data_1A1E
# 
_entry.id   1A1E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A1E         
WWPDB D_1000170272 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A1E 
_pdbx_database_status.recvd_initial_deposition_date   1997-12-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shewchuk, L.' 1 
'Jordan, S.'   2 
# 
_citation.id                        primary 
_citation.title                     'Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            36 
_citation.page_first                6283 
_citation.page_last                 6293 
_citation.year                      1997 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9174343 
_citation.pdbx_database_id_DOI      10.1021/bi970019n 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Charifson, P.S.' 1  
primary 'Shewchuk, L.M.'  2  
primary 'Rocque, W.'      3  
primary 'Hummel, C.W.'    4  
primary 'Jordan, S.R.'    5  
primary 'Mohr, C.'        6  
primary 'Pacofsky, G.J.'  7  
primary 'Peel, M.R.'      8  
primary 'Rodriguez, M.'   9  
primary 'Sternbach, D.D.' 10 
primary 'Consler, T.G.'   11 
# 
_cell.entry_id           1A1E 
_cell.length_a           51.600 
_cell.length_b           67.200 
_cell.length_c           75.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1A1E 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'C-SRC TYROSINE KINASE'                  12303.886 2  2.7.1.112 ? 'SH2 DOMAIN' ? 
2 polymer man 'ACE-PHOSPHOTYR-GLU-(3-BUTYLPIPERIDINE)' 539.558   2  ?         ? ?            ? 
3 water   nat water                                    18.015    44 ?         ? ?            ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
;
;MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
;
A,B ? 
2 'polypeptide(L)' no yes '(ACE)(PTR)E(DIY)' XYEX C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   SER n 
1 4   ILE n 
1 5   GLN n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   TRP n 
1 10  TYR n 
1 11  PHE n 
1 12  GLY n 
1 13  LYS n 
1 14  ILE n 
1 15  THR n 
1 16  ARG n 
1 17  ARG n 
1 18  GLU n 
1 19  SER n 
1 20  GLU n 
1 21  ARG n 
1 22  LEU n 
1 23  LEU n 
1 24  LEU n 
1 25  ASN n 
1 26  ALA n 
1 27  GLU n 
1 28  ASN n 
1 29  PRO n 
1 30  ARG n 
1 31  GLY n 
1 32  THR n 
1 33  PHE n 
1 34  LEU n 
1 35  VAL n 
1 36  ARG n 
1 37  GLU n 
1 38  SER n 
1 39  GLU n 
1 40  THR n 
1 41  THR n 
1 42  LYS n 
1 43  GLY n 
1 44  ALA n 
1 45  TYR n 
1 46  CYS n 
1 47  LEU n 
1 48  SER n 
1 49  VAL n 
1 50  SER n 
1 51  ASP n 
1 52  PHE n 
1 53  ASP n 
1 54  ASN n 
1 55  ALA n 
1 56  LYS n 
1 57  GLY n 
1 58  LEU n 
1 59  ASN n 
1 60  VAL n 
1 61  LYS n 
1 62  HIS n 
1 63  TYR n 
1 64  LYS n 
1 65  ILE n 
1 66  ARG n 
1 67  LYS n 
1 68  LEU n 
1 69  ASP n 
1 70  SER n 
1 71  GLY n 
1 72  GLY n 
1 73  PHE n 
1 74  TYR n 
1 75  ILE n 
1 76  THR n 
1 77  SER n 
1 78  ARG n 
1 79  THR n 
1 80  GLN n 
1 81  PHE n 
1 82  ASN n 
1 83  SER n 
1 84  LEU n 
1 85  GLN n 
1 86  GLN n 
1 87  LEU n 
1 88  VAL n 
1 89  ALA n 
1 90  TYR n 
1 91  TYR n 
1 92  SER n 
1 93  LYS n 
1 94  HIS n 
1 95  ALA n 
1 96  ASP n 
1 97  GLY n 
1 98  LEU n 
1 99  CYS n 
1 100 HIS n 
1 101 ARG n 
1 102 LEU n 
1 103 THR n 
1 104 THR n 
1 105 VAL n 
1 106 CYS n 
1 107 PRO n 
2 1   ACE n 
2 2   PTR n 
2 3   GLU n 
2 4   DIY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SRC 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    CYTOPLASM 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 SRC 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP SRC_HUMAN 1 P12931 1 
;GSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGP
LAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRES
ERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLC
HRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLR
HEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENL
VCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERG
YRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
;
? 
2 PDB 1A1E      2 1A1E   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A1E A 2 ? 107 ? P12931 143 ? 248 ? 144 249 
2 1 1A1E B 2 ? 107 ? P12931 143 ? 248 ? 144 249 
3 2 1A1E C 1 ? 4   ? 1A1E   100 ? 103 ? 100 103 
4 2 1A1E D 1 ? 4   ? 1A1E   100 ? 103 ? 100 103 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'    ?                 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE           ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ?                 'C3 H7 N O2 S'   121.158 
DIY non-polymer         . 5-BUTYLPIPERIDINE ?                 'C9 H19 N'       141.254 
GLN 'L-peptide linking' y GLUTAMINE         ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ?                 'C5 H9 N O2'     115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P'  261.168 
SER 'L-peptide linking' y SERINE            ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1A1E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.6 
_exptl_crystal.density_percent_sol   54. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLIZED FROM 2M AMMONIUM SULFATE AT 22 DEGREES C., pH 8.0, temperature 295K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           295 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IIC' 
_diffrn_detector.pdbx_collection_date   1993-11 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A1E 
_reflns.observed_criterion_sigma_I   1. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             43.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   11927 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92. 
_reflns.pdbx_Rmerge_I_obs            0.0440000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11. 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_all   84. 
_reflns_shell.Rmerge_I_obs           0.1500000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.7 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A1E 
_refine.ls_number_reflns_obs                     15626 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               100000. 
_refine.pdbx_data_cutoff_low_absF                0. 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6. 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    91. 
_refine.ls_R_factor_obs                          0.1920000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1920000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;PARTIALLY REFINED. NO SIDE CHAIN DENSITY FOR THE FOLLOWING
RESIDUES, THEREFORE MODELLED AS ALA: LYS A 184, ASN A 196,
LYS A 198, ASP A 211, GLN B 147, LYS B 155, GLU B 169,
LYS B 184, ASP B 195, ASN B 196, LYS B 198, ASP B 211,
LYS B 235.
NO DENSITY VISIBLE FOR THE FOLLOWING RESIDUES, THEREFORE
NOT INCLUDED IN THE MODEL: MET A 143, ASP A 144, SER A 145,
MET B 143, ASP B 144, SER B 145.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1SHD' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1639 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         76 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               1759 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        6. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.128 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.09 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   UNRESTRAINED 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.2 
_refine_ls_shell.d_res_low                        2.3 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.percent_reflns_obs               82. 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.PTY  PARAM19.PTY 'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.793000 
_struct_ncs_oper.matrix[1][2]   0.304500 
_struct_ncs_oper.matrix[1][3]   -0.527600 
_struct_ncs_oper.matrix[2][1]   0.305400 
_struct_ncs_oper.matrix[2][2]   0.948100 
_struct_ncs_oper.matrix[2][3]   0.088100 
_struct_ncs_oper.matrix[3][1]   0.527100 
_struct_ncs_oper.matrix[3][2]   -0.091300 
_struct_ncs_oper.matrix[3][3]   -0.844900 
_struct_ncs_oper.vector[1]      97.85380 
_struct_ncs_oper.vector[2]      -1.15720 
_struct_ncs_oper.vector[3]      33.29030 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1A1E 
_struct.title                     'C-SRC (SH2 DOMAIN) COMPLEXED WITH ACE-PHOSPHOTYR-GLU-(3-BUTYLPIPERIDINE)' 
_struct.pdbx_descriptor           'C-SRC TYROSINE KINASE, ACE-PHOSPHOTYR-GLU-(3-BUTYLPIPERIDINE)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A1E 
_struct_keywords.pdbx_keywords   'COMPLEX (TRANSFERASE/PEPTIDE)' 
_struct_keywords.text            'COMPLEX (TRANSFERASE-PEPTIDE), COMPLEX (TRANSFERASE-PEPTIDE) complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 16 ? LEU A 23 ? ARG A 158 LEU A 165 1 ? 8  
HELX_P HELX_P2 2 LEU A 84 ? LYS A 93 ? LEU A 226 LYS A 235 1 ? 10 
HELX_P HELX_P3 3 ARG B 16 ? LEU B 23 ? ARG B 158 LEU B 165 1 ? 8  
HELX_P HELX_P4 4 LEU B 84 ? LYS B 93 ? LEU B 226 LYS B 235 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? C ACE 1 C  ? ? ? 1_555 C PTR 2 N ? ? C ACE 100 C PTR 101 1_555 ? ? ? ? ? ? ? 1.319 ? 
covale2 covale ? ? C PTR 2 C  ? ? ? 1_555 C GLU 3 N ? ? C PTR 101 C GLU 102 1_555 ? ? ? ? ? ? ? 1.310 ? 
covale3 covale ? ? C DIY 4 N1 ? ? ? 1_555 C GLU 3 C ? ? C DIY 103 C GLU 102 1_555 ? ? ? ? ? ? ? 1.379 ? 
covale4 covale ? ? D ACE 1 C  ? ? ? 1_555 D PTR 2 N ? ? D ACE 100 D PTR 101 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale5 covale ? ? D PTR 2 C  ? ? ? 1_555 D GLU 3 N ? ? D PTR 101 D GLU 102 1_555 ? ? ? ? ? ? ? 1.302 ? 
covale6 covale ? ? D DIY 4 N1 ? ? ? 1_555 D GLU 3 C ? ? D DIY 103 D GLU 102 1_555 ? ? ? ? ? ? ? 1.360 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 33 ? GLU A 37 ? PHE A 175 GLU A 179 
A 2 TYR A 45 ? ASP A 53 ? TYR A 187 ASP A 195 
A 3 GLY A 57 ? ILE A 65 ? GLY A 199 ILE A 207 
B 1 PHE B 33 ? GLU B 37 ? PHE B 175 GLU B 179 
B 2 TYR B 45 ? ASP B 53 ? TYR B 187 ASP B 195 
B 3 GLY B 57 ? ILE B 65 ? GLY B 199 ILE B 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 34 ? O LEU A 176 N SER A 48 ? N SER A 190 
A 2 3 O TYR A 45 ? O TYR A 187 N ILE A 65 ? N ILE A 207 
B 1 2 O LEU B 34 ? O LEU B 176 N SER B 48 ? N SER B 190 
B 2 3 O TYR B 45 ? O TYR B 187 N ILE B 65 ? N ILE B 207 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACE C 100' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ACE D 100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ARG A 16 ? ARG A 158 . ? 1_555 ? 
2 AC1 2 HOH G .  ? HOH C 509 . ? 1_555 ? 
3 AC2 2 ARG B 16 ? ARG B 158 . ? 1_555 ? 
4 AC2 2 HOH H .  ? HOH D 506 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1A1E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A1E 
_atom_sites.fract_transf_matrix[1][1]   0.019380 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014881 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013298 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . ILE A 1 4   ? 57.904 24.527  16.458 1.00 39.85 ? 146 ILE A N     1 
ATOM   2    C CA    . ILE A 1 4   ? 56.635 24.239  17.114 1.00 34.90 ? 146 ILE A CA    1 
ATOM   3    C C     . ILE A 1 4   ? 56.572 24.562  18.605 1.00 30.37 ? 146 ILE A C     1 
ATOM   4    O O     . ILE A 1 4   ? 55.469 24.718  19.110 1.00 28.58 ? 146 ILE A O     1 
ATOM   5    C CB    . ILE A 1 4   ? 56.298 22.729  16.823 1.00 41.60 ? 146 ILE A CB    1 
ATOM   6    C CG1   . ILE A 1 4   ? 54.801 22.586  16.888 1.00 46.86 ? 146 ILE A CG1   1 
ATOM   7    C CG2   . ILE A 1 4   ? 56.788 21.712  17.860 1.00 40.93 ? 146 ILE A CG2   1 
ATOM   8    C CD1   . ILE A 1 4   ? 54.254 21.316  16.167 1.00 51.24 ? 146 ILE A CD1   1 
ATOM   9    N N     . GLN A 1 5   ? 57.662 24.770  19.354 1.00 25.21 ? 147 GLN A N     1 
ATOM   10   C CA    . GLN A 1 5   ? 57.613 25.033  20.783 1.00 26.40 ? 147 GLN A CA    1 
ATOM   11   C C     . GLN A 1 5   ? 56.900 26.327  21.164 1.00 29.28 ? 147 GLN A C     1 
ATOM   12   O O     . GLN A 1 5   ? 56.362 26.525  22.258 1.00 29.11 ? 147 GLN A O     1 
ATOM   13   C CB    . GLN A 1 5   ? 59.011 25.055  21.332 1.00 30.06 ? 147 GLN A CB    1 
ATOM   14   C CG    . GLN A 1 5   ? 59.793 23.746  21.131 1.00 35.31 ? 147 GLN A CG    1 
ATOM   15   C CD    . GLN A 1 5   ? 59.327 22.536  21.926 1.00 34.04 ? 147 GLN A CD    1 
ATOM   16   O OE1   . GLN A 1 5   ? 58.589 22.624  22.893 1.00 40.21 ? 147 GLN A OE1   1 
ATOM   17   N NE2   . GLN A 1 5   ? 59.747 21.350  21.557 1.00 37.74 ? 147 GLN A NE2   1 
ATOM   18   H H     . GLN A 1 5   ? 58.538 24.744  18.916 1.00 0.00  ? 147 GLN A H     1 
ATOM   19   H HE21  . GLN A 1 5   ? 59.440 20.580  22.077 1.00 0.00  ? 147 GLN A HE21  1 
ATOM   20   H HE22  . GLN A 1 5   ? 60.346 21.260  20.786 1.00 0.00  ? 147 GLN A HE22  1 
ATOM   21   N N     . ALA A 1 6   ? 56.845 27.237  20.207 1.00 32.66 ? 148 ALA A N     1 
ATOM   22   C CA    . ALA A 1 6   ? 56.186 28.522  20.346 1.00 29.62 ? 148 ALA A CA    1 
ATOM   23   C C     . ALA A 1 6   ? 54.837 28.636  19.657 1.00 30.54 ? 148 ALA A C     1 
ATOM   24   O O     . ALA A 1 6   ? 54.261 29.721  19.634 1.00 35.64 ? 148 ALA A O     1 
ATOM   25   C CB    . ALA A 1 6   ? 57.071 29.539  19.779 1.00 33.63 ? 148 ALA A CB    1 
ATOM   26   H H     . ALA A 1 6   ? 57.275 27.031  19.352 1.00 0.00  ? 148 ALA A H     1 
ATOM   27   N N     . GLU A 1 7   ? 54.304 27.566  19.064 1.00 29.35 ? 149 GLU A N     1 
ATOM   28   C CA    . GLU A 1 7   ? 52.959 27.627  18.498 1.00 31.31 ? 149 GLU A CA    1 
ATOM   29   C C     . GLU A 1 7   ? 51.949 27.843  19.603 1.00 32.05 ? 149 GLU A C     1 
ATOM   30   O O     . GLU A 1 7   ? 52.005 27.254  20.687 1.00 34.74 ? 149 GLU A O     1 
ATOM   31   C CB    . GLU A 1 7   ? 52.607 26.338  17.774 1.00 33.07 ? 149 GLU A CB    1 
ATOM   32   C CG    . GLU A 1 7   ? 53.382 26.299  16.475 1.00 40.36 ? 149 GLU A CG    1 
ATOM   33   C CD    . GLU A 1 7   ? 52.943 27.296  15.388 1.00 46.61 ? 149 GLU A CD    1 
ATOM   34   O OE1   . GLU A 1 7   ? 51.985 28.070  15.565 1.00 52.98 ? 149 GLU A OE1   1 
ATOM   35   O OE2   . GLU A 1 7   ? 53.552 27.293  14.313 1.00 47.50 ? 149 GLU A OE2   1 
ATOM   36   H H     . GLU A 1 7   ? 54.818 26.734  19.008 1.00 0.00  ? 149 GLU A H     1 
ATOM   37   N N     . GLU A 1 8   ? 51.010 28.723  19.322 1.00 30.84 ? 150 GLU A N     1 
ATOM   38   C CA    . GLU A 1 8   ? 49.965 29.075  20.274 1.00 32.89 ? 150 GLU A CA    1 
ATOM   39   C C     . GLU A 1 8   ? 49.084 27.883  20.681 1.00 32.29 ? 150 GLU A C     1 
ATOM   40   O O     . GLU A 1 8   ? 48.588 27.727  21.802 1.00 30.75 ? 150 GLU A O     1 
ATOM   41   C CB    . GLU A 1 8   ? 49.102 30.170  19.661 1.00 38.22 ? 150 GLU A CB    1 
ATOM   42   C CG    . GLU A 1 8   ? 48.796 29.816  18.214 1.00 54.79 ? 150 GLU A CG    1 
ATOM   43   C CD    . GLU A 1 8   ? 47.701 30.562  17.446 1.00 67.00 ? 150 GLU A CD    1 
ATOM   44   O OE1   . GLU A 1 8   ? 46.993 31.404  18.042 1.00 70.62 ? 150 GLU A OE1   1 
ATOM   45   O OE2   . GLU A 1 8   ? 47.540 30.273  16.229 1.00 73.19 ? 150 GLU A OE2   1 
ATOM   46   H H     . GLU A 1 8   ? 51.015 29.156  18.443 1.00 0.00  ? 150 GLU A H     1 
ATOM   47   N N     . TRP A 1 9   ? 48.882 26.974  19.727 1.00 31.94 ? 151 TRP A N     1 
ATOM   48   C CA    . TRP A 1 9   ? 48.074 25.816  20.002 1.00 29.61 ? 151 TRP A CA    1 
ATOM   49   C C     . TRP A 1 9   ? 48.911 24.659  20.505 1.00 29.07 ? 151 TRP A C     1 
ATOM   50   O O     . TRP A 1 9   ? 48.288 23.707  20.921 1.00 32.24 ? 151 TRP A O     1 
ATOM   51   C CB    . TRP A 1 9   ? 47.318 25.401  18.749 1.00 28.05 ? 151 TRP A CB    1 
ATOM   52   C CG    . TRP A 1 9   ? 48.172 25.378  17.495 1.00 28.52 ? 151 TRP A CG    1 
ATOM   53   C CD1   . TRP A 1 9   ? 48.006 26.429  16.657 1.00 31.21 ? 151 TRP A CD1   1 
ATOM   54   C CD2   . TRP A 1 9   ? 49.126 24.465  17.071 1.00 30.03 ? 151 TRP A CD2   1 
ATOM   55   N NE1   . TRP A 1 9   ? 48.876 26.200  15.686 1.00 35.02 ? 151 TRP A NE1   1 
ATOM   56   C CE2   . TRP A 1 9   ? 49.557 25.062  15.895 1.00 28.55 ? 151 TRP A CE2   1 
ATOM   57   C CE3   . TRP A 1 9   ? 49.718 23.259  17.448 1.00 29.46 ? 151 TRP A CE3   1 
ATOM   58   C CZ2   . TRP A 1 9   ? 50.528 24.478  15.084 1.00 24.69 ? 151 TRP A CZ2   1 
ATOM   59   C CZ3   . TRP A 1 9   ? 50.697 22.673  16.664 1.00 21.48 ? 151 TRP A CZ3   1 
ATOM   60   C CH2   . TRP A 1 9   ? 51.105 23.278  15.494 1.00 27.93 ? 151 TRP A CH2   1 
ATOM   61   H H     . TRP A 1 9   ? 49.283 27.094  18.841 1.00 0.00  ? 151 TRP A H     1 
ATOM   62   H HE1   . TRP A 1 9   ? 49.006 26.785  14.914 1.00 0.00  ? 151 TRP A HE1   1 
ATOM   63   N N     . TYR A 1 10  ? 50.249 24.671  20.526 1.00 25.53 ? 152 TYR A N     1 
ATOM   64   C CA    . TYR A 1 10  ? 51.032 23.544  20.950 1.00 21.14 ? 152 TYR A CA    1 
ATOM   65   C C     . TYR A 1 10  ? 51.331 23.647  22.425 1.00 24.05 ? 152 TYR A C     1 
ATOM   66   O O     . TYR A 1 10  ? 51.958 24.637  22.825 1.00 25.67 ? 152 TYR A O     1 
ATOM   67   C CB    . TYR A 1 10  ? 52.327 23.500  20.155 1.00 25.04 ? 152 TYR A CB    1 
ATOM   68   C CG    . TYR A 1 10  ? 53.093 22.214  20.433 1.00 25.76 ? 152 TYR A CG    1 
ATOM   69   C CD1   . TYR A 1 10  ? 52.523 20.993  20.031 1.00 28.43 ? 152 TYR A CD1   1 
ATOM   70   C CD2   . TYR A 1 10  ? 54.316 22.252  21.117 1.00 23.17 ? 152 TYR A CD2   1 
ATOM   71   C CE1   . TYR A 1 10  ? 53.183 19.797  20.323 1.00 26.40 ? 152 TYR A CE1   1 
ATOM   72   C CE2   . TYR A 1 10  ? 54.968 21.064  21.415 1.00 25.82 ? 152 TYR A CE2   1 
ATOM   73   C CZ    . TYR A 1 10  ? 54.391 19.856  21.008 1.00 24.81 ? 152 TYR A CZ    1 
ATOM   74   O OH    . TYR A 1 10  ? 55.042 18.697  21.284 1.00 26.29 ? 152 TYR A OH    1 
ATOM   75   H H     . TYR A 1 10  ? 50.715 25.484  20.240 1.00 0.00  ? 152 TYR A H     1 
ATOM   76   H HH    . TYR A 1 10  ? 54.533 17.956  20.948 1.00 0.00  ? 152 TYR A HH    1 
ATOM   77   N N     . PHE A 1 11  ? 50.926 22.617  23.219 1.00 17.07 ? 153 PHE A N     1 
ATOM   78   C CA    . PHE A 1 11  ? 51.145 22.606  24.643 1.00 15.27 ? 153 PHE A CA    1 
ATOM   79   C C     . PHE A 1 11  ? 52.146 21.610  25.185 1.00 19.69 ? 153 PHE A C     1 
ATOM   80   O O     . PHE A 1 11  ? 52.141 21.250  26.360 1.00 21.27 ? 153 PHE A O     1 
ATOM   81   C CB    . PHE A 1 11  ? 49.832 22.422  25.318 1.00 14.84 ? 153 PHE A CB    1 
ATOM   82   C CG    . PHE A 1 11  ? 48.978 23.696  25.362 1.00 16.47 ? 153 PHE A CG    1 
ATOM   83   C CD1   . PHE A 1 11  ? 48.343 24.202  24.217 1.00 23.76 ? 153 PHE A CD1   1 
ATOM   84   C CD2   . PHE A 1 11  ? 48.772 24.358  26.573 1.00 20.62 ? 153 PHE A CD2   1 
ATOM   85   C CE1   . PHE A 1 11  ? 47.516 25.335  24.269 1.00 19.10 ? 153 PHE A CE1   1 
ATOM   86   C CE2   . PHE A 1 11  ? 47.940 25.497  26.627 1.00 21.45 ? 153 PHE A CE2   1 
ATOM   87   C CZ    . PHE A 1 11  ? 47.320 25.976  25.484 1.00 20.56 ? 153 PHE A CZ    1 
ATOM   88   H H     . PHE A 1 11  ? 50.469 21.855  22.806 1.00 0.00  ? 153 PHE A H     1 
ATOM   89   N N     . GLY A 1 12  ? 53.073 21.177  24.334 1.00 20.81 ? 154 GLY A N     1 
ATOM   90   C CA    . GLY A 1 12  ? 54.199 20.327  24.726 1.00 23.48 ? 154 GLY A CA    1 
ATOM   91   C C     . GLY A 1 12  ? 53.868 19.004  25.431 1.00 26.43 ? 154 GLY A C     1 
ATOM   92   O O     . GLY A 1 12  ? 53.008 18.224  25.024 1.00 29.67 ? 154 GLY A O     1 
ATOM   93   H H     . GLY A 1 12  ? 52.998 21.441  23.394 1.00 0.00  ? 154 GLY A H     1 
ATOM   94   N N     . LYS A 1 13  ? 54.538 18.775  26.538 1.00 25.62 ? 155 LYS A N     1 
ATOM   95   C CA    . LYS A 1 13  ? 54.435 17.588  27.340 1.00 25.46 ? 155 LYS A CA    1 
ATOM   96   C C     . LYS A 1 13  ? 53.436 17.676  28.462 1.00 26.91 ? 155 LYS A C     1 
ATOM   97   O O     . LYS A 1 13  ? 53.607 16.963  29.452 1.00 28.91 ? 155 LYS A O     1 
ATOM   98   C CB    . LYS A 1 13  ? 55.802 17.281  27.909 1.00 28.16 ? 155 LYS A CB    1 
ATOM   99   C CG    . LYS A 1 13  ? 56.841 16.872  26.873 1.00 27.91 ? 155 LYS A CG    1 
ATOM   100  C CD    . LYS A 1 13  ? 58.261 16.839  27.463 1.00 34.11 ? 155 LYS A CD    1 
ATOM   101  C CE    . LYS A 1 13  ? 59.260 16.042  26.628 1.00 39.72 ? 155 LYS A CE    1 
ATOM   102  N NZ    . LYS A 1 13  ? 59.159 16.344  25.206 1.00 52.82 ? 155 LYS A NZ    1 
ATOM   103  H H     . LYS A 1 13  ? 55.158 19.470  26.841 1.00 0.00  ? 155 LYS A H     1 
ATOM   104  H HZ1   . LYS A 1 13  ? 58.202 16.113  24.870 1.00 0.00  ? 155 LYS A HZ1   1 
ATOM   105  H HZ2   . LYS A 1 13  ? 59.346 17.355  25.052 1.00 0.00  ? 155 LYS A HZ2   1 
ATOM   106  H HZ3   . LYS A 1 13  ? 59.856 15.779  24.681 1.00 0.00  ? 155 LYS A HZ3   1 
ATOM   107  N N     . ILE A 1 14  ? 52.417 18.539  28.459 1.00 28.13 ? 156 ILE A N     1 
ATOM   108  C CA    . ILE A 1 14  ? 51.444 18.528  29.538 1.00 26.74 ? 156 ILE A CA    1 
ATOM   109  C C     . ILE A 1 14  ? 50.741 17.168  29.599 1.00 30.47 ? 156 ILE A C     1 
ATOM   110  O O     . ILE A 1 14  ? 50.695 16.420  28.599 1.00 30.47 ? 156 ILE A O     1 
ATOM   111  C CB    . ILE A 1 14  ? 50.353 19.629  29.386 1.00 25.70 ? 156 ILE A CB    1 
ATOM   112  C CG1   . ILE A 1 14  ? 49.647 19.615  28.041 1.00 18.49 ? 156 ILE A CG1   1 
ATOM   113  C CG2   . ILE A 1 14  ? 51.060 20.967  29.637 1.00 31.61 ? 156 ILE A CG2   1 
ATOM   114  C CD1   . ILE A 1 14  ? 48.375 20.403  28.293 1.00 22.02 ? 156 ILE A CD1   1 
ATOM   115  H H     . ILE A 1 14  ? 52.325 19.183  27.726 1.00 0.00  ? 156 ILE A H     1 
ATOM   116  N N     . THR A 1 15  ? 50.166 16.816  30.750 1.00 27.43 ? 157 THR A N     1 
ATOM   117  C CA    . THR A 1 15  ? 49.619 15.484  30.873 1.00 26.27 ? 157 THR A CA    1 
ATOM   118  C C     . THR A 1 15  ? 48.213 15.454  30.360 1.00 26.83 ? 157 THR A C     1 
ATOM   119  O O     . THR A 1 15  ? 47.620 16.518  30.167 1.00 30.00 ? 157 THR A O     1 
ATOM   120  C CB    . THR A 1 15  ? 49.659 15.043  32.334 1.00 23.93 ? 157 THR A CB    1 
ATOM   121  O OG1   . THR A 1 15  ? 48.891 15.980  33.050 1.00 23.94 ? 157 THR A OG1   1 
ATOM   122  C CG2   . THR A 1 15  ? 51.066 14.970  32.892 1.00 20.75 ? 157 THR A CG2   1 
ATOM   123  H H     . THR A 1 15  ? 50.116 17.448  31.497 1.00 0.00  ? 157 THR A H     1 
ATOM   124  H HG1   . THR A 1 15  ? 49.272 16.855  32.944 1.00 0.00  ? 157 THR A HG1   1 
ATOM   125  N N     . ARG A 1 16  ? 47.657 14.264  30.148 1.00 22.17 ? 158 ARG A N     1 
ATOM   126  C CA    . ARG A 1 16  ? 46.308 14.100  29.731 1.00 18.73 ? 158 ARG A CA    1 
ATOM   127  C C     . ARG A 1 16  ? 45.369 14.784  30.729 1.00 21.18 ? 158 ARG A C     1 
ATOM   128  O O     . ARG A 1 16  ? 44.358 15.444  30.413 1.00 19.46 ? 158 ARG A O     1 
ATOM   129  C CB    . ARG A 1 16  ? 46.043 12.607  29.634 1.00 23.95 ? 158 ARG A CB    1 
ATOM   130  C CG    . ARG A 1 16  ? 44.580 12.434  29.388 1.00 20.12 ? 158 ARG A CG    1 
ATOM   131  C CD    . ARG A 1 16  ? 44.092 11.075  29.706 1.00 23.23 ? 158 ARG A CD    1 
ATOM   132  N NE    . ARG A 1 16  ? 44.070 10.526  28.381 1.00 24.48 ? 158 ARG A NE    1 
ATOM   133  C CZ    . ARG A 1 16  ? 42.939 10.163  27.789 1.00 21.65 ? 158 ARG A CZ    1 
ATOM   134  N NH1   . ARG A 1 16  ? 41.735 10.274  28.373 1.00 23.88 ? 158 ARG A NH1   1 
ATOM   135  N NH2   . ARG A 1 16  ? 43.076 9.744   26.527 1.00 23.22 ? 158 ARG A NH2   1 
ATOM   136  H H     . ARG A 1 16  ? 48.203 13.463  30.286 1.00 0.00  ? 158 ARG A H     1 
ATOM   137  H HE    . ARG A 1 16  ? 44.916 10.416  27.898 1.00 0.00  ? 158 ARG A HE    1 
ATOM   138  H HH11  . ARG A 1 16  ? 41.661 10.645  29.299 1.00 0.00  ? 158 ARG A HH11  1 
ATOM   139  H HH12  . ARG A 1 16  ? 40.913 9.985   27.882 1.00 0.00  ? 158 ARG A HH12  1 
ATOM   140  H HH21  . ARG A 1 16  ? 43.981 9.723   26.103 1.00 0.00  ? 158 ARG A HH21  1 
ATOM   141  H HH22  . ARG A 1 16  ? 42.273 9.452   26.007 1.00 0.00  ? 158 ARG A HH22  1 
ATOM   142  N N     . ARG A 1 17  ? 45.712 14.595  31.974 1.00 24.90 ? 159 ARG A N     1 
ATOM   143  C CA    . ARG A 1 17  ? 44.917 15.188  33.018 1.00 29.49 ? 159 ARG A CA    1 
ATOM   144  C C     . ARG A 1 17  ? 44.963 16.732  33.011 1.00 31.46 ? 159 ARG A C     1 
ATOM   145  O O     . ARG A 1 17  ? 43.925 17.388  33.193 1.00 32.74 ? 159 ARG A O     1 
ATOM   146  C CB    . ARG A 1 17  ? 45.421 14.638  34.308 1.00 27.87 ? 159 ARG A CB    1 
ATOM   147  C CG    . ARG A 1 17  ? 44.587 15.192  35.434 1.00 31.90 ? 159 ARG A CG    1 
ATOM   148  C CD    . ARG A 1 17  ? 45.364 14.937  36.684 1.00 34.86 ? 159 ARG A CD    1 
ATOM   149  N NE    . ARG A 1 17  ? 44.829 15.727  37.754 1.00 36.08 ? 159 ARG A NE    1 
ATOM   150  C CZ    . ARG A 1 17  ? 45.494 15.874  38.885 1.00 39.72 ? 159 ARG A CZ    1 
ATOM   151  N NH1   . ARG A 1 17  ? 46.699 15.276  39.069 1.00 36.21 ? 159 ARG A NH1   1 
ATOM   152  N NH2   . ARG A 1 17  ? 44.875 16.613  39.826 1.00 40.60 ? 159 ARG A NH2   1 
ATOM   153  H H     . ARG A 1 17  ? 46.500 14.057  32.195 1.00 0.00  ? 159 ARG A H     1 
ATOM   154  H HE    . ARG A 1 17  ? 43.958 16.164  37.644 1.00 0.00  ? 159 ARG A HE    1 
ATOM   155  H HH11  . ARG A 1 17  ? 47.095 14.715  38.342 1.00 0.00  ? 159 ARG A HH11  1 
ATOM   156  H HH12  . ARG A 1 17  ? 47.191 15.397  39.931 1.00 0.00  ? 159 ARG A HH12  1 
ATOM   157  H HH21  . ARG A 1 17  ? 43.974 17.006  39.641 1.00 0.00  ? 159 ARG A HH21  1 
ATOM   158  H HH22  . ARG A 1 17  ? 45.316 16.769  40.710 1.00 0.00  ? 159 ARG A HH22  1 
ATOM   159  N N     . GLU A 1 18  ? 46.138 17.348  32.816 1.00 31.47 ? 160 GLU A N     1 
ATOM   160  C CA    . GLU A 1 18  ? 46.265 18.803  32.796 1.00 32.01 ? 160 GLU A CA    1 
ATOM   161  C C     . GLU A 1 18  ? 45.558 19.382  31.572 1.00 30.83 ? 160 GLU A C     1 
ATOM   162  O O     . GLU A 1 18  ? 44.852 20.391  31.680 1.00 31.58 ? 160 GLU A O     1 
ATOM   163  C CB    . GLU A 1 18  ? 47.762 19.106  32.847 1.00 37.96 ? 160 GLU A CB    1 
ATOM   164  C CG    . GLU A 1 18  ? 48.181 20.546  32.710 1.00 56.95 ? 160 GLU A CG    1 
ATOM   165  C CD    . GLU A 1 18  ? 47.528 21.553  33.668 1.00 66.26 ? 160 GLU A CD    1 
ATOM   166  O OE1   . GLU A 1 18  ? 47.111 21.222  34.792 1.00 73.13 ? 160 GLU A OE1   1 
ATOM   167  O OE2   . GLU A 1 18  ? 47.425 22.724  33.295 1.00 69.92 ? 160 GLU A OE2   1 
ATOM   168  H H     . GLU A 1 18  ? 46.941 16.802  32.682 1.00 0.00  ? 160 GLU A H     1 
ATOM   169  N N     . SER A 1 19  ? 45.555 18.679  30.433 1.00 27.80 ? 161 SER A N     1 
ATOM   170  C CA    . SER A 1 19  ? 44.879 19.156  29.229 1.00 28.77 ? 161 SER A CA    1 
ATOM   171  C C     . SER A 1 19  ? 43.380 19.285  29.460 1.00 27.29 ? 161 SER A C     1 
ATOM   172  O O     . SER A 1 19  ? 42.755 20.230  28.978 1.00 27.81 ? 161 SER A O     1 
ATOM   173  C CB    . SER A 1 19  ? 45.101 18.209  28.028 1.00 22.43 ? 161 SER A CB    1 
ATOM   174  O OG    . SER A 1 19  ? 44.339 16.999  28.085 1.00 25.63 ? 161 SER A OG    1 
ATOM   175  H H     . SER A 1 19  ? 46.021 17.817  30.406 1.00 0.00  ? 161 SER A H     1 
ATOM   176  H HG    . SER A 1 19  ? 43.403 17.211  28.107 1.00 0.00  ? 161 SER A HG    1 
ATOM   177  N N     . GLU A 1 20  ? 42.794 18.312  30.141 1.00 26.89 ? 162 GLU A N     1 
ATOM   178  C CA    . GLU A 1 20  ? 41.397 18.340  30.448 1.00 26.25 ? 162 GLU A CA    1 
ATOM   179  C C     . GLU A 1 20  ? 41.154 19.450  31.439 1.00 28.08 ? 162 GLU A C     1 
ATOM   180  O O     . GLU A 1 20  ? 40.155 20.150  31.285 1.00 29.14 ? 162 GLU A O     1 
ATOM   181  C CB    . GLU A 1 20  ? 40.959 17.047  31.042 1.00 25.32 ? 162 GLU A CB    1 
ATOM   182  C CG    . GLU A 1 20  ? 40.999 15.974  29.960 1.00 35.30 ? 162 GLU A CG    1 
ATOM   183  C CD    . GLU A 1 20  ? 40.197 14.699  30.257 1.00 38.38 ? 162 GLU A CD    1 
ATOM   184  O OE1   . GLU A 1 20  ? 39.616 14.574  31.333 1.00 40.34 ? 162 GLU A OE1   1 
ATOM   185  O OE2   . GLU A 1 20  ? 40.117 13.818  29.385 1.00 41.77 ? 162 GLU A OE2   1 
ATOM   186  H H     . GLU A 1 20  ? 43.333 17.551  30.443 1.00 0.00  ? 162 GLU A H     1 
ATOM   187  N N     . ARG A 1 21  ? 42.019 19.693  32.432 1.00 32.55 ? 163 ARG A N     1 
ATOM   188  C CA    . ARG A 1 21  ? 41.821 20.804  33.342 1.00 35.31 ? 163 ARG A CA    1 
ATOM   189  C C     . ARG A 1 21  ? 41.819 22.106  32.532 1.00 33.76 ? 163 ARG A C     1 
ATOM   190  O O     . ARG A 1 21  ? 40.955 22.935  32.764 1.00 34.93 ? 163 ARG A O     1 
ATOM   191  C CB    . ARG A 1 21  ? 42.914 20.845  34.365 1.00 41.56 ? 163 ARG A CB    1 
ATOM   192  C CG    . ARG A 1 21  ? 42.424 21.708  35.530 1.00 55.93 ? 163 ARG A CG    1 
ATOM   193  C CD    . ARG A 1 21  ? 43.408 21.817  36.706 1.00 69.51 ? 163 ARG A CD    1 
ATOM   194  N NE    . ARG A 1 21  ? 44.701 22.313  36.243 1.00 83.06 ? 163 ARG A NE    1 
ATOM   195  C CZ    . ARG A 1 21  ? 44.942 23.575  35.824 1.00 87.27 ? 163 ARG A CZ    1 
ATOM   196  N NH1   . ARG A 1 21  ? 43.977 24.522  35.836 1.00 91.02 ? 163 ARG A NH1   1 
ATOM   197  N NH2   . ARG A 1 21  ? 46.159 23.856  35.343 1.00 89.27 ? 163 ARG A NH2   1 
ATOM   198  H H     . ARG A 1 21  ? 42.799 19.110  32.545 1.00 0.00  ? 163 ARG A H     1 
ATOM   199  H HE    . ARG A 1 21  ? 45.451 21.683  36.236 1.00 0.00  ? 163 ARG A HE    1 
ATOM   200  H HH11  . ARG A 1 21  ? 43.059 24.296  36.160 1.00 0.00  ? 163 ARG A HH11  1 
ATOM   201  H HH12  . ARG A 1 21  ? 44.182 25.449  35.520 1.00 0.00  ? 163 ARG A HH12  1 
ATOM   202  H HH21  . ARG A 1 21  ? 46.858 23.142  35.302 1.00 0.00  ? 163 ARG A HH21  1 
ATOM   203  H HH22  . ARG A 1 21  ? 46.370 24.780  35.025 1.00 0.00  ? 163 ARG A HH22  1 
ATOM   204  N N     . LEU A 1 22  ? 42.722 22.323  31.583 1.00 29.55 ? 164 LEU A N     1 
ATOM   205  C CA    . LEU A 1 22  ? 42.689 23.483  30.734 1.00 25.50 ? 164 LEU A CA    1 
ATOM   206  C C     . LEU A 1 22  ? 41.435 23.585  29.888 1.00 30.93 ? 164 LEU A C     1 
ATOM   207  O O     . LEU A 1 22  ? 40.846 24.653  29.789 1.00 34.11 ? 164 LEU A O     1 
ATOM   208  C CB    . LEU A 1 22  ? 43.832 23.483  29.783 1.00 21.59 ? 164 LEU A CB    1 
ATOM   209  C CG    . LEU A 1 22  ? 45.156 23.641  30.431 1.00 26.16 ? 164 LEU A CG    1 
ATOM   210  C CD1   . LEU A 1 22  ? 46.288 23.436  29.445 1.00 26.44 ? 164 LEU A CD1   1 
ATOM   211  C CD2   . LEU A 1 22  ? 45.204 25.031  31.004 1.00 27.32 ? 164 LEU A CD2   1 
ATOM   212  H H     . LEU A 1 22  ? 43.439 21.667  31.456 1.00 0.00  ? 164 LEU A H     1 
ATOM   213  N N     . LEU A 1 23  ? 40.991 22.543  29.190 1.00 32.46 ? 165 LEU A N     1 
ATOM   214  C CA    . LEU A 1 23  ? 39.837 22.616  28.300 1.00 32.49 ? 165 LEU A CA    1 
ATOM   215  C C     . LEU A 1 23  ? 38.415 22.670  28.882 1.00 33.87 ? 165 LEU A C     1 
ATOM   216  O O     . LEU A 1 23  ? 37.472 23.245  28.305 1.00 31.92 ? 165 LEU A O     1 
ATOM   217  C CB    . LEU A 1 23  ? 39.966 21.436  27.356 1.00 30.60 ? 165 LEU A CB    1 
ATOM   218  C CG    . LEU A 1 23  ? 41.110 21.473  26.399 1.00 28.37 ? 165 LEU A CG    1 
ATOM   219  C CD1   . LEU A 1 23  ? 41.201 20.170  25.676 1.00 24.89 ? 165 LEU A CD1   1 
ATOM   220  C CD2   . LEU A 1 23  ? 40.874 22.561  25.355 1.00 29.91 ? 165 LEU A CD2   1 
ATOM   221  H H     . LEU A 1 23  ? 41.460 21.688  29.278 1.00 0.00  ? 165 LEU A H     1 
ATOM   222  N N     . LEU A 1 24  ? 38.220 22.033  30.024 1.00 36.17 ? 166 LEU A N     1 
ATOM   223  C CA    . LEU A 1 24  ? 36.932 21.981  30.664 1.00 39.36 ? 166 LEU A CA    1 
ATOM   224  C C     . LEU A 1 24  ? 36.625 23.239  31.460 1.00 37.46 ? 166 LEU A C     1 
ATOM   225  O O     . LEU A 1 24  ? 36.730 23.286  32.685 1.00 37.70 ? 166 LEU A O     1 
ATOM   226  C CB    . LEU A 1 24  ? 36.897 20.762  31.574 1.00 44.36 ? 166 LEU A CB    1 
ATOM   227  C CG    . LEU A 1 24  ? 36.943 19.356  30.986 1.00 49.72 ? 166 LEU A CG    1 
ATOM   228  C CD1   . LEU A 1 24  ? 36.980 18.339  32.135 1.00 50.93 ? 166 LEU A CD1   1 
ATOM   229  C CD2   . LEU A 1 24  ? 35.752 19.145  30.061 1.00 49.39 ? 166 LEU A CD2   1 
ATOM   230  H H     . LEU A 1 24  ? 38.978 21.581  30.449 1.00 0.00  ? 166 LEU A H     1 
ATOM   231  N N     . ASN A 1 25  ? 36.214 24.282  30.786 1.00 40.10 ? 167 ASN A N     1 
ATOM   232  C CA    . ASN A 1 25  ? 35.911 25.531  31.458 1.00 43.47 ? 167 ASN A CA    1 
ATOM   233  C C     . ASN A 1 25  ? 34.901 26.290  30.651 1.00 41.87 ? 167 ASN A C     1 
ATOM   234  O O     . ASN A 1 25  ? 35.030 26.356  29.429 1.00 41.52 ? 167 ASN A O     1 
ATOM   235  C CB    . ASN A 1 25  ? 37.175 26.371  31.602 1.00 50.74 ? 167 ASN A CB    1 
ATOM   236  C CG    . ASN A 1 25  ? 37.004 27.829  32.023 1.00 56.70 ? 167 ASN A CG    1 
ATOM   237  O OD1   . ASN A 1 25  ? 37.932 28.599  31.860 1.00 59.66 ? 167 ASN A OD1   1 
ATOM   238  N ND2   . ASN A 1 25  ? 35.916 28.366  32.586 1.00 62.00 ? 167 ASN A ND2   1 
ATOM   239  H H     . ASN A 1 25  ? 36.109 24.219  29.814 1.00 0.00  ? 167 ASN A H     1 
ATOM   240  H HD21  . ASN A 1 25  ? 35.945 29.320  32.806 1.00 0.00  ? 167 ASN A HD21  1 
ATOM   241  H HD22  . ASN A 1 25  ? 35.130 27.808  32.764 1.00 0.00  ? 167 ASN A HD22  1 
ATOM   242  N N     . ALA A 1 26  ? 33.945 26.866  31.366 1.00 39.88 ? 168 ALA A N     1 
ATOM   243  C CA    . ALA A 1 26  ? 32.880 27.649  30.806 1.00 38.31 ? 168 ALA A CA    1 
ATOM   244  C C     . ALA A 1 26  ? 33.220 28.670  29.731 1.00 40.79 ? 168 ALA A C     1 
ATOM   245  O O     . ALA A 1 26  ? 32.388 28.954  28.859 1.00 41.97 ? 168 ALA A O     1 
ATOM   246  C CB    . ALA A 1 26  ? 32.211 28.364  31.922 1.00 41.33 ? 168 ALA A CB    1 
ATOM   247  H H     . ALA A 1 26  ? 33.967 26.750  32.338 1.00 0.00  ? 168 ALA A H     1 
ATOM   248  N N     . GLU A 1 27  ? 34.443 29.227  29.779 1.00 41.52 ? 169 GLU A N     1 
ATOM   249  C CA    . GLU A 1 27  ? 34.843 30.212  28.786 1.00 45.85 ? 169 GLU A CA    1 
ATOM   250  C C     . GLU A 1 27  ? 35.242 29.670  27.438 1.00 44.72 ? 169 GLU A C     1 
ATOM   251  O O     . GLU A 1 27  ? 35.440 30.427  26.480 1.00 45.22 ? 169 GLU A O     1 
ATOM   252  C CB    . GLU A 1 27  ? 36.007 31.057  29.278 1.00 54.96 ? 169 GLU A CB    1 
ATOM   253  C CG    . GLU A 1 27  ? 37.386 30.461  29.524 1.00 70.18 ? 169 GLU A CG    1 
ATOM   254  C CD    . GLU A 1 27  ? 38.506 31.485  29.762 1.00 78.34 ? 169 GLU A CD    1 
ATOM   255  O OE1   . GLU A 1 27  ? 38.323 32.679  29.464 1.00 83.34 ? 169 GLU A OE1   1 
ATOM   256  O OE2   . GLU A 1 27  ? 39.585 31.084  30.225 1.00 84.02 ? 169 GLU A OE2   1 
ATOM   257  H H     . GLU A 1 27  ? 35.069 28.968  30.487 1.00 0.00  ? 169 GLU A H     1 
ATOM   258  N N     . ASN A 1 28  ? 35.291 28.343  27.348 1.00 43.72 ? 170 ASN A N     1 
ATOM   259  C CA    . ASN A 1 28  ? 35.702 27.690  26.126 1.00 41.20 ? 170 ASN A CA    1 
ATOM   260  C C     . ASN A 1 28  ? 34.565 27.152  25.270 1.00 38.56 ? 170 ASN A C     1 
ATOM   261  O O     . ASN A 1 28  ? 33.719 26.449  25.809 1.00 38.12 ? 170 ASN A O     1 
ATOM   262  C CB    . ASN A 1 28  ? 36.656 26.539  26.454 1.00 42.04 ? 170 ASN A CB    1 
ATOM   263  C CG    . ASN A 1 28  ? 37.948 26.968  27.122 1.00 38.49 ? 170 ASN A CG    1 
ATOM   264  O OD1   . ASN A 1 28  ? 38.444 28.058  26.901 1.00 40.51 ? 170 ASN A OD1   1 
ATOM   265  N ND2   . ASN A 1 28  ? 38.560 26.122  27.919 1.00 36.13 ? 170 ASN A ND2   1 
ATOM   266  H H     . ASN A 1 28  ? 35.044 27.799  28.125 1.00 0.00  ? 170 ASN A H     1 
ATOM   267  H HD21  . ASN A 1 28  ? 39.393 26.419  28.340 1.00 0.00  ? 170 ASN A HD21  1 
ATOM   268  H HD22  . ASN A 1 28  ? 38.181 25.232  28.073 1.00 0.00  ? 170 ASN A HD22  1 
ATOM   269  N N     . PRO A 1 29  ? 34.472 27.501  23.968 1.00 39.10 ? 171 PRO A N     1 
ATOM   270  C CA    . PRO A 1 29  ? 33.495 27.081  22.960 1.00 37.13 ? 171 PRO A CA    1 
ATOM   271  C C     . PRO A 1 29  ? 33.706 25.594  22.688 1.00 40.03 ? 171 PRO A C     1 
ATOM   272  O O     . PRO A 1 29  ? 34.822 25.074  22.875 1.00 42.39 ? 171 PRO A O     1 
ATOM   273  C CB    . PRO A 1 29  ? 33.817 27.877  21.727 1.00 36.38 ? 171 PRO A CB    1 
ATOM   274  C CG    . PRO A 1 29  ? 34.230 29.143  22.377 1.00 38.99 ? 171 PRO A CG    1 
ATOM   275  C CD    . PRO A 1 29  ? 35.221 28.588  23.348 1.00 39.52 ? 171 PRO A CD    1 
ATOM   276  N N     . ARG A 1 30  ? 32.684 24.865  22.269 1.00 39.70 ? 172 ARG A N     1 
ATOM   277  C CA    . ARG A 1 30  ? 32.925 23.504  21.853 1.00 37.53 ? 172 ARG A CA    1 
ATOM   278  C C     . ARG A 1 30  ? 33.882 23.612  20.696 1.00 34.18 ? 172 ARG A C     1 
ATOM   279  O O     . ARG A 1 30  ? 33.691 24.453  19.818 1.00 35.38 ? 172 ARG A O     1 
ATOM   280  C CB    . ARG A 1 30  ? 31.710 22.811  21.303 1.00 41.98 ? 172 ARG A CB    1 
ATOM   281  C CG    . ARG A 1 30  ? 30.591 22.439  22.217 1.00 49.41 ? 172 ARG A CG    1 
ATOM   282  C CD    . ARG A 1 30  ? 29.945 21.340  21.413 1.00 57.46 ? 172 ARG A CD    1 
ATOM   283  N NE    . ARG A 1 30  ? 28.532 21.147  21.663 1.00 64.65 ? 172 ARG A NE    1 
ATOM   284  C CZ    . ARG A 1 30  ? 27.587 21.992  21.212 1.00 63.86 ? 172 ARG A CZ    1 
ATOM   285  N NH1   . ARG A 1 30  ? 27.915 23.074  20.483 1.00 62.60 ? 172 ARG A NH1   1 
ATOM   286  N NH2   . ARG A 1 30  ? 26.305 21.742  21.510 1.00 65.23 ? 172 ARG A NH2   1 
ATOM   287  H H     . ARG A 1 30  ? 31.780 25.242  22.242 1.00 0.00  ? 172 ARG A H     1 
ATOM   288  H HE    . ARG A 1 30  ? 28.251 20.366  22.184 1.00 0.00  ? 172 ARG A HE    1 
ATOM   289  H HH11  . ARG A 1 30  ? 28.874 23.260  20.268 1.00 0.00  ? 172 ARG A HH11  1 
ATOM   290  H HH12  . ARG A 1 30  ? 27.200 23.692  20.156 1.00 0.00  ? 172 ARG A HH12  1 
ATOM   291  H HH21  . ARG A 1 30  ? 26.066 20.940  22.058 1.00 0.00  ? 172 ARG A HH21  1 
ATOM   292  H HH22  . ARG A 1 30  ? 25.587 22.357  21.185 1.00 0.00  ? 172 ARG A HH22  1 
ATOM   293  N N     . GLY A 1 31  ? 34.885 22.765  20.660 1.00 31.80 ? 173 GLY A N     1 
ATOM   294  C CA    . GLY A 1 31  ? 35.838 22.861  19.576 1.00 27.63 ? 173 GLY A CA    1 
ATOM   295  C C     . GLY A 1 31  ? 37.068 23.581  20.087 1.00 24.76 ? 173 GLY A C     1 
ATOM   296  O O     . GLY A 1 31  ? 37.914 23.888  19.269 1.00 26.34 ? 173 GLY A O     1 
ATOM   297  H H     . GLY A 1 31  ? 34.986 22.081  21.354 1.00 0.00  ? 173 GLY A H     1 
ATOM   298  N N     . THR A 1 32  ? 37.222 23.975  21.351 1.00 23.78 ? 174 THR A N     1 
ATOM   299  C CA    . THR A 1 32  ? 38.496 24.524  21.804 1.00 24.23 ? 174 THR A CA    1 
ATOM   300  C C     . THR A 1 32  ? 39.428 23.329  21.849 1.00 25.76 ? 174 THR A C     1 
ATOM   301  O O     . THR A 1 32  ? 39.036 22.261  22.332 1.00 26.59 ? 174 THR A O     1 
ATOM   302  C CB    . THR A 1 32  ? 38.359 25.164  23.214 1.00 25.78 ? 174 THR A CB    1 
ATOM   303  O OG1   . THR A 1 32  ? 37.400 26.195  23.006 1.00 31.10 ? 174 THR A OG1   1 
ATOM   304  C CG2   . THR A 1 32  ? 39.635 25.762  23.813 1.00 19.59 ? 174 THR A CG2   1 
ATOM   305  H H     . THR A 1 32  ? 36.475 23.895  21.980 1.00 0.00  ? 174 THR A H     1 
ATOM   306  H HG1   . THR A 1 32  ? 37.731 26.814  22.351 1.00 0.00  ? 174 THR A HG1   1 
ATOM   307  N N     . PHE A 1 33  ? 40.663 23.523  21.429 1.00 26.01 ? 175 PHE A N     1 
ATOM   308  C CA    . PHE A 1 33  ? 41.638 22.459  21.343 1.00 26.71 ? 175 PHE A CA    1 
ATOM   309  C C     . PHE A 1 33  ? 43.077 22.815  21.709 1.00 26.97 ? 175 PHE A C     1 
ATOM   310  O O     . PHE A 1 33  ? 43.436 23.997  21.829 1.00 25.42 ? 175 PHE A O     1 
ATOM   311  C CB    . PHE A 1 33  ? 41.646 21.943  19.931 1.00 20.59 ? 175 PHE A CB    1 
ATOM   312  C CG    . PHE A 1 33  ? 42.261 22.948  18.968 1.00 24.11 ? 175 PHE A CG    1 
ATOM   313  C CD1   . PHE A 1 33  ? 41.531 24.062  18.538 1.00 30.41 ? 175 PHE A CD1   1 
ATOM   314  C CD2   . PHE A 1 33  ? 43.551 22.752  18.508 1.00 21.53 ? 175 PHE A CD2   1 
ATOM   315  C CE1   . PHE A 1 33  ? 42.105 24.958  17.648 1.00 28.67 ? 175 PHE A CE1   1 
ATOM   316  C CE2   . PHE A 1 33  ? 44.111 23.651  17.628 1.00 21.38 ? 175 PHE A CE2   1 
ATOM   317  C CZ    . PHE A 1 33  ? 43.398 24.754  17.194 1.00 24.74 ? 175 PHE A CZ    1 
ATOM   318  H H     . PHE A 1 33  ? 40.931 24.427  21.164 1.00 0.00  ? 175 PHE A H     1 
ATOM   319  N N     . LEU A 1 34  ? 43.894 21.759  21.790 1.00 23.00 ? 176 LEU A N     1 
ATOM   320  C CA    . LEU A 1 34  ? 45.314 21.915  21.919 1.00 19.96 ? 176 LEU A CA    1 
ATOM   321  C C     . LEU A 1 34  ? 45.949 20.675  21.323 1.00 22.24 ? 176 LEU A C     1 
ATOM   322  O O     . LEU A 1 34  ? 45.261 19.672  21.068 1.00 22.83 ? 176 LEU A O     1 
ATOM   323  C CB    . LEU A 1 34  ? 45.600 22.145  23.377 1.00 15.89 ? 176 LEU A CB    1 
ATOM   324  C CG    . LEU A 1 34  ? 45.209 21.203  24.483 1.00 19.78 ? 176 LEU A CG    1 
ATOM   325  C CD1   . LEU A 1 34  ? 46.274 20.136  24.592 1.00 20.56 ? 176 LEU A CD1   1 
ATOM   326  C CD2   . LEU A 1 34  ? 45.238 21.902  25.834 1.00 15.01 ? 176 LEU A CD2   1 
ATOM   327  H H     . LEU A 1 34  ? 43.513 20.857  21.760 1.00 0.00  ? 176 LEU A H     1 
ATOM   328  N N     . VAL A 1 35  ? 47.195 20.788  20.901 1.00 23.04 ? 177 VAL A N     1 
ATOM   329  C CA    . VAL A 1 35  ? 47.987 19.642  20.467 1.00 25.35 ? 177 VAL A CA    1 
ATOM   330  C C     . VAL A 1 35  ? 49.077 19.407  21.550 1.00 27.66 ? 177 VAL A C     1 
ATOM   331  O O     . VAL A 1 35  ? 49.590 20.341  22.188 1.00 29.46 ? 177 VAL A O     1 
ATOM   332  C CB    . VAL A 1 35  ? 48.639 19.906  19.098 1.00 24.71 ? 177 VAL A CB    1 
ATOM   333  C CG1   . VAL A 1 35  ? 49.488 18.716  18.641 1.00 21.09 ? 177 VAL A CG1   1 
ATOM   334  C CG2   . VAL A 1 35  ? 47.526 20.155  18.089 1.00 22.23 ? 177 VAL A CG2   1 
ATOM   335  H H     . VAL A 1 35  ? 47.605 21.678  20.878 1.00 0.00  ? 177 VAL A H     1 
ATOM   336  N N     . ARG A 1 36  ? 49.447 18.176  21.895 1.00 28.02 ? 178 ARG A N     1 
ATOM   337  C CA    . ARG A 1 36  ? 50.458 17.906  22.918 1.00 24.88 ? 178 ARG A CA    1 
ATOM   338  C C     . ARG A 1 36  ? 51.128 16.596  22.539 1.00 23.78 ? 178 ARG A C     1 
ATOM   339  O O     . ARG A 1 36  ? 50.762 15.941  21.553 1.00 24.76 ? 178 ARG A O     1 
ATOM   340  C CB    . ARG A 1 36  ? 49.782 17.781  24.290 1.00 20.20 ? 178 ARG A CB    1 
ATOM   341  C CG    . ARG A 1 36  ? 48.661 16.757  24.291 1.00 15.41 ? 178 ARG A CG    1 
ATOM   342  C CD    . ARG A 1 36  ? 48.066 16.703  25.634 1.00 16.78 ? 178 ARG A CD    1 
ATOM   343  N NE    . ARG A 1 36  ? 46.951 15.778  25.625 1.00 19.93 ? 178 ARG A NE    1 
ATOM   344  C CZ    . ARG A 1 36  ? 47.122 14.496  25.987 1.00 20.23 ? 178 ARG A CZ    1 
ATOM   345  N NH1   . ARG A 1 36  ? 48.309 13.997  26.346 1.00 26.64 ? 178 ARG A NH1   1 
ATOM   346  N NH2   . ARG A 1 36  ? 46.051 13.721  25.994 1.00 22.48 ? 178 ARG A NH2   1 
ATOM   347  H H     . ARG A 1 36  ? 49.024 17.416  21.444 1.00 0.00  ? 178 ARG A H     1 
ATOM   348  H HE    . ARG A 1 36  ? 46.063 16.091  25.352 1.00 0.00  ? 178 ARG A HE    1 
ATOM   349  H HH11  . ARG A 1 36  ? 49.117 14.585  26.352 1.00 0.00  ? 178 ARG A HH11  1 
ATOM   350  H HH12  . ARG A 1 36  ? 48.388 13.035  26.608 1.00 0.00  ? 178 ARG A HH12  1 
ATOM   351  H HH21  . ARG A 1 36  ? 45.161 14.096  25.736 1.00 0.00  ? 178 ARG A HH21  1 
ATOM   352  H HH22  . ARG A 1 36  ? 46.131 12.760  26.257 1.00 0.00  ? 178 ARG A HH22  1 
ATOM   353  N N     . GLU A 1 37  ? 52.130 16.210  23.279 1.00 24.01 ? 179 GLU A N     1 
ATOM   354  C CA    . GLU A 1 37  ? 52.697 14.912  23.096 1.00 23.93 ? 179 GLU A CA    1 
ATOM   355  C C     . GLU A 1 37  ? 51.780 13.917  23.815 1.00 25.42 ? 179 GLU A C     1 
ATOM   356  O O     . GLU A 1 37  ? 51.038 14.193  24.779 1.00 23.27 ? 179 GLU A O     1 
ATOM   357  C CB    . GLU A 1 37  ? 54.027 14.873  23.704 1.00 20.67 ? 179 GLU A CB    1 
ATOM   358  C CG    . GLU A 1 37  ? 55.066 15.448  22.824 1.00 25.80 ? 179 GLU A CG    1 
ATOM   359  C CD    . GLU A 1 37  ? 56.419 15.353  23.492 1.00 36.58 ? 179 GLU A CD    1 
ATOM   360  O OE1   . GLU A 1 37  ? 56.718 14.425  24.256 1.00 42.95 ? 179 GLU A OE1   1 
ATOM   361  O OE2   . GLU A 1 37  ? 57.230 16.256  23.305 1.00 43.10 ? 179 GLU A OE2   1 
ATOM   362  H H     . GLU A 1 37  ? 52.494 16.811  23.962 1.00 0.00  ? 179 GLU A H     1 
ATOM   363  N N     . SER A 1 38  ? 51.735 12.714  23.255 1.00 28.07 ? 180 SER A N     1 
ATOM   364  C CA    . SER A 1 38  ? 50.979 11.647  23.866 1.00 28.26 ? 180 SER A CA    1 
ATOM   365  C C     . SER A 1 38  ? 51.861 11.163  25.017 1.00 29.13 ? 180 SER A C     1 
ATOM   366  O O     . SER A 1 38  ? 53.031 10.868  24.808 1.00 31.47 ? 180 SER A O     1 
ATOM   367  C CB    . SER A 1 38  ? 50.743 10.494  22.878 1.00 23.26 ? 180 SER A CB    1 
ATOM   368  O OG    . SER A 1 38  ? 50.093 9.444   23.593 1.00 24.35 ? 180 SER A OG    1 
ATOM   369  H H     . SER A 1 38  ? 52.219 12.549  22.419 1.00 0.00  ? 180 SER A H     1 
ATOM   370  H HG    . SER A 1 38  ? 49.931 8.706   23.001 1.00 0.00  ? 180 SER A HG    1 
ATOM   371  N N     . GLU A 1 39  ? 51.355 11.097  26.259 1.00 33.07 ? 181 GLU A N     1 
ATOM   372  C CA    . GLU A 1 39  ? 52.109 10.556  27.406 1.00 35.63 ? 181 GLU A CA    1 
ATOM   373  C C     . GLU A 1 39  ? 52.392 9.045   27.249 1.00 35.20 ? 181 GLU A C     1 
ATOM   374  O O     . GLU A 1 39  ? 53.452 8.492   27.455 1.00 43.68 ? 181 GLU A O     1 
ATOM   375  C CB    . GLU A 1 39  ? 51.371 10.592  28.722 1.00 31.67 ? 181 GLU A CB    1 
ATOM   376  C CG    . GLU A 1 39  ? 50.684 11.832  29.205 1.00 32.97 ? 181 GLU A CG    1 
ATOM   377  C CD    . GLU A 1 39  ? 50.235 11.646  30.645 1.00 28.17 ? 181 GLU A CD    1 
ATOM   378  O OE1   . GLU A 1 39  ? 51.012 11.203  31.476 1.00 25.15 ? 181 GLU A OE1   1 
ATOM   379  O OE2   . GLU A 1 39  ? 49.093 11.953  30.950 1.00 29.59 ? 181 GLU A OE2   1 
ATOM   380  H H     . GLU A 1 39  ? 50.444 11.423  26.410 1.00 0.00  ? 181 GLU A H     1 
ATOM   381  N N     . THR A 1 40  ? 51.351 8.391   26.811 1.00 36.87 ? 182 THR A N     1 
ATOM   382  C CA    . THR A 1 40  ? 51.196 6.990   26.639 1.00 32.60 ? 182 THR A CA    1 
ATOM   383  C C     . THR A 1 40  ? 51.819 6.470   25.363 1.00 35.22 ? 182 THR A C     1 
ATOM   384  O O     . THR A 1 40  ? 52.094 5.304   25.381 1.00 43.25 ? 182 THR A O     1 
ATOM   385  C CB    . THR A 1 40  ? 49.684 6.827   26.814 1.00 28.19 ? 182 THR A CB    1 
ATOM   386  O OG1   . THR A 1 40  ? 49.395 6.687   28.208 1.00 33.27 ? 182 THR A OG1   1 
ATOM   387  C CG2   . THR A 1 40  ? 49.162 5.697   26.095 1.00 32.68 ? 182 THR A CG2   1 
ATOM   388  H H     . THR A 1 40  ? 50.577 8.937   26.570 1.00 0.00  ? 182 THR A H     1 
ATOM   389  H HG1   . THR A 1 40  ? 49.848 5.914   28.553 1.00 0.00  ? 182 THR A HG1   1 
ATOM   390  N N     . THR A 1 41  ? 52.129 7.152   24.263 1.00 32.10 ? 183 THR A N     1 
ATOM   391  C CA    . THR A 1 41  ? 52.632 6.503   23.067 1.00 29.04 ? 183 THR A CA    1 
ATOM   392  C C     . THR A 1 41  ? 53.753 7.455   22.687 1.00 31.13 ? 183 THR A C     1 
ATOM   393  O O     . THR A 1 41  ? 53.501 8.568   22.201 1.00 32.01 ? 183 THR A O     1 
ATOM   394  C CB    . THR A 1 41  ? 51.574 6.482   21.931 1.00 28.81 ? 183 THR A CB    1 
ATOM   395  O OG1   . THR A 1 41  ? 50.393 5.765   22.315 1.00 30.13 ? 183 THR A OG1   1 
ATOM   396  C CG2   . THR A 1 41  ? 52.133 5.835   20.700 1.00 32.06 ? 183 THR A CG2   1 
ATOM   397  H H     . THR A 1 41  ? 52.014 8.125   24.261 1.00 0.00  ? 183 THR A H     1 
ATOM   398  H HG1   . THR A 1 41  ? 50.000 6.184   23.084 1.00 0.00  ? 183 THR A HG1   1 
ATOM   399  N N     . LYS A 1 42  ? 54.987 7.104   22.969 1.00 35.83 ? 184 LYS A N     1 
ATOM   400  C CA    . LYS A 1 42  ? 56.087 7.996   22.630 1.00 39.28 ? 184 LYS A CA    1 
ATOM   401  C C     . LYS A 1 42  ? 56.147 8.071   21.132 1.00 37.94 ? 184 LYS A C     1 
ATOM   402  O O     . LYS A 1 42  ? 55.862 7.118   20.398 1.00 39.37 ? 184 LYS A O     1 
ATOM   403  C CB    . LYS A 1 42  ? 57.456 7.505   23.112 1.00 41.68 ? 184 LYS A CB    1 
ATOM   404  H H     . LYS A 1 42  ? 55.167 6.245   23.406 1.00 0.00  ? 184 LYS A H     1 
ATOM   405  N N     . GLY A 1 43  ? 56.405 9.288   20.715 1.00 37.58 ? 185 GLY A N     1 
ATOM   406  C CA    . GLY A 1 43  ? 56.434 9.545   19.289 1.00 36.42 ? 185 GLY A CA    1 
ATOM   407  C C     . GLY A 1 43  ? 55.063 9.870   18.695 1.00 31.71 ? 185 GLY A C     1 
ATOM   408  O O     . GLY A 1 43  ? 55.056 10.181  17.512 1.00 33.11 ? 185 GLY A O     1 
ATOM   409  H H     . GLY A 1 43  ? 56.575 10.010  21.356 1.00 0.00  ? 185 GLY A H     1 
ATOM   410  N N     . ALA A 1 44  ? 53.921 9.782   19.374 1.00 27.79 ? 186 ALA A N     1 
ATOM   411  C CA    . ALA A 1 44  ? 52.684 10.213  18.768 1.00 25.81 ? 186 ALA A CA    1 
ATOM   412  C C     . ALA A 1 44  ? 52.263 11.510  19.479 1.00 24.09 ? 186 ALA A C     1 
ATOM   413  O O     . ALA A 1 44  ? 52.739 11.840  20.572 1.00 20.88 ? 186 ALA A O     1 
ATOM   414  C CB    . ALA A 1 44  ? 51.598 9.170   18.955 1.00 26.02 ? 186 ALA A CB    1 
ATOM   415  H H     . ALA A 1 44  ? 53.920 9.424   20.286 1.00 0.00  ? 186 ALA A H     1 
ATOM   416  N N     . TYR A 1 45  ? 51.389 12.297  18.871 1.00 22.46 ? 187 TYR A N     1 
ATOM   417  C CA    . TYR A 1 45  ? 50.861 13.517  19.427 1.00 19.86 ? 187 TYR A CA    1 
ATOM   418  C C     . TYR A 1 45  ? 49.439 13.306  19.855 1.00 20.68 ? 187 TYR A C     1 
ATOM   419  O O     . TYR A 1 45  ? 48.922 12.213  19.665 1.00 17.00 ? 187 TYR A O     1 
ATOM   420  C CB    . TYR A 1 45  ? 50.848 14.633  18.411 1.00 22.85 ? 187 TYR A CB    1 
ATOM   421  C CG    . TYR A 1 45  ? 52.259 15.018  18.195 1.00 25.41 ? 187 TYR A CG    1 
ATOM   422  C CD1   . TYR A 1 45  ? 52.895 15.775  19.173 1.00 24.38 ? 187 TYR A CD1   1 
ATOM   423  C CD2   . TYR A 1 45  ? 52.913 14.554  17.065 1.00 31.24 ? 187 TYR A CD2   1 
ATOM   424  C CE1   . TYR A 1 45  ? 54.231 16.074  19.019 1.00 27.68 ? 187 TYR A CE1   1 
ATOM   425  C CE2   . TYR A 1 45  ? 54.257 14.852  16.900 1.00 32.04 ? 187 TYR A CE2   1 
ATOM   426  C CZ    . TYR A 1 45  ? 54.902 15.605  17.878 1.00 34.91 ? 187 TYR A CZ    1 
ATOM   427  O OH    . TYR A 1 45  ? 56.239 15.907  17.709 1.00 42.96 ? 187 TYR A OH    1 
ATOM   428  H H     . TYR A 1 45  ? 51.080 12.031  17.981 1.00 0.00  ? 187 TYR A H     1 
ATOM   429  H HH    . TYR A 1 45  ? 56.554 15.520  16.889 1.00 0.00  ? 187 TYR A HH    1 
ATOM   430  N N     . CYS A 1 46  ? 48.768 14.342  20.353 1.00 19.68 ? 188 CYS A N     1 
ATOM   431  C CA    . CYS A 1 46  ? 47.383 14.189  20.691 1.00 19.16 ? 188 CYS A CA    1 
ATOM   432  C C     . CYS A 1 46  ? 46.637 15.487  20.467 1.00 17.10 ? 188 CYS A C     1 
ATOM   433  O O     . CYS A 1 46  ? 47.177 16.549  20.755 1.00 20.94 ? 188 CYS A O     1 
ATOM   434  C CB    . CYS A 1 46  ? 47.377 13.731  22.121 1.00 16.83 ? 188 CYS A CB    1 
ATOM   435  S SG    . CYS A 1 46  ? 45.683 13.613  22.675 1.00 27.01 ? 188 CYS A SG    1 
ATOM   436  H H     . CYS A 1 46  ? 49.217 15.203  20.488 1.00 0.00  ? 188 CYS A H     1 
ATOM   437  N N     . LEU A 1 47  ? 45.445 15.426  19.870 1.00 19.44 ? 189 LEU A N     1 
ATOM   438  C CA    . LEU A 1 47  ? 44.609 16.575  19.647 1.00 17.21 ? 189 LEU A CA    1 
ATOM   439  C C     . LEU A 1 47  ? 43.515 16.432  20.657 1.00 21.02 ? 189 LEU A C     1 
ATOM   440  O O     . LEU A 1 47  ? 42.823 15.441  20.607 1.00 18.77 ? 189 LEU A O     1 
ATOM   441  C CB    . LEU A 1 47  ? 43.996 16.548  18.294 1.00 20.68 ? 189 LEU A CB    1 
ATOM   442  C CG    . LEU A 1 47  ? 43.003 17.630  17.973 1.00 19.91 ? 189 LEU A CG    1 
ATOM   443  C CD1   . LEU A 1 47  ? 43.608 19.013  18.129 1.00 21.93 ? 189 LEU A CD1   1 
ATOM   444  C CD2   . LEU A 1 47  ? 42.538 17.427  16.540 1.00 14.55 ? 189 LEU A CD2   1 
ATOM   445  H H     . LEU A 1 47  ? 45.122 14.552  19.568 1.00 0.00  ? 189 LEU A H     1 
ATOM   446  N N     . SER A 1 48  ? 43.443 17.339  21.654 1.00 23.15 ? 190 SER A N     1 
ATOM   447  C CA    . SER A 1 48  ? 42.440 17.290  22.712 1.00 22.43 ? 190 SER A CA    1 
ATOM   448  C C     . SER A 1 48  ? 41.431 18.381  22.379 1.00 25.76 ? 190 SER A C     1 
ATOM   449  O O     . SER A 1 48  ? 41.835 19.511  22.099 1.00 27.98 ? 190 SER A O     1 
ATOM   450  C CB    . SER A 1 48  ? 43.206 17.495  24.005 1.00 18.14 ? 190 SER A CB    1 
ATOM   451  O OG    . SER A 1 48  ? 44.162 16.436  24.193 1.00 21.82 ? 190 SER A OG    1 
ATOM   452  H H     . SER A 1 48  ? 44.098 18.067  21.668 1.00 0.00  ? 190 SER A H     1 
ATOM   453  H HG    . SER A 1 48  ? 44.640 16.577  25.014 1.00 0.00  ? 190 SER A HG    1 
ATOM   454  N N     . VAL A 1 49  ? 40.134 18.054  22.355 1.00 29.16 ? 191 VAL A N     1 
ATOM   455  C CA    . VAL A 1 49  ? 39.057 18.930  21.882 1.00 26.30 ? 191 VAL A CA    1 
ATOM   456  C C     . VAL A 1 49  ? 37.964 18.956  22.924 1.00 29.07 ? 191 VAL A C     1 
ATOM   457  O O     . VAL A 1 49  ? 37.595 17.879  23.419 1.00 28.11 ? 191 VAL A O     1 
ATOM   458  C CB    . VAL A 1 49  ? 38.408 18.418  20.600 1.00 23.48 ? 191 VAL A CB    1 
ATOM   459  C CG1   . VAL A 1 49  ? 37.480 19.497  20.012 1.00 26.05 ? 191 VAL A CG1   1 
ATOM   460  C CG2   . VAL A 1 49  ? 39.460 18.079  19.585 1.00 21.10 ? 191 VAL A CG2   1 
ATOM   461  H H     . VAL A 1 49  ? 39.885 17.164  22.677 1.00 0.00  ? 191 VAL A H     1 
ATOM   462  N N     . SER A 1 50  ? 37.491 20.163  23.291 1.00 29.41 ? 192 SER A N     1 
ATOM   463  C CA    . SER A 1 50  ? 36.393 20.281  24.237 1.00 32.55 ? 192 SER A CA    1 
ATOM   464  C C     . SER A 1 50  ? 35.090 20.074  23.459 1.00 34.48 ? 192 SER A C     1 
ATOM   465  O O     . SER A 1 50  ? 34.956 20.401  22.258 1.00 32.22 ? 192 SER A O     1 
ATOM   466  C CB    . SER A 1 50  ? 36.367 21.658  24.913 1.00 30.21 ? 192 SER A CB    1 
ATOM   467  O OG    . SER A 1 50  ? 36.250 22.714  23.969 1.00 32.87 ? 192 SER A OG    1 
ATOM   468  H H     . SER A 1 50  ? 37.893 20.974  22.915 1.00 0.00  ? 192 SER A H     1 
ATOM   469  H HG    . SER A 1 50  ? 36.998 22.690  23.367 1.00 0.00  ? 192 SER A HG    1 
ATOM   470  N N     . ASP A 1 51  ? 34.136 19.534  24.183 1.00 36.81 ? 193 ASP A N     1 
ATOM   471  C CA    . ASP A 1 51  ? 32.863 19.278  23.591 1.00 45.14 ? 193 ASP A CA    1 
ATOM   472  C C     . ASP A 1 51  ? 31.884 19.257  24.727 1.00 47.93 ? 193 ASP A C     1 
ATOM   473  O O     . ASP A 1 51  ? 32.263 19.362  25.903 1.00 48.33 ? 193 ASP A O     1 
ATOM   474  C CB    . ASP A 1 51  ? 32.952 17.940  22.915 1.00 49.10 ? 193 ASP A CB    1 
ATOM   475  C CG    . ASP A 1 51  ? 31.735 17.456  22.138 1.00 53.11 ? 193 ASP A CG    1 
ATOM   476  O OD1   . ASP A 1 51  ? 31.013 18.263  21.506 1.00 53.24 ? 193 ASP A OD1   1 
ATOM   477  O OD2   . ASP A 1 51  ? 31.528 16.217  22.168 1.00 60.56 ? 193 ASP A OD2   1 
ATOM   478  H H     . ASP A 1 51  ? 34.297 19.309  25.123 1.00 0.00  ? 193 ASP A H     1 
ATOM   479  N N     . PHE A 1 52  ? 30.612 19.203  24.394 1.00 55.96 ? 194 PHE A N     1 
ATOM   480  C CA    . PHE A 1 52  ? 29.614 19.020  25.409 1.00 61.92 ? 194 PHE A CA    1 
ATOM   481  C C     . PHE A 1 52  ? 28.322 18.647  24.732 1.00 64.95 ? 194 PHE A C     1 
ATOM   482  O O     . PHE A 1 52  ? 28.005 19.015  23.569 1.00 62.98 ? 194 PHE A O     1 
ATOM   483  C CB    . PHE A 1 52  ? 29.400 20.297  26.289 1.00 63.14 ? 194 PHE A CB    1 
ATOM   484  C CG    . PHE A 1 52  ? 28.428 21.359  25.851 1.00 66.23 ? 194 PHE A CG    1 
ATOM   485  C CD1   . PHE A 1 52  ? 27.060 21.220  26.130 1.00 70.28 ? 194 PHE A CD1   1 
ATOM   486  C CD2   . PHE A 1 52  ? 28.924 22.468  25.169 1.00 68.08 ? 194 PHE A CD2   1 
ATOM   487  C CE1   . PHE A 1 52  ? 26.189 22.218  25.709 1.00 75.36 ? 194 PHE A CE1   1 
ATOM   488  C CE2   . PHE A 1 52  ? 28.052 23.466  24.750 1.00 70.88 ? 194 PHE A CE2   1 
ATOM   489  C CZ    . PHE A 1 52  ? 26.686 23.336  25.018 1.00 74.40 ? 194 PHE A CZ    1 
ATOM   490  H H     . PHE A 1 52  ? 30.347 19.288  23.454 1.00 0.00  ? 194 PHE A H     1 
ATOM   491  N N     . ASP A 1 53  ? 27.653 17.918  25.625 1.00 69.46 ? 195 ASP A N     1 
ATOM   492  C CA    . ASP A 1 53  ? 26.308 17.430  25.424 1.00 74.42 ? 195 ASP A CA    1 
ATOM   493  C C     . ASP A 1 53  ? 25.482 17.812  26.650 1.00 75.53 ? 195 ASP A C     1 
ATOM   494  O O     . ASP A 1 53  ? 26.019 18.151  27.709 1.00 75.03 ? 195 ASP A O     1 
ATOM   495  C CB    . ASP A 1 53  ? 26.296 15.911  25.264 1.00 75.95 ? 195 ASP A CB    1 
ATOM   496  C CG    . ASP A 1 53  ? 26.644 15.077  26.486 1.00 76.79 ? 195 ASP A CG    1 
ATOM   497  O OD1   . ASP A 1 53  ? 27.546 15.420  27.230 1.00 80.07 ? 195 ASP A OD1   1 
ATOM   498  O OD2   . ASP A 1 53  ? 26.001 14.069  26.726 1.00 76.47 ? 195 ASP A OD2   1 
ATOM   499  H H     . ASP A 1 53  ? 28.100 17.700  26.469 1.00 0.00  ? 195 ASP A H     1 
ATOM   500  N N     . ASN A 1 54  ? 24.156 17.810  26.478 1.00 77.15 ? 196 ASN A N     1 
ATOM   501  C CA    . ASN A 1 54  ? 23.243 18.090  27.572 1.00 77.56 ? 196 ASN A CA    1 
ATOM   502  C C     . ASN A 1 54  ? 23.136 16.911  28.542 1.00 77.24 ? 196 ASN A C     1 
ATOM   503  O O     . ASN A 1 54  ? 22.519 17.047  29.602 1.00 79.68 ? 196 ASN A O     1 
ATOM   504  C CB    . ASN A 1 54  ? 21.857 18.401  27.032 1.00 76.71 ? 196 ASN A CB    1 
ATOM   505  H H     . ASN A 1 54  ? 23.791 17.614  25.590 1.00 0.00  ? 196 ASN A H     1 
ATOM   506  N N     . ALA A 1 55  ? 23.699 15.737  28.220 1.00 76.41 ? 197 ALA A N     1 
ATOM   507  C CA    . ALA A 1 55  ? 23.633 14.621  29.138 1.00 75.78 ? 197 ALA A CA    1 
ATOM   508  C C     . ALA A 1 55  ? 24.851 14.642  30.043 1.00 73.60 ? 197 ALA A C     1 
ATOM   509  O O     . ALA A 1 55  ? 24.672 14.838  31.243 1.00 73.95 ? 197 ALA A O     1 
ATOM   510  C CB    . ALA A 1 55  ? 23.590 13.296  28.374 1.00 78.27 ? 197 ALA A CB    1 
ATOM   511  H H     . ALA A 1 55  ? 24.157 15.635  27.360 1.00 0.00  ? 197 ALA A H     1 
ATOM   512  N N     . LYS A 1 56  ? 26.080 14.450  29.558 1.00 71.60 ? 198 LYS A N     1 
ATOM   513  C CA    . LYS A 1 56  ? 27.280 14.500  30.378 1.00 67.99 ? 198 LYS A CA    1 
ATOM   514  C C     . LYS A 1 56  ? 27.808 15.938  30.556 1.00 65.29 ? 198 LYS A C     1 
ATOM   515  O O     . LYS A 1 56  ? 28.704 16.125  31.383 1.00 68.15 ? 198 LYS A O     1 
ATOM   516  C CB    . LYS A 1 56  ? 28.397 13.645  29.753 1.00 65.33 ? 198 LYS A CB    1 
ATOM   517  H H     . LYS A 1 56  ? 26.178 14.266  28.601 1.00 0.00  ? 198 LYS A H     1 
ATOM   518  N N     . GLY A 1 57  ? 27.348 17.019  29.902 1.00 59.24 ? 199 GLY A N     1 
ATOM   519  C CA    . GLY A 1 57  ? 27.905 18.351  30.130 1.00 52.59 ? 199 GLY A CA    1 
ATOM   520  C C     . GLY A 1 57  ? 29.195 18.527  29.335 1.00 48.34 ? 199 GLY A C     1 
ATOM   521  O O     . GLY A 1 57  ? 29.332 17.981  28.239 1.00 48.07 ? 199 GLY A O     1 
ATOM   522  H H     . GLY A 1 57  ? 26.620 16.911  29.255 1.00 0.00  ? 199 GLY A H     1 
ATOM   523  N N     . LEU A 1 58  ? 30.190 19.243  29.836 1.00 42.41 ? 200 LEU A N     1 
ATOM   524  C CA    . LEU A 1 58  ? 31.425 19.447  29.107 1.00 40.80 ? 200 LEU A CA    1 
ATOM   525  C C     . LEU A 1 58  ? 32.350 18.235  29.283 1.00 37.89 ? 200 LEU A C     1 
ATOM   526  O O     . LEU A 1 58  ? 32.498 17.738  30.397 1.00 36.71 ? 200 LEU A O     1 
ATOM   527  C CB    . LEU A 1 58  ? 32.143 20.729  29.616 1.00 46.73 ? 200 LEU A CB    1 
ATOM   528  C CG    . LEU A 1 58  ? 31.676 22.181  29.379 1.00 45.04 ? 200 LEU A CG    1 
ATOM   529  C CD1   . LEU A 1 58  ? 32.497 23.126  30.276 1.00 39.52 ? 200 LEU A CD1   1 
ATOM   530  C CD2   . LEU A 1 58  ? 31.792 22.524  27.892 1.00 39.09 ? 200 LEU A CD2   1 
ATOM   531  H H     . LEU A 1 58  ? 30.088 19.646  30.724 1.00 0.00  ? 200 LEU A H     1 
ATOM   532  N N     . ASN A 1 59  ? 33.030 17.773  28.235 1.00 35.69 ? 201 ASN A N     1 
ATOM   533  C CA    . ASN A 1 59  ? 33.928 16.625  28.250 1.00 31.85 ? 201 ASN A CA    1 
ATOM   534  C C     . ASN A 1 59  ? 34.932 16.846  27.146 1.00 27.94 ? 201 ASN A C     1 
ATOM   535  O O     . ASN A 1 59  ? 34.670 17.596  26.207 1.00 28.29 ? 201 ASN A O     1 
ATOM   536  C CB    . ASN A 1 59  ? 33.189 15.315  27.969 1.00 35.36 ? 201 ASN A CB    1 
ATOM   537  C CG    . ASN A 1 59  ? 32.254 15.329  26.759 1.00 33.48 ? 201 ASN A CG    1 
ATOM   538  O OD1   . ASN A 1 59  ? 32.598 14.912  25.652 1.00 34.83 ? 201 ASN A OD1   1 
ATOM   539  N ND2   . ASN A 1 59  ? 31.022 15.771  26.902 1.00 34.48 ? 201 ASN A ND2   1 
ATOM   540  H H     . ASN A 1 59  ? 32.917 18.244  27.384 1.00 0.00  ? 201 ASN A H     1 
ATOM   541  H HD21  . ASN A 1 59  ? 30.446 15.768  26.110 1.00 0.00  ? 201 ASN A HD21  1 
ATOM   542  H HD22  . ASN A 1 59  ? 30.713 16.086  27.777 1.00 0.00  ? 201 ASN A HD22  1 
ATOM   543  N N     . VAL A 1 60  ? 36.087 16.214  27.266 1.00 26.34 ? 202 VAL A N     1 
ATOM   544  C CA    . VAL A 1 60  ? 37.197 16.357  26.330 1.00 25.52 ? 202 VAL A CA    1 
ATOM   545  C C     . VAL A 1 60  ? 37.353 15.067  25.519 1.00 26.25 ? 202 VAL A C     1 
ATOM   546  O O     . VAL A 1 60  ? 37.275 13.990  26.092 1.00 25.52 ? 202 VAL A O     1 
ATOM   547  C CB    . VAL A 1 60  ? 38.501 16.650  27.149 1.00 20.99 ? 202 VAL A CB    1 
ATOM   548  C CG1   . VAL A 1 60  ? 39.668 16.888  26.247 1.00 22.20 ? 202 VAL A CG1   1 
ATOM   549  C CG2   . VAL A 1 60  ? 38.353 17.896  27.955 1.00 19.61 ? 202 VAL A CG2   1 
ATOM   550  H H     . VAL A 1 60  ? 36.205 15.613  28.030 1.00 0.00  ? 202 VAL A H     1 
ATOM   551  N N     . LYS A 1 61  ? 37.553 15.082  24.225 1.00 24.38 ? 203 LYS A N     1 
ATOM   552  C CA    . LYS A 1 61  ? 37.786 13.889  23.427 1.00 25.13 ? 203 LYS A CA    1 
ATOM   553  C C     . LYS A 1 61  ? 39.252 13.925  23.081 1.00 22.80 ? 203 LYS A C     1 
ATOM   554  O O     . LYS A 1 61  ? 39.734 15.003  22.751 1.00 23.62 ? 203 LYS A O     1 
ATOM   555  C CB    . LYS A 1 61  ? 37.052 13.902  22.095 1.00 29.98 ? 203 LYS A CB    1 
ATOM   556  C CG    . LYS A 1 61  ? 35.558 14.022  22.095 1.00 33.46 ? 203 LYS A CG    1 
ATOM   557  C CD    . LYS A 1 61  ? 34.922 12.890  22.846 1.00 36.30 ? 203 LYS A CD    1 
ATOM   558  C CE    . LYS A 1 61  ? 33.398 12.906  22.689 1.00 46.15 ? 203 LYS A CE    1 
ATOM   559  N NZ    . LYS A 1 61  ? 32.738 14.083  23.246 1.00 47.97 ? 203 LYS A NZ    1 
ATOM   560  H H     . LYS A 1 61  ? 37.545 15.948  23.768 1.00 0.00  ? 203 LYS A H     1 
ATOM   561  H HZ1   . LYS A 1 61  ? 33.097 14.938  22.775 1.00 0.00  ? 203 LYS A HZ1   1 
ATOM   562  H HZ2   . LYS A 1 61  ? 31.712 14.009  23.095 1.00 0.00  ? 203 LYS A HZ2   1 
ATOM   563  H HZ3   . LYS A 1 61  ? 32.935 14.141  24.266 1.00 0.00  ? 203 LYS A HZ3   1 
ATOM   564  N N     . HIS A 1 62  ? 40.016 12.852  23.126 1.00 22.60 ? 204 HIS A N     1 
ATOM   565  C CA    . HIS A 1 62  ? 41.409 12.862  22.748 1.00 17.89 ? 204 HIS A CA    1 
ATOM   566  C C     . HIS A 1 62  ? 41.628 12.015  21.496 1.00 21.03 ? 204 HIS A C     1 
ATOM   567  O O     . HIS A 1 62  ? 41.250 10.853  21.443 1.00 23.98 ? 204 HIS A O     1 
ATOM   568  C CB    . HIS A 1 62  ? 42.237 12.322  23.872 1.00 18.27 ? 204 HIS A CB    1 
ATOM   569  C CG    . HIS A 1 62  ? 42.145 13.145  25.128 1.00 17.63 ? 204 HIS A CG    1 
ATOM   570  N ND1   . HIS A 1 62  ? 42.916 14.161  25.517 1.00 14.76 ? 204 HIS A ND1   1 
ATOM   571  C CD2   . HIS A 1 62  ? 41.206 12.908  26.097 1.00 17.34 ? 204 HIS A CD2   1 
ATOM   572  C CE1   . HIS A 1 62  ? 42.479 14.524  26.696 1.00 14.74 ? 204 HIS A CE1   1 
ATOM   573  N NE2   . HIS A 1 62  ? 41.460 13.781  27.018 1.00 16.52 ? 204 HIS A NE2   1 
ATOM   574  H H     . HIS A 1 62  ? 39.620 12.009  23.430 1.00 0.00  ? 204 HIS A H     1 
ATOM   575  H HD1   . HIS A 1 62  ? 43.656 14.554  25.023 1.00 0.00  ? 204 HIS A HD1   1 
ATOM   576  H HE2   . HIS A 1 62  ? 40.952 13.871  27.848 1.00 0.00  ? 204 HIS A HE2   1 
ATOM   577  N N     . TYR A 1 63  ? 42.244 12.527  20.443 1.00 19.25 ? 205 TYR A N     1 
ATOM   578  C CA    . TYR A 1 63  ? 42.469 11.853  19.206 1.00 19.64 ? 205 TYR A CA    1 
ATOM   579  C C     . TYR A 1 63  ? 43.971 11.697  19.075 1.00 23.83 ? 205 TYR A C     1 
ATOM   580  O O     . TYR A 1 63  ? 44.687 12.699  19.180 1.00 28.46 ? 205 TYR A O     1 
ATOM   581  C CB    . TYR A 1 63  ? 41.935 12.692  18.046 1.00 18.01 ? 205 TYR A CB    1 
ATOM   582  C CG    . TYR A 1 63  ? 40.447 12.863  18.117 1.00 20.77 ? 205 TYR A CG    1 
ATOM   583  C CD1   . TYR A 1 63  ? 39.932 13.872  18.936 1.00 26.86 ? 205 TYR A CD1   1 
ATOM   584  C CD2   . TYR A 1 63  ? 39.595 12.030  17.390 1.00 21.18 ? 205 TYR A CD2   1 
ATOM   585  C CE1   . TYR A 1 63  ? 38.554 14.060  19.045 1.00 27.73 ? 205 TYR A CE1   1 
ATOM   586  C CE2   . TYR A 1 63  ? 38.204 12.225  17.490 1.00 23.54 ? 205 TYR A CE2   1 
ATOM   587  C CZ    . TYR A 1 63  ? 37.693 13.237  18.321 1.00 25.89 ? 205 TYR A CZ    1 
ATOM   588  O OH    . TYR A 1 63  ? 36.345 13.470  18.445 1.00 24.39 ? 205 TYR A OH    1 
ATOM   589  H H     . TYR A 1 63  ? 42.573 13.446  20.519 1.00 0.00  ? 205 TYR A H     1 
ATOM   590  H HH    . TYR A 1 63  ? 36.200 14.197  19.055 1.00 0.00  ? 205 TYR A HH    1 
ATOM   591  N N     . LYS A 1 64  ? 44.524 10.498  18.936 1.00 25.34 ? 206 LYS A N     1 
ATOM   592  C CA    . LYS A 1 64  ? 45.951 10.353  18.753 1.00 22.42 ? 206 LYS A CA    1 
ATOM   593  C C     . LYS A 1 64  ? 46.400 10.840  17.382 1.00 20.33 ? 206 LYS A C     1 
ATOM   594  O O     . LYS A 1 64  ? 45.622 10.731  16.445 1.00 21.79 ? 206 LYS A O     1 
ATOM   595  C CB    . LYS A 1 64  ? 46.240 8.880   19.012 1.00 22.76 ? 206 LYS A CB    1 
ATOM   596  C CG    . LYS A 1 64  ? 47.679 8.501   19.056 1.00 25.49 ? 206 LYS A CG    1 
ATOM   597  C CD    . LYS A 1 64  ? 47.858 7.096   19.539 1.00 29.79 ? 206 LYS A CD    1 
ATOM   598  C CE    . LYS A 1 64  ? 47.658 6.887   21.030 1.00 32.70 ? 206 LYS A CE    1 
ATOM   599  N NZ    . LYS A 1 64  ? 47.815 5.482   21.392 1.00 35.95 ? 206 LYS A NZ    1 
ATOM   600  H H     . LYS A 1 64  ? 43.957 9.699   18.958 1.00 0.00  ? 206 LYS A H     1 
ATOM   601  H HZ1   . LYS A 1 64  ? 48.772 5.163   21.138 1.00 0.00  ? 206 LYS A HZ1   1 
ATOM   602  H HZ2   . LYS A 1 64  ? 47.673 5.370   22.416 1.00 0.00  ? 206 LYS A HZ2   1 
ATOM   603  H HZ3   . LYS A 1 64  ? 47.112 4.912   20.880 1.00 0.00  ? 206 LYS A HZ3   1 
ATOM   604  N N     . ILE A 1 65  ? 47.594 11.426  17.226 1.00 21.95 ? 207 ILE A N     1 
ATOM   605  C CA    . ILE A 1 65  ? 48.129 11.845  15.935 1.00 20.97 ? 207 ILE A CA    1 
ATOM   606  C C     . ILE A 1 65  ? 49.413 11.040  15.766 1.00 21.10 ? 207 ILE A C     1 
ATOM   607  O O     . ILE A 1 65  ? 50.358 11.087  16.541 1.00 19.39 ? 207 ILE A O     1 
ATOM   608  C CB    . ILE A 1 65  ? 48.450 13.403  15.861 1.00 21.81 ? 207 ILE A CB    1 
ATOM   609  C CG1   . ILE A 1 65  ? 47.220 14.307  16.074 1.00 14.06 ? 207 ILE A CG1   1 
ATOM   610  C CG2   . ILE A 1 65  ? 48.960 13.680  14.446 1.00 17.18 ? 207 ILE A CG2   1 
ATOM   611  C CD1   . ILE A 1 65  ? 47.458 15.800  16.422 1.00 16.25 ? 207 ILE A CD1   1 
ATOM   612  H H     . ILE A 1 65  ? 48.139 11.582  18.024 1.00 0.00  ? 207 ILE A H     1 
ATOM   613  N N     . ARG A 1 66  ? 49.417 10.221  14.726 1.00 24.10 ? 208 ARG A N     1 
ATOM   614  C CA    . ARG A 1 66  ? 50.550 9.386   14.444 1.00 23.05 ? 208 ARG A CA    1 
ATOM   615  C C     . ARG A 1 66  ? 51.440 10.052  13.428 1.00 23.21 ? 208 ARG A C     1 
ATOM   616  O O     . ARG A 1 66  ? 50.989 10.741  12.520 1.00 22.91 ? 208 ARG A O     1 
ATOM   617  C CB    . ARG A 1 66  ? 50.048 8.087   13.922 1.00 23.23 ? 208 ARG A CB    1 
ATOM   618  C CG    . ARG A 1 66  ? 49.204 7.283   14.849 1.00 25.87 ? 208 ARG A CG    1 
ATOM   619  C CD    . ARG A 1 66  ? 50.066 6.382   15.656 1.00 24.20 ? 208 ARG A CD    1 
ATOM   620  N NE    . ARG A 1 66  ? 49.164 5.560   16.462 1.00 31.39 ? 208 ARG A NE    1 
ATOM   621  C CZ    . ARG A 1 66  ? 49.539 4.624   17.347 1.00 30.66 ? 208 ARG A CZ    1 
ATOM   622  N NH1   . ARG A 1 66  ? 50.843 4.404   17.565 1.00 35.64 ? 208 ARG A NH1   1 
ATOM   623  N NH2   . ARG A 1 66  ? 48.598 3.947   18.034 1.00 25.79 ? 208 ARG A NH2   1 
ATOM   624  H H     . ARG A 1 66  ? 48.633 10.184  14.139 1.00 0.00  ? 208 ARG A H     1 
ATOM   625  H HE    . ARG A 1 66  ? 48.203 5.705   16.346 1.00 0.00  ? 208 ARG A HE    1 
ATOM   626  H HH11  . ARG A 1 66  ? 51.530 4.936   17.069 1.00 0.00  ? 208 ARG A HH11  1 
ATOM   627  H HH12  . ARG A 1 66  ? 51.129 3.708   18.223 1.00 0.00  ? 208 ARG A HH12  1 
ATOM   628  H HH21  . ARG A 1 66  ? 47.629 4.144   17.882 1.00 0.00  ? 208 ARG A HH21  1 
ATOM   629  H HH22  . ARG A 1 66  ? 48.868 3.248   18.696 1.00 0.00  ? 208 ARG A HH22  1 
ATOM   630  N N     . LYS A 1 67  ? 52.718 9.853   13.595 1.00 27.14 ? 209 LYS A N     1 
ATOM   631  C CA    . LYS A 1 67  ? 53.721 10.371  12.726 1.00 33.50 ? 209 LYS A CA    1 
ATOM   632  C C     . LYS A 1 67  ? 54.160 9.318   11.708 1.00 34.94 ? 209 LYS A C     1 
ATOM   633  O O     . LYS A 1 67  ? 54.645 8.237   12.073 1.00 41.04 ? 209 LYS A O     1 
ATOM   634  C CB    . LYS A 1 67  ? 54.802 10.836  13.699 1.00 38.67 ? 209 LYS A CB    1 
ATOM   635  C CG    . LYS A 1 67  ? 56.069 11.403  13.147 1.00 48.04 ? 209 LYS A CG    1 
ATOM   636  C CD    . LYS A 1 67  ? 55.759 12.587  12.268 1.00 54.57 ? 209 LYS A CD    1 
ATOM   637  C CE    . LYS A 1 67  ? 57.034 13.253  11.757 1.00 61.59 ? 209 LYS A CE    1 
ATOM   638  N NZ    . LYS A 1 67  ? 57.668 12.477  10.711 1.00 63.80 ? 209 LYS A NZ    1 
ATOM   639  H H     . LYS A 1 67  ? 53.005 9.316   14.362 1.00 0.00  ? 209 LYS A H     1 
ATOM   640  H HZ1   . LYS A 1 67  ? 57.013 12.373  9.910  1.00 0.00  ? 209 LYS A HZ1   1 
ATOM   641  H HZ2   . LYS A 1 67  ? 58.530 12.964  10.392 1.00 0.00  ? 209 LYS A HZ2   1 
ATOM   642  H HZ3   . LYS A 1 67  ? 57.918 11.537  11.080 1.00 0.00  ? 209 LYS A HZ3   1 
ATOM   643  N N     . LEU A 1 68  ? 53.981 9.537   10.420 1.00 35.07 ? 210 LEU A N     1 
ATOM   644  C CA    . LEU A 1 68  ? 54.470 8.623   9.403  1.00 39.73 ? 210 LEU A CA    1 
ATOM   645  C C     . LEU A 1 68  ? 55.993 8.756   9.326  1.00 46.15 ? 210 LEU A C     1 
ATOM   646  O O     . LEU A 1 68  ? 56.585 9.846   9.523  1.00 49.70 ? 210 LEU A O     1 
ATOM   647  C CB    . LEU A 1 68  ? 53.893 8.951   8.040  1.00 34.25 ? 210 LEU A CB    1 
ATOM   648  C CG    . LEU A 1 68  ? 52.408 8.838   7.908  1.00 38.73 ? 210 LEU A CG    1 
ATOM   649  C CD1   . LEU A 1 68  ? 51.899 9.730   6.803  1.00 36.08 ? 210 LEU A CD1   1 
ATOM   650  C CD2   . LEU A 1 68  ? 52.075 7.391   7.671  1.00 33.64 ? 210 LEU A CD2   1 
ATOM   651  H H     . LEU A 1 68  ? 53.502 10.344  10.140 1.00 0.00  ? 210 LEU A H     1 
ATOM   652  N N     . ASP A 1 69  ? 56.641 7.670   8.919  1.00 53.89 ? 211 ASP A N     1 
ATOM   653  C CA    . ASP A 1 69  ? 58.100 7.614   8.759  1.00 57.39 ? 211 ASP A CA    1 
ATOM   654  C C     . ASP A 1 69  ? 58.574 8.556   7.650  1.00 58.32 ? 211 ASP A C     1 
ATOM   655  O O     . ASP A 1 69  ? 59.665 9.114   7.701  1.00 59.71 ? 211 ASP A O     1 
ATOM   656  C CB    . ASP A 1 69  ? 58.516 6.175   8.447  1.00 58.12 ? 211 ASP A CB    1 
ATOM   657  H H     . ASP A 1 69  ? 56.120 6.866   8.715  1.00 0.00  ? 211 ASP A H     1 
ATOM   658  N N     . SER A 1 70  ? 57.727 8.814   6.655  1.00 60.97 ? 212 SER A N     1 
ATOM   659  C CA    . SER A 1 70  ? 58.027 9.754   5.593  1.00 65.61 ? 212 SER A CA    1 
ATOM   660  C C     . SER A 1 70  ? 57.840 11.235  5.980  1.00 64.15 ? 212 SER A C     1 
ATOM   661  O O     . SER A 1 70  ? 57.988 12.115  5.127  1.00 65.92 ? 212 SER A O     1 
ATOM   662  C CB    . SER A 1 70  ? 57.147 9.355   4.358  1.00 72.05 ? 212 SER A CB    1 
ATOM   663  O OG    . SER A 1 70  ? 55.738 9.145   4.557  1.00 77.84 ? 212 SER A OG    1 
ATOM   664  H H     . SER A 1 70  ? 56.865 8.349   6.640  1.00 0.00  ? 212 SER A H     1 
ATOM   665  H HG    . SER A 1 70  ? 55.606 8.436   5.190  1.00 0.00  ? 212 SER A HG    1 
ATOM   666  N N     . GLY A 1 71  ? 57.440 11.579  7.221  1.00 61.51 ? 213 GLY A N     1 
ATOM   667  C CA    . GLY A 1 71  ? 57.291 12.975  7.607  1.00 55.28 ? 213 GLY A CA    1 
ATOM   668  C C     . GLY A 1 71  ? 55.900 13.399  8.056  1.00 49.73 ? 213 GLY A C     1 
ATOM   669  O O     . GLY A 1 71  ? 55.795 14.043  9.098  1.00 49.96 ? 213 GLY A O     1 
ATOM   670  H H     . GLY A 1 71  ? 57.246 10.876  7.876  1.00 0.00  ? 213 GLY A H     1 
ATOM   671  N N     . GLY A 1 72  ? 54.893 12.938  7.335  1.00 41.97 ? 214 GLY A N     1 
ATOM   672  C CA    . GLY A 1 72  ? 53.519 13.287  7.597  1.00 36.16 ? 214 GLY A CA    1 
ATOM   673  C C     . GLY A 1 72  ? 52.904 12.892  8.927  1.00 31.55 ? 214 GLY A C     1 
ATOM   674  O O     . GLY A 1 72  ? 53.527 12.233  9.758  1.00 31.13 ? 214 GLY A O     1 
ATOM   675  H H     . GLY A 1 72  ? 55.089 12.333  6.590  1.00 0.00  ? 214 GLY A H     1 
ATOM   676  N N     . PHE A 1 73  ? 51.618 13.259  9.052  1.00 29.10 ? 215 PHE A N     1 
ATOM   677  C CA    . PHE A 1 73  ? 50.797 13.110  10.256 1.00 26.79 ? 215 PHE A CA    1 
ATOM   678  C C     . PHE A 1 73  ? 49.379 12.708  9.898  1.00 23.99 ? 215 PHE A C     1 
ATOM   679  O O     . PHE A 1 73  ? 48.891 13.093  8.828  1.00 25.70 ? 215 PHE A O     1 
ATOM   680  C CB    . PHE A 1 73  ? 50.717 14.447  11.056 1.00 24.14 ? 215 PHE A CB    1 
ATOM   681  C CG    . PHE A 1 73  ? 52.067 14.910  11.606 1.00 23.06 ? 215 PHE A CG    1 
ATOM   682  C CD1   . PHE A 1 73  ? 52.878 15.731  10.819 1.00 22.60 ? 215 PHE A CD1   1 
ATOM   683  C CD2   . PHE A 1 73  ? 52.483 14.516  12.885 1.00 23.74 ? 215 PHE A CD2   1 
ATOM   684  C CE1   . PHE A 1 73  ? 54.099 16.162  11.301 1.00 17.81 ? 215 PHE A CE1   1 
ATOM   685  C CE2   . PHE A 1 73  ? 53.713 14.955  13.363 1.00 24.42 ? 215 PHE A CE2   1 
ATOM   686  C CZ    . PHE A 1 73  ? 54.514 15.777  12.567 1.00 20.26 ? 215 PHE A CZ    1 
ATOM   687  H H     . PHE A 1 73  ? 51.191 13.662  8.269  1.00 0.00  ? 215 PHE A H     1 
ATOM   688  N N     . TYR A 1 74  ? 48.657 11.962  10.736 1.00 24.02 ? 216 TYR A N     1 
ATOM   689  C CA    . TYR A 1 74  ? 47.287 11.607  10.378 1.00 19.56 ? 216 TYR A CA    1 
ATOM   690  C C     . TYR A 1 74  ? 46.503 11.283  11.624 1.00 14.56 ? 216 TYR A C     1 
ATOM   691  O O     . TYR A 1 74  ? 47.109 10.935  12.623 1.00 16.22 ? 216 TYR A O     1 
ATOM   692  C CB    . TYR A 1 74  ? 47.277 10.367  9.405  1.00 19.63 ? 216 TYR A CB    1 
ATOM   693  C CG    . TYR A 1 74  ? 47.756 9.038   10.008 1.00 17.55 ? 216 TYR A CG    1 
ATOM   694  C CD1   . TYR A 1 74  ? 46.870 8.255   10.739 1.00 15.68 ? 216 TYR A CD1   1 
ATOM   695  C CD2   . TYR A 1 74  ? 49.063 8.604   9.864  1.00 16.76 ? 216 TYR A CD2   1 
ATOM   696  C CE1   . TYR A 1 74  ? 47.264 7.067   11.337 1.00 22.39 ? 216 TYR A CE1   1 
ATOM   697  C CE2   . TYR A 1 74  ? 49.477 7.397   10.451 1.00 21.37 ? 216 TYR A CE2   1 
ATOM   698  C CZ    . TYR A 1 74  ? 48.575 6.635   11.190 1.00 22.94 ? 216 TYR A CZ    1 
ATOM   699  O OH    . TYR A 1 74  ? 48.974 5.460   11.806 1.00 23.92 ? 216 TYR A OH    1 
ATOM   700  H H     . TYR A 1 74  ? 49.042 11.655  11.583 1.00 0.00  ? 216 TYR A H     1 
ATOM   701  H HH    . TYR A 1 74  ? 49.905 5.306   11.630 1.00 0.00  ? 216 TYR A HH    1 
ATOM   702  N N     . ILE A 1 75  ? 45.193 11.398  11.538 1.00 15.98 ? 217 ILE A N     1 
ATOM   703  C CA    . ILE A 1 75  ? 44.280 10.935  12.557 1.00 19.85 ? 217 ILE A CA    1 
ATOM   704  C C     . ILE A 1 75  ? 43.467 9.867   11.821 1.00 20.91 ? 217 ILE A C     1 
ATOM   705  O O     . ILE A 1 75  ? 43.114 8.867   12.448 1.00 22.82 ? 217 ILE A O     1 
ATOM   706  C CB    . ILE A 1 75  ? 43.310 12.026  13.102 1.00 18.78 ? 217 ILE A CB    1 
ATOM   707  C CG1   . ILE A 1 75  ? 44.181 13.099  13.802 1.00 19.91 ? 217 ILE A CG1   1 
ATOM   708  C CG2   . ILE A 1 75  ? 42.328 11.450  14.109 1.00 16.51 ? 217 ILE A CG2   1 
ATOM   709  C CD1   . ILE A 1 75  ? 43.407 14.207  14.488 1.00 23.75 ? 217 ILE A CD1   1 
ATOM   710  H H     . ILE A 1 75  ? 44.817 11.821  10.738 1.00 0.00  ? 217 ILE A H     1 
ATOM   711  N N     . THR A 1 76  ? 43.123 9.993   10.524 1.00 24.04 ? 218 THR A N     1 
ATOM   712  C CA    . THR A 1 76  ? 42.415 8.944   9.788  1.00 22.88 ? 218 THR A CA    1 
ATOM   713  C C     . THR A 1 76  ? 43.085 8.627   8.452  1.00 21.97 ? 218 THR A C     1 
ATOM   714  O O     . THR A 1 76  ? 43.977 9.344   8.002  1.00 24.53 ? 218 THR A O     1 
ATOM   715  C CB    . THR A 1 76  ? 40.929 9.283   9.483  1.00 20.80 ? 218 THR A CB    1 
ATOM   716  O OG1   . THR A 1 76  ? 40.840 10.370  8.585  1.00 28.09 ? 218 THR A OG1   1 
ATOM   717  C CG2   . THR A 1 76  ? 40.193 9.718   10.721 1.00 21.40 ? 218 THR A CG2   1 
ATOM   718  H H     . THR A 1 76  ? 43.356 10.821  10.054 1.00 0.00  ? 218 THR A H     1 
ATOM   719  H HG1   . THR A 1 76  ? 41.261 11.141  8.972  1.00 0.00  ? 218 THR A HG1   1 
ATOM   720  N N     . SER A 1 77  ? 42.647 7.560   7.790  1.00 20.59 ? 219 SER A N     1 
ATOM   721  C CA    . SER A 1 77  ? 43.144 7.154   6.483  1.00 23.91 ? 219 SER A CA    1 
ATOM   722  C C     . SER A 1 77  ? 42.568 8.047   5.400  1.00 23.85 ? 219 SER A C     1 
ATOM   723  O O     . SER A 1 77  ? 42.974 7.978   4.236  1.00 26.15 ? 219 SER A O     1 
ATOM   724  C CB    . SER A 1 77  ? 42.747 5.703   6.203  1.00 18.00 ? 219 SER A CB    1 
ATOM   725  O OG    . SER A 1 77  ? 41.349 5.557   6.417  1.00 22.07 ? 219 SER A OG    1 
ATOM   726  H H     . SER A 1 77  ? 41.948 7.015   8.207  1.00 0.00  ? 219 SER A H     1 
ATOM   727  H HG    . SER A 1 77  ? 41.139 5.780   7.327  1.00 0.00  ? 219 SER A HG    1 
ATOM   728  N N     . ARG A 1 78  ? 41.568 8.861   5.733  1.00 28.03 ? 220 ARG A N     1 
ATOM   729  C CA    . ARG A 1 78  ? 41.018 9.776   4.752  1.00 29.16 ? 220 ARG A CA    1 
ATOM   730  C C     . ARG A 1 78  ? 42.063 10.756  4.252  1.00 29.39 ? 220 ARG A C     1 
ATOM   731  O O     . ARG A 1 78  ? 42.240 10.738  3.056  1.00 27.21 ? 220 ARG A O     1 
ATOM   732  C CB    . ARG A 1 78  ? 39.898 10.518  5.349  1.00 32.41 ? 220 ARG A CB    1 
ATOM   733  C CG    . ARG A 1 78  ? 39.170 10.866  4.124  1.00 36.29 ? 220 ARG A CG    1 
ATOM   734  C CD    . ARG A 1 78  ? 37.946 11.569  4.547  1.00 40.41 ? 220 ARG A CD    1 
ATOM   735  N NE    . ARG A 1 78  ? 37.235 11.806  3.325  1.00 50.19 ? 220 ARG A NE    1 
ATOM   736  C CZ    . ARG A 1 78  ? 36.248 12.676  3.200  1.00 56.31 ? 220 ARG A CZ    1 
ATOM   737  N NH1   . ARG A 1 78  ? 35.868 13.383  4.267  1.00 62.50 ? 220 ARG A NH1   1 
ATOM   738  N NH2   . ARG A 1 78  ? 35.708 12.824  1.978  1.00 61.86 ? 220 ARG A NH2   1 
ATOM   739  H H     . ARG A 1 78  ? 41.203 8.842   6.642  1.00 0.00  ? 220 ARG A H     1 
ATOM   740  H HE    . ARG A 1 78  ? 37.497 11.291  2.534  1.00 0.00  ? 220 ARG A HE    1 
ATOM   741  H HH11  . ARG A 1 78  ? 36.329 13.250  5.145  1.00 0.00  ? 220 ARG A HH11  1 
ATOM   742  H HH12  . ARG A 1 78  ? 35.123 14.045  4.189  1.00 0.00  ? 220 ARG A HH12  1 
ATOM   743  H HH21  . ARG A 1 78  ? 36.055 12.287  1.209  1.00 0.00  ? 220 ARG A HH21  1 
ATOM   744  H HH22  . ARG A 1 78  ? 34.959 13.471  1.837  1.00 0.00  ? 220 ARG A HH22  1 
ATOM   745  N N     . THR A 1 79  ? 42.827 11.493  5.070  1.00 31.25 ? 221 THR A N     1 
ATOM   746  C CA    . THR A 1 79  ? 43.860 12.417  4.633  1.00 33.29 ? 221 THR A CA    1 
ATOM   747  C C     . THR A 1 79  ? 45.020 12.365  5.585  1.00 26.67 ? 221 THR A C     1 
ATOM   748  O O     . THR A 1 79  ? 44.831 11.997  6.731  1.00 28.77 ? 221 THR A O     1 
ATOM   749  C CB    . THR A 1 79  ? 43.434 13.869  4.632  1.00 42.07 ? 221 THR A CB    1 
ATOM   750  O OG1   . THR A 1 79  ? 42.867 14.240  5.882  1.00 53.09 ? 221 THR A OG1   1 
ATOM   751  C CG2   . THR A 1 79  ? 42.399 14.020  3.527  1.00 44.98 ? 221 THR A CG2   1 
ATOM   752  H H     . THR A 1 79  ? 42.678 11.402  6.033  1.00 0.00  ? 221 THR A H     1 
ATOM   753  H HG1   . THR A 1 79  ? 43.515 14.112  6.578  1.00 0.00  ? 221 THR A HG1   1 
ATOM   754  N N     . GLN A 1 80  ? 46.190 12.724  5.094  1.00 25.32 ? 222 GLN A N     1 
ATOM   755  C CA    . GLN A 1 80  ? 47.473 12.728  5.801  1.00 32.19 ? 222 GLN A CA    1 
ATOM   756  C C     . GLN A 1 80  ? 47.938 14.178  5.675  1.00 34.50 ? 222 GLN A C     1 
ATOM   757  O O     . GLN A 1 80  ? 47.487 14.854  4.748  1.00 37.46 ? 222 GLN A O     1 
ATOM   758  C CB    . GLN A 1 80  ? 48.520 11.841  5.111  1.00 35.36 ? 222 GLN A CB    1 
ATOM   759  C CG    . GLN A 1 80  ? 48.391 10.309  5.224  1.00 49.63 ? 222 GLN A CG    1 
ATOM   760  C CD    . GLN A 1 80  ? 47.010 9.713   4.906  1.00 54.79 ? 222 GLN A CD    1 
ATOM   761  O OE1   . GLN A 1 80  ? 46.311 8.997   5.692  1.00 43.69 ? 222 GLN A OE1   1 
ATOM   762  N NE2   . GLN A 1 80  ? 46.668 10.093  3.658  1.00 46.99 ? 222 GLN A NE2   1 
ATOM   763  H H     . GLN A 1 80  ? 46.202 13.018  4.161  1.00 0.00  ? 222 GLN A H     1 
ATOM   764  H HE21  . GLN A 1 80  ? 45.805 9.786   3.313  1.00 0.00  ? 222 GLN A HE21  1 
ATOM   765  H HE22  . GLN A 1 80  ? 47.275 10.655  3.133  1.00 0.00  ? 222 GLN A HE22  1 
ATOM   766  N N     . PHE A 1 81  ? 48.831 14.728  6.495  1.00 35.40 ? 223 PHE A N     1 
ATOM   767  C CA    . PHE A 1 81  ? 49.219 16.136  6.420  1.00 31.94 ? 223 PHE A CA    1 
ATOM   768  C C     . PHE A 1 81  ? 50.712 16.177  6.576  1.00 32.10 ? 223 PHE A C     1 
ATOM   769  O O     . PHE A 1 81  ? 51.317 15.347  7.251  1.00 31.98 ? 223 PHE A O     1 
ATOM   770  C CB    . PHE A 1 81  ? 48.635 16.967  7.563  1.00 27.90 ? 223 PHE A CB    1 
ATOM   771  C CG    . PHE A 1 81  ? 47.131 16.812  7.691  1.00 25.41 ? 223 PHE A CG    1 
ATOM   772  C CD1   . PHE A 1 81  ? 46.275 17.492  6.833  1.00 26.42 ? 223 PHE A CD1   1 
ATOM   773  C CD2   . PHE A 1 81  ? 46.618 15.898  8.612  1.00 24.98 ? 223 PHE A CD2   1 
ATOM   774  C CE1   . PHE A 1 81  ? 44.907 17.248  6.895  1.00 25.69 ? 223 PHE A CE1   1 
ATOM   775  C CE2   . PHE A 1 81  ? 45.255 15.661  8.673  1.00 24.43 ? 223 PHE A CE2   1 
ATOM   776  C CZ    . PHE A 1 81  ? 44.402 16.328  7.806  1.00 22.01 ? 223 PHE A CZ    1 
ATOM   777  H H     . PHE A 1 81  ? 49.247 14.164  7.180  1.00 0.00  ? 223 PHE A H     1 
ATOM   778  N N     . ASN A 1 82  ? 51.350 17.144  5.956  1.00 35.97 ? 224 ASN A N     1 
ATOM   779  C CA    . ASN A 1 82  ? 52.785 17.288  6.072  1.00 38.95 ? 224 ASN A CA    1 
ATOM   780  C C     . ASN A 1 82  ? 53.202 17.960  7.354  1.00 38.79 ? 224 ASN A C     1 
ATOM   781  O O     . ASN A 1 82  ? 54.391 17.917  7.648  1.00 40.17 ? 224 ASN A O     1 
ATOM   782  C CB    . ASN A 1 82  ? 53.384 18.124  4.970  1.00 49.92 ? 224 ASN A CB    1 
ATOM   783  C CG    . ASN A 1 82  ? 53.236 17.548  3.575  1.00 61.98 ? 224 ASN A CG    1 
ATOM   784  O OD1   . ASN A 1 82  ? 53.340 18.306  2.612  1.00 70.65 ? 224 ASN A OD1   1 
ATOM   785  N ND2   . ASN A 1 82  ? 52.934 16.264  3.344  1.00 67.80 ? 224 ASN A ND2   1 
ATOM   786  H H     . ASN A 1 82  ? 50.845 17.779  5.406  1.00 0.00  ? 224 ASN A H     1 
ATOM   787  H HD21  . ASN A 1 82  ? 52.858 15.978  2.411  1.00 0.00  ? 224 ASN A HD21  1 
ATOM   788  H HD22  . ASN A 1 82  ? 52.798 15.650  4.095  1.00 0.00  ? 224 ASN A HD22  1 
ATOM   789  N N     . SER A 1 83  ? 52.305 18.592  8.124  1.00 35.37 ? 225 SER A N     1 
ATOM   790  C CA    . SER A 1 83  ? 52.678 19.267  9.352  1.00 30.47 ? 225 SER A CA    1 
ATOM   791  C C     . SER A 1 83  ? 51.451 19.311  10.247 1.00 26.97 ? 225 SER A C     1 
ATOM   792  O O     . SER A 1 83  ? 50.302 19.219  9.784  1.00 24.83 ? 225 SER A O     1 
ATOM   793  C CB    . SER A 1 83  ? 53.104 20.682  9.041  1.00 33.00 ? 225 SER A CB    1 
ATOM   794  O OG    . SER A 1 83  ? 52.061 21.400  8.343  1.00 39.92 ? 225 SER A OG    1 
ATOM   795  H H     . SER A 1 83  ? 51.365 18.598  7.848  1.00 0.00  ? 225 SER A H     1 
ATOM   796  H HG    . SER A 1 83  ? 51.861 20.952  7.518  1.00 0.00  ? 225 SER A HG    1 
ATOM   797  N N     . LEU A 1 84  ? 51.708 19.504  11.536 1.00 26.47 ? 226 LEU A N     1 
ATOM   798  C CA    . LEU A 1 84  ? 50.670 19.689  12.515 1.00 26.67 ? 226 LEU A CA    1 
ATOM   799  C C     . LEU A 1 84  ? 49.945 20.992  12.228 1.00 31.80 ? 226 LEU A C     1 
ATOM   800  O O     . LEU A 1 84  ? 48.757 21.130  12.543 1.00 37.47 ? 226 LEU A O     1 
ATOM   801  C CB    . LEU A 1 84  ? 51.290 19.725  13.868 1.00 26.13 ? 226 LEU A CB    1 
ATOM   802  C CG    . LEU A 1 84  ? 51.820 18.422  14.378 1.00 31.64 ? 226 LEU A CG    1 
ATOM   803  C CD1   . LEU A 1 84  ? 52.590 18.717  15.697 1.00 29.77 ? 226 LEU A CD1   1 
ATOM   804  C CD2   . LEU A 1 84  ? 50.662 17.433  14.510 1.00 28.50 ? 226 LEU A CD2   1 
ATOM   805  H H     . LEU A 1 84  ? 52.642 19.521  11.832 1.00 0.00  ? 226 LEU A H     1 
ATOM   806  N N     . GLN A 1 85  ? 50.604 21.971  11.605 1.00 32.21 ? 227 GLN A N     1 
ATOM   807  C CA    . GLN A 1 85  ? 49.975 23.221  11.208 1.00 33.16 ? 227 GLN A CA    1 
ATOM   808  C C     . GLN A 1 85  ? 48.898 22.892  10.182 1.00 31.76 ? 227 GLN A C     1 
ATOM   809  O O     . GLN A 1 85  ? 47.747 23.337  10.283 1.00 33.34 ? 227 GLN A O     1 
ATOM   810  C CB    . GLN A 1 85  ? 51.009 24.149  10.584 1.00 39.58 ? 227 GLN A CB    1 
ATOM   811  C CG    . GLN A 1 85  ? 52.176 24.628  11.483 1.00 50.74 ? 227 GLN A CG    1 
ATOM   812  C CD    . GLN A 1 85  ? 53.277 23.642  11.927 1.00 54.91 ? 227 GLN A CD    1 
ATOM   813  O OE1   . GLN A 1 85  ? 53.444 22.545  11.391 1.00 57.21 ? 227 GLN A OE1   1 
ATOM   814  N NE2   . GLN A 1 85  ? 54.101 23.967  12.918 1.00 51.78 ? 227 GLN A NE2   1 
ATOM   815  H H     . GLN A 1 85  ? 51.555 21.842  11.406 1.00 0.00  ? 227 GLN A H     1 
ATOM   816  H HE21  . GLN A 1 85  ? 54.786 23.314  13.169 1.00 0.00  ? 227 GLN A HE21  1 
ATOM   817  H HE22  . GLN A 1 85  ? 54.010 24.833  13.367 1.00 0.00  ? 227 GLN A HE22  1 
ATOM   818  N N     . GLN A 1 86  ? 49.232 22.060  9.190  1.00 32.15 ? 228 GLN A N     1 
ATOM   819  C CA    . GLN A 1 86  ? 48.262 21.608  8.182  1.00 30.43 ? 228 GLN A CA    1 
ATOM   820  C C     . GLN A 1 86  ? 47.069 20.817  8.714  1.00 29.65 ? 228 GLN A C     1 
ATOM   821  O O     . GLN A 1 86  ? 45.911 20.921  8.272  1.00 29.69 ? 228 GLN A O     1 
ATOM   822  C CB    . GLN A 1 86  ? 48.884 20.711  7.158  1.00 39.40 ? 228 GLN A CB    1 
ATOM   823  C CG    . GLN A 1 86  ? 49.922 21.229  6.199  1.00 50.41 ? 228 GLN A CG    1 
ATOM   824  C CD    . GLN A 1 86  ? 50.119 20.299  4.989  1.00 61.57 ? 228 GLN A CD    1 
ATOM   825  O OE1   . GLN A 1 86  ? 49.577 19.195  4.805  1.00 56.39 ? 228 GLN A OE1   1 
ATOM   826  N NE2   . GLN A 1 86  ? 50.972 20.762  4.090  1.00 69.80 ? 228 GLN A NE2   1 
ATOM   827  H H     . GLN A 1 86  ? 50.156 21.740  9.133  1.00 0.00  ? 228 GLN A H     1 
ATOM   828  H HE21  . GLN A 1 86  ? 51.137 20.211  3.297  1.00 0.00  ? 228 GLN A HE21  1 
ATOM   829  H HE22  . GLN A 1 86  ? 51.412 21.626  4.231  1.00 0.00  ? 228 GLN A HE22  1 
ATOM   830  N N     . LEU A 1 87  ? 47.362 19.942  9.662  1.00 28.04 ? 229 LEU A N     1 
ATOM   831  C CA    . LEU A 1 87  ? 46.326 19.156  10.286 1.00 26.04 ? 229 LEU A CA    1 
ATOM   832  C C     . LEU A 1 87  ? 45.393 20.091  11.014 1.00 28.08 ? 229 LEU A C     1 
ATOM   833  O O     . LEU A 1 87  ? 44.189 19.983  10.780 1.00 31.71 ? 229 LEU A O     1 
ATOM   834  C CB    . LEU A 1 87  ? 47.000 18.148  11.225 1.00 25.23 ? 229 LEU A CB    1 
ATOM   835  C CG    . LEU A 1 87  ? 46.184 17.103  11.973 1.00 24.28 ? 229 LEU A CG    1 
ATOM   836  C CD1   . LEU A 1 87  ? 47.062 15.884  12.215 1.00 22.85 ? 229 LEU A CD1   1 
ATOM   837  C CD2   . LEU A 1 87  ? 45.600 17.724  13.235 1.00 19.27 ? 229 LEU A CD2   1 
ATOM   838  H H     . LEU A 1 87  ? 48.294 19.827  9.943  1.00 0.00  ? 229 LEU A H     1 
ATOM   839  N N     . VAL A 1 88  ? 45.906 21.017  11.841 1.00 29.74 ? 230 VAL A N     1 
ATOM   840  C CA    . VAL A 1 88  ? 45.083 21.967  12.595 1.00 30.29 ? 230 VAL A CA    1 
ATOM   841  C C     . VAL A 1 88  ? 44.212 22.840  11.703 1.00 29.35 ? 230 VAL A C     1 
ATOM   842  O O     . VAL A 1 88  ? 43.022 23.043  11.954 1.00 30.66 ? 230 VAL A O     1 
ATOM   843  C CB    . VAL A 1 88  ? 46.025 22.819  13.481 1.00 33.21 ? 230 VAL A CB    1 
ATOM   844  C CG1   . VAL A 1 88  ? 45.320 24.027  14.078 1.00 25.63 ? 230 VAL A CG1   1 
ATOM   845  C CG2   . VAL A 1 88  ? 46.496 21.925  14.649 1.00 31.18 ? 230 VAL A CG2   1 
ATOM   846  H H     . VAL A 1 88  ? 46.879 21.059  11.945 1.00 0.00  ? 230 VAL A H     1 
ATOM   847  N N     . ALA A 1 89  ? 44.774 23.338  10.619 1.00 30.66 ? 231 ALA A N     1 
ATOM   848  C CA    . ALA A 1 89  ? 43.975 24.090  9.686  1.00 30.78 ? 231 ALA A CA    1 
ATOM   849  C C     . ALA A 1 89  ? 42.904 23.215  9.049  1.00 35.19 ? 231 ALA A C     1 
ATOM   850  O O     . ALA A 1 89  ? 41.755 23.658  8.958  1.00 40.32 ? 231 ALA A O     1 
ATOM   851  C CB    . ALA A 1 89  ? 44.866 24.637  8.618  1.00 30.45 ? 231 ALA A CB    1 
ATOM   852  H H     . ALA A 1 89  ? 45.729 23.197  10.449 1.00 0.00  ? 231 ALA A H     1 
ATOM   853  N N     . TYR A 1 90  ? 43.176 21.959  8.645  1.00 36.41 ? 232 TYR A N     1 
ATOM   854  C CA    . TYR A 1 90  ? 42.170 21.141  8.033  1.00 30.58 ? 232 TYR A CA    1 
ATOM   855  C C     . TYR A 1 90  ? 41.024 20.843  8.979  1.00 31.68 ? 232 TYR A C     1 
ATOM   856  O O     . TYR A 1 90  ? 39.847 20.902  8.567  1.00 37.03 ? 232 TYR A O     1 
ATOM   857  C CB    . TYR A 1 90  ? 42.820 19.873  7.567  1.00 33.21 ? 232 TYR A CB    1 
ATOM   858  C CG    . TYR A 1 90  ? 41.799 18.899  6.988  1.00 37.62 ? 232 TYR A CG    1 
ATOM   859  C CD1   . TYR A 1 90  ? 41.297 19.040  5.700  1.00 40.02 ? 232 TYR A CD1   1 
ATOM   860  C CD2   . TYR A 1 90  ? 41.314 17.846  7.761  1.00 39.21 ? 232 TYR A CD2   1 
ATOM   861  C CE1   . TYR A 1 90  ? 40.331 18.140  5.203  1.00 44.40 ? 232 TYR A CE1   1 
ATOM   862  C CE2   . TYR A 1 90  ? 40.369 16.960  7.278  1.00 41.02 ? 232 TYR A CE2   1 
ATOM   863  C CZ    . TYR A 1 90  ? 39.864 17.088  6.013  1.00 43.95 ? 232 TYR A CZ    1 
ATOM   864  O OH    . TYR A 1 90  ? 38.912 16.136  5.623  1.00 47.64 ? 232 TYR A OH    1 
ATOM   865  H H     . TYR A 1 90  ? 44.078 21.598  8.772  1.00 0.00  ? 232 TYR A H     1 
ATOM   866  H HH    . TYR A 1 90  ? 38.762 15.519  6.343  1.00 0.00  ? 232 TYR A HH    1 
ATOM   867  N N     . TYR A 1 91  ? 41.282 20.493  10.229 1.00 30.35 ? 233 TYR A N     1 
ATOM   868  C CA    . TYR A 1 91  ? 40.156 20.223  11.106 1.00 31.04 ? 233 TYR A CA    1 
ATOM   869  C C     . TYR A 1 91  ? 39.461 21.480  11.617 1.00 34.28 ? 233 TYR A C     1 
ATOM   870  O O     . TYR A 1 91  ? 38.459 21.375  12.342 1.00 31.02 ? 233 TYR A O     1 
ATOM   871  C CB    . TYR A 1 91  ? 40.606 19.336  12.275 1.00 29.31 ? 233 TYR A CB    1 
ATOM   872  C CG    . TYR A 1 91  ? 40.843 17.923  11.736 1.00 28.19 ? 233 TYR A CG    1 
ATOM   873  C CD1   . TYR A 1 91  ? 39.781 17.116  11.336 1.00 26.42 ? 233 TYR A CD1   1 
ATOM   874  C CD2   . TYR A 1 91  ? 42.139 17.483  11.565 1.00 25.97 ? 233 TYR A CD2   1 
ATOM   875  C CE1   . TYR A 1 91  ? 40.023 15.874  10.754 1.00 27.89 ? 233 TYR A CE1   1 
ATOM   876  C CE2   . TYR A 1 91  ? 42.384 16.252  10.983 1.00 29.25 ? 233 TYR A CE2   1 
ATOM   877  C CZ    . TYR A 1 91  ? 41.333 15.445  10.579 1.00 27.19 ? 233 TYR A CZ    1 
ATOM   878  O OH    . TYR A 1 91  ? 41.627 14.216  10.033 1.00 26.01 ? 233 TYR A OH    1 
ATOM   879  H H     . TYR A 1 91  ? 42.204 20.418  10.553 1.00 0.00  ? 233 TYR A H     1 
ATOM   880  H HH    . TYR A 1 91  ? 42.579 14.102  9.994  1.00 0.00  ? 233 TYR A HH    1 
ATOM   881  N N     . SER A 1 92  ? 39.968 22.688  11.322 1.00 36.43 ? 234 SER A N     1 
ATOM   882  C CA    . SER A 1 92  ? 39.232 23.912  11.629 1.00 41.71 ? 234 SER A CA    1 
ATOM   883  C C     . SER A 1 92  ? 38.158 24.161  10.558 1.00 43.83 ? 234 SER A C     1 
ATOM   884  O O     . SER A 1 92  ? 37.074 24.702  10.841 1.00 45.06 ? 234 SER A O     1 
ATOM   885  C CB    . SER A 1 92  ? 40.201 25.085  11.689 1.00 42.30 ? 234 SER A CB    1 
ATOM   886  O OG    . SER A 1 92  ? 40.986 25.046  12.883 1.00 48.73 ? 234 SER A OG    1 
ATOM   887  H H     . SER A 1 92  ? 40.847 22.750  10.893 1.00 0.00  ? 234 SER A H     1 
ATOM   888  H HG    . SER A 1 92  ? 40.408 25.087  13.648 1.00 0.00  ? 234 SER A HG    1 
ATOM   889  N N     . LYS A 1 93  ? 38.405 23.735  9.309  1.00 43.62 ? 235 LYS A N     1 
ATOM   890  C CA    . LYS A 1 93  ? 37.400 23.893  8.274  1.00 44.37 ? 235 LYS A CA    1 
ATOM   891  C C     . LYS A 1 93  ? 36.572 22.621  8.232  1.00 45.23 ? 235 LYS A C     1 
ATOM   892  O O     . LYS A 1 93  ? 35.493 22.622  7.646  1.00 47.48 ? 235 LYS A O     1 
ATOM   893  C CB    . LYS A 1 93  ? 37.993 24.075  6.876  1.00 45.84 ? 235 LYS A CB    1 
ATOM   894  C CG    . LYS A 1 93  ? 39.224 24.966  6.768  1.00 52.21 ? 235 LYS A CG    1 
ATOM   895  C CD    . LYS A 1 93  ? 39.628 25.326  5.331  1.00 60.70 ? 235 LYS A CD    1 
ATOM   896  C CE    . LYS A 1 93  ? 40.046 24.236  4.323  1.00 66.54 ? 235 LYS A CE    1 
ATOM   897  N NZ    . LYS A 1 93  ? 40.265 24.818  2.993  1.00 66.58 ? 235 LYS A NZ    1 
ATOM   898  H H     . LYS A 1 93  ? 39.265 23.317  9.096  1.00 0.00  ? 235 LYS A H     1 
ATOM   899  H HZ1   . LYS A 1 93  ? 41.018 25.533  3.047  1.00 0.00  ? 235 LYS A HZ1   1 
ATOM   900  H HZ2   . LYS A 1 93  ? 40.545 24.069  2.329  1.00 0.00  ? 235 LYS A HZ2   1 
ATOM   901  H HZ3   . LYS A 1 93  ? 39.386 25.264  2.661  1.00 0.00  ? 235 LYS A HZ3   1 
ATOM   902  N N     . HIS A 1 94  ? 37.018 21.451  8.704  1.00 46.64 ? 236 HIS A N     1 
ATOM   903  C CA    . HIS A 1 94  ? 36.224 20.215  8.622  1.00 42.62 ? 236 HIS A CA    1 
ATOM   904  C C     . HIS A 1 94  ? 36.349 19.282  9.810  1.00 35.78 ? 236 HIS A C     1 
ATOM   905  O O     . HIS A 1 94  ? 37.446 18.801  10.035 1.00 37.09 ? 236 HIS A O     1 
ATOM   906  C CB    . HIS A 1 94  ? 36.618 19.369  7.450  1.00 49.99 ? 236 HIS A CB    1 
ATOM   907  C CG    . HIS A 1 94  ? 36.622 20.122  6.150  1.00 60.24 ? 236 HIS A CG    1 
ATOM   908  N ND1   . HIS A 1 94  ? 35.571 20.599  5.496  1.00 63.25 ? 236 HIS A ND1   1 
ATOM   909  C CD2   . HIS A 1 94  ? 37.764 20.459  5.455  1.00 65.54 ? 236 HIS A CD2   1 
ATOM   910  C CE1   . HIS A 1 94  ? 36.031 21.213  4.431  1.00 67.12 ? 236 HIS A CE1   1 
ATOM   911  N NE2   . HIS A 1 94  ? 37.350 21.125  4.405  1.00 68.25 ? 236 HIS A NE2   1 
ATOM   912  H H     . HIS A 1 94  ? 37.905 21.416  9.119  1.00 0.00  ? 236 HIS A H     1 
ATOM   913  H HD1   . HIS A 1 94  ? 34.637 20.511  5.756  1.00 0.00  ? 236 HIS A HD1   1 
ATOM   914  H HE2   . HIS A 1 94  ? 37.926 21.498  3.711  1.00 0.00  ? 236 HIS A HE2   1 
ATOM   915  N N     . ALA A 1 95  ? 35.290 18.944  10.534 1.00 27.99 ? 237 ALA A N     1 
ATOM   916  C CA    . ALA A 1 95  ? 35.396 18.003  11.624 1.00 29.67 ? 237 ALA A CA    1 
ATOM   917  C C     . ALA A 1 95  ? 35.897 16.623  11.147 1.00 31.84 ? 237 ALA A C     1 
ATOM   918  O O     . ALA A 1 95  ? 36.722 15.996  11.822 1.00 32.54 ? 237 ALA A O     1 
ATOM   919  C CB    . ALA A 1 95  ? 34.030 17.857  12.267 1.00 26.48 ? 237 ALA A CB    1 
ATOM   920  H H     . ALA A 1 95  ? 34.419 19.341  10.325 1.00 0.00  ? 237 ALA A H     1 
ATOM   921  N N     . ASP A 1 96  ? 35.299 16.142  10.036 1.00 31.47 ? 238 ASP A N     1 
ATOM   922  C CA    . ASP A 1 96  ? 35.733 14.959  9.306  1.00 31.52 ? 238 ASP A CA    1 
ATOM   923  C C     . ASP A 1 96  ? 36.179 13.780  10.157 1.00 32.45 ? 238 ASP A C     1 
ATOM   924  O O     . ASP A 1 96  ? 37.289 13.245  10.070 1.00 34.35 ? 238 ASP A O     1 
ATOM   925  C CB    . ASP A 1 96  ? 36.846 15.401  8.419  1.00 34.44 ? 238 ASP A CB    1 
ATOM   926  C CG    . ASP A 1 96  ? 36.895 14.546  7.189  1.00 37.26 ? 238 ASP A CG    1 
ATOM   927  O OD1   . ASP A 1 96  ? 36.017 14.742  6.360  1.00 55.92 ? 238 ASP A OD1   1 
ATOM   928  O OD2   . ASP A 1 96  ? 37.799 13.726  7.015  1.00 35.84 ? 238 ASP A OD2   1 
ATOM   929  H H     . ASP A 1 96  ? 34.517 16.624  9.697  1.00 0.00  ? 238 ASP A H     1 
ATOM   930  N N     . GLY A 1 97  ? 35.270 13.461  11.072 1.00 32.40 ? 239 GLY A N     1 
ATOM   931  C CA    . GLY A 1 97  ? 35.421 12.390  12.045 1.00 29.09 ? 239 GLY A CA    1 
ATOM   932  C C     . GLY A 1 97  ? 35.377 12.865  13.482 1.00 30.73 ? 239 GLY A C     1 
ATOM   933  O O     . GLY A 1 97  ? 34.819 12.182  14.341 1.00 33.04 ? 239 GLY A O     1 
ATOM   934  H H     . GLY A 1 97  ? 34.441 13.983  11.093 1.00 0.00  ? 239 GLY A H     1 
ATOM   935  N N     . LEU A 1 98  ? 35.970 14.029  13.750 1.00 31.00 ? 240 LEU A N     1 
ATOM   936  C CA    . LEU A 1 98  ? 36.041 14.583  15.092 1.00 28.63 ? 240 LEU A CA    1 
ATOM   937  C C     . LEU A 1 98  ? 34.675 14.997  15.601 1.00 30.55 ? 240 LEU A C     1 
ATOM   938  O O     . LEU A 1 98  ? 33.761 15.301  14.827 1.00 30.86 ? 240 LEU A O     1 
ATOM   939  C CB    . LEU A 1 98  ? 36.906 15.813  15.134 1.00 25.52 ? 240 LEU A CB    1 
ATOM   940  C CG    . LEU A 1 98  ? 38.236 15.758  14.434 1.00 30.51 ? 240 LEU A CG    1 
ATOM   941  C CD1   . LEU A 1 98  ? 38.879 17.085  14.671 1.00 31.73 ? 240 LEU A CD1   1 
ATOM   942  C CD2   . LEU A 1 98  ? 39.146 14.652  14.913 1.00 28.43 ? 240 LEU A CD2   1 
ATOM   943  H H     . LEU A 1 98  ? 36.374 14.531  13.012 1.00 0.00  ? 240 LEU A H     1 
ATOM   944  N N     . CYS A 1 99  ? 34.555 15.037  16.926 1.00 33.84 ? 241 CYS A N     1 
ATOM   945  C CA    . CYS A 1 99  ? 33.324 15.483  17.581 1.00 35.58 ? 241 CYS A CA    1 
ATOM   946  C C     . CYS A 1 99  ? 32.887 16.889  17.129 1.00 36.15 ? 241 CYS A C     1 
ATOM   947  O O     . CYS A 1 99  ? 31.696 17.194  17.058 1.00 36.40 ? 241 CYS A O     1 
ATOM   948  C CB    . CYS A 1 99  ? 33.512 15.476  19.120 1.00 31.06 ? 241 CYS A CB    1 
ATOM   949  S SG    . CYS A 1 99  ? 34.879 16.464  19.800 1.00 31.75 ? 241 CYS A SG    1 
ATOM   950  H H     . CYS A 1 99  ? 35.314 14.759  17.480 1.00 0.00  ? 241 CYS A H     1 
ATOM   951  N N     . HIS A 1 100 ? 33.806 17.786  16.769 1.00 34.65 ? 242 HIS A N     1 
ATOM   952  C CA    . HIS A 1 100 ? 33.432 19.123  16.376 1.00 34.53 ? 242 HIS A CA    1 
ATOM   953  C C     . HIS A 1 100 ? 34.639 19.674  15.659 1.00 31.40 ? 242 HIS A C     1 
ATOM   954  O O     . HIS A 1 100 ? 35.737 19.249  15.968 1.00 32.54 ? 242 HIS A O     1 
ATOM   955  C CB    . HIS A 1 100 ? 33.101 19.928  17.656 1.00 39.15 ? 242 HIS A CB    1 
ATOM   956  C CG    . HIS A 1 100 ? 32.432 21.284  17.410 1.00 43.83 ? 242 HIS A CG    1 
ATOM   957  N ND1   . HIS A 1 100 ? 31.146 21.595  17.568 1.00 45.92 ? 242 HIS A ND1   1 
ATOM   958  C CD2   . HIS A 1 100 ? 33.068 22.431  16.982 1.00 45.20 ? 242 HIS A CD2   1 
ATOM   959  C CE1   . HIS A 1 100 ? 31.000 22.863  17.248 1.00 45.27 ? 242 HIS A CE1   1 
ATOM   960  N NE2   . HIS A 1 100 ? 32.164 23.366  16.903 1.00 46.12 ? 242 HIS A NE2   1 
ATOM   961  H H     . HIS A 1 100 ? 34.753 17.532  16.771 1.00 0.00  ? 242 HIS A H     1 
ATOM   962  H HD1   . HIS A 1 100 ? 30.441 20.992  17.867 1.00 0.00  ? 242 HIS A HD1   1 
ATOM   963  H HE2   . HIS A 1 100 ? 32.325 24.289  16.632 1.00 0.00  ? 242 HIS A HE2   1 
ATOM   964  N N     . ARG A 1 101 ? 34.495 20.550  14.681 1.00 31.49 ? 243 ARG A N     1 
ATOM   965  C CA    . ARG A 1 101 ? 35.645 21.170  14.061 1.00 33.94 ? 243 ARG A CA    1 
ATOM   966  C C     . ARG A 1 101 ? 36.318 22.038  15.096 1.00 33.58 ? 243 ARG A C     1 
ATOM   967  O O     . ARG A 1 101 ? 35.705 22.458  16.084 1.00 31.81 ? 243 ARG A O     1 
ATOM   968  C CB    . ARG A 1 101 ? 35.265 22.047  12.850 1.00 43.71 ? 243 ARG A CB    1 
ATOM   969  C CG    . ARG A 1 101 ? 34.201 23.121  13.005 1.00 55.76 ? 243 ARG A CG    1 
ATOM   970  C CD    . ARG A 1 101 ? 34.068 24.008  11.738 1.00 67.98 ? 243 ARG A CD    1 
ATOM   971  N NE    . ARG A 1 101 ? 34.492 25.382  12.029 1.00 81.00 ? 243 ARG A NE    1 
ATOM   972  C CZ    . ARG A 1 101 ? 33.731 26.273  12.727 1.00 87.67 ? 243 ARG A CZ    1 
ATOM   973  N NH1   . ARG A 1 101 ? 32.498 25.944  13.191 1.00 90.68 ? 243 ARG A NH1   1 
ATOM   974  N NH2   . ARG A 1 101 ? 34.237 27.483  13.051 1.00 90.90 ? 243 ARG A NH2   1 
ATOM   975  H H     . ARG A 1 101 ? 33.595 20.783  14.371 1.00 0.00  ? 243 ARG A H     1 
ATOM   976  H HE    . ARG A 1 101 ? 35.369 25.675  11.705 1.00 0.00  ? 243 ARG A HE    1 
ATOM   977  H HH11  . ARG A 1 101 ? 32.128 25.030  13.023 1.00 0.00  ? 243 ARG A HH11  1 
ATOM   978  H HH12  . ARG A 1 101 ? 31.960 26.616  13.700 1.00 0.00  ? 243 ARG A HH12  1 
ATOM   979  H HH21  . ARG A 1 101 ? 35.169 27.725  12.779 1.00 0.00  ? 243 ARG A HH21  1 
ATOM   980  H HH22  . ARG A 1 101 ? 33.680 28.137  13.563 1.00 0.00  ? 243 ARG A HH22  1 
ATOM   981  N N     . LEU A 1 102 ? 37.583 22.291  14.852 1.00 32.91 ? 244 LEU A N     1 
ATOM   982  C CA    . LEU A 1 102 ? 38.387 23.027  15.777 1.00 35.29 ? 244 LEU A CA    1 
ATOM   983  C C     . LEU A 1 102 ? 37.965 24.488  15.657 1.00 39.08 ? 244 LEU A C     1 
ATOM   984  O O     . LEU A 1 102 ? 37.946 25.045  14.554 1.00 40.26 ? 244 LEU A O     1 
ATOM   985  C CB    . LEU A 1 102 ? 39.857 22.777  15.399 1.00 28.51 ? 244 LEU A CB    1 
ATOM   986  C CG    . LEU A 1 102 ? 40.374 21.349  15.355 1.00 23.04 ? 244 LEU A CG    1 
ATOM   987  C CD1   . LEU A 1 102 ? 41.856 21.367  15.090 1.00 21.01 ? 244 LEU A CD1   1 
ATOM   988  C CD2   . LEU A 1 102 ? 40.055 20.650  16.658 1.00 19.18 ? 244 LEU A CD2   1 
ATOM   989  H H     . LEU A 1 102 ? 37.985 21.969  14.018 1.00 0.00  ? 244 LEU A H     1 
ATOM   990  N N     . THR A 1 103 ? 37.518 25.087  16.764 1.00 38.95 ? 245 THR A N     1 
ATOM   991  C CA    . THR A 1 103 ? 37.132 26.479  16.754 1.00 38.54 ? 245 THR A CA    1 
ATOM   992  C C     . THR A 1 103 ? 38.121 27.403  17.484 1.00 43.25 ? 245 THR A C     1 
ATOM   993  O O     . THR A 1 103 ? 38.762 28.265  16.868 1.00 50.33 ? 245 THR A O     1 
ATOM   994  C CB    . THR A 1 103 ? 35.708 26.618  17.355 1.00 30.76 ? 245 THR A CB    1 
ATOM   995  O OG1   . THR A 1 103 ? 35.653 26.045  18.633 1.00 25.82 ? 245 THR A OG1   1 
ATOM   996  C CG2   . THR A 1 103 ? 34.700 25.928  16.460 1.00 29.07 ? 245 THR A CG2   1 
ATOM   997  H H     . THR A 1 103 ? 37.451 24.574  17.596 1.00 0.00  ? 245 THR A H     1 
ATOM   998  H HG1   . THR A 1 103 ? 35.876 25.113  18.576 1.00 0.00  ? 245 THR A HG1   1 
ATOM   999  N N     . THR A 1 104 ? 38.413 27.177  18.760 1.00 42.26 ? 246 THR A N     1 
ATOM   1000 C CA    . THR A 1 104 ? 39.190 28.128  19.540 1.00 37.60 ? 246 THR A CA    1 
ATOM   1001 C C     . THR A 1 104 ? 40.542 27.530  19.966 1.00 36.90 ? 246 THR A C     1 
ATOM   1002 O O     . THR A 1 104 ? 40.506 26.422  20.526 1.00 36.79 ? 246 THR A O     1 
ATOM   1003 C CB    . THR A 1 104 ? 38.284 28.488  20.751 1.00 35.35 ? 246 THR A CB    1 
ATOM   1004 O OG1   . THR A 1 104 ? 36.969 28.779  20.266 1.00 38.21 ? 246 THR A OG1   1 
ATOM   1005 C CG2   . THR A 1 104 ? 38.882 29.597  21.567 1.00 32.01 ? 246 THR A CG2   1 
ATOM   1006 H H     . THR A 1 104 ? 38.098 26.352  19.185 1.00 0.00  ? 246 THR A H     1 
ATOM   1007 H HG1   . THR A 1 104 ? 37.009 29.519  19.656 1.00 0.00  ? 246 THR A HG1   1 
ATOM   1008 N N     . VAL A 1 105 ? 41.737 28.122  19.723 1.00 33.18 ? 247 VAL A N     1 
ATOM   1009 C CA    . VAL A 1 105 ? 42.977 27.616  20.314 1.00 28.45 ? 247 VAL A CA    1 
ATOM   1010 C C     . VAL A 1 105 ? 42.769 27.785  21.827 1.00 33.97 ? 247 VAL A C     1 
ATOM   1011 O O     . VAL A 1 105 ? 42.163 28.755  22.309 1.00 38.81 ? 247 VAL A O     1 
ATOM   1012 C CB    . VAL A 1 105 ? 44.160 28.413  19.914 1.00 17.02 ? 247 VAL A CB    1 
ATOM   1013 C CG1   . VAL A 1 105 ? 45.420 27.963  20.615 1.00 18.99 ? 247 VAL A CG1   1 
ATOM   1014 C CG2   . VAL A 1 105 ? 44.324 28.211  18.465 1.00 16.06 ? 247 VAL A CG2   1 
ATOM   1015 H H     . VAL A 1 105 ? 41.772 28.907  19.138 1.00 0.00  ? 247 VAL A H     1 
ATOM   1016 N N     . CYS A 1 106 ? 43.115 26.771  22.605 1.00 35.76 ? 248 CYS A N     1 
ATOM   1017 C CA    . CYS A 1 106 ? 42.958 26.809  24.039 1.00 33.93 ? 248 CYS A CA    1 
ATOM   1018 C C     . CYS A 1 106 ? 43.822 27.937  24.601 1.00 36.51 ? 248 CYS A C     1 
ATOM   1019 O O     . CYS A 1 106 ? 44.981 28.051  24.179 1.00 37.74 ? 248 CYS A O     1 
ATOM   1020 C CB    . CYS A 1 106 ? 43.409 25.472  24.614 1.00 32.07 ? 248 CYS A CB    1 
ATOM   1021 S SG    . CYS A 1 106 ? 43.195 25.327  26.398 1.00 29.71 ? 248 CYS A SG    1 
ATOM   1022 H H     . CYS A 1 106 ? 43.491 25.966  22.192 1.00 0.00  ? 248 CYS A H     1 
ATOM   1023 N N     . PRO A 1 107 ? 43.252 28.823  25.448 1.00 40.37 ? 249 PRO A N     1 
ATOM   1024 C CA    . PRO A 1 107 ? 43.962 29.927  26.107 1.00 40.02 ? 249 PRO A CA    1 
ATOM   1025 C C     . PRO A 1 107 ? 45.122 29.429  26.983 1.00 39.69 ? 249 PRO A C     1 
ATOM   1026 O O     . PRO A 1 107 ? 46.265 29.684  26.606 1.00 41.47 ? 249 PRO A O     1 
ATOM   1027 C CB    . PRO A 1 107 ? 42.869 30.653  26.874 1.00 41.26 ? 249 PRO A CB    1 
ATOM   1028 C CG    . PRO A 1 107 ? 41.696 29.678  26.937 1.00 40.12 ? 249 PRO A CG    1 
ATOM   1029 C CD    . PRO A 1 107 ? 41.801 29.085  25.541 1.00 38.56 ? 249 PRO A CD    1 
ATOM   1030 O OXT   . PRO A 1 107 ? 44.874 28.766  28.003 1.00 38.54 ? 249 PRO A OXT   1 
ATOM   1031 N N     . ILE B 1 4   ? 30.755 13.640  37.890 1.00 77.32 ? 146 ILE B N     1 
ATOM   1032 C CA    . ILE B 1 4   ? 32.008 12.945  38.050 1.00 73.86 ? 146 ILE B CA    1 
ATOM   1033 C C     . ILE B 1 4   ? 32.864 13.150  36.814 1.00 74.84 ? 146 ILE B C     1 
ATOM   1034 O O     . ILE B 1 4   ? 34.063 13.036  36.987 1.00 74.55 ? 146 ILE B O     1 
ATOM   1035 C CB    . ILE B 1 4   ? 31.674 11.452  38.341 1.00 72.64 ? 146 ILE B CB    1 
ATOM   1036 C CG1   . ILE B 1 4   ? 32.864 10.875  39.023 1.00 71.22 ? 146 ILE B CG1   1 
ATOM   1037 C CG2   . ILE B 1 4   ? 31.362 10.615  37.091 1.00 72.33 ? 146 ILE B CG2   1 
ATOM   1038 C CD1   . ILE B 1 4   ? 32.556 9.467   39.437 1.00 70.68 ? 146 ILE B CD1   1 
ATOM   1039 N N     . GLN B 1 5   ? 32.373 13.467  35.586 1.00 76.76 ? 147 GLN B N     1 
ATOM   1040 C CA    . GLN B 1 5   ? 33.247 13.756  34.425 1.00 77.88 ? 147 GLN B CA    1 
ATOM   1041 C C     . GLN B 1 5   ? 34.323 14.841  34.696 1.00 77.14 ? 147 GLN B C     1 
ATOM   1042 O O     . GLN B 1 5   ? 35.322 14.994  33.992 1.00 74.64 ? 147 GLN B O     1 
ATOM   1043 C CB    . GLN B 1 5   ? 32.372 14.214  33.233 1.00 76.70 ? 147 GLN B CB    1 
ATOM   1044 H H     . GLN B 1 5   ? 31.402 13.506  35.464 1.00 0.00  ? 147 GLN B H     1 
ATOM   1045 N N     . ALA B 1 6   ? 33.901 15.638  35.701 1.00 77.96 ? 148 ALA B N     1 
ATOM   1046 C CA    . ALA B 1 6   ? 34.624 16.731  36.358 1.00 76.29 ? 148 ALA B CA    1 
ATOM   1047 C C     . ALA B 1 6   ? 35.258 16.519  37.768 1.00 71.95 ? 148 ALA B C     1 
ATOM   1048 O O     . ALA B 1 6   ? 35.363 17.471  38.554 1.00 74.37 ? 148 ALA B O     1 
ATOM   1049 C CB    . ALA B 1 6   ? 33.654 17.915  36.403 1.00 78.01 ? 148 ALA B CB    1 
ATOM   1050 H H     . ALA B 1 6   ? 32.998 15.464  36.033 1.00 0.00  ? 148 ALA B H     1 
ATOM   1051 N N     . GLU B 1 7   ? 35.638 15.288  38.139 1.00 62.95 ? 149 GLU B N     1 
ATOM   1052 C CA    . GLU B 1 7   ? 36.366 14.976  39.378 1.00 49.56 ? 149 GLU B CA    1 
ATOM   1053 C C     . GLU B 1 7   ? 37.839 14.941  39.069 1.00 44.00 ? 149 GLU B C     1 
ATOM   1054 O O     . GLU B 1 7   ? 38.164 14.323  38.067 1.00 42.34 ? 149 GLU B O     1 
ATOM   1055 C CB    . GLU B 1 7   ? 36.042 13.610  39.909 1.00 47.71 ? 149 GLU B CB    1 
ATOM   1056 C CG    . GLU B 1 7   ? 34.738 13.612  40.589 1.00 49.76 ? 149 GLU B CG    1 
ATOM   1057 C CD    . GLU B 1 7   ? 34.699 14.386  41.887 1.00 53.93 ? 149 GLU B CD    1 
ATOM   1058 O OE1   . GLU B 1 7   ? 35.697 14.992  42.329 1.00 59.76 ? 149 GLU B OE1   1 
ATOM   1059 O OE2   . GLU B 1 7   ? 33.615 14.361  42.489 1.00 62.85 ? 149 GLU B OE2   1 
ATOM   1060 H H     . GLU B 1 7   ? 35.415 14.544  37.543 1.00 0.00  ? 149 GLU B H     1 
ATOM   1061 N N     . GLU B 1 8   ? 38.819 15.437  39.808 1.00 39.53 ? 150 GLU B N     1 
ATOM   1062 C CA    . GLU B 1 8   ? 40.206 15.352  39.339 1.00 39.64 ? 150 GLU B CA    1 
ATOM   1063 C C     . GLU B 1 8   ? 40.703 13.911  39.043 1.00 36.88 ? 150 GLU B C     1 
ATOM   1064 O O     . GLU B 1 8   ? 41.378 13.627  38.050 1.00 30.37 ? 150 GLU B O     1 
ATOM   1065 C CB    . GLU B 1 8   ? 41.147 16.029  40.387 1.00 49.95 ? 150 GLU B CB    1 
ATOM   1066 C CG    . GLU B 1 8   ? 41.256 17.578  40.355 1.00 64.18 ? 150 GLU B CG    1 
ATOM   1067 C CD    . GLU B 1 8   ? 42.031 18.218  39.171 1.00 73.51 ? 150 GLU B CD    1 
ATOM   1068 O OE1   . GLU B 1 8   ? 42.676 17.505  38.386 1.00 77.30 ? 150 GLU B OE1   1 
ATOM   1069 O OE2   . GLU B 1 8   ? 42.074 19.446  39.019 1.00 78.82 ? 150 GLU B OE2   1 
ATOM   1070 H H     . GLU B 1 8   ? 38.618 15.861  40.668 1.00 0.00  ? 150 GLU B H     1 
ATOM   1071 N N     . TRP B 1 9   ? 40.313 12.948  39.893 1.00 32.88 ? 151 TRP B N     1 
ATOM   1072 C CA    . TRP B 1 9   ? 40.726 11.547  39.816 1.00 28.27 ? 151 TRP B CA    1 
ATOM   1073 C C     . TRP B 1 9   ? 39.990 10.656  38.840 1.00 28.10 ? 151 TRP B C     1 
ATOM   1074 O O     . TRP B 1 9   ? 40.448 9.551   38.587 1.00 24.58 ? 151 TRP B O     1 
ATOM   1075 C CB    . TRP B 1 9   ? 40.633 10.926  41.198 1.00 23.32 ? 151 TRP B CB    1 
ATOM   1076 C CG    . TRP B 1 9   ? 39.371 11.229  42.011 1.00 21.56 ? 151 TRP B CG    1 
ATOM   1077 C CD1   . TRP B 1 9   ? 39.479 12.074  43.087 1.00 20.91 ? 151 TRP B CD1   1 
ATOM   1078 C CD2   . TRP B 1 9   ? 38.080 10.754  41.837 1.00 18.58 ? 151 TRP B CD2   1 
ATOM   1079 N NE1   . TRP B 1 9   ? 38.258 12.150  43.618 1.00 19.91 ? 151 TRP B NE1   1 
ATOM   1080 C CE2   . TRP B 1 9   ? 37.417 11.372  42.922 1.00 17.31 ? 151 TRP B CE2   1 
ATOM   1081 C CE3   . TRP B 1 9   ? 37.357 9.912   40.990 1.00 15.39 ? 151 TRP B CE3   1 
ATOM   1082 C CZ2   . TRP B 1 9   ? 36.070 11.184  43.171 1.00 17.49 ? 151 TRP B CZ2   1 
ATOM   1083 C CZ3   . TRP B 1 9   ? 36.001 9.720   41.220 1.00 14.67 ? 151 TRP B CZ3   1 
ATOM   1084 C CH2   . TRP B 1 9   ? 35.364 10.334  42.297 1.00 22.22 ? 151 TRP B CH2   1 
ATOM   1085 H H     . TRP B 1 9   ? 39.707 13.202  40.619 1.00 0.00  ? 151 TRP B H     1 
ATOM   1086 H HE1   . TRP B 1 9   ? 38.014 12.689  44.394 1.00 0.00  ? 151 TRP B HE1   1 
ATOM   1087 N N     . TYR B 1 10  ? 38.895 11.132  38.244 1.00 27.93 ? 152 TYR B N     1 
ATOM   1088 C CA    . TYR B 1 10  ? 38.091 10.325  37.372 1.00 27.47 ? 152 TYR B CA    1 
ATOM   1089 C C     . TYR B 1 10  ? 38.622 10.401  35.962 1.00 31.09 ? 152 TYR B C     1 
ATOM   1090 O O     . TYR B 1 10  ? 38.401 11.393  35.269 1.00 34.97 ? 152 TYR B O     1 
ATOM   1091 C CB    . TYR B 1 10  ? 36.634 10.797  37.413 1.00 27.94 ? 152 TYR B CB    1 
ATOM   1092 C CG    . TYR B 1 10  ? 35.723 9.811   36.657 1.00 36.76 ? 152 TYR B CG    1 
ATOM   1093 C CD1   . TYR B 1 10  ? 35.484 8.533   37.180 1.00 36.20 ? 152 TYR B CD1   1 
ATOM   1094 C CD2   . TYR B 1 10  ? 35.170 10.158  35.420 1.00 38.40 ? 152 TYR B CD2   1 
ATOM   1095 C CE1   . TYR B 1 10  ? 34.697 7.616   36.472 1.00 40.57 ? 152 TYR B CE1   1 
ATOM   1096 C CE2   . TYR B 1 10  ? 34.383 9.234   34.716 1.00 41.35 ? 152 TYR B CE2   1 
ATOM   1097 C CZ    . TYR B 1 10  ? 34.153 7.967   35.236 1.00 41.39 ? 152 TYR B CZ    1 
ATOM   1098 O OH    . TYR B 1 10  ? 33.402 7.042   34.545 1.00 44.41 ? 152 TYR B OH    1 
ATOM   1099 H H     . TYR B 1 10  ? 38.632 12.062  38.407 1.00 0.00  ? 152 TYR B H     1 
ATOM   1100 H HH    . TYR B 1 10  ? 33.349 6.229   35.052 1.00 0.00  ? 152 TYR B HH    1 
ATOM   1101 N N     . PHE B 1 11  ? 39.289 9.353   35.469 1.00 30.49 ? 153 PHE B N     1 
ATOM   1102 C CA    . PHE B 1 11  ? 39.788 9.378   34.112 1.00 27.45 ? 153 PHE B CA    1 
ATOM   1103 C C     . PHE B 1 11  ? 38.862 8.780   33.071 1.00 30.67 ? 153 PHE B C     1 
ATOM   1104 O O     . PHE B 1 11  ? 39.283 8.563   31.936 1.00 35.03 ? 153 PHE B O     1 
ATOM   1105 C CB    . PHE B 1 11  ? 41.141 8.700   34.044 1.00 26.21 ? 153 PHE B CB    1 
ATOM   1106 C CG    . PHE B 1 11  ? 42.280 9.587   34.571 1.00 27.75 ? 153 PHE B CG    1 
ATOM   1107 C CD1   . PHE B 1 11  ? 42.224 10.158  35.861 1.00 28.56 ? 153 PHE B CD1   1 
ATOM   1108 C CD2   . PHE B 1 11  ? 43.418 9.792   33.780 1.00 26.60 ? 153 PHE B CD2   1 
ATOM   1109 C CE1   . PHE B 1 11  ? 43.283 10.923  36.355 1.00 24.15 ? 153 PHE B CE1   1 
ATOM   1110 C CE2   . PHE B 1 11  ? 44.478 10.560  34.280 1.00 28.71 ? 153 PHE B CE2   1 
ATOM   1111 C CZ    . PHE B 1 11  ? 44.409 11.117  35.565 1.00 26.56 ? 153 PHE B CZ    1 
ATOM   1112 H H     . PHE B 1 11  ? 39.441 8.564   36.030 1.00 0.00  ? 153 PHE B H     1 
ATOM   1113 N N     . GLY B 1 12  ? 37.599 8.505   33.395 1.00 31.13 ? 154 GLY B N     1 
ATOM   1114 C CA    . GLY B 1 12  ? 36.643 8.032   32.436 1.00 30.11 ? 154 GLY B CA    1 
ATOM   1115 C C     . GLY B 1 12  ? 36.997 6.685   31.863 1.00 34.18 ? 154 GLY B C     1 
ATOM   1116 O O     . GLY B 1 12  ? 37.589 5.829   32.519 1.00 36.37 ? 154 GLY B O     1 
ATOM   1117 H H     . GLY B 1 12  ? 37.313 8.631   34.323 1.00 0.00  ? 154 GLY B H     1 
ATOM   1118 N N     . LYS B 1 13  ? 36.647 6.515   30.602 1.00 35.68 ? 155 LYS B N     1 
ATOM   1119 C CA    . LYS B 1 13  ? 36.879 5.269   29.919 1.00 36.15 ? 155 LYS B CA    1 
ATOM   1120 C C     . LYS B 1 13  ? 38.252 5.067   29.287 1.00 36.67 ? 155 LYS B C     1 
ATOM   1121 O O     . LYS B 1 13  ? 38.415 4.948   28.078 1.00 38.40 ? 155 LYS B O     1 
ATOM   1122 C CB    . LYS B 1 13  ? 35.761 5.138   28.880 1.00 37.52 ? 155 LYS B CB    1 
ATOM   1123 H H     . LYS B 1 13  ? 36.220 7.253   30.120 1.00 0.00  ? 155 LYS B H     1 
ATOM   1124 N N     . ILE B 1 14  ? 39.317 5.070   30.074 1.00 39.79 ? 156 ILE B N     1 
ATOM   1125 C CA    . ILE B 1 14  ? 40.638 4.778   29.555 1.00 37.47 ? 156 ILE B CA    1 
ATOM   1126 C C     . ILE B 1 14  ? 40.792 3.256   29.689 1.00 43.37 ? 156 ILE B C     1 
ATOM   1127 O O     . ILE B 1 14  ? 40.058 2.581   30.427 1.00 46.79 ? 156 ILE B O     1 
ATOM   1128 C CB    . ILE B 1 14  ? 41.725 5.518   30.365 1.00 34.36 ? 156 ILE B CB    1 
ATOM   1129 C CG1   . ILE B 1 14  ? 41.631 5.328   31.860 1.00 28.03 ? 156 ILE B CG1   1 
ATOM   1130 C CG2   . ILE B 1 14  ? 41.522 6.982   30.093 1.00 37.99 ? 156 ILE B CG2   1 
ATOM   1131 C CD1   . ILE B 1 14  ? 42.866 5.883   32.591 1.00 27.16 ? 156 ILE B CD1   1 
ATOM   1132 H H     . ILE B 1 14  ? 39.210 5.274   31.026 1.00 0.00  ? 156 ILE B H     1 
ATOM   1133 N N     . THR B 1 15  ? 41.742 2.627   29.008 1.00 44.39 ? 157 THR B N     1 
ATOM   1134 C CA    . THR B 1 15  ? 41.883 1.195   29.116 1.00 40.18 ? 157 THR B CA    1 
ATOM   1135 C C     . THR B 1 15  ? 42.819 0.846   30.258 1.00 38.29 ? 157 THR B C     1 
ATOM   1136 O O     . THR B 1 15  ? 43.540 1.700   30.777 1.00 39.02 ? 157 THR B O     1 
ATOM   1137 C CB    . THR B 1 15  ? 42.427 0.663   27.772 1.00 43.61 ? 157 THR B CB    1 
ATOM   1138 O OG1   . THR B 1 15  ? 43.810 0.934   27.784 1.00 46.49 ? 157 THR B OG1   1 
ATOM   1139 C CG2   . THR B 1 15  ? 41.710 1.252   26.550 1.00 42.07 ? 157 THR B CG2   1 
ATOM   1140 H H     . THR B 1 15  ? 42.349 3.136   28.431 1.00 0.00  ? 157 THR B H     1 
ATOM   1141 H HG1   . THR B 1 15  ? 44.205 0.623   26.966 1.00 0.00  ? 157 THR B HG1   1 
ATOM   1142 N N     . ARG B 1 16  ? 42.921 -0.422  30.600 1.00 34.16 ? 158 ARG B N     1 
ATOM   1143 C CA    . ARG B 1 16  ? 43.846 -0.870  31.588 1.00 35.10 ? 158 ARG B CA    1 
ATOM   1144 C C     . ARG B 1 16  ? 45.281 -0.564  31.158 1.00 36.34 ? 158 ARG B C     1 
ATOM   1145 O O     . ARG B 1 16  ? 46.114 -0.217  32.011 1.00 36.42 ? 158 ARG B O     1 
ATOM   1146 C CB    . ARG B 1 16  ? 43.650 -2.385  31.808 1.00 38.19 ? 158 ARG B CB    1 
ATOM   1147 C CG    . ARG B 1 16  ? 44.723 -2.880  32.776 1.00 39.95 ? 158 ARG B CG    1 
ATOM   1148 C CD    . ARG B 1 16  ? 44.790 -4.362  33.002 1.00 49.29 ? 158 ARG B CD    1 
ATOM   1149 N NE    . ARG B 1 16  ? 43.629 -4.791  33.739 1.00 53.75 ? 158 ARG B NE    1 
ATOM   1150 C CZ    . ARG B 1 16  ? 43.773 -5.601  34.782 1.00 56.85 ? 158 ARG B CZ    1 
ATOM   1151 N NH1   . ARG B 1 16  ? 44.986 -6.056  35.163 1.00 54.83 ? 158 ARG B NH1   1 
ATOM   1152 N NH2   . ARG B 1 16  ? 42.661 -5.860  35.484 1.00 62.07 ? 158 ARG B NH2   1 
ATOM   1153 H H     . ARG B 1 16  ? 42.342 -1.079  30.161 1.00 0.00  ? 158 ARG B H     1 
ATOM   1154 H HE    . ARG B 1 16  ? 42.737 -4.487  33.472 1.00 0.00  ? 158 ARG B HE    1 
ATOM   1155 H HH11  . ARG B 1 16  ? 45.804 -5.784  34.656 1.00 0.00  ? 158 ARG B HH11  1 
ATOM   1156 H HH12  . ARG B 1 16  ? 45.066 -6.665  35.952 1.00 0.00  ? 158 ARG B HH12  1 
ATOM   1157 H HH21  . ARG B 1 16  ? 41.790 -5.451  35.211 1.00 0.00  ? 158 ARG B HH21  1 
ATOM   1158 H HH22  . ARG B 1 16  ? 42.702 -6.463  36.281 1.00 0.00  ? 158 ARG B HH22  1 
ATOM   1159 N N     . ARG B 1 17  ? 45.615 -0.709  29.871 1.00 38.74 ? 159 ARG B N     1 
ATOM   1160 C CA    . ARG B 1 17  ? 46.988 -0.413  29.429 1.00 43.71 ? 159 ARG B CA    1 
ATOM   1161 C C     . ARG B 1 17  ? 47.269 1.084   29.617 1.00 40.70 ? 159 ARG B C     1 
ATOM   1162 O O     . ARG B 1 17  ? 48.265 1.420   30.250 1.00 39.24 ? 159 ARG B O     1 
ATOM   1163 C CB    . ARG B 1 17  ? 47.275 -0.791  27.913 1.00 50.97 ? 159 ARG B CB    1 
ATOM   1164 C CG    . ARG B 1 17  ? 46.596 -0.017  26.744 1.00 62.79 ? 159 ARG B CG    1 
ATOM   1165 C CD    . ARG B 1 17  ? 47.087 -0.294  25.307 1.00 68.70 ? 159 ARG B CD    1 
ATOM   1166 N NE    . ARG B 1 17  ? 46.654 0.790   24.432 1.00 75.01 ? 159 ARG B NE    1 
ATOM   1167 C CZ    . ARG B 1 17  ? 47.183 1.085   23.226 1.00 76.39 ? 159 ARG B CZ    1 
ATOM   1168 N NH1   . ARG B 1 17  ? 48.200 0.373   22.698 1.00 76.05 ? 159 ARG B NH1   1 
ATOM   1169 N NH2   . ARG B 1 17  ? 46.727 2.147   22.552 1.00 77.09 ? 159 ARG B NH2   1 
ATOM   1170 H H     . ARG B 1 17  ? 44.946 -1.012  29.222 1.00 0.00  ? 159 ARG B H     1 
ATOM   1171 H HE    . ARG B 1 17  ? 45.917 1.352   24.747 1.00 0.00  ? 159 ARG B HE    1 
ATOM   1172 H HH11  . ARG B 1 17  ? 48.585 -0.400  23.203 1.00 0.00  ? 159 ARG B HH11  1 
ATOM   1173 H HH12  . ARG B 1 17  ? 48.569 0.618   21.802 1.00 0.00  ? 159 ARG B HH12  1 
ATOM   1174 H HH21  . ARG B 1 17  ? 46.001 2.713   22.943 1.00 0.00  ? 159 ARG B HH21  1 
ATOM   1175 H HH22  . ARG B 1 17  ? 47.112 2.375   21.658 1.00 0.00  ? 159 ARG B HH22  1 
ATOM   1176 N N     . GLU B 1 18  ? 46.354 1.965   29.183 1.00 40.01 ? 160 GLU B N     1 
ATOM   1177 C CA    . GLU B 1 18  ? 46.460 3.400   29.270 1.00 40.66 ? 160 GLU B CA    1 
ATOM   1178 C C     . GLU B 1 18  ? 46.710 3.766   30.718 1.00 39.86 ? 160 GLU B C     1 
ATOM   1179 O O     . GLU B 1 18  ? 47.750 4.389   30.951 1.00 38.53 ? 160 GLU B O     1 
ATOM   1180 C CB    . GLU B 1 18  ? 45.166 4.037   28.732 1.00 45.63 ? 160 GLU B CB    1 
ATOM   1181 C CG    . GLU B 1 18  ? 44.901 3.778   27.231 1.00 55.09 ? 160 GLU B CG    1 
ATOM   1182 C CD    . GLU B 1 18  ? 46.096 4.143   26.329 1.00 66.32 ? 160 GLU B CD    1 
ATOM   1183 O OE1   . GLU B 1 18  ? 46.378 5.330   26.154 1.00 75.12 ? 160 GLU B OE1   1 
ATOM   1184 O OE2   . GLU B 1 18  ? 46.844 3.279   25.833 1.00 68.76 ? 160 GLU B OE2   1 
ATOM   1185 H H     . GLU B 1 18  ? 45.544 1.601   28.771 1.00 0.00  ? 160 GLU B H     1 
ATOM   1186 N N     . SER B 1 19  ? 45.901 3.306   31.714 1.00 37.50 ? 161 SER B N     1 
ATOM   1187 C CA    . SER B 1 19  ? 46.133 3.598   33.133 1.00 31.39 ? 161 SER B CA    1 
ATOM   1188 C C     . SER B 1 19  ? 47.424 3.059   33.678 1.00 29.44 ? 161 SER B C     1 
ATOM   1189 O O     . SER B 1 19  ? 47.975 3.663   34.588 1.00 30.58 ? 161 SER B O     1 
ATOM   1190 C CB    . SER B 1 19  ? 45.039 3.042   34.007 1.00 28.98 ? 161 SER B CB    1 
ATOM   1191 O OG    . SER B 1 19  ? 44.926 1.632   34.060 1.00 33.63 ? 161 SER B OG    1 
ATOM   1192 H H     . SER B 1 19  ? 45.129 2.755   31.471 1.00 0.00  ? 161 SER B H     1 
ATOM   1193 H HG    . SER B 1 19  ? 44.755 1.291   33.179 1.00 0.00  ? 161 SER B HG    1 
ATOM   1194 N N     . GLU B 1 20  ? 47.926 1.930   33.178 1.00 30.60 ? 162 GLU B N     1 
ATOM   1195 C CA    . GLU B 1 20  ? 49.164 1.418   33.690 1.00 33.04 ? 162 GLU B CA    1 
ATOM   1196 C C     . GLU B 1 20  ? 50.245 2.271   33.097 1.00 34.83 ? 162 GLU B C     1 
ATOM   1197 O O     . GLU B 1 20  ? 51.246 2.495   33.761 1.00 38.48 ? 162 GLU B O     1 
ATOM   1198 C CB    . GLU B 1 20  ? 49.360 -0.045  33.310 1.00 38.65 ? 162 GLU B CB    1 
ATOM   1199 C CG    . GLU B 1 20  ? 48.343 -0.934  34.039 1.00 46.27 ? 162 GLU B CG    1 
ATOM   1200 C CD    . GLU B 1 20  ? 48.597 -2.438  34.266 1.00 53.59 ? 162 GLU B CD    1 
ATOM   1201 O OE1   . GLU B 1 20  ? 49.564 -2.819  34.915 1.00 54.57 ? 162 GLU B OE1   1 
ATOM   1202 O OE2   . GLU B 1 20  ? 47.723 -3.258  33.967 1.00 59.54 ? 162 GLU B OE2   1 
ATOM   1203 H H     . GLU B 1 20  ? 47.452 1.453   32.465 1.00 0.00  ? 162 GLU B H     1 
ATOM   1204 N N     . ARG B 1 21  ? 50.052 2.831   31.895 1.00 36.87 ? 163 ARG B N     1 
ATOM   1205 C CA    . ARG B 1 21  ? 51.016 3.723   31.246 1.00 35.39 ? 163 ARG B CA    1 
ATOM   1206 C C     . ARG B 1 21  ? 51.001 5.039   31.967 1.00 32.71 ? 163 ARG B C     1 
ATOM   1207 O O     . ARG B 1 21  ? 52.061 5.496   32.350 1.00 37.67 ? 163 ARG B O     1 
ATOM   1208 C CB    . ARG B 1 21  ? 50.661 3.962   29.795 1.00 40.30 ? 163 ARG B CB    1 
ATOM   1209 C CG    . ARG B 1 21  ? 51.120 2.818   28.880 1.00 46.78 ? 163 ARG B CG    1 
ATOM   1210 C CD    . ARG B 1 21  ? 50.307 2.771   27.572 1.00 52.27 ? 163 ARG B CD    1 
ATOM   1211 N NE    . ARG B 1 21  ? 51.006 2.049   26.510 1.00 57.98 ? 163 ARG B NE    1 
ATOM   1212 C CZ    . ARG B 1 21  ? 50.496 2.027   25.263 1.00 59.87 ? 163 ARG B CZ    1 
ATOM   1213 N NH1   . ARG B 1 21  ? 49.327 2.633   24.965 1.00 59.31 ? 163 ARG B NH1   1 
ATOM   1214 N NH2   . ARG B 1 21  ? 51.225 1.491   24.257 1.00 65.97 ? 163 ARG B NH2   1 
ATOM   1215 H H     . ARG B 1 21  ? 49.217 2.632   31.423 1.00 0.00  ? 163 ARG B H     1 
ATOM   1216 H HE    . ARG B 1 21  ? 51.845 1.581   26.705 1.00 0.00  ? 163 ARG B HE    1 
ATOM   1217 H HH11  . ARG B 1 21  ? 48.817 3.114   25.678 1.00 0.00  ? 163 ARG B HH11  1 
ATOM   1218 H HH12  . ARG B 1 21  ? 48.971 2.601   24.031 1.00 0.00  ? 163 ARG B HH12  1 
ATOM   1219 H HH21  . ARG B 1 21  ? 52.133 1.116   24.442 1.00 0.00  ? 163 ARG B HH21  1 
ATOM   1220 H HH22  . ARG B 1 21  ? 50.856 1.470   23.328 1.00 0.00  ? 163 ARG B HH22  1 
ATOM   1221 N N     . LEU B 1 22  ? 49.852 5.647   32.241 1.00 28.33 ? 164 LEU B N     1 
ATOM   1222 C CA    . LEU B 1 22  ? 49.784 6.871   32.989 1.00 26.51 ? 164 LEU B CA    1 
ATOM   1223 C C     . LEU B 1 22  ? 50.316 6.797   34.394 1.00 31.73 ? 164 LEU B C     1 
ATOM   1224 O O     . LEU B 1 22  ? 50.876 7.783   34.866 1.00 36.43 ? 164 LEU B O     1 
ATOM   1225 C CB    . LEU B 1 22  ? 48.409 7.322   33.099 1.00 20.38 ? 164 LEU B CB    1 
ATOM   1226 C CG    . LEU B 1 22  ? 47.773 7.595   31.816 1.00 22.32 ? 164 LEU B CG    1 
ATOM   1227 C CD1   . LEU B 1 22  ? 46.307 7.795   32.053 1.00 18.66 ? 164 LEU B CD1   1 
ATOM   1228 C CD2   . LEU B 1 22  ? 48.443 8.771   31.172 1.00 25.78 ? 164 LEU B CD2   1 
ATOM   1229 H H     . LEU B 1 22  ? 49.018 5.245   31.920 1.00 0.00  ? 164 LEU B H     1 
ATOM   1230 N N     . LEU B 1 23  ? 50.103 5.683   35.102 1.00 39.41 ? 165 LEU B N     1 
ATOM   1231 C CA    . LEU B 1 23  ? 50.593 5.485   36.466 1.00 42.42 ? 165 LEU B CA    1 
ATOM   1232 C C     . LEU B 1 23  ? 52.051 5.033   36.724 1.00 47.68 ? 165 LEU B C     1 
ATOM   1233 O O     . LEU B 1 23  ? 52.655 5.443   37.747 1.00 49.46 ? 165 LEU B O     1 
ATOM   1234 C CB    . LEU B 1 23  ? 49.632 4.515   37.143 1.00 38.38 ? 165 LEU B CB    1 
ATOM   1235 C CG    . LEU B 1 23  ? 48.274 5.066   37.480 1.00 37.28 ? 165 LEU B CG    1 
ATOM   1236 C CD1   . LEU B 1 23  ? 47.367 3.943   37.864 1.00 33.89 ? 165 LEU B CD1   1 
ATOM   1237 C CD2   . LEU B 1 23  ? 48.385 6.031   38.619 1.00 31.76 ? 165 LEU B CD2   1 
ATOM   1238 H H     . LEU B 1 23  ? 49.591 4.960   34.685 1.00 0.00  ? 165 LEU B H     1 
ATOM   1239 N N     . LEU B 1 24  ? 52.678 4.195   35.869 1.00 51.52 ? 166 LEU B N     1 
ATOM   1240 C CA    . LEU B 1 24  ? 54.032 3.698   36.115 1.00 53.38 ? 166 LEU B CA    1 
ATOM   1241 C C     . LEU B 1 24  ? 55.034 4.749   35.755 1.00 55.74 ? 166 LEU B C     1 
ATOM   1242 O O     . LEU B 1 24  ? 55.467 4.990   34.629 1.00 52.57 ? 166 LEU B O     1 
ATOM   1243 C CB    . LEU B 1 24  ? 54.366 2.474   35.309 1.00 51.54 ? 166 LEU B CB    1 
ATOM   1244 C CG    . LEU B 1 24  ? 53.660 1.236   35.764 1.00 51.35 ? 166 LEU B CG    1 
ATOM   1245 C CD1   . LEU B 1 24  ? 53.780 0.200   34.672 1.00 54.18 ? 166 LEU B CD1   1 
ATOM   1246 C CD2   . LEU B 1 24  ? 54.207 0.801   37.101 1.00 49.29 ? 166 LEU B CD2   1 
ATOM   1247 H H     . LEU B 1 24  ? 52.210 3.911   35.057 1.00 0.00  ? 166 LEU B H     1 
ATOM   1248 N N     . ASN B 1 25  ? 55.303 5.406   36.869 1.00 61.30 ? 167 ASN B N     1 
ATOM   1249 C CA    . ASN B 1 25  ? 56.235 6.504   36.892 1.00 63.25 ? 167 ASN B CA    1 
ATOM   1250 C C     . ASN B 1 25  ? 56.881 6.545   38.283 1.00 65.41 ? 167 ASN B C     1 
ATOM   1251 O O     . ASN B 1 25  ? 56.188 6.650   39.303 1.00 65.78 ? 167 ASN B O     1 
ATOM   1252 C CB    . ASN B 1 25  ? 55.428 7.756   36.541 1.00 58.29 ? 167 ASN B CB    1 
ATOM   1253 C CG    . ASN B 1 25  ? 56.211 9.033   36.597 1.00 51.25 ? 167 ASN B CG    1 
ATOM   1254 O OD1   . ASN B 1 25  ? 57.281 9.120   37.198 1.00 45.78 ? 167 ASN B OD1   1 
ATOM   1255 N ND2   . ASN B 1 25  ? 55.647 10.063  36.000 1.00 50.14 ? 167 ASN B ND2   1 
ATOM   1256 H H     . ASN B 1 25  ? 54.858 5.140   37.700 1.00 0.00  ? 167 ASN B H     1 
ATOM   1257 H HD21  . ASN B 1 25  ? 56.130 10.915  36.016 1.00 0.00  ? 167 ASN B HD21  1 
ATOM   1258 H HD22  . ASN B 1 25  ? 54.776 9.959   35.562 1.00 0.00  ? 167 ASN B HD22  1 
ATOM   1259 N N     . ALA B 1 26  ? 58.223 6.422   38.304 1.00 66.22 ? 168 ALA B N     1 
ATOM   1260 C CA    . ALA B 1 26  ? 59.022 6.404   39.535 1.00 63.80 ? 168 ALA B CA    1 
ATOM   1261 C C     . ALA B 1 26  ? 59.210 7.735   40.239 1.00 60.86 ? 168 ALA B C     1 
ATOM   1262 O O     . ALA B 1 26  ? 59.824 7.785   41.301 1.00 57.00 ? 168 ALA B O     1 
ATOM   1263 C CB    . ALA B 1 26  ? 60.413 5.859   39.270 1.00 65.29 ? 168 ALA B CB    1 
ATOM   1264 H H     . ALA B 1 26  ? 58.692 6.340   37.448 1.00 0.00  ? 168 ALA B H     1 
ATOM   1265 N N     . GLU B 1 27  ? 58.741 8.804   39.608 1.00 58.58 ? 169 GLU B N     1 
ATOM   1266 C CA    . GLU B 1 27  ? 58.729 10.108  40.226 1.00 56.51 ? 169 GLU B CA    1 
ATOM   1267 C C     . GLU B 1 27  ? 57.445 10.206  41.054 1.00 52.53 ? 169 GLU B C     1 
ATOM   1268 O O     . GLU B 1 27  ? 57.387 11.051  41.949 1.00 56.94 ? 169 GLU B O     1 
ATOM   1269 C CB    . GLU B 1 27  ? 58.741 11.211  39.152 1.00 59.20 ? 169 GLU B CB    1 
ATOM   1270 H H     . GLU B 1 27  ? 58.393 8.705   38.697 1.00 0.00  ? 169 GLU B H     1 
ATOM   1271 N N     . ASN B 1 28  ? 56.416 9.360   40.856 1.00 45.44 ? 170 ASN B N     1 
ATOM   1272 C CA    . ASN B 1 28  ? 55.154 9.436   41.615 1.00 39.64 ? 170 ASN B CA    1 
ATOM   1273 C C     . ASN B 1 28  ? 55.215 8.668   42.908 1.00 33.05 ? 170 ASN B C     1 
ATOM   1274 O O     . ASN B 1 28  ? 55.942 7.675   42.952 1.00 34.25 ? 170 ASN B O     1 
ATOM   1275 C CB    . ASN B 1 28  ? 53.934 8.844   40.876 1.00 40.18 ? 170 ASN B CB    1 
ATOM   1276 C CG    . ASN B 1 28  ? 53.494 9.610   39.659 1.00 35.08 ? 170 ASN B CG    1 
ATOM   1277 O OD1   . ASN B 1 28  ? 53.660 10.815  39.617 1.00 34.14 ? 170 ASN B OD1   1 
ATOM   1278 N ND2   . ASN B 1 28  ? 52.935 8.983   38.630 1.00 39.53 ? 170 ASN B ND2   1 
ATOM   1279 H H     . ASN B 1 28  ? 56.510 8.661   40.176 1.00 0.00  ? 170 ASN B H     1 
ATOM   1280 H HD21  . ASN B 1 28  ? 52.666 9.527   37.861 1.00 0.00  ? 170 ASN B HD21  1 
ATOM   1281 H HD22  . ASN B 1 28  ? 52.806 8.012   38.659 1.00 0.00  ? 170 ASN B HD22  1 
ATOM   1282 N N     . PRO B 1 29  ? 54.581 9.092   43.994 1.00 29.20 ? 171 PRO B N     1 
ATOM   1283 C CA    . PRO B 1 29  ? 54.613 8.360   45.237 1.00 30.60 ? 171 PRO B CA    1 
ATOM   1284 C C     . PRO B 1 29  ? 53.686 7.136   45.205 1.00 35.00 ? 171 PRO B C     1 
ATOM   1285 O O     . PRO B 1 29  ? 52.695 7.122   44.464 1.00 41.89 ? 171 PRO B O     1 
ATOM   1286 C CB    . PRO B 1 29  ? 54.252 9.441   46.224 1.00 30.60 ? 171 PRO B CB    1 
ATOM   1287 C CG    . PRO B 1 29  ? 53.269 10.258  45.457 1.00 29.49 ? 171 PRO B CG    1 
ATOM   1288 C CD    . PRO B 1 29  ? 54.061 10.433  44.216 1.00 26.73 ? 171 PRO B CD    1 
ATOM   1289 N N     . ARG B 1 30  ? 53.927 6.086   45.988 1.00 35.84 ? 172 ARG B N     1 
ATOM   1290 C CA    . ARG B 1 30  ? 52.987 4.982   45.939 1.00 36.83 ? 172 ARG B CA    1 
ATOM   1291 C C     . ARG B 1 30  ? 51.634 5.353   46.539 1.00 31.42 ? 172 ARG B C     1 
ATOM   1292 O O     . ARG B 1 30  ? 51.483 6.120   47.508 1.00 29.73 ? 172 ARG B O     1 
ATOM   1293 C CB    . ARG B 1 30  ? 53.672 3.785   46.616 1.00 43.60 ? 172 ARG B CB    1 
ATOM   1294 C CG    . ARG B 1 30  ? 54.485 3.968   47.871 1.00 52.17 ? 172 ARG B CG    1 
ATOM   1295 C CD    . ARG B 1 30  ? 55.226 2.668   48.142 1.00 62.61 ? 172 ARG B CD    1 
ATOM   1296 N NE    . ARG B 1 30  ? 54.293 1.554   48.350 1.00 73.27 ? 172 ARG B NE    1 
ATOM   1297 C CZ    . ARG B 1 30  ? 54.595 0.503   49.138 1.00 78.48 ? 172 ARG B CZ    1 
ATOM   1298 N NH1   . ARG B 1 30  ? 55.791 0.447   49.760 1.00 83.46 ? 172 ARG B NH1   1 
ATOM   1299 N NH2   . ARG B 1 30  ? 53.679 -0.463  49.338 1.00 79.29 ? 172 ARG B NH2   1 
ATOM   1300 H H     . ARG B 1 30  ? 54.711 6.060   46.576 1.00 0.00  ? 172 ARG B H     1 
ATOM   1301 H HE    . ARG B 1 30  ? 53.422 1.575   47.901 1.00 0.00  ? 172 ARG B HE    1 
ATOM   1302 H HH11  . ARG B 1 30  ? 56.454 1.185   49.636 1.00 0.00  ? 172 ARG B HH11  1 
ATOM   1303 H HH12  . ARG B 1 30  ? 56.015 -0.333  50.345 1.00 0.00  ? 172 ARG B HH12  1 
ATOM   1304 H HH21  . ARG B 1 30  ? 52.781 -0.398  48.903 1.00 0.00  ? 172 ARG B HH21  1 
ATOM   1305 H HH22  . ARG B 1 30  ? 53.897 -1.245  49.921 1.00 0.00  ? 172 ARG B HH22  1 
ATOM   1306 N N     . GLY B 1 31  ? 50.595 4.786   45.955 1.00 24.11 ? 173 GLY B N     1 
ATOM   1307 C CA    . GLY B 1 31  ? 49.259 5.144   46.356 1.00 21.32 ? 173 GLY B CA    1 
ATOM   1308 C C     . GLY B 1 31  ? 48.772 6.169   45.334 1.00 24.29 ? 173 GLY B C     1 
ATOM   1309 O O     . GLY B 1 31  ? 47.676 6.676   45.537 1.00 25.98 ? 173 GLY B O     1 
ATOM   1310 H H     . GLY B 1 31  ? 50.733 4.121   45.248 1.00 0.00  ? 173 GLY B H     1 
ATOM   1311 N N     . THR B 1 32  ? 49.507 6.630   44.304 1.00 21.12 ? 174 THR B N     1 
ATOM   1312 C CA    . THR B 1 32  ? 48.975 7.533   43.292 1.00 21.63 ? 174 THR B CA    1 
ATOM   1313 C C     . THR B 1 32  ? 47.866 6.761   42.578 1.00 23.72 ? 174 THR B C     1 
ATOM   1314 O O     . THR B 1 32  ? 48.046 5.571   42.293 1.00 26.79 ? 174 THR B O     1 
ATOM   1315 C CB    . THR B 1 32  ? 50.155 7.964   42.331 1.00 21.18 ? 174 THR B CB    1 
ATOM   1316 O OG1   . THR B 1 32  ? 51.012 8.739   43.144 1.00 20.46 ? 174 THR B OG1   1 
ATOM   1317 C CG2   . THR B 1 32  ? 49.762 8.794   41.121 1.00 17.27 ? 174 THR B CG2   1 
ATOM   1318 H H     . THR B 1 32  ? 50.442 6.345   44.232 1.00 0.00  ? 174 THR B H     1 
ATOM   1319 H HG1   . THR B 1 32  ? 50.532 9.498   43.483 1.00 0.00  ? 174 THR B HG1   1 
ATOM   1320 N N     . PHE B 1 33  ? 46.736 7.357   42.222 1.00 21.47 ? 175 PHE B N     1 
ATOM   1321 C CA    . PHE B 1 33  ? 45.673 6.568   41.673 1.00 20.04 ? 175 PHE B CA    1 
ATOM   1322 C C     . PHE B 1 33  ? 44.859 7.297   40.619 1.00 24.98 ? 175 PHE B C     1 
ATOM   1323 O O     . PHE B 1 33  ? 45.027 8.500   40.406 1.00 23.72 ? 175 PHE B O     1 
ATOM   1324 C CB    . PHE B 1 33  ? 44.790 6.183   42.834 1.00 21.56 ? 175 PHE B CB    1 
ATOM   1325 C CG    . PHE B 1 33  ? 43.992 7.368   43.409 1.00 21.49 ? 175 PHE B CG    1 
ATOM   1326 C CD1   . PHE B 1 33  ? 44.570 8.211   44.380 1.00 20.18 ? 175 PHE B CD1   1 
ATOM   1327 C CD2   . PHE B 1 33  ? 42.683 7.634   42.951 1.00 16.64 ? 175 PHE B CD2   1 
ATOM   1328 C CE1   . PHE B 1 33  ? 43.846 9.300   44.877 1.00 18.18 ? 175 PHE B CE1   1 
ATOM   1329 C CE2   . PHE B 1 33  ? 41.979 8.732   43.463 1.00 23.32 ? 175 PHE B CE2   1 
ATOM   1330 C CZ    . PHE B 1 33  ? 42.560 9.567   44.425 1.00 17.54 ? 175 PHE B CZ    1 
ATOM   1331 H H     . PHE B 1 33  ? 46.629 8.325   42.333 1.00 0.00  ? 175 PHE B H     1 
ATOM   1332 N N     . LEU B 1 34  ? 43.895 6.588   40.030 1.00 27.10 ? 176 LEU B N     1 
ATOM   1333 C CA    . LEU B 1 34  ? 42.896 7.143   39.125 1.00 24.46 ? 176 LEU B CA    1 
ATOM   1334 C C     . LEU B 1 34  ? 41.697 6.192   39.146 1.00 25.54 ? 176 LEU B C     1 
ATOM   1335 O O     . LEU B 1 34  ? 41.867 5.021   39.482 1.00 24.78 ? 176 LEU B O     1 
ATOM   1336 C CB    . LEU B 1 34  ? 43.457 7.266   37.728 1.00 23.90 ? 176 LEU B CB    1 
ATOM   1337 C CG    . LEU B 1 34  ? 43.979 6.065   36.986 1.00 28.20 ? 176 LEU B CG    1 
ATOM   1338 C CD1   . LEU B 1 34  ? 42.870 5.386   36.205 1.00 26.34 ? 176 LEU B CD1   1 
ATOM   1339 C CD2   . LEU B 1 34  ? 45.044 6.547   36.000 1.00 27.07 ? 176 LEU B CD2   1 
ATOM   1340 H H     . LEU B 1 34  ? 43.856 5.628   40.219 1.00 0.00  ? 176 LEU B H     1 
ATOM   1341 N N     . VAL B 1 35  ? 40.486 6.641   38.839 1.00 26.85 ? 177 VAL B N     1 
ATOM   1342 C CA    . VAL B 1 35  ? 39.285 5.819   38.817 1.00 24.93 ? 177 VAL B CA    1 
ATOM   1343 C C     . VAL B 1 35  ? 38.896 5.868   37.350 1.00 26.51 ? 177 VAL B C     1 
ATOM   1344 O O     . VAL B 1 35  ? 38.917 6.914   36.692 1.00 26.59 ? 177 VAL B O     1 
ATOM   1345 C CB    . VAL B 1 35  ? 38.164 6.430   39.719 1.00 21.65 ? 177 VAL B CB    1 
ATOM   1346 C CG1   . VAL B 1 35  ? 36.891 5.621   39.811 1.00 17.27 ? 177 VAL B CG1   1 
ATOM   1347 C CG2   . VAL B 1 35  ? 38.704 6.466   41.096 1.00 15.19 ? 177 VAL B CG2   1 
ATOM   1348 H H     . VAL B 1 35  ? 40.395 7.589   38.612 1.00 0.00  ? 177 VAL B H     1 
ATOM   1349 N N     . ARG B 1 36  ? 38.608 4.716   36.782 1.00 26.33 ? 178 ARG B N     1 
ATOM   1350 C CA    . ARG B 1 36  ? 38.247 4.639   35.405 1.00 26.02 ? 178 ARG B CA    1 
ATOM   1351 C C     . ARG B 1 36  ? 37.160 3.608   35.314 1.00 30.73 ? 178 ARG B C     1 
ATOM   1352 O O     . ARG B 1 36  ? 36.824 2.946   36.300 1.00 31.96 ? 178 ARG B O     1 
ATOM   1353 C CB    . ARG B 1 36  ? 39.451 4.233   34.611 1.00 25.38 ? 178 ARG B CB    1 
ATOM   1354 C CG    . ARG B 1 36  ? 40.119 3.018   35.153 1.00 25.79 ? 178 ARG B CG    1 
ATOM   1355 C CD    . ARG B 1 36  ? 41.064 2.514   34.119 1.00 28.40 ? 178 ARG B CD    1 
ATOM   1356 N NE    . ARG B 1 36  ? 41.619 1.240   34.556 1.00 36.88 ? 178 ARG B NE    1 
ATOM   1357 C CZ    . ARG B 1 36  ? 41.095 0.047   34.199 1.00 34.29 ? 178 ARG B CZ    1 
ATOM   1358 N NH1   . ARG B 1 36  ? 40.018 -0.033  33.392 1.00 31.74 ? 178 ARG B NH1   1 
ATOM   1359 N NH2   . ARG B 1 36  ? 41.684 -1.058  34.704 1.00 29.95 ? 178 ARG B NH2   1 
ATOM   1360 H H     . ARG B 1 36  ? 38.642 3.895   37.316 1.00 0.00  ? 178 ARG B H     1 
ATOM   1361 H HE    . ARG B 1 36  ? 42.409 1.249   35.136 1.00 0.00  ? 178 ARG B HE    1 
ATOM   1362 H HH11  . ARG B 1 36  ? 39.590 0.802   33.045 1.00 0.00  ? 178 ARG B HH11  1 
ATOM   1363 H HH12  . ARG B 1 36  ? 39.647 -0.927  33.141 1.00 0.00  ? 178 ARG B HH12  1 
ATOM   1364 H HH21  . ARG B 1 36  ? 42.472 -0.970  35.313 1.00 0.00  ? 178 ARG B HH21  1 
ATOM   1365 H HH22  . ARG B 1 36  ? 41.332 -1.964  34.469 1.00 0.00  ? 178 ARG B HH22  1 
ATOM   1366 N N     . GLU B 1 37  ? 36.568 3.465   34.153 1.00 35.92 ? 179 GLU B N     1 
ATOM   1367 C CA    . GLU B 1 37  ? 35.548 2.458   33.928 1.00 39.46 ? 179 GLU B CA    1 
ATOM   1368 C C     . GLU B 1 37  ? 36.161 1.111   33.619 1.00 38.78 ? 179 GLU B C     1 
ATOM   1369 O O     . GLU B 1 37  ? 37.244 1.009   33.026 1.00 38.50 ? 179 GLU B O     1 
ATOM   1370 C CB    . GLU B 1 37  ? 34.694 2.876   32.782 1.00 46.53 ? 179 GLU B CB    1 
ATOM   1371 C CG    . GLU B 1 37  ? 33.946 4.159   33.091 1.00 55.35 ? 179 GLU B CG    1 
ATOM   1372 C CD    . GLU B 1 37  ? 32.953 4.602   32.023 1.00 61.15 ? 179 GLU B CD    1 
ATOM   1373 O OE1   . GLU B 1 37  ? 33.021 4.119   30.883 1.00 61.29 ? 179 GLU B OE1   1 
ATOM   1374 O OE2   . GLU B 1 37  ? 32.122 5.460   32.346 1.00 67.16 ? 179 GLU B OE2   1 
ATOM   1375 H H     . GLU B 1 37  ? 36.822 4.057   33.414 1.00 0.00  ? 179 GLU B H     1 
ATOM   1376 N N     . SER B 1 38  ? 35.518 0.027   34.034 1.00 40.32 ? 180 SER B N     1 
ATOM   1377 C CA    . SER B 1 38  ? 36.063 -1.282  33.744 1.00 42.14 ? 180 SER B CA    1 
ATOM   1378 C C     . SER B 1 38  ? 35.781 -1.576  32.276 1.00 42.39 ? 180 SER B C     1 
ATOM   1379 O O     . SER B 1 38  ? 34.643 -1.408  31.833 1.00 42.61 ? 180 SER B O     1 
ATOM   1380 C CB    . SER B 1 38  ? 35.376 -2.314  34.610 1.00 41.75 ? 180 SER B CB    1 
ATOM   1381 O OG    . SER B 1 38  ? 35.956 -3.614  34.488 1.00 41.60 ? 180 SER B OG    1 
ATOM   1382 H H     . SER B 1 38  ? 34.679 0.112   34.534 1.00 0.00  ? 180 SER B H     1 
ATOM   1383 H HG    . SER B 1 38  ? 35.486 -4.229  35.055 1.00 0.00  ? 180 SER B HG    1 
ATOM   1384 N N     . GLU B 1 39  ? 36.794 -1.970  31.510 1.00 44.67 ? 181 GLU B N     1 
ATOM   1385 C CA    . GLU B 1 39  ? 36.591 -2.396  30.125 1.00 52.62 ? 181 GLU B CA    1 
ATOM   1386 C C     . GLU B 1 39  ? 35.694 -3.667  30.088 1.00 54.37 ? 181 GLU B C     1 
ATOM   1387 O O     . GLU B 1 39  ? 34.819 -3.877  29.239 1.00 53.82 ? 181 GLU B O     1 
ATOM   1388 C CB    . GLU B 1 39  ? 37.907 -2.778  29.451 1.00 56.71 ? 181 GLU B CB    1 
ATOM   1389 C CG    . GLU B 1 39  ? 39.177 -1.918  29.496 1.00 66.14 ? 181 GLU B CG    1 
ATOM   1390 C CD    . GLU B 1 39  ? 40.451 -2.685  29.095 1.00 70.50 ? 181 GLU B CD    1 
ATOM   1391 O OE1   . GLU B 1 39  ? 40.434 -3.905  29.084 1.00 80.17 ? 181 GLU B OE1   1 
ATOM   1392 O OE2   . GLU B 1 39  ? 41.503 -2.096  28.850 1.00 70.38 ? 181 GLU B OE2   1 
ATOM   1393 H H     . GLU B 1 39  ? 37.700 -1.975  31.883 1.00 0.00  ? 181 GLU B H     1 
ATOM   1394 N N     . THR B 1 40  ? 36.056 -4.547  31.030 1.00 56.85 ? 182 THR B N     1 
ATOM   1395 C CA    . THR B 1 40  ? 35.480 -5.850  31.339 1.00 57.28 ? 182 THR B CA    1 
ATOM   1396 C C     . THR B 1 40  ? 34.082 -5.987  31.965 1.00 55.70 ? 182 THR B C     1 
ATOM   1397 O O     . THR B 1 40  ? 33.262 -6.787  31.510 1.00 58.18 ? 182 THR B O     1 
ATOM   1398 C CB    . THR B 1 40  ? 36.566 -6.525  32.208 1.00 57.69 ? 182 THR B CB    1 
ATOM   1399 O OG1   . THR B 1 40  ? 37.689 -6.586  31.342 1.00 55.43 ? 182 THR B OG1   1 
ATOM   1400 C CG2   . THR B 1 40  ? 36.220 -7.901  32.779 1.00 65.73 ? 182 THR B CG2   1 
ATOM   1401 H H     . THR B 1 40  ? 36.812 -4.278  31.588 1.00 0.00  ? 182 THR B H     1 
ATOM   1402 H HG1   . THR B 1 40  ? 37.935 -5.698  31.073 1.00 0.00  ? 182 THR B HG1   1 
ATOM   1403 N N     . THR B 1 41  ? 33.715 -5.264  33.008 1.00 51.90 ? 183 THR B N     1 
ATOM   1404 C CA    . THR B 1 41  ? 32.431 -5.513  33.615 1.00 47.23 ? 183 THR B CA    1 
ATOM   1405 C C     . THR B 1 41  ? 31.663 -4.264  33.322 1.00 48.34 ? 183 THR B C     1 
ATOM   1406 O O     . THR B 1 41  ? 31.996 -3.163  33.767 1.00 47.75 ? 183 THR B O     1 
ATOM   1407 C CB    . THR B 1 41  ? 32.612 -5.723  35.106 1.00 48.79 ? 183 THR B CB    1 
ATOM   1408 O OG1   . THR B 1 41  ? 33.525 -6.827  35.272 1.00 47.20 ? 183 THR B OG1   1 
ATOM   1409 C CG2   . THR B 1 41  ? 31.260 -5.836  35.795 1.00 41.24 ? 183 THR B CG2   1 
ATOM   1410 H H     . THR B 1 41  ? 34.307 -4.569  33.364 1.00 0.00  ? 183 THR B H     1 
ATOM   1411 H HG1   . THR B 1 41  ? 33.156 -7.613  34.862 1.00 0.00  ? 183 THR B HG1   1 
ATOM   1412 N N     . LYS B 1 42  ? 30.626 -4.494  32.552 1.00 49.79 ? 184 LYS B N     1 
ATOM   1413 C CA    . LYS B 1 42  ? 29.740 -3.433  32.165 1.00 51.17 ? 184 LYS B CA    1 
ATOM   1414 C C     . LYS B 1 42  ? 29.069 -2.956  33.438 1.00 51.82 ? 184 LYS B C     1 
ATOM   1415 O O     . LYS B 1 42  ? 28.475 -3.734  34.195 1.00 54.64 ? 184 LYS B O     1 
ATOM   1416 C CB    . LYS B 1 42  ? 28.678 -3.931  31.193 1.00 48.53 ? 184 LYS B CB    1 
ATOM   1417 H H     . LYS B 1 42  ? 30.453 -5.405  32.236 1.00 0.00  ? 184 LYS B H     1 
ATOM   1418 N N     . GLY B 1 43  ? 29.351 -1.680  33.685 1.00 53.40 ? 185 GLY B N     1 
ATOM   1419 C CA    . GLY B 1 43  ? 28.812 -0.935  34.818 1.00 52.96 ? 185 GLY B CA    1 
ATOM   1420 C C     . GLY B 1 43  ? 29.731 -0.836  36.036 1.00 49.78 ? 185 GLY B C     1 
ATOM   1421 O O     . GLY B 1 43  ? 29.326 -0.283  37.069 1.00 50.44 ? 185 GLY B O     1 
ATOM   1422 H H     . GLY B 1 43  ? 29.955 -1.214  33.071 1.00 0.00  ? 185 GLY B H     1 
ATOM   1423 N N     . ALA B 1 44  ? 30.950 -1.375  35.933 1.00 43.93 ? 186 ALA B N     1 
ATOM   1424 C CA    . ALA B 1 44  ? 31.841 -1.390  37.071 1.00 40.75 ? 186 ALA B CA    1 
ATOM   1425 C C     . ALA B 1 44  ? 32.907 -0.372  36.814 1.00 37.28 ? 186 ALA B C     1 
ATOM   1426 O O     . ALA B 1 44  ? 33.175 0.022   35.671 1.00 38.32 ? 186 ALA B O     1 
ATOM   1427 C CB    . ALA B 1 44  ? 32.514 -2.774  37.269 1.00 34.85 ? 186 ALA B CB    1 
ATOM   1428 H H     . ALA B 1 44  ? 31.241 -1.762  35.081 1.00 0.00  ? 186 ALA B H     1 
ATOM   1429 N N     . TYR B 1 45  ? 33.486 0.045   37.919 1.00 33.46 ? 187 TYR B N     1 
ATOM   1430 C CA    . TYR B 1 45  ? 34.586 0.962   37.871 1.00 30.07 ? 187 TYR B CA    1 
ATOM   1431 C C     . TYR B 1 45  ? 35.799 0.220   38.322 1.00 29.21 ? 187 TYR B C     1 
ATOM   1432 O O     . TYR B 1 45  ? 35.742 -0.917  38.773 1.00 26.71 ? 187 TYR B O     1 
ATOM   1433 C CB    . TYR B 1 45  ? 34.341 2.128   38.778 1.00 32.19 ? 187 TYR B CB    1 
ATOM   1434 C CG    . TYR B 1 45  ? 33.184 2.909   38.234 1.00 32.48 ? 187 TYR B CG    1 
ATOM   1435 C CD1   . TYR B 1 45  ? 33.422 3.826   37.212 1.00 35.84 ? 187 TYR B CD1   1 
ATOM   1436 C CD2   . TYR B 1 45  ? 31.909 2.693   38.734 1.00 35.48 ? 187 TYR B CD2   1 
ATOM   1437 C CE1   . TYR B 1 45  ? 32.370 4.540   36.669 1.00 36.66 ? 187 TYR B CE1   1 
ATOM   1438 C CE2   . TYR B 1 45  ? 30.853 3.407   38.195 1.00 38.36 ? 187 TYR B CE2   1 
ATOM   1439 C CZ    . TYR B 1 45  ? 31.102 4.322   37.172 1.00 40.07 ? 187 TYR B CZ    1 
ATOM   1440 O OH    . TYR B 1 45  ? 30.067 5.040   36.637 1.00 47.95 ? 187 TYR B OH    1 
ATOM   1441 H H     . TYR B 1 45  ? 33.161 -0.276  38.786 1.00 0.00  ? 187 TYR B H     1 
ATOM   1442 H HH    . TYR B 1 45  ? 29.248 4.794   37.073 1.00 0.00  ? 187 TYR B HH    1 
ATOM   1443 N N     . CYS B 1 46  ? 36.915 0.876   38.190 1.00 29.82 ? 188 CYS B N     1 
ATOM   1444 C CA    . CYS B 1 46  ? 38.160 0.297   38.591 1.00 29.69 ? 188 CYS B CA    1 
ATOM   1445 C C     . CYS B 1 46  ? 38.954 1.415   39.281 1.00 27.86 ? 188 CYS B C     1 
ATOM   1446 O O     . CYS B 1 46  ? 38.877 2.597   38.905 1.00 25.59 ? 188 CYS B O     1 
ATOM   1447 C CB    . CYS B 1 46  ? 38.811 -0.248  37.310 1.00 26.27 ? 188 CYS B CB    1 
ATOM   1448 S SG    . CYS B 1 46  ? 40.444 -0.921  37.704 1.00 40.11 ? 188 CYS B SG    1 
ATOM   1449 H H     . CYS B 1 46  ? 36.902 1.779   37.811 1.00 0.00  ? 188 CYS B H     1 
ATOM   1450 N N     . LEU B 1 47  ? 39.675 1.053   40.334 1.00 24.60 ? 189 LEU B N     1 
ATOM   1451 C CA    . LEU B 1 47  ? 40.567 1.936   41.050 1.00 20.46 ? 189 LEU B CA    1 
ATOM   1452 C C     . LEU B 1 47  ? 41.964 1.369   40.790 1.00 24.44 ? 189 LEU B C     1 
ATOM   1453 O O     . LEU B 1 47  ? 42.269 0.301   41.343 1.00 23.74 ? 189 LEU B O     1 
ATOM   1454 C CB    . LEU B 1 47  ? 40.231 1.872   42.513 1.00 21.82 ? 189 LEU B CB    1 
ATOM   1455 C CG    . LEU B 1 47  ? 41.036 2.597   43.541 1.00 22.50 ? 189 LEU B CG    1 
ATOM   1456 C CD1   . LEU B 1 47  ? 40.857 4.110   43.433 1.00 18.98 ? 189 LEU B CD1   1 
ATOM   1457 C CD2   . LEU B 1 47  ? 40.489 2.191   44.900 1.00 20.44 ? 189 LEU B CD2   1 
ATOM   1458 H H     . LEU B 1 47  ? 39.598 0.128   40.646 1.00 0.00  ? 189 LEU B H     1 
ATOM   1459 N N     . SER B 1 48  ? 42.789 2.011   39.922 1.00 21.11 ? 190 SER B N     1 
ATOM   1460 C CA    . SER B 1 48  ? 44.138 1.584   39.630 1.00 18.59 ? 190 SER B CA    1 
ATOM   1461 C C     . SER B 1 48  ? 45.044 2.431   40.515 1.00 21.74 ? 190 SER B C     1 
ATOM   1462 O O     . SER B 1 48  ? 44.903 3.655   40.520 1.00 25.73 ? 190 SER B O     1 
ATOM   1463 C CB    . SER B 1 48  ? 44.360 1.856   38.224 1.00 16.99 ? 190 SER B CB    1 
ATOM   1464 O OG    . SER B 1 48  ? 43.339 1.204   37.475 1.00 21.96 ? 190 SER B OG    1 
ATOM   1465 H H     . SER B 1 48  ? 42.449 2.810   39.468 1.00 0.00  ? 190 SER B H     1 
ATOM   1466 H HG    . SER B 1 48  ? 43.377 0.259   37.637 1.00 0.00  ? 190 SER B HG    1 
ATOM   1467 N N     . VAL B 1 49  ? 45.967 1.810   41.249 1.00 24.74 ? 191 VAL B N     1 
ATOM   1468 C CA    . VAL B 1 49  ? 46.821 2.410   42.279 1.00 23.94 ? 191 VAL B CA    1 
ATOM   1469 C C     . VAL B 1 49  ? 48.282 2.017   42.032 1.00 28.32 ? 191 VAL B C     1 
ATOM   1470 O O     . VAL B 1 49  ? 48.490 0.819   41.816 1.00 26.51 ? 191 VAL B O     1 
ATOM   1471 C CB    . VAL B 1 49  ? 46.415 1.873   43.667 1.00 22.27 ? 191 VAL B CB    1 
ATOM   1472 C CG1   . VAL B 1 49  ? 47.116 2.699   44.709 1.00 19.72 ? 191 VAL B CG1   1 
ATOM   1473 C CG2   . VAL B 1 49  ? 44.921 1.902   43.863 1.00 17.32 ? 191 VAL B CG2   1 
ATOM   1474 H H     . VAL B 1 49  ? 46.087 0.853   41.083 1.00 0.00  ? 191 VAL B H     1 
ATOM   1475 N N     . SER B 1 50  ? 49.343 2.840   42.023 1.00 28.74 ? 192 SER B N     1 
ATOM   1476 C CA    . SER B 1 50  ? 50.679 2.290   41.815 1.00 29.87 ? 192 SER B CA    1 
ATOM   1477 C C     . SER B 1 50  ? 51.197 1.858   43.179 1.00 31.32 ? 192 SER B C     1 
ATOM   1478 O O     . SER B 1 50  ? 50.793 2.417   44.211 1.00 33.25 ? 192 SER B O     1 
ATOM   1479 C CB    . SER B 1 50  ? 51.623 3.315   41.224 1.00 29.40 ? 192 SER B CB    1 
ATOM   1480 O OG    . SER B 1 50  ? 51.735 4.406   42.107 1.00 27.72 ? 192 SER B OG    1 
ATOM   1481 H H     . SER B 1 50  ? 49.221 3.803   42.155 1.00 0.00  ? 192 SER B H     1 
ATOM   1482 H HG    . SER B 1 50  ? 52.333 5.059   41.736 1.00 0.00  ? 192 SER B HG    1 
ATOM   1483 N N     . ASP B 1 51  ? 52.100 0.901   43.188 1.00 32.22 ? 193 ASP B N     1 
ATOM   1484 C CA    . ASP B 1 51  ? 52.624 0.376   44.417 1.00 36.91 ? 193 ASP B CA    1 
ATOM   1485 C C     . ASP B 1 51  ? 54.083 0.070   44.170 1.00 36.57 ? 193 ASP B C     1 
ATOM   1486 O O     . ASP B 1 51  ? 54.546 0.151   43.028 1.00 36.03 ? 193 ASP B O     1 
ATOM   1487 C CB    . ASP B 1 51  ? 51.848 -0.893  44.766 1.00 39.69 ? 193 ASP B CB    1 
ATOM   1488 C CG    . ASP B 1 51  ? 52.234 -1.483  46.113 1.00 43.46 ? 193 ASP B CG    1 
ATOM   1489 O OD1   . ASP B 1 51  ? 52.443 -0.715  47.060 1.00 45.59 ? 193 ASP B OD1   1 
ATOM   1490 O OD2   . ASP B 1 51  ? 52.311 -2.709  46.205 1.00 40.83 ? 193 ASP B OD2   1 
ATOM   1491 H H     . ASP B 1 51  ? 52.422 0.538   42.336 1.00 0.00  ? 193 ASP B H     1 
ATOM   1492 N N     . PHE B 1 52  ? 54.848 -0.284  45.180 1.00 41.46 ? 194 PHE B N     1 
ATOM   1493 C CA    . PHE B 1 52  ? 56.226 -0.667  44.940 1.00 47.52 ? 194 PHE B CA    1 
ATOM   1494 C C     . PHE B 1 52  ? 56.556 -1.806  45.891 1.00 51.53 ? 194 PHE B C     1 
ATOM   1495 O O     . PHE B 1 52  ? 56.486 -1.673  47.119 1.00 49.89 ? 194 PHE B O     1 
ATOM   1496 C CB    . PHE B 1 52  ? 57.185 0.492   45.194 1.00 46.62 ? 194 PHE B CB    1 
ATOM   1497 C CG    . PHE B 1 52  ? 58.614 0.170   44.777 1.00 47.15 ? 194 PHE B CG    1 
ATOM   1498 C CD1   . PHE B 1 52  ? 59.462 -0.556  45.634 1.00 47.59 ? 194 PHE B CD1   1 
ATOM   1499 C CD2   . PHE B 1 52  ? 59.086 0.593   43.532 1.00 48.15 ? 194 PHE B CD2   1 
ATOM   1500 C CE1   . PHE B 1 52  ? 60.769 -0.862  45.257 1.00 44.11 ? 194 PHE B CE1   1 
ATOM   1501 C CE2   . PHE B 1 52  ? 60.402 0.282   43.159 1.00 46.57 ? 194 PHE B CE2   1 
ATOM   1502 C CZ    . PHE B 1 52  ? 61.235 -0.440  44.015 1.00 44.20 ? 194 PHE B CZ    1 
ATOM   1503 H H     . PHE B 1 52  ? 54.488 -0.289  46.091 1.00 0.00  ? 194 PHE B H     1 
ATOM   1504 N N     . ASP B 1 53  ? 56.988 -2.908  45.290 1.00 59.73 ? 195 ASP B N     1 
ATOM   1505 C CA    . ASP B 1 53  ? 57.367 -4.131  45.993 1.00 66.93 ? 195 ASP B CA    1 
ATOM   1506 C C     . ASP B 1 53  ? 58.823 -4.268  45.622 1.00 70.96 ? 195 ASP B C     1 
ATOM   1507 O O     . ASP B 1 53  ? 59.111 -4.259  44.429 1.00 66.02 ? 195 ASP B O     1 
ATOM   1508 C CB    . ASP B 1 53  ? 56.616 -5.369  45.457 1.00 66.17 ? 195 ASP B CB    1 
ATOM   1509 H H     . ASP B 1 53  ? 57.057 -2.901  44.313 1.00 0.00  ? 195 ASP B H     1 
ATOM   1510 N N     . ASN B 1 54  ? 59.722 -4.422  46.607 1.00 79.37 ? 196 ASN B N     1 
ATOM   1511 C CA    . ASN B 1 54  ? 61.179 -4.568  46.399 1.00 87.31 ? 196 ASN B CA    1 
ATOM   1512 C C     . ASN B 1 54  ? 61.654 -5.420  45.202 1.00 90.58 ? 196 ASN B C     1 
ATOM   1513 O O     . ASN B 1 54  ? 62.656 -5.146  44.544 1.00 91.88 ? 196 ASN B O     1 
ATOM   1514 C CB    . ASN B 1 54  ? 61.802 -5.167  47.653 1.00 86.55 ? 196 ASN B CB    1 
ATOM   1515 H H     . ASN B 1 54  ? 59.390 -4.439  47.528 1.00 0.00  ? 196 ASN B H     1 
ATOM   1516 N N     . ALA B 1 55  ? 60.885 -6.490  44.974 1.00 93.27 ? 197 ALA B N     1 
ATOM   1517 C CA    . ALA B 1 55  ? 61.089 -7.439  43.886 1.00 92.75 ? 197 ALA B CA    1 
ATOM   1518 C C     . ALA B 1 55  ? 60.449 -6.987  42.553 1.00 91.38 ? 197 ALA B C     1 
ATOM   1519 O O     . ALA B 1 55  ? 61.116 -6.820  41.521 1.00 92.22 ? 197 ALA B O     1 
ATOM   1520 C CB    . ALA B 1 55  ? 60.477 -8.777  44.285 1.00 94.25 ? 197 ALA B CB    1 
ATOM   1521 H H     . ALA B 1 55  ? 60.132 -6.647  45.580 1.00 0.00  ? 197 ALA B H     1 
ATOM   1522 N N     . LYS B 1 56  ? 59.131 -6.712  42.639 1.00 85.16 ? 198 LYS B N     1 
ATOM   1523 C CA    . LYS B 1 56  ? 58.332 -6.376  41.468 1.00 78.48 ? 198 LYS B CA    1 
ATOM   1524 C C     . LYS B 1 56  ? 58.573 -4.946  41.000 1.00 73.75 ? 198 LYS B C     1 
ATOM   1525 O O     . LYS B 1 56  ? 58.234 -4.576  39.881 1.00 73.59 ? 198 LYS B O     1 
ATOM   1526 C CB    . LYS B 1 56  ? 56.853 -6.544  41.800 1.00 76.65 ? 198 LYS B CB    1 
ATOM   1527 H H     . LYS B 1 56  ? 58.697 -6.739  43.517 1.00 0.00  ? 198 LYS B H     1 
ATOM   1528 N N     . GLY B 1 57  ? 59.222 -4.164  41.858 1.00 68.47 ? 199 GLY B N     1 
ATOM   1529 C CA    . GLY B 1 57  ? 59.447 -2.760  41.618 1.00 62.97 ? 199 GLY B CA    1 
ATOM   1530 C C     . GLY B 1 57  ? 58.097 -2.063  41.652 1.00 56.02 ? 199 GLY B C     1 
ATOM   1531 O O     . GLY B 1 57  ? 57.234 -2.341  42.494 1.00 52.01 ? 199 GLY B O     1 
ATOM   1532 H H     . GLY B 1 57  ? 59.562 -4.558  42.688 1.00 0.00  ? 199 GLY B H     1 
ATOM   1533 N N     . LEU B 1 58  ? 57.992 -1.141  40.712 1.00 52.68 ? 200 LEU B N     1 
ATOM   1534 C CA    . LEU B 1 58  ? 56.806 -0.369  40.463 1.00 50.54 ? 200 LEU B CA    1 
ATOM   1535 C C     . LEU B 1 58  ? 55.773 -1.228  39.784 1.00 49.30 ? 200 LEU B C     1 
ATOM   1536 O O     . LEU B 1 58  ? 56.102 -1.822  38.761 1.00 51.37 ? 200 LEU B O     1 
ATOM   1537 C CB    . LEU B 1 58  ? 57.036 0.778   39.535 1.00 50.16 ? 200 LEU B CB    1 
ATOM   1538 C CG    . LEU B 1 58  ? 57.381 2.095   40.130 1.00 50.64 ? 200 LEU B CG    1 
ATOM   1539 C CD1   . LEU B 1 58  ? 57.115 3.136   39.046 1.00 54.93 ? 200 LEU B CD1   1 
ATOM   1540 C CD2   . LEU B 1 58  ? 56.543 2.424   41.363 1.00 49.86 ? 200 LEU B CD2   1 
ATOM   1541 H H     . LEU B 1 58  ? 58.774 -0.972  40.147 1.00 0.00  ? 200 LEU B H     1 
ATOM   1542 N N     . ASN B 1 59  ? 54.530 -1.257  40.276 1.00 44.89 ? 201 ASN B N     1 
ATOM   1543 C CA    . ASN B 1 59  ? 53.471 -2.046  39.688 1.00 35.31 ? 201 ASN B CA    1 
ATOM   1544 C C     . ASN B 1 59  ? 52.201 -1.308  40.022 1.00 28.84 ? 201 ASN B C     1 
ATOM   1545 O O     . ASN B 1 59  ? 52.138 -0.498  40.938 1.00 28.46 ? 201 ASN B O     1 
ATOM   1546 C CB    . ASN B 1 59  ? 53.470 -3.474  40.283 1.00 35.44 ? 201 ASN B CB    1 
ATOM   1547 C CG    . ASN B 1 59  ? 53.355 -3.578  41.779 1.00 34.69 ? 201 ASN B CG    1 
ATOM   1548 O OD1   . ASN B 1 59  ? 52.256 -3.795  42.283 1.00 36.43 ? 201 ASN B OD1   1 
ATOM   1549 N ND2   . ASN B 1 59  ? 54.430 -3.465  42.555 1.00 31.82 ? 201 ASN B ND2   1 
ATOM   1550 H H     . ASN B 1 59  ? 54.328 -0.720  41.070 1.00 0.00  ? 201 ASN B H     1 
ATOM   1551 H HD21  . ASN B 1 59  ? 54.299 -3.541  43.522 1.00 0.00  ? 201 ASN B HD21  1 
ATOM   1552 H HD22  . ASN B 1 59  ? 55.311 -3.312  42.153 1.00 0.00  ? 201 ASN B HD22  1 
ATOM   1553 N N     . VAL B 1 60  ? 51.241 -1.475  39.171 1.00 22.98 ? 202 VAL B N     1 
ATOM   1554 C CA    . VAL B 1 60  ? 49.949 -0.881  39.365 1.00 27.41 ? 202 VAL B CA    1 
ATOM   1555 C C     . VAL B 1 60  ? 48.990 -2.001  39.809 1.00 25.27 ? 202 VAL B C     1 
ATOM   1556 O O     . VAL B 1 60  ? 49.088 -3.090  39.274 1.00 29.30 ? 202 VAL B O     1 
ATOM   1557 C CB    . VAL B 1 60  ? 49.568 -0.240  37.991 1.00 26.20 ? 202 VAL B CB    1 
ATOM   1558 C CG1   . VAL B 1 60  ? 48.141 0.237   38.026 1.00 21.51 ? 202 VAL B CG1   1 
ATOM   1559 C CG2   . VAL B 1 60  ? 50.551 0.874   37.640 1.00 24.12 ? 202 VAL B CG2   1 
ATOM   1560 H H     . VAL B 1 60  ? 51.400 -2.021  38.373 1.00 0.00  ? 202 VAL B H     1 
ATOM   1561 N N     . LYS B 1 61  ? 48.062 -1.873  40.738 1.00 27.36 ? 203 LYS B N     1 
ATOM   1562 C CA    . LYS B 1 61  ? 47.085 -2.906  41.087 1.00 26.09 ? 203 LYS B CA    1 
ATOM   1563 C C     . LYS B 1 61  ? 45.743 -2.347  40.639 1.00 27.24 ? 203 LYS B C     1 
ATOM   1564 O O     . LYS B 1 61  ? 45.574 -1.117  40.577 1.00 31.40 ? 203 LYS B O     1 
ATOM   1565 C CB    . LYS B 1 61  ? 47.094 -3.113  42.558 1.00 25.93 ? 203 LYS B CB    1 
ATOM   1566 C CG    . LYS B 1 61  ? 48.485 -3.555  42.920 1.00 27.51 ? 203 LYS B CG    1 
ATOM   1567 C CD    . LYS B 1 61  ? 48.438 -4.073  44.305 1.00 36.45 ? 203 LYS B CD    1 
ATOM   1568 C CE    . LYS B 1 61  ? 49.677 -4.909  44.559 1.00 40.35 ? 203 LYS B CE    1 
ATOM   1569 N NZ    . LYS B 1 61  ? 50.881 -4.093  44.534 1.00 50.52 ? 203 LYS B NZ    1 
ATOM   1570 H H     . LYS B 1 61  ? 48.024 -1.027  41.229 1.00 0.00  ? 203 LYS B H     1 
ATOM   1571 H HZ1   . LYS B 1 61  ? 50.820 -3.361  45.271 1.00 0.00  ? 203 LYS B HZ1   1 
ATOM   1572 H HZ2   . LYS B 1 61  ? 51.711 -4.694  44.711 1.00 0.00  ? 203 LYS B HZ2   1 
ATOM   1573 H HZ3   . LYS B 1 61  ? 50.974 -3.640  43.602 1.00 0.00  ? 203 LYS B HZ3   1 
ATOM   1574 N N     . HIS B 1 62  ? 44.787 -3.173  40.234 1.00 27.53 ? 204 HIS B N     1 
ATOM   1575 C CA    . HIS B 1 62  ? 43.494 -2.750  39.735 1.00 27.05 ? 204 HIS B CA    1 
ATOM   1576 C C     . HIS B 1 62  ? 42.466 -3.381  40.658 1.00 29.08 ? 204 HIS B C     1 
ATOM   1577 O O     . HIS B 1 62  ? 42.502 -4.595  40.859 1.00 31.79 ? 204 HIS B O     1 
ATOM   1578 C CB    . HIS B 1 62  ? 43.295 -3.245  38.326 1.00 26.61 ? 204 HIS B CB    1 
ATOM   1579 C CG    . HIS B 1 62  ? 44.298 -2.581  37.400 1.00 32.81 ? 204 HIS B CG    1 
ATOM   1580 N ND1   . HIS B 1 62  ? 44.260 -1.377  36.811 1.00 34.84 ? 204 HIS B ND1   1 
ATOM   1581 C CD2   . HIS B 1 62  ? 45.479 -3.181  37.032 1.00 30.16 ? 204 HIS B CD2   1 
ATOM   1582 C CE1   . HIS B 1 62  ? 45.366 -1.254  36.105 1.00 30.74 ? 204 HIS B CE1   1 
ATOM   1583 N NE2   . HIS B 1 62  ? 46.085 -2.339  36.252 1.00 28.99 ? 204 HIS B NE2   1 
ATOM   1584 H H     . HIS B 1 62  ? 44.968 -4.135  40.275 1.00 0.00  ? 204 HIS B H     1 
ATOM   1585 H HD1   . HIS B 1 62  ? 43.548 -0.717  36.890 1.00 0.00  ? 204 HIS B HD1   1 
ATOM   1586 H HE2   . HIS B 1 62  ? 46.954 -2.493  35.834 1.00 0.00  ? 204 HIS B HE2   1 
ATOM   1587 N N     . TYR B 1 63  ? 41.608 -2.586  41.307 1.00 27.10 ? 205 TYR B N     1 
ATOM   1588 C CA    . TYR B 1 63  ? 40.546 -3.036  42.197 1.00 23.95 ? 205 TYR B CA    1 
ATOM   1589 C C     . TYR B 1 63  ? 39.205 -2.795  41.513 1.00 23.24 ? 205 TYR B C     1 
ATOM   1590 O O     . TYR B 1 63  ? 38.972 -1.648  41.143 1.00 27.15 ? 205 TYR B O     1 
ATOM   1591 C CB    . TYR B 1 63  ? 40.679 -2.252  43.483 1.00 19.35 ? 205 TYR B CB    1 
ATOM   1592 C CG    . TYR B 1 63  ? 41.994 -2.596  44.185 1.00 25.57 ? 205 TYR B CG    1 
ATOM   1593 C CD1   . TYR B 1 63  ? 42.095 -3.696  45.063 1.00 22.15 ? 205 TYR B CD1   1 
ATOM   1594 C CD2   . TYR B 1 63  ? 43.095 -1.766  43.975 1.00 23.68 ? 205 TYR B CD2   1 
ATOM   1595 C CE1   . TYR B 1 63  ? 43.289 -3.953  45.732 1.00 22.26 ? 205 TYR B CE1   1 
ATOM   1596 C CE2   . TYR B 1 63  ? 44.295 -2.025  44.651 1.00 21.52 ? 205 TYR B CE2   1 
ATOM   1597 C CZ    . TYR B 1 63  ? 44.391 -3.107  45.527 1.00 23.16 ? 205 TYR B CZ    1 
ATOM   1598 O OH    . TYR B 1 63  ? 45.573 -3.282  46.237 1.00 23.84 ? 205 TYR B OH    1 
ATOM   1599 H H     . TYR B 1 63  ? 41.702 -1.621  41.173 1.00 0.00  ? 205 TYR B H     1 
ATOM   1600 H HH    . TYR B 1 63  ? 45.481 -4.028  46.834 1.00 0.00  ? 205 TYR B HH    1 
ATOM   1601 N N     . LYS B 1 64  ? 38.324 -3.763  41.252 1.00 20.58 ? 206 LYS B N     1 
ATOM   1602 C CA    . LYS B 1 64  ? 37.074 -3.510  40.584 1.00 18.92 ? 206 LYS B CA    1 
ATOM   1603 C C     . LYS B 1 64  ? 36.163 -2.807  41.594 1.00 22.87 ? 206 LYS B C     1 
ATOM   1604 O O     . LYS B 1 64  ? 36.281 -3.036  42.808 1.00 19.82 ? 206 LYS B O     1 
ATOM   1605 C CB    . LYS B 1 64  ? 36.530 -4.854  40.117 1.00 18.87 ? 206 LYS B CB    1 
ATOM   1606 C CG    . LYS B 1 64  ? 35.343 -4.649  39.219 1.00 23.91 ? 206 LYS B CG    1 
ATOM   1607 C CD    . LYS B 1 64  ? 34.904 -5.927  38.526 1.00 34.16 ? 206 LYS B CD    1 
ATOM   1608 C CE    . LYS B 1 64  ? 35.912 -6.521  37.563 1.00 34.73 ? 206 LYS B CE    1 
ATOM   1609 N NZ    . LYS B 1 64  ? 35.473 -7.788  36.999 1.00 41.96 ? 206 LYS B NZ    1 
ATOM   1610 H H     . LYS B 1 64  ? 38.536 -4.680  41.525 1.00 0.00  ? 206 LYS B H     1 
ATOM   1611 H HZ1   . LYS B 1 64  ? 34.583 -7.647  36.480 1.00 0.00  ? 206 LYS B HZ1   1 
ATOM   1612 H HZ2   . LYS B 1 64  ? 36.200 -8.148  36.349 1.00 0.00  ? 206 LYS B HZ2   1 
ATOM   1613 H HZ3   . LYS B 1 64  ? 35.323 -8.475  37.765 1.00 0.00  ? 206 LYS B HZ3   1 
ATOM   1614 N N     . ILE B 1 65  ? 35.235 -1.935  41.177 1.00 22.25 ? 207 ILE B N     1 
ATOM   1615 C CA    . ILE B 1 65  ? 34.360 -1.231  42.116 1.00 24.23 ? 207 ILE B CA    1 
ATOM   1616 C C     . ILE B 1 65  ? 33.000 -1.575  41.528 1.00 24.91 ? 207 ILE B C     1 
ATOM   1617 O O     . ILE B 1 65  ? 32.768 -1.268  40.367 1.00 26.71 ? 207 ILE B O     1 
ATOM   1618 C CB    . ILE B 1 65  ? 34.596 0.352   42.116 1.00 22.09 ? 207 ILE B CB    1 
ATOM   1619 C CG1   . ILE B 1 65  ? 36.008 0.799   42.572 1.00 19.37 ? 207 ILE B CG1   1 
ATOM   1620 C CG2   . ILE B 1 65  ? 33.573 0.937   43.073 1.00 18.47 ? 207 ILE B CG2   1 
ATOM   1621 C CD1   . ILE B 1 65  ? 36.333 2.276   42.264 1.00 14.75 ? 207 ILE B CD1   1 
ATOM   1622 H H     . ILE B 1 65  ? 35.139 -1.764  40.217 1.00 0.00  ? 207 ILE B H     1 
ATOM   1623 N N     . ARG B 1 66  ? 32.114 -2.249  42.263 1.00 28.87 ? 208 ARG B N     1 
ATOM   1624 C CA    . ARG B 1 66  ? 30.792 -2.645  41.781 1.00 27.49 ? 208 ARG B CA    1 
ATOM   1625 C C     . ARG B 1 66  ? 29.721 -1.755  42.344 1.00 30.21 ? 208 ARG B C     1 
ATOM   1626 O O     . ARG B 1 66  ? 29.754 -1.256  43.472 1.00 28.93 ? 208 ARG B O     1 
ATOM   1627 C CB    . ARG B 1 66  ? 30.475 -4.074  42.160 1.00 30.70 ? 208 ARG B CB    1 
ATOM   1628 C CG    . ARG B 1 66  ? 31.434 -4.961  41.427 1.00 27.54 ? 208 ARG B CG    1 
ATOM   1629 C CD    . ARG B 1 66  ? 30.880 -6.296  41.100 1.00 27.89 ? 208 ARG B CD    1 
ATOM   1630 N NE    . ARG B 1 66  ? 31.995 -7.149  40.715 1.00 33.33 ? 208 ARG B NE    1 
ATOM   1631 C CZ    . ARG B 1 66  ? 32.005 -7.907  39.598 1.00 33.77 ? 208 ARG B CZ    1 
ATOM   1632 N NH1   . ARG B 1 66  ? 30.959 -7.908  38.775 1.00 33.22 ? 208 ARG B NH1   1 
ATOM   1633 N NH2   . ARG B 1 66  ? 33.031 -8.745  39.332 1.00 30.77 ? 208 ARG B NH2   1 
ATOM   1634 H H     . ARG B 1 66  ? 32.364 -2.493  43.178 1.00 0.00  ? 208 ARG B H     1 
ATOM   1635 H HE    . ARG B 1 66  ? 32.781 -7.174  41.299 1.00 0.00  ? 208 ARG B HE    1 
ATOM   1636 H HH11  . ARG B 1 66  ? 30.159 -7.345  38.982 1.00 0.00  ? 208 ARG B HH11  1 
ATOM   1637 H HH12  . ARG B 1 66  ? 30.973 -8.472  37.949 1.00 0.00  ? 208 ARG B HH12  1 
ATOM   1638 H HH21  . ARG B 1 66  ? 33.800 -8.811  39.968 1.00 0.00  ? 208 ARG B HH21  1 
ATOM   1639 H HH22  . ARG B 1 66  ? 33.021 -9.299  38.499 1.00 0.00  ? 208 ARG B HH22  1 
ATOM   1640 N N     . LYS B 1 67  ? 28.766 -1.494  41.485 1.00 35.45 ? 209 LYS B N     1 
ATOM   1641 C CA    . LYS B 1 67  ? 27.714 -0.574  41.838 1.00 38.21 ? 209 LYS B CA    1 
ATOM   1642 C C     . LYS B 1 67  ? 26.592 -1.475  42.353 1.00 37.59 ? 209 LYS B C     1 
ATOM   1643 O O     . LYS B 1 67  ? 26.172 -2.370  41.631 1.00 38.56 ? 209 LYS B O     1 
ATOM   1644 C CB    . LYS B 1 67  ? 27.422 0.208   40.532 1.00 42.91 ? 209 LYS B CB    1 
ATOM   1645 C CG    . LYS B 1 67  ? 26.708 1.581   40.600 1.00 53.99 ? 209 LYS B CG    1 
ATOM   1646 C CD    . LYS B 1 67  ? 25.283 1.634   41.136 1.00 60.46 ? 209 LYS B CD    1 
ATOM   1647 C CE    . LYS B 1 67  ? 24.228 1.169   40.125 1.00 69.97 ? 209 LYS B CE    1 
ATOM   1648 N NZ    . LYS B 1 67  ? 22.982 0.783   40.777 1.00 73.52 ? 209 LYS B NZ    1 
ATOM   1649 H H     . LYS B 1 67  ? 28.767 -1.924  40.604 1.00 0.00  ? 209 LYS B H     1 
ATOM   1650 H HZ1   . LYS B 1 67  ? 22.597 1.596   41.298 1.00 0.00  ? 209 LYS B HZ1   1 
ATOM   1651 H HZ2   . LYS B 1 67  ? 22.296 0.475   40.059 1.00 0.00  ? 209 LYS B HZ2   1 
ATOM   1652 H HZ3   . LYS B 1 67  ? 23.165 0.002   41.439 1.00 0.00  ? 209 LYS B HZ3   1 
ATOM   1653 N N     . LEU B 1 68  ? 26.121 -1.423  43.590 1.00 36.21 ? 210 LEU B N     1 
ATOM   1654 C CA    . LEU B 1 68  ? 24.989 -2.200  44.038 1.00 39.83 ? 210 LEU B CA    1 
ATOM   1655 C C     . LEU B 1 68  ? 23.723 -1.759  43.307 1.00 43.73 ? 210 LEU B C     1 
ATOM   1656 O O     . LEU B 1 68  ? 23.580 -0.594  42.910 1.00 40.78 ? 210 LEU B O     1 
ATOM   1657 C CB    . LEU B 1 68  ? 24.815 -1.994  45.495 1.00 40.88 ? 210 LEU B CB    1 
ATOM   1658 C CG    . LEU B 1 68  ? 25.983 -2.501  46.296 1.00 44.38 ? 210 LEU B CG    1 
ATOM   1659 C CD1   . LEU B 1 68  ? 26.189 -1.617  47.524 1.00 44.74 ? 210 LEU B CD1   1 
ATOM   1660 C CD2   . LEU B 1 68  ? 25.757 -3.977  46.561 1.00 38.67 ? 210 LEU B CD2   1 
ATOM   1661 H H     . LEU B 1 68  ? 26.562 -0.829  44.232 1.00 0.00  ? 210 LEU B H     1 
ATOM   1662 N N     . ASP B 1 69  ? 22.754 -2.653  43.087 1.00 50.92 ? 211 ASP B N     1 
ATOM   1663 C CA    . ASP B 1 69  ? 21.554 -2.320  42.321 1.00 58.64 ? 211 ASP B CA    1 
ATOM   1664 C C     . ASP B 1 69  ? 20.814 -1.074  42.838 1.00 60.30 ? 211 ASP B C     1 
ATOM   1665 O O     . ASP B 1 69  ? 20.496 -0.198  42.017 1.00 59.45 ? 211 ASP B O     1 
ATOM   1666 C CB    . ASP B 1 69  ? 20.629 -3.539  42.308 1.00 60.82 ? 211 ASP B CB    1 
ATOM   1667 H H     . ASP B 1 69  ? 22.851 -3.558  43.450 1.00 0.00  ? 211 ASP B H     1 
ATOM   1668 N N     . SER B 1 70  ? 20.685 -0.940  44.174 1.00 58.95 ? 212 SER B N     1 
ATOM   1669 C CA    . SER B 1 70  ? 20.147 0.266   44.819 1.00 61.31 ? 212 SER B CA    1 
ATOM   1670 C C     . SER B 1 70  ? 20.928 1.558   44.475 1.00 60.34 ? 212 SER B C     1 
ATOM   1671 O O     . SER B 1 70  ? 20.329 2.626   44.360 1.00 62.18 ? 212 SER B O     1 
ATOM   1672 C CB    . SER B 1 70  ? 20.176 0.093   46.318 1.00 61.72 ? 212 SER B CB    1 
ATOM   1673 O OG    . SER B 1 70  ? 21.470 -0.416  46.660 1.00 70.33 ? 212 SER B OG    1 
ATOM   1674 H H     . SER B 1 70  ? 20.965 -1.686  44.744 1.00 0.00  ? 212 SER B H     1 
ATOM   1675 H HG    . SER B 1 70  ? 21.525 -0.539  47.610 1.00 0.00  ? 212 SER B HG    1 
ATOM   1676 N N     . GLY B 1 71  ? 22.270 1.471   44.285 1.00 58.55 ? 213 GLY B N     1 
ATOM   1677 C CA    . GLY B 1 71  ? 23.088 2.610   43.892 1.00 51.41 ? 213 GLY B CA    1 
ATOM   1678 C C     . GLY B 1 71  ? 24.499 2.619   44.455 1.00 46.82 ? 213 GLY B C     1 
ATOM   1679 O O     . GLY B 1 71  ? 25.393 3.074   43.750 1.00 45.69 ? 213 GLY B O     1 
ATOM   1680 H H     . GLY B 1 71  ? 22.707 0.604   44.418 1.00 0.00  ? 213 GLY B H     1 
ATOM   1681 N N     . GLY B 1 72  ? 24.656 2.150   45.701 1.00 43.61 ? 214 GLY B N     1 
ATOM   1682 C CA    . GLY B 1 72  ? 25.938 2.080   46.395 1.00 39.89 ? 214 GLY B CA    1 
ATOM   1683 C C     . GLY B 1 72  ? 27.107 1.478   45.622 1.00 37.45 ? 214 GLY B C     1 
ATOM   1684 O O     . GLY B 1 72  ? 26.936 0.888   44.564 1.00 38.58 ? 214 GLY B O     1 
ATOM   1685 H H     . GLY B 1 72  ? 23.860 1.834   46.176 1.00 0.00  ? 214 GLY B H     1 
ATOM   1686 N N     . PHE B 1 73  ? 28.324 1.565   46.160 1.00 33.27 ? 215 PHE B N     1 
ATOM   1687 C CA    . PHE B 1 73  ? 29.580 1.106   45.556 1.00 27.06 ? 215 PHE B CA    1 
ATOM   1688 C C     . PHE B 1 73  ? 30.436 0.331   46.556 1.00 21.32 ? 215 PHE B C     1 
ATOM   1689 O O     . PHE B 1 73  ? 30.478 0.698   47.736 1.00 21.44 ? 215 PHE B O     1 
ATOM   1690 C CB    . PHE B 1 73  ? 30.436 2.288   45.090 1.00 25.83 ? 215 PHE B CB    1 
ATOM   1691 C CG    . PHE B 1 73  ? 29.851 3.032   43.930 1.00 22.15 ? 215 PHE B CG    1 
ATOM   1692 C CD1   . PHE B 1 73  ? 30.077 2.551   42.646 1.00 22.86 ? 215 PHE B CD1   1 
ATOM   1693 C CD2   . PHE B 1 73  ? 29.084 4.158   44.191 1.00 21.60 ? 215 PHE B CD2   1 
ATOM   1694 C CE1   . PHE B 1 73  ? 29.469 3.201   41.598 1.00 23.39 ? 215 PHE B CE1   1 
ATOM   1695 C CE2   . PHE B 1 73  ? 28.486 4.792   43.120 1.00 18.24 ? 215 PHE B CE2   1 
ATOM   1696 C CZ    . PHE B 1 73  ? 28.673 4.319   41.833 1.00 18.73 ? 215 PHE B CZ    1 
ATOM   1697 H H     . PHE B 1 73  ? 28.386 1.976   47.046 1.00 0.00  ? 215 PHE B H     1 
ATOM   1698 N N     . TYR B 1 74  ? 31.181 -0.692  46.167 1.00 18.50 ? 216 TYR B N     1 
ATOM   1699 C CA    . TYR B 1 74  ? 31.989 -1.429  47.135 1.00 20.58 ? 216 TYR B CA    1 
ATOM   1700 C C     . TYR B 1 74  ? 33.172 -2.079  46.409 1.00 21.78 ? 216 TYR B C     1 
ATOM   1701 O O     . TYR B 1 74  ? 33.147 -2.340  45.190 1.00 18.01 ? 216 TYR B O     1 
ATOM   1702 C CB    . TYR B 1 74  ? 31.114 -2.523  47.859 1.00 14.78 ? 216 TYR B CB    1 
ATOM   1703 C CG    . TYR B 1 74  ? 30.711 -3.702  46.958 1.00 22.86 ? 216 TYR B CG    1 
ATOM   1704 C CD1   . TYR B 1 74  ? 31.589 -4.788  46.751 1.00 20.47 ? 216 TYR B CD1   1 
ATOM   1705 C CD2   . TYR B 1 74  ? 29.481 -3.686  46.304 1.00 23.18 ? 216 TYR B CD2   1 
ATOM   1706 C CE1   . TYR B 1 74  ? 31.225 -5.841  45.905 1.00 19.10 ? 216 TYR B CE1   1 
ATOM   1707 C CE2   . TYR B 1 74  ? 29.123 -4.738  45.451 1.00 23.26 ? 216 TYR B CE2   1 
ATOM   1708 C CZ    . TYR B 1 74  ? 29.997 -5.803  45.250 1.00 21.33 ? 216 TYR B CZ    1 
ATOM   1709 O OH    . TYR B 1 74  ? 29.660 -6.803  44.357 1.00 25.34 ? 216 TYR B OH    1 
ATOM   1710 H H     . TYR B 1 74  ? 31.190 -0.956  45.223 1.00 0.00  ? 216 TYR B H     1 
ATOM   1711 H HH    . TYR B 1 74  ? 28.804 -6.610  43.968 1.00 0.00  ? 216 TYR B HH    1 
ATOM   1712 N N     . ILE B 1 75  ? 34.247 -2.180  47.180 1.00 23.05 ? 217 ILE B N     1 
ATOM   1713 C CA    . ILE B 1 75  ? 35.410 -2.940  46.790 1.00 23.46 ? 217 ILE B CA    1 
ATOM   1714 C C     . ILE B 1 75  ? 35.340 -4.176  47.728 1.00 25.51 ? 217 ILE B C     1 
ATOM   1715 O O     . ILE B 1 75  ? 35.601 -5.297  47.290 1.00 25.99 ? 217 ILE B O     1 
ATOM   1716 C CB    . ILE B 1 75  ? 36.734 -2.095  47.015 1.00 24.56 ? 217 ILE B CB    1 
ATOM   1717 C CG1   . ILE B 1 75  ? 36.863 -1.021  45.935 1.00 18.29 ? 217 ILE B CG1   1 
ATOM   1718 C CG2   . ILE B 1 75  ? 37.978 -3.001  46.931 1.00 21.91 ? 217 ILE B CG2   1 
ATOM   1719 C CD1   . ILE B 1 75  ? 38.104 -0.111  46.103 1.00 11.16 ? 217 ILE B CD1   1 
ATOM   1720 H H     . ILE B 1 75  ? 34.251 -1.722  48.046 1.00 0.00  ? 217 ILE B H     1 
ATOM   1721 N N     . THR B 1 76  ? 34.911 -4.131  49.006 1.00 25.10 ? 218 THR B N     1 
ATOM   1722 C CA    . THR B 1 76  ? 34.892 -5.276  49.908 1.00 23.44 ? 218 THR B CA    1 
ATOM   1723 C C     . THR B 1 76  ? 33.601 -5.312  50.698 1.00 22.58 ? 218 THR B C     1 
ATOM   1724 O O     . THR B 1 76  ? 32.794 -4.393  50.575 1.00 23.25 ? 218 THR B O     1 
ATOM   1725 C CB    . THR B 1 76  ? 36.095 -5.266  50.913 1.00 21.01 ? 218 THR B CB    1 
ATOM   1726 O OG1   . THR B 1 76  ? 35.820 -4.312  51.919 1.00 18.43 ? 218 THR B OG1   1 
ATOM   1727 C CG2   . THR B 1 76  ? 37.420 -4.995  50.228 1.00 21.32 ? 218 THR B CG2   1 
ATOM   1728 H H     . THR B 1 76  ? 34.591 -3.272  49.351 1.00 0.00  ? 218 THR B H     1 
ATOM   1729 H HG1   . THR B 1 76  ? 35.717 -3.445  51.519 1.00 0.00  ? 218 THR B HG1   1 
ATOM   1730 N N     . SER B 1 77  ? 33.371 -6.315  51.544 1.00 22.05 ? 219 SER B N     1 
ATOM   1731 C CA    . SER B 1 77  ? 32.099 -6.443  52.259 1.00 19.01 ? 219 SER B CA    1 
ATOM   1732 C C     . SER B 1 77  ? 32.050 -5.604  53.522 1.00 19.03 ? 219 SER B C     1 
ATOM   1733 O O     . SER B 1 77  ? 31.024 -5.390  54.178 1.00 22.90 ? 219 SER B O     1 
ATOM   1734 C CB    . SER B 1 77  ? 31.918 -7.936  52.570 1.00 16.28 ? 219 SER B CB    1 
ATOM   1735 O OG    . SER B 1 77  ? 33.115 -8.405  53.201 1.00 21.73 ? 219 SER B OG    1 
ATOM   1736 H H     . SER B 1 77  ? 34.071 -6.985  51.692 1.00 0.00  ? 219 SER B H     1 
ATOM   1737 H HG    . SER B 1 77  ? 33.025 -9.339  53.405 1.00 0.00  ? 219 SER B HG    1 
ATOM   1738 N N     . ARG B 1 78  ? 33.250 -5.223  53.935 1.00 17.92 ? 220 ARG B N     1 
ATOM   1739 C CA    . ARG B 1 78  ? 33.421 -4.401  55.111 1.00 22.81 ? 220 ARG B CA    1 
ATOM   1740 C C     . ARG B 1 78  ? 32.683 -3.036  55.055 1.00 26.00 ? 220 ARG B C     1 
ATOM   1741 O O     . ARG B 1 78  ? 31.965 -2.687  55.999 1.00 25.26 ? 220 ARG B O     1 
ATOM   1742 C CB    . ARG B 1 78  ? 34.928 -4.263  55.278 1.00 23.38 ? 220 ARG B CB    1 
ATOM   1743 C CG    . ARG B 1 78  ? 35.086 -3.750  56.658 1.00 28.29 ? 220 ARG B CG    1 
ATOM   1744 C CD    . ARG B 1 78  ? 36.523 -3.680  57.010 1.00 36.67 ? 220 ARG B CD    1 
ATOM   1745 N NE    . ARG B 1 78  ? 36.537 -3.426  58.430 1.00 46.20 ? 220 ARG B NE    1 
ATOM   1746 C CZ    . ARG B 1 78  ? 37.509 -2.823  59.109 1.00 47.81 ? 220 ARG B CZ    1 
ATOM   1747 N NH1   . ARG B 1 78  ? 38.583 -2.379  58.445 1.00 49.02 ? 220 ARG B NH1   1 
ATOM   1748 N NH2   . ARG B 1 78  ? 37.342 -2.744  60.449 1.00 53.26 ? 220 ARG B NH2   1 
ATOM   1749 H H     . ARG B 1 78  ? 34.041 -5.506  53.430 1.00 0.00  ? 220 ARG B H     1 
ATOM   1750 H HE    . ARG B 1 78  ? 35.758 -3.725  58.942 1.00 0.00  ? 220 ARG B HE    1 
ATOM   1751 H HH11  . ARG B 1 78  ? 38.645 -2.503  57.455 1.00 0.00  ? 220 ARG B HH11  1 
ATOM   1752 H HH12  . ARG B 1 78  ? 39.323 -1.923  58.939 1.00 0.00  ? 220 ARG B HH12  1 
ATOM   1753 H HH21  . ARG B 1 78  ? 36.522 -3.128  60.874 1.00 0.00  ? 220 ARG B HH21  1 
ATOM   1754 H HH22  . ARG B 1 78  ? 38.038 -2.302  61.014 1.00 0.00  ? 220 ARG B HH22  1 
ATOM   1755 N N     . THR B 1 79  ? 32.708 -2.364  53.888 1.00 28.49 ? 221 THR B N     1 
ATOM   1756 C CA    . THR B 1 79  ? 32.136 -1.039  53.691 1.00 30.43 ? 221 THR B CA    1 
ATOM   1757 C C     . THR B 1 79  ? 31.570 -0.855  52.295 1.00 26.25 ? 221 THR B C     1 
ATOM   1758 O O     . THR B 1 79  ? 32.148 -1.366  51.333 1.00 29.25 ? 221 THR B O     1 
ATOM   1759 C CB    . THR B 1 79  ? 33.185 0.086   53.825 1.00 34.19 ? 221 THR B CB    1 
ATOM   1760 O OG1   . THR B 1 79  ? 34.358 -0.130  53.076 1.00 40.87 ? 221 THR B OG1   1 
ATOM   1761 C CG2   . THR B 1 79  ? 33.678 0.056   55.218 1.00 40.69 ? 221 THR B CG2   1 
ATOM   1762 H H     . THR B 1 79  ? 33.139 -2.795  53.121 1.00 0.00  ? 221 THR B H     1 
ATOM   1763 H HG1   . THR B 1 79  ? 34.962 0.605   53.207 1.00 0.00  ? 221 THR B HG1   1 
ATOM   1764 N N     . GLN B 1 80  ? 30.526 -0.035  52.170 1.00 23.11 ? 222 GLN B N     1 
ATOM   1765 C CA    . GLN B 1 80  ? 29.897 0.315   50.895 1.00 23.57 ? 222 GLN B CA    1 
ATOM   1766 C C     . GLN B 1 80  ? 29.809 1.837   51.000 1.00 23.82 ? 222 GLN B C     1 
ATOM   1767 O O     . GLN B 1 80  ? 29.724 2.391   52.096 1.00 21.35 ? 222 GLN B O     1 
ATOM   1768 C CB    . GLN B 1 80  ? 28.448 -0.128  50.738 1.00 28.73 ? 222 GLN B CB    1 
ATOM   1769 C CG    . GLN B 1 80  ? 27.889 -1.502  50.972 1.00 43.53 ? 222 GLN B CG    1 
ATOM   1770 C CD    . GLN B 1 80  ? 28.285 -2.053  52.312 1.00 47.69 ? 222 GLN B CD    1 
ATOM   1771 O OE1   . GLN B 1 80  ? 28.215 -1.383  53.334 1.00 54.07 ? 222 GLN B OE1   1 
ATOM   1772 N NE2   . GLN B 1 80  ? 28.593 -3.309  52.481 1.00 50.65 ? 222 GLN B NE2   1 
ATOM   1773 H H     . GLN B 1 80  ? 30.155 0.360   52.986 1.00 0.00  ? 222 GLN B H     1 
ATOM   1774 H HE21  . GLN B 1 80  ? 28.841 -3.596  53.383 1.00 0.00  ? 222 GLN B HE21  1 
ATOM   1775 H HE22  . GLN B 1 80  ? 28.570 -3.926  51.720 1.00 0.00  ? 222 GLN B HE22  1 
ATOM   1776 N N     . PHE B 1 81  ? 29.726 2.549   49.885 1.00 22.63 ? 223 PHE B N     1 
ATOM   1777 C CA    . PHE B 1 81  ? 29.707 3.989   49.872 1.00 21.05 ? 223 PHE B CA    1 
ATOM   1778 C C     . PHE B 1 81  ? 28.534 4.422   49.052 1.00 25.77 ? 223 PHE B C     1 
ATOM   1779 O O     . PHE B 1 81  ? 28.270 3.784   48.016 1.00 25.49 ? 223 PHE B O     1 
ATOM   1780 C CB    . PHE B 1 81  ? 30.952 4.431   49.229 1.00 18.19 ? 223 PHE B CB    1 
ATOM   1781 C CG    . PHE B 1 81  ? 32.059 4.030   50.155 1.00 20.32 ? 223 PHE B CG    1 
ATOM   1782 C CD1   . PHE B 1 81  ? 32.258 4.776   51.329 1.00 19.76 ? 223 PHE B CD1   1 
ATOM   1783 C CD2   . PHE B 1 81  ? 32.858 2.928   49.847 1.00 21.34 ? 223 PHE B CD2   1 
ATOM   1784 C CE1   . PHE B 1 81  ? 33.259 4.399   52.210 1.00 17.88 ? 223 PHE B CE1   1 
ATOM   1785 C CE2   . PHE B 1 81  ? 33.872 2.563   50.752 1.00 21.03 ? 223 PHE B CE2   1 
ATOM   1786 C CZ    . PHE B 1 81  ? 34.063 3.296   51.921 1.00 18.94 ? 223 PHE B CZ    1 
ATOM   1787 H H     . PHE B 1 81  ? 29.675 2.074   49.030 1.00 0.00  ? 223 PHE B H     1 
ATOM   1788 N N     . ASN B 1 82  ? 27.870 5.526   49.416 1.00 25.60 ? 224 ASN B N     1 
ATOM   1789 C CA    . ASN B 1 82  ? 26.750 5.907   48.567 1.00 23.25 ? 224 ASN B CA    1 
ATOM   1790 C C     . ASN B 1 82  ? 27.238 6.653   47.378 1.00 22.20 ? 224 ASN B C     1 
ATOM   1791 O O     . ASN B 1 82  ? 26.424 6.867   46.487 1.00 26.71 ? 224 ASN B O     1 
ATOM   1792 C CB    . ASN B 1 82  ? 25.737 6.761   49.247 1.00 19.52 ? 224 ASN B CB    1 
ATOM   1793 C CG    . ASN B 1 82  ? 24.839 6.024   50.219 1.00 18.96 ? 224 ASN B CG    1 
ATOM   1794 O OD1   . ASN B 1 82  ? 24.099 5.102   49.904 1.00 24.38 ? 224 ASN B OD1   1 
ATOM   1795 N ND2   . ASN B 1 82  ? 24.848 6.439   51.463 1.00 20.99 ? 224 ASN B ND2   1 
ATOM   1796 H H     . ASN B 1 82  ? 28.123 6.046   50.206 1.00 0.00  ? 224 ASN B H     1 
ATOM   1797 H HD21  . ASN B 1 82  ? 24.271 5.970   52.100 1.00 0.00  ? 224 ASN B HD21  1 
ATOM   1798 H HD22  . ASN B 1 82  ? 25.418 7.192   51.724 1.00 0.00  ? 224 ASN B HD22  1 
ATOM   1799 N N     . SER B 1 83  ? 28.506 7.083   47.318 1.00 23.70 ? 225 SER B N     1 
ATOM   1800 C CA    . SER B 1 83  ? 29.008 7.642   46.076 1.00 24.00 ? 225 SER B CA    1 
ATOM   1801 C C     . SER B 1 83  ? 30.452 7.292   45.819 1.00 24.15 ? 225 SER B C     1 
ATOM   1802 O O     . SER B 1 83  ? 31.178 6.876   46.738 1.00 28.82 ? 225 SER B O     1 
ATOM   1803 C CB    . SER B 1 83  ? 28.843 9.171   46.061 1.00 26.31 ? 225 SER B CB    1 
ATOM   1804 O OG    . SER B 1 83  ? 29.364 9.964   47.121 1.00 29.15 ? 225 SER B OG    1 
ATOM   1805 H H     . SER B 1 83  ? 29.088 7.021   48.104 1.00 0.00  ? 225 SER B H     1 
ATOM   1806 H HG    . SER B 1 83  ? 29.173 10.890  46.952 1.00 0.00  ? 225 SER B HG    1 
ATOM   1807 N N     . LEU B 1 84  ? 30.901 7.491   44.585 1.00 24.10 ? 226 LEU B N     1 
ATOM   1808 C CA    . LEU B 1 84  ? 32.291 7.261   44.259 1.00 23.12 ? 226 LEU B CA    1 
ATOM   1809 C C     . LEU B 1 84  ? 33.206 8.200   44.955 1.00 22.92 ? 226 LEU B C     1 
ATOM   1810 O O     . LEU B 1 84  ? 34.316 7.837   45.309 1.00 29.82 ? 226 LEU B O     1 
ATOM   1811 C CB    . LEU B 1 84  ? 32.616 7.408   42.800 1.00 24.39 ? 226 LEU B CB    1 
ATOM   1812 C CG    . LEU B 1 84  ? 32.231 6.262   41.903 1.00 29.47 ? 226 LEU B CG    1 
ATOM   1813 C CD1   . LEU B 1 84  ? 32.749 6.531   40.515 1.00 27.13 ? 226 LEU B CD1   1 
ATOM   1814 C CD2   . LEU B 1 84  ? 32.893 4.968   42.380 1.00 32.26 ? 226 LEU B CD2   1 
ATOM   1815 H H     . LEU B 1 84  ? 30.284 7.797   43.888 1.00 0.00  ? 226 LEU B H     1 
ATOM   1816 N N     . GLN B 1 85  ? 32.767 9.417   45.229 1.00 26.02 ? 227 GLN B N     1 
ATOM   1817 C CA    . GLN B 1 85  ? 33.646 10.363  45.914 1.00 25.27 ? 227 GLN B CA    1 
ATOM   1818 C C     . GLN B 1 85  ? 33.793 9.954   47.364 1.00 21.79 ? 227 GLN B C     1 
ATOM   1819 O O     . GLN B 1 85  ? 34.903 10.106  47.875 1.00 24.89 ? 227 GLN B O     1 
ATOM   1820 C CB    . GLN B 1 85  ? 33.057 11.781  45.741 1.00 29.56 ? 227 GLN B CB    1 
ATOM   1821 C CG    . GLN B 1 85  ? 33.890 12.927  46.306 1.00 31.14 ? 227 GLN B CG    1 
ATOM   1822 C CD    . GLN B 1 85  ? 33.624 13.084  47.777 1.00 29.42 ? 227 GLN B CD    1 
ATOM   1823 O OE1   . GLN B 1 85  ? 32.502 12.855  48.226 1.00 30.20 ? 227 GLN B OE1   1 
ATOM   1824 N NE2   . GLN B 1 85  ? 34.598 13.428  48.575 1.00 29.94 ? 227 GLN B NE2   1 
ATOM   1825 H H     . GLN B 1 85  ? 31.859 9.683   44.975 1.00 0.00  ? 227 GLN B H     1 
ATOM   1826 H HE21  . GLN B 1 85  ? 34.391 13.521  49.527 1.00 0.00  ? 227 GLN B HE21  1 
ATOM   1827 H HE22  . GLN B 1 85  ? 35.496 13.582  48.214 1.00 0.00  ? 227 GLN B HE22  1 
ATOM   1828 N N     . GLN B 1 86  ? 32.764 9.398   48.018 1.00 20.50 ? 228 GLN B N     1 
ATOM   1829 C CA    . GLN B 1 86  ? 32.926 8.918   49.394 1.00 19.50 ? 228 GLN B CA    1 
ATOM   1830 C C     . GLN B 1 86  ? 33.883 7.731   49.497 1.00 19.08 ? 228 GLN B C     1 
ATOM   1831 O O     . GLN B 1 86  ? 34.663 7.603   50.451 1.00 20.84 ? 228 GLN B O     1 
ATOM   1832 C CB    . GLN B 1 86  ? 31.577 8.538   49.947 1.00 23.81 ? 228 GLN B CB    1 
ATOM   1833 C CG    . GLN B 1 86  ? 30.719 9.769   50.254 1.00 21.59 ? 228 GLN B CG    1 
ATOM   1834 C CD    . GLN B 1 86  ? 29.286 9.379   50.446 1.00 23.03 ? 228 GLN B CD    1 
ATOM   1835 O OE1   . GLN B 1 86  ? 28.521 9.444   49.498 1.00 23.27 ? 228 GLN B OE1   1 
ATOM   1836 N NE2   . GLN B 1 86  ? 28.813 8.881   51.570 1.00 22.62 ? 228 GLN B NE2   1 
ATOM   1837 H H     . GLN B 1 86  ? 31.895 9.311   47.573 1.00 0.00  ? 228 GLN B H     1 
ATOM   1838 H HE21  . GLN B 1 86  ? 27.861 8.656   51.599 1.00 0.00  ? 228 GLN B HE21  1 
ATOM   1839 H HE22  . GLN B 1 86  ? 29.409 8.749   52.336 1.00 0.00  ? 228 GLN B HE22  1 
ATOM   1840 N N     . LEU B 1 87  ? 33.849 6.853   48.494 1.00 18.87 ? 229 LEU B N     1 
ATOM   1841 C CA    . LEU B 1 87  ? 34.803 5.772   48.421 1.00 19.86 ? 229 LEU B CA    1 
ATOM   1842 C C     . LEU B 1 87  ? 36.229 6.326   48.242 1.00 21.79 ? 229 LEU B C     1 
ATOM   1843 O O     . LEU B 1 87  ? 37.109 5.896   48.997 1.00 25.00 ? 229 LEU B O     1 
ATOM   1844 C CB    . LEU B 1 87  ? 34.396 4.828   47.241 1.00 21.06 ? 229 LEU B CB    1 
ATOM   1845 C CG    . LEU B 1 87  ? 35.261 3.575   46.951 1.00 22.93 ? 229 LEU B CG    1 
ATOM   1846 C CD1   . LEU B 1 87  ? 34.380 2.477   46.376 1.00 19.15 ? 229 LEU B CD1   1 
ATOM   1847 C CD2   . LEU B 1 87  ? 36.391 3.905   45.977 1.00 20.86 ? 229 LEU B CD2   1 
ATOM   1848 H H     . LEU B 1 87  ? 33.167 6.943   47.796 1.00 0.00  ? 229 LEU B H     1 
ATOM   1849 N N     . VAL B 1 88  ? 36.578 7.264   47.339 1.00 20.08 ? 230 VAL B N     1 
ATOM   1850 C CA    . VAL B 1 88  ? 37.952 7.726   47.227 1.00 18.14 ? 230 VAL B CA    1 
ATOM   1851 C C     . VAL B 1 88  ? 38.367 8.396   48.530 1.00 20.70 ? 230 VAL B C     1 
ATOM   1852 O O     . VAL B 1 88  ? 39.460 8.170   49.052 1.00 26.12 ? 230 VAL B O     1 
ATOM   1853 C CB    . VAL B 1 88  ? 38.077 8.686   46.025 1.00 17.96 ? 230 VAL B CB    1 
ATOM   1854 C CG1   . VAL B 1 88  ? 39.457 9.327   46.017 1.00 19.14 ? 230 VAL B CG1   1 
ATOM   1855 C CG2   . VAL B 1 88  ? 37.937 7.939   44.732 1.00 9.07  ? 230 VAL B CG2   1 
ATOM   1856 H H     . VAL B 1 88  ? 35.894 7.641   46.748 1.00 0.00  ? 230 VAL B H     1 
ATOM   1857 N N     . ALA B 1 89  ? 37.455 9.152   49.124 1.00 22.95 ? 231 ALA B N     1 
ATOM   1858 C CA    . ALA B 1 89  ? 37.695 9.841   50.395 1.00 21.75 ? 231 ALA B CA    1 
ATOM   1859 C C     . ALA B 1 89  ? 38.033 8.886   51.543 1.00 24.90 ? 231 ALA B C     1 
ATOM   1860 O O     . ALA B 1 89  ? 39.002 9.097   52.300 1.00 24.92 ? 231 ALA B O     1 
ATOM   1861 C CB    . ALA B 1 89  ? 36.429 10.635  50.740 1.00 21.89 ? 231 ALA B CB    1 
ATOM   1862 H H     . ALA B 1 89  ? 36.581 9.255   48.694 1.00 0.00  ? 231 ALA B H     1 
ATOM   1863 N N     . TYR B 1 90  ? 37.229 7.822   51.696 1.00 23.13 ? 232 TYR B N     1 
ATOM   1864 C CA    . TYR B 1 90  ? 37.484 6.819   52.713 1.00 19.46 ? 232 TYR B CA    1 
ATOM   1865 C C     . TYR B 1 90  ? 38.847 6.148   52.499 1.00 18.78 ? 232 TYR B C     1 
ATOM   1866 O O     . TYR B 1 90  ? 39.660 6.070   53.417 1.00 17.90 ? 232 TYR B O     1 
ATOM   1867 C CB    . TYR B 1 90  ? 36.333 5.853   52.607 1.00 24.88 ? 232 TYR B CB    1 
ATOM   1868 C CG    . TYR B 1 90  ? 36.537 4.713   53.560 1.00 26.33 ? 232 TYR B CG    1 
ATOM   1869 C CD1   . TYR B 1 90  ? 36.193 4.863   54.882 1.00 27.25 ? 232 TYR B CD1   1 
ATOM   1870 C CD2   . TYR B 1 90  ? 37.156 3.546   53.114 1.00 28.97 ? 232 TYR B CD2   1 
ATOM   1871 C CE1   . TYR B 1 90  ? 36.494 3.833   55.771 1.00 31.74 ? 232 TYR B CE1   1 
ATOM   1872 C CE2   . TYR B 1 90  ? 37.469 2.524   53.998 1.00 27.25 ? 232 TYR B CE2   1 
ATOM   1873 C CZ    . TYR B 1 90  ? 37.144 2.686   55.327 1.00 30.39 ? 232 TYR B CZ    1 
ATOM   1874 O OH    . TYR B 1 90  ? 37.494 1.714   56.230 1.00 41.03 ? 232 TYR B OH    1 
ATOM   1875 H H     . TYR B 1 90  ? 36.452 7.720   51.107 1.00 0.00  ? 232 TYR B H     1 
ATOM   1876 H HH    . TYR B 1 90  ? 37.200 1.971   57.107 1.00 0.00  ? 232 TYR B HH    1 
ATOM   1877 N N     . TYR B 1 91  ? 39.179 5.655   51.302 1.00 21.38 ? 233 TYR B N     1 
ATOM   1878 C CA    . TYR B 1 91  ? 40.430 4.943   51.061 1.00 21.22 ? 233 TYR B CA    1 
ATOM   1879 C C     . TYR B 1 91  ? 41.645 5.795   51.030 1.00 24.34 ? 233 TYR B C     1 
ATOM   1880 O O     . TYR B 1 91  ? 42.737 5.219   51.068 1.00 23.73 ? 233 TYR B O     1 
ATOM   1881 C CB    . TYR B 1 91  ? 40.393 4.124   49.755 1.00 20.13 ? 233 TYR B CB    1 
ATOM   1882 C CG    . TYR B 1 91  ? 39.543 2.874   50.033 1.00 21.52 ? 233 TYR B CG    1 
ATOM   1883 C CD1   . TYR B 1 91  ? 40.066 1.798   50.793 1.00 26.61 ? 233 TYR B CD1   1 
ATOM   1884 C CD2   . TYR B 1 91  ? 38.239 2.802   49.564 1.00 20.40 ? 233 TYR B CD2   1 
ATOM   1885 C CE1   . TYR B 1 91  ? 39.288 0.667   51.078 1.00 20.44 ? 233 TYR B CE1   1 
ATOM   1886 C CE2   . TYR B 1 91  ? 37.458 1.681   49.836 1.00 23.51 ? 233 TYR B CE2   1 
ATOM   1887 C CZ    . TYR B 1 91  ? 37.985 0.616   50.595 1.00 24.32 ? 233 TYR B CZ    1 
ATOM   1888 O OH    . TYR B 1 91  ? 37.179 -0.470  50.881 1.00 22.93 ? 233 TYR B OH    1 
ATOM   1889 H H     . TYR B 1 91  ? 38.557 5.777   50.555 1.00 0.00  ? 233 TYR B H     1 
ATOM   1890 H HH    . TYR B 1 91  ? 37.666 -1.097  51.420 1.00 0.00  ? 233 TYR B HH    1 
ATOM   1891 N N     . SER B 1 92  ? 41.493 7.114   50.901 1.00 24.63 ? 234 SER B N     1 
ATOM   1892 C CA    . SER B 1 92  ? 42.598 8.038   51.080 1.00 27.36 ? 234 SER B CA    1 
ATOM   1893 C C     . SER B 1 92  ? 42.942 8.099   52.566 1.00 28.72 ? 234 SER B C     1 
ATOM   1894 O O     . SER B 1 92  ? 44.090 8.334   52.921 1.00 29.87 ? 234 SER B O     1 
ATOM   1895 C CB    . SER B 1 92  ? 42.205 9.427   50.537 1.00 29.99 ? 234 SER B CB    1 
ATOM   1896 O OG    . SER B 1 92  ? 42.134 9.484   49.094 1.00 34.78 ? 234 SER B OG    1 
ATOM   1897 H H     . SER B 1 92  ? 40.608 7.470   50.678 1.00 0.00  ? 234 SER B H     1 
ATOM   1898 H HG    . SER B 1 92  ? 41.886 10.370  48.820 1.00 0.00  ? 234 SER B HG    1 
ATOM   1899 N N     . LYS B 1 93  ? 41.982 7.894   53.482 1.00 33.49 ? 235 LYS B N     1 
ATOM   1900 C CA    . LYS B 1 93  ? 42.275 7.881   54.910 1.00 32.27 ? 235 LYS B CA    1 
ATOM   1901 C C     . LYS B 1 93  ? 42.605 6.461   55.366 1.00 32.34 ? 235 LYS B C     1 
ATOM   1902 O O     . LYS B 1 93  ? 43.459 6.292   56.225 1.00 34.26 ? 235 LYS B O     1 
ATOM   1903 C CB    . LYS B 1 93  ? 41.077 8.394   55.734 1.00 27.83 ? 235 LYS B CB    1 
ATOM   1904 H H     . LYS B 1 93  ? 41.060 7.749   53.183 1.00 0.00  ? 235 LYS B H     1 
ATOM   1905 N N     . HIS B 1 94  ? 42.016 5.381   54.831 1.00 34.76 ? 236 HIS B N     1 
ATOM   1906 C CA    . HIS B 1 94  ? 42.196 3.998   55.267 1.00 30.08 ? 236 HIS B CA    1 
ATOM   1907 C C     . HIS B 1 94  ? 42.445 3.038   54.111 1.00 28.74 ? 236 HIS B C     1 
ATOM   1908 O O     . HIS B 1 94  ? 41.538 2.874   53.312 1.00 34.33 ? 236 HIS B O     1 
ATOM   1909 C CB    . HIS B 1 94  ? 40.957 3.490   55.994 1.00 35.42 ? 236 HIS B CB    1 
ATOM   1910 C CG    . HIS B 1 94  ? 40.446 4.467   57.021 1.00 39.78 ? 236 HIS B CG    1 
ATOM   1911 N ND1   . HIS B 1 94  ? 40.906 4.732   58.234 1.00 44.24 ? 236 HIS B ND1   1 
ATOM   1912 C CD2   . HIS B 1 94  ? 39.429 5.352   56.761 1.00 46.27 ? 236 HIS B CD2   1 
ATOM   1913 C CE1   . HIS B 1 94  ? 40.225 5.749   58.709 1.00 47.71 ? 236 HIS B CE1   1 
ATOM   1914 N NE2   . HIS B 1 94  ? 39.338 6.117   57.815 1.00 48.31 ? 236 HIS B NE2   1 
ATOM   1915 H H     . HIS B 1 94  ? 41.409 5.534   54.079 1.00 0.00  ? 236 HIS B H     1 
ATOM   1916 H HD1   . HIS B 1 94  ? 41.623 4.257   58.693 1.00 0.00  ? 236 HIS B HD1   1 
ATOM   1917 H HE2   . HIS B 1 94  ? 38.705 6.852   57.922 1.00 0.00  ? 236 HIS B HE2   1 
ATOM   1918 N N     . ALA B 1 95  ? 43.577 2.341   53.973 1.00 27.35 ? 237 ALA B N     1 
ATOM   1919 C CA    . ALA B 1 95  ? 43.769 1.418   52.857 1.00 24.20 ? 237 ALA B CA    1 
ATOM   1920 C C     . ALA B 1 95  ? 42.832 0.222   52.889 1.00 24.50 ? 237 ALA B C     1 
ATOM   1921 O O     . ALA B 1 95  ? 42.461 -0.271  51.827 1.00 28.18 ? 237 ALA B O     1 
ATOM   1922 C CB    . ALA B 1 95  ? 45.175 0.852   52.836 1.00 21.89 ? 237 ALA B CB    1 
ATOM   1923 H H     . ALA B 1 95  ? 44.292 2.451   54.634 1.00 0.00  ? 237 ALA B H     1 
ATOM   1924 N N     . ASP B 1 96  ? 42.488 -0.269  54.099 1.00 28.69 ? 238 ASP B N     1 
ATOM   1925 C CA    . ASP B 1 96  ? 41.583 -1.395  54.354 1.00 26.94 ? 238 ASP B CA    1 
ATOM   1926 C C     . ASP B 1 96  ? 41.610 -2.519  53.365 1.00 24.45 ? 238 ASP B C     1 
ATOM   1927 O O     . ASP B 1 96  ? 40.582 -2.973  52.880 1.00 22.95 ? 238 ASP B O     1 
ATOM   1928 C CB    . ASP B 1 96  ? 40.164 -0.930  54.406 1.00 34.00 ? 238 ASP B CB    1 
ATOM   1929 C CG    . ASP B 1 96  ? 39.753 -0.316  55.696 1.00 44.27 ? 238 ASP B CG    1 
ATOM   1930 O OD1   . ASP B 1 96  ? 40.586 0.230   56.444 1.00 53.16 ? 238 ASP B OD1   1 
ATOM   1931 O OD2   . ASP B 1 96  ? 38.555 -0.355  55.962 1.00 46.80 ? 238 ASP B OD2   1 
ATOM   1932 H H     . ASP B 1 96  ? 42.880 0.169   54.881 1.00 0.00  ? 238 ASP B H     1 
ATOM   1933 N N     . GLY B 1 97  ? 42.808 -2.936  53.003 1.00 23.17 ? 239 GLY B N     1 
ATOM   1934 C CA    . GLY B 1 97  ? 42.919 -4.032  52.085 1.00 23.57 ? 239 GLY B CA    1 
ATOM   1935 C C     . GLY B 1 97  ? 43.666 -3.655  50.842 1.00 29.48 ? 239 GLY B C     1 
ATOM   1936 O O     . GLY B 1 97  ? 44.189 -4.532  50.158 1.00 34.77 ? 239 GLY B O     1 
ATOM   1937 H H     . GLY B 1 97  ? 43.612 -2.502  53.357 1.00 0.00  ? 239 GLY B H     1 
ATOM   1938 N N     . LEU B 1 98  ? 43.657 -2.393  50.436 1.00 32.04 ? 240 LEU B N     1 
ATOM   1939 C CA    . LEU B 1 98  ? 44.397 -1.984  49.247 1.00 30.72 ? 240 LEU B CA    1 
ATOM   1940 C C     . LEU B 1 98  ? 45.903 -2.025  49.563 1.00 30.49 ? 240 LEU B C     1 
ATOM   1941 O O     . LEU B 1 98  ? 46.329 -1.959  50.733 1.00 29.77 ? 240 LEU B O     1 
ATOM   1942 C CB    . LEU B 1 98  ? 44.026 -0.563  48.832 1.00 24.19 ? 240 LEU B CB    1 
ATOM   1943 C CG    . LEU B 1 98  ? 42.624 -0.131  48.615 1.00 25.24 ? 240 LEU B CG    1 
ATOM   1944 C CD1   . LEU B 1 98  ? 42.680 1.316   48.184 1.00 24.59 ? 240 LEU B CD1   1 
ATOM   1945 C CD2   . LEU B 1 98  ? 41.952 -0.945  47.556 1.00 25.68 ? 240 LEU B CD2   1 
ATOM   1946 H H     . LEU B 1 98  ? 43.147 -1.726  50.941 1.00 0.00  ? 240 LEU B H     1 
ATOM   1947 N N     . CYS B 1 99  ? 46.720 -2.085  48.505 1.00 32.52 ? 241 CYS B N     1 
ATOM   1948 C CA    . CYS B 1 99  ? 48.159 -2.099  48.673 1.00 30.55 ? 241 CYS B CA    1 
ATOM   1949 C C     . CYS B 1 99  ? 48.668 -0.859  49.386 1.00 31.60 ? 241 CYS B C     1 
ATOM   1950 O O     . CYS B 1 99  ? 49.626 -0.929  50.147 1.00 36.57 ? 241 CYS B O     1 
ATOM   1951 C CB    . CYS B 1 99  ? 48.772 -2.218  47.321 1.00 27.85 ? 241 CYS B CB    1 
ATOM   1952 S SG    . CYS B 1 99  ? 48.292 -0.852  46.229 1.00 35.25 ? 241 CYS B SG    1 
ATOM   1953 H H     . CYS B 1 99  ? 46.339 -2.120  47.603 1.00 0.00  ? 241 CYS B H     1 
ATOM   1954 N N     . HIS B 1 100 ? 48.112 0.336   49.204 1.00 32.68 ? 242 HIS B N     1 
ATOM   1955 C CA    . HIS B 1 100 ? 48.558 1.542   49.897 1.00 28.57 ? 242 HIS B CA    1 
ATOM   1956 C C     . HIS B 1 100 ? 47.331 2.421   50.039 1.00 26.99 ? 242 HIS B C     1 
ATOM   1957 O O     . HIS B 1 100 ? 46.447 2.329   49.190 1.00 26.47 ? 242 HIS B O     1 
ATOM   1958 C CB    . HIS B 1 100 ? 49.625 2.287   49.054 1.00 28.17 ? 242 HIS B CB    1 
ATOM   1959 C CG    . HIS B 1 100 ? 50.393 3.362   49.818 1.00 29.05 ? 242 HIS B CG    1 
ATOM   1960 N ND1   . HIS B 1 100 ? 51.598 3.299   50.370 1.00 35.83 ? 242 HIS B ND1   1 
ATOM   1961 C CD2   . HIS B 1 100 ? 49.936 4.605   50.143 1.00 32.22 ? 242 HIS B CD2   1 
ATOM   1962 C CE1   . HIS B 1 100 ? 51.886 4.409   51.015 1.00 29.37 ? 242 HIS B CE1   1 
ATOM   1963 N NE2   . HIS B 1 100 ? 50.859 5.188   50.858 1.00 34.58 ? 242 HIS B NE2   1 
ATOM   1964 H H     . HIS B 1 100 ? 47.366 0.411   48.574 1.00 0.00  ? 242 HIS B H     1 
ATOM   1965 H HD1   . HIS B 1 100 ? 52.195 2.528   50.306 1.00 0.00  ? 242 HIS B HD1   1 
ATOM   1966 H HE2   . HIS B 1 100 ? 50.787 6.090   51.226 1.00 0.00  ? 242 HIS B HE2   1 
ATOM   1967 N N     . ARG B 1 101 ? 47.202 3.264   51.064 1.00 25.32 ? 243 ARG B N     1 
ATOM   1968 C CA    . ARG B 1 101 ? 46.090 4.220   51.031 1.00 27.97 ? 243 ARG B CA    1 
ATOM   1969 C C     . ARG B 1 101 ? 46.320 5.121   49.821 1.00 25.63 ? 243 ARG B C     1 
ATOM   1970 O O     . ARG B 1 101 ? 47.435 5.253   49.304 1.00 29.26 ? 243 ARG B O     1 
ATOM   1971 C CB    . ARG B 1 101 ? 46.016 5.091   52.279 1.00 28.16 ? 243 ARG B CB    1 
ATOM   1972 C CG    . ARG B 1 101 ? 47.345 5.725   52.526 1.00 42.37 ? 243 ARG B CG    1 
ATOM   1973 C CD    . ARG B 1 101 ? 47.271 6.967   53.384 1.00 55.27 ? 243 ARG B CD    1 
ATOM   1974 N NE    . ARG B 1 101 ? 46.506 6.714   54.581 1.00 68.03 ? 243 ARG B NE    1 
ATOM   1975 C CZ    . ARG B 1 101 ? 46.872 5.838   55.532 1.00 76.00 ? 243 ARG B CZ    1 
ATOM   1976 N NH1   . ARG B 1 101 ? 48.011 5.106   55.441 1.00 77.93 ? 243 ARG B NH1   1 
ATOM   1977 N NH2   . ARG B 1 101 ? 46.052 5.703   56.578 1.00 79.87 ? 243 ARG B NH2   1 
ATOM   1978 H H     . ARG B 1 101 ? 47.830 3.245   51.816 1.00 0.00  ? 243 ARG B H     1 
ATOM   1979 H HE    . ARG B 1 101 ? 45.671 7.210   54.708 1.00 0.00  ? 243 ARG B HE    1 
ATOM   1980 H HH11  . ARG B 1 101 ? 48.610 5.209   54.647 1.00 0.00  ? 243 ARG B HH11  1 
ATOM   1981 H HH12  . ARG B 1 101 ? 48.252 4.463   56.168 1.00 0.00  ? 243 ARG B HH12  1 
ATOM   1982 H HH21  . ARG B 1 101 ? 45.211 6.241   56.626 1.00 0.00  ? 243 ARG B HH21  1 
ATOM   1983 H HH22  . ARG B 1 101 ? 46.280 5.064   57.313 1.00 0.00  ? 243 ARG B HH22  1 
ATOM   1984 N N     . LEU B 1 102 ? 45.271 5.679   49.271 1.00 26.60 ? 244 LEU B N     1 
ATOM   1985 C CA    . LEU B 1 102 ? 45.395 6.534   48.112 1.00 25.30 ? 244 LEU B CA    1 
ATOM   1986 C C     . LEU B 1 102 ? 46.082 7.887   48.492 1.00 28.96 ? 244 LEU B C     1 
ATOM   1987 O O     . LEU B 1 102 ? 45.699 8.550   49.474 1.00 27.77 ? 244 LEU B O     1 
ATOM   1988 C CB    . LEU B 1 102 ? 43.972 6.693   47.565 1.00 20.32 ? 244 LEU B CB    1 
ATOM   1989 C CG    . LEU B 1 102 ? 43.111 5.471   47.260 1.00 16.79 ? 244 LEU B CG    1 
ATOM   1990 C CD1   . LEU B 1 102 ? 41.747 5.944   46.804 1.00 12.68 ? 244 LEU B CD1   1 
ATOM   1991 C CD2   . LEU B 1 102 ? 43.779 4.600   46.241 1.00 10.85 ? 244 LEU B CD2   1 
ATOM   1992 H H     . LEU B 1 102 ? 44.384 5.514   49.653 1.00 0.00  ? 244 LEU B H     1 
ATOM   1993 N N     . THR B 1 103 ? 47.150 8.295   47.792 1.00 26.94 ? 245 THR B N     1 
ATOM   1994 C CA    . THR B 1 103 ? 47.808 9.531   48.103 1.00 28.12 ? 245 THR B CA    1 
ATOM   1995 C C     . THR B 1 103 ? 47.529 10.565  47.012 1.00 29.27 ? 245 THR B C     1 
ATOM   1996 O O     . THR B 1 103 ? 46.528 11.273  47.044 1.00 34.50 ? 245 THR B O     1 
ATOM   1997 C CB    . THR B 1 103 ? 49.324 9.255   48.286 1.00 25.95 ? 245 THR B CB    1 
ATOM   1998 O OG1   . THR B 1 103 ? 49.768 8.600   47.116 1.00 35.28 ? 245 THR B OG1   1 
ATOM   1999 C CG2   . THR B 1 103 ? 49.645 8.291   49.407 1.00 26.28 ? 245 THR B CG2   1 
ATOM   2000 H H     . THR B 1 103 ? 47.486 7.741   47.057 1.00 0.00  ? 245 THR B H     1 
ATOM   2001 H HG1   . THR B 1 103 ? 49.615 9.165   46.355 1.00 0.00  ? 245 THR B HG1   1 
ATOM   2002 N N     . THR B 1 104 ? 48.321 10.631  45.973 1.00 29.04 ? 246 THR B N     1 
ATOM   2003 C CA    . THR B 1 104 ? 48.252 11.633  44.935 1.00 31.43 ? 246 THR B CA    1 
ATOM   2004 C C     . THR B 1 104 ? 47.317 11.217  43.793 1.00 29.88 ? 246 THR B C     1 
ATOM   2005 O O     . THR B 1 104 ? 47.284 10.024  43.499 1.00 28.81 ? 246 THR B O     1 
ATOM   2006 C CB    . THR B 1 104 ? 49.812 11.803  44.634 1.00 33.06 ? 246 THR B CB    1 
ATOM   2007 O OG1   . THR B 1 104 ? 50.267 12.750  45.605 1.00 38.69 ? 246 THR B OG1   1 
ATOM   2008 C CG2   . THR B 1 104 ? 50.209 12.245  43.261 1.00 37.65 ? 246 THR B CG2   1 
ATOM   2009 H H     . THR B 1 104 ? 49.016 9.946   45.893 1.00 0.00  ? 246 THR B H     1 
ATOM   2010 H HG1   . THR B 1 104 ? 51.207 12.905  45.486 1.00 0.00  ? 246 THR B HG1   1 
ATOM   2011 N N     . VAL B 1 105 ? 46.511 12.081  43.141 1.00 27.95 ? 247 VAL B N     1 
ATOM   2012 C CA    . VAL B 1 105 ? 45.754 11.686  41.969 1.00 23.99 ? 247 VAL B CA    1 
ATOM   2013 C C     . VAL B 1 105 ? 46.800 11.634  40.857 1.00 28.69 ? 247 VAL B C     1 
ATOM   2014 O O     . VAL B 1 105 ? 47.794 12.376  40.904 1.00 33.20 ? 247 VAL B O     1 
ATOM   2015 C CB    . VAL B 1 105 ? 44.671 12.711  41.604 1.00 23.03 ? 247 VAL B CB    1 
ATOM   2016 C CG1   . VAL B 1 105 ? 44.035 12.418  40.237 1.00 27.77 ? 247 VAL B CG1   1 
ATOM   2017 C CG2   . VAL B 1 105 ? 43.558 12.592  42.605 1.00 20.55 ? 247 VAL B CG2   1 
ATOM   2018 H H     . VAL B 1 105 ? 46.435 13.001  43.469 1.00 0.00  ? 247 VAL B H     1 
ATOM   2019 N N     . CYS B 1 106 ? 46.647 10.777  39.855 1.00 24.92 ? 248 CYS B N     1 
ATOM   2020 C CA    . CYS B 1 106 ? 47.581 10.640  38.764 1.00 26.51 ? 248 CYS B CA    1 
ATOM   2021 C C     . CYS B 1 106 ? 47.846 12.008  38.126 1.00 27.64 ? 248 CYS B C     1 
ATOM   2022 O O     . CYS B 1 106 ? 46.889 12.767  37.902 1.00 28.21 ? 248 CYS B O     1 
ATOM   2023 C CB    . CYS B 1 106 ? 46.959 9.687   37.747 1.00 25.72 ? 248 CYS B CB    1 
ATOM   2024 S SG    . CYS B 1 106 ? 48.023 9.319   36.347 1.00 25.81 ? 248 CYS B SG    1 
ATOM   2025 H H     . CYS B 1 106 ? 45.853 10.204  39.856 1.00 0.00  ? 248 CYS B H     1 
ATOM   2026 N N     . PRO B 1 107 ? 49.091 12.393  37.880 1.00 27.87 ? 249 PRO B N     1 
ATOM   2027 C CA    . PRO B 1 107 ? 49.443 13.658  37.252 1.00 28.24 ? 249 PRO B CA    1 
ATOM   2028 C C     . PRO B 1 107 ? 48.758 13.926  35.908 1.00 30.33 ? 249 PRO B C     1 
ATOM   2029 O O     . PRO B 1 107 ? 48.546 13.013  35.119 1.00 31.22 ? 249 PRO B O     1 
ATOM   2030 C CB    . PRO B 1 107 ? 50.930 13.584  37.170 1.00 24.99 ? 249 PRO B CB    1 
ATOM   2031 C CG    . PRO B 1 107 ? 51.225 12.808  38.426 1.00 29.26 ? 249 PRO B CG    1 
ATOM   2032 C CD    . PRO B 1 107 ? 50.277 11.654  38.271 1.00 26.58 ? 249 PRO B CD    1 
ATOM   2033 O OXT   . PRO B 1 107 ? 48.371 15.062  35.669 1.00 33.17 ? 249 PRO B OXT   1 
HETATM 2034 C C     . ACE C 2 1   ? 41.369 7.480   24.907 1.00 27.66 ? 100 ACE C C     1 
HETATM 2035 O O     . ACE C 2 1   ? 40.982 8.646   25.040 1.00 27.16 ? 100 ACE C O     1 
HETATM 2036 C CH3   . ACE C 2 1   ? 41.474 6.555   26.093 1.00 27.43 ? 100 ACE C CH3   1 
HETATM 2037 N N     . PTR C 2 2   ? 41.838 6.994   23.774 1.00 28.73 ? 101 PTR C N     1 
HETATM 2038 C CA    . PTR C 2 2   ? 41.782 7.728   22.537 1.00 26.95 ? 101 PTR C CA    1 
HETATM 2039 C C     . PTR C 2 2   ? 40.563 7.299   21.754 1.00 28.13 ? 101 PTR C C     1 
HETATM 2040 O O     . PTR C 2 2   ? 40.051 6.186   21.889 1.00 26.56 ? 101 PTR C O     1 
HETATM 2041 C CB    . PTR C 2 2   ? 43.071 7.460   21.783 1.00 23.41 ? 101 PTR C CB    1 
HETATM 2042 C CG    . PTR C 2 2   ? 44.205 8.076   22.580 1.00 22.84 ? 101 PTR C CG    1 
HETATM 2043 C CD1   . PTR C 2 2   ? 44.824 7.356   23.589 1.00 22.18 ? 101 PTR C CD1   1 
HETATM 2044 C CD2   . PTR C 2 2   ? 44.599 9.354   22.298 1.00 22.46 ? 101 PTR C CD2   1 
HETATM 2045 C CE1   . PTR C 2 2   ? 45.843 7.910   24.322 1.00 19.35 ? 101 PTR C CE1   1 
HETATM 2046 C CE2   . PTR C 2 2   ? 45.619 9.911   23.024 1.00 19.45 ? 101 PTR C CE2   1 
HETATM 2047 C CZ    . PTR C 2 2   ? 46.237 9.189   24.026 1.00 24.05 ? 101 PTR C CZ    1 
HETATM 2048 O OH    . PTR C 2 2   ? 47.362 9.749   24.699 1.00 21.98 ? 101 PTR C OH    1 
HETATM 2049 P P     . PTR C 2 2   ? 47.344 10.205  26.184 1.00 25.49 ? 101 PTR C P     1 
HETATM 2050 O O1P   . PTR C 2 2   ? 47.482 8.958   26.940 1.00 33.12 ? 101 PTR C O1P   1 
HETATM 2051 O O2P   . PTR C 2 2   ? 48.525 11.085  26.301 1.00 24.55 ? 101 PTR C O2P   1 
HETATM 2052 O O3P   . PTR C 2 2   ? 46.024 10.893  26.339 1.00 29.48 ? 101 PTR C O3P   1 
HETATM 2053 H H     . PTR C 2 2   ? 42.239 6.100   23.774 1.00 0.00  ? 101 PTR C H     1 
ATOM   2054 N N     . GLU C 2 3   ? 40.061 8.254   21.011 1.00 28.52 ? 102 GLU C N     1 
ATOM   2055 C CA    . GLU C 2 3   ? 38.928 8.069   20.164 1.00 29.75 ? 102 GLU C CA    1 
ATOM   2056 C C     . GLU C 2 3   ? 39.304 7.214   18.960 1.00 33.27 ? 102 GLU C C     1 
ATOM   2057 O O     . GLU C 2 3   ? 40.441 7.388   18.486 1.00 34.91 ? 102 GLU C O     1 
ATOM   2058 C CB    . GLU C 2 3   ? 38.457 9.416   19.703 1.00 31.81 ? 102 GLU C CB    1 
ATOM   2059 C CG    . GLU C 2 3   ? 37.902 10.266  20.813 1.00 34.25 ? 102 GLU C CG    1 
ATOM   2060 C CD    . GLU C 2 3   ? 36.752 9.617   21.534 1.00 33.86 ? 102 GLU C CD    1 
ATOM   2061 O OE1   . GLU C 2 3   ? 35.752 9.299   20.909 1.00 38.89 ? 102 GLU C OE1   1 
ATOM   2062 O OE2   . GLU C 2 3   ? 36.863 9.432   22.730 1.00 39.68 ? 102 GLU C OE2   1 
ATOM   2063 H H     . GLU C 2 3   ? 40.484 9.137   21.038 1.00 0.00  ? 102 GLU C H     1 
HETATM 2064 N N1    . DIY C 2 4   ? 38.424 6.332   18.370 1.00 34.20 ? 103 DIY C N1    1 
HETATM 2065 C C2    . DIY C 2 4   ? 37.066 6.061   18.880 1.00 31.05 ? 103 DIY C C2    1 
HETATM 2066 C C6    . DIY C 2 4   ? 38.670 5.769   17.047 1.00 32.78 ? 103 DIY C C6    1 
HETATM 2067 C C3    . DIY C 2 4   ? 36.118 6.859   17.957 1.00 29.21 ? 103 DIY C C3    1 
HETATM 2068 C C4    . DIY C 2 4   ? 36.360 6.554   16.470 1.00 30.25 ? 103 DIY C C4    1 
HETATM 2069 C C5    . DIY C 2 4   ? 37.823 6.549   16.019 1.00 31.55 ? 103 DIY C C5    1 
HETATM 2070 C "C1'" . DIY C 2 4   ? 38.443 7.921   15.722 1.00 37.62 ? 103 DIY C "C1'" 1 
HETATM 2071 C "C2'" . DIY C 2 4   ? 37.956 8.718   14.527 1.00 37.33 ? 103 DIY C "C2'" 1 
HETATM 2072 C "C3'" . DIY C 2 4   ? 38.983 9.781   14.331 1.00 33.27 ? 103 DIY C "C3'" 1 
HETATM 2073 C "C4'" . DIY C 2 4   ? 38.337 10.644  13.283 1.00 37.33 ? 103 DIY C "C4'" 1 
HETATM 2074 C C     . ACE D 2 1   ? 43.293 -8.128  37.550 1.00 43.21 ? 100 ACE D C     1 
HETATM 2075 O O     . ACE D 2 1   ? 44.067 -7.186  37.788 1.00 43.77 ? 100 ACE D O     1 
HETATM 2076 C CH3   . ACE D 2 1   ? 43.519 -9.010  36.332 1.00 43.64 ? 100 ACE D CH3   1 
HETATM 2077 N N     . PTR D 2 2   ? 42.169 -8.311  38.208 1.00 39.22 ? 101 PTR D N     1 
HETATM 2078 C CA    . PTR D 2 2   ? 41.875 -7.504  39.354 1.00 36.12 ? 101 PTR D CA    1 
HETATM 2079 C C     . PTR D 2 2   ? 42.397 -8.189  40.590 1.00 37.80 ? 101 PTR D C     1 
HETATM 2080 O O     . PTR D 2 2   ? 42.867 -9.329  40.591 1.00 45.10 ? 101 PTR D O     1 
HETATM 2081 C CB    . PTR D 2 2   ? 40.391 -7.291  39.374 1.00 27.97 ? 101 PTR D CB    1 
HETATM 2082 C CG    . PTR D 2 2   ? 40.020 -6.467  38.165 1.00 31.86 ? 101 PTR D CG    1 
HETATM 2083 C CD1   . PTR D 2 2   ? 39.433 -7.066  37.071 1.00 34.28 ? 101 PTR D CD1   1 
HETATM 2084 C CD2   . PTR D 2 2   ? 40.203 -5.089  38.163 1.00 37.49 ? 101 PTR D CD2   1 
HETATM 2085 C CE1   . PTR D 2 2   ? 39.023 -6.299  35.991 1.00 37.86 ? 101 PTR D CE1   1 
HETATM 2086 C CE2   . PTR D 2 2   ? 39.795 -4.303  37.080 1.00 34.38 ? 101 PTR D CE2   1 
HETATM 2087 C CZ    . PTR D 2 2   ? 39.197 -4.913  35.992 1.00 38.82 ? 101 PTR D CZ    1 
HETATM 2088 O OH    . PTR D 2 2   ? 38.714 -4.103  34.899 1.00 41.51 ? 101 PTR D OH    1 
HETATM 2089 P P     . PTR D 2 2   ? 39.563 -3.959  33.541 1.00 47.87 ? 101 PTR D P     1 
HETATM 2090 O O1P   . PTR D 2 2   ? 39.296 -5.223  32.855 1.00 52.07 ? 101 PTR D O1P   1 
HETATM 2091 O O2P   . PTR D 2 2   ? 38.986 -2.729  32.920 1.00 47.47 ? 101 PTR D O2P   1 
HETATM 2092 O O3P   . PTR D 2 2   ? 40.975 -3.833  34.058 1.00 42.25 ? 101 PTR D O3P   1 
HETATM 2093 H H     . PTR D 2 2   ? 41.534 -8.998  37.915 1.00 0.00  ? 101 PTR D H     1 
ATOM   2094 N N     . GLU D 2 3   ? 42.346 -7.452  41.662 1.00 35.79 ? 102 GLU D N     1 
ATOM   2095 C CA    . GLU D 2 3   ? 42.821 -7.926  42.925 1.00 34.63 ? 102 GLU D CA    1 
ATOM   2096 C C     . GLU D 2 3   ? 41.649 -8.473  43.728 1.00 35.54 ? 102 GLU D C     1 
ATOM   2097 O O     . GLU D 2 3   ? 40.525 -7.995  43.504 1.00 34.74 ? 102 GLU D O     1 
ATOM   2098 C CB    . GLU D 2 3   ? 43.463 -6.759  43.607 1.00 36.94 ? 102 GLU D CB    1 
ATOM   2099 C CG    . GLU D 2 3   ? 44.713 -6.254  42.920 1.00 44.78 ? 102 GLU D CG    1 
ATOM   2100 C CD    . GLU D 2 3   ? 45.850 -7.203  43.155 1.00 44.55 ? 102 GLU D CD    1 
ATOM   2101 O OE1   . GLU D 2 3   ? 46.351 -7.236  44.279 1.00 52.97 ? 102 GLU D OE1   1 
ATOM   2102 O OE2   . GLU D 2 3   ? 46.213 -7.920  42.238 1.00 52.00 ? 102 GLU D OE2   1 
ATOM   2103 H H     . GLU D 2 3   ? 41.972 -6.548  41.602 1.00 0.00  ? 102 GLU D H     1 
HETATM 2104 N N1    . DIY D 2 4   ? 41.771 -9.459  44.656 1.00 33.85 ? 103 DIY D N1    1 
HETATM 2105 C C2    . DIY D 2 4   ? 43.010 -10.208 44.879 1.00 32.36 ? 103 DIY D C2    1 
HETATM 2106 C C6    . DIY D 2 4   ? 40.672 -9.774  45.545 1.00 32.27 ? 103 DIY D C6    1 
HETATM 2107 C C3    . DIY D 2 4   ? 43.503 -9.748  46.237 1.00 29.78 ? 103 DIY D C3    1 
HETATM 2108 C C4    . DIY D 2 4   ? 42.397 -9.944  47.266 1.00 30.92 ? 103 DIY D C4    1 
HETATM 2109 C C5    . DIY D 2 4   ? 41.021 -9.341  46.932 1.00 31.51 ? 103 DIY D C5    1 
HETATM 2110 C "C1'" . DIY D 2 4   ? 40.916 -7.843  47.112 1.00 30.24 ? 103 DIY D "C1'" 1 
HETATM 2111 C "C2'" . DIY D 2 4   ? 41.200 -7.514  48.554 1.00 30.79 ? 103 DIY D "C2'" 1 
HETATM 2112 C "C3'" . DIY D 2 4   ? 41.546 -6.062  48.731 1.00 28.44 ? 103 DIY D "C3'" 1 
HETATM 2113 C "C4'" . DIY D 2 4   ? 40.343 -5.283  48.302 1.00 30.51 ? 103 DIY D "C4'" 1 
HETATM 2114 O O     . HOH E 3 .   ? 43.110 8.210   18.158 1.00 26.33 ? 501 HOH A O     1 
HETATM 2115 H H1    . HOH E 3 .   ? 43.931 7.881   18.524 1.00 0.00  ? 501 HOH A H1    1 
HETATM 2116 H H2    . HOH E 3 .   ? 43.372 8.943   17.601 1.00 0.00  ? 501 HOH A H2    1 
HETATM 2117 O O     . HOH E 3 .   ? 43.939 12.449  9.267  1.00 20.68 ? 502 HOH A O     1 
HETATM 2118 H H1    . HOH E 3 .   ? 44.344 12.211  8.433  1.00 0.00  ? 502 HOH A H1    1 
HETATM 2119 H H2    . HOH E 3 .   ? 44.448 11.975  9.925  1.00 0.00  ? 502 HOH A H2    1 
HETATM 2120 O O     . HOH E 3 .   ? 39.772 12.895  8.755  1.00 32.58 ? 503 HOH A O     1 
HETATM 2121 H H1    . HOH E 3 .   ? 40.416 12.198  8.880  1.00 0.00  ? 503 HOH A H1    1 
HETATM 2122 H H2    . HOH E 3 .   ? 40.169 13.665  9.163  1.00 0.00  ? 503 HOH A H2    1 
HETATM 2123 O O     . HOH E 3 .   ? 36.228 14.808  29.815 1.00 43.87 ? 504 HOH A O     1 
HETATM 2124 H H1    . HOH E 3 .   ? 35.333 14.883  29.485 1.00 0.00  ? 504 HOH A H1    1 
HETATM 2125 H H2    . HOH E 3 .   ? 36.751 14.593  29.043 1.00 0.00  ? 504 HOH A H2    1 
HETATM 2126 O O     . HOH E 3 .   ? 34.691 11.014  18.574 1.00 64.48 ? 508 HOH A O     1 
HETATM 2127 H H1    . HOH E 3 .   ? 34.919 10.390  19.263 1.00 0.00  ? 508 HOH A H1    1 
HETATM 2128 H H2    . HOH E 3 .   ? 35.317 11.730  18.682 1.00 0.00  ? 508 HOH A H2    1 
HETATM 2129 O O     . HOH E 3 .   ? 53.583 8.260   15.804 1.00 32.29 ? 511 HOH A O     1 
HETATM 2130 H H1    . HOH E 3 .   ? 53.644 8.055   14.871 1.00 0.00  ? 511 HOH A H1    1 
HETATM 2131 H H2    . HOH E 3 .   ? 54.241 8.941   15.944 1.00 0.00  ? 511 HOH A H2    1 
HETATM 2132 O O     . HOH E 3 .   ? 58.391 20.336  24.453 1.00 34.50 ? 514 HOH A O     1 
HETATM 2133 H H1    . HOH E 3 .   ? 58.665 21.132  24.908 1.00 0.00  ? 514 HOH A H1    1 
HETATM 2134 H H2    . HOH E 3 .   ? 58.378 19.663  25.133 1.00 0.00  ? 514 HOH A H2    1 
HETATM 2135 O O     . HOH E 3 .   ? 55.868 20.737  27.952 1.00 31.15 ? 515 HOH A O     1 
HETATM 2136 H H1    . HOH E 3 .   ? 56.781 20.790  28.234 1.00 0.00  ? 515 HOH A H1    1 
HETATM 2137 H H2    . HOH E 3 .   ? 55.546 19.920  28.334 1.00 0.00  ? 515 HOH A H2    1 
HETATM 2138 O O     . HOH E 3 .   ? 54.914 20.458  30.869 1.00 74.97 ? 516 HOH A O     1 
HETATM 2139 H H1    . HOH E 3 .   ? 55.293 19.920  31.564 1.00 0.00  ? 516 HOH A H1    1 
HETATM 2140 H H2    . HOH E 3 .   ? 55.163 21.354  31.096 1.00 0.00  ? 516 HOH A H2    1 
HETATM 2141 O O     . HOH E 3 .   ? 53.992 27.639  23.151 1.00 25.50 ? 517 HOH A O     1 
HETATM 2142 H H1    . HOH E 3 .   ? 54.684 27.692  23.810 1.00 0.00  ? 517 HOH A H1    1 
HETATM 2143 H H2    . HOH E 3 .   ? 53.233 28.049  23.566 1.00 0.00  ? 517 HOH A H2    1 
HETATM 2144 O O     . HOH E 3 .   ? 51.830 30.427  17.049 1.00 49.21 ? 518 HOH A O     1 
HETATM 2145 H H1    . HOH E 3 .   ? 51.282 30.314  16.272 1.00 0.00  ? 518 HOH A H1    1 
HETATM 2146 H H2    . HOH E 3 .   ? 51.602 31.296  17.379 1.00 0.00  ? 518 HOH A H2    1 
HETATM 2147 O O     . HOH E 3 .   ? 47.434 29.532  23.319 1.00 52.60 ? 519 HOH A O     1 
HETATM 2148 H H1    . HOH E 3 .   ? 47.583 28.706  22.859 1.00 0.00  ? 519 HOH A H1    1 
HETATM 2149 H H2    . HOH E 3 .   ? 48.190 30.073  23.092 1.00 0.00  ? 519 HOH A H2    1 
HETATM 2150 O O     . HOH E 3 .   ? 52.183 14.653  27.165 1.00 33.44 ? 520 HOH A O     1 
HETATM 2151 H H1    . HOH E 3 .   ? 52.210 15.081  28.021 1.00 0.00  ? 520 HOH A H1    1 
HETATM 2152 H H2    . HOH E 3 .   ? 51.385 14.986  26.756 1.00 0.00  ? 520 HOH A H2    1 
HETATM 2153 O O     . HOH E 3 .   ? 42.156 27.781  30.668 1.00 55.38 ? 524 HOH A O     1 
HETATM 2154 H H1    . HOH E 3 .   ? 42.833 28.285  30.216 1.00 0.00  ? 524 HOH A H1    1 
HETATM 2155 H H2    . HOH E 3 .   ? 42.058 26.986  30.144 1.00 0.00  ? 524 HOH A H2    1 
HETATM 2156 O O     . HOH E 3 .   ? 31.300 21.132  14.264 1.00 37.05 ? 525 HOH A O     1 
HETATM 2157 H H1    . HOH E 3 .   ? 32.150 21.302  14.671 1.00 0.00  ? 525 HOH A H1    1 
HETATM 2158 H H2    . HOH E 3 .   ? 31.019 20.296  14.635 1.00 0.00  ? 525 HOH A H2    1 
HETATM 2159 O O     . HOH E 3 .   ? 33.281 23.168  24.883 1.00 49.77 ? 526 HOH A O     1 
HETATM 2160 H H1    . HOH E 3 .   ? 33.748 23.743  24.277 1.00 0.00  ? 526 HOH A H1    1 
HETATM 2161 H H2    . HOH E 3 .   ? 33.916 22.487  25.106 1.00 0.00  ? 526 HOH A H2    1 
HETATM 2162 O O     . HOH E 3 .   ? 48.197 4.761   23.740 1.00 31.94 ? 527 HOH A O     1 
HETATM 2163 H H1    . HOH E 3 .   ? 48.071 4.212   24.514 1.00 0.00  ? 527 HOH A H1    1 
HETATM 2164 H H2    . HOH E 3 .   ? 49.147 4.826   23.644 1.00 0.00  ? 527 HOH A H2    1 
HETATM 2165 O O     . HOH E 3 .   ? 47.203 4.073   13.321 1.00 21.91 ? 528 HOH A O     1 
HETATM 2166 H H1    . HOH E 3 .   ? 46.535 3.634   13.847 1.00 0.00  ? 528 HOH A H1    1 
HETATM 2167 H H2    . HOH E 3 .   ? 46.792 4.893   13.048 1.00 0.00  ? 528 HOH A H2    1 
HETATM 2168 O O     . HOH E 3 .   ? 51.998 5.012   12.178 1.00 51.24 ? 531 HOH A O     1 
HETATM 2169 H H1    . HOH E 3 .   ? 51.538 5.839   12.031 1.00 0.00  ? 531 HOH A H1    1 
HETATM 2170 H H2    . HOH E 3 .   ? 51.306 4.351   12.184 1.00 0.00  ? 531 HOH A H2    1 
HETATM 2171 O O     . HOH E 3 .   ? 45.524 4.576   20.883 1.00 28.13 ? 535 HOH A O     1 
HETATM 2172 H H1    . HOH E 3 .   ? 45.975 5.000   21.613 1.00 0.00  ? 535 HOH A H1    1 
HETATM 2173 H H2    . HOH E 3 .   ? 45.976 4.897   20.103 1.00 0.00  ? 535 HOH A H2    1 
HETATM 2174 O O     . HOH E 3 .   ? 57.349 18.862  22.619 1.00 38.42 ? 536 HOH A O     1 
HETATM 2175 H H1    . HOH E 3 .   ? 57.597 18.025  23.011 1.00 0.00  ? 536 HOH A H1    1 
HETATM 2176 H H2    . HOH E 3 .   ? 56.520 18.683  22.174 1.00 0.00  ? 536 HOH A H2    1 
HETATM 2177 O O     . HOH E 3 .   ? 54.692 19.837  11.910 1.00 36.01 ? 539 HOH A O     1 
HETATM 2178 H H1    . HOH E 3 .   ? 55.008 19.615  12.786 1.00 0.00  ? 539 HOH A H1    1 
HETATM 2179 H H2    . HOH E 3 .   ? 54.878 19.059  11.384 1.00 0.00  ? 539 HOH A H2    1 
HETATM 2180 O O     . HOH E 3 .   ? 29.029 19.332  19.337 1.00 54.21 ? 540 HOH A O     1 
HETATM 2181 H H1    . HOH E 3 .   ? 29.813 18.786  19.275 1.00 0.00  ? 540 HOH A H1    1 
HETATM 2182 H H2    . HOH E 3 .   ? 28.940 19.519  20.272 1.00 0.00  ? 540 HOH A H2    1 
HETATM 2183 O O     . HOH E 3 .   ? 50.893 11.181  34.201 1.00 47.24 ? 541 HOH A O     1 
HETATM 2184 H H1    . HOH E 3 .   ? 50.330 11.656  33.590 1.00 0.00  ? 541 HOH A H1    1 
HETATM 2185 H H2    . HOH E 3 .   ? 51.512 10.712  33.641 1.00 0.00  ? 541 HOH A H2    1 
HETATM 2186 O O     . HOH E 3 .   ? 48.678 15.437  40.952 1.00 43.32 ? 542 HOH A O     1 
HETATM 2187 H H1    . HOH E 3 .   ? 48.426 15.628  40.048 1.00 0.00  ? 542 HOH A H1    1 
HETATM 2188 H H2    . HOH E 3 .   ? 48.457 14.513  41.073 1.00 0.00  ? 542 HOH A H2    1 
HETATM 2189 O O     . HOH F 3 .   ? 47.197 12.443  32.916 1.00 23.12 ? 500 HOH B O     1 
HETATM 2190 H H1    . HOH F 3 .   ? 48.100 12.526  33.222 1.00 0.00  ? 500 HOH B H1    1 
HETATM 2191 H H2    . HOH F 3 .   ? 46.664 12.636  33.687 1.00 0.00  ? 500 HOH B H2    1 
HETATM 2192 O O     . HOH F 3 .   ? 34.420 -1.246  49.745 1.00 16.40 ? 507 HOH B O     1 
HETATM 2193 H H1    . HOH F 3 .   ? 33.645 -1.501  49.244 1.00 0.00  ? 507 HOH B H1    1 
HETATM 2194 H H2    . HOH F 3 .   ? 35.130 -1.239  49.103 1.00 0.00  ? 507 HOH B H2    1 
HETATM 2195 O O     . HOH F 3 .   ? 45.725 -5.887  47.041 1.00 44.03 ? 510 HOH B O     1 
HETATM 2196 H H1    . HOH F 3 .   ? 45.574 -5.981  47.981 1.00 0.00  ? 510 HOH B H1    1 
HETATM 2197 H H2    . HOH F 3 .   ? 45.878 -6.780  46.732 1.00 0.00  ? 510 HOH B H2    1 
HETATM 2198 O O     . HOH F 3 .   ? 46.019 6.969   28.472 1.00 47.16 ? 512 HOH B O     1 
HETATM 2199 H H1    . HOH F 3 .   ? 46.000 7.653   29.141 1.00 0.00  ? 512 HOH B H1    1 
HETATM 2200 H H2    . HOH F 3 .   ? 46.495 7.362   27.740 1.00 0.00  ? 512 HOH B H2    1 
HETATM 2201 O O     . HOH F 3 .   ? 47.992 17.658  36.958 1.00 46.05 ? 513 HOH B O     1 
HETATM 2202 H H1    . HOH F 3 .   ? 48.143 17.286  37.827 1.00 0.00  ? 513 HOH B H1    1 
HETATM 2203 H H2    . HOH F 3 .   ? 47.829 18.587  37.120 1.00 0.00  ? 513 HOH B H2    1 
HETATM 2204 O O     . HOH F 3 .   ? 36.799 -9.190  38.730 1.00 35.38 ? 521 HOH B O     1 
HETATM 2205 H H1    . HOH F 3 .   ? 36.784 -8.517  39.411 1.00 0.00  ? 521 HOH B H1    1 
HETATM 2206 H H2    . HOH F 3 .   ? 35.895 -9.235  38.417 1.00 0.00  ? 521 HOH B H2    1 
HETATM 2207 O O     . HOH F 3 .   ? 37.938 -2.783  52.276 1.00 31.50 ? 522 HOH B O     1 
HETATM 2208 H H1    . HOH F 3 .   ? 38.368 -1.928  52.307 1.00 0.00  ? 522 HOH B H1    1 
HETATM 2209 H H2    . HOH F 3 .   ? 38.633 -3.409  52.478 1.00 0.00  ? 522 HOH B H2    1 
HETATM 2210 O O     . HOH F 3 .   ? 56.107 6.921   47.748 1.00 57.26 ? 529 HOH B O     1 
HETATM 2211 H H1    . HOH F 3 .   ? 56.970 7.167   47.416 1.00 0.00  ? 529 HOH B H1    1 
HETATM 2212 H H2    . HOH F 3 .   ? 55.526 7.005   46.992 1.00 0.00  ? 529 HOH B H2    1 
HETATM 2213 O O     . HOH F 3 .   ? 54.549 5.580   41.331 1.00 57.21 ? 530 HOH B O     1 
HETATM 2214 H H1    . HOH F 3 .   ? 55.216 6.240   41.142 1.00 0.00  ? 530 HOH B H1    1 
HETATM 2215 H H2    . HOH F 3 .   ? 54.411 5.133   40.496 1.00 0.00  ? 530 HOH B H2    1 
HETATM 2216 O O     . HOH F 3 .   ? 28.894 -3.334  39.061 1.00 38.79 ? 532 HOH B O     1 
HETATM 2217 H H1    . HOH F 3 .   ? 29.568 -3.568  38.423 1.00 0.00  ? 532 HOH B H1    1 
HETATM 2218 H H2    . HOH F 3 .   ? 28.775 -4.126  39.585 1.00 0.00  ? 532 HOH B H2    1 
HETATM 2219 O O     . HOH F 3 .   ? 23.229 4.191   47.545 1.00 43.91 ? 533 HOH B O     1 
HETATM 2220 H H1    . HOH F 3 .   ? 23.929 4.773   47.250 1.00 0.00  ? 533 HOH B H1    1 
HETATM 2221 H H2    . HOH F 3 .   ? 23.240 4.266   48.499 1.00 0.00  ? 533 HOH B H2    1 
HETATM 2222 O O     . HOH F 3 .   ? 27.742 -6.848  42.129 1.00 46.17 ? 534 HOH B O     1 
HETATM 2223 H H1    . HOH F 3 .   ? 28.212 -7.619  42.446 1.00 0.00  ? 534 HOH B H1    1 
HETATM 2224 H H2    . HOH F 3 .   ? 27.202 -7.175  41.409 1.00 0.00  ? 534 HOH B H2    1 
HETATM 2225 O O     . HOH F 3 .   ? 29.018 8.618   42.764 1.00 39.05 ? 537 HOH B O     1 
HETATM 2226 H H1    . HOH F 3 .   ? 29.127 8.845   43.687 1.00 0.00  ? 537 HOH B H1    1 
HETATM 2227 H H2    . HOH F 3 .   ? 28.482 9.325   42.405 1.00 0.00  ? 537 HOH B H2    1 
HETATM 2228 O O     . HOH F 3 .   ? 31.286 10.831  43.339 1.00 31.81 ? 538 HOH B O     1 
HETATM 2229 H H1    . HOH F 3 .   ? 31.312 10.334  42.521 1.00 0.00  ? 538 HOH B H1    1 
HETATM 2230 H H2    . HOH F 3 .   ? 30.758 10.294  43.930 1.00 0.00  ? 538 HOH B H2    1 
HETATM 2231 O O     . HOH F 3 .   ? 36.631 -1.075  54.001 1.00 39.98 ? 543 HOH B O     1 
HETATM 2232 H H1    . HOH F 3 .   ? 37.227 -0.759  54.680 1.00 0.00  ? 543 HOH B H1    1 
HETATM 2233 H H2    . HOH F 3 .   ? 35.923 -0.431  53.984 1.00 0.00  ? 543 HOH B H2    1 
HETATM 2234 O O     . HOH G 3 .   ? 39.125 10.295  24.369 1.00 22.92 ? 509 HOH C O     1 
HETATM 2235 H H1    . HOH G 3 .   ? 39.687 10.877  24.881 1.00 0.00  ? 509 HOH C H1    1 
HETATM 2236 H H2    . HOH G 3 .   ? 38.401 10.852  24.083 1.00 0.00  ? 509 HOH C H2    1 
HETATM 2237 O O     . HOH G 3 .   ? 37.974 5.688   23.820 1.00 54.80 ? 523 HOH C O     1 
HETATM 2238 H H1    . HOH G 3 .   ? 37.581 5.087   24.453 1.00 0.00  ? 523 HOH C H1    1 
HETATM 2239 H H2    . HOH G 3 .   ? 37.419 6.467   23.853 1.00 0.00  ? 523 HOH C H2    1 
HETATM 2240 O O     . HOH H 3 .   ? 38.840 -6.219  42.707 1.00 29.27 ? 505 HOH D O     1 
HETATM 2241 H H1    . HOH H 3 .   ? 39.328 -6.538  43.466 1.00 0.00  ? 505 HOH D H1    1 
HETATM 2242 H H2    . HOH H 3 .   ? 39.099 -6.802  41.993 1.00 0.00  ? 505 HOH D H2    1 
HETATM 2243 O O     . HOH H 3 .   ? 45.673 -5.722  39.277 1.00 39.11 ? 506 HOH D O     1 
HETATM 2244 H H1    . HOH H 3 .   ? 45.259 -6.315  38.650 1.00 0.00  ? 506 HOH D H1    1 
HETATM 2245 H H2    . HOH H 3 .   ? 46.610 -5.799  39.098 1.00 0.00  ? 506 HOH D H2    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   143 ?   ?   ?   A . n 
A 1 2   ASP 2   144 ?   ?   ?   A . n 
A 1 3   SER 3   145 ?   ?   ?   A . n 
A 1 4   ILE 4   146 146 ILE ILE A . n 
A 1 5   GLN 5   147 147 GLN GLN A . n 
A 1 6   ALA 6   148 148 ALA ALA A . n 
A 1 7   GLU 7   149 149 GLU GLU A . n 
A 1 8   GLU 8   150 150 GLU GLU A . n 
A 1 9   TRP 9   151 151 TRP TRP A . n 
A 1 10  TYR 10  152 152 TYR TYR A . n 
A 1 11  PHE 11  153 153 PHE PHE A . n 
A 1 12  GLY 12  154 154 GLY GLY A . n 
A 1 13  LYS 13  155 155 LYS LYS A . n 
A 1 14  ILE 14  156 156 ILE ILE A . n 
A 1 15  THR 15  157 157 THR THR A . n 
A 1 16  ARG 16  158 158 ARG ARG A . n 
A 1 17  ARG 17  159 159 ARG ARG A . n 
A 1 18  GLU 18  160 160 GLU GLU A . n 
A 1 19  SER 19  161 161 SER SER A . n 
A 1 20  GLU 20  162 162 GLU GLU A . n 
A 1 21  ARG 21  163 163 ARG ARG A . n 
A 1 22  LEU 22  164 164 LEU LEU A . n 
A 1 23  LEU 23  165 165 LEU LEU A . n 
A 1 24  LEU 24  166 166 LEU LEU A . n 
A 1 25  ASN 25  167 167 ASN ASN A . n 
A 1 26  ALA 26  168 168 ALA ALA A . n 
A 1 27  GLU 27  169 169 GLU GLU A . n 
A 1 28  ASN 28  170 170 ASN ASN A . n 
A 1 29  PRO 29  171 171 PRO PRO A . n 
A 1 30  ARG 30  172 172 ARG ARG A . n 
A 1 31  GLY 31  173 173 GLY GLY A . n 
A 1 32  THR 32  174 174 THR THR A . n 
A 1 33  PHE 33  175 175 PHE PHE A . n 
A 1 34  LEU 34  176 176 LEU LEU A . n 
A 1 35  VAL 35  177 177 VAL VAL A . n 
A 1 36  ARG 36  178 178 ARG ARG A . n 
A 1 37  GLU 37  179 179 GLU GLU A . n 
A 1 38  SER 38  180 180 SER SER A . n 
A 1 39  GLU 39  181 181 GLU GLU A . n 
A 1 40  THR 40  182 182 THR THR A . n 
A 1 41  THR 41  183 183 THR THR A . n 
A 1 42  LYS 42  184 184 LYS LYS A . n 
A 1 43  GLY 43  185 185 GLY GLY A . n 
A 1 44  ALA 44  186 186 ALA ALA A . n 
A 1 45  TYR 45  187 187 TYR TYR A . n 
A 1 46  CYS 46  188 188 CYS CYS A . n 
A 1 47  LEU 47  189 189 LEU LEU A . n 
A 1 48  SER 48  190 190 SER SER A . n 
A 1 49  VAL 49  191 191 VAL VAL A . n 
A 1 50  SER 50  192 192 SER SER A . n 
A 1 51  ASP 51  193 193 ASP ASP A . n 
A 1 52  PHE 52  194 194 PHE PHE A . n 
A 1 53  ASP 53  195 195 ASP ASP A . n 
A 1 54  ASN 54  196 196 ASN ASN A . n 
A 1 55  ALA 55  197 197 ALA ALA A . n 
A 1 56  LYS 56  198 198 LYS LYS A . n 
A 1 57  GLY 57  199 199 GLY GLY A . n 
A 1 58  LEU 58  200 200 LEU LEU A . n 
A 1 59  ASN 59  201 201 ASN ASN A . n 
A 1 60  VAL 60  202 202 VAL VAL A . n 
A 1 61  LYS 61  203 203 LYS LYS A . n 
A 1 62  HIS 62  204 204 HIS HIS A . n 
A 1 63  TYR 63  205 205 TYR TYR A . n 
A 1 64  LYS 64  206 206 LYS LYS A . n 
A 1 65  ILE 65  207 207 ILE ILE A . n 
A 1 66  ARG 66  208 208 ARG ARG A . n 
A 1 67  LYS 67  209 209 LYS LYS A . n 
A 1 68  LEU 68  210 210 LEU LEU A . n 
A 1 69  ASP 69  211 211 ASP ASP A . n 
A 1 70  SER 70  212 212 SER SER A . n 
A 1 71  GLY 71  213 213 GLY GLY A . n 
A 1 72  GLY 72  214 214 GLY GLY A . n 
A 1 73  PHE 73  215 215 PHE PHE A . n 
A 1 74  TYR 74  216 216 TYR TYR A . n 
A 1 75  ILE 75  217 217 ILE ILE A . n 
A 1 76  THR 76  218 218 THR THR A . n 
A 1 77  SER 77  219 219 SER SER A . n 
A 1 78  ARG 78  220 220 ARG ARG A . n 
A 1 79  THR 79  221 221 THR THR A . n 
A 1 80  GLN 80  222 222 GLN GLN A . n 
A 1 81  PHE 81  223 223 PHE PHE A . n 
A 1 82  ASN 82  224 224 ASN ASN A . n 
A 1 83  SER 83  225 225 SER SER A . n 
A 1 84  LEU 84  226 226 LEU LEU A . n 
A 1 85  GLN 85  227 227 GLN GLN A . n 
A 1 86  GLN 86  228 228 GLN GLN A . n 
A 1 87  LEU 87  229 229 LEU LEU A . n 
A 1 88  VAL 88  230 230 VAL VAL A . n 
A 1 89  ALA 89  231 231 ALA ALA A . n 
A 1 90  TYR 90  232 232 TYR TYR A . n 
A 1 91  TYR 91  233 233 TYR TYR A . n 
A 1 92  SER 92  234 234 SER SER A . n 
A 1 93  LYS 93  235 235 LYS LYS A . n 
A 1 94  HIS 94  236 236 HIS HIS A . n 
A 1 95  ALA 95  237 237 ALA ALA A . n 
A 1 96  ASP 96  238 238 ASP ASP A . n 
A 1 97  GLY 97  239 239 GLY GLY A . n 
A 1 98  LEU 98  240 240 LEU LEU A . n 
A 1 99  CYS 99  241 241 CYS CYS A . n 
A 1 100 HIS 100 242 242 HIS HIS A . n 
A 1 101 ARG 101 243 243 ARG ARG A . n 
A 1 102 LEU 102 244 244 LEU LEU A . n 
A 1 103 THR 103 245 245 THR THR A . n 
A 1 104 THR 104 246 246 THR THR A . n 
A 1 105 VAL 105 247 247 VAL VAL A . n 
A 1 106 CYS 106 248 248 CYS CYS A . n 
A 1 107 PRO 107 249 249 PRO PRO A . n 
B 1 1   MET 1   143 ?   ?   ?   B . n 
B 1 2   ASP 2   144 ?   ?   ?   B . n 
B 1 3   SER 3   145 ?   ?   ?   B . n 
B 1 4   ILE 4   146 146 ILE ILE B . n 
B 1 5   GLN 5   147 147 GLN GLN B . n 
B 1 6   ALA 6   148 148 ALA ALA B . n 
B 1 7   GLU 7   149 149 GLU GLU B . n 
B 1 8   GLU 8   150 150 GLU GLU B . n 
B 1 9   TRP 9   151 151 TRP TRP B . n 
B 1 10  TYR 10  152 152 TYR TYR B . n 
B 1 11  PHE 11  153 153 PHE PHE B . n 
B 1 12  GLY 12  154 154 GLY GLY B . n 
B 1 13  LYS 13  155 155 LYS LYS B . n 
B 1 14  ILE 14  156 156 ILE ILE B . n 
B 1 15  THR 15  157 157 THR THR B . n 
B 1 16  ARG 16  158 158 ARG ARG B . n 
B 1 17  ARG 17  159 159 ARG ARG B . n 
B 1 18  GLU 18  160 160 GLU GLU B . n 
B 1 19  SER 19  161 161 SER SER B . n 
B 1 20  GLU 20  162 162 GLU GLU B . n 
B 1 21  ARG 21  163 163 ARG ARG B . n 
B 1 22  LEU 22  164 164 LEU LEU B . n 
B 1 23  LEU 23  165 165 LEU LEU B . n 
B 1 24  LEU 24  166 166 LEU LEU B . n 
B 1 25  ASN 25  167 167 ASN ASN B . n 
B 1 26  ALA 26  168 168 ALA ALA B . n 
B 1 27  GLU 27  169 169 GLU GLU B . n 
B 1 28  ASN 28  170 170 ASN ASN B . n 
B 1 29  PRO 29  171 171 PRO PRO B . n 
B 1 30  ARG 30  172 172 ARG ARG B . n 
B 1 31  GLY 31  173 173 GLY GLY B . n 
B 1 32  THR 32  174 174 THR THR B . n 
B 1 33  PHE 33  175 175 PHE PHE B . n 
B 1 34  LEU 34  176 176 LEU LEU B . n 
B 1 35  VAL 35  177 177 VAL VAL B . n 
B 1 36  ARG 36  178 178 ARG ARG B . n 
B 1 37  GLU 37  179 179 GLU GLU B . n 
B 1 38  SER 38  180 180 SER SER B . n 
B 1 39  GLU 39  181 181 GLU GLU B . n 
B 1 40  THR 40  182 182 THR THR B . n 
B 1 41  THR 41  183 183 THR THR B . n 
B 1 42  LYS 42  184 184 LYS LYS B . n 
B 1 43  GLY 43  185 185 GLY GLY B . n 
B 1 44  ALA 44  186 186 ALA ALA B . n 
B 1 45  TYR 45  187 187 TYR TYR B . n 
B 1 46  CYS 46  188 188 CYS CYS B . n 
B 1 47  LEU 47  189 189 LEU LEU B . n 
B 1 48  SER 48  190 190 SER SER B . n 
B 1 49  VAL 49  191 191 VAL VAL B . n 
B 1 50  SER 50  192 192 SER SER B . n 
B 1 51  ASP 51  193 193 ASP ASP B . n 
B 1 52  PHE 52  194 194 PHE PHE B . n 
B 1 53  ASP 53  195 195 ASP ASP B . n 
B 1 54  ASN 54  196 196 ASN ASN B . n 
B 1 55  ALA 55  197 197 ALA ALA B . n 
B 1 56  LYS 56  198 198 LYS LYS B . n 
B 1 57  GLY 57  199 199 GLY GLY B . n 
B 1 58  LEU 58  200 200 LEU LEU B . n 
B 1 59  ASN 59  201 201 ASN ASN B . n 
B 1 60  VAL 60  202 202 VAL VAL B . n 
B 1 61  LYS 61  203 203 LYS LYS B . n 
B 1 62  HIS 62  204 204 HIS HIS B . n 
B 1 63  TYR 63  205 205 TYR TYR B . n 
B 1 64  LYS 64  206 206 LYS LYS B . n 
B 1 65  ILE 65  207 207 ILE ILE B . n 
B 1 66  ARG 66  208 208 ARG ARG B . n 
B 1 67  LYS 67  209 209 LYS LYS B . n 
B 1 68  LEU 68  210 210 LEU LEU B . n 
B 1 69  ASP 69  211 211 ASP ASP B . n 
B 1 70  SER 70  212 212 SER SER B . n 
B 1 71  GLY 71  213 213 GLY GLY B . n 
B 1 72  GLY 72  214 214 GLY GLY B . n 
B 1 73  PHE 73  215 215 PHE PHE B . n 
B 1 74  TYR 74  216 216 TYR TYR B . n 
B 1 75  ILE 75  217 217 ILE ILE B . n 
B 1 76  THR 76  218 218 THR THR B . n 
B 1 77  SER 77  219 219 SER SER B . n 
B 1 78  ARG 78  220 220 ARG ARG B . n 
B 1 79  THR 79  221 221 THR THR B . n 
B 1 80  GLN 80  222 222 GLN GLN B . n 
B 1 81  PHE 81  223 223 PHE PHE B . n 
B 1 82  ASN 82  224 224 ASN ASN B . n 
B 1 83  SER 83  225 225 SER SER B . n 
B 1 84  LEU 84  226 226 LEU LEU B . n 
B 1 85  GLN 85  227 227 GLN GLN B . n 
B 1 86  GLN 86  228 228 GLN GLN B . n 
B 1 87  LEU 87  229 229 LEU LEU B . n 
B 1 88  VAL 88  230 230 VAL VAL B . n 
B 1 89  ALA 89  231 231 ALA ALA B . n 
B 1 90  TYR 90  232 232 TYR TYR B . n 
B 1 91  TYR 91  233 233 TYR TYR B . n 
B 1 92  SER 92  234 234 SER SER B . n 
B 1 93  LYS 93  235 235 LYS LYS B . n 
B 1 94  HIS 94  236 236 HIS HIS B . n 
B 1 95  ALA 95  237 237 ALA ALA B . n 
B 1 96  ASP 96  238 238 ASP ASP B . n 
B 1 97  GLY 97  239 239 GLY GLY B . n 
B 1 98  LEU 98  240 240 LEU LEU B . n 
B 1 99  CYS 99  241 241 CYS CYS B . n 
B 1 100 HIS 100 242 242 HIS HIS B . n 
B 1 101 ARG 101 243 243 ARG ARG B . n 
B 1 102 LEU 102 244 244 LEU LEU B . n 
B 1 103 THR 103 245 245 THR THR B . n 
B 1 104 THR 104 246 246 THR THR B . n 
B 1 105 VAL 105 247 247 VAL VAL B . n 
B 1 106 CYS 106 248 248 CYS CYS B . n 
B 1 107 PRO 107 249 249 PRO PRO B . n 
C 2 1   ACE 1   100 100 ACE ACE C . n 
C 2 2   PTR 2   101 101 PTR PTR C . n 
C 2 3   GLU 3   102 102 GLU GLU C . n 
C 2 4   DIY 4   103 103 DIY DIY C . n 
D 2 1   ACE 1   100 100 ACE ACE D . n 
D 2 2   PTR 2   101 101 PTR PTR D . n 
D 2 3   GLU 3   102 102 GLU GLU D . n 
D 2 4   DIY 4   103 103 DIY DIY D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  501 501 HOH HOH A . 
E 3 HOH 2  502 502 HOH HOH A . 
E 3 HOH 3  503 503 HOH HOH A . 
E 3 HOH 4  504 504 HOH HOH A . 
E 3 HOH 5  508 508 HOH HOH A . 
E 3 HOH 6  511 511 HOH HOH A . 
E 3 HOH 7  514 514 HOH HOH A . 
E 3 HOH 8  515 515 HOH HOH A . 
E 3 HOH 9  516 516 HOH HOH A . 
E 3 HOH 10 517 517 HOH HOH A . 
E 3 HOH 11 518 518 HOH HOH A . 
E 3 HOH 12 519 519 HOH HOH A . 
E 3 HOH 13 520 520 HOH HOH A . 
E 3 HOH 14 524 524 HOH HOH A . 
E 3 HOH 15 525 525 HOH HOH A . 
E 3 HOH 16 526 526 HOH HOH A . 
E 3 HOH 17 527 527 HOH HOH A . 
E 3 HOH 18 528 528 HOH HOH A . 
E 3 HOH 19 531 531 HOH HOH A . 
E 3 HOH 20 535 535 HOH HOH A . 
E 3 HOH 21 536 536 HOH HOH A . 
E 3 HOH 22 539 539 HOH HOH A . 
E 3 HOH 23 540 540 HOH HOH A . 
E 3 HOH 24 541 541 HOH HOH A . 
E 3 HOH 25 542 542 HOH HOH A . 
F 3 HOH 1  500 500 HOH HOH B . 
F 3 HOH 2  507 507 HOH HOH B . 
F 3 HOH 3  510 510 HOH HOH B . 
F 3 HOH 4  512 512 HOH HOH B . 
F 3 HOH 5  513 513 HOH HOH B . 
F 3 HOH 6  521 521 HOH HOH B . 
F 3 HOH 7  522 522 HOH HOH B . 
F 3 HOH 8  529 529 HOH HOH B . 
F 3 HOH 9  530 530 HOH HOH B . 
F 3 HOH 10 532 532 HOH HOH B . 
F 3 HOH 11 533 533 HOH HOH B . 
F 3 HOH 12 534 534 HOH HOH B . 
F 3 HOH 13 537 537 HOH HOH B . 
F 3 HOH 14 538 538 HOH HOH B . 
F 3 HOH 15 543 543 HOH HOH B . 
G 3 HOH 1  509 509 HOH HOH C . 
G 3 HOH 2  523 523 HOH HOH C . 
H 3 HOH 1  505 505 HOH HOH D . 
H 3 HOH 2  506 506 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 C PTR 2 C PTR 101 ? TYR O-PHOSPHOTYROSINE 
2 D PTR 2 D PTR 101 ? TYR O-PHOSPHOTYROSINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-04-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
5 4 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source        
2 4 'Structure model' pdbx_database_status 
3 4 'Structure model' software             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.source'              
2 4 'Structure model' '_pdbx_database_status.process_site' 
3 4 'Structure model' '_software.name'                     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
bioteX 'data reduction' . ? 3 
bioteX 'data scaling'   . ? 4 
X-PLOR phasing          . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 H    A ILE 217 ? ? H2  A HOH 502 ? ? 0.91 
2 1 HG1  B THR 245 ? ? H   B THR 246 ? ? 1.09 
3 1 HZ3  B LYS 206 ? ? H2  B HOH 521 ? ? 1.15 
4 1 HG   B SER 190 ? ? HD1 B HIS 204 ? ? 1.24 
5 1 HH12 A ARG 159 ? ? H1  A HOH 542 ? ? 1.26 
6 1 H    B ARG 172 ? ? H2  B HOH 529 ? ? 1.32 
7 1 HZ2  A LYS 206 ? ? O   A HOH 527 ? ? 1.55 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 A HIS 204 ? ? CD2 A HIS 204 ? ? 1.294 1.373 -0.079 0.011 N 
2 1 NE2 A HIS 242 ? ? CD2 A HIS 242 ? ? 1.303 1.373 -0.070 0.011 N 
3 1 NE2 B HIS 204 ? ? CD2 B HIS 204 ? ? 1.298 1.373 -0.075 0.011 N 
4 1 NE2 B HIS 236 ? ? CD2 B HIS 236 ? ? 1.306 1.373 -0.067 0.011 N 
5 1 NE2 B HIS 242 ? ? CD2 B HIS 242 ? ? 1.305 1.373 -0.068 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD1 A TRP 151 ? ? CG  A TRP 151 ? ? CD2 A TRP 151 ? ? 113.95 106.30 7.65   0.80 N 
2  1 CB  A TRP 151 ? ? CG  A TRP 151 ? ? CD1 A TRP 151 ? ? 115.51 127.00 -11.49 1.30 N 
3  1 CG  A TRP 151 ? ? CD1 A TRP 151 ? ? NE1 A TRP 151 ? ? 103.83 110.10 -6.27  1.00 N 
4  1 CE2 A TRP 151 ? ? CD2 A TRP 151 ? ? CG  A TRP 151 ? ? 100.93 107.30 -6.37  0.80 N 
5  1 CG  A TRP 151 ? ? CD2 A TRP 151 ? ? CE3 A TRP 151 ? ? 141.10 133.90 7.20   0.90 N 
6  1 CG  A ARG 158 ? ? CD  A ARG 158 ? ? NE  A ARG 158 ? ? 99.10  111.80 -12.70 2.10 N 
7  1 NE  A ARG 158 ? ? CZ  A ARG 158 ? ? NH2 A ARG 158 ? ? 114.80 120.30 -5.50  0.50 N 
8  1 NE  A ARG 159 ? ? CZ  A ARG 159 ? ? NH2 A ARG 159 ? ? 115.34 120.30 -4.96  0.50 N 
9  1 C   A ASN 170 ? ? N   A PRO 171 ? ? CA  A PRO 171 ? ? 129.40 119.30 10.10  1.50 Y 
10 1 NE  A ARG 178 ? ? CZ  A ARG 178 ? ? NH2 A ARG 178 ? ? 117.25 120.30 -3.05  0.50 N 
11 1 CA  A ARG 220 ? ? CB  A ARG 220 ? ? CG  A ARG 220 ? ? 99.13  113.40 -14.27 2.20 N 
12 1 NE  A ARG 220 ? ? CZ  A ARG 220 ? ? NH2 A ARG 220 ? ? 117.29 120.30 -3.01  0.50 N 
13 1 CD1 B TRP 151 ? ? CG  B TRP 151 ? ? CD2 B TRP 151 ? ? 112.49 106.30 6.19   0.80 N 
14 1 CB  B TRP 151 ? ? CG  B TRP 151 ? ? CD1 B TRP 151 ? ? 118.24 127.00 -8.76  1.30 N 
15 1 CE2 B TRP 151 ? ? CD2 B TRP 151 ? ? CG  B TRP 151 ? ? 100.99 107.30 -6.31  0.80 N 
16 1 CG  B TRP 151 ? ? CD2 B TRP 151 ? ? CE3 B TRP 151 ? ? 139.90 133.90 6.00   0.90 N 
17 1 NE  B ARG 158 ? ? CZ  B ARG 158 ? ? NH2 B ARG 158 ? ? 116.05 120.30 -4.25  0.50 N 
18 1 NE  B ARG 178 ? ? CZ  B ARG 178 ? ? NH2 B ARG 178 ? ? 117.04 120.30 -3.26  0.50 N 
19 1 NE  B ARG 220 ? ? CZ  B ARG 220 ? ? NH2 B ARG 220 ? ? 116.23 120.30 -4.07  0.50 N 
20 1 CA  B GLN 222 ? ? CB  B GLN 222 ? ? CG  B GLN 222 ? ? 127.16 113.40 13.76  2.20 N 
21 1 NE  B ARG 243 ? ? CZ  B ARG 243 ? ? NH2 B ARG 243 ? ? 116.92 120.30 -3.38  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 197 ? ? -91.04  -65.53 
2 1 ASN B 196 ? ? -39.18  -36.97 
3 1 ASP B 238 ? ? 34.92   45.74  
4 1 THR B 245 ? ? -108.54 -88.61 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 184 ? CG  ? A LYS 42 CG  
2  1 Y 1 A LYS 184 ? CD  ? A LYS 42 CD  
3  1 Y 1 A LYS 184 ? CE  ? A LYS 42 CE  
4  1 Y 1 A LYS 184 ? NZ  ? A LYS 42 NZ  
5  1 Y 1 A ASN 196 ? CG  ? A ASN 54 CG  
6  1 Y 1 A ASN 196 ? OD1 ? A ASN 54 OD1 
7  1 Y 1 A ASN 196 ? ND2 ? A ASN 54 ND2 
8  1 Y 1 A LYS 198 ? CG  ? A LYS 56 CG  
9  1 Y 1 A LYS 198 ? CD  ? A LYS 56 CD  
10 1 Y 1 A LYS 198 ? CE  ? A LYS 56 CE  
11 1 Y 1 A LYS 198 ? NZ  ? A LYS 56 NZ  
12 1 Y 1 A ASP 211 ? CG  ? A ASP 69 CG  
13 1 Y 1 A ASP 211 ? OD1 ? A ASP 69 OD1 
14 1 Y 1 A ASP 211 ? OD2 ? A ASP 69 OD2 
15 1 Y 1 B GLN 147 ? CG  ? B GLN 5  CG  
16 1 Y 1 B GLN 147 ? CD  ? B GLN 5  CD  
17 1 Y 1 B GLN 147 ? OE1 ? B GLN 5  OE1 
18 1 Y 1 B GLN 147 ? NE2 ? B GLN 5  NE2 
19 1 Y 1 B LYS 155 ? CG  ? B LYS 13 CG  
20 1 Y 1 B LYS 155 ? CD  ? B LYS 13 CD  
21 1 Y 1 B LYS 155 ? CE  ? B LYS 13 CE  
22 1 Y 1 B LYS 155 ? NZ  ? B LYS 13 NZ  
23 1 Y 1 B GLU 169 ? CG  ? B GLU 27 CG  
24 1 Y 1 B GLU 169 ? CD  ? B GLU 27 CD  
25 1 Y 1 B GLU 169 ? OE1 ? B GLU 27 OE1 
26 1 Y 1 B GLU 169 ? OE2 ? B GLU 27 OE2 
27 1 Y 1 B LYS 184 ? CG  ? B LYS 42 CG  
28 1 Y 1 B LYS 184 ? CD  ? B LYS 42 CD  
29 1 Y 1 B LYS 184 ? CE  ? B LYS 42 CE  
30 1 Y 1 B LYS 184 ? NZ  ? B LYS 42 NZ  
31 1 Y 1 B ASP 195 ? CG  ? B ASP 53 CG  
32 1 Y 1 B ASP 195 ? OD1 ? B ASP 53 OD1 
33 1 Y 1 B ASP 195 ? OD2 ? B ASP 53 OD2 
34 1 Y 1 B ASN 196 ? CG  ? B ASN 54 CG  
35 1 Y 1 B ASN 196 ? OD1 ? B ASN 54 OD1 
36 1 Y 1 B ASN 196 ? ND2 ? B ASN 54 ND2 
37 1 Y 1 B LYS 198 ? CG  ? B LYS 56 CG  
38 1 Y 1 B LYS 198 ? CD  ? B LYS 56 CD  
39 1 Y 1 B LYS 198 ? CE  ? B LYS 56 CE  
40 1 Y 1 B LYS 198 ? NZ  ? B LYS 56 NZ  
41 1 Y 1 B ASP 211 ? CG  ? B ASP 69 CG  
42 1 Y 1 B ASP 211 ? OD1 ? B ASP 69 OD1 
43 1 Y 1 B ASP 211 ? OD2 ? B ASP 69 OD2 
44 1 Y 1 B LYS 235 ? CG  ? B LYS 93 CG  
45 1 Y 1 B LYS 235 ? CD  ? B LYS 93 CD  
46 1 Y 1 B LYS 235 ? CE  ? B LYS 93 CE  
47 1 Y 1 B LYS 235 ? NZ  ? B LYS 93 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 143 ? A MET 1 
2 1 Y 1 A ASP 144 ? A ASP 2 
3 1 Y 1 A SER 145 ? A SER 3 
4 1 Y 1 B MET 143 ? B MET 1 
5 1 Y 1 B ASP 144 ? B ASP 2 
6 1 Y 1 B SER 145 ? B SER 3 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#