.30  ? 149 GLU A CG    1 
ATOM   47   C CD    . GLU A 1 7   ? 53.549 27.170  15.015 1.00 41.11  ? 149 GLU A CD    1 
ATOM   48   O OE1   . GLU A 1 7   ? 52.789 28.150  15.034 1.00 39.78  ? 149 GLU A OE1   1 
ATOM   49   O OE2   . GLU A 1 7   ? 54.114 26.861  13.971 1.00 47.04  ? 149 GLU A OE2   1 
ATOM   50   H H     . GLU A 1 7   ? 55.117 26.746  18.864 1.00 0.00   ? 149 GLU A H     1 
ATOM   51   N N     . GLU A 1 8   ? 51.360 28.879  19.098 1.00 33.41  ? 150 GLU A N     1 
ATOM   52   C CA    . GLU A 1 8   ? 50.313 29.194  20.080 1.00 35.06  ? 150 GLU A CA    1 
ATOM   53   C C     . GLU A 1 8   ? 49.453 27.980  20.420 1.00 33.56  ? 150 GLU A C     1 
ATOM   54   O O     . GLU A 1 8   ? 48.835 27.921  21.479 1.00 31.26  ? 150 GLU A O     1 
ATOM   55   C CB    . GLU A 1 8   ? 49.378 30.322  19.556 1.00 31.80  ? 150 GLU A CB    1 
ATOM   56   C CG    . GLU A 1 8   ? 48.694 29.970  18.233 1.00 39.55  ? 150 GLU A CG    1 
ATOM   57   C CD    . GLU A 1 8   ? 47.615 30.942  17.755 1.00 44.66  ? 150 GLU A CD    1 
ATOM   58   O OE1   . GLU A 1 8   ? 47.136 31.771  18.531 1.00 45.88  ? 150 GLU A OE1   1 
ATOM   59   O OE2   . GLU A 1 8   ? 47.241 30.853  16.591 1.00 50.31  ? 150 GLU A OE2   1 
ATOM   60   H H     . GLU A 1 8   ? 51.381 29.360  18.244 1.00 0.00   ? 150 GLU A H     1 
ATOM   61   N N     . TRP A 1 9   ? 49.335 27.028  19.454 1.00 33.58  ? 151 TRP A N     1 
ATOM   62   C CA    . TRP A 1 9   ? 48.509 25.859  19.682 1.00 29.31  ? 151 TRP A CA    1 
ATOM   63   C C     . TRP A 1 9   ? 49.292 24.674  20.206 1.00 26.00  ? 151 TRP A C     1 
ATOM   64   O O     . TRP A 1 9   ? 48.704 23.630  20.470 1.00 28.04  ? 151 TRP A O     1 
ATOM   65   C CB    . TRP A 1 9   ? 47.746 25.476  18.390 1.00 26.84  ? 151 TRP A CB    1 
ATOM   66   C CG    . TRP A 1 9   ? 48.586 25.463  17.125 1.00 30.51  ? 151 TRP A CG    1 
ATOM   67   C CD1   . TRP A 1 9   ? 48.463 26.480  16.234 1.00 30.44  ? 151 TRP A CD1   1 
ATOM   68   C CD2   . TRP A 1 9   ? 49.549 24.537  16.758 1.00 28.80  ? 151 TRP A CD2   1 
ATOM   69   N NE1   . TRP A 1 9   ? 49.366 26.242  15.308 1.00 30.50  ? 151 TRP A NE1   1 
ATOM   70   C CE2   . TRP A 1 9   ? 50.030 25.105  15.565 1.00 26.97  ? 151 TRP A CE2   1 
ATOM   71   C CE3   . TRP A 1 9   ? 50.099 23.341  17.234 1.00 23.51  ? 151 TRP A CE3   1 
ATOM   72   C CZ2   . TRP A 1 9   ? 51.063 24.519  14.845 1.00 27.10  ? 151 TRP A CZ2   1 
ATOM   73   C CZ3   . TRP A 1 9   ? 51.132 22.744  16.510 1.00 27.56  ? 151 TRP A CZ3   1 
ATOM   74   C CH2   . TRP A 1 9   ? 51.608 23.322  15.320 1.00 29.62  ? 151 TRP A CH2   1 
ATOM   75   H H     . TRP A 1 9   ? 49.809 27.133  18.603 1.00 0.00   ? 151 TRP A H     1 
ATOM   76   H HE1   . TRP A 1 9   ? 49.531 26.817  14.536 1.00 0.00   ? 151 TRP A HE1   1 
ATOM   77   N N     . TYR A 1 10  ? 50.610 24.735  20.302 1.00 24.69  ? 152 TYR A N     1 
ATOM   78   C CA    . TYR A 1 10  ? 51.367 23.600  20.823 1.00 24.91  ? 152 TYR A CA    1 
ATOM   79   C C     . TYR A 1 10  ? 51.614 23.732  22.325 1.00 27.67  ? 152 TYR A C     1 
ATOM   80   O O     . TYR A 1 10  ? 52.158 24.724  22.837 1.00 28.05  ? 152 TYR A O     1 
ATOM   81   C CB    . TYR A 1 10  ? 52.688 23.517  20.127 1.00 23.78  ? 152 TYR A CB    1 
ATOM   82   C CG    . TYR A 1 10  ? 53.464 22.252  20.416 1.00 27.61  ? 152 TYR A CG    1 
ATOM   83   C CD1   . TYR A 1 10  ? 52.923 21.023  20.010 1.00 29.46  ? 152 TYR A CD1   1 
ATOM   84   C CD2   . TYR A 1 10  ? 54.718 22.311  21.027 1.00 24.33  ? 152 TYR A CD2   1 
ATOM   85   C CE1   . TYR A 1 10  ? 53.610 19.833  20.255 1.00 24.98  ? 152 TYR A CE1   1 
ATOM   86   C CE2   . TYR A 1 10  ? 55.405 21.114  21.257 1.00 28.30  ? 152 TYR A CE2   1 
ATOM   87   C CZ    . TYR A 1 10  ? 54.831 19.893  20.877 1.00 25.91  ? 152 TYR A CZ    1 
ATOM   88   O OH    . TYR A 1 10  ? 55.462 18.703  21.051 1.00 26.52  ? 152 TYR A OH    1 
ATOM   89   H H     . TYR A 1 10  ? 51.081 25.547  20.022 1.00 0.00   ? 152 TYR A H     1 
ATOM   90   H HH    . TYR A 1 10  ? 56.319 18.851  21.457 1.00 0.00   ? 152 TYR A HH    1 
ATOM   91   N N     . PHE A 1 11  ? 51.328 22.661  23.055 1.00 27.69  ? 153 PHE A N     1 
ATOM   92   C CA    . PHE A 1 11  ? 51.443 22.694  24.504 1.00 25.59  ? 153 PHE A CA    1 
ATOM   93   C C     . PHE A 1 11  ? 52.439 21.676  25.029 1.00 25.77  ? 153 PHE A C     1 
ATOM   94   O O     . PHE A 1 11  ? 52.406 21.235  26.181 1.00 23.37  ? 153 PHE A O     1 
ATOM   95   C CB    . PHE A 1 11  ? 50.060 22.481  25.113 1.00 24.67  ? 153 PHE A CB    1 
ATOM   96   C CG    . PHE A 1 11  ? 49.239 23.775  25.187 1.00 26.44  ? 153 PHE A CG    1 
ATOM   97   C CD1   . PHE A 1 11  ? 48.727 24.369  24.013 1.00 24.58  ? 153 PHE A CD1   1 
ATOM   98   C CD2   . PHE A 1 11  ? 48.949 24.345  26.446 1.00 24.20  ? 153 PHE A CD2   1 
ATOM   99   C CE1   . PHE A 1 11  ? 47.929 25.513  24.107 1.00 20.30  ? 153 PHE A CE1   1 
ATOM   100  C CE2   . PHE A 1 11  ? 48.150 25.489  26.514 1.00 23.18  ? 153 PHE A CE2   1 
ATOM   101  C CZ    . PHE A 1 11  ? 47.623 26.056  25.357 1.00 20.82  ? 153 PHE A CZ    1 
ATOM   102  H H     . PHE A 1 11  ? 51.036 21.837  22.612 1.00 0.00   ? 153 PHE A H     1 
ATOM   103  N N     . GLY A 1 12  ? 53.396 21.336  24.159 1.00 22.12  ? 154 GLY A N     1 
ATOM   104  C CA    . GLY A 1 12  ? 54.540 20.526  24.532 1.00 22.85  ? 154 GLY A CA    1 
ATOM   105  C C     . GLY A 1 12  ? 54.200 19.194  25.168 1.00 24.88  ? 154 GLY A C     1 
ATOM   106  O O     . GLY A 1 12  ? 53.352 18.434  24.699 1.00 23.50  ? 154 GLY A O     1 
ATOM   107  H H     . GLY A 1 12  ? 53.321 21.646  23.233 1.00 0.00   ? 154 GLY A H     1 
ATOM   108  N N     . LYS A 1 13  ? 54.833 19.016  26.310 1.00 26.11  ? 155 LYS A N     1 
ATOM   109  C CA    . LYS A 1 13  ? 54.679 17.815  27.067 1.00 29.20  ? 155 LYS A CA    1 
ATOM   110  C C     . LYS A 1 13  ? 53.618 17.914  28.145 1.00 29.21  ? 155 LYS A C     1 
ATOM   111  O O     . LYS A 1 13  ? 53.730 17.248  29.184 1.00 32.38  ? 155 LYS A O     1 
ATOM   112  C CB    . LYS A 1 13  ? 55.999 17.443  27.683 1.00 28.97  ? 155 LYS A CB    1 
ATOM   113  C CG    . LYS A 1 13  ? 57.090 17.291  26.675 1.00 33.52  ? 155 LYS A CG    1 
ATOM   114  C CD    . LYS A 1 13  ? 58.381 16.873  27.331 1.00 33.09  ? 155 LYS A CD    1 
ATOM   115  C CE    . LYS A 1 13  ? 59.379 16.836  26.209 1.00 40.65  ? 155 LYS A CE    1 
ATOM   116  N NZ    . LYS A 1 13  ? 60.403 15.828  26.445 1.00 49.23  ? 155 LYS A NZ    1 
ATOM   117  H H     . LYS A 1 13  ? 55.422 19.723  26.647 1.00 0.00   ? 155 LYS A H     1 
ATOM   118  H HZ1   . LYS A 1 13  ? 59.957 14.892  26.522 1.00 0.00   ? 155 LYS A HZ1   1 
ATOM   119  H HZ2   . LYS A 1 13  ? 61.077 15.827  25.653 1.00 0.00   ? 155 LYS A HZ2   1 
ATOM   120  H HZ3   . LYS A 1 13  ? 60.907 16.046  27.328 1.00 0.00   ? 155 LYS A HZ3   1 
ATOM   121  N N     . ILE A 1 14  ? 52.547 18.705  28.023 1.00 26.83  ? 156 ILE A N     1 
ATOM   122  C CA    . ILE A 1 14  ? 51.550 18.584  29.053 1.00 27.71  ? 156 ILE A CA    1 
ATOM   123  C C     . ILE A 1 14  ? 50.830 17.233  28.949 1.00 31.46  ? 156 ILE A C     1 
ATOM   124  O O     . ILE A 1 14  ? 50.663 16.654  27.870 1.00 26.66  ? 156 ILE A O     1 
ATOM   125  C CB    . ILE A 1 14  ? 50.509 19.746  29.020 1.00 30.04  ? 156 ILE A CB    1 
ATOM   126  C CG1   . ILE A 1 14  ? 49.603 19.745  27.833 1.00 30.08  ? 156 ILE A CG1   1 
ATOM   127  C CG2   . ILE A 1 14  ? 51.327 21.047  29.134 1.00 37.33  ? 156 ILE A CG2   1 
ATOM   128  C CD1   . ILE A 1 14  ? 48.453 20.732  28.178 1.00 33.01  ? 156 ILE A CD1   1 
ATOM   129  H H     . ILE A 1 14  ? 52.447 19.330  27.276 1.00 0.00   ? 156 ILE A H     1 
ATOM   130  N N     . THR A 1 15  ? 50.402 16.719  30.101 1.00 29.33  ? 157 THR A N     1 
ATOM   131  C CA    . THR A 1 15  ? 49.761 15.415  30.197 1.00 27.37  ? 157 THR A CA    1 
ATOM   132  C C     . THR A 1 15  ? 48.375 15.418  29.601 1.00 27.00  ? 157 THR A C     1 
ATOM   133  O O     . THR A 1 15  ? 47.755 16.497  29.517 1.00 29.86  ? 157 THR A O     1 
ATOM   134  C CB    . THR A 1 15  ? 49.651 14.992  31.688 1.00 25.50  ? 157 THR A CB    1 
ATOM   135  O OG1   . THR A 1 15  ? 48.722 15.936  32.254 1.00 25.07  ? 157 THR A OG1   1 
ATOM   136  C CG2   . THR A 1 15  ? 50.995 14.922  32.410 1.00 24.18  ? 157 THR A CG2   1 
ATOM   137  H H     . THR A 1 15  ? 50.524 17.242  30.921 1.00 0.00   ? 157 THR A H     1 
ATOM   138  H HG1   . THR A 1 15  ? 49.070 16.826  32.156 1.00 0.00   ? 157 THR A HG1   1 
ATOM   139  N N     . ARG A 1 16  ? 47.763 14.262  29.281 1.00 26.90  ? 158 ARG A N     1 
ATOM   140  C CA    . ARG A 1 16  ? 46.392 14.309  28.821 1.00 25.10  ? 158 ARG A CA    1 
ATOM   141  C C     . ARG A 1 16  ? 45.441 14.880  29.844 1.00 23.04  ? 158 ARG A C     1 
ATOM   142  O O     . ARG A 1 16  ? 44.489 15.561  29.475 1.00 22.77  ? 158 ARG A O     1 
ATOM   143  C CB    . ARG A 1 16  ? 45.862 12.912  28.384 1.00 27.42  ? 158 ARG A CB    1 
ATOM   144  C CG    . ARG A 1 16  ? 45.751 11.754  29.327 1.00 35.99  ? 158 ARG A CG    1 
ATOM   145  C CD    . ARG A 1 16  ? 44.570 10.909  28.935 1.00 34.99  ? 158 ARG A CD    1 
ATOM   146  N NE    . ARG A 1 16  ? 44.662 10.570  27.544 1.00 44.05  ? 158 ARG A NE    1 
ATOM   147  C CZ    . ARG A 1 16  ? 43.651 10.136  26.802 1.00 42.72  ? 158 ARG A CZ    1 
ATOM   148  N NH1   . ARG A 1 16  ? 42.416 9.951   27.247 1.00 44.34  ? 158 ARG A NH1   1 
ATOM   149  N NH2   . ARG A 1 16  ? 43.906 9.974   25.528 1.00 47.84  ? 158 ARG A NH2   1 
ATOM   150  H H     . ARG A 1 16  ? 48.236 13.407  29.358 1.00 0.00   ? 158 ARG A H     1 
ATOM   151  H HE    . ARG A 1 16  ? 45.535 10.666  27.110 1.00 0.00   ? 158 ARG A HE    1 
ATOM   152  H HH11  . ARG A 1 16  ? 42.195 10.142  28.203 1.00 0.00   ? 158 ARG A HH11  1 
ATOM   153  H HH12  . ARG A 1 16  ? 41.705 9.621   26.626 1.00 0.00   ? 158 ARG A HH12  1 
ATOM   154  H HH21  . ARG A 1 16  ? 44.818 10.175  25.171 1.00 0.00   ? 158 ARG A HH21  1 
ATOM   155  H HH22  . ARG A 1 16  ? 43.188 9.649   24.912 1.00 0.00   ? 158 ARG A HH22  1 
ATOM   156  N N     . ARG A 1 17  ? 45.698 14.615  31.121 1.00 24.90  ? 159 ARG A N     1 
ATOM   157  C CA    . ARG A 1 17  ? 44.833 15.090  32.170 1.00 28.11  ? 159 ARG A CA    1 
ATOM   158  C C     . ARG A 1 17  ? 44.910 16.638  32.268 1.00 27.81  ? 159 ARG A C     1 
ATOM   159  O O     . ARG A 1 17  ? 43.872 17.325  32.454 1.00 28.16  ? 159 ARG A O     1 
ATOM   160  C CB    . ARG A 1 17  ? 45.263 14.432  33.477 1.00 28.56  ? 159 ARG A CB    1 
ATOM   161  C CG    . ARG A 1 17  ? 44.509 15.026  34.675 1.00 33.88  ? 159 ARG A CG    1 
ATOM   162  C CD    . ARG A 1 17  ? 45.247 14.678  35.958 1.00 35.67  ? 159 ARG A CD    1 
ATOM   163  N NE    . ARG A 1 17  ? 44.691 15.367  37.101 1.00 32.94  ? 159 ARG A NE    1 
ATOM   164  C CZ    . ARG A 1 17  ? 45.303 15.363  38.256 1.00 30.09  ? 159 ARG A CZ    1 
ATOM   165  N NH1   . ARG A 1 17  ? 46.435 14.698  38.423 1.00 25.75  ? 159 ARG A NH1   1 
ATOM   166  N NH2   . ARG A 1 17  ? 44.812 16.126  39.203 1.00 34.90  ? 159 ARG A NH2   1 
ATOM   167  H H     . ARG A 1 17  ? 46.490 14.087  31.353 1.00 0.00   ? 159 ARG A H     1 
ATOM   168  H HE    . ARG A 1 17  ? 43.841 15.845  37.008 1.00 0.00   ? 159 ARG A HE    1 
ATOM   169  H HH11  . ARG A 1 17  ? 46.833 14.189  37.660 1.00 0.00   ? 159 ARG A HH11  1 
ATOM   170  H HH12  . ARG A 1 17  ? 46.892 14.704  39.312 1.00 0.00   ? 159 ARG A HH12  1 
ATOM   171  H HH21  . ARG A 1 17  ? 43.999 16.682  39.027 1.00 0.00   ? 159 ARG A HH21  1 
ATOM   172  H HH22  . ARG A 1 17  ? 45.250 16.152  40.102 1.00 0.00   ? 159 ARG A HH22  1 
ATOM   173  N N     . GLU A 1 18  ? 46.143 17.191  32.164 1.00 31.13  ? 160 GLU A N     1 
ATOM   174  C CA    . GLU A 1 18  ? 46.349 18.648  32.171 1.00 33.14  ? 160 GLU A CA    1 
ATOM   175  C C     . GLU A 1 18  ? 45.686 19.287  30.949 1.00 32.82  ? 160 GLU A C     1 
ATOM   176  O O     . GLU A 1 18  ? 44.922 20.255  31.094 1.00 32.89  ? 160 GLU A O     1 
ATOM   177  C CB    . GLU A 1 18  ? 47.852 18.948  32.202 1.00 34.15  ? 160 GLU A CB    1 
ATOM   178  C CG    . GLU A 1 18  ? 48.278 20.432  32.283 1.00 41.48  ? 160 GLU A CG    1 
ATOM   179  C CD    . GLU A 1 18  ? 47.618 21.357  33.350 1.00 45.11  ? 160 GLU A CD    1 
ATOM   180  O OE1   . GLU A 1 18  ? 47.113 20.914  34.389 1.00 49.78  ? 160 GLU A OE1   1 
ATOM   181  O OE2   . GLU A 1 18  ? 47.605 22.570  33.151 1.00 46.76  ? 160 GLU A OE2   1 
ATOM   182  H H     . GLU A 1 18  ? 46.922 16.602  32.082 1.00 0.00   ? 160 GLU A H     1 
ATOM   183  N N     . SER A 1 19  ? 45.790 18.664  29.755 1.00 32.68  ? 161 SER A N     1 
ATOM   184  C CA    . SER A 1 19  ? 45.131 19.219  28.571 1.00 32.30  ? 161 SER A CA    1 
ATOM   185  C C     . SER A 1 19  ? 43.617 19.236  28.750 1.00 29.46  ? 161 SER A C     1 
ATOM   186  O O     . SER A 1 19  ? 42.950 20.188  28.376 1.00 28.64  ? 161 SER A O     1 
ATOM   187  C CB    . SER A 1 19  ? 45.547 18.403  27.306 1.00 33.98  ? 161 SER A CB    1 
ATOM   188  O OG    . SER A 1 19  ? 45.089 17.038  27.251 1.00 40.10  ? 161 SER A OG    1 
ATOM   189  H H     . SER A 1 19  ? 46.309 17.836  29.681 1.00 0.00   ? 161 SER A H     1 
ATOM   190  H HG    . SER A 1 19  ? 45.435 16.553  28.004 1.00 0.00   ? 161 SER A HG    1 
ATOM   191  N N     . GLU A 1 20  ? 43.029 18.254  29.422 1.00 30.19  ? 162 GLU A N     1 
ATOM   192  C CA    . GLU A 1 20  ? 41.606 18.261  29.697 1.00 29.71  ? 162 GLU A CA    1 
ATOM   193  C C     . GLU A 1 20  ? 41.262 19.323  30.710 1.00 31.22  ? 162 GLU A C     1 
ATOM   194  O O     . GLU A 1 20  ? 40.208 19.954  30.591 1.00 31.03  ? 162 GLU A O     1 
ATOM   195  C CB    . GLU A 1 20  ? 41.172 16.913  30.230 1.00 33.33  ? 162 GLU A CB    1 
ATOM   196  C CG    . GLU A 1 20  ? 40.757 15.981  29.086 1.00 32.46  ? 162 GLU A CG    1 
ATOM   197  C CD    . GLU A 1 20  ? 40.526 14.566  29.559 1.00 38.34  ? 162 GLU A CD    1 
ATOM   198  O OE1   . GLU A 1 20  ? 39.843 14.400  30.562 1.00 39.14  ? 162 GLU A OE1   1 
ATOM   199  O OE2   . GLU A 1 20  ? 41.035 13.651  28.915 1.00 34.21  ? 162 GLU A OE2   1 
ATOM   200  H H     . GLU A 1 20  ? 43.572 17.503  29.741 1.00 0.00   ? 162 GLU A H     1 
ATOM   201  N N     . ARG A 1 21  ? 42.138 19.540  31.706 1.00 30.29  ? 163 ARG A N     1 
ATOM   202  C CA    . ARG A 1 21  ? 41.969 20.638  32.650 1.00 32.97  ? 163 ARG A CA    1 
ATOM   203  C C     . ARG A 1 21  ? 41.883 21.995  31.905 1.00 33.03  ? 163 ARG A C     1 
ATOM   204  O O     . ARG A 1 21  ? 40.961 22.785  32.150 1.00 34.53  ? 163 ARG A O     1 
ATOM   205  C CB    . ARG A 1 21  ? 43.146 20.690  33.649 1.00 29.91  ? 163 ARG A CB    1 
ATOM   206  C CG    . ARG A 1 21  ? 42.725 21.731  34.691 1.00 37.77  ? 163 ARG A CG    1 
ATOM   207  C CD    . ARG A 1 21  ? 43.703 22.016  35.783 1.00 33.14  ? 163 ARG A CD    1 
ATOM   208  N NE    . ARG A 1 21  ? 44.962 22.531  35.290 1.00 39.34  ? 163 ARG A NE    1 
ATOM   209  C CZ    . ARG A 1 21  ? 45.148 23.803  34.968 1.00 40.22  ? 163 ARG A CZ    1 
ATOM   210  N NH1   . ARG A 1 21  ? 44.158 24.661  35.037 1.00 45.73  ? 163 ARG A NH1   1 
ATOM   211  N NH2   . ARG A 1 21  ? 46.367 24.253  34.739 1.00 45.36  ? 163 ARG A NH2   1 
ATOM   212  H H     . ARG A 1 21  ? 42.911 18.945  31.800 1.00 0.00   ? 163 ARG A H     1 
ATOM   213  H HE    . ARG A 1 21  ? 45.713 21.910  35.189 1.00 0.00   ? 163 ARG A HE    1 
ATOM   214  H HH11  . ARG A 1 21  ? 43.253 24.357  35.335 1.00 0.00   ? 163 ARG A HH11  1 
ATOM   215  H HH12  . ARG A 1 21  ? 44.308 25.619  34.792 1.00 0.00   ? 163 ARG A HH12  1 
ATOM   216  H HH21  . ARG A 1 21  ? 47.150 23.634  34.808 1.00 0.00   ? 163 ARG A HH21  1 
ATOM   217  H HH22  . ARG A 1 21  ? 46.508 25.213  34.496 1.00 0.00   ? 163 ARG A HH22  1 
ATOM   218  N N     . LEU A 1 22  ? 42.803 22.282  30.965 1.00 33.03  ? 164 LEU A N     1 
ATOM   219  C CA    . LEU A 1 22  ? 42.750 23.522  30.192 1.00 30.77  ? 164 LEU A CA    1 
ATOM   220  C C     . LEU A 1 22  ? 41.598 23.567  29.226 1.00 31.49  ? 164 LEU A C     1 
ATOM   221  O O     . LEU A 1 22  ? 40.888 24.586  29.106 1.00 31.34  ? 164 LEU A O     1 
ATOM   222  C CB    . LEU A 1 22  ? 44.047 23.709  29.422 1.00 32.69  ? 164 LEU A CB    1 
ATOM   223  C CG    . LEU A 1 22  ? 45.346 23.701  30.251 1.00 33.43  ? 164 LEU A CG    1 
ATOM   224  C CD1   . LEU A 1 22  ? 46.535 23.772  29.343 1.00 34.36  ? 164 LEU A CD1   1 
ATOM   225  C CD2   . LEU A 1 22  ? 45.347 24.854  31.239 1.00 35.81  ? 164 LEU A CD2   1 
ATOM   226  H H     . LEU A 1 22  ? 43.527 21.644  30.794 1.00 0.00   ? 164 LEU A H     1 
ATOM   227  N N     . LEU A 1 23  ? 41.300 22.438  28.581 1.00 31.75  ? 165 LEU A N     1 
ATOM   228  C CA    . LEU A 1 23  ? 40.248 22.443  27.574 1.00 33.57  ? 165 LEU A CA    1 
ATOM   229  C C     . LEU A 1 23  ? 38.851 22.352  28.095 1.00 33.03  ? 165 LEU A C     1 
ATOM   230  O O     . LEU A 1 23  ? 37.946 22.920  27.486 1.00 32.21  ? 165 LEU A O     1 
ATOM   231  C CB    . LEU A 1 23  ? 40.453 21.308  26.543 1.00 32.45  ? 165 LEU A CB    1 
ATOM   232  C CG    . LEU A 1 23  ? 41.716 21.407  25.684 1.00 30.83  ? 165 LEU A CG    1 
ATOM   233  C CD1   . LEU A 1 23  ? 41.986 20.078  25.050 1.00 30.07  ? 165 LEU A CD1   1 
ATOM   234  C CD2   . LEU A 1 23  ? 41.549 22.494  24.631 1.00 30.19  ? 165 LEU A CD2   1 
ATOM   235  H H     . LEU A 1 23  ? 41.786 21.611  28.783 1.00 0.00   ? 165 LEU A H     1 
ATOM   236  N N     . LEU A 1 24  ? 38.617 21.711  29.230 1.00 36.56  ? 166 LEU A N     1 
ATOM   237  C CA    . LEU A 1 24  ? 37.259 21.607  29.767 1.00 41.33  ? 166 LEU A CA    1 
ATOM   238  C C     . LEU A 1 24  ? 36.760 22.916  30.373 1.00 43.92  ? 166 LEU A C     1 
ATOM   239  O O     . LEU A 1 24  ? 35.635 23.023  30.857 1.00 45.18  ? 166 LEU A O     1 
ATOM   240  C CB    . LEU A 1 24  ? 37.205 20.487  30.831 1.00 43.58  ? 166 LEU A CB    1 
ATOM   241  C CG    . LEU A 1 24  ? 37.033 19.023  30.332 1.00 43.03  ? 166 LEU A CG    1 
ATOM   242  C CD1   . LEU A 1 24  ? 37.421 18.015  31.392 1.00 42.99  ? 166 LEU A CD1   1 
ATOM   243  C CD2   . LEU A 1 24  ? 35.622 18.824  29.922 1.00 37.94  ? 166 LEU A CD2   1 
ATOM   244  H H     . LEU A 1 24  ? 39.362 21.301  29.717 1.00 0.00   ? 166 LEU A H     1 
ATOM   245  N N     . ASN A 1 25  ? 37.548 23.969  30.342 1.00 45.74  ? 167 ASN A N     1 
ATOM   246  C CA    . ASN A 1 25  ? 37.092 25.223  30.880 1.00 50.31  ? 167 ASN A CA    1 
ATOM   247  C C     . ASN A 1 25  ? 35.979 25.798  30.029 1.00 51.40  ? 167 ASN A C     1 
ATOM   248  O O     . ASN A 1 25  ? 36.144 26.077  28.849 1.00 52.42  ? 167 ASN A O     1 
ATOM   249  C CB    . ASN A 1 25  ? 38.271 26.164  30.949 1.00 51.61  ? 167 ASN A CB    1 
ATOM   250  C CG    . ASN A 1 25  ? 37.953 27.543  31.470 1.00 47.69  ? 167 ASN A CG    1 
ATOM   251  O OD1   . ASN A 1 25  ? 36.895 28.096  31.198 1.00 50.96  ? 167 ASN A OD1   1 
ATOM   252  N ND2   . ASN A 1 25  ? 38.832 28.114  32.260 1.00 46.07  ? 167 ASN A ND2   1 
ATOM   253  H H     . ASN A 1 25  ? 38.445 23.899  29.953 1.00 0.00   ? 167 ASN A H     1 
ATOM   254  H HD21  . ASN A 1 25  ? 38.623 29.009  32.597 1.00 0.00   ? 167 ASN A HD21  1 
ATOM   255  H HD22  . ASN A 1 25  ? 39.660 27.644  32.492 1.00 0.00   ? 167 ASN A HD22  1 
ATOM   256  N N     . ALA A 1 26  ? 34.899 26.071  30.745 1.00 54.92  ? 168 ALA A N     1 
ATOM   257  C CA    . ALA A 1 26  ? 33.636 26.534  30.189 1.00 56.54  ? 168 ALA A CA    1 
ATOM   258  C C     . ALA A 1 26  ? 33.626 27.789  29.287 1.00 56.97  ? 168 ALA A C     1 
ATOM   259  O O     . ALA A 1 26  ? 32.662 28.058  28.542 1.00 55.34  ? 168 ALA A O     1 
ATOM   260  C CB    . ALA A 1 26  ? 32.720 26.743  31.369 1.00 57.05  ? 168 ALA A CB    1 
ATOM   261  H H     . ALA A 1 26  ? 34.954 25.953  31.716 1.00 0.00   ? 168 ALA A H     1 
ATOM   262  N N     . GLU A 1 27  ? 34.667 28.629  29.409 1.00 56.69  ? 169 GLU A N     1 
ATOM   263  C CA    . GLU A 1 27  ? 34.846 29.774  28.521 1.00 54.85  ? 169 GLU A CA    1 
ATOM   264  C C     . GLU A 1 27  ? 35.071 29.316  27.079 1.00 50.99  ? 169 GLU A C     1 
ATOM   265  O O     . GLU A 1 27  ? 34.611 29.951  26.112 1.00 51.11  ? 169 GLU A O     1 
ATOM   266  C CB    . GLU A 1 27  ? 36.038 30.583  29.012 1.00 59.17  ? 169 GLU A CB    1 
ATOM   267  C CG    . GLU A 1 27  ? 36.682 31.457  27.915 1.00 69.18  ? 169 GLU A CG    1 
ATOM   268  C CD    . GLU A 1 27  ? 37.885 32.311  28.335 1.00 74.61  ? 169 GLU A CD    1 
ATOM   269  O OE1   . GLU A 1 27  ? 38.308 32.247  29.499 1.00 78.07  ? 169 GLU A OE1   1 
ATOM   270  O OE2   . GLU A 1 27  ? 38.370 33.078  27.493 1.00 74.09  ? 169 GLU A OE2   1 
ATOM   271  H H     . GLU A 1 27  ? 35.327 28.468  30.116 1.00 0.00   ? 169 GLU A H     1 
ATOM   272  N N     . ASN A 1 28  ? 35.779 28.184  26.937 1.00 47.82  ? 170 ASN A N     1 
ATOM   273  C CA    . ASN A 1 28  ? 36.183 27.648  25.641 1.00 41.42  ? 170 ASN A CA    1 
ATOM   274  C C     . ASN A 1 28  ? 34.968 27.287  24.834 1.00 37.32  ? 170 ASN A C     1 
ATOM   275  O O     . ASN A 1 28  ? 34.018 26.730  25.364 1.00 39.62  ? 170 ASN A O     1 
ATOM   276  C CB    . ASN A 1 28  ? 37.057 26.420  25.839 1.00 37.56  ? 170 ASN A CB    1 
ATOM   277  C CG    . ASN A 1 28  ? 38.380 26.754  26.482 1.00 38.69  ? 170 ASN A CG    1 
ATOM   278  O OD1   . ASN A 1 28  ? 38.914 27.854  26.310 1.00 38.58  ? 170 ASN A OD1   1 
ATOM   279  N ND2   . ASN A 1 28  ? 39.003 25.838  27.220 1.00 42.23  ? 170 ASN A ND2   1 
ATOM   280  H H     . ASN A 1 28  ? 36.037 27.693  27.744 1.00 0.00   ? 170 ASN A H     1 
ATOM   281  H HD21  . ASN A 1 28  ? 39.860 26.088  27.623 1.00 0.00   ? 170 ASN A HD21  1 
ATOM   282  H HD22  . ASN A 1 28  ? 38.602 24.952  27.343 1.00 0.00   ? 170 ASN A HD22  1 
ATOM   283  N N     . PRO A 1 29  ? 34.827 27.688  23.586 1.00 34.79  ? 171 PRO A N     1 
ATOM   284  C CA    . PRO A 1 29  ? 33.754 27.169  22.745 1.00 36.12  ? 171 PRO A CA    1 
ATOM   285  C C     . PRO A 1 29  ? 34.090 25.733  22.319 1.00 40.00  ? 171 PRO A C     1 
ATOM   286  O O     . PRO A 1 29  ? 35.226 25.278  22.524 1.00 41.47  ? 171 PRO A O     1 
ATOM   287  C CB    . PRO A 1 29  ? 33.704 28.149  21.623 1.00 33.25  ? 171 PRO A CB    1 
ATOM   288  C CG    . PRO A 1 29  ? 35.091 28.672  21.491 1.00 33.78  ? 171 PRO A CG    1 
ATOM   289  C CD    . PRO A 1 29  ? 35.648 28.692  22.922 1.00 31.22  ? 171 PRO A CD    1 
ATOM   290  N N     . ARG A 1 30  ? 33.139 24.956  21.791 1.00 41.21  ? 172 ARG A N     1 
ATOM   291  C CA    . ARG A 1 30  ? 33.482 23.631  21.332 1.00 41.20  ? 172 ARG A CA    1 
ATOM   292  C C     . ARG A 1 30  ? 34.348 23.747  20.113 1.00 36.33  ? 172 ARG A C     1 
ATOM   293  O O     . ARG A 1 30  ? 34.125 24.593  19.251 1.00 35.75  ? 172 ARG A O     1 
ATOM   294  C CB    . ARG A 1 30  ? 32.223 22.837  21.036 1.00 48.84  ? 172 ARG A CB    1 
ATOM   295  C CG    . ARG A 1 30  ? 31.389 23.299  19.875 1.00 61.57  ? 172 ARG A CG    1 
ATOM   296  C CD    . ARG A 1 30  ? 30.006 22.691  20.012 1.00 71.13  ? 172 ARG A CD    1 
ATOM   297  N NE    . ARG A 1 30  ? 30.007 21.252  19.795 1.00 79.64  ? 172 ARG A NE    1 
ATOM   298  C CZ    . ARG A 1 30  ? 29.095 20.466  20.378 1.00 85.42  ? 172 ARG A CZ    1 
ATOM   299  N NH1   . ARG A 1 30  ? 28.162 20.981  21.205 1.00 85.29  ? 172 ARG A NH1   1 
ATOM   300  N NH2   . ARG A 1 30  ? 29.099 19.162  20.077 1.00 87.93  ? 172 ARG A NH2   1 
ATOM   301  H H     . ARG A 1 30  ? 32.218 25.283  21.716 1.00 0.00   ? 172 ARG A H     1 
ATOM   302  H HE    . ARG A 1 30  ? 30.686 20.853  19.213 1.00 0.00   ? 172 ARG A HE    1 
ATOM   303  H HH11  . ARG A 1 30  ? 28.145 21.964  21.390 1.00 0.00   ? 172 ARG A HH11  1 
ATOM   304  H HH12  . ARG A 1 30  ? 27.487 20.380  21.633 1.00 0.00   ? 172 ARG A HH12  1 
ATOM   305  H HH21  . ARG A 1 30  ? 29.772 18.800  19.432 1.00 0.00   ? 172 ARG A HH21  1 
ATOM   306  H HH22  . ARG A 1 30  ? 28.429 18.550  20.497 1.00 0.00   ? 172 ARG A HH22  1 
ATOM   307  N N     . GLY A 1 31  ? 35.324 22.871  20.057 1.00 34.06  ? 173 GLY A N     1 
ATOM   308  C CA    . GLY A 1 31  ? 36.304 22.906  18.998 1.00 32.32  ? 173 GLY A CA    1 
ATOM   309  C C     . GLY A 1 31  ? 37.566 23.639  19.441 1.00 30.71  ? 173 GLY A C     1 
ATOM   310  O O     . GLY A 1 31  ? 38.474 23.849  18.627 1.00 32.06  ? 173 GLY A O     1 
ATOM   311  H H     . GLY A 1 31  ? 35.389 22.179  20.748 1.00 0.00   ? 173 GLY A H     1 
ATOM   312  N N     . THR A 1 32  ? 37.600 24.234  20.656 1.00 26.31  ? 174 THR A N     1 
ATOM   313  C CA    . THR A 1 32  ? 38.889 24.669  21.212 1.00 26.36  ? 174 THR A CA    1 
ATOM   314  C C     . THR A 1 32  ? 39.828 23.476  21.241 1.00 24.79  ? 174 THR A C     1 
ATOM   315  O O     . THR A 1 32  ? 39.429 22.358  21.581 1.00 27.56  ? 174 THR A O     1 
ATOM   316  C CB    . THR A 1 32  ? 38.662 25.244  22.606 1.00 26.87  ? 174 THR A CB    1 
ATOM   317  O OG1   . THR A 1 32  ? 37.666 26.257  22.542 1.00 26.87  ? 174 THR A OG1   1 
ATOM   318  C CG2   . THR A 1 32  ? 39.921 25.864  23.209 1.00 22.01  ? 174 THR A CG2   1 
ATOM   319  H H     . THR A 1 32  ? 36.772 24.374  21.161 1.00 0.00   ? 174 THR A H     1 
ATOM   320  H HG1   . THR A 1 32  ? 37.522 26.620  23.419 1.00 0.00   ? 174 THR A HG1   1 
ATOM   321  N N     . PHE A 1 33  ? 41.074 23.709  20.888 1.00 24.52  ? 175 PHE A N     1 
ATOM   322  C CA    . PHE A 1 33  ? 42.018 22.597  20.773 1.00 25.44  ? 175 PHE A CA    1 
ATOM   323  C C     . PHE A 1 33  ? 43.444 22.968  21.147 1.00 26.22  ? 175 PHE A C     1 
ATOM   324  O O     . PHE A 1 33  ? 43.767 24.139  21.374 1.00 29.45  ? 175 PHE A O     1 
ATOM   325  C CB    . PHE A 1 33  ? 42.069 22.140  19.315 1.00 26.18  ? 175 PHE A CB    1 
ATOM   326  C CG    . PHE A 1 33  ? 42.793 23.144  18.398 1.00 25.86  ? 175 PHE A CG    1 
ATOM   327  C CD1   . PHE A 1 33  ? 42.129 24.289  17.926 1.00 25.59  ? 175 PHE A CD1   1 
ATOM   328  C CD2   . PHE A 1 33  ? 44.127 22.920  18.028 1.00 26.18  ? 175 PHE A CD2   1 
ATOM   329  C CE1   . PHE A 1 33  ? 42.796 25.201  17.097 1.00 24.36  ? 175 PHE A CE1   1 
ATOM   330  C CE2   . PHE A 1 33  ? 44.792 23.832  17.198 1.00 27.01  ? 175 PHE A CE2   1 
ATOM   331  C CZ    . PHE A 1 33  ? 44.127 24.973  16.734 1.00 21.73  ? 175 PHE A CZ    1 
ATOM   332  H H     . PHE A 1 33  ? 41.369 24.625  20.703 1.00 0.00   ? 175 PHE A H     1 
ATOM   333  N N     . LEU A 1 34  ? 44.241 21.917  21.187 1.00 24.23  ? 176 LEU A N     1 
ATOM   334  C CA    . LEU A 1 34  ? 45.684 22.007  21.422 1.00 24.00  ? 176 LEU A CA    1 
ATOM   335  C C     . LEU A 1 34  ? 46.349 20.693  21.024 1.00 26.08  ? 176 LEU A C     1 
ATOM   336  O O     . LEU A 1 34  ? 45.672 19.692  20.745 1.00 23.84  ? 176 LEU A O     1 
ATOM   337  C CB    . LEU A 1 34  ? 46.009 22.342  22.884 1.00 23.21  ? 176 LEU A CB    1 
ATOM   338  C CG    . LEU A 1 34  ? 45.603 21.273  23.913 1.00 21.81  ? 176 LEU A CG    1 
ATOM   339  C CD1   . LEU A 1 34  ? 46.530 20.055  23.934 1.00 19.68  ? 176 LEU A CD1   1 
ATOM   340  C CD2   . LEU A 1 34  ? 45.612 21.827  25.348 1.00 22.15  ? 176 LEU A CD2   1 
ATOM   341  H H     . LEU A 1 34  ? 43.847 21.030  21.053 1.00 0.00   ? 176 LEU A H     1 
ATOM   342  N N     . VAL A 1 35  ? 47.588 20.896  20.502 1.00 23.81  ? 177 VAL A N     1 
ATOM   343  C CA    . VAL A 1 35  ? 48.426 19.794  20.109 1.00 23.98  ? 177 VAL A CA    1 
ATOM   344  C C     . VAL A 1 35  ? 49.417 19.630  21.249 1.00 25.75  ? 177 VAL A C     1 
ATOM   345  O O     . VAL A 1 35  ? 49.875 20.626  21.853 1.00 25.74  ? 177 VAL A O     1 
ATOM   346  C CB    . VAL A 1 35  ? 49.134 20.041  18.737 1.00 24.14  ? 177 VAL A CB    1 
ATOM   347  C CG1   . VAL A 1 35  ? 49.999 18.853  18.345 1.00 19.03  ? 177 VAL A CG1   1 
ATOM   348  C CG2   . VAL A 1 35  ? 48.071 20.240  17.674 1.00 17.54  ? 177 VAL A CG2   1 
ATOM   349  H H     . VAL A 1 35  ? 47.917 21.812  20.391 1.00 0.00   ? 177 VAL A H     1 
ATOM   350  N N     . ARG A 1 36  ? 49.868 18.384  21.478 1.00 25.62  ? 178 ARG A N     1 
ATOM   351  C CA    . ARG A 1 36  ? 50.871 18.044  22.503 1.00 24.24  ? 178 ARG A CA    1 
ATOM   352  C C     . ARG A 1 36  ? 51.578 16.772  22.138 1.00 22.54  ? 178 ARG A C     1 
ATOM   353  O O     . ARG A 1 36  ? 51.123 16.049  21.258 1.00 26.36  ? 178 ARG A O     1 
ATOM   354  C CB    . ARG A 1 36  ? 50.196 17.864  23.878 1.00 20.32  ? 178 ARG A CB    1 
ATOM   355  C CG    . ARG A 1 36  ? 49.122 16.768  23.863 1.00 22.52  ? 178 ARG A CG    1 
ATOM   356  C CD    . ARG A 1 36  ? 48.403 16.633  25.193 1.00 23.06  ? 178 ARG A CD    1 
ATOM   357  N NE    . ARG A 1 36  ? 47.270 15.709  25.093 1.00 25.86  ? 178 ARG A NE    1 
ATOM   358  C CZ    . ARG A 1 36  ? 47.405 14.421  25.357 1.00 25.25  ? 178 ARG A CZ    1 
ATOM   359  N NH1   . ARG A 1 36  ? 48.580 13.917  25.748 1.00 21.06  ? 178 ARG A NH1   1 
ATOM   360  N NH2   . ARG A 1 36  ? 46.351 13.611  25.205 1.00 20.46  ? 178 ARG A NH2   1 
ATOM   361  H H     . ARG A 1 36  ? 49.507 17.657  20.929 1.00 0.00   ? 178 ARG A H     1 
ATOM   362  H HE    . ARG A 1 36  ? 46.393 16.054  24.824 1.00 0.00   ? 178 ARG A HE    1 
ATOM   363  H HH11  . ARG A 1 36  ? 49.374 14.517  25.845 1.00 0.00   ? 178 ARG A HH11  1 
ATOM   364  H HH12  . ARG A 1 36  ? 48.665 12.940  25.944 1.00 0.00   ? 178 ARG A HH12  1 
ATOM   365  H HH21  . ARG A 1 36  ? 45.476 13.982  24.895 1.00 0.00   ? 178 ARG A HH21  1 
ATOM   366  H HH22  . ARG A 1 36  ? 46.439 12.634  25.401 1.00 0.00   ? 178 ARG A HH22  1 
ATOM   367  N N     . GLU A 1 37  ? 52.686 16.456  22.768 1.00 24.25  ? 179 GLU A N     1 
ATOM   368  C CA    . GLU A 1 37  ? 53.297 15.139  22.600 1.00 25.35  ? 179 GLU A CA    1 
ATOM   369  C C     . GLU A 1 37  ? 52.309 14.073  23.129 1.00 29.93  ? 179 GLU A C     1 
ATOM   370  O O     . GLU A 1 37  ? 51.468 14.350  24.004 1.00 29.30  ? 179 GLU A O     1 
ATOM   371  C CB    . GLU A 1 37  ? 54.564 15.042  23.398 1.00 22.67  ? 179 GLU A CB    1 
ATOM   372  C CG    . GLU A 1 37  ? 55.791 15.741  22.824 1.00 28.09  ? 179 GLU A CG    1 
ATOM   373  C CD    . GLU A 1 37  ? 57.067 15.512  23.577 1.00 28.76  ? 179 GLU A CD    1 
ATOM   374  O OE1   . GLU A 1 37  ? 57.088 14.705  24.489 1.00 35.52  ? 179 GLU A OE1   1 
ATOM   375  O OE2   . GLU A 1 37  ? 58.064 16.158  23.292 1.00 34.44  ? 179 GLU A OE2   1 
ATOM   376  H H     . GLU A 1 37  ? 53.109 17.113  23.359 1.00 0.00   ? 179 GLU A H     1 
ATOM   377  N N     . SER A 1 38  ? 52.235 12.899  22.513 1.00 30.38  ? 180 SER A N     1 
ATOM   378  C CA    . SER A 1 38  ? 51.466 11.778  23.070 1.00 31.85  ? 180 SER A CA    1 
ATOM   379  C C     . SER A 1 38  ? 52.210 11.297  24.328 1.00 28.61  ? 180 SER A C     1 
ATOM   380  O O     . SER A 1 38  ? 53.421 11.056  24.272 1.00 27.00  ? 180 SER A O     1 
ATOM   381  C CB    . SER A 1 38  ? 51.391 10.644  22.054 1.00 30.93  ? 180 SER A CB    1 
ATOM   382  O OG    . SER A 1 38  ? 50.809 9.422   22.525 1.00 38.55  ? 180 SER A OG    1 
ATOM   383  H H     . SER A 1 38  ? 52.707 12.777  21.663 1.00 0.00   ? 180 SER A H     1 
ATOM   384  H HG    . SER A 1 38  ? 50.807 8.774   21.817 1.00 0.00   ? 180 SER A HG    1 
ATOM   385  N N     . GLU A 1 39  ? 51.531 11.103  25.465 1.00 29.56  ? 181 GLU A N     1 
ATOM   386  C CA    . GLU A 1 39  ? 52.167 10.595  26.684 1.00 31.04  ? 181 GLU A CA    1 
ATOM   387  C C     . GLU A 1 39  ? 52.447 9.118   26.548 1.00 32.63  ? 181 GLU A C     1 
ATOM   388  O O     . GLU A 1 39  ? 53.489 8.658   27.002 1.00 34.47  ? 181 GLU A O     1 
ATOM   389  C CB    . GLU A 1 39  ? 51.306 10.682  27.929 1.00 30.26  ? 181 GLU A CB    1 
ATOM   390  C CG    . GLU A 1 39  ? 50.947 12.038  28.447 1.00 32.84  ? 181 GLU A CG    1 
ATOM   391  C CD    . GLU A 1 39  ? 50.530 11.973  29.908 1.00 31.94  ? 181 GLU A CD    1 
ATOM   392  O OE1   . GLU A 1 39  ? 51.396 11.846  30.785 1.00 33.87  ? 181 GLU A OE1   1 
ATOM   393  O OE2   . GLU A 1 39  ? 49.338 12.067  30.148 1.00 30.29  ? 181 GLU A OE2   1 
ATOM   394  H H     . GLU A 1 39  ? 50.573 11.308  25.483 1.00 0.00   ? 181 GLU A H     1 
ATOM   395  N N     . THR A 1 40  ? 51.518 8.363   25.932 1.00 33.25  ? 182 THR A N     1 
ATOM   396  C CA    . THR A 1 40  ? 51.630 6.924   25.872 1.00 32.94  ? 182 THR A CA    1 
ATOM   397  C C     . THR A 1 40  ? 52.209 6.369   24.563 1.00 35.45  ? 182 THR A C     1 
ATOM   398  O O     . THR A 1 40  ? 52.319 5.140   24.438 1.00 38.18  ? 182 THR A O     1 
ATOM   399  C CB    . THR A 1 40  ? 50.247 6.323   26.100 1.00 33.34  ? 182 THR A CB    1 
ATOM   400  O OG1   . THR A 1 40  ? 49.447 6.906   25.071 1.00 35.49  ? 182 THR A OG1   1 
ATOM   401  C CG2   . THR A 1 40  ? 49.687 6.537   27.471 1.00 29.89  ? 182 THR A CG2   1 
ATOM   402  H H     . THR A 1 40  ? 50.747 8.800   25.514 1.00 0.00   ? 182 THR A H     1 
ATOM   403  H HG1   . THR A 1 40  ? 49.448 7.861   25.167 1.00 0.00   ? 182 THR A HG1   1 
ATOM   404  N N     . THR A 1 41  ? 52.492 7.159   23.510 1.00 34.09  ? 183 THR A N     1 
ATOM   405  C CA    . THR A 1 41  ? 53.119 6.612   22.310 1.00 33.28  ? 183 THR A CA    1 
ATOM   406  C C     . THR A 1 41  ? 54.343 7.436   21.994 1.00 36.69  ? 183 THR A C     1 
ATOM   407  O O     . THR A 1 41  ? 54.202 8.632   21.747 1.00 37.64  ? 183 THR A O     1 
ATOM   408  C CB    . THR A 1 41  ? 52.192 6.683   21.091 1.00 32.20  ? 183 THR A CB    1 
ATOM   409  O OG1   . THR A 1 41  ? 50.911 6.216   21.506 1.00 34.57  ? 183 THR A OG1   1 
ATOM   410  C CG2   . THR A 1 41  ? 52.718 5.890   19.899 1.00 32.56  ? 183 THR A CG2   1 
ATOM   411  H H     . THR A 1 41  ? 52.274 8.114   23.549 1.00 0.00   ? 183 THR A H     1 
ATOM   412  H HG1   . THR A 1 41  ? 50.580 6.774   22.214 1.00 0.00   ? 183 THR A HG1   1 
ATOM   413  N N     . LYS A 1 42  ? 55.540 6.844   21.942 1.00 37.67  ? 184 LYS A N     1 
ATOM   414  C CA    . LYS A 1 42  ? 56.730 7.610   21.638 1.00 38.02  ? 184 LYS A CA    1 
ATOM   415  C C     . LYS A 1 42  ? 56.680 8.093   20.209 1.00 38.70  ? 184 LYS A C     1 
ATOM   416  O O     . LYS A 1 42  ? 56.202 7.386   19.313 1.00 39.51  ? 184 LYS A O     1 
ATOM   417  C CB    . LYS A 1 42  ? 57.985 6.779   21.789 1.00 43.10  ? 184 LYS A CB    1 
ATOM   418  H H     . LYS A 1 42  ? 55.613 5.882   22.111 1.00 0.00   ? 184 LYS A H     1 
ATOM   419  N N     . GLY A 1 43  ? 57.106 9.323   19.987 1.00 38.69  ? 185 GLY A N     1 
ATOM   420  C CA    . GLY A 1 43  ? 57.162 9.852   18.642 1.00 36.01  ? 185 GLY A CA    1 
ATOM   421  C C     . GLY A 1 43  ? 55.828 10.356  18.104 1.00 36.04  ? 185 GLY A C     1 
ATOM   422  O O     . GLY A 1 43  ? 55.826 11.016  17.055 1.00 37.85  ? 185 GLY A O     1 
ATOM   423  H H     . GLY A 1 43  ? 57.387 9.883   20.741 1.00 0.00   ? 185 GLY A H     1 
ATOM   424  N N     . ALA A 1 44  ? 54.678 10.049  18.712 1.00 32.06  ? 186 ALA A N     1 
ATOM   425  C CA    . ALA A 1 44  ? 53.397 10.576  18.222 1.00 29.77  ? 186 ALA A CA    1 
ATOM   426  C C     . ALA A 1 44  ? 52.948 11.870  18.935 1.00 29.82  ? 186 ALA A C     1 
ATOM   427  O O     . ALA A 1 44  ? 53.515 12.256  19.971 1.00 27.65  ? 186 ALA A O     1 
ATOM   428  C CB    . ALA A 1 44  ? 52.297 9.527   18.414 1.00 24.75  ? 186 ALA A CB    1 
ATOM   429  H H     . ALA A 1 44  ? 54.689 9.463   19.497 1.00 0.00   ? 186 ALA A H     1 
ATOM   430  N N     . TYR A 1 45  ? 51.924 12.560  18.428 1.00 26.30  ? 187 TYR A N     1 
ATOM   431  C CA    . TYR A 1 45  ? 51.403 13.736  19.103 1.00 25.03  ? 187 TYR A CA    1 
ATOM   432  C C     . TYR A 1 45  ? 49.958 13.473  19.323 1.00 26.10  ? 187 TYR A C     1 
ATOM   433  O O     . TYR A 1 45  ? 49.406 12.471  18.852 1.00 24.60  ? 187 TYR A O     1 
ATOM   434  C CB    . TYR A 1 45  ? 51.495 15.025  18.272 1.00 25.45  ? 187 TYR A CB    1 
ATOM   435  C CG    . TYR A 1 45  ? 52.913 15.398  17.955 1.00 27.53  ? 187 TYR A CG    1 
ATOM   436  C CD1   . TYR A 1 45  ? 53.578 14.788  16.883 1.00 29.74  ? 187 TYR A CD1   1 
ATOM   437  C CD2   . TYR A 1 45  ? 53.581 16.271  18.812 1.00 28.77  ? 187 TYR A CD2   1 
ATOM   438  C CE1   . TYR A 1 45  ? 54.923 15.084  16.664 1.00 29.44  ? 187 TYR A CE1   1 
ATOM   439  C CE2   . TYR A 1 45  ? 54.918 16.572  18.588 1.00 25.67  ? 187 TYR A CE2   1 
ATOM   440  C CZ    . TYR A 1 45  ? 55.570 15.984  17.515 1.00 32.24  ? 187 TYR A CZ    1 
ATOM   441  O OH    . TYR A 1 45  ? 56.909 16.215  17.342 1.00 35.09  ? 187 TYR A OH    1 
ATOM   442  H H     . TYR A 1 45  ? 51.517 12.268  17.586 1.00 0.00   ? 187 TYR A H     1 
ATOM   443  H HH    . TYR A 1 45  ? 57.227 16.793  18.039 1.00 0.00   ? 187 TYR A HH    1 
ATOM   444  N N     . SER A 1 46  ? 49.313 14.397  20.014 1.00 27.76  ? 188 SER A N     1 
ATOM   445  C CA    . SER A 1 46  ? 47.938 14.252  20.254 1.00 30.44  ? 188 SER A CA    1 
ATOM   446  C C     . SER A 1 46  ? 47.245 15.617  20.051 1.00 30.68  ? 188 SER A C     1 
ATOM   447  O O     . SER A 1 46  ? 47.792 16.710  20.296 1.00 28.14  ? 188 SER A O     1 
ATOM   448  C CB    . SER A 1 46  ? 47.876 13.572  21.685 1.00 36.42  ? 188 SER A CB    1 
ATOM   449  O OG    . SER A 1 46  ? 47.786 12.082  21.552 1.00 48.18  ? 188 SER A OG    1 
ATOM   450  H H     . SER A 1 46  ? 49.793 15.180  20.357 1.00 0.00   ? 188 SER A H     1 
ATOM   451  H HG    . SER A 1 46  ? 46.993 11.851  21.062 1.00 0.00   ? 188 SER A HG    1 
ATOM   452  N N     . LEU A 1 47  ? 46.104 15.552  19.361 1.00 26.35  ? 189 LEU A N     1 
ATOM   453  C CA    . LEU A 1 47  ? 45.265 16.703  19.144 1.00 26.67  ? 189 LEU A CA    1 
ATOM   454  C C     . LEU A 1 47  ? 44.087 16.516  20.076 1.00 28.46  ? 189 LEU A C     1 
ATOM   455  O O     . LEU A 1 47  ? 43.323 15.551  19.937 1.00 25.42  ? 189 LEU A O     1 
ATOM   456  C CB    . LEU A 1 47  ? 44.784 16.761  17.691 1.00 23.56  ? 189 LEU A CB    1 
ATOM   457  C CG    . LEU A 1 47  ? 43.769 17.824  17.284 1.00 28.65  ? 189 LEU A CG    1 
ATOM   458  C CD1   . LEU A 1 47  ? 44.369 19.266  17.453 1.00 22.28  ? 189 LEU A CD1   1 
ATOM   459  C CD2   . LEU A 1 47  ? 43.331 17.517  15.834 1.00 26.61  ? 189 LEU A CD2   1 
ATOM   460  H H     . LEU A 1 47  ? 45.827 14.689  18.988 1.00 0.00   ? 189 LEU A H     1 
ATOM   461  N N     . SER A 1 48  ? 43.982 17.380  21.090 1.00 24.32  ? 190 SER A N     1 
ATOM   462  C CA    . SER A 1 48  ? 42.904 17.267  22.052 1.00 23.12  ? 190 SER A CA    1 
ATOM   463  C C     . SER A 1 48  ? 41.946 18.407  21.747 1.00 25.61  ? 190 SER A C     1 
ATOM   464  O O     . SER A 1 48  ? 42.361 19.580  21.580 1.00 23.04  ? 190 SER A O     1 
ATOM   465  C CB    . SER A 1 48  ? 43.512 17.379  23.431 1.00 20.77  ? 190 SER A CB    1 
ATOM   466  O OG    . SER A 1 48  ? 44.594 16.466  23.653 1.00 22.30  ? 190 SER A OG    1 
ATOM   467  H H     . SER A 1 48  ? 44.642 18.098  21.184 1.00 0.00   ? 190 SER A H     1 
ATOM   468  H HG    . SER A 1 48  ? 45.292 16.636  23.016 1.00 0.00   ? 190 SER A HG    1 
ATOM   469  N N     . VAL A 1 49  ? 40.670 18.035  21.632 1.00 24.96  ? 191 VAL A N     1 
ATOM   470  C CA    . VAL A 1 49  ? 39.619 18.918  21.140 1.00 27.61  ? 191 VAL A CA    1 
ATOM   471  C C     . VAL A 1 49  ? 38.455 18.933  22.096 1.00 31.73  ? 191 VAL A C     1 
ATOM   472  O O     . VAL A 1 49  ? 38.005 17.857  22.512 1.00 34.38  ? 191 VAL A O     1 
ATOM   473  C CB    . VAL A 1 49  ? 39.115 18.443  19.730 1.00 24.10  ? 191 VAL A CB    1 
ATOM   474  C CG1   . VAL A 1 49  ? 38.191 19.465  19.117 1.00 19.61  ? 191 VAL A CG1   1 
ATOM   475  C CG2   . VAL A 1 49  ? 40.295 18.330  18.773 1.00 23.28  ? 191 VAL A CG2   1 
ATOM   476  H H     . VAL A 1 49  ? 40.427 17.122  21.891 1.00 0.00   ? 191 VAL A H     1 
ATOM   477  N N     . SER A 1 50  ? 37.990 20.118  22.509 1.00 32.19  ? 192 SER A N     1 
ATOM   478  C CA    . SER A 1 50  ? 36.845 20.208  23.396 1.00 33.62  ? 192 SER A CA    1 
ATOM   479  C C     . SER A 1 50  ? 35.554 20.025  22.595 1.00 36.71  ? 192 SER A C     1 
ATOM   480  O O     . SER A 1 50  ? 35.415 20.573  21.485 1.00 35.06  ? 192 SER A O     1 
ATOM   481  C CB    . SER A 1 50  ? 36.835 21.573  24.065 1.00 32.99  ? 192 SER A CB    1 
ATOM   482  O OG    . SER A 1 50  ? 36.697 22.595  23.081 1.00 31.41  ? 192 SER A OG    1 
ATOM   483  H H     . SER A 1 50  ? 38.431 20.940  22.207 1.00 0.00   ? 192 SER A H     1 
ATOM   484  H HG    . SER A 1 50  ? 37.433 22.549  22.466 1.00 0.00   ? 192 SER A HG    1 
ATOM   485  N N     . ASP A 1 51  ? 34.561 19.360  23.162 1.00 40.51  ? 193 ASP A N     1 
ATOM   486  C CA    . ASP A 1 51  ? 33.319 19.135  22.468 1.00 45.20  ? 193 ASP A CA    1 
ATOM   487  C C     . ASP A 1 51  ? 32.222 19.083  23.507 1.00 46.84  ? 193 ASP A C     1 
ATOM   488  O O     . ASP A 1 51  ? 32.520 19.116  24.708 1.00 46.70  ? 193 ASP A O     1 
ATOM   489  C CB    . ASP A 1 51  ? 33.438 17.819  21.707 1.00 50.59  ? 193 ASP A CB    1 
ATOM   490  C CG    . ASP A 1 51  ? 32.302 17.524  20.726 1.00 55.18  ? 193 ASP A CG    1 
ATOM   491  O OD1   . ASP A 1 51  ? 31.754 18.437  20.064 1.00 53.32  ? 193 ASP A OD1   1 
ATOM   492  O OD2   . ASP A 1 51  ? 31.960 16.344  20.638 1.00 59.57  ? 193 ASP A OD2   1 
ATOM   493  H H     . ASP A 1 51  ? 34.672 19.014  24.072 1.00 0.00   ? 193 ASP A H     1 
ATOM   494  N N     . PHE A 1 52  ? 30.946 19.123  23.113 1.00 50.52  ? 194 PHE A N     1 
ATOM   495  C CA    . PHE A 1 52  ? 29.837 19.000  24.061 1.00 53.09  ? 194 PHE A CA    1 
ATOM   496  C C     . PHE A 1 52  ? 28.689 18.139  23.555 1.00 54.64  ? 194 PHE A C     1 
ATOM   497  O O     . PHE A 1 52  ? 28.281 18.229  22.389 1.00 52.99  ? 194 PHE A O     1 
ATOM   498  C CB    . PHE A 1 52  ? 29.253 20.375  24.395 1.00 54.30  ? 194 PHE A CB    1 
ATOM   499  C CG    . PHE A 1 52  ? 28.177 20.310  25.491 1.00 53.86  ? 194 PHE A CG    1 
ATOM   500  C CD1   . PHE A 1 52  ? 28.548 20.064  26.821 1.00 51.99  ? 194 PHE A CD1   1 
ATOM   501  C CD2   . PHE A 1 52  ? 26.817 20.427  25.161 1.00 54.79  ? 194 PHE A CD2   1 
ATOM   502  C CE1   . PHE A 1 52  ? 27.584 19.952  27.812 1.00 48.33  ? 194 PHE A CE1   1 
ATOM   503  C CE2   . PHE A 1 52  ? 25.854 20.309  26.165 1.00 53.80  ? 194 PHE A CE2   1 
ATOM   504  C CZ    . PHE A 1 52  ? 26.245 20.045  27.478 1.00 53.60  ? 194 PHE A CZ    1 
ATOM   505  H H     . PHE A 1 52  ? 30.746 19.238  22.161 1.00 0.00   ? 194 PHE A H     1 
ATOM   506  N N     . ASP A 1 53  ? 28.073 17.423  24.487 1.00 59.27  ? 195 ASP A N     1 
ATOM   507  C CA    . ASP A 1 53  ? 26.820 16.708  24.228 1.00 64.11  ? 195 ASP A CA    1 
ATOM   508  C C     . ASP A 1 53  ? 26.017 16.636  25.524 1.00 64.26  ? 195 ASP A C     1 
ATOM   509  O O     . ASP A 1 53  ? 26.572 16.649  26.640 1.00 62.49  ? 195 ASP A O     1 
ATOM   510  C CB    . ASP A 1 53  ? 27.087 15.260  23.673 1.00 67.50  ? 195 ASP A CB    1 
ATOM   511  C CG    . ASP A 1 53  ? 27.498 14.207  24.690 1.00 67.21  ? 195 ASP A CG    1 
ATOM   512  O OD1   . ASP A 1 53  ? 26.626 13.650  25.341 1.00 67.07  ? 195 ASP A OD1   1 
ATOM   513  O OD2   . ASP A 1 53  ? 28.683 13.955  24.833 1.00 69.28  ? 195 ASP A OD2   1 
ATOM   514  H H     . ASP A 1 53  ? 28.470 17.370  25.381 1.00 0.00   ? 195 ASP A H     1 
ATOM   515  N N     . ASN A 1 54  ? 24.688 16.622  25.418 1.00 68.15  ? 196 ASN A N     1 
ATOM   516  C CA    . ASN A 1 54  ? 23.861 16.619  26.624 1.00 71.53  ? 196 ASN A CA    1 
ATOM   517  C C     . ASN A 1 54  ? 23.670 15.227  27.229 1.00 72.14  ? 196 ASN A C     1 
ATOM   518  O O     . ASN A 1 54  ? 22.553 14.728  27.412 1.00 74.20  ? 196 ASN A O     1 
ATOM   519  C CB    . ASN A 1 54  ? 22.484 17.236  26.319 1.00 68.59  ? 196 ASN A CB    1 
ATOM   520  H H     . ASN A 1 54  ? 24.266 16.614  24.533 1.00 0.00   ? 196 ASN A H     1 
ATOM   521  N N     . ALA A 1 55  ? 24.813 14.627  27.574 1.00 73.32  ? 197 ALA A N     1 
ATOM   522  C CA    . ALA A 1 55  ? 24.885 13.306  28.177 1.00 72.00  ? 197 ALA A CA    1 
ATOM   523  C C     . ALA A 1 55  ? 26.274 13.087  28.757 1.00 70.51  ? 197 ALA A C     1 
ATOM   524  O O     . ALA A 1 55  ? 26.394 12.609  29.886 1.00 72.27  ? 197 ALA A O     1 
ATOM   525  C CB    . ALA A 1 55  ? 24.617 12.198  27.153 1.00 71.26  ? 197 ALA A CB    1 
ATOM   526  H H     . ALA A 1 55  ? 25.652 15.105  27.411 1.00 0.00   ? 197 ALA A H     1 
ATOM   527  N N     . LYS A 1 56  ? 27.353 13.424  28.061 1.00 68.55  ? 198 LYS A N     1 
ATOM   528  C CA    . LYS A 1 56  ? 28.679 13.360  28.667 1.00 68.65  ? 198 LYS A CA    1 
ATOM   529  C C     . LYS A 1 56  ? 29.032 14.715  29.269 1.00 67.43  ? 198 LYS A C     1 
ATOM   530  O O     . LYS A 1 56  ? 29.901 14.851  30.143 1.00 67.70  ? 198 LYS A O     1 
ATOM   531  C CB    . LYS A 1 56  ? 29.759 13.041  27.641 1.00 66.83  ? 198 LYS A CB    1 
ATOM   532  H H     . LYS A 1 56  ? 27.258 13.719  27.131 1.00 0.00   ? 198 LYS A H     1 
ATOM   533  N N     . GLY A 1 57  ? 28.275 15.737  28.878 1.00 64.98  ? 199 GLY A N     1 
ATOM   534  C CA    . GLY A 1 57  ? 28.650 17.077  29.235 1.00 63.57  ? 199 GLY A CA    1 
ATOM   535  C C     . GLY A 1 57  ? 29.810 17.536  28.358 1.00 60.86  ? 199 GLY A C     1 
ATOM   536  O O     . GLY A 1 57  ? 30.045 17.014  27.267 1.00 62.54  ? 199 GLY A O     1 
ATOM   537  H H     . GLY A 1 57  ? 27.466 15.576  28.349 1.00 0.00   ? 199 GLY A H     1 
ATOM   538  N N     . LEU A 1 58  ? 30.449 18.643  28.733 1.00 57.94  ? 200 LEU A N     1 
ATOM   539  C CA    . LEU A 1 58  ? 31.650 19.097  28.063 1.00 52.37  ? 200 LEU A CA    1 
ATOM   540  C C     . LEU A 1 58  ? 32.622 17.979  28.273 1.00 50.88  ? 200 LEU A C     1 
ATOM   541  O O     . LEU A 1 58  ? 32.737 17.405  29.364 1.00 50.93  ? 200 LEU A O     1 
ATOM   542  C CB    . LEU A 1 58  ? 32.241 20.369  28.692 1.00 50.48  ? 200 LEU A CB    1 
ATOM   543  C CG    . LEU A 1 58  ? 31.549 21.692  28.504 1.00 47.45  ? 200 LEU A CG    1 
ATOM   544  C CD1   . LEU A 1 58  ? 32.258 22.753  29.320 1.00 50.49  ? 200 LEU A CD1   1 
ATOM   545  C CD2   . LEU A 1 58  ? 31.581 22.078  27.051 1.00 48.66  ? 200 LEU A CD2   1 
ATOM   546  H H     . LEU A 1 58  ? 30.096 19.165  29.484 1.00 0.00   ? 200 LEU A H     1 
ATOM   547  N N     . ASN A 1 59  ? 33.257 17.612  27.190 1.00 47.44  ? 201 ASN A N     1 
ATOM   548  C CA    . ASN A 1 59  ? 34.266 16.575  27.258 1.00 45.69  ? 201 ASN A CA    1 
ATOM   549  C C     . ASN A 1 59  ? 35.324 16.877  26.187 1.00 42.88  ? 201 ASN A C     1 
ATOM   550  O O     . ASN A 1 59  ? 35.232 17.848  25.412 1.00 39.46  ? 201 ASN A O     1 
ATOM   551  C CB    . ASN A 1 59  ? 33.605 15.173  27.040 1.00 43.47  ? 201 ASN A CB    1 
ATOM   552  C CG    . ASN A 1 59  ? 32.955 15.031  25.678 1.00 39.60  ? 201 ASN A CG    1 
ATOM   553  O OD1   . ASN A 1 59  ? 33.465 14.310  24.822 1.00 40.67  ? 201 ASN A OD1   1 
ATOM   554  N ND2   . ASN A 1 59  ? 31.852 15.709  25.399 1.00 39.97  ? 201 ASN A ND2   1 
ATOM   555  H H     . ASN A 1 59  ? 33.050 18.039  26.332 1.00 0.00   ? 201 ASN A H     1 
ATOM   556  H HD21  . ASN A 1 59  ? 31.462 15.591  24.509 1.00 0.00   ? 201 ASN A HD21  1 
ATOM   557  H HD22  . ASN A 1 59  ? 31.457 16.301  26.073 1.00 0.00   ? 201 ASN A HD22  1 
ATOM   558  N N     . VAL A 1 60  ? 36.409 16.111  26.261 1.00 39.07  ? 202 VAL A N     1 
ATOM   559  C CA    . VAL A 1 60  ? 37.518 16.299  25.358 1.00 35.77  ? 202 VAL A CA    1 
ATOM   560  C C     . VAL A 1 60  ? 37.724 15.018  24.579 1.00 35.44  ? 202 VAL A C     1 
ATOM   561  O O     . VAL A 1 60  ? 37.684 13.921  25.158 1.00 31.85  ? 202 VAL A O     1 
ATOM   562  C CB    . VAL A 1 60  ? 38.791 16.669  26.189 1.00 33.06  ? 202 VAL A CB    1 
ATOM   563  C CG1   . VAL A 1 60  ? 40.041 16.731  25.323 1.00 25.68  ? 202 VAL A CG1   1 
ATOM   564  C CG2   . VAL A 1 60  ? 38.573 18.049  26.830 1.00 32.05  ? 202 VAL A CG2   1 
ATOM   565  H H     . VAL A 1 60  ? 36.456 15.407  26.941 1.00 0.00   ? 202 VAL A H     1 
ATOM   566  N N     . LYS A 1 61  ? 37.955 15.141  23.266 1.00 35.04  ? 203 LYS A N     1 
ATOM   567  C CA    . LYS A 1 61  ? 38.396 13.992  22.462 1.00 30.56  ? 203 LYS A CA    1 
ATOM   568  C C     . LYS A 1 61  ? 39.867 14.151  22.093 1.00 28.21  ? 203 LYS A C     1 
ATOM   569  O O     . LYS A 1 61  ? 40.391 15.239  21.907 1.00 29.09  ? 203 LYS A O     1 
ATOM   570  C CB    . LYS A 1 61  ? 37.519 13.879  21.225 1.00 31.06  ? 203 LYS A CB    1 
ATOM   571  C CG    . LYS A 1 61  ? 36.118 13.589  21.731 1.00 29.60  ? 203 LYS A CG    1 
ATOM   572  C CD    . LYS A 1 61  ? 35.081 13.542  20.671 1.00 33.25  ? 203 LYS A CD    1 
ATOM   573  C CE    . LYS A 1 61  ? 33.698 13.761  21.299 1.00 34.82  ? 203 LYS A CE    1 
ATOM   574  N NZ    . LYS A 1 61  ? 33.481 12.832  22.380 1.00 37.03  ? 203 LYS A NZ    1 
ATOM   575  H H     . LYS A 1 61  ? 37.828 16.011  22.834 1.00 0.00   ? 203 LYS A H     1 
ATOM   576  H HZ1   . LYS A 1 61  ? 33.537 11.859  22.017 1.00 0.00   ? 203 LYS A HZ1   1 
ATOM   577  H HZ2   . LYS A 1 61  ? 34.209 12.972  23.110 1.00 0.00   ? 203 LYS A HZ2   1 
ATOM   578  H HZ3   . LYS A 1 61  ? 32.540 12.994  22.793 1.00 0.00   ? 203 LYS A HZ3   1 
ATOM   579  N N     . HIS A 1 62  ? 40.615 13.077  22.224 1.00 27.99  ? 204 HIS A N     1 
ATOM   580  C CA    . HIS A 1 62  ? 42.022 13.043  21.950 1.00 27.26  ? 204 HIS A CA    1 
ATOM   581  C C     . HIS A 1 62  ? 42.273 12.201  20.669 1.00 28.54  ? 204 HIS A C     1 
ATOM   582  O O     . HIS A 1 62  ? 41.820 11.062  20.567 1.00 25.77  ? 204 HIS A O     1 
ATOM   583  C CB    . HIS A 1 62  ? 42.721 12.421  23.144 1.00 28.30  ? 204 HIS A CB    1 
ATOM   584  C CG    . HIS A 1 62  ? 42.497 13.146  24.470 1.00 35.42  ? 204 HIS A CG    1 
ATOM   585  N ND1   . HIS A 1 62  ? 43.129 14.196  25.026 1.00 34.81  ? 204 HIS A ND1   1 
ATOM   586  C CD2   . HIS A 1 62  ? 41.503 12.792  25.325 1.00 33.49  ? 204 HIS A CD2   1 
ATOM   587  C CE1   . HIS A 1 62  ? 42.544 14.490  26.160 1.00 30.93  ? 204 HIS A CE1   1 
ATOM   588  N NE2   . HIS A 1 62  ? 41.586 13.619  26.312 1.00 33.10  ? 204 HIS A NE2   1 
ATOM   589  H H     . HIS A 1 62  ? 40.185 12.251  22.527 1.00 0.00   ? 204 HIS A H     1 
ATOM   590  H HD1   . HIS A 1 62  ? 43.897 14.662  24.646 1.00 0.00   ? 204 HIS A HD1   1 
ATOM   591  H HE2   . HIS A 1 62  ? 40.994 13.595  27.090 1.00 0.00   ? 204 HIS A HE2   1 
ATOM   592  N N     . TYR A 1 63  ? 42.981 12.738  19.671 1.00 26.29  ? 205 TYR A N     1 
ATOM   593  C CA    . TYR A 1 63  ? 43.296 12.060  18.408 1.00 23.06  ? 205 TYR A CA    1 
ATOM   594  C C     . TYR A 1 63  ? 44.785 11.930  18.325 1.00 23.09  ? 205 TYR A C     1 
ATOM   595  O O     . TYR A 1 63  ? 45.518 12.917  18.465 1.00 26.13  ? 205 TYR A O     1 
ATOM   596  C CB    . TYR A 1 63  ? 42.875 12.868  17.209 1.00 18.91  ? 205 TYR A CB    1 
ATOM   597  C CG    . TYR A 1 63  ? 41.412 13.167  17.193 1.00 18.99  ? 205 TYR A CG    1 
ATOM   598  C CD1   . TYR A 1 63  ? 40.542 12.197  16.710 1.00 22.69  ? 205 TYR A CD1   1 
ATOM   599  C CD2   . TYR A 1 63  ? 40.920 14.360  17.748 1.00 21.67  ? 205 TYR A CD2   1 
ATOM   600  C CE1   . TYR A 1 63  ? 39.169 12.432  16.741 1.00 24.10  ? 205 TYR A CE1   1 
ATOM   601  C CE2   . TYR A 1 63  ? 39.542 14.590  17.794 1.00 20.55  ? 205 TYR A CE2   1 
ATOM   602  C CZ    . TYR A 1 63  ? 38.679 13.613  17.322 1.00 24.77  ? 205 TYR A CZ    1 
ATOM   603  O OH    . TYR A 1 63  ? 37.330 13.853  17.347 1.00 23.36  ? 205 TYR A OH    1 
ATOM   604  H H     . TYR A 1 63  ? 43.314 13.651  19.791 1.00 0.00   ? 205 TYR A H     1 
ATOM   605  H HH    . TYR A 1 63  ? 37.162 14.696  17.775 1.00 0.00   ? 205 TYR A HH    1 
ATOM   606  N N     . LYS A 1 64  ? 45.302 10.730  18.211 1.00 20.62  ? 206 LYS A N     1 
ATOM   607  C CA    . LYS A 1 64  ? 46.717 10.576  18.002 1.00 21.81  ? 206 LYS A CA    1 
ATOM   608  C C     . LYS A 1 64  ? 47.065 11.203  16.649 1.00 21.80  ? 206 LYS A C     1 
ATOM   609  O O     . LYS A 1 64  ? 46.251 11.164  15.726 1.00 21.36  ? 206 LYS A O     1 
ATOM   610  C CB    . LYS A 1 64  ? 47.038 9.098   17.981 1.00 26.38  ? 206 LYS A CB    1 
ATOM   611  C CG    . LYS A 1 64  ? 48.524 8.757   17.861 1.00 33.39  ? 206 LYS A CG    1 
ATOM   612  C CD    . LYS A 1 64  ? 49.080 8.515   19.238 1.00 40.15  ? 206 LYS A CD    1 
ATOM   613  C CE    . LYS A 1 64  ? 48.383 7.311   19.776 1.00 41.52  ? 206 LYS A CE    1 
ATOM   614  N NZ    . LYS A 1 64  ? 48.550 7.335   21.181 1.00 45.45  ? 206 LYS A NZ    1 
ATOM   615  H H     . LYS A 1 64  ? 44.725 9.940   18.268 1.00 0.00   ? 206 LYS A H     1 
ATOM   616  H HZ1   . LYS A 1 64  ? 49.564 7.307   21.410 1.00 0.00   ? 206 LYS A HZ1   1 
ATOM   617  H HZ2   . LYS A 1 64  ? 48.131 8.206   21.566 1.00 0.00   ? 206 LYS A HZ2   1 
ATOM   618  H HZ3   . LYS A 1 64  ? 48.078 6.509   21.600 1.00 0.00   ? 206 LYS A HZ3   1 
ATOM   619  N N     . ILE A 1 65  ? 48.246 11.778  16.513 1.00 20.20  ? 207 ILE A N     1 
ATOM   620  C CA    . ILE A 1 65  ? 48.744 12.236  15.241 1.00 24.26  ? 207 ILE A CA    1 
ATOM   621  C C     . ILE A 1 65  ? 50.017 11.422  15.073 1.00 25.74  ? 207 ILE A C     1 
ATOM   622  O O     . ILE A 1 65  ? 50.910 11.462  15.943 1.00 26.03  ? 207 ILE A O     1 
ATOM   623  C CB    . ILE A 1 65  ? 49.120 13.745  15.254 1.00 22.77  ? 207 ILE A CB    1 
ATOM   624  C CG1   . ILE A 1 65  ? 47.892 14.629  15.504 1.00 20.56  ? 207 ILE A CG1   1 
ATOM   625  C CG2   . ILE A 1 65  ? 49.843 14.050  13.940 1.00 20.58  ? 207 ILE A CG2   1 
ATOM   626  C CD1   . ILE A 1 65  ? 48.310 16.044  15.975 1.00 20.67  ? 207 ILE A CD1   1 
ATOM   627  H H     . ILE A 1 65  ? 48.806 11.898  17.308 1.00 0.00   ? 207 ILE A H     1 
ATOM   628  N N     . ARG A 1 66  ? 50.117 10.654  13.987 1.00 25.86  ? 208 ARG A N     1 
ATOM   629  C CA    . ARG A 1 66  ? 51.314 9.867   13.772 1.00 28.39  ? 208 ARG A CA    1 
ATOM   630  C C     . ARG A 1 66  ? 52.192 10.521  12.730 1.00 27.47  ? 208 ARG A C     1 
ATOM   631  O O     . ARG A 1 66  ? 51.684 11.175  11.814 1.00 26.56  ? 208 ARG A O     1 
ATOM   632  C CB    . ARG A 1 66  ? 50.973 8.495   13.259 1.00 29.17  ? 208 ARG A CB    1 
ATOM   633  C CG    . ARG A 1 66  ? 50.003 7.723   14.072 1.00 28.32  ? 208 ARG A CG    1 
ATOM   634  C CD    . ARG A 1 66  ? 50.729 6.628   14.761 1.00 26.70  ? 208 ARG A CD    1 
ATOM   635  N NE    . ARG A 1 66  ? 49.755 5.940   15.574 1.00 33.81  ? 208 ARG A NE    1 
ATOM   636  C CZ    . ARG A 1 66  ? 50.055 4.978   16.444 1.00 30.87  ? 208 ARG A CZ    1 
ATOM   637  N NH1   . ARG A 1 66  ? 51.308 4.590   16.612 1.00 27.31  ? 208 ARG A NH1   1 
ATOM   638  N NH2   . ARG A 1 66  ? 49.054 4.452   17.170 1.00 30.06  ? 208 ARG A NH2   1 
ATOM   639  H H     . ARG A 1 66  ? 49.384 10.622  13.337 1.00 0.00   ? 208 ARG A H     1 
ATOM   640  H HE    . ARG A 1 66  ? 48.815 6.197   15.480 1.00 0.00   ? 208 ARG A HE    1 
ATOM   641  H HH11  . ARG A 1 66  ? 52.040 5.020   16.083 1.00 0.00   ? 208 ARG A HH11  1 
ATOM   642  H HH12  . ARG A 1 66  ? 51.524 3.867   17.268 1.00 0.00   ? 208 ARG A HH12  1 
ATOM   643  H HH21  . ARG A 1 66  ? 48.119 4.785   17.048 1.00 0.00   ? 208 ARG A HH21  1 
ATOM   644  H HH22  . ARG A 1 66  ? 49.244 3.728   17.833 1.00 0.00   ? 208 ARG A HH22  1 
ATOM   645  N N     . LYS A 1 67  ? 53.494 10.314  12.847 1.00 28.98  ? 209 LYS A N     1 
ATOM   646  C CA    . LYS A 1 67  ? 54.442 10.824  11.880 1.00 31.75  ? 209 LYS A CA    1 
ATOM   647  C C     . LYS A 1 67  ? 54.882 9.680   10.962 1.00 32.62  ? 209 LYS A C     1 
ATOM   648  O O     . LYS A 1 67  ? 55.110 8.563   11.436 1.00 31.05  ? 209 LYS A O     1 
ATOM   649  C CB    . LYS A 1 67  ? 55.639 11.402  12.597 1.00 30.51  ? 209 LYS A CB    1 
ATOM   650  C CG    . LYS A 1 67  ? 56.482 12.189  11.610 1.00 33.27  ? 209 LYS A CG    1 
ATOM   651  C CD    . LYS A 1 67  ? 57.538 12.949  12.352 1.00 37.74  ? 209 LYS A CD    1 
ATOM   652  C CE    . LYS A 1 67  ? 58.409 13.695  11.350 1.00 42.58  ? 209 LYS A CE    1 
ATOM   653  N NZ    . LYS A 1 67  ? 59.590 14.211  12.031 1.00 41.21  ? 209 LYS A NZ    1 
ATOM   654  H H     . LYS A 1 67  ? 53.826 9.800   13.612 1.00 0.00   ? 209 LYS A H     1 
ATOM   655  H HZ1   . LYS A 1 67  ? 60.128 13.421  12.440 1.00 0.00   ? 209 LYS A HZ1   1 
ATOM   656  H HZ2   . LYS A 1 67  ? 60.188 14.722  11.350 1.00 0.00   ? 209 LYS A HZ2   1 
ATOM   657  H HZ3   . LYS A 1 67  ? 59.297 14.860  12.789 1.00 0.00   ? 209 LYS A HZ3   1 
ATOM   658  N N     . LEU A 1 68  ? 54.904 9.936   9.642  1.00 32.05  ? 210 LEU A N     1 
ATOM   659  C CA    . LEU A 1 68  ? 55.260 8.958   8.615  1.00 32.07  ? 210 LEU A CA    1 
ATOM   660  C C     . LEU A 1 68  ? 56.716 9.044   8.399  1.00 36.67  ? 210 LEU A C     1 
ATOM   661  O O     . LEU A 1 68  ? 57.244 10.134  8.574  1.00 41.65  ? 210 LEU A O     1 
ATOM   662  C CB    . LEU A 1 68  ? 54.584 9.286   7.339  1.00 28.20  ? 210 LEU A CB    1 
ATOM   663  C CG    . LEU A 1 68  ? 53.064 9.228   7.368  1.00 33.72  ? 210 LEU A CG    1 
ATOM   664  C CD1   . LEU A 1 68  ? 52.496 10.078  6.241  1.00 31.63  ? 210 LEU A CD1   1 
ATOM   665  C CD2   . LEU A 1 68  ? 52.595 7.775   7.217  1.00 32.32  ? 210 LEU A CD2   1 
ATOM   666  H H     . LEU A 1 68  ? 54.665 10.839  9.349  1.00 0.00   ? 210 LEU A H     1 
ATOM   667  N N     . ASP A 1 69  ? 57.388 8.037   7.857  1.00 42.35  ? 211 ASP A N     1 
ATOM   668  C CA    . ASP A 1 69  ? 58.834 8.095   7.658  1.00 44.67  ? 211 ASP A CA    1 
ATOM   669  C C     . ASP A 1 69  ? 59.233 9.174   6.659  1.00 45.16  ? 211 ASP A C     1 
ATOM   670  O O     . ASP A 1 69  ? 60.312 9.744   6.753  1.00 44.51  ? 211 ASP A O     1 
ATOM   671  C CB    . ASP A 1 69  ? 59.330 6.752   7.182  1.00 51.32  ? 211 ASP A CB    1 
ATOM   672  C CG    . ASP A 1 69  ? 59.085 5.630   8.223  1.00 62.44  ? 211 ASP A CG    1 
ATOM   673  O OD1   . ASP A 1 69  ? 59.119 5.918   9.430  1.00 66.39  ? 211 ASP A OD1   1 
ATOM   674  O OD2   . ASP A 1 69  ? 58.851 4.463   7.832  1.00 67.38  ? 211 ASP A OD2   1 
ATOM   675  H H     . ASP A 1 69  ? 56.901 7.232   7.583  1.00 0.00   ? 211 ASP A H     1 
ATOM   676  N N     . SER A 1 70  ? 58.328 9.574   5.742  1.00 46.25  ? 212 SER A N     1 
ATOM   677  C CA    . SER A 1 70  ? 58.554 10.700  4.819  1.00 42.48  ? 212 SER A CA    1 
ATOM   678  C C     . SER A 1 70  ? 58.663 12.006  5.575  1.00 41.78  ? 212 SER A C     1 
ATOM   679  O O     . SER A 1 70  ? 59.136 12.988  5.028  1.00 42.81  ? 212 SER A O     1 
ATOM   680  C CB    . SER A 1 70  ? 57.401 10.878  3.841  1.00 39.41  ? 212 SER A CB    1 
ATOM   681  O OG    . SER A 1 70  ? 56.189 11.242  4.535  1.00 40.93  ? 212 SER A OG    1 
ATOM   682  H H     . SER A 1 70  ? 57.477 9.091   5.687  1.00 0.00   ? 212 SER A H     1 
ATOM   683  H HG    . SER A 1 70  ? 55.959 10.552  5.161  1.00 0.00   ? 212 SER A HG    1 
ATOM   684  N N     . GLY A 1 71  ? 58.076 12.061  6.765  1.00 39.56  ? 213 GLY A N     1 
ATOM   685  C CA    . GLY A 1 71  ? 58.117 13.255  7.579  1.00 38.40  ? 213 GLY A CA    1 
ATOM   686  C C     . GLY A 1 71  ? 56.720 13.837  7.755  1.00 38.71  ? 213 GLY A C     1 
ATOM   687  O O     . GLY A 1 71  ? 56.526 14.731  8.587  1.00 41.49  ? 213 GLY A O     1 
ATOM   688  H H     . GLY A 1 71  ? 57.603 11.271  7.100  1.00 0.00   ? 213 GLY A H     1 
ATOM   689  N N     . GLY A 1 72  ? 55.720 13.304  7.037  1.00 32.79  ? 214 GLY A N     1 
ATOM   690  C CA    . GLY A 1 72  ? 54.369 13.814  7.158  1.00 31.63  ? 214 GLY A CA    1 
ATOM   691  C C     . GLY A 1 72  ? 53.649 13.367  8.436  1.00 30.17  ? 214 GLY A C     1 
ATOM   692  O O     . GLY A 1 72  ? 54.160 12.606  9.259  1.00 30.83  ? 214 GLY A O     1 
ATOM   693  H H     . GLY A 1 72  ? 55.905 12.562  6.424  1.00 0.00   ? 214 GLY A H     1 
ATOM   694  N N     . PHE A 1 73  ? 52.405 13.782  8.582  1.00 27.96  ? 215 PHE A N     1 
ATOM   695  C CA    . PHE A 1 73  ? 51.632 13.504  9.771  1.00 26.68  ? 215 PHE A CA    1 
ATOM   696  C C     . PHE A 1 73  ? 50.236 13.116  9.365  1.00 25.60  ? 215 PHE A C     1 
ATOM   697  O O     . PHE A 1 73  ? 49.762 13.515  8.284  1.00 27.94  ? 215 PHE A O     1 
ATOM   698  C CB    . PHE A 1 73  ? 51.556 14.746  10.652 1.00 26.24  ? 215 PHE A CB    1 
ATOM   699  C CG    . PHE A 1 73  ? 52.901 15.205  11.208 1.00 26.50  ? 215 PHE A CG    1 
ATOM   700  C CD1   . PHE A 1 73  ? 53.387 14.658  12.398 1.00 24.15  ? 215 PHE A CD1   1 
ATOM   701  C CD2   . PHE A 1 73  ? 53.672 16.129  10.486 1.00 26.78  ? 215 PHE A CD2   1 
ATOM   702  C CE1   . PHE A 1 73  ? 54.631 15.054  12.870 1.00 25.56  ? 215 PHE A CE1   1 
ATOM   703  C CE2   . PHE A 1 73  ? 54.916 16.524  10.967 1.00 27.58  ? 215 PHE A CE2   1 
ATOM   704  C CZ    . PHE A 1 73  ? 55.400 15.978  12.154 1.00 29.11  ? 215 PHE A CZ    1 
ATOM   705  H H     . PHE A 1 73  ? 51.991 14.297  7.859  1.00 0.00   ? 215 PHE A H     1 
ATOM   706  N N     . TYR A 1 74  ? 49.510 12.350  10.187 1.00 24.19  ? 216 TYR A N     1 
ATOM   707  C CA    . TYR A 1 74  ? 48.121 12.042  9.851  1.00 22.55  ? 216 TYR A CA    1 
ATOM   708  C C     . TYR A 1 74  ? 47.363 11.649  11.125 1.00 20.10  ? 216 TYR A C     1 
ATOM   709  O O     . TYR A 1 74  ? 47.975 11.254  12.124 1.00 21.97  ? 216 TYR A O     1 
ATOM   710  C CB    . TYR A 1 74  ? 48.051 10.849  8.760  1.00 24.03  ? 216 TYR A CB    1 
ATOM   711  C CG    . TYR A 1 74  ? 48.416 9.439   9.316  1.00 22.26  ? 216 TYR A CG    1 
ATOM   712  C CD1   . TYR A 1 74  ? 47.437 8.656   9.958  1.00 20.55  ? 216 TYR A CD1   1 
ATOM   713  C CD2   . TYR A 1 74  ? 49.746 9.005   9.279  1.00 21.19  ? 216 TYR A CD2   1 
ATOM   714  C CE1   . TYR A 1 74  ? 47.801 7.423   10.503 1.00 20.38  ? 216 TYR A CE1   1 
ATOM   715  C CE2   . TYR A 1 74  ? 50.112 7.784   9.807  1.00 18.98  ? 216 TYR A CE2   1 
ATOM   716  C CZ    . TYR A 1 74  ? 49.119 6.999   10.387 1.00 19.43  ? 216 TYR A CZ    1 
ATOM   717  O OH    . TYR A 1 74  ? 49.480 5.791   10.920 1.00 24.32  ? 216 TYR A OH    1 
ATOM   718  H H     . TYR A 1 74  ? 49.907 11.997  11.010 1.00 0.00   ? 216 TYR A H     1 
ATOM   719  H HH    . TYR A 1 74  ? 50.424 5.660   10.806 1.00 0.00   ? 216 TYR A HH    1 
ATOM   720  N N     . ILE A 1 75  ? 46.037 11.773  11.026 1.00 21.11  ? 217 ILE A N     1 
ATOM   721  C CA    . ILE A 1 75  ? 45.063 11.294  11.965 1.00 20.66  ? 217 ILE A CA    1 
ATOM   722  C C     . ILE A 1 75  ? 44.206 10.243  11.241 1.00 22.97  ? 217 ILE A C     1 
ATOM   723  O O     . ILE A 1 75  ? 43.759 9.246   11.832 1.00 22.71  ? 217 ILE A O     1 
ATOM   724  C CB    . ILE A 1 75  ? 44.184 12.472  12.459 1.00 18.55  ? 217 ILE A CB    1 
ATOM   725  C CG1   . ILE A 1 75  ? 45.040 13.430  13.257 1.00 19.15  ? 217 ILE A CG1   1 
ATOM   726  C CG2   . ILE A 1 75  ? 43.033 11.972  13.355 1.00 21.13  ? 217 ILE A CG2   1 
ATOM   727  C CD1   . ILE A 1 75  ? 44.247 14.661  13.816 1.00 22.08  ? 217 ILE A CD1   1 
ATOM   728  H H     . ILE A 1 75  ? 45.696 12.236  10.235 1.00 0.00   ? 217 ILE A H     1 
ATOM   729  N N     . THR A 1 76  ? 43.883 10.413  9.954  1.00 26.09  ? 218 THR A N     1 
ATOM   730  C CA    . THR A 1 76  ? 43.068 9.430   9.205  1.00 27.75  ? 218 THR A CA    1 
ATOM   731  C C     . THR A 1 76  ? 43.754 9.099   7.881  1.00 29.04  ? 218 THR A C     1 
ATOM   732  O O     . THR A 1 76  ? 44.698 9.801   7.477  1.00 26.37  ? 218 THR A O     1 
ATOM   733  C CB    . THR A 1 76  ? 41.633 9.949   8.866  1.00 28.57  ? 218 THR A CB    1 
ATOM   734  O OG1   . THR A 1 76  ? 41.720 10.875  7.762  1.00 26.33  ? 218 THR A OG1   1 
ATOM   735  C CG2   . THR A 1 76  ? 40.978 10.581  10.105 1.00 29.85  ? 218 THR A CG2   1 
ATOM   736  H H     . THR A 1 76  ? 44.197 11.217  9.490  1.00 0.00   ? 218 THR A H     1 
ATOM   737  H HG1   . THR A 1 76  ? 42.093 10.429  6.998  1.00 0.00   ? 218 THR A HG1   1 
ATOM   738  N N     . SER A 1 77  ? 43.215 8.086   7.174  1.00 26.44  ? 219 SER A N     1 
ATOM   739  C CA    . SER A 1 77  ? 43.684 7.654   5.841  1.00 25.95  ? 219 SER A CA    1 
ATOM   740  C C     . SER A 1 77  ? 43.242 8.590   4.708  1.00 24.10  ? 219 SER A C     1 
ATOM   741  O O     . SER A 1 77  ? 43.660 8.478   3.545  1.00 25.27  ? 219 SER A O     1 
ATOM   742  C CB    . SER A 1 77  ? 43.141 6.269   5.542  1.00 23.17  ? 219 SER A CB    1 
ATOM   743  O OG    . SER A 1 77  ? 41.752 6.308   5.739  1.00 25.85  ? 219 SER A OG    1 
ATOM   744  H H     . SER A 1 77  ? 42.461 7.603   7.571  1.00 0.00   ? 219 SER A H     1 
ATOM   745  H HG    . SER A 1 77  ? 41.378 5.443   5.557  1.00 0.00   ? 219 SER A HG    1 
ATOM   746  N N     . ARG A 1 78  ? 42.329 9.494   5.037  1.00 22.50  ? 220 ARG A N     1 
ATOM   747  C CA    . ARG A 1 78  ? 41.762 10.413  4.074  1.00 27.75  ? 220 ARG A CA    1 
ATOM   748  C C     . ARG A 1 78  ? 42.773 11.437  3.621  1.00 28.34  ? 220 ARG A C     1 
ATOM   749  O O     . ARG A 1 78  ? 42.944 11.662  2.432  1.00 31.71  ? 220 ARG A O     1 
ATOM   750  C CB    . ARG A 1 78  ? 40.535 11.078  4.693  1.00 29.55  ? 220 ARG A CB    1 
ATOM   751  C CG    . ARG A 1 78  ? 39.445 11.415  3.716  1.00 38.18  ? 220 ARG A CG    1 
ATOM   752  C CD    . ARG A 1 78  ? 38.248 12.118  4.385  1.00 43.37  ? 220 ARG A CD    1 
ATOM   753  N NE    . ARG A 1 78  ? 37.382 12.843  3.442  1.00 48.48  ? 220 ARG A NE    1 
ATOM   754  C CZ    . ARG A 1 78  ? 37.771 13.978  2.816  1.00 52.68  ? 220 ARG A CZ    1 
ATOM   755  N NH1   . ARG A 1 78  ? 38.974 14.505  3.008  1.00 57.14  ? 220 ARG A NH1   1 
ATOM   756  N NH2   . ARG A 1 78  ? 36.958 14.627  1.975  1.00 54.82  ? 220 ARG A NH2   1 
ATOM   757  H H     . ARG A 1 78  ? 42.027 9.541   5.968  1.00 0.00   ? 220 ARG A H     1 
ATOM   758  H HE    . ARG A 1 78  ? 36.487 12.489  3.260  1.00 0.00   ? 220 ARG A HE    1 
ATOM   759  H HH11  . ARG A 1 78  ? 39.621 14.062  3.629  1.00 0.00   ? 220 ARG A HH11  1 
ATOM   760  H HH12  . ARG A 1 78  ? 39.234 15.345  2.531  1.00 0.00   ? 220 ARG A HH12  1 
ATOM   761  H HH21  . ARG A 1 78  ? 36.039 14.275  1.797  1.00 0.00   ? 220 ARG A HH21  1 
ATOM   762  H HH22  . ARG A 1 78  ? 37.269 15.464  1.525  1.00 0.00   ? 220 ARG A HH22  1 
ATOM   763  N N     . THR A 1 79  ? 43.519 12.006  4.548  1.00 28.22  ? 221 THR A N     1 
ATOM   764  C CA    . THR A 1 79  ? 44.459 13.071  4.259  1.00 31.55  ? 221 THR A CA    1 
ATOM   765  C C     . THR A 1 79  ? 45.706 12.948  5.099  1.00 32.86  ? 221 THR A C     1 
ATOM   766  O O     . THR A 1 79  ? 45.631 12.479  6.235  1.00 35.53  ? 221 THR A O     1 
ATOM   767  C CB    . THR A 1 79  ? 43.851 14.522  4.502  1.00 31.87  ? 221 THR A CB    1 
ATOM   768  O OG1   . THR A 1 79  ? 42.540 14.491  4.002  1.00 36.27  ? 221 THR A OG1   1 
ATOM   769  C CG2   . THR A 1 79  ? 44.637 15.616  3.805  1.00 28.08  ? 221 THR A CG2   1 
ATOM   770  H H     . THR A 1 79  ? 43.434 11.695  5.473  1.00 0.00   ? 221 THR A H     1 
ATOM   771  H HG1   . THR A 1 79  ? 42.559 14.279  3.066  1.00 0.00   ? 221 THR A HG1   1 
ATOM   772  N N     . GLN A 1 80  ? 46.882 13.333  4.576  1.00 31.82  ? 222 GLN A N     1 
ATOM   773  C CA    . GLN A 1 80  ? 48.108 13.444  5.379  1.00 32.39  ? 222 GLN A CA    1 
ATOM   774  C C     . GLN A 1 80  ? 48.696 14.848  5.143  1.00 32.59  ? 222 GLN A C     1 
ATOM   775  O O     . GLN A 1 80  ? 48.233 15.590  4.245  1.00 32.23  ? 222 GLN A O     1 
ATOM   776  C CB    . GLN A 1 80  ? 49.148 12.353  5.016  1.00 31.67  ? 222 GLN A CB    1 
ATOM   777  C CG    . GLN A 1 80  ? 49.880 12.494  3.717  1.00 36.54  ? 222 GLN A CG    1 
ATOM   778  C CD    . GLN A 1 80  ? 50.848 11.353  3.403  1.00 43.27  ? 222 GLN A CD    1 
ATOM   779  O OE1   . GLN A 1 80  ? 52.071 11.478  3.453  1.00 43.73  ? 222 GLN A OE1   1 
ATOM   780  N NE2   . GLN A 1 80  ? 50.369 10.150  3.088  1.00 42.76  ? 222 GLN A NE2   1 
ATOM   781  H H     . GLN A 1 80  ? 46.924 13.548  3.621  1.00 0.00   ? 222 GLN A H     1 
ATOM   782  H HE21  . GLN A 1 80  ? 51.017 9.442   2.893  1.00 0.00   ? 222 GLN A HE21  1 
ATOM   783  H HE22  . GLN A 1 80  ? 49.401 10.000  3.059  1.00 0.00   ? 222 GLN A HE22  1 
ATOM   784  N N     . PHE A 1 81  ? 49.654 15.286  5.964  1.00 30.29  ? 223 PHE A N     1 
ATOM   785  C CA    . PHE A 1 81  ? 50.102 16.673  5.944  1.00 30.34  ? 223 PHE A CA    1 
ATOM   786  C C     . PHE A 1 81  ? 51.582 16.719  6.125  1.00 30.86  ? 223 PHE A C     1 
ATOM   787  O O     . PHE A 1 81  ? 52.154 15.880  6.806  1.00 31.42  ? 223 PHE A O     1 
ATOM   788  C CB    . PHE A 1 81  ? 49.451 17.473  7.073  1.00 23.29  ? 223 PHE A CB    1 
ATOM   789  C CG    . PHE A 1 81  ? 47.948 17.337  7.073  1.00 28.26  ? 223 PHE A CG    1 
ATOM   790  C CD1   . PHE A 1 81  ? 47.170 18.139  6.240  1.00 27.88  ? 223 PHE A CD1   1 
ATOM   791  C CD2   . PHE A 1 81  ? 47.335 16.369  7.889  1.00 28.34  ? 223 PHE A CD2   1 
ATOM   792  C CE1   . PHE A 1 81  ? 45.787 17.968  6.229  1.00 28.78  ? 223 PHE A CE1   1 
ATOM   793  C CE2   . PHE A 1 81  ? 45.946 16.217  7.863  1.00 24.07  ? 223 PHE A CE2   1 
ATOM   794  C CZ    . PHE A 1 81  ? 45.164 17.016  7.035  1.00 27.30  ? 223 PHE A CZ    1 
ATOM   795  H H     . PHE A 1 81  ? 50.066 14.660  6.595  1.00 0.00   ? 223 PHE A H     1 
ATOM   796  N N     . ASN A 1 82  ? 52.244 17.703  5.525  1.00 32.39  ? 224 ASN A N     1 
ATOM   797  C CA    . ASN A 1 82  ? 53.692 17.834  5.664  1.00 35.41  ? 224 ASN A CA    1 
ATOM   798  C C     . ASN A 1 82  ? 54.173 18.449  6.986  1.00 31.61  ? 224 ASN A C     1 
ATOM   799  O O     . ASN A 1 82  ? 55.372 18.535  7.273  1.00 28.31  ? 224 ASN A O     1 
ATOM   800  C CB    . ASN A 1 82  ? 54.209 18.671  4.489  1.00 41.55  ? 224 ASN A CB    1 
ATOM   801  C CG    . ASN A 1 82  ? 54.224 17.862  3.206  1.00 48.89  ? 224 ASN A CG    1 
ATOM   802  O OD1   . ASN A 1 82  ? 54.308 16.625  3.198  1.00 51.26  ? 224 ASN A OD1   1 
ATOM   803  N ND2   . ASN A 1 82  ? 54.112 18.518  2.058  1.00 55.83  ? 224 ASN A ND2   1 
ATOM   804  H H     . ASN A 1 82  ? 51.752 18.352  4.980  1.00 0.00   ? 224 ASN A H     1 
ATOM   805  H HD21  . ASN A 1 82  ? 54.122 17.991  1.233  1.00 0.00   ? 224 ASN A HD21  1 
ATOM   806  H HD22  . ASN A 1 82  ? 54.023 19.494  2.058  1.00 0.00   ? 224 ASN A HD22  1 
ATOM   807  N N     . SER A 1 83  ? 53.238 18.942  7.805  1.00 30.84  ? 225 SER A N     1 
ATOM   808  C CA    . SER A 1 83  ? 53.590 19.583  9.061  1.00 31.46  ? 225 SER A CA    1 
ATOM   809  C C     . SER A 1 83  ? 52.359 19.593  9.991  1.00 29.26  ? 225 SER A C     1 
ATOM   810  O O     . SER A 1 83  ? 51.214 19.585  9.561  1.00 29.46  ? 225 SER A O     1 
ATOM   811  C CB    . SER A 1 83  ? 54.056 21.059  8.791  1.00 27.12  ? 225 SER A CB    1 
ATOM   812  O OG    . SER A 1 83  ? 52.934 21.880  8.387  1.00 29.01  ? 225 SER A OG    1 
ATOM   813  H H     . SER A 1 83  ? 52.294 18.869  7.553  1.00 0.00   ? 225 SER A H     1 
ATOM   814  H HG    . SER A 1 83  ? 52.549 21.523  7.583  1.00 0.00   ? 225 SER A HG    1 
ATOM   815  N N     . LEU A 1 84  ? 52.535 19.740  11.283 1.00 27.23  ? 226 LEU A N     1 
ATOM   816  C CA    . LEU A 1 84  ? 51.471 19.915  12.211 1.00 27.45  ? 226 LEU A CA    1 
ATOM   817  C C     . LEU A 1 84  ? 50.762 21.205  11.935 1.00 25.86  ? 226 LEU A C     1 
ATOM   818  O O     . LEU A 1 84  ? 49.533 21.242  11.956 1.00 26.65  ? 226 LEU A O     1 
ATOM   819  C CB    . LEU A 1 84  ? 52.077 19.895  13.634 1.00 28.73  ? 226 LEU A CB    1 
ATOM   820  C CG    . LEU A 1 84  ? 52.555 18.496  14.042 1.00 26.68  ? 226 LEU A CG    1 
ATOM   821  C CD1   . LEU A 1 84  ? 53.399 18.603  15.282 1.00 24.69  ? 226 LEU A CD1   1 
ATOM   822  C CD2   . LEU A 1 84  ? 51.333 17.568  14.178 1.00 22.51  ? 226 LEU A CD2   1 
ATOM   823  H H     . LEU A 1 84  ? 53.452 19.729  11.628 1.00 0.00   ? 226 LEU A H     1 
ATOM   824  N N     . GLN A 1 85  ? 51.494 22.247  11.538 1.00 28.45  ? 227 GLN A N     1 
ATOM   825  C CA    . GLN A 1 85  ? 50.887 23.522  11.168 1.00 31.23  ? 227 GLN A CA    1 
ATOM   826  C C     . GLN A 1 85  ? 49.839 23.361  10.066 1.00 26.97  ? 227 GLN A C     1 
ATOM   827  O O     . GLN A 1 85  ? 48.704 23.851  10.144 1.00 29.08  ? 227 GLN A O     1 
ATOM   828  C CB    . GLN A 1 85  ? 51.973 24.522  10.704 1.00 38.13  ? 227 GLN A CB    1 
ATOM   829  C CG    . GLN A 1 85  ? 53.022 24.944  11.746 1.00 41.57  ? 227 GLN A CG    1 
ATOM   830  C CD    . GLN A 1 85  ? 54.102 23.905  12.167 1.00 48.42  ? 227 GLN A CD    1 
ATOM   831  O OE1   . GLN A 1 85  ? 54.159 22.745  11.705 1.00 40.87  ? 227 GLN A OE1   1 
ATOM   832  N NE2   . GLN A 1 85  ? 55.091 24.282  12.991 1.00 49.69  ? 227 GLN A NE2   1 
ATOM   833  H H     . GLN A 1 85  ? 52.468 22.154  11.493 1.00 0.00   ? 227 GLN A H     1 
ATOM   834  H HE21  . GLN A 1 85  ? 55.756 23.607  13.238 1.00 0.00   ? 227 GLN A HE21  1 
ATOM   835  H HE22  . GLN A 1 85  ? 55.129 25.204  13.322 1.00 0.00   ? 227 GLN A HE22  1 
ATOM   836  N N     . GLN A 1 86  ? 50.173 22.556  9.060  1.00 30.76  ? 228 GLN A N     1 
ATOM   837  C CA    . GLN A 1 86  ? 49.241 22.288  7.959  1.00 28.79  ? 228 GLN A CA    1 
ATOM   838  C C     . GLN A 1 86  ? 48.088 21.397  8.348  1.00 26.26  ? 228 GLN A C     1 
ATOM   839  O O     . GLN A 1 86  ? 46.979 21.543  7.837  1.00 30.28  ? 228 GLN A O     1 
ATOM   840  C CB    . GLN A 1 86  ? 50.003 21.662  6.810  1.00 33.85  ? 228 GLN A CB    1 
ATOM   841  C CG    . GLN A 1 86  ? 50.778 22.766  6.122  1.00 34.98  ? 228 GLN A CG    1 
ATOM   842  C CD    . GLN A 1 86  ? 51.921 22.297  5.263  1.00 38.19  ? 228 GLN A CD    1 
ATOM   843  O OE1   . GLN A 1 86  ? 52.873 21.722  5.789  1.00 38.68  ? 228 GLN A OE1   1 
ATOM   844  N NE2   . GLN A 1 86  ? 51.870 22.487  3.947  1.00 36.06  ? 228 GLN A NE2   1 
ATOM   845  H H     . GLN A 1 86  ? 51.058 22.135  9.055  1.00 0.00   ? 228 GLN A H     1 
ATOM   846  H HE21  . GLN A 1 86  ? 52.629 22.171  3.415  1.00 0.00   ? 228 GLN A HE21  1 
ATOM   847  H HE22  . GLN A 1 86  ? 51.093 22.929  3.545  1.00 0.00   ? 228 GLN A HE22  1 
ATOM   848  N N     . LEU A 1 87  ? 48.300 20.488  9.307  1.00 25.96  ? 229 LEU A N     1 
ATOM   849  C CA    . LEU A 1 87  ? 47.230 19.643  9.836  1.00 23.07  ? 229 LEU A CA    1 
ATOM   850  C C     . LEU A 1 87  ? 46.230 20.500  10.606 1.00 24.26  ? 229 LEU A C     1 
ATOM   851  O O     . LEU A 1 87  ? 45.008 20.391  10.473 1.00 24.17  ? 229 LEU A O     1 
ATOM   852  C CB    . LEU A 1 87  ? 47.872 18.562  10.754 1.00 21.87  ? 229 LEU A CB    1 
ATOM   853  C CG    . LEU A 1 87  ? 46.970 17.486  11.432 1.00 26.54  ? 229 LEU A CG    1 
ATOM   854  C CD1   . LEU A 1 87  ? 47.837 16.313  11.863 1.00 22.62  ? 229 LEU A CD1   1 
ATOM   855  C CD2   . LEU A 1 87  ? 46.269 18.045  12.679 1.00 24.56  ? 229 LEU A CD2   1 
ATOM   856  H H     . LEU A 1 87  ? 49.205 20.385  9.668  1.00 0.00   ? 229 LEU A H     1 
ATOM   857  N N     . VAL A 1 88  ? 46.743 21.395  11.461 1.00 29.12  ? 230 VAL A N     1 
ATOM   858  C CA    . VAL A 1 88  ? 45.890 22.281  12.251 1.00 26.74  ? 230 VAL A CA    1 
ATOM   859  C C     . VAL A 1 88  ? 45.124 23.196  11.309 1.00 27.66  ? 230 VAL A C     1 
ATOM   860  O O     . VAL A 1 88  ? 43.908 23.304  11.409 1.00 30.34  ? 230 VAL A O     1 
ATOM   861  C CB    . VAL A 1 88  ? 46.798 23.086  13.226 1.00 29.68  ? 230 VAL A CB    1 
ATOM   862  C CG1   . VAL A 1 88  ? 46.009 24.216  13.899 1.00 20.93  ? 230 VAL A CG1   1 
ATOM   863  C CG2   . VAL A 1 88  ? 47.404 22.100  14.264 1.00 24.37  ? 230 VAL A CG2   1 
ATOM   864  H H     . VAL A 1 88  ? 47.716 21.457  11.559 1.00 0.00   ? 230 VAL A H     1 
ATOM   865  N N     . ALA A 1 89  ? 45.804 23.837  10.354 1.00 27.17  ? 231 ALA A N     1 
ATOM   866  C CA    . ALA A 1 89  ? 45.130 24.689  9.389  1.00 27.29  ? 231 ALA A CA    1 
ATOM   867  C C     . ALA A 1 89  ? 44.025 23.927  8.659  1.00 29.09  ? 231 ALA A C     1 
ATOM   868  O O     . ALA A 1 89  ? 42.886 24.411  8.508  1.00 31.04  ? 231 ALA A O     1 
ATOM   869  C CB    . ALA A 1 89  ? 46.128 25.170  8.375  1.00 25.57  ? 231 ALA A CB    1 
ATOM   870  H H     . ALA A 1 89  ? 46.777 23.730  10.303 1.00 0.00   ? 231 ALA A H     1 
ATOM   871  N N     . TYR A 1 90  ? 44.307 22.682  8.241  1.00 30.11  ? 232 TYR A N     1 
ATOM   872  C CA    . TYR A 1 90  ? 43.291 21.911  7.536  1.00 27.73  ? 232 TYR A CA    1 
ATOM   873  C C     . TYR A 1 90  ? 42.078 21.631  8.398  1.00 27.09  ? 232 TYR A C     1 
ATOM   874  O O     . TYR A 1 90  ? 40.940 21.942  8.023  1.00 26.62  ? 232 TYR A O     1 
ATOM   875  C CB    . TYR A 1 90  ? 43.846 20.596  7.074  1.00 29.77  ? 232 TYR A CB    1 
ATOM   876  C CG    . TYR A 1 90  ? 42.802 19.834  6.274  1.00 34.09  ? 232 TYR A CG    1 
ATOM   877  C CD1   . TYR A 1 90  ? 42.651 20.150  4.918  1.00 38.90  ? 232 TYR A CD1   1 
ATOM   878  C CD2   . TYR A 1 90  ? 41.998 18.840  6.861  1.00 32.73  ? 232 TYR A CD2   1 
ATOM   879  C CE1   . TYR A 1 90  ? 41.674 19.513  4.158  1.00 38.32  ? 232 TYR A CE1   1 
ATOM   880  C CE2   . TYR A 1 90  ? 41.017 18.206  6.098  1.00 36.71  ? 232 TYR A CE2   1 
ATOM   881  C CZ    . TYR A 1 90  ? 40.871 18.550  4.744  1.00 38.86  ? 232 TYR A CZ    1 
ATOM   882  O OH    . TYR A 1 90  ? 39.882 18.022  3.953  1.00 41.04  ? 232 TYR A OH    1 
ATOM   883  H H     . TYR A 1 90  ? 45.191 22.294  8.409  1.00 0.00   ? 232 TYR A H     1 
ATOM   884  H HH    . TYR A 1 90  ? 39.954 18.383  3.066  1.00 0.00   ? 232 TYR A HH    1 
ATOM   885  N N     . TYR A 1 91  ? 42.268 21.038  9.579  1.00 29.69  ? 233 TYR A N     1 
ATOM   886  C CA    . TYR A 1 91  ? 41.130 20.664  10.407 1.00 28.36  ? 233 TYR A CA    1 
ATOM   887  C C     . TYR A 1 91  ? 40.452 21.857  11.042 1.00 29.25  ? 233 TYR A C     1 
ATOM   888  O O     . TYR A 1 91  ? 39.403 21.741  11.686 1.00 27.92  ? 233 TYR A O     1 
ATOM   889  C CB    . TYR A 1 91  ? 41.585 19.663  11.465 1.00 26.54  ? 233 TYR A CB    1 
ATOM   890  C CG    . TYR A 1 91  ? 41.810 18.266  10.877 1.00 27.09  ? 233 TYR A CG    1 
ATOM   891  C CD1   . TYR A 1 91  ? 40.723 17.497  10.404 1.00 27.52  ? 233 TYR A CD1   1 
ATOM   892  C CD2   . TYR A 1 91  ? 43.103 17.745  10.827 1.00 25.56  ? 233 TYR A CD2   1 
ATOM   893  C CE1   . TYR A 1 91  ? 40.931 16.205  9.900  1.00 27.27  ? 233 TYR A CE1   1 
ATOM   894  C CE2   . TYR A 1 91  ? 43.322 16.459  10.315 1.00 27.57  ? 233 TYR A CE2   1 
ATOM   895  C CZ    . TYR A 1 91  ? 42.230 15.696  9.867  1.00 25.62  ? 233 TYR A CZ    1 
ATOM   896  O OH    . TYR A 1 91  ? 42.445 14.394  9.444  1.00 26.70  ? 233 TYR A OH    1 
ATOM   897  H H     . TYR A 1 91  ? 43.179 20.853  9.890  1.00 0.00   ? 233 TYR A H     1 
ATOM   898  H HH    . TYR A 1 91  ? 41.606 13.989  9.214  1.00 0.00   ? 233 TYR A HH    1 
ATOM   899  N N     . SER A 1 92  ? 41.049 23.039  10.852 1.00 32.55  ? 234 SER A N     1 
ATOM   900  C CA    . SER A 1 92  ? 40.386 24.280  11.232 1.00 34.90  ? 234 SER A CA    1 
ATOM   901  C C     . SER A 1 92  ? 39.319 24.558  10.190 1.00 35.47  ? 234 SER A C     1 
ATOM   902  O O     . SER A 1 92  ? 38.276 25.131  10.497 1.00 35.63  ? 234 SER A O     1 
ATOM   903  C CB    . SER A 1 92  ? 41.393 25.422  11.271 1.00 33.53  ? 234 SER A CB    1 
ATOM   904  O OG    . SER A 1 92  ? 42.329 25.242  12.339 1.00 34.43  ? 234 SER A OG    1 
ATOM   905  H H     . SER A 1 92  ? 41.943 23.071  10.452 1.00 0.00   ? 234 SER A H     1 
ATOM   906  H HG    . SER A 1 92  ? 42.803 24.417  12.214 1.00 0.00   ? 234 SER A HG    1 
ATOM   907  N N     . LYS A 1 93  ? 39.533 24.130  8.938  1.00 37.88  ? 235 LYS A N     1 
ATOM   908  C CA    . LYS A 1 93  ? 38.534 24.300  7.887  1.00 39.69  ? 235 LYS A CA    1 
ATOM   909  C C     . LYS A 1 93  ? 37.599 23.109  7.714  1.00 39.80  ? 235 LYS A C     1 
ATOM   910  O O     . LYS A 1 93  ? 36.580 23.234  7.038  1.00 42.58  ? 235 LYS A O     1 
ATOM   911  C CB    . LYS A 1 93  ? 39.188 24.554  6.517  1.00 39.05  ? 235 LYS A CB    1 
ATOM   912  C CG    . LYS A 1 93  ? 40.147 25.697  6.570  1.00 44.80  ? 235 LYS A CG    1 
ATOM   913  C CD    . LYS A 1 93  ? 40.913 25.797  5.287  1.00 49.57  ? 235 LYS A CD    1 
ATOM   914  C CE    . LYS A 1 93  ? 42.047 26.786  5.535  1.00 51.81  ? 235 LYS A CE    1 
ATOM   915  N NZ    . LYS A 1 93  ? 42.936 26.852  4.388  1.00 56.54  ? 235 LYS A NZ    1 
ATOM   916  H H     . LYS A 1 93  ? 40.382 23.691  8.722  1.00 0.00   ? 235 LYS A H     1 
ATOM   917  H HZ1   . LYS A 1 93  ? 42.401 27.160  3.551  1.00 0.00   ? 235 LYS A HZ1   1 
ATOM   918  H HZ2   . LYS A 1 93  ? 43.700 27.531  4.580  1.00 0.00   ? 235 LYS A HZ2   1 
ATOM   919  H HZ3   . LYS A 1 93  ? 43.345 25.912  4.212  1.00 0.00   ? 235 LYS A HZ3   1 
ATOM   920  N N     . HIS A 1 94  ? 37.907 21.895  8.160  1.00 39.71  ? 236 HIS A N     1 
ATOM   921  C CA    . HIS A 1 94  ? 37.064 20.732  7.869  1.00 37.94  ? 236 HIS A CA    1 
ATOM   922  C C     . HIS A 1 94  ? 37.251 19.723  8.969  1.00 35.76  ? 236 HIS A C     1 
ATOM   923  O O     . HIS A 1 94  ? 38.390 19.355  9.275  1.00 35.83  ? 236 HIS A O     1 
ATOM   924  C CB    . HIS A 1 94  ? 37.462 20.034  6.570  1.00 38.63  ? 236 HIS A CB    1 
ATOM   925  C CG    . HIS A 1 94  ? 37.568 20.953  5.379  1.00 36.25  ? 236 HIS A CG    1 
ATOM   926  N ND1   . HIS A 1 94  ? 36.561 21.564  4.757  1.00 35.21  ? 236 HIS A ND1   1 
ATOM   927  C CD2   . HIS A 1 94  ? 38.747 21.298  4.775  1.00 32.42  ? 236 HIS A CD2   1 
ATOM   928  C CE1   . HIS A 1 94  ? 37.083 22.274  3.781  1.00 35.03  ? 236 HIS A CE1   1 
ATOM   929  N NE2   . HIS A 1 94  ? 38.396 22.100  3.798  1.00 34.84  ? 236 HIS A NE2   1 
ATOM   930  H H     . HIS A 1 94  ? 38.718 21.775  8.697  1.00 0.00   ? 236 HIS A H     1 
ATOM   931  H HD1   . HIS A 1 94  ? 35.616 21.497  4.983  1.00 0.00   ? 236 HIS A HD1   1 
ATOM   932  H HE2   . HIS A 1 94  ? 39.018 22.513  3.168  1.00 0.00   ? 236 HIS A HE2   1 
ATOM   933  N N     . ALA A 1 95  ? 36.156 19.308  9.595  1.00 32.91  ? 237 ALA A N     1 
ATOM   934  C CA    . ALA A 1 95  ? 36.265 18.344  10.661 1.00 33.17  ? 237 ALA A CA    1 
ATOM   935  C C     . ALA A 1 95  ? 36.770 17.017  10.066 1.00 34.40  ? 237 ALA A C     1 
ATOM   936  O O     . ALA A 1 95  ? 37.702 16.392  10.572 1.00 30.30  ? 237 ALA A O     1 
ATOM   937  C CB    . ALA A 1 95  ? 34.903 18.155  11.276 1.00 31.70  ? 237 ALA A CB    1 
ATOM   938  H H     . ALA A 1 95  ? 35.278 19.656  9.333  1.00 0.00   ? 237 ALA A H     1 
ATOM   939  N N     . ASP A 1 96  ? 36.147 16.600  8.956  1.00 36.20  ? 238 ASP A N     1 
ATOM   940  C CA    . ASP A 1 96  ? 36.493 15.367  8.241  1.00 37.60  ? 238 ASP A CA    1 
ATOM   941  C C     . ASP A 1 96  ? 36.815 14.164  9.118  1.00 33.01  ? 238 ASP A C     1 
ATOM   942  O O     . ASP A 1 96  ? 37.891 13.540  9.087  1.00 32.90  ? 238 ASP A O     1 
ATOM   943  C CB    . ASP A 1 96  ? 37.666 15.655  7.249  1.00 42.72  ? 238 ASP A CB    1 
ATOM   944  C CG    . ASP A 1 96  ? 37.252 16.304  5.913  1.00 50.79  ? 238 ASP A CG    1 
ATOM   945  O OD1   . ASP A 1 96  ? 36.110 16.779  5.775  1.00 52.08  ? 238 ASP A OD1   1 
ATOM   946  O OD2   . ASP A 1 96  ? 38.083 16.338  4.999  1.00 47.93  ? 238 ASP A OD2   1 
ATOM   947  H H     . ASP A 1 96  ? 35.418 17.150  8.601  1.00 0.00   ? 238 ASP A H     1 
ATOM   948  N N     . GLY A 1 97  ? 35.832 13.820  9.919  1.00 31.00  ? 239 GLY A N     1 
ATOM   949  C CA    . GLY A 1 97  ? 35.970 12.717  10.852 1.00 32.00  ? 239 GLY A CA    1 
ATOM   950  C C     . GLY A 1 97  ? 36.196 13.185  12.294 1.00 30.27  ? 239 GLY A C     1 
ATOM   951  O O     . GLY A 1 97  ? 35.815 12.483  13.231 1.00 32.82  ? 239 GLY A O     1 
ATOM   952  H H     . GLY A 1 97  ? 34.989 14.318  9.886  1.00 0.00   ? 239 GLY A H     1 
ATOM   953  N N     . LEU A 1 98  ? 36.817 14.344  12.567 1.00 32.16  ? 240 LEU A N     1 
ATOM   954  C CA    . LEU A 1 98  ? 36.966 14.835  13.943 1.00 30.11  ? 240 LEU A CA    1 
ATOM   955  C C     . LEU A 1 98  ? 35.612 15.212  14.511 1.00 30.81  ? 240 LEU A C     1 
ATOM   956  O O     . LEU A 1 98  ? 34.649 15.456  13.767 1.00 31.43  ? 240 LEU A O     1 
ATOM   957  C CB    . LEU A 1 98  ? 37.840 16.069  14.017 1.00 30.18  ? 240 LEU A CB    1 
ATOM   958  C CG    . LEU A 1 98  ? 39.277 16.069  13.457 1.00 31.51  ? 240 LEU A CG    1 
ATOM   959  C CD1   . LEU A 1 98  ? 39.937 17.373  13.858 1.00 26.41  ? 240 LEU A CD1   1 
ATOM   960  C CD2   . LEU A 1 98  ? 40.094 14.869  13.973 1.00 28.46  ? 240 LEU A CD2   1 
ATOM   961  H H     . LEU A 1 98  ? 37.180 14.876  11.829 1.00 0.00   ? 240 LEU A H     1 
ATOM   962  N N     . CYS A 1 99  ? 35.494 15.261  15.832 1.00 30.39  ? 241 CYS A N     1 
ATOM   963  C CA    . CYS A 1 99  ? 34.234 15.623  16.459 1.00 32.06  ? 241 CYS A CA    1 
ATOM   964  C C     . CYS A 1 99  ? 33.741 17.029  16.071 1.00 34.49  ? 241 CYS A C     1 
ATOM   965  O O     . CYS A 1 99  ? 32.542 17.315  16.039 1.00 35.02  ? 241 CYS A O     1 
ATOM   966  C CB    . CYS A 1 99  ? 34.382 15.556  17.993 1.00 35.07  ? 241 CYS A CB    1 
ATOM   967  S SG    . CYS A 1 99  ? 35.562 16.732  18.747 1.00 34.40  ? 241 CYS A SG    1 
ATOM   968  H H     . CYS A 1 99  ? 36.269 15.050  16.394 1.00 0.00   ? 241 CYS A H     1 
ATOM   969  N N     . HIS A 1 100 ? 34.659 17.925  15.712 1.00 33.97  ? 242 HIS A N     1 
ATOM   970  C CA    . HIS A 1 100 ? 34.331 19.290  15.410 1.00 35.25  ? 242 HIS A CA    1 
ATOM   971  C C     . HIS A 1 100 ? 35.494 19.848  14.659 1.00 33.61  ? 242 HIS A C     1 
ATOM   972  O O     . HIS A 1 100 ? 36.599 19.356  14.770 1.00 34.11  ? 242 HIS A O     1 
ATOM   973  C CB    . HIS A 1 100 ? 34.117 20.125  16.728 1.00 40.98  ? 242 HIS A CB    1 
ATOM   974  C CG    . HIS A 1 100 ? 33.366 21.463  16.511 1.00 43.55  ? 242 HIS A CG    1 
ATOM   975  N ND1   . HIS A 1 100 ? 32.045 21.687  16.537 1.00 43.05  ? 242 HIS A ND1   1 
ATOM   976  C CD2   . HIS A 1 100 ? 33.962 22.649  16.182 1.00 39.78  ? 242 HIS A CD2   1 
ATOM   977  C CE1   . HIS A 1 100 ? 31.833 22.937  16.223 1.00 42.27  ? 242 HIS A CE1   1 
ATOM   978  N NE2   . HIS A 1 100 ? 33.001 23.503  16.016 1.00 44.34  ? 242 HIS A NE2   1 
ATOM   979  H H     . HIS A 1 100 ? 35.595 17.642  15.652 1.00 0.00   ? 242 HIS A H     1 
ATOM   980  H HD1   . HIS A 1 100 ? 31.359 21.029  16.753 1.00 0.00   ? 242 HIS A HD1   1 
ATOM   981  H HE2   . HIS A 1 100 ? 33.128 24.440  15.770 1.00 0.00   ? 242 HIS A HE2   1 
ATOM   982  N N     . ARG A 1 101 ? 35.215 20.848  13.844 1.00 36.61  ? 243 ARG A N     1 
ATOM   983  C CA    . ARG A 1 101 ? 36.208 21.692  13.172 1.00 37.95  ? 243 ARG A CA    1 
ATOM   984  C C     . ARG A 1 101 ? 37.051 22.357  14.281 1.00 36.07  ? 243 ARG A C     1 
ATOM   985  O O     . ARG A 1 101 ? 36.502 22.677  15.345 1.00 34.10  ? 243 ARG A O     1 
ATOM   986  C CB    . ARG A 1 101 ? 35.400 22.709  12.373 1.00 44.64  ? 243 ARG A CB    1 
ATOM   987  C CG    . ARG A 1 101 ? 35.978 23.408  11.142 1.00 54.34  ? 243 ARG A CG    1 
ATOM   988  C CD    . ARG A 1 101 ? 35.279 24.803  10.979 1.00 60.21  ? 243 ARG A CD    1 
ATOM   989  N NE    . ARG A 1 101 ? 35.735 25.725  12.039 1.00 65.11  ? 243 ARG A NE    1 
ATOM   990  C CZ    . ARG A 1 101 ? 36.330 26.906  11.784 1.00 66.53  ? 243 ARG A CZ    1 
ATOM   991  N NH1   . ARG A 1 101 ? 36.520 27.308  10.514 1.00 68.47  ? 243 ARG A NH1   1 
ATOM   992  N NH2   . ARG A 1 101 ? 36.835 27.625  12.805 1.00 61.95  ? 243 ARG A NH2   1 
ATOM   993  H H     . ARG A 1 101 ? 34.270 21.042  13.675 1.00 0.00   ? 243 ARG A H     1 
ATOM   994  H HE    . ARG A 1 101 ? 35.598 25.465  12.973 1.00 0.00   ? 243 ARG A HE    1 
ATOM   995  H HH11  . ARG A 1 101 ? 36.219 26.729  9.756  1.00 0.00   ? 243 ARG A HH11  1 
ATOM   996  H HH12  . ARG A 1 101 ? 36.962 28.185  10.328 1.00 0.00   ? 243 ARG A HH12  1 
ATOM   997  H HH21  . ARG A 1 101 ? 36.766 27.281  13.741 1.00 0.00   ? 243 ARG A HH21  1 
ATOM   998  H HH22  . ARG A 1 101 ? 37.279 28.503  12.627 1.00 0.00   ? 243 ARG A HH22  1 
ATOM   999  N N     . LEU A 1 102 ? 38.347 22.542  14.149 1.00 36.72  ? 244 LEU A N     1 
ATOM   1000 C CA    . LEU A 1 102 ? 39.115 23.244  15.187 1.00 37.85  ? 244 LEU A CA    1 
ATOM   1001 C C     . LEU A 1 102 ? 38.773 24.750  15.143 1.00 37.48  ? 244 LEU A C     1 
ATOM   1002 O O     . LEU A 1 102 ? 38.766 25.360  14.072 1.00 37.49  ? 244 LEU A O     1 
ATOM   1003 C CB    . LEU A 1 102 ? 40.621 23.022  14.934 1.00 33.77  ? 244 LEU A CB    1 
ATOM   1004 C CG    . LEU A 1 102 ? 41.105 21.541  14.784 1.00 30.67  ? 244 LEU A CG    1 
ATOM   1005 C CD1   . LEU A 1 102 ? 42.631 21.501  14.601 1.00 23.00  ? 244 LEU A CD1   1 
ATOM   1006 C CD2   . LEU A 1 102 ? 40.668 20.723  15.991 1.00 30.15  ? 244 LEU A CD2   1 
ATOM   1007 H H     . LEU A 1 102 ? 38.805 22.208  13.350 1.00 0.00   ? 244 LEU A H     1 
ATOM   1008 N N     . THR A 1 103 ? 38.297 25.329  16.250 1.00 38.86  ? 245 THR A N     1 
ATOM   1009 C CA    . THR A 1 103 ? 37.916 26.732  16.273 1.00 39.23  ? 245 THR A CA    1 
ATOM   1010 C C     . THR A 1 103 ? 38.879 27.578  17.129 1.00 42.87  ? 245 THR A C     1 
ATOM   1011 O O     . THR A 1 103 ? 39.791 28.222  16.610 1.00 50.72  ? 245 THR A O     1 
ATOM   1012 C CB    . THR A 1 103 ? 36.452 26.858  16.797 1.00 34.06  ? 245 THR A CB    1 
ATOM   1013 O OG1   . THR A 1 103 ? 36.404 26.369  18.131 1.00 38.77  ? 245 THR A OG1   1 
ATOM   1014 C CG2   . THR A 1 103 ? 35.489 26.060  15.971 1.00 29.08  ? 245 THR A CG2   1 
ATOM   1015 H H     . THR A 1 103 ? 38.203 24.795  17.066 1.00 0.00   ? 245 THR A H     1 
ATOM   1016 H HG1   . THR A 1 103 ? 36.678 25.449  18.145 1.00 0.00   ? 245 THR A HG1   1 
ATOM   1017 N N     . THR A 1 104 ? 38.757 27.639  18.437 1.00 41.34  ? 246 THR A N     1 
ATOM   1018 C CA    . THR A 1 104 ? 39.632 28.408  19.250 1.00 38.27  ? 246 THR A CA    1 
ATOM   1019 C C     . THR A 1 104 ? 40.898 27.623  19.610 1.00 36.68  ? 246 THR A C     1 
ATOM   1020 O O     . THR A 1 104 ? 40.864 26.445  19.998 1.00 36.36  ? 246 THR A O     1 
ATOM   1021 C CB    . THR A 1 104 ? 38.915 28.877  20.528 1.00 37.15  ? 246 THR A CB    1 
ATOM   1022 O OG1   . THR A 1 104 ? 37.706 29.440  20.113 1.00 44.94  ? 246 THR A OG1   1 
ATOM   1023 C CG2   . THR A 1 104 ? 39.707 29.866  21.304 1.00 38.20  ? 246 THR A CG2   1 
ATOM   1024 H H     . THR A 1 104 ? 38.035 27.135  18.867 1.00 0.00   ? 246 THR A H     1 
ATOM   1025 H HG1   . THR A 1 104 ? 37.881 30.178  19.525 1.00 0.00   ? 246 THR A HG1   1 
ATOM   1026 N N     . VAL A 1 105 ? 42.054 28.295  19.534 1.00 35.78  ? 247 VAL A N     1 
ATOM   1027 C CA    . VAL A 1 105 ? 43.328 27.788  20.046 1.00 32.73  ? 247 VAL A CA    1 
ATOM   1028 C C     . VAL A 1 105 ? 43.199 27.884  21.570 1.00 33.49  ? 247 VAL A C     1 
ATOM   1029 O O     . VAL A 1 105 ? 42.808 28.941  22.083 1.00 31.10  ? 247 VAL A O     1 
ATOM   1030 C CB    . VAL A 1 105 ? 44.482 28.633  19.472 1.00 30.98  ? 247 VAL A CB    1 
ATOM   1031 C CG1   . VAL A 1 105 ? 45.733 28.288  20.211 1.00 34.63  ? 247 VAL A CG1   1 
ATOM   1032 C CG2   . VAL A 1 105 ? 44.714 28.300  18.038 1.00 30.91  ? 247 VAL A CG2   1 
ATOM   1033 H H     . VAL A 1 105 ? 42.046 29.178  19.111 1.00 0.00   ? 247 VAL A H     1 
ATOM   1034 N N     . CYS A 1 106 ? 43.421 26.794  22.309 1.00 33.35  ? 248 CYS A N     1 
ATOM   1035 C CA    . CYS A 1 106 ? 43.409 26.842  23.762 1.00 32.00  ? 248 CYS A CA    1 
ATOM   1036 C C     . CYS A 1 106 ? 44.281 28.003  24.301 1.00 31.50  ? 248 CYS A C     1 
ATOM   1037 O O     . CYS A 1 106 ? 45.446 28.157  23.891 1.00 27.37  ? 248 CYS A O     1 
ATOM   1038 C CB    . CYS A 1 106 ? 43.925 25.535  24.335 1.00 29.53  ? 248 CYS A CB    1 
ATOM   1039 S SG    . CYS A 1 106 ? 43.522 25.319  26.097 1.00 30.52  ? 248 CYS A SG    1 
ATOM   1040 H H     . CYS A 1 106 ? 43.596 25.941  21.861 1.00 0.00   ? 248 CYS A H     1 
ATOM   1041 N N     . PRO A 1 107 ? 43.726 28.869  25.163 1.00 31.67  ? 249 PRO A N     1 
ATOM   1042 C CA    . PRO A 1 107 ? 44.516 29.857  25.849 1.00 31.45  ? 249 PRO A CA    1 
ATOM   1043 C C     . PRO A 1 107 ? 45.312 29.206  26.958 1.00 37.29  ? 249 PRO A C     1 
ATOM   1044 O O     . PRO A 1 107 ? 44.752 28.394  27.739 1.00 41.59  ? 249 PRO A O     1 
ATOM   1045 C CB    . PRO A 1 107 ? 43.527 30.848  26.315 1.00 28.74  ? 249 PRO A CB    1 
ATOM   1046 C CG    . PRO A 1 107 ? 42.256 30.115  26.474 1.00 31.40  ? 249 PRO A CG    1 
ATOM   1047 C CD    . PRO A 1 107 ? 42.296 29.035  25.384 1.00 29.83  ? 249 PRO A CD    1 
ATOM   1048 O OXT   . PRO A 1 107 ? 46.509 29.511  26.984 1.00 44.02  ? 249 PRO A OXT   1 
HETATM 1049 C C     . ACE B 2 1   ? 41.551 7.808   24.138 1.00 36.77  ? 100 ACE C C     1 
HETATM 1050 O O     . ACE B 2 1   ? 41.428 9.033   24.179 1.00 37.13  ? 100 ACE C O     1 
HETATM 1051 C CH3   . ACE B 2 1   ? 41.326 7.003   25.407 1.00 35.80  ? 100 ACE C CH3   1 
HETATM 1052 N N     . PTH B 2 2   ? 41.997 7.205   23.042 1.00 34.90  ? 101 PTH C N     1 
HETATM 1053 C CA    . PTH B 2 2   ? 42.130 7.935   21.809 1.00 32.57  ? 101 PTH C CA    1 
HETATM 1054 C C     . PTH B 2 2   ? 40.958 7.554   20.905 1.00 32.94  ? 101 PTH C C     1 
HETATM 1055 O O     . PTH B 2 2   ? 40.427 6.434   20.980 1.00 33.52  ? 101 PTH C O     1 
HETATM 1056 C CB    . PTH B 2 2   ? 43.505 7.601   21.180 1.00 33.14  ? 101 PTH C CB    1 
HETATM 1057 C CG    . PTH B 2 2   ? 44.756 8.148   21.898 1.00 35.14  ? 101 PTH C CG    1 
HETATM 1058 C CD1   . PTH B 2 2   ? 45.178 9.463   21.712 1.00 36.26  ? 101 PTH C CD1   1 
HETATM 1059 C CD2   . PTH B 2 2   ? 45.452 7.371   22.823 1.00 32.67  ? 101 PTH C CD2   1 
HETATM 1060 C CE1   . PTH B 2 2   ? 46.289 10.056  22.288 1.00 38.46  ? 101 PTH C CE1   1 
HETATM 1061 C CE2   . PTH B 2 2   ? 46.556 7.908   23.465 1.00 33.48  ? 101 PTH C CE2   1 
HETATM 1062 C CZ    . PTH B 2 2   ? 46.956 9.237   23.196 1.00 37.33  ? 101 PTH C CZ    1 
HETATM 1063 C CF    . PTH B 2 2   ? 46.556 11.551  21.973 1.00 44.44  ? 101 PTH C CF    1 
HETATM 1064 O OH    . PTH B 2 2   ? 48.052 9.698   23.851 1.00 36.86  ? 101 PTH C OH    1 
HETATM 1065 P P     . PTH B 2 2   ? 47.698 10.425  25.399 1.00 38.79  ? 101 PTH C P     1 
HETATM 1066 O O1P   . PTH B 2 2   ? 47.782 9.395   26.359 1.00 42.83  ? 101 PTH C O1P   1 
HETATM 1067 O O2P   . PTH B 2 2   ? 46.270 11.022  25.247 1.00 36.87  ? 101 PTH C O2P   1 
HETATM 1068 O O3P   . PTH B 2 2   ? 48.818 11.368  25.438 1.00 40.86  ? 101 PTH C O3P   1 
HETATM 1069 O OF    . PTH B 2 2   ? 45.325 12.311  21.898 1.00 59.72  ? 101 PTH C OF    1 
HETATM 1070 H H     . PTH B 2 2   ? 42.237 6.255   23.073 1.00 0.00   ? 101 PTH C H     1 
HETATM 1071 H HOF   . PTH B 2 2   ? 44.864 12.257  22.738 1.00 0.00   ? 101 PTH C HOF   1 
ATOM   1072 N N     . GLU B 2 3   ? 40.478 8.526   20.128 1.00 31.91  ? 102 GLU C N     1 
ATOM   1073 C CA    . GLU B 2 3   ? 39.397 8.369   19.169 1.00 31.06  ? 102 GLU C CA    1 
ATOM   1074 C C     . GLU B 2 3   ? 39.868 7.645   17.901 1.00 28.49  ? 102 GLU C C     1 
ATOM   1075 O O     . GLU B 2 3   ? 41.101 7.637   17.666 1.00 28.71  ? 102 GLU C O     1 
ATOM   1076 C CB    . GLU B 2 3   ? 38.857 9.730   18.774 1.00 28.30  ? 102 GLU C CB    1 
ATOM   1077 C CG    . GLU B 2 3   ? 38.336 10.513  19.944 1.00 33.29  ? 102 GLU C CG    1 
ATOM   1078 C CD    . GLU B 2 3   ? 37.131 9.899   20.690 1.00 40.29  ? 102 GLU C CD    1 
ATOM   1079 O OE1   . GLU B 2 3   ? 36.049 9.762   20.098 1.00 41.57  ? 102 GLU C OE1   1 
ATOM   1080 O OE2   . GLU B 2 3   ? 37.238 9.635   21.904 1.00 38.05  ? 102 GLU C OE2   1 
ATOM   1081 H H     . GLU B 2 3   ? 40.885 9.413   20.210 1.00 0.00   ? 102 GLU C H     1 
HETATM 1082 N N     . DIP B 2 4   ? 38.966 6.976   17.093 1.00 30.74  ? 103 DIP C N     1 
HETATM 1083 C C1    . DIP B 2 4   ? 37.601 6.681   17.528 1.00 26.32  ? 103 DIP C C1    1 
HETATM 1084 C C2    . DIP B 2 4   ? 37.749 5.432   18.377 1.00 28.07  ? 103 DIP C C2    1 
HETATM 1085 C C3    . DIP B 2 4   ? 36.391 5.026   18.876 1.00 36.28  ? 103 DIP C C3    1 
HETATM 1086 C C4    . DIP B 2 4   ? 36.556 3.761   19.702 1.00 42.69  ? 103 DIP C C4    1 
HETATM 1087 C C5    . DIP B 2 4   ? 35.170 3.138   20.031 1.00 45.60  ? 103 DIP C C5    1 
HETATM 1088 C "C1'" . DIP B 2 4   ? 39.329 6.460   15.762 1.00 30.72  ? 103 DIP C "C1'" 1 
HETATM 1089 C "C2'" . DIP B 2 4   ? 39.785 7.618   14.864 1.00 29.89  ? 103 DIP C "C2'" 1 
HETATM 1090 C "C3'" . DIP B 2 4   ? 38.637 8.424   14.312 1.00 32.05  ? 103 DIP C "C3'" 1 
HETATM 1091 C "C4'" . DIP B 2 4   ? 39.248 9.585   13.551 1.00 34.24  ? 103 DIP C "C4'" 1 
HETATM 1092 C "C5'" . DIP B 2 4   ? 38.203 10.512  13.005 1.00 32.75  ? 103 DIP C "C5'" 1 
ATOM   1093 N N     . ALA C 1 6   ? 34.301 14.414  34.326 1.00 46.04  ? 148 ALA B N     1 
ATOM   1094 C CA    . ALA C 1 6   ? 34.605 15.592  35.157 1.00 47.19  ? 148 ALA B CA    1 
ATOM   1095 C C     . ALA C 1 6   ? 35.693 15.425  36.237 1.00 46.65  ? 148 ALA B C     1 
ATOM   1096 O O     . ALA C 1 6   ? 36.583 16.259  36.345 1.00 49.11  ? 148 ALA B O     1 
ATOM   1097 C CB    . ALA C 1 6   ? 33.343 16.081  35.864 1.00 47.07  ? 148 ALA B CB    1 
ATOM   1098 N N     . GLU C 1 7   ? 35.716 14.316  36.984 1.00 44.52  ? 149 GLU B N     1 
ATOM   1099 C CA    . GLU C 1 7   ? 36.723 14.078  38.044 1.00 38.43  ? 149 GLU B CA    1 
ATOM   1100 C C     . GLU C 1 7   ? 38.142 13.972  37.531 1.00 36.50  ? 149 GLU B C     1 
ATOM   1101 O O     . GLU C 1 7   ? 38.364 13.228  36.579 1.00 36.58  ? 149 GLU B O     1 
ATOM   1102 C CB    . GLU C 1 7   ? 36.405 12.790  38.743 1.00 37.11  ? 149 GLU B CB    1 
ATOM   1103 C CG    . GLU C 1 7   ? 34.946 12.707  39.162 1.00 28.12  ? 149 GLU B CG    1 
ATOM   1104 C CD    . GLU C 1 7   ? 34.705 13.288  40.506 1.00 29.50  ? 149 GLU B CD    1 
ATOM   1105 O OE1   . GLU C 1 7   ? 35.646 13.804  41.096 1.00 32.13  ? 149 GLU B OE1   1 
ATOM   1106 O OE2   . GLU C 1 7   ? 33.579 13.205  40.970 1.00 35.24  ? 149 GLU B OE2   1 
ATOM   1107 H H     . GLU C 1 7   ? 35.036 13.630  36.823 1.00 0.00   ? 149 GLU B H     1 
ATOM   1108 N N     . GLU C 1 8   ? 39.127 14.603  38.172 1.00 35.21  ? 150 GLU B N     1 
ATOM   1109 C CA    . GLU C 1 8   ? 40.510 14.582  37.691 1.00 38.03  ? 150 GLU B CA    1 
ATOM   1110 C C     . GLU C 1 8   ? 41.160 13.191  37.644 1.00 36.83  ? 150 GLU B C     1 
ATOM   1111 O O     . GLU C 1 8   ? 42.148 12.984  36.925 1.00 34.22  ? 150 GLU B O     1 
ATOM   1112 C CB    . GLU C 1 8   ? 41.427 15.548  38.565 1.00 41.54  ? 150 GLU B CB    1 
ATOM   1113 C CG    . GLU C 1 8   ? 41.247 15.433  40.103 1.00 51.47  ? 150 GLU B CG    1 
ATOM   1114 C CD    . GLU C 1 8   ? 42.274 16.147  41.027 1.00 55.07  ? 150 GLU B CD    1 
ATOM   1115 O OE1   . GLU C 1 8   ? 42.823 17.202  40.674 1.00 61.11  ? 150 GLU B OE1   1 
ATOM   1116 O OE2   . GLU C 1 8   ? 42.560 15.632  42.100 1.00 51.58  ? 150 GLU B OE2   1 
ATOM   1117 H H     . GLU C 1 8   ? 38.918 15.097  38.992 1.00 0.00   ? 150 GLU B H     1 
ATOM   1118 N N     . TRP C 1 9   ? 40.608 12.223  38.400 1.00 34.23  ? 151 TRP B N     1 
ATOM   1119 C CA    . TRP C 1 9   ? 41.117 10.868  38.409 1.00 30.18  ? 151 TRP B CA    1 
ATOM   1120 C C     . TRP C 1 9   ? 40.396 9.965   37.424 1.00 27.33  ? 151 TRP B C     1 
ATOM   1121 O O     . TRP C 1 9   ? 40.768 8.808   37.224 1.00 28.82  ? 151 TRP B O     1 
ATOM   1122 C CB    . TRP C 1 9   ? 41.041 10.291  39.867 1.00 27.00  ? 151 TRP B CB    1 
ATOM   1123 C CG    . TRP C 1 9   ? 39.740 10.553  40.599 1.00 18.62  ? 151 TRP B CG    1 
ATOM   1124 C CD1   . TRP C 1 9   ? 39.723 11.450  41.619 1.00 18.01  ? 151 TRP B CD1   1 
ATOM   1125 C CD2   . TRP C 1 9   ? 38.509 9.962   40.342 1.00 23.22  ? 151 TRP B CD2   1 
ATOM   1126 N NE1   . TRP C 1 9   ? 38.477 11.455  42.017 1.00 19.14  ? 151 TRP B NE1   1 
ATOM   1127 C CE2   . TRP C 1 9   ? 37.708 10.595  41.304 1.00 19.14  ? 151 TRP B CE2   1 
ATOM   1128 C CE3   . TRP C 1 9   ? 37.946 9.011   39.430 1.00 20.84  ? 151 TRP B CE3   1 
ATOM   1129 C CZ2   . TRP C 1 9   ? 36.337 10.290  41.369 1.00 20.54  ? 151 TRP B CZ2   1 
ATOM   1130 C CZ3   . TRP C 1 9   ? 36.604 8.702   39.494 1.00 18.51  ? 151 TRP B CZ3   1 
ATOM   1131 C CH2   . TRP C 1 9   ? 35.797 9.338   40.467 1.00 24.46  ? 151 TRP B CH2   1 
ATOM   1132 H H     . TRP C 1 9   ? 39.836 12.443  38.962 1.00 0.00   ? 151 TRP B H     1 
ATOM   1133 H HE1   . TRP C 1 9   ? 38.139 12.014  42.744 1.00 0.00   ? 151 TRP B HE1   1 
ATOM   1134 N N     . TYR C 1 10  ? 39.327 10.438  36.806 1.00 27.84  ? 152 TYR B N     1 
ATOM   1135 C CA    . TYR C 1 10  ? 38.652 9.629   35.816 1.00 29.39  ? 152 TYR B CA    1 
ATOM   1136 C C     . TYR C 1 10  ? 39.350 9.785   34.458 1.00 31.26  ? 152 TYR B C     1 
ATOM   1137 O O     . TYR C 1 10  ? 39.361 10.889  33.900 1.00 29.28  ? 152 TYR B O     1 
ATOM   1138 C CB    . TYR C 1 10  ? 37.200 10.064  35.732 1.00 30.78  ? 152 TYR B CB    1 
ATOM   1139 C CG    . TYR C 1 10  ? 36.402 9.211   34.748 1.00 33.85  ? 152 TYR B CG    1 
ATOM   1140 C CD1   . TYR C 1 10  ? 36.246 7.852   35.007 1.00 37.18  ? 152 TYR B CD1   1 
ATOM   1141 C CD2   . TYR C 1 10  ? 35.914 9.763   33.565 1.00 32.72  ? 152 TYR B CD2   1 
ATOM   1142 C CE1   . TYR C 1 10  ? 35.588 7.040   34.108 1.00 42.40  ? 152 TYR B CE1   1 
ATOM   1143 C CE2   . TYR C 1 10  ? 35.247 8.959   32.654 1.00 37.09  ? 152 TYR B CE2   1 
ATOM   1144 C CZ    . TYR C 1 10  ? 35.108 7.600   32.935 1.00 44.52  ? 152 TYR B CZ    1 
ATOM   1145 O OH    . TYR C 1 10  ? 34.521 6.755   32.041 1.00 47.88  ? 152 TYR B OH    1 
ATOM   1146 H H     . TYR C 1 10  ? 38.993 11.335  37.018 1.00 0.00   ? 152 TYR B H     1 
ATOM   1147 H HH    . TYR C 1 10  ? 34.512 5.865   32.400 1.00 0.00   ? 152 TYR B HH    1 
ATOM   1148 N N     . PHE C 1 11  ? 39.998 8.716   33.942 1.00 28.72  ? 153 PHE B N     1 
ATOM   1149 C CA    . PHE C 1 11  ? 40.647 8.751   32.639 1.00 25.94  ? 153 PHE B CA    1 
ATOM   1150 C C     . PHE C 1 11  ? 39.846 8.102   31.516 1.00 28.25  ? 153 PHE B C     1 
ATOM   1151 O O     . PHE C 1 11  ? 40.386 7.805   30.424 1.00 30.88  ? 153 PHE B O     1 
ATOM   1152 C CB    . PHE C 1 11  ? 41.996 8.102   32.678 1.00 22.00  ? 153 PHE B CB    1 
ATOM   1153 C CG    . PHE C 1 11  ? 43.037 9.024   33.269 1.00 22.43  ? 153 PHE B CG    1 
ATOM   1154 C CD1   . PHE C 1 11  ? 42.850 9.586   34.547 1.00 24.76  ? 153 PHE B CD1   1 
ATOM   1155 C CD2   . PHE C 1 11  ? 44.192 9.301   32.552 1.00 23.63  ? 153 PHE B CD2   1 
ATOM   1156 C CE1   . PHE C 1 11  ? 43.818 10.432  35.097 1.00 24.36  ? 153 PHE B CE1   1 
ATOM   1157 C CE2   . PHE C 1 11  ? 45.163 10.150  33.107 1.00 26.39  ? 153 PHE B CE2   1 
ATOM   1158 C CZ    . PHE C 1 11  ? 44.977 10.723  34.379 1.00 24.93  ? 153 PHE B CZ    1 
ATOM   1159 H H     . PHE C 1 11  ? 40.032 7.888   34.464 1.00 0.00   ? 153 PHE B H     1 
ATOM   1160 N N     . GLY C 1 12  ? 38.529 7.921   31.734 1.00 29.77  ? 154 GLY B N     1 
ATOM   1161 C CA    . GLY C 1 12  ? 37.609 7.460   30.679 1.00 33.92  ? 154 GLY B CA    1 
ATOM   1162 C C     . GLY C 1 12  ? 37.984 6.119   30.058 1.00 34.91  ? 154 GLY B C     1 
ATOM   1163 O O     . GLY C 1 12  ? 38.346 5.182   30.770 1.00 35.44  ? 154 GLY B O     1 
ATOM   1164 H H     . GLY C 1 12  ? 38.169 8.103   32.627 1.00 0.00   ? 154 GLY B H     1 
ATOM   1165 N N     . LYS C 1 13  ? 38.016 6.055   28.724 1.00 32.95  ? 155 LYS B N     1 
ATOM   1166 C CA    . LYS C 1 13  ? 38.269 4.814   28.011 1.00 31.81  ? 155 LYS B CA    1 
ATOM   1167 C C     . LYS C 1 13  ? 39.719 4.569   27.757 1.00 32.14  ? 155 LYS B C     1 
ATOM   1168 O O     . LYS C 1 13  ? 40.036 3.933   26.750 1.00 37.07  ? 155 LYS B O     1 
ATOM   1169 C CB    . LYS C 1 13  ? 37.558 4.761   26.644 1.00 31.16  ? 155 LYS B CB    1 
ATOM   1170 C CG    . LYS C 1 13  ? 36.052 4.799   26.717 1.00 37.19  ? 155 LYS B CG    1 
ATOM   1171 C CD    . LYS C 1 13  ? 35.424 4.484   25.337 1.00 46.57  ? 155 LYS B CD    1 
ATOM   1172 C CE    . LYS C 1 13  ? 34.622 5.654   24.724 1.00 54.54  ? 155 LYS B CE    1 
ATOM   1173 N NZ    . LYS C 1 13  ? 35.449 6.534   23.900 1.00 57.74  ? 155 LYS B NZ    1 
ATOM   1174 H H     . LYS C 1 13  ? 37.863 6.874   28.208 1.00 0.00   ? 155 LYS B H     1 
ATOM   1175 H HZ1   . LYS C 1 13  ? 35.864 5.988   23.118 1.00 0.00   ? 155 LYS B HZ1   1 
ATOM   1176 H HZ2   . LYS C 1 13  ? 34.862 7.301   23.514 1.00 0.00   ? 155 LYS B HZ2   1 
ATOM   1177 H HZ3   . LYS C 1 13  ? 36.210 6.940   24.482 1.00 0.00   ? 155 LYS B HZ3   1 
ATOM   1178 N N     . ILE C 1 14  ? 40.680 5.085   28.512 1.00 34.48  ? 156 ILE B N     1 
ATOM   1179 C CA    . ILE C 1 14  ? 42.026 4.623   28.256 1.00 33.63  ? 156 ILE B CA    1 
ATOM   1180 C C     . ILE C 1 14  ? 42.089 3.109   28.574 1.00 34.73  ? 156 ILE B C     1 
ATOM   1181 O O     . ILE C 1 14  ? 41.310 2.577   29.388 1.00 29.88  ? 156 ILE B O     1 
ATOM   1182 C CB    . ILE C 1 14  ? 43.054 5.377   29.102 1.00 37.89  ? 156 ILE B CB    1 
ATOM   1183 C CG1   . ILE C 1 14  ? 42.896 5.175   30.591 1.00 41.22  ? 156 ILE B CG1   1 
ATOM   1184 C CG2   . ILE C 1 14  ? 42.909 6.825   28.719 1.00 40.30  ? 156 ILE B CG2   1 
ATOM   1185 C CD1   . ILE C 1 14  ? 44.303 5.233   31.225 1.00 39.88  ? 156 ILE B CD1   1 
ATOM   1186 H H     . ILE C 1 14  ? 40.487 5.746   29.209 1.00 0.00   ? 156 ILE B H     1 
ATOM   1187 N N     . THR C 1 15  ? 43.030 2.390   27.983 1.00 33.08  ? 157 THR B N     1 
ATOM   1188 C CA    . THR C 1 15  ? 43.064 0.962   28.130 1.00 32.15  ? 157 THR B CA    1 
ATOM   1189 C C     . THR C 1 15  ? 43.867 0.512   29.329 1.00 29.00  ? 157 THR B C     1 
ATOM   1190 O O     . THR C 1 15  ? 44.577 1.320   29.918 1.00 29.81  ? 157 THR B O     1 
ATOM   1191 C CB    . THR C 1 15  ? 43.651 0.363   26.822 1.00 31.25  ? 157 THR B CB    1 
ATOM   1192 O OG1   . THR C 1 15  ? 45.044 0.715   26.820 1.00 32.76  ? 157 THR B OG1   1 
ATOM   1193 C CG2   . THR C 1 15  ? 42.889 0.815   25.556 1.00 29.53  ? 157 THR B CG2   1 
ATOM   1194 H H     . THR C 1 15  ? 43.711 2.837   27.439 1.00 0.00   ? 157 THR B H     1 
ATOM   1195 H HG1   . THR C 1 15  ? 45.133 1.671   26.835 1.00 0.00   ? 157 THR B HG1   1 
ATOM   1196 N N     . ARG C 1 16  ? 43.896 -0.783  29.636 1.00 29.17  ? 158 ARG B N     1 
ATOM   1197 C CA    . ARG C 1 16  ? 44.731 -1.333  30.669 1.00 28.72  ? 158 ARG B CA    1 
ATOM   1198 C C     . ARG C 1 16  ? 46.164 -1.038  30.358 1.00 28.56  ? 158 ARG B C     1 
ATOM   1199 O O     . ARG C 1 16  ? 46.869 -0.514  31.225 1.00 26.99  ? 158 ARG B O     1 
ATOM   1200 C CB    . ARG C 1 16  ? 44.561 -2.871  30.804 1.00 28.80  ? 158 ARG B CB    1 
ATOM   1201 C CG    . ARG C 1 16  ? 45.623 -3.429  31.766 1.00 33.08  ? 158 ARG B CG    1 
ATOM   1202 C CD    . ARG C 1 16  ? 45.714 -4.943  31.840 1.00 36.63  ? 158 ARG B CD    1 
ATOM   1203 N NE    . ARG C 1 16  ? 44.644 -5.377  32.681 1.00 38.02  ? 158 ARG B NE    1 
ATOM   1204 C CZ    . ARG C 1 16  ? 44.843 -6.125  33.757 1.00 33.10  ? 158 ARG B CZ    1 
ATOM   1205 N NH1   . ARG C 1 16  ? 46.060 -6.530  34.119 1.00 28.78  ? 158 ARG B NH1   1 
ATOM   1206 N NH2   . ARG C 1 16  ? 43.766 -6.356  34.498 1.00 36.21  ? 158 ARG B NH2   1 
ATOM   1207 H H     . ARG C 1 16  ? 43.318 -1.393  29.132 1.00 0.00   ? 158 ARG B H     1 
ATOM   1208 H HE    . ARG C 1 16  ? 43.729 -5.112  32.454 1.00 0.00   ? 158 ARG B HE    1 
ATOM   1209 H HH11  . ARG C 1 16  ? 46.856 -6.270  33.573 1.00 0.00   ? 158 ARG B HH11  1 
ATOM   1210 H HH12  . ARG C 1 16  ? 46.177 -7.094  34.937 1.00 0.00   ? 158 ARG B HH12  1 
ATOM   1211 H HH21  . ARG C 1 16  ? 42.882 -5.973  34.229 1.00 0.00   ? 158 ARG B HH21  1 
ATOM   1212 H HH22  . ARG C 1 16  ? 43.839 -6.913  35.326 1.00 0.00   ? 158 ARG B HH22  1 
ATOM   1213 N N     . ARG C 1 17  ? 46.609 -1.327  29.141 1.00 29.13  ? 159 ARG B N     1 
ATOM   1214 C CA    . ARG C 1 17  ? 47.992 -1.066  28.769 1.00 31.38  ? 159 ARG B CA    1 
ATOM   1215 C C     . ARG C 1 17  ? 48.316 0.441   28.873 1.00 27.88  ? 159 ARG B C     1 
ATOM   1216 O O     . ARG C 1 17  ? 49.386 0.830   29.384 1.00 27.76  ? 159 ARG B O     1 
ATOM   1217 C CB    . ARG C 1 17  ? 48.248 -1.564  27.321 1.00 34.62  ? 159 ARG B CB    1 
ATOM   1218 C CG    . ARG C 1 17  ? 49.656 -1.232  26.872 1.00 41.41  ? 159 ARG B CG    1 
ATOM   1219 C CD    . ARG C 1 17  ? 49.963 -1.686  25.469 1.00 51.98  ? 159 ARG B CD    1 
ATOM   1220 N NE    . ARG C 1 17  ? 49.611 -0.709  24.436 1.00 58.05  ? 159 ARG B NE    1 
ATOM   1221 C CZ    . ARG C 1 17  ? 49.696 -1.041  23.152 1.00 59.17  ? 159 ARG B CZ    1 
ATOM   1222 N NH1   . ARG C 1 17  ? 50.109 -2.254  22.802 1.00 64.31  ? 159 ARG B NH1   1 
ATOM   1223 N NH2   . ARG C 1 17  ? 49.321 -0.174  22.235 1.00 63.94  ? 159 ARG B NH2   1 
ATOM   1224 H H     . ARG C 1 17  ? 45.998 -1.721  28.484 1.00 0.00   ? 159 ARG B H     1 
ATOM   1225 H HE    . ARG C 1 17  ? 49.313 0.189   24.692 1.00 0.00   ? 159 ARG B HE    1 
ATOM   1226 H HH11  . ARG C 1 17  ? 50.357 -2.920  23.505 1.00 0.00   ? 159 ARG B HH11  1 
ATOM   1227 H HH12  . ARG C 1 17  ? 50.172 -2.501  21.835 1.00 0.00   ? 159 ARG B HH12  1 
ATOM   1228 H HH21  . ARG C 1 17  ? 48.976 0.724   22.507 1.00 0.00   ? 159 ARG B HH21  1 
ATOM   1229 H HH22  . ARG C 1 17  ? 49.381 -0.414  21.266 1.00 0.00   ? 159 ARG B HH22  1 
ATOM   1230 N N     . GLU C 1 18  ? 47.404 1.298   28.375 1.00 26.26  ? 160 GLU B N     1 
ATOM   1231 C CA    . GLU C 1 18  ? 47.605 2.728   28.457 1.00 29.43  ? 160 GLU B CA    1 
ATOM   1232 C C     . GLU C 1 18  ? 47.767 3.227   29.894 1.00 30.81  ? 160 GLU B C     1 
ATOM   1233 O O     . GLU C 1 18  ? 48.711 3.983   30.194 1.00 29.69  ? 160 GLU B O     1 
ATOM   1234 C CB    . GLU C 1 18  ? 46.452 3.443   27.806 1.00 28.49  ? 160 GLU B CB    1 
ATOM   1235 C CG    . GLU C 1 18  ? 46.614 3.359   26.272 1.00 32.98  ? 160 GLU B CG    1 
ATOM   1236 C CD    . GLU C 1 18  ? 45.425 3.881   25.442 1.00 35.46  ? 160 GLU B CD    1 
ATOM   1237 O OE1   . GLU C 1 18  ? 44.290 3.822   25.929 1.00 33.39  ? 160 GLU B OE1   1 
ATOM   1238 O OE2   . GLU C 1 18  ? 45.636 4.264   24.279 1.00 35.14  ? 160 GLU B OE2   1 
ATOM   1239 H H     . GLU C 1 18  ? 46.593 0.948   27.951 1.00 0.00   ? 160 GLU B H     1 
ATOM   1240 N N     . SER C 1 19  ? 46.910 2.724   30.809 1.00 32.31  ? 161 SER B N     1 
ATOM   1241 C CA    . SER C 1 19  ? 46.953 3.116   32.208 1.00 29.17  ? 161 SER B CA    1 
ATOM   1242 C C     . SER C 1 19  ? 48.257 2.719   32.805 1.00 28.10  ? 161 SER B C     1 
ATOM   1243 O O     . SER C 1 19  ? 48.837 3.498   33.544 1.00 32.41  ? 161 SER B O     1 
ATOM   1244 C CB    . SER C 1 19  ? 45.828 2.456   32.977 1.00 30.72  ? 161 SER B CB    1 
ATOM   1245 O OG    . SER C 1 19  ? 46.014 1.046   33.139 1.00 31.54  ? 161 SER B OG    1 
ATOM   1246 H H     . SER C 1 19  ? 46.237 2.073   30.520 1.00 0.00   ? 161 SER B H     1 
ATOM   1247 H HG    . SER C 1 19  ? 45.275 0.680   33.631 1.00 0.00   ? 161 SER B HG    1 
ATOM   1248 N N     . GLU C 1 20  ? 48.793 1.561   32.442 1.00 29.23  ? 162 GLU B N     1 
ATOM   1249 C CA    . GLU C 1 20  ? 50.078 1.135   32.967 1.00 31.36  ? 162 GLU B CA    1 
ATOM   1250 C C     . GLU C 1 20  ? 51.220 1.979   32.420 1.00 34.28  ? 162 GLU B C     1 
ATOM   1251 O O     . GLU C 1 20  ? 52.198 2.294   33.135 1.00 32.73  ? 162 GLU B O     1 
ATOM   1252 C CB    . GLU C 1 20  ? 50.330 -0.310  32.628 1.00 31.97  ? 162 GLU B CB    1 
ATOM   1253 C CG    . GLU C 1 20  ? 49.198 -1.133  33.167 1.00 38.34  ? 162 GLU B CG    1 
ATOM   1254 C CD    . GLU C 1 20  ? 49.543 -2.581  33.385 1.00 47.22  ? 162 GLU B CD    1 
ATOM   1255 O OE1   . GLU C 1 20  ? 50.684 -2.858  33.748 1.00 51.08  ? 162 GLU B OE1   1 
ATOM   1256 O OE2   . GLU C 1 20  ? 48.633 -3.416  33.274 1.00 49.87  ? 162 GLU B OE2   1 
ATOM   1257 H H     . GLU C 1 20  ? 48.315 0.985   31.810 1.00 0.00   ? 162 GLU B H     1 
ATOM   1258 N N     . ARG C 1 21  ? 51.135 2.344   31.136 1.00 34.31  ? 163 ARG B N     1 
ATOM   1259 C CA    . ARG C 1 21  ? 52.093 3.281   30.566 1.00 35.20  ? 163 ARG B CA    1 
ATOM   1260 C C     . ARG C 1 21  ? 52.084 4.608   31.342 1.00 32.34  ? 163 ARG B C     1 
ATOM   1261 O O     . ARG C 1 21  ? 53.121 5.092   31.745 1.00 27.79  ? 163 ARG B O     1 
ATOM   1262 C CB    . ARG C 1 21  ? 51.729 3.543   29.139 1.00 40.41  ? 163 ARG B CB    1 
ATOM   1263 C CG    . ARG C 1 21  ? 52.285 2.522   28.245 1.00 49.62  ? 163 ARG B CG    1 
ATOM   1264 C CD    . ARG C 1 21  ? 51.466 2.433   26.974 1.00 59.32  ? 163 ARG B CD    1 
ATOM   1265 N NE    . ARG C 1 21  ? 51.969 1.308   26.204 1.00 68.99  ? 163 ARG B NE    1 
ATOM   1266 C CZ    . ARG C 1 21  ? 51.920 1.271   24.884 1.00 73.42  ? 163 ARG B CZ    1 
ATOM   1267 N NH1   . ARG C 1 21  ? 51.393 2.282   24.195 1.00 76.05  ? 163 ARG B NH1   1 
ATOM   1268 N NH2   . ARG C 1 21  ? 52.405 0.186   24.268 1.00 76.20  ? 163 ARG B NH2   1 
ATOM   1269 H H     . ARG C 1 21  ? 50.421 1.977   30.573 1.00 0.00   ? 163 ARG B H     1 
ATOM   1270 H HE    . ARG C 1 21  ? 52.360 0.547   26.682 1.00 0.00   ? 163 ARG B HE    1 
ATOM   1271 H HH11  . ARG C 1 21  ? 51.029 3.079   24.677 1.00 0.00   ? 163 ARG B HH11  1 
ATOM   1272 H HH12  . ARG C 1 21  ? 51.361 2.244   23.196 1.00 0.00   ? 163 ARG B HH12  1 
ATOM   1273 H HH21  . ARG C 1 21  ? 52.789 -0.565  24.806 1.00 0.00   ? 163 ARG B HH21  1 
ATOM   1274 H HH22  . ARG C 1 21  ? 52.383 0.126   23.270 1.00 0.00   ? 163 ARG B HH22  1 
ATOM   1275 N N     . LEU C 1 22  ? 50.894 5.154   31.603 1.00 30.80  ? 164 LEU B N     1 
ATOM   1276 C CA    . LEU C 1 22  ? 50.726 6.370   32.364 1.00 29.68  ? 164 LEU B CA    1 
ATOM   1277 C C     . LEU C 1 22  ? 51.149 6.271   33.819 1.00 32.41  ? 164 LEU B C     1 
ATOM   1278 O O     . LEU C 1 22  ? 51.901 7.110   34.305 1.00 34.49  ? 164 LEU B O     1 
ATOM   1279 C CB    . LEU C 1 22  ? 49.292 6.789   32.352 1.00 25.07  ? 164 LEU B CB    1 
ATOM   1280 C CG    . LEU C 1 22  ? 48.689 7.299   31.081 1.00 29.16  ? 164 LEU B CG    1 
ATOM   1281 C CD1   . LEU C 1 22  ? 47.211 7.499   31.295 1.00 26.04  ? 164 LEU B CD1   1 
ATOM   1282 C CD2   . LEU C 1 22  ? 49.356 8.602   30.672 1.00 31.90  ? 164 LEU B CD2   1 
ATOM   1283 H H     . LEU C 1 22  ? 50.093 4.706   31.260 1.00 0.00   ? 164 LEU B H     1 
ATOM   1284 N N     . LEU C 1 23  ? 50.726 5.233   34.514 1.00 31.11  ? 165 LEU B N     1 
ATOM   1285 C CA    . LEU C 1 23  ? 50.904 5.195   35.972 1.00 32.43  ? 165 LEU B CA    1 
ATOM   1286 C C     . LEU C 1 23  ? 52.360 4.950   36.328 1.00 34.78  ? 165 LEU B C     1 
ATOM   1287 O O     . LEU C 1 23  ? 52.841 5.361   37.388 1.00 39.24  ? 165 LEU B O     1 
ATOM   1288 C CB    . LEU C 1 23  ? 50.099 4.058   36.579 1.00 29.59  ? 165 LEU B CB    1 
ATOM   1289 C CG    . LEU C 1 23  ? 48.608 4.354   36.639 1.00 29.97  ? 165 LEU B CG    1 
ATOM   1290 C CD1   . LEU C 1 23  ? 47.803 3.173   37.180 1.00 25.07  ? 165 LEU B CD1   1 
ATOM   1291 C CD2   . LEU C 1 23  ? 48.275 5.552   37.530 1.00 27.27  ? 165 LEU B CD2   1 
ATOM   1292 H H     . LEU C 1 23  ? 50.291 4.484   34.056 1.00 0.00   ? 165 LEU B H     1 
ATOM   1293 N N     . LEU C 1 24  ? 53.041 4.273   35.444 1.00 37.35  ? 166 LEU B N     1 
ATOM   1294 C CA    . LEU C 1 24  ? 54.446 3.971   35.662 1.00 42.24  ? 166 LEU B CA    1 
ATOM   1295 C C     . LEU C 1 24  ? 55.341 5.032   34.998 1.00 47.94  ? 166 LEU B C     1 
ATOM   1296 O O     . LEU C 1 24  ? 56.562 5.022   35.150 1.00 51.17  ? 166 LEU B O     1 
ATOM   1297 C CB    . LEU C 1 24  ? 54.812 2.616   35.044 1.00 44.29  ? 166 LEU B CB    1 
ATOM   1298 C CG    . LEU C 1 24  ? 54.054 1.417   35.632 1.00 45.06  ? 166 LEU B CG    1 
ATOM   1299 C CD1   . LEU C 1 24  ? 54.248 0.137   34.806 1.00 40.51  ? 166 LEU B CD1   1 
ATOM   1300 C CD2   . LEU C 1 24  ? 54.497 1.064   37.053 1.00 46.33  ? 166 LEU B CD2   1 
ATOM   1301 H H     . LEU C 1 24  ? 52.600 3.965   34.625 1.00 0.00   ? 166 LEU B H     1 
ATOM   1302 N N     . ASN C 1 25  ? 54.656 6.129   34.356 1.00 54.93  ? 167 ASN B N     1 
ATOM   1303 C CA    . ASN C 1 25  ? 55.527 6.923   33.478 1.00 60.84  ? 167 ASN B CA    1 
ATOM   1304 C C     . ASN C 1 25  ? 55.886 8.271   34.114 1.00 64.38  ? 167 ASN B C     1 
ATOM   1305 O O     . ASN C 1 25  ? 55.474 9.339   33.647 1.00 63.23  ? 167 ASN B O     1 
ATOM   1306 C CB    . ASN C 1 25  ? 54.829 7.238   32.156 1.00 66.24  ? 167 ASN B CB    1 
ATOM   1307 C CG    . ASN C 1 25  ? 55.802 7.771   31.100 1.00 72.83  ? 167 ASN B CG    1 
ATOM   1308 O OD1   . ASN C 1 25  ? 56.917 7.260   30.984 1.00 74.03  ? 167 ASN B OD1   1 
ATOM   1309 N ND2   . ASN C 1 25  ? 55.452 8.772   30.315 1.00 78.03  ? 167 ASN B ND2   1 
ATOM   1310 H H     . ASN C 1 25  ? 53.707 6.324   34.492 1.00 0.00   ? 167 ASN B H     1 
ATOM   1311 H HD21  . ASN C 1 25  ? 56.107 9.079   29.655 1.00 0.00   ? 167 ASN B HD21  1 
ATOM   1312 H HD22  . ASN C 1 25  ? 54.565 9.179   30.406 1.00 0.00   ? 167 ASN B HD22  1 
ATOM   1313 N N     . ALA C 1 26  ? 56.674 8.209   35.162 1.00 66.41  ? 168 ALA B N     1 
ATOM   1314 C CA    . ALA C 1 26  ? 57.146 9.418   35.845 1.00 69.45  ? 168 ALA B CA    1 
ATOM   1315 C C     . ALA C 1 26  ? 58.037 9.026   37.009 1.00 68.45  ? 168 ALA B C     1 
ATOM   1316 O O     . ALA C 1 26  ? 58.706 7.984   36.977 1.00 69.80  ? 168 ALA B O     1 
ATOM   1317 C CB    . ALA C 1 26  ? 55.957 10.228  36.371 1.00 70.98  ? 168 ALA B CB    1 
ATOM   1318 H H     . ALA C 1 26  ? 56.954 7.332   35.497 1.00 0.00   ? 168 ALA B H     1 
ATOM   1319 N N     . GLU C 1 27  ? 58.021 9.886   37.995 1.00 65.62  ? 169 GLU B N     1 
ATOM   1320 C CA    . GLU C 1 27  ? 58.742 9.665   39.242 1.00 63.56  ? 169 GLU B CA    1 
ATOM   1321 C C     . GLU C 1 27  ? 57.722 9.628   40.381 1.00 61.15  ? 169 GLU B C     1 
ATOM   1322 O O     . GLU C 1 27  ? 57.510 10.627  41.079 1.00 60.86  ? 169 GLU B O     1 
ATOM   1323 C CB    . GLU C 1 27  ? 59.749 10.783  39.485 1.00 65.11  ? 169 GLU B CB    1 
ATOM   1324 H H     . GLU C 1 27  ? 57.504 10.711  37.891 1.00 0.00   ? 169 GLU B H     1 
ATOM   1325 N N     . ASN C 1 28  ? 56.569 9.009   39.749 1.00 56.17  ? 170 ASN B N     1 
ATOM   1326 C CA    . ASN C 1 28  ? 55.338 8.839   40.469 1.00 52.24  ? 170 ASN B CA    1 
ATOM   1327 C C     . ASN C 1 28  ? 55.478 7.905   41.622 1.00 48.53  ? 170 ASN B C     1 
ATOM   1328 O O     . ASN C 1 28  ? 56.050 6.836   41.465 1.00 44.58  ? 170 ASN B O     1 
ATOM   1329 C CB    . ASN C 1 28  ? 54.246 8.235   39.585 1.00 54.09  ? 170 ASN B CB    1 
ATOM   1330 C CG    . ASN C 1 28  ? 53.562 9.293   38.742 1.00 55.29  ? 170 ASN B CG    1 
ATOM   1331 O OD1   . ASN C 1 28  ? 53.256 9.076   37.578 1.00 53.34  ? 170 ASN B OD1   1 
ATOM   1332 N ND2   . ASN C 1 28  ? 53.343 10.488  39.260 1.00 58.53  ? 170 ASN B ND2   1 
ATOM   1333 H H     . ASN C 1 28  ? 56.632 8.704   38.820 1.00 0.00   ? 170 ASN B H     1 
ATOM   1334 H HD21  . ASN C 1 28  ? 52.900 11.152  38.693 1.00 0.00   ? 170 ASN B HD21  1 
ATOM   1335 H HD22  . ASN C 1 28  ? 53.622 10.682  40.179 1.00 0.00   ? 170 ASN B HD22  1 
ATOM   1336 N N     . PRO C 1 29  ? 55.054 8.321   42.831 1.00 46.39  ? 171 PRO B N     1 
ATOM   1337 C CA    . PRO C 1 29  ? 55.055 7.472   44.011 1.00 45.95  ? 171 PRO B CA    1 
ATOM   1338 C C     . PRO C 1 29  ? 54.090 6.266   43.881 1.00 44.55  ? 171 PRO B C     1 
ATOM   1339 O O     . PRO C 1 29  ? 53.264 6.140   42.965 1.00 43.50  ? 171 PRO B O     1 
ATOM   1340 C CB    . PRO C 1 29  ? 54.672 8.452   45.118 1.00 46.20  ? 171 PRO B CB    1 
ATOM   1341 C CG    . PRO C 1 29  ? 53.717 9.414   44.478 1.00 43.06  ? 171 PRO B CG    1 
ATOM   1342 C CD    . PRO C 1 29  ? 54.313 9.569   43.081 1.00 45.22  ? 171 PRO B CD    1 
ATOM   1343 N N     . ARG C 1 30  ? 54.217 5.354   44.835 1.00 42.90  ? 172 ARG B N     1 
ATOM   1344 C CA    . ARG C 1 30  ? 53.293 4.244   44.991 1.00 35.63  ? 172 ARG B CA    1 
ATOM   1345 C C     . ARG C 1 30  ? 51.964 4.891   45.317 1.00 30.54  ? 172 ARG B C     1 
ATOM   1346 O O     . ARG C 1 30  ? 51.925 5.934   45.973 1.00 32.06  ? 172 ARG B O     1 
ATOM   1347 C CB    . ARG C 1 30  ? 53.715 3.383   46.156 1.00 37.91  ? 172 ARG B CB    1 
ATOM   1348 C CG    . ARG C 1 30  ? 55.140 2.880   46.170 1.00 42.83  ? 172 ARG B CG    1 
ATOM   1349 C CD    . ARG C 1 30  ? 55.459 2.653   47.631 1.00 48.29  ? 172 ARG B CD    1 
ATOM   1350 N NE    . ARG C 1 30  ? 56.670 1.868   47.827 1.00 57.07  ? 172 ARG B NE    1 
ATOM   1351 C CZ    . ARG C 1 30  ? 57.868 2.397   48.113 1.00 60.23  ? 172 ARG B CZ    1 
ATOM   1352 N NH1   . ARG C 1 30  ? 58.055 3.719   48.243 1.00 62.85  ? 172 ARG B NH1   1 
ATOM   1353 N NH2   . ARG C 1 30  ? 58.887 1.569   48.316 1.00 61.44  ? 172 ARG B NH2   1 
ATOM   1354 H H     . ARG C 1 30  ? 54.966 5.432   45.462 1.00 0.00   ? 172 ARG B H     1 
ATOM   1355 H HE    . ARG C 1 30  ? 56.605 0.894   47.745 1.00 0.00   ? 172 ARG B HE    1 
ATOM   1356 H HH11  . ARG C 1 30  ? 57.285 4.347   48.126 1.00 0.00   ? 172 ARG B HH11  1 
ATOM   1357 H HH12  . ARG C 1 30  ? 58.964 4.077   48.457 1.00 0.00   ? 172 ARG B HH12  1 
ATOM   1358 H HH21  . ARG C 1 30  ? 58.748 0.581   48.254 1.00 0.00   ? 172 ARG B HH21  1 
ATOM   1359 H HH22  . ARG C 1 30  ? 59.793 1.934   48.531 1.00 0.00   ? 172 ARG B HH22  1 
ATOM   1360 N N     . GLY C 1 31  ? 50.872 4.274   44.948 1.00 24.49  ? 173 GLY B N     1 
ATOM   1361 C CA    . GLY C 1 31  ? 49.576 4.813   45.267 1.00 25.84  ? 173 GLY B CA    1 
ATOM   1362 C C     . GLY C 1 31  ? 49.081 5.870   44.267 1.00 29.44  ? 173 GLY B C     1 
ATOM   1363 O O     . GLY C 1 31  ? 48.071 6.567   44.533 1.00 28.63  ? 173 GLY B O     1 
ATOM   1364 H H     . GLY C 1 31  ? 50.937 3.434   44.448 1.00 0.00   ? 173 GLY B H     1 
ATOM   1365 N N     . THR C 1 32  ? 49.814 6.071   43.154 1.00 28.62  ? 174 THR B N     1 
ATOM   1366 C CA    . THR C 1 32  ? 49.310 6.888   42.062 1.00 27.88  ? 174 THR B CA    1 
ATOM   1367 C C     . THR C 1 32  ? 48.275 5.980   41.369 1.00 27.48  ? 174 THR B C     1 
ATOM   1368 O O     . THR C 1 32  ? 48.462 4.759   41.177 1.00 21.06  ? 174 THR B O     1 
ATOM   1369 C CB    . THR C 1 32  ? 50.447 7.280   41.082 1.00 30.46  ? 174 THR B CB    1 
ATOM   1370 O OG1   . THR C 1 32  ? 51.410 7.989   41.831 1.00 31.95  ? 174 THR B OG1   1 
ATOM   1371 C CG2   . THR C 1 32  ? 49.990 8.169   39.963 1.00 29.90  ? 174 THR B CG2   1 
ATOM   1372 H H     . THR C 1 32  ? 50.701 5.660   43.080 1.00 0.00   ? 174 THR B H     1 
ATOM   1373 H HG1   . THR C 1 32  ? 51.746 7.428   42.534 1.00 0.00   ? 174 THR B HG1   1 
ATOM   1374 N N     . PHE C 1 33  ? 47.155 6.595   41.014 1.00 26.41  ? 175 PHE B N     1 
ATOM   1375 C CA    . PHE C 1 33  ? 46.035 5.845   40.487 1.00 26.39  ? 175 PHE B CA    1 
ATOM   1376 C C     . PHE C 1 33  ? 45.244 6.654   39.463 1.00 27.98  ? 175 PHE B C     1 
ATOM   1377 O O     . PHE C 1 33  ? 45.397 7.883   39.312 1.00 25.17  ? 175 PHE B O     1 
ATOM   1378 C CB    . PHE C 1 33  ? 45.064 5.434   41.649 1.00 23.33  ? 175 PHE B CB    1 
ATOM   1379 C CG    . PHE C 1 33  ? 44.281 6.621   42.223 1.00 21.35  ? 175 PHE B CG    1 
ATOM   1380 C CD1   . PHE C 1 33  ? 44.919 7.534   43.080 1.00 22.99  ? 175 PHE B CD1   1 
ATOM   1381 C CD2   . PHE C 1 33  ? 42.954 6.824   41.827 1.00 20.63  ? 175 PHE B CD2   1 
ATOM   1382 C CE1   . PHE C 1 33  ? 44.185 8.578   43.601 1.00 19.96  ? 175 PHE B CE1   1 
ATOM   1383 C CE2   . PHE C 1 33  ? 42.227 7.879   42.347 1.00 19.49  ? 175 PHE B CE2   1 
ATOM   1384 C CZ    . PHE C 1 33  ? 42.852 8.748   43.226 1.00 19.30  ? 175 PHE B CZ    1 
ATOM   1385 H H     . PHE C 1 33  ? 47.085 7.568   41.110 1.00 0.00   ? 175 PHE B H     1 
ATOM   1386 N N     . LEU C 1 34  ? 44.287 5.925   38.880 1.00 24.64  ? 176 LEU B N     1 
ATOM   1387 C CA    . LEU C 1 34  ? 43.245 6.503   38.047 1.00 26.15  ? 176 LEU B CA    1 
ATOM   1388 C C     . LEU C 1 34  ? 42.089 5.516   37.991 1.00 25.66  ? 176 LEU B C     1 
ATOM   1389 O O     . LEU C 1 34  ? 42.273 4.322   38.295 1.00 26.22  ? 176 LEU B O     1 
ATOM   1390 C CB    . LEU C 1 34  ? 43.777 6.783   36.595 1.00 25.75  ? 176 LEU B CB    1 
ATOM   1391 C CG    . LEU C 1 34  ? 44.407 5.633   35.778 1.00 21.20  ? 176 LEU B CG    1 
ATOM   1392 C CD1   . LEU C 1 34  ? 43.299 4.832   35.110 1.00 16.08  ? 176 LEU B CD1   1 
ATOM   1393 C CD2   . LEU C 1 34  ? 45.457 6.218   34.824 1.00 19.97  ? 176 LEU B CD2   1 
ATOM   1394 H H     . LEU C 1 34  ? 44.288 4.956   39.021 1.00 0.00   ? 176 LEU B H     1 
ATOM   1395 N N     . VAL C 1 35  ? 40.904 6.010   37.627 1.00 25.03  ? 177 VAL B N     1 
ATOM   1396 C CA    . VAL C 1 35  ? 39.750 5.173   37.332 1.00 26.96  ? 177 VAL B CA    1 
ATOM   1397 C C     . VAL C 1 35  ? 39.464 5.251   35.805 1.00 32.04  ? 177 VAL B C     1 
ATOM   1398 O O     . VAL C 1 35  ? 39.535 6.340   35.205 1.00 30.30  ? 177 VAL B O     1 
ATOM   1399 C CB    . VAL C 1 35  ? 38.521 5.660   38.126 1.00 22.95  ? 177 VAL B CB    1 
ATOM   1400 C CG1   . VAL C 1 35  ? 37.291 4.821   37.759 1.00 24.50  ? 177 VAL B CG1   1 
ATOM   1401 C CG2   . VAL C 1 35  ? 38.800 5.535   39.615 1.00 22.79  ? 177 VAL B CG2   1 
ATOM   1402 H H     . VAL C 1 35  ? 40.806 6.982   37.555 1.00 0.00   ? 177 VAL B H     1 
ATOM   1403 N N     . ARG C 1 36  ? 39.107 4.127   35.168 1.00 30.78  ? 178 ARG B N     1 
ATOM   1404 C CA    . ARG C 1 36  ? 38.830 4.066   33.741 1.00 29.89  ? 178 ARG B CA    1 
ATOM   1405 C C     . ARG C 1 36  ? 37.659 3.136   33.477 1.00 32.45  ? 178 ARG B C     1 
ATOM   1406 O O     . ARG C 1 36  ? 37.273 2.369   34.362 1.00 26.94  ? 178 ARG B O     1 
ATOM   1407 C CB    . ARG C 1 36  ? 40.070 3.554   33.012 1.00 28.36  ? 178 ARG B CB    1 
ATOM   1408 C CG    . ARG C 1 36  ? 40.576 2.204   33.529 1.00 27.20  ? 178 ARG B CG    1 
ATOM   1409 C CD    . ARG C 1 36  ? 41.763 1.788   32.746 1.00 26.28  ? 178 ARG B CD    1 
ATOM   1410 N NE    . ARG C 1 36  ? 42.408 0.603   33.303 1.00 31.32  ? 178 ARG B NE    1 
ATOM   1411 C CZ    . ARG C 1 36  ? 42.035 -0.639  33.034 1.00 26.29  ? 178 ARG B CZ    1 
ATOM   1412 N NH1   . ARG C 1 36  ? 41.021 -0.871  32.231 1.00 27.24  ? 178 ARG B NH1   1 
ATOM   1413 N NH2   . ARG C 1 36  ? 42.709 -1.668  33.565 1.00 25.15  ? 178 ARG B NH2   1 
ATOM   1414 H H     . ARG C 1 36  ? 39.028 3.303   35.691 1.00 0.00   ? 178 ARG B H     1 
ATOM   1415 H HE    . ARG C 1 36  ? 43.163 0.734   33.913 1.00 0.00   ? 178 ARG B HE    1 
ATOM   1416 H HH11  . ARG C 1 36  ? 40.525 -0.107  31.818 1.00 0.00   ? 178 ARG B HH11  1 
ATOM   1417 H HH12  . ARG C 1 36  ? 40.745 -1.812  32.033 1.00 0.00   ? 178 ARG B HH12  1 
ATOM   1418 H HH21  . ARG C 1 36  ? 43.492 -1.497  34.163 1.00 0.00   ? 178 ARG B HH21  1 
ATOM   1419 H HH22  . ARG C 1 36  ? 42.429 -2.607  33.363 1.00 0.00   ? 178 ARG B HH22  1 
ATOM   1420 N N     . GLU C 1 37  ? 37.004 3.193   32.314 1.00 37.08  ? 179 GLU B N     1 
ATOM   1421 C CA    . GLU C 1 37  ? 35.948 2.234   31.977 1.00 46.81  ? 179 GLU B CA    1 
ATOM   1422 C C     . GLU C 1 37  ? 36.537 0.807   31.906 1.00 50.65  ? 179 GLU B C     1 
ATOM   1423 O O     . GLU C 1 37  ? 37.675 0.644   31.441 1.00 51.12  ? 179 GLU B O     1 
ATOM   1424 C CB    . GLU C 1 37  ? 35.339 2.603   30.630 1.00 47.99  ? 179 GLU B CB    1 
ATOM   1425 C CG    . GLU C 1 37  ? 34.315 3.743   30.704 1.00 52.21  ? 179 GLU B CG    1 
ATOM   1426 C CD    . GLU C 1 37  ? 33.728 4.108   29.345 1.00 55.16  ? 179 GLU B CD    1 
ATOM   1427 O OE1   . GLU C 1 37  ? 33.118 3.245   28.713 1.00 61.37  ? 179 GLU B OE1   1 
ATOM   1428 O OE2   . GLU C 1 37  ? 33.900 5.250   28.899 1.00 57.68  ? 179 GLU B OE2   1 
ATOM   1429 H H     . GLU C 1 37  ? 37.236 3.894   31.670 1.00 0.00   ? 179 GLU B H     1 
ATOM   1430 N N     . SER C 1 38  ? 35.895 -0.234  32.452 1.00 54.67  ? 180 SER B N     1 
ATOM   1431 C CA    . SER C 1 38  ? 36.468 -1.576  32.348 1.00 57.38  ? 180 SER B CA    1 
ATOM   1432 C C     . SER C 1 38  ? 36.533 -1.985  30.894 1.00 55.42  ? 180 SER B C     1 
ATOM   1433 O O     . SER C 1 38  ? 35.609 -1.674  30.148 1.00 51.37  ? 180 SER B O     1 
ATOM   1434 C CB    . SER C 1 38  ? 35.596 -2.572  33.112 1.00 61.50  ? 180 SER B CB    1 
ATOM   1435 O OG    . SER C 1 38  ? 36.066 -3.923  33.097 1.00 61.68  ? 180 SER B OG    1 
ATOM   1436 H H     . SER C 1 38  ? 35.045 -0.097  32.919 1.00 0.00   ? 180 SER B H     1 
ATOM   1437 H HG    . SER C 1 38  ? 35.463 -4.478  33.597 1.00 0.00   ? 180 SER B HG    1 
ATOM   1438 N N     . GLU C 1 39  ? 37.594 -2.688  30.475 1.00 57.41  ? 181 GLU B N     1 
ATOM   1439 C CA    . GLU C 1 39  ? 37.612 -3.241  29.124 1.00 60.72  ? 181 GLU B CA    1 
ATOM   1440 C C     . GLU C 1 39  ? 36.782 -4.512  29.150 1.00 62.14  ? 181 GLU B C     1 
ATOM   1441 O O     . GLU C 1 39  ? 35.875 -4.700  28.332 1.00 63.66  ? 181 GLU B O     1 
ATOM   1442 C CB    . GLU C 1 39  ? 38.997 -3.659  28.650 1.00 61.70  ? 181 GLU B CB    1 
ATOM   1443 C CG    . GLU C 1 39  ? 40.043 -2.546  28.584 1.00 65.83  ? 181 GLU B CG    1 
ATOM   1444 C CD    . GLU C 1 39  ? 41.403 -2.979  28.053 1.00 70.11  ? 181 GLU B CD    1 
ATOM   1445 O OE1   . GLU C 1 39  ? 41.667 -4.145  27.836 1.00 77.34  ? 181 GLU B OE1   1 
ATOM   1446 O OE2   . GLU C 1 39  ? 42.229 -2.135  27.790 1.00 72.50  ? 181 GLU B OE2   1 
ATOM   1447 H H     . GLU C 1 39  ? 38.356 -2.831  31.074 1.00 0.00   ? 181 GLU B H     1 
ATOM   1448 N N     . THR C 1 40  ? 37.040 -5.363  30.148 1.00 63.19  ? 182 THR B N     1 
ATOM   1449 C CA    . THR C 1 40  ? 36.428 -6.678  30.239 1.00 62.15  ? 182 THR B CA    1 
ATOM   1450 C C     . THR C 1 40  ? 34.973 -6.740  30.636 1.00 60.76  ? 182 THR B C     1 
ATOM   1451 O O     . THR C 1 40  ? 34.341 -7.757  30.395 1.00 63.02  ? 182 THR B O     1 
ATOM   1452 C CB    . THR C 1 40  ? 37.235 -7.570  31.224 1.00 63.59  ? 182 THR B CB    1 
ATOM   1453 O OG1   . THR C 1 40  ? 37.209 -7.010  32.561 1.00 66.25  ? 182 THR B OG1   1 
ATOM   1454 C CG2   . THR C 1 40  ? 38.652 -7.735  30.708 1.00 66.48  ? 182 THR B CG2   1 
ATOM   1455 H H     . THR C 1 40  ? 37.668 -5.089  30.848 1.00 0.00   ? 182 THR B H     1 
ATOM   1456 H HG1   . THR C 1 40  ? 37.597 -6.132  32.548 1.00 0.00   ? 182 THR B HG1   1 
ATOM   1457 N N     . THR C 1 41  ? 34.359 -5.726  31.222 1.00 59.91  ? 183 THR B N     1 
ATOM   1458 C CA    . THR C 1 41  ? 33.028 -5.895  31.764 1.00 58.26  ? 183 THR B CA    1 
ATOM   1459 C C     . THR C 1 41  ? 32.226 -4.632  31.557 1.00 58.59  ? 183 THR B C     1 
ATOM   1460 O O     . THR C 1 41  ? 32.579 -3.555  32.050 1.00 60.22  ? 183 THR B O     1 
ATOM   1461 C CB    . THR C 1 41  ? 33.119 -6.192  33.298 1.00 58.25  ? 183 THR B CB    1 
ATOM   1462 O OG1   . THR C 1 41  ? 34.158 -7.174  33.538 1.00 53.66  ? 183 THR B OG1   1 
ATOM   1463 C CG2   . THR C 1 41  ? 31.790 -6.686  33.833 1.00 53.75  ? 183 THR B CG2   1 
ATOM   1464 H H     . THR C 1 41  ? 34.807 -4.857  31.289 1.00 0.00   ? 183 THR B H     1 
ATOM   1465 H HG1   . THR C 1 41  ? 33.949 -7.984  33.067 1.00 0.00   ? 183 THR B HG1   1 
ATOM   1466 N N     . LYS C 1 42  ? 31.077 -4.764  30.926 1.00 56.58  ? 184 LYS B N     1 
ATOM   1467 C CA    . LYS C 1 42  ? 30.255 -3.604  30.654 1.00 58.09  ? 184 LYS B CA    1 
ATOM   1468 C C     . LYS C 1 42  ? 29.687 -2.975  31.921 1.00 57.28  ? 184 LYS B C     1 
ATOM   1469 O O     . LYS C 1 42  ? 29.379 -3.670  32.890 1.00 58.67  ? 184 LYS B O     1 
ATOM   1470 C CB    . LYS C 1 42  ? 29.109 -4.012  29.719 1.00 59.20  ? 184 LYS B CB    1 
ATOM   1471 H H     . LYS C 1 42  ? 30.777 -5.652  30.639 1.00 0.00   ? 184 LYS B H     1 
ATOM   1472 N N     . GLY C 1 43  ? 29.601 -1.643  31.957 1.00 56.95  ? 185 GLY B N     1 
ATOM   1473 C CA    . GLY C 1 43  ? 29.018 -0.920  33.098 1.00 55.20  ? 185 GLY B CA    1 
ATOM   1474 C C     . GLY C 1 43  ? 29.948 -0.704  34.305 1.00 53.10  ? 185 GLY B C     1 
ATOM   1475 O O     . GLY C 1 43  ? 29.736 0.167   35.158 1.00 54.99  ? 185 GLY B O     1 
ATOM   1476 H H     . GLY C 1 43  ? 29.939 -1.128  31.195 1.00 0.00   ? 185 GLY B H     1 
ATOM   1477 N N     . ALA C 1 44  ? 30.938 -1.548  34.428 1.00 49.17  ? 186 ALA B N     1 
ATOM   1478 C CA    . ALA C 1 44  ? 31.898 -1.469  35.492 1.00 45.60  ? 186 ALA B CA    1 
ATOM   1479 C C     . ALA C 1 44  ? 32.967 -0.404  35.208 1.00 41.85  ? 186 ALA B C     1 
ATOM   1480 O O     . ALA C 1 44  ? 33.051 0.190   34.129 1.00 40.31  ? 186 ALA B O     1 
ATOM   1481 C CB    . ALA C 1 44  ? 32.586 -2.882  35.636 1.00 46.78  ? 186 ALA B CB    1 
ATOM   1482 H H     . ALA C 1 44  ? 31.029 -2.265  33.766 1.00 0.00   ? 186 ALA B H     1 
ATOM   1483 N N     . TYR C 1 45  ? 33.860 -0.199  36.167 1.00 36.56  ? 187 TYR B N     1 
ATOM   1484 C CA    . TYR C 1 45  ? 35.031 0.619   35.963 1.00 32.69  ? 187 TYR B CA    1 
ATOM   1485 C C     . TYR C 1 45  ? 36.214 -0.184  36.409 1.00 28.25  ? 187 TYR B C     1 
ATOM   1486 O O     . TYR C 1 45  ? 36.064 -1.289  36.911 1.00 30.41  ? 187 TYR B O     1 
ATOM   1487 C CB    . TYR C 1 45  ? 34.930 1.872   36.774 1.00 30.83  ? 187 TYR B CB    1 
ATOM   1488 C CG    . TYR C 1 45  ? 33.785 2.759   36.303 1.00 32.11  ? 187 TYR B CG    1 
ATOM   1489 C CD1   . TYR C 1 45  ? 33.964 3.636   35.223 1.00 35.00  ? 187 TYR B CD1   1 
ATOM   1490 C CD2   . TYR C 1 45  ? 32.557 2.715   36.971 1.00 35.21  ? 187 TYR B CD2   1 
ATOM   1491 C CE1   . TYR C 1 45  ? 32.911 4.466   34.821 1.00 31.73  ? 187 TYR B CE1   1 
ATOM   1492 C CE2   . TYR C 1 45  ? 31.514 3.554   36.572 1.00 33.98  ? 187 TYR B CE2   1 
ATOM   1493 C CZ    . TYR C 1 45  ? 31.704 4.409   35.497 1.00 33.82  ? 187 TYR B CZ    1 
ATOM   1494 O OH    . TYR C 1 45  ? 30.690 5.270   35.155 1.00 40.41  ? 187 TYR B OH    1 
ATOM   1495 H H     . TYR C 1 45  ? 33.720 -0.617  37.042 1.00 0.00   ? 187 TYR B H     1 
ATOM   1496 H HH    . TYR C 1 45  ? 29.927 5.104   35.713 1.00 0.00   ? 187 TYR B HH    1 
ATOM   1497 N N     . SER C 1 46  ? 37.399 0.340   36.287 1.00 27.01  ? 188 SER B N     1 
ATOM   1498 C CA    . SER C 1 46  ? 38.595 -0.353  36.687 1.00 28.37  ? 188 SER B CA    1 
ATOM   1499 C C     . SER C 1 46  ? 39.456 0.671   37.390 1.00 29.02  ? 188 SER B C     1 
ATOM   1500 O O     . SER C 1 46  ? 39.582 1.815   36.931 1.00 28.19  ? 188 SER B O     1 
ATOM   1501 C CB    . SER C 1 46  ? 39.326 -0.879  35.461 1.00 31.10  ? 188 SER B CB    1 
ATOM   1502 O OG    . SER C 1 46  ? 38.565 -1.731  34.607 1.00 33.22  ? 188 SER B OG    1 
ATOM   1503 H H     . SER C 1 46  ? 37.480 1.240   35.909 1.00 0.00   ? 188 SER B H     1 
ATOM   1504 H HG    . SER C 1 46  ? 38.276 -2.503  35.099 1.00 0.00   ? 188 SER B HG    1 
ATOM   1505 N N     . LEU C 1 47  ? 39.972 0.312   38.549 1.00 26.01  ? 189 LEU B N     1 
ATOM   1506 C CA    . LEU C 1 47  ? 40.832 1.184   39.321 1.00 26.69  ? 189 LEU B CA    1 
ATOM   1507 C C     . LEU C 1 47  ? 42.241 0.667   39.119 1.00 29.28  ? 189 LEU B C     1 
ATOM   1508 O O     . LEU C 1 47  ? 42.523 -0.529  39.361 1.00 30.89  ? 189 LEU B O     1 
ATOM   1509 C CB    . LEU C 1 47  ? 40.427 1.123   40.818 1.00 26.28  ? 189 LEU B CB    1 
ATOM   1510 C CG    . LEU C 1 47  ? 41.322 1.746   41.866 1.00 24.71  ? 189 LEU B CG    1 
ATOM   1511 C CD1   . LEU C 1 47  ? 41.428 3.237   41.677 1.00 22.25  ? 189 LEU B CD1   1 
ATOM   1512 C CD2   . LEU C 1 47  ? 40.721 1.461   43.235 1.00 27.16  ? 189 LEU B CD2   1 
ATOM   1513 H H     . LEU C 1 47  ? 39.766 -0.579  38.901 1.00 0.00   ? 189 LEU B H     1 
ATOM   1514 N N     . SER C 1 48  ? 43.140 1.534   38.659 1.00 23.42  ? 190 SER B N     1 
ATOM   1515 C CA    . SER C 1 48  ? 44.480 1.092   38.416 1.00 26.23  ? 190 SER B CA    1 
ATOM   1516 C C     . SER C 1 48  ? 45.381 1.901   39.341 1.00 27.56  ? 190 SER B C     1 
ATOM   1517 O O     . SER C 1 48  ? 45.241 3.135   39.388 1.00 27.82  ? 190 SER B O     1 
ATOM   1518 C CB    . SER C 1 48  ? 44.766 1.296   36.899 1.00 21.53  ? 190 SER B CB    1 
ATOM   1519 O OG    . SER C 1 48  ? 43.801 0.595   36.077 1.00 24.10  ? 190 SER B OG    1 
ATOM   1520 H H     . SER C 1 48  ? 42.887 2.465   38.488 1.00 0.00   ? 190 SER B H     1 
ATOM   1521 H HG    . SER C 1 48  ? 42.919 0.924   36.266 1.00 0.00   ? 190 SER B HG    1 
ATOM   1522 N N     . VAL C 1 49  ? 46.281 1.207   40.094 1.00 29.02  ? 191 VAL B N     1 
ATOM   1523 C CA    . VAL C 1 49  ? 47.095 1.786   41.194 1.00 27.63  ? 191 VAL B CA    1 
ATOM   1524 C C     . VAL C 1 49  ? 48.531 1.294   41.095 1.00 28.26  ? 191 VAL B C     1 
ATOM   1525 O O     . VAL C 1 49  ? 48.778 0.101   40.866 1.00 29.84  ? 191 VAL B O     1 
ATOM   1526 C CB    . VAL C 1 49  ? 46.527 1.357   42.609 1.00 30.44  ? 191 VAL B CB    1 
ATOM   1527 C CG1   . VAL C 1 49  ? 47.222 2.132   43.728 1.00 28.78  ? 191 VAL B CG1   1 
ATOM   1528 C CG2   . VAL C 1 49  ? 45.029 1.584   42.676 1.00 28.90  ? 191 VAL B CG2   1 
ATOM   1529 H H     . VAL C 1 49  ? 46.400 0.256   39.895 1.00 0.00   ? 191 VAL B H     1 
ATOM   1530 N N     . SER C 1 50  ? 49.513 2.171   41.218 1.00 28.76  ? 192 SER B N     1 
ATOM   1531 C CA    . SER C 1 50  ? 50.871 1.736   41.183 1.00 27.50  ? 192 SER B CA    1 
ATOM   1532 C C     . SER C 1 50  ? 51.262 1.243   42.586 1.00 30.89  ? 192 SER B C     1 
ATOM   1533 O O     . SER C 1 50  ? 50.789 1.740   43.650 1.00 29.27  ? 192 SER B O     1 
ATOM   1534 C CB    . SER C 1 50  ? 51.785 2.887   40.707 1.00 28.55  ? 192 SER B CB    1 
ATOM   1535 O OG    . SER C 1 50  ? 51.871 3.919   41.681 1.00 26.00  ? 192 SER B OG    1 
ATOM   1536 H H     . SER C 1 50  ? 49.307 3.122   41.333 1.00 0.00   ? 192 SER B H     1 
ATOM   1537 H HG    . SER C 1 50  ? 52.444 4.618   41.358 1.00 0.00   ? 192 SER B HG    1 
ATOM   1538 N N     . ASP C 1 51  ? 52.260 0.402   42.578 1.00 32.16  ? 193 ASP B N     1 
ATOM   1539 C CA    . ASP C 1 51  ? 52.646 -0.352  43.735 1.00 36.83  ? 193 ASP B CA    1 
ATOM   1540 C C     . ASP C 1 51  ? 54.118 -0.620  43.594 1.00 38.59  ? 193 ASP B C     1 
ATOM   1541 O O     . ASP C 1 51  ? 54.707 -0.520  42.510 1.00 37.76  ? 193 ASP B O     1 
ATOM   1542 C CB    . ASP C 1 51  ? 51.862 -1.689  43.779 1.00 41.73  ? 193 ASP B CB    1 
ATOM   1543 C CG    . ASP C 1 51  ? 52.128 -2.577  44.963 1.00 42.65  ? 193 ASP B CG    1 
ATOM   1544 O OD1   . ASP C 1 51  ? 52.272 -2.077  46.032 1.00 44.54  ? 193 ASP B OD1   1 
ATOM   1545 O OD2   . ASP C 1 51  ? 52.178 -3.767  44.804 1.00 47.89  ? 193 ASP B OD2   1 
ATOM   1546 H H     . ASP C 1 51  ? 52.766 0.281   41.748 1.00 0.00   ? 193 ASP B H     1 
ATOM   1547 N N     . PHE C 1 52  ? 54.776 -0.939  44.693 1.00 44.84  ? 194 PHE B N     1 
ATOM   1548 C CA    . PHE C 1 52  ? 56.167 -1.359  44.654 1.00 49.47  ? 194 PHE B CA    1 
ATOM   1549 C C     . PHE C 1 52  ? 56.351 -2.543  45.582 1.00 52.21  ? 194 PHE B C     1 
ATOM   1550 O O     . PHE C 1 52  ? 55.999 -2.455  46.751 1.00 54.45  ? 194 PHE B O     1 
ATOM   1551 C CB    . PHE C 1 52  ? 57.098 -0.221  45.106 1.00 50.19  ? 194 PHE B CB    1 
ATOM   1552 C CG    . PHE C 1 52  ? 58.539 -0.688  45.251 1.00 52.48  ? 194 PHE B CG    1 
ATOM   1553 C CD1   . PHE C 1 52  ? 59.364 -0.743  44.127 1.00 50.39  ? 194 PHE B CD1   1 
ATOM   1554 C CD2   . PHE C 1 52  ? 59.013 -1.155  46.489 1.00 53.21  ? 194 PHE B CD2   1 
ATOM   1555 C CE1   . PHE C 1 52  ? 60.647 -1.265  44.251 1.00 48.95  ? 194 PHE B CE1   1 
ATOM   1556 C CE2   . PHE C 1 52  ? 60.304 -1.665  46.581 1.00 52.54  ? 194 PHE B CE2   1 
ATOM   1557 C CZ    . PHE C 1 52  ? 61.107 -1.745  45.462 1.00 47.10  ? 194 PHE B CZ    1 
ATOM   1558 H H     . PHE C 1 52  ? 54.315 -0.891  45.557 1.00 0.00   ? 194 PHE B H     1 
ATOM   1559 N N     . ASP C 1 53  ? 57.071 -3.547  45.103 1.00 56.28  ? 195 ASP B N     1 
ATOM   1560 C CA    . ASP C 1 53  ? 57.520 -4.646  45.935 1.00 61.15  ? 195 ASP B CA    1 
ATOM   1561 C C     . ASP C 1 53  ? 58.866 -5.090  45.421 1.00 62.41  ? 195 ASP B C     1 
ATOM   1562 O O     . ASP C 1 53  ? 59.358 -4.625  44.386 1.00 59.74  ? 195 ASP B O     1 
ATOM   1563 C CB    . ASP C 1 53  ? 56.444 -5.795  45.946 1.00 68.26  ? 195 ASP B CB    1 
ATOM   1564 C CG    . ASP C 1 53  ? 56.201 -6.605  44.708 1.00 74.53  ? 195 ASP B CG    1 
ATOM   1565 O OD1   . ASP C 1 53  ? 56.939 -7.552  44.497 1.00 75.38  ? 195 ASP B OD1   1 
ATOM   1566 O OD2   . ASP C 1 53  ? 55.255 -6.327  43.979 1.00 78.50  ? 195 ASP B OD2   1 
ATOM   1567 H H     . ASP C 1 53  ? 57.308 -3.547  44.152 1.00 0.00   ? 195 ASP B H     1 
ATOM   1568 N N     . ASN C 1 54  ? 59.584 -5.783  46.300 1.00 66.14  ? 196 ASN B N     1 
ATOM   1569 C CA    . ASN C 1 54  ? 60.986 -6.136  46.033 1.00 67.23  ? 196 ASN B CA    1 
ATOM   1570 C C     . ASN C 1 54  ? 61.208 -7.083  44.857 1.00 67.32  ? 196 ASN B C     1 
ATOM   1571 O O     . ASN C 1 54  ? 62.135 -6.939  44.055 1.00 66.00  ? 196 ASN B O     1 
ATOM   1572 C CB    . ASN C 1 54  ? 61.634 -6.787  47.261 1.00 65.32  ? 196 ASN B CB    1 
ATOM   1573 H H     . ASN C 1 54  ? 59.170 -6.064  47.143 1.00 0.00   ? 196 ASN B H     1 
ATOM   1574 N N     . ALA C 1 55  ? 60.332 -8.062  44.727 1.00 67.70  ? 197 ALA B N     1 
ATOM   1575 C CA    . ALA C 1 55  ? 60.446 -8.961  43.611 1.00 69.41  ? 197 ALA B CA    1 
ATOM   1576 C C     . ALA C 1 55  ? 60.038 -8.246  42.334 1.00 69.55  ? 197 ALA B C     1 
ATOM   1577 O O     . ALA C 1 55  ? 60.802 -8.233  41.365 1.00 71.41  ? 197 ALA B O     1 
ATOM   1578 C CB    . ALA C 1 55  ? 59.538 -10.164 43.790 1.00 71.84  ? 197 ALA B CB    1 
ATOM   1579 H H     . ALA C 1 55  ? 59.613 -8.175  45.383 1.00 0.00   ? 197 ALA B H     1 
ATOM   1580 N N     . LYS C 1 56  ? 58.851 -7.623  42.322 1.00 67.53  ? 198 LYS B N     1 
ATOM   1581 C CA    . LYS C 1 56  ? 58.333 -7.025  41.095 1.00 63.76  ? 198 LYS B CA    1 
ATOM   1582 C C     . LYS C 1 56  ? 58.844 -5.640  40.791 1.00 62.56  ? 198 LYS B C     1 
ATOM   1583 O O     . LYS C 1 56  ? 58.778 -5.201  39.633 1.00 63.82  ? 198 LYS B O     1 
ATOM   1584 C CB    . LYS C 1 56  ? 56.821 -6.924  41.101 1.00 60.84  ? 198 LYS B CB    1 
ATOM   1585 C CG    . LYS C 1 56  ? 56.147 -8.254  41.161 1.00 66.07  ? 198 LYS B CG    1 
ATOM   1586 C CD    . LYS C 1 56  ? 54.655 -8.071  41.145 1.00 70.30  ? 198 LYS B CD    1 
ATOM   1587 C CE    . LYS C 1 56  ? 53.966 -9.423  41.339 1.00 78.11  ? 198 LYS B CE    1 
ATOM   1588 N NZ    . LYS C 1 56  ? 53.978 -9.876  42.729 1.00 85.09  ? 198 LYS B NZ    1 
ATOM   1589 H H     . LYS C 1 56  ? 58.325 -7.568  43.147 1.00 0.00   ? 198 LYS B H     1 
ATOM   1590 H HZ1   . LYS C 1 56  ? 53.484 -9.182  43.325 1.00 0.00   ? 198 LYS B HZ1   1 
ATOM   1591 H HZ2   . LYS C 1 56  ? 53.498 -10.796 42.798 1.00 0.00   ? 198 LYS B HZ2   1 
ATOM   1592 H HZ3   . LYS C 1 56  ? 54.961 -9.973  43.053 1.00 0.00   ? 198 LYS B HZ3   1 
ATOM   1593 N N     . GLY C 1 57  ? 59.401 -4.936  41.771 1.00 57.91  ? 199 GLY B N     1 
ATOM   1594 C CA    . GLY C 1 57  ? 59.711 -3.552  41.548 1.00 55.62  ? 199 GLY B CA    1 
ATOM   1595 C C     . GLY C 1 57  ? 58.386 -2.796  41.434 1.00 53.58  ? 199 GLY B C     1 
ATOM   1596 O O     . GLY C 1 57  ? 57.382 -3.133  42.093 1.00 52.51  ? 199 GLY B O     1 
ATOM   1597 H H     . GLY C 1 57  ? 59.598 -5.356  42.634 1.00 0.00   ? 199 GLY B H     1 
ATOM   1598 N N     . LEU C 1 58  ? 58.367 -1.727  40.648 1.00 50.51  ? 200 LEU B N     1 
ATOM   1599 C CA    . LEU C 1 58  ? 57.134 -1.000  40.469 1.00 47.97  ? 200 LEU B CA    1 
ATOM   1600 C C     . LEU C 1 58  ? 56.247 -1.794  39.531 1.00 42.50  ? 200 LEU B C     1 
ATOM   1601 O O     . LEU C 1 58  ? 56.732 -2.429  38.597 1.00 42.53  ? 200 LEU B O     1 
ATOM   1602 C CB    . LEU C 1 58  ? 57.421 0.380   39.905 1.00 52.13  ? 200 LEU B CB    1 
ATOM   1603 C CG    . LEU C 1 58  ? 58.095 1.387   40.835 1.00 55.43  ? 200 LEU B CG    1 
ATOM   1604 C CD1   . LEU C 1 58  ? 58.695 2.473   39.954 1.00 59.95  ? 200 LEU B CD1   1 
ATOM   1605 C CD2   . LEU C 1 58  ? 57.115 1.957   41.860 1.00 53.73  ? 200 LEU B CD2   1 
ATOM   1606 H H     . LEU C 1 58  ? 59.184 -1.434  40.193 1.00 0.00   ? 200 LEU B H     1 
ATOM   1607 N N     . ASN C 1 59  ? 54.944 -1.773  39.794 1.00 35.83  ? 201 ASN B N     1 
ATOM   1608 C CA    . ASN C 1 59  ? 53.985 -2.556  39.047 1.00 31.43  ? 201 ASN B CA    1 
ATOM   1609 C C     . ASN C 1 59  ? 52.611 -1.957  39.296 1.00 32.66  ? 201 ASN B C     1 
ATOM   1610 O O     . ASN C 1 59  ? 52.385 -1.188  40.241 1.00 33.62  ? 201 ASN B O     1 
ATOM   1611 C CB    . ASN C 1 59  ? 54.026 -4.003  39.527 1.00 29.55  ? 201 ASN B CB    1 
ATOM   1612 C CG    . ASN C 1 59  ? 53.480 -4.195  40.937 1.00 30.01  ? 201 ASN B CG    1 
ATOM   1613 O OD1   . ASN C 1 59  ? 52.278 -4.454  41.143 1.00 30.77  ? 201 ASN B OD1   1 
ATOM   1614 N ND2   . ASN C 1 59  ? 54.322 -4.052  41.958 1.00 35.33  ? 201 ASN B ND2   1 
ATOM   1615 H H     . ASN C 1 59  ? 54.621 -1.204  40.523 1.00 0.00   ? 201 ASN B H     1 
ATOM   1616 H HD21  . ASN C 1 59  ? 53.964 -4.177  42.860 1.00 0.00   ? 201 ASN B HD21  1 
ATOM   1617 H HD22  . ASN C 1 59  ? 55.262 -3.830  41.791 1.00 0.00   ? 201 ASN B HD22  1 
ATOM   1618 N N     . VAL C 1 60  ? 51.678 -2.251  38.401 1.00 30.24  ? 202 VAL B N     1 
ATOM   1619 C CA    . VAL C 1 60  ? 50.349 -1.702  38.471 1.00 28.87  ? 202 VAL B CA    1 
ATOM   1620 C C     . VAL C 1 60  ? 49.368 -2.804  38.812 1.00 31.15  ? 202 VAL B C     1 
ATOM   1621 O O     . VAL C 1 60  ? 49.368 -3.884  38.206 1.00 33.46  ? 202 VAL B O     1 
ATOM   1622 C CB    . VAL C 1 60  ? 49.977 -1.078  37.108 1.00 29.51  ? 202 VAL B CB    1 
ATOM   1623 C CG1   . VAL C 1 60  ? 48.543 -0.524  37.160 1.00 23.80  ? 202 VAL B CG1   1 
ATOM   1624 C CG2   . VAL C 1 60  ? 50.996 0.031   36.765 1.00 24.60  ? 202 VAL B CG2   1 
ATOM   1625 H H     . VAL C 1 60  ? 51.900 -2.862  37.668 1.00 0.00   ? 202 VAL B H     1 
ATOM   1626 N N     . LYS C 1 61  ? 48.507 -2.550  39.791 1.00 28.92  ? 203 LYS B N     1 
ATOM   1627 C CA    . LYS C 1 61  ? 47.433 -3.473  40.092 1.00 27.67  ? 203 LYS B CA    1 
ATOM   1628 C C     . LYS C 1 61  ? 46.112 -2.873  39.625 1.00 26.33  ? 203 LYS B C     1 
ATOM   1629 O O     . LYS C 1 61  ? 45.922 -1.644  39.541 1.00 25.27  ? 203 LYS B O     1 
ATOM   1630 C CB    . LYS C 1 61  ? 47.414 -3.754  41.594 1.00 29.38  ? 203 LYS B CB    1 
ATOM   1631 C CG    . LYS C 1 61  ? 48.726 -4.350  42.007 1.00 30.92  ? 203 LYS B CG    1 
ATOM   1632 C CD    . LYS C 1 61  ? 48.631 -5.202  43.233 1.00 32.99  ? 203 LYS B CD    1 
ATOM   1633 C CE    . LYS C 1 61  ? 49.755 -6.234  43.185 1.00 37.15  ? 203 LYS B CE    1 
ATOM   1634 N NZ    . LYS C 1 61  ? 51.068 -5.623  43.182 1.00 38.45  ? 203 LYS B NZ    1 
ATOM   1635 H H     . LYS C 1 61  ? 48.600 -1.728  40.316 1.00 0.00   ? 203 LYS B H     1 
ATOM   1636 H HZ1   . LYS C 1 61  ? 51.190 -5.057  44.046 1.00 0.00   ? 203 LYS B HZ1   1 
ATOM   1637 H HZ2   . LYS C 1 61  ? 51.796 -6.365  43.148 1.00 0.00   ? 203 LYS B HZ2   1 
ATOM   1638 H HZ3   . LYS C 1 61  ? 51.162 -5.008  42.349 1.00 0.00   ? 203 LYS B HZ3   1 
ATOM   1639 N N     . HIS C 1 62  ? 45.243 -3.780  39.199 1.00 23.06  ? 204 HIS B N     1 
ATOM   1640 C CA    . HIS C 1 62  ? 43.984 -3.389  38.616 1.00 25.03  ? 204 HIS B CA    1 
ATOM   1641 C C     . HIS C 1 62  ? 42.852 -4.037  39.390 1.00 27.69  ? 204 HIS B C     1 
ATOM   1642 O O     . HIS C 1 62  ? 42.898 -5.246  39.679 1.00 25.79  ? 204 HIS B O     1 
ATOM   1643 C CB    . HIS C 1 62  ? 43.928 -3.831  37.132 1.00 22.39  ? 204 HIS B CB    1 
ATOM   1644 C CG    . HIS C 1 62  ? 45.020 -3.219  36.280 1.00 25.36  ? 204 HIS B CG    1 
ATOM   1645 N ND1   . HIS C 1 62  ? 45.037 -2.049  35.620 1.00 25.74  ? 204 HIS B ND1   1 
ATOM   1646 C CD2   . HIS C 1 62  ? 46.211 -3.856  36.065 1.00 24.82  ? 204 HIS B CD2   1 
ATOM   1647 C CE1   . HIS C 1 62  ? 46.211 -1.977  35.008 1.00 28.58  ? 204 HIS B CE1   1 
ATOM   1648 N NE2   . HIS C 1 62  ? 46.902 -3.067  35.293 1.00 29.94  ? 204 HIS B NE2   1 
ATOM   1649 H H     . HIS C 1 62  ? 45.461 -4.732  39.282 1.00 0.00   ? 204 HIS B H     1 
ATOM   1650 H HD1   . HIS C 1 62  ? 44.327 -1.384  35.596 1.00 0.00   ? 204 HIS B HD1   1 
ATOM   1651 H HE2   . HIS C 1 62  ? 47.804 -3.254  34.970 1.00 0.00   ? 204 HIS B HE2   1 
ATOM   1652 N N     . TYR C 1 63  ? 41.828 -3.244  39.735 1.00 28.64  ? 205 TYR B N     1 
ATOM   1653 C CA    . TYR C 1 63  ? 40.735 -3.701  40.573 1.00 28.23  ? 205 TYR B CA    1 
ATOM   1654 C C     . TYR C 1 63  ? 39.453 -3.354  39.868 1.00 29.11  ? 205 TYR B C     1 
ATOM   1655 O O     . TYR C 1 63  ? 39.195 -2.188  39.571 1.00 28.84  ? 205 TYR B O     1 
ATOM   1656 C CB    . TYR C 1 63  ? 40.680 -2.998  41.950 1.00 21.57  ? 205 TYR B CB    1 
ATOM   1657 C CG    . TYR C 1 63  ? 41.922 -3.145  42.781 1.00 22.82  ? 205 TYR B CG    1 
ATOM   1658 C CD1   . TYR C 1 63  ? 43.034 -2.339  42.498 1.00 23.84  ? 205 TYR B CD1   1 
ATOM   1659 C CD2   . TYR C 1 63  ? 42.008 -4.174  43.736 1.00 25.39  ? 205 TYR B CD2   1 
ATOM   1660 C CE1   . TYR C 1 63  ? 44.224 -2.526  43.209 1.00 22.05  ? 205 TYR B CE1   1 
ATOM   1661 C CE2   . TYR C 1 63  ? 43.204 -4.354  44.459 1.00 21.67  ? 205 TYR B CE2   1 
ATOM   1662 C CZ    . TYR C 1 63  ? 44.305 -3.557  44.157 1.00 21.61  ? 205 TYR B CZ    1 
ATOM   1663 O OH    . TYR C 1 63  ? 45.496 -3.747  44.810 1.00 23.06  ? 205 TYR B OH    1 
ATOM   1664 H H     . TYR C 1 63  ? 41.817 -2.320  39.409 1.00 0.00   ? 205 TYR B H     1 
ATOM   1665 H HH    . TYR C 1 63  ? 45.404 -4.464  45.441 1.00 0.00   ? 205 TYR B HH    1 
ATOM   1666 N N     . LYS C 1 64  ? 38.642 -4.349  39.534 1.00 27.64  ? 206 LYS B N     1 
ATOM   1667 C CA    . LYS C 1 64  ? 37.328 -4.084  39.025 1.00 27.27  ? 206 LYS B CA    1 
ATOM   1668 C C     . LYS C 1 64  ? 36.490 -3.307  40.035 1.00 27.44  ? 206 LYS B C     1 
ATOM   1669 O O     . LYS C 1 64  ? 36.502 -3.580  41.245 1.00 22.11  ? 206 LYS B O     1 
ATOM   1670 C CB    . LYS C 1 64  ? 36.641 -5.390  38.722 1.00 31.62  ? 206 LYS B CB    1 
ATOM   1671 C CG    . LYS C 1 64  ? 35.330 -5.156  37.962 1.00 47.09  ? 206 LYS B CG    1 
ATOM   1672 C CD    . LYS C 1 64  ? 34.804 -6.470  37.721 1.00 57.31  ? 206 LYS B CD    1 
ATOM   1673 C CE    . LYS C 1 64  ? 35.734 -7.422  36.984 1.00 57.96  ? 206 LYS B CE    1 
ATOM   1674 N NZ    . LYS C 1 64  ? 35.994 -6.949  35.662 1.00 56.10  ? 206 LYS B NZ    1 
ATOM   1675 H H     . LYS C 1 64  ? 38.944 -5.276  39.636 1.00 0.00   ? 206 LYS B H     1 
ATOM   1676 H HZ1   . LYS C 1 64  ? 35.099 -6.879  35.137 1.00 0.00   ? 206 LYS B HZ1   1 
ATOM   1677 H HZ2   . LYS C 1 64  ? 36.442 -6.012  35.710 1.00 0.00   ? 206 LYS B HZ2   1 
ATOM   1678 H HZ3   . LYS C 1 64  ? 36.630 -7.612  35.175 1.00 0.00   ? 206 LYS B HZ3   1 
ATOM   1679 N N     . ILE C 1 65  ? 35.672 -2.405  39.506 1.00 21.49  ? 207 ILE B N     1 
ATOM   1680 C CA    . ILE C 1 65  ? 34.727 -1.736  40.328 1.00 21.83  ? 207 ILE B CA    1 
ATOM   1681 C C     . ILE C 1 65  ? 33.426 -2.180  39.728 1.00 24.35  ? 207 ILE B C     1 
ATOM   1682 O O     . ILE C 1 65  ? 33.147 -1.837  38.589 1.00 27.79  ? 207 ILE B O     1 
ATOM   1683 C CB    . ILE C 1 65  ? 34.909 -0.160  40.278 1.00 22.04  ? 207 ILE B CB    1 
ATOM   1684 C CG1   . ILE C 1 65  ? 36.270 0.235   40.837 1.00 21.53  ? 207 ILE B CG1   1 
ATOM   1685 C CG2   . ILE C 1 65  ? 33.820 0.500   41.092 1.00 18.64  ? 207 ILE B CG2   1 
ATOM   1686 C CD1   . ILE C 1 65  ? 36.608 1.720   40.570 1.00 25.36  ? 207 ILE B CD1   1 
ATOM   1687 H H     . ILE C 1 65  ? 35.720 -2.201  38.549 1.00 0.00   ? 207 ILE B H     1 
ATOM   1688 N N     . ARG C 1 66  ? 32.637 -2.980  40.449 1.00 22.08  ? 208 ARG B N     1 
ATOM   1689 C CA    . ARG C 1 66  ? 31.354 -3.410  39.990 1.00 24.73  ? 208 ARG B CA    1 
ATOM   1690 C C     . ARG C 1 66  ? 30.275 -2.412  40.318 1.00 26.71  ? 208 ARG B C     1 
ATOM   1691 O O     . ARG C 1 66  ? 30.341 -1.762  41.356 1.00 25.34  ? 208 ARG B O     1 
ATOM   1692 C CB    . ARG C 1 66  ? 30.992 -4.703  40.642 1.00 25.13  ? 208 ARG B CB    1 
ATOM   1693 C CG    . ARG C 1 66  ? 31.974 -5.791  40.354 1.00 33.59  ? 208 ARG B CG    1 
ATOM   1694 C CD    . ARG C 1 66  ? 31.471 -6.656  39.221 1.00 34.38  ? 208 ARG B CD    1 
ATOM   1695 N NE    . ARG C 1 66  ? 32.331 -7.804  39.029 1.00 36.00  ? 208 ARG B NE    1 
ATOM   1696 C CZ    . ARG C 1 66  ? 32.467 -8.419  37.859 1.00 37.95  ? 208 ARG B CZ    1 
ATOM   1697 N NH1   . ARG C 1 66  ? 31.782 -8.018  36.785 1.00 35.13  ? 208 ARG B NH1   1 
ATOM   1698 N NH2   . ARG C 1 66  ? 33.433 -9.343  37.762 1.00 39.71  ? 208 ARG B NH2   1 
ATOM   1699 H H     . ARG C 1 66  ? 32.950 -3.284  41.326 1.00 0.00   ? 208 ARG B H     1 
ATOM   1700 H HE    . ARG C 1 66  ? 32.836 -8.143  39.797 1.00 0.00   ? 208 ARG B HE    1 
ATOM   1701 H HH11  . ARG C 1 66  ? 31.154 -7.243  36.853 1.00 0.00   ? 208 ARG B HH11  1 
ATOM   1702 H HH12  . ARG C 1 66  ? 31.897 -8.493  35.913 1.00 0.00   ? 208 ARG B HH12  1 
ATOM   1703 H HH21  . ARG C 1 66  ? 34.014 -9.544  38.551 1.00 0.00   ? 208 ARG B HH21  1 
ATOM   1704 H HH22  . ARG C 1 66  ? 33.573 -9.832  36.901 1.00 0.00   ? 208 ARG B HH22  1 
ATOM   1705 N N     . LYS C 1 67  ? 29.258 -2.319  39.476 1.00 27.99  ? 209 LYS B N     1 
ATOM   1706 C CA    . LYS C 1 67  ? 28.098 -1.452  39.673 1.00 31.65  ? 209 LYS B CA    1 
ATOM   1707 C C     . LYS C 1 67  ? 26.902 -2.323  40.062 1.00 33.01  ? 209 LYS B C     1 
ATOM   1708 O O     . LYS C 1 67  ? 26.618 -3.316  39.393 1.00 35.57  ? 209 LYS B O     1 
ATOM   1709 C CB    . LYS C 1 67  ? 27.816 -0.715  38.374 1.00 32.45  ? 209 LYS B CB    1 
ATOM   1710 C CG    . LYS C 1 67  ? 26.453 -0.067  38.157 1.00 38.55  ? 209 LYS B CG    1 
ATOM   1711 C CD    . LYS C 1 67  ? 26.170 0.982   39.186 1.00 41.71  ? 209 LYS B CD    1 
ATOM   1712 C CE    . LYS C 1 67  ? 25.157 1.963   38.609 1.00 49.32  ? 209 LYS B CE    1 
ATOM   1713 N NZ    . LYS C 1 67  ? 25.731 2.789   37.552 1.00 51.60  ? 209 LYS B NZ    1 
ATOM   1714 H H     . LYS C 1 67  ? 29.285 -2.869  38.666 1.00 0.00   ? 209 LYS B H     1 
ATOM   1715 H HZ1   . LYS C 1 67  ? 26.067 2.180   36.779 1.00 0.00   ? 209 LYS B HZ1   1 
ATOM   1716 H HZ2   . LYS C 1 67  ? 25.006 3.441   37.189 1.00 0.00   ? 209 LYS B HZ2   1 
ATOM   1717 H HZ3   . LYS C 1 67  ? 26.529 3.336   37.934 1.00 0.00   ? 209 LYS B HZ3   1 
ATOM   1718 N N     . LEU C 1 68  ? 26.211 -1.954  41.139 1.00 31.63  ? 210 LEU B N     1 
ATOM   1719 C CA    . LEU C 1 68  ? 25.069 -2.656  41.675 1.00 32.59  ? 210 LEU B CA    1 
ATOM   1720 C C     . LEU C 1 68  ? 23.833 -2.194  40.955 1.00 34.49  ? 210 LEU B C     1 
ATOM   1721 O O     . LEU C 1 68  ? 23.767 -1.014  40.598 1.00 35.76  ? 210 LEU B O     1 
ATOM   1722 C CB    . LEU C 1 68  ? 24.962 -2.342  43.178 1.00 31.08  ? 210 LEU B CB    1 
ATOM   1723 C CG    . LEU C 1 68  ? 26.171 -2.833  44.010 1.00 36.28  ? 210 LEU B CG    1 
ATOM   1724 C CD1   . LEU C 1 68  ? 26.246 -2.166  45.390 1.00 32.60  ? 210 LEU B CD1   1 
ATOM   1725 C CD2   . LEU C 1 68  ? 26.045 -4.315  44.153 1.00 34.25  ? 210 LEU B CD2   1 
ATOM   1726 H H     . LEU C 1 68  ? 26.500 -1.143  41.604 1.00 0.00   ? 210 LEU B H     1 
ATOM   1727 N N     . ASP C 1 69  ? 22.805 -3.044  40.837 1.00 34.17  ? 211 ASP B N     1 
ATOM   1728 C CA    . ASP C 1 69  ? 21.553 -2.654  40.200 1.00 38.02  ? 211 ASP B CA    1 
ATOM   1729 C C     . ASP C 1 69  ? 20.911 -1.415  40.813 1.00 38.65  ? 211 ASP B C     1 
ATOM   1730 O O     . ASP C 1 69  ? 20.320 -0.577  40.128 1.00 33.78  ? 211 ASP B O     1 
ATOM   1731 C CB    . ASP C 1 69  ? 20.537 -3.766  40.289 1.00 46.60  ? 211 ASP B CB    1 
ATOM   1732 C CG    . ASP C 1 69  ? 20.712 -4.854  39.250 1.00 55.38  ? 211 ASP B CG    1 
ATOM   1733 O OD1   . ASP C 1 69  ? 21.591 -4.748  38.392 1.00 64.08  ? 211 ASP B OD1   1 
ATOM   1734 O OD2   . ASP C 1 69  ? 19.969 -5.827  39.315 1.00 63.61  ? 211 ASP B OD2   1 
ATOM   1735 H H     . ASP C 1 69  ? 22.897 -3.954  41.189 1.00 0.00   ? 211 ASP B H     1 
ATOM   1736 N N     . SER C 1 70  ? 21.050 -1.247  42.134 1.00 36.81  ? 212 SER B N     1 
ATOM   1737 C CA    . SER C 1 70  ? 20.458 -0.085  42.773 1.00 37.00  ? 212 SER B CA    1 
ATOM   1738 C C     . SER C 1 70  ? 21.318 1.167   42.561 1.00 34.58  ? 212 SER B C     1 
ATOM   1739 O O     . SER C 1 70  ? 20.951 2.191   43.078 1.00 33.89  ? 212 SER B O     1 
ATOM   1740 C CB    . SER C 1 70  ? 20.257 -0.392  44.252 1.00 36.82  ? 212 SER B CB    1 
ATOM   1741 O OG    . SER C 1 70  ? 21.498 -0.785  44.779 1.00 42.75  ? 212 SER B OG    1 
ATOM   1742 H H     . SER C 1 70  ? 21.547 -1.903  42.666 1.00 0.00   ? 212 SER B H     1 
ATOM   1743 H HG    . SER C 1 70  ? 21.810 -1.566  44.316 1.00 0.00   ? 212 SER B HG    1 
ATOM   1744 N N     . GLY C 1 71  ? 22.481 1.126   41.911 1.00 28.47  ? 213 GLY B N     1 
ATOM   1745 C CA    . GLY C 1 71  ? 23.205 2.333   41.657 1.00 29.90  ? 213 GLY B CA    1 
ATOM   1746 C C     . GLY C 1 71  ? 24.623 2.404   42.215 1.00 32.16  ? 213 GLY B C     1 
ATOM   1747 O O     . GLY C 1 71  ? 25.497 3.006   41.549 1.00 36.84  ? 213 GLY B O     1 
ATOM   1748 H H     . GLY C 1 71  ? 22.841 0.267   41.606 1.00 0.00   ? 213 GLY B H     1 
ATOM   1749 N N     . GLY C 1 72  ? 24.927 1.768   43.350 1.00 27.53  ? 214 GLY B N     1 
ATOM   1750 C CA    . GLY C 1 72  ? 26.240 1.906   43.965 1.00 20.82  ? 214 GLY B CA    1 
ATOM   1751 C C     . GLY C 1 72  ? 27.361 1.072   43.356 1.00 24.11  ? 214 GLY B C     1 
ATOM   1752 O O     . GLY C 1 72  ? 27.198 0.406   42.321 1.00 26.10  ? 214 GLY B O     1 
ATOM   1753 H H     . GLY C 1 72  ? 24.254 1.198   43.777 1.00 0.00   ? 214 GLY B H     1 
ATOM   1754 N N     . PHE C 1 73  ? 28.524 1.048   44.056 1.00 21.44  ? 215 PHE B N     1 
ATOM   1755 C CA    . PHE C 1 73  ? 29.756 0.443   43.528 1.00 21.20  ? 215 PHE B CA    1 
ATOM   1756 C C     . PHE C 1 73  ? 30.530 -0.249  44.636 1.00 22.66  ? 215 PHE B C     1 
ATOM   1757 O O     . PHE C 1 73  ? 30.382 0.077   45.819 1.00 26.30  ? 215 PHE B O     1 
ATOM   1758 C CB    . PHE C 1 73  ? 30.666 1.516   42.950 1.00 24.65  ? 215 PHE B CB    1 
ATOM   1759 C CG    . PHE C 1 73  ? 30.003 2.268   41.819 1.00 27.52  ? 215 PHE B CG    1 
ATOM   1760 C CD1   . PHE C 1 73  ? 30.072 1.752   40.527 1.00 26.40  ? 215 PHE B CD1   1 
ATOM   1761 C CD2   . PHE C 1 73  ? 29.325 3.459   42.085 1.00 29.95  ? 215 PHE B CD2   1 
ATOM   1762 C CE1   . PHE C 1 73  ? 29.441 2.432   39.483 1.00 32.91  ? 215 PHE B CE1   1 
ATOM   1763 C CE2   . PHE C 1 73  ? 28.697 4.142   41.042 1.00 33.92  ? 215 PHE B CE2   1 
ATOM   1764 C CZ    . PHE C 1 73  ? 28.753 3.627   39.740 1.00 34.24  ? 215 PHE B CZ    1 
ATOM   1765 H H     . PHE C 1 73  ? 28.543 1.450   44.949 1.00 0.00   ? 215 PHE B H     1 
ATOM   1766 N N     . TYR C 1 74  ? 31.352 -1.195  44.226 1.00 21.02  ? 216 TYR B N     1 
ATOM   1767 C CA    . TYR C 1 74  ? 32.199 -1.932  45.168 1.00 18.37  ? 216 TYR B CA    1 
ATOM   1768 C C     . TYR C 1 74  ? 33.347 -2.635  44.456 1.00 20.77  ? 216 TYR B C     1 
ATOM   1769 O O     . TYR C 1 74  ? 33.296 -2.870  43.238 1.00 24.35  ? 216 TYR B O     1 
ATOM   1770 C CB    . TYR C 1 74  ? 31.385 -2.995  45.932 1.00 20.05  ? 216 TYR B CB    1 
ATOM   1771 C CG    . TYR C 1 74  ? 30.980 -4.215  45.087 1.00 21.02  ? 216 TYR B CG    1 
ATOM   1772 C CD1   . TYR C 1 74  ? 31.866 -5.293  44.917 1.00 22.26  ? 216 TYR B CD1   1 
ATOM   1773 C CD2   . TYR C 1 74  ? 29.715 -4.257  44.491 1.00 22.72  ? 216 TYR B CD2   1 
ATOM   1774 C CE1   . TYR C 1 74  ? 31.484 -6.403  44.145 1.00 24.29  ? 216 TYR B CE1   1 
ATOM   1775 C CE2   . TYR C 1 74  ? 29.335 -5.362  43.721 1.00 28.29  ? 216 TYR B CE2   1 
ATOM   1776 C CZ    . TYR C 1 74  ? 30.218 -6.435  43.548 1.00 25.82  ? 216 TYR B CZ    1 
ATOM   1777 O OH    . TYR C 1 74  ? 29.842 -7.508  42.802 1.00 26.81  ? 216 TYR B OH    1 
ATOM   1778 H H     . TYR C 1 74  ? 31.398 -1.410  43.271 1.00 0.00   ? 216 TYR B H     1 
ATOM   1779 H HH    . TYR C 1 74  ? 28.952 -7.371  42.470 1.00 0.00   ? 216 TYR B HH    1 
ATOM   1780 N N     . ILE C 1 75  ? 34.344 -2.913  45.274 1.00 22.20  ? 217 ILE B N     1 
ATOM   1781 C CA    . ILE C 1 75  ? 35.523 -3.692  44.890 1.00 21.09  ? 217 ILE B CA    1 
ATOM   1782 C C     . ILE C 1 75  ? 35.600 -4.916  45.801 1.00 27.28  ? 217 ILE B C     1 
ATOM   1783 O O     . ILE C 1 75  ? 35.709 -6.052  45.337 1.00 27.10  ? 217 ILE B O     1 
ATOM   1784 C CB    . ILE C 1 75  ? 36.827 -2.912  45.068 1.00 20.77  ? 217 ILE B CB    1 
ATOM   1785 C CG1   . ILE C 1 75  ? 36.966 -1.732  44.105 1.00 20.84  ? 217 ILE B CG1   1 
ATOM   1786 C CG2   . ILE C 1 75  ? 38.064 -3.794  44.833 1.00 21.34  ? 217 ILE B CG2   1 
ATOM   1787 C CD1   . ILE C 1 75  ? 38.132 -0.799  44.451 1.00 15.77  ? 217 ILE B CD1   1 
ATOM   1788 H H     . ILE C 1 75  ? 34.293 -2.578  46.193 1.00 0.00   ? 217 ILE B H     1 
ATOM   1789 N N     . THR C 1 76  ? 35.187 -4.709  47.147 1.00 26.43  ? 218 THR B N     1 
ATOM   1790 C CA    . THR C 1 76  ? 35.008 -5.829  48.062 1.00 24.66  ? 218 THR B CA    1 
ATOM   1791 C C     . THR C 1 76  ? 33.676 -5.703  48.800 1.00 24.66  ? 218 THR B C     1 
ATOM   1792 O O     . THR C 1 76  ? 33.002 -4.678  48.744 1.00 22.89  ? 218 THR B O     1 
ATOM   1793 C CB    . THR C 1 76  ? 36.164 -5.930  49.123 1.00 23.80  ? 218 THR B CB    1 
ATOM   1794 O OG1   . THR C 1 76  ? 35.937 -4.923  50.134 1.00 25.39  ? 218 THR B OG1   1 
ATOM   1795 C CG2   . THR C 1 76  ? 37.532 -5.807  48.484 1.00 23.96  ? 218 THR B CG2   1 
ATOM   1796 H H     . THR C 1 76  ? 35.020 -3.797  47.464 1.00 0.00   ? 218 THR B H     1 
ATOM   1797 H HG1   . THR C 1 76  ? 36.634 -4.968  50.793 1.00 0.00   ? 218 THR B HG1   1 
ATOM   1798 N N     . SER C 1 77  ? 33.394 -6.750  49.587 1.00 20.97  ? 219 SER B N     1 
ATOM   1799 C CA    . SER C 1 77  ? 32.222 -6.885  50.456 1.00 23.07  ? 219 SER B CA    1 
ATOM   1800 C C     . SER C 1 77  ? 32.333 -6.056  51.727 1.00 19.72  ? 219 SER B C     1 
ATOM   1801 O O     . SER C 1 77  ? 31.374 -5.960  52.489 1.00 23.28  ? 219 SER B O     1 
ATOM   1802 C CB    . SER C 1 77  ? 32.060 -8.360  50.887 1.00 26.46  ? 219 SER B CB    1 
ATOM   1803 O OG    . SER C 1 77  ? 33.252 -8.785  51.569 1.00 22.92  ? 219 SER B OG    1 
ATOM   1804 H H     . SER C 1 77  ? 34.030 -7.494  49.581 1.00 0.00   ? 219 SER B H     1 
ATOM   1805 H HG    . SER C 1 77  ? 33.157 -9.701  51.839 1.00 0.00   ? 219 SER B HG    1 
ATOM   1806 N N     . ARG C 1 78  ? 33.527 -5.561  52.056 1.00 21.35  ? 220 ARG B N     1 
ATOM   1807 C CA    . ARG C 1 78  ? 33.694 -4.814  53.289 1.00 26.11  ? 220 ARG B CA    1 
ATOM   1808 C C     . ARG C 1 78  ? 32.900 -3.499  53.283 1.00 26.38  ? 220 ARG B C     1 
ATOM   1809 O O     . ARG C 1 78  ? 32.141 -3.226  54.236 1.00 23.01  ? 220 ARG B O     1 
ATOM   1810 C CB    . ARG C 1 78  ? 35.170 -4.565  53.467 1.00 22.97  ? 220 ARG B CB    1 
ATOM   1811 C CG    . ARG C 1 78  ? 35.528 -4.338  54.907 1.00 25.60  ? 220 ARG B CG    1 
ATOM   1812 C CD    . ARG C 1 78  ? 37.005 -3.930  54.942 1.00 33.07  ? 220 ARG B CD    1 
ATOM   1813 N NE    . ARG C 1 78  ? 37.426 -3.752  56.317 1.00 38.10  ? 220 ARG B NE    1 
ATOM   1814 C CZ    . ARG C 1 78  ? 37.005 -2.732  57.050 1.00 40.35  ? 220 ARG B CZ    1 
ATOM   1815 N NH1   . ARG C 1 78  ? 36.203 -1.792  56.567 1.00 46.98  ? 220 ARG B NH1   1 
ATOM   1816 N NH2   . ARG C 1 78  ? 37.224 -2.749  58.330 1.00 41.99  ? 220 ARG B NH2   1 
ATOM   1817 H H     . ARG C 1 78  ? 34.294 -5.702  51.463 1.00 0.00   ? 220 ARG B H     1 
ATOM   1818 H HE    . ARG C 1 78  ? 38.039 -4.404  56.716 1.00 0.00   ? 220 ARG B HE    1 
ATOM   1819 H HH11  . ARG C 1 78  ? 35.894 -1.838  55.617 1.00 0.00   ? 220 ARG B HH11  1 
ATOM   1820 H HH12  . ARG C 1 78  ? 35.907 -1.038  57.153 1.00 0.00   ? 220 ARG B HH12  1 
ATOM   1821 H HH21  . ARG C 1 78  ? 37.703 -3.523  58.745 1.00 0.00   ? 220 ARG B HH21  1 
ATOM   1822 H HH22  . ARG C 1 78  ? 36.914 -1.988  58.900 1.00 0.00   ? 220 ARG B HH22  1 
ATOM   1823 N N     . THR C 1 79  ? 32.997 -2.726  52.238 1.00 22.68  ? 221 THR B N     1 
ATOM   1824 C CA    . THR C 1 79  ? 32.251 -1.469  52.089 1.00 28.21  ? 221 THR B CA    1 
ATOM   1825 C C     . THR C 1 79  ? 31.737 -1.316  50.657 1.00 29.18  ? 221 THR B C     1 
ATOM   1826 O O     . THR C 1 79  ? 32.354 -1.811  49.705 1.00 28.19  ? 221 THR B O     1 
ATOM   1827 C CB    . THR C 1 79  ? 33.165 -0.259  52.355 1.00 30.61  ? 221 THR B CB    1 
ATOM   1828 O OG1   . THR C 1 79  ? 34.278 -0.286  51.468 1.00 33.17  ? 221 THR B OG1   1 
ATOM   1829 C CG2   . THR C 1 79  ? 33.723 -0.209  53.777 1.00 25.42  ? 221 THR B CG2   1 
ATOM   1830 H H     . THR C 1 79  ? 33.599 -2.997  51.514 1.00 0.00   ? 221 THR B H     1 
ATOM   1831 H HG1   . THR C 1 79  ? 34.843 0.471   51.640 1.00 0.00   ? 221 THR B HG1   1 
ATOM   1832 N N     . GLN C 1 80  ? 30.607 -0.641  50.551 1.00 27.07  ? 222 GLN B N     1 
ATOM   1833 C CA    . GLN C 1 80  ? 30.011 -0.277  49.251 1.00 32.50  ? 222 GLN B CA    1 
ATOM   1834 C C     . GLN C 1 80  ? 29.706 1.219   49.305 1.00 32.61  ? 222 GLN B C     1 
ATOM   1835 O O     . GLN C 1 80  ? 29.585 1.806   50.392 1.00 24.52  ? 222 GLN B O     1 
ATOM   1836 C CB    . GLN C 1 80  ? 28.761 -1.114  48.930 1.00 34.13  ? 222 GLN B CB    1 
ATOM   1837 C CG    . GLN C 1 80  ? 27.848 -1.380  50.123 1.00 44.73  ? 222 GLN B CG    1 
ATOM   1838 C CD    . GLN C 1 80  ? 26.653 -2.276  49.762 1.00 51.30  ? 222 GLN B CD    1 
ATOM   1839 O OE1   . GLN C 1 80  ? 26.260 -3.130  50.556 1.00 58.96  ? 222 GLN B OE1   1 
ATOM   1840 N NE2   . GLN C 1 80  ? 26.043 -2.134  48.598 1.00 52.28  ? 222 GLN B NE2   1 
ATOM   1841 H H     . GLN C 1 80  ? 30.144 -0.370  51.371 1.00 0.00   ? 222 GLN B H     1 
ATOM   1842 H HE21  . GLN C 1 80  ? 25.286 -2.726  48.409 1.00 0.00   ? 222 GLN B HE21  1 
ATOM   1843 H HE22  . GLN C 1 80  ? 26.353 -1.456  47.962 1.00 0.00   ? 222 GLN B HE22  1 
ATOM   1844 N N     . PHE C 1 81  ? 29.593 1.818   48.138 1.00 29.00  ? 223 PHE B N     1 
ATOM   1845 C CA    . PHE C 1 81  ? 29.417 3.273   48.036 1.00 28.79  ? 223 PHE B CA    1 
ATOM   1846 C C     . PHE C 1 81  ? 28.258 3.636   47.107 1.00 29.02  ? 223 PHE B C     1 
ATOM   1847 O O     . PHE C 1 81  ? 28.088 3.058   46.030 1.00 30.59  ? 223 PHE B O     1 
ATOM   1848 C CB    . PHE C 1 81  ? 30.728 3.867   47.521 1.00 23.59  ? 223 PHE B CB    1 
ATOM   1849 C CG    . PHE C 1 81  ? 31.941 3.279   48.252 1.00 26.27  ? 223 PHE B CG    1 
ATOM   1850 C CD1   . PHE C 1 81  ? 32.544 2.098   47.792 1.00 26.03  ? 223 PHE B CD1   1 
ATOM   1851 C CD2   . PHE C 1 81  ? 32.442 3.919   49.391 1.00 23.75  ? 223 PHE B CD2   1 
ATOM   1852 C CE1   . PHE C 1 81  ? 33.647 1.561   48.473 1.00 21.28  ? 223 PHE B CE1   1 
ATOM   1853 C CE2   . PHE C 1 81  ? 33.542 3.382   50.071 1.00 27.54  ? 223 PHE B CE2   1 
ATOM   1854 C CZ    . PHE C 1 81  ? 34.144 2.203   49.613 1.00 24.34  ? 223 PHE B CZ    1 
ATOM   1855 H H     . PHE C 1 81  ? 29.627 1.281   47.319 1.00 0.00   ? 223 PHE B H     1 
ATOM   1856 N N     . ASN C 1 82  ? 27.596 4.710   47.500 1.00 28.05  ? 224 ASN B N     1 
ATOM   1857 C CA    . ASN C 1 82  ? 26.457 5.172   46.739 1.00 24.99  ? 224 ASN B CA    1 
ATOM   1858 C C     . ASN C 1 82  ? 26.864 5.906   45.492 1.00 24.30  ? 224 ASN B C     1 
ATOM   1859 O O     . ASN C 1 82  ? 26.013 6.134   44.650 1.00 30.87  ? 224 ASN B O     1 
ATOM   1860 C CB    . ASN C 1 82  ? 25.600 6.092   47.604 1.00 22.73  ? 224 ASN B CB    1 
ATOM   1861 C CG    . ASN C 1 82  ? 24.751 5.320   48.597 1.00 29.94  ? 224 ASN B CG    1 
ATOM   1862 O OD1   . ASN C 1 82  ? 24.732 5.589   49.808 1.00 31.93  ? 224 ASN B OD1   1 
ATOM   1863 N ND2   . ASN C 1 82  ? 24.002 4.351   48.096 1.00 27.07  ? 224 ASN B ND2   1 
ATOM   1864 H H     . ASN C 1 82  ? 27.877 5.192   48.306 1.00 0.00   ? 224 ASN B H     1 
ATOM   1865 H HD21  . ASN C 1 82  ? 23.446 3.840   48.720 1.00 0.00   ? 224 ASN B HD21  1 
ATOM   1866 H HD22  . ASN C 1 82  ? 24.017 4.168   47.133 1.00 0.00   ? 224 ASN B HD22  1 
ATOM   1867 N N     . SER C 1 83  ? 28.135 6.291   45.341 1.00 24.22  ? 225 SER B N     1 
ATOM   1868 C CA    . SER C 1 83  ? 28.651 6.915   44.124 1.00 25.67  ? 225 SER B CA    1 
ATOM   1869 C C     . SER C 1 83  ? 30.091 6.478   43.964 1.00 23.07  ? 225 SER B C     1 
ATOM   1870 O O     . SER C 1 83  ? 30.755 6.036   44.923 1.00 20.84  ? 225 SER B O     1 
ATOM   1871 C CB    . SER C 1 83  ? 28.611 8.496   44.190 1.00 24.42  ? 225 SER B CB    1 
ATOM   1872 O OG    . SER C 1 83  ? 29.485 9.036   45.208 1.00 25.36  ? 225 SER B OG    1 
ATOM   1873 H H     . SER C 1 83  ? 28.754 6.147   46.086 1.00 0.00   ? 225 SER B H     1 
ATOM   1874 H HG    . SER C 1 83  ? 29.424 9.994   45.207 1.00 0.00   ? 225 SER B HG    1 
ATOM   1875 N N     . LEU C 1 84  ? 30.621 6.725   42.764 1.00 23.76  ? 226 LEU B N     1 
ATOM   1876 C CA    . LEU C 1 84  ? 31.984 6.347   42.436 1.00 24.28  ? 226 LEU B CA    1 
ATOM   1877 C C     . LEU C 1 84  ? 33.020 7.274   43.068 1.00 25.33  ? 226 LEU B C     1 
ATOM   1878 O O     . LEU C 1 84  ? 34.149 6.872   43.388 1.00 22.04  ? 226 LEU B O     1 
ATOM   1879 C CB    . LEU C 1 84  ? 32.133 6.308   40.880 1.00 26.04  ? 226 LEU B CB    1 
ATOM   1880 C CG    . LEU C 1 84  ? 33.469 5.890   40.333 1.00 25.59  ? 226 LEU B CG    1 
ATOM   1881 C CD1   . LEU C 1 84  ? 33.600 4.390   40.529 1.00 30.42  ? 226 LEU B CD1   1 
ATOM   1882 C CD2   . LEU C 1 84  ? 33.600 6.238   38.883 1.00 26.46  ? 226 LEU B CD2   1 
ATOM   1883 H H     . LEU C 1 84  ? 30.075 7.174   42.085 1.00 0.00   ? 226 LEU B H     1 
ATOM   1884 N N     . GLN C 1 85  ? 32.646 8.543   43.310 1.00 24.53  ? 227 GLN B N     1 
ATOM   1885 C CA    . GLN C 1 85  ? 33.555 9.488   43.931 1.00 22.32  ? 227 GLN B CA    1 
ATOM   1886 C C     . GLN C 1 85  ? 33.755 9.156   45.419 1.00 18.83  ? 227 GLN B C     1 
ATOM   1887 O O     . GLN C 1 85  ? 34.857 9.299   45.973 1.00 19.94  ? 227 GLN B O     1 
ATOM   1888 C CB    . GLN C 1 85  ? 32.983 10.916  43.733 1.00 21.75  ? 227 GLN B CB    1 
ATOM   1889 C CG    . GLN C 1 85  ? 33.909 12.020  44.229 1.00 24.40  ? 227 GLN B CG    1 
ATOM   1890 C CD    . GLN C 1 85  ? 33.635 12.374  45.693 1.00 21.96  ? 227 GLN B CD    1 
ATOM   1891 O OE1   . GLN C 1 85  ? 32.516 12.211  46.162 1.00 28.97  ? 227 GLN B OE1   1 
ATOM   1892 N NE2   . GLN C 1 85  ? 34.580 12.817  46.502 1.00 25.03  ? 227 GLN B NE2   1 
ATOM   1893 H H     . GLN C 1 85  ? 31.744 8.834   43.063 1.00 0.00   ? 227 GLN B H     1 
ATOM   1894 H HE21  . GLN C 1 85  ? 34.326 13.022  47.425 1.00 0.00   ? 227 GLN B HE21  1 
ATOM   1895 H HE22  . GLN C 1 85  ? 35.495 12.929  46.171 1.00 0.00   ? 227 GLN B HE22  1 
ATOM   1896 N N     . GLN C 1 86  ? 32.707 8.696   46.085 1.00 20.65  ? 228 GLN B N     1 
ATOM   1897 C CA    . GLN C 1 86  ? 32.828 8.299   47.481 1.00 23.56  ? 228 GLN B CA    1 
ATOM   1898 C C     . GLN C 1 86  ? 33.761 7.100   47.635 1.00 24.15  ? 228 GLN B C     1 
ATOM   1899 O O     . GLN C 1 86  ? 34.503 7.012   48.626 1.00 22.80  ? 228 GLN B O     1 
ATOM   1900 C CB    . GLN C 1 86  ? 31.472 7.935   48.046 1.00 27.96  ? 228 GLN B CB    1 
ATOM   1901 C CG    . GLN C 1 86  ? 30.530 9.089   48.190 1.00 24.01  ? 228 GLN B CG    1 
ATOM   1902 C CD    . GLN C 1 86  ? 29.147 8.606   48.458 1.00 21.77  ? 228 GLN B CD    1 
ATOM   1903 O OE1   . GLN C 1 86  ? 28.273 8.616   47.583 1.00 25.66  ? 228 GLN B OE1   1 
ATOM   1904 N NE2   . GLN C 1 86  ? 28.850 8.164   49.651 1.00 26.64  ? 228 GLN B NE2   1 
ATOM   1905 H H     . GLN C 1 86  ? 31.840 8.622   45.634 1.00 0.00   ? 228 GLN B H     1 
ATOM   1906 H HE21  . GLN C 1 86  ? 27.934 7.852   49.803 1.00 0.00   ? 228 GLN B HE21  1 
ATOM   1907 H HE22  . GLN C 1 86  ? 29.533 8.154   50.354 1.00 0.00   ? 228 GLN B HE22  1 
ATOM   1908 N N     . LEU C 1 87  ? 33.716 6.163   46.646 1.00 25.06  ? 229 LEU B N     1 
ATOM   1909 C CA    . LEU C 1 87  ? 34.643 5.036   46.609 1.00 21.39  ? 229 LEU B CA    1 
ATOM   1910 C C     . LEU C 1 87  ? 36.067 5.526   46.649 1.00 20.24  ? 229 LEU B C     1 
ATOM   1911 O O     . LEU C 1 87  ? 36.900 5.119   47.473 1.00 24.59  ? 229 LEU B O     1 
ATOM   1912 C CB    . LEU C 1 87  ? 34.407 4.185   45.335 1.00 23.10  ? 229 LEU B CB    1 
ATOM   1913 C CG    . LEU C 1 87  ? 35.287 2.881   45.177 1.00 22.79  ? 229 LEU B CG    1 
ATOM   1914 C CD1   . LEU C 1 87  ? 34.437 1.789   44.551 1.00 22.20  ? 229 LEU B CD1   1 
ATOM   1915 C CD2   . LEU C 1 87  ? 36.547 3.129   44.372 1.00 21.23  ? 229 LEU B CD2   1 
ATOM   1916 H H     . LEU C 1 87  ? 33.042 6.248   45.940 1.00 0.00   ? 229 LEU B H     1 
ATOM   1917 N N     . VAL C 1 88  ? 36.366 6.439   45.723 1.00 26.61  ? 230 VAL B N     1 
ATOM   1918 C CA    . VAL C 1 88  ? 37.714 6.989   45.569 1.00 25.70  ? 230 VAL B CA    1 
ATOM   1919 C C     . VAL C 1 88  ? 38.100 7.740   46.827 1.00 25.76  ? 230 VAL B C     1 
ATOM   1920 O O     . VAL C 1 88  ? 39.194 7.527   47.362 1.00 27.00  ? 230 VAL B O     1 
ATOM   1921 C CB    . VAL C 1 88  ? 37.793 7.953   44.288 1.00 26.14  ? 230 VAL B CB    1 
ATOM   1922 C CG1   . VAL C 1 88  ? 39.187 8.575   44.125 1.00 23.04  ? 230 VAL B CG1   1 
ATOM   1923 C CG2   . VAL C 1 88  ? 37.507 7.156   43.055 1.00 24.24  ? 230 VAL B CG2   1 
ATOM   1924 H H     . VAL C 1 88  ? 35.657 6.753   45.124 1.00 0.00   ? 230 VAL B H     1 
ATOM   1925 N N     . ALA C 1 89  ? 37.197 8.589   47.333 1.00 25.42  ? 231 ALA B N     1 
ATOM   1926 C CA    . ALA C 1 89  ? 37.473 9.319   48.557 1.00 25.64  ? 231 ALA B CA    1 
ATOM   1927 C C     . ALA C 1 89  ? 37.764 8.349   49.733 1.00 26.56  ? 231 ALA B C     1 
ATOM   1928 O O     . ALA C 1 89  ? 38.765 8.516   50.444 1.00 25.55  ? 231 ALA B O     1 
ATOM   1929 C CB    . ALA C 1 89  ? 36.272 10.186  48.888 1.00 24.45  ? 231 ALA B CB    1 
ATOM   1930 H H     . ALA C 1 89  ? 36.342 8.719   46.873 1.00 0.00   ? 231 ALA B H     1 
ATOM   1931 N N     . TYR C 1 90  ? 36.935 7.292   49.937 1.00 23.19  ? 232 TYR B N     1 
ATOM   1932 C CA    . TYR C 1 90  ? 37.182 6.263   50.953 1.00 22.40  ? 232 TYR B CA    1 
ATOM   1933 C C     . TYR C 1 90  ? 38.533 5.603   50.843 1.00 20.84  ? 232 TYR B C     1 
ATOM   1934 O O     . TYR C 1 90  ? 39.268 5.564   51.848 1.00 21.52  ? 232 TYR B O     1 
ATOM   1935 C CB    . TYR C 1 90  ? 36.119 5.157   50.866 1.00 25.46  ? 232 TYR B CB    1 
ATOM   1936 C CG    . TYR C 1 90  ? 36.250 4.124   51.971 1.00 29.94  ? 232 TYR B CG    1 
ATOM   1937 C CD1   . TYR C 1 90  ? 35.731 4.439   53.243 1.00 30.88  ? 232 TYR B CD1   1 
ATOM   1938 C CD2   . TYR C 1 90  ? 36.928 2.896   51.749 1.00 29.93  ? 232 TYR B CD2   1 
ATOM   1939 C CE1   . TYR C 1 90  ? 35.870 3.522   54.301 1.00 33.47  ? 232 TYR B CE1   1 
ATOM   1940 C CE2   . TYR C 1 90  ? 37.075 1.981   52.811 1.00 31.85  ? 232 TYR B CE2   1 
ATOM   1941 C CZ    . TYR C 1 90  ? 36.567 2.313   54.087 1.00 33.73  ? 232 TYR B CZ    1 
ATOM   1942 O OH    . TYR C 1 90  ? 36.716 1.454   55.151 1.00 29.81  ? 232 TYR B OH    1 
ATOM   1943 H H     . TYR C 1 90  ? 36.134 7.213   49.379 1.00 0.00   ? 232 TYR B H     1 
ATOM   1944 H HH    . TYR C 1 90  ? 36.313 1.839   55.933 1.00 0.00   ? 232 TYR B HH    1 
ATOM   1945 N N     . TYR C 1 91  ? 38.876 5.093   49.648 1.00 20.70  ? 233 TYR B N     1 
ATOM   1946 C CA    . TYR C 1 91  ? 40.134 4.375   49.483 1.00 20.63  ? 233 TYR B CA    1 
ATOM   1947 C C     . TYR C 1 91  ? 41.389 5.253   49.439 1.00 21.97  ? 233 TYR B C     1 
ATOM   1948 O O     . TYR C 1 91  ? 42.538 4.779   49.545 1.00 18.41  ? 233 TYR B O     1 
ATOM   1949 C CB    . TYR C 1 91  ? 40.029 3.498   48.221 1.00 22.97  ? 233 TYR B CB    1 
ATOM   1950 C CG    . TYR C 1 91  ? 39.202 2.226   48.428 1.00 18.54  ? 233 TYR B CG    1 
ATOM   1951 C CD1   . TYR C 1 91  ? 39.745 1.159   49.170 1.00 21.16  ? 233 TYR B CD1   1 
ATOM   1952 C CD2   . TYR C 1 91  ? 37.997 2.086   47.762 1.00 13.73  ? 233 TYR B CD2   1 
ATOM   1953 C CE1   . TYR C 1 91  ? 39.026 -0.031  49.297 1.00 24.52  ? 233 TYR B CE1   1 
ATOM   1954 C CE2   . TYR C 1 91  ? 37.271 0.901   47.882 1.00 23.87  ? 233 TYR B CE2   1 
ATOM   1955 C CZ    . TYR C 1 91  ? 37.799 -0.158  48.659 1.00 24.69  ? 233 TYR B CZ    1 
ATOM   1956 O OH    . TYR C 1 91  ? 37.127 -1.382  48.730 1.00 27.05  ? 233 TYR B OH    1 
ATOM   1957 H H     . TYR C 1 91  ? 38.276 5.205   48.881 1.00 0.00   ? 233 TYR B H     1 
ATOM   1958 H HH    . TYR C 1 91  ? 36.300 -1.322  48.247 1.00 0.00   ? 233 TYR B HH    1 
ATOM   1959 N N     . SER C 1 92  ? 41.184 6.578   49.350 1.00 23.08  ? 234 SER B N     1 
ATOM   1960 C CA    . SER C 1 92  ? 42.284 7.527   49.552 1.00 27.31  ? 234 SER B CA    1 
ATOM   1961 C C     . SER C 1 92  ? 42.703 7.571   51.018 1.00 27.07  ? 234 SER B C     1 
ATOM   1962 O O     . SER C 1 92  ? 43.835 7.940   51.367 1.00 30.21  ? 234 SER B O     1 
ATOM   1963 C CB    . SER C 1 92  ? 41.829 8.898   49.140 1.00 29.93  ? 234 SER B CB    1 
ATOM   1964 O OG    . SER C 1 92  ? 41.522 8.863   47.747 1.00 44.98  ? 234 SER B OG    1 
ATOM   1965 H H     . SER C 1 92  ? 40.287 6.915   49.147 1.00 0.00   ? 234 SER B H     1 
ATOM   1966 H HG    . SER C 1 92  ? 41.228 9.731   47.462 1.00 0.00   ? 234 SER B HG    1 
ATOM   1967 N N     . LYS C 1 93  ? 41.777 7.265   51.916 1.00 25.65  ? 235 LYS B N     1 
ATOM   1968 C CA    . LYS C 1 93  ? 42.094 7.269   53.315 1.00 27.17  ? 235 LYS B CA    1 
ATOM   1969 C C     . LYS C 1 93  ? 42.290 5.856   53.853 1.00 28.59  ? 235 LYS B C     1 
ATOM   1970 O O     . LYS C 1 93  ? 42.939 5.670   54.878 1.00 30.02  ? 235 LYS B O     1 
ATOM   1971 C CB    . LYS C 1 93  ? 40.977 7.949   54.044 1.00 29.93  ? 235 LYS B CB    1 
ATOM   1972 C CG    . LYS C 1 93  ? 40.775 9.400   53.624 1.00 39.06  ? 235 LYS B CG    1 
ATOM   1973 C CD    . LYS C 1 93  ? 41.987 10.281  53.990 1.00 46.65  ? 235 LYS B CD    1 
ATOM   1974 C CE    . LYS C 1 93  ? 42.008 11.535  53.110 1.00 50.02  ? 235 LYS B CE    1 
ATOM   1975 N NZ    . LYS C 1 93  ? 43.336 12.118  53.115 1.00 55.30  ? 235 LYS B NZ    1 
ATOM   1976 H H     . LYS C 1 93  ? 40.871 7.035   51.622 1.00 0.00   ? 235 LYS B H     1 
ATOM   1977 H HZ1   . LYS C 1 93  ? 44.020 11.427  52.745 1.00 0.00   ? 235 LYS B HZ1   1 
ATOM   1978 H HZ2   . LYS C 1 93  ? 43.344 12.968  52.516 1.00 0.00   ? 235 LYS B HZ2   1 
ATOM   1979 H HZ3   . LYS C 1 93  ? 43.597 12.377  54.088 1.00 0.00   ? 235 LYS B HZ3   1 
ATOM   1980 N N     . HIS C 1 94  ? 41.715 4.816   53.235 1.00 30.53  ? 236 HIS B N     1 
ATOM   1981 C CA    . HIS C 1 94  ? 41.785 3.432   53.759 1.00 29.05  ? 236 HIS B CA    1 
ATOM   1982 C C     . HIS C 1 94  ? 42.075 2.428   52.666 1.00 25.96  ? 236 HIS B C     1 
ATOM   1983 O O     . HIS C 1 94  ? 41.189 2.189   51.849 1.00 25.74  ? 236 HIS B O     1 
ATOM   1984 C CB    . HIS C 1 94  ? 40.461 3.007   54.386 1.00 27.76  ? 236 HIS B CB    1 
ATOM   1985 C CG    . HIS C 1 94  ? 40.037 3.971   55.455 1.00 27.57  ? 236 HIS B CG    1 
ATOM   1986 N ND1   . HIS C 1 94  ? 40.794 4.298   56.479 1.00 28.14  ? 236 HIS B ND1   1 
ATOM   1987 C CD2   . HIS C 1 94  ? 38.908 4.752   55.470 1.00 29.42  ? 236 HIS B CD2   1 
ATOM   1988 C CE1   . HIS C 1 94  ? 40.195 5.265   57.128 1.00 29.25  ? 236 HIS B CE1   1 
ATOM   1989 N NE2   . HIS C 1 94  ? 39.051 5.536   56.519 1.00 29.85  ? 236 HIS B NE2   1 
ATOM   1990 H H     . HIS C 1 94  ? 41.227 4.977   52.401 1.00 0.00   ? 236 HIS B H     1 
ATOM   1991 H HD1   . HIS C 1 94  ? 41.649 3.893   56.713 1.00 0.00   ? 236 HIS B HD1   1 
ATOM   1992 H HE2   . HIS C 1 94  ? 38.410 6.215   56.804 1.00 0.00   ? 236 HIS B HE2   1 
ATOM   1993 N N     . ALA C 1 95  ? 43.299 1.863   52.615 1.00 23.35  ? 237 ALA B N     1 
ATOM   1994 C CA    . ALA C 1 95  ? 43.627 0.856   51.604 1.00 24.30  ? 237 ALA B CA    1 
ATOM   1995 C C     . ALA C 1 95  ? 42.681 -0.335  51.650 1.00 24.55  ? 237 ALA B C     1 
ATOM   1996 O O     . ALA C 1 95  ? 42.199 -0.753  50.602 1.00 20.24  ? 237 ALA B O     1 
ATOM   1997 C CB    . ALA C 1 95  ? 45.037 0.294   51.782 1.00 22.60  ? 237 ALA B CB    1 
ATOM   1998 H H     . ALA C 1 95  ? 43.981 2.131   53.266 1.00 0.00   ? 237 ALA B H     1 
ATOM   1999 N N     . ASP C 1 96  ? 42.452 -0.941  52.841 1.00 24.12  ? 238 ASP B N     1 
ATOM   2000 C CA    . ASP C 1 96  ? 41.503 -2.040  52.981 1.00 24.09  ? 238 ASP B CA    1 
ATOM   2001 C C     . ASP C 1 96  ? 41.568 -3.129  51.904 1.00 24.04  ? 238 ASP B C     1 
ATOM   2002 O O     . ASP C 1 96  ? 40.568 -3.476  51.253 1.00 27.90  ? 238 ASP B O     1 
ATOM   2003 C CB    . ASP C 1 96  ? 40.093 -1.534  52.991 1.00 25.70  ? 238 ASP B CB    1 
ATOM   2004 C CG    . ASP C 1 96  ? 39.628 -0.777  54.200 1.00 30.79  ? 238 ASP B CG    1 
ATOM   2005 O OD1   . ASP C 1 96  ? 40.470 -0.328  55.006 1.00 36.18  ? 238 ASP B OD1   1 
ATOM   2006 O OD2   . ASP C 1 96  ? 38.404 -0.643  54.329 1.00 29.50  ? 238 ASP B OD2   1 
ATOM   2007 H H     . ASP C 1 96  ? 42.939 -0.631  53.633 1.00 0.00   ? 238 ASP B H     1 
ATOM   2008 N N     . GLY C 1 97  ? 42.746 -3.722  51.691 1.00 23.55  ? 239 GLY B N     1 
ATOM   2009 C CA    . GLY C 1 97  ? 42.833 -4.786  50.717 1.00 26.26  ? 239 GLY B CA    1 
ATOM   2010 C C     . GLY C 1 97  ? 43.500 -4.323  49.451 1.00 27.99  ? 239 GLY B C     1 
ATOM   2011 O O     . GLY C 1 97  ? 44.133 -5.145  48.810 1.00 27.39  ? 239 GLY B O     1 
ATOM   2012 H H     . GLY C 1 97  ? 43.541 -3.439  52.189 1.00 0.00   ? 239 GLY B H     1 
ATOM   2013 N N     . LEU C 1 98  ? 43.414 -3.036  49.054 1.00 29.37  ? 240 LEU B N     1 
ATOM   2014 C CA    . LEU C 1 98  ? 44.174 -2.547  47.878 1.00 29.86  ? 240 LEU B CA    1 
ATOM   2015 C C     . LEU C 1 98  ? 45.649 -2.550  48.202 1.00 27.58  ? 240 LEU B C     1 
ATOM   2016 O O     . LEU C 1 98  ? 46.000 -2.518  49.382 1.00 26.91  ? 240 LEU B O     1 
ATOM   2017 C CB    . LEU C 1 98  ? 43.806 -1.081  47.453 1.00 26.78  ? 240 LEU B CB    1 
ATOM   2018 C CG    . LEU C 1 98  ? 42.345 -0.634  47.283 1.00 26.70  ? 240 LEU B CG    1 
ATOM   2019 C CD1   . LEU C 1 98  ? 42.365 0.808   46.800 1.00 24.93  ? 240 LEU B CD1   1 
ATOM   2020 C CD2   . LEU C 1 98  ? 41.563 -1.533  46.289 1.00 26.28  ? 240 LEU B CD2   1 
ATOM   2021 H H     . LEU C 1 98  ? 42.841 -2.415  49.550 1.00 0.00   ? 240 LEU B H     1 
ATOM   2022 N N     . CYS C 1 99  ? 46.539 -2.492  47.194 1.00 29.35  ? 241 CYS B N     1 
ATOM   2023 C CA    . CYS C 1 99  ? 48.001 -2.507  47.438 1.00 29.92  ? 241 CYS B CA    1 
ATOM   2024 C C     . CYS C 1 99  ? 48.519 -1.302  48.183 1.00 28.69  ? 241 CYS B C     1 
ATOM   2025 O O     . CYS C 1 99  ? 49.604 -1.298  48.776 1.00 24.95  ? 241 CYS B O     1 
ATOM   2026 C CB    . CYS C 1 99  ? 48.814 -2.581  46.136 1.00 31.87  ? 241 CYS B CB    1 
ATOM   2027 S SG    . CYS C 1 99  ? 48.261 -1.400  44.856 1.00 31.56  ? 241 CYS B SG    1 
ATOM   2028 H H     . CYS C 1 99  ? 46.211 -2.438  46.272 1.00 0.00   ? 241 CYS B H     1 
ATOM   2029 N N     . HIS C 1 100 ? 47.749 -0.224  48.097 1.00 26.71  ? 242 HIS B N     1 
ATOM   2030 C CA    . HIS C 1 100 ? 48.163 1.016   48.724 1.00 28.95  ? 242 HIS B CA    1 
ATOM   2031 C C     . HIS C 1 100 ? 46.976 1.921   48.695 1.00 28.37  ? 242 HIS B C     1 
ATOM   2032 O O     . HIS C 1 100 ? 46.053 1.672   47.917 1.00 25.45  ? 242 HIS B O     1 
ATOM   2033 C CB    . HIS C 1 100 ? 49.322 1.628   47.937 1.00 30.16  ? 242 HIS B CB    1 
ATOM   2034 C CG    . HIS C 1 100 ? 49.958 2.850   48.567 1.00 28.64  ? 242 HIS B CG    1 
ATOM   2035 N ND1   . HIS C 1 100 ? 49.440 4.070   48.754 1.00 29.15  ? 242 HIS B ND1   1 
ATOM   2036 C CD2   . HIS C 1 100 ? 51.253 2.874   48.983 1.00 30.47  ? 242 HIS B CD2   1 
ATOM   2037 C CE1   . HIS C 1 100 ? 50.364 4.827   49.268 1.00 28.28  ? 242 HIS B CE1   1 
ATOM   2038 N NE2   . HIS C 1 100 ? 51.452 4.099   49.412 1.00 30.48  ? 242 HIS B NE2   1 
ATOM   2039 H H     . HIS C 1 100 ? 46.900 -0.266  47.609 1.00 0.00   ? 242 HIS B H     1 
ATOM   2040 H HD1   . HIS C 1 100 ? 48.529 4.343   48.542 1.00 0.00   ? 242 HIS B HD1   1 
ATOM   2041 H HE2   . HIS C 1 100 ? 52.293 4.426   49.787 1.00 0.00   ? 242 HIS B HE2   1 
ATOM   2042 N N     . ARG C 1 101 ? 46.932 2.950   49.557 1.00 31.24  ? 243 ARG B N     1 
ATOM   2043 C CA    . ARG C 1 101 ? 45.809 3.886   49.518 1.00 30.39  ? 243 ARG B CA    1 
ATOM   2044 C C     . ARG C 1 101 ? 45.902 4.707   48.246 1.00 26.81  ? 243 ARG B C     1 
ATOM   2045 O O     . ARG C 1 101 ? 47.011 4.887   47.714 1.00 27.40  ? 243 ARG B O     1 
ATOM   2046 C CB    . ARG C 1 101 ? 45.865 4.818   50.652 1.00 32.53  ? 243 ARG B CB    1 
ATOM   2047 C CG    . ARG C 1 101 ? 45.628 4.223   51.986 1.00 38.87  ? 243 ARG B CG    1 
ATOM   2048 C CD    . ARG C 1 101 ? 45.706 5.450   52.827 1.00 48.03  ? 243 ARG B CD    1 
ATOM   2049 N NE    . ARG C 1 101 ? 45.852 5.182   54.234 1.00 54.95  ? 243 ARG B NE    1 
ATOM   2050 C CZ    . ARG C 1 101 ? 46.252 6.113   55.078 1.00 55.99  ? 243 ARG B CZ    1 
ATOM   2051 N NH1   . ARG C 1 101 ? 46.532 7.330   54.629 1.00 58.02  ? 243 ARG B NH1   1 
ATOM   2052 N NH2   . ARG C 1 101 ? 46.395 5.804   56.360 1.00 60.02  ? 243 ARG B NH2   1 
ATOM   2053 H H     . ARG C 1 101 ? 47.651 3.073   50.211 1.00 0.00   ? 243 ARG B H     1 
ATOM   2054 H HE    . ARG C 1 101 ? 45.649 4.285   54.573 1.00 0.00   ? 243 ARG B HE    1 
ATOM   2055 H HH11  . ARG C 1 101 ? 46.439 7.537   53.655 1.00 0.00   ? 243 ARG B HH11  1 
ATOM   2056 H HH12  . ARG C 1 101 ? 46.836 8.040   55.265 1.00 0.00   ? 243 ARG B HH12  1 
ATOM   2057 H HH21  . ARG C 1 101 ? 46.200 4.875   56.675 1.00 0.00   ? 243 ARG B HH21  1 
ATOM   2058 H HH22  . ARG C 1 101 ? 46.698 6.500   57.011 1.00 0.00   ? 243 ARG B HH22  1 
ATOM   2059 N N     . LEU C 1 102 ? 44.769 5.184   47.775 1.00 26.66  ? 244 LEU B N     1 
ATOM   2060 C CA    . LEU C 1 102 ? 44.718 5.977   46.564 1.00 29.60  ? 244 LEU B CA    1 
ATOM   2061 C C     . LEU C 1 102 ? 45.192 7.404   46.848 1.00 31.85  ? 244 LEU B C     1 
ATOM   2062 O O     . LEU C 1 102 ? 44.373 8.336   47.002 1.00 36.22  ? 244 LEU B O     1 
ATOM   2063 C CB    . LEU C 1 102 ? 43.289 6.001   46.033 1.00 25.15  ? 244 LEU B CB    1 
ATOM   2064 C CG    . LEU C 1 102 ? 42.646 4.658   45.779 1.00 24.40  ? 244 LEU B CG    1 
ATOM   2065 C CD1   . LEU C 1 102 ? 41.370 4.893   45.040 1.00 26.06  ? 244 LEU B CD1   1 
ATOM   2066 C CD2   . LEU C 1 102 ? 43.573 3.756   44.986 1.00 20.01  ? 244 LEU B CD2   1 
ATOM   2067 H H     . LEU C 1 102 ? 43.937 4.997   48.257 1.00 0.00   ? 244 LEU B H     1 
ATOM   2068 N N     . THR C 1 103 ? 46.495 7.584   46.901 1.00 29.38  ? 245 THR B N     1 
ATOM   2069 C CA    . THR C 1 103 ? 46.994 8.866   47.305 1.00 37.17  ? 245 THR B CA    1 
ATOM   2070 C C     . THR C 1 103 ? 47.317 9.924   46.220 1.00 40.00  ? 245 THR B C     1 
ATOM   2071 O O     . THR C 1 103 ? 46.906 11.082  46.361 1.00 43.10  ? 245 THR B O     1 
ATOM   2072 C CB    . THR C 1 103 ? 48.156 8.534   48.222 1.00 37.24  ? 245 THR B CB    1 
ATOM   2073 O OG1   . THR C 1 103 ? 48.934 7.459   47.700 1.00 40.48  ? 245 THR B OG1   1 
ATOM   2074 C CG2   . THR C 1 103 ? 47.567 8.122   49.574 1.00 40.35  ? 245 THR B CG2   1 
ATOM   2075 H H     . THR C 1 103 ? 47.111 6.858   46.669 1.00 0.00   ? 245 THR B H     1 
ATOM   2076 H HG1   . THR C 1 103 ? 49.661 7.270   48.298 1.00 0.00   ? 245 THR B HG1   1 
ATOM   2077 N N     . THR C 1 104 ? 48.032 9.653   45.126 1.00 38.76  ? 246 THR B N     1 
ATOM   2078 C CA    . THR C 1 104 ? 48.240 10.679  44.108 1.00 35.49  ? 246 THR B CA    1 
ATOM   2079 C C     . THR C 1 104 ? 47.396 10.393  42.875 1.00 32.92  ? 246 THR B C     1 
ATOM   2080 O O     . THR C 1 104 ? 47.467 9.273   42.334 1.00 29.78  ? 246 THR B O     1 
ATOM   2081 C CB    . THR C 1 104 ? 49.684 10.671  43.732 1.00 38.41  ? 246 THR B CB    1 
ATOM   2082 O OG1   . THR C 1 104 ? 50.330 10.909  44.960 1.00 42.99  ? 246 THR B OG1   1 
ATOM   2083 C CG2   . THR C 1 104 ? 50.076 11.676  42.652 1.00 36.43  ? 246 THR B CG2   1 
ATOM   2084 H H     . THR C 1 104 ? 48.419 8.761   45.005 1.00 0.00   ? 246 THR B H     1 
ATOM   2085 H HG1   . THR C 1 104 ? 50.045 11.755  45.313 1.00 0.00   ? 246 THR B HG1   1 
ATOM   2086 N N     . VAL C 1 105 ? 46.580 11.359  42.431 1.00 27.62  ? 247 VAL B N     1 
ATOM   2087 C CA    . VAL C 1 105 ? 45.911 11.208  41.165 1.00 26.80  ? 247 VAL B CA    1 
ATOM   2088 C C     . VAL C 1 105 ? 46.978 11.175  40.048 1.00 27.70  ? 247 VAL B C     1 
ATOM   2089 O O     . VAL C 1 105 ? 47.960 11.935  40.103 1.00 29.31  ? 247 VAL B O     1 
ATOM   2090 C CB    . VAL C 1 105 ? 44.954 12.354  40.935 1.00 25.42  ? 247 VAL B CB    1 
ATOM   2091 C CG1   . VAL C 1 105 ? 44.358 12.199  39.546 1.00 29.08  ? 247 VAL B CG1   1 
ATOM   2092 C CG2   . VAL C 1 105 ? 43.827 12.311  41.881 1.00 18.58  ? 247 VAL B CG2   1 
ATOM   2093 H H     . VAL C 1 105 ? 46.439 12.167  42.967 1.00 0.00   ? 247 VAL B H     1 
ATOM   2094 N N     . CYS C 1 106 ? 46.882 10.238  39.089 1.00 26.30  ? 248 CYS B N     1 
ATOM   2095 C CA    . CYS C 1 106 ? 47.777 10.189  37.923 1.00 24.75  ? 248 CYS B CA    1 
ATOM   2096 C C     . CYS C 1 106 ? 47.875 11.575  37.268 1.00 21.19  ? 248 CYS B C     1 
ATOM   2097 O O     . CYS C 1 106 ? 46.840 12.227  37.071 1.00 20.83  ? 248 CYS B O     1 
ATOM   2098 C CB    . CYS C 1 106 ? 47.245 9.220   36.884 1.00 26.43  ? 248 CYS B CB    1 
ATOM   2099 S SG    . CYS C 1 106 ? 48.499 8.933   35.618 1.00 29.19  ? 248 CYS B SG    1 
ATOM   2100 H H     . CYS C 1 106 ? 46.183 9.556   39.171 1.00 0.00   ? 248 CYS B H     1 
ATOM   2101 N N     . PRO C 1 107 ? 49.082 12.088  37.119 1.00 23.43  ? 249 PRO B N     1 
ATOM   2102 C CA    . PRO C 1 107 ? 49.321 13.449  36.657 1.00 31.05  ? 249 PRO B CA    1 
ATOM   2103 C C     . PRO C 1 107 ? 48.721 13.656  35.268 1.00 35.83  ? 249 PRO B C     1 
ATOM   2104 O O     . PRO C 1 107 ? 48.642 12.697  34.489 1.00 36.26  ? 249 PRO B O     1 
ATOM   2105 C CB    . PRO C 1 107 ? 50.804 13.617  36.638 1.00 30.89  ? 249 PRO B CB    1 
ATOM   2106 C CG    . PRO C 1 107 ? 51.422 12.320  37.085 1.00 29.34  ? 249 PRO B CG    1 
ATOM   2107 C CD    . PRO C 1 107 ? 50.304 11.347  37.331 1.00 23.75  ? 249 PRO B CD    1 
ATOM   2108 O OXT   . PRO C 1 107 ? 48.264 14.761  34.995 1.00 37.62  ? 249 PRO B OXT   1 
HETATM 2109 C C     . ACE D 2 1   ? 44.003 -8.842  36.507 1.00 32.69  ? 100 ACE D C     1 
HETATM 2110 O O     . ACE D 2 1   ? 44.610 -7.759  36.619 1.00 34.09  ? 100 ACE D O     1 
HETATM 2111 C CH3   . ACE D 2 1   ? 44.332 -9.781  35.357 1.00 29.14  ? 100 ACE D CH3   1 
HETATM 2112 N N     . PTH D 2 2   ? 42.905 -9.163  37.211 1.00 33.09  ? 101 PTH D N     1 
HETATM 2113 C CA    . PTH D 2 2   ? 42.386 -8.370  38.330 1.00 32.70  ? 101 PTH D CA    1 
HETATM 2114 C C     . PTH D 2 2   ? 42.630 -9.002  39.672 1.00 33.56  ? 101 PTH D C     1 
HETATM 2115 O O     . PTH D 2 2   ? 42.485 -10.221 39.858 1.00 33.03  ? 101 PTH D O     1 
HETATM 2116 C CB    . PTH D 2 2   ? 40.901 -8.171  38.242 1.00 33.13  ? 101 PTH D CB    1 
HETATM 2117 C CG    . PTH D 2 2   ? 40.554 -7.345  37.039 1.00 39.74  ? 101 PTH D CG    1 
HETATM 2118 C CD1   . PTH D 2 2   ? 40.691 -5.988  37.025 1.00 42.35  ? 101 PTH D CD1   1 
HETATM 2119 C CD2   . PTH D 2 2   ? 40.113 -7.971  35.897 1.00 45.61  ? 101 PTH D CD2   1 
HETATM 2120 C CE1   . PTH D 2 2   ? 40.438 -5.241  35.899 1.00 46.72  ? 101 PTH D CE1   1 
HETATM 2121 C CE2   . PTH D 2 2   ? 39.856 -7.250  34.738 1.00 47.83  ? 101 PTH D CE2   1 
HETATM 2122 C CZ    . PTH D 2 2   ? 39.976 -5.879  34.736 1.00 47.97  ? 101 PTH D CZ    1 
HETATM 2123 C CF    . PTH D 2 2   ? 40.531 -3.865  35.806 1.00 47.94  ? 101 PTH D CF    1 
HETATM 2124 O OH    . PTH D 2 2   ? 39.680 -5.225  33.563 1.00 43.21  ? 101 PTH D OH    1 
HETATM 2125 P P     . PTH D 2 2   ? 40.898 -4.628  32.492 1.00 41.38  ? 101 PTH D P     1 
HETATM 2126 O O1P   . PTH D 2 2   ? 41.059 -5.634  31.493 1.00 41.29  ? 101 PTH D O1P   1 
HETATM 2127 O O2P   . PTH D 2 2   ? 42.138 -4.409  33.387 1.00 41.02  ? 101 PTH D O2P   1 
HETATM 2128 O O3P   . PTH D 2 2   ? 40.111 -3.413  32.204 1.00 43.43  ? 101 PTH D O3P   1 
HETATM 2129 O OF    . PTH D 2 2   ? 40.773 -3.198  36.831 1.00 55.10  ? 101 PTH D OF    1 
HETATM 2130 H H     . PTH D 2 2   ? 42.421 -9.977  36.961 1.00 0.00   ? 101 PTH D H     1 
HETATM 2131 H HF2   . PTH D 2 2   ? 40.393 -3.385  34.848 1.00 0.00   ? 101 PTH D HF2   1 
ATOM   2132 N N     . GLU D 2 3   ? 42.928 -8.087  40.583 1.00 31.34  ? 102 GLU D N     1 
ATOM   2133 C CA    . GLU D 2 3   ? 43.208 -8.412  41.955 1.00 29.79  ? 102 GLU D CA    1 
ATOM   2134 C C     . GLU D 2 3   ? 41.930 -8.796  42.707 1.00 29.42  ? 102 GLU D C     1 
ATOM   2135 O O     . GLU D 2 3   ? 40.839 -8.322  42.353 1.00 33.38  ? 102 GLU D O     1 
ATOM   2136 C CB    . GLU D 2 3   ? 43.834 -7.220  42.633 1.00 28.48  ? 102 GLU D CB    1 
ATOM   2137 C CG    . GLU D 2 3   ? 45.067 -6.681  41.978 1.00 28.82  ? 102 GLU D CG    1 
ATOM   2138 C CD    . GLU D 2 3   ? 46.215 -7.663  41.952 1.00 37.15  ? 102 GLU D CD    1 
ATOM   2139 O OE1   . GLU D 2 3   ? 46.395 -8.443  42.893 1.00 40.24  ? 102 GLU D OE1   1 
ATOM   2140 O OE2   . GLU D 2 3   ? 46.963 -7.603  40.985 1.00 41.14  ? 102 GLU D OE2   1 
ATOM   2141 H H     . GLU D 2 3   ? 42.959 -7.147  40.309 1.00 0.00   ? 102 GLU D H     1 
HETATM 2142 N N     . DIP D 2 4   ? 41.984 -9.642  43.758 1.00 28.43  ? 103 DIP D N     1 
HETATM 2143 C C1    . DIP D 2 4   ? 43.250 -10.306 44.123 1.00 29.26  ? 103 DIP D C1    1 
HETATM 2144 C C2    . DIP D 2 4   ? 43.202 -11.596 43.298 1.00 35.19  ? 103 DIP D C2    1 
HETATM 2145 C C3    . DIP D 2 4   ? 44.438 -12.404 43.393 1.00 38.41  ? 103 DIP D C3    1 
HETATM 2146 C C4    . DIP D 2 4   ? 44.156 -13.539 42.419 1.00 45.40  ? 103 DIP D C4    1 
HETATM 2147 C C5    . DIP D 2 4   ? 45.192 -14.666 42.541 1.00 50.85  ? 103 DIP D C5    1 
HETATM 2148 C "C1'" . DIP D 2 4   ? 40.777 -9.935  44.511 1.00 24.84  ? 103 DIP D "C1'" 1 
HETATM 2149 C "C2'" . DIP D 2 4   ? 41.031 -9.319  45.881 1.00 30.03  ? 103 DIP D "C2'" 1 
HETATM 2150 C "C3'" . DIP D 2 4   ? 40.863 -7.824  45.867 1.00 28.65  ? 103 DIP D "C3'" 1 
HETATM 2151 C "C4'" . DIP D 2 4   ? 41.322 -7.264  47.178 1.00 31.47  ? 103 DIP D "C4'" 1 
HETATM 2152 C "C5'" . DIP D 2 4   ? 41.025 -5.745  47.282 1.00 30.22  ? 103 DIP D "C5'" 1 
HETATM 2153 O O     . HOH E 3 .   ? 52.117 30.270  16.717 1.00 63.05  ? 503 HOH A O     1 
HETATM 2154 H H1    . HOH E 3 .   ? 51.944 29.791  15.907 1.00 0.00   ? 503 HOH A H1    1 
HETATM 2155 H H2    . HOH E 3 .   ? 51.472 30.977  16.720 1.00 0.00   ? 503 HOH A H2    1 
HETATM 2156 O O     . HOH E 3 .   ? 54.190 27.525  22.790 1.00 25.13  ? 504 HOH A O     1 
HETATM 2157 H H1    . HOH E 3 .   ? 55.092 27.276  22.991 1.00 0.00   ? 504 HOH A H1    1 
HETATM 2158 H H2    . HOH E 3 .   ? 53.884 27.977  23.577 1.00 0.00   ? 504 HOH A H2    1 
HETATM 2159 O O     . HOH E 3 .   ? 58.459 20.546  24.366 1.00 29.65  ? 505 HOH A O     1 
HETATM 2160 H H1    . HOH E 3 .   ? 58.493 20.760  25.298 1.00 0.00   ? 505 HOH A H1    1 
HETATM 2161 H H2    . HOH E 3 .   ? 58.377 19.593  24.341 1.00 0.00   ? 505 HOH A H2    1 
HETATM 2162 O O     . HOH E 3 .   ? 57.713 18.895  22.359 1.00 43.15  ? 506 HOH A O     1 
HETATM 2163 H H1    . HOH E 3 .   ? 58.085 18.124  22.787 1.00 0.00   ? 506 HOH A H1    1 
HETATM 2164 H H2    . HOH E 3 .   ? 56.905 18.579  21.955 1.00 0.00   ? 506 HOH A H2    1 
HETATM 2165 O O     . HOH E 3 .   ? 47.675 29.479  23.372 1.00 31.95  ? 507 HOH A O     1 
HETATM 2166 H H1    . HOH E 3 .   ? 46.887 28.955  23.515 1.00 0.00   ? 507 HOH A H1    1 
HETATM 2167 H H2    . HOH E 3 .   ? 47.582 30.221  23.970 1.00 0.00   ? 507 HOH A H2    1 
HETATM 2168 O O     . HOH E 3 .   ? 56.131 21.069  27.790 1.00 28.55  ? 508 HOH A O     1 
HETATM 2169 H H1    . HOH E 3 .   ? 55.253 21.108  27.411 1.00 0.00   ? 508 HOH A H1    1 
HETATM 2170 H H2    . HOH E 3 .   ? 56.564 21.862  27.474 1.00 0.00   ? 508 HOH A H2    1 
HETATM 2171 O O     . HOH E 3 .   ? 52.535 15.158  26.485 1.00 26.90  ? 509 HOH A O     1 
HETATM 2172 H H1    . HOH E 3 .   ? 52.816 14.652  25.723 1.00 0.00   ? 509 HOH A H1    1 
HETATM 2173 H H2    . HOH E 3 .   ? 51.641 15.430  26.276 1.00 0.00   ? 509 HOH A H2    1 
HETATM 2174 O O     . HOH E 3 .   ? 55.825 12.400  25.957 1.00 73.53  ? 510 HOH A O     1 
HETATM 2175 H H1    . HOH E 3 .   ? 55.186 11.691  26.027 1.00 0.00   ? 510 HOH A H1    1 
HETATM 2176 H H2    . HOH E 3 .   ? 55.650 12.798  25.104 1.00 0.00   ? 510 HOH A H2    1 
HETATM 2177 O O     . HOH E 3 .   ? 43.404 17.500  36.679 1.00 55.36  ? 511 HOH A O     1 
HETATM 2178 H H1    . HOH E 3 .   ? 43.659 18.412  36.818 1.00 0.00   ? 511 HOH A H1    1 
HETATM 2179 H H2    . HOH E 3 .   ? 43.482 17.370  35.734 1.00 0.00   ? 511 HOH A H2    1 
HETATM 2180 O O     . HOH E 3 .   ? 54.502 8.755   15.005 1.00 34.24  ? 515 HOH A O     1 
HETATM 2181 H H1    . HOH E 3 .   ? 54.143 8.528   15.863 1.00 0.00   ? 515 HOH A H1    1 
HETATM 2182 H H2    . HOH E 3 .   ? 54.125 8.108   14.409 1.00 0.00   ? 515 HOH A H2    1 
HETATM 2183 O O     . HOH E 3 .   ? 46.336 4.934   20.081 1.00 29.64  ? 516 HOH A O     1 
HETATM 2184 H H1    . HOH E 3 .   ? 46.118 4.767   20.998 1.00 0.00   ? 516 HOH A H1    1 
HETATM 2185 H H2    . HOH E 3 .   ? 45.532 4.733   19.603 1.00 0.00   ? 516 HOH A H2    1 
HETATM 2186 O O     . HOH E 3 .   ? 48.304 4.322   12.877 1.00 26.55  ? 517 HOH A O     1 
HETATM 2187 H H1    . HOH E 3 .   ? 47.659 4.040   13.525 1.00 0.00   ? 517 HOH A H1    1 
HETATM 2188 H H2    . HOH E 3 .   ? 47.923 5.108   12.486 1.00 0.00   ? 517 HOH A H2    1 
HETATM 2189 O O     . HOH E 3 .   ? 44.704 12.836  8.617  1.00 23.93  ? 518 HOH A O     1 
HETATM 2190 H H1    . HOH E 3 .   ? 45.431 12.351  8.227  1.00 0.00   ? 518 HOH A H1    1 
HETATM 2191 H H2    . HOH E 3 .   ? 44.772 12.656  9.555  1.00 0.00   ? 518 HOH A H2    1 
HETATM 2192 O O     . HOH E 3 .   ? 51.854 4.951   11.462 1.00 34.81  ? 519 HOH A O     1 
HETATM 2193 H H1    . HOH E 3 .   ? 51.513 5.823   11.263 1.00 0.00   ? 519 HOH A H1    1 
HETATM 2194 H H2    . HOH E 3 .   ? 51.088 4.379   11.423 1.00 0.00   ? 519 HOH A H2    1 
HETATM 2195 O O     . HOH E 3 .   ? 55.998 5.379   7.763  1.00 37.18  ? 520 HOH A O     1 
HETATM 2196 H H1    . HOH E 3 .   ? 56.888 5.412   8.114  1.00 0.00   ? 520 HOH A H1    1 
HETATM 2197 H H2    . HOH E 3 .   ? 56.033 4.707   7.082  1.00 0.00   ? 520 HOH A H2    1 
HETATM 2198 O O     . HOH E 3 .   ? 46.627 9.383   5.617  1.00 31.72  ? 521 HOH A O     1 
HETATM 2199 H H1    . HOH E 3 .   ? 46.284 8.601   6.049  1.00 0.00   ? 521 HOH A H1    1 
HETATM 2200 H H2    . HOH E 3 .   ? 47.284 9.051   5.006  1.00 0.00   ? 521 HOH A H2    1 
HETATM 2201 O O     . HOH E 3 .   ? 40.397 13.205  7.942  1.00 28.16  ? 522 HOH A O     1 
HETATM 2202 H H1    . HOH E 3 .   ? 40.321 14.147  7.793  1.00 0.00   ? 522 HOH A H1    1 
HETATM 2203 H H2    . HOH E 3 .   ? 39.582 12.965  8.383  1.00 0.00   ? 522 HOH A H2    1 
HETATM 2204 O O     . HOH E 3 .   ? 39.984 14.432  5.362  1.00 35.07  ? 523 HOH A O     1 
HETATM 2205 H H1    . HOH E 3 .   ? 40.810 13.956  5.271  1.00 0.00   ? 523 HOH A H1    1 
HETATM 2206 H H2    . HOH E 3 .   ? 40.077 15.187  4.782  1.00 0.00   ? 523 HOH A H2    1 
HETATM 2207 O O     . HOH E 3 .   ? 39.428 6.893   4.342  1.00 24.10  ? 524 HOH A O     1 
HETATM 2208 H H1    . HOH E 3 .   ? 40.315 6.815   4.692  1.00 0.00   ? 524 HOH A H1    1 
HETATM 2209 H H2    . HOH E 3 .   ? 38.898 6.328   4.904  1.00 0.00   ? 524 HOH A H2    1 
HETATM 2210 O O     . HOH E 3 .   ? 33.530 11.868  1.414  1.00 64.95  ? 525 HOH A O     1 
HETATM 2211 H H1    . HOH E 3 .   ? 34.120 11.383  0.836  1.00 0.00   ? 525 HOH A H1    1 
HETATM 2212 H H2    . HOH E 3 .   ? 34.103 12.463  1.897  1.00 0.00   ? 525 HOH A H2    1 
HETATM 2213 O O     . HOH E 3 .   ? 55.293 19.816  12.059 1.00 30.87  ? 526 HOH A O     1 
HETATM 2214 H H1    . HOH E 3 .   ? 55.509 20.719  12.292 1.00 0.00   ? 526 HOH A H1    1 
HETATM 2215 H H2    . HOH E 3 .   ? 56.005 19.295  12.431 1.00 0.00   ? 526 HOH A H2    1 
HETATM 2216 O O     . HOH E 3 .   ? 31.922 15.474  12.530 1.00 73.89  ? 527 HOH A O     1 
HETATM 2217 H H1    . HOH E 3 .   ? 32.485 15.740  13.257 1.00 0.00   ? 527 HOH A H1    1 
HETATM 2218 H H2    . HOH E 3 .   ? 32.500 14.985  11.944 1.00 0.00   ? 527 HOH A H2    1 
HETATM 2219 O O     . HOH E 3 .   ? 32.295 21.298  13.101 1.00 41.29  ? 528 HOH A O     1 
HETATM 2220 H H1    . HOH E 3 .   ? 31.766 20.512  13.242 1.00 0.00   ? 528 HOH A H1    1 
HETATM 2221 H H2    . HOH E 3 .   ? 31.831 21.780  12.416 1.00 0.00   ? 528 HOH A H2    1 
HETATM 2222 O O     . HOH E 3 .   ? 49.248 28.968  27.677 1.00 38.11  ? 529 HOH A O     1 
HETATM 2223 H H1    . HOH E 3 .   ? 48.869 28.271  28.213 1.00 0.00   ? 529 HOH A H1    1 
HETATM 2224 H H2    . HOH E 3 .   ? 48.494 29.389  27.264 1.00 0.00   ? 529 HOH A H2    1 
HETATM 2225 O O     . HOH E 3 .   ? 60.862 19.057  23.802 1.00 36.04  ? 541 HOH A O     1 
HETATM 2226 H H1    . HOH E 3 .   ? 60.961 20.005  23.711 1.00 0.00   ? 541 HOH A H1    1 
HETATM 2227 H H2    . HOH E 3 .   ? 59.958 18.884  23.539 1.00 0.00   ? 541 HOH A H2    1 
HETATM 2228 O O     . HOH E 3 .   ? 47.941 26.410  11.695 1.00 43.45  ? 542 HOH A O     1 
HETATM 2229 H H1    . HOH E 3 .   ? 47.205 25.802  11.622 1.00 0.00   ? 542 HOH A H1    1 
HETATM 2230 H H2    . HOH E 3 .   ? 48.660 25.972  11.240 1.00 0.00   ? 542 HOH A H2    1 
HETATM 2231 O O     . HOH E 3 .   ? 51.175 18.508  32.501 1.00 28.20  ? 543 HOH A O     1 
HETATM 2232 H H1    . HOH E 3 .   ? 50.395 17.988  32.693 1.00 0.00   ? 543 HOH A H1    1 
HETATM 2233 H H2    . HOH E 3 .   ? 51.161 19.211  33.151 1.00 0.00   ? 543 HOH A H2    1 
HETATM 2234 O O     . HOH E 3 .   ? 49.317 27.174  29.728 1.00 42.21  ? 544 HOH A O     1 
HETATM 2235 H H1    . HOH E 3 .   ? 49.279 27.861  29.063 1.00 0.00   ? 544 HOH A H1    1 
HETATM 2236 H H2    . HOH E 3 .   ? 50.245 27.111  29.955 1.00 0.00   ? 544 HOH A H2    1 
HETATM 2237 O O     . HOH E 3 .   ? 41.704 10.614  29.680 1.00 60.20  ? 545 HOH A O     1 
HETATM 2238 H H1    . HOH E 3 .   ? 42.038 11.482  29.452 1.00 0.00   ? 545 HOH A H1    1 
HETATM 2239 H H2    . HOH E 3 .   ? 40.752 10.713  29.672 1.00 0.00   ? 545 HOH A H2    1 
HETATM 2240 O O     . HOH E 3 .   ? 41.854 17.084  34.324 1.00 38.15  ? 547 HOH A O     1 
HETATM 2241 H H1    . HOH E 3 .   ? 42.553 17.168  33.676 1.00 0.00   ? 547 HOH A H1    1 
HETATM 2242 H H2    . HOH E 3 .   ? 41.330 17.877  34.215 1.00 0.00   ? 547 HOH A H2    1 
HETATM 2243 O O     . HOH E 3 .   ? 45.969 18.775  36.130 1.00 42.40  ? 548 HOH A O     1 
HETATM 2244 H H1    . HOH E 3 .   ? 45.482 18.394  35.399 1.00 0.00   ? 548 HOH A H1    1 
HETATM 2245 H H2    . HOH E 3 .   ? 46.430 19.522  35.748 1.00 0.00   ? 548 HOH A H2    1 
HETATM 2246 O O     . HOH E 3 .   ? 36.509 14.542  29.294 1.00 61.05  ? 549 HOH A O     1 
HETATM 2247 H H1    . HOH E 3 .   ? 36.614 14.415  28.351 1.00 0.00   ? 549 HOH A H1    1 
HETATM 2248 H H2    . HOH E 3 .   ? 37.400 14.505  29.642 1.00 0.00   ? 549 HOH A H2    1 
HETATM 2249 O O     . HOH E 3 .   ? 39.182 12.306  27.288 1.00 49.79  ? 550 HOH A O     1 
HETATM 2250 H H1    . HOH E 3 .   ? 39.240 13.237  27.071 1.00 0.00   ? 550 HOH A H1    1 
HETATM 2251 H H2    . HOH E 3 .   ? 39.804 12.187  28.006 1.00 0.00   ? 550 HOH A H2    1 
HETATM 2252 O O     . HOH E 3 .   ? 35.451 11.750  16.663 1.00 70.97  ? 551 HOH A O     1 
HETATM 2253 H H1    . HOH E 3 .   ? 35.198 11.381  17.509 1.00 0.00   ? 551 HOH A H1    1 
HETATM 2254 H H2    . HOH E 3 .   ? 34.957 11.239  16.021 1.00 0.00   ? 551 HOH A H2    1 
HETATM 2255 O O     . HOH E 3 .   ? 56.475 34.143  17.719 1.00 59.14  ? 553 HOH A O     1 
HETATM 2256 H H1    . HOH E 3 .   ? 57.155 34.473  17.132 1.00 0.00   ? 553 HOH A H1    1 
HETATM 2257 H H2    . HOH E 3 .   ? 56.582 33.192  17.700 1.00 0.00   ? 553 HOH A H2    1 
HETATM 2258 O O     . HOH E 3 .   ? 59.829 22.521  14.923 1.00 73.66  ? 554 HOH A O     1 
HETATM 2259 H H1    . HOH E 3 .   ? 59.743 23.461  14.765 1.00 0.00   ? 554 HOH A H1    1 
HETATM 2260 H H2    . HOH E 3 .   ? 59.642 22.117  14.076 1.00 0.00   ? 554 HOH A H2    1 
HETATM 2261 O O     . HOH E 3 .   ? 56.361 13.026  20.548 1.00 36.51  ? 555 HOH A O     1 
HETATM 2262 H H1    . HOH E 3 .   ? 55.566 12.678  20.145 1.00 0.00   ? 555 HOH A H1    1 
HETATM 2263 H H2    . HOH E 3 .   ? 56.061 13.428  21.363 1.00 0.00   ? 555 HOH A H2    1 
HETATM 2264 O O     . HOH E 3 .   ? 52.972 30.725  21.653 1.00 42.49  ? 561 HOH A O     1 
HETATM 2265 H H1    . HOH E 3 .   ? 53.195 30.019  21.046 1.00 0.00   ? 561 HOH A H1    1 
HETATM 2266 H H2    . HOH E 3 .   ? 53.606 31.416  21.461 1.00 0.00   ? 561 HOH A H2    1 
HETATM 2267 O O     . HOH E 3 .   ? 50.974 31.151  23.811 1.00 55.93  ? 562 HOH A O     1 
HETATM 2268 H H1    . HOH E 3 .   ? 51.897 31.397  23.865 1.00 0.00   ? 562 HOH A H1    1 
HETATM 2269 H H2    . HOH E 3 .   ? 50.958 30.413  23.202 1.00 0.00   ? 562 HOH A H2    1 
HETATM 2270 O O     . HOH E 3 .   ? 57.855 18.767  14.295 1.00 53.52  ? 563 HOH A O     1 
HETATM 2271 H H1    . HOH E 3 .   ? 58.078 18.077  14.919 1.00 0.00   ? 563 HOH A H1    1 
HETATM 2272 H H2    . HOH E 3 .   ? 58.662 18.916  13.803 1.00 0.00   ? 563 HOH A H2    1 
HETATM 2273 O O     . HOH E 3 .   ? 46.379 31.728  22.001 1.00 45.22  ? 564 HOH A O     1 
HETATM 2274 H H1    . HOH E 3 .   ? 46.203 30.806  22.188 1.00 0.00   ? 564 HOH A H1    1 
HETATM 2275 H H2    . HOH E 3 .   ? 46.584 31.748  21.066 1.00 0.00   ? 564 HOH A H2    1 
HETATM 2276 O O     . HOH E 3 .   ? 41.896 31.094  18.177 1.00 44.49  ? 565 HOH A O     1 
HETATM 2277 H H1    . HOH E 3 .   ? 41.905 30.409  18.846 1.00 0.00   ? 565 HOH A H1    1 
HETATM 2278 H H2    . HOH E 3 .   ? 41.375 30.726  17.463 1.00 0.00   ? 565 HOH A H2    1 
HETATM 2279 O O     . HOH E 3 .   ? 42.796 31.730  22.311 1.00 55.73  ? 566 HOH A O     1 
HETATM 2280 H H1    . HOH E 3 .   ? 42.630 32.672  22.273 1.00 0.00   ? 566 HOH A H1    1 
HETATM 2281 H H2    . HOH E 3 .   ? 43.577 31.646  22.859 1.00 0.00   ? 566 HOH A H2    1 
HETATM 2282 O O     . HOH E 3 .   ? 57.817 17.335  30.707 1.00 69.58  ? 568 HOH A O     1 
HETATM 2283 H H1    . HOH E 3 .   ? 58.553 17.490  31.299 1.00 0.00   ? 568 HOH A H1    1 
HETATM 2284 H H2    . HOH E 3 .   ? 58.212 16.938  29.931 1.00 0.00   ? 568 HOH A H2    1 
HETATM 2285 O O     . HOH E 3 .   ? 50.428 18.260  35.095 1.00 46.22  ? 569 HOH A O     1 
HETATM 2286 H H1    . HOH E 3 .   ? 50.435 18.123  36.042 1.00 0.00   ? 569 HOH A H1    1 
HETATM 2287 H H2    . HOH E 3 .   ? 49.936 17.516  34.749 1.00 0.00   ? 569 HOH A H2    1 
HETATM 2288 O O     . HOH E 3 .   ? 48.066 14.979  40.404 1.00 73.48  ? 570 HOH A O     1 
HETATM 2289 H H1    . HOH E 3 .   ? 48.213 14.119  40.797 1.00 0.00   ? 570 HOH A H1    1 
HETATM 2290 H H2    . HOH E 3 .   ? 48.317 15.601  41.087 1.00 0.00   ? 570 HOH A H2    1 
HETATM 2291 O O     . HOH E 3 .   ? 39.984 27.891  29.236 1.00 65.75  ? 571 HOH A O     1 
HETATM 2292 H H1    . HOH E 3 .   ? 40.374 27.170  29.730 1.00 0.00   ? 571 HOH A H1    1 
HETATM 2293 H H2    . HOH E 3 .   ? 39.777 27.512  28.381 1.00 0.00   ? 571 HOH A H2    1 
HETATM 2294 O O     . HOH E 3 .   ? 35.163 23.116  27.682 1.00 66.33  ? 572 HOH A O     1 
HETATM 2295 H H1    . HOH E 3 .   ? 35.395 23.117  26.753 1.00 0.00   ? 572 HOH A H1    1 
HETATM 2296 H H2    . HOH E 3 .   ? 34.208 23.184  27.691 1.00 0.00   ? 572 HOH A H2    1 
HETATM 2297 O O     . HOH E 3 .   ? 29.275 20.119  31.639 1.00 68.51  ? 573 HOH A O     1 
HETATM 2298 H H1    . HOH E 3 .   ? 29.605 20.521  32.443 1.00 0.00   ? 573 HOH A H1    1 
HETATM 2299 H H2    . HOH E 3 .   ? 28.365 20.409  31.582 1.00 0.00   ? 573 HOH A H2    1 
HETATM 2300 O O     . HOH E 3 .   ? 37.868 11.825  31.008 1.00 47.03  ? 576 HOH A O     1 
HETATM 2301 H H1    . HOH E 3 .   ? 37.623 11.073  31.548 1.00 0.00   ? 576 HOH A H1    1 
HETATM 2302 H H2    . HOH E 3 .   ? 38.605 12.224  31.471 1.00 0.00   ? 576 HOH A H2    1 
HETATM 2303 O O     . HOH E 3 .   ? 55.180 6.156   5.126  1.00 50.55  ? 578 HOH A O     1 
HETATM 2304 H H1    . HOH E 3 .   ? 54.458 6.489   4.594  1.00 0.00   ? 578 HOH A H1    1 
HETATM 2305 H H2    . HOH E 3 .   ? 55.732 6.921   5.288  1.00 0.00   ? 578 HOH A H2    1 
HETATM 2306 O O     . HOH E 3 .   ? 50.261 7.646   3.879  1.00 32.58  ? 579 HOH A O     1 
HETATM 2307 H H1    . HOH E 3 .   ? 50.807 6.869   3.997  1.00 0.00   ? 579 HOH A H1    1 
HETATM 2308 H H2    . HOH E 3 .   ? 49.364 7.312   3.891  1.00 0.00   ? 579 HOH A H2    1 
HETATM 2309 O O     . HOH E 3 .   ? 53.445 5.742   15.746 1.00 71.91  ? 580 HOH A O     1 
HETATM 2310 H H1    . HOH E 3 .   ? 53.633 5.659   16.681 1.00 0.00   ? 580 HOH A H1    1 
HETATM 2311 H H2    . HOH E 3 .   ? 52.743 5.112   15.585 1.00 0.00   ? 580 HOH A H2    1 
HETATM 2312 O O     . HOH E 3 .   ? 47.110 13.442  1.822  1.00 52.14  ? 581 HOH A O     1 
HETATM 2313 H H1    . HOH E 3 .   ? 46.491 12.847  1.400  1.00 0.00   ? 581 HOH A H1    1 
HETATM 2314 H H2    . HOH E 3 .   ? 46.665 13.725  2.621  1.00 0.00   ? 581 HOH A H2    1 
HETATM 2315 O O     . HOH E 3 .   ? 36.380 18.056  3.072  1.00 50.66  ? 582 HOH A O     1 
HETATM 2316 H H1    . HOH E 3 .   ? 35.835 17.892  3.841  1.00 0.00   ? 582 HOH A H1    1 
HETATM 2317 H H2    . HOH E 3 .   ? 35.829 18.587  2.497  1.00 0.00   ? 582 HOH A H2    1 
HETATM 2318 O O     . HOH E 3 .   ? 47.608 20.938  3.517  1.00 57.72  ? 583 HOH A O     1 
HETATM 2319 H H1    . HOH E 3 .   ? 47.644 21.441  2.704  1.00 0.00   ? 583 HOH A H1    1 
HETATM 2320 H H2    . HOH E 3 .   ? 47.764 20.033  3.246  1.00 0.00   ? 583 HOH A H2    1 
HETATM 2321 O O     . HOH E 3 .   ? 50.455 27.643  12.856 1.00 53.19  ? 597 HOH A O     1 
HETATM 2322 H H1    . HOH E 3 .   ? 50.300 27.154  12.048 1.00 0.00   ? 597 HOH A H1    1 
HETATM 2323 H H2    . HOH E 3 .   ? 51.356 27.428  13.097 1.00 0.00   ? 597 HOH A H2    1 
HETATM 2324 O O     . HOH E 3 .   ? 40.133 32.016  23.424 1.00 48.06  ? 598 HOH A O     1 
HETATM 2325 H H1    . HOH E 3 .   ? 40.209 31.651  24.306 1.00 0.00   ? 598 HOH A H1    1 
HETATM 2326 H H2    . HOH E 3 .   ? 40.690 31.455  22.883 1.00 0.00   ? 598 HOH A H2    1 
HETATM 2327 O O     . HOH E 3 .   ? 54.841 13.784  27.948 1.00 47.54  ? 599 HOH A O     1 
HETATM 2328 H H1    . HOH E 3 .   ? 54.315 14.058  28.699 1.00 0.00   ? 599 HOH A H1    1 
HETATM 2329 H H2    . HOH E 3 .   ? 54.875 12.830  28.013 1.00 0.00   ? 599 HOH A H2    1 
HETATM 2330 O O     . HOH E 3 .   ? 40.652 30.662  29.759 1.00 55.26  ? 601 HOH A O     1 
HETATM 2331 H H1    . HOH E 3 .   ? 39.823 31.086  29.983 1.00 0.00   ? 601 HOH A H1    1 
HETATM 2332 H H2    . HOH E 3 .   ? 40.890 30.171  30.545 1.00 0.00   ? 601 HOH A H2    1 
HETATM 2333 O O     . HOH E 3 .   ? 55.132 4.007   22.248 1.00 76.05  ? 602 HOH A O     1 
HETATM 2334 H H1    . HOH E 3 .   ? 54.421 4.177   22.866 1.00 0.00   ? 602 HOH A H1    1 
HETATM 2335 H H2    . HOH E 3 .   ? 55.419 3.117   22.451 1.00 0.00   ? 602 HOH A H2    1 
HETATM 2336 O O     . HOH E 3 .   ? 33.997 7.809   13.161 1.00 42.42  ? 604 HOH A O     1 
HETATM 2337 H H1    . HOH E 3 .   ? 33.722 6.946   13.471 1.00 0.00   ? 604 HOH A H1    1 
HETATM 2338 H H2    . HOH E 3 .   ? 34.316 8.255   13.945 1.00 0.00   ? 604 HOH A H2    1 
HETATM 2339 O O     . HOH E 3 .   ? 52.409 6.094   4.258  1.00 48.27  ? 605 HOH A O     1 
HETATM 2340 H H1    . HOH E 3 .   ? 52.660 5.189   4.443  1.00 0.00   ? 605 HOH A H1    1 
HETATM 2341 H H2    . HOH E 3 .   ? 53.211 6.598   4.395  1.00 0.00   ? 605 HOH A H2    1 
HETATM 2342 O O     . HOH E 3 .   ? 54.023 5.991   10.768 1.00 35.49  ? 606 HOH A O     1 
HETATM 2343 H H1    . HOH E 3 .   ? 53.985 5.069   10.513 1.00 0.00   ? 606 HOH A H1    1 
HETATM 2344 H H2    . HOH E 3 .   ? 53.107 6.246   10.881 1.00 0.00   ? 606 HOH A H2    1 
HETATM 2345 O O     . HOH E 3 .   ? 38.296 9.756   -3.155 1.00 53.01  ? 607 HOH A O     1 
HETATM 2346 H H1    . HOH E 3 .   ? 38.296 10.713  -3.155 1.00 0.00   ? 607 HOH A H1    1 
HETATM 2347 H H2    . HOH E 3 .   ? 38.296 9.516   -4.082 1.00 0.00   ? 607 HOH A H2    1 
HETATM 2348 O O     . HOH E 3 .   ? 47.285 10.500  3.203  1.00 30.98  ? 608 HOH A O     1 
HETATM 2349 H H1    . HOH E 3 .   ? 46.419 10.158  3.425  1.00 0.00   ? 608 HOH A H1    1 
HETATM 2350 H H2    . HOH E 3 .   ? 47.426 11.216  3.822  1.00 0.00   ? 608 HOH A H2    1 
HETATM 2351 O O     . HOH E 3 .   ? 53.399 13.859  3.677  1.00 57.20  ? 609 HOH A O     1 
HETATM 2352 H H1    . HOH E 3 .   ? 52.796 13.925  2.937  1.00 0.00   ? 609 HOH A H1    1 
HETATM 2353 H H2    . HOH E 3 .   ? 53.267 12.974  4.016  1.00 0.00   ? 609 HOH A H2    1 
HETATM 2354 O O     . HOH E 3 .   ? 33.535 15.338  9.564  1.00 44.86  ? 610 HOH A O     1 
HETATM 2355 H H1    . HOH E 3 .   ? 33.921 15.476  8.699  1.00 0.00   ? 610 HOH A H1    1 
HETATM 2356 H H2    . HOH E 3 .   ? 34.253 15.501  10.176 1.00 0.00   ? 610 HOH A H2    1 
HETATM 2357 O O     . HOH E 3 .   ? 58.167 12.192  15.369 1.00 79.68  ? 613 HOH A O     1 
HETATM 2358 H H1    . HOH E 3 .   ? 57.613 12.712  15.951 1.00 0.00   ? 613 HOH A H1    1 
HETATM 2359 H H2    . HOH E 3 .   ? 57.828 11.300  15.448 1.00 0.00   ? 613 HOH A H2    1 
HETATM 2360 O O     . HOH E 3 .   ? 52.752 25.054  7.485  1.00 55.07  ? 614 HOH A O     1 
HETATM 2361 H H1    . HOH E 3 .   ? 52.711 25.413  6.599  1.00 0.00   ? 614 HOH A H1    1 
HETATM 2362 H H2    . HOH E 3 .   ? 52.796 24.106  7.358  1.00 0.00   ? 614 HOH A H2    1 
HETATM 2363 O O     . HOH E 3 .   ? 33.775 9.950   11.270 1.00 72.04  ? 615 HOH A O     1 
HETATM 2364 H H1    . HOH E 3 .   ? 34.320 10.605  11.707 1.00 0.00   ? 615 HOH A H1    1 
HETATM 2365 H H2    . HOH E 3 .   ? 33.235 9.581   11.969 1.00 0.00   ? 615 HOH A H2    1 
HETATM 2366 O O     . HOH E 3 .   ? 58.459 22.493  10.979 1.00 56.87  ? 624 HOH A O     1 
HETATM 2367 H H1    . HOH E 3 .   ? 57.512 22.526  11.116 1.00 0.00   ? 624 HOH A H1    1 
HETATM 2368 H H2    . HOH E 3 .   ? 58.813 23.138  11.591 1.00 0.00   ? 624 HOH A H2    1 
HETATM 2369 O O     . HOH E 3 .   ? 55.379 24.334  9.347  1.00 55.10  ? 625 HOH A O     1 
HETATM 2370 H H1    . HOH E 3 .   ? 54.849 23.858  8.708  1.00 0.00   ? 625 HOH A H1    1 
HETATM 2371 H H2    . HOH E 3 .   ? 55.128 23.961  10.192 1.00 0.00   ? 625 HOH A H2    1 
HETATM 2372 O O     . HOH E 3 .   ? 35.147 12.382  24.883 1.00 49.21  ? 626 HOH A O     1 
HETATM 2373 H H1    . HOH E 3 .   ? 36.093 12.500  24.967 1.00 0.00   ? 626 HOH A H1    1 
HETATM 2374 H H2    . HOH E 3 .   ? 34.793 13.271  24.890 1.00 0.00   ? 626 HOH A H2    1 
HETATM 2375 O O     . HOH E 3 .   ? 41.604 27.330  14.163 1.00 73.97  ? 627 HOH A O     1 
HETATM 2376 H H1    . HOH E 3 .   ? 41.063 27.612  14.901 1.00 0.00   ? 627 HOH A H1    1 
HETATM 2377 H H2    . HOH E 3 .   ? 41.344 26.422  14.008 1.00 0.00   ? 627 HOH A H2    1 
HETATM 2378 O O     . HOH E 3 .   ? 41.534 10.392  0.168  1.00 73.53  ? 628 HOH A O     1 
HETATM 2379 H H1    . HOH E 3 .   ? 41.570 11.346  0.235  1.00 0.00   ? 628 HOH A H1    1 
HETATM 2380 H H2    . HOH E 3 .   ? 41.034 10.226  -0.631 1.00 0.00   ? 628 HOH A H2    1 
HETATM 2381 O O     . HOH E 3 .   ? 32.814 20.188  9.173  1.00 59.31  ? 629 HOH A O     1 
HETATM 2382 H H1    . HOH E 3 .   ? 33.225 20.912  8.701  1.00 0.00   ? 629 HOH A H1    1 
HETATM 2383 H H2    . HOH E 3 .   ? 31.876 20.374  9.128  1.00 0.00   ? 629 HOH A H2    1 
HETATM 2384 O O     . HOH E 3 .   ? 58.425 15.096  14.874 1.00 80.44  ? 636 HOH A O     1 
HETATM 2385 H H1    . HOH E 3 .   ? 58.534 16.032  15.044 1.00 0.00   ? 636 HOH A H1    1 
HETATM 2386 H H2    . HOH E 3 .   ? 58.952 14.932  14.092 1.00 0.00   ? 636 HOH A H2    1 
HETATM 2387 O O     . HOH E 3 .   ? 55.965 10.725  22.729 1.00 57.53  ? 637 HOH A O     1 
HETATM 2388 H H1    . HOH E 3 .   ? 55.440 11.179  23.388 1.00 0.00   ? 637 HOH A H1    1 
HETATM 2389 H H2    . HOH E 3 .   ? 55.391 10.033  22.400 1.00 0.00   ? 637 HOH A H2    1 
HETATM 2390 O O     . HOH E 3 .   ? 58.815 13.550  19.043 1.00 67.00  ? 638 HOH A O     1 
HETATM 2391 H H1    . HOH E 3 .   ? 59.527 13.249  19.608 1.00 0.00   ? 638 HOH A H1    1 
HETATM 2392 H H2    . HOH E 3 .   ? 58.360 12.749  18.782 1.00 0.00   ? 638 HOH A H2    1 
HETATM 2393 O O     . HOH E 3 .   ? 50.600 19.475  3.968  1.00 41.91  ? 639 HOH A O     1 
HETATM 2394 H H1    . HOH E 3 .   ? 51.108 19.717  4.742  1.00 0.00   ? 639 HOH A H1    1 
HETATM 2395 H H2    . HOH E 3 .   ? 50.766 20.180  3.342  1.00 0.00   ? 639 HOH A H2    1 
HETATM 2396 O O     . HOH E 3 .   ? 46.674 23.176  5.347  1.00 45.34  ? 640 HOH A O     1 
HETATM 2397 H H1    . HOH E 3 .   ? 47.033 22.544  5.970  1.00 0.00   ? 640 HOH A H1    1 
HETATM 2398 H H2    . HOH E 3 .   ? 47.262 23.131  4.593  1.00 0.00   ? 640 HOH A H2    1 
HETATM 2399 O O     . HOH E 3 .   ? 43.749 24.486  4.883  1.00 58.54  ? 641 HOH A O     1 
HETATM 2400 H H1    . HOH E 3 .   ? 43.758 24.250  3.955  1.00 0.00   ? 641 HOH A H1    1 
HETATM 2401 H H2    . HOH E 3 .   ? 43.143 23.863  5.283  1.00 0.00   ? 641 HOH A H2    1 
HETATM 2402 O O     . HOH E 3 .   ? 33.805 17.409  7.443  1.00 49.47  ? 642 HOH A O     1 
HETATM 2403 H H1    . HOH E 3 .   ? 34.446 17.411  8.154  1.00 0.00   ? 642 HOH A H1    1 
HETATM 2404 H H2    . HOH E 3 .   ? 34.316 17.207  6.659  1.00 0.00   ? 642 HOH A H2    1 
HETATM 2405 O O     . HOH E 3 .   ? 32.025 13.000  9.896  1.00 56.31  ? 643 HOH A O     1 
HETATM 2406 H H1    . HOH E 3 .   ? 31.881 13.879  10.247 1.00 0.00   ? 643 HOH A H1    1 
HETATM 2407 H H2    . HOH E 3 .   ? 32.758 12.655  10.406 1.00 0.00   ? 643 HOH A H2    1 
HETATM 2408 O O     . HOH E 3 .   ? 42.680 27.048  29.407 1.00 53.36  ? 644 HOH A O     1 
HETATM 2409 H H1    . HOH E 3 .   ? 43.306 27.334  28.741 1.00 0.00   ? 644 HOH A H1    1 
HETATM 2410 H H2    . HOH E 3 .   ? 42.772 27.688  30.113 1.00 0.00   ? 644 HOH A H2    1 
HETATM 2411 O O     . HOH E 3 .   ? 38.076 30.203  24.478 1.00 65.54  ? 645 HOH A O     1 
HETATM 2412 H H1    . HOH E 3 .   ? 38.069 30.907  23.830 1.00 0.00   ? 645 HOH A H1    1 
HETATM 2413 H H2    . HOH E 3 .   ? 37.189 30.201  24.839 1.00 0.00   ? 645 HOH A H2    1 
HETATM 2414 O O     . HOH E 3 .   ? 53.504 34.265  19.988 1.00 76.16  ? 652 HOH A O     1 
HETATM 2415 H H1    . HOH E 3 .   ? 53.962 35.081  20.188 1.00 0.00   ? 652 HOH A H1    1 
HETATM 2416 H H2    . HOH E 3 .   ? 52.590 34.525  19.872 1.00 0.00   ? 652 HOH A H2    1 
HETATM 2417 O O     . HOH E 3 .   ? 55.672 32.619  20.094 1.00 34.43  ? 653 HOH A O     1 
HETATM 2418 H H1    . HOH E 3 .   ? 55.099 32.998  20.761 1.00 0.00   ? 653 HOH A H1    1 
HETATM 2419 H H2    . HOH E 3 .   ? 55.326 31.738  19.953 1.00 0.00   ? 653 HOH A H2    1 
HETATM 2420 O O     . HOH E 3 .   ? 54.765 31.304  16.546 1.00 40.63  ? 654 HOH A O     1 
HETATM 2421 H H1    . HOH E 3 .   ? 54.655 31.526  15.621 1.00 0.00   ? 654 HOH A H1    1 
HETATM 2422 H H2    . HOH E 3 .   ? 54.350 30.447  16.638 1.00 0.00   ? 654 HOH A H2    1 
HETATM 2423 O O     . HOH E 3 .   ? 49.843 23.654  31.609 1.00 52.16  ? 655 HOH A O     1 
HETATM 2424 H H1    . HOH E 3 .   ? 50.055 24.403  31.053 1.00 0.00   ? 655 HOH A H1    1 
HETATM 2425 H H2    . HOH E 3 .   ? 50.647 23.136  31.631 1.00 0.00   ? 655 HOH A H2    1 
HETATM 2426 O O     . HOH E 3 .   ? 32.773 22.529  23.924 1.00 52.36  ? 656 HOH A O     1 
HETATM 2427 H H1    . HOH E 3 .   ? 32.517 21.646  24.192 1.00 0.00   ? 656 HOH A H1    1 
HETATM 2428 H H2    . HOH E 3 .   ? 31.994 23.063  24.081 1.00 0.00   ? 656 HOH A H2    1 
HETATM 2429 O O     . HOH E 3 .   ? 48.402 5.624   22.878 1.00 70.55  ? 657 HOH A O     1 
HETATM 2430 H H1    . HOH E 3 .   ? 48.038 5.177   22.114 1.00 0.00   ? 657 HOH A H1    1 
HETATM 2431 H H2    . HOH E 3 .   ? 49.274 5.904   22.599 1.00 0.00   ? 657 HOH A H2    1 
HETATM 2432 O O     . HOH E 3 .   ? 61.024 15.325  10.096 1.00 55.65  ? 659 HOH A O     1 
HETATM 2433 H H1    . HOH E 3 .   ? 60.252 15.582  10.600 1.00 0.00   ? 659 HOH A H1    1 
HETATM 2434 H H2    . HOH E 3 .   ? 61.765 15.567  10.651 1.00 0.00   ? 659 HOH A H2    1 
HETATM 2435 O O     . HOH E 3 .   ? 58.152 16.734  9.672  1.00 52.24  ? 660 HOH A O     1 
HETATM 2436 H H1    . HOH E 3 .   ? 57.632 16.004  9.335  1.00 0.00   ? 660 HOH A H1    1 
HETATM 2437 H H2    . HOH E 3 .   ? 58.807 16.322  10.236 1.00 0.00   ? 660 HOH A H2    1 
HETATM 2438 O O     . HOH E 3 .   ? 48.215 17.763  2.289  1.00 106.03 ? 661 HOH A O     1 
HETATM 2439 H H1    . HOH E 3 .   ? 47.893 17.096  2.896  1.00 0.00   ? 661 HOH A H1    1 
HETATM 2440 H H2    . HOH E 3 .   ? 47.423 18.170  1.938  1.00 0.00   ? 661 HOH A H2    1 
HETATM 2441 O O     . HOH E 3 .   ? 51.327 15.536  2.231  1.00 58.29  ? 662 HOH A O     1 
HETATM 2442 H H1    . HOH E 3 .   ? 51.662 15.279  1.372  1.00 0.00   ? 662 HOH A H1    1 
HETATM 2443 H H2    . HOH E 3 .   ? 50.398 15.305  2.205  1.00 0.00   ? 662 HOH A H2    1 
HETATM 2444 O O     . HOH E 3 .   ? 54.396 9.838   3.001  1.00 73.38  ? 663 HOH A O     1 
HETATM 2445 H H1    . HOH E 3 .   ? 55.323 9.756   3.224  1.00 0.00   ? 663 HOH A H1    1 
HETATM 2446 H H2    . HOH E 3 .   ? 54.222 9.095   2.424  1.00 0.00   ? 663 HOH A H2    1 
HETATM 2447 O O     . HOH E 3 .   ? 59.945 26.567  11.310 1.00 61.71  ? 664 HOH A O     1 
HETATM 2448 H H1    . HOH E 3 .   ? 59.641 27.474  11.339 1.00 0.00   ? 664 HOH A H1    1 
HETATM 2449 H H2    . HOH E 3 .   ? 59.740 26.218  12.177 1.00 0.00   ? 664 HOH A H2    1 
HETATM 2450 O O     . HOH E 3 .   ? 57.939 27.548  8.126  1.00 52.07  ? 665 HOH A O     1 
HETATM 2451 H H1    . HOH E 3 .   ? 57.320 27.918  7.497  1.00 0.00   ? 665 HOH A H1    1 
HETATM 2452 H H2    . HOH E 3 .   ? 57.432 27.448  8.931  1.00 0.00   ? 665 HOH A H2    1 
HETATM 2453 O O     . HOH E 3 .   ? 55.308 22.764  5.550  1.00 64.62  ? 666 HOH A O     1 
HETATM 2454 H H1    . HOH E 3 .   ? 54.463 22.386  5.305  1.00 0.00   ? 666 HOH A H1    1 
HETATM 2455 H H2    . HOH E 3 .   ? 55.754 22.915  4.717  1.00 0.00   ? 666 HOH A H2    1 
HETATM 2456 O O     . HOH E 3 .   ? 57.154 19.767  9.986  1.00 77.22  ? 667 HOH A O     1 
HETATM 2457 H H1    . HOH E 3 .   ? 58.018 19.615  10.369 1.00 0.00   ? 667 HOH A H1    1 
HETATM 2458 H H2    . HOH E 3 .   ? 56.756 20.431  10.549 1.00 0.00   ? 667 HOH A H2    1 
HETATM 2459 O O     . HOH E 3 .   ? 45.372 28.483  14.163 1.00 74.83  ? 668 HOH A O     1 
HETATM 2460 H H1    . HOH E 3 .   ? 44.645 27.892  14.359 1.00 0.00   ? 668 HOH A H1    1 
HETATM 2461 H H2    . HOH E 3 .   ? 45.572 28.904  14.999 1.00 0.00   ? 668 HOH A H2    1 
HETATM 2462 O O     . HOH E 3 .   ? 31.231 11.144  22.281 1.00 50.35  ? 670 HOH A O     1 
HETATM 2463 H H1    . HOH E 3 .   ? 31.199 11.872  22.901 1.00 0.00   ? 670 HOH A H1    1 
HETATM 2464 H H2    . HOH E 3 .   ? 30.314 10.908  22.141 1.00 0.00   ? 670 HOH A H2    1 
HETATM 2465 O O     . HOH E 3 .   ? 30.495 15.029  22.846 1.00 53.70  ? 671 HOH A O     1 
HETATM 2466 H H1    . HOH E 3 .   ? 30.987 15.446  22.138 1.00 0.00   ? 671 HOH A H1    1 
HETATM 2467 H H2    . HOH E 3 .   ? 29.594 15.324  22.718 1.00 0.00   ? 671 HOH A H2    1 
HETATM 2468 O O     . HOH E 3 .   ? 45.846 32.972  25.343 1.00 54.86  ? 672 HOH A O     1 
HETATM 2469 H H1    . HOH E 3 .   ? 45.962 33.840  25.730 1.00 0.00   ? 672 HOH A H1    1 
HETATM 2470 H H2    . HOH E 3 .   ? 45.528 33.145  24.457 1.00 0.00   ? 672 HOH A H2    1 
HETATM 2471 O O     . HOH E 3 .   ? 41.041 33.863  25.910 1.00 63.44  ? 673 HOH A O     1 
HETATM 2472 H H1    . HOH E 3 .   ? 40.337 34.081  25.299 1.00 0.00   ? 673 HOH A H1    1 
HETATM 2473 H H2    . HOH E 3 .   ? 41.844 34.095  25.444 1.00 0.00   ? 673 HOH A H2    1 
HETATM 2474 O O     . HOH E 3 .   ? 42.312 32.882  29.358 1.00 54.69  ? 674 HOH A O     1 
HETATM 2475 H H1    . HOH E 3 .   ? 41.856 32.507  30.111 1.00 0.00   ? 674 HOH A H1    1 
HETATM 2476 H H2    . HOH E 3 .   ? 43.232 32.906  29.622 1.00 0.00   ? 674 HOH A H2    1 
HETATM 2477 O O     . HOH E 3 .   ? 31.395 18.467  12.387 1.00 62.45  ? 685 HOH A O     1 
HETATM 2478 H H1    . HOH E 3 .   ? 31.839 18.041  13.120 1.00 0.00   ? 685 HOH A H1    1 
HETATM 2479 H H2    . HOH E 3 .   ? 30.751 19.043  12.798 1.00 0.00   ? 685 HOH A H2    1 
HETATM 2480 O O     . HOH E 3 .   ? 33.778 20.377  5.872  1.00 88.30  ? 686 HOH A O     1 
HETATM 2481 H H1    . HOH E 3 .   ? 33.902 21.306  6.067  1.00 0.00   ? 686 HOH A H1    1 
HETATM 2482 H H2    . HOH E 3 .   ? 32.852 20.301  5.642  1.00 0.00   ? 686 HOH A H2    1 
HETATM 2483 O O     . HOH E 3 .   ? 38.185 19.979  1.974  1.00 74.71  ? 687 HOH A O     1 
HETATM 2484 H H1    . HOH E 3 .   ? 39.131 20.096  2.067  1.00 0.00   ? 687 HOH A H1    1 
HETATM 2485 H H2    . HOH E 3 .   ? 37.919 20.657  1.353  1.00 0.00   ? 687 HOH A H2    1 
HETATM 2486 O O     . HOH E 3 .   ? 44.451 28.134  10.476 1.00 60.22  ? 692 HOH A O     1 
HETATM 2487 H H1    . HOH E 3 .   ? 44.152 27.368  9.985  1.00 0.00   ? 692 HOH A H1    1 
HETATM 2488 H H2    . HOH E 3 .   ? 44.131 27.988  11.366 1.00 0.00   ? 692 HOH A H2    1 
HETATM 2489 O O     . HOH E 3 .   ? 60.598 17.194  29.996 1.00 68.46  ? 693 HOH A O     1 
HETATM 2490 H H1    . HOH E 3 .   ? 61.158 16.820  29.315 1.00 0.00   ? 693 HOH A H1    1 
HETATM 2491 H H2    . HOH E 3 .   ? 59.708 17.087  29.661 1.00 0.00   ? 693 HOH A H2    1 
HETATM 2492 O O     . HOH F 3 .   ? 39.476 10.736  23.296 1.00 25.37  ? 500 HOH C O     1 
HETATM 2493 H H1    . HOH F 3 .   ? 39.999 9.959   23.493 1.00 0.00   ? 500 HOH C H1    1 
HETATM 2494 H H2    . HOH F 3 .   ? 39.977 11.463  23.667 1.00 0.00   ? 500 HOH C H2    1 
HETATM 2495 O O     . HOH F 3 .   ? 43.547 8.527   17.281 1.00 30.31  ? 501 HOH C O     1 
HETATM 2496 H H1    . HOH F 3 .   ? 43.427 9.306   16.738 1.00 0.00   ? 501 HOH C H1    1 
HETATM 2497 H H2    . HOH F 3 .   ? 42.660 8.197   17.426 1.00 0.00   ? 501 HOH C H2    1 
HETATM 2498 O O     . HOH F 3 .   ? 35.083 8.166   15.816 1.00 66.13  ? 603 HOH C O     1 
HETATM 2499 H H1    . HOH F 3 .   ? 35.004 8.350   14.880 1.00 0.00   ? 603 HOH C H1    1 
HETATM 2500 H H2    . HOH F 3 .   ? 35.343 9.002   16.203 1.00 0.00   ? 603 HOH C H2    1 
HETATM 2501 O O     . HOH G 3 .   ? 50.337 2.755   19.985 1.00 32.83  ? 502 HOH B O     1 
HETATM 2502 H H1    . HOH G 3 .   ? 50.653 2.102   20.609 1.00 0.00   ? 502 HOH B H1    1 
HETATM 2503 H H2    . HOH G 3 .   ? 50.503 3.595   20.412 1.00 0.00   ? 502 HOH B H2    1 
HETATM 2504 O O     . HOH G 3 .   ? 51.160 11.304  33.758 1.00 37.32  ? 512 HOH B O     1 
HETATM 2505 H H1    . HOH G 3 .   ? 51.785 10.796  34.276 1.00 0.00   ? 512 HOH B H1    1 
HETATM 2506 H H2    . HOH G 3 .   ? 51.516 11.289  32.870 1.00 0.00   ? 512 HOH B H2    1 
HETATM 2507 O O     . HOH G 3 .   ? 47.289 12.390  32.057 1.00 26.04  ? 513 HOH B O     1 
HETATM 2508 H H1    . HOH G 3 .   ? 47.943 12.276  31.367 1.00 0.00   ? 513 HOH B H1    1 
HETATM 2509 H H2    . HOH G 3 .   ? 47.802 12.490  32.859 1.00 0.00   ? 513 HOH B H2    1 
HETATM 2510 O O     . HOH G 3 .   ? 48.198 16.969  36.510 1.00 30.79  ? 514 HOH B O     1 
HETATM 2511 H H1    . HOH G 3 .   ? 48.065 16.256  37.134 1.00 0.00   ? 514 HOH B H1    1 
HETATM 2512 H H2    . HOH G 3 .   ? 48.176 17.763  37.044 1.00 0.00   ? 514 HOH B H2    1 
HETATM 2513 O O     . HOH G 3 .   ? 40.050 0.462   30.323 1.00 74.00  ? 530 HOH B O     1 
HETATM 2514 H H1    . HOH G 3 .   ? 39.431 1.167   30.513 1.00 0.00   ? 530 HOH B H1    1 
HETATM 2515 H H2    . HOH G 3 .   ? 39.622 -0.329  30.652 1.00 0.00   ? 530 HOH B H2    1 
HETATM 2516 O O     . HOH G 3 .   ? 32.491 -10.805 34.622 1.00 34.73  ? 531 HOH B O     1 
HETATM 2517 H H1    . HOH G 3 .   ? 32.513 -11.053 33.698 1.00 0.00   ? 531 HOH B H1    1 
HETATM 2518 H H2    . HOH G 3 .   ? 32.858 -9.921  34.642 1.00 0.00   ? 531 HOH B H2    1 
HETATM 2519 O O     . HOH G 3 .   ? 27.070 -3.156  35.556 1.00 56.59  ? 532 HOH B O     1 
HETATM 2520 H H1    . HOH G 3 .   ? 27.114 -3.095  34.602 1.00 0.00   ? 532 HOH B H1    1 
HETATM 2521 H H2    . HOH G 3 .   ? 26.176 -2.893  35.773 1.00 0.00   ? 532 HOH B H2    1 
HETATM 2522 O O     . HOH G 3 .   ? 52.722 -3.599  36.211 1.00 33.22  ? 533 HOH B O     1 
HETATM 2523 H H1    . HOH G 3 .   ? 53.193 -3.426  35.396 1.00 0.00   ? 533 HOH B H1    1 
HETATM 2524 H H2    . HOH G 3 .   ? 53.409 -3.800  36.847 1.00 0.00   ? 533 HOH B H2    1 
HETATM 2525 O O     . HOH G 3 .   ? 46.170 -6.331  38.572 1.00 26.61  ? 534 HOH B O     1 
HETATM 2526 H H1    . HOH G 3 .   ? 45.692 -6.455  37.752 1.00 0.00   ? 534 HOH B H1    1 
HETATM 2527 H H2    . HOH G 3 .   ? 46.094 -7.171  39.024 1.00 0.00   ? 534 HOH B H2    1 
HETATM 2528 O O     . HOH G 3 .   ? 36.645 -1.772  52.566 1.00 28.08  ? 535 HOH B O     1 
HETATM 2529 H H1    . HOH G 3 .   ? 37.437 -2.054  53.025 1.00 0.00   ? 535 HOH B H1    1 
HETATM 2530 H H2    . HOH G 3 .   ? 36.382 -2.535  52.051 1.00 0.00   ? 535 HOH B H2    1 
HETATM 2531 O O     . HOH G 3 .   ? 37.983 -3.164  50.652 1.00 23.85  ? 536 HOH B O     1 
HETATM 2532 H H1    . HOH G 3 .   ? 37.173 -3.632  50.452 1.00 0.00   ? 536 HOH B H1    1 
HETATM 2533 H H2    . HOH G 3 .   ? 38.631 -3.855  50.790 1.00 0.00   ? 536 HOH B H2    1 
HETATM 2534 O O     . HOH G 3 .   ? 34.457 -2.015  47.982 1.00 23.73  ? 537 HOH B O     1 
HETATM 2535 H H1    . HOH G 3 .   ? 33.838 -2.312  47.315 1.00 0.00   ? 537 HOH B H1    1 
HETATM 2536 H H2    . HOH G 3 .   ? 35.306 -2.020  47.541 1.00 0.00   ? 537 HOH B H2    1 
HETATM 2537 O O     . HOH G 3 .   ? 36.695 14.374  44.256 1.00 37.15  ? 538 HOH B O     1 
HETATM 2538 H H1    . HOH G 3 .   ? 37.576 14.599  43.958 1.00 0.00   ? 538 HOH B H1    1 
HETATM 2539 H H2    . HOH G 3 .   ? 36.732 14.466  45.208 1.00 0.00   ? 538 HOH B H2    1 
HETATM 2540 O O     . HOH G 3 .   ? 48.885 2.800   51.648 1.00 42.89  ? 539 HOH B O     1 
HETATM 2541 H H1    . HOH G 3 .   ? 48.539 3.259   50.883 1.00 0.00   ? 539 HOH B H1    1 
HETATM 2542 H H2    . HOH G 3 .   ? 48.535 1.912   51.574 1.00 0.00   ? 539 HOH B H2    1 
HETATM 2543 O O     . HOH G 3 .   ? 42.756 12.446  32.119 1.00 40.44  ? 546 HOH B O     1 
HETATM 2544 H H1    . HOH G 3 .   ? 41.957 12.971  32.173 1.00 0.00   ? 546 HOH B H1    1 
HETATM 2545 H H2    . HOH G 3 .   ? 42.922 12.357  31.180 1.00 0.00   ? 546 HOH B H2    1 
HETATM 2546 O O     . HOH G 3 .   ? 34.112 0.252   18.596 1.00 64.60  ? 552 HOH B O     1 
HETATM 2547 H H1    . HOH G 3 .   ? 34.112 1.209   18.596 1.00 0.00   ? 552 HOH B H1    1 
HETATM 2548 H H2    . HOH G 3 .   ? 34.112 0.012   17.669 1.00 0.00   ? 552 HOH B H2    1 
HETATM 2549 O O     . HOH G 3 .   ? 28.887 7.682   40.572 1.00 34.90  ? 556 HOH B O     1 
HETATM 2550 H H1    . HOH G 3 .   ? 29.070 6.940   39.995 1.00 0.00   ? 556 HOH B H1    1 
HETATM 2551 H H2    . HOH G 3 .   ? 29.229 7.413   41.425 1.00 0.00   ? 556 HOH B H2    1 
HETATM 2552 O O     . HOH G 3 .   ? 30.684 9.640   41.518 1.00 30.88  ? 557 HOH B O     1 
HETATM 2553 H H1    . HOH G 3 .   ? 31.284 10.374  41.387 1.00 0.00   ? 557 HOH B H1    1 
HETATM 2554 H H2    . HOH G 3 .   ? 30.502 9.644   42.458 1.00 0.00   ? 557 HOH B H2    1 
HETATM 2555 O O     . HOH G 3 .   ? 29.516 12.761  42.856 1.00 44.81  ? 558 HOH B O     1 
HETATM 2556 H H1    . HOH G 3 .   ? 29.676 13.620  42.464 1.00 0.00   ? 558 HOH B H1    1 
HETATM 2557 H H2    . HOH G 3 .   ? 30.172 12.688  43.549 1.00 0.00   ? 558 HOH B H2    1 
HETATM 2558 O O     . HOH G 3 .   ? 51.029 -3.647  49.703 1.00 59.03  ? 559 HOH B O     1 
HETATM 2559 H H1    . HOH G 3 .   ? 51.170 -3.153  48.895 1.00 0.00   ? 559 HOH B H1    1 
HETATM 2560 H H2    . HOH G 3 .   ? 50.309 -3.192  50.140 1.00 0.00   ? 559 HOH B H2    1 
HETATM 2561 O O     . HOH G 3 .   ? 42.227 2.838   58.093 1.00 43.54  ? 560 HOH B O     1 
HETATM 2562 H H1    . HOH G 3 .   ? 42.253 2.582   59.015 1.00 0.00   ? 560 HOH B H1    1 
HETATM 2563 H H2    . HOH G 3 .   ? 41.849 2.082   57.644 1.00 0.00   ? 560 HOH B H2    1 
HETATM 2564 O O     . HOH G 3 .   ? 52.874 9.670   34.869 1.00 91.86  ? 567 HOH B O     1 
HETATM 2565 H H1    . HOH G 3 .   ? 53.000 9.455   35.793 1.00 0.00   ? 567 HOH B H1    1 
HETATM 2566 H H2    . HOH G 3 .   ? 52.524 8.868   34.482 1.00 0.00   ? 567 HOH B H2    1 
HETATM 2567 O O     . HOH G 3 .   ? 37.562 8.013   26.559 1.00 45.61  ? 574 HOH B O     1 
HETATM 2568 H H1    . HOH G 3 .   ? 37.061 7.365   27.054 1.00 0.00   ? 574 HOH B H1    1 
HETATM 2569 H H2    . HOH G 3 .   ? 38.364 7.555   26.308 1.00 0.00   ? 574 HOH B H2    1 
HETATM 2570 O O     . HOH G 3 .   ? 41.065 13.352  34.526 1.00 49.47  ? 575 HOH B O     1 
HETATM 2571 H H1    . HOH G 3 .   ? 40.882 12.550  35.016 1.00 0.00   ? 575 HOH B H1    1 
HETATM 2572 H H2    . HOH G 3 .   ? 41.649 13.853  35.095 1.00 0.00   ? 575 HOH B H2    1 
HETATM 2573 O O     . HOH G 3 .   ? 42.235 4.358   24.008 1.00 31.55  ? 577 HOH B O     1 
HETATM 2574 H H1    . HOH G 3 .   ? 41.758 4.579   23.208 1.00 0.00   ? 577 HOH B H1    1 
HETATM 2575 H H2    . HOH G 3 .   ? 43.158 4.420   23.762 1.00 0.00   ? 577 HOH B H2    1 
HETATM 2576 O O     . HOH G 3 .   ? 45.896 -5.907  46.680 1.00 43.37  ? 584 HOH B O     1 
HETATM 2577 H H1    . HOH G 3 .   ? 46.184 -5.599  45.821 1.00 0.00   ? 584 HOH B H1    1 
HETATM 2578 H H2    . HOH G 3 .   ? 45.270 -5.246  46.975 1.00 0.00   ? 584 HOH B H2    1 
HETATM 2579 O O     . HOH G 3 .   ? 36.701 13.657  33.985 1.00 69.43  ? 585 HOH B O     1 
HETATM 2580 H H1    . HOH G 3 .   ? 37.277 13.007  34.388 1.00 0.00   ? 585 HOH B H1    1 
HETATM 2581 H H2    . HOH G 3 .   ? 36.451 13.269  33.147 1.00 0.00   ? 585 HOH B H2    1 
HETATM 2582 O O     . HOH G 3 .   ? 47.095 0.063   24.570 1.00 55.55  ? 586 HOH B O     1 
HETATM 2583 H H1    . HOH G 3 .   ? 46.460 0.444   25.176 1.00 0.00   ? 586 HOH B H1    1 
HETATM 2584 H H2    . HOH G 3 .   ? 47.211 -0.836  24.878 1.00 0.00   ? 586 HOH B H2    1 
HETATM 2585 O O     . HOH G 3 .   ? 47.835 -6.381  36.507 1.00 63.95  ? 588 HOH B O     1 
HETATM 2586 H H1    . HOH G 3 .   ? 47.459 -7.096  35.993 1.00 0.00   ? 588 HOH B H1    1 
HETATM 2587 H H2    . HOH G 3 .   ? 47.125 -6.102  37.086 1.00 0.00   ? 588 HOH B H2    1 
HETATM 2588 O O     . HOH G 3 .   ? 43.503 -5.992  28.751 1.00 53.43  ? 589 HOH B O     1 
HETATM 2589 H H1    . HOH G 3 .   ? 42.814 -5.822  29.394 1.00 0.00   ? 589 HOH B H1    1 
HETATM 2590 H H2    . HOH G 3 .   ? 43.280 -5.432  28.007 1.00 0.00   ? 589 HOH B H2    1 
HETATM 2591 O O     . HOH G 3 .   ? 54.539 4.655   39.902 1.00 53.08  ? 590 HOH B O     1 
HETATM 2592 H H1    . HOH G 3 .   ? 53.970 4.561   39.138 1.00 0.00   ? 590 HOH B H1    1 
HETATM 2593 H H2    . HOH G 3 .   ? 54.732 5.592   39.944 1.00 0.00   ? 590 HOH B H2    1 
HETATM 2594 O O     . HOH G 3 .   ? 50.052 -4.926  35.792 1.00 48.41  ? 591 HOH B O     1 
HETATM 2595 H H1    . HOH G 3 .   ? 50.033 -3.977  35.916 1.00 0.00   ? 591 HOH B H1    1 
HETATM 2596 H H2    . HOH G 3 .   ? 49.798 -5.284  36.643 1.00 0.00   ? 591 HOH B H2    1 
HETATM 2597 O O     . HOH G 3 .   ? 28.949 -6.900  37.569 1.00 79.87  ? 592 HOH B O     1 
HETATM 2598 H H1    . HOH G 3 .   ? 28.651 -6.376  38.313 1.00 0.00   ? 592 HOH B H1    1 
HETATM 2599 H H2    . HOH G 3 .   ? 28.576 -6.463  36.803 1.00 0.00   ? 592 HOH B H2    1 
HETATM 2600 O O     . HOH G 3 .   ? 26.333 0.571   47.089 1.00 63.22  ? 593 HOH B O     1 
HETATM 2601 H H1    . HOH G 3 .   ? 25.892 1.421   47.077 1.00 0.00   ? 593 HOH B H1    1 
HETATM 2602 H H2    . HOH G 3 .   ? 25.674 -0.036  47.425 1.00 0.00   ? 593 HOH B H2    1 
HETATM 2603 O O     . HOH G 3 .   ? 44.740 -2.990  53.544 1.00 39.64  ? 594 HOH B O     1 
HETATM 2604 H H1    . HOH G 3 .   ? 45.528 -3.488  53.761 1.00 0.00   ? 594 HOH B H1    1 
HETATM 2605 H H2    . HOH G 3 .   ? 44.249 -2.948  54.364 1.00 0.00   ? 594 HOH B H2    1 
HETATM 2606 O O     . HOH G 3 .   ? 43.744 11.214  46.540 1.00 36.25  ? 595 HOH B O     1 
HETATM 2607 H H1    . HOH G 3 .   ? 42.794 11.320  46.582 1.00 0.00   ? 595 HOH B H1    1 
HETATM 2608 H H2    . HOH G 3 .   ? 44.076 12.095  46.365 1.00 0.00   ? 595 HOH B H2    1 
HETATM 2609 O O     . HOH G 3 .   ? 47.303 14.422  43.421 1.00 58.48  ? 596 HOH B O     1 
HETATM 2610 H H1    . HOH G 3 .   ? 47.350 13.470  43.333 1.00 0.00   ? 596 HOH B H1    1 
HETATM 2611 H H2    . HOH G 3 .   ? 47.445 14.752  42.534 1.00 0.00   ? 596 HOH B H2    1 
HETATM 2612 O O     . HOH G 3 .   ? 49.669 16.702  38.634 1.00 49.50  ? 600 HOH B O     1 
HETATM 2613 H H1    . HOH G 3 .   ? 49.954 17.542  38.275 1.00 0.00   ? 600 HOH B H1    1 
HETATM 2614 H H2    . HOH G 3 .   ? 49.853 16.767  39.571 1.00 0.00   ? 600 HOH B H2    1 
HETATM 2615 O O     . HOH G 3 .   ? 46.102 -2.533  24.646 1.00 57.06  ? 611 HOH B O     1 
HETATM 2616 H H1    . HOH G 3 .   ? 46.876 -2.433  24.092 1.00 0.00   ? 611 HOH B H1    1 
HETATM 2617 H H2    . HOH G 3 .   ? 45.812 -3.432  24.493 1.00 0.00   ? 611 HOH B H2    1 
HETATM 2618 O O     . HOH G 3 .   ? 48.478 -0.285  52.772 1.00 59.46  ? 612 HOH B O     1 
HETATM 2619 H H1    . HOH G 3 .   ? 47.769 -0.334  53.413 1.00 0.00   ? 612 HOH B H1    1 
HETATM 2620 H H2    . HOH G 3 .   ? 48.126 -0.712  51.991 1.00 0.00   ? 612 HOH B H2    1 
HETATM 2621 O O     . HOH G 3 .   ? 38.197 15.267  41.034 1.00 48.31  ? 616 HOH B O     1 
HETATM 2622 H H1    . HOH G 3 .   ? 38.270 14.439  41.509 1.00 0.00   ? 616 HOH B H1    1 
HETATM 2623 H H2    . HOH G 3 .   ? 37.284 15.301  40.750 1.00 0.00   ? 616 HOH B H2    1 
HETATM 2624 O O     . HOH G 3 .   ? 37.864 5.897   23.109 1.00 50.68  ? 617 HOH B O     1 
HETATM 2625 H H1    . HOH G 3 .   ? 38.264 6.542   22.526 1.00 0.00   ? 617 HOH B H1    1 
HETATM 2626 H H2    . HOH G 3 .   ? 38.427 5.126   23.037 1.00 0.00   ? 617 HOH B H2    1 
HETATM 2627 O O     . HOH G 3 .   ? 43.331 -2.056  20.716 1.00 72.01  ? 618 HOH B O     1 
HETATM 2628 H H1    . HOH G 3 .   ? 42.680 -2.756  20.674 1.00 0.00   ? 618 HOH B H1    1 
HETATM 2629 H H2    . HOH G 3 .   ? 43.395 -1.843  21.647 1.00 0.00   ? 618 HOH B H2    1 
HETATM 2630 O O     . HOH G 3 .   ? 54.230 -0.218  30.617 1.00 54.84  ? 619 HOH B O     1 
HETATM 2631 H H1    . HOH G 3 .   ? 53.702 0.362   31.165 1.00 0.00   ? 619 HOH B H1    1 
HETATM 2632 H H2    . HOH G 3 .   ? 55.081 -0.252  31.054 1.00 0.00   ? 619 HOH B H2    1 
HETATM 2633 O O     . HOH G 3 .   ? 39.946 2.795   24.068 1.00 68.78  ? 620 HOH B O     1 
HETATM 2634 H H1    . HOH G 3 .   ? 40.026 3.365   23.303 1.00 0.00   ? 620 HOH B H1    1 
HETATM 2635 H H2    . HOH G 3 .   ? 40.004 3.388   24.817 1.00 0.00   ? 620 HOH B H2    1 
HETATM 2636 O O     . HOH G 3 .   ? 51.019 -5.988  39.348 1.00 48.74  ? 621 HOH B O     1 
HETATM 2637 H H1    . HOH G 3 .   ? 50.540 -5.208  39.067 1.00 0.00   ? 621 HOH B H1    1 
HETATM 2638 H H2    . HOH G 3 .   ? 51.591 -5.678  40.050 1.00 0.00   ? 621 HOH B H2    1 
HETATM 2639 O O     . HOH G 3 .   ? 23.502 0.671   45.478 1.00 44.46  ? 622 HOH B O     1 
HETATM 2640 H H1    . HOH G 3 .   ? 22.811 0.961   44.882 1.00 0.00   ? 622 HOH B H1    1 
HETATM 2641 H H2    . HOH G 3 .   ? 23.256 -0.224  45.713 1.00 0.00   ? 622 HOH B H2    1 
HETATM 2642 O O     . HOH G 3 .   ? 47.194 -2.926  51.847 1.00 36.19  ? 623 HOH B O     1 
HETATM 2643 H H1    . HOH G 3 .   ? 46.453 -3.287  52.333 1.00 0.00   ? 623 HOH B H1    1 
HETATM 2644 H H2    . HOH G 3 .   ? 47.912 -2.912  52.480 1.00 0.00   ? 623 HOH B H2    1 
HETATM 2645 O O     . HOH G 3 .   ? 29.185 -3.914  37.168 1.00 30.97  ? 630 HOH B O     1 
HETATM 2646 H H1    . HOH G 3 .   ? 28.381 -3.646  36.724 1.00 0.00   ? 630 HOH B H1    1 
HETATM 2647 H H2    . HOH G 3 .   ? 28.958 -3.913  38.098 1.00 0.00   ? 630 HOH B H2    1 
HETATM 2648 O O     . HOH G 3 .   ? 24.664 -3.286  37.025 1.00 61.80  ? 631 HOH B O     1 
HETATM 2649 H H1    . HOH G 3 .   ? 25.571 -2.980  37.045 1.00 0.00   ? 631 HOH B H1    1 
HETATM 2650 H H2    . HOH G 3 .   ? 24.374 -3.120  36.128 1.00 0.00   ? 631 HOH B H2    1 
HETATM 2651 O O     . HOH G 3 .   ? 20.019 4.700   42.634 1.00 69.85  ? 632 HOH B O     1 
HETATM 2652 H H1    . HOH G 3 .   ? 20.520 3.889   42.721 1.00 0.00   ? 632 HOH B H1    1 
HETATM 2653 H H2    . HOH G 3 .   ? 19.143 4.476   42.948 1.00 0.00   ? 632 HOH B H2    1 
HETATM 2654 O O     . HOH G 3 .   ? 39.387 0.487   57.702 1.00 41.06  ? 633 HOH B O     1 
HETATM 2655 H H1    . HOH G 3 .   ? 40.086 0.717   58.315 1.00 0.00   ? 633 HOH B H1    1 
HETATM 2656 H H2    . HOH G 3 .   ? 38.580 0.609   58.202 1.00 0.00   ? 633 HOH B H2    1 
HETATM 2657 O O     . HOH G 3 .   ? 45.318 2.630   55.026 1.00 60.33  ? 634 HOH B O     1 
HETATM 2658 H H1    . HOH G 3 .   ? 45.979 1.948   55.150 1.00 0.00   ? 634 HOH B H1    1 
HETATM 2659 H H2    . HOH G 3 .   ? 44.703 2.256   54.395 1.00 0.00   ? 634 HOH B H2    1 
HETATM 2660 O O     . HOH G 3 .   ? 44.531 3.610   21.653 1.00 39.82  ? 635 HOH B O     1 
HETATM 2661 H H1    . HOH G 3 .   ? 44.350 3.603   22.593 1.00 0.00   ? 635 HOH B H1    1 
HETATM 2662 H H2    . HOH G 3 .   ? 45.414 3.974   21.581 1.00 0.00   ? 635 HOH B H2    1 
HETATM 2663 O O     . HOH G 3 .   ? 45.163 -5.935  53.924 1.00 51.42  ? 646 HOH B O     1 
HETATM 2664 H H1    . HOH G 3 .   ? 45.166 -5.526  53.059 1.00 0.00   ? 646 HOH B H1    1 
HETATM 2665 H H2    . HOH G 3 .   ? 44.625 -6.719  53.817 1.00 0.00   ? 646 HOH B H2    1 
HETATM 2666 O O     . HOH G 3 .   ? 48.802 -5.993  46.727 1.00 47.34  ? 647 HOH B O     1 
HETATM 2667 H H1    . HOH G 3 .   ? 49.629 -5.629  46.411 1.00 0.00   ? 647 HOH B H1    1 
HETATM 2668 H H2    . HOH G 3 .   ? 48.128 -5.476  46.286 1.00 0.00   ? 647 HOH B H2    1 
HETATM 2669 O O     . HOH G 3 .   ? 39.719 11.849  46.715 1.00 45.19  ? 648 HOH B O     1 
HETATM 2670 H H1    . HOH G 3 .   ? 40.053 12.743  46.642 1.00 0.00   ? 648 HOH B H1    1 
HETATM 2671 H H2    . HOH G 3 .   ? 38.800 11.914  46.455 1.00 0.00   ? 648 HOH B H2    1 
HETATM 2672 O O     . HOH G 3 .   ? 40.257 14.313  42.763 1.00 49.40  ? 649 HOH B O     1 
HETATM 2673 H H1    . HOH G 3 .   ? 39.546 14.676  42.235 1.00 0.00   ? 649 HOH B H1    1 
HETATM 2674 H H2    . HOH G 3 .   ? 41.032 14.806  42.493 1.00 0.00   ? 649 HOH B H2    1 
HETATM 2675 O O     . HOH G 3 .   ? 44.888 13.382  45.335 1.00 51.75  ? 650 HOH B O     1 
HETATM 2676 H H1    . HOH G 3 .   ? 45.278 13.058  46.147 1.00 0.00   ? 650 HOH B H1    1 
HETATM 2677 H H2    . HOH G 3 .   ? 44.339 14.117  45.610 1.00 0.00   ? 650 HOH B H2    1 
HETATM 2678 O O     . HOH G 3 .   ? 45.219 -2.885  27.299 1.00 41.87  ? 651 HOH B O     1 
HETATM 2679 H H1    . HOH G 3 .   ? 44.290 -2.720  27.461 1.00 0.00   ? 651 HOH B H1    1 
HETATM 2680 H H2    . HOH G 3 .   ? 45.318 -3.830  27.414 1.00 0.00   ? 651 HOH B H2    1 
HETATM 2681 O O     . HOH G 3 .   ? 48.839 2.309   23.028 1.00 74.46  ? 658 HOH B O     1 
HETATM 2682 H H1    . HOH G 3 .   ? 49.585 1.780   22.747 1.00 0.00   ? 658 HOH B H1    1 
HETATM 2683 H H2    . HOH G 3 .   ? 49.078 3.205   22.791 1.00 0.00   ? 658 HOH B H2    1 
HETATM 2684 O O     . HOH G 3 .   ? 38.658 10.481  26.352 1.00 104.43 ? 669 HOH B O     1 
HETATM 2685 H H1    . HOH G 3 .   ? 39.059 10.921  25.603 1.00 0.00   ? 669 HOH B H1    1 
HETATM 2686 H H2    . HOH G 3 .   ? 38.006 11.103  26.675 1.00 0.00   ? 669 HOH B H2    1 
HETATM 2687 O O     . HOH G 3 .   ? 51.860 -0.326  28.766 1.00 66.74  ? 675 HOH B O     1 
HETATM 2688 H H1    . HOH G 3 .   ? 51.453 0.220   29.439 1.00 0.00   ? 675 HOH B H1    1 
HETATM 2689 H H2    . HOH G 3 .   ? 51.157 -0.498  28.139 1.00 0.00   ? 675 HOH B H2    1 
HETATM 2690 O O     . HOH G 3 .   ? 56.309 1.526   31.409 1.00 66.77  ? 676 HOH B O     1 
HETATM 2691 H H1    . HOH G 3 .   ? 56.715 0.664   31.504 1.00 0.00   ? 676 HOH B H1    1 
HETATM 2692 H H2    . HOH G 3 .   ? 56.953 2.042   30.924 1.00 0.00   ? 676 HOH B H2    1 
HETATM 2693 O O     . HOH G 3 .   ? 55.658 4.227   31.532 1.00 46.34  ? 677 HOH B O     1 
HETATM 2694 H H1    . HOH G 3 .   ? 55.658 3.278   31.653 1.00 0.00   ? 677 HOH B H1    1 
HETATM 2695 H H2    . HOH G 3 .   ? 56.577 4.450   31.386 1.00 0.00   ? 677 HOH B H2    1 
HETATM 2696 O O     . HOH G 3 .   ? 56.842 5.848   38.330 1.00 56.30  ? 678 HOH B O     1 
HETATM 2697 H H1    . HOH G 3 .   ? 56.242 5.119   38.489 1.00 0.00   ? 678 HOH B H1    1 
HETATM 2698 H H2    . HOH G 3 .   ? 56.962 5.857   37.380 1.00 0.00   ? 678 HOH B H2    1 
HETATM 2699 O O     . HOH G 3 .   ? 58.244 7.324   46.040 1.00 63.17  ? 679 HOH B O     1 
HETATM 2700 H H1    . HOH G 3 .   ? 57.314 7.097   46.043 1.00 0.00   ? 679 HOH B H1    1 
HETATM 2701 H H2    . HOH G 3 .   ? 58.472 7.389   45.113 1.00 0.00   ? 679 HOH B H2    1 
HETATM 2702 O O     . HOH G 3 .   ? 56.266 5.719   47.555 1.00 81.18  ? 680 HOH B O     1 
HETATM 2703 H H1    . HOH G 3 .   ? 57.187 5.720   47.293 1.00 0.00   ? 680 HOH B H1    1 
HETATM 2704 H H2    . HOH G 3 .   ? 55.782 5.793   46.732 1.00 0.00   ? 680 HOH B H2    1 
HETATM 2705 O O     . HOH G 3 .   ? 53.155 6.331   48.828 1.00 62.37  ? 681 HOH B O     1 
HETATM 2706 H H1    . HOH G 3 .   ? 52.310 6.502   48.412 1.00 0.00   ? 681 HOH B H1    1 
HETATM 2707 H H2    . HOH G 3 .   ? 53.691 5.947   48.134 1.00 0.00   ? 681 HOH B H2    1 
HETATM 2708 O O     . HOH G 3 .   ? 54.415 0.520   49.602 1.00 66.67  ? 682 HOH B O     1 
HETATM 2709 H H1    . HOH G 3 .   ? 53.516 0.838   49.683 1.00 0.00   ? 682 HOH B H1    1 
HETATM 2710 H H2    . HOH G 3 .   ? 54.382 -0.112  48.884 1.00 0.00   ? 682 HOH B H2    1 
HETATM 2711 O O     . HOH G 3 .   ? 42.873 -8.269  32.317 1.00 89.17  ? 683 HOH B O     1 
HETATM 2712 H H1    . HOH G 3 .   ? 42.238 -8.190  31.605 1.00 0.00   ? 683 HOH B H1    1 
HETATM 2713 H H2    . HOH G 3 .   ? 43.198 -9.167  32.250 1.00 0.00   ? 683 HOH B H2    1 
HETATM 2714 O O     . HOH G 3 .   ? 29.342 7.283   37.630 1.00 59.96  ? 684 HOH B O     1 
HETATM 2715 H H1    . HOH G 3 .   ? 29.745 6.781   36.922 1.00 0.00   ? 684 HOH B H1    1 
HETATM 2716 H H2    . HOH G 3 .   ? 29.648 8.180   37.493 1.00 0.00   ? 684 HOH B H2    1 
HETATM 2717 O O     . HOH G 3 .   ? 37.232 -4.310  35.289 1.00 80.16  ? 688 HOH B O     1 
HETATM 2718 H H1    . HOH G 3 .   ? 37.205 -3.673  34.575 1.00 0.00   ? 688 HOH B H1    1 
HETATM 2719 H H2    . HOH G 3 .   ? 36.601 -4.983  35.034 1.00 0.00   ? 688 HOH B H2    1 
HETATM 2720 O O     . HOH G 3 .   ? 32.439 -1.143  30.149 1.00 84.77  ? 689 HOH B O     1 
HETATM 2721 H H1    . HOH G 3 .   ? 32.483 -1.894  30.741 1.00 0.00   ? 689 HOH B H1    1 
HETATM 2722 H H2    . HOH G 3 .   ? 31.507 -0.928  30.102 1.00 0.00   ? 689 HOH B H2    1 
HETATM 2723 O O     . HOH G 3 .   ? 35.535 0.595   27.252 1.00 61.57  ? 690 HOH B O     1 
HETATM 2724 H H1    . HOH G 3 .   ? 35.968 0.559   26.399 1.00 0.00   ? 690 HOH B H1    1 
HETATM 2725 H H2    . HOH G 3 .   ? 35.024 1.404   27.228 1.00 0.00   ? 690 HOH B H2    1 
HETATM 2726 O O     . HOH G 3 .   ? 31.529 1.248   31.734 1.00 62.44  ? 691 HOH B O     1 
HETATM 2727 H H1    . HOH G 3 .   ? 30.586 1.140   31.609 1.00 0.00   ? 691 HOH B H1    1 
HETATM 2728 H H2    . HOH G 3 .   ? 31.819 1.736   30.963 1.00 0.00   ? 691 HOH B H2    1 
HETATM 2729 O O     . HOH H 3 .   ? 45.978 -8.601  45.781 1.00 52.99  ? 540 HOH D O     1 
HETATM 2730 H H1    . HOH H 3 .   ? 46.244 -8.917  44.917 1.00 0.00   ? 540 HOH D H1    1 
HETATM 2731 H H2    . HOH H 3 .   ? 46.164 -9.331  46.371 1.00 0.00   ? 540 HOH D H2    1 
HETATM 2732 O O     . HOH H 3 .   ? 41.560 -11.723 36.275 1.00 38.34  ? 587 HOH D O     1 
HETATM 2733 H H1    . HOH H 3 .   ? 41.955 -11.157 36.938 1.00 0.00   ? 587 HOH D H1    1 
HETATM 2734 H H2    . HOH H 3 .   ? 41.039 -12.352 36.775 1.00 0.00   ? 587 HOH D H2    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   143 ?   ?   ?   A . n 
A 1 2   ASP 2   144 144 ASP ASP A . n 
A 1 3   SER 3   145 145 SER SER A . n 
A 1 4   ILE 4   146 146 ILE ILE A . n 
A 1 5   GLN 5   147 147 GLN GLN A . n 
A 1 6   ALA 6   148 148 ALA ALA A . n 
A 1 7   GLU 7   149 149 GLU GLU A . n 
A 1 8   GLU 8   150 150 GLU GLU A . n 
A 1 9   TRP 9   151 151 TRP TRP A . n 
A 1 10  TYR 10  152 152 TYR TYR A . n 
A 1 11  PHE 11  153 153 PHE PHE A . n 
A 1 12  GLY 12  154 154 GLY GLY A . n 
A 1 13  LYS 13  155 155 LYS LYS A . n 
A 1 14  ILE 14  156 156 ILE ILE A . n 
A 1 15  THR 15  157 157 THR THR A . n 
A 1 16  ARG 16  158 158 ARG ARG A . n 
A 1 17  ARG 17  159 159 ARG ARG A . n 
A 1 18  GLU 18  160 160 GLU GLU A . n 
A 1 19  SER 19  161 161 SER SER A . n 
A 1 20  GLU 20  162 162 GLU GLU A . n 
A 1 21  ARG 21  163 163 ARG ARG A . n 
A 1 22  LEU 22  164 164 LEU LEU A . n 
A 1 23  LEU 23  165 165 LEU LEU A . n 
A 1 24  LEU 24  166 166 LEU LEU A . n 
A 1 25  ASN 25  167 167 ASN ASN A . n 
A 1 26  ALA 26  168 168 ALA ALA A . n 
A 1 27  GLU 27  169 169 GLU GLU A . n 
A 1 28  ASN 28  170 170 ASN ASN A . n 
A 1 29  PRO 29  171 171 PRO PRO A . n 
A 1 30  ARG 30  172 172 ARG ARG A . n 
A 1 31  GLY 31  173 173 GLY GLY A . n 
A 1 32  THR 32  174 174 THR THR A . n 
A 1 33  PHE 33  175 175 PHE PHE A . n 
A 1 34  LEU 34  176 176 LEU LEU A . n 
A 1 35  VAL 35  177 177 VAL VAL A . n 
A 1 36  ARG 36  178 178 ARG ARG A . n 
A 1 37  GLU 37  179 179 GLU GLU A . n 
A 1 38  SER 38  180 180 SER SER A . n 
A 1 39  GLU 39  181 181 GLU GLU A . n 
A 1 40  THR 40  182 182 THR THR A . n 
A 1 41  THR 41  183 183 THR THR A . n 
A 1 42  LYS 42  184 184 LYS LYS A . n 
A 1 43  GLY 43  185 185 GLY GLY A . n 
A 1 44  ALA 44  186 186 ALA ALA A . n 
A 1 45  TYR 45  187 187 TYR TYR A . n 
A 1 46  SER 46  188 188 SER SER A . n 
A 1 47  LEU 47  189 189 LEU LEU A . n 
A 1 48  SER 48  190 190 SER SER A . n 
A 1 49  VAL 49  191 191 VAL VAL A . n 
A 1 50  SER 50  192 192 SER SER A . n 
A 1 51  ASP 51  193 193 ASP ASP A . n 
A 1 52  PHE 52  194 194 PHE PHE A . n 
A 1 53  ASP 53  195 195 ASP ASP A . n 
A 1 54  ASN 54  196 196 ASN ASN A . n 
A 1 55  ALA 55  197 197 ALA ALA A . n 
A 1 56  LYS 56  198 198 LYS LYS A . n 
A 1 57  GLY 57  199 199 GLY GLY A . n 
A 1 58  LEU 58  200 200 LEU LEU A . n 
A 1 59  ASN 59  201 201 ASN ASN A . n 
A 1 60  VAL 60  202 202 VAL VAL A . n 
A 1 61  LYS 61  203 203 LYS LYS A . n 
A 1 62  HIS 62  204 204 HIS HIS A . n 
A 1 63  TYR 63  205 205 TYR TYR A . n 
A 1 64  LYS 64  206 206 LYS LYS A . n 
A 1 65  ILE 65  207 207 ILE ILE A . n 
A 1 66  ARG 66  208 208 ARG ARG A . n 
A 1 67  LYS 67  209 209 LYS LYS A . n 
A 1 68  LEU 68  210 210 LEU LEU A . n 
A 1 69  ASP 69  211 211 ASP ASP A . n 
A 1 70  SER 70  212 212 SER SER A . n 
A 1 71  GLY 71  213 213 GLY GLY A . n 
A 1 72  GLY 72  214 214 GLY GLY A . n 
A 1 73  PHE 73  215 215 PHE PHE A . n 
A 1 74  TYR 74  216 216 TYR TYR A . n 
A 1 75  ILE 75  217 217 ILE ILE A . n 
A 1 76  THR 76  218 218 THR THR A . n 
A 1 77  SER 77  219 219 SER SER A . n 
A 1 78  ARG 78  220 220 ARG ARG A . n 
A 1 79  THR 79  221 221 THR THR A . n 
A 1 80  GLN 80  222 222 GLN GLN A . n 
A 1 81  PHE 81  223 223 PHE PHE A . n 
A 1 82  ASN 82  224 224 ASN ASN A . n 
A 1 83  SER 83  225 225 SER SER A . n 
A 1 84  LEU 84  226 226 LEU LEU A . n 
A 1 85  GLN 85  227 227 GLN GLN A . n 
A 1 86  GLN 86  228 228 GLN GLN A . n 
A 1 87  LEU 87  229 229 LEU LEU A . n 
A 1 88  VAL 88  230 230 VAL VAL A . n 
A 1 89  ALA 89  231 231 ALA ALA A . n 
A 1 90  TYR 90  232 232 TYR TYR A . n 
A 1 91  TYR 91  233 233 TYR TYR A . n 
A 1 92  SER 92  234 234 SER SER A . n 
A 1 93  LYS 93  235 235 LYS LYS A . n 
A 1 94  HIS 94  236 236 HIS HIS A . n 
A 1 95  ALA 95  237 237 ALA ALA A . n 
A 1 96  ASP 96  238 238 ASP ASP A . n 
A 1 97  GLY 97  239 239 GLY GLY A . n 
A 1 98  LEU 98  240 240 LEU LEU A . n 
A 1 99  CYS 99  241 241 CYS CYS A . n 
A 1 100 HIS 100 242 242 HIS HIS A . n 
A 1 101 ARG 101 243 243 ARG ARG A . n 
A 1 102 LEU 102 244 244 LEU LEU A . n 
A 1 103 THR 103 245 245 THR THR A . n 
A 1 104 THR 104 246 246 THR THR A . n 
A 1 105 VAL 105 247 247 VAL VAL A . n 
A 1 106 CYS 106 248 248 CYS CYS A . n 
A 1 107 PRO 107 249 249 PRO PRO A . n 
B 2 1   ACE 1   100 100 ACE ACE C . n 
B 2 2   PTH 2   101 101 PTH PTH C . n 
B 2 3   GLU 3   102 102 GLU GLU C . n 
B 2 4   DIP 4   103 103 DIP DIP C . n 
C 1 1   MET 1   143 ?   ?   ?   B . n 
C 1 2   ASP 2   144 ?   ?   ?   B . n 
C 1 3   SER 3   145 ?   ?   ?   B . n 
C 1 4   ILE 4   146 ?   ?   ?   B . n 
C 1 5   GLN 5   147 ?   ?   ?   B . n 
C 1 6   ALA 6   148 148 ALA ALA B . n 
C 1 7   GLU 7   149 149 GLU GLU B . n 
C 1 8   GLU 8   150 150 GLU GLU B . n 
C 1 9   TRP 9   151 151 TRP TRP B . n 
C 1 10  TYR 10  152 152 TYR TYR B . n 
C 1 11  PHE 11  153 153 PHE PHE B . n 
C 1 12  GLY 12  154 154 GLY GLY B . n 
C 1 13  LYS 13  155 155 LYS LYS B . n 
C 1 14  ILE 14  156 156 ILE ILE B . n 
C 1 15  THR 15  157 157 THR THR B . n 
C 1 16  ARG 16  158 158 ARG ARG B . n 
C 1 17  ARG 17  159 159 ARG ARG B . n 
C 1 18  GLU 18  160 160 GLU GLU B . n 
C 1 19  SER 19  161 161 SER SER B . n 
C 1 20  GLU 20  162 162 GLU GLU B . n 
C 1 21  ARG 21  163 163 ARG ARG B . n 
C 1 22  LEU 22  164 164 LEU LEU B . n 
C 1 23  LEU 23  165 165 LEU LEU B . n 
C 1 24  LEU 24  166 166 LEU LEU B . n 
C 1 25  ASN 25  167 167 ASN ASN B . n 
C 1 26  ALA 26  168 168 ALA ALA B . n 
C 1 27  GLU 27  169 169 GLU GLU B . n 
C 1 28  ASN 28  170 170 ASN ASN B . n 
C 1 29  PRO 29  171 171 PRO PRO B . n 
C 1 30  ARG 30  172 172 ARG ARG B . n 
C 1 31  GLY 31  173 173 GLY GLY B . n 
C 1 32  THR 32  174 174 THR THR B . n 
C 1 33  PHE 33  175 175 PHE PHE B . n 
C 1 34  LEU 34  176 176 LEU LEU B . n 
C 1 35  VAL 35  177 177 VAL VAL B . n 
C 1 36  ARG 36  178 178 ARG ARG B . n 
C 1 37  GLU 37  179 179 GLU GLU B . n 
C 1 38  SER 38  180 180 SER SER B . n 
C 1 39  GLU 39  181 181 GLU GLU B . n 
C 1 40  THR 40  182 182 THR THR B . n 
C 1 41  THR 41  183 183 THR THR B . n 
C 1 42  LYS 42  184 184 LYS LYS B . n 
C 1 43  GLY 43  185 185 GLY GLY B . n 
C 1 44  ALA 44  186 186 ALA ALA B . n 
C 1 45  TYR 45  187 187 TYR TYR B . n 
C 1 46  SER 46  188 188 SER SER B . n 
C 1 47  LEU 47  189 189 LEU LEU B . n 
C 1 48  SER 48  190 190 SER SER B . n 
C 1 49  VAL 49  191 191 VAL VAL B . n 
C 1 50  SER 50  192 192 SER SER B . n 
C 1 51  ASP 51  193 193 ASP ASP B . n 
C 1 52  PHE 52  194 194 PHE PHE B . n 
C 1 53  ASP 53  195 195 ASP ASP B . n 
C 1 54  ASN 54  196 196 ASN ASN B . n 
C 1 55  ALA 55  197 197 ALA ALA B . n 
C 1 56  LYS 56  198 198 LYS LYS B . n 
C 1 57  GLY 57  199 199 GLY GLY B . n 
C 1 58  LEU 58  200 200 LEU LEU B . n 
C 1 59  ASN 59  201 201 ASN ASN B . n 
C 1 60  VAL 60  202 202 VAL VAL B . n 
C 1 61  LYS 61  203 203 LYS LYS B . n 
C 1 62  HIS 62  204 204 HIS HIS B . n 
C 1 63  TYR 63  205 205 TYR TYR B . n 
C 1 64  LYS 64  206 206 LYS LYS B . n 
C 1 65  ILE 65  207 207 ILE ILE B . n 
C 1 66  ARG 66  208 208 ARG ARG B . n 
C 1 67  LYS 67  209 209 LYS LYS B . n 
C 1 68  LEU 68  210 210 LEU LEU B . n 
C 1 69  ASP 69  211 211 ASP ASP B . n 
C 1 70  SER 70  212 212 SER SER B . n 
C 1 71  GLY 71  213 213 GLY GLY B . n 
C 1 72  GLY 72  214 214 GLY GLY B . n 
C 1 73  PHE 73  215 215 PHE PHE B . n 
C 1 74  TYR 74  216 216 TYR TYR B . n 
C 1 75  ILE 75  217 217 ILE ILE B . n 
C 1 76  THR 76  218 218 THR THR B . n 
C 1 77  SER 77  219 219 SER SER B . n 
C 1 78  ARG 78  220 220 ARG ARG B . n 
C 1 79  THR 79  221 221 THR THR B . n 
C 1 80  GLN 80  222 222 GLN GLN B . n 
C 1 81  PHE 81  223 223 PHE PHE B . n 
C 1 82  ASN 82  224 224 ASN ASN B . n 
C 1 83  SER 83  225 225 SER SER B . n 
C 1 84  LEU 84  226 226 LEU LEU B . n 
C 1 85  GLN 85  227 227 GLN GLN B . n 
C 1 86  GLN 86  228 228 GLN GLN B . n 
C 1 87  LEU 87  229 229 LEU LEU B . n 
C 1 88  VAL 88  230 230 VAL VAL B . n 
C 1 89  ALA 89  231 231 ALA ALA B . n 
C 1 90  TYR 90  232 232 TYR TYR B . n 
C 1 91  TYR 91  233 233 TYR TYR B . n 
C 1 92  SER 92  234 234 SER SER B . n 
C 1 93  LYS 93  235 235 LYS LYS B . n 
C 1 94  HIS 94  236 236 HIS HIS B . n 
C 1 95  ALA 95  237 237 ALA ALA B . n 
C 1 96  ASP 96  238 238 ASP ASP B . n 
C 1 97  GLY 97  239 239 GLY GLY B . n 
C 1 98  LEU 98  240 240 LEU LEU B . n 
C 1 99  CYS 99  241 241 CYS CYS B . n 
C 1 100 HIS 100 242 242 HIS HIS B . n 
C 1 101 ARG 101 243 243 ARG ARG B . n 
C 1 102 LEU 102 244 244 LEU LEU B . n 
C 1 103 THR 103 245 245 THR THR B . n 
C 1 104 THR 104 246 246 THR THR B . n 
C 1 105 VAL 105 247 247 VAL VAL B . n 
C 1 106 CYS 106 248 248 CYS CYS B . n 
C 1 107 PRO 107 249 249 PRO PRO B . n 
D 2 1   ACE 1   100 100 ACE ACE D . n 
D 2 2   PTH 2   101 101 PTH PTH D . n 
D 2 3   GLU 3   102 102 GLU GLU D . n 
D 2 4   DIP 4   103 103 DIP DIP D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1   503 503 HOH HOH A . 
E 3 HOH 2   504 504 HOH HOH A . 
E 3 HOH 3   505 505 HOH HOH A . 
E 3 HOH 4   506 506 HOH HOH A . 
E 3 HOH 5   507 507 HOH HOH A . 
E 3 HOH 6   508 508 HOH HOH A . 
E 3 HOH 7   509 509 HOH HOH A . 
E 3 HOH 8   510 510 HOH HOH A . 
E 3 HOH 9   511 511 HOH HOH A . 
E 3 HOH 10  515 515 HOH HOH A . 
E 3 HOH 11  516 516 HOH HOH A . 
E 3 HOH 12  517 517 HOH HOH A . 
E 3 HOH 13  518 518 HOH HOH A . 
E 3 HOH 14  519 519 HOH HOH A . 
E 3 HOH 15  520 520 HOH HOH A . 
E 3 HOH 16  521 521 HOH HOH A . 
E 3 HOH 17  522 522 HOH HOH A . 
E 3 HOH 18  523 523 HOH HOH A . 
E 3 HOH 19  524 524 HOH HOH A . 
E 3 HOH 20  525 525 HOH HOH A . 
E 3 HOH 21  526 526 HOH HOH A . 
E 3 HOH 22  527 527 HOH HOH A . 
E 3 HOH 23  528 528 HOH HOH A . 
E 3 HOH 24  529 529 HOH HOH A . 
E 3 HOH 25  541 541 HOH HOH A . 
E 3 HOH 26  542 542 HOH HOH A . 
E 3 HOH 27  543 543 HOH HOH A . 
E 3 HOH 28  544 544 HOH HOH A . 
E 3 HOH 29  545 545 HOH HOH A . 
E 3 HOH 30  547 547 HOH HOH A . 
E 3 HOH 31  548 548 HOH HOH A . 
E 3 HOH 32  549 549 HOH HOH A . 
E 3 HOH 33  550 550 HOH HOH A . 
E 3 HOH 34  551 551 HOH HOH A . 
E 3 HOH 35  553 553 HOH HOH A . 
E 3 HOH 36  554 554 HOH HOH A . 
E 3 HOH 37  555 555 HOH HOH A . 
E 3 HOH 38  561 561 HOH HOH A . 
E 3 HOH 39  562 562 HOH HOH A . 
E 3 HOH 40  563 563 HOH HOH A . 
E 3 HOH 41  564 564 HOH HOH A . 
E 3 HOH 42  565 565 HOH HOH A . 
E 3 HOH 43  566 566 HOH HOH A . 
E 3 HOH 44  568 568 HOH HOH A . 
E 3 HOH 45  569 569 HOH HOH A . 
E 3 HOH 46  570 570 HOH HOH A . 
E 3 HOH 47  571 571 HOH HOH A . 
E 3 HOH 48  572 572 HOH HOH A . 
E 3 HOH 49  573 573 HOH HOH A . 
E 3 HOH 50  576 576 HOH HOH A . 
E 3 HOH 51  578 578 HOH HOH A . 
E 3 HOH 52  579 579 HOH HOH A . 
E 3 HOH 53  580 580 HOH HOH A . 
E 3 HOH 54  581 581 HOH HOH A . 
E 3 HOH 55  582 582 HOH HOH A . 
E 3 HOH 56  583 583 HOH HOH A . 
E 3 HOH 57  597 597 HOH HOH A . 
E 3 HOH 58  598 598 HOH HOH A . 
E 3 HOH 59  599 599 HOH HOH A . 
E 3 HOH 60  601 601 HOH HOH A . 
E 3 HOH 61  602 602 HOH HOH A . 
E 3 HOH 62  604 604 HOH HOH A . 
E 3 HOH 63  605 605 HOH HOH A . 
E 3 HOH 64  606 606 HOH HOH A . 
E 3 HOH 65  607 607 HOH HOH A . 
E 3 HOH 66  608 608 HOH HOH A . 
E 3 HOH 67  609 609 HOH HOH A . 
E 3 HOH 68  610 610 HOH HOH A . 
E 3 HOH 69  613 613 HOH HOH A . 
E 3 HOH 70  614 614 HOH HOH A . 
E 3 HOH 71  615 615 HOH HOH A . 
E 3 HOH 72  624 624 HOH HOH A . 
E 3 HOH 73  625 625 HOH HOH A . 
E 3 HOH 74  626 626 HOH HOH A . 
E 3 HOH 75  627 627 HOH HOH A . 
E 3 HOH 76  628 628 HOH HOH A . 
E 3 HOH 77  629 629 HOH HOH A . 
E 3 HOH 78  636 636 HOH HOH A . 
E 3 HOH 79  637 637 HOH HOH A . 
E 3 HOH 80  638 638 HOH HOH A . 
E 3 HOH 81  639 639 HOH HOH A . 
E 3 HOH 82  640 640 HOH HOH A . 
E 3 HOH 83  641 641 HOH HOH A . 
E 3 HOH 84  642 642 HOH HOH A . 
E 3 HOH 85  643 643 HOH HOH A . 
E 3 HOH 86  644 644 HOH HOH A . 
E 3 HOH 87  645 645 HOH HOH A . 
E 3 HOH 88  652 652 HOH HOH A . 
E 3 HOH 89  653 653 HOH HOH A . 
E 3 HOH 90  654 654 HOH HOH A . 
E 3 HOH 91  655 655 HOH HOH A . 
E 3 HOH 92  656 656 HOH HOH A . 
E 3 HOH 93  657 657 HOH HOH A . 
E 3 HOH 94  659 659 HOH HOH A . 
E 3 HOH 95  660 660 HOH HOH A . 
E 3 HOH 96  661 661 HOH HOH A . 
E 3 HOH 97  662 662 HOH HOH A . 
E 3 HOH 98  663 663 HOH HOH A . 
E 3 HOH 99  664 664 HOH HOH A . 
E 3 HOH 100 665 665 HOH HOH A . 
E 3 HOH 101 666 666 HOH HOH A . 
E 3 HOH 102 667 667 HOH HOH A . 
E 3 HOH 103 668 668 HOH HOH A . 
E 3 HOH 104 670 670 HOH HOH A . 
E 3 HOH 105 671 671 HOH HOH A . 
E 3 HOH 106 672 672 HOH HOH A . 
E 3 HOH 107 673 673 HOH HOH A . 
E 3 HOH 108 674 674 HOH HOH A . 
E 3 HOH 109 685 685 HOH HOH A . 
E 3 HOH 110 686 686 HOH HOH A . 
E 3 HOH 111 687 687 HOH HOH A . 
E 3 HOH 112 692 692 HOH HOH A . 
E 3 HOH 113 693 693 HOH HOH A . 
F 3 HOH 1   500 500 HOH HOH C . 
F 3 HOH 2   501 501 HOH HOH C . 
F 3 HOH 3   603 603 HOH HOH C . 
G 3 HOH 1   502 502 HOH HOH B . 
G 3 HOH 2   512 512 HOH HOH B . 
G 3 HOH 3   513 513 HOH HOH B . 
G 3 HOH 4   514 514 HOH HOH B . 
G 3 HOH 5   530 530 HOH HOH B . 
G 3 HOH 6   531 531 HOH HOH B . 
G 3 HOH 7   532 532 HOH HOH B . 
G 3 HOH 8   533 533 HOH HOH B . 
G 3 HOH 9   534 534 HOH HOH B . 
G 3 HOH 10  535 535 HOH HOH B . 
G 3 HOH 11  536 536 HOH HOH B . 
G 3 HOH 12  537 537 HOH HOH B . 
G 3 HOH 13  538 538 HOH HOH B . 
G 3 HOH 14  539 539 HOH HOH B . 
G 3 HOH 15  546 546 HOH HOH B . 
G 3 HOH 16  552 552 HOH HOH B . 
G 3 HOH 17  556 556 HOH HOH B . 
G 3 HOH 18  557 557 HOH HOH B . 
G 3 HOH 19  558 558 HOH HOH B . 
G 3 HOH 20  559 559 HOH HOH B . 
G 3 HOH 21  560 560 HOH HOH B . 
G 3 HOH 22  567 567 HOH HOH B . 
G 3 HOH 23  574 574 HOH HOH B . 
G 3 HOH 24  575 575 HOH HOH B . 
G 3 HOH 25  577 577 HOH HOH B . 
G 3 HOH 26  584 584 HOH HOH B . 
G 3 HOH 27  585 585 HOH HOH B . 
G 3 HOH 28  586 586 HOH HOH B . 
G 3 HOH 29  588 588 HOH HOH B . 
G 3 HOH 30  589 589 HOH HOH B . 
G 3 HOH 31  590 590 HOH HOH B . 
G 3 HOH 32  591 591 HOH HOH B . 
G 3 HOH 33  592 592 HOH HOH B . 
G 3 HOH 34  593 593 HOH HOH B . 
G 3 HOH 35  594 594 HOH HOH B . 
G 3 HOH 36  595 595 HOH HOH B . 
G 3 HOH 37  596 596 HOH HOH B . 
G 3 HOH 38  600 600 HOH HOH B . 
G 3 HOH 39  611 611 HOH HOH B . 
G 3 HOH 40  612 612 HOH HOH B . 
G 3 HOH 41  616 616 HOH HOH B . 
G 3 HOH 42  617 617 HOH HOH B . 
G 3 HOH 43  618 618 HOH HOH B . 
G 3 HOH 44  619 619 HOH HOH B . 
G 3 HOH 45  620 620 HOH HOH B . 
G 3 HOH 46  621 621 HOH HOH B . 
G 3 HOH 47  622 622 HOH HOH B . 
G 3 HOH 48  623 623 HOH HOH B . 
G 3 HOH 49  630 630 HOH HOH B . 
G 3 HOH 50  631 631 HOH HOH B . 
G 3 HOH 51  632 632 HOH HOH B . 
G 3 HOH 52  633 633 HOH HOH B . 
G 3 HOH 53  634 634 HOH HOH B . 
G 3 HOH 54  635 635 HOH HOH B . 
G 3 HOH 55  646 646 HOH HOH B . 
G 3 HOH 56  647 647 HOH HOH B . 
G 3 HOH 57  648 648 HOH HOH B . 
G 3 HOH 58  649 649 HOH HOH B . 
G 3 HOH 59  650 650 HOH HOH B . 
G 3 HOH 60  651 651 HOH HOH B . 
G 3 HOH 61  658 658 HOH HOH B . 
G 3 HOH 62  669 669 HOH HOH B . 
G 3 HOH 63  675 675 HOH HOH B . 
G 3 HOH 64  676 676 HOH HOH B . 
G 3 HOH 65  677 677 HOH HOH B . 
G 3 HOH 66  678 678 HOH HOH B . 
G 3 HOH 67  679 679 HOH HOH B . 
G 3 HOH 68  680 680 HOH HOH B . 
G 3 HOH 69  681 681 HOH HOH B . 
G 3 HOH 70  682 682 HOH HOH B . 
G 3 HOH 71  683 683 HOH HOH B . 
G 3 HOH 72  684 684 HOH HOH B . 
G 3 HOH 73  688 688 HOH HOH B . 
G 3 HOH 74  689 689 HOH HOH B . 
G 3 HOH 75  690 690 HOH HOH B . 
G 3 HOH 76  691 691 HOH HOH B . 
H 3 HOH 1   540 540 HOH HOH D . 
H 3 HOH 2   587 587 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B PTH 2 C PTH 101 ? TYR CE1-METHYLENE-HYDROXY-PHOSPHOTYROSINE 
2 D PTH 2 D PTH 101 ? TYR CE1-METHYLENE-HYDROXY-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-04-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-08-10 
5 'Structure model' 1 4 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 5 'Structure model' 'Data collection'           
5 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' diffrn_source        
2 5 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_diffrn_source.source'              
2 5 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
R-AXIS 'data reduction' . ? 3 
R-AXIS 'data scaling'   . ? 4 
X-PLOR phasing          . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HH   A TYR 152 ? ? H2 A HOH 506 ? ? 0.82 
2  1 HH11 A ARG 208 ? ? H2 A HOH 580 ? ? 0.87 
3  1 H1   A HOH 529 ? ? H1 A HOH 544 ? ? 1.03 
4  1 H    A GLN 222 ? ? H2 A HOH 581 ? ? 1.05 
5  1 HG   A SER 188 ? ? CF C PTH 101 ? ? 1.05 
6  1 H    B LEU 226 ? ? H2 B HOH 556 ? ? 1.10 
7  1 H    A ASP 238 ? ? H1 A HOH 642 ? ? 1.10 
8  1 HG   A SER 145 ? ? H2 A HOH 664 ? ? 1.12 
9  1 H    B ARG 243 ? ? H1 B HOH 539 ? ? 1.13 
10 1 HZ2  A LYS 209 ? ? H1 A HOH 659 ? ? 1.14 
11 1 H2   A HOH 604 ? ? H1 C HOH 603 ? ? 1.16 
12 1 HH   A TYR 216 ? ? H1 A HOH 519 ? ? 1.19 
13 1 H1   A HOH 516 ? ? H2 B HOH 635 ? ? 1.21 
14 1 H    A ILE 217 ? ? H2 A HOH 518 ? ? 1.22 
15 1 H    B LYS 209 ? ? H2 B HOH 630 ? ? 1.23 
16 1 H    B ILE 217 ? ? H1 B HOH 537 ? ? 1.24 
17 1 HZ2  B LYS 206 ? ? H2 B HOH 688 ? ? 1.24 
18 1 HH21 B ARG 159 ? ? H1 B HOH 658 ? ? 1.24 
19 1 H    A VAL 247 ? ? H1 A HOH 565 ? ? 1.27 
20 1 H1   A HOH 578 ? ? H2 A HOH 605 ? ? 1.27 
21 1 H    D PTH 101 ? ? H1 D HOH 587 ? ? 1.27 
22 1 H    B ALA 237 ? ? H2 B HOH 634 ? ? 1.35 
23 1 HZ3  A LYS 209 ? ? H2 A HOH 636 ? ? 1.35 
24 1 OG   A SER 188 ? ? CF C PTH 101 ? ? 1.40 
25 1 HZ3  A LYS 206 ? ? O  A HOH 657 ? ? 1.59 
26 1 O    A HOH 550 ? ? O  B HOH 669 ? ? 2.12 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 HD22 B ASN 224 ? ? 1_555 O    A HOH 529 ? ? 4_456 0.67 
2  1 HH12 B ARG 159 ? ? 1_555 H1   A HOH 503 ? ? 3_745 0.91 
3  1 O    A GLU 169 ? ? 1_555 HH22 B ARG 172 ? ? 4_456 0.97 
4  1 HD22 B ASN 224 ? ? 1_555 H1   A HOH 529 ? ? 4_456 1.16 
5  1 O    A SER 219 ? ? 1_555 HE   B ARG 208 ? ? 2_654 1.26 
6  1 HH12 B ARG 159 ? ? 1_555 O    A HOH 503 ? ? 3_745 1.35 
7  1 ND2  B ASN 224 ? ? 1_555 O    A HOH 529 ? ? 4_456 1.40 
8  1 OH   B TYR 216 ? ? 1_555 H1   A HOH 521 ? ? 2_655 1.56 
9  1 O    B ASN 224 ? ? 1_555 H2   A HOH 544 ? ? 4_456 1.57 
10 1 O    A HOH 665 ? ? 1_555 O    B HOH 589 ? ? 3_755 1.65 
11 1 O    A GLU 169 ? ? 1_555 NH2  B ARG 172 ? ? 4_456 1.86 
12 1 OH   B TYR 216 ? ? 1_555 O    A HOH 521 ? ? 2_655 1.98 
13 1 O    A HOH 693 ? ? 1_555 O    B HOH 538 ? ? 4_556 2.15 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB  A SER 188 ? ? OG  A SER 188 ? ? 1.499 1.418 0.081  0.013 N 
2 1 NE2 A HIS 204 ? ? CD2 A HIS 204 ? ? 1.290 1.373 -0.083 0.011 N 
3 1 NE2 A HIS 242 ? ? CD2 A HIS 242 ? ? 1.296 1.373 -0.077 0.011 N 
4 1 NE2 B HIS 204 ? ? CD2 B HIS 204 ? ? 1.302 1.373 -0.071 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD1 A TRP 151 ? ? CG  A TRP 151 ? ? CD2 A TRP 151 ? ? 112.94 106.30 6.64   0.80 N 
2  1 CE2 A TRP 151 ? ? CD2 A TRP 151 ? ? CG  A TRP 151 ? ? 101.10 107.30 -6.20  0.80 N 
3  1 NE  A ARG 158 ? ? CZ  A ARG 158 ? ? NH1 A ARG 158 ? ? 124.59 120.30 4.29   0.50 N 
4  1 NE  A ARG 158 ? ? CZ  A ARG 158 ? ? NH2 A ARG 158 ? ? 115.86 120.30 -4.44  0.50 N 
5  1 CD1 B TRP 151 ? ? CG  B TRP 151 ? ? CD2 B TRP 151 ? ? 114.12 106.30 7.82   0.80 N 
6  1 CB  B TRP 151 ? ? CG  B TRP 151 ? ? CD1 B TRP 151 ? ? 119.18 127.00 -7.82  1.30 N 
7  1 CG  B TRP 151 ? ? CD1 B TRP 151 ? ? NE1 B TRP 151 ? ? 104.06 110.10 -6.04  1.00 N 
8  1 CE2 B TRP 151 ? ? CD2 B TRP 151 ? ? CG  B TRP 151 ? ? 100.78 107.30 -6.52  0.80 N 
9  1 NE  B ARG 158 ? ? CZ  B ARG 158 ? ? NH2 B ARG 158 ? ? 115.44 120.30 -4.86  0.50 N 
10 1 CA  B GLU 169 ? ? C   B GLU 169 ? ? N   B ASN 170 ? ? 102.45 117.20 -14.75 2.20 Y 
11 1 NE  B ARG 208 ? ? CZ  B ARG 208 ? ? NH2 B ARG 208 ? ? 117.17 120.30 -3.13  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 197 ? ? -165.61 -44.81  
2 1 THR A 245 ? ? -110.67 -82.02  
3 1 ASN B 167 ? ? -105.46 68.77   
4 1 ALA B 168 ? ? -179.84 -150.97 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 LEU A 176 ? ? 12.87 
2 1 GLU B 169 ? ? 22.52 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 144 ? CG  ? A ASP 2  CG  
2  1 Y 1 A ASP 144 ? OD1 ? A ASP 2  OD1 
3  1 Y 1 A ASP 144 ? OD2 ? A ASP 2  OD2 
4  1 Y 1 A LYS 184 ? CG  ? A LYS 42 CG  
5  1 Y 1 A LYS 184 ? CD  ? A LYS 42 CD  
6  1 Y 1 A LYS 184 ? CE  ? A LYS 42 CE  
7  1 Y 1 A LYS 184 ? NZ  ? A LYS 42 NZ  
8  1 Y 1 A ASN 196 ? CG  ? A ASN 54 CG  
9  1 Y 1 A ASN 196 ? OD1 ? A ASN 54 OD1 
10 1 Y 1 A ASN 196 ? ND2 ? A ASN 54 ND2 
11 1 Y 1 A LYS 198 ? CG  ? A LYS 56 CG  
12 1 Y 1 A LYS 198 ? CD  ? A LYS 56 CD  
13 1 Y 1 A LYS 198 ? CE  ? A LYS 56 CE  
14 1 Y 1 A LYS 198 ? NZ  ? A LYS 56 NZ  
15 1 Y 1 B GLU 169 ? CG  ? C GLU 27 CG  
16 1 Y 1 B GLU 169 ? CD  ? C GLU 27 CD  
17 1 Y 1 B GLU 169 ? OE1 ? C GLU 27 OE1 
18 1 Y 1 B GLU 169 ? OE2 ? C GLU 27 OE2 
19 1 Y 1 B LYS 184 ? CG  ? C LYS 42 CG  
20 1 Y 1 B LYS 184 ? CD  ? C LYS 42 CD  
21 1 Y 1 B LYS 184 ? CE  ? C LYS 42 CE  
22 1 Y 1 B LYS 184 ? NZ  ? C LYS 42 NZ  
23 1 Y 1 B ASN 196 ? CG  ? C ASN 54 CG  
24 1 Y 1 B ASN 196 ? OD1 ? C ASN 54 OD1 
25 1 Y 1 B ASN 196 ? ND2 ? C ASN 54 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 143 ? A MET 1 
2 1 Y 1 B MET 143 ? C MET 1 
3 1 Y 1 B ASP 144 ? C ASP 2 
4 1 Y 1 B SER 145 ? C SER 3 
5 1 Y 1 B ILE 146 ? C ILE 4 
6 1 Y 1 B GLN 147 ? C GLN 5 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#