data_1A31
# 
_entry.id   1A31 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A31         
RCSB  PDE0142      
WWPDB D_1000170329 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A31 
_pdbx_database_status.recvd_initial_deposition_date   1998-01-27 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Redinbo, M.R.'  1 
'Stewart, L.'    2 
'Kuhn, P.'       3 
'Champoux, J.J.' 4 
'Hol, W.G.J.'    5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of human topoisomerase I in covalent and noncovalent complexes with DNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            279 
_citation.page_first                1504 
_citation.page_last                 1513 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9488644 
_citation.pdbx_database_id_DOI      10.1126/science.279.5356.1504 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Redinbo, M.R.'  1 
primary 'Stewart, L.'    2 
primary 'Kuhn, P.'       3 
primary 'Champoux, J.J.' 4 
primary 'Hol, W.G.'      5 
# 
_cell.entry_id           1A31 
_cell.length_a           72.000 
_cell.length_b           66.600 
_cell.length_c           71.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1A31 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*5IUP*5IU*TP*GP*AP*AP*AP*AP*AP*5IUP*5IUP*5IUP*5IUP*T)-3')
;
7452.674  1   ?        ? ?                                   ? 
2 polymer syn 
;DNA (5'-D(*AP*AP*AP*AP*AP*TP*5IUP*5IUP*5IUP*5IUP*CP*AP*AP*AP*GP*TP*CP*TP*TP*TP*TP*T)-3')
;
7161.867  1   ?        ? ?                                   ? 
3 polymer man 'PROTEIN (TOPOISOMERASE I)'                                                                   70118.844 1   5.99.1.2 
? 'CORE DOMAIN AND C-TERMINAL DOMAIN' ? 
4 water   nat water                                                                                         18.015    409 ?        
? ?                                   ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DA)(DA)(DA)(DA)(DA)(DG)(DA)(DC)(5IU)(5IU)(DT)(DG)(DA)(DA)(DA)(DA)(DA)(5IU)(5IU)
(5IU)(5IU)(DT)
;
AAAAAGACUUTGAAAAAUUUUT C ? 
2 polydeoxyribonucleotide no yes 
;(DA)(DA)(DA)(DA)(DA)(DT)(5IU)(5IU)(5IU)(5IU)(DC)(DA)(DA)(DA)(DG)(DT)(DC)(DT)(DT)
(DT)(DT)(DT)
;
AAAAATUUUUCAAAGTCTTTTT D ? 
3 'polypeptide(L)'        no yes 
;KPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAE
EVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKL
LKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLV
SWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILN
KHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAK
KEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLN(PTR)LDPRITV
AWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
;KPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAE
EVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKL
LKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLV
SWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILN
KHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAK
KEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCK
KWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DC  n 
1 9   5IU n 
1 10  5IU n 
1 11  DT  n 
1 12  DG  n 
1 13  DA  n 
1 14  DA  n 
1 15  DA  n 
1 16  DA  n 
1 17  DA  n 
1 18  5IU n 
1 19  5IU n 
1 20  5IU n 
1 21  5IU n 
1 22  DT  n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   5IU n 
2 8   5IU n 
2 9   5IU n 
2 10  5IU n 
2 11  DC  n 
2 12  DA  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DC  n 
2 18  DT  n 
2 19  DT  n 
2 20  DT  n 
2 21  DT  n 
2 22  DT  n 
3 1   LYS n 
3 2   PRO n 
3 3   LYS n 
3 4   ASN n 
3 5   LYS n 
3 6   ASP n 
3 7   LYS n 
3 8   ASP n 
3 9   LYS n 
3 10  LYS n 
3 11  VAL n 
3 12  PRO n 
3 13  GLU n 
3 14  PRO n 
3 15  ASP n 
3 16  ASN n 
3 17  LYS n 
3 18  LYS n 
3 19  LYS n 
3 20  LYS n 
3 21  PRO n 
3 22  LYS n 
3 23  LYS n 
3 24  GLU n 
3 25  GLU n 
3 26  GLU n 
3 27  GLN n 
3 28  LYS n 
3 29  TRP n 
3 30  LYS n 
3 31  TRP n 
3 32  TRP n 
3 33  GLU n 
3 34  GLU n 
3 35  GLU n 
3 36  ARG n 
3 37  TYR n 
3 38  PRO n 
3 39  GLU n 
3 40  GLY n 
3 41  ILE n 
3 42  LYS n 
3 43  TRP n 
3 44  LYS n 
3 45  PHE n 
3 46  LEU n 
3 47  GLU n 
3 48  HIS n 
3 49  LYS n 
3 50  GLY n 
3 51  PRO n 
3 52  VAL n 
3 53  PHE n 
3 54  ALA n 
3 55  PRO n 
3 56  PRO n 
3 57  TYR n 
3 58  GLU n 
3 59  PRO n 
3 60  LEU n 
3 61  PRO n 
3 62  GLU n 
3 63  ASN n 
3 64  VAL n 
3 65  LYS n 
3 66  PHE n 
3 67  TYR n 
3 68  TYR n 
3 69  ASP n 
3 70  GLY n 
3 71  LYS n 
3 72  VAL n 
3 73  MET n 
3 74  LYS n 
3 75  LEU n 
3 76  SER n 
3 77  PRO n 
3 78  LYS n 
3 79  ALA n 
3 80  GLU n 
3 81  GLU n 
3 82  VAL n 
3 83  ALA n 
3 84  THR n 
3 85  PHE n 
3 86  PHE n 
3 87  ALA n 
3 88  LYS n 
3 89  MET n 
3 90  LEU n 
3 91  ASP n 
3 92  HIS n 
3 93  GLU n 
3 94  TYR n 
3 95  THR n 
3 96  THR n 
3 97  LYS n 
3 98  GLU n 
3 99  ILE n 
3 100 PHE n 
3 101 ARG n 
3 102 LYS n 
3 103 ASN n 
3 104 PHE n 
3 105 PHE n 
3 106 LYS n 
3 107 ASP n 
3 108 TRP n 
3 109 ARG n 
3 110 LYS n 
3 111 GLU n 
3 112 MET n 
3 113 THR n 
3 114 ASN n 
3 115 GLU n 
3 116 GLU n 
3 117 LYS n 
3 118 ASN n 
3 119 ILE n 
3 120 ILE n 
3 121 THR n 
3 122 ASN n 
3 123 LEU n 
3 124 SER n 
3 125 LYS n 
3 126 CYS n 
3 127 ASP n 
3 128 PHE n 
3 129 THR n 
3 130 GLN n 
3 131 MET n 
3 132 SER n 
3 133 GLN n 
3 134 TYR n 
3 135 PHE n 
3 136 LYS n 
3 137 ALA n 
3 138 GLN n 
3 139 THR n 
3 140 GLU n 
3 141 ALA n 
3 142 ARG n 
3 143 LYS n 
3 144 GLN n 
3 145 MET n 
3 146 SER n 
3 147 LYS n 
3 148 GLU n 
3 149 GLU n 
3 150 LYS n 
3 151 LEU n 
3 152 LYS n 
3 153 ILE n 
3 154 LYS n 
3 155 GLU n 
3 156 GLU n 
3 157 ASN n 
3 158 GLU n 
3 159 LYS n 
3 160 LEU n 
3 161 LEU n 
3 162 LYS n 
3 163 GLU n 
3 164 TYR n 
3 165 GLY n 
3 166 PHE n 
3 167 CYS n 
3 168 ILE n 
3 169 MET n 
3 170 ASP n 
3 171 ASN n 
3 172 HIS n 
3 173 LYS n 
3 174 GLU n 
3 175 ARG n 
3 176 ILE n 
3 177 ALA n 
3 178 ASN n 
3 179 PHE n 
3 180 LYS n 
3 181 ILE n 
3 182 GLU n 
3 183 PRO n 
3 184 PRO n 
3 185 GLY n 
3 186 LEU n 
3 187 PHE n 
3 188 ARG n 
3 189 GLY n 
3 190 ARG n 
3 191 GLY n 
3 192 ASN n 
3 193 HIS n 
3 194 PRO n 
3 195 LYS n 
3 196 MET n 
3 197 GLY n 
3 198 MET n 
3 199 LEU n 
3 200 LYS n 
3 201 ARG n 
3 202 ARG n 
3 203 ILE n 
3 204 MET n 
3 205 PRO n 
3 206 GLU n 
3 207 ASP n 
3 208 ILE n 
3 209 ILE n 
3 210 ILE n 
3 211 ASN n 
3 212 CYS n 
3 213 SER n 
3 214 LYS n 
3 215 ASP n 
3 216 ALA n 
3 217 LYS n 
3 218 VAL n 
3 219 PRO n 
3 220 SER n 
3 221 PRO n 
3 222 PRO n 
3 223 PRO n 
3 224 GLY n 
3 225 HIS n 
3 226 LYS n 
3 227 TRP n 
3 228 LYS n 
3 229 GLU n 
3 230 VAL n 
3 231 ARG n 
3 232 HIS n 
3 233 ASP n 
3 234 ASN n 
3 235 LYS n 
3 236 VAL n 
3 237 THR n 
3 238 TRP n 
3 239 LEU n 
3 240 VAL n 
3 241 SER n 
3 242 TRP n 
3 243 THR n 
3 244 GLU n 
3 245 ASN n 
3 246 ILE n 
3 247 GLN n 
3 248 GLY n 
3 249 SER n 
3 250 ILE n 
3 251 LYS n 
3 252 TYR n 
3 253 ILE n 
3 254 MET n 
3 255 LEU n 
3 256 ASN n 
3 257 PRO n 
3 258 SER n 
3 259 SER n 
3 260 ARG n 
3 261 ILE n 
3 262 LYS n 
3 263 GLY n 
3 264 GLU n 
3 265 LYS n 
3 266 ASP n 
3 267 TRP n 
3 268 GLN n 
3 269 LYS n 
3 270 TYR n 
3 271 GLU n 
3 272 THR n 
3 273 ALA n 
3 274 ARG n 
3 275 ARG n 
3 276 LEU n 
3 277 LYS n 
3 278 LYS n 
3 279 CYS n 
3 280 VAL n 
3 281 ASP n 
3 282 LYS n 
3 283 ILE n 
3 284 ARG n 
3 285 ASN n 
3 286 GLN n 
3 287 TYR n 
3 288 ARG n 
3 289 GLU n 
3 290 ASP n 
3 291 TRP n 
3 292 LYS n 
3 293 SER n 
3 294 LYS n 
3 295 GLU n 
3 296 MET n 
3 297 LYS n 
3 298 VAL n 
3 299 ARG n 
3 300 GLN n 
3 301 ARG n 
3 302 ALA n 
3 303 VAL n 
3 304 ALA n 
3 305 LEU n 
3 306 TYR n 
3 307 PHE n 
3 308 ILE n 
3 309 ASP n 
3 310 LYS n 
3 311 LEU n 
3 312 ALA n 
3 313 LEU n 
3 314 ARG n 
3 315 ALA n 
3 316 GLY n 
3 317 ASN n 
3 318 GLU n 
3 319 LYS n 
3 320 GLU n 
3 321 GLU n 
3 322 GLY n 
3 323 GLU n 
3 324 THR n 
3 325 ALA n 
3 326 ASP n 
3 327 THR n 
3 328 VAL n 
3 329 GLY n 
3 330 CYS n 
3 331 CYS n 
3 332 SER n 
3 333 LEU n 
3 334 ARG n 
3 335 VAL n 
3 336 GLU n 
3 337 HIS n 
3 338 ILE n 
3 339 ASN n 
3 340 LEU n 
3 341 HIS n 
3 342 PRO n 
3 343 GLU n 
3 344 LEU n 
3 345 ASP n 
3 346 GLY n 
3 347 GLN n 
3 348 GLU n 
3 349 TYR n 
3 350 VAL n 
3 351 VAL n 
3 352 GLU n 
3 353 PHE n 
3 354 ASP n 
3 355 PHE n 
3 356 LEU n 
3 357 GLY n 
3 358 LYS n 
3 359 ASP n 
3 360 SER n 
3 361 ILE n 
3 362 ARG n 
3 363 TYR n 
3 364 TYR n 
3 365 ASN n 
3 366 LYS n 
3 367 VAL n 
3 368 PRO n 
3 369 VAL n 
3 370 GLU n 
3 371 LYS n 
3 372 ARG n 
3 373 VAL n 
3 374 PHE n 
3 375 LYS n 
3 376 ASN n 
3 377 LEU n 
3 378 GLN n 
3 379 LEU n 
3 380 PHE n 
3 381 MET n 
3 382 GLU n 
3 383 ASN n 
3 384 LYS n 
3 385 GLN n 
3 386 PRO n 
3 387 GLU n 
3 388 ASP n 
3 389 ASP n 
3 390 LEU n 
3 391 PHE n 
3 392 ASP n 
3 393 ARG n 
3 394 LEU n 
3 395 ASN n 
3 396 THR n 
3 397 GLY n 
3 398 ILE n 
3 399 LEU n 
3 400 ASN n 
3 401 LYS n 
3 402 HIS n 
3 403 LEU n 
3 404 GLN n 
3 405 ASP n 
3 406 LEU n 
3 407 MET n 
3 408 GLU n 
3 409 GLY n 
3 410 LEU n 
3 411 THR n 
3 412 ALA n 
3 413 LYS n 
3 414 VAL n 
3 415 PHE n 
3 416 ARG n 
3 417 THR n 
3 418 TYR n 
3 419 ASN n 
3 420 ALA n 
3 421 SER n 
3 422 ILE n 
3 423 THR n 
3 424 LEU n 
3 425 GLN n 
3 426 GLN n 
3 427 GLN n 
3 428 LEU n 
3 429 LYS n 
3 430 GLU n 
3 431 LEU n 
3 432 THR n 
3 433 ALA n 
3 434 PRO n 
3 435 ASP n 
3 436 GLU n 
3 437 ASN n 
3 438 ILE n 
3 439 PRO n 
3 440 ALA n 
3 441 LYS n 
3 442 ILE n 
3 443 LEU n 
3 444 SER n 
3 445 TYR n 
3 446 ASN n 
3 447 ARG n 
3 448 ALA n 
3 449 ASN n 
3 450 ARG n 
3 451 ALA n 
3 452 VAL n 
3 453 ALA n 
3 454 ILE n 
3 455 LEU n 
3 456 CYS n 
3 457 ASN n 
3 458 HIS n 
3 459 GLN n 
3 460 ARG n 
3 461 ALA n 
3 462 PRO n 
3 463 PRO n 
3 464 LYS n 
3 465 THR n 
3 466 PHE n 
3 467 GLU n 
3 468 LYS n 
3 469 SER n 
3 470 MET n 
3 471 MET n 
3 472 ASN n 
3 473 LEU n 
3 474 GLN n 
3 475 THR n 
3 476 LYS n 
3 477 ILE n 
3 478 ASP n 
3 479 ALA n 
3 480 LYS n 
3 481 LYS n 
3 482 GLU n 
3 483 GLN n 
3 484 LEU n 
3 485 ALA n 
3 486 ASP n 
3 487 ALA n 
3 488 ARG n 
3 489 ARG n 
3 490 ASP n 
3 491 LEU n 
3 492 LYS n 
3 493 SER n 
3 494 ALA n 
3 495 LYS n 
3 496 ALA n 
3 497 ASP n 
3 498 ALA n 
3 499 LYS n 
3 500 VAL n 
3 501 MET n 
3 502 LYS n 
3 503 ASP n 
3 504 ALA n 
3 505 LYS n 
3 506 THR n 
3 507 LYS n 
3 508 LYS n 
3 509 VAL n 
3 510 VAL n 
3 511 GLU n 
3 512 SER n 
3 513 LYS n 
3 514 LYS n 
3 515 LYS n 
3 516 ALA n 
3 517 VAL n 
3 518 GLN n 
3 519 ARG n 
3 520 LEU n 
3 521 GLU n 
3 522 GLU n 
3 523 GLN n 
3 524 LEU n 
3 525 MET n 
3 526 LYS n 
3 527 LEU n 
3 528 GLU n 
3 529 VAL n 
3 530 GLN n 
3 531 ALA n 
3 532 THR n 
3 533 ASP n 
3 534 ARG n 
3 535 GLU n 
3 536 GLU n 
3 537 ASN n 
3 538 LYS n 
3 539 GLN n 
3 540 ILE n 
3 541 ALA n 
3 542 LEU n 
3 543 GLY n 
3 544 THR n 
3 545 SER n 
3 546 LYS n 
3 547 LEU n 
3 548 ASN n 
3 549 PTR n 
3 550 LEU n 
3 551 ASP n 
3 552 PRO n 
3 553 ARG n 
3 554 ILE n 
3 555 THR n 
3 556 VAL n 
3 557 ALA n 
3 558 TRP n 
3 559 CYS n 
3 560 LYS n 
3 561 LYS n 
3 562 TRP n 
3 563 GLY n 
3 564 VAL n 
3 565 PRO n 
3 566 ILE n 
3 567 GLU n 
3 568 LYS n 
3 569 ILE n 
3 570 TYR n 
3 571 ASN n 
3 572 LYS n 
3 573 THR n 
3 574 GLN n 
3 575 ARG n 
3 576 GLU n 
3 577 LYS n 
3 578 PHE n 
3 579 ALA n 
3 580 TRP n 
3 581 ALA n 
3 582 ILE n 
3 583 ASP n 
3 584 MET n 
3 585 ALA n 
3 586 ASP n 
3 587 GLU n 
3 588 ASP n 
3 589 TYR n 
3 590 GLU n 
3 591 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEUS 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TOP1_HUMAN 3 ? ? ? ? 
2 PDB 1A31       1 ? ? ? ? 
3 PDB 1A31       2 ? ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A31 A 1 ? 591 ? P11387 175 ? 765 ? 175 765 
2 2 1A31 C 1 ? 22  ? 1A31   1   ? 22  ? 1   22  
3 3 1A31 D 1 ? 22  ? 1A31   101 ? 122 ? 101 122 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1A31 
_struct_ref_seq_dif.mon_id                       PTR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      549 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P11387 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          723 
_struct_ref_seq_dif.details                      'MODIFIED RESIDUE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            723 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5IU 'DNA linking'       n "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ?                 'C9 H12 I N2 O8 P' 434.078 
ALA 'L-peptide linking' y ALANINE                                   ?                 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                  ?                 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ?                 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ?                 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ?                 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ?                 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ?                 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ?                 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ?                 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ?                 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ?                 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                   ?                 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ?                 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                     ?                 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ?                 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                   ?                 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                    ?                 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                ?                 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ?                 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                   ?                 'C5 H9 N O2'       115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                         PHOSPHONOTYROSINE 'C9 H12 N O6 P'    261.168 
SER 'L-peptide linking' y SERINE                                    ?                 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                 ?                 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ?                 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                  ?                 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                    ?                 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1A31 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.00 
_exptl_crystal.density_percent_sol   38.51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295.00 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.7 
_exptl_crystal_grow.pdbx_details    'pH 7.7, VAPOR DIFFUSION, SITTING DROP, temperature 295.00K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 TRIS-HCL  ? ? ? 
1 2  1 EDTA      ? ? ? 
1 3  1 DTT       ? ? ? 
1 4  1 MGCL2     ? ? ? 
1 5  1 'PEG 400' ? ? ? 
1 6  2 TRIS-HCL  ? ? ? 
1 7  2 MGCL2     ? ? ? 
1 8  2 DTT       ? ? ? 
1 9  2 'PEG 400' ? ? ? 
1 10 3 TRIS-HCL  ? ? ? 
1 11 3 MGCL2     ? ? ? 
1 12 3 'PEG 400' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.980 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             0.980 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A31 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.1 
_reflns.number_obs                   42786 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.7 
_reflns.pdbx_Rmerge_I_obs            0.0550000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.9 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.1 
_reflns_shell.d_res_low              2.15 
_reflns_shell.percent_possible_all   95.5 
_reflns_shell.Rmerge_I_obs           0.3450000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        2.2 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A31 
_refine.ls_number_reflns_obs                     42786 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.1 
_refine.ls_percent_reflns_obs                    97.2 
_refine.ls_R_factor_obs                          0.2470000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2470000 
_refine.ls_R_factor_R_free                       0.3100000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.1 
_refine.ls_number_reflns_R_free                  2672 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.2197 
_refine.aniso_B[2][2]                            4.4100 
_refine.aniso_B[3][3]                            -4.6297 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.1741 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MULTIPLE ISOMORPHOUS REPLACEMENT WITH ANOMALOUS SCATTERING' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3691 
_refine_hist.pdbx_number_atoms_nucleic_acid   892 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             409 
_refine_hist.number_atoms_total               4992 
_refine_hist.d_res_high                       2.1 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.55  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.4  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.51  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   25 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             1367 
_refine_ls_shell.R_factor_R_work                  0.3520000 
_refine_ls_shell.percent_reflns_obs               86.3 
_refine_ls_shell.R_factor_R_free                  0.3820000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.8 
_refine_ls_shell.number_reflns_R_free             100 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO   TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM_NDBX.DNA TOP_NDBX.DNA 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1A31 
_struct.title                     'HUMAN RECONSTITUTED DNA TOPOISOMERASE I IN COVALENT COMPLEX WITH A 22 BASE PAIR DNA DUPLEX' 
_struct.pdbx_descriptor           'TOPOISOMERASE I (E.C.5.99.1.2)/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A31 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA 
_struct_keywords.text            'TOPOISOMERASE I/DNA, DNA, TOPOISOMERASE I, ISOMERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO C 77  ? MET C 89  ? PRO A 251 MET A 263 1 ? 13 
HELX_P HELX_P2  2  GLU C 93  ? THR C 96  ? GLU A 267 THR A 270 5 ? 4  
HELX_P HELX_P3  3  GLU C 98  ? GLU C 111 ? GLU A 272 GLU A 285 1 ? 14 
HELX_P HELX_P4  4  ASN C 114 ? ILE C 119 ? ASN A 288 ILE A 293 1 ? 6  
HELX_P HELX_P5  5  THR C 129 ? LYS C 143 ? THR A 303 LYS A 317 1 ? 15 
HELX_P HELX_P6  6  LYS C 147 ? TYR C 164 ? LYS A 321 TYR A 338 1 ? 18 
HELX_P HELX_P7  7  PRO C 205 ? ASP C 207 ? PRO A 379 ASP A 381 5 ? 3  
HELX_P HELX_P8  8  ARG C 260 ? LYS C 292 ? ARG A 434 LYS A 466 1 ? 33 
HELX_P HELX_P9  9  VAL C 298 ? LEU C 311 ? VAL A 472 LEU A 485 1 ? 14 
HELX_P HELX_P10 10 CYS C 330 ? SER C 332 ? CYS A 504 SER A 506 5 ? 3  
HELX_P HELX_P11 11 VAL C 335 ? HIS C 337 ? VAL A 509 HIS A 511 5 ? 3  
HELX_P HELX_P12 12 LYS C 358 ? SER C 360 ? LYS A 532 SER A 534 5 ? 3  
HELX_P HELX_P13 13 LYS C 371 ? LEU C 379 ? LYS A 545 LEU A 553 1 ? 9  
HELX_P HELX_P14 14 THR C 396 ? LEU C 406 ? THR A 570 LEU A 580 1 ? 11 
HELX_P HELX_P15 15 ALA C 412 ? LEU C 431 ? ALA A 586 LEU A 605 1 ? 20 
HELX_P HELX_P16 16 ILE C 438 ? ALA C 451 ? ILE A 612 ALA A 625 1 ? 14 
HELX_P HELX_P17 17 PRO C 552 ? LYS C 561 ? PRO A 726 LYS A 735 1 ? 10 
HELX_P HELX_P18 18 ILE C 566 ? LYS C 568 ? ILE A 740 LYS A 742 5 ? 3  
HELX_P HELX_P19 19 LYS C 572 ? LYS C 577 ? LYS A 746 LYS A 751 1 ? 6  
HELX_P HELX_P20 20 ALA C 579 ? ILE C 582 ? ALA A 753 ILE A 756 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C PTR 549 N     ? ? ? 1_555 C ASN 548 C     ? ? A PTR 723 A ASN 722 1_555 ? ? ? ? ? ? ?             1.338 ? 
covale2  covale ? ? C PTR 549 C     ? ? ? 1_555 C LEU 550 N     ? ? A PTR 723 A LEU 724 1_555 ? ? ? ? ? ? ?             1.325 ? 
covale3  covale ? ? C PTR 549 O3P   ? ? ? 1_555 A 5IU 10  "C3'" ? ? A PTR 723 C 5IU 10  1_555 ? ? ? ? ? ? ?             1.456 ? 
covale4  covale ? ? A 5IU 9   "O3'" ? ? ? 1_555 A 5IU 10  P     ? ? C 5IU 9   C 5IU 10  1_555 ? ? ? ? ? ? ?             1.601 ? 
covale5  covale ? ? A 5IU 9   P     ? ? ? 1_555 A DC  8   "O3'" ? ? C 5IU 9   C DC  8   1_555 ? ? ? ? ? ? ?             1.609 ? 
covale6  covale ? ? A 5IU 18  "O3'" ? ? ? 1_555 A 5IU 19  P     ? ? C 5IU 18  C 5IU 19  1_555 ? ? ? ? ? ? ?             1.581 ? 
covale7  covale ? ? A 5IU 18  P     ? ? ? 1_555 A DA  17  "O3'" ? ? C 5IU 18  C DA  17  1_555 ? ? ? ? ? ? ?             1.605 ? 
covale8  covale ? ? A 5IU 19  "O3'" ? ? ? 1_555 A 5IU 20  P     ? ? C 5IU 19  C 5IU 20  1_555 ? ? ? ? ? ? ?             1.586 ? 
covale9  covale ? ? A 5IU 20  "O3'" ? ? ? 1_555 A 5IU 21  P     ? ? C 5IU 20  C 5IU 21  1_555 ? ? ? ? ? ? ?             1.612 ? 
covale10 covale ? ? A 5IU 21  "O3'" ? ? ? 1_555 A DT  22  P     ? ? C 5IU 21  C DT  22  1_555 ? ? ? ? ? ? ?             1.601 ? 
covale11 covale ? ? B 5IU 7   "O3'" ? ? ? 1_555 B 5IU 8   P     ? ? D 5IU 107 D 5IU 108 1_555 ? ? ? ? ? ? ?             1.611 ? 
covale12 covale ? ? B 5IU 7   P     ? ? ? 1_555 B DT  6   "O3'" ? ? D 5IU 107 D DT  106 1_555 ? ? ? ? ? ? ?             1.604 ? 
covale13 covale ? ? B 5IU 8   "O3'" ? ? ? 1_555 B 5IU 9   P     ? ? D 5IU 108 D 5IU 109 1_555 ? ? ? ? ? ? ?             1.600 ? 
covale14 covale ? ? B 5IU 9   "O3'" ? ? ? 1_555 B 5IU 10  P     ? ? D 5IU 109 D 5IU 110 1_555 ? ? ? ? ? ? ?             1.609 ? 
covale15 covale ? ? B 5IU 10  "O3'" ? ? ? 1_555 B DC  11  P     ? ? D 5IU 110 D DC  111 1_555 ? ? ? ? ? ? ?             1.594 ? 
hydrog1  hydrog ? ? A DA  1   N1    ? ? ? 1_555 B DT  22  N3    ? ? C DA  1   D DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog2  hydrog ? ? A DA  1   N6    ? ? ? 1_555 B DT  22  O4    ? ? C DA  1   D DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog3  hydrog ? ? A DA  2   N1    ? ? ? 1_555 B DT  21  N3    ? ? C DA  2   D DT  121 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog4  hydrog ? ? A DA  2   N6    ? ? ? 1_555 B DT  21  O4    ? ? C DA  2   D DT  121 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog5  hydrog ? ? A DA  3   N1    ? ? ? 1_555 B DT  20  N3    ? ? C DA  3   D DT  120 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog6  hydrog ? ? A DA  3   N6    ? ? ? 1_555 B DT  20  O4    ? ? C DA  3   D DT  120 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog7  hydrog ? ? A DA  4   N1    ? ? ? 1_555 B DT  19  N3    ? ? C DA  4   D DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog8  hydrog ? ? A DA  4   N6    ? ? ? 1_555 B DT  19  O4    ? ? C DA  4   D DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog9  hydrog ? ? A DA  5   N1    ? ? ? 1_555 B DT  18  N3    ? ? C DA  5   D DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog10 hydrog ? ? A DA  5   N6    ? ? ? 1_555 B DT  18  O4    ? ? C DA  5   D DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog11 hydrog ? ? A DG  6   N1    ? ? ? 1_555 B DC  17  N3    ? ? C DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog12 hydrog ? ? A DG  6   N2    ? ? ? 1_555 B DC  17  O2    ? ? C DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog13 hydrog ? ? A DG  6   O6    ? ? ? 1_555 B DC  17  N4    ? ? C DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog14 hydrog ? ? A DA  7   N1    ? ? ? 1_555 B DT  16  N3    ? ? C DA  7   D DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog15 hydrog ? ? A DA  7   N6    ? ? ? 1_555 B DT  16  O4    ? ? C DA  7   D DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog16 hydrog ? ? A DC  8   N3    ? ? ? 1_555 B DG  15  N1    ? ? C DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog17 hydrog ? ? A DC  8   N4    ? ? ? 1_555 B DG  15  O6    ? ? C DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog18 hydrog ? ? A DC  8   O2    ? ? ? 1_555 B DG  15  N2    ? ? C DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog19 hydrog ? ? A 5IU 9   N3    ? ? ? 1_555 B DA  14  N1    ? ? C 5IU 9   D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog20 hydrog ? ? A 5IU 9   O4    ? ? ? 1_555 B DA  14  N6    ? ? C 5IU 9   D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog21 hydrog ? ? A 5IU 10  N3    ? ? ? 1_555 B DA  13  N1    ? ? C 5IU 10  D DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog22 hydrog ? ? A 5IU 10  O4    ? ? ? 1_555 B DA  13  N6    ? ? C 5IU 10  D DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog23 hydrog ? ? A DT  11  N3    ? ? ? 1_555 B DA  12  N1    ? ? C DT  11  D DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog24 hydrog ? ? A DT  11  O4    ? ? ? 1_555 B DA  12  N6    ? ? C DT  11  D DA  112 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog25 hydrog ? ? A DG  12  N1    ? ? ? 1_555 B DC  11  N3    ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog26 hydrog ? ? A DG  12  N2    ? ? ? 1_555 B DC  11  O2    ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog27 hydrog ? ? A DG  12  O6    ? ? ? 1_555 B DC  11  N4    ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog28 hydrog ? ? A DA  13  N1    ? ? ? 1_555 B 5IU 10  N3    ? ? C DA  13  D 5IU 110 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog29 hydrog ? ? A DA  13  N6    ? ? ? 1_555 B 5IU 10  O4    ? ? C DA  13  D 5IU 110 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog30 hydrog ? ? A DA  14  N1    ? ? ? 1_555 B 5IU 9   N3    ? ? C DA  14  D 5IU 109 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog31 hydrog ? ? A DA  14  N6    ? ? ? 1_555 B 5IU 9   O4    ? ? C DA  14  D 5IU 109 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog32 hydrog ? ? A DA  15  N1    ? ? ? 1_555 B 5IU 8   N3    ? ? C DA  15  D 5IU 108 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog33 hydrog ? ? A DA  15  N6    ? ? ? 1_555 B 5IU 8   O4    ? ? C DA  15  D 5IU 108 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog34 hydrog ? ? A DA  16  N1    ? ? ? 1_555 B 5IU 7   N3    ? ? C DA  16  D 5IU 107 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog35 hydrog ? ? A DA  16  N6    ? ? ? 1_555 B 5IU 7   O4    ? ? C DA  16  D 5IU 107 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog36 hydrog ? ? A DA  17  N1    ? ? ? 1_555 B DT  6   N3    ? ? C DA  17  D DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog37 hydrog ? ? A DA  17  N6    ? ? ? 1_555 B DT  6   O4    ? ? C DA  17  D DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog38 hydrog ? ? A 5IU 18  N3    ? ? ? 1_555 B DA  5   N1    ? ? C 5IU 18  D DA  105 1_555 ? ? ? ? ? ? '5IU-DA PAIR' ?     ? 
hydrog39 hydrog ? ? A 5IU 19  N3    ? ? ? 1_555 B DA  4   N1    ? ? C 5IU 19  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog40 hydrog ? ? A 5IU 19  O4    ? ? ? 1_555 B DA  4   N6    ? ? C 5IU 19  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog41 hydrog ? ? A 5IU 20  N3    ? ? ? 1_555 B DA  3   N1    ? ? C 5IU 20  D DA  103 1_555 ? ? ? ? ? ? '5IU-DA PAIR' ?     ? 
hydrog42 hydrog ? ? A 5IU 21  N3    ? ? ? 1_555 B DA  2   N1    ? ? C 5IU 21  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog43 hydrog ? ? A 5IU 21  O4    ? ? ? 1_555 B DA  2   N6    ? ? C 5IU 21  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog44 hydrog ? ? A DT  22  N3    ? ? ? 1_555 B DA  1   N1    ? ? C DT  22  D DA  101 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
hydrog45 hydrog ? ? A DT  22  O4    ? ? ? 1_555 B DA  1   N6    ? ? C DT  22  D DA  101 1_555 ? ? ? ? ? ? WATSON-CRICK  ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE C 166 ? MET C 169 ? PHE A 340 MET A 343 
A 2 HIS C 172 ? ARG C 175 ? HIS A 346 ARG A 349 
B 1 ILE C 209 ? ASN C 211 ? ILE A 383 ASN A 385 
B 2 GLU C 229 ? ARG C 231 ? GLU A 403 ARG A 405 
C 1 VAL C 240 ? THR C 243 ? VAL A 414 THR A 417 
C 2 ILE C 250 ? ILE C 253 ? ILE A 424 ILE A 427 
D 1 ILE C 338 ? HIS C 341 ? ILE A 512 HIS A 515 
D 2 VAL C 350 ? LEU C 356 ? VAL A 524 LEU A 530 
D 3 ARG C 362 ? PRO C 368 ? ARG A 536 PRO A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O CYS C 167 ? O CYS A 341 N GLU C 174 ? N GLU A 348 
B 1 2 O ILE C 210 ? O ILE A 384 N GLU C 229 ? N GLU A 403 
C 1 2 O VAL C 240 ? O VAL A 414 N ILE C 253 ? N ILE A 427 
D 1 2 O ASN C 339 ? O ASN A 513 N GLU C 352 ? N GLU A 526 
D 2 3 O VAL C 351 ? O VAL A 525 N VAL C 367 ? N VAL A 541 
# 
_database_PDB_matrix.entry_id          1A31 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A31 
_atom_sites.fract_transf_matrix[1][1]   0.013889 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002026 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015015 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014075 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 10.934  5.673   46.113  1.00 67.75 ? 1    DA  C "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 10.618  6.557   47.199  1.00 66.79 ? 1    DA  C "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 11.810  7.432   47.515  1.00 65.85 ? 1    DA  C "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 12.869  6.671   48.157  1.00 64.91 ? 1    DA  C "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 12.425  8.009   46.249  1.00 65.45 ? 1    DA  C "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 13.003  9.256   46.554  1.00 65.31 ? 1    DA  C "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 13.523  7.021   45.909  1.00 65.63 ? 1    DA  C "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 13.985  6.538   47.274  1.00 62.99 ? 1    DA  C "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 14.343  5.127   47.231  1.00 59.58 ? 1    DA  C N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 13.562  4.106   46.751  1.00 55.90 ? 1    DA  C C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 14.121  2.930   46.846  1.00 56.22 ? 1    DA  C N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 15.354  3.186   47.419  1.00 57.92 ? 1    DA  C C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 16.417  2.344   47.791  1.00 59.41 ? 1    DA  C C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 16.391  1.020   47.647  1.00 59.84 ? 1    DA  C N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 17.519  2.922   48.336  1.00 57.87 ? 1    DA  C N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 17.523  4.246   48.503  1.00 58.70 ? 1    DA  C C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 16.578  5.139   48.205  1.00 59.28 ? 1    DA  C N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 15.508  4.538   47.656  1.00 59.41 ? 1    DA  C C4    1 
ATOM   19   P P     . DA  A 1 2   ? 13.353  10.259  45.368  1.00 63.51 ? 2    DA  C P     1 
ATOM   20   O OP1   . DA  A 1 2   ? 13.093  11.613  45.951  1.00 68.17 ? 2    DA  C OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? 12.671  9.841   44.131  1.00 62.57 ? 2    DA  C OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? 14.920  10.078  45.175  1.00 60.64 ? 2    DA  C "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? 15.515  8.806   45.357  1.00 54.13 ? 2    DA  C "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? 16.925  8.791   44.821  1.00 50.96 ? 2    DA  C "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? 17.361  7.429   44.972  1.00 48.82 ? 2    DA  C "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? 17.106  9.099   43.336  1.00 48.73 ? 2    DA  C "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? 18.455  9.557   43.145  1.00 49.41 ? 2    DA  C "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? 16.884  7.747   42.687  1.00 45.45 ? 2    DA  C "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? 17.493  6.806   43.710  1.00 46.80 ? 2    DA  C "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? 16.856  5.498   43.818  1.00 47.47 ? 2    DA  C N9    1 
ATOM   31   C C8    . DA  A 1 2   ? 15.570  5.113   43.522  1.00 40.37 ? 2    DA  C C8    1 
ATOM   32   N N7    . DA  A 1 2   ? 15.338  3.845   43.747  1.00 39.85 ? 2    DA  C N7    1 
ATOM   33   C C5    . DA  A 1 2   ? 16.550  3.363   44.220  1.00 40.57 ? 2    DA  C C5    1 
ATOM   34   C C6    . DA  A 1 2   ? 16.966  2.097   44.627  1.00 40.74 ? 2    DA  C C6    1 
ATOM   35   N N6    . DA  A 1 2   ? 16.175  1.040   44.637  1.00 40.34 ? 2    DA  C N6    1 
ATOM   36   N N1    . DA  A 1 2   ? 18.245  1.953   45.035  1.00 40.85 ? 2    DA  C N1    1 
ATOM   37   C C2    . DA  A 1 2   ? 19.041  3.024   45.041  1.00 41.00 ? 2    DA  C C2    1 
ATOM   38   N N3    . DA  A 1 2   ? 18.765  4.271   44.689  1.00 43.48 ? 2    DA  C N3    1 
ATOM   39   C C4    . DA  A 1 2   ? 17.489  4.373   44.276  1.00 44.16 ? 2    DA  C C4    1 
ATOM   40   P P     . DA  A 1 3   ? 19.040  9.807   41.659  1.00 53.46 ? 3    DA  C P     1 
ATOM   41   O OP1   . DA  A 1 3   ? 19.349  11.235  41.501  1.00 52.27 ? 3    DA  C OP1   1 
ATOM   42   O OP2   . DA  A 1 3   ? 18.216  9.140   40.636  1.00 55.55 ? 3    DA  C OP2   1 
ATOM   43   O "O5'" . DA  A 1 3   ? 20.407  8.987   41.688  1.00 52.35 ? 3    DA  C "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3   ? 21.234  8.983   42.868  1.00 51.41 ? 3    DA  C "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3   ? 22.276  7.888   42.793  1.00 48.37 ? 3    DA  C "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3   ? 21.662  6.605   43.009  1.00 49.62 ? 3    DA  C "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3   ? 23.075  7.763   41.498  1.00 46.19 ? 3    DA  C "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3   ? 24.410  7.443   41.870  1.00 45.61 ? 3    DA  C "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3   ? 22.411  6.611   40.767  1.00 44.35 ? 3    DA  C "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3   ? 21.873  5.738   41.894  1.00 47.59 ? 3    DA  C "C1'" 1 
ATOM   51   N N9    . DA  A 1 3   ? 20.597  5.064   41.629  1.00 44.63 ? 3    DA  C N9    1 
ATOM   52   C C8    . DA  A 1 3   ? 19.429  5.618   41.165  1.00 41.87 ? 3    DA  C C8    1 
ATOM   53   N N7    . DA  A 1 3   ? 18.437  4.763   41.076  1.00 40.47 ? 3    DA  C N7    1 
ATOM   54   C C5    . DA  A 1 3   ? 18.997  3.563   41.481  1.00 36.89 ? 3    DA  C C5    1 
ATOM   55   C C6    . DA  A 1 3   ? 18.473  2.270   41.596  1.00 32.55 ? 3    DA  C C6    1 
ATOM   56   N N6    . DA  A 1 3   ? 17.246  1.938   41.268  1.00 26.18 ? 3    DA  C N6    1 
ATOM   57   N N1    . DA  A 1 3   ? 19.277  1.307   42.064  1.00 35.71 ? 3    DA  C N1    1 
ATOM   58   C C2    . DA  A 1 3   ? 20.534  1.625   42.378  1.00 36.38 ? 3    DA  C C2    1 
ATOM   59   N N3    . DA  A 1 3   ? 21.152  2.801   42.290  1.00 32.83 ? 3    DA  C N3    1 
ATOM   60   C C4    . DA  A 1 3   ? 20.321  3.738   41.831  1.00 40.14 ? 3    DA  C C4    1 
ATOM   61   P P     . DA  A 1 4   ? 25.561  7.310   40.756  1.00 52.51 ? 4    DA  C P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 26.770  7.503   41.559  1.00 48.39 ? 4    DA  C OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 25.293  8.182   39.571  1.00 47.52 ? 4    DA  C OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 25.534  5.759   40.435  1.00 45.29 ? 4    DA  C "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 25.657  4.878   41.529  1.00 42.18 ? 4    DA  C "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 25.646  3.461   41.056  1.00 40.80 ? 4    DA  C "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 24.293  3.052   40.807  1.00 41.26 ? 4    DA  C "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 26.425  3.247   39.771  1.00 43.11 ? 4    DA  C "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 27.209  2.064   39.964  1.00 49.56 ? 4    DA  C "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 25.341  3.093   38.720  1.00 40.17 ? 4    DA  C "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 24.210  2.472   39.528  1.00 41.14 ? 4    DA  C "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 22.834  2.670   39.054  1.00 41.65 ? 4    DA  C N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 22.244  3.804   38.558  1.00 38.36 ? 4    DA  C C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 20.984  3.643   38.274  1.00 41.74 ? 4    DA  C N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 20.718  2.335   38.586  1.00 41.24 ? 4    DA  C C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 19.552  1.562   38.508  1.00 43.57 ? 4    DA  C C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 18.382  2.022   38.082  1.00 45.22 ? 4    DA  C N6    1 
ATOM   78   N N1    . DA  A 1 4   ? 19.636  0.265   38.899  1.00 43.03 ? 4    DA  C N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 20.801  -0.199  39.327  1.00 44.59 ? 4    DA  C C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 21.960  0.433   39.447  1.00 42.38 ? 4    DA  C N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 21.848  1.707   39.061  1.00 42.68 ? 4    DA  C C4    1 
ATOM   82   P P     . DA  A 1 5   ? 28.204  1.549   38.810  1.00 52.16 ? 5    DA  C P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 29.485  1.173   39.463  1.00 49.85 ? 5    DA  C OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 28.182  2.555   37.742  1.00 51.60 ? 5    DA  C OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 27.480  0.218   38.332  1.00 49.25 ? 5    DA  C "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 26.835  -0.622  39.300  1.00 44.93 ? 5    DA  C "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 26.043  -1.693  38.601  1.00 44.23 ? 5    DA  C "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 24.753  -1.186  38.220  1.00 42.51 ? 5    DA  C "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 26.706  -2.183  37.321  1.00 44.98 ? 5    DA  C "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 26.639  -3.607  37.306  1.00 47.90 ? 5    DA  C "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 25.873  -1.545  36.221  1.00 43.27 ? 5    DA  C "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 24.497  -1.481  36.866  1.00 40.18 ? 5    DA  C "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 23.584  -0.456  36.357  1.00 33.19 ? 5    DA  C N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 23.864  0.828   35.967  1.00 33.29 ? 5    DA  C C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 22.820  1.495   35.554  1.00 31.10 ? 5    DA  C N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 21.779  0.593   35.675  1.00 27.03 ? 5    DA  C C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 20.403  0.683   35.382  1.00 28.38 ? 5    DA  C C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 19.806  1.769   34.920  1.00 28.75 ? 5    DA  C N6    1 
ATOM   99   N N1    . DA  A 1 5   ? 19.651  -0.402  35.597  1.00 28.15 ? 5    DA  C N1    1 
ATOM   100  C C2    . DA  A 1 5   ? 20.237  -1.496  36.096  1.00 31.92 ? 5    DA  C C2    1 
ATOM   101  N N3    . DA  A 1 5   ? 21.511  -1.702  36.419  1.00 31.52 ? 5    DA  C N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 22.237  -0.608  36.175  1.00 29.54 ? 5    DA  C C4    1 
ATOM   103  P P     . DG  A 1 6   ? 27.299  -4.432  36.095  1.00 51.52 ? 6    DG  C P     1 
ATOM   104  O OP1   . DG  A 1 6   ? 27.847  -5.638  36.730  1.00 50.65 ? 6    DG  C OP1   1 
ATOM   105  O OP2   . DG  A 1 6   ? 28.188  -3.482  35.348  1.00 52.34 ? 6    DG  C OP2   1 
ATOM   106  O "O5'" . DG  A 1 6   ? 26.040  -4.818  35.200  1.00 45.86 ? 6    DG  C "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 6   ? 24.904  -5.391  35.833  1.00 39.37 ? 6    DG  C "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 6   ? 23.770  -5.567  34.858  1.00 35.25 ? 6    DG  C "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 6   ? 23.053  -4.323  34.694  1.00 34.04 ? 6    DG  C "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 6   ? 24.146  -6.050  33.457  1.00 34.67 ? 6    DG  C "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 6   ? 23.452  -7.263  33.209  1.00 30.56 ? 6    DG  C "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 6   ? 23.616  -4.945  32.549  1.00 34.25 ? 6    DG  C "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 6   ? 22.543  -4.275  33.395  1.00 29.27 ? 6    DG  C "C1'" 1 
ATOM   114  N N9    . DG  A 1 6   ? 22.278  -2.878  33.084  1.00 24.74 ? 6    DG  C N9    1 
ATOM   115  C C8    . DG  A 1 6   ? 23.177  -1.855  33.052  1.00 26.52 ? 6    DG  C C8    1 
ATOM   116  N N7    . DG  A 1 6   ? 22.638  -0.716  32.717  1.00 29.99 ? 6    DG  C N7    1 
ATOM   117  C C5    . DG  A 1 6   ? 21.312  -1.016  32.520  1.00 27.43 ? 6    DG  C C5    1 
ATOM   118  C C6    . DG  A 1 6   ? 20.240  -0.191  32.149  1.00 30.60 ? 6    DG  C C6    1 
ATOM   119  O O6    . DG  A 1 6   ? 20.248  0.993   31.886  1.00 34.78 ? 6    DG  C O6    1 
ATOM   120  N N1    . DG  A 1 6   ? 19.058  -0.889  32.098  1.00 29.83 ? 6    DG  C N1    1 
ATOM   121  C C2    . DG  A 1 6   ? 18.927  -2.216  32.371  1.00 29.96 ? 6    DG  C C2    1 
ATOM   122  N N2    . DG  A 1 6   ? 17.711  -2.708  32.288  1.00 23.47 ? 6    DG  C N2    1 
ATOM   123  N N3    . DG  A 1 6   ? 19.919  -2.998  32.704  1.00 26.30 ? 6    DG  C N3    1 
ATOM   124  C C4    . DG  A 1 6   ? 21.072  -2.340  32.761  1.00 23.14 ? 6    DG  C C4    1 
ATOM   125  P P     . DA  A 1 7   ? 23.718  -8.076  31.864  1.00 31.21 ? 7    DA  C P     1 
ATOM   126  O OP1   . DA  A 1 7   ? 23.615  -9.507  32.182  1.00 34.01 ? 7    DA  C OP1   1 
ATOM   127  O OP2   . DA  A 1 7   ? 24.892  -7.584  31.095  1.00 28.55 ? 7    DA  C OP2   1 
ATOM   128  O "O5'" . DA  A 1 7   ? 22.434  -7.696  31.017  1.00 27.01 ? 7    DA  C "O5'" 1 
ATOM   129  C "C5'" . DA  A 1 7   ? 21.165  -7.920  31.558  1.00 26.75 ? 7    DA  C "C5'" 1 
ATOM   130  C "C4'" . DA  A 1 7   ? 20.112  -7.481  30.577  1.00 31.61 ? 7    DA  C "C4'" 1 
ATOM   131  O "O4'" . DA  A 1 7   ? 20.077  -6.049  30.493  1.00 31.95 ? 7    DA  C "O4'" 1 
ATOM   132  C "C3'" . DA  A 1 7   ? 20.333  -7.975  29.155  1.00 35.25 ? 7    DA  C "C3'" 1 
ATOM   133  O "O3'" . DA  A 1 7   ? 19.085  -8.462  28.678  1.00 41.28 ? 7    DA  C "O3'" 1 
ATOM   134  C "C2'" . DA  A 1 7   ? 20.787  -6.728  28.408  1.00 34.95 ? 7    DA  C "C2'" 1 
ATOM   135  C "C1'" . DA  A 1 7   ? 20.038  -5.648  29.145  1.00 33.52 ? 7    DA  C "C1'" 1 
ATOM   136  N N9    . DA  A 1 7   ? 20.543  -4.268  29.073  1.00 34.92 ? 7    DA  C N9    1 
ATOM   137  C C8    . DA  A 1 7   ? 21.825  -3.793  29.181  1.00 33.12 ? 7    DA  C C8    1 
ATOM   138  N N7    . DA  A 1 7   ? 21.905  -2.483  29.115  1.00 34.08 ? 7    DA  C N7    1 
ATOM   139  C C5    . DA  A 1 7   ? 20.596  -2.072  28.940  1.00 27.54 ? 7    DA  C C5    1 
ATOM   140  C C6    . DA  A 1 7   ? 20.008  -0.804  28.800  1.00 30.72 ? 7    DA  C C6    1 
ATOM   141  N N6    . DA  A 1 7   ? 20.676  0.332   28.794  1.00 23.93 ? 7    DA  C N6    1 
ATOM   142  N N1    . DA  A 1 7   ? 18.683  -0.752  28.660  1.00 25.66 ? 7    DA  C N1    1 
ATOM   143  C C2    . DA  A 1 7   ? 17.996  -1.892  28.657  1.00 25.10 ? 7    DA  C C2    1 
ATOM   144  N N3    . DA  A 1 7   ? 18.426  -3.136  28.773  1.00 28.15 ? 7    DA  C N3    1 
ATOM   145  C C4    . DA  A 1 7   ? 19.748  -3.159  28.912  1.00 27.69 ? 7    DA  C C4    1 
ATOM   146  P P     . DC  A 1 8   ? 19.031  -9.264  27.304  1.00 31.07 ? 8    DC  C P     1 
ATOM   147  O OP1   . DC  A 1 8   ? 17.678  -9.816  27.179  1.00 44.05 ? 8    DC  C OP1   1 
ATOM   148  O OP2   . DC  A 1 8   ? 20.208  -10.180 27.257  1.00 42.86 ? 8    DC  C OP2   1 
ATOM   149  O "O5'" . DC  A 1 8   ? 19.253  -8.095  26.254  1.00 45.30 ? 8    DC  C "O5'" 1 
ATOM   150  C "C5'" . DC  A 1 8   ? 18.470  -8.000  25.076  1.00 41.57 ? 8    DC  C "C5'" 1 
ATOM   151  C "C4'" . DC  A 1 8   ? 17.516  -6.839  25.181  1.00 42.45 ? 8    DC  C "C4'" 1 
ATOM   152  O "O4'" . DC  A 1 8   ? 18.120  -5.764  25.953  1.00 42.98 ? 8    DC  C "O4'" 1 
ATOM   153  C "C3'" . DC  A 1 8   ? 17.260  -6.270  23.793  1.00 42.93 ? 8    DC  C "C3'" 1 
ATOM   154  O "O3'" . DC  A 1 8   ? 15.923  -6.364  23.338  1.00 44.98 ? 8    DC  C "O3'" 1 
ATOM   155  C "C2'" . DC  A 1 8   ? 17.675  -4.818  23.871  1.00 42.65 ? 8    DC  C "C2'" 1 
ATOM   156  C "C1'" . DC  A 1 8   ? 17.805  -4.521  25.341  1.00 41.29 ? 8    DC  C "C1'" 1 
ATOM   157  N N1    . DC  A 1 8   ? 18.953  -3.607  25.478  1.00 38.92 ? 8    DC  C N1    1 
ATOM   158  C C2    . DC  A 1 8   ? 18.709  -2.220  25.428  1.00 38.85 ? 8    DC  C C2    1 
ATOM   159  O O2    . DC  A 1 8   ? 17.549  -1.817  25.445  1.00 36.29 ? 8    DC  C O2    1 
ATOM   160  N N3    . DC  A 1 8   ? 19.743  -1.370  25.375  1.00 34.52 ? 8    DC  C N3    1 
ATOM   161  C C4    . DC  A 1 8   ? 20.982  -1.838  25.398  1.00 35.06 ? 8    DC  C C4    1 
ATOM   162  N N4    . DC  A 1 8   ? 21.954  -0.964  25.263  1.00 27.45 ? 8    DC  C N4    1 
ATOM   163  C C5    . DC  A 1 8   ? 21.266  -3.226  25.541  1.00 31.33 ? 8    DC  C C5    1 
ATOM   164  C C6    . DC  A 1 8   ? 20.229  -4.070  25.579  1.00 33.04 ? 8    DC  C C6    1 
HETATM 165  N N1    . 5IU A 1 9   ? 16.673  -1.281  21.544  1.00 38.02 ? 9    5IU C N1    1 
HETATM 166  C C2    . 5IU A 1 9   ? 17.308  -0.062  21.578  1.00 38.23 ? 9    5IU C C2    1 
HETATM 167  N N3    . 5IU A 1 9   ? 18.666  -0.134  21.632  1.00 35.58 ? 9    5IU C N3    1 
HETATM 168  C C4    . 5IU A 1 9   ? 19.426  -1.275  21.639  1.00 40.14 ? 9    5IU C C4    1 
HETATM 169  C C5    . 5IU A 1 9   ? 18.697  -2.493  21.557  1.00 36.98 ? 9    5IU C C5    1 
HETATM 170  C C6    . 5IU A 1 9   ? 17.378  -2.446  21.521  1.00 40.91 ? 9    5IU C C6    1 
HETATM 171  O O2    . 5IU A 1 9   ? 16.727  0.992   21.543  1.00 42.82 ? 9    5IU C O2    1 
HETATM 172  O O4    . 5IU A 1 9   ? 20.634  -1.203  21.718  1.00 38.14 ? 9    5IU C O4    1 
HETATM 173  I I5    . 5IU A 1 9   ? 19.675  -4.153  21.488  0.29 61.22 ? 9    5IU C I5    1 
HETATM 174  C "C1'" . 5IU A 1 9   ? 15.222  -1.344  21.549  1.00 33.19 ? 9    5IU C "C1'" 1 
HETATM 175  C "C2'" . 5IU A 1 9   ? 14.633  -2.046  20.347  1.00 34.07 ? 9    5IU C "C2'" 1 
HETATM 176  C "C3'" . 5IU A 1 9   ? 13.303  -2.500  20.911  1.00 35.10 ? 9    5IU C "C3'" 1 
HETATM 177  C "C4'" . 5IU A 1 9   ? 13.652  -2.880  22.350  1.00 35.39 ? 9    5IU C "C4'" 1 
HETATM 178  O "O3'" . 5IU A 1 9   ? 12.393  -1.402  20.981  1.00 37.76 ? 9    5IU C "O3'" 1 
HETATM 179  O "O4'" . 5IU A 1 9   ? 14.842  -2.126  22.661  1.00 33.09 ? 9    5IU C "O4'" 1 
HETATM 180  C "C5'" . 5IU A 1 9   ? 13.944  -4.343  22.544  1.00 37.53 ? 9    5IU C "C5'" 1 
HETATM 181  O "O5'" . 5IU A 1 9   ? 15.000  -4.742  21.660  1.00 40.53 ? 9    5IU C "O5'" 1 
HETATM 182  P P     . 5IU A 1 9   ? 15.636  -6.194  21.764  1.00 46.93 ? 9    5IU C P     1 
HETATM 183  O OP1   . 5IU A 1 9   ? 14.637  -7.230  21.373  1.00 45.47 ? 9    5IU C OP1   1 
HETATM 184  O OP2   . 5IU A 1 9   ? 16.947  -6.145  21.072  1.00 35.21 ? 9    5IU C OP2   1 
HETATM 185  N N1    . 5IU A 1 10  ? 16.815  1.926   18.410  1.00 37.17 ? 10   5IU C N1    1 
HETATM 186  C C2    . 5IU A 1 10  ? 18.037  2.534   18.463  1.00 35.64 ? 10   5IU C C2    1 
HETATM 187  N N3    . 5IU A 1 10  ? 19.093  1.705   18.280  1.00 34.99 ? 10   5IU C N3    1 
HETATM 188  C C4    . 5IU A 1 10  ? 19.056  0.361   18.049  1.00 37.18 ? 10   5IU C C4    1 
HETATM 189  C C5    . 5IU A 1 10  ? 17.747  -0.215  17.959  1.00 37.54 ? 10   5IU C C5    1 
HETATM 190  C C6    . 5IU A 1 10  ? 16.693  0.581   18.155  1.00 37.40 ? 10   5IU C C6    1 
HETATM 191  O O2    . 5IU A 1 10  ? 18.173  3.722   18.659  1.00 35.36 ? 10   5IU C O2    1 
HETATM 192  O O4    . 5IU A 1 10  ? 20.094  -0.258  17.950  1.00 44.00 ? 10   5IU C O4    1 
HETATM 193  I I5    . 5IU A 1 10  ? 17.587  -2.112  17.553  0.18 49.69 ? 10   5IU C I5    1 
HETATM 194  C "C1'" . 5IU A 1 10  ? 15.680  2.804   18.641  1.00 34.83 ? 10   5IU C "C1'" 1 
HETATM 195  C "C2'" . 5IU A 1 10  ? 14.797  2.977   17.444  1.00 38.87 ? 10   5IU C "C2'" 1 
HETATM 196  C "C3'" . 5IU A 1 10  ? 13.386  3.093   18.009  1.00 38.90 ? 10   5IU C "C3'" 1 
HETATM 197  C "C4'" . 5IU A 1 10  ? 13.546  2.813   19.504  1.00 35.20 ? 10   5IU C "C4'" 1 
HETATM 198  O "O4'" . 5IU A 1 10  ? 14.881  2.299   19.673  1.00 32.85 ? 10   5IU C "O4'" 1 
HETATM 199  C "C5'" . 5IU A 1 10  ? 12.620  1.770   20.094  1.00 34.10 ? 10   5IU C "C5'" 1 
HETATM 200  O "O5'" . 5IU A 1 10  ? 12.751  0.485   19.375  1.00 38.04 ? 10   5IU C "O5'" 1 
HETATM 201  P P     . 5IU A 1 10  ? 11.779  -0.765  19.647  1.00 37.59 ? 10   5IU C P     1 
HETATM 202  O OP1   . 5IU A 1 10  ? 10.404  -0.337  19.997  1.00 32.35 ? 10   5IU C OP1   1 
HETATM 203  O OP2   . 5IU A 1 10  ? 11.978  -1.743  18.555  1.00 37.44 ? 10   5IU C OP2   1 
ATOM   204  O "O5'" . DT  A 1 11  ? 13.762  5.377   14.769  1.00 62.30 ? 11   DT  C "O5'" 1 
ATOM   205  C "C5'" . DT  A 1 11  ? 14.325  6.396   15.620  1.00 59.59 ? 11   DT  C "C5'" 1 
ATOM   206  C "C4'" . DT  A 1 11  ? 15.840  6.495   15.459  1.00 62.19 ? 11   DT  C "C4'" 1 
ATOM   207  O "O4'" . DT  A 1 11  ? 16.540  5.335   16.010  1.00 61.05 ? 11   DT  C "O4'" 1 
ATOM   208  C "C3'" . DT  A 1 11  ? 16.478  6.765   14.108  1.00 59.80 ? 11   DT  C "C3'" 1 
ATOM   209  O "O3'" . DT  A 1 11  ? 16.534  8.185   13.871  1.00 59.29 ? 11   DT  C "O3'" 1 
ATOM   210  C "C2'" . DT  A 1 11  ? 17.950  6.300   14.344  1.00 57.23 ? 11   DT  C "C2'" 1 
ATOM   211  C "C1'" . DT  A 1 11  ? 17.868  5.338   15.515  1.00 55.37 ? 11   DT  C "C1'" 1 
ATOM   212  N N1    . DT  A 1 11  ? 18.241  3.933   15.228  1.00 53.06 ? 11   DT  C N1    1 
ATOM   213  C C2    . DT  A 1 11  ? 19.577  3.575   15.235  1.00 52.68 ? 11   DT  C C2    1 
ATOM   214  O O2    . DT  A 1 11  ? 20.483  4.371   15.429  1.00 53.22 ? 11   DT  C O2    1 
ATOM   215  N N3    . DT  A 1 11  ? 19.824  2.265   14.992  1.00 48.27 ? 11   DT  C N3    1 
ATOM   216  C C4    . DT  A 1 11  ? 18.900  1.282   14.747  1.00 50.62 ? 11   DT  C C4    1 
ATOM   217  O O4    . DT  A 1 11  ? 19.273  0.141   14.588  1.00 56.88 ? 11   DT  C O4    1 
ATOM   218  C C5    . DT  A 1 11  ? 17.518  1.723   14.711  1.00 48.35 ? 11   DT  C C5    1 
ATOM   219  C C7    . DT  A 1 11  ? 16.447  0.743   14.362  1.00 49.06 ? 11   DT  C C7    1 
ATOM   220  C C6    . DT  A 1 11  ? 17.265  3.002   14.969  1.00 50.27 ? 11   DT  C C6    1 
ATOM   221  P P     . DG  A 1 12  ? 16.893  8.779   12.417  1.00 56.62 ? 12   DG  C P     1 
ATOM   222  O OP1   . DG  A 1 12  ? 16.103  10.044  12.279  1.00 60.50 ? 12   DG  C OP1   1 
ATOM   223  O OP2   . DG  A 1 12  ? 16.750  7.714   11.395  1.00 57.79 ? 12   DG  C OP2   1 
ATOM   224  O "O5'" . DG  A 1 12  ? 18.431  9.178   12.493  1.00 58.01 ? 12   DG  C "O5'" 1 
ATOM   225  C "C5'" . DG  A 1 12  ? 18.914  10.100  13.502  1.00 61.18 ? 12   DG  C "C5'" 1 
ATOM   226  C "C4'" . DG  A 1 12  ? 20.424  10.217  13.434  1.00 60.67 ? 12   DG  C "C4'" 1 
ATOM   227  O "O4'" . DG  A 1 12  ? 21.029  8.911   13.584  1.00 62.41 ? 12   DG  C "O4'" 1 
ATOM   228  C "C3'" . DG  A 1 12  ? 20.980  10.759  12.120  1.00 62.67 ? 12   DG  C "C3'" 1 
ATOM   229  O "O3'" . DG  A 1 12  ? 22.172  11.493  12.395  1.00 62.66 ? 12   DG  C "O3'" 1 
ATOM   230  C "C2'" . DG  A 1 12  ? 21.277  9.508   11.312  1.00 60.54 ? 12   DG  C "C2'" 1 
ATOM   231  C "C1'" . DG  A 1 12  ? 21.728  8.536   12.392  1.00 57.47 ? 12   DG  C "C1'" 1 
ATOM   232  N N9    . DG  A 1 12  ? 21.398  7.146   12.117  1.00 48.39 ? 12   DG  C N9    1 
ATOM   233  C C8    . DG  A 1 12  ? 20.188  6.657   11.698  1.00 42.62 ? 12   DG  C C8    1 
ATOM   234  N N7    . DG  A 1 12  ? 20.166  5.358   11.621  1.00 41.38 ? 12   DG  C N7    1 
ATOM   235  C C5    . DG  A 1 12  ? 21.442  4.966   11.979  1.00 38.25 ? 12   DG  C C5    1 
ATOM   236  C C6    . DG  A 1 12  ? 22.002  3.662   12.104  1.00 41.36 ? 12   DG  C C6    1 
ATOM   237  O O6    . DG  A 1 12  ? 21.456  2.571   11.940  1.00 37.80 ? 12   DG  C O6    1 
ATOM   238  N N1    . DG  A 1 12  ? 23.336  3.718   12.490  1.00 39.48 ? 12   DG  C N1    1 
ATOM   239  C C2    . DG  A 1 12  ? 24.028  4.867   12.752  1.00 45.11 ? 12   DG  C C2    1 
ATOM   240  N N2    . DG  A 1 12  ? 25.298  4.699   13.107  1.00 44.09 ? 12   DG  C N2    1 
ATOM   241  N N3    . DG  A 1 12  ? 23.509  6.092   12.665  1.00 45.38 ? 12   DG  C N3    1 
ATOM   242  C C4    . DG  A 1 12  ? 22.221  6.061   12.271  1.00 43.07 ? 12   DG  C C4    1 
ATOM   243  P P     . DA  A 1 13  ? 22.987  12.176  11.189  1.00 64.61 ? 13   DA  C P     1 
ATOM   244  O OP1   . DA  A 1 13  ? 23.799  13.276  11.829  1.00 64.25 ? 13   DA  C OP1   1 
ATOM   245  O OP2   . DA  A 1 13  ? 22.053  12.494  10.057  1.00 62.39 ? 13   DA  C OP2   1 
ATOM   246  O "O5'" . DA  A 1 13  ? 23.946  11.009  10.679  1.00 62.90 ? 13   DA  C "O5'" 1 
ATOM   247  C "C5'" . DA  A 1 13  ? 25.304  10.881  11.167  1.00 55.51 ? 13   DA  C "C5'" 1 
ATOM   248  C "C4'" . DA  A 1 13  ? 26.077  9.968   10.249  1.00 50.34 ? 13   DA  C "C4'" 1 
ATOM   249  O "O4'" . DA  A 1 13  ? 25.470  8.651   10.320  1.00 51.25 ? 13   DA  C "O4'" 1 
ATOM   250  C "C3'" . DA  A 1 13  ? 26.006  10.368  8.768   1.00 48.97 ? 13   DA  C "C3'" 1 
ATOM   251  O "O3'" . DA  A 1 13  ? 27.201  9.983   8.074   1.00 51.60 ? 13   DA  C "O3'" 1 
ATOM   252  C "C2'" . DA  A 1 13  ? 24.885  9.487   8.242   1.00 45.47 ? 13   DA  C "C2'" 1 
ATOM   253  C "C1'" . DA  A 1 13  ? 25.208  8.223   9.004   1.00 44.90 ? 13   DA  C "C1'" 1 
ATOM   254  N N9    . DA  A 1 13  ? 24.172  7.198   9.045   1.00 40.27 ? 13   DA  C N9    1 
ATOM   255  C C8    . DA  A 1 13  ? 22.833  7.337   8.836   1.00 40.72 ? 13   DA  C C8    1 
ATOM   256  N N7    . DA  A 1 13  ? 22.183  6.201   8.818   1.00 40.53 ? 13   DA  C N7    1 
ATOM   257  C C5    . DA  A 1 13  ? 23.160  5.253   9.049   1.00 35.47 ? 13   DA  C C5    1 
ATOM   258  C C6    . DA  A 1 13  ? 23.120  3.865   9.109   1.00 35.25 ? 13   DA  C C6    1 
ATOM   259  N N6    . DA  A 1 13  ? 22.036  3.155   8.871   1.00 42.49 ? 13   DA  C N6    1 
ATOM   260  N N1    . DA  A 1 13  ? 24.255  3.220   9.401   1.00 39.34 ? 13   DA  C N1    1 
ATOM   261  C C2    . DA  A 1 13  ? 25.362  3.931   9.592   1.00 38.81 ? 13   DA  C C2    1 
ATOM   262  N N3    . DA  A 1 13  ? 25.537  5.239   9.526   1.00 38.58 ? 13   DA  C N3    1 
ATOM   263  C C4    . DA  A 1 13  ? 24.383  5.851   9.242   1.00 36.68 ? 13   DA  C C4    1 
ATOM   264  P P     . DA  A 1 14  ? 28.587  10.779  8.315   1.00 53.44 ? 14   DA  C P     1 
ATOM   265  O OP1   . DA  A 1 14  ? 28.657  11.123  9.761   1.00 49.90 ? 14   DA  C OP1   1 
ATOM   266  O OP2   . DA  A 1 14  ? 28.794  11.841  7.302   1.00 57.09 ? 14   DA  C OP2   1 
ATOM   267  O "O5'" . DA  A 1 14  ? 29.640  9.656   7.977   1.00 51.03 ? 14   DA  C "O5'" 1 
ATOM   268  C "C5'" . DA  A 1 14  ? 29.808  8.560   8.865   1.00 53.92 ? 14   DA  C "C5'" 1 
ATOM   269  C "C4'" . DA  A 1 14  ? 30.071  7.293   8.091   1.00 52.95 ? 14   DA  C "C4'" 1 
ATOM   270  O "O4'" . DA  A 1 14  ? 28.883  6.494   7.881   1.00 51.99 ? 14   DA  C "O4'" 1 
ATOM   271  C "C3'" . DA  A 1 14  ? 30.673  7.506   6.712   1.00 53.25 ? 14   DA  C "C3'" 1 
ATOM   272  O "O3'" . DA  A 1 14  ? 31.657  6.519   6.515   1.00 55.37 ? 14   DA  C "O3'" 1 
ATOM   273  C "C2'" . DA  A 1 14  ? 29.524  7.202   5.774   1.00 50.39 ? 14   DA  C "C2'" 1 
ATOM   274  C "C1'" . DA  A 1 14  ? 28.872  6.068   6.529   1.00 49.90 ? 14   DA  C "C1'" 1 
ATOM   275  N N9    . DA  A 1 14  ? 27.483  5.809   6.162   1.00 43.33 ? 14   DA  C N9    1 
ATOM   276  C C8    . DA  A 1 14  ? 26.567  6.744   5.817   1.00 41.11 ? 14   DA  C C8    1 
ATOM   277  N N7    . DA  A 1 14  ? 25.374  6.257   5.613   1.00 45.59 ? 14   DA  C N7    1 
ATOM   278  C C5    . DA  A 1 14  ? 25.522  4.901   5.829   1.00 36.35 ? 14   DA  C C5    1 
ATOM   279  C C6    . DA  A 1 14  ? 24.608  3.837   5.806   1.00 38.70 ? 14   DA  C C6    1 
ATOM   280  N N6    . DA  A 1 14  ? 23.317  3.995   5.530   1.00 41.09 ? 14   DA  C N6    1 
ATOM   281  N N1    . DA  A 1 14  ? 25.071  2.602   6.081   1.00 37.30 ? 14   DA  C N1    1 
ATOM   282  C C2    . DA  A 1 14  ? 26.365  2.457   6.344   1.00 34.65 ? 14   DA  C C2    1 
ATOM   283  N N3    . DA  A 1 14  ? 27.321  3.382   6.399   1.00 39.26 ? 14   DA  C N3    1 
ATOM   284  C C4    . DA  A 1 14  ? 26.822  4.598   6.139   1.00 37.50 ? 14   DA  C C4    1 
ATOM   285  P P     . DA  A 1 15  ? 32.371  6.429   5.102   1.00 58.54 ? 15   DA  C P     1 
ATOM   286  O OP1   . DA  A 1 15  ? 33.719  6.975   5.258   1.00 60.05 ? 15   DA  C OP1   1 
ATOM   287  O OP2   . DA  A 1 15  ? 31.458  6.997   4.065   1.00 56.57 ? 15   DA  C OP2   1 
ATOM   288  O "O5'" . DA  A 1 15  ? 32.495  4.863   4.898   1.00 57.70 ? 15   DA  C "O5'" 1 
ATOM   289  C "C5'" . DA  A 1 15  ? 32.519  3.995   6.031   1.00 55.80 ? 15   DA  C "C5'" 1 
ATOM   290  C "C4'" . DA  A 1 15  ? 32.041  2.629   5.615   1.00 58.16 ? 15   DA  C "C4'" 1 
ATOM   291  O "O4'" . DA  A 1 15  ? 30.612  2.661   5.379   1.00 57.03 ? 15   DA  C "O4'" 1 
ATOM   292  C "C3'" . DA  A 1 15  ? 32.674  2.141   4.310   1.00 56.88 ? 15   DA  C "C3'" 1 
ATOM   293  O "O3'" . DA  A 1 15  ? 32.886  0.739   4.419   1.00 59.80 ? 15   DA  C "O3'" 1 
ATOM   294  C "C2'" . DA  A 1 15  ? 31.615  2.444   3.272   1.00 54.60 ? 15   DA  C "C2'" 1 
ATOM   295  C "C1'" . DA  A 1 15  ? 30.332  2.212   4.062   1.00 54.01 ? 15   DA  C "C1'" 1 
ATOM   296  N N9    . DA  A 1 15  ? 29.160  2.954   3.578   1.00 51.02 ? 15   DA  C N9    1 
ATOM   297  C C8    . DA  A 1 15  ? 29.098  4.284   3.239   1.00 49.87 ? 15   DA  C C8    1 
ATOM   298  N N7    . DA  A 1 15  ? 27.907  4.675   2.852   1.00 47.98 ? 15   DA  C N7    1 
ATOM   299  C C5    . DA  A 1 15  ? 27.135  3.531   2.940   1.00 40.86 ? 15   DA  C C5    1 
ATOM   300  C C6    . DA  A 1 15  ? 25.782  3.291   2.681   1.00 39.59 ? 15   DA  C C6    1 
ATOM   301  N N6    . DA  A 1 15  ? 24.930  4.233   2.276   1.00 41.97 ? 15   DA  C N6    1 
ATOM   302  N N1    . DA  A 1 15  ? 25.323  2.043   2.866   1.00 44.21 ? 15   DA  C N1    1 
ATOM   303  C C2    . DA  A 1 15  ? 26.174  1.099   3.296   1.00 46.35 ? 15   DA  C C2    1 
ATOM   304  N N3    . DA  A 1 15  ? 27.472  1.202   3.581   1.00 46.55 ? 15   DA  C N3    1 
ATOM   305  C C4    . DA  A 1 15  ? 27.894  2.459   3.379   1.00 46.40 ? 15   DA  C C4    1 
ATOM   306  P P     . DA  A 1 16  ? 33.758  -0.040  3.320   1.00 60.69 ? 16   DA  C P     1 
ATOM   307  O OP1   . DA  A 1 16  ? 34.692  -0.934  4.083   1.00 58.71 ? 16   DA  C OP1   1 
ATOM   308  O OP2   . DA  A 1 16  ? 34.294  0.905   2.311   1.00 58.76 ? 16   DA  C OP2   1 
ATOM   309  O "O5'" . DA  A 1 16  ? 32.652  -0.965  2.676   1.00 57.97 ? 16   DA  C "O5'" 1 
ATOM   310  C "C5'" . DA  A 1 16  ? 31.792  -1.681  3.535   1.00 57.37 ? 16   DA  C "C5'" 1 
ATOM   311  C "C4'" . DA  A 1 16  ? 30.602  -2.172  2.760   1.00 59.57 ? 16   DA  C "C4'" 1 
ATOM   312  O "O4'" . DA  A 1 16  ? 29.712  -1.063  2.454   1.00 58.23 ? 16   DA  C "O4'" 1 
ATOM   313  C "C3'" . DA  A 1 16  ? 30.972  -2.826  1.428   1.00 59.63 ? 16   DA  C "C3'" 1 
ATOM   314  O "O3'" . DA  A 1 16  ? 30.367  -4.124  1.381   1.00 65.47 ? 16   DA  C "O3'" 1 
ATOM   315  C "C2'" . DA  A 1 16  ? 30.399  -1.871  0.386   1.00 57.97 ? 16   DA  C "C2'" 1 
ATOM   316  C "C1'" . DA  A 1 16  ? 29.235  -1.231  1.132   1.00 55.90 ? 16   DA  C "C1'" 1 
ATOM   317  N N9    . DA  A 1 16  ? 28.791  0.074   0.640   1.00 50.10 ? 16   DA  C N9    1 
ATOM   318  C C8    . DA  A 1 16  ? 29.568  1.163   0.377   1.00 46.71 ? 16   DA  C C8    1 
ATOM   319  N N7    . DA  A 1 16  ? 28.890  2.206   -0.048  1.00 50.39 ? 16   DA  C N7    1 
ATOM   320  C C5    . DA  A 1 16  ? 27.575  1.773   -0.066  1.00 47.88 ? 16   DA  C C5    1 
ATOM   321  C C6    . DA  A 1 16  ? 26.367  2.416   -0.412  1.00 48.51 ? 16   DA  C C6    1 
ATOM   322  N N6    . DA  A 1 16  ? 26.289  3.687   -0.794  1.00 47.71 ? 16   DA  C N6    1 
ATOM   323  N N1    . DA  A 1 16  ? 25.230  1.699   -0.335  1.00 45.87 ? 16   DA  C N1    1 
ATOM   324  C C2    . DA  A 1 16  ? 25.303  0.435   0.080   1.00 46.93 ? 16   DA  C C2    1 
ATOM   325  N N3    . DA  A 1 16  ? 26.373  -0.271  0.446   1.00 48.09 ? 16   DA  C N3    1 
ATOM   326  C C4    . DA  A 1 16  ? 27.495  0.463   0.349   1.00 49.70 ? 16   DA  C C4    1 
ATOM   327  P P     . DA  A 1 17  ? 30.548  -5.066  0.091   1.00 67.92 ? 17   DA  C P     1 
ATOM   328  O OP1   . DA  A 1 17  ? 31.273  -6.295  0.545   1.00 65.05 ? 17   DA  C OP1   1 
ATOM   329  O OP2   . DA  A 1 17  ? 31.089  -4.257  -1.055  1.00 66.12 ? 17   DA  C OP2   1 
ATOM   330  O "O5'" . DA  A 1 17  ? 29.039  -5.412  -0.278  1.00 63.94 ? 17   DA  C "O5'" 1 
ATOM   331  C "C5'" . DA  A 1 17  ? 28.091  -4.352  -0.270  1.00 62.46 ? 17   DA  C "C5'" 1 
ATOM   332  C "C4'" . DA  A 1 17  ? 26.826  -4.768  -0.967  1.00 60.53 ? 17   DA  C "C4'" 1 
ATOM   333  O "O4'" . DA  A 1 17  ? 26.124  -3.555  -1.303  1.00 60.34 ? 17   DA  C "O4'" 1 
ATOM   334  C "C3'" . DA  A 1 17  ? 27.073  -5.468  -2.290  1.00 61.42 ? 17   DA  C "C3'" 1 
ATOM   335  O "O3'" . DA  A 1 17  ? 26.009  -6.399  -2.481  1.00 65.72 ? 17   DA  C "O3'" 1 
ATOM   336  C "C2'" . DA  A 1 17  ? 27.083  -4.333  -3.301  1.00 58.77 ? 17   DA  C "C2'" 1 
ATOM   337  C "C1'" . DA  A 1 17  ? 26.154  -3.285  -2.691  1.00 56.12 ? 17   DA  C "C1'" 1 
ATOM   338  N N9    . DA  A 1 17  ? 26.623  -1.901  -2.869  1.00 52.84 ? 17   DA  C N9    1 
ATOM   339  C C8    . DA  A 1 17  ? 27.931  -1.468  -2.827  1.00 47.40 ? 17   DA  C C8    1 
ATOM   340  N N7    . DA  A 1 17  ? 28.073  -0.186  -3.055  1.00 46.79 ? 17   DA  C N7    1 
ATOM   341  C C5    . DA  A 1 17  ? 26.778  0.269   -3.245  1.00 46.22 ? 17   DA  C C5    1 
ATOM   342  C C6    . DA  A 1 17  ? 26.268  1.541   -3.521  1.00 47.97 ? 17   DA  C C6    1 
ATOM   343  N N6    . DA  A 1 17  ? 27.025  2.620   -3.636  1.00 52.85 ? 17   DA  C N6    1 
ATOM   344  N N1    . DA  A 1 17  ? 24.931  1.669   -3.663  1.00 50.07 ? 17   DA  C N1    1 
ATOM   345  C C2    . DA  A 1 17  ? 24.170  0.581   -3.505  1.00 49.23 ? 17   DA  C C2    1 
ATOM   346  N N3    . DA  A 1 17  ? 24.535  -0.673  -3.234  1.00 48.87 ? 17   DA  C N3    1 
ATOM   347  C C4    . DA  A 1 17  ? 25.873  -0.768  -3.123  1.00 48.35 ? 17   DA  C C4    1 
HETATM 348  N N1    . 5IU A 1 18  ? 24.928  -2.112  -6.500  1.00 63.23 ? 18   5IU C N1    1 
HETATM 349  C C2    . 5IU A 1 18  ? 24.704  -0.775  -6.709  1.00 60.57 ? 18   5IU C C2    1 
HETATM 350  N N3    . 5IU A 1 18  ? 25.842  -0.020  -6.879  1.00 57.63 ? 18   5IU C N3    1 
HETATM 351  C C4    . 5IU A 1 18  ? 27.147  -0.471  -6.876  1.00 59.30 ? 18   5IU C C4    1 
HETATM 352  C C5    . 5IU A 1 18  ? 27.312  -1.899  -6.636  1.00 59.16 ? 18   5IU C C5    1 
HETATM 353  C C6    . 5IU A 1 18  ? 26.207  -2.634  -6.462  1.00 62.00 ? 18   5IU C C6    1 
HETATM 354  O O2    . 5IU A 1 18  ? 23.587  -0.293  -6.753  1.00 53.60 ? 18   5IU C O2    1 
HETATM 355  O O4    . 5IU A 1 18  ? 28.055  0.318   -7.070  1.00 64.97 ? 18   5IU C O4    1 
HETATM 356  I I5    . 5IU A 1 18  ? 29.115  -2.652  -6.570  0.33 70.79 ? 18   5IU C I5    1 
HETATM 357  C "C1'" . 5IU A 1 18  ? 23.745  -2.972  -6.321  1.00 64.71 ? 18   5IU C "C1'" 1 
HETATM 358  C "C2'" . 5IU A 1 18  ? 23.802  -4.290  -7.061  1.00 66.74 ? 18   5IU C "C2'" 1 
HETATM 359  C "C3'" . 5IU A 1 18  ? 22.827  -5.131  -6.251  1.00 65.16 ? 18   5IU C "C3'" 1 
HETATM 360  C "C4'" . 5IU A 1 18  ? 22.954  -4.588  -4.840  1.00 64.87 ? 18   5IU C "C4'" 1 
HETATM 361  O "O3'" . 5IU A 1 18  ? 21.526  -4.869  -6.699  1.00 66.03 ? 18   5IU C "O3'" 1 
HETATM 362  O "O4'" . 5IU A 1 18  ? 23.680  -3.341  -4.958  1.00 67.29 ? 18   5IU C "O4'" 1 
HETATM 363  C "C5'" . 5IU A 1 18  ? 23.680  -5.556  -3.947  1.00 63.81 ? 18   5IU C "C5'" 1 
HETATM 364  O "O5'" . 5IU A 1 18  ? 24.782  -6.085  -4.650  1.00 63.49 ? 18   5IU C "O5'" 1 
HETATM 365  P P     . 5IU A 1 18  ? 25.784  -7.070  -3.922  1.00 67.32 ? 18   5IU C P     1 
HETATM 366  O OP1   . 5IU A 1 18  ? 25.110  -8.376  -3.679  1.00 69.10 ? 18   5IU C OP1   1 
HETATM 367  O OP2   . 5IU A 1 18  ? 27.065  -7.027  -4.679  1.00 70.87 ? 18   5IU C OP2   1 
HETATM 368  N N1    . 5IU A 1 19  ? 22.187  -0.971  -9.942  1.00 58.95 ? 19   5IU C N1    1 
HETATM 369  C C2    . 5IU A 1 19  ? 22.679  0.307   -9.863  1.00 56.03 ? 19   5IU C C2    1 
HETATM 370  N N3    . 5IU A 1 19  ? 24.041  0.399   -9.860  1.00 48.92 ? 19   5IU C N3    1 
HETATM 371  C C4    . 5IU A 1 19  ? 24.941  -0.643  -9.906  1.00 55.95 ? 19   5IU C C4    1 
HETATM 372  C C5    . 5IU A 1 19  ? 24.353  -1.978  -10.002 1.00 57.17 ? 19   5IU C C5    1 
HETATM 373  C C6    . 5IU A 1 19  ? 23.019  -2.064  -10.024 1.00 57.22 ? 19   5IU C C6    1 
HETATM 374  O O2    . 5IU A 1 19  ? 21.959  1.278   -9.794  1.00 55.19 ? 19   5IU C O2    1 
HETATM 375  O O4    . 5IU A 1 19  ? 26.134  -0.401  -9.846  1.00 55.72 ? 19   5IU C O4    1 
HETATM 376  I I5    . 5IU A 1 19  ? 25.522  -3.556  -10.083 0.48 72.48 ? 19   5IU C I5    1 
HETATM 377  C "C1'" . 5IU A 1 19  ? 20.729  -1.124  -9.914  1.00 60.97 ? 19   5IU C "C1'" 1 
HETATM 378  C "C2'" . 5IU A 1 19  ? 20.165  -2.128  -10.890 1.00 63.12 ? 19   5IU C "C2'" 1 
HETATM 379  C "C3'" . 5IU A 1 19  ? 18.857  -2.505  -10.207 1.00 65.22 ? 19   5IU C "C3'" 1 
HETATM 380  C "C4'" . 5IU A 1 19  ? 19.163  -2.376  -8.723  1.00 64.46 ? 19   5IU C "C4'" 1 
HETATM 381  O "O3'" . 5IU A 1 19  ? 17.834  -1.581  -10.537 1.00 65.41 ? 19   5IU C "O3'" 1 
HETATM 382  O "O4'" . 5IU A 1 19  ? 20.394  -1.635  -8.644  1.00 64.10 ? 19   5IU C "O4'" 1 
HETATM 383  C "C5'" . 5IU A 1 19  ? 19.295  -3.696  -8.007  1.00 62.58 ? 19   5IU C "C5'" 1 
HETATM 384  O "O5'" . 5IU A 1 19  ? 20.167  -4.548  -8.727  1.00 63.42 ? 19   5IU C "O5'" 1 
HETATM 385  P P     . 5IU A 1 19  ? 20.983  -5.666  -7.952  1.00 67.21 ? 19   5IU C P     1 
HETATM 386  O OP1   . 5IU A 1 19  ? 20.037  -6.698  -7.421  1.00 64.94 ? 19   5IU C OP1   1 
HETATM 387  O OP2   . 5IU A 1 19  ? 22.183  -6.078  -8.759  1.00 64.63 ? 19   5IU C OP2   1 
HETATM 388  N N1    . 5IU A 1 20  ? 22.298  1.011   -13.683 1.00 58.00 ? 20   5IU C N1    1 
HETATM 389  C C2    . 5IU A 1 20  ? 23.600  1.487   -13.583 1.00 60.57 ? 20   5IU C C2    1 
HETATM 390  N N3    . 5IU A 1 20  ? 24.567  0.520   -13.496 1.00 60.07 ? 20   5IU C N3    1 
HETATM 391  C C4    . 5IU A 1 20  ? 24.382  -0.844  -13.499 1.00 66.05 ? 20   5IU C C4    1 
HETATM 392  C C5    . 5IU A 1 20  ? 23.008  -1.284  -13.624 1.00 66.46 ? 20   5IU C C5    1 
HETATM 393  C C6    . 5IU A 1 20  ? 22.038  -0.350  -13.710 1.00 62.04 ? 20   5IU C C6    1 
HETATM 394  O O2    . 5IU A 1 20  ? 23.881  2.672   -13.573 1.00 59.45 ? 20   5IU C O2    1 
HETATM 395  O O4    . 5IU A 1 20  ? 25.351  -1.604  -13.396 1.00 62.10 ? 20   5IU C O4    1 
HETATM 396  I I5    . 5IU A 1 20  ? 22.660  -3.204  -13.647 0.54 80.45 ? 20   5IU C I5    1 
HETATM 397  C "C1'" . 5IU A 1 20  ? 21.197  2.006   -13.736 1.00 58.50 ? 20   5IU C "C1'" 1 
HETATM 398  C "C2'" . 5IU A 1 20  ? 19.968  1.583   -14.527 1.00 60.60 ? 20   5IU C "C2'" 1 
HETATM 399  C "C3'" . 5IU A 1 20  ? 18.799  2.200   -13.759 1.00 60.71 ? 20   5IU C "C3'" 1 
HETATM 400  C "C4'" . 5IU A 1 20  ? 19.307  2.243   -12.325 1.00 60.33 ? 20   5IU C "C4'" 1 
HETATM 401  O "O3'" . 5IU A 1 20  ? 18.476  3.525   -14.176 1.00 62.52 ? 20   5IU C "O3'" 1 
HETATM 402  O "O4'" . 5IU A 1 20  ? 20.750  2.215   -12.411 1.00 60.38 ? 20   5IU C "O4'" 1 
HETATM 403  C "C5'" . 5IU A 1 20  ? 18.809  1.105   -11.467 1.00 61.31 ? 20   5IU C "C5'" 1 
HETATM 404  O "O5'" . 5IU A 1 20  ? 18.821  -0.109  -12.219 1.00 64.59 ? 20   5IU C "O5'" 1 
HETATM 405  P P     . 5IU A 1 20  ? 17.644  -1.160  -12.054 1.00 64.11 ? 20   5IU C P     1 
HETATM 406  O OP1   . 5IU A 1 20  ? 16.329  -0.469  -12.212 1.00 62.81 ? 20   5IU C OP1   1 
HETATM 407  O OP2   . 5IU A 1 20  ? 17.939  -2.394  -12.843 1.00 62.01 ? 20   5IU C OP2   1 
HETATM 408  N N1    . 5IU A 1 21  ? 23.428  3.589   -16.948 1.00 59.99 ? 21   5IU C N1    1 
HETATM 409  C C2    . 5IU A 1 21  ? 24.766  3.357   -16.793 1.00 62.51 ? 21   5IU C C2    1 
HETATM 410  N N3    . 5IU A 1 21  ? 25.105  2.025   -16.651 1.00 62.36 ? 21   5IU C N3    1 
HETATM 411  C C4    . 5IU A 1 21  ? 24.255  0.938   -16.722 1.00 64.83 ? 21   5IU C C4    1 
HETATM 412  C C5    . 5IU A 1 21  ? 22.879  1.255   -17.025 1.00 69.51 ? 21   5IU C C5    1 
HETATM 413  C C6    . 5IU A 1 21  ? 22.535  2.552   -17.089 1.00 65.44 ? 21   5IU C C6    1 
HETATM 414  O O2    . 5IU A 1 21  ? 25.593  4.254   -16.811 1.00 60.95 ? 21   5IU C O2    1 
HETATM 415  O O4    . 5IU A 1 21  ? 24.678  -0.187  -16.514 1.00 61.91 ? 21   5IU C O4    1 
HETATM 416  I I5    . 5IU A 1 21  ? 21.618  -0.213  -17.358 0.44 85.21 ? 21   5IU C I5    1 
HETATM 417  C "C1'" . 5IU A 1 21  ? 22.973  4.983   -16.920 1.00 62.69 ? 21   5IU C "C1'" 1 
HETATM 418  C "C2'" . 5IU A 1 21  ? 22.069  5.377   -18.072 1.00 64.82 ? 21   5IU C "C2'" 1 
HETATM 419  C "C3'" . 5IU A 1 21  ? 21.260  6.517   -17.469 1.00 64.67 ? 21   5IU C "C3'" 1 
HETATM 420  C "C4'" . 5IU A 1 21  ? 21.171  6.165   -15.990 1.00 63.45 ? 21   5IU C "C4'" 1 
HETATM 421  O "O3'" . 5IU A 1 21  ? 22.005  7.712   -17.578 1.00 65.69 ? 21   5IU C "O3'" 1 
HETATM 422  O "O4'" . 5IU A 1 21  ? 22.180  5.148   -15.748 1.00 64.65 ? 21   5IU C "O4'" 1 
HETATM 423  C "C5'" . 5IU A 1 21  ? 19.807  5.744   -15.501 1.00 63.05 ? 21   5IU C "C5'" 1 
HETATM 424  O "O5'" . 5IU A 1 21  ? 19.300  4.652   -16.270 1.00 62.91 ? 21   5IU C "O5'" 1 
HETATM 425  P P     . 5IU A 1 21  ? 18.065  3.815   -15.707 1.00 66.07 ? 21   5IU C P     1 
HETATM 426  O OP1   . 5IU A 1 21  ? 16.880  4.728   -15.666 1.00 61.96 ? 21   5IU C OP1   1 
HETATM 427  O OP2   . 5IU A 1 21  ? 17.988  2.521   -16.451 1.00 65.25 ? 21   5IU C OP2   1 
ATOM   428  P P     . DT  A 1 22  ? 21.525  8.856   -18.590 1.00 68.53 ? 22   DT  C P     1 
ATOM   429  O OP1   . DT  A 1 22  ? 21.076  10.008  -17.740 1.00 69.60 ? 22   DT  C OP1   1 
ATOM   430  O OP2   . DT  A 1 22  ? 20.614  8.299   -19.630 1.00 71.07 ? 22   DT  C OP2   1 
ATOM   431  O "O5'" . DT  A 1 22  ? 22.889  9.253   -19.281 1.00 66.16 ? 22   DT  C "O5'" 1 
ATOM   432  C "C5'" . DT  A 1 22  ? 23.982  9.689   -18.477 1.00 62.91 ? 22   DT  C "C5'" 1 
ATOM   433  C "C4'" . DT  A 1 22  ? 25.295  9.365   -19.151 1.00 63.77 ? 22   DT  C "C4'" 1 
ATOM   434  O "O4'" . DT  A 1 22  ? 25.702  8.010   -18.878 1.00 59.11 ? 22   DT  C "O4'" 1 
ATOM   435  C "C3'" . DT  A 1 22  ? 25.316  9.538   -20.680 1.00 65.53 ? 22   DT  C "C3'" 1 
ATOM   436  O "O3'" . DT  A 1 22  ? 26.528  10.127  -21.139 1.00 69.63 ? 22   DT  C "O3'" 1 
ATOM   437  C "C2'" . DT  A 1 22  ? 25.405  8.112   -21.183 1.00 63.68 ? 22   DT  C "C2'" 1 
ATOM   438  C "C1'" . DT  A 1 22  ? 26.224  7.480   -20.074 1.00 58.75 ? 22   DT  C "C1'" 1 
ATOM   439  N N1    . DT  A 1 22  ? 26.040  6.058   -20.031 1.00 55.22 ? 22   DT  C N1    1 
ATOM   440  C C2    . DT  A 1 22  ? 27.134  5.263   -19.820 1.00 52.01 ? 22   DT  C C2    1 
ATOM   441  O O2    . DT  A 1 22  ? 28.257  5.702   -19.653 1.00 49.90 ? 22   DT  C O2    1 
ATOM   442  N N3    . DT  A 1 22  ? 26.867  3.933   -19.818 1.00 48.00 ? 22   DT  C N3    1 
ATOM   443  C C4    . DT  A 1 22  ? 25.643  3.334   -20.007 1.00 50.26 ? 22   DT  C C4    1 
ATOM   444  O O4    . DT  A 1 22  ? 25.563  2.119   -19.986 1.00 52.88 ? 22   DT  C O4    1 
ATOM   445  C C5    . DT  A 1 22  ? 24.526  4.246   -20.222 1.00 51.83 ? 22   DT  C C5    1 
ATOM   446  C C7    . DT  A 1 22  ? 23.149  3.703   -20.449 1.00 50.63 ? 22   DT  C C7    1 
ATOM   447  C C6    . DT  A 1 22  ? 24.784  5.543   -20.214 1.00 53.36 ? 22   DT  C C6    1 
ATOM   448  O "O5'" . DA  B 2 1   ? 33.767  -3.057  -18.919 1.00 76.66 ? 101  DA  D "O5'" 1 
ATOM   449  C "C5'" . DA  B 2 1   ? 34.976  -2.964  -19.707 1.00 71.97 ? 101  DA  D "C5'" 1 
ATOM   450  C "C4'" . DA  B 2 1   ? 35.388  -1.514  -19.661 1.00 68.15 ? 101  DA  D "C4'" 1 
ATOM   451  O "O4'" . DA  B 2 1   ? 34.230  -0.736  -20.029 1.00 66.44 ? 101  DA  D "O4'" 1 
ATOM   452  C "C3'" . DA  B 2 1   ? 35.772  -1.044  -18.259 1.00 67.16 ? 101  DA  D "C3'" 1 
ATOM   453  O "O3'" . DA  B 2 1   ? 36.844  -0.097  -18.333 1.00 67.04 ? 101  DA  D "O3'" 1 
ATOM   454  C "C2'" . DA  B 2 1   ? 34.474  -0.480  -17.687 1.00 63.88 ? 101  DA  D "C2'" 1 
ATOM   455  C "C1'" . DA  B 2 1   ? 33.714  0.009   -18.914 1.00 61.83 ? 101  DA  D "C1'" 1 
ATOM   456  N N9    . DA  B 2 1   ? 32.263  -0.206  -18.883 1.00 52.83 ? 101  DA  D N9    1 
ATOM   457  C C8    . DA  B 2 1   ? 31.626  -1.393  -18.659 1.00 47.08 ? 101  DA  D C8    1 
ATOM   458  N N7    . DA  B 2 1   ? 30.325  -1.321  -18.759 1.00 43.68 ? 101  DA  D N7    1 
ATOM   459  C C5    . DA  B 2 1   ? 30.082  0.008   -19.055 1.00 45.02 ? 101  DA  D C5    1 
ATOM   460  C C6    . DA  B 2 1   ? 28.902  0.717   -19.304 1.00 46.43 ? 101  DA  D C6    1 
ATOM   461  N N6    . DA  B 2 1   ? 27.699  0.163   -19.312 1.00 49.75 ? 101  DA  D N6    1 
ATOM   462  N N1    . DA  B 2 1   ? 29.000  2.034   -19.565 1.00 49.85 ? 101  DA  D N1    1 
ATOM   463  C C2    . DA  B 2 1   ? 30.206  2.584   -19.587 1.00 51.80 ? 101  DA  D C2    1 
ATOM   464  N N3    . DA  B 2 1   ? 31.394  2.022   -19.382 1.00 51.78 ? 101  DA  D N3    1 
ATOM   465  C C4    . DA  B 2 1   ? 31.263  0.713   -19.117 1.00 48.23 ? 101  DA  D C4    1 
ATOM   466  P P     . DA  B 2 2   ? 37.561  0.407   -16.978 1.00 68.28 ? 102  DA  D P     1 
ATOM   467  O OP1   . DA  B 2 2   ? 38.994  0.709   -17.266 1.00 67.27 ? 102  DA  D OP1   1 
ATOM   468  O OP2   . DA  B 2 2   ? 37.216  -0.558  -15.885 1.00 64.64 ? 102  DA  D OP2   1 
ATOM   469  O "O5'" . DA  B 2 2   ? 36.823  1.785   -16.708 1.00 64.22 ? 102  DA  D "O5'" 1 
ATOM   470  C "C5'" . DA  B 2 2   ? 35.481  1.968   -17.169 1.00 63.40 ? 102  DA  D "C5'" 1 
ATOM   471  C "C4'" . DA  B 2 2   ? 35.018  3.360   -16.844 1.00 63.79 ? 102  DA  D "C4'" 1 
ATOM   472  O "O4'" . DA  B 2 2   ? 33.599  3.408   -17.113 1.00 63.28 ? 102  DA  D "O4'" 1 
ATOM   473  C "C3'" . DA  B 2 2   ? 35.178  3.704   -15.363 1.00 66.40 ? 102  DA  D "C3'" 1 
ATOM   474  O "O3'" . DA  B 2 2   ? 35.509  5.083   -15.231 1.00 69.72 ? 102  DA  D "O3'" 1 
ATOM   475  C "C2'" . DA  B 2 2   ? 33.823  3.400   -14.757 1.00 64.45 ? 102  DA  D "C2'" 1 
ATOM   476  C "C1'" . DA  B 2 2   ? 32.855  3.605   -15.916 1.00 61.55 ? 102  DA  D "C1'" 1 
ATOM   477  N N9    . DA  B 2 2   ? 31.792  2.608   -15.904 1.00 56.87 ? 102  DA  D N9    1 
ATOM   478  C C8    . DA  B 2 2   ? 31.930  1.269   -15.640 1.00 55.84 ? 102  DA  D C8    1 
ATOM   479  N N7    . DA  B 2 2   ? 30.803  0.604   -15.695 1.00 54.94 ? 102  DA  D N7    1 
ATOM   480  C C5    . DA  B 2 2   ? 29.862  1.570   -16.015 1.00 48.56 ? 102  DA  D C5    1 
ATOM   481  C C6    . DA  B 2 2   ? 28.482  1.507   -16.210 1.00 45.96 ? 102  DA  D C6    1 
ATOM   482  N N6    . DA  B 2 2   ? 27.774  0.392   -16.057 1.00 44.62 ? 102  DA  D N6    1 
ATOM   483  N N1    . DA  B 2 2   ? 27.841  2.640   -16.552 1.00 45.42 ? 102  DA  D N1    1 
ATOM   484  C C2    . DA  B 2 2   ? 28.549  3.764   -16.655 1.00 45.34 ? 102  DA  D C2    1 
ATOM   485  N N3    . DA  B 2 2   ? 29.854  3.956   -16.469 1.00 44.76 ? 102  DA  D N3    1 
ATOM   486  C C4    . DA  B 2 2   ? 30.458  2.808   -16.153 1.00 48.82 ? 102  DA  D C4    1 
ATOM   487  P P     . DA  B 2 3   ? 35.432  5.790   -13.794 1.00 72.54 ? 103  DA  D P     1 
ATOM   488  O OP1   . DA  B 2 3   ? 36.377  6.960   -13.860 1.00 72.45 ? 103  DA  D OP1   1 
ATOM   489  O OP2   . DA  B 2 3   ? 35.636  4.724   -12.742 1.00 72.49 ? 103  DA  D OP2   1 
ATOM   490  O "O5'" . DA  B 2 3   ? 33.915  6.310   -13.729 1.00 70.86 ? 103  DA  D "O5'" 1 
ATOM   491  C "C5'" . DA  B 2 3   ? 33.452  7.264   -14.703 1.00 72.49 ? 103  DA  D "C5'" 1 
ATOM   492  C "C4'" . DA  B 2 3   ? 32.062  7.758   -14.377 1.00 71.96 ? 103  DA  D "C4'" 1 
ATOM   493  O "O4'" . DA  B 2 3   ? 31.138  6.662   -14.530 1.00 72.19 ? 103  DA  D "O4'" 1 
ATOM   494  C "C3'" . DA  B 2 3   ? 31.831  8.344   -12.978 1.00 72.84 ? 103  DA  D "C3'" 1 
ATOM   495  O "O3'" . DA  B 2 3   ? 31.139  9.594   -13.069 1.00 73.33 ? 103  DA  D "O3'" 1 
ATOM   496  C "C2'" . DA  B 2 3   ? 30.969  7.302   -12.278 1.00 71.32 ? 103  DA  D "C2'" 1 
ATOM   497  C "C1'" . DA  B 2 3   ? 30.270  6.579   -13.412 1.00 68.96 ? 103  DA  D "C1'" 1 
ATOM   498  N N9    . DA  B 2 3   ? 30.032  5.157   -13.150 1.00 64.96 ? 103  DA  D N9    1 
ATOM   499  C C8    . DA  B 2 3   ? 30.918  4.217   -12.680 1.00 62.87 ? 103  DA  D C8    1 
ATOM   500  N N7    . DA  B 2 3   ? 30.393  3.021   -12.538 1.00 59.46 ? 103  DA  D N7    1 
ATOM   501  C C5    . DA  B 2 3   ? 29.076  3.184   -12.945 1.00 58.18 ? 103  DA  D C5    1 
ATOM   502  C C6    . DA  B 2 3   ? 27.997  2.291   -13.034 1.00 56.55 ? 103  DA  D C6    1 
ATOM   503  N N6    . DA  B 2 3   ? 28.089  1.008   -12.725 1.00 55.50 ? 103  DA  D N6    1 
ATOM   504  N N1    . DA  B 2 3   ? 26.810  2.771   -13.471 1.00 55.82 ? 103  DA  D N1    1 
ATOM   505  C C2    . DA  B 2 3   ? 26.736  4.064   -13.816 1.00 56.63 ? 103  DA  D C2    1 
ATOM   506  N N3    . DA  B 2 3   ? 27.685  4.999   -13.787 1.00 56.54 ? 103  DA  D N3    1 
ATOM   507  C C4    . DA  B 2 3   ? 28.840  4.491   -13.333 1.00 59.70 ? 103  DA  D C4    1 
ATOM   508  P P     . DA  B 2 4   ? 30.506  10.265  -11.740 1.00 76.35 ? 104  DA  D P     1 
ATOM   509  O OP1   . DA  B 2 4   ? 30.644  11.746  -11.905 1.00 76.63 ? 104  DA  D OP1   1 
ATOM   510  O OP2   . DA  B 2 4   ? 30.997  9.624   -10.487 1.00 77.49 ? 104  DA  D OP2   1 
ATOM   511  O "O5'" . DA  B 2 4   ? 28.971  9.892   -11.863 1.00 74.77 ? 104  DA  D "O5'" 1 
ATOM   512  C "C5'" . DA  B 2 4   ? 28.250  10.178  -13.066 1.00 72.00 ? 104  DA  D "C5'" 1 
ATOM   513  C "C4'" . DA  B 2 4   ? 26.784  9.931   -12.832 1.00 70.29 ? 104  DA  D "C4'" 1 
ATOM   514  O "O4'" . DA  B 2 4   ? 26.580  8.507   -12.688 1.00 69.84 ? 104  DA  D "O4'" 1 
ATOM   515  C "C3'" . DA  B 2 4   ? 26.293  10.561  -11.533 1.00 69.98 ? 104  DA  D "C3'" 1 
ATOM   516  O "O3'" . DA  B 2 4   ? 24.952  11.004  -11.679 1.00 71.92 ? 104  DA  D "O3'" 1 
ATOM   517  C "C2'" . DA  B 2 4   ? 26.364  9.422   -10.532 1.00 69.02 ? 104  DA  D "C2'" 1 
ATOM   518  C "C1'" . DA  B 2 4   ? 26.089  8.193   -11.392 1.00 66.56 ? 104  DA  D "C1'" 1 
ATOM   519  N N9    . DA  B 2 4   ? 26.777  6.980   -10.938 1.00 62.08 ? 104  DA  D N9    1 
ATOM   520  C C8    . DA  B 2 4   ? 28.073  6.872   -10.473 1.00 57.77 ? 104  DA  D C8    1 
ATOM   521  N N7    . DA  B 2 4   ? 28.415  5.650   -10.133 1.00 54.10 ? 104  DA  D N7    1 
ATOM   522  C C5    . DA  B 2 4   ? 27.271  4.894   -10.400 1.00 56.55 ? 104  DA  D C5    1 
ATOM   523  C C6    . DA  B 2 4   ? 26.980  3.499   -10.269 1.00 52.98 ? 104  DA  D C6    1 
ATOM   524  N N6    . DA  B 2 4   ? 27.841  2.601   -9.780  1.00 49.36 ? 104  DA  D N6    1 
ATOM   525  N N1    . DA  B 2 4   ? 25.754  3.075   -10.654 1.00 51.20 ? 104  DA  D N1    1 
ATOM   526  C C2    . DA  B 2 4   ? 24.876  3.984   -11.110 1.00 51.55 ? 104  DA  D C2    1 
ATOM   527  N N3    . DA  B 2 4   ? 25.021  5.311   -11.262 1.00 51.82 ? 104  DA  D N3    1 
ATOM   528  C C4    . DA  B 2 4   ? 26.255  5.704   -10.892 1.00 56.28 ? 104  DA  D C4    1 
ATOM   529  P P     . DA  B 2 5   ? 24.174  11.591  -10.406 1.00 73.15 ? 105  DA  D P     1 
ATOM   530  O OP1   . DA  B 2 5   ? 23.574  12.912  -10.775 1.00 75.39 ? 105  DA  D OP1   1 
ATOM   531  O OP2   . DA  B 2 5   ? 25.122  11.497  -9.245  1.00 74.72 ? 105  DA  D OP2   1 
ATOM   532  O "O5'" . DA  B 2 5   ? 22.958  10.574  -10.192 1.00 71.83 ? 105  DA  D "O5'" 1 
ATOM   533  C "C5'" . DA  B 2 5   ? 23.194  9.173   -10.031 1.00 65.95 ? 105  DA  D "C5'" 1 
ATOM   534  C "C4'" . DA  B 2 5   ? 21.886  8.430   -9.888  1.00 63.53 ? 105  DA  D "C4'" 1 
ATOM   535  O "O4'" . DA  B 2 5   ? 22.227  7.041   -9.723  1.00 61.73 ? 105  DA  D "O4'" 1 
ATOM   536  C "C3'" . DA  B 2 5   ? 21.078  8.804   -8.653  1.00 62.26 ? 105  DA  D "C3'" 1 
ATOM   537  O "O3'" . DA  B 2 5   ? 19.684  8.598   -8.898  1.00 64.50 ? 105  DA  D "O3'" 1 
ATOM   538  C "C2'" . DA  B 2 5   ? 21.618  7.865   -7.594  1.00 60.59 ? 105  DA  D "C2'" 1 
ATOM   539  C "C1'" . DA  B 2 5   ? 22.119  6.648   -8.372  1.00 57.45 ? 105  DA  D "C1'" 1 
ATOM   540  N N9    . DA  B 2 5   ? 23.444  6.205   -7.945  1.00 52.80 ? 105  DA  D N9    1 
ATOM   541  C C8    . DA  B 2 5   ? 24.523  6.992   -7.600  1.00 51.20 ? 105  DA  D C8    1 
ATOM   542  N N7    . DA  B 2 5   ? 25.580  6.313   -7.234  1.00 48.84 ? 105  DA  D N7    1 
ATOM   543  C C5    . DA  B 2 5   ? 25.177  4.985   -7.353  1.00 44.83 ? 105  DA  D C5    1 
ATOM   544  C C6    . DA  B 2 5   ? 25.838  3.781   -7.109  1.00 43.01 ? 105  DA  D C6    1 
ATOM   545  N N6    . DA  B 2 5   ? 27.096  3.706   -6.690  1.00 48.30 ? 105  DA  D N6    1 
ATOM   546  N N1    . DA  B 2 5   ? 25.156  2.635   -7.317  1.00 46.23 ? 105  DA  D N1    1 
ATOM   547  C C2    . DA  B 2 5   ? 23.895  2.716   -7.762  1.00 45.40 ? 105  DA  D C2    1 
ATOM   548  N N3    . DA  B 2 5   ? 23.167  3.790   -8.032  1.00 44.18 ? 105  DA  D N3    1 
ATOM   549  C C4    . DA  B 2 5   ? 23.872  4.907   -7.797  1.00 47.10 ? 105  DA  D C4    1 
ATOM   550  P P     . DT  B 2 6   ? 18.596  9.197   -7.867  1.00 67.91 ? 106  DT  D P     1 
ATOM   551  O OP1   . DT  B 2 6   ? 17.379  9.674   -8.603  1.00 68.00 ? 106  DT  D OP1   1 
ATOM   552  O OP2   . DT  B 2 6   ? 19.307  10.131  -6.951  1.00 67.05 ? 106  DT  D OP2   1 
ATOM   553  O "O5'" . DT  B 2 6   ? 18.182  7.916   -7.031  1.00 65.19 ? 106  DT  D "O5'" 1 
ATOM   554  C "C5'" . DT  B 2 6   ? 19.148  6.916   -6.728  1.00 59.88 ? 106  DT  D "C5'" 1 
ATOM   555  C "C4'" . DT  B 2 6   ? 18.462  5.598   -6.478  1.00 58.51 ? 106  DT  D "C4'" 1 
ATOM   556  O "O4'" . DT  B 2 6   ? 19.498  4.604   -6.482  1.00 54.67 ? 106  DT  D "O4'" 1 
ATOM   557  C "C3'" . DT  B 2 6   ? 17.755  5.483   -5.127  1.00 60.36 ? 106  DT  D "C3'" 1 
ATOM   558  O "O3'" . DT  B 2 6   ? 16.532  4.748   -5.264  1.00 66.17 ? 106  DT  D "O3'" 1 
ATOM   559  C "C2'" . DT  B 2 6   ? 18.761  4.775   -4.238  1.00 57.87 ? 106  DT  D "C2'" 1 
ATOM   560  C "C1'" . DT  B 2 6   ? 19.732  4.083   -5.191  1.00 55.21 ? 106  DT  D "C1'" 1 
ATOM   561  N N1    . DT  B 2 6   ? 21.110  4.423   -4.859  1.00 51.20 ? 106  DT  D N1    1 
ATOM   562  C C2    . DT  B 2 6   ? 22.034  3.424   -4.735  1.00 51.71 ? 106  DT  D C2    1 
ATOM   563  O O2    . DT  B 2 6   ? 21.745  2.255   -4.863  1.00 55.42 ? 106  DT  D O2    1 
ATOM   564  N N3    . DT  B 2 6   ? 23.313  3.846   -4.443  1.00 46.74 ? 106  DT  D N3    1 
ATOM   565  C C4    . DT  B 2 6   ? 23.731  5.148   -4.262  1.00 47.73 ? 106  DT  D C4    1 
ATOM   566  O O4    . DT  B 2 6   ? 24.911  5.383   -4.008  1.00 45.86 ? 106  DT  D O4    1 
ATOM   567  C C5    . DT  B 2 6   ? 22.687  6.154   -4.396  1.00 48.39 ? 106  DT  D C5    1 
ATOM   568  C C7    . DT  B 2 6   ? 23.033  7.597   -4.203  1.00 49.13 ? 106  DT  D C7    1 
ATOM   569  C C6    . DT  B 2 6   ? 21.449  5.743   -4.688  1.00 49.19 ? 106  DT  D C6    1 
HETATM 570  N N1    . 5IU B 2 7   ? 20.382  1.743   -1.591  1.00 55.96 ? 107  5IU D N1    1 
HETATM 571  C C2    . 5IU B 2 7   ? 21.654  1.226   -1.432  1.00 51.74 ? 107  5IU D C2    1 
HETATM 572  N N3    . 5IU B 2 7   ? 22.615  2.152   -1.174  1.00 49.58 ? 107  5IU D N3    1 
HETATM 573  C C4    . 5IU B 2 7   ? 22.448  3.498   -1.026  1.00 51.94 ? 107  5IU D C4    1 
HETATM 574  C C5    . 5IU B 2 7   ? 21.107  3.966   -1.162  1.00 53.24 ? 107  5IU D C5    1 
HETATM 575  C C6    . 5IU B 2 7   ? 20.149  3.085   -1.456  1.00 55.13 ? 107  5IU D C6    1 
HETATM 576  O O2    . 5IU B 2 7   ? 21.917  0.054   -1.496  1.00 47.53 ? 107  5IU D O2    1 
HETATM 577  O O4    . 5IU B 2 7   ? 23.413  4.215   -0.795  1.00 47.42 ? 107  5IU D O4    1 
HETATM 578  I I5    . 5IU B 2 7   ? 20.766  5.860   -0.881  0.29 76.59 ? 107  5IU D I5    1 
HETATM 579  C "C1'" . 5IU B 2 7   ? 19.258  0.827   -1.906  1.00 60.34 ? 107  5IU D "C1'" 1 
HETATM 580  C "C2'" . 5IU B 2 7   ? 17.956  1.124   -1.183  1.00 62.36 ? 107  5IU D "C2'" 1 
HETATM 581  C "C3'" . 5IU B 2 7   ? 16.907  0.558   -2.132  1.00 63.83 ? 107  5IU D "C3'" 1 
HETATM 582  C "C4'" . 5IU B 2 7   ? 17.547  0.689   -3.510  1.00 62.51 ? 107  5IU D "C4'" 1 
HETATM 583  O "O3'" . 5IU B 2 7   ? 16.619  -0.816  -1.885  1.00 65.67 ? 107  5IU D "O3'" 1 
HETATM 584  O "O4'" . 5IU B 2 7   ? 18.948  0.973   -3.285  1.00 61.99 ? 107  5IU D "O4'" 1 
HETATM 585  C "C5'" . 5IU B 2 7   ? 16.928  1.793   -4.314  1.00 64.01 ? 107  5IU D "C5'" 1 
HETATM 586  O "O5'" . 5IU B 2 7   ? 16.824  2.966   -3.521  1.00 65.72 ? 107  5IU D "O5'" 1 
HETATM 587  P P     . 5IU B 2 7   ? 15.823  4.117   -3.971  1.00 67.90 ? 107  5IU D P     1 
HETATM 588  O OP1   . 5IU B 2 7   ? 14.535  3.464   -4.385  1.00 67.87 ? 107  5IU D OP1   1 
HETATM 589  O OP2   . 5IU B 2 7   ? 15.816  5.174   -2.916  1.00 70.40 ? 107  5IU D OP2   1 
HETATM 590  N N1    . 5IU B 2 8   ? 21.330  -0.756  1.675   1.00 47.68 ? 108  5IU D N1    1 
HETATM 591  C C2    . 5IU B 2 8   ? 22.621  -0.424  2.064   1.00 47.08 ? 108  5IU D C2    1 
HETATM 592  N N3    . 5IU B 2 8   ? 22.830  0.891   2.294   1.00 44.50 ? 108  5IU D N3    1 
HETATM 593  C C4    . 5IU B 2 8   ? 21.904  1.892   2.212   1.00 53.99 ? 108  5IU D C4    1 
HETATM 594  C C5    . 5IU B 2 8   ? 20.573  1.466   1.839   1.00 54.84 ? 108  5IU D C5    1 
HETATM 595  C C6    . 5IU B 2 8   ? 20.360  0.185   1.585   1.00 52.26 ? 108  5IU D C6    1 
HETATM 596  O O2    . 5IU B 2 8   ? 23.505  -1.228  2.216   1.00 50.14 ? 108  5IU D O2    1 
HETATM 597  O O4    . 5IU B 2 8   ? 22.238  3.051   2.447   1.00 55.87 ? 108  5IU D O4    1 
HETATM 598  I I5    . 5IU B 2 8   ? 19.160  2.787   1.740   0.38 72.98 ? 108  5IU D I5    1 
HETATM 599  C "C1'" . 5IU B 2 8   ? 20.995  -2.139  1.340   1.00 47.85 ? 108  5IU D "C1'" 1 
HETATM 600  C "C2'" . 5IU B 2 8   ? 19.962  -2.745  2.253   1.00 47.79 ? 108  5IU D "C2'" 1 
HETATM 601  C "C3'" . 5IU B 2 8   ? 19.446  -3.870  1.383   1.00 49.05 ? 108  5IU D "C3'" 1 
HETATM 602  C "C4'" . 5IU B 2 8   ? 19.566  -3.313  -0.031  1.00 49.44 ? 108  5IU D "C4'" 1 
HETATM 603  O "O3'" . 5IU B 2 8   ? 20.269  -5.022  1.515   1.00 47.96 ? 108  5IU D "O3'" 1 
HETATM 604  O "O4'" . 5IU B 2 8   ? 20.386  -2.133  0.075   1.00 43.49 ? 108  5IU D "O4'" 1 
HETATM 605  C "C5'" . 5IU B 2 8   ? 18.250  -2.926  -0.655  1.00 54.33 ? 108  5IU D "C5'" 1 
HETATM 606  O "O5'" . 5IU B 2 8   ? 17.605  -1.905  0.122   1.00 62.44 ? 108  5IU D "O5'" 1 
HETATM 607  P P     . 5IU B 2 8   ? 16.228  -1.299  -0.399  1.00 65.20 ? 108  5IU D P     1 
HETATM 608  O OP1   . 5IU B 2 8   ? 15.289  -2.435  -0.616  1.00 64.48 ? 108  5IU D OP1   1 
HETATM 609  O OP2   . 5IU B 2 8   ? 15.791  -0.102  0.398   1.00 62.50 ? 108  5IU D OP2   1 
HETATM 610  N N1    . 5IU B 2 9   ? 24.071  -2.164  5.324   1.00 54.54 ? 109  5IU D N1    1 
HETATM 611  C C2    . 5IU B 2 9   ? 25.025  -1.147  5.269   1.00 55.53 ? 109  5IU D C2    1 
HETATM 612  N N3    . 5IU B 2 9   ? 24.501  0.111   5.313   1.00 50.52 ? 109  5IU D N3    1 
HETATM 613  C C4    . 5IU B 2 9   ? 23.175  0.441   5.381   1.00 52.03 ? 109  5IU D C4    1 
HETATM 614  C C5    . 5IU B 2 9   ? 22.282  -0.644  5.416   1.00 48.01 ? 109  5IU D C5    1 
HETATM 615  C C6    . 5IU B 2 9   ? 22.745  -1.876  5.399   1.00 51.16 ? 109  5IU D C6    1 
HETATM 616  O O2    . 5IU B 2 9   ? 26.235  -1.333  5.189   1.00 61.03 ? 109  5IU D O2    1 
HETATM 617  O O4    . 5IU B 2 9   ? 22.828  1.602   5.404   1.00 49.76 ? 109  5IU D O4    1 
HETATM 618  I I5    . 5IU B 2 9   ? 20.411  -0.229  5.459   0.45 70.92 ? 109  5IU D I5    1 
HETATM 619  C "C1'" . 5IU B 2 9   ? 24.493  -3.568  5.285   1.00 53.45 ? 109  5IU D "C1'" 1 
HETATM 620  C "C2'" . 5IU B 2 9   ? 23.644  -4.520  6.098   1.00 54.68 ? 109  5IU D "C2'" 1 
HETATM 621  C "C3'" . 5IU B 2 9   ? 23.969  -5.839  5.418   1.00 56.57 ? 109  5IU D "C3'" 1 
HETATM 622  C "C4'" . 5IU B 2 9   ? 24.181  -5.445  3.954   1.00 55.63 ? 109  5IU D "C4'" 1 
HETATM 623  O "O3'" . 5IU B 2 9   ? 25.204  -6.369  5.915   1.00 60.55 ? 109  5IU D "O3'" 1 
HETATM 624  O "O4'" . 5IU B 2 9   ? 24.347  -4.015  3.960   1.00 55.22 ? 109  5IU D "O4'" 1 
HETATM 625  C "C5'" . 5IU B 2 9   ? 23.060  -5.775  3.000   1.00 53.23 ? 109  5IU D "C5'" 1 
HETATM 626  O "O5'" . 5IU B 2 9   ? 21.873  -5.115  3.406   1.00 51.10 ? 109  5IU D "O5'" 1 
HETATM 627  P P     . 5IU B 2 9   ? 20.462  -5.687  2.957   1.00 50.04 ? 109  5IU D P     1 
HETATM 628  O OP1   . 5IU B 2 9   ? 20.627  -7.131  2.724   1.00 52.03 ? 109  5IU D OP1   1 
HETATM 629  O OP2   . 5IU B 2 9   ? 19.472  -5.203  3.953   1.00 48.09 ? 109  5IU D OP2   1 
HETATM 630  N N1    . 5IU B 2 10  ? 26.192  -1.564  8.936   1.00 48.88 ? 110  5IU D N1    1 
HETATM 631  C C2    . 5IU B 2 10  ? 26.160  -0.187  8.965   1.00 45.77 ? 110  5IU D C2    1 
HETATM 632  N N3    . 5IU B 2 10  ? 24.908  0.353   8.899   1.00 39.18 ? 110  5IU D N3    1 
HETATM 633  C C4    . 5IU B 2 10  ? 23.724  -0.325  8.850   1.00 42.30 ? 110  5IU D C4    1 
HETATM 634  C C5    . 5IU B 2 10  ? 23.832  -1.750  8.873   1.00 44.43 ? 110  5IU D C5    1 
HETATM 635  C C6    . 5IU B 2 10  ? 25.039  -2.297  8.904   1.00 48.66 ? 110  5IU D C6    1 
HETATM 636  O O2    . 5IU B 2 10  ? 27.151  0.504   9.051   1.00 49.68 ? 110  5IU D O2    1 
HETATM 637  O O4    . 5IU B 2 10  ? 22.692  0.284   8.789   1.00 42.82 ? 110  5IU D O4    1 
HETATM 638  I I5    . 5IU B 2 10  ? 22.217  -2.813  8.859   0.33 67.70 ? 110  5IU D I5    1 
HETATM 639  C "C1'" . 5IU B 2 10  ? 27.477  -2.269  8.910   1.00 52.20 ? 110  5IU D "C1'" 1 
HETATM 640  C "C2'" . 5IU B 2 10  ? 27.577  -3.409  9.901   1.00 52.13 ? 110  5IU D "C2'" 1 
HETATM 641  C "C3'" . 5IU B 2 10  ? 28.586  -4.323  9.222   1.00 55.80 ? 110  5IU D "C3'" 1 
HETATM 642  C "C4'" . 5IU B 2 10  ? 28.323  -4.127  7.738   1.00 56.69 ? 110  5IU D "C4'" 1 
HETATM 643  O "O3'" . 5IU B 2 10  ? 29.918  -3.913  9.509   1.00 56.21 ? 110  5IU D "O3'" 1 
HETATM 644  O "O4'" . 5IU B 2 10  ? 27.609  -2.873  7.631   1.00 55.40 ? 110  5IU D "O4'" 1 
HETATM 645  C "C5'" . 5IU B 2 10  ? 27.530  -5.251  7.120   1.00 57.47 ? 110  5IU D "C5'" 1 
HETATM 646  O "O5'" . 5IU B 2 10  ? 26.415  -5.557  7.949   1.00 61.28 ? 110  5IU D "O5'" 1 
HETATM 647  P P     . 5IU B 2 10  ? 25.377  -6.664  7.487   1.00 63.04 ? 110  5IU D P     1 
HETATM 648  O OP1   . 5IU B 2 10  ? 26.039  -7.990  7.541   1.00 65.66 ? 110  5IU D OP1   1 
HETATM 649  O OP2   . 5IU B 2 10  ? 24.103  -6.437  8.211   1.00 58.90 ? 110  5IU D OP2   1 
ATOM   650  P P     . DC  B 2 11  ? 30.445  -4.006  11.011  1.00 56.27 ? 111  DC  D P     1 
ATOM   651  O OP1   . DC  B 2 11  ? 31.923  -4.208  10.908  1.00 56.21 ? 111  DC  D OP1   1 
ATOM   652  O OP2   . DC  B 2 11  ? 29.602  -4.951  11.736  1.00 59.20 ? 111  DC  D OP2   1 
ATOM   653  O "O5'" . DC  B 2 11  ? 30.132  -2.564  11.583  1.00 51.18 ? 111  DC  D "O5'" 1 
ATOM   654  C "C5'" . DC  B 2 11  ? 30.840  -1.460  11.100  1.00 45.99 ? 111  DC  D "C5'" 1 
ATOM   655  C "C4'" . DC  B 2 11  ? 30.464  -0.254  11.907  1.00 45.18 ? 111  DC  D "C4'" 1 
ATOM   656  O "O4'" . DC  B 2 11  ? 29.082  0.065   11.620  1.00 44.58 ? 111  DC  D "O4'" 1 
ATOM   657  C "C3'" . DC  B 2 11  ? 30.537  -0.540  13.401  1.00 42.23 ? 111  DC  D "C3'" 1 
ATOM   658  O "O3'" . DC  B 2 11  ? 31.235  0.517   14.034  1.00 40.24 ? 111  DC  D "O3'" 1 
ATOM   659  C "C2'" . DC  B 2 11  ? 29.073  -0.608  13.824  1.00 41.43 ? 111  DC  D "C2'" 1 
ATOM   660  C "C1'" . DC  B 2 11  ? 28.400  0.296   12.813  1.00 37.65 ? 111  DC  D "C1'" 1 
ATOM   661  N N1    . DC  B 2 11  ? 26.978  0.056   12.572  1.00 37.44 ? 111  DC  D N1    1 
ATOM   662  C C2    . DC  B 2 11  ? 26.112  1.151   12.551  1.00 42.56 ? 111  DC  D C2    1 
ATOM   663  O O2    . DC  B 2 11  ? 26.580  2.283   12.653  1.00 45.75 ? 111  DC  D O2    1 
ATOM   664  N N3    . DC  B 2 11  ? 24.795  0.949   12.403  1.00 38.87 ? 111  DC  D N3    1 
ATOM   665  C C4    . DC  B 2 11  ? 24.327  -0.283  12.259  1.00 37.42 ? 111  DC  D C4    1 
ATOM   666  N N4    . DC  B 2 11  ? 23.021  -0.426  12.121  1.00 40.28 ? 111  DC  D N4    1 
ATOM   667  C C5    . DC  B 2 11  ? 25.182  -1.418  12.248  1.00 37.51 ? 111  DC  D C5    1 
ATOM   668  C C6    . DC  B 2 11  ? 26.495  -1.205  12.401  1.00 35.37 ? 111  DC  D C6    1 
ATOM   669  P P     . DA  B 2 12  ? 31.978  0.251   15.429  1.00 44.33 ? 112  DA  D P     1 
ATOM   670  O OP1   . DA  B 2 12  ? 33.308  0.858   15.293  1.00 40.46 ? 112  DA  D OP1   1 
ATOM   671  O OP2   . DA  B 2 12  ? 31.866  -1.152  15.842  1.00 42.33 ? 112  DA  D OP2   1 
ATOM   672  O "O5'" . DA  B 2 12  ? 31.117  1.109   16.464  1.00 38.87 ? 112  DA  D "O5'" 1 
ATOM   673  C "C5'" . DA  B 2 12  ? 30.915  2.503   16.240  1.00 34.93 ? 112  DA  D "C5'" 1 
ATOM   674  C "C4'" . DA  B 2 12  ? 29.647  2.949   16.917  1.00 35.66 ? 112  DA  D "C4'" 1 
ATOM   675  O "O4'" . DA  B 2 12  ? 28.456  2.467   16.222  1.00 35.84 ? 112  DA  D "O4'" 1 
ATOM   676  C "C3'" . DA  B 2 12  ? 29.523  2.460   18.360  1.00 34.13 ? 112  DA  D "C3'" 1 
ATOM   677  O "O3'" . DA  B 2 12  ? 28.956  3.515   19.144  1.00 33.13 ? 112  DA  D "O3'" 1 
ATOM   678  C "C2'" . DA  B 2 12  ? 28.504  1.342   18.240  1.00 30.75 ? 112  DA  D "C2'" 1 
ATOM   679  C "C1'" . DA  B 2 12  ? 27.583  1.973   17.213  1.00 35.09 ? 112  DA  D "C1'" 1 
ATOM   680  N N9    . DA  B 2 12  ? 26.584  1.110   16.585  1.00 38.72 ? 112  DA  D N9    1 
ATOM   681  C C8    . DA  B 2 12  ? 26.633  -0.243  16.385  1.00 39.10 ? 112  DA  D C8    1 
ATOM   682  N N7    . DA  B 2 12  ? 25.510  -0.745  15.922  1.00 39.68 ? 112  DA  D N7    1 
ATOM   683  C C5    . DA  B 2 12  ? 24.683  0.352   15.788  1.00 37.99 ? 112  DA  D C5    1 
ATOM   684  C C6    . DA  B 2 12  ? 23.347  0.475   15.394  1.00 39.82 ? 112  DA  D C6    1 
ATOM   685  N N6    . DA  B 2 12  ? 22.582  -0.564  15.077  1.00 42.75 ? 112  DA  D N6    1 
ATOM   686  N N1    . DA  B 2 12  ? 22.812  1.713   15.352  1.00 42.99 ? 112  DA  D N1    1 
ATOM   687  C C2    . DA  B 2 12  ? 23.585  2.751   15.707  1.00 45.64 ? 112  DA  D C2    1 
ATOM   688  N N3    . DA  B 2 12  ? 24.851  2.757   16.123  1.00 40.97 ? 112  DA  D N3    1 
ATOM   689  C C4    . DA  B 2 12  ? 25.347  1.513   16.146  1.00 38.09 ? 112  DA  D C4    1 
ATOM   690  P P     . DA  B 2 13  ? 29.879  4.351   20.142  1.00 32.50 ? 113  DA  D P     1 
ATOM   691  O OP1   . DA  B 2 13  ? 31.053  4.732   19.391  1.00 32.35 ? 113  DA  D OP1   1 
ATOM   692  O OP2   . DA  B 2 13  ? 30.024  3.548   21.335  1.00 24.30 ? 113  DA  D OP2   1 
ATOM   693  O "O5'" . DA  B 2 13  ? 29.058  5.662   20.420  1.00 29.82 ? 113  DA  D "O5'" 1 
ATOM   694  C "C5'" . DA  B 2 13  ? 28.905  6.625   19.389  1.00 31.57 ? 113  DA  D "C5'" 1 
ATOM   695  C "C4'" . DA  B 2 13  ? 27.507  7.181   19.435  1.00 32.51 ? 113  DA  D "C4'" 1 
ATOM   696  O "O4'" . DA  B 2 13  ? 26.500  6.255   18.947  1.00 28.92 ? 113  DA  D "O4'" 1 
ATOM   697  C "C3'" . DA  B 2 13  ? 27.061  7.560   20.836  1.00 27.97 ? 113  DA  D "C3'" 1 
ATOM   698  O "O3'" . DA  B 2 13  ? 26.318  8.738   20.648  1.00 30.03 ? 113  DA  D "O3'" 1 
ATOM   699  C "C2'" . DA  B 2 13  ? 26.149  6.415   21.250  1.00 24.14 ? 113  DA  D "C2'" 1 
ATOM   700  C "C1'" . DA  B 2 13  ? 25.486  6.070   19.928  1.00 28.95 ? 113  DA  D "C1'" 1 
ATOM   701  N N9    . DA  B 2 13  ? 24.988  4.694   19.805  1.00 31.50 ? 113  DA  D N9    1 
ATOM   702  C C8    . DA  B 2 13  ? 25.689  3.559   20.096  1.00 33.77 ? 113  DA  D C8    1 
ATOM   703  N N7    . DA  B 2 13  ? 25.023  2.454   19.878  1.00 30.01 ? 113  DA  D N7    1 
ATOM   704  C C5    . DA  B 2 13  ? 23.801  2.885   19.423  1.00 26.93 ? 113  DA  D C5    1 
ATOM   705  C C6    . DA  B 2 13  ? 22.660  2.193   19.024  1.00 25.82 ? 113  DA  D C6    1 
ATOM   706  N N6    . DA  B 2 13  ? 22.583  0.875   18.993  1.00 27.92 ? 113  DA  D N6    1 
ATOM   707  N N1    . DA  B 2 13  ? 21.593  2.909   18.640  1.00 28.43 ? 113  DA  D N1    1 
ATOM   708  C C2    . DA  B 2 13  ? 21.682  4.235   18.643  1.00 31.42 ? 113  DA  D C2    1 
ATOM   709  N N3    . DA  B 2 13  ? 22.705  5.007   18.981  1.00 32.07 ? 113  DA  D N3    1 
ATOM   710  C C4    . DA  B 2 13  ? 23.754  4.264   19.371  1.00 29.66 ? 113  DA  D C4    1 
ATOM   711  P P     . DA  B 2 14  ? 25.801  9.547   21.911  1.00 35.87 ? 114  DA  D P     1 
ATOM   712  O OP1   . DA  B 2 14  ? 25.850  10.941  21.448  1.00 36.08 ? 114  DA  D OP1   1 
ATOM   713  O OP2   . DA  B 2 14  ? 26.608  9.131   23.091  1.00 33.01 ? 114  DA  D OP2   1 
ATOM   714  O "O5'" . DA  B 2 14  ? 24.294  9.073   21.979  1.00 31.71 ? 114  DA  D "O5'" 1 
ATOM   715  C "C5'" . DA  B 2 14  ? 23.390  9.466   20.964  1.00 28.19 ? 114  DA  D "C5'" 1 
ATOM   716  C "C4'" . DA  B 2 14  ? 22.005  9.047   21.364  1.00 30.45 ? 114  DA  D "C4'" 1 
ATOM   717  O "O4'" . DA  B 2 14  ? 21.895  7.610   21.235  1.00 33.71 ? 114  DA  D "O4'" 1 
ATOM   718  C "C3'" . DA  B 2 14  ? 21.695  9.352   22.833  1.00 30.53 ? 114  DA  D "C3'" 1 
ATOM   719  O "O3'" . DA  B 2 14  ? 20.296  9.594   22.911  1.00 32.67 ? 114  DA  D "O3'" 1 
ATOM   720  C "C2'" . DA  B 2 14  ? 22.009  8.037   23.532  1.00 23.63 ? 114  DA  D "C2'" 1 
ATOM   721  C "C1'" . DA  B 2 14  ? 21.503  7.058   22.485  1.00 29.19 ? 114  DA  D "C1'" 1 
ATOM   722  N N9    . DA  B 2 14  ? 21.987  5.670   22.549  1.00 28.62 ? 114  DA  D N9    1 
ATOM   723  C C8    . DA  B 2 14  ? 23.204  5.205   22.985  1.00 21.03 ? 114  DA  D C8    1 
ATOM   724  N N7    . DA  B 2 14  ? 23.295  3.901   22.985  1.00 22.96 ? 114  DA  D N7    1 
ATOM   725  C C5    . DA  B 2 14  ? 22.071  3.475   22.501  1.00 26.56 ? 114  DA  D C5    1 
ATOM   726  C C6    . DA  B 2 14  ? 21.540  2.187   22.253  1.00 30.41 ? 114  DA  D C6    1 
ATOM   727  N N6    . DA  B 2 14  ? 22.206  1.055   22.487  1.00 25.26 ? 114  DA  D N6    1 
ATOM   728  N N1    . DA  B 2 14  ? 20.284  2.104   21.750  1.00 31.46 ? 114  DA  D N1    1 
ATOM   729  C C2    . DA  B 2 14  ? 19.621  3.241   21.508  1.00 29.78 ? 114  DA  D C2    1 
ATOM   730  N N3    . DA  B 2 14  ? 20.018  4.505   21.696  1.00 31.83 ? 114  DA  D N3    1 
ATOM   731  C C4    . DA  B 2 14  ? 21.263  4.552   22.205  1.00 25.13 ? 114  DA  D C4    1 
ATOM   732  P P     . DG  B 2 15  ? 19.742  10.835  23.732  1.00 28.77 ? 115  DG  D P     1 
ATOM   733  O OP1   . DG  B 2 15  ? 19.699  12.006  22.846  1.00 30.07 ? 115  DG  D OP1   1 
ATOM   734  O OP2   . DG  B 2 15  ? 20.490  10.875  24.949  1.00 21.25 ? 115  DG  D OP2   1 
ATOM   735  O "O5'" . DG  B 2 15  ? 18.262  10.370  24.012  1.00 24.47 ? 115  DG  D "O5'" 1 
ATOM   736  C "C5'" . DG  B 2 15  ? 18.030  9.326   24.922  1.00 26.86 ? 115  DG  D "C5'" 1 
ATOM   737  C "C4'" . DG  B 2 15  ? 17.075  8.326   24.328  1.00 26.68 ? 115  DG  D "C4'" 1 
ATOM   738  O "O4'" . DG  B 2 15  ? 17.836  7.255   23.718  1.00 24.69 ? 115  DG  D "O4'" 1 
ATOM   739  C "C3'" . DG  B 2 15  ? 16.263  7.689   25.438  1.00 26.35 ? 115  DG  D "C3'" 1 
ATOM   740  O "O3'" . DG  B 2 15  ? 14.905  8.017   25.372  1.00 27.22 ? 115  DG  D "O3'" 1 
ATOM   741  C "C2'" . DG  B 2 15  ? 16.451  6.196   25.304  1.00 26.66 ? 115  DG  D "C2'" 1 
ATOM   742  C "C1'" . DG  B 2 15  ? 17.324  5.977   24.096  1.00 24.43 ? 115  DG  D "C1'" 1 
ATOM   743  N N9    . DG  B 2 15  ? 18.439  5.176   24.589  1.00 28.46 ? 115  DG  D N9    1 
ATOM   744  C C8    . DG  B 2 15  ? 19.634  5.664   25.058  1.00 24.54 ? 115  DG  D C8    1 
ATOM   745  N N7    . DG  B 2 15  ? 20.425  4.725   25.501  1.00 29.00 ? 115  DG  D N7    1 
ATOM   746  C C5    . DG  B 2 15  ? 19.726  3.547   25.291  1.00 26.79 ? 115  DG  D C5    1 
ATOM   747  C C6    . DG  B 2 15  ? 20.090  2.230   25.550  1.00 24.65 ? 115  DG  D C6    1 
ATOM   748  O O6    . DG  B 2 15  ? 21.120  1.824   26.008  1.00 30.12 ? 115  DG  D O6    1 
ATOM   749  N N1    . DG  B 2 15  ? 19.096  1.340   25.212  1.00 21.79 ? 115  DG  D N1    1 
ATOM   750  C C2    . DG  B 2 15  ? 17.888  1.677   24.696  1.00 24.11 ? 115  DG  D C2    1 
ATOM   751  N N2    . DG  B 2 15  ? 17.045  0.670   24.485  1.00 24.86 ? 115  DG  D N2    1 
ATOM   752  N N3    . DG  B 2 15  ? 17.534  2.920   24.424  1.00 27.80 ? 115  DG  D N3    1 
ATOM   753  C C4    . DG  B 2 15  ? 18.495  3.799   24.740  1.00 28.46 ? 115  DG  D C4    1 
ATOM   754  P P     . DT  B 2 16  ? 14.059  8.048   26.733  1.00 31.63 ? 116  DT  D P     1 
ATOM   755  O OP1   . DT  B 2 16  ? 12.873  8.882   26.493  1.00 36.54 ? 116  DT  D OP1   1 
ATOM   756  O OP2   . DT  B 2 16  ? 14.905  8.290   27.911  1.00 28.62 ? 116  DT  D OP2   1 
ATOM   757  O "O5'" . DT  B 2 16  ? 13.567  6.555   26.890  1.00 27.33 ? 116  DT  D "O5'" 1 
ATOM   758  C "C5'" . DT  B 2 16  ? 12.897  5.933   25.814  1.00 27.71 ? 116  DT  D "C5'" 1 
ATOM   759  C "C4'" . DT  B 2 16  ? 12.595  4.499   26.159  1.00 31.59 ? 116  DT  D "C4'" 1 
ATOM   760  O "O4'" . DT  B 2 16  ? 13.799  3.703   26.166  1.00 29.36 ? 116  DT  D "O4'" 1 
ATOM   761  C "C3'" . DT  B 2 16  ? 11.947  4.304   27.523  1.00 31.76 ? 116  DT  D "C3'" 1 
ATOM   762  O "O3'" . DT  B 2 16  ? 10.843  3.418   27.355  1.00 28.22 ? 116  DT  D "O3'" 1 
ATOM   763  C "C2'" . DT  B 2 16  ? 13.057  3.707   28.375  1.00 28.50 ? 116  DT  D "C2'" 1 
ATOM   764  C "C1'" . DT  B 2 16  ? 13.920  2.970   27.354  1.00 33.29 ? 116  DT  D "C1'" 1 
ATOM   765  N N1    . DT  B 2 16  ? 15.368  2.889   27.671  1.00 37.84 ? 116  DT  D N1    1 
ATOM   766  C C2    . DT  B 2 16  ? 15.990  1.654   27.636  1.00 36.22 ? 116  DT  D C2    1 
ATOM   767  O O2    . DT  B 2 16  ? 15.422  0.623   27.345  1.00 40.30 ? 116  DT  D O2    1 
ATOM   768  N N3    . DT  B 2 16  ? 17.319  1.676   27.952  1.00 37.03 ? 116  DT  D N3    1 
ATOM   769  C C4    . DT  B 2 16  ? 18.076  2.763   28.301  1.00 35.18 ? 116  DT  D C4    1 
ATOM   770  O O4    . DT  B 2 16  ? 19.247  2.609   28.580  1.00 31.59 ? 116  DT  D O4    1 
ATOM   771  C C5    . DT  B 2 16  ? 17.372  4.024   28.306  1.00 35.22 ? 116  DT  D C5    1 
ATOM   772  C C7    . DT  B 2 16  ? 18.126  5.264   28.657  1.00 29.11 ? 116  DT  D C7    1 
ATOM   773  C C6    . DT  B 2 16  ? 16.069  4.026   27.997  1.00 28.39 ? 116  DT  D C6    1 
ATOM   774  P P     . DC  B 2 17  ? 9.751   3.322   28.490  1.00 33.04 ? 117  DC  D P     1 
ATOM   775  O OP1   . DC  B 2 17  ? 8.482   2.993   27.819  1.00 28.92 ? 117  DC  D OP1   1 
ATOM   776  O OP2   . DC  B 2 17  ? 9.835   4.526   29.343  1.00 22.40 ? 117  DC  D OP2   1 
ATOM   777  O "O5'" . DC  B 2 17  ? 10.240  2.058   29.297  1.00 31.50 ? 117  DC  D "O5'" 1 
ATOM   778  C "C5'" . DC  B 2 17  ? 10.468  0.843   28.614  1.00 31.43 ? 117  DC  D "C5'" 1 
ATOM   779  C "C4'" . DC  B 2 17  ? 11.186  -0.120  29.519  1.00 33.84 ? 117  DC  D "C4'" 1 
ATOM   780  O "O4'" . DC  B 2 17  ? 12.587  0.229   29.600  1.00 32.44 ? 117  DC  D "O4'" 1 
ATOM   781  C "C3'" . DC  B 2 17  ? 10.665  -0.160  30.965  1.00 36.00 ? 117  DC  D "C3'" 1 
ATOM   782  O "O3'" . DC  B 2 17  ? 10.443  -1.509  31.341  1.00 40.63 ? 117  DC  D "O3'" 1 
ATOM   783  C "C2'" . DC  B 2 17  ? 11.813  0.394   31.786  1.00 35.73 ? 117  DC  D "C2'" 1 
ATOM   784  C "C1'" . DC  B 2 17  ? 13.008  0.016   30.936  1.00 35.37 ? 117  DC  D "C1'" 1 
ATOM   785  N N1    . DC  B 2 17  ? 14.240  0.790   31.183  1.00 36.36 ? 117  DC  D N1    1 
ATOM   786  C C2    . DC  B 2 17  ? 15.437  0.099   31.300  1.00 38.81 ? 117  DC  D C2    1 
ATOM   787  O O2    . DC  B 2 17  ? 15.420  -1.110  31.207  1.00 44.42 ? 117  DC  D O2    1 
ATOM   788  N N3    . DC  B 2 17  ? 16.590  0.771   31.515  1.00 37.14 ? 117  DC  D N3    1 
ATOM   789  C C4    . DC  B 2 17  ? 16.576  2.096   31.603  1.00 32.85 ? 117  DC  D C4    1 
ATOM   790  N N4    . DC  B 2 17  ? 17.742  2.704   31.783  1.00 27.26 ? 117  DC  D N4    1 
ATOM   791  C C5    . DC  B 2 17  ? 15.362  2.845   31.503  1.00 34.39 ? 117  DC  D C5    1 
ATOM   792  C C6    . DC  B 2 17  ? 14.223  2.154   31.292  1.00 38.74 ? 117  DC  D C6    1 
ATOM   793  P P     . DT  B 2 18  ? 10.037  -1.877  32.849  1.00 44.99 ? 118  DT  D P     1 
ATOM   794  O OP1   . DT  B 2 18  ? 8.860   -2.736  32.648  1.00 48.83 ? 118  DT  D OP1   1 
ATOM   795  O OP2   . DT  B 2 18  ? 9.945   -0.727  33.734  1.00 42.13 ? 118  DT  D OP2   1 
ATOM   796  O "O5'" . DT  B 2 18  ? 11.256  -2.780  33.313  1.00 39.84 ? 118  DT  D "O5'" 1 
ATOM   797  C "C5'" . DT  B 2 18  ? 11.758  -3.761  32.435  1.00 37.57 ? 118  DT  D "C5'" 1 
ATOM   798  C "C4'" . DT  B 2 18  ? 12.911  -4.467  33.084  1.00 40.04 ? 118  DT  D "C4'" 1 
ATOM   799  O "O4'" . DT  B 2 18  ? 13.999  -3.541  33.233  1.00 40.42 ? 118  DT  D "O4'" 1 
ATOM   800  C "C3'" . DT  B 2 18  ? 12.623  -4.977  34.487  1.00 39.97 ? 118  DT  D "C3'" 1 
ATOM   801  O "O3'" . DT  B 2 18  ? 13.334  -6.196  34.616  1.00 42.14 ? 118  DT  D "O3'" 1 
ATOM   802  C "C2'" . DT  B 2 18  ? 13.201  -3.896  35.383  1.00 38.92 ? 118  DT  D "C2'" 1 
ATOM   803  C "C1'" . DT  B 2 18  ? 14.409  -3.477  34.576  1.00 39.48 ? 118  DT  D "C1'" 1 
ATOM   804  N N1    . DT  B 2 18  ? 14.945  -2.135  34.787  1.00 39.09 ? 118  DT  D N1    1 
ATOM   805  C C2    . DT  B 2 18  ? 16.295  -2.041  34.977  1.00 40.99 ? 118  DT  D C2    1 
ATOM   806  O O2    . DT  B 2 18  ? 17.006  -3.010  35.086  1.00 46.54 ? 118  DT  D O2    1 
ATOM   807  N N3    . DT  B 2 18  ? 16.780  -0.772  35.054  1.00 36.09 ? 118  DT  D N3    1 
ATOM   808  C C4    . DT  B 2 18  ? 16.058  0.390   34.996  1.00 39.60 ? 118  DT  D C4    1 
ATOM   809  O O4    . DT  B 2 18  ? 16.634  1.456   35.085  1.00 37.92 ? 118  DT  D O4    1 
ATOM   810  C C5    . DT  B 2 18  ? 14.631  0.223   34.838  1.00 37.67 ? 118  DT  D C5    1 
ATOM   811  C C7    . DT  B 2 18  ? 13.764  1.438   34.786  1.00 31.82 ? 118  DT  D C7    1 
ATOM   812  C C6    . DT  B 2 18  ? 14.148  -1.020  34.746  1.00 36.34 ? 118  DT  D C6    1 
ATOM   813  P P     . DT  B 2 19  ? 13.078  -7.124  35.882  1.00 48.03 ? 119  DT  D P     1 
ATOM   814  O OP1   . DT  B 2 19  ? 12.985  -8.529  35.372  1.00 46.64 ? 119  DT  D OP1   1 
ATOM   815  O OP2   . DT  B 2 19  ? 11.996  -6.557  36.715  1.00 42.78 ? 119  DT  D OP2   1 
ATOM   816  O "O5'" . DT  B 2 19  ? 14.430  -6.999  36.677  1.00 43.70 ? 119  DT  D "O5'" 1 
ATOM   817  C "C5'" . DT  B 2 19  ? 15.636  -7.305  36.029  1.00 39.80 ? 119  DT  D "C5'" 1 
ATOM   818  C "C4'" . DT  B 2 19  ? 16.791  -6.983  36.936  1.00 38.11 ? 119  DT  D "C4'" 1 
ATOM   819  O "O4'" . DT  B 2 19  ? 17.021  -5.557  36.987  1.00 35.86 ? 119  DT  D "O4'" 1 
ATOM   820  C "C3'" . DT  B 2 19  ? 16.618  -7.447  38.375  1.00 39.02 ? 119  DT  D "C3'" 1 
ATOM   821  O "O3'" . DT  B 2 19  ? 17.801  -8.172  38.683  1.00 45.63 ? 119  DT  D "O3'" 1 
ATOM   822  C "C2'" . DT  B 2 19  ? 16.516  -6.144  39.171  1.00 37.62 ? 119  DT  D "C2'" 1 
ATOM   823  C "C1'" . DT  B 2 19  ? 17.307  -5.170  38.310  1.00 35.70 ? 119  DT  D "C1'" 1 
ATOM   824  N N1    . DT  B 2 19  ? 16.988  -3.732  38.427  1.00 35.51 ? 119  DT  D N1    1 
ATOM   825  C C2    . DT  B 2 19  ? 18.045  -2.852  38.492  1.00 37.19 ? 119  DT  D C2    1 
ATOM   826  O O2    . DT  B 2 19  ? 19.207  -3.197  38.502  1.00 33.13 ? 119  DT  D O2    1 
ATOM   827  N N3    . DT  B 2 19  ? 17.692  -1.537  38.559  1.00 34.56 ? 119  DT  D N3    1 
ATOM   828  C C4    . DT  B 2 19  ? 16.430  -1.015  38.577  1.00 36.16 ? 119  DT  D C4    1 
ATOM   829  O O4    . DT  B 2 19  ? 16.288  0.181   38.635  1.00 35.52 ? 119  DT  D O4    1 
ATOM   830  C C5    . DT  B 2 19  ? 15.361  -1.980  38.525  1.00 35.94 ? 119  DT  D C5    1 
ATOM   831  C C7    . DT  B 2 19  ? 13.948  -1.496  38.560  1.00 36.06 ? 119  DT  D C7    1 
ATOM   832  C C6    . DT  B 2 19  ? 15.687  -3.278  38.448  1.00 35.36 ? 119  DT  D C6    1 
ATOM   833  P P     . DT  B 2 20  ? 18.036  -8.746  40.154  1.00 47.94 ? 120  DT  D P     1 
ATOM   834  O OP1   . DT  B 2 20  ? 18.701  -10.053 39.946  1.00 47.43 ? 120  DT  D OP1   1 
ATOM   835  O OP2   . DT  B 2 20  ? 16.749  -8.658  40.906  1.00 46.52 ? 120  DT  D OP2   1 
ATOM   836  O "O5'" . DT  B 2 20  ? 19.121  -7.766  40.729  1.00 42.31 ? 120  DT  D "O5'" 1 
ATOM   837  C "C5'" . DT  B 2 20  ? 20.279  -7.531  39.971  1.00 37.49 ? 120  DT  D "C5'" 1 
ATOM   838  C "C4'" . DT  B 2 20  ? 21.111  -6.476  40.644  1.00 45.17 ? 120  DT  D "C4'" 1 
ATOM   839  O "O4'" . DT  B 2 20  ? 20.457  -5.185  40.542  1.00 44.88 ? 120  DT  D "O4'" 1 
ATOM   840  C "C3'" . DT  B 2 20  ? 21.343  -6.720  42.135  1.00 47.81 ? 120  DT  D "C3'" 1 
ATOM   841  O "O3'" . DT  B 2 20  ? 22.734  -6.559  42.374  1.00 52.78 ? 120  DT  D "O3'" 1 
ATOM   842  C "C2'" . DT  B 2 20  ? 20.522  -5.633  42.823  1.00 47.73 ? 120  DT  D "C2'" 1 
ATOM   843  C "C1'" . DT  B 2 20  ? 20.524  -4.525  41.785  1.00 43.13 ? 120  DT  D "C1'" 1 
ATOM   844  N N1    . DT  B 2 20  ? 19.415  -3.553  41.834  1.00 41.95 ? 120  DT  D N1    1 
ATOM   845  C C2    . DT  B 2 20  ? 19.763  -2.209  41.866  1.00 44.42 ? 120  DT  D C2    1 
ATOM   846  O O2    . DT  B 2 20  ? 20.920  -1.819  41.872  1.00 41.95 ? 120  DT  D O2    1 
ATOM   847  N N3    . DT  B 2 20  ? 18.698  -1.333  41.883  1.00 38.56 ? 120  DT  D N3    1 
ATOM   848  C C4    . DT  B 2 20  ? 17.355  -1.655  41.865  1.00 40.72 ? 120  DT  D C4    1 
ATOM   849  O O4    . DT  B 2 20  ? 16.523  -0.752  41.844  1.00 36.60 ? 120  DT  D O4    1 
ATOM   850  C C5    . DT  B 2 20  ? 17.062  -3.089  41.848  1.00 37.92 ? 120  DT  D C5    1 
ATOM   851  C C7    . DT  B 2 20  ? 15.641  -3.537  41.838  1.00 37.58 ? 120  DT  D C7    1 
ATOM   852  C C6    . DT  B 2 20  ? 18.091  -3.951  41.840  1.00 37.44 ? 120  DT  D C6    1 
ATOM   853  P P     . DT  B 2 21  ? 23.344  -6.850  43.814  1.00 54.71 ? 121  DT  D P     1 
ATOM   854  O OP1   . DT  B 2 21  ? 24.619  -7.550  43.493  1.00 54.53 ? 121  DT  D OP1   1 
ATOM   855  O OP2   . DT  B 2 21  ? 22.332  -7.479  44.695  1.00 54.02 ? 121  DT  D OP2   1 
ATOM   856  O "O5'" . DT  B 2 21  ? 23.688  -5.390  44.348  1.00 54.10 ? 121  DT  D "O5'" 1 
ATOM   857  C "C5'" . DT  B 2 21  ? 24.524  -4.538  43.556  1.00 51.08 ? 121  DT  D "C5'" 1 
ATOM   858  C "C4'" . DT  B 2 21  ? 24.618  -3.164  44.166  1.00 49.30 ? 121  DT  D "C4'" 1 
ATOM   859  O "O4'" . DT  B 2 21  ? 23.358  -2.473  43.995  1.00 46.68 ? 121  DT  D "O4'" 1 
ATOM   860  C "C3'" . DT  B 2 21  ? 24.954  -3.109  45.657  1.00 49.38 ? 121  DT  D "C3'" 1 
ATOM   861  O "O3'" . DT  B 2 21  ? 26.082  -2.250  45.857  1.00 51.09 ? 121  DT  D "O3'" 1 
ATOM   862  C "C2'" . DT  B 2 21  ? 23.689  -2.567  46.306  1.00 46.15 ? 121  DT  D "C2'" 1 
ATOM   863  C "C1'" . DT  B 2 21  ? 23.036  -1.777  45.179  1.00 45.39 ? 121  DT  D "C1'" 1 
ATOM   864  N N1    . DT  B 2 21  ? 21.571  -1.684  45.242  1.00 40.88 ? 121  DT  D N1    1 
ATOM   865  C C2    . DT  B 2 21  ? 20.990  -0.434  45.191  1.00 39.17 ? 121  DT  D C2    1 
ATOM   866  O O2    . DT  B 2 21  ? 21.628  0.594   45.116  1.00 41.44 ? 121  DT  D O2    1 
ATOM   867  N N3    . DT  B 2 21  ? 19.639  -0.434  45.232  1.00 32.99 ? 121  DT  D N3    1 
ATOM   868  C C4    . DT  B 2 21  ? 18.812  -1.513  45.331  1.00 35.19 ? 121  DT  D C4    1 
ATOM   869  O O4    . DT  B 2 21  ? 17.615  -1.335  45.357  1.00 41.24 ? 121  DT  D O4    1 
ATOM   870  C C5    . DT  B 2 21  ? 19.481  -2.808  45.393  1.00 35.14 ? 121  DT  D C5    1 
ATOM   871  C C7    . DT  B 2 21  ? 18.665  -4.058  45.514  1.00 34.31 ? 121  DT  D C7    1 
ATOM   872  C C6    . DT  B 2 21  ? 20.812  -2.826  45.343  1.00 33.75 ? 121  DT  D C6    1 
ATOM   873  P P     . DT  B 2 22  ? 26.772  -2.150  47.302  1.00 56.06 ? 122  DT  D P     1 
ATOM   874  O OP1   . DT  B 2 22  ? 28.204  -1.986  47.004  1.00 54.98 ? 122  DT  D OP1   1 
ATOM   875  O OP2   . DT  B 2 22  ? 26.343  -3.252  48.201  1.00 56.69 ? 122  DT  D OP2   1 
ATOM   876  O "O5'" . DT  B 2 22  ? 26.153  -0.788  47.847  1.00 58.23 ? 122  DT  D "O5'" 1 
ATOM   877  C "C5'" . DT  B 2 22  ? 26.061  0.370   46.969  1.00 59.28 ? 122  DT  D "C5'" 1 
ATOM   878  C "C4'" . DT  B 2 22  ? 25.224  1.464   47.593  1.00 57.66 ? 122  DT  D "C4'" 1 
ATOM   879  O "O4'" . DT  B 2 22  ? 23.822  1.332   47.266  1.00 56.29 ? 122  DT  D "O4'" 1 
ATOM   880  C "C3'" . DT  B 2 22  ? 25.313  1.563   49.116  1.00 58.35 ? 122  DT  D "C3'" 1 
ATOM   881  O "O3'" . DT  B 2 22  ? 25.603  2.859   49.583  1.00 60.54 ? 122  DT  D "O3'" 1 
ATOM   882  C "C2'" . DT  B 2 22  ? 23.897  1.294   49.577  1.00 57.02 ? 122  DT  D "C2'" 1 
ATOM   883  C "C1'" . DT  B 2 22  ? 23.068  1.716   48.392  1.00 55.03 ? 122  DT  D "C1'" 1 
ATOM   884  N N1    . DT  B 2 22  ? 21.777  1.014   48.353  1.00 54.90 ? 122  DT  D N1    1 
ATOM   885  C C2    . DT  B 2 22  ? 20.650  1.774   48.130  1.00 54.18 ? 122  DT  D C2    1 
ATOM   886  O O2    . DT  B 2 22  ? 20.700  2.966   47.887  1.00 55.23 ? 122  DT  D O2    1 
ATOM   887  N N3    . DT  B 2 22  ? 19.465  1.078   48.200  1.00 50.82 ? 122  DT  D N3    1 
ATOM   888  C C4    . DT  B 2 22  ? 19.310  -0.276  48.447  1.00 50.97 ? 122  DT  D C4    1 
ATOM   889  O O4    . DT  B 2 22  ? 18.191  -0.768  48.492  1.00 50.04 ? 122  DT  D O4    1 
ATOM   890  C C5    . DT  B 2 22  ? 20.533  -1.013  48.640  1.00 53.45 ? 122  DT  D C5    1 
ATOM   891  C C7    . DT  B 2 22  ? 20.447  -2.477  48.917  1.00 57.47 ? 122  DT  D C7    1 
ATOM   892  C C6    . DT  B 2 22  ? 21.696  -0.348  48.572  1.00 52.08 ? 122  DT  D C6    1 
ATOM   893  N N     . ILE C 3 41  ? 13.814  -17.405 31.138  1.00 63.13 ? 215  ILE A N     1 
ATOM   894  C CA    . ILE C 3 41  ? 14.872  -18.107 30.327  1.00 65.52 ? 215  ILE A CA    1 
ATOM   895  C C     . ILE C 3 41  ? 14.812  -17.733 28.839  1.00 64.51 ? 215  ILE A C     1 
ATOM   896  O O     . ILE C 3 41  ? 13.723  -17.515 28.282  1.00 63.87 ? 215  ILE A O     1 
ATOM   897  C CB    . ILE C 3 41  ? 14.784  -19.657 30.477  1.00 67.49 ? 215  ILE A CB    1 
ATOM   898  C CG1   . ILE C 3 41  ? 15.045  -20.043 31.934  1.00 70.02 ? 215  ILE A CG1   1 
ATOM   899  C CG2   . ILE C 3 41  ? 15.807  -20.374 29.552  1.00 67.96 ? 215  ILE A CG2   1 
ATOM   900  C CD1   . ILE C 3 41  ? 15.231  -21.551 32.163  1.00 72.41 ? 215  ILE A CD1   1 
ATOM   901  N N     . LYS C 3 42  ? 15.988  -17.695 28.202  1.00 59.98 ? 216  LYS A N     1 
ATOM   902  C CA    . LYS C 3 42  ? 16.112  -17.325 26.790  1.00 54.59 ? 216  LYS A CA    1 
ATOM   903  C C     . LYS C 3 42  ? 16.543  -18.442 25.839  1.00 51.29 ? 216  LYS A C     1 
ATOM   904  O O     . LYS C 3 42  ? 16.366  -18.330 24.632  1.00 46.41 ? 216  LYS A O     1 
ATOM   905  C CB    . LYS C 3 42  ? 17.090  -16.171 26.669  1.00 56.40 ? 216  LYS A CB    1 
ATOM   906  C CG    . LYS C 3 42  ? 16.747  -15.007 27.554  1.00 55.68 ? 216  LYS A CG    1 
ATOM   907  C CD    . LYS C 3 42  ? 15.470  -14.338 27.118  1.00 60.34 ? 216  LYS A CD    1 
ATOM   908  C CE    . LYS C 3 42  ? 15.313  -13.062 27.921  1.00 66.59 ? 216  LYS A CE    1 
ATOM   909  N NZ    . LYS C 3 42  ? 14.329  -12.098 27.354  1.00 73.76 ? 216  LYS A NZ    1 
ATOM   910  N N     . TRP C 3 43  ? 17.168  -19.475 26.376  1.00 49.41 ? 217  TRP A N     1 
ATOM   911  C CA    . TRP C 3 43  ? 17.615  -20.594 25.563  1.00 48.95 ? 217  TRP A CA    1 
ATOM   912  C C     . TRP C 3 43  ? 18.027  -21.755 26.444  1.00 49.51 ? 217  TRP A C     1 
ATOM   913  O O     . TRP C 3 43  ? 18.106  -21.646 27.675  1.00 53.06 ? 217  TRP A O     1 
ATOM   914  C CB    . TRP C 3 43  ? 18.801  -20.191 24.687  1.00 45.95 ? 217  TRP A CB    1 
ATOM   915  C CG    . TRP C 3 43  ? 19.821  -19.353 25.422  1.00 48.85 ? 217  TRP A CG    1 
ATOM   916  C CD1   . TRP C 3 43  ? 19.936  -17.995 25.371  1.00 50.01 ? 217  TRP A CD1   1 
ATOM   917  C CD2   . TRP C 3 43  ? 20.872  -19.809 26.290  1.00 47.29 ? 217  TRP A CD2   1 
ATOM   918  N NE1   . TRP C 3 43  ? 20.989  -17.573 26.147  1.00 44.88 ? 217  TRP A NE1   1 
ATOM   919  C CE2   . TRP C 3 43  ? 21.577  -18.660 26.726  1.00 47.73 ? 217  TRP A CE2   1 
ATOM   920  C CE3   . TRP C 3 43  ? 21.279  -21.064 26.749  1.00 46.96 ? 217  TRP A CE3   1 
ATOM   921  C CZ2   . TRP C 3 43  ? 22.691  -18.737 27.577  1.00 49.54 ? 217  TRP A CZ2   1 
ATOM   922  C CZ3   . TRP C 3 43  ? 22.386  -21.140 27.594  1.00 51.39 ? 217  TRP A CZ3   1 
ATOM   923  C CH2   . TRP C 3 43  ? 23.074  -19.978 28.006  1.00 50.82 ? 217  TRP A CH2   1 
ATOM   924  N N     . LYS C 3 44  ? 18.351  -22.854 25.789  1.00 48.45 ? 218  LYS A N     1 
ATOM   925  C CA    . LYS C 3 44  ? 18.797  -24.042 26.472  1.00 48.46 ? 218  LYS A CA    1 
ATOM   926  C C     . LYS C 3 44  ? 20.247  -24.327 26.082  1.00 48.45 ? 218  LYS A C     1 
ATOM   927  O O     . LYS C 3 44  ? 21.098  -24.585 26.934  1.00 46.84 ? 218  LYS A O     1 
ATOM   928  C CB    . LYS C 3 44  ? 17.887  -25.195 26.093  1.00 51.43 ? 218  LYS A CB    1 
ATOM   929  C CG    . LYS C 3 44  ? 16.520  -25.012 26.653  1.00 59.81 ? 218  LYS A CG    1 
ATOM   930  C CD    . LYS C 3 44  ? 16.426  -25.613 28.061  1.00 66.63 ? 218  LYS A CD    1 
ATOM   931  C CE    . LYS C 3 44  ? 17.378  -24.996 29.094  1.00 68.61 ? 218  LYS A CE    1 
ATOM   932  N NZ    . LYS C 3 44  ? 16.959  -23.612 29.485  1.00 73.38 ? 218  LYS A NZ    1 
ATOM   933  N N     . PHE C 3 45  ? 20.518  -24.283 24.785  1.00 45.65 ? 219  PHE A N     1 
ATOM   934  C CA    . PHE C 3 45  ? 21.860  -24.523 24.296  1.00 43.69 ? 219  PHE A CA    1 
ATOM   935  C C     . PHE C 3 45  ? 22.330  -23.256 23.591  1.00 42.71 ? 219  PHE A C     1 
ATOM   936  O O     . PHE C 3 45  ? 21.543  -22.573 22.949  1.00 42.56 ? 219  PHE A O     1 
ATOM   937  C CB    . PHE C 3 45  ? 21.876  -25.729 23.328  1.00 40.08 ? 219  PHE A CB    1 
ATOM   938  C CG    . PHE C 3 45  ? 23.247  -26.102 22.854  1.00 39.65 ? 219  PHE A CG    1 
ATOM   939  C CD1   . PHE C 3 45  ? 24.159  -26.716 23.716  1.00 43.60 ? 219  PHE A CD1   1 
ATOM   940  C CD2   . PHE C 3 45  ? 23.655  -25.793 21.566  1.00 40.95 ? 219  PHE A CD2   1 
ATOM   941  C CE1   . PHE C 3 45  ? 25.479  -26.994 23.302  1.00 45.05 ? 219  PHE A CE1   1 
ATOM   942  C CE2   . PHE C 3 45  ? 24.976  -26.068 21.142  1.00 42.38 ? 219  PHE A CE2   1 
ATOM   943  C CZ    . PHE C 3 45  ? 25.883  -26.674 22.008  1.00 38.11 ? 219  PHE A CZ    1 
ATOM   944  N N     . LEU C 3 46  ? 23.591  -22.901 23.792  1.00 38.39 ? 220  LEU A N     1 
ATOM   945  C CA    . LEU C 3 46  ? 24.156  -21.734 23.132  1.00 37.62 ? 220  LEU A CA    1 
ATOM   946  C C     . LEU C 3 46  ? 25.635  -21.916 22.915  1.00 40.71 ? 220  LEU A C     1 
ATOM   947  O O     . LEU C 3 46  ? 26.433  -21.775 23.835  1.00 40.56 ? 220  LEU A O     1 
ATOM   948  C CB    . LEU C 3 46  ? 23.903  -20.443 23.915  1.00 37.33 ? 220  LEU A CB    1 
ATOM   949  C CG    . LEU C 3 46  ? 24.628  -19.185 23.399  1.00 27.44 ? 220  LEU A CG    1 
ATOM   950  C CD1   . LEU C 3 46  ? 24.292  -18.965 21.964  1.00 24.70 ? 220  LEU A CD1   1 
ATOM   951  C CD2   . LEU C 3 46  ? 24.271  -17.960 24.205  1.00 26.62 ? 220  LEU A CD2   1 
ATOM   952  N N     . GLU C 3 47  ? 26.002  -22.185 21.671  1.00 41.58 ? 221  GLU A N     1 
ATOM   953  C CA    . GLU C 3 47  ? 27.393  -22.378 21.345  1.00 41.03 ? 221  GLU A CA    1 
ATOM   954  C C     . GLU C 3 47  ? 27.734  -21.436 20.204  1.00 40.97 ? 221  GLU A C     1 
ATOM   955  O O     . GLU C 3 47  ? 27.028  -21.394 19.193  1.00 42.80 ? 221  GLU A O     1 
ATOM   956  C CB    . GLU C 3 47  ? 27.633  -23.837 20.940  1.00 43.99 ? 221  GLU A CB    1 
ATOM   957  C CG    . GLU C 3 47  ? 29.104  -24.258 20.948  1.00 49.18 ? 221  GLU A CG    1 
ATOM   958  C CD    . GLU C 3 47  ? 29.299  -25.721 20.585  1.00 51.84 ? 221  GLU A CD    1 
ATOM   959  O OE1   . GLU C 3 47  ? 29.381  -26.032 19.371  1.00 55.78 ? 221  GLU A OE1   1 
ATOM   960  O OE2   . GLU C 3 47  ? 29.362  -26.559 21.508  1.00 50.68 ? 221  GLU A OE2   1 
ATOM   961  N N     . HIS C 3 48  ? 28.771  -20.634 20.403  1.00 35.10 ? 222  HIS A N     1 
ATOM   962  C CA    . HIS C 3 48  ? 29.225  -19.697 19.391  1.00 34.16 ? 222  HIS A CA    1 
ATOM   963  C C     . HIS C 3 48  ? 30.738  -19.619 19.402  1.00 34.72 ? 222  HIS A C     1 
ATOM   964  O O     . HIS C 3 48  ? 31.374  -20.055 20.346  1.00 36.68 ? 222  HIS A O     1 
ATOM   965  C CB    . HIS C 3 48  ? 28.644  -18.315 19.646  1.00 36.11 ? 222  HIS A CB    1 
ATOM   966  C CG    . HIS C 3 48  ? 28.971  -17.754 20.992  1.00 29.74 ? 222  HIS A CG    1 
ATOM   967  N ND1   . HIS C 3 48  ? 30.072  -16.959 21.221  1.00 28.31 ? 222  HIS A ND1   1 
ATOM   968  C CD2   . HIS C 3 48  ? 28.334  -17.868 22.180  1.00 27.17 ? 222  HIS A CD2   1 
ATOM   969  C CE1   . HIS C 3 48  ? 30.098  -16.604 22.492  1.00 29.33 ? 222  HIS A CE1   1 
ATOM   970  N NE2   . HIS C 3 48  ? 29.053  -17.141 23.097  1.00 32.68 ? 222  HIS A NE2   1 
ATOM   971  N N     . LYS C 3 49  ? 31.295  -18.927 18.427  1.00 35.13 ? 223  LYS A N     1 
ATOM   972  C CA    . LYS C 3 49  ? 32.741  -18.808 18.304  1.00 36.99 ? 223  LYS A CA    1 
ATOM   973  C C     . LYS C 3 49  ? 33.434  -17.623 18.970  1.00 37.22 ? 223  LYS A C     1 
ATOM   974  O O     . LYS C 3 49  ? 34.648  -17.549 18.887  1.00 34.58 ? 223  LYS A O     1 
ATOM   975  C CB    . LYS C 3 49  ? 33.121  -18.785 16.820  1.00 44.04 ? 223  LYS A CB    1 
ATOM   976  C CG    . LYS C 3 49  ? 32.550  -19.929 15.978  1.00 52.94 ? 223  LYS A CG    1 
ATOM   977  C CD    . LYS C 3 49  ? 33.260  -21.266 16.225  1.00 61.73 ? 223  LYS A CD    1 
ATOM   978  C CE    . LYS C 3 49  ? 32.743  -22.358 15.276  1.00 65.72 ? 223  LYS A CE    1 
ATOM   979  N NZ    . LYS C 3 49  ? 33.693  -23.516 15.155  1.00 69.18 ? 223  LYS A NZ    1 
ATOM   980  N N     . GLY C 3 50  ? 32.732  -16.728 19.658  1.00 37.11 ? 224  GLY A N     1 
ATOM   981  C CA    . GLY C 3 50  ? 33.451  -15.577 20.206  1.00 32.18 ? 224  GLY A CA    1 
ATOM   982  C C     . GLY C 3 50  ? 33.631  -14.419 19.202  1.00 32.08 ? 224  GLY A C     1 
ATOM   983  O O     . GLY C 3 50  ? 33.451  -14.572 17.995  1.00 27.65 ? 224  GLY A O     1 
ATOM   984  N N     . PRO C 3 51  ? 34.078  -13.250 19.672  1.00 28.85 ? 225  PRO A N     1 
ATOM   985  C CA    . PRO C 3 51  ? 34.243  -12.111 18.784  1.00 29.43 ? 225  PRO A CA    1 
ATOM   986  C C     . PRO C 3 51  ? 35.413  -12.121 17.851  1.00 32.41 ? 225  PRO A C     1 
ATOM   987  O O     . PRO C 3 51  ? 36.303  -12.920 17.973  1.00 37.05 ? 225  PRO A O     1 
ATOM   988  C CB    . PRO C 3 51  ? 34.402  -10.972 19.765  1.00 29.81 ? 225  PRO A CB    1 
ATOM   989  C CG    . PRO C 3 51  ? 35.261  -11.589 20.797  1.00 28.34 ? 225  PRO A CG    1 
ATOM   990  C CD    . PRO C 3 51  ? 34.583  -12.928 21.013  1.00 29.89 ? 225  PRO A CD    1 
ATOM   991  N N     . VAL C 3 52  ? 35.386  -11.187 16.906  1.00 33.17 ? 226  VAL A N     1 
ATOM   992  C CA    . VAL C 3 52  ? 36.474  -10.989 15.975  1.00 32.06 ? 226  VAL A CA    1 
ATOM   993  C C     . VAL C 3 52  ? 37.090  -9.685  16.481  1.00 33.09 ? 226  VAL A C     1 
ATOM   994  O O     . VAL C 3 52  ? 36.440  -8.645  16.564  1.00 33.31 ? 226  VAL A O     1 
ATOM   995  C CB    . VAL C 3 52  ? 35.985  -10.829 14.517  1.00 32.87 ? 226  VAL A CB    1 
ATOM   996  C CG1   . VAL C 3 52  ? 37.153  -10.439 13.616  1.00 26.05 ? 226  VAL A CG1   1 
ATOM   997  C CG2   . VAL C 3 52  ? 35.391  -12.130 14.037  1.00 31.37 ? 226  VAL A CG2   1 
ATOM   998  N N     . PHE C 3 53  ? 38.309  -9.782  16.949  1.00 30.76 ? 227  PHE A N     1 
ATOM   999  C CA    . PHE C 3 53  ? 38.962  -8.624  17.439  1.00 32.81 ? 227  PHE A CA    1 
ATOM   1000 C C     . PHE C 3 53  ? 39.453  -7.752  16.331  1.00 36.59 ? 227  PHE A C     1 
ATOM   1001 O O     . PHE C 3 53  ? 39.826  -8.229  15.267  1.00 39.89 ? 227  PHE A O     1 
ATOM   1002 C CB    . PHE C 3 53  ? 40.132  -9.044  18.292  1.00 35.53 ? 227  PHE A CB    1 
ATOM   1003 C CG    . PHE C 3 53  ? 39.725  -9.676  19.578  1.00 41.16 ? 227  PHE A CG    1 
ATOM   1004 C CD1   . PHE C 3 53  ? 39.408  -11.030 19.629  1.00 39.10 ? 227  PHE A CD1   1 
ATOM   1005 C CD2   . PHE C 3 53  ? 39.625  -8.903  20.746  1.00 37.96 ? 227  PHE A CD2   1 
ATOM   1006 C CE1   . PHE C 3 53  ? 38.996  -11.622 20.832  1.00 42.36 ? 227  PHE A CE1   1 
ATOM   1007 C CE2   . PHE C 3 53  ? 39.215  -9.476  21.942  1.00 43.20 ? 227  PHE A CE2   1 
ATOM   1008 C CZ    . PHE C 3 53  ? 38.895  -10.847 21.985  1.00 43.94 ? 227  PHE A CZ    1 
ATOM   1009 N N     . ALA C 3 54  ? 39.532  -6.464  16.626  1.00 38.78 ? 228  ALA A N     1 
ATOM   1010 C CA    . ALA C 3 54  ? 40.001  -5.457  15.686  1.00 41.76 ? 228  ALA A CA    1 
ATOM   1011 C C     . ALA C 3 54  ? 41.403  -5.777  15.130  1.00 42.23 ? 228  ALA A C     1 
ATOM   1012 O O     . ALA C 3 54  ? 42.279  -6.302  15.837  1.00 37.06 ? 228  ALA A O     1 
ATOM   1013 C CB    . ALA C 3 54  ? 39.977  -4.058  16.355  1.00 39.36 ? 228  ALA A CB    1 
ATOM   1014 N N     . PRO C 3 55  ? 41.629  -5.460  13.837  1.00 45.47 ? 229  PRO A N     1 
ATOM   1015 C CA    . PRO C 3 55  ? 42.916  -5.715  13.179  1.00 46.66 ? 229  PRO A CA    1 
ATOM   1016 C C     . PRO C 3 55  ? 43.957  -4.906  13.896  1.00 49.54 ? 229  PRO A C     1 
ATOM   1017 O O     . PRO C 3 55  ? 43.684  -3.840  14.375  1.00 54.42 ? 229  PRO A O     1 
ATOM   1018 C CB    . PRO C 3 55  ? 42.719  -5.134  11.781  1.00 49.60 ? 229  PRO A CB    1 
ATOM   1019 C CG    . PRO C 3 55  ? 41.225  -4.992  11.633  1.00 47.08 ? 229  PRO A CG    1 
ATOM   1020 C CD    . PRO C 3 55  ? 40.773  -4.611  12.991  1.00 44.88 ? 229  PRO A CD    1 
ATOM   1021 N N     . PRO C 3 56  ? 45.166  -5.430  14.004  1.00 51.35 ? 230  PRO A N     1 
ATOM   1022 C CA    . PRO C 3 56  ? 46.252  -4.715  14.687  1.00 48.89 ? 230  PRO A CA    1 
ATOM   1023 C C     . PRO C 3 56  ? 46.695  -3.493  13.899  1.00 47.23 ? 230  PRO A C     1 
ATOM   1024 O O     . PRO C 3 56  ? 46.753  -3.534  12.668  1.00 47.87 ? 230  PRO A O     1 
ATOM   1025 C CB    . PRO C 3 56  ? 47.360  -5.755  14.743  1.00 52.14 ? 230  PRO A CB    1 
ATOM   1026 C CG    . PRO C 3 56  ? 46.607  -7.078  14.610  1.00 57.37 ? 230  PRO A CG    1 
ATOM   1027 C CD    . PRO C 3 56  ? 45.568  -6.775  13.588  1.00 51.84 ? 230  PRO A CD    1 
ATOM   1028 N N     . TYR C 3 57  ? 47.098  -2.457  14.624  1.00 48.38 ? 231  TYR A N     1 
ATOM   1029 C CA    . TYR C 3 57  ? 47.526  -1.205  14.025  1.00 46.99 ? 231  TYR A CA    1 
ATOM   1030 C C     . TYR C 3 57  ? 48.707  -1.401  13.090  1.00 48.12 ? 231  TYR A C     1 
ATOM   1031 O O     . TYR C 3 57  ? 49.664  -2.127  13.395  1.00 46.41 ? 231  TYR A O     1 
ATOM   1032 C CB    . TYR C 3 57  ? 47.854  -0.171  15.125  1.00 46.10 ? 231  TYR A CB    1 
ATOM   1033 C CG    . TYR C 3 57  ? 48.426  1.133   14.599  1.00 46.97 ? 231  TYR A CG    1 
ATOM   1034 C CD1   . TYR C 3 57  ? 47.715  1.910   13.694  1.00 51.15 ? 231  TYR A CD1   1 
ATOM   1035 C CD2   . TYR C 3 57  ? 49.716  1.538   14.930  1.00 49.17 ? 231  TYR A CD2   1 
ATOM   1036 C CE1   . TYR C 3 57  ? 48.291  3.050   13.122  1.00 50.30 ? 231  TYR A CE1   1 
ATOM   1037 C CE2   . TYR C 3 57  ? 50.293  2.666   14.363  1.00 46.17 ? 231  TYR A CE2   1 
ATOM   1038 C CZ    . TYR C 3 57  ? 49.583  3.411   13.465  1.00 46.47 ? 231  TYR A CZ    1 
ATOM   1039 O OH    . TYR C 3 57  ? 50.188  4.496   12.902  1.00 43.89 ? 231  TYR A OH    1 
ATOM   1040 N N     . GLU C 3 58  ? 48.607  -0.773  11.928  1.00 47.98 ? 232  GLU A N     1 
ATOM   1041 C CA    . GLU C 3 58  ? 49.644  -0.801  10.907  1.00 48.49 ? 232  GLU A CA    1 
ATOM   1042 C C     . GLU C 3 58  ? 50.386  0.508   10.961  1.00 43.97 ? 232  GLU A C     1 
ATOM   1043 O O     . GLU C 3 58  ? 49.863  1.549   10.641  1.00 44.35 ? 232  GLU A O     1 
ATOM   1044 C CB    . GLU C 3 58  ? 49.036  -0.980  9.519   1.00 56.56 ? 232  GLU A CB    1 
ATOM   1045 C CG    . GLU C 3 58  ? 48.478  -2.377  9.309   1.00 71.54 ? 232  GLU A CG    1 
ATOM   1046 C CD    . GLU C 3 58  ? 49.556  -3.458  9.451   1.00 76.82 ? 232  GLU A CD    1 
ATOM   1047 O OE1   . GLU C 3 58  ? 50.351  -3.610  8.489   1.00 79.67 ? 232  GLU A OE1   1 
ATOM   1048 O OE2   . GLU C 3 58  ? 49.617  -4.135  10.522  1.00 82.22 ? 232  GLU A OE2   1 
ATOM   1049 N N     . PRO C 3 59  ? 51.638  0.463   11.371  1.00 40.65 ? 233  PRO A N     1 
ATOM   1050 C CA    . PRO C 3 59  ? 52.424  1.685   11.455  1.00 39.48 ? 233  PRO A CA    1 
ATOM   1051 C C     . PRO C 3 59  ? 52.510  2.390   10.123  1.00 38.48 ? 233  PRO A C     1 
ATOM   1052 O O     . PRO C 3 59  ? 52.649  1.753   9.085   1.00 40.45 ? 233  PRO A O     1 
ATOM   1053 C CB    . PRO C 3 59  ? 53.786  1.172   11.861  1.00 37.73 ? 233  PRO A CB    1 
ATOM   1054 C CG    . PRO C 3 59  ? 53.455  -0.049  12.614  1.00 42.17 ? 233  PRO A CG    1 
ATOM   1055 C CD    . PRO C 3 59  ? 52.424  -0.700  11.771  1.00 40.05 ? 233  PRO A CD    1 
ATOM   1056 N N     . LEU C 3 60  ? 52.496  3.712   10.172  1.00 37.04 ? 234  LEU A N     1 
ATOM   1057 C CA    . LEU C 3 60  ? 52.604  4.536   8.995   1.00 39.28 ? 234  LEU A CA    1 
ATOM   1058 C C     . LEU C 3 60  ? 53.889  4.249   8.209   1.00 44.31 ? 234  LEU A C     1 
ATOM   1059 O O     . LEU C 3 60  ? 54.872  3.745   8.759   1.00 42.71 ? 234  LEU A O     1 
ATOM   1060 C CB    . LEU C 3 60  ? 52.649  5.995   9.421   1.00 41.13 ? 234  LEU A CB    1 
ATOM   1061 C CG    . LEU C 3 60  ? 51.387  6.666   9.938   1.00 40.34 ? 234  LEU A CG    1 
ATOM   1062 C CD1   . LEU C 3 60  ? 51.761  8.041   10.450  1.00 41.51 ? 234  LEU A CD1   1 
ATOM   1063 C CD2   . LEU C 3 60  ? 50.349  6.762   8.812   1.00 38.82 ? 234  LEU A CD2   1 
ATOM   1064 N N     . PRO C 3 61  ? 53.871  4.506   6.890   1.00 45.64 ? 235  PRO A N     1 
ATOM   1065 C CA    . PRO C 3 61  ? 55.043  4.292   6.039   1.00 46.77 ? 235  PRO A CA    1 
ATOM   1066 C C     . PRO C 3 61  ? 56.044  5.381   6.395   1.00 47.96 ? 235  PRO A C     1 
ATOM   1067 O O     . PRO C 3 61  ? 55.656  6.459   6.846   1.00 49.88 ? 235  PRO A O     1 
ATOM   1068 C CB    . PRO C 3 61  ? 54.494  4.549   4.631   1.00 45.31 ? 235  PRO A CB    1 
ATOM   1069 C CG    . PRO C 3 61  ? 53.091  4.141   4.740   1.00 49.66 ? 235  PRO A CG    1 
ATOM   1070 C CD    . PRO C 3 61  ? 52.680  4.754   6.068   1.00 49.89 ? 235  PRO A CD    1 
ATOM   1071 N N     . GLU C 3 62  ? 57.314  5.126   6.140   1.00 51.70 ? 236  GLU A N     1 
ATOM   1072 C CA    . GLU C 3 62  ? 58.346  6.102   6.438   1.00 53.57 ? 236  GLU A CA    1 
ATOM   1073 C C     . GLU C 3 62  ? 58.115  7.428   5.777   1.00 51.27 ? 236  GLU A C     1 
ATOM   1074 O O     . GLU C 3 62  ? 58.319  8.479   6.375   1.00 50.85 ? 236  GLU A O     1 
ATOM   1075 C CB    . GLU C 3 62  ? 59.701  5.612   5.955   1.00 65.37 ? 236  GLU A CB    1 
ATOM   1076 C CG    . GLU C 3 62  ? 60.271  4.483   6.760   1.00 72.36 ? 236  GLU A CG    1 
ATOM   1077 C CD    . GLU C 3 62  ? 60.087  4.669   8.268   1.00 76.91 ? 236  GLU A CD    1 
ATOM   1078 O OE1   . GLU C 3 62  ? 60.724  5.586   8.854   1.00 79.57 ? 236  GLU A OE1   1 
ATOM   1079 O OE2   . GLU C 3 62  ? 59.310  3.882   8.867   1.00 78.10 ? 236  GLU A OE2   1 
ATOM   1080 N N     . ASN C 3 63  ? 57.834  7.367   4.490   1.00 48.93 ? 237  ASN A N     1 
ATOM   1081 C CA    . ASN C 3 63  ? 57.606  8.561   3.722   1.00 52.03 ? 237  ASN A CA    1 
ATOM   1082 C C     . ASN C 3 63  ? 56.493  9.425   4.307   1.00 52.96 ? 237  ASN A C     1 
ATOM   1083 O O     . ASN C 3 63  ? 56.544  10.641  4.236   1.00 56.04 ? 237  ASN A O     1 
ATOM   1084 C CB    . ASN C 3 63  ? 57.371  8.229   2.232   1.00 56.33 ? 237  ASN A CB    1 
ATOM   1085 C CG    . ASN C 3 63  ? 56.252  7.192   2.002   1.00 58.98 ? 237  ASN A CG    1 
ATOM   1086 O OD1   . ASN C 3 63  ? 56.266  6.092   2.550   1.00 61.86 ? 237  ASN A OD1   1 
ATOM   1087 N ND2   . ASN C 3 63  ? 55.318  7.522   1.112   1.00 62.23 ? 237  ASN A ND2   1 
ATOM   1088 N N     . VAL C 3 64  ? 55.519  8.803   4.950   1.00 52.84 ? 238  VAL A N     1 
ATOM   1089 C CA    . VAL C 3 64  ? 54.420  9.560   5.523   1.00 51.08 ? 238  VAL A CA    1 
ATOM   1090 C C     . VAL C 3 64  ? 54.880  10.192  6.825   1.00 51.30 ? 238  VAL A C     1 
ATOM   1091 O O     . VAL C 3 64  ? 55.114  9.488   7.801   1.00 53.13 ? 238  VAL A O     1 
ATOM   1092 C CB    . VAL C 3 64  ? 53.250  8.659   5.782   1.00 48.97 ? 238  VAL A CB    1 
ATOM   1093 C CG1   . VAL C 3 64  ? 52.072  9.472   6.273   1.00 49.18 ? 238  VAL A CG1   1 
ATOM   1094 C CG2   . VAL C 3 64  ? 52.923  7.905   4.529   1.00 42.80 ? 238  VAL A CG2   1 
ATOM   1095 N N     . LYS C 3 65  ? 54.895  11.521  6.873   1.00 49.01 ? 239  LYS A N     1 
ATOM   1096 C CA    . LYS C 3 65  ? 55.373  12.225  8.055   1.00 46.08 ? 239  LYS A CA    1 
ATOM   1097 C C     . LYS C 3 65  ? 54.446  13.226  8.718   1.00 44.11 ? 239  LYS A C     1 
ATOM   1098 O O     . LYS C 3 65  ? 53.557  13.775  8.081   1.00 42.66 ? 239  LYS A O     1 
ATOM   1099 C CB    . LYS C 3 65  ? 56.692  12.910  7.718   1.00 48.40 ? 239  LYS A CB    1 
ATOM   1100 C CG    . LYS C 3 65  ? 57.752  11.935  7.253   1.00 51.74 ? 239  LYS A CG    1 
ATOM   1101 C CD    . LYS C 3 65  ? 58.947  12.653  6.695   1.00 54.70 ? 239  LYS A CD    1 
ATOM   1102 C CE    . LYS C 3 65  ? 59.959  11.668  6.134   1.00 56.54 ? 239  LYS A CE    1 
ATOM   1103 N NZ    . LYS C 3 65  ? 60.394  10.672  7.143   1.00 59.84 ? 239  LYS A NZ    1 
ATOM   1104 N N     . PHE C 3 66  ? 54.752  13.510  9.984   1.00 42.18 ? 240  PHE A N     1 
ATOM   1105 C CA    . PHE C 3 66  ? 54.021  14.429  10.851  1.00 43.64 ? 240  PHE A CA    1 
ATOM   1106 C C     . PHE C 3 66  ? 54.888  15.610  11.265  1.00 46.80 ? 240  PHE A C     1 
ATOM   1107 O O     . PHE C 3 66  ? 56.020  15.434  11.731  1.00 46.56 ? 240  PHE A O     1 
ATOM   1108 C CB    . PHE C 3 66  ? 53.575  13.696  12.108  1.00 43.27 ? 240  PHE A CB    1 
ATOM   1109 C CG    . PHE C 3 66  ? 53.112  14.588  13.207  1.00 43.25 ? 240  PHE A CG    1 
ATOM   1110 C CD1   . PHE C 3 66  ? 51.819  15.108  13.208  1.00 42.66 ? 240  PHE A CD1   1 
ATOM   1111 C CD2   . PHE C 3 66  ? 53.959  14.876  14.271  1.00 49.31 ? 240  PHE A CD2   1 
ATOM   1112 C CE1   . PHE C 3 66  ? 51.369  15.887  14.268  1.00 49.47 ? 240  PHE A CE1   1 
ATOM   1113 C CE2   . PHE C 3 66  ? 53.527  15.653  15.339  1.00 52.24 ? 240  PHE A CE2   1 
ATOM   1114 C CZ    . PHE C 3 66  ? 52.229  16.166  15.338  1.00 52.44 ? 240  PHE A CZ    1 
ATOM   1115 N N     . TYR C 3 67  ? 54.323  16.808  11.180  1.00 48.13 ? 241  TYR A N     1 
ATOM   1116 C CA    . TYR C 3 67  ? 55.083  17.993  11.528  1.00 49.45 ? 241  TYR A CA    1 
ATOM   1117 C C     . TYR C 3 67  ? 54.570  18.733  12.723  1.00 49.83 ? 241  TYR A C     1 
ATOM   1118 O O     . TYR C 3 67  ? 53.361  18.831  12.949  1.00 47.45 ? 241  TYR A O     1 
ATOM   1119 C CB    . TYR C 3 67  ? 55.128  18.970  10.353  1.00 52.60 ? 241  TYR A CB    1 
ATOM   1120 C CG    . TYR C 3 67  ? 55.691  18.349  9.124   1.00 55.15 ? 241  TYR A CG    1 
ATOM   1121 C CD1   . TYR C 3 67  ? 54.946  17.435  8.395   1.00 55.35 ? 241  TYR A CD1   1 
ATOM   1122 C CD2   . TYR C 3 67  ? 57.013  18.562  8.765   1.00 57.38 ? 241  TYR A CD2   1 
ATOM   1123 C CE1   . TYR C 3 67  ? 55.508  16.733  7.349   1.00 59.33 ? 241  TYR A CE1   1 
ATOM   1124 C CE2   . TYR C 3 67  ? 57.588  17.870  7.721   1.00 61.08 ? 241  TYR A CE2   1 
ATOM   1125 C CZ    . TYR C 3 67  ? 56.838  16.951  7.023   1.00 61.47 ? 241  TYR A CZ    1 
ATOM   1126 O OH    . TYR C 3 67  ? 57.452  16.212  6.044   1.00 69.83 ? 241  TYR A OH    1 
ATOM   1127 N N     . TYR C 3 68  ? 55.507  19.165  13.551  1.00 50.54 ? 242  TYR A N     1 
ATOM   1128 C CA    . TYR C 3 68  ? 55.149  19.970  14.683  1.00 51.86 ? 242  TYR A CA    1 
ATOM   1129 C C     . TYR C 3 68  ? 55.973  21.248  14.604  1.00 51.47 ? 242  TYR A C     1 
ATOM   1130 O O     . TYR C 3 68  ? 57.211  21.214  14.493  1.00 48.75 ? 242  TYR A O     1 
ATOM   1131 C CB    . TYR C 3 68  ? 55.359  19.253  16.009  1.00 53.63 ? 242  TYR A CB    1 
ATOM   1132 C CG    . TYR C 3 68  ? 54.780  20.046  17.169  1.00 60.12 ? 242  TYR A CG    1 
ATOM   1133 C CD1   . TYR C 3 68  ? 53.418  20.333  17.223  1.00 59.60 ? 242  TYR A CD1   1 
ATOM   1134 C CD2   . TYR C 3 68  ? 55.598  20.535  18.196  1.00 63.12 ? 242  TYR A CD2   1 
ATOM   1135 C CE1   . TYR C 3 68  ? 52.878  21.084  18.274  1.00 65.24 ? 242  TYR A CE1   1 
ATOM   1136 C CE2   . TYR C 3 68  ? 55.069  21.293  19.253  1.00 65.90 ? 242  TYR A CE2   1 
ATOM   1137 C CZ    . TYR C 3 68  ? 53.699  21.561  19.287  1.00 67.19 ? 242  TYR A CZ    1 
ATOM   1138 O OH    . TYR C 3 68  ? 53.137  22.272  20.329  1.00 67.39 ? 242  TYR A OH    1 
ATOM   1139 N N     . ASP C 3 69  ? 55.272  22.366  14.647  1.00 53.18 ? 243  ASP A N     1 
ATOM   1140 C CA    . ASP C 3 69  ? 55.896  23.663  14.588  1.00 57.37 ? 243  ASP A CA    1 
ATOM   1141 C C     . ASP C 3 69  ? 56.876  23.680  13.423  1.00 59.67 ? 243  ASP A C     1 
ATOM   1142 O O     . ASP C 3 69  ? 58.034  24.088  13.567  1.00 60.87 ? 243  ASP A O     1 
ATOM   1143 C CB    . ASP C 3 69  ? 56.614  23.950  15.909  1.00 62.19 ? 243  ASP A CB    1 
ATOM   1144 C CG    . ASP C 3 69  ? 56.691  25.433  16.215  1.00 67.71 ? 243  ASP A CG    1 
ATOM   1145 O OD1   . ASP C 3 69  ? 55.977  26.215  15.529  1.00 71.67 ? 243  ASP A OD1   1 
ATOM   1146 O OD2   . ASP C 3 69  ? 57.457  25.821  17.133  1.00 69.70 ? 243  ASP A OD2   1 
ATOM   1147 N N     . GLY C 3 70  ? 56.414  23.191  12.282  1.00 60.59 ? 244  GLY A N     1 
ATOM   1148 C CA    . GLY C 3 70  ? 57.234  23.153  11.093  1.00 56.57 ? 244  GLY A CA    1 
ATOM   1149 C C     . GLY C 3 70  ? 58.201  22.001  11.073  1.00 56.51 ? 244  GLY A C     1 
ATOM   1150 O O     . GLY C 3 70  ? 58.568  21.537  9.999   1.00 60.65 ? 244  GLY A O     1 
ATOM   1151 N N     . LYS C 3 71  ? 58.671  21.574  12.235  1.00 55.78 ? 245  LYS A N     1 
ATOM   1152 C CA    . LYS C 3 71  ? 59.599  20.458  12.293  1.00 60.32 ? 245  LYS A CA    1 
ATOM   1153 C C     . LYS C 3 71  ? 58.952  19.104  11.979  1.00 60.71 ? 245  LYS A C     1 
ATOM   1154 O O     . LYS C 3 71  ? 57.743  18.934  12.112  1.00 60.13 ? 245  LYS A O     1 
ATOM   1155 C CB    . LYS C 3 71  ? 60.229  20.355  13.684  1.00 66.11 ? 245  LYS A CB    1 
ATOM   1156 C CG    . LYS C 3 71  ? 61.535  21.131  13.884  1.00 71.37 ? 245  LYS A CG    1 
ATOM   1157 C CD    . LYS C 3 71  ? 62.366  20.467  15.007  1.00 79.31 ? 245  LYS A CD    1 
ATOM   1158 C CE    . LYS C 3 71  ? 63.693  21.188  15.309  1.00 82.00 ? 245  LYS A CE    1 
ATOM   1159 N NZ    . LYS C 3 71  ? 64.440  20.533  16.453  1.00 84.65 ? 245  LYS A NZ    1 
ATOM   1160 N N     . VAL C 3 72  ? 59.768  18.158  11.524  1.00 60.13 ? 246  VAL A N     1 
ATOM   1161 C CA    . VAL C 3 72  ? 59.301  16.796  11.261  1.00 60.47 ? 246  VAL A CA    1 
ATOM   1162 C C     . VAL C 3 72  ? 59.341  16.140  12.642  1.00 61.02 ? 246  VAL A C     1 
ATOM   1163 O O     . VAL C 3 72  ? 60.022  16.656  13.555  1.00 62.69 ? 246  VAL A O     1 
ATOM   1164 C CB    . VAL C 3 72  ? 60.279  16.011  10.333  1.00 60.94 ? 246  VAL A CB    1 
ATOM   1165 C CG1   . VAL C 3 72  ? 59.814  14.565  10.156  1.00 54.55 ? 246  VAL A CG1   1 
ATOM   1166 C CG2   . VAL C 3 72  ? 60.406  16.698  8.969   1.00 62.19 ? 246  VAL A CG2   1 
ATOM   1167 N N     . MET C 3 73  ? 58.645  15.019  12.810  1.00 59.25 ? 247  MET A N     1 
ATOM   1168 C CA    . MET C 3 73  ? 58.649  14.324  14.087  1.00 58.06 ? 247  MET A CA    1 
ATOM   1169 C C     . MET C 3 73  ? 58.086  12.924  14.015  1.00 58.82 ? 247  MET A C     1 
ATOM   1170 O O     . MET C 3 73  ? 56.890  12.743  13.819  1.00 61.97 ? 247  MET A O     1 
ATOM   1171 C CB    . MET C 3 73  ? 57.866  15.119  15.119  1.00 59.25 ? 247  MET A CB    1 
ATOM   1172 C CG    . MET C 3 73  ? 57.872  14.480  16.495  1.00 60.09 ? 247  MET A CG    1 
ATOM   1173 S SD    . MET C 3 73  ? 57.433  15.655  17.801  1.00 59.65 ? 247  MET A SD    1 
ATOM   1174 C CE    . MET C 3 73  ? 58.305  17.145  17.158  1.00 60.41 ? 247  MET A CE    1 
ATOM   1175 N N     . LYS C 3 74  ? 58.926  11.932  14.274  1.00 57.21 ? 248  LYS A N     1 
ATOM   1176 C CA    . LYS C 3 74  ? 58.416  10.581  14.216  1.00 58.93 ? 248  LYS A CA    1 
ATOM   1177 C C     . LYS C 3 74  ? 57.749  10.253  15.519  1.00 55.64 ? 248  LYS A C     1 
ATOM   1178 O O     . LYS C 3 74  ? 58.406  10.155  16.543  1.00 56.85 ? 248  LYS A O     1 
ATOM   1179 C CB    . LYS C 3 74  ? 59.514  9.561   13.942  1.00 66.05 ? 248  LYS A CB    1 
ATOM   1180 C CG    . LYS C 3 74  ? 58.957  8.141   13.762  1.00 74.63 ? 248  LYS A CG    1 
ATOM   1181 C CD    . LYS C 3 74  ? 60.048  7.116   13.453  1.00 82.62 ? 248  LYS A CD    1 
ATOM   1182 C CE    . LYS C 3 74  ? 59.468  5.709   13.278  1.00 88.99 ? 248  LYS A CE    1 
ATOM   1183 N NZ    . LYS C 3 74  ? 60.524  4.698   12.899  1.00 94.33 ? 248  LYS A NZ    1 
ATOM   1184 N N     . LEU C 3 75  ? 56.454  10.003  15.456  1.00 53.35 ? 249  LEU A N     1 
ATOM   1185 C CA    . LEU C 3 75  ? 55.664  9.677   16.631  1.00 50.02 ? 249  LEU A CA    1 
ATOM   1186 C C     . LEU C 3 75  ? 55.778  8.258   17.167  1.00 47.42 ? 249  LEU A C     1 
ATOM   1187 O O     . LEU C 3 75  ? 55.831  7.305   16.421  1.00 44.83 ? 249  LEU A O     1 
ATOM   1188 C CB    . LEU C 3 75  ? 54.194  9.959   16.336  1.00 51.22 ? 249  LEU A CB    1 
ATOM   1189 C CG    . LEU C 3 75  ? 53.851  11.409  16.044  1.00 51.47 ? 249  LEU A CG    1 
ATOM   1190 C CD1   . LEU C 3 75  ? 52.408  11.497  15.636  1.00 50.67 ? 249  LEU A CD1   1 
ATOM   1191 C CD2   . LEU C 3 75  ? 54.110  12.239  17.288  1.00 54.19 ? 249  LEU A CD2   1 
ATOM   1192 N N     . SER C 3 76  ? 55.763  8.154   18.490  1.00 42.58 ? 250  SER A N     1 
ATOM   1193 C CA    . SER C 3 76  ? 55.775  6.857   19.137  1.00 42.01 ? 250  SER A CA    1 
ATOM   1194 C C     . SER C 3 76  ? 54.587  6.098   18.534  1.00 42.96 ? 250  SER A C     1 
ATOM   1195 O O     . SER C 3 76  ? 53.556  6.693   18.204  1.00 43.11 ? 250  SER A O     1 
ATOM   1196 C CB    . SER C 3 76  ? 55.623  7.007   20.654  1.00 43.62 ? 250  SER A CB    1 
ATOM   1197 O OG    . SER C 3 76  ? 54.667  7.999   20.985  1.00 43.34 ? 250  SER A OG    1 
ATOM   1198 N N     . PRO C 3 77  ? 54.719  4.782   18.377  1.00 42.79 ? 251  PRO A N     1 
ATOM   1199 C CA    . PRO C 3 77  ? 53.654  3.974   17.806  1.00 43.22 ? 251  PRO A CA    1 
ATOM   1200 C C     . PRO C 3 77  ? 52.289  4.256   18.383  1.00 44.40 ? 251  PRO A C     1 
ATOM   1201 O O     . PRO C 3 77  ? 51.329  4.381   17.642  1.00 48.19 ? 251  PRO A O     1 
ATOM   1202 C CB    . PRO C 3 77  ? 54.115  2.551   18.084  1.00 46.49 ? 251  PRO A CB    1 
ATOM   1203 C CG    . PRO C 3 77  ? 54.999  2.698   19.293  1.00 45.76 ? 251  PRO A CG    1 
ATOM   1204 C CD    . PRO C 3 77  ? 55.755  3.937   18.978  1.00 44.62 ? 251  PRO A CD    1 
ATOM   1205 N N     . LYS C 3 78  ? 52.191  4.367   19.699  1.00 40.92 ? 252  LYS A N     1 
ATOM   1206 C CA    . LYS C 3 78  ? 50.899  4.629   20.305  1.00 41.02 ? 252  LYS A CA    1 
ATOM   1207 C C     . LYS C 3 78  ? 50.435  6.043   19.966  1.00 40.72 ? 252  LYS A C     1 
ATOM   1208 O O     . LYS C 3 78  ? 49.313  6.251   19.517  1.00 40.80 ? 252  LYS A O     1 
ATOM   1209 C CB    . LYS C 3 78  ? 50.976  4.417   21.814  1.00 47.18 ? 252  LYS A CB    1 
ATOM   1210 C CG    . LYS C 3 78  ? 49.643  4.522   22.516  1.00 55.89 ? 252  LYS A CG    1 
ATOM   1211 C CD    . LYS C 3 78  ? 48.855  3.214   22.493  1.00 65.76 ? 252  LYS A CD    1 
ATOM   1212 C CE    . LYS C 3 78  ? 47.421  3.415   23.046  1.00 67.46 ? 252  LYS A CE    1 
ATOM   1213 N NZ    . LYS C 3 78  ? 46.590  2.165   23.007  1.00 70.07 ? 252  LYS A NZ    1 
ATOM   1214 N N     . ALA C 3 79  ? 51.318  7.013   20.128  1.00 37.45 ? 253  ALA A N     1 
ATOM   1215 C CA    . ALA C 3 79  ? 50.966  8.379   19.832  1.00 35.84 ? 253  ALA A CA    1 
ATOM   1216 C C     . ALA C 3 79  ? 50.654  8.509   18.372  1.00 36.29 ? 253  ALA A C     1 
ATOM   1217 O O     . ALA C 3 79  ? 49.887  9.377   17.982  1.00 38.42 ? 253  ALA A O     1 
ATOM   1218 C CB    . ALA C 3 79  ? 52.094  9.299   20.193  1.00 42.07 ? 253  ALA A CB    1 
ATOM   1219 N N     . GLU C 3 80  ? 51.305  7.683   17.557  1.00 33.28 ? 254  GLU A N     1 
ATOM   1220 C CA    . GLU C 3 80  ? 51.103  7.711   16.123  1.00 32.97 ? 254  GLU A CA    1 
ATOM   1221 C C     . GLU C 3 80  ? 49.712  7.212   15.797  1.00 34.93 ? 254  GLU A C     1 
ATOM   1222 O O     . GLU C 3 80  ? 48.970  7.852   15.054  1.00 35.17 ? 254  GLU A O     1 
ATOM   1223 C CB    . GLU C 3 80  ? 52.118  6.813   15.430  1.00 33.68 ? 254  GLU A CB    1 
ATOM   1224 C CG    . GLU C 3 80  ? 51.989  6.769   13.920  1.00 35.19 ? 254  GLU A CG    1 
ATOM   1225 C CD    . GLU C 3 80  ? 52.974  5.800   13.309  1.00 40.41 ? 254  GLU A CD    1 
ATOM   1226 O OE1   . GLU C 3 80  ? 54.179  6.094   13.342  1.00 50.05 ? 254  GLU A OE1   1 
ATOM   1227 O OE2   . GLU C 3 80  ? 52.563  4.737   12.820  1.00 41.95 ? 254  GLU A OE2   1 
ATOM   1228 N N     . GLU C 3 81  ? 49.363  6.077   16.368  1.00 35.11 ? 255  GLU A N     1 
ATOM   1229 C CA    . GLU C 3 81  ? 48.065  5.478   16.131  1.00 37.21 ? 255  GLU A CA    1 
ATOM   1230 C C     . GLU C 3 81  ? 46.931  6.455   16.474  1.00 35.13 ? 255  GLU A C     1 
ATOM   1231 O O     . GLU C 3 81  ? 46.024  6.668   15.694  1.00 36.78 ? 255  GLU A O     1 
ATOM   1232 C CB    . GLU C 3 81  ? 47.964  4.201   16.940  1.00 34.65 ? 255  GLU A CB    1 
ATOM   1233 C CG    . GLU C 3 81  ? 46.695  3.460   16.747  1.00 39.25 ? 255  GLU A CG    1 
ATOM   1234 C CD    . GLU C 3 81  ? 46.659  2.184   17.550  1.00 46.99 ? 255  GLU A CD    1 
ATOM   1235 O OE1   . GLU C 3 81  ? 47.542  1.993   18.421  1.00 46.69 ? 255  GLU A OE1   1 
ATOM   1236 O OE2   . GLU C 3 81  ? 45.750  1.356   17.307  1.00 50.42 ? 255  GLU A OE2   1 
ATOM   1237 N N     . VAL C 3 82  ? 47.026  7.092   17.628  1.00 31.47 ? 256  VAL A N     1 
ATOM   1238 C CA    . VAL C 3 82  ? 46.018  8.041   18.049  1.00 30.65 ? 256  VAL A CA    1 
ATOM   1239 C C     . VAL C 3 82  ? 45.937  9.204   17.052  1.00 32.43 ? 256  VAL A C     1 
ATOM   1240 O O     . VAL C 3 82  ? 44.849  9.669   16.685  1.00 32.10 ? 256  VAL A O     1 
ATOM   1241 C CB    . VAL C 3 82  ? 46.365  8.530   19.473  1.00 33.31 ? 256  VAL A CB    1 
ATOM   1242 C CG1   . VAL C 3 82  ? 45.313  9.470   20.029  1.00 25.04 ? 256  VAL A CG1   1 
ATOM   1243 C CG2   . VAL C 3 82  ? 46.492  7.337   20.379  1.00 30.53 ? 256  VAL A CG2   1 
ATOM   1244 N N     . ALA C 3 83  ? 47.082  9.667   16.590  1.00 31.86 ? 257  ALA A N     1 
ATOM   1245 C CA    . ALA C 3 83  ? 47.087  10.773  15.654  1.00 30.19 ? 257  ALA A CA    1 
ATOM   1246 C C     . ALA C 3 83  ? 46.430  10.412  14.325  1.00 29.04 ? 257  ALA A C     1 
ATOM   1247 O O     . ALA C 3 83  ? 45.799  11.252  13.693  1.00 25.16 ? 257  ALA A O     1 
ATOM   1248 C CB    . ALA C 3 83  ? 48.500  11.249  15.426  1.00 32.79 ? 257  ALA A CB    1 
ATOM   1249 N N     . THR C 3 84  ? 46.590  9.171   13.899  1.00 25.23 ? 258  THR A N     1 
ATOM   1250 C CA    . THR C 3 84  ? 46.004  8.790   12.638  1.00 28.63 ? 258  THR A CA    1 
ATOM   1251 C C     . THR C 3 84  ? 44.495  8.946   12.741  1.00 29.78 ? 258  THR A C     1 
ATOM   1252 O O     . THR C 3 84  ? 43.828  9.356   11.784  1.00 34.20 ? 258  THR A O     1 
ATOM   1253 C CB    . THR C 3 84  ? 46.375  7.340   12.220  1.00 32.74 ? 258  THR A CB    1 
ATOM   1254 O OG1   . THR C 3 84  ? 45.827  6.402   13.154  1.00 35.55 ? 258  THR A OG1   1 
ATOM   1255 C CG2   . THR C 3 84  ? 47.876  7.154   12.156  1.00 33.90 ? 258  THR A CG2   1 
ATOM   1256 N N     . PHE C 3 85  ? 43.976  8.635   13.922  1.00 27.44 ? 259  PHE A N     1 
ATOM   1257 C CA    . PHE C 3 85  ? 42.546  8.730   14.172  1.00 31.04 ? 259  PHE A CA    1 
ATOM   1258 C C     . PHE C 3 85  ? 42.092  10.145  13.843  1.00 33.98 ? 259  PHE A C     1 
ATOM   1259 O O     . PHE C 3 85  ? 41.150  10.365  13.072  1.00 33.26 ? 259  PHE A O     1 
ATOM   1260 C CB    . PHE C 3 85  ? 42.262  8.413   15.633  1.00 27.03 ? 259  PHE A CB    1 
ATOM   1261 C CG    . PHE C 3 85  ? 42.566  7.002   16.025  1.00 27.28 ? 259  PHE A CG    1 
ATOM   1262 C CD1   . PHE C 3 85  ? 42.444  5.965   15.110  1.00 30.07 ? 259  PHE A CD1   1 
ATOM   1263 C CD2   . PHE C 3 85  ? 42.892  6.690   17.339  1.00 31.38 ? 259  PHE A CD2   1 
ATOM   1264 C CE1   . PHE C 3 85  ? 42.642  4.635   15.497  1.00 29.29 ? 259  PHE A CE1   1 
ATOM   1265 C CE2   . PHE C 3 85  ? 43.093  5.365   17.737  1.00 33.48 ? 259  PHE A CE2   1 
ATOM   1266 C CZ    . PHE C 3 85  ? 42.963  4.335   16.814  1.00 27.05 ? 259  PHE A CZ    1 
ATOM   1267 N N     . PHE C 3 86  ? 42.801  11.112  14.411  1.00 36.88 ? 260  PHE A N     1 
ATOM   1268 C CA    . PHE C 3 86  ? 42.469  12.500  14.156  1.00 37.84 ? 260  PHE A CA    1 
ATOM   1269 C C     . PHE C 3 86  ? 42.682  12.842  12.683  1.00 33.51 ? 260  PHE A C     1 
ATOM   1270 O O     . PHE C 3 86  ? 41.889  13.549  12.082  1.00 31.53 ? 260  PHE A O     1 
ATOM   1271 C CB    . PHE C 3 86  ? 43.334  13.407  15.024  1.00 39.86 ? 260  PHE A CB    1 
ATOM   1272 C CG    . PHE C 3 86  ? 42.868  14.830  15.047  1.00 41.84 ? 260  PHE A CG    1 
ATOM   1273 C CD1   . PHE C 3 86  ? 41.790  15.199  15.849  1.00 44.82 ? 260  PHE A CD1   1 
ATOM   1274 C CD2   . PHE C 3 86  ? 43.508  15.805  14.283  1.00 46.07 ? 260  PHE A CD2   1 
ATOM   1275 C CE1   . PHE C 3 86  ? 41.328  16.524  15.876  1.00 46.89 ? 260  PHE A CE1   1 
ATOM   1276 C CE2   . PHE C 3 86  ? 43.063  17.135  14.292  1.00 47.99 ? 260  PHE A CE2   1 
ATOM   1277 C CZ    . PHE C 3 86  ? 41.974  17.501  15.100  1.00 47.46 ? 260  PHE A CZ    1 
ATOM   1278 N N     . ALA C 3 87  ? 43.785  12.363  12.135  1.00 35.08 ? 261  ALA A N     1 
ATOM   1279 C CA    . ALA C 3 87  ? 44.124  12.626  10.747  1.00 37.76 ? 261  ALA A CA    1 
ATOM   1280 C C     . ALA C 3 87  ? 43.030  12.167  9.809   1.00 36.50 ? 261  ALA A C     1 
ATOM   1281 O O     . ALA C 3 87  ? 42.608  12.923  8.964   1.00 36.82 ? 261  ALA A O     1 
ATOM   1282 C CB    . ALA C 3 87  ? 45.453  11.958  10.383  1.00 34.04 ? 261  ALA A CB    1 
ATOM   1283 N N     . LYS C 3 88  ? 42.527  10.963  10.006  1.00 34.11 ? 262  LYS A N     1 
ATOM   1284 C CA    . LYS C 3 88  ? 41.496  10.463  9.123   1.00 36.94 ? 262  LYS A CA    1 
ATOM   1285 C C     . LYS C 3 88  ? 40.203  11.243  9.234   1.00 38.04 ? 262  LYS A C     1 
ATOM   1286 O O     . LYS C 3 88  ? 39.304  11.059  8.436   1.00 44.14 ? 262  LYS A O     1 
ATOM   1287 C CB    . LYS C 3 88  ? 41.200  9.001   9.405   1.00 40.48 ? 262  LYS A CB    1 
ATOM   1288 C CG    . LYS C 3 88  ? 42.337  8.030   9.159   1.00 43.07 ? 262  LYS A CG    1 
ATOM   1289 C CD    . LYS C 3 88  ? 41.869  6.609   9.509   1.00 46.32 ? 262  LYS A CD    1 
ATOM   1290 C CE    . LYS C 3 88  ? 42.926  5.531   9.258   1.00 49.34 ? 262  LYS A CE    1 
ATOM   1291 N NZ    . LYS C 3 88  ? 42.277  4.193   9.033   1.00 52.23 ? 262  LYS A NZ    1 
ATOM   1292 N N     . MET C 3 89  ? 40.084  12.121  10.224  1.00 37.45 ? 263  MET A N     1 
ATOM   1293 C CA    . MET C 3 89  ? 38.838  12.863  10.381  1.00 37.56 ? 263  MET A CA    1 
ATOM   1294 C C     . MET C 3 89  ? 38.890  14.364  10.090  1.00 39.44 ? 263  MET A C     1 
ATOM   1295 O O     . MET C 3 89  ? 37.920  15.092  10.362  1.00 33.46 ? 263  MET A O     1 
ATOM   1296 C CB    . MET C 3 89  ? 38.290  12.615  11.779  1.00 33.61 ? 263  MET A CB    1 
ATOM   1297 C CG    . MET C 3 89  ? 37.775  11.190  11.970  1.00 34.16 ? 263  MET A CG    1 
ATOM   1298 S SD    . MET C 3 89  ? 37.273  10.770  13.677  1.00 37.90 ? 263  MET A SD    1 
ATOM   1299 C CE    . MET C 3 89  ? 35.719  11.726  13.903  1.00 31.78 ? 263  MET A CE    1 
ATOM   1300 N N     . LEU C 3 90  ? 40.020  14.805  9.535   1.00 36.98 ? 264  LEU A N     1 
ATOM   1301 C CA    . LEU C 3 90  ? 40.236  16.207  9.202   1.00 37.20 ? 264  LEU A CA    1 
ATOM   1302 C C     . LEU C 3 90  ? 39.315  16.676  8.109   1.00 38.27 ? 264  LEU A C     1 
ATOM   1303 O O     . LEU C 3 90  ? 39.177  17.858  7.871   1.00 43.81 ? 264  LEU A O     1 
ATOM   1304 C CB    . LEU C 3 90  ? 41.671  16.448  8.765   1.00 37.35 ? 264  LEU A CB    1 
ATOM   1305 C CG    . LEU C 3 90  ? 42.796  16.328  9.788   1.00 38.64 ? 264  LEU A CG    1 
ATOM   1306 C CD1   . LEU C 3 90  ? 44.129  16.661  9.111   1.00 40.44 ? 264  LEU A CD1   1 
ATOM   1307 C CD2   . LEU C 3 90  ? 42.534  17.252  10.946  1.00 33.60 ? 264  LEU A CD2   1 
ATOM   1308 N N     . ASP C 3 91  ? 38.740  15.731  7.398   1.00 38.10 ? 265  ASP A N     1 
ATOM   1309 C CA    . ASP C 3 91  ? 37.816  16.043  6.327   1.00 38.73 ? 265  ASP A CA    1 
ATOM   1310 C C     . ASP C 3 91  ? 36.428  16.094  6.944   1.00 38.78 ? 265  ASP A C     1 
ATOM   1311 O O     . ASP C 3 91  ? 35.472  16.273  6.236   1.00 41.28 ? 265  ASP A O     1 
ATOM   1312 C CB    . ASP C 3 91  ? 37.843  14.913  5.311   1.00 46.56 ? 265  ASP A CB    1 
ATOM   1313 C CG    . ASP C 3 91  ? 37.648  13.553  5.963   1.00 55.80 ? 265  ASP A CG    1 
ATOM   1314 O OD1   . ASP C 3 91  ? 38.627  13.022  6.524   1.00 63.07 ? 265  ASP A OD1   1 
ATOM   1315 O OD2   . ASP C 3 91  ? 36.508  13.042  5.995   1.00 64.83 ? 265  ASP A OD2   1 
ATOM   1316 N N     . HIS C 3 92  ? 36.338  15.900  8.261   1.00 34.13 ? 266  HIS A N     1 
ATOM   1317 C CA    . HIS C 3 92  ? 35.052  15.873  8.926   1.00 31.16 ? 266  HIS A CA    1 
ATOM   1318 C C     . HIS C 3 92  ? 34.831  17.016  9.914   1.00 32.59 ? 266  HIS A C     1 
ATOM   1319 O O     . HIS C 3 92  ? 35.739  17.419  10.625  1.00 29.32 ? 266  HIS A O     1 
ATOM   1320 C CB    . HIS C 3 92  ? 34.936  14.532  9.640   1.00 31.41 ? 266  HIS A CB    1 
ATOM   1321 C CG    . HIS C 3 92  ? 33.531  14.108  9.915   1.00 25.46 ? 266  HIS A CG    1 
ATOM   1322 N ND1   . HIS C 3 92  ? 32.787  14.626  10.951  1.00 28.87 ? 266  HIS A ND1   1 
ATOM   1323 C CD2   . HIS C 3 92  ? 32.747  13.207  9.287   1.00 22.32 ? 266  HIS A CD2   1 
ATOM   1324 C CE1   . HIS C 3 92  ? 31.595  14.060  10.943  1.00 33.64 ? 266  HIS A CE1   1 
ATOM   1325 N NE2   . HIS C 3 92  ? 31.548  13.197  9.947   1.00 35.44 ? 266  HIS A NE2   1 
ATOM   1326 N N     . GLU C 3 93  ? 33.590  17.462  10.022  1.00 30.82 ? 267  GLU A N     1 
ATOM   1327 C CA    . GLU C 3 93  ? 33.235  18.560  10.934  1.00 33.16 ? 267  GLU A CA    1 
ATOM   1328 C C     . GLU C 3 93  ? 33.643  18.306  12.374  1.00 33.78 ? 267  GLU A C     1 
ATOM   1329 O O     . GLU C 3 93  ? 33.826  19.243  13.159  1.00 32.82 ? 267  GLU A O     1 
ATOM   1330 C CB    . GLU C 3 93  ? 31.724  18.818  10.913  1.00 29.40 ? 267  GLU A CB    1 
ATOM   1331 N N     . TYR C 3 94  ? 33.699  17.033  12.758  1.00 35.07 ? 268  TYR A N     1 
ATOM   1332 C CA    . TYR C 3 94  ? 34.062  16.721  14.124  1.00 31.53 ? 268  TYR A CA    1 
ATOM   1333 C C     . TYR C 3 94  ? 35.310  17.477  14.500  1.00 32.01 ? 268  TYR A C     1 
ATOM   1334 O O     . TYR C 3 94  ? 35.371  18.066  15.566  1.00 34.05 ? 268  TYR A O     1 
ATOM   1335 C CB    . TYR C 3 94  ? 34.244  15.218  14.309  1.00 29.15 ? 268  TYR A CB    1 
ATOM   1336 C CG    . TYR C 3 94  ? 33.022  14.552  14.888  1.00 31.19 ? 268  TYR A CG    1 
ATOM   1337 C CD1   . TYR C 3 94  ? 32.553  14.898  16.159  1.00 28.05 ? 268  TYR A CD1   1 
ATOM   1338 C CD2   . TYR C 3 94  ? 32.305  13.595  14.164  1.00 35.45 ? 268  TYR A CD2   1 
ATOM   1339 C CE1   . TYR C 3 94  ? 31.397  14.308  16.702  1.00 34.24 ? 268  TYR A CE1   1 
ATOM   1340 C CE2   . TYR C 3 94  ? 31.133  12.997  14.701  1.00 36.04 ? 268  TYR A CE2   1 
ATOM   1341 C CZ    . TYR C 3 94  ? 30.689  13.366  15.962  1.00 34.18 ? 268  TYR A CZ    1 
ATOM   1342 O OH    . TYR C 3 94  ? 29.522  12.848  16.478  1.00 38.79 ? 268  TYR A OH    1 
ATOM   1343 N N     . THR C 3 95  ? 36.257  17.535  13.572  1.00 33.21 ? 269  THR A N     1 
ATOM   1344 C CA    . THR C 3 95  ? 37.530  18.211  13.811  1.00 36.37 ? 269  THR A CA    1 
ATOM   1345 C C     . THR C 3 95  ? 37.485  19.716  13.962  1.00 36.65 ? 269  THR A C     1 
ATOM   1346 O O     . THR C 3 95  ? 38.479  20.314  14.353  1.00 36.27 ? 269  THR A O     1 
ATOM   1347 C CB    . THR C 3 95  ? 38.596  17.858  12.755  1.00 33.82 ? 269  THR A CB    1 
ATOM   1348 O OG1   . THR C 3 95  ? 38.013  17.892  11.454  1.00 31.42 ? 269  THR A OG1   1 
ATOM   1349 C CG2   . THR C 3 95  ? 39.132  16.482  13.004  1.00 35.87 ? 269  THR A CG2   1 
ATOM   1350 N N     . THR C 3 96  ? 36.330  20.312  13.704  1.00 36.77 ? 270  THR A N     1 
ATOM   1351 C CA    . THR C 3 96  ? 36.193  21.754  13.823  1.00 38.88 ? 270  THR A CA    1 
ATOM   1352 C C     . THR C 3 96  ? 35.529  22.134  15.146  1.00 43.38 ? 270  THR A C     1 
ATOM   1353 O O     . THR C 3 96  ? 35.430  23.305  15.492  1.00 44.58 ? 270  THR A O     1 
ATOM   1354 C CB    . THR C 3 96  ? 35.393  22.307  12.648  1.00 36.91 ? 270  THR A CB    1 
ATOM   1355 O OG1   . THR C 3 96  ? 34.043  21.863  12.726  1.00 36.39 ? 270  THR A OG1   1 
ATOM   1356 C CG2   . THR C 3 96  ? 35.960  21.767  11.356  1.00 37.38 ? 270  THR A CG2   1 
ATOM   1357 N N     . LYS C 3 97  ? 35.115  21.119  15.899  1.00 43.52 ? 271  LYS A N     1 
ATOM   1358 C CA    . LYS C 3 97  ? 34.477  21.367  17.184  1.00 43.68 ? 271  LYS A CA    1 
ATOM   1359 C C     . LYS C 3 97  ? 35.557  21.494  18.247  1.00 41.05 ? 271  LYS A C     1 
ATOM   1360 O O     . LYS C 3 97  ? 36.506  20.701  18.278  1.00 40.04 ? 271  LYS A O     1 
ATOM   1361 C CB    . LYS C 3 97  ? 33.515  20.219  17.525  1.00 45.59 ? 271  LYS A CB    1 
ATOM   1362 C CG    . LYS C 3 97  ? 32.450  19.973  16.472  1.00 48.70 ? 271  LYS A CG    1 
ATOM   1363 C CD    . LYS C 3 97  ? 31.577  18.783  16.846  1.00 54.65 ? 271  LYS A CD    1 
ATOM   1364 C CE    . LYS C 3 97  ? 30.450  18.572  15.817  1.00 60.53 ? 271  LYS A CE    1 
ATOM   1365 N NZ    . LYS C 3 97  ? 29.327  17.662  16.263  1.00 64.21 ? 271  LYS A NZ    1 
ATOM   1366 N N     . GLU C 3 98  ? 35.433  22.504  19.095  1.00 39.18 ? 272  GLU A N     1 
ATOM   1367 C CA    . GLU C 3 98  ? 36.395  22.715  20.162  1.00 43.06 ? 272  GLU A CA    1 
ATOM   1368 C C     . GLU C 3 98  ? 36.379  21.617  21.226  1.00 41.98 ? 272  GLU A C     1 
ATOM   1369 O O     . GLU C 3 98  ? 37.431  21.222  21.733  1.00 39.19 ? 272  GLU A O     1 
ATOM   1370 C CB    . GLU C 3 98  ? 36.220  24.087  20.799  1.00 49.08 ? 272  GLU A CB    1 
ATOM   1371 C CG    . GLU C 3 98  ? 37.032  25.179  20.097  1.00 59.89 ? 272  GLU A CG    1 
ATOM   1372 C CD    . GLU C 3 98  ? 38.478  24.753  19.791  1.00 65.93 ? 272  GLU A CD    1 
ATOM   1373 O OE1   . GLU C 3 98  ? 39.228  24.329  20.715  1.00 67.98 ? 272  GLU A OE1   1 
ATOM   1374 O OE2   . GLU C 3 98  ? 38.859  24.837  18.606  1.00 69.94 ? 272  GLU A OE2   1 
ATOM   1375 N N     . ILE C 3 99  ? 35.196  21.101  21.526  1.00 38.45 ? 273  ILE A N     1 
ATOM   1376 C CA    . ILE C 3 99  ? 35.074  20.023  22.500  1.00 36.88 ? 273  ILE A CA    1 
ATOM   1377 C C     . ILE C 3 99  ? 35.876  18.837  21.984  1.00 33.13 ? 273  ILE A C     1 
ATOM   1378 O O     . ILE C 3 99  ? 36.660  18.241  22.705  1.00 33.59 ? 273  ILE A O     1 
ATOM   1379 C CB    . ILE C 3 99  ? 33.617  19.561  22.652  1.00 41.48 ? 273  ILE A CB    1 
ATOM   1380 C CG1   . ILE C 3 99  ? 32.717  20.716  23.091  1.00 41.81 ? 273  ILE A CG1   1 
ATOM   1381 C CG2   . ILE C 3 99  ? 33.536  18.457  23.679  1.00 41.48 ? 273  ILE A CG2   1 
ATOM   1382 C CD1   . ILE C 3 99  ? 33.034  21.245  24.474  1.00 53.39 ? 273  ILE A CD1   1 
ATOM   1383 N N     . PHE C 3 100 ? 35.667  18.505  20.713  1.00 29.13 ? 274  PHE A N     1 
ATOM   1384 C CA    . PHE C 3 100 ? 36.363  17.400  20.090  1.00 32.26 ? 274  PHE A CA    1 
ATOM   1385 C C     . PHE C 3 100 ? 37.891  17.596  20.126  1.00 33.76 ? 274  PHE A C     1 
ATOM   1386 O O     . PHE C 3 100 ? 38.632  16.748  20.646  1.00 32.46 ? 274  PHE A O     1 
ATOM   1387 C CB    . PHE C 3 100 ? 35.885  17.236  18.644  1.00 28.41 ? 274  PHE A CB    1 
ATOM   1388 C CG    . PHE C 3 100 ? 36.253  15.921  18.041  1.00 26.29 ? 274  PHE A CG    1 
ATOM   1389 C CD1   . PHE C 3 100 ? 37.462  15.756  17.383  1.00 24.03 ? 274  PHE A CD1   1 
ATOM   1390 C CD2   . PHE C 3 100 ? 35.403  14.826  18.159  1.00 30.42 ? 274  PHE A CD2   1 
ATOM   1391 C CE1   . PHE C 3 100 ? 37.826  14.498  16.842  1.00 27.22 ? 274  PHE A CE1   1 
ATOM   1392 C CE2   . PHE C 3 100 ? 35.748  13.567  17.626  1.00 29.28 ? 274  PHE A CE2   1 
ATOM   1393 C CZ    . PHE C 3 100 ? 36.958  13.402  16.966  1.00 28.23 ? 274  PHE A CZ    1 
ATOM   1394 N N     . ARG C 3 101 ? 38.352  18.702  19.559  1.00 34.29 ? 275  ARG A N     1 
ATOM   1395 C CA    . ARG C 3 101 ? 39.781  19.006  19.497  1.00 36.37 ? 275  ARG A CA    1 
ATOM   1396 C C     . ARG C 3 101 ? 40.440  18.890  20.872  1.00 36.91 ? 275  ARG A C     1 
ATOM   1397 O O     . ARG C 3 101 ? 41.496  18.273  21.026  1.00 39.04 ? 275  ARG A O     1 
ATOM   1398 C CB    . ARG C 3 101 ? 39.994  20.399  18.878  1.00 36.49 ? 275  ARG A CB    1 
ATOM   1399 C CG    . ARG C 3 101 ? 39.299  20.559  17.531  1.00 39.89 ? 275  ARG A CG    1 
ATOM   1400 C CD    . ARG C 3 101 ? 39.580  21.888  16.862  1.00 43.34 ? 275  ARG A CD    1 
ATOM   1401 N NE    . ARG C 3 101 ? 40.998  22.076  16.548  1.00 49.60 ? 275  ARG A NE    1 
ATOM   1402 C CZ    . ARG C 3 101 ? 41.591  21.764  15.394  1.00 47.85 ? 275  ARG A CZ    1 
ATOM   1403 N NH1   . ARG C 3 101 ? 40.908  21.238  14.382  1.00 47.72 ? 275  ARG A NH1   1 
ATOM   1404 N NH2   . ARG C 3 101 ? 42.885  21.973  15.256  1.00 52.41 ? 275  ARG A NH2   1 
ATOM   1405 N N     . LYS C 3 102 ? 39.798  19.456  21.883  1.00 38.51 ? 276  LYS A N     1 
ATOM   1406 C CA    . LYS C 3 102 ? 40.330  19.388  23.230  1.00 42.38 ? 276  LYS A CA    1 
ATOM   1407 C C     . LYS C 3 102 ? 40.338  17.981  23.812  1.00 42.11 ? 276  LYS A C     1 
ATOM   1408 O O     . LYS C 3 102 ? 41.376  17.523  24.324  1.00 43.37 ? 276  LYS A O     1 
ATOM   1409 C CB    . LYS C 3 102 ? 39.561  20.320  24.150  1.00 49.46 ? 276  LYS A CB    1 
ATOM   1410 C CG    . LYS C 3 102 ? 39.829  21.794  23.876  1.00 61.51 ? 276  LYS A CG    1 
ATOM   1411 C CD    . LYS C 3 102 ? 41.072  22.316  24.636  1.00 68.44 ? 276  LYS A CD    1 
ATOM   1412 C CE    . LYS C 3 102 ? 41.082  23.859  24.718  1.00 72.81 ? 276  LYS A CE    1 
ATOM   1413 N NZ    . LYS C 3 102 ? 41.982  24.451  25.765  1.00 67.27 ? 276  LYS A NZ    1 
ATOM   1414 N N     . ASN C 3 103 ? 39.203  17.297  23.736  1.00 36.47 ? 277  ASN A N     1 
ATOM   1415 C CA    . ASN C 3 103 ? 39.117  15.956  24.266  1.00 36.98 ? 277  ASN A CA    1 
ATOM   1416 C C     . ASN C 3 103 ? 40.160  15.076  23.599  1.00 39.42 ? 277  ASN A C     1 
ATOM   1417 O O     . ASN C 3 103 ? 40.851  14.306  24.271  1.00 43.99 ? 277  ASN A O     1 
ATOM   1418 C CB    . ASN C 3 103 ? 37.711  15.391  24.099  1.00 36.05 ? 277  ASN A CB    1 
ATOM   1419 C CG    . ASN C 3 103 ? 36.741  15.932  25.136  1.00 31.74 ? 277  ASN A CG    1 
ATOM   1420 O OD1   . ASN C 3 103 ? 37.154  16.473  26.159  1.00 40.92 ? 277  ASN A OD1   1 
ATOM   1421 N ND2   . ASN C 3 103 ? 35.461  15.709  24.919  1.00 28.52 ? 277  ASN A ND2   1 
ATOM   1422 N N     . PHE C 3 104 ? 40.304  15.228  22.290  1.00 35.75 ? 278  PHE A N     1 
ATOM   1423 C CA    . PHE C 3 104 ? 41.291  14.459  21.551  1.00 36.15 ? 278  PHE A CA    1 
ATOM   1424 C C     . PHE C 3 104 ? 42.696  14.846  22.012  1.00 34.28 ? 278  PHE A C     1 
ATOM   1425 O O     . PHE C 3 104 ? 43.537  13.990  22.259  1.00 27.81 ? 278  PHE A O     1 
ATOM   1426 C CB    . PHE C 3 104 ? 41.183  14.729  20.034  1.00 37.39 ? 278  PHE A CB    1 
ATOM   1427 C CG    . PHE C 3 104 ? 42.468  14.469  19.279  1.00 38.93 ? 278  PHE A CG    1 
ATOM   1428 C CD1   . PHE C 3 104 ? 42.827  13.180  18.923  1.00 36.01 ? 278  PHE A CD1   1 
ATOM   1429 C CD2   . PHE C 3 104 ? 43.349  15.511  18.989  1.00 38.53 ? 278  PHE A CD2   1 
ATOM   1430 C CE1   . PHE C 3 104 ? 44.043  12.930  18.306  1.00 36.93 ? 278  PHE A CE1   1 
ATOM   1431 C CE2   . PHE C 3 104 ? 44.554  15.267  18.378  1.00 34.99 ? 278  PHE A CE2   1 
ATOM   1432 C CZ    . PHE C 3 104 ? 44.903  13.970  18.034  1.00 38.06 ? 278  PHE A CZ    1 
ATOM   1433 N N     . PHE C 3 105 ? 42.965  16.144  22.036  1.00 34.33 ? 279  PHE A N     1 
ATOM   1434 C CA    . PHE C 3 105 ? 44.280  16.587  22.403  1.00 37.03 ? 279  PHE A CA    1 
ATOM   1435 C C     . PHE C 3 105 ? 44.738  16.031  23.753  1.00 39.51 ? 279  PHE A C     1 
ATOM   1436 O O     . PHE C 3 105 ? 45.811  15.435  23.871  1.00 40.77 ? 279  PHE A O     1 
ATOM   1437 C CB    . PHE C 3 105 ? 44.365  18.106  22.375  1.00 42.24 ? 279  PHE A CB    1 
ATOM   1438 C CG    . PHE C 3 105 ? 45.777  18.630  22.200  1.00 48.20 ? 279  PHE A CG    1 
ATOM   1439 C CD1   . PHE C 3 105 ? 46.593  18.132  21.198  1.00 48.93 ? 279  PHE A CD1   1 
ATOM   1440 C CD2   . PHE C 3 105 ? 46.296  19.600  23.047  1.00 44.69 ? 279  PHE A CD2   1 
ATOM   1441 C CE1   . PHE C 3 105 ? 47.893  18.605  21.030  1.00 51.67 ? 279  PHE A CE1   1 
ATOM   1442 C CE2   . PHE C 3 105 ? 47.590  20.079  22.882  1.00 45.87 ? 279  PHE A CE2   1 
ATOM   1443 C CZ    . PHE C 3 105 ? 48.392  19.572  21.881  1.00 49.90 ? 279  PHE A CZ    1 
ATOM   1444 N N     . LYS C 3 106 ? 43.902  16.194  24.761  1.00 38.68 ? 280  LYS A N     1 
ATOM   1445 C CA    . LYS C 3 106 ? 44.243  15.700  26.084  1.00 40.77 ? 280  LYS A CA    1 
ATOM   1446 C C     . LYS C 3 106 ? 44.485  14.184  26.087  1.00 38.73 ? 280  LYS A C     1 
ATOM   1447 O O     . LYS C 3 106 ? 45.470  13.708  26.645  1.00 32.25 ? 280  LYS A O     1 
ATOM   1448 C CB    . LYS C 3 106 ? 43.113  16.062  27.057  1.00 45.89 ? 280  LYS A CB    1 
ATOM   1449 C CG    . LYS C 3 106 ? 43.209  15.443  28.438  1.00 48.71 ? 280  LYS A CG    1 
ATOM   1450 C CD    . LYS C 3 106 ? 41.814  15.317  29.058  1.00 56.61 ? 280  LYS A CD    1 
ATOM   1451 C CE    . LYS C 3 106 ? 40.944  14.167  28.445  1.00 60.70 ? 280  LYS A CE    1 
ATOM   1452 N NZ    . LYS C 3 106 ? 40.552  14.212  26.966  1.00 52.98 ? 280  LYS A NZ    1 
ATOM   1453 N N     . ASP C 3 107 ? 43.566  13.427  25.496  1.00 36.34 ? 281  ASP A N     1 
ATOM   1454 C CA    . ASP C 3 107 ? 43.699  11.976  25.504  1.00 37.36 ? 281  ASP A CA    1 
ATOM   1455 C C     . ASP C 3 107 ? 44.912  11.535  24.712  1.00 39.86 ? 281  ASP A C     1 
ATOM   1456 O O     . ASP C 3 107 ? 45.584  10.583  25.092  1.00 39.39 ? 281  ASP A O     1 
ATOM   1457 C CB    . ASP C 3 107 ? 42.432  11.273  24.979  1.00 36.93 ? 281  ASP A CB    1 
ATOM   1458 C CG    . ASP C 3 107 ? 41.369  11.064  26.054  1.00 34.12 ? 281  ASP A CG    1 
ATOM   1459 O OD1   . ASP C 3 107 ? 41.638  11.356  27.236  1.00 40.18 ? 281  ASP A OD1   1 
ATOM   1460 O OD2   . ASP C 3 107 ? 40.267  10.594  25.717  1.00 31.63 ? 281  ASP A OD2   1 
ATOM   1461 N N     . TRP C 3 108 ? 45.202  12.241  23.619  1.00 41.33 ? 282  TRP A N     1 
ATOM   1462 C CA    . TRP C 3 108 ? 46.349  11.900  22.784  1.00 38.97 ? 282  TRP A CA    1 
ATOM   1463 C C     . TRP C 3 108 ? 47.604  12.016  23.646  1.00 40.02 ? 282  TRP A C     1 
ATOM   1464 O O     . TRP C 3 108 ? 48.443  11.124  23.644  1.00 39.67 ? 282  TRP A O     1 
ATOM   1465 C CB    . TRP C 3 108 ? 46.425  12.835  21.572  1.00 38.25 ? 282  TRP A CB    1 
ATOM   1466 C CG    . TRP C 3 108 ? 47.549  12.528  20.624  1.00 37.17 ? 282  TRP A CG    1 
ATOM   1467 C CD1   . TRP C 3 108 ? 48.120  11.315  20.389  1.00 35.48 ? 282  TRP A CD1   1 
ATOM   1468 C CD2   . TRP C 3 108 ? 48.240  13.467  19.800  1.00 33.74 ? 282  TRP A CD2   1 
ATOM   1469 N NE1   . TRP C 3 108 ? 49.125  11.436  19.455  1.00 32.31 ? 282  TRP A NE1   1 
ATOM   1470 C CE2   . TRP C 3 108 ? 49.202  12.744  19.061  1.00 33.72 ? 282  TRP A CE2   1 
ATOM   1471 C CE3   . TRP C 3 108 ? 48.103  14.837  19.572  1.00 34.28 ? 282  TRP A CE3   1 
ATOM   1472 C CZ2   . TRP C 3 108 ? 50.066  13.359  18.156  1.00 33.56 ? 282  TRP A CZ2   1 
ATOM   1473 C CZ3   . TRP C 3 108 ? 48.952  15.446  18.667  1.00 35.39 ? 282  TRP A CZ3   1 
ATOM   1474 C CH2   . TRP C 3 108 ? 49.905  14.702  17.951  1.00 34.59 ? 282  TRP A CH2   1 
ATOM   1475 N N     . ARG C 3 109 ? 47.704  13.101  24.402  1.00 41.25 ? 283  ARG A N     1 
ATOM   1476 C CA    . ARG C 3 109 ? 48.841  13.322  25.270  1.00 44.03 ? 283  ARG A CA    1 
ATOM   1477 C C     . ARG C 3 109 ? 49.072  12.238  26.305  1.00 43.71 ? 283  ARG A C     1 
ATOM   1478 O O     . ARG C 3 109 ? 50.218  11.924  26.598  1.00 42.51 ? 283  ARG A O     1 
ATOM   1479 C CB    . ARG C 3 109 ? 48.733  14.677  25.951  1.00 48.65 ? 283  ARG A CB    1 
ATOM   1480 C CG    . ARG C 3 109 ? 49.022  15.832  25.003  1.00 53.54 ? 283  ARG A CG    1 
ATOM   1481 C CD    . ARG C 3 109 ? 48.839  17.194  25.657  1.00 52.15 ? 283  ARG A CD    1 
ATOM   1482 N NE    . ARG C 3 109 ? 50.131  17.825  25.874  1.00 56.92 ? 283  ARG A NE    1 
ATOM   1483 C CZ    . ARG C 3 109 ? 50.806  17.800  27.013  1.00 51.55 ? 283  ARG A CZ    1 
ATOM   1484 N NH1   . ARG C 3 109 ? 50.333  17.182  28.084  1.00 52.74 ? 283  ARG A NH1   1 
ATOM   1485 N NH2   . ARG C 3 109 ? 51.987  18.377  27.059  1.00 56.99 ? 283  ARG A NH2   1 
ATOM   1486 N N     . LYS C 3 110 ? 48.012  11.663  26.858  1.00 42.26 ? 284  LYS A N     1 
ATOM   1487 C CA    . LYS C 3 110 ? 48.182  10.612  27.849  1.00 43.95 ? 284  LYS A CA    1 
ATOM   1488 C C     . LYS C 3 110 ? 48.868  9.396   27.241  1.00 44.48 ? 284  LYS A C     1 
ATOM   1489 O O     . LYS C 3 110 ? 49.340  8.514   27.961  1.00 49.25 ? 284  LYS A O     1 
ATOM   1490 C CB    . LYS C 3 110 ? 46.841  10.166  28.426  1.00 45.75 ? 284  LYS A CB    1 
ATOM   1491 C CG    . LYS C 3 110 ? 45.984  11.275  29.015  1.00 52.55 ? 284  LYS A CG    1 
ATOM   1492 C CD    . LYS C 3 110 ? 44.717  10.694  29.644  1.00 53.34 ? 284  LYS A CD    1 
ATOM   1493 C CE    . LYS C 3 110 ? 43.617  11.735  29.805  1.00 53.91 ? 284  LYS A CE    1 
ATOM   1494 N NZ    . LYS C 3 110 ? 42.309  11.081  30.131  1.00 54.90 ? 284  LYS A NZ    1 
ATOM   1495 N N     . GLU C 3 111 ? 48.918  9.335   25.920  1.00 44.61 ? 285  GLU A N     1 
ATOM   1496 C CA    . GLU C 3 111 ? 49.531  8.208   25.251  1.00 43.85 ? 285  GLU A CA    1 
ATOM   1497 C C     . GLU C 3 111 ? 50.903  8.541   24.729  1.00 43.33 ? 285  GLU A C     1 
ATOM   1498 O O     . GLU C 3 111 ? 51.613  7.660   24.289  1.00 45.54 ? 285  GLU A O     1 
ATOM   1499 C CB    . GLU C 3 111 ? 48.645  7.700   24.110  1.00 42.79 ? 285  GLU A CB    1 
ATOM   1500 C CG    . GLU C 3 111 ? 47.176  7.354   24.513  1.00 48.23 ? 285  GLU A CG    1 
ATOM   1501 C CD    . GLU C 3 111 ? 47.012  6.293   25.620  1.00 45.99 ? 285  GLU A CD    1 
ATOM   1502 O OE1   . GLU C 3 111 ? 47.754  5.292   25.649  1.00 51.15 ? 285  GLU A OE1   1 
ATOM   1503 O OE2   . GLU C 3 111 ? 46.097  6.443   26.451  1.00 45.33 ? 285  GLU A OE2   1 
ATOM   1504 N N     . MET C 3 112 ? 51.281  9.811   24.774  1.00 38.82 ? 286  MET A N     1 
ATOM   1505 C CA    . MET C 3 112 ? 52.587  10.198  24.282  1.00 41.76 ? 286  MET A CA    1 
ATOM   1506 C C     . MET C 3 112 ? 53.741  9.834   25.236  1.00 43.22 ? 286  MET A C     1 
ATOM   1507 O O     . MET C 3 112 ? 53.526  9.545   26.416  1.00 45.53 ? 286  MET A O     1 
ATOM   1508 C CB    . MET C 3 112 ? 52.623  11.697  24.038  1.00 39.77 ? 286  MET A CB    1 
ATOM   1509 C CG    . MET C 3 112 ? 51.667  12.217  22.998  1.00 38.23 ? 286  MET A CG    1 
ATOM   1510 S SD    . MET C 3 112 ? 51.898  14.000  22.932  1.00 44.64 ? 286  MET A SD    1 
ATOM   1511 C CE    . MET C 3 112 ? 50.712  14.552  21.733  1.00 41.41 ? 286  MET A CE    1 
ATOM   1512 N N     . THR C 3 113 ? 54.960  9.834   24.716  1.00 42.08 ? 287  THR A N     1 
ATOM   1513 C CA    . THR C 3 113 ? 56.110  9.567   25.561  1.00 44.01 ? 287  THR A CA    1 
ATOM   1514 C C     . THR C 3 113 ? 56.310  10.875  26.323  1.00 46.90 ? 287  THR A C     1 
ATOM   1515 O O     . THR C 3 113 ? 55.696  11.889  25.988  1.00 47.02 ? 287  THR A O     1 
ATOM   1516 C CB    . THR C 3 113 ? 57.370  9.281   24.735  1.00 43.56 ? 287  THR A CB    1 
ATOM   1517 O OG1   . THR C 3 113 ? 57.711  10.438  23.955  1.00 37.23 ? 287  THR A OG1   1 
ATOM   1518 C CG2   . THR C 3 113 ? 57.140  8.090   23.822  1.00 45.98 ? 287  THR A CG2   1 
ATOM   1519 N N     . ASN C 3 114 ? 57.193  10.881  27.311  1.00 52.48 ? 288  ASN A N     1 
ATOM   1520 C CA    . ASN C 3 114 ? 57.421  12.087  28.108  1.00 52.61 ? 288  ASN A CA    1 
ATOM   1521 C C     . ASN C 3 114 ? 57.927  13.275  27.336  1.00 50.97 ? 288  ASN A C     1 
ATOM   1522 O O     . ASN C 3 114 ? 57.632  14.418  27.667  1.00 50.28 ? 288  ASN A O     1 
ATOM   1523 C CB    . ASN C 3 114 ? 58.376  11.789  29.245  1.00 59.22 ? 288  ASN A CB    1 
ATOM   1524 C CG    . ASN C 3 114 ? 57.740  10.942  30.319  1.00 64.91 ? 288  ASN A CG    1 
ATOM   1525 O OD1   . ASN C 3 114 ? 58.403  10.118  30.959  1.00 67.79 ? 288  ASN A OD1   1 
ATOM   1526 N ND2   . ASN C 3 114 ? 56.421  11.130  30.517  1.00 70.68 ? 288  ASN A ND2   1 
ATOM   1527 N N     . GLU C 3 115 ? 58.712  12.988  26.310  1.00 51.18 ? 289  GLU A N     1 
ATOM   1528 C CA    . GLU C 3 115 ? 59.287  14.018  25.467  1.00 50.31 ? 289  GLU A CA    1 
ATOM   1529 C C     . GLU C 3 115 ? 58.260  14.639  24.519  1.00 49.93 ? 289  GLU A C     1 
ATOM   1530 O O     . GLU C 3 115 ? 58.333  15.836  24.188  1.00 48.83 ? 289  GLU A O     1 
ATOM   1531 C CB    . GLU C 3 115 ? 60.448  13.425  24.666  1.00 49.36 ? 289  GLU A CB    1 
ATOM   1532 N N     . GLU C 3 116 ? 57.337  13.806  24.045  1.00 48.45 ? 290  GLU A N     1 
ATOM   1533 C CA    . GLU C 3 116 ? 56.293  14.247  23.126  1.00 49.75 ? 290  GLU A CA    1 
ATOM   1534 C C     . GLU C 3 116 ? 55.389  15.255  23.825  1.00 48.30 ? 290  GLU A C     1 
ATOM   1535 O O     . GLU C 3 116 ? 54.943  16.241  23.224  1.00 47.96 ? 290  GLU A O     1 
ATOM   1536 C CB    . GLU C 3 116 ? 55.510  13.032  22.589  1.00 51.10 ? 290  GLU A CB    1 
ATOM   1537 C CG    . GLU C 3 116 ? 56.316  12.199  21.549  1.00 51.80 ? 290  GLU A CG    1 
ATOM   1538 C CD    . GLU C 3 116 ? 55.741  10.819  21.254  1.00 52.86 ? 290  GLU A CD    1 
ATOM   1539 O OE1   . GLU C 3 116 ? 54.948  10.310  22.077  1.00 50.05 ? 290  GLU A OE1   1 
ATOM   1540 O OE2   . GLU C 3 116 ? 56.108  10.231  20.209  1.00 50.32 ? 290  GLU A OE2   1 
ATOM   1541 N N     . LYS C 3 117 ? 55.176  15.014  25.120  1.00 48.35 ? 291  LYS A N     1 
ATOM   1542 C CA    . LYS C 3 117 ? 54.352  15.874  25.956  1.00 50.05 ? 291  LYS A CA    1 
ATOM   1543 C C     . LYS C 3 117 ? 55.028  17.224  26.057  1.00 52.20 ? 291  LYS A C     1 
ATOM   1544 O O     . LYS C 3 117 ? 54.395  18.276  25.924  1.00 53.94 ? 291  LYS A O     1 
ATOM   1545 C CB    . LYS C 3 117 ? 54.197  15.269  27.353  1.00 47.60 ? 291  LYS A CB    1 
ATOM   1546 C CG    . LYS C 3 117 ? 53.817  13.813  27.309  1.00 48.24 ? 291  LYS A CG    1 
ATOM   1547 C CD    . LYS C 3 117 ? 53.281  13.253  28.626  1.00 52.04 ? 291  LYS A CD    1 
ATOM   1548 C CE    . LYS C 3 117 ? 52.789  11.811  28.384  1.00 55.13 ? 291  LYS A CE    1 
ATOM   1549 N NZ    . LYS C 3 117 ? 52.158  11.115  29.540  1.00 55.97 ? 291  LYS A NZ    1 
ATOM   1550 N N     . ASN C 3 118 ? 56.348  17.181  26.230  1.00 50.58 ? 292  ASN A N     1 
ATOM   1551 C CA    . ASN C 3 118 ? 57.126  18.390  26.357  1.00 49.72 ? 292  ASN A CA    1 
ATOM   1552 C C     . ASN C 3 118 ? 57.089  19.216  25.113  1.00 47.77 ? 292  ASN A C     1 
ATOM   1553 O O     . ASN C 3 118 ? 57.022  20.435  25.176  1.00 51.52 ? 292  ASN A O     1 
ATOM   1554 C CB    . ASN C 3 118 ? 58.559  18.062  26.717  1.00 50.75 ? 292  ASN A CB    1 
ATOM   1555 C CG    . ASN C 3 118 ? 58.710  17.636  28.164  1.00 53.64 ? 292  ASN A CG    1 
ATOM   1556 O OD1   . ASN C 3 118 ? 57.738  17.612  28.930  1.00 55.13 ? 292  ASN A OD1   1 
ATOM   1557 N ND2   . ASN C 3 118 ? 59.939  17.329  28.559  1.00 56.36 ? 292  ASN A ND2   1 
ATOM   1558 N N     . ILE C 3 119 ? 57.093  18.554  23.976  1.00 46.28 ? 293  ILE A N     1 
ATOM   1559 C CA    . ILE C 3 119 ? 57.079  19.252  22.721  1.00 46.16 ? 293  ILE A CA    1 
ATOM   1560 C C     . ILE C 3 119 ? 55.708  19.635  22.217  1.00 48.42 ? 293  ILE A C     1 
ATOM   1561 O O     . ILE C 3 119 ? 55.406  20.810  22.068  1.00 49.36 ? 293  ILE A O     1 
ATOM   1562 C CB    . ILE C 3 119 ? 57.784  18.422  21.709  1.00 47.50 ? 293  ILE A CB    1 
ATOM   1563 C CG1   . ILE C 3 119 ? 59.190  18.119  22.245  1.00 48.17 ? 293  ILE A CG1   1 
ATOM   1564 C CG2   . ILE C 3 119 ? 57.800  19.135  20.383  1.00 50.05 ? 293  ILE A CG2   1 
ATOM   1565 C CD1   . ILE C 3 119 ? 60.005  17.215  21.383  1.00 54.52 ? 293  ILE A CD1   1 
ATOM   1566 N N     . ILE C 3 120 ? 54.890  18.635  21.924  1.00 50.95 ? 294  ILE A N     1 
ATOM   1567 C CA    . ILE C 3 120 ? 53.546  18.879  21.407  1.00 53.13 ? 294  ILE A CA    1 
ATOM   1568 C C     . ILE C 3 120 ? 52.622  19.420  22.503  1.00 53.68 ? 294  ILE A C     1 
ATOM   1569 O O     . ILE C 3 120 ? 52.042  18.653  23.280  1.00 54.86 ? 294  ILE A O     1 
ATOM   1570 C CB    . ILE C 3 120 ? 52.971  17.572  20.804  1.00 55.32 ? 294  ILE A CB    1 
ATOM   1571 C CG1   . ILE C 3 120 ? 54.068  16.880  19.983  1.00 53.37 ? 294  ILE A CG1   1 
ATOM   1572 C CG2   . ILE C 3 120 ? 51.728  17.866  19.929  1.00 50.35 ? 294  ILE A CG2   1 
ATOM   1573 C CD1   . ILE C 3 120 ? 53.765  15.435  19.633  1.00 57.98 ? 294  ILE A CD1   1 
ATOM   1574 N N     . THR C 3 121 ? 52.458  20.735  22.545  1.00 51.05 ? 295  THR A N     1 
ATOM   1575 C CA    . THR C 3 121 ? 51.608  21.335  23.552  1.00 50.15 ? 295  THR A CA    1 
ATOM   1576 C C     . THR C 3 121 ? 50.529  22.191  22.918  1.00 51.15 ? 295  THR A C     1 
ATOM   1577 O O     . THR C 3 121 ? 49.660  22.722  23.612  1.00 54.07 ? 295  THR A O     1 
ATOM   1578 C CB    . THR C 3 121 ? 52.429  22.192  24.479  1.00 52.53 ? 295  THR A CB    1 
ATOM   1579 O OG1   . THR C 3 121 ? 53.045  23.231  23.716  1.00 58.01 ? 295  THR A OG1   1 
ATOM   1580 C CG2   . THR C 3 121 ? 53.502  21.356  25.148  1.00 48.21 ? 295  THR A CG2   1 
ATOM   1581 N N     . ASN C 3 122 ? 50.551  22.304  21.596  1.00 51.08 ? 296  ASN A N     1 
ATOM   1582 C CA    . ASN C 3 122 ? 49.551  23.103  20.898  1.00 50.88 ? 296  ASN A CA    1 
ATOM   1583 C C     . ASN C 3 122 ? 49.004  22.346  19.711  1.00 48.82 ? 296  ASN A C     1 
ATOM   1584 O O     . ASN C 3 122 ? 49.720  22.050  18.756  1.00 47.35 ? 296  ASN A O     1 
ATOM   1585 C CB    . ASN C 3 122 ? 50.143  24.428  20.420  1.00 52.99 ? 296  ASN A CB    1 
ATOM   1586 C CG    . ASN C 3 122 ? 49.099  25.358  19.860  1.00 59.73 ? 296  ASN A CG    1 
ATOM   1587 O OD1   . ASN C 3 122 ? 47.920  24.993  19.710  1.00 64.21 ? 296  ASN A OD1   1 
ATOM   1588 N ND2   . ASN C 3 122 ? 49.500  26.596  19.618  1.00 63.58 ? 296  ASN A ND2   1 
ATOM   1589 N N     . LEU C 3 123 ? 47.729  22.014  19.773  1.00 48.24 ? 297  LEU A N     1 
ATOM   1590 C CA    . LEU C 3 123 ? 47.112  21.288  18.689  1.00 49.59 ? 297  LEU A CA    1 
ATOM   1591 C C     . LEU C 3 123 ? 47.277  22.077  17.389  1.00 50.82 ? 297  LEU A C     1 
ATOM   1592 O O     . LEU C 3 123 ? 47.566  21.506  16.322  1.00 47.83 ? 297  LEU A O     1 
ATOM   1593 C CB    . LEU C 3 123 ? 45.629  21.089  19.003  1.00 48.23 ? 297  LEU A CB    1 
ATOM   1594 C CG    . LEU C 3 123 ? 44.833  20.357  17.925  1.00 51.26 ? 297  LEU A CG    1 
ATOM   1595 C CD1   . LEU C 3 123 ? 45.405  18.958  17.825  1.00 51.13 ? 297  LEU A CD1   1 
ATOM   1596 C CD2   . LEU C 3 123 ? 43.331  20.325  18.240  1.00 52.18 ? 297  LEU A CD2   1 
ATOM   1597 N N     . SER C 3 124 ? 47.132  23.392  17.518  1.00 53.22 ? 298  SER A N     1 
ATOM   1598 C CA    . SER C 3 124 ? 47.200  24.308  16.383  1.00 53.69 ? 298  SER A CA    1 
ATOM   1599 C C     . SER C 3 124 ? 48.546  24.265  15.705  1.00 53.07 ? 298  SER A C     1 
ATOM   1600 O O     . SER C 3 124 ? 48.722  24.784  14.605  1.00 53.96 ? 298  SER A O     1 
ATOM   1601 C CB    . SER C 3 124 ? 46.851  25.746  16.798  1.00 54.02 ? 298  SER A CB    1 
ATOM   1602 O OG    . SER C 3 124 ? 47.975  26.414  17.328  1.00 58.12 ? 298  SER A OG    1 
ATOM   1603 N N     . LYS C 3 125 ? 49.493  23.610  16.349  1.00 52.76 ? 299  LYS A N     1 
ATOM   1604 C CA    . LYS C 3 125 ? 50.802  23.518  15.757  1.00 55.67 ? 299  LYS A CA    1 
ATOM   1605 C C     . LYS C 3 125 ? 51.061  22.171  15.125  1.00 54.38 ? 299  LYS A C     1 
ATOM   1606 O O     . LYS C 3 125 ? 52.081  21.971  14.478  1.00 53.99 ? 299  LYS A O     1 
ATOM   1607 C CB    . LYS C 3 125 ? 51.881  23.863  16.782  1.00 57.49 ? 299  LYS A CB    1 
ATOM   1608 C CG    . LYS C 3 125 ? 52.391  25.289  16.636  1.00 62.18 ? 299  LYS A CG    1 
ATOM   1609 C CD    . LYS C 3 125 ? 53.260  25.712  17.802  1.00 69.60 ? 299  LYS A CD    1 
ATOM   1610 C CE    . LYS C 3 125 ? 53.498  27.250  17.821  1.00 75.11 ? 299  LYS A CE    1 
ATOM   1611 N NZ    . LYS C 3 125 ? 54.424  27.854  16.778  1.00 71.39 ? 299  LYS A NZ    1 
ATOM   1612 N N     . CYS C 3 126 ? 50.130  21.246  15.296  1.00 51.51 ? 300  CYS A N     1 
ATOM   1613 C CA    . CYS C 3 126 ? 50.319  19.919  14.742  1.00 46.31 ? 300  CYS A CA    1 
ATOM   1614 C C     . CYS C 3 126 ? 49.900  19.894  13.321  1.00 41.21 ? 300  CYS A C     1 
ATOM   1615 O O     . CYS C 3 126 ? 48.922  20.511  12.954  1.00 44.22 ? 300  CYS A O     1 
ATOM   1616 C CB    . CYS C 3 126 ? 49.507  18.909  15.528  1.00 49.80 ? 300  CYS A CB    1 
ATOM   1617 S SG    . CYS C 3 126 ? 49.989  18.818  17.292  1.00 47.60 ? 300  CYS A SG    1 
ATOM   1618 N N     . ASP C 3 127 ? 50.650  19.184  12.510  1.00 40.93 ? 301  ASP A N     1 
ATOM   1619 C CA    . ASP C 3 127 ? 50.290  19.087  11.110  1.00 45.71 ? 301  ASP A CA    1 
ATOM   1620 C C     . ASP C 3 127 ? 50.007  17.647  10.747  1.00 42.33 ? 301  ASP A C     1 
ATOM   1621 O O     . ASP C 3 127 ? 50.926  16.833  10.688  1.00 39.41 ? 301  ASP A O     1 
ATOM   1622 C CB    . ASP C 3 127 ? 51.402  19.638  10.227  1.00 50.04 ? 301  ASP A CB    1 
ATOM   1623 C CG    . ASP C 3 127 ? 51.043  19.587  8.776   1.00 52.37 ? 301  ASP A CG    1 
ATOM   1624 O OD1   . ASP C 3 127 ? 49.847  19.822  8.488   1.00 51.71 ? 301  ASP A OD1   1 
ATOM   1625 O OD2   . ASP C 3 127 ? 51.921  19.282  7.938   1.00 62.28 ? 301  ASP A OD2   1 
ATOM   1626 N N     . PHE C 3 128 ? 48.729  17.336  10.575  1.00 38.01 ? 302  PHE A N     1 
ATOM   1627 C CA    . PHE C 3 128 ? 48.277  15.992  10.229  1.00 41.00 ? 302  PHE A CA    1 
ATOM   1628 C C     . PHE C 3 128 ? 47.985  15.878  8.743   1.00 45.62 ? 302  PHE A C     1 
ATOM   1629 O O     . PHE C 3 128 ? 47.428  14.868  8.284   1.00 48.03 ? 302  PHE A O     1 
ATOM   1630 C CB    . PHE C 3 128 ? 46.995  15.645  10.991  1.00 38.33 ? 302  PHE A CB    1 
ATOM   1631 C CG    . PHE C 3 128 ? 47.106  15.797  12.464  1.00 37.65 ? 302  PHE A CG    1 
ATOM   1632 C CD1   . PHE C 3 128 ? 47.784  14.850  13.221  1.00 35.46 ? 302  PHE A CD1   1 
ATOM   1633 C CD2   . PHE C 3 128 ? 46.595  16.918  13.092  1.00 35.74 ? 302  PHE A CD2   1 
ATOM   1634 C CE1   . PHE C 3 128 ? 47.943  15.013  14.598  1.00 38.58 ? 302  PHE A CE1   1 
ATOM   1635 C CE2   . PHE C 3 128 ? 46.744  17.092  14.464  1.00 37.10 ? 302  PHE A CE2   1 
ATOM   1636 C CZ    . PHE C 3 128 ? 47.431  16.137  15.220  1.00 35.82 ? 302  PHE A CZ    1 
ATOM   1637 N N     . THR C 3 129 ? 48.297  16.925  7.998   1.00 44.86 ? 303  THR A N     1 
ATOM   1638 C CA    . THR C 3 129 ? 48.010  16.917  6.587   1.00 47.39 ? 303  THR A CA    1 
ATOM   1639 C C     . THR C 3 129 ? 48.589  15.742  5.824   1.00 48.41 ? 303  THR A C     1 
ATOM   1640 O O     . THR C 3 129 ? 47.875  15.086  5.060   1.00 47.62 ? 303  THR A O     1 
ATOM   1641 C CB    . THR C 3 129 ? 48.441  18.205  5.950   1.00 50.20 ? 303  THR A CB    1 
ATOM   1642 O OG1   . THR C 3 129 ? 49.854  18.391  6.145   1.00 54.81 ? 303  THR A OG1   1 
ATOM   1643 C CG2   . THR C 3 129 ? 47.657  19.347  6.576   1.00 48.36 ? 303  THR A CG2   1 
ATOM   1644 N N     . GLN C 3 130 ? 49.883  15.492  5.987   1.00 48.28 ? 304  GLN A N     1 
ATOM   1645 C CA    . GLN C 3 130 ? 50.476  14.379  5.269   1.00 46.27 ? 304  GLN A CA    1 
ATOM   1646 C C     . GLN C 3 130 ? 49.851  13.045  5.623   1.00 44.23 ? 304  GLN A C     1 
ATOM   1647 O O     . GLN C 3 130 ? 49.606  12.223  4.748   1.00 43.42 ? 304  GLN A O     1 
ATOM   1648 C CB    . GLN C 3 130 ? 51.991  14.372  5.403   1.00 50.24 ? 304  GLN A CB    1 
ATOM   1649 C CG    . GLN C 3 130 ? 52.615  15.143  4.263   1.00 58.04 ? 304  GLN A CG    1 
ATOM   1650 C CD    . GLN C 3 130 ? 54.088  14.879  4.092   1.00 60.24 ? 304  GLN A CD    1 
ATOM   1651 O OE1   . GLN C 3 130 ? 54.543  13.730  4.121   1.00 56.56 ? 304  GLN A OE1   1 
ATOM   1652 N NE2   . GLN C 3 130 ? 54.850  15.956  3.888   1.00 64.22 ? 304  GLN A NE2   1 
ATOM   1653 N N     . MET C 3 131 ? 49.519  12.853  6.887   1.00 42.47 ? 305  MET A N     1 
ATOM   1654 C CA    . MET C 3 131 ? 48.882  11.619  7.310   1.00 41.12 ? 305  MET A CA    1 
ATOM   1655 C C     . MET C 3 131 ? 47.546  11.509  6.583   1.00 40.65 ? 305  MET A C     1 
ATOM   1656 O O     . MET C 3 131 ? 47.121  10.451  6.101   1.00 38.92 ? 305  MET A O     1 
ATOM   1657 C CB    . MET C 3 131 ? 48.607  11.683  8.806   1.00 45.74 ? 305  MET A CB    1 
ATOM   1658 C CG    . MET C 3 131 ? 49.436  10.726  9.622   1.00 53.04 ? 305  MET A CG    1 
ATOM   1659 S SD    . MET C 3 131 ? 49.228  10.938  11.405  1.00 59.84 ? 305  MET A SD    1 
ATOM   1660 C CE    . MET C 3 131 ? 50.249  12.410  11.679  1.00 58.03 ? 305  MET A CE    1 
ATOM   1661 N N     . SER C 3 132 ? 46.886  12.645  6.564   1.00 40.06 ? 306  SER A N     1 
ATOM   1662 C CA    . SER C 3 132 ? 45.602  12.796  5.974   1.00 41.98 ? 306  SER A CA    1 
ATOM   1663 C C     . SER C 3 132 ? 45.674  12.474  4.498   1.00 43.10 ? 306  SER A C     1 
ATOM   1664 O O     . SER C 3 132 ? 44.833  11.757  3.971   1.00 43.24 ? 306  SER A O     1 
ATOM   1665 C CB    . SER C 3 132 ? 45.182  14.235  6.201   1.00 45.49 ? 306  SER A CB    1 
ATOM   1666 O OG    . SER C 3 132 ? 43.796  14.383  6.114   1.00 58.89 ? 306  SER A OG    1 
ATOM   1667 N N     . GLN C 3 133 ? 46.687  12.998  3.818   1.00 43.86 ? 307  GLN A N     1 
ATOM   1668 C CA    . GLN C 3 133 ? 46.821  12.755  2.388   1.00 46.14 ? 307  GLN A CA    1 
ATOM   1669 C C     . GLN C 3 133 ? 46.881  11.262  2.137   1.00 43.40 ? 307  GLN A C     1 
ATOM   1670 O O     . GLN C 3 133 ? 46.199  10.746  1.249   1.00 42.40 ? 307  GLN A O     1 
ATOM   1671 C CB    . GLN C 3 133 ? 48.101  13.417  1.858   1.00 51.44 ? 307  GLN A CB    1 
ATOM   1672 C CG    . GLN C 3 133 ? 48.625  12.842  0.523   1.00 61.80 ? 307  GLN A CG    1 
ATOM   1673 C CD    . GLN C 3 133 ? 50.155  12.703  0.476   1.00 65.21 ? 307  GLN A CD    1 
ATOM   1674 O OE1   . GLN C 3 133 ? 50.732  11.933  1.249   1.00 67.04 ? 307  GLN A OE1   1 
ATOM   1675 N NE2   . GLN C 3 133 ? 50.804  13.430  -0.449  1.00 60.76 ? 307  GLN A NE2   1 
ATOM   1676 N N     . TYR C 3 134 ? 47.695  10.593  2.948   1.00 42.13 ? 308  TYR A N     1 
ATOM   1677 C CA    . TYR C 3 134 ? 47.923  9.160   2.844   1.00 39.65 ? 308  TYR A CA    1 
ATOM   1678 C C     . TYR C 3 134 ? 46.681  8.328   2.903   1.00 38.28 ? 308  TYR A C     1 
ATOM   1679 O O     . TYR C 3 134 ? 46.418  7.543   2.000   1.00 39.47 ? 308  TYR A O     1 
ATOM   1680 C CB    . TYR C 3 134 ? 48.863  8.705   3.932   1.00 46.35 ? 308  TYR A CB    1 
ATOM   1681 C CG    . TYR C 3 134 ? 49.001  7.206   4.055   1.00 48.13 ? 308  TYR A CG    1 
ATOM   1682 C CD1   . TYR C 3 134 ? 49.648  6.451   3.072   1.00 49.40 ? 308  TYR A CD1   1 
ATOM   1683 C CD2   . TYR C 3 134 ? 48.549  6.556   5.196   1.00 48.72 ? 308  TYR A CD2   1 
ATOM   1684 C CE1   . TYR C 3 134 ? 49.845  5.090   3.234   1.00 52.26 ? 308  TYR A CE1   1 
ATOM   1685 C CE2   . TYR C 3 134 ? 48.740  5.201   5.373   1.00 50.00 ? 308  TYR A CE2   1 
ATOM   1686 C CZ    . TYR C 3 134 ? 49.395  4.467   4.397   1.00 52.72 ? 308  TYR A CZ    1 
ATOM   1687 O OH    . TYR C 3 134 ? 49.661  3.130   4.607   1.00 57.88 ? 308  TYR A OH    1 
ATOM   1688 N N     . PHE C 3 135 ? 45.954  8.431   4.002   1.00 37.85 ? 309  PHE A N     1 
ATOM   1689 C CA    . PHE C 3 135 ? 44.722  7.668   4.126   1.00 39.75 ? 309  PHE A CA    1 
ATOM   1690 C C     . PHE C 3 135 ? 43.735  7.953   2.991   1.00 41.76 ? 309  PHE A C     1 
ATOM   1691 O O     . PHE C 3 135 ? 43.171  7.022   2.417   1.00 43.60 ? 309  PHE A O     1 
ATOM   1692 C CB    . PHE C 3 135 ? 44.114  7.914   5.491   1.00 38.99 ? 309  PHE A CB    1 
ATOM   1693 C CG    . PHE C 3 135 ? 44.990  7.475   6.601   1.00 35.40 ? 309  PHE A CG    1 
ATOM   1694 C CD1   . PHE C 3 135 ? 45.424  6.159   6.659   1.00 31.86 ? 309  PHE A CD1   1 
ATOM   1695 C CD2   . PHE C 3 135 ? 45.414  8.366   7.565   1.00 32.82 ? 309  PHE A CD2   1 
ATOM   1696 C CE1   . PHE C 3 135 ? 46.241  5.729   7.662   1.00 30.96 ? 309  PHE A CE1   1 
ATOM   1697 C CE2   . PHE C 3 135 ? 46.234  7.946   8.584   1.00 34.89 ? 309  PHE A CE2   1 
ATOM   1698 C CZ    . PHE C 3 135 ? 46.659  6.626   8.627   1.00 32.69 ? 309  PHE A CZ    1 
ATOM   1699 N N     . LYS C 3 136 ? 43.613  9.212   2.594   1.00 42.07 ? 310  LYS A N     1 
ATOM   1700 C CA    . LYS C 3 136 ? 42.710  9.549   1.496   1.00 46.62 ? 310  LYS A CA    1 
ATOM   1701 C C     . LYS C 3 136 ? 43.191  8.758   0.281   1.00 47.33 ? 310  LYS A C     1 
ATOM   1702 O O     . LYS C 3 136 ? 42.412  8.153   -0.453  1.00 48.44 ? 310  LYS A O     1 
ATOM   1703 C CB    . LYS C 3 136 ? 42.732  11.056  1.176   1.00 53.07 ? 310  LYS A CB    1 
ATOM   1704 C CG    . LYS C 3 136 ? 41.994  11.969  2.189   1.00 60.44 ? 310  LYS A CG    1 
ATOM   1705 C CD    . LYS C 3 136 ? 41.289  13.159  1.498   1.00 65.73 ? 310  LYS A CD    1 
ATOM   1706 C CE    . LYS C 3 136 ? 40.593  14.115  2.492   1.00 68.98 ? 310  LYS A CE    1 
ATOM   1707 N NZ    . LYS C 3 136 ? 41.413  15.349  2.789   1.00 77.92 ? 310  LYS A NZ    1 
ATOM   1708 N N     . ALA C 3 137 ? 44.500  8.755   0.096   1.00 41.09 ? 311  ALA A N     1 
ATOM   1709 C CA    . ALA C 3 137 ? 45.075  8.035   -1.007  1.00 39.20 ? 311  ALA A CA    1 
ATOM   1710 C C     . ALA C 3 137 ? 44.661  6.573   -0.899  1.00 43.28 ? 311  ALA A C     1 
ATOM   1711 O O     . ALA C 3 137 ? 44.117  6.007   -1.838  1.00 41.64 ? 311  ALA A O     1 
ATOM   1712 C CB    . ALA C 3 137 ? 46.570  8.161   -0.973  1.00 36.64 ? 311  ALA A CB    1 
ATOM   1713 N N     . GLN C 3 138 ? 44.891  5.978   0.266   1.00 45.04 ? 312  GLN A N     1 
ATOM   1714 C CA    . GLN C 3 138 ? 44.556  4.573   0.475   1.00 46.73 ? 312  GLN A CA    1 
ATOM   1715 C C     . GLN C 3 138 ? 43.125  4.276   0.100   1.00 47.29 ? 312  GLN A C     1 
ATOM   1716 O O     . GLN C 3 138 ? 42.821  3.227   -0.495  1.00 46.15 ? 312  GLN A O     1 
ATOM   1717 C CB    . GLN C 3 138 ? 44.792  4.166   1.925   1.00 49.09 ? 312  GLN A CB    1 
ATOM   1718 C CG    . GLN C 3 138 ? 46.228  4.265   2.349   1.00 61.66 ? 312  GLN A CG    1 
ATOM   1719 C CD    . GLN C 3 138 ? 47.166  3.699   1.296   1.00 69.70 ? 312  GLN A CD    1 
ATOM   1720 O OE1   . GLN C 3 138 ? 47.159  2.483   1.026   1.00 74.97 ? 312  GLN A OE1   1 
ATOM   1721 N NE2   . GLN C 3 138 ? 47.973  4.577   0.665   1.00 69.47 ? 312  GLN A NE2   1 
ATOM   1722 N N     . THR C 3 139 ? 42.244  5.204   0.451   1.00 43.41 ? 313  THR A N     1 
ATOM   1723 C CA    . THR C 3 139 ? 40.842  5.032   0.156   1.00 45.54 ? 313  THR A CA    1 
ATOM   1724 C C     . THR C 3 139 ? 40.616  5.034   -1.347  1.00 47.28 ? 313  THR A C     1 
ATOM   1725 O O     . THR C 3 139 ? 39.849  4.220   -1.872  1.00 46.27 ? 313  THR A O     1 
ATOM   1726 C CB    . THR C 3 139 ? 40.016  6.113   0.829   1.00 44.95 ? 313  THR A CB    1 
ATOM   1727 O OG1   . THR C 3 139 ? 40.123  5.959   2.244   1.00 46.60 ? 313  THR A OG1   1 
ATOM   1728 C CG2   . THR C 3 139 ? 38.562  5.978   0.440   1.00 46.75 ? 313  THR A CG2   1 
ATOM   1729 N N     . GLU C 3 140 ? 41.310  5.919   -2.039  1.00 49.61 ? 314  GLU A N     1 
ATOM   1730 C CA    . GLU C 3 140 ? 41.173  6.011   -3.486  1.00 50.13 ? 314  GLU A CA    1 
ATOM   1731 C C     . GLU C 3 140 ? 41.575  4.682   -4.085  1.00 49.74 ? 314  GLU A C     1 
ATOM   1732 O O     . GLU C 3 140 ? 40.876  4.151   -4.950  1.00 49.93 ? 314  GLU A O     1 
ATOM   1733 C CB    . GLU C 3 140 ? 42.072  7.113   -4.046  1.00 53.43 ? 314  GLU A CB    1 
ATOM   1734 C CG    . GLU C 3 140 ? 41.986  7.273   -5.562  1.00 52.70 ? 314  GLU A CG    1 
ATOM   1735 C CD    . GLU C 3 140 ? 40.576  7.430   -6.034  1.00 52.51 ? 314  GLU A CD    1 
ATOM   1736 O OE1   . GLU C 3 140 ? 39.781  8.082   -5.325  1.00 53.07 ? 314  GLU A OE1   1 
ATOM   1737 O OE2   . GLU C 3 140 ? 40.253  6.884   -7.104  1.00 53.34 ? 314  GLU A OE2   1 
ATOM   1738 N N     . ALA C 3 141 ? 42.669  4.140   -3.573  1.00 49.99 ? 315  ALA A N     1 
ATOM   1739 C CA    . ALA C 3 141 ? 43.225  2.875   -4.030  1.00 50.40 ? 315  ALA A CA    1 
ATOM   1740 C C     . ALA C 3 141 ? 42.166  1.784   -3.977  1.00 53.82 ? 315  ALA A C     1 
ATOM   1741 O O     . ALA C 3 141 ? 41.918  1.078   -4.959  1.00 58.02 ? 315  ALA A O     1 
ATOM   1742 C CB    . ALA C 3 141 ? 44.402  2.492   -3.166  1.00 50.29 ? 315  ALA A CB    1 
ATOM   1743 N N     . ARG C 3 142 ? 41.534  1.648   -2.825  1.00 53.59 ? 316  ARG A N     1 
ATOM   1744 C CA    . ARG C 3 142 ? 40.518  0.629   -2.680  1.00 52.15 ? 316  ARG A CA    1 
ATOM   1745 C C     . ARG C 3 142 ? 39.407  0.865   -3.683  1.00 49.30 ? 316  ARG A C     1 
ATOM   1746 O O     . ARG C 3 142 ? 38.744  -0.075  -4.105  1.00 50.31 ? 316  ARG A O     1 
ATOM   1747 C CB    . ARG C 3 142 ? 40.000  0.588   -1.231  1.00 58.43 ? 316  ARG A CB    1 
ATOM   1748 N N     . LYS C 3 143 ? 39.205  2.112   -4.081  1.00 49.88 ? 317  LYS A N     1 
ATOM   1749 C CA    . LYS C 3 143 ? 38.162  2.417   -5.052  1.00 53.49 ? 317  LYS A CA    1 
ATOM   1750 C C     . LYS C 3 143 ? 38.630  1.969   -6.416  1.00 54.19 ? 317  LYS A C     1 
ATOM   1751 O O     . LYS C 3 143 ? 37.886  1.327   -7.163  1.00 59.02 ? 317  LYS A O     1 
ATOM   1752 C CB    . LYS C 3 143 ? 37.849  3.913   -5.090  1.00 55.76 ? 317  LYS A CB    1 
ATOM   1753 N N     . GLN C 3 144 ? 39.871  2.319   -6.731  1.00 54.67 ? 318  GLN A N     1 
ATOM   1754 C CA    . GLN C 3 144 ? 40.471  1.975   -8.008  1.00 55.68 ? 318  GLN A CA    1 
ATOM   1755 C C     . GLN C 3 144 ? 41.132  0.608   -7.950  1.00 55.94 ? 318  GLN A C     1 
ATOM   1756 O O     . GLN C 3 144 ? 42.344  0.455   -8.113  1.00 59.08 ? 318  GLN A O     1 
ATOM   1757 C CB    . GLN C 3 144 ? 41.473  3.052   -8.432  1.00 55.13 ? 318  GLN A CB    1 
ATOM   1758 C CG    . GLN C 3 144 ? 40.841  4.437   -8.653  1.00 61.75 ? 318  GLN A CG    1 
ATOM   1759 C CD    . GLN C 3 144 ? 39.633  4.431   -9.601  1.00 63.51 ? 318  GLN A CD    1 
ATOM   1760 O OE1   . GLN C 3 144 ? 39.742  4.075   -10.787 1.00 63.55 ? 318  GLN A OE1   1 
ATOM   1761 N NE2   . GLN C 3 144 ? 38.460  4.821   -9.090  1.00 64.05 ? 318  GLN A NE2   1 
ATOM   1762 N N     . MET C 3 145 ? 40.302  -0.405  -7.752  1.00 56.74 ? 319  MET A N     1 
ATOM   1763 C CA    . MET C 3 145 ? 40.789  -1.768  -7.663  1.00 54.64 ? 319  MET A CA    1 
ATOM   1764 C C     . MET C 3 145 ? 40.219  -2.716  -8.735  1.00 54.53 ? 319  MET A C     1 
ATOM   1765 O O     . MET C 3 145 ? 39.135  -2.518  -9.274  1.00 54.60 ? 319  MET A O     1 
ATOM   1766 C CB    . MET C 3 145 ? 40.517  -2.329  -6.266  1.00 54.49 ? 319  MET A CB    1 
ATOM   1767 N N     . SER C 3 146 ? 41.041  -3.728  -9.053  1.00 54.49 ? 320  SER A N     1 
ATOM   1768 C CA    . SER C 3 146 ? 40.697  -4.750  -10.021 1.00 54.70 ? 320  SER A CA    1 
ATOM   1769 C C     . SER C 3 146 ? 39.634  -5.645  -9.455  1.00 51.14 ? 320  SER A C     1 
ATOM   1770 O O     . SER C 3 146 ? 39.551  -5.835  -8.234  1.00 46.97 ? 320  SER A O     1 
ATOM   1771 C CB    . SER C 3 146 ? 41.921  -5.597  -10.421 1.00 60.40 ? 320  SER A CB    1 
ATOM   1772 O OG    . SER C 3 146 ? 42.481  -6.316  -9.328  1.00 61.69 ? 320  SER A OG    1 
ATOM   1773 N N     . LYS C 3 147 ? 38.794  -6.157  -10.352 1.00 48.67 ? 321  LYS A N     1 
ATOM   1774 C CA    . LYS C 3 147 ? 37.719  -7.045  -10.015 1.00 46.76 ? 321  LYS A CA    1 
ATOM   1775 C C     . LYS C 3 147 ? 38.367  -8.243  -9.349  1.00 46.81 ? 321  LYS A C     1 
ATOM   1776 O O     . LYS C 3 147 ? 37.811  -8.812  -8.418  1.00 45.11 ? 321  LYS A O     1 
ATOM   1777 C CB    . LYS C 3 147 ? 36.959  -7.419  -11.284 1.00 49.02 ? 321  LYS A CB    1 
ATOM   1778 C CG    . LYS C 3 147 ? 36.158  -6.249  -11.857 1.00 47.37 ? 321  LYS A CG    1 
ATOM   1779 C CD    . LYS C 3 147 ? 35.598  -6.530  -13.241 1.00 52.94 ? 321  LYS A CD    1 
ATOM   1780 C CE    . LYS C 3 147 ? 34.648  -5.402  -13.694 1.00 61.22 ? 321  LYS A CE    1 
ATOM   1781 N NZ    . LYS C 3 147 ? 34.391  -5.387  -15.183 1.00 67.25 ? 321  LYS A NZ    1 
ATOM   1782 N N     . GLU C 3 148 ? 39.577  -8.574  -9.792  1.00 47.80 ? 322  GLU A N     1 
ATOM   1783 C CA    . GLU C 3 148 ? 40.335  -9.675  -9.206  1.00 53.69 ? 322  GLU A CA    1 
ATOM   1784 C C     . GLU C 3 148 ? 40.620  -9.307  -7.748  1.00 51.94 ? 322  GLU A C     1 
ATOM   1785 O O     . GLU C 3 148 ? 40.561  -10.150 -6.857  1.00 53.11 ? 322  GLU A O     1 
ATOM   1786 C CB    . GLU C 3 148 ? 41.664  -9.903  -9.949  1.00 61.97 ? 322  GLU A CB    1 
ATOM   1787 C CG    . GLU C 3 148 ? 42.535  -11.075 -9.414  1.00 75.04 ? 322  GLU A CG    1 
ATOM   1788 C CD    . GLU C 3 148 ? 43.755  -11.424 -10.322 1.00 81.29 ? 322  GLU A CD    1 
ATOM   1789 O OE1   . GLU C 3 148 ? 44.640  -10.547 -10.522 1.00 84.64 ? 322  GLU A OE1   1 
ATOM   1790 O OE2   . GLU C 3 148 ? 43.834  -12.580 -10.832 1.00 83.35 ? 322  GLU A OE2   1 
ATOM   1791 N N     . GLU C 3 149 ? 40.999  -8.053  -7.530  1.00 51.38 ? 323  GLU A N     1 
ATOM   1792 C CA    . GLU C 3 149 ? 41.272  -7.571  -6.191  1.00 51.35 ? 323  GLU A CA    1 
ATOM   1793 C C     . GLU C 3 149 ? 39.966  -7.629  -5.385  1.00 50.29 ? 323  GLU A C     1 
ATOM   1794 O O     . GLU C 3 149 ? 39.854  -8.354  -4.397  1.00 47.73 ? 323  GLU A O     1 
ATOM   1795 C CB    . GLU C 3 149 ? 41.805  -6.137  -6.267  1.00 55.39 ? 323  GLU A CB    1 
ATOM   1796 C CG    . GLU C 3 149 ? 43.250  -6.026  -6.800  1.00 66.51 ? 323  GLU A CG    1 
ATOM   1797 C CD    . GLU C 3 149 ? 43.631  -4.611  -7.307  1.00 71.35 ? 323  GLU A CD    1 
ATOM   1798 O OE1   . GLU C 3 149 ? 42.753  -3.751  -7.454  1.00 75.06 ? 323  GLU A OE1   1 
ATOM   1799 O OE2   . GLU C 3 149 ? 44.821  -4.341  -7.569  1.00 70.99 ? 323  GLU A OE2   1 
ATOM   1800 N N     . LYS C 3 150 ? 38.947  -6.928  -5.874  1.00 49.85 ? 324  LYS A N     1 
ATOM   1801 C CA    . LYS C 3 150 ? 37.666  -6.878  -5.198  1.00 50.64 ? 324  LYS A CA    1 
ATOM   1802 C C     . LYS C 3 150 ? 37.089  -8.234  -4.774  1.00 51.52 ? 324  LYS A C     1 
ATOM   1803 O O     . LYS C 3 150 ? 36.707  -8.418  -3.610  1.00 50.09 ? 324  LYS A O     1 
ATOM   1804 C CB    . LYS C 3 150 ? 36.669  -6.113  -6.059  1.00 53.41 ? 324  LYS A CB    1 
ATOM   1805 C CG    . LYS C 3 150 ? 37.081  -4.674  -6.353  1.00 53.63 ? 324  LYS A CG    1 
ATOM   1806 C CD    . LYS C 3 150 ? 35.919  -3.874  -6.945  1.00 60.30 ? 324  LYS A CD    1 
ATOM   1807 C CE    . LYS C 3 150 ? 35.253  -4.623  -8.117  1.00 62.35 ? 324  LYS A CE    1 
ATOM   1808 N NZ    . LYS C 3 150 ? 34.270  -3.803  -8.918  1.00 69.08 ? 324  LYS A NZ    1 
ATOM   1809 N N     . LEU C 3 151 ? 37.121  -9.210  -5.679  1.00 51.42 ? 325  LEU A N     1 
ATOM   1810 C CA    . LEU C 3 151 ? 36.578  -10.539 -5.390  1.00 49.58 ? 325  LEU A CA    1 
ATOM   1811 C C     . LEU C 3 151 ? 37.297  -11.311 -4.277  1.00 46.92 ? 325  LEU A C     1 
ATOM   1812 O O     . LEU C 3 151 ? 36.652  -11.948 -3.438  1.00 47.48 ? 325  LEU A O     1 
ATOM   1813 C CB    . LEU C 3 151 ? 36.514  -11.385 -6.668  1.00 47.49 ? 325  LEU A CB    1 
ATOM   1814 C CG    . LEU C 3 151 ? 35.861  -12.766 -6.528  1.00 50.26 ? 325  LEU A CG    1 
ATOM   1815 C CD1   . LEU C 3 151 ? 34.462  -12.614 -5.910  1.00 50.45 ? 325  LEU A CD1   1 
ATOM   1816 C CD2   . LEU C 3 151 ? 35.805  -13.474 -7.894  1.00 50.00 ? 325  LEU A CD2   1 
ATOM   1817 N N     . LYS C 3 152 ? 38.616  -11.209 -4.240  1.00 43.81 ? 326  LYS A N     1 
ATOM   1818 C CA    . LYS C 3 152 ? 39.394  -11.923 -3.248  1.00 45.50 ? 326  LYS A CA    1 
ATOM   1819 C C     . LYS C 3 152 ? 38.897  -11.567 -1.860  1.00 47.79 ? 326  LYS A C     1 
ATOM   1820 O O     . LYS C 3 152 ? 38.345  -12.406 -1.132  1.00 46.99 ? 326  LYS A O     1 
ATOM   1821 C CB    . LYS C 3 152 ? 40.879  -11.587 -3.401  1.00 43.96 ? 326  LYS A CB    1 
ATOM   1822 N N     . ILE C 3 153 ? 39.011  -10.289 -1.542  1.00 49.59 ? 327  ILE A N     1 
ATOM   1823 C CA    . ILE C 3 153 ? 38.591  -9.774  -0.256  1.00 51.39 ? 327  ILE A CA    1 
ATOM   1824 C C     . ILE C 3 153 ? 37.130  -10.061 -0.013  1.00 47.89 ? 327  ILE A C     1 
ATOM   1825 O O     . ILE C 3 153 ? 36.750  -10.382 1.101   1.00 48.56 ? 327  ILE A O     1 
ATOM   1826 C CB    . ILE C 3 153 ? 38.869  -8.269  -0.139  1.00 56.61 ? 327  ILE A CB    1 
ATOM   1827 C CG1   . ILE C 3 153 ? 40.366  -8.021  -0.357  1.00 59.67 ? 327  ILE A CG1   1 
ATOM   1828 C CG2   . ILE C 3 153 ? 38.488  -7.772  1.247   1.00 60.41 ? 327  ILE A CG2   1 
ATOM   1829 C CD1   . ILE C 3 153 ? 40.763  -6.572  -0.340  1.00 64.33 ? 327  ILE A CD1   1 
ATOM   1830 N N     . LYS C 3 154 ? 36.312  -9.958  -1.055  1.00 44.85 ? 328  LYS A N     1 
ATOM   1831 C CA    . LYS C 3 154 ? 34.898  -10.236 -0.901  1.00 41.38 ? 328  LYS A CA    1 
ATOM   1832 C C     . LYS C 3 154 ? 34.726  -11.686 -0.429  1.00 45.11 ? 328  LYS A C     1 
ATOM   1833 O O     . LYS C 3 154 ? 33.865  -12.003 0.408   1.00 42.19 ? 328  LYS A O     1 
ATOM   1834 C CB    . LYS C 3 154 ? 34.171  -9.984  -2.203  1.00 37.88 ? 328  LYS A CB    1 
ATOM   1835 C CG    . LYS C 3 154 ? 32.792  -10.490 -2.180  1.00 40.58 ? 328  LYS A CG    1 
ATOM   1836 C CD    . LYS C 3 154 ? 32.219  -10.494 -3.554  1.00 49.23 ? 328  LYS A CD    1 
ATOM   1837 C CE    . LYS C 3 154 ? 30.987  -11.377 -3.568  1.00 55.12 ? 328  LYS A CE    1 
ATOM   1838 N NZ    . LYS C 3 154 ? 30.139  -11.154 -4.771  1.00 58.09 ? 328  LYS A NZ    1 
ATOM   1839 N N     . GLU C 3 155 ? 35.548  -12.579 -0.955  1.00 45.61 ? 329  GLU A N     1 
ATOM   1840 C CA    . GLU C 3 155 ? 35.456  -13.956 -0.509  1.00 52.35 ? 329  GLU A CA    1 
ATOM   1841 C C     . GLU C 3 155 ? 36.091  -14.057 0.886   1.00 52.27 ? 329  GLU A C     1 
ATOM   1842 O O     . GLU C 3 155 ? 35.589  -14.772 1.763   1.00 51.08 ? 329  GLU A O     1 
ATOM   1843 C CB    . GLU C 3 155 ? 36.092  -14.898 -1.528  1.00 57.25 ? 329  GLU A CB    1 
ATOM   1844 C CG    . GLU C 3 155 ? 35.241  -15.067 -2.817  1.00 65.77 ? 329  GLU A CG    1 
ATOM   1845 C CD    . GLU C 3 155 ? 33.833  -15.654 -2.567  1.00 69.39 ? 329  GLU A CD    1 
ATOM   1846 O OE1   . GLU C 3 155 ? 33.720  -16.804 -2.077  1.00 75.00 ? 329  GLU A OE1   1 
ATOM   1847 O OE2   . GLU C 3 155 ? 32.856  -14.965 -2.879  1.00 70.13 ? 329  GLU A OE2   1 
ATOM   1848 N N     . GLU C 3 156 ? 37.118  -13.238 1.125   1.00 50.00 ? 330  GLU A N     1 
ATOM   1849 C CA    . GLU C 3 156 ? 37.800  -13.207 2.421   1.00 50.37 ? 330  GLU A CA    1 
ATOM   1850 C C     . GLU C 3 156 ? 36.797  -12.846 3.503   1.00 49.75 ? 330  GLU A C     1 
ATOM   1851 O O     . GLU C 3 156 ? 36.830  -13.372 4.621   1.00 50.21 ? 330  GLU A O     1 
ATOM   1852 C CB    . GLU C 3 156 ? 38.919  -12.162 2.436   1.00 47.46 ? 330  GLU A CB    1 
ATOM   1853 N N     . ASN C 3 157 ? 35.920  -11.924 3.147   1.00 49.33 ? 331  ASN A N     1 
ATOM   1854 C CA    . ASN C 3 157 ? 34.907  -11.432 4.052   1.00 53.00 ? 331  ASN A CA    1 
ATOM   1855 C C     . ASN C 3 157 ? 33.871  -12.491 4.255   1.00 54.87 ? 331  ASN A C     1 
ATOM   1856 O O     . ASN C 3 157 ? 33.336  -12.646 5.350   1.00 56.39 ? 331  ASN A O     1 
ATOM   1857 C CB    . ASN C 3 157 ? 34.240  -10.170 3.496   1.00 56.38 ? 331  ASN A CB    1 
ATOM   1858 C CG    . ASN C 3 157 ? 35.164  -8.937  3.522   1.00 63.85 ? 331  ASN A CG    1 
ATOM   1859 O OD1   . ASN C 3 157 ? 36.341  -9.001  3.951   1.00 67.67 ? 331  ASN A OD1   1 
ATOM   1860 N ND2   . ASN C 3 157 ? 34.645  -7.804  3.022   1.00 67.58 ? 331  ASN A ND2   1 
ATOM   1861 N N     . GLU C 3 158 ? 33.603  -13.267 3.219   1.00 52.72 ? 332  GLU A N     1 
ATOM   1862 C CA    . GLU C 3 158 ? 32.589  -14.281 3.384   1.00 51.32 ? 332  GLU A CA    1 
ATOM   1863 C C     . GLU C 3 158 ? 33.043  -15.397 4.282   1.00 47.94 ? 332  GLU A C     1 
ATOM   1864 O O     . GLU C 3 158 ? 32.231  -16.053 4.911   1.00 47.39 ? 332  GLU A O     1 
ATOM   1865 C CB    . GLU C 3 158 ? 32.168  -14.832 2.050   1.00 55.58 ? 332  GLU A CB    1 
ATOM   1866 C CG    . GLU C 3 158 ? 30.896  -15.611 2.130   1.00 63.13 ? 332  GLU A CG    1 
ATOM   1867 C CD    . GLU C 3 158 ? 30.479  -16.076 0.761   1.00 64.82 ? 332  GLU A CD    1 
ATOM   1868 O OE1   . GLU C 3 158 ? 30.061  -15.230 -0.058  1.00 68.29 ? 332  GLU A OE1   1 
ATOM   1869 O OE2   . GLU C 3 158 ? 30.627  -17.283 0.487   1.00 69.16 ? 332  GLU A OE2   1 
ATOM   1870 N N     . LYS C 3 159 ? 34.346  -15.584 4.376   1.00 48.59 ? 333  LYS A N     1 
ATOM   1871 C CA    . LYS C 3 159 ? 34.882  -16.651 5.216   1.00 52.15 ? 333  LYS A CA    1 
ATOM   1872 C C     . LYS C 3 159 ? 34.819  -16.292 6.692   1.00 49.56 ? 333  LYS A C     1 
ATOM   1873 O O     . LYS C 3 159 ? 34.799  -17.152 7.568   1.00 52.16 ? 333  LYS A O     1 
ATOM   1874 C CB    . LYS C 3 159 ? 36.337  -16.983 4.826   1.00 54.22 ? 333  LYS A CB    1 
ATOM   1875 N N     . LEU C 3 160 ? 34.868  -15.003 6.980   1.00 47.79 ? 334  LEU A N     1 
ATOM   1876 C CA    . LEU C 3 160 ? 34.822  -14.576 8.359   1.00 44.83 ? 334  LEU A CA    1 
ATOM   1877 C C     . LEU C 3 160 ? 33.386  -14.701 8.850   1.00 43.24 ? 334  LEU A C     1 
ATOM   1878 O O     . LEU C 3 160 ? 33.107  -15.292 9.891   1.00 40.92 ? 334  LEU A O     1 
ATOM   1879 C CB    . LEU C 3 160 ? 35.274  -13.133 8.430   1.00 44.63 ? 334  LEU A CB    1 
ATOM   1880 C CG    . LEU C 3 160 ? 35.627  -12.568 9.799   1.00 49.24 ? 334  LEU A CG    1 
ATOM   1881 C CD1   . LEU C 3 160 ? 36.834  -13.305 10.393  1.00 43.63 ? 334  LEU A CD1   1 
ATOM   1882 C CD2   . LEU C 3 160 ? 35.919  -11.074 9.641   1.00 47.30 ? 334  LEU A CD2   1 
ATOM   1883 N N     . LEU C 3 161 ? 32.475  -14.210 8.029   1.00 42.86 ? 335  LEU A N     1 
ATOM   1884 C CA    . LEU C 3 161 ? 31.076  -14.220 8.365   1.00 48.66 ? 335  LEU A CA    1 
ATOM   1885 C C     . LEU C 3 161 ? 30.499  -15.622 8.450   1.00 49.99 ? 335  LEU A C     1 
ATOM   1886 O O     . LEU C 3 161 ? 29.587  -15.873 9.238   1.00 48.96 ? 335  LEU A O     1 
ATOM   1887 C CB    . LEU C 3 161 ? 30.301  -13.365 7.360   1.00 52.77 ? 335  LEU A CB    1 
ATOM   1888 C CG    . LEU C 3 161 ? 28.833  -12.915 7.600   1.00 59.35 ? 335  LEU A CG    1 
ATOM   1889 C CD1   . LEU C 3 161 ? 27.816  -14.001 7.215   1.00 61.13 ? 335  LEU A CD1   1 
ATOM   1890 C CD2   . LEU C 3 161 ? 28.601  -12.430 9.023   1.00 60.34 ? 335  LEU A CD2   1 
ATOM   1891 N N     . LYS C 3 162 ? 30.958  -16.519 7.584   1.00 51.58 ? 336  LYS A N     1 
ATOM   1892 C CA    . LYS C 3 162 ? 30.453  -17.881 7.618   1.00 51.70 ? 336  LYS A CA    1 
ATOM   1893 C C     . LYS C 3 162 ? 30.933  -18.562 8.871   1.00 49.99 ? 336  LYS A C     1 
ATOM   1894 O O     . LYS C 3 162 ? 30.200  -19.360 9.457   1.00 54.53 ? 336  LYS A O     1 
ATOM   1895 C CB    . LYS C 3 162 ? 30.881  -18.671 6.395   1.00 53.03 ? 336  LYS A CB    1 
ATOM   1896 C CG    . LYS C 3 162 ? 29.893  -18.534 5.236   1.00 64.69 ? 336  LYS A CG    1 
ATOM   1897 C CD    . LYS C 3 162 ? 30.388  -19.217 3.957   1.00 72.33 ? 336  LYS A CD    1 
ATOM   1898 C CE    . LYS C 3 162 ? 29.388  -19.114 2.796   1.00 72.83 ? 336  LYS A CE    1 
ATOM   1899 N NZ    . LYS C 3 162 ? 29.928  -19.783 1.548   1.00 77.31 ? 336  LYS A NZ    1 
ATOM   1900 N N     . GLU C 3 163 ? 32.121  -18.189 9.330   1.00 45.72 ? 337  GLU A N     1 
ATOM   1901 C CA    . GLU C 3 163 ? 32.674  -18.791 10.515  1.00 45.94 ? 337  GLU A CA    1 
ATOM   1902 C C     . GLU C 3 163 ? 32.266  -18.109 11.808  1.00 47.04 ? 337  GLU A C     1 
ATOM   1903 O O     . GLU C 3 163 ? 31.834  -18.780 12.733  1.00 47.32 ? 337  GLU A O     1 
ATOM   1904 C CB    . GLU C 3 163 ? 34.193  -18.857 10.430  1.00 44.72 ? 337  GLU A CB    1 
ATOM   1905 N N     . TYR C 3 164 ? 32.400  -16.787 11.877  1.00 47.59 ? 338  TYR A N     1 
ATOM   1906 C CA    . TYR C 3 164 ? 32.067  -16.045 13.099  1.00 46.24 ? 338  TYR A CA    1 
ATOM   1907 C C     . TYR C 3 164 ? 30.737  -15.332 13.119  1.00 42.41 ? 338  TYR A C     1 
ATOM   1908 O O     . TYR C 3 164 ? 30.413  -14.685 14.097  1.00 42.10 ? 338  TYR A O     1 
ATOM   1909 C CB    . TYR C 3 164 ? 33.141  -15.000 13.416  1.00 49.02 ? 338  TYR A CB    1 
ATOM   1910 C CG    . TYR C 3 164 ? 34.521  -15.564 13.623  1.00 52.30 ? 338  TYR A CG    1 
ATOM   1911 C CD1   . TYR C 3 164 ? 35.393  -15.709 12.550  1.00 53.84 ? 338  TYR A CD1   1 
ATOM   1912 C CD2   . TYR C 3 164 ? 34.973  -15.906 14.888  1.00 53.43 ? 338  TYR A CD2   1 
ATOM   1913 C CE1   . TYR C 3 164 ? 36.696  -16.183 12.727  1.00 59.34 ? 338  TYR A CE1   1 
ATOM   1914 C CE2   . TYR C 3 164 ? 36.284  -16.381 15.082  1.00 59.03 ? 338  TYR A CE2   1 
ATOM   1915 C CZ    . TYR C 3 164 ? 37.142  -16.512 13.993  1.00 58.31 ? 338  TYR A CZ    1 
ATOM   1916 O OH    . TYR C 3 164 ? 38.451  -16.927 14.138  1.00 61.70 ? 338  TYR A OH    1 
ATOM   1917 N N     . GLY C 3 165 ? 30.007  -15.364 12.009  1.00 42.60 ? 339  GLY A N     1 
ATOM   1918 C CA    . GLY C 3 165 ? 28.720  -14.676 11.940  1.00 36.70 ? 339  GLY A CA    1 
ATOM   1919 C C     . GLY C 3 165 ? 27.494  -15.470 12.332  1.00 41.07 ? 339  GLY A C     1 
ATOM   1920 O O     . GLY C 3 165 ? 26.363  -14.997 12.186  1.00 39.66 ? 339  GLY A O     1 
ATOM   1921 N N     . PHE C 3 166 ? 27.711  -16.702 12.794  1.00 42.43 ? 340  PHE A N     1 
ATOM   1922 C CA    . PHE C 3 166 ? 26.631  -17.589 13.210  1.00 37.90 ? 340  PHE A CA    1 
ATOM   1923 C C     . PHE C 3 166 ? 26.949  -18.326 14.500  1.00 37.99 ? 340  PHE A C     1 
ATOM   1924 O O     . PHE C 3 166 ? 28.092  -18.577 14.845  1.00 34.35 ? 340  PHE A O     1 
ATOM   1925 C CB    . PHE C 3 166 ? 26.351  -18.643 12.150  1.00 38.43 ? 340  PHE A CB    1 
ATOM   1926 C CG    . PHE C 3 166 ? 25.996  -18.088 10.825  1.00 45.27 ? 340  PHE A CG    1 
ATOM   1927 C CD1   . PHE C 3 166 ? 26.976  -17.603 9.969   1.00 45.08 ? 340  PHE A CD1   1 
ATOM   1928 C CD2   . PHE C 3 166 ? 24.664  -18.058 10.413  1.00 53.15 ? 340  PHE A CD2   1 
ATOM   1929 C CE1   . PHE C 3 166 ? 26.638  -17.104 8.711   1.00 51.45 ? 340  PHE A CE1   1 
ATOM   1930 C CE2   . PHE C 3 166 ? 24.306  -17.556 9.143   1.00 51.73 ? 340  PHE A CE2   1 
ATOM   1931 C CZ    . PHE C 3 166 ? 25.298  -17.073 8.294   1.00 50.67 ? 340  PHE A CZ    1 
ATOM   1932 N N     . CYS C 3 167 ? 25.909  -18.775 15.155  1.00 33.05 ? 341  CYS A N     1 
ATOM   1933 C CA    . CYS C 3 167 ? 26.111  -19.492 16.371  1.00 35.06 ? 341  CYS A CA    1 
ATOM   1934 C C     . CYS C 3 167 ? 24.995  -20.510 16.407  1.00 36.50 ? 341  CYS A C     1 
ATOM   1935 O O     . CYS C 3 167 ? 24.139  -20.540 15.524  1.00 40.51 ? 341  CYS A O     1 
ATOM   1936 C CB    . CYS C 3 167 ? 25.960  -18.546 17.541  1.00 35.39 ? 341  CYS A CB    1 
ATOM   1937 S SG    . CYS C 3 167 ? 24.251  -18.033 17.711  1.00 38.44 ? 341  CYS A SG    1 
ATOM   1938 N N     . ILE C 3 168 ? 25.044  -21.385 17.399  1.00 35.26 ? 342  ILE A N     1 
ATOM   1939 C CA    . ILE C 3 168 ? 24.015  -22.380 17.549  1.00 37.21 ? 342  ILE A CA    1 
ATOM   1940 C C     . ILE C 3 168 ? 23.350  -22.108 18.843  1.00 38.16 ? 342  ILE A C     1 
ATOM   1941 O O     . ILE C 3 168 ? 23.996  -22.119 19.881  1.00 38.96 ? 342  ILE A O     1 
ATOM   1942 C CB    . ILE C 3 168 ? 24.560  -23.808 17.650  1.00 38.93 ? 342  ILE A CB    1 
ATOM   1943 C CG1   . ILE C 3 168 ? 25.195  -24.218 16.317  1.00 43.08 ? 342  ILE A CG1   1 
ATOM   1944 C CG2   . ILE C 3 168 ? 23.423  -24.762 18.038  1.00 32.79 ? 342  ILE A CG2   1 
ATOM   1945 C CD1   . ILE C 3 168 ? 25.660  -25.660 16.274  1.00 46.70 ? 342  ILE A CD1   1 
ATOM   1946 N N     . MET C 3 169 ? 22.087  -21.738 18.764  1.00 39.05 ? 343  MET A N     1 
ATOM   1947 C CA    . MET C 3 169 ? 21.304  -21.517 19.960  1.00 43.08 ? 343  MET A CA    1 
ATOM   1948 C C     . MET C 3 169 ? 20.256  -22.608 19.863  1.00 47.84 ? 343  MET A C     1 
ATOM   1949 O O     . MET C 3 169 ? 19.580  -22.730 18.843  1.00 48.66 ? 343  MET A O     1 
ATOM   1950 C CB    . MET C 3 169 ? 20.630  -20.149 19.985  1.00 42.58 ? 343  MET A CB    1 
ATOM   1951 C CG    . MET C 3 169 ? 19.777  -19.923 21.256  1.00 44.03 ? 343  MET A CG    1 
ATOM   1952 S SD    . MET C 3 169 ? 18.837  -18.352 21.363  1.00 46.91 ? 343  MET A SD    1 
ATOM   1953 C CE    . MET C 3 169 ? 20.149  -17.209 21.629  1.00 40.83 ? 343  MET A CE    1 
ATOM   1954 N N     . ASP C 3 170 ? 20.149  -23.428 20.900  1.00 50.79 ? 344  ASP A N     1 
ATOM   1955 C CA    . ASP C 3 170 ? 19.208  -24.534 20.905  1.00 50.42 ? 344  ASP A CA    1 
ATOM   1956 C C     . ASP C 3 170 ? 19.428  -25.444 19.671  1.00 53.33 ? 344  ASP A C     1 
ATOM   1957 O O     . ASP C 3 170 ? 20.553  -25.883 19.394  1.00 51.90 ? 344  ASP A O     1 
ATOM   1958 C CB    . ASP C 3 170 ? 17.771  -24.007 21.004  1.00 51.28 ? 344  ASP A CB    1 
ATOM   1959 C CG    . ASP C 3 170 ? 17.498  -23.310 22.327  1.00 53.70 ? 344  ASP A CG    1 
ATOM   1960 O OD1   . ASP C 3 170 ? 18.288  -23.510 23.264  1.00 53.32 ? 344  ASP A OD1   1 
ATOM   1961 O OD2   . ASP C 3 170 ? 16.502  -22.556 22.436  1.00 58.98 ? 344  ASP A OD2   1 
ATOM   1962 N N     . ASN C 3 171 ? 18.377  -25.670 18.897  1.00 58.08 ? 345  ASN A N     1 
ATOM   1963 C CA    . ASN C 3 171 ? 18.443  -26.544 17.733  1.00 62.99 ? 345  ASN A CA    1 
ATOM   1964 C C     . ASN C 3 171 ? 18.996  -25.933 16.433  1.00 62.89 ? 345  ASN A C     1 
ATOM   1965 O O     . ASN C 3 171 ? 19.543  -26.641 15.590  1.00 66.53 ? 345  ASN A O     1 
ATOM   1966 C CB    . ASN C 3 171 ? 17.045  -27.113 17.455  1.00 71.64 ? 345  ASN A CB    1 
ATOM   1967 C CG    . ASN C 3 171 ? 16.384  -27.704 18.707  1.00 76.21 ? 345  ASN A CG    1 
ATOM   1968 O OD1   . ASN C 3 171 ? 16.612  -28.876 19.051  1.00 78.50 ? 345  ASN A OD1   1 
ATOM   1969 N ND2   . ASN C 3 171 ? 15.575  -26.890 19.408  1.00 80.01 ? 345  ASN A ND2   1 
ATOM   1970 N N     . HIS C 3 172 ? 18.865  -24.631 16.251  1.00 60.27 ? 346  HIS A N     1 
ATOM   1971 C CA    . HIS C 3 172 ? 19.322  -24.023 15.012  1.00 58.32 ? 346  HIS A CA    1 
ATOM   1972 C C     . HIS C 3 172 ? 20.564  -23.117 15.037  1.00 56.57 ? 346  HIS A C     1 
ATOM   1973 O O     . HIS C 3 172 ? 21.052  -22.693 16.089  1.00 56.58 ? 346  HIS A O     1 
ATOM   1974 C CB    . HIS C 3 172 ? 18.150  -23.254 14.402  1.00 61.08 ? 346  HIS A CB    1 
ATOM   1975 C CG    . HIS C 3 172 ? 16.834  -23.956 14.532  1.00 61.29 ? 346  HIS A CG    1 
ATOM   1976 N ND1   . HIS C 3 172 ? 16.478  -25.031 13.743  1.00 62.29 ? 346  HIS A ND1   1 
ATOM   1977 C CD2   . HIS C 3 172 ? 15.781  -23.741 15.355  1.00 63.97 ? 346  HIS A CD2   1 
ATOM   1978 C CE1   . HIS C 3 172 ? 15.267  -25.434 14.075  1.00 60.96 ? 346  HIS A CE1   1 
ATOM   1979 N NE2   . HIS C 3 172 ? 14.821  -24.672 15.053  1.00 61.41 ? 346  HIS A NE2   1 
ATOM   1980 N N     . LYS C 3 173 ? 21.122  -22.887 13.853  1.00 54.87 ? 347  LYS A N     1 
ATOM   1981 C CA    . LYS C 3 173 ? 22.268  -22.001 13.728  1.00 54.40 ? 347  LYS A CA    1 
ATOM   1982 C C     . LYS C 3 173 ? 21.604  -20.642 13.649  1.00 54.82 ? 347  LYS A C     1 
ATOM   1983 O O     . LYS C 3 173 ? 20.499  -20.522 13.111  1.00 56.58 ? 347  LYS A O     1 
ATOM   1984 C CB    . LYS C 3 173 ? 23.038  -22.251 12.435  1.00 52.66 ? 347  LYS A CB    1 
ATOM   1985 N N     . GLU C 3 174 ? 22.263  -19.636 14.188  1.00 51.27 ? 348  GLU A N     1 
ATOM   1986 C CA    . GLU C 3 174 ? 21.687  -18.323 14.161  1.00 45.98 ? 348  GLU A CA    1 
ATOM   1987 C C     . GLU C 3 174 ? 22.724  -17.366 13.675  1.00 45.54 ? 348  GLU A C     1 
ATOM   1988 O O     . GLU C 3 174 ? 23.921  -17.610 13.810  1.00 44.59 ? 348  GLU A O     1 
ATOM   1989 C CB    . GLU C 3 174 ? 21.243  -17.947 15.564  1.00 46.28 ? 348  GLU A CB    1 
ATOM   1990 C CG    . GLU C 3 174 ? 20.044  -18.729 16.074  1.00 48.87 ? 348  GLU A CG    1 
ATOM   1991 C CD    . GLU C 3 174 ? 18.713  -18.242 15.503  1.00 53.70 ? 348  GLU A CD    1 
ATOM   1992 O OE1   . GLU C 3 174 ? 18.710  -17.653 14.406  1.00 59.68 ? 348  GLU A OE1   1 
ATOM   1993 O OE2   . GLU C 3 174 ? 17.656  -18.427 16.149  1.00 54.53 ? 348  GLU A OE2   1 
ATOM   1994 N N     . ARG C 3 175 ? 22.247  -16.281 13.090  1.00 46.69 ? 349  ARG A N     1 
ATOM   1995 C CA    . ARG C 3 175 ? 23.090  -15.217 12.576  1.00 46.95 ? 349  ARG A CA    1 
ATOM   1996 C C     . ARG C 3 175 ? 23.340  -14.200 13.689  1.00 41.49 ? 349  ARG A C     1 
ATOM   1997 O O     . ARG C 3 175 ? 22.460  -13.887 14.493  1.00 38.20 ? 349  ARG A O     1 
ATOM   1998 C CB    . ARG C 3 175 ? 22.398  -14.551 11.378  1.00 54.58 ? 349  ARG A CB    1 
ATOM   1999 C CG    . ARG C 3 175 ? 23.121  -13.354 10.763  1.00 61.04 ? 349  ARG A CG    1 
ATOM   2000 C CD    . ARG C 3 175 ? 24.329  -13.755 9.923   1.00 65.25 ? 349  ARG A CD    1 
ATOM   2001 N NE    . ARG C 3 175 ? 24.962  -12.576 9.341   1.00 71.81 ? 349  ARG A NE    1 
ATOM   2002 C CZ    . ARG C 3 175 ? 24.672  -12.068 8.143   1.00 74.53 ? 349  ARG A CZ    1 
ATOM   2003 N NH1   . ARG C 3 175 ? 23.764  -12.645 7.363   1.00 77.37 ? 349  ARG A NH1   1 
ATOM   2004 N NH2   . ARG C 3 175 ? 25.268  -10.949 7.742   1.00 78.05 ? 349  ARG A NH2   1 
ATOM   2005 N N     . ILE C 3 176 ? 24.566  -13.719 13.742  1.00 38.35 ? 350  ILE A N     1 
ATOM   2006 C CA    . ILE C 3 176 ? 24.985  -12.751 14.741  1.00 40.16 ? 350  ILE A CA    1 
ATOM   2007 C C     . ILE C 3 176 ? 24.981  -11.369 14.094  1.00 42.19 ? 350  ILE A C     1 
ATOM   2008 O O     . ILE C 3 176 ? 25.405  -11.222 12.956  1.00 42.31 ? 350  ILE A O     1 
ATOM   2009 C CB    . ILE C 3 176 ? 26.404  -13.099 15.283  1.00 39.70 ? 350  ILE A CB    1 
ATOM   2010 C CG1   . ILE C 3 176 ? 26.379  -14.427 16.049  1.00 38.22 ? 350  ILE A CG1   1 
ATOM   2011 C CG2   . ILE C 3 176 ? 26.912  -12.022 16.208  1.00 38.67 ? 350  ILE A CG2   1 
ATOM   2012 C CD1   . ILE C 3 176 ? 27.765  -15.015 16.260  1.00 37.94 ? 350  ILE A CD1   1 
ATOM   2013 N N     . ALA C 3 177 ? 24.457  -10.375 14.819  1.00 40.35 ? 351  ALA A N     1 
ATOM   2014 C CA    . ALA C 3 177 ? 24.372  -9.005  14.332  1.00 38.64 ? 351  ALA A CA    1 
ATOM   2015 C C     . ALA C 3 177 ? 25.730  -8.330  14.128  1.00 42.45 ? 351  ALA A C     1 
ATOM   2016 O O     . ALA C 3 177 ? 26.071  -7.906  13.024  1.00 44.13 ? 351  ALA A O     1 
ATOM   2017 C CB    . ALA C 3 177 ? 23.537  -8.191  15.287  1.00 35.68 ? 351  ALA A CB    1 
ATOM   2018 N N     . ASN C 3 178 ? 26.497  -8.252  15.209  1.00 39.84 ? 352  ASN A N     1 
ATOM   2019 C CA    . ASN C 3 178 ? 27.796  -7.605  15.197  1.00 41.04 ? 352  ASN A CA    1 
ATOM   2020 C C     . ASN C 3 178 ? 28.792  -8.529  15.868  1.00 40.40 ? 352  ASN A C     1 
ATOM   2021 O O     . ASN C 3 178 ? 28.820  -8.634  17.101  1.00 44.19 ? 352  ASN A O     1 
ATOM   2022 C CB    . ASN C 3 178 ? 27.703  -6.322  16.012  1.00 44.81 ? 352  ASN A CB    1 
ATOM   2023 C CG    . ASN C 3 178 ? 27.138  -6.567  17.418  1.00 48.80 ? 352  ASN A CG    1 
ATOM   2024 O OD1   . ASN C 3 178 ? 26.283  -7.459  17.617  1.00 44.82 ? 352  ASN A OD1   1 
ATOM   2025 N ND2   . ASN C 3 178 ? 27.590  -5.791  18.391  1.00 46.03 ? 352  ASN A ND2   1 
ATOM   2026 N N     . PHE C 3 179 ? 29.550  -9.272  15.085  1.00 37.48 ? 353  PHE A N     1 
ATOM   2027 C CA    . PHE C 3 179 ? 30.522  -10.182 15.666  1.00 38.77 ? 353  PHE A CA    1 
ATOM   2028 C C     . PHE C 3 179 ? 31.929  -9.584  15.866  1.00 37.75 ? 353  PHE A C     1 
ATOM   2029 O O     . PHE C 3 179 ? 32.777  -10.211 16.487  1.00 39.02 ? 353  PHE A O     1 
ATOM   2030 C CB    . PHE C 3 179 ? 30.572  -11.493 14.878  1.00 41.37 ? 353  PHE A CB    1 
ATOM   2031 C CG    . PHE C 3 179 ? 31.054  -11.328 13.466  1.00 46.91 ? 353  PHE A CG    1 
ATOM   2032 C CD1   . PHE C 3 179 ? 32.412  -11.313 13.186  1.00 48.06 ? 353  PHE A CD1   1 
ATOM   2033 C CD2   . PHE C 3 179 ? 30.150  -11.201 12.420  1.00 42.08 ? 353  PHE A CD2   1 
ATOM   2034 C CE1   . PHE C 3 179 ? 32.869  -11.154 11.900  1.00 50.33 ? 353  PHE A CE1   1 
ATOM   2035 C CE2   . PHE C 3 179 ? 30.605  -11.042 11.130  1.00 46.96 ? 353  PHE A CE2   1 
ATOM   2036 C CZ    . PHE C 3 179 ? 31.966  -11.027 10.867  1.00 45.65 ? 353  PHE A CZ    1 
ATOM   2037 N N     . LYS C 3 180 ? 32.175  -8.390  15.353  1.00 34.81 ? 354  LYS A N     1 
ATOM   2038 C CA    . LYS C 3 180 ? 33.481  -7.738  15.503  1.00 38.42 ? 354  LYS A CA    1 
ATOM   2039 C C     . LYS C 3 180 ? 33.480  -6.723  16.640  1.00 37.20 ? 354  LYS A C     1 
ATOM   2040 O O     . LYS C 3 180 ? 32.523  -5.993  16.816  1.00 42.83 ? 354  LYS A O     1 
ATOM   2041 C CB    . LYS C 3 180 ? 33.850  -7.006  14.227  1.00 39.22 ? 354  LYS A CB    1 
ATOM   2042 C CG    . LYS C 3 180 ? 33.839  -7.859  13.012  1.00 40.81 ? 354  LYS A CG    1 
ATOM   2043 C CD    . LYS C 3 180 ? 33.271  -7.052  11.887  1.00 43.95 ? 354  LYS A CD    1 
ATOM   2044 C CE    . LYS C 3 180 ? 33.800  -7.534  10.567  1.00 49.50 ? 354  LYS A CE    1 
ATOM   2045 N NZ    . LYS C 3 180 ? 33.296  -6.703  9.441   1.00 51.87 ? 354  LYS A NZ    1 
ATOM   2046 N N     . ILE C 3 181 ? 34.561  -6.682  17.412  1.00 36.15 ? 355  ILE A N     1 
ATOM   2047 C CA    . ILE C 3 181 ? 34.660  -5.737  18.511  1.00 33.82 ? 355  ILE A CA    1 
ATOM   2048 C C     . ILE C 3 181 ? 34.867  -4.314  17.941  1.00 36.23 ? 355  ILE A C     1 
ATOM   2049 O O     . ILE C 3 181 ? 35.645  -4.147  17.000  1.00 39.34 ? 355  ILE A O     1 
ATOM   2050 C CB    . ILE C 3 181 ? 35.880  -6.078  19.398  1.00 33.99 ? 355  ILE A CB    1 
ATOM   2051 C CG1   . ILE C 3 181 ? 35.814  -7.528  19.899  1.00 29.84 ? 355  ILE A CG1   1 
ATOM   2052 C CG2   . ILE C 3 181 ? 35.989  -5.080  20.548  1.00 35.91 ? 355  ILE A CG2   1 
ATOM   2053 C CD1   . ILE C 3 181 ? 34.670  -7.813  20.778  1.00 26.11 ? 355  ILE A CD1   1 
ATOM   2054 N N     . GLU C 3 182 ? 34.228  -3.297  18.531  1.00 33.57 ? 356  GLU A N     1 
ATOM   2055 C CA    . GLU C 3 182 ? 34.398  -1.920  18.057  1.00 31.15 ? 356  GLU A CA    1 
ATOM   2056 C C     . GLU C 3 182 ? 35.863  -1.534  18.133  1.00 33.10 ? 356  GLU A C     1 
ATOM   2057 O O     . GLU C 3 182 ? 36.492  -1.668  19.157  1.00 31.53 ? 356  GLU A O     1 
ATOM   2058 C CB    . GLU C 3 182 ? 33.606  -0.926  18.901  1.00 38.33 ? 356  GLU A CB    1 
ATOM   2059 C CG    . GLU C 3 182 ? 32.100  -1.037  18.797  1.00 44.51 ? 356  GLU A CG    1 
ATOM   2060 C CD    . GLU C 3 182 ? 31.378  -0.164  19.810  1.00 46.94 ? 356  GLU A CD    1 
ATOM   2061 O OE1   . GLU C 3 182 ? 32.018  0.687   20.453  1.00 47.83 ? 356  GLU A OE1   1 
ATOM   2062 O OE2   . GLU C 3 182 ? 30.157  -0.340  19.973  1.00 52.05 ? 356  GLU A OE2   1 
ATOM   2063 N N     . PRO C 3 183 ? 36.435  -1.116  17.011  1.00 31.17 ? 357  PRO A N     1 
ATOM   2064 C CA    . PRO C 3 183 ? 37.827  -0.703  16.909  1.00 29.68 ? 357  PRO A CA    1 
ATOM   2065 C C     . PRO C 3 183 ? 38.124  0.535   17.720  1.00 27.16 ? 357  PRO A C     1 
ATOM   2066 O O     . PRO C 3 183 ? 37.238  1.308   18.059  1.00 26.66 ? 357  PRO A O     1 
ATOM   2067 C CB    . PRO C 3 183 ? 37.967  -0.393  15.423  1.00 31.01 ? 357  PRO A CB    1 
ATOM   2068 C CG    . PRO C 3 183 ? 37.003  -1.318  14.793  1.00 33.57 ? 357  PRO A CG    1 
ATOM   2069 C CD    . PRO C 3 183 ? 35.815  -1.197  15.679  1.00 32.01 ? 357  PRO A CD    1 
ATOM   2070 N N     . PRO C 3 184 ? 39.398  0.721   18.076  1.00 28.68 ? 358  PRO A N     1 
ATOM   2071 C CA    . PRO C 3 184 ? 39.757  1.907   18.846  1.00 27.88 ? 358  PRO A CA    1 
ATOM   2072 C C     . PRO C 3 184 ? 39.505  3.104   17.946  1.00 27.67 ? 358  PRO A C     1 
ATOM   2073 O O     . PRO C 3 184 ? 39.485  2.960   16.761  1.00 26.75 ? 358  PRO A O     1 
ATOM   2074 C CB    . PRO C 3 184 ? 41.245  1.697   19.120  1.00 25.43 ? 358  PRO A CB    1 
ATOM   2075 C CG    . PRO C 3 184 ? 41.697  0.837   17.996  1.00 26.68 ? 358  PRO A CG    1 
ATOM   2076 C CD    . PRO C 3 184 ? 40.564  -0.144  17.863  1.00 25.61 ? 358  PRO A CD    1 
ATOM   2077 N N     . GLY C 3 185 ? 39.318  4.275   18.509  1.00 26.45 ? 359  GLY A N     1 
ATOM   2078 C CA    . GLY C 3 185 ? 39.061  5.430   17.670  1.00 28.79 ? 359  GLY A CA    1 
ATOM   2079 C C     . GLY C 3 185 ? 38.613  6.582   18.546  1.00 31.53 ? 359  GLY A C     1 
ATOM   2080 O O     . GLY C 3 185 ? 38.681  6.453   19.776  1.00 32.64 ? 359  GLY A O     1 
ATOM   2081 N N     . LEU C 3 186 ? 38.165  7.683   17.944  1.00 28.78 ? 360  LEU A N     1 
ATOM   2082 C CA    . LEU C 3 186 ? 37.719  8.873   18.672  1.00 28.06 ? 360  LEU A CA    1 
ATOM   2083 C C     . LEU C 3 186 ? 36.214  8.871   18.860  1.00 27.09 ? 360  LEU A C     1 
ATOM   2084 O O     . LEU C 3 186 ? 35.481  8.642   17.923  1.00 27.31 ? 360  LEU A O     1 
ATOM   2085 C CB    . LEU C 3 186 ? 38.178  10.117  17.918  1.00 30.36 ? 360  LEU A CB    1 
ATOM   2086 C CG    . LEU C 3 186 ? 39.701  10.134  17.675  1.00 29.38 ? 360  LEU A CG    1 
ATOM   2087 C CD1   . LEU C 3 186 ? 40.092  11.396  16.917  1.00 35.77 ? 360  LEU A CD1   1 
ATOM   2088 C CD2   . LEU C 3 186 ? 40.459  10.063  19.006  1.00 30.99 ? 360  LEU A CD2   1 
ATOM   2089 N N     . PHE C 3 187 ? 35.749  9.210   20.052  1.00 26.77 ? 361  PHE A N     1 
ATOM   2090 C CA    . PHE C 3 187 ? 34.321  9.151   20.307  1.00 29.41 ? 361  PHE A CA    1 
ATOM   2091 C C     . PHE C 3 187 ? 33.460  10.129  19.541  1.00 29.54 ? 361  PHE A C     1 
ATOM   2092 O O     . PHE C 3 187 ? 33.567  11.322  19.725  1.00 32.25 ? 361  PHE A O     1 
ATOM   2093 C CB    . PHE C 3 187 ? 34.029  9.276   21.798  1.00 33.60 ? 361  PHE A CB    1 
ATOM   2094 C CG    . PHE C 3 187 ? 32.566  9.067   22.163  1.00 38.62 ? 361  PHE A CG    1 
ATOM   2095 C CD1   . PHE C 3 187 ? 31.947  7.830   21.988  1.00 39.88 ? 361  PHE A CD1   1 
ATOM   2096 C CD2   . PHE C 3 187 ? 31.802  10.114  22.681  1.00 41.11 ? 361  PHE A CD2   1 
ATOM   2097 C CE1   . PHE C 3 187 ? 30.595  7.634   22.352  1.00 38.80 ? 361  PHE A CE1   1 
ATOM   2098 C CE2   . PHE C 3 187 ? 30.444  9.925   23.049  1.00 39.64 ? 361  PHE A CE2   1 
ATOM   2099 C CZ    . PHE C 3 187 ? 29.843  8.681   22.871  1.00 36.31 ? 361  PHE A CZ    1 
ATOM   2100 N N     . ARG C 3 188 ? 32.519  9.606   18.774  1.00 27.52 ? 362  ARG A N     1 
ATOM   2101 C CA    . ARG C 3 188 ? 31.635  10.445  17.987  1.00 28.33 ? 362  ARG A CA    1 
ATOM   2102 C C     . ARG C 3 188 ? 30.309  10.673  18.691  1.00 30.68 ? 362  ARG A C     1 
ATOM   2103 O O     . ARG C 3 188 ? 29.299  10.082  18.369  1.00 29.32 ? 362  ARG A O     1 
ATOM   2104 C CB    . ARG C 3 188 ? 31.480  9.835   16.601  1.00 26.05 ? 362  ARG A CB    1 
ATOM   2105 C CG    . ARG C 3 188 ? 32.828  9.718   15.937  1.00 30.61 ? 362  ARG A CG    1 
ATOM   2106 C CD    . ARG C 3 188 ? 32.845  8.782   14.761  1.00 36.81 ? 362  ARG A CD    1 
ATOM   2107 N NE    . ARG C 3 188 ? 32.451  9.392   13.490  1.00 44.12 ? 362  ARG A NE    1 
ATOM   2108 C CZ    . ARG C 3 188 ? 33.234  9.503   12.409  1.00 42.24 ? 362  ARG A CZ    1 
ATOM   2109 N NH1   . ARG C 3 188 ? 34.489  9.058   12.404  1.00 42.87 ? 362  ARG A NH1   1 
ATOM   2110 N NH2   . ARG C 3 188 ? 32.746  10.054  11.302  1.00 40.81 ? 362  ARG A NH2   1 
ATOM   2111 N N     . GLY C 3 189 ? 30.352  11.497  19.727  1.00 32.84 ? 363  GLY A N     1 
ATOM   2112 C CA    . GLY C 3 189 ? 29.145  11.797  20.468  1.00 35.10 ? 363  GLY A CA    1 
ATOM   2113 C C     . GLY C 3 189 ? 28.330  12.770  19.667  1.00 36.50 ? 363  GLY A C     1 
ATOM   2114 O O     . GLY C 3 189 ? 28.890  13.667  19.037  1.00 36.30 ? 363  GLY A O     1 
ATOM   2115 N N     . ARG C 3 190 ? 27.011  12.609  19.717  1.00 39.53 ? 364  ARG A N     1 
ATOM   2116 C CA    . ARG C 3 190 ? 26.090  13.479  18.986  1.00 38.41 ? 364  ARG A CA    1 
ATOM   2117 C C     . ARG C 3 190 ? 25.732  14.730  19.781  1.00 37.26 ? 364  ARG A C     1 
ATOM   2118 O O     . ARG C 3 190 ? 25.968  14.772  20.979  1.00 35.95 ? 364  ARG A O     1 
ATOM   2119 C CB    . ARG C 3 190 ? 24.867  12.684  18.530  1.00 39.85 ? 364  ARG A CB    1 
ATOM   2120 C CG    . ARG C 3 190 ? 25.294  11.471  17.696  1.00 43.19 ? 364  ARG A CG    1 
ATOM   2121 C CD    . ARG C 3 190 ? 24.277  11.055  16.639  1.00 49.83 ? 364  ARG A CD    1 
ATOM   2122 N NE    . ARG C 3 190 ? 23.651  9.772   16.947  1.00 56.52 ? 364  ARG A NE    1 
ATOM   2123 C CZ    . ARG C 3 190 ? 23.609  8.714   16.130  1.00 60.69 ? 364  ARG A CZ    1 
ATOM   2124 N NH1   . ARG C 3 190 ? 24.173  8.757   14.914  1.00 60.21 ? 364  ARG A NH1   1 
ATOM   2125 N NH2   . ARG C 3 190 ? 22.963  7.611   16.529  1.00 61.87 ? 364  ARG A NH2   1 
ATOM   2126 N N     . GLY C 3 191 ? 25.348  15.795  19.070  1.00 39.54 ? 365  GLY A N     1 
ATOM   2127 C CA    . GLY C 3 191 ? 25.013  17.062  19.715  1.00 38.39 ? 365  GLY A CA    1 
ATOM   2128 C C     . GLY C 3 191 ? 26.227  17.714  20.355  1.00 40.47 ? 365  GLY A C     1 
ATOM   2129 O O     . GLY C 3 191 ? 27.306  17.709  19.773  1.00 46.86 ? 365  GLY A O     1 
ATOM   2130 N N     . ASN C 3 192 ? 26.068  18.294  21.533  1.00 42.02 ? 366  ASN A N     1 
ATOM   2131 C CA    . ASN C 3 192 ? 27.186  18.897  22.236  1.00 47.19 ? 366  ASN A CA    1 
ATOM   2132 C C     . ASN C 3 192 ? 27.686  17.856  23.221  1.00 45.52 ? 366  ASN A C     1 
ATOM   2133 O O     . ASN C 3 192 ? 27.822  18.099  24.409  1.00 47.84 ? 366  ASN A O     1 
ATOM   2134 C CB    . ASN C 3 192 ? 26.750  20.163  22.994  1.00 55.38 ? 366  ASN A CB    1 
ATOM   2135 C CG    . ASN C 3 192 ? 25.621  19.898  24.028  1.00 63.15 ? 366  ASN A CG    1 
ATOM   2136 O OD1   . ASN C 3 192 ? 24.498  20.331  23.822  1.00 74.54 ? 366  ASN A OD1   1 
ATOM   2137 N ND2   . ASN C 3 192 ? 25.939  19.263  25.159  1.00 62.43 ? 366  ASN A ND2   1 
ATOM   2138 N N     . HIS C 3 193 ? 27.965  16.656  22.755  1.00 43.45 ? 367  HIS A N     1 
ATOM   2139 C CA    . HIS C 3 193 ? 28.399  15.669  23.728  1.00 40.73 ? 367  HIS A CA    1 
ATOM   2140 C C     . HIS C 3 193 ? 29.723  16.088  24.320  1.00 36.65 ? 367  HIS A C     1 
ATOM   2141 O O     . HIS C 3 193 ? 30.699  16.299  23.614  1.00 35.28 ? 367  HIS A O     1 
ATOM   2142 C CB    . HIS C 3 193 ? 28.468  14.272  23.132  1.00 43.45 ? 367  HIS A CB    1 
ATOM   2143 C CG    . HIS C 3 193 ? 28.370  13.187  24.152  1.00 44.37 ? 367  HIS A CG    1 
ATOM   2144 N ND1   . HIS C 3 193 ? 29.289  13.034  25.169  1.00 43.26 ? 367  HIS A ND1   1 
ATOM   2145 C CD2   . HIS C 3 193 ? 27.452  12.210  24.329  1.00 45.48 ? 367  HIS A CD2   1 
ATOM   2146 C CE1   . HIS C 3 193 ? 28.939  12.011  25.923  1.00 38.85 ? 367  HIS A CE1   1 
ATOM   2147 N NE2   . HIS C 3 193 ? 27.831  11.491  25.437  1.00 43.27 ? 367  HIS A NE2   1 
ATOM   2148 N N     . PRO C 3 194 ? 29.767  16.220  25.635  1.00 32.00 ? 368  PRO A N     1 
ATOM   2149 C CA    . PRO C 3 194 ? 31.004  16.623  26.302  1.00 35.87 ? 368  PRO A CA    1 
ATOM   2150 C C     . PRO C 3 194 ? 32.166  15.618  26.194  1.00 37.20 ? 368  PRO A C     1 
ATOM   2151 O O     . PRO C 3 194 ? 33.276  15.858  26.678  1.00 36.52 ? 368  PRO A O     1 
ATOM   2152 C CB    . PRO C 3 194 ? 30.543  16.832  27.757  1.00 39.08 ? 368  PRO A CB    1 
ATOM   2153 C CG    . PRO C 3 194 ? 29.309  15.977  27.874  1.00 33.37 ? 368  PRO A CG    1 
ATOM   2154 C CD    . PRO C 3 194 ? 28.635  16.210  26.575  1.00 29.33 ? 368  PRO A CD    1 
ATOM   2155 N N     . LYS C 3 195 ? 31.918  14.465  25.588  1.00 36.93 ? 369  LYS A N     1 
ATOM   2156 C CA    . LYS C 3 195 ? 32.990  13.505  25.510  1.00 35.08 ? 369  LYS A CA    1 
ATOM   2157 C C     . LYS C 3 195 ? 33.459  13.226  24.118  1.00 36.92 ? 369  LYS A C     1 
ATOM   2158 O O     . LYS C 3 195 ? 34.389  12.448  23.930  1.00 42.78 ? 369  LYS A O     1 
ATOM   2159 C CB    . LYS C 3 195 ? 32.608  12.218  26.219  1.00 38.44 ? 369  LYS A CB    1 
ATOM   2160 C CG    . LYS C 3 195 ? 32.247  12.442  27.686  1.00 46.04 ? 369  LYS A CG    1 
ATOM   2161 C CD    . LYS C 3 195 ? 32.356  11.176  28.533  1.00 48.42 ? 369  LYS A CD    1 
ATOM   2162 C CE    . LYS C 3 195 ? 31.844  11.435  29.944  1.00 48.03 ? 369  LYS A CE    1 
ATOM   2163 N NZ    . LYS C 3 195 ? 32.108  10.300  30.848  1.00 53.48 ? 369  LYS A NZ    1 
ATOM   2164 N N     . MET C 3 196 ? 32.831  13.859  23.136  1.00 29.42 ? 370  MET A N     1 
ATOM   2165 C CA    . MET C 3 196 ? 33.237  13.635  21.758  1.00 29.20 ? 370  MET A CA    1 
ATOM   2166 C C     . MET C 3 196 ? 34.736  13.908  21.658  1.00 31.71 ? 370  MET A C     1 
ATOM   2167 O O     . MET C 3 196 ? 35.253  14.788  22.340  1.00 32.29 ? 370  MET A O     1 
ATOM   2168 C CB    . MET C 3 196 ? 32.446  14.542  20.801  1.00 31.50 ? 370  MET A CB    1 
ATOM   2169 C CG    . MET C 3 196 ? 32.638  16.062  21.019  1.00 30.79 ? 370  MET A CG    1 
ATOM   2170 S SD    . MET C 3 196 ? 32.083  17.045  19.601  1.00 38.57 ? 370  MET A SD    1 
ATOM   2171 C CE    . MET C 3 196 ? 30.322  16.922  19.760  1.00 39.95 ? 370  MET A CE    1 
ATOM   2172 N N     . GLY C 3 197 ? 35.437  13.129  20.832  1.00 30.47 ? 371  GLY A N     1 
ATOM   2173 C CA    . GLY C 3 197 ? 36.873  13.308  20.689  1.00 31.06 ? 371  GLY A CA    1 
ATOM   2174 C C     . GLY C 3 197 ? 37.697  12.477  21.659  1.00 31.93 ? 371  GLY A C     1 
ATOM   2175 O O     . GLY C 3 197 ? 38.914  12.322  21.478  1.00 33.55 ? 371  GLY A O     1 
ATOM   2176 N N     . MET C 3 198 ? 37.066  11.967  22.709  1.00 30.32 ? 372  MET A N     1 
ATOM   2177 C CA    . MET C 3 198 ? 37.766  11.141  23.660  1.00 30.02 ? 372  MET A CA    1 
ATOM   2178 C C     . MET C 3 198 ? 38.176  9.844   23.006  1.00 30.87 ? 372  MET A C     1 
ATOM   2179 O O     . MET C 3 198 ? 37.555  9.400   22.052  1.00 31.16 ? 372  MET A O     1 
ATOM   2180 C CB    . MET C 3 198 ? 36.927  10.881  24.888  1.00 26.83 ? 372  MET A CB    1 
ATOM   2181 C CG    . MET C 3 198 ? 36.823  12.134  25.693  1.00 38.56 ? 372  MET A CG    1 
ATOM   2182 S SD    . MET C 3 198 ? 36.119  11.982  27.333  1.00 45.05 ? 372  MET A SD    1 
ATOM   2183 C CE    . MET C 3 198 ? 36.702  10.451  27.867  1.00 50.61 ? 372  MET A CE    1 
ATOM   2184 N N     . LEU C 3 199 ? 39.251  9.268   23.501  1.00 33.53 ? 373  LEU A N     1 
ATOM   2185 C CA    . LEU C 3 199 ? 39.785  8.049   22.960  1.00 32.58 ? 373  LEU A CA    1 
ATOM   2186 C C     . LEU C 3 199 ? 39.154  6.800   23.493  1.00 33.04 ? 373  LEU A C     1 
ATOM   2187 O O     . LEU C 3 199 ? 39.166  6.527   24.672  1.00 29.99 ? 373  LEU A O     1 
ATOM   2188 C CB    . LEU C 3 199 ? 41.273  7.981   23.222  1.00 36.60 ? 373  LEU A CB    1 
ATOM   2189 C CG    . LEU C 3 199 ? 42.026  6.809   22.581  1.00 44.63 ? 373  LEU A CG    1 
ATOM   2190 C CD1   . LEU C 3 199 ? 42.077  6.899   21.032  1.00 39.21 ? 373  LEU A CD1   1 
ATOM   2191 C CD2   . LEU C 3 199 ? 43.441  6.769   23.197  1.00 39.52 ? 373  LEU A CD2   1 
ATOM   2192 N N     . LYS C 3 200 ? 38.605  6.043   22.566  1.00 35.16 ? 374  LYS A N     1 
ATOM   2193 C CA    . LYS C 3 200 ? 37.984  4.769   22.834  1.00 37.63 ? 374  LYS A CA    1 
ATOM   2194 C C     . LYS C 3 200 ? 39.174  3.794   22.707  1.00 40.45 ? 374  LYS A C     1 
ATOM   2195 O O     . LYS C 3 200 ? 39.898  3.830   21.724  1.00 41.24 ? 374  LYS A O     1 
ATOM   2196 C CB    . LYS C 3 200 ? 36.903  4.537   21.762  1.00 36.75 ? 374  LYS A CB    1 
ATOM   2197 C CG    . LYS C 3 200 ? 36.433  3.107   21.571  1.00 41.78 ? 374  LYS A CG    1 
ATOM   2198 C CD    . LYS C 3 200 ? 34.936  3.028   21.175  1.00 42.98 ? 374  LYS A CD    1 
ATOM   2199 C CE    . LYS C 3 200 ? 34.629  3.538   19.776  1.00 47.64 ? 374  LYS A CE    1 
ATOM   2200 N NZ    . LYS C 3 200 ? 33.312  2.992   19.245  1.00 42.36 ? 374  LYS A NZ    1 
ATOM   2201 N N     . ARG C 3 201 ? 39.404  2.984   23.732  1.00 40.24 ? 375  ARG A N     1 
ATOM   2202 C CA    . ARG C 3 201 ? 40.524  2.067   23.702  1.00 40.92 ? 375  ARG A CA    1 
ATOM   2203 C C     . ARG C 3 201 ? 40.250  0.784   22.950  1.00 38.68 ? 375  ARG A C     1 
ATOM   2204 O O     . ARG C 3 201 ? 39.117  0.421   22.727  1.00 36.27 ? 375  ARG A O     1 
ATOM   2205 C CB    . ARG C 3 201 ? 40.961  1.698   25.119  1.00 43.50 ? 375  ARG A CB    1 
ATOM   2206 C CG    . ARG C 3 201 ? 40.231  0.483   25.662  1.00 54.91 ? 375  ARG A CG    1 
ATOM   2207 C CD    . ARG C 3 201 ? 41.088  -0.344  26.649  1.00 63.20 ? 375  ARG A CD    1 
ATOM   2208 N NE    . ARG C 3 201 ? 40.359  -1.476  27.231  1.00 66.62 ? 375  ARG A NE    1 
ATOM   2209 C CZ    . ARG C 3 201 ? 39.096  -1.427  27.688  1.00 72.52 ? 375  ARG A CZ    1 
ATOM   2210 N NH1   . ARG C 3 201 ? 38.367  -0.303  27.644  1.00 69.29 ? 375  ARG A NH1   1 
ATOM   2211 N NH2   . ARG C 3 201 ? 38.555  -2.516  28.222  1.00 75.49 ? 375  ARG A NH2   1 
ATOM   2212 N N     . ARG C 3 202 ? 41.327  0.054   22.707  1.00 38.01 ? 376  ARG A N     1 
ATOM   2213 C CA    . ARG C 3 202 ? 41.343  -1.231  22.032  1.00 37.70 ? 376  ARG A CA    1 
ATOM   2214 C C     . ARG C 3 202 ? 41.022  -2.335  23.052  1.00 37.39 ? 376  ARG A C     1 
ATOM   2215 O O     . ARG C 3 202 ? 41.771  -2.590  24.012  1.00 38.35 ? 376  ARG A O     1 
ATOM   2216 C CB    . ARG C 3 202 ? 42.726  -1.437  21.408  1.00 35.15 ? 376  ARG A CB    1 
ATOM   2217 C CG    . ARG C 3 202 ? 43.054  -2.860  20.923  1.00 38.73 ? 376  ARG A CG    1 
ATOM   2218 C CD    . ARG C 3 202 ? 44.393  -2.907  20.190  1.00 35.28 ? 376  ARG A CD    1 
ATOM   2219 N NE    . ARG C 3 202 ? 44.346  -2.231  18.895  1.00 39.36 ? 376  ARG A NE    1 
ATOM   2220 C CZ    . ARG C 3 202 ? 43.857  -2.764  17.778  1.00 44.92 ? 376  ARG A CZ    1 
ATOM   2221 N NH1   . ARG C 3 202 ? 43.345  -3.999  17.759  1.00 51.04 ? 376  ARG A NH1   1 
ATOM   2222 N NH2   . ARG C 3 202 ? 43.919  -2.065  16.664  1.00 49.86 ? 376  ARG A NH2   1 
ATOM   2223 N N     . ILE C 3 203 ? 39.915  -3.008  22.794  1.00 34.67 ? 377  ILE A N     1 
ATOM   2224 C CA    . ILE C 3 203 ? 39.392  -4.072  23.640  1.00 35.66 ? 377  ILE A CA    1 
ATOM   2225 C C     . ILE C 3 203 ? 40.146  -5.384  23.503  1.00 37.75 ? 377  ILE A C     1 
ATOM   2226 O O     . ILE C 3 203 ? 40.179  -5.984  22.441  1.00 41.93 ? 377  ILE A O     1 
ATOM   2227 C CB    . ILE C 3 203 ? 37.888  -4.283  23.333  1.00 32.36 ? 377  ILE A CB    1 
ATOM   2228 C CG1   . ILE C 3 203 ? 37.133  -2.981  23.591  1.00 32.77 ? 377  ILE A CG1   1 
ATOM   2229 C CG2   . ILE C 3 203 ? 37.313  -5.381  24.176  1.00 26.73 ? 377  ILE A CG2   1 
ATOM   2230 C CD1   . ILE C 3 203 ? 37.225  -2.503  25.019  1.00 31.97 ? 377  ILE A CD1   1 
ATOM   2231 N N     . MET C 3 204 ? 40.693  -5.863  24.608  1.00 38.11 ? 378  MET A N     1 
ATOM   2232 C CA    . MET C 3 204 ? 41.460  -7.097  24.575  1.00 38.45 ? 378  MET A CA    1 
ATOM   2233 C C     . MET C 3 204 ? 40.631  -8.285  24.990  1.00 34.50 ? 378  MET A C     1 
ATOM   2234 O O     . MET C 3 204 ? 39.564  -8.120  25.536  1.00 32.24 ? 378  MET A O     1 
ATOM   2235 C CB    . MET C 3 204 ? 42.666  -6.939  25.474  1.00 39.34 ? 378  MET A CB    1 
ATOM   2236 C CG    . MET C 3 204 ? 43.494  -5.714  25.110  1.00 49.86 ? 378  MET A CG    1 
ATOM   2237 S SD    . MET C 3 204 ? 44.161  -5.716  23.388  1.00 58.44 ? 378  MET A SD    1 
ATOM   2238 C CE    . MET C 3 204 ? 45.474  -6.971  23.577  1.00 57.91 ? 378  MET A CE    1 
ATOM   2239 N N     . PRO C 3 205 ? 41.080  -9.501  24.659  1.00 34.84 ? 379  PRO A N     1 
ATOM   2240 C CA    . PRO C 3 205 ? 40.341  -10.712 25.035  1.00 34.26 ? 379  PRO A CA    1 
ATOM   2241 C C     . PRO C 3 205 ? 40.152  -10.694 26.523  1.00 33.63 ? 379  PRO A C     1 
ATOM   2242 O O     . PRO C 3 205 ? 39.152  -11.157 27.051  1.00 37.96 ? 379  PRO A O     1 
ATOM   2243 C CB    . PRO C 3 205 ? 41.302  -11.825 24.652  1.00 39.07 ? 379  PRO A CB    1 
ATOM   2244 C CG    . PRO C 3 205 ? 41.950  -11.273 23.411  1.00 37.94 ? 379  PRO A CG    1 
ATOM   2245 C CD    . PRO C 3 205 ? 42.218  -9.828  23.779  1.00 36.30 ? 379  PRO A CD    1 
ATOM   2246 N N     . GLU C 3 206 ? 41.131  -10.131 27.192  1.00 34.49 ? 380  GLU A N     1 
ATOM   2247 C CA    . GLU C 3 206 ? 41.097  -10.051 28.639  1.00 41.32 ? 380  GLU A CA    1 
ATOM   2248 C C     . GLU C 3 206 ? 39.950  -9.175  29.152  1.00 42.26 ? 380  GLU A C     1 
ATOM   2249 O O     . GLU C 3 206 ? 39.622  -9.223  30.331  1.00 40.35 ? 380  GLU A O     1 
ATOM   2250 C CB    . GLU C 3 206 ? 42.456  -9.588  29.187  1.00 40.06 ? 380  GLU A CB    1 
ATOM   2251 C CG    . GLU C 3 206 ? 43.595  -10.663 29.179  1.00 46.68 ? 380  GLU A CG    1 
ATOM   2252 C CD    . GLU C 3 206 ? 44.066  -11.160 27.778  1.00 53.82 ? 380  GLU A CD    1 
ATOM   2253 O OE1   . GLU C 3 206 ? 43.689  -10.593 26.721  1.00 54.71 ? 380  GLU A OE1   1 
ATOM   2254 O OE2   . GLU C 3 206 ? 44.849  -12.136 27.733  1.00 53.75 ? 380  GLU A OE2   1 
ATOM   2255 N N     . ASP C 3 207 ? 39.353  -8.362  28.279  1.00 40.51 ? 381  ASP A N     1 
ATOM   2256 C CA    . ASP C 3 207 ? 38.215  -7.504  28.684  1.00 40.06 ? 381  ASP A CA    1 
ATOM   2257 C C     . ASP C 3 207 ? 36.896  -8.150  28.266  1.00 39.92 ? 381  ASP A C     1 
ATOM   2258 O O     . ASP C 3 207 ? 35.826  -7.621  28.530  1.00 39.74 ? 381  ASP A O     1 
ATOM   2259 C CB    . ASP C 3 207 ? 38.267  -6.127  27.986  1.00 38.29 ? 381  ASP A CB    1 
ATOM   2260 C CG    . ASP C 3 207 ? 39.613  -5.431  28.123  1.00 40.18 ? 381  ASP A CG    1 
ATOM   2261 O OD1   . ASP C 3 207 ? 40.096  -5.297  29.262  1.00 44.88 ? 381  ASP A OD1   1 
ATOM   2262 O OD2   . ASP C 3 207 ? 40.184  -5.002  27.092  1.00 43.67 ? 381  ASP A OD2   1 
ATOM   2263 N N     . ILE C 3 208 ? 36.981  -9.276  27.565  1.00 40.08 ? 382  ILE A N     1 
ATOM   2264 C CA    . ILE C 3 208 ? 35.796  -9.952  27.026  1.00 36.50 ? 382  ILE A CA    1 
ATOM   2265 C C     . ILE C 3 208 ? 35.136  -11.025 27.888  1.00 35.31 ? 382  ILE A C     1 
ATOM   2266 O O     . ILE C 3 208 ? 35.784  -11.977 28.337  1.00 37.09 ? 382  ILE A O     1 
ATOM   2267 C CB    . ILE C 3 208 ? 36.154  -10.553 25.649  1.00 32.45 ? 382  ILE A CB    1 
ATOM   2268 C CG1   . ILE C 3 208 ? 36.529  -9.446  24.685  1.00 31.77 ? 382  ILE A CG1   1 
ATOM   2269 C CG2   . ILE C 3 208 ? 35.022  -11.340 25.110  1.00 34.84 ? 382  ILE A CG2   1 
ATOM   2270 C CD1   . ILE C 3 208 ? 35.469  -8.412  24.566  1.00 31.75 ? 382  ILE A CD1   1 
ATOM   2271 N N     . ILE C 3 209 ? 33.836  -10.891 28.092  1.00 33.55 ? 383  ILE A N     1 
ATOM   2272 C CA    . ILE C 3 209 ? 33.099  -11.879 28.858  1.00 34.13 ? 383  ILE A CA    1 
ATOM   2273 C C     . ILE C 3 209 ? 32.307  -12.684 27.839  1.00 36.82 ? 383  ILE A C     1 
ATOM   2274 O O     . ILE C 3 209 ? 31.578  -12.117 27.025  1.00 36.17 ? 383  ILE A O     1 
ATOM   2275 C CB    . ILE C 3 209 ? 32.135  -11.250 29.914  1.00 32.68 ? 383  ILE A CB    1 
ATOM   2276 C CG1   . ILE C 3 209 ? 32.912  -10.414 30.931  1.00 30.11 ? 383  ILE A CG1   1 
ATOM   2277 C CG2   . ILE C 3 209 ? 31.384  -12.347 30.660  1.00 36.42 ? 383  ILE A CG2   1 
ATOM   2278 C CD1   . ILE C 3 209 ? 32.126  -10.049 32.158  1.00 32.54 ? 383  ILE A CD1   1 
ATOM   2279 N N     . ILE C 3 210 ? 32.530  -13.997 27.841  1.00 36.81 ? 384  ILE A N     1 
ATOM   2280 C CA    . ILE C 3 210 ? 31.846  -14.913 26.940  1.00 36.08 ? 384  ILE A CA    1 
ATOM   2281 C C     . ILE C 3 210 ? 30.642  -15.553 27.626  1.00 36.58 ? 384  ILE A C     1 
ATOM   2282 O O     . ILE C 3 210 ? 30.701  -15.920 28.806  1.00 36.57 ? 384  ILE A O     1 
ATOM   2283 C CB    . ILE C 3 210 ? 32.780  -16.058 26.519  1.00 36.75 ? 384  ILE A CB    1 
ATOM   2284 C CG1   . ILE C 3 210 ? 33.951  -15.526 25.698  1.00 34.60 ? 384  ILE A CG1   1 
ATOM   2285 C CG2   . ILE C 3 210 ? 32.002  -17.093 25.743  1.00 31.97 ? 384  ILE A CG2   1 
ATOM   2286 C CD1   . ILE C 3 210 ? 33.539  -14.996 24.332  1.00 33.95 ? 384  ILE A CD1   1 
ATOM   2287 N N     . ASN C 3 211 ? 29.559  -15.705 26.882  1.00 38.62 ? 385  ASN A N     1 
ATOM   2288 C CA    . ASN C 3 211 ? 28.377  -16.351 27.440  1.00 38.75 ? 385  ASN A CA    1 
ATOM   2289 C C     . ASN C 3 211 ? 27.952  -17.431 26.480  1.00 38.02 ? 385  ASN A C     1 
ATOM   2290 O O     . ASN C 3 211 ? 27.929  -17.236 25.256  1.00 31.81 ? 385  ASN A O     1 
ATOM   2291 C CB    . ASN C 3 211 ? 27.218  -15.373 27.649  1.00 37.83 ? 385  ASN A CB    1 
ATOM   2292 C CG    . ASN C 3 211 ? 26.096  -15.968 28.491  1.00 37.25 ? 385  ASN A CG    1 
ATOM   2293 O OD1   . ASN C 3 211 ? 26.339  -16.705 29.445  1.00 34.77 ? 385  ASN A OD1   1 
ATOM   2294 N ND2   . ASN C 3 211 ? 24.867  -15.628 28.146  1.00 31.20 ? 385  ASN A ND2   1 
ATOM   2295 N N     . CYS C 3 212 ? 27.684  -18.592 27.054  1.00 37.47 ? 386  CYS A N     1 
ATOM   2296 C CA    . CYS C 3 212 ? 27.227  -19.743 26.299  1.00 42.01 ? 386  CYS A CA    1 
ATOM   2297 C C     . CYS C 3 212 ? 26.694  -20.761 27.293  1.00 42.33 ? 386  CYS A C     1 
ATOM   2298 O O     . CYS C 3 212 ? 26.760  -20.529 28.498  1.00 40.29 ? 386  CYS A O     1 
ATOM   2299 C CB    . CYS C 3 212 ? 28.374  -20.327 25.481  1.00 43.54 ? 386  CYS A CB    1 
ATOM   2300 S SG    . CYS C 3 212 ? 29.791  -20.715 26.478  1.00 41.72 ? 386  CYS A SG    1 
ATOM   2301 N N     . SER C 3 213 ? 26.048  -21.806 26.789  1.00 42.03 ? 387  SER A N     1 
ATOM   2302 C CA    . SER C 3 213 ? 25.529  -22.850 27.660  1.00 46.50 ? 387  SER A CA    1 
ATOM   2303 C C     . SER C 3 213 ? 26.683  -23.610 28.343  1.00 48.85 ? 387  SER A C     1 
ATOM   2304 O O     . SER C 3 213 ? 27.827  -23.558 27.876  1.00 43.24 ? 387  SER A O     1 
ATOM   2305 C CB    . SER C 3 213 ? 24.605  -23.798 26.882  1.00 47.28 ? 387  SER A CB    1 
ATOM   2306 O OG    . SER C 3 213 ? 25.173  -24.252 25.648  1.00 51.05 ? 387  SER A OG    1 
ATOM   2307 N N     . LYS C 3 214 ? 26.370  -24.229 29.478  1.00 48.40 ? 388  LYS A N     1 
ATOM   2308 C CA    . LYS C 3 214 ? 27.316  -25.003 30.281  1.00 47.76 ? 388  LYS A CA    1 
ATOM   2309 C C     . LYS C 3 214 ? 27.964  -26.148 29.510  1.00 46.83 ? 388  LYS A C     1 
ATOM   2310 O O     . LYS C 3 214 ? 29.115  -26.479 29.702  1.00 42.97 ? 388  LYS A O     1 
ATOM   2311 C CB    . LYS C 3 214 ? 26.575  -25.577 31.497  1.00 51.93 ? 388  LYS A CB    1 
ATOM   2312 C CG    . LYS C 3 214 ? 25.914  -24.507 32.336  1.00 58.95 ? 388  LYS A CG    1 
ATOM   2313 C CD    . LYS C 3 214 ? 24.995  -25.033 33.436  1.00 60.72 ? 388  LYS A CD    1 
ATOM   2314 C CE    . LYS C 3 214 ? 24.627  -23.875 34.387  1.00 63.48 ? 388  LYS A CE    1 
ATOM   2315 N NZ    . LYS C 3 214 ? 24.136  -22.641 33.666  1.00 59.19 ? 388  LYS A NZ    1 
ATOM   2316 N N     . ASP C 3 215 ? 27.162  -26.815 28.697  1.00 46.76 ? 389  ASP A N     1 
ATOM   2317 C CA    . ASP C 3 215 ? 27.601  -27.949 27.902  1.00 50.91 ? 389  ASP A CA    1 
ATOM   2318 C C     . ASP C 3 215 ? 28.217  -27.592 26.550  1.00 50.28 ? 389  ASP A C     1 
ATOM   2319 O O     . ASP C 3 215 ? 28.446  -28.466 25.709  1.00 48.61 ? 389  ASP A O     1 
ATOM   2320 C CB    . ASP C 3 215 ? 26.381  -28.828 27.639  1.00 56.46 ? 389  ASP A CB    1 
ATOM   2321 C CG    . ASP C 3 215 ? 25.276  -28.071 26.927  1.00 55.19 ? 389  ASP A CG    1 
ATOM   2322 O OD1   . ASP C 3 215 ? 25.304  -26.823 26.952  1.00 54.91 ? 389  ASP A OD1   1 
ATOM   2323 O OD2   . ASP C 3 215 ? 24.391  -28.725 26.334  1.00 56.95 ? 389  ASP A OD2   1 
ATOM   2324 N N     . ALA C 3 216 ? 28.392  -26.311 26.298  1.00 51.45 ? 390  ALA A N     1 
ATOM   2325 C CA    . ALA C 3 216 ? 28.938  -25.879 25.015  1.00 50.19 ? 390  ALA A CA    1 
ATOM   2326 C C     . ALA C 3 216 ? 30.463  -25.797 24.924  1.00 46.23 ? 390  ALA A C     1 
ATOM   2327 O O     . ALA C 3 216 ? 31.138  -25.567 25.911  1.00 48.32 ? 390  ALA A O     1 
ATOM   2328 C CB    . ALA C 3 216 ? 28.314  -24.526 24.620  1.00 49.04 ? 390  ALA A CB    1 
ATOM   2329 N N     . LYS C 3 217 ? 31.010  -26.051 23.744  1.00 41.67 ? 391  LYS A N     1 
ATOM   2330 C CA    . LYS C 3 217 ? 32.448  -25.919 23.563  1.00 41.21 ? 391  LYS A CA    1 
ATOM   2331 C C     . LYS C 3 217 ? 32.768  -24.442 23.700  1.00 41.05 ? 391  LYS A C     1 
ATOM   2332 O O     . LYS C 3 217 ? 32.300  -23.643 22.907  1.00 42.61 ? 391  LYS A O     1 
ATOM   2333 C CB    . LYS C 3 217 ? 32.874  -26.347 22.165  1.00 41.56 ? 391  LYS A CB    1 
ATOM   2334 C CG    . LYS C 3 217 ? 34.335  -26.035 21.908  1.00 46.43 ? 391  LYS A CG    1 
ATOM   2335 C CD    . LYS C 3 217 ? 34.784  -26.385 20.495  1.00 56.61 ? 391  LYS A CD    1 
ATOM   2336 C CE    . LYS C 3 217 ? 34.617  -27.874 20.183  1.00 64.96 ? 391  LYS A CE    1 
ATOM   2337 N NZ    . LYS C 3 217 ? 34.567  -28.721 21.412  1.00 74.94 ? 391  LYS A NZ    1 
ATOM   2338 N N     . VAL C 3 218 ? 33.564  -24.083 24.697  1.00 41.59 ? 392  VAL A N     1 
ATOM   2339 C CA    . VAL C 3 218 ? 33.908  -22.684 24.902  1.00 38.94 ? 392  VAL A CA    1 
ATOM   2340 C C     . VAL C 3 218 ? 34.845  -22.171 23.831  1.00 37.62 ? 392  VAL A C     1 
ATOM   2341 O O     . VAL C 3 218 ? 35.836  -22.801 23.528  1.00 39.33 ? 392  VAL A O     1 
ATOM   2342 C CB    . VAL C 3 218 ? 34.544  -22.450 26.300  1.00 34.83 ? 392  VAL A CB    1 
ATOM   2343 C CG1   . VAL C 3 218 ? 34.978  -20.976 26.458  1.00 33.70 ? 392  VAL A CG1   1 
ATOM   2344 C CG2   . VAL C 3 218 ? 33.548  -22.818 27.387  1.00 28.69 ? 392  VAL A CG2   1 
ATOM   2345 N N     . PRO C 3 219 ? 34.517  -21.021 23.219  1.00 36.60 ? 393  PRO A N     1 
ATOM   2346 C CA    . PRO C 3 219 ? 35.411  -20.513 22.199  1.00 36.66 ? 393  PRO A CA    1 
ATOM   2347 C C     . PRO C 3 219 ? 36.741  -20.192 22.862  1.00 39.15 ? 393  PRO A C     1 
ATOM   2348 O O     . PRO C 3 219 ? 36.793  -19.630 23.955  1.00 43.52 ? 393  PRO A O     1 
ATOM   2349 C CB    . PRO C 3 219 ? 34.692  -19.244 21.722  1.00 35.00 ? 393  PRO A CB    1 
ATOM   2350 C CG    . PRO C 3 219 ? 33.951  -18.812 22.876  1.00 32.88 ? 393  PRO A CG    1 
ATOM   2351 C CD    . PRO C 3 219 ? 33.378  -20.114 23.389  1.00 36.07 ? 393  PRO A CD    1 
ATOM   2352 N N     . SER C 3 220 ? 37.816  -20.594 22.223  1.00 40.30 ? 394  SER A N     1 
ATOM   2353 C CA    . SER C 3 220 ? 39.117  -20.338 22.773  1.00 43.24 ? 394  SER A CA    1 
ATOM   2354 C C     . SER C 3 220 ? 39.589  -18.960 22.327  1.00 44.84 ? 394  SER A C     1 
ATOM   2355 O O     . SER C 3 220 ? 39.404  -18.571 21.184  1.00 42.29 ? 394  SER A O     1 
ATOM   2356 C CB    . SER C 3 220 ? 40.078  -21.443 22.340  1.00 42.06 ? 394  SER A CB    1 
ATOM   2357 O OG    . SER C 3 220 ? 39.821  -21.861 21.016  1.00 47.15 ? 394  SER A OG    1 
ATOM   2358 N N     . PRO C 3 221 ? 40.134  -18.166 23.257  1.00 47.18 ? 395  PRO A N     1 
ATOM   2359 C CA    . PRO C 3 221 ? 40.626  -16.820 22.938  1.00 50.97 ? 395  PRO A CA    1 
ATOM   2360 C C     . PRO C 3 221 ? 41.869  -16.862 22.036  1.00 52.04 ? 395  PRO A C     1 
ATOM   2361 O O     . PRO C 3 221 ? 42.406  -17.933 21.772  1.00 55.91 ? 395  PRO A O     1 
ATOM   2362 C CB    . PRO C 3 221 ? 40.951  -16.252 24.331  1.00 49.52 ? 395  PRO A CB    1 
ATOM   2363 C CG    . PRO C 3 221 ? 41.316  -17.432 25.117  1.00 47.20 ? 395  PRO A CG    1 
ATOM   2364 C CD    . PRO C 3 221 ? 40.280  -18.446 24.697  1.00 47.39 ? 395  PRO A CD    1 
ATOM   2365 N N     . PRO C 3 222 ? 42.327  -15.698 21.533  1.00 51.82 ? 396  PRO A N     1 
ATOM   2366 C CA    . PRO C 3 222 ? 43.514  -15.675 20.676  1.00 50.32 ? 396  PRO A CA    1 
ATOM   2367 C C     . PRO C 3 222 ? 44.651  -16.291 21.460  1.00 50.30 ? 396  PRO A C     1 
ATOM   2368 O O     . PRO C 3 222 ? 44.688  -16.173 22.683  1.00 48.11 ? 396  PRO A O     1 
ATOM   2369 C CB    . PRO C 3 222 ? 43.774  -14.186 20.502  1.00 52.80 ? 396  PRO A CB    1 
ATOM   2370 C CG    . PRO C 3 222 ? 42.394  -13.613 20.485  1.00 54.33 ? 396  PRO A CG    1 
ATOM   2371 C CD    . PRO C 3 222 ? 41.712  -14.360 21.614  1.00 51.75 ? 396  PRO A CD    1 
ATOM   2372 N N     . PRO C 3 223 ? 45.587  -16.959 20.774  1.00 52.74 ? 397  PRO A N     1 
ATOM   2373 C CA    . PRO C 3 223 ? 46.751  -17.608 21.389  1.00 54.09 ? 397  PRO A CA    1 
ATOM   2374 C C     . PRO C 3 223 ? 47.545  -16.630 22.219  1.00 54.36 ? 397  PRO A C     1 
ATOM   2375 O O     . PRO C 3 223 ? 47.892  -15.551 21.746  1.00 56.26 ? 397  PRO A O     1 
ATOM   2376 C CB    . PRO C 3 223 ? 47.546  -18.078 20.178  1.00 55.61 ? 397  PRO A CB    1 
ATOM   2377 C CG    . PRO C 3 223 ? 46.454  -18.463 19.226  1.00 58.23 ? 397  PRO A CG    1 
ATOM   2378 C CD    . PRO C 3 223 ? 45.524  -17.266 19.334  1.00 55.99 ? 397  PRO A CD    1 
ATOM   2379 N N     . GLY C 3 224 ? 47.843  -17.017 23.449  1.00 54.81 ? 398  GLY A N     1 
ATOM   2380 C CA    . GLY C 3 224 ? 48.582  -16.149 24.352  1.00 56.87 ? 398  GLY A CA    1 
ATOM   2381 C C     . GLY C 3 224 ? 47.674  -15.230 25.166  1.00 57.38 ? 398  GLY A C     1 
ATOM   2382 O O     . GLY C 3 224 ? 48.151  -14.310 25.846  1.00 60.08 ? 398  GLY A O     1 
ATOM   2383 N N     . HIS C 3 225 ? 46.365  -15.502 25.120  1.00 53.72 ? 399  HIS A N     1 
ATOM   2384 C CA    . HIS C 3 225 ? 45.378  -14.700 25.828  1.00 51.98 ? 399  HIS A CA    1 
ATOM   2385 C C     . HIS C 3 225 ? 44.417  -15.475 26.684  1.00 51.04 ? 399  HIS A C     1 
ATOM   2386 O O     . HIS C 3 225 ? 44.485  -16.692 26.773  1.00 49.67 ? 399  HIS A O     1 
ATOM   2387 C CB    . HIS C 3 225 ? 44.553  -13.909 24.839  1.00 51.69 ? 399  HIS A CB    1 
ATOM   2388 C CG    . HIS C 3 225 ? 45.304  -12.804 24.209  1.00 53.39 ? 399  HIS A CG    1 
ATOM   2389 N ND1   . HIS C 3 225 ? 45.404  -11.556 24.788  1.00 52.07 ? 399  HIS A ND1   1 
ATOM   2390 C CD2   . HIS C 3 225 ? 46.041  -12.759 23.073  1.00 54.81 ? 399  HIS A CD2   1 
ATOM   2391 C CE1   . HIS C 3 225 ? 46.174  -10.791 24.038  1.00 58.43 ? 399  HIS A CE1   1 
ATOM   2392 N NE2   . HIS C 3 225 ? 46.575  -11.494 22.988  1.00 57.21 ? 399  HIS A NE2   1 
ATOM   2393 N N     . LYS C 3 226 ? 43.487  -14.729 27.267  1.00 49.75 ? 400  LYS A N     1 
ATOM   2394 C CA    . LYS C 3 226 ? 42.442  -15.279 28.113  1.00 47.77 ? 400  LYS A CA    1 
ATOM   2395 C C     . LYS C 3 226 ? 41.249  -14.331 28.054  1.00 44.07 ? 400  LYS A C     1 
ATOM   2396 O O     . LYS C 3 226 ? 41.413  -13.149 27.760  1.00 43.58 ? 400  LYS A O     1 
ATOM   2397 C CB    . LYS C 3 226 ? 42.939  -15.391 29.554  1.00 47.28 ? 400  LYS A CB    1 
ATOM   2398 C CG    . LYS C 3 226 ? 43.963  -16.476 29.772  1.00 45.78 ? 400  LYS A CG    1 
ATOM   2399 C CD    . LYS C 3 226 ? 44.591  -16.379 31.147  1.00 43.66 ? 400  LYS A CD    1 
ATOM   2400 C CE    . LYS C 3 226 ? 45.614  -17.472 31.343  1.00 46.47 ? 400  LYS A CE    1 
ATOM   2401 N NZ    . LYS C 3 226 ? 46.217  -17.440 32.691  1.00 45.89 ? 400  LYS A NZ    1 
ATOM   2402 N N     . TRP C 3 227 ? 40.052  -14.885 28.190  1.00 42.23 ? 401  TRP A N     1 
ATOM   2403 C CA    . TRP C 3 227 ? 38.835  -14.093 28.215  1.00 39.33 ? 401  TRP A CA    1 
ATOM   2404 C C     . TRP C 3 227 ? 38.811  -13.485 29.612  1.00 41.50 ? 401  TRP A C     1 
ATOM   2405 O O     . TRP C 3 227 ? 39.515  -13.936 30.497  1.00 45.84 ? 401  TRP A O     1 
ATOM   2406 C CB    . TRP C 3 227 ? 37.610  -14.998 28.083  1.00 38.09 ? 401  TRP A CB    1 
ATOM   2407 C CG    . TRP C 3 227 ? 37.534  -15.857 26.839  1.00 37.56 ? 401  TRP A CG    1 
ATOM   2408 C CD1   . TRP C 3 227 ? 37.341  -17.214 26.786  1.00 37.76 ? 401  TRP A CD1   1 
ATOM   2409 C CD2   . TRP C 3 227 ? 37.513  -15.402 25.492  1.00 35.09 ? 401  TRP A CD2   1 
ATOM   2410 N NE1   . TRP C 3 227 ? 37.186  -17.625 25.490  1.00 31.91 ? 401  TRP A NE1   1 
ATOM   2411 C CE2   . TRP C 3 227 ? 37.305  -16.536 24.668  1.00 35.55 ? 401  TRP A CE2   1 
ATOM   2412 C CE3   . TRP C 3 227 ? 37.673  -14.149 24.890  1.00 31.20 ? 401  TRP A CE3   1 
ATOM   2413 C CZ2   . TRP C 3 227 ? 37.218  -16.450 23.281  1.00 33.82 ? 401  TRP A CZ2   1 
ATOM   2414 C CZ3   . TRP C 3 227 ? 37.589  -14.059 23.521  1.00 30.74 ? 401  TRP A CZ3   1 
ATOM   2415 C CH2   . TRP C 3 227 ? 37.380  -15.207 22.721  1.00 33.44 ? 401  TRP A CH2   1 
ATOM   2416 N N     . LYS C 3 228 ? 37.971  -12.483 29.823  1.00 43.59 ? 402  LYS A N     1 
ATOM   2417 C CA    . LYS C 3 228 ? 37.850  -11.865 31.138  1.00 41.57 ? 402  LYS A CA    1 
ATOM   2418 C C     . LYS C 3 228 ? 37.135  -12.865 32.055  1.00 39.57 ? 402  LYS A C     1 
ATOM   2419 O O     . LYS C 3 228 ? 37.530  -13.100 33.196  1.00 41.52 ? 402  LYS A O     1 
ATOM   2420 C CB    . LYS C 3 228 ? 37.028  -10.582 31.009  1.00 43.49 ? 402  LYS A CB    1 
ATOM   2421 C CG    . LYS C 3 228 ? 36.977  -9.687  32.234  1.00 46.71 ? 402  LYS A CG    1 
ATOM   2422 C CD    . LYS C 3 228 ? 36.141  -8.437  31.925  1.00 44.92 ? 402  LYS A CD    1 
ATOM   2423 C CE    . LYS C 3 228 ? 35.938  -7.560  33.143  1.00 49.49 ? 402  LYS A CE    1 
ATOM   2424 N NZ    . LYS C 3 228 ? 34.954  -6.448  32.869  1.00 54.60 ? 402  LYS A NZ    1 
ATOM   2425 N N     . GLU C 3 229 ? 36.130  -13.515 31.505  1.00 34.48 ? 403  GLU A N     1 
ATOM   2426 C CA    . GLU C 3 229 ? 35.361  -14.479 32.247  1.00 34.88 ? 403  GLU A CA    1 
ATOM   2427 C C     . GLU C 3 229 ? 34.487  -15.242 31.264  1.00 39.62 ? 403  GLU A C     1 
ATOM   2428 O O     . GLU C 3 229 ? 34.358  -14.862 30.087  1.00 39.47 ? 403  GLU A O     1 
ATOM   2429 C CB    . GLU C 3 229 ? 34.483  -13.748 33.250  1.00 30.76 ? 403  GLU A CB    1 
ATOM   2430 C CG    . GLU C 3 229 ? 33.437  -14.614 33.893  1.00 39.20 ? 403  GLU A CG    1 
ATOM   2431 C CD    . GLU C 3 229 ? 32.245  -13.824 34.328  1.00 47.42 ? 403  GLU A CD    1 
ATOM   2432 O OE1   . GLU C 3 229 ? 32.393  -12.602 34.509  1.00 47.46 ? 403  GLU A OE1   1 
ATOM   2433 O OE2   . GLU C 3 229 ? 31.153  -14.415 34.488  1.00 49.38 ? 403  GLU A OE2   1 
ATOM   2434 N N     . VAL C 3 230 ? 33.926  -16.351 31.722  1.00 38.35 ? 404  VAL A N     1 
ATOM   2435 C CA    . VAL C 3 230 ? 33.038  -17.139 30.888  1.00 39.08 ? 404  VAL A CA    1 
ATOM   2436 C C     . VAL C 3 230 ? 31.860  -17.440 31.749  1.00 38.59 ? 404  VAL A C     1 
ATOM   2437 O O     . VAL C 3 230 ? 32.013  -17.831 32.888  1.00 39.64 ? 404  VAL A O     1 
ATOM   2438 C CB    . VAL C 3 230 ? 33.635  -18.488 30.481  1.00 41.07 ? 404  VAL A CB    1 
ATOM   2439 C CG1   . VAL C 3 230 ? 32.749  -19.143 29.443  1.00 35.53 ? 404  VAL A CG1   1 
ATOM   2440 C CG2   . VAL C 3 230 ? 35.044  -18.316 29.970  1.00 39.36 ? 404  VAL A CG2   1 
ATOM   2441 N N     . ARG C 3 231 ? 30.674  -17.173 31.240  1.00 39.75 ? 405  ARG A N     1 
ATOM   2442 C CA    . ARG C 3 231 ? 29.526  -17.483 32.048  1.00 39.61 ? 405  ARG A CA    1 
ATOM   2443 C C     . ARG C 3 231 ? 28.504  -18.222 31.242  1.00 38.54 ? 405  ARG A C     1 
ATOM   2444 O O     . ARG C 3 231 ? 28.632  -18.338 30.023  1.00 38.01 ? 405  ARG A O     1 
ATOM   2445 C CB    . ARG C 3 231 ? 28.960  -16.238 32.759  1.00 41.28 ? 405  ARG A CB    1 
ATOM   2446 C CG    . ARG C 3 231 ? 28.190  -15.207 31.933  1.00 39.79 ? 405  ARG A CG    1 
ATOM   2447 C CD    . ARG C 3 231 ? 27.529  -14.130 32.849  1.00 30.98 ? 405  ARG A CD    1 
ATOM   2448 N NE    . ARG C 3 231 ? 28.504  -13.381 33.631  1.00 35.59 ? 405  ARG A NE    1 
ATOM   2449 C CZ    . ARG C 3 231 ? 28.509  -12.054 33.795  1.00 39.48 ? 405  ARG A CZ    1 
ATOM   2450 N NH1   . ARG C 3 231 ? 27.573  -11.294 33.236  1.00 34.04 ? 405  ARG A NH1   1 
ATOM   2451 N NH2   . ARG C 3 231 ? 29.507  -11.476 34.457  1.00 28.82 ? 405  ARG A NH2   1 
ATOM   2452 N N     . HIS C 3 232 ? 27.583  -18.856 31.951  1.00 37.21 ? 406  HIS A N     1 
ATOM   2453 C CA    . HIS C 3 232 ? 26.518  -19.625 31.328  1.00 41.28 ? 406  HIS A CA    1 
ATOM   2454 C C     . HIS C 3 232 ? 25.208  -19.154 31.970  1.00 45.42 ? 406  HIS A C     1 
ATOM   2455 O O     . HIS C 3 232 ? 24.693  -19.799 32.895  1.00 46.58 ? 406  HIS A O     1 
ATOM   2456 C CB    . HIS C 3 232 ? 26.722  -21.131 31.588  1.00 44.92 ? 406  HIS A CB    1 
ATOM   2457 C CG    . HIS C 3 232 ? 28.132  -21.613 31.370  1.00 46.16 ? 406  HIS A CG    1 
ATOM   2458 N ND1   . HIS C 3 232 ? 28.744  -21.592 30.139  1.00 46.86 ? 406  HIS A ND1   1 
ATOM   2459 C CD2   . HIS C 3 232 ? 29.054  -22.078 32.246  1.00 47.10 ? 406  HIS A CD2   1 
ATOM   2460 C CE1   . HIS C 3 232 ? 29.992  -22.014 30.268  1.00 48.65 ? 406  HIS A CE1   1 
ATOM   2461 N NE2   . HIS C 3 232 ? 30.201  -22.313 31.533  1.00 45.61 ? 406  HIS A NE2   1 
ATOM   2462 N N     . ASP C 3 233 ? 24.721  -17.990 31.546  1.00 42.83 ? 407  ASP A N     1 
ATOM   2463 C CA    . ASP C 3 233 ? 23.491  -17.415 32.093  1.00 40.74 ? 407  ASP A CA    1 
ATOM   2464 C C     . ASP C 3 233 ? 22.405  -17.490 31.059  1.00 36.95 ? 407  ASP A C     1 
ATOM   2465 O O     . ASP C 3 233 ? 22.277  -16.596 30.236  1.00 36.55 ? 407  ASP A O     1 
ATOM   2466 C CB    . ASP C 3 233 ? 23.741  -15.956 32.470  1.00 45.89 ? 407  ASP A CB    1 
ATOM   2467 C CG    . ASP C 3 233 ? 22.520  -15.261 33.016  1.00 48.56 ? 407  ASP A CG    1 
ATOM   2468 O OD1   . ASP C 3 233 ? 21.398  -15.805 32.955  1.00 48.27 ? 407  ASP A OD1   1 
ATOM   2469 O OD2   . ASP C 3 233 ? 22.711  -14.141 33.507  1.00 50.01 ? 407  ASP A OD2   1 
ATOM   2470 N N     . ASN C 3 234 ? 21.545  -18.481 31.180  1.00 37.39 ? 408  ASN A N     1 
ATOM   2471 C CA    . ASN C 3 234 ? 20.498  -18.661 30.187  1.00 41.24 ? 408  ASN A CA    1 
ATOM   2472 C C     . ASN C 3 234 ? 19.307  -17.728 30.341  1.00 40.08 ? 408  ASN A C     1 
ATOM   2473 O O     . ASN C 3 234 ? 18.227  -17.963 29.784  1.00 34.06 ? 408  ASN A O     1 
ATOM   2474 C CB    . ASN C 3 234 ? 20.054  -20.104 30.173  1.00 43.96 ? 408  ASN A CB    1 
ATOM   2475 C CG    . ASN C 3 234 ? 19.259  -20.474 31.390  1.00 52.49 ? 408  ASN A CG    1 
ATOM   2476 O OD1   . ASN C 3 234 ? 18.460  -21.409 31.322  1.00 59.48 ? 408  ASN A OD1   1 
ATOM   2477 N ND2   . ASN C 3 234 ? 19.416  -19.714 32.502  1.00 49.51 ? 408  ASN A ND2   1 
ATOM   2478 N N     . LYS C 3 235 ? 19.529  -16.672 31.112  1.00 39.72 ? 409  LYS A N     1 
ATOM   2479 C CA    . LYS C 3 235 ? 18.509  -15.675 31.367  1.00 40.01 ? 409  LYS A CA    1 
ATOM   2480 C C     . LYS C 3 235 ? 18.756  -14.460 30.472  1.00 41.34 ? 409  LYS A C     1 
ATOM   2481 O O     . LYS C 3 235 ? 17.871  -13.618 30.338  1.00 43.75 ? 409  LYS A O     1 
ATOM   2482 C CB    . LYS C 3 235 ? 18.558  -15.245 32.834  1.00 42.49 ? 409  LYS A CB    1 
ATOM   2483 C CG    . LYS C 3 235 ? 18.590  -16.397 33.814  1.00 47.72 ? 409  LYS A CG    1 
ATOM   2484 C CD    . LYS C 3 235 ? 17.233  -17.066 33.883  1.00 59.99 ? 409  LYS A CD    1 
ATOM   2485 C CE    . LYS C 3 235 ? 17.345  -18.488 34.393  1.00 65.43 ? 409  LYS A CE    1 
ATOM   2486 N NZ    . LYS C 3 235 ? 18.092  -18.581 35.668  1.00 69.46 ? 409  LYS A NZ    1 
ATOM   2487 N N     . VAL C 3 236 ? 19.960  -14.325 29.918  1.00 34.71 ? 410  VAL A N     1 
ATOM   2488 C CA    . VAL C 3 236 ? 20.262  -13.186 29.056  1.00 32.68 ? 410  VAL A CA    1 
ATOM   2489 C C     . VAL C 3 236 ? 20.369  -13.670 27.635  1.00 33.27 ? 410  VAL A C     1 
ATOM   2490 O O     . VAL C 3 236 ? 20.451  -14.864 27.390  1.00 33.25 ? 410  VAL A O     1 
ATOM   2491 C CB    . VAL C 3 236 ? 21.537  -12.449 29.479  1.00 29.61 ? 410  VAL A CB    1 
ATOM   2492 C CG1   . VAL C 3 236 ? 21.365  -11.914 30.880  1.00 31.35 ? 410  VAL A CG1   1 
ATOM   2493 C CG2   . VAL C 3 236 ? 22.730  -13.367 29.439  1.00 32.37 ? 410  VAL A CG2   1 
ATOM   2494 N N     . THR C 3 237 ? 20.353  -12.745 26.690  1.00 33.82 ? 411  THR A N     1 
ATOM   2495 C CA    . THR C 3 237 ? 20.385  -13.136 25.294  1.00 30.58 ? 411  THR A CA    1 
ATOM   2496 C C     . THR C 3 237 ? 21.712  -12.904 24.637  1.00 28.82 ? 411  THR A C     1 
ATOM   2497 O O     . THR C 3 237 ? 21.916  -13.303 23.513  1.00 34.37 ? 411  THR A O     1 
ATOM   2498 C CB    . THR C 3 237 ? 19.290  -12.392 24.471  1.00 27.89 ? 411  THR A CB    1 
ATOM   2499 O OG1   . THR C 3 237 ? 19.638  -11.004 24.338  1.00 32.05 ? 411  THR A OG1   1 
ATOM   2500 C CG2   . THR C 3 237 ? 17.961  -12.457 25.177  1.00 31.35 ? 411  THR A CG2   1 
ATOM   2501 N N     . TRP C 3 238 ? 22.651  -12.305 25.335  1.00 30.15 ? 412  TRP A N     1 
ATOM   2502 C CA    . TRP C 3 238 ? 23.924  -12.013 24.689  1.00 31.61 ? 412  TRP A CA    1 
ATOM   2503 C C     . TRP C 3 238 ? 25.009  -13.094 24.685  1.00 32.74 ? 412  TRP A C     1 
ATOM   2504 O O     . TRP C 3 238 ? 25.104  -13.934 25.587  1.00 29.78 ? 412  TRP A O     1 
ATOM   2505 C CB    . TRP C 3 238 ? 24.461  -10.693 25.232  1.00 36.13 ? 412  TRP A CB    1 
ATOM   2506 C CG    . TRP C 3 238 ? 24.549  -10.657 26.713  1.00 32.22 ? 412  TRP A CG    1 
ATOM   2507 C CD1   . TRP C 3 238 ? 23.585  -10.238 27.597  1.00 32.99 ? 412  TRP A CD1   1 
ATOM   2508 C CD2   . TRP C 3 238 ? 25.674  -11.040 27.489  1.00 27.51 ? 412  TRP A CD2   1 
ATOM   2509 N NE1   . TRP C 3 238 ? 24.060  -10.323 28.887  1.00 33.41 ? 412  TRP A NE1   1 
ATOM   2510 C CE2   . TRP C 3 238 ? 25.344  -10.808 28.852  1.00 32.30 ? 412  TRP A CE2   1 
ATOM   2511 C CE3   . TRP C 3 238 ? 26.942  -11.537 27.171  1.00 29.72 ? 412  TRP A CE3   1 
ATOM   2512 C CZ2   . TRP C 3 238 ? 26.236  -11.085 29.898  1.00 33.56 ? 412  TRP A CZ2   1 
ATOM   2513 C CZ3   . TRP C 3 238 ? 27.840  -11.810 28.218  1.00 27.46 ? 412  TRP A CZ3   1 
ATOM   2514 C CH2   . TRP C 3 238 ? 27.484  -11.571 29.559  1.00 31.29 ? 412  TRP A CH2   1 
ATOM   2515 N N     . LEU C 3 239 ? 25.873  -13.051 23.675  1.00 28.23 ? 413  LEU A N     1 
ATOM   2516 C CA    . LEU C 3 239 ? 26.907  -14.052 23.579  1.00 29.58 ? 413  LEU A CA    1 
ATOM   2517 C C     . LEU C 3 239 ? 28.200  -13.535 24.114  1.00 28.83 ? 413  LEU A C     1 
ATOM   2518 O O     . LEU C 3 239 ? 29.028  -14.294 24.584  1.00 30.54 ? 413  LEU A O     1 
ATOM   2519 C CB    . LEU C 3 239 ? 27.124  -14.454 22.127  1.00 33.73 ? 413  LEU A CB    1 
ATOM   2520 C CG    . LEU C 3 239 ? 25.954  -14.509 21.147  1.00 35.96 ? 413  LEU A CG    1 
ATOM   2521 C CD1   . LEU C 3 239 ? 26.456  -15.142 19.858  1.00 39.66 ? 413  LEU A CD1   1 
ATOM   2522 C CD2   . LEU C 3 239 ? 24.814  -15.287 21.699  1.00 32.86 ? 413  LEU A CD2   1 
ATOM   2523 N N     . VAL C 3 240 ? 28.392  -12.240 23.942  1.00 26.29 ? 414  VAL A N     1 
ATOM   2524 C CA    . VAL C 3 240 ? 29.607  -11.572 24.360  1.00 26.56 ? 414  VAL A CA    1 
ATOM   2525 C C     . VAL C 3 240 ? 29.292  -10.176 24.857  1.00 28.97 ? 414  VAL A C     1 
ATOM   2526 O O     . VAL C 3 240 ? 28.296  -9.578  24.457  1.00 33.99 ? 414  VAL A O     1 
ATOM   2527 C CB    . VAL C 3 240 ? 30.548  -11.412 23.169  1.00 29.03 ? 414  VAL A CB    1 
ATOM   2528 C CG1   . VAL C 3 240 ? 31.775  -10.593 23.548  1.00 32.19 ? 414  VAL A CG1   1 
ATOM   2529 C CG2   . VAL C 3 240 ? 30.953  -12.763 22.645  1.00 35.73 ? 414  VAL A CG2   1 
ATOM   2530 N N     . SER C 3 241 ? 30.119  -9.676  25.769  1.00 29.35 ? 415  SER A N     1 
ATOM   2531 C CA    . SER C 3 241 ? 29.946  -8.328  26.297  1.00 35.44 ? 415  SER A CA    1 
ATOM   2532 C C     . SER C 3 241 ? 31.262  -7.803  26.830  1.00 35.94 ? 415  SER A C     1 
ATOM   2533 O O     . SER C 3 241 ? 32.246  -8.533  26.934  1.00 40.70 ? 415  SER A O     1 
ATOM   2534 C CB    . SER C 3 241 ? 28.886  -8.274  27.392  1.00 32.60 ? 415  SER A CB    1 
ATOM   2535 O OG    . SER C 3 241 ? 29.320  -8.971  28.529  1.00 39.24 ? 415  SER A OG    1 
ATOM   2536 N N     . TRP C 3 242 ? 31.313  -6.502  27.067  1.00 36.32 ? 416  TRP A N     1 
ATOM   2537 C CA    . TRP C 3 242 ? 32.515  -5.886  27.598  1.00 36.96 ? 416  TRP A CA    1 
ATOM   2538 C C     . TRP C 3 242 ? 32.164  -4.461  28.011  1.00 37.45 ? 416  TRP A C     1 
ATOM   2539 O O     . TRP C 3 242 ? 31.164  -3.914  27.562  1.00 37.86 ? 416  TRP A O     1 
ATOM   2540 C CB    . TRP C 3 242 ? 33.628  -5.900  26.541  1.00 32.02 ? 416  TRP A CB    1 
ATOM   2541 C CG    . TRP C 3 242 ? 33.466  -4.893  25.422  1.00 34.35 ? 416  TRP A CG    1 
ATOM   2542 C CD1   . TRP C 3 242 ? 33.916  -3.608  25.415  1.00 32.62 ? 416  TRP A CD1   1 
ATOM   2543 C CD2   . TRP C 3 242 ? 32.864  -5.107  24.137  1.00 31.46 ? 416  TRP A CD2   1 
ATOM   2544 N NE1   . TRP C 3 242 ? 33.650  -3.016  24.215  1.00 30.99 ? 416  TRP A NE1   1 
ATOM   2545 C CE2   . TRP C 3 242 ? 33.003  -3.912  23.404  1.00 31.21 ? 416  TRP A CE2   1 
ATOM   2546 C CE3   . TRP C 3 242 ? 32.236  -6.196  23.532  1.00 30.49 ? 416  TRP A CE3   1 
ATOM   2547 C CZ2   . TRP C 3 242 ? 32.531  -3.760  22.100  1.00 32.73 ? 416  TRP A CZ2   1 
ATOM   2548 C CZ3   . TRP C 3 242 ? 31.771  -6.053  22.244  1.00 32.71 ? 416  TRP A CZ3   1 
ATOM   2549 C CH2   . TRP C 3 242 ? 31.922  -4.838  21.531  1.00 32.47 ? 416  TRP A CH2   1 
ATOM   2550 N N     . THR C 3 243 ? 32.981  -3.843  28.846  1.00 37.43 ? 417  THR A N     1 
ATOM   2551 C CA    . THR C 3 243 ? 32.686  -2.486  29.264  1.00 37.72 ? 417  THR A CA    1 
ATOM   2552 C C     . THR C 3 243 ? 33.477  -1.461  28.461  1.00 36.89 ? 417  THR A C     1 
ATOM   2553 O O     . THR C 3 243 ? 34.700  -1.519  28.357  1.00 34.11 ? 417  THR A O     1 
ATOM   2554 C CB    . THR C 3 243 ? 32.865  -2.302  30.774  1.00 39.11 ? 417  THR A CB    1 
ATOM   2555 O OG1   . THR C 3 243 ? 31.920  -3.131  31.466  1.00 36.78 ? 417  THR A OG1   1 
ATOM   2556 C CG2   . THR C 3 243 ? 32.609  -0.863  31.150  1.00 38.77 ? 417  THR A CG2   1 
ATOM   2557 N N     . GLU C 3 244 ? 32.728  -0.589  27.811  1.00 36.75 ? 418  GLU A N     1 
ATOM   2558 C CA    . GLU C 3 244 ? 33.269  0.468   26.985  1.00 39.99 ? 418  GLU A CA    1 
ATOM   2559 C C     . GLU C 3 244 ? 33.900  1.495   27.923  1.00 42.36 ? 418  GLU A C     1 
ATOM   2560 O O     . GLU C 3 244 ? 33.320  1.889   28.930  1.00 43.01 ? 418  GLU A O     1 
ATOM   2561 C CB    . GLU C 3 244 ? 32.141  1.082   26.167  1.00 40.12 ? 418  GLU A CB    1 
ATOM   2562 C CG    . GLU C 3 244 ? 32.418  2.497   25.736  1.00 50.79 ? 418  GLU A CG    1 
ATOM   2563 C CD    . GLU C 3 244 ? 31.513  3.517   26.403  1.00 51.77 ? 418  GLU A CD    1 
ATOM   2564 O OE1   . GLU C 3 244 ? 30.916  3.232   27.464  1.00 48.87 ? 418  GLU A OE1   1 
ATOM   2565 O OE2   . GLU C 3 244 ? 31.391  4.623   25.829  1.00 64.77 ? 418  GLU A OE2   1 
ATOM   2566 N N     . ASN C 3 245 ? 35.081  1.965   27.581  1.00 44.76 ? 419  ASN A N     1 
ATOM   2567 C CA    . ASN C 3 245 ? 35.780  2.874   28.477  1.00 43.91 ? 419  ASN A CA    1 
ATOM   2568 C C     . ASN C 3 245 ? 35.311  4.300   28.522  1.00 44.36 ? 419  ASN A C     1 
ATOM   2569 O O     . ASN C 3 245 ? 35.547  4.984   29.502  1.00 45.57 ? 419  ASN A O     1 
ATOM   2570 C CB    . ASN C 3 245 ? 37.278  2.868   28.166  1.00 47.87 ? 419  ASN A CB    1 
ATOM   2571 C CG    . ASN C 3 245 ? 37.599  3.488   26.806  1.00 48.82 ? 419  ASN A CG    1 
ATOM   2572 O OD1   . ASN C 3 245 ? 37.064  3.079   25.779  1.00 52.82 ? 419  ASN A OD1   1 
ATOM   2573 N ND2   . ASN C 3 245 ? 38.487  4.463   26.803  1.00 46.14 ? 419  ASN A ND2   1 
ATOM   2574 N N     . ILE C 3 246 ? 34.641  4.763   27.481  1.00 42.40 ? 420  ILE A N     1 
ATOM   2575 C CA    . ILE C 3 246 ? 34.246  6.152   27.503  1.00 39.34 ? 420  ILE A CA    1 
ATOM   2576 C C     . ILE C 3 246 ? 33.088  6.520   28.409  1.00 40.69 ? 420  ILE A C     1 
ATOM   2577 O O     . ILE C 3 246 ? 33.038  7.641   28.901  1.00 44.16 ? 420  ILE A O     1 
ATOM   2578 C CB    . ILE C 3 246 ? 34.149  6.704   26.076  1.00 43.80 ? 420  ILE A CB    1 
ATOM   2579 C CG1   . ILE C 3 246 ? 35.576  6.861   25.553  1.00 39.70 ? 420  ILE A CG1   1 
ATOM   2580 C CG2   . ILE C 3 246 ? 33.386  8.045   26.020  1.00 39.38 ? 420  ILE A CG2   1 
ATOM   2581 C CD1   . ILE C 3 246 ? 35.660  6.906   24.097  1.00 48.67 ? 420  ILE A CD1   1 
ATOM   2582 N N     . GLN C 3 247 ? 32.153  5.615   28.635  1.00 38.31 ? 421  GLN A N     1 
ATOM   2583 C CA    . GLN C 3 247 ? 31.047  5.937   29.529  1.00 41.38 ? 421  GLN A CA    1 
ATOM   2584 C C     . GLN C 3 247 ? 30.822  4.823   30.555  1.00 44.23 ? 421  GLN A C     1 
ATOM   2585 O O     . GLN C 3 247 ? 29.917  4.884   31.390  1.00 46.58 ? 421  GLN A O     1 
ATOM   2586 C CB    . GLN C 3 247 ? 29.771  6.255   28.748  1.00 41.59 ? 421  GLN A CB    1 
ATOM   2587 C CG    . GLN C 3 247 ? 30.012  7.314   27.701  1.00 48.62 ? 421  GLN A CG    1 
ATOM   2588 C CD    . GLN C 3 247 ? 28.775  8.072   27.312  1.00 51.91 ? 421  GLN A CD    1 
ATOM   2589 O OE1   . GLN C 3 247 ? 28.210  7.849   26.235  1.00 53.37 ? 421  GLN A OE1   1 
ATOM   2590 N NE2   . GLN C 3 247 ? 28.404  9.054   28.151  1.00 50.35 ? 421  GLN A NE2   1 
ATOM   2591 N N     . GLY C 3 248 ? 31.671  3.808   30.496  1.00 39.67 ? 422  GLY A N     1 
ATOM   2592 C CA    . GLY C 3 248 ? 31.542  2.723   31.442  1.00 38.83 ? 422  GLY A CA    1 
ATOM   2593 C C     . GLY C 3 248 ? 30.308  1.871   31.289  1.00 38.74 ? 422  GLY A C     1 
ATOM   2594 O O     . GLY C 3 248 ? 29.926  1.191   32.214  1.00 42.86 ? 422  GLY A O     1 
ATOM   2595 N N     . SER C 3 249 ? 29.665  1.913   30.122  1.00 38.78 ? 423  SER A N     1 
ATOM   2596 C CA    . SER C 3 249 ? 28.481  1.074   29.875  1.00 40.25 ? 423  SER A CA    1 
ATOM   2597 C C     . SER C 3 249 ? 28.954  -0.279  29.315  1.00 38.56 ? 423  SER A C     1 
ATOM   2598 O O     . SER C 3 249 ? 30.121  -0.439  28.910  1.00 38.52 ? 423  SER A O     1 
ATOM   2599 C CB    . SER C 3 249 ? 27.551  1.736   28.864  1.00 43.25 ? 423  SER A CB    1 
ATOM   2600 O OG    . SER C 3 249 ? 28.179  1.747   27.596  1.00 47.55 ? 423  SER A OG    1 
ATOM   2601 N N     . ILE C 3 250 ? 28.072  -1.251  29.285  1.00 35.44 ? 424  ILE A N     1 
ATOM   2602 C CA    . ILE C 3 250 ? 28.446  -2.558  28.785  1.00 37.71 ? 424  ILE A CA    1 
ATOM   2603 C C     . ILE C 3 250 ? 27.986  -2.719  27.338  1.00 34.33 ? 424  ILE A C     1 
ATOM   2604 O O     . ILE C 3 250 ? 26.869  -2.397  27.017  1.00 32.69 ? 424  ILE A O     1 
ATOM   2605 C CB    . ILE C 3 250 ? 27.825  -3.652  29.652  1.00 38.95 ? 424  ILE A CB    1 
ATOM   2606 C CG1   . ILE C 3 250 ? 28.176  -3.391  31.101  1.00 36.36 ? 424  ILE A CG1   1 
ATOM   2607 C CG2   . ILE C 3 250 ? 28.379  -4.995  29.288  1.00 40.10 ? 424  ILE A CG2   1 
ATOM   2608 C CD1   . ILE C 3 250 ? 27.173  -4.015  32.042  1.00 49.13 ? 424  ILE A CD1   1 
ATOM   2609 N N     . LYS C 3 251 ? 28.887  -3.164  26.466  1.00 36.76 ? 425  LYS A N     1 
ATOM   2610 C CA    . LYS C 3 251 ? 28.576  -3.407  25.046  1.00 35.48 ? 425  LYS A CA    1 
ATOM   2611 C C     . LYS C 3 251 ? 28.413  -4.910  24.885  1.00 36.70 ? 425  LYS A C     1 
ATOM   2612 O O     . LYS C 3 251 ? 29.165  -5.680  25.495  1.00 30.88 ? 425  LYS A O     1 
ATOM   2613 C CB    . LYS C 3 251 ? 29.713  -2.935  24.134  1.00 34.99 ? 425  LYS A CB    1 
ATOM   2614 C CG    . LYS C 3 251 ? 29.923  -1.412  24.075  1.00 35.31 ? 425  LYS A CG    1 
ATOM   2615 C CD    . LYS C 3 251 ? 28.635  -0.661  23.728  1.00 36.72 ? 425  LYS A CD    1 
ATOM   2616 C CE    . LYS C 3 251 ? 28.881  0.839   23.463  1.00 40.09 ? 425  LYS A CE    1 
ATOM   2617 N NZ    . LYS C 3 251 ? 29.096  1.204   22.021  1.00 31.57 ? 425  LYS A NZ    1 
ATOM   2618 N N     . TYR C 3 252 ? 27.476  -5.318  24.032  1.00 32.63 ? 426  TYR A N     1 
ATOM   2619 C CA    . TYR C 3 252 ? 27.173  -6.728  23.780  1.00 30.68 ? 426  TYR A CA    1 
ATOM   2620 C C     . TYR C 3 252 ? 27.218  -7.159  22.300  1.00 31.05 ? 426  TYR A C     1 
ATOM   2621 O O     . TYR C 3 252 ? 27.071  -6.352  21.376  1.00 28.68 ? 426  TYR A O     1 
ATOM   2622 C CB    . TYR C 3 252 ? 25.735  -7.040  24.261  1.00 26.48 ? 426  TYR A CB    1 
ATOM   2623 C CG    . TYR C 3 252 ? 25.410  -6.638  25.674  1.00 28.75 ? 426  TYR A CG    1 
ATOM   2624 C CD1   . TYR C 3 252 ? 25.720  -7.487  26.741  1.00 33.52 ? 426  TYR A CD1   1 
ATOM   2625 C CD2   . TYR C 3 252 ? 24.812  -5.414  25.956  1.00 22.22 ? 426  TYR A CD2   1 
ATOM   2626 C CE1   . TYR C 3 252 ? 25.453  -7.123  28.063  1.00 29.81 ? 426  TYR A CE1   1 
ATOM   2627 C CE2   . TYR C 3 252 ? 24.534  -5.046  27.275  1.00 29.12 ? 426  TYR A CE2   1 
ATOM   2628 C CZ    . TYR C 3 252 ? 24.865  -5.905  28.318  1.00 30.48 ? 426  TYR A CZ    1 
ATOM   2629 O OH    . TYR C 3 252 ? 24.638  -5.556  29.620  1.00 31.33 ? 426  TYR A OH    1 
ATOM   2630 N N     . ILE C 3 253 ? 27.391  -8.465  22.109  1.00 31.13 ? 427  ILE A N     1 
ATOM   2631 C CA    . ILE C 3 253 ? 27.313  -9.048  20.782  1.00 30.43 ? 427  ILE A CA    1 
ATOM   2632 C C     . ILE C 3 253 ? 26.031  -9.878  20.839  1.00 32.38 ? 427  ILE A C     1 
ATOM   2633 O O     . ILE C 3 253 ? 25.930  -10.815 21.645  1.00 33.18 ? 427  ILE A O     1 
ATOM   2634 C CB    . ILE C 3 253 ? 28.476  -9.977  20.436  1.00 33.67 ? 427  ILE A CB    1 
ATOM   2635 C CG1   . ILE C 3 253 ? 29.752  -9.139  20.272  1.00 33.58 ? 427  ILE A CG1   1 
ATOM   2636 C CG2   . ILE C 3 253 ? 28.137  -10.749 19.151  1.00 29.39 ? 427  ILE A CG2   1 
ATOM   2637 C CD1   . ILE C 3 253 ? 30.962  -9.832  19.660  1.00 29.30 ? 427  ILE A CD1   1 
ATOM   2638 N N     . MET C 3 254 ? 25.043  -9.497  20.042  1.00 31.84 ? 428  MET A N     1 
ATOM   2639 C CA    . MET C 3 254 ? 23.772  -10.187 20.015  1.00 34.87 ? 428  MET A CA    1 
ATOM   2640 C C     . MET C 3 254 ? 23.393  -10.681 18.610  1.00 37.95 ? 428  MET A C     1 
ATOM   2641 O O     . MET C 3 254 ? 24.157  -10.515 17.656  1.00 38.03 ? 428  MET A O     1 
ATOM   2642 C CB    . MET C 3 254 ? 22.676  -9.306  20.630  1.00 35.09 ? 428  MET A CB    1 
ATOM   2643 C CG    . MET C 3 254 ? 22.735  -9.222  22.159  1.00 39.13 ? 428  MET A CG    1 
ATOM   2644 S SD    . MET C 3 254 ? 21.555  -8.021  22.845  1.00 47.73 ? 428  MET A SD    1 
ATOM   2645 C CE    . MET C 3 254 ? 22.005  -7.965  24.564  1.00 46.22 ? 428  MET A CE    1 
ATOM   2646 N N     . LEU C 3 255 ? 22.221  -11.304 18.503  1.00 39.35 ? 429  LEU A N     1 
ATOM   2647 C CA    . LEU C 3 255 ? 21.729  -11.880 17.255  1.00 40.97 ? 429  LEU A CA    1 
ATOM   2648 C C     . LEU C 3 255 ? 20.959  -10.984 16.321  1.00 40.87 ? 429  LEU A C     1 
ATOM   2649 O O     . LEU C 3 255 ? 20.403  -9.958  16.706  1.00 43.79 ? 429  LEU A O     1 
ATOM   2650 C CB    . LEU C 3 255 ? 20.880  -13.113 17.539  1.00 34.64 ? 429  LEU A CB    1 
ATOM   2651 C CG    . LEU C 3 255 ? 21.540  -14.274 18.254  1.00 35.09 ? 429  LEU A CG    1 
ATOM   2652 C CD1   . LEU C 3 255 ? 20.566  -15.436 18.303  1.00 32.02 ? 429  LEU A CD1   1 
ATOM   2653 C CD2   . LEU C 3 255 ? 22.820  -14.654 17.526  1.00 33.52 ? 429  LEU A CD2   1 
ATOM   2654 N N     . ASN C 3 256 ? 20.945  -11.435 15.074  1.00 41.63 ? 430  ASN A N     1 
ATOM   2655 C CA    . ASN C 3 256 ? 20.268  -10.803 13.967  1.00 41.69 ? 430  ASN A CA    1 
ATOM   2656 C C     . ASN C 3 256 ? 18.798  -10.585 14.257  1.00 42.21 ? 430  ASN A C     1 
ATOM   2657 O O     . ASN C 3 256 ? 18.214  -11.215 15.136  1.00 39.67 ? 430  ASN A O     1 
ATOM   2658 C CB    . ASN C 3 256 ? 20.369  -11.733 12.766  1.00 48.59 ? 430  ASN A CB    1 
ATOM   2659 C CG    . ASN C 3 256 ? 20.298  -10.998 11.462  1.00 57.22 ? 430  ASN A CG    1 
ATOM   2660 O OD1   . ASN C 3 256 ? 20.931  -9.948  11.325  1.00 64.53 ? 430  ASN A OD1   1 
ATOM   2661 N ND2   . ASN C 3 256 ? 19.539  -11.515 10.499  1.00 58.23 ? 430  ASN A ND2   1 
ATOM   2662 N N     . PRO C 3 257 ? 18.183  -9.621  13.571  1.00 43.82 ? 431  PRO A N     1 
ATOM   2663 C CA    . PRO C 3 257 ? 16.762  -9.369  13.794  1.00 45.46 ? 431  PRO A CA    1 
ATOM   2664 C C     . PRO C 3 257 ? 15.949  -10.609 13.411  1.00 43.54 ? 431  PRO A C     1 
ATOM   2665 O O     . PRO C 3 257 ? 14.909  -10.878 14.020  1.00 45.82 ? 431  PRO A O     1 
ATOM   2666 C CB    . PRO C 3 257 ? 16.470  -8.217  12.840  1.00 44.72 ? 431  PRO A CB    1 
ATOM   2667 C CG    . PRO C 3 257 ? 17.742  -7.461  12.836  1.00 48.30 ? 431  PRO A CG    1 
ATOM   2668 C CD    . PRO C 3 257 ? 18.785  -8.552  12.759  1.00 46.55 ? 431  PRO A CD    1 
ATOM   2669 N N     . SER C 3 258 ? 16.432  -11.353 12.415  1.00 39.67 ? 432  SER A N     1 
ATOM   2670 C CA    . SER C 3 258 ? 15.749  -12.559 11.957  1.00 38.46 ? 432  SER A CA    1 
ATOM   2671 C C     . SER C 3 258 ? 15.857  -13.700 12.965  1.00 39.78 ? 432  SER A C     1 
ATOM   2672 O O     . SER C 3 258 ? 15.395  -14.802 12.738  1.00 41.83 ? 432  SER A O     1 
ATOM   2673 C CB    . SER C 3 258 ? 16.232  -12.958 10.566  1.00 39.14 ? 432  SER A CB    1 
ATOM   2674 O OG    . SER C 3 258 ? 17.633  -13.076 10.539  1.00 46.44 ? 432  SER A OG    1 
ATOM   2675 N N     . SER C 3 259 ? 16.432  -13.401 14.119  1.00 40.90 ? 433  SER A N     1 
ATOM   2676 C CA    . SER C 3 259 ? 16.531  -14.394 15.182  1.00 41.54 ? 433  SER A CA    1 
ATOM   2677 C C     . SER C 3 259 ? 15.184  -14.712 15.802  1.00 35.76 ? 433  SER A C     1 
ATOM   2678 O O     . SER C 3 259 ? 14.310  -13.864 15.963  1.00 33.02 ? 433  SER A O     1 
ATOM   2679 C CB    . SER C 3 259 ? 17.416  -13.895 16.320  1.00 38.14 ? 433  SER A CB    1 
ATOM   2680 O OG    . SER C 3 259 ? 18.734  -13.751 15.867  1.00 59.48 ? 433  SER A OG    1 
ATOM   2681 N N     . ARG C 3 260 ? 15.106  -15.914 16.310  1.00 33.84 ? 434  ARG A N     1 
ATOM   2682 C CA    . ARG C 3 260 ? 13.912  -16.324 16.967  1.00 34.79 ? 434  ARG A CA    1 
ATOM   2683 C C     . ARG C 3 260 ? 13.881  -15.524 18.240  1.00 36.11 ? 434  ARG A C     1 
ATOM   2684 O O     . ARG C 3 260 ? 12.866  -14.971 18.623  1.00 40.96 ? 434  ARG A O     1 
ATOM   2685 C CB    . ARG C 3 260 ? 14.028  -17.789 17.293  1.00 36.81 ? 434  ARG A CB    1 
ATOM   2686 C CG    . ARG C 3 260 ? 13.085  -18.249 18.340  1.00 43.09 ? 434  ARG A CG    1 
ATOM   2687 C CD    . ARG C 3 260 ? 13.852  -18.920 19.441  1.00 48.35 ? 434  ARG A CD    1 
ATOM   2688 N NE    . ARG C 3 260 ? 13.739  -18.138 20.654  1.00 51.59 ? 434  ARG A NE    1 
ATOM   2689 C CZ    . ARG C 3 260 ? 14.557  -18.244 21.690  1.00 53.91 ? 434  ARG A CZ    1 
ATOM   2690 N NH1   . ARG C 3 260 ? 15.570  -19.102 21.662  1.00 56.31 ? 434  ARG A NH1   1 
ATOM   2691 N NH2   . ARG C 3 260 ? 14.325  -17.532 22.779  1.00 53.40 ? 434  ARG A NH2   1 
ATOM   2692 N N     . ILE C 3 261 ? 15.022  -15.419 18.892  1.00 35.87 ? 435  ILE A N     1 
ATOM   2693 C CA    . ILE C 3 261 ? 15.061  -14.689 20.137  1.00 36.75 ? 435  ILE A CA    1 
ATOM   2694 C C     . ILE C 3 261 ? 14.689  -13.223 19.941  1.00 37.08 ? 435  ILE A C     1 
ATOM   2695 O O     . ILE C 3 261 ? 13.938  -12.654 20.712  1.00 37.67 ? 435  ILE A O     1 
ATOM   2696 C CB    . ILE C 3 261 ? 16.406  -14.834 20.781  1.00 38.45 ? 435  ILE A CB    1 
ATOM   2697 C CG1   . ILE C 3 261 ? 16.273  -14.595 22.276  1.00 41.01 ? 435  ILE A CG1   1 
ATOM   2698 C CG2   . ILE C 3 261 ? 17.395  -13.899 20.141  1.00 36.87 ? 435  ILE A CG2   1 
ATOM   2699 C CD1   . ILE C 3 261 ? 17.237  -15.430 23.090  1.00 42.20 ? 435  ILE A CD1   1 
ATOM   2700 N N     . LYS C 3 262 ? 15.176  -12.625 18.873  1.00 40.11 ? 436  LYS A N     1 
ATOM   2701 C CA    . LYS C 3 262 ? 14.853  -11.246 18.606  1.00 40.50 ? 436  LYS A CA    1 
ATOM   2702 C C     . LYS C 3 262 ? 13.440  -11.165 18.078  1.00 42.72 ? 436  LYS A C     1 
ATOM   2703 O O     . LYS C 3 262 ? 12.590  -10.514 18.678  1.00 45.58 ? 436  LYS A O     1 
ATOM   2704 C CB    . LYS C 3 262 ? 15.833  -10.650 17.600  1.00 43.08 ? 436  LYS A CB    1 
ATOM   2705 C CG    . LYS C 3 262 ? 17.190  -10.267 18.200  1.00 47.83 ? 436  LYS A CG    1 
ATOM   2706 C CD    . LYS C 3 262 ? 17.026  -9.285  19.370  1.00 51.53 ? 436  LYS A CD    1 
ATOM   2707 C CE    . LYS C 3 262 ? 18.277  -8.414  19.581  1.00 54.82 ? 436  LYS A CE    1 
ATOM   2708 N NZ    . LYS C 3 262 ? 19.206  -8.943  20.613  1.00 56.12 ? 436  LYS A NZ    1 
ATOM   2709 N N     . GLY C 3 263 ? 13.184  -11.871 16.989  1.00 39.46 ? 437  GLY A N     1 
ATOM   2710 C CA    . GLY C 3 263 ? 11.858  -11.842 16.404  1.00 39.86 ? 437  GLY A CA    1 
ATOM   2711 C C     . GLY C 3 263 ? 10.707  -11.985 17.389  1.00 40.06 ? 437  GLY A C     1 
ATOM   2712 O O     . GLY C 3 263 ? 9.690   -11.281 17.357  1.00 41.07 ? 437  GLY A O     1 
ATOM   2713 N N     . GLU C 3 264 ? 10.875  -12.922 18.293  1.00 40.41 ? 438  GLU A N     1 
ATOM   2714 C CA    . GLU C 3 264 ? 9.870   -13.172 19.283  1.00 40.95 ? 438  GLU A CA    1 
ATOM   2715 C C     . GLU C 3 264 ? 9.571   -11.933 20.130  1.00 40.22 ? 438  GLU A C     1 
ATOM   2716 O O     . GLU C 3 264 ? 8.427   -11.679 20.462  1.00 43.67 ? 438  GLU A O     1 
ATOM   2717 C CB    . GLU C 3 264 ? 10.366  -14.320 20.119  1.00 44.81 ? 438  GLU A CB    1 
ATOM   2718 C CG    . GLU C 3 264 ? 9.568   -14.642 21.311  1.00 58.65 ? 438  GLU A CG    1 
ATOM   2719 C CD    . GLU C 3 264 ? 10.129  -15.873 22.016  1.00 69.75 ? 438  GLU A CD    1 
ATOM   2720 O OE1   . GLU C 3 264 ? 11.333  -15.852 22.434  1.00 72.41 ? 438  GLU A OE1   1 
ATOM   2721 O OE2   . GLU C 3 264 ? 9.356   -16.860 22.132  1.00 72.92 ? 438  GLU A OE2   1 
ATOM   2722 N N     . LYS C 3 265 ? 10.578  -11.144 20.469  1.00 36.17 ? 439  LYS A N     1 
ATOM   2723 C CA    . LYS C 3 265 ? 10.326  -9.966  21.286  1.00 37.52 ? 439  LYS A CA    1 
ATOM   2724 C C     . LYS C 3 265 ? 9.507   -8.968  20.539  1.00 34.84 ? 439  LYS A C     1 
ATOM   2725 O O     . LYS C 3 265 ? 8.658   -8.329  21.105  1.00 33.06 ? 439  LYS A O     1 
ATOM   2726 C CB    . LYS C 3 265 ? 11.625  -9.285  21.689  1.00 48.09 ? 439  LYS A CB    1 
ATOM   2727 C CG    . LYS C 3 265 ? 12.462  -10.074 22.659  1.00 60.25 ? 439  LYS A CG    1 
ATOM   2728 C CD    . LYS C 3 265 ? 13.865  -9.460  22.788  1.00 70.48 ? 439  LYS A CD    1 
ATOM   2729 C CE    . LYS C 3 265 ? 14.974  -10.541 22.801  1.00 72.73 ? 439  LYS A CE    1 
ATOM   2730 N NZ    . LYS C 3 265 ? 16.301  -10.069 22.270  1.00 73.51 ? 439  LYS A NZ    1 
ATOM   2731 N N     . ASP C 3 266 ? 9.818   -8.827  19.264  1.00 36.69 ? 440  ASP A N     1 
ATOM   2732 C CA    . ASP C 3 266 ? 9.145   -7.891  18.392  1.00 39.95 ? 440  ASP A CA    1 
ATOM   2733 C C     . ASP C 3 266 ? 7.676   -8.271  18.293  1.00 39.74 ? 440  ASP A C     1 
ATOM   2734 O O     . ASP C 3 266 ? 6.785   -7.423  18.294  1.00 37.95 ? 440  ASP A O     1 
ATOM   2735 C CB    . ASP C 3 266 ? 9.803   -7.931  17.020  1.00 41.37 ? 440  ASP A CB    1 
ATOM   2736 C CG    . ASP C 3 266 ? 9.917   -6.555  16.391  1.00 47.12 ? 440  ASP A CG    1 
ATOM   2737 O OD1   . ASP C 3 266 ? 10.089  -5.556  17.136  1.00 47.49 ? 440  ASP A OD1   1 
ATOM   2738 O OD2   . ASP C 3 266 ? 9.838   -6.468  15.149  1.00 51.03 ? 440  ASP A OD2   1 
ATOM   2739 N N     . TRP C 3 267 ? 7.439   -9.559  18.143  1.00 43.77 ? 441  TRP A N     1 
ATOM   2740 C CA    . TRP C 3 267 ? 6.093   -10.087 18.064  1.00 46.40 ? 441  TRP A CA    1 
ATOM   2741 C C     . TRP C 3 267 ? 5.410   -9.679  19.370  1.00 40.66 ? 441  TRP A C     1 
ATOM   2742 O O     . TRP C 3 267 ? 4.376   -9.023  19.371  1.00 34.74 ? 441  TRP A O     1 
ATOM   2743 C CB    . TRP C 3 267 ? 6.161   -11.613 17.903  1.00 55.50 ? 441  TRP A CB    1 
ATOM   2744 C CG    . TRP C 3 267 ? 4.835   -12.306 17.954  1.00 67.72 ? 441  TRP A CG    1 
ATOM   2745 C CD1   . TRP C 3 267 ? 3.609   -11.724 18.106  1.00 72.16 ? 441  TRP A CD1   1 
ATOM   2746 C CD2   . TRP C 3 267 ? 4.600   -13.720 17.917  1.00 75.22 ? 441  TRP A CD2   1 
ATOM   2747 N NE1   . TRP C 3 267 ? 2.624   -12.674 18.174  1.00 76.22 ? 441  TRP A NE1   1 
ATOM   2748 C CE2   . TRP C 3 267 ? 3.199   -13.911 18.061  1.00 78.98 ? 441  TRP A CE2   1 
ATOM   2749 C CE3   . TRP C 3 267 ? 5.431   -14.844 17.773  1.00 79.45 ? 441  TRP A CE3   1 
ATOM   2750 C CZ2   . TRP C 3 267 ? 2.612   -15.186 18.073  1.00 83.34 ? 441  TRP A CZ2   1 
ATOM   2751 C CZ3   . TRP C 3 267 ? 4.845   -16.123 17.783  1.00 83.65 ? 441  TRP A CZ3   1 
ATOM   2752 C CH2   . TRP C 3 267 ? 3.445   -16.277 17.933  1.00 85.43 ? 441  TRP A CH2   1 
ATOM   2753 N N     . GLN C 3 268 ? 6.035   -10.027 20.484  1.00 38.71 ? 442  GLN A N     1 
ATOM   2754 C CA    . GLN C 3 268 ? 5.476   -9.663  21.760  1.00 39.26 ? 442  GLN A CA    1 
ATOM   2755 C C     . GLN C 3 268 ? 5.251   -8.150  21.841  1.00 39.33 ? 442  GLN A C     1 
ATOM   2756 O O     . GLN C 3 268 ? 4.183   -7.715  22.246  1.00 44.58 ? 442  GLN A O     1 
ATOM   2757 C CB    . GLN C 3 268 ? 6.382   -10.114 22.889  1.00 43.80 ? 442  GLN A CB    1 
ATOM   2758 C CG    . GLN C 3 268 ? 5.717   -9.911  24.246  1.00 63.67 ? 442  GLN A CG    1 
ATOM   2759 C CD    . GLN C 3 268 ? 6.675   -10.021 25.435  1.00 72.61 ? 442  GLN A CD    1 
ATOM   2760 O OE1   . GLN C 3 268 ? 7.877   -10.283 25.264  1.00 80.03 ? 442  GLN A OE1   1 
ATOM   2761 N NE2   . GLN C 3 268 ? 6.140   -9.841  26.659  1.00 76.94 ? 442  GLN A NE2   1 
ATOM   2762 N N     . LYS C 3 269 ? 6.201   -7.362  21.336  1.00 36.90 ? 443  LYS A N     1 
ATOM   2763 C CA    . LYS C 3 269 ? 6.112   -5.902  21.368  1.00 32.67 ? 443  LYS A CA    1 
ATOM   2764 C C     . LYS C 3 269 ? 4.852   -5.353  20.743  1.00 33.69 ? 443  LYS A C     1 
ATOM   2765 O O     . LYS C 3 269 ? 4.209   -4.463  21.278  1.00 30.94 ? 443  LYS A O     1 
ATOM   2766 C CB    . LYS C 3 269 ? 7.300   -5.293  20.647  1.00 36.19 ? 443  LYS A CB    1 
ATOM   2767 C CG    . LYS C 3 269 ? 7.478   -3.793  20.866  1.00 38.04 ? 443  LYS A CG    1 
ATOM   2768 C CD    . LYS C 3 269 ? 8.628   -3.252  20.010  1.00 41.39 ? 443  LYS A CD    1 
ATOM   2769 C CE    . LYS C 3 269 ? 8.153   -3.041  18.565  1.00 43.84 ? 443  LYS A CE    1 
ATOM   2770 N NZ    . LYS C 3 269 ? 9.239   -2.862  17.561  1.00 36.97 ? 443  LYS A NZ    1 
ATOM   2771 N N     . TYR C 3 270 ? 4.521   -5.825  19.557  1.00 35.80 ? 444  TYR A N     1 
ATOM   2772 C CA    . TYR C 3 270 ? 3.304   -5.339  18.930  1.00 38.83 ? 444  TYR A CA    1 
ATOM   2773 C C     . TYR C 3 270 ? 2.020   -5.797  19.648  1.00 38.28 ? 444  TYR A C     1 
ATOM   2774 O O     . TYR C 3 270 ? 1.010   -5.086  19.664  1.00 40.16 ? 444  TYR A O     1 
ATOM   2775 C CB    . TYR C 3 270 ? 3.306   -5.696  17.444  1.00 37.12 ? 444  TYR A CB    1 
ATOM   2776 C CG    . TYR C 3 270 ? 4.339   -4.893  16.694  1.00 38.83 ? 444  TYR A CG    1 
ATOM   2777 C CD1   . TYR C 3 270 ? 4.138   -3.528  16.451  1.00 38.19 ? 444  TYR A CD1   1 
ATOM   2778 C CD2   . TYR C 3 270 ? 5.539   -5.478  16.275  1.00 38.93 ? 444  TYR A CD2   1 
ATOM   2779 C CE1   . TYR C 3 270 ? 5.098   -2.768  15.816  1.00 38.61 ? 444  TYR A CE1   1 
ATOM   2780 C CE2   . TYR C 3 270 ? 6.515   -4.720  15.638  1.00 38.82 ? 444  TYR A CE2   1 
ATOM   2781 C CZ    . TYR C 3 270 ? 6.285   -3.367  15.416  1.00 39.30 ? 444  TYR A CZ    1 
ATOM   2782 O OH    . TYR C 3 270 ? 7.226   -2.602  14.802  1.00 40.71 ? 444  TYR A OH    1 
ATOM   2783 N N     . GLU C 3 271 ? 2.067   -6.986  20.223  1.00 36.91 ? 445  GLU A N     1 
ATOM   2784 C CA    . GLU C 3 271 ? 0.935   -7.522  20.951  1.00 38.79 ? 445  GLU A CA    1 
ATOM   2785 C C     . GLU C 3 271 ? 0.563   -6.587  22.075  1.00 38.83 ? 445  GLU A C     1 
ATOM   2786 O O     . GLU C 3 271 ? -0.606  -6.184  22.229  1.00 42.76 ? 445  GLU A O     1 
ATOM   2787 C CB    . GLU C 3 271 ? 1.288   -8.892  21.512  1.00 42.63 ? 445  GLU A CB    1 
ATOM   2788 C CG    . GLU C 3 271 ? 1.197   -9.997  20.473  1.00 48.42 ? 445  GLU A CG    1 
ATOM   2789 C CD    . GLU C 3 271 ? -0.151  -9.971  19.724  1.00 55.59 ? 445  GLU A CD    1 
ATOM   2790 O OE1   . GLU C 3 271 ? -1.217  -9.976  20.394  1.00 60.20 ? 445  GLU A OE1   1 
ATOM   2791 O OE2   . GLU C 3 271 ? -0.144  -9.911  18.469  1.00 56.26 ? 445  GLU A OE2   1 
ATOM   2792 N N     . THR C 3 272 ? 1.592   -6.194  22.805  1.00 37.18 ? 446  THR A N     1 
ATOM   2793 C CA    . THR C 3 272 ? 1.457   -5.303  23.927  1.00 35.60 ? 446  THR A CA    1 
ATOM   2794 C C     . THR C 3 272 ? 0.782   -4.041  23.468  1.00 36.88 ? 446  THR A C     1 
ATOM   2795 O O     . THR C 3 272 ? -0.052  -3.489  24.182  1.00 38.26 ? 446  THR A O     1 
ATOM   2796 C CB    . THR C 3 272 ? 2.827   -4.923  24.473  1.00 38.97 ? 446  THR A CB    1 
ATOM   2797 O OG1   . THR C 3 272 ? 3.528   -6.092  24.898  1.00 40.46 ? 446  THR A OG1   1 
ATOM   2798 C CG2   . THR C 3 272 ? 2.688   -4.002  25.649  1.00 42.49 ? 446  THR A CG2   1 
ATOM   2799 N N     . ALA C 3 273 ? 1.152   -3.579  22.280  1.00 38.50 ? 447  ALA A N     1 
ATOM   2800 C CA    . ALA C 3 273 ? 0.580   -2.360  21.732  1.00 38.27 ? 447  ALA A CA    1 
ATOM   2801 C C     . ALA C 3 273 ? -0.885  -2.570  21.376  1.00 38.50 ? 447  ALA A C     1 
ATOM   2802 O O     . ALA C 3 273 ? -1.714  -1.668  21.530  1.00 33.89 ? 447  ALA A O     1 
ATOM   2803 C CB    . ALA C 3 273 ? 1.357   -1.922  20.514  1.00 36.21 ? 447  ALA A CB    1 
ATOM   2804 N N     . ARG C 3 274 ? -1.184  -3.750  20.862  1.00 38.14 ? 448  ARG A N     1 
ATOM   2805 C CA    . ARG C 3 274 ? -2.549  -4.054  20.493  1.00 45.08 ? 448  ARG A CA    1 
ATOM   2806 C C     . ARG C 3 274 ? -3.406  -4.014  21.733  1.00 47.86 ? 448  ARG A C     1 
ATOM   2807 O O     . ARG C 3 274 ? -4.555  -3.562  21.698  1.00 49.20 ? 448  ARG A O     1 
ATOM   2808 C CB    . ARG C 3 274 ? -2.636  -5.418  19.836  1.00 43.05 ? 448  ARG A CB    1 
ATOM   2809 C CG    . ARG C 3 274 ? -2.105  -5.401  18.424  1.00 45.36 ? 448  ARG A CG    1 
ATOM   2810 C CD    . ARG C 3 274 ? -2.174  -6.770  17.766  1.00 49.38 ? 448  ARG A CD    1 
ATOM   2811 N NE    . ARG C 3 274 ? -3.515  -7.110  17.288  1.00 46.78 ? 448  ARG A NE    1 
ATOM   2812 C CZ    . ARG C 3 274 ? -3.921  -8.343  17.024  1.00 48.80 ? 448  ARG A CZ    1 
ATOM   2813 N NH1   . ARG C 3 274 ? -3.103  -9.373  17.193  1.00 47.90 ? 448  ARG A NH1   1 
ATOM   2814 N NH2   . ARG C 3 274 ? -5.142  -8.546  16.553  1.00 50.89 ? 448  ARG A NH2   1 
ATOM   2815 N N     . ARG C 3 275 ? -2.840  -4.500  22.832  1.00 48.52 ? 449  ARG A N     1 
ATOM   2816 C CA    . ARG C 3 275 ? -3.557  -4.499  24.084  1.00 46.63 ? 449  ARG A CA    1 
ATOM   2817 C C     . ARG C 3 275 ? -3.787  -3.093  24.554  1.00 44.03 ? 449  ARG A C     1 
ATOM   2818 O O     . ARG C 3 275 ? -4.799  -2.789  25.149  1.00 48.24 ? 449  ARG A O     1 
ATOM   2819 C CB    . ARG C 3 275 ? -2.811  -5.313  25.124  1.00 51.15 ? 449  ARG A CB    1 
ATOM   2820 C CG    . ARG C 3 275 ? -2.903  -6.795  24.848  1.00 55.31 ? 449  ARG A CG    1 
ATOM   2821 C CD    . ARG C 3 275 ? -1.967  -7.608  25.733  1.00 63.92 ? 449  ARG A CD    1 
ATOM   2822 N NE    . ARG C 3 275 ? -1.854  -8.987  25.239  1.00 69.06 ? 449  ARG A NE    1 
ATOM   2823 C CZ    . ARG C 3 275 ? -0.710  -9.665  25.148  1.00 68.62 ? 449  ARG A CZ    1 
ATOM   2824 N NH1   . ARG C 3 275 ? 0.417   -9.096  25.524  1.00 66.42 ? 449  ARG A NH1   1 
ATOM   2825 N NH2   . ARG C 3 275 ? -0.692  -10.904 24.665  1.00 68.51 ? 449  ARG A NH2   1 
ATOM   2826 N N     . LEU C 3 276 ? -2.862  -2.205  24.258  1.00 43.34 ? 450  LEU A N     1 
ATOM   2827 C CA    . LEU C 3 276 ? -3.063  -0.845  24.693  1.00 45.52 ? 450  LEU A CA    1 
ATOM   2828 C C     . LEU C 3 276 ? -4.322  -0.339  24.042  1.00 48.94 ? 450  LEU A C     1 
ATOM   2829 O O     . LEU C 3 276 ? -5.160  0.273   24.699  1.00 52.97 ? 450  LEU A O     1 
ATOM   2830 C CB    . LEU C 3 276 ? -1.880  0.034   24.306  1.00 43.36 ? 450  LEU A CB    1 
ATOM   2831 C CG    . LEU C 3 276 ? -2.066  1.545   24.478  1.00 46.03 ? 450  LEU A CG    1 
ATOM   2832 C CD1   . LEU C 3 276 ? -2.645  1.853   25.854  1.00 41.27 ? 450  LEU A CD1   1 
ATOM   2833 C CD2   . LEU C 3 276 ? -0.754  2.291   24.246  1.00 43.36 ? 450  LEU A CD2   1 
ATOM   2834 N N     . LYS C 3 277 ? -4.463  -0.653  22.755  1.00 55.51 ? 451  LYS A N     1 
ATOM   2835 C CA    . LYS C 3 277 ? -5.610  -0.230  21.941  1.00 57.72 ? 451  LYS A CA    1 
ATOM   2836 C C     . LYS C 3 277 ? -6.961  -0.341  22.677  1.00 55.78 ? 451  LYS A C     1 
ATOM   2837 O O     . LYS C 3 277 ? -7.748  0.602   22.729  1.00 52.45 ? 451  LYS A O     1 
ATOM   2838 C CB    . LYS C 3 277 ? -5.639  -1.058  20.642  1.00 61.40 ? 451  LYS A CB    1 
ATOM   2839 C CG    . LYS C 3 277 ? -6.717  -0.651  19.652  1.00 68.38 ? 451  LYS A CG    1 
ATOM   2840 C CD    . LYS C 3 277 ? -6.994  -1.747  18.608  1.00 71.78 ? 451  LYS A CD    1 
ATOM   2841 C CE    . LYS C 3 277 ? -8.160  -1.368  17.663  1.00 67.58 ? 451  LYS A CE    1 
ATOM   2842 N NZ    . LYS C 3 277 ? -8.395  -2.365  16.550  1.00 67.78 ? 451  LYS A NZ    1 
ATOM   2843 N N     . LYS C 3 278 ? -7.183  -1.506  23.272  1.00 54.23 ? 452  LYS A N     1 
ATOM   2844 C CA    . LYS C 3 278 ? -8.407  -1.776  23.998  1.00 55.24 ? 452  LYS A CA    1 
ATOM   2845 C C     . LYS C 3 278 ? -8.549  -0.899  25.230  1.00 56.90 ? 452  LYS A C     1 
ATOM   2846 O O     . LYS C 3 278 ? -9.606  -0.296  25.478  1.00 60.40 ? 452  LYS A O     1 
ATOM   2847 C CB    . LYS C 3 278 ? -8.422  -3.248  24.409  1.00 56.69 ? 452  LYS A CB    1 
ATOM   2848 C CG    . LYS C 3 278 ? -8.130  -4.192  23.258  1.00 56.94 ? 452  LYS A CG    1 
ATOM   2849 C CD    . LYS C 3 278 ? -8.061  -5.634  23.718  1.00 57.27 ? 452  LYS A CD    1 
ATOM   2850 C CE    . LYS C 3 278 ? -7.774  -6.560  22.542  1.00 65.13 ? 452  LYS A CE    1 
ATOM   2851 N NZ    . LYS C 3 278 ? -7.627  -8.001  22.926  1.00 73.47 ? 452  LYS A NZ    1 
ATOM   2852 N N     . CYS C 3 279 ? -7.484  -0.839  26.020  1.00 55.53 ? 453  CYS A N     1 
ATOM   2853 C CA    . CYS C 3 279 ? -7.506  -0.062  27.238  1.00 55.46 ? 453  CYS A CA    1 
ATOM   2854 C C     . CYS C 3 279 ? -7.271  1.419   27.052  1.00 53.60 ? 453  CYS A C     1 
ATOM   2855 O O     . CYS C 3 279 ? -7.427  2.181   28.001  1.00 53.63 ? 453  CYS A O     1 
ATOM   2856 C CB    . CYS C 3 279 ? -6.471  -0.618  28.201  1.00 56.47 ? 453  CYS A CB    1 
ATOM   2857 S SG    . CYS C 3 279 ? -6.793  -2.329  28.616  1.00 72.44 ? 453  CYS A SG    1 
ATOM   2858 N N     . VAL C 3 280 ? -6.926  1.846   25.840  1.00 51.80 ? 454  VAL A N     1 
ATOM   2859 C CA    . VAL C 3 280 ? -6.642  3.260   25.656  1.00 55.08 ? 454  VAL A CA    1 
ATOM   2860 C C     . VAL C 3 280 ? -7.796  4.152   26.007  1.00 52.29 ? 454  VAL A C     1 
ATOM   2861 O O     . VAL C 3 280 ? -7.594  5.253   26.503  1.00 50.92 ? 454  VAL A O     1 
ATOM   2862 C CB    . VAL C 3 280 ? -6.192  3.629   24.238  1.00 57.15 ? 454  VAL A CB    1 
ATOM   2863 C CG1   . VAL C 3 280 ? -5.786  5.076   24.213  1.00 60.98 ? 454  VAL A CG1   1 
ATOM   2864 C CG2   . VAL C 3 280 ? -5.001  2.850   23.848  1.00 58.40 ? 454  VAL A CG2   1 
ATOM   2865 N N     . ASP C 3 281 ? -8.993  3.707   25.689  1.00 54.20 ? 455  ASP A N     1 
ATOM   2866 C CA    . ASP C 3 281 ? -10.155 4.517   25.995  1.00 59.28 ? 455  ASP A CA    1 
ATOM   2867 C C     . ASP C 3 281 ? -10.284 4.701   27.499  1.00 58.24 ? 455  ASP A C     1 
ATOM   2868 O O     . ASP C 3 281 ? -10.379 5.823   27.989  1.00 55.47 ? 455  ASP A O     1 
ATOM   2869 C CB    . ASP C 3 281 ? -11.393 3.879   25.389  1.00 69.29 ? 455  ASP A CB    1 
ATOM   2870 C CG    . ASP C 3 281 ? -11.472 4.108   23.878  1.00 78.10 ? 455  ASP A CG    1 
ATOM   2871 O OD1   . ASP C 3 281 ? -10.389 4.320   23.266  1.00 82.91 ? 455  ASP A OD1   1 
ATOM   2872 O OD2   . ASP C 3 281 ? -12.607 4.105   23.307  1.00 83.75 ? 455  ASP A OD2   1 
ATOM   2873 N N     . LYS C 3 282 ? -10.218 3.588   28.215  1.00 58.96 ? 456  LYS A N     1 
ATOM   2874 C CA    . LYS C 3 282 ? -10.291 3.579   29.675  1.00 57.37 ? 456  LYS A CA    1 
ATOM   2875 C C     . LYS C 3 282 ? -9.191  4.480   30.214  1.00 54.11 ? 456  LYS A C     1 
ATOM   2876 O O     . LYS C 3 282 ? -9.409  5.301   31.102  1.00 50.60 ? 456  LYS A O     1 
ATOM   2877 C CB    . LYS C 3 282 ? -10.069 2.149   30.186  1.00 61.59 ? 456  LYS A CB    1 
ATOM   2878 C CG    . LYS C 3 282 ? -9.827  2.055   31.676  1.00 68.33 ? 456  LYS A CG    1 
ATOM   2879 C CD    . LYS C 3 282 ? -8.654  1.135   31.975  1.00 74.25 ? 456  LYS A CD    1 
ATOM   2880 C CE    . LYS C 3 282 ? -8.142  1.361   33.398  1.00 75.15 ? 456  LYS A CE    1 
ATOM   2881 N NZ    . LYS C 3 282 ? -6.770  0.820   33.552  1.00 75.38 ? 456  LYS A NZ    1 
ATOM   2882 N N     . ILE C 3 283 ? -8.011  4.305   29.644  1.00 51.76 ? 457  ILE A N     1 
ATOM   2883 C CA    . ILE C 3 283 ? -6.842  5.062   30.040  1.00 51.97 ? 457  ILE A CA    1 
ATOM   2884 C C     . ILE C 3 283 ? -6.952  6.569   29.789  1.00 52.71 ? 457  ILE A C     1 
ATOM   2885 O O     . ILE C 3 283 ? -6.517  7.389   30.620  1.00 50.79 ? 457  ILE A O     1 
ATOM   2886 C CB    . ILE C 3 283 ? -5.597  4.520   29.334  1.00 53.91 ? 457  ILE A CB    1 
ATOM   2887 C CG1   . ILE C 3 283 ? -5.393  3.058   29.732  1.00 55.91 ? 457  ILE A CG1   1 
ATOM   2888 C CG2   . ILE C 3 283 ? -4.347  5.335   29.730  1.00 50.69 ? 457  ILE A CG2   1 
ATOM   2889 C CD1   . ILE C 3 283 ? -4.167  2.428   29.114  1.00 62.15 ? 457  ILE A CD1   1 
ATOM   2890 N N     . ARG C 3 284 ? -7.442  6.928   28.613  1.00 53.71 ? 458  ARG A N     1 
ATOM   2891 C CA    . ARG C 3 284 ? -7.587  8.335   28.257  1.00 54.25 ? 458  ARG A CA    1 
ATOM   2892 C C     . ARG C 3 284 ? -8.612  9.022   29.165  1.00 58.22 ? 458  ARG A C     1 
ATOM   2893 O O     . ARG C 3 284 ? -8.444  10.195  29.521  1.00 59.27 ? 458  ARG A O     1 
ATOM   2894 C CB    . ARG C 3 284 ? -7.989  8.477   26.782  1.00 52.98 ? 458  ARG A CB    1 
ATOM   2895 C CG    . ARG C 3 284 ? -6.908  8.053   25.784  1.00 53.16 ? 458  ARG A CG    1 
ATOM   2896 C CD    . ARG C 3 284 ? -7.403  8.118   24.328  1.00 51.49 ? 458  ARG A CD    1 
ATOM   2897 N NE    . ARG C 3 284 ? -6.302  7.930   23.380  1.00 50.10 ? 458  ARG A NE    1 
ATOM   2898 C CZ    . ARG C 3 284 ? -6.416  7.295   22.220  1.00 53.11 ? 458  ARG A CZ    1 
ATOM   2899 N NH1   . ARG C 3 284 ? -7.591  6.783   21.857  1.00 50.98 ? 458  ARG A NH1   1 
ATOM   2900 N NH2   . ARG C 3 284 ? -5.339  7.113   21.447  1.00 48.78 ? 458  ARG A NH2   1 
ATOM   2901 N N     . ASN C 3 285 ? -9.646  8.277   29.547  1.00 61.90 ? 459  ASN A N     1 
ATOM   2902 C CA    . ASN C 3 285 ? -10.720 8.777   30.413  1.00 63.59 ? 459  ASN A CA    1 
ATOM   2903 C C     . ASN C 3 285 ? -10.244 8.943   31.868  1.00 62.68 ? 459  ASN A C     1 
ATOM   2904 O O     . ASN C 3 285 ? -10.728 9.824   32.596  1.00 68.61 ? 459  ASN A O     1 
ATOM   2905 C CB    . ASN C 3 285 ? -11.955 7.855   30.315  1.00 62.45 ? 459  ASN A CB    1 
ATOM   2906 C CG    . ASN C 3 285 ? -12.593 7.840   28.908  1.00 62.34 ? 459  ASN A CG    1 
ATOM   2907 O OD1   . ASN C 3 285 ? -12.941 8.881   28.346  1.00 61.08 ? 459  ASN A OD1   1 
ATOM   2908 N ND2   . ASN C 3 285 ? -12.762 6.650   28.330  1.00 63.80 ? 459  ASN A ND2   1 
ATOM   2909 N N     . GLN C 3 286 ? -9.264  8.151   32.276  1.00 60.85 ? 460  GLN A N     1 
ATOM   2910 C CA    . GLN C 3 286 ? -8.744  8.246   33.635  1.00 58.70 ? 460  GLN A CA    1 
ATOM   2911 C C     . GLN C 3 286 ? -7.800  9.427   33.814  1.00 58.24 ? 460  GLN A C     1 
ATOM   2912 O O     . GLN C 3 286 ? -7.990  10.206  34.742  1.00 56.12 ? 460  GLN A O     1 
ATOM   2913 C CB    . GLN C 3 286 ? -8.017  7.004   34.007  1.00 62.95 ? 460  GLN A CB    1 
ATOM   2914 C CG    . GLN C 3 286 ? -7.516  6.981   35.462  1.00 75.17 ? 460  GLN A CG    1 
ATOM   2915 C CD    . GLN C 3 286 ? -6.773  5.685   35.812  1.00 82.46 ? 460  GLN A CD    1 
ATOM   2916 O OE1   . GLN C 3 286 ? -6.636  4.756   34.979  1.00 89.14 ? 460  GLN A OE1   1 
ATOM   2917 N NE2   . GLN C 3 286 ? -6.243  5.614   37.053  1.00 86.03 ? 460  GLN A NE2   1 
ATOM   2918 N N     . TYR C 3 287 ? -6.780  9.558   32.958  1.00 58.29 ? 461  TYR A N     1 
ATOM   2919 C CA    . TYR C 3 287 ? -5.846  10.687  33.064  1.00 56.61 ? 461  TYR A CA    1 
ATOM   2920 C C     . TYR C 3 287 ? -6.567  11.983  32.693  1.00 56.27 ? 461  TYR A C     1 
ATOM   2921 O O     . TYR C 3 287 ? -6.134  13.079  33.073  1.00 54.51 ? 461  TYR A O     1 
ATOM   2922 C CB    . TYR C 3 287 ? -4.533  10.471  32.253  1.00 52.90 ? 461  TYR A CB    1 
ATOM   2923 C CG    . TYR C 3 287 ? -4.559  10.656  30.732  1.00 52.63 ? 461  TYR A CG    1 
ATOM   2924 C CD1   . TYR C 3 287 ? -4.831  11.900  30.152  1.00 51.76 ? 461  TYR A CD1   1 
ATOM   2925 C CD2   . TYR C 3 287 ? -4.274  9.594   29.877  1.00 48.91 ? 461  TYR A CD2   1 
ATOM   2926 C CE1   . TYR C 3 287 ? -4.821  12.075  28.772  1.00 47.82 ? 461  TYR A CE1   1 
ATOM   2927 C CE2   . TYR C 3 287 ? -4.261  9.765   28.489  1.00 49.05 ? 461  TYR A CE2   1 
ATOM   2928 C CZ    . TYR C 3 287 ? -4.539  11.012  27.945  1.00 49.07 ? 461  TYR A CZ    1 
ATOM   2929 O OH    . TYR C 3 287 ? -4.529  11.191  26.579  1.00 43.64 ? 461  TYR A OH    1 
ATOM   2930 N N     . ARG C 3 288 ? -7.647  11.844  31.926  1.00 56.39 ? 462  ARG A N     1 
ATOM   2931 C CA    . ARG C 3 288 ? -8.446  13.001  31.544  1.00 57.82 ? 462  ARG A CA    1 
ATOM   2932 C C     . ARG C 3 288 ? -9.225  13.429  32.781  1.00 57.71 ? 462  ARG A C     1 
ATOM   2933 O O     . ARG C 3 288 ? -9.648  14.580  32.912  1.00 59.31 ? 462  ARG A O     1 
ATOM   2934 C CB    . ARG C 3 288 ? -9.361  12.692  30.353  1.00 58.09 ? 462  ARG A CB    1 
ATOM   2935 C CG    . ARG C 3 288 ? -8.778  13.208  29.039  1.00 58.60 ? 462  ARG A CG    1 
ATOM   2936 C CD    . ARG C 3 288 ? -9.713  13.052  27.888  1.00 59.82 ? 462  ARG A CD    1 
ATOM   2937 N NE    . ARG C 3 288 ? -9.415  14.034  26.855  1.00 63.43 ? 462  ARG A NE    1 
ATOM   2938 C CZ    . ARG C 3 288 ? -8.587  13.841  25.834  1.00 68.25 ? 462  ARG A CZ    1 
ATOM   2939 N NH1   . ARG C 3 288 ? -7.931  12.692  25.691  1.00 67.68 ? 462  ARG A NH1   1 
ATOM   2940 N NH2   . ARG C 3 288 ? -8.501  14.751  24.880  1.00 70.84 ? 462  ARG A NH2   1 
ATOM   2941 N N     . GLU C 3 289 ? -9.302  12.522  33.730  1.00 56.88 ? 463  GLU A N     1 
ATOM   2942 C CA    . GLU C 3 289 ? -9.982  12.783  34.978  1.00 58.22 ? 463  GLU A CA    1 
ATOM   2943 C C     . GLU C 3 289 ? -8.941  13.364  35.956  1.00 58.66 ? 463  GLU A C     1 
ATOM   2944 O O     . GLU C 3 289 ? -9.220  14.314  36.713  1.00 54.43 ? 463  GLU A O     1 
ATOM   2945 C CB    . GLU C 3 289 ? -10.576 11.470  35.508  1.00 58.83 ? 463  GLU A CB    1 
ATOM   2946 N N     . ASP C 3 290 ? -7.728  12.794  35.894  1.00 59.37 ? 464  ASP A N     1 
ATOM   2947 C CA    . ASP C 3 290 ? -6.601  13.185  36.749  1.00 57.91 ? 464  ASP A CA    1 
ATOM   2948 C C     . ASP C 3 290 ? -6.176  14.620  36.492  1.00 56.00 ? 464  ASP A C     1 
ATOM   2949 O O     . ASP C 3 290 ? -5.407  15.183  37.276  1.00 52.56 ? 464  ASP A O     1 
ATOM   2950 C CB    . ASP C 3 290 ? -5.384  12.271  36.529  1.00 61.81 ? 464  ASP A CB    1 
ATOM   2951 C CG    . ASP C 3 290 ? -5.669  10.795  36.832  1.00 66.09 ? 464  ASP A CG    1 
ATOM   2952 O OD1   . ASP C 3 290 ? -6.848  10.387  36.879  1.00 71.54 ? 464  ASP A OD1   1 
ATOM   2953 O OD2   . ASP C 3 290 ? -4.699  10.024  37.011  1.00 64.87 ? 464  ASP A OD2   1 
ATOM   2954 N N     . TRP C 3 291 ? -6.636  15.182  35.377  1.00 58.34 ? 465  TRP A N     1 
ATOM   2955 C CA    . TRP C 3 291 ? -6.330  16.569  35.005  1.00 62.22 ? 465  TRP A CA    1 
ATOM   2956 C C     . TRP C 3 291 ? -6.990  17.569  35.978  1.00 65.58 ? 465  TRP A C     1 
ATOM   2957 O O     . TRP C 3 291 ? -6.772  18.790  35.905  1.00 67.11 ? 465  TRP A O     1 
ATOM   2958 C CB    . TRP C 3 291 ? -6.796  16.855  33.567  1.00 59.40 ? 465  TRP A CB    1 
ATOM   2959 C CG    . TRP C 3 291 ? -5.972  16.216  32.473  1.00 58.11 ? 465  TRP A CG    1 
ATOM   2960 C CD1   . TRP C 3 291 ? -4.768  15.588  32.628  1.00 56.53 ? 465  TRP A CD1   1 
ATOM   2961 C CD2   . TRP C 3 291 ? -6.299  16.128  31.079  1.00 59.60 ? 465  TRP A CD2   1 
ATOM   2962 N NE1   . TRP C 3 291 ? -4.334  15.109  31.404  1.00 57.74 ? 465  TRP A NE1   1 
ATOM   2963 C CE2   . TRP C 3 291 ? -5.251  15.434  30.449  1.00 58.07 ? 465  TRP A CE2   1 
ATOM   2964 C CE3   . TRP C 3 291 ? -7.380  16.579  30.291  1.00 60.54 ? 465  TRP A CE3   1 
ATOM   2965 C CZ2   . TRP C 3 291 ? -5.254  15.157  29.065  1.00 56.24 ? 465  TRP A CZ2   1 
ATOM   2966 C CZ3   . TRP C 3 291 ? -7.383  16.306  28.909  1.00 55.82 ? 465  TRP A CZ3   1 
ATOM   2967 C CH2   . TRP C 3 291 ? -6.324  15.610  28.324  1.00 54.24 ? 465  TRP A CH2   1 
ATOM   2968 N N     . LYS C 3 292 ? -7.795  17.045  36.894  1.00 67.35 ? 466  LYS A N     1 
ATOM   2969 C CA    . LYS C 3 292 ? -8.495  17.884  37.858  1.00 70.52 ? 466  LYS A CA    1 
ATOM   2970 C C     . LYS C 3 292 ? -8.294  17.378  39.284  1.00 69.28 ? 466  LYS A C     1 
ATOM   2971 O O     . LYS C 3 292 ? -9.202  17.456  40.117  1.00 71.06 ? 466  LYS A O     1 
ATOM   2972 C CB    . LYS C 3 292 ? -9.991  17.931  37.511  1.00 70.35 ? 466  LYS A CB    1 
ATOM   2973 N N     . SER C 3 293 ? -7.092  16.914  39.576  1.00 67.41 ? 467  SER A N     1 
ATOM   2974 C CA    . SER C 3 293 ? -6.802  16.388  40.892  1.00 68.09 ? 467  SER A CA    1 
ATOM   2975 C C     . SER C 3 293 ? -6.247  17.415  41.863  1.00 68.48 ? 467  SER A C     1 
ATOM   2976 O O     . SER C 3 293 ? -5.711  18.454  41.464  1.00 69.53 ? 467  SER A O     1 
ATOM   2977 C CB    . SER C 3 293 ? -5.847  15.184  40.788  1.00 69.36 ? 467  SER A CB    1 
ATOM   2978 O OG    . SER C 3 293 ? -5.178  14.878  42.016  1.00 74.03 ? 467  SER A OG    1 
ATOM   2979 N N     . LYS C 3 294 ? -6.406  17.099  43.143  1.00 70.17 ? 468  LYS A N     1 
ATOM   2980 C CA    . LYS C 3 294 ? -5.935  17.897  44.251  1.00 67.02 ? 468  LYS A CA    1 
ATOM   2981 C C     . LYS C 3 294 ? -4.558  17.353  44.541  1.00 66.84 ? 468  LYS A C     1 
ATOM   2982 O O     . LYS C 3 294 ? -4.160  17.232  45.701  1.00 74.21 ? 468  LYS A O     1 
ATOM   2983 C CB    . LYS C 3 294 ? -6.840  17.688  45.462  1.00 67.92 ? 468  LYS A CB    1 
ATOM   2984 N N     . GLU C 3 295 ? -3.877  16.948  43.494  1.00 63.57 ? 469  GLU A N     1 
ATOM   2985 C CA    . GLU C 3 295 ? -2.548  16.422  43.631  1.00 63.76 ? 469  GLU A CA    1 
ATOM   2986 C C     . GLU C 3 295 ? -1.840  16.729  42.346  1.00 64.28 ? 469  GLU A C     1 
ATOM   2987 O O     . GLU C 3 295 ? -2.005  16.000  41.364  1.00 63.97 ? 469  GLU A O     1 
ATOM   2988 C CB    . GLU C 3 295 ? -2.574  14.921  43.908  1.00 62.19 ? 469  GLU A CB    1 
ATOM   2989 C CG    . GLU C 3 295 ? -2.171  14.607  45.348  1.00 66.42 ? 469  GLU A CG    1 
ATOM   2990 C CD    . GLU C 3 295 ? -1.761  13.169  45.576  1.00 67.27 ? 469  GLU A CD    1 
ATOM   2991 O OE1   . GLU C 3 295 ? -2.370  12.272  44.945  1.00 68.90 ? 469  GLU A OE1   1 
ATOM   2992 O OE2   . GLU C 3 295 ? -0.833  12.949  46.392  1.00 66.23 ? 469  GLU A OE2   1 
ATOM   2993 N N     . MET C 3 296 ? -1.143  17.862  42.341  1.00 65.67 ? 470  MET A N     1 
ATOM   2994 C CA    . MET C 3 296 ? -0.373  18.317  41.188  1.00 67.54 ? 470  MET A CA    1 
ATOM   2995 C C     . MET C 3 296 ? 0.339   17.097  40.608  1.00 67.53 ? 470  MET A C     1 
ATOM   2996 O O     . MET C 3 296 ? 0.436   16.975  39.396  1.00 68.54 ? 470  MET A O     1 
ATOM   2997 C CB    . MET C 3 296 ? 0.643   19.363  41.615  1.00 65.82 ? 470  MET A CB    1 
ATOM   2998 C CG    . MET C 3 296 ? 1.049   20.281  40.508  1.00 67.21 ? 470  MET A CG    1 
ATOM   2999 S SD    . MET C 3 296 ? 2.354   21.329  41.080  1.00 79.24 ? 470  MET A SD    1 
ATOM   3000 C CE    . MET C 3 296 ? 1.446   23.006  41.288  1.00 77.09 ? 470  MET A CE    1 
ATOM   3001 N N     . LYS C 3 297 ? 0.810   16.210  41.488  1.00 67.01 ? 471  LYS A N     1 
ATOM   3002 C CA    . LYS C 3 297 ? 1.468   14.942  41.115  1.00 65.29 ? 471  LYS A CA    1 
ATOM   3003 C C     . LYS C 3 297 ? 0.578   14.164  40.108  1.00 63.45 ? 471  LYS A C     1 
ATOM   3004 O O     . LYS C 3 297 ? 0.983   13.903  38.959  1.00 63.48 ? 471  LYS A O     1 
ATOM   3005 C CB    . LYS C 3 297 ? 1.691   14.082  42.364  1.00 61.77 ? 471  LYS A CB    1 
ATOM   3006 N N     . VAL C 3 298 ? -0.606  13.768  40.559  1.00 58.64 ? 472  VAL A N     1 
ATOM   3007 C CA    . VAL C 3 298 ? -1.565  13.060  39.719  1.00 56.16 ? 472  VAL A CA    1 
ATOM   3008 C C     . VAL C 3 298 ? -1.732  13.859  38.415  1.00 52.88 ? 472  VAL A C     1 
ATOM   3009 O O     . VAL C 3 298 ? -1.884  13.300  37.332  1.00 50.27 ? 472  VAL A O     1 
ATOM   3010 C CB    . VAL C 3 298 ? -2.942  12.957  40.453  1.00 54.66 ? 472  VAL A CB    1 
ATOM   3011 C CG1   . VAL C 3 298 ? -4.023  12.401  39.521  1.00 56.13 ? 472  VAL A CG1   1 
ATOM   3012 C CG2   . VAL C 3 298 ? -2.814  12.086  41.689  1.00 54.59 ? 472  VAL A CG2   1 
ATOM   3013 N N     . ARG C 3 299 ? -1.670  15.172  38.546  1.00 50.95 ? 473  ARG A N     1 
ATOM   3014 C CA    . ARG C 3 299 ? -1.842  16.064  37.426  1.00 51.87 ? 473  ARG A CA    1 
ATOM   3015 C C     . ARG C 3 299 ? -0.577  16.141  36.602  1.00 48.86 ? 473  ARG A C     1 
ATOM   3016 O O     . ARG C 3 299 ? -0.637  16.278  35.380  1.00 48.69 ? 473  ARG A O     1 
ATOM   3017 C CB    . ARG C 3 299 ? -2.255  17.472  37.898  1.00 56.17 ? 473  ARG A CB    1 
ATOM   3018 C CG    . ARG C 3 299 ? -3.683  17.592  38.489  1.00 58.43 ? 473  ARG A CG    1 
ATOM   3019 C CD    . ARG C 3 299 ? -4.177  19.027  38.391  1.00 58.33 ? 473  ARG A CD    1 
ATOM   3020 N NE    . ARG C 3 299 ? -5.543  19.190  38.880  1.00 64.56 ? 473  ARG A NE    1 
ATOM   3021 C CZ    . ARG C 3 299 ? -6.132  20.368  39.083  1.00 66.59 ? 473  ARG A CZ    1 
ATOM   3022 N NH1   . ARG C 3 299 ? -5.488  21.506  38.828  1.00 66.39 ? 473  ARG A NH1   1 
ATOM   3023 N NH2   . ARG C 3 299 ? -7.353  20.422  39.610  1.00 65.58 ? 473  ARG A NH2   1 
ATOM   3024 N N     . GLN C 3 300 ? 0.568   16.048  37.256  1.00 43.79 ? 474  GLN A N     1 
ATOM   3025 C CA    . GLN C 3 300 ? 1.819   16.139  36.535  1.00 40.04 ? 474  GLN A CA    1 
ATOM   3026 C C     . GLN C 3 300 ? 1.950   14.959  35.647  1.00 37.79 ? 474  GLN A C     1 
ATOM   3027 O O     . GLN C 3 300 ? 2.129   15.125  34.458  1.00 37.81 ? 474  GLN A O     1 
ATOM   3028 C CB    . GLN C 3 300 ? 3.019   16.320  37.464  1.00 42.10 ? 474  GLN A CB    1 
ATOM   3029 C CG    . GLN C 3 300 ? 2.994   17.687  38.117  1.00 46.77 ? 474  GLN A CG    1 
ATOM   3030 C CD    . GLN C 3 300 ? 4.326   18.226  38.469  1.00 48.72 ? 474  GLN A CD    1 
ATOM   3031 O OE1   . GLN C 3 300 ? 5.364   17.657  38.125  1.00 55.58 ? 474  GLN A OE1   1 
ATOM   3032 N NE2   . GLN C 3 300 ? 4.348   19.356  39.176  1.00 53.69 ? 474  GLN A NE2   1 
ATOM   3033 N N     . ARG C 3 301 ? 1.737   13.770  36.171  1.00 39.51 ? 475  ARG A N     1 
ATOM   3034 C CA    . ARG C 3 301 ? 1.857   12.615  35.308  1.00 42.77 ? 475  ARG A CA    1 
ATOM   3035 C C     . ARG C 3 301 ? 0.766   12.591  34.229  1.00 41.58 ? 475  ARG A C     1 
ATOM   3036 O O     . ARG C 3 301 ? 1.024   12.289  33.069  1.00 44.94 ? 475  ARG A O     1 
ATOM   3037 C CB    . ARG C 3 301 ? 1.881   11.307  36.107  1.00 42.01 ? 475  ARG A CB    1 
ATOM   3038 C CG    . ARG C 3 301 ? 0.593   10.965  36.770  1.00 50.27 ? 475  ARG A CG    1 
ATOM   3039 C CD    . ARG C 3 301 ? 0.502   9.476   37.087  1.00 51.49 ? 475  ARG A CD    1 
ATOM   3040 N NE    . ARG C 3 301 ? -0.845  9.118   37.535  1.00 55.86 ? 475  ARG A NE    1 
ATOM   3041 C CZ    . ARG C 3 301 ? -1.206  9.024   38.809  1.00 59.61 ? 475  ARG A CZ    1 
ATOM   3042 N NH1   . ARG C 3 301 ? -0.323  9.253   39.774  1.00 61.43 ? 475  ARG A NH1   1 
ATOM   3043 N NH2   . ARG C 3 301 ? -2.460  8.725   39.128  1.00 65.03 ? 475  ARG A NH2   1 
ATOM   3044 N N     . ALA C 3 302 ? -0.443  12.945  34.598  1.00 40.23 ? 476  ALA A N     1 
ATOM   3045 C CA    . ALA C 3 302 ? -1.524  12.921  33.639  1.00 43.38 ? 476  ALA A CA    1 
ATOM   3046 C C     . ALA C 3 302 ? -1.272  13.791  32.422  1.00 41.95 ? 476  ALA A C     1 
ATOM   3047 O O     . ALA C 3 302 ? -1.609  13.426  31.294  1.00 45.96 ? 476  ALA A O     1 
ATOM   3048 C CB    . ALA C 3 302 ? -2.789  13.335  34.306  1.00 47.55 ? 476  ALA A CB    1 
ATOM   3049 N N     . VAL C 3 303 ? -0.734  14.969  32.663  1.00 38.82 ? 477  VAL A N     1 
ATOM   3050 C CA    . VAL C 3 303 ? -0.471  15.888  31.578  1.00 40.06 ? 477  VAL A CA    1 
ATOM   3051 C C     . VAL C 3 303 ? 0.584   15.280  30.670  1.00 39.02 ? 477  VAL A C     1 
ATOM   3052 O O     . VAL C 3 303 ? 0.474   15.309  29.439  1.00 38.06 ? 477  VAL A O     1 
ATOM   3053 C CB    . VAL C 3 303 ? 0.005   17.238  32.125  1.00 39.93 ? 477  VAL A CB    1 
ATOM   3054 C CG1   . VAL C 3 303 ? 0.505   18.127  31.009  1.00 40.41 ? 477  VAL A CG1   1 
ATOM   3055 C CG2   . VAL C 3 303 ? -1.131  17.918  32.839  1.00 40.64 ? 477  VAL A CG2   1 
ATOM   3056 N N     . ALA C 3 304 ? 1.613   14.737  31.312  1.00 37.35 ? 478  ALA A N     1 
ATOM   3057 C CA    . ALA C 3 304 ? 2.720   14.111  30.615  1.00 36.03 ? 478  ALA A CA    1 
ATOM   3058 C C     . ALA C 3 304 ? 2.234   12.898  29.834  1.00 32.93 ? 478  ALA A C     1 
ATOM   3059 O O     . ALA C 3 304 ? 2.681   12.619  28.723  1.00 33.42 ? 478  ALA A O     1 
ATOM   3060 C CB    . ALA C 3 304 ? 3.805   13.711  31.625  1.00 32.80 ? 478  ALA A CB    1 
ATOM   3061 N N     . LEU C 3 305 ? 1.322   12.162  30.426  1.00 30.21 ? 479  LEU A N     1 
ATOM   3062 C CA    . LEU C 3 305 ? 0.773   11.011  29.773  1.00 31.61 ? 479  LEU A CA    1 
ATOM   3063 C C     . LEU C 3 305 ? 0.047   11.512  28.518  1.00 32.81 ? 479  LEU A C     1 
ATOM   3064 O O     . LEU C 3 305 ? 0.162   10.958  27.432  1.00 31.46 ? 479  LEU A O     1 
ATOM   3065 C CB    . LEU C 3 305 ? -0.159  10.336  30.752  1.00 32.82 ? 479  LEU A CB    1 
ATOM   3066 C CG    . LEU C 3 305 ? -0.834  9.035   30.358  1.00 37.71 ? 479  LEU A CG    1 
ATOM   3067 C CD1   . LEU C 3 305 ? 0.034   8.123   29.493  1.00 36.06 ? 479  LEU A CD1   1 
ATOM   3068 C CD2   . LEU C 3 305 ? -1.192  8.384   31.645  1.00 35.75 ? 479  LEU A CD2   1 
ATOM   3069 N N     . TYR C 3 306 ? -0.625  12.623  28.667  1.00 34.46 ? 480  TYR A N     1 
ATOM   3070 C CA    . TYR C 3 306 ? -1.339  13.237  27.577  1.00 38.56 ? 480  TYR A CA    1 
ATOM   3071 C C     . TYR C 3 306 ? -0.448  13.515  26.380  1.00 41.78 ? 480  TYR A C     1 
ATOM   3072 O O     . TYR C 3 306 ? -0.780  13.173  25.254  1.00 44.86 ? 480  TYR A O     1 
ATOM   3073 C CB    . TYR C 3 306 ? -1.888  14.550  28.078  1.00 38.59 ? 480  TYR A CB    1 
ATOM   3074 C CG    . TYR C 3 306 ? -2.525  15.391  27.026  1.00 44.92 ? 480  TYR A CG    1 
ATOM   3075 C CD1   . TYR C 3 306 ? -3.543  14.878  26.213  1.00 48.39 ? 480  TYR A CD1   1 
ATOM   3076 C CD2   . TYR C 3 306 ? -2.198  16.735  26.905  1.00 45.35 ? 480  TYR A CD2   1 
ATOM   3077 C CE1   . TYR C 3 306 ? -4.222  15.699  25.315  1.00 46.62 ? 480  TYR A CE1   1 
ATOM   3078 C CE2   . TYR C 3 306 ? -2.863  17.555  26.016  1.00 46.37 ? 480  TYR A CE2   1 
ATOM   3079 C CZ    . TYR C 3 306 ? -3.875  17.039  25.227  1.00 47.26 ? 480  TYR A CZ    1 
ATOM   3080 O OH    . TYR C 3 306 ? -4.554  17.874  24.364  1.00 53.72 ? 480  TYR A OH    1 
ATOM   3081 N N     . PHE C 3 307 ? 0.612   14.270  26.614  1.00 42.04 ? 481  PHE A N     1 
ATOM   3082 C CA    . PHE C 3 307 ? 1.538   14.622  25.557  1.00 43.69 ? 481  PHE A CA    1 
ATOM   3083 C C     . PHE C 3 307 ? 2.089   13.383  24.911  1.00 42.20 ? 481  PHE A C     1 
ATOM   3084 O O     . PHE C 3 307 ? 2.215   13.299  23.695  1.00 44.93 ? 481  PHE A O     1 
ATOM   3085 C CB    . PHE C 3 307 ? 2.696   15.437  26.110  1.00 45.07 ? 481  PHE A CB    1 
ATOM   3086 C CG    . PHE C 3 307 ? 2.290   16.789  26.583  1.00 51.27 ? 481  PHE A CG    1 
ATOM   3087 C CD1   . PHE C 3 307 ? 1.100   17.359  26.144  1.00 50.27 ? 481  PHE A CD1   1 
ATOM   3088 C CD2   . PHE C 3 307 ? 3.091   17.498  27.469  1.00 49.07 ? 481  PHE A CD2   1 
ATOM   3089 C CE1   . PHE C 3 307 ? 0.703   18.596  26.593  1.00 52.70 ? 481  PHE A CE1   1 
ATOM   3090 C CE2   . PHE C 3 307 ? 2.702   18.745  27.925  1.00 50.38 ? 481  PHE A CE2   1 
ATOM   3091 C CZ    . PHE C 3 307 ? 1.505   19.302  27.481  1.00 53.81 ? 481  PHE A CZ    1 
ATOM   3092 N N     . ILE C 3 308 ? 2.461   12.431  25.745  1.00 40.04 ? 482  ILE A N     1 
ATOM   3093 C CA    . ILE C 3 308 ? 3.017   11.196  25.239  1.00 42.95 ? 482  ILE A CA    1 
ATOM   3094 C C     . ILE C 3 308 ? 1.992   10.556  24.322  1.00 43.28 ? 482  ILE A C     1 
ATOM   3095 O O     . ILE C 3 308 ? 2.271   10.273  23.170  1.00 44.08 ? 482  ILE A O     1 
ATOM   3096 C CB    . ILE C 3 308 ? 3.413   10.262  26.404  1.00 40.56 ? 482  ILE A CB    1 
ATOM   3097 C CG1   . ILE C 3 308 ? 4.645   10.841  27.119  1.00 43.24 ? 482  ILE A CG1   1 
ATOM   3098 C CG2   . ILE C 3 308 ? 3.659   8.855   25.902  1.00 41.21 ? 482  ILE A CG2   1 
ATOM   3099 C CD1   . ILE C 3 308 ? 5.080   10.103  28.378  1.00 40.74 ? 482  ILE A CD1   1 
ATOM   3100 N N     . ASP C 3 309 ? 0.778   10.408  24.827  1.00 43.17 ? 483  ASP A N     1 
ATOM   3101 C CA    . ASP C 3 309 ? -0.282  9.800   24.053  1.00 45.95 ? 483  ASP A CA    1 
ATOM   3102 C C     . ASP C 3 309 ? -0.566  10.613  22.801  1.00 46.68 ? 483  ASP A C     1 
ATOM   3103 O O     . ASP C 3 309 ? -0.403  10.120  21.685  1.00 48.22 ? 483  ASP A O     1 
ATOM   3104 C CB    . ASP C 3 309 ? -1.544  9.671   24.922  1.00 50.10 ? 483  ASP A CB    1 
ATOM   3105 C CG    . ASP C 3 309 ? -2.751  9.100   24.164  1.00 52.48 ? 483  ASP A CG    1 
ATOM   3106 O OD1   . ASP C 3 309 ? -2.577  8.342   23.174  1.00 49.06 ? 483  ASP A OD1   1 
ATOM   3107 O OD2   . ASP C 3 309 ? -3.887  9.415   24.587  1.00 53.46 ? 483  ASP A OD2   1 
ATOM   3108 N N     . LYS C 3 310 ? -0.933  11.870  23.002  1.00 46.53 ? 484  LYS A N     1 
ATOM   3109 C CA    . LYS C 3 310 ? -1.285  12.765  21.917  1.00 48.22 ? 484  LYS A CA    1 
ATOM   3110 C C     . LYS C 3 310 ? -0.171  13.142  20.953  1.00 46.87 ? 484  LYS A C     1 
ATOM   3111 O O     . LYS C 3 310 ? -0.369  13.111  19.751  1.00 47.46 ? 484  LYS A O     1 
ATOM   3112 C CB    . LYS C 3 310 ? -1.922  14.039  22.484  1.00 48.34 ? 484  LYS A CB    1 
ATOM   3113 N N     . LEU C 3 311 ? 0.975   13.552  21.489  1.00 43.79 ? 485  LEU A N     1 
ATOM   3114 C CA    . LEU C 3 311 ? 2.088   13.976  20.659  1.00 40.44 ? 485  LEU A CA    1 
ATOM   3115 C C     . LEU C 3 311 ? 3.173   12.946  20.475  1.00 43.09 ? 485  LEU A C     1 
ATOM   3116 O O     . LEU C 3 311 ? 4.158   13.179  19.762  1.00 45.08 ? 485  LEU A O     1 
ATOM   3117 C CB    . LEU C 3 311 ? 2.699   15.229  21.242  1.00 41.81 ? 485  LEU A CB    1 
ATOM   3118 C CG    . LEU C 3 311 ? 1.630   16.289  21.407  1.00 45.20 ? 485  LEU A CG    1 
ATOM   3119 C CD1   . LEU C 3 311 ? 2.213   17.434  22.134  1.00 48.83 ? 485  LEU A CD1   1 
ATOM   3120 C CD2   . LEU C 3 311 ? 1.105   16.715  20.065  1.00 46.20 ? 485  LEU A CD2   1 
ATOM   3121 N N     . ALA C 3 312 ? 3.049   11.826  21.170  1.00 41.17 ? 486  ALA A N     1 
ATOM   3122 C CA    . ALA C 3 312 ? 4.053   10.772  21.052  1.00 40.95 ? 486  ALA A CA    1 
ATOM   3123 C C     . ALA C 3 312 ? 5.454   11.167  21.495  1.00 41.84 ? 486  ALA A C     1 
ATOM   3124 O O     . ALA C 3 312 ? 6.438   10.671  20.949  1.00 39.57 ? 486  ALA A O     1 
ATOM   3125 C CB    . ALA C 3 312 ? 4.099   10.265  19.657  1.00 41.23 ? 486  ALA A CB    1 
ATOM   3126 N N     . LEU C 3 313 ? 5.545   12.073  22.455  1.00 36.16 ? 487  LEU A N     1 
ATOM   3127 C CA    . LEU C 3 313 ? 6.836   12.447  22.965  1.00 31.47 ? 487  LEU A CA    1 
ATOM   3128 C C     . LEU C 3 313 ? 7.343   11.205  23.670  1.00 34.14 ? 487  LEU A C     1 
ATOM   3129 O O     . LEU C 3 313 ? 6.549   10.375  24.135  1.00 33.04 ? 487  LEU A O     1 
ATOM   3130 C CB    . LEU C 3 313 ? 6.701   13.532  24.007  1.00 27.48 ? 487  LEU A CB    1 
ATOM   3131 C CG    . LEU C 3 313 ? 6.024   14.840  23.640  1.00 28.38 ? 487  LEU A CG    1 
ATOM   3132 C CD1   . LEU C 3 313 ? 6.209   15.764  24.808  1.00 26.14 ? 487  LEU A CD1   1 
ATOM   3133 C CD2   . LEU C 3 313 ? 6.612   15.433  22.382  1.00 26.85 ? 487  LEU A CD2   1 
ATOM   3134 N N     . ARG C 3 314 ? 8.664   11.090  23.758  1.00 36.96 ? 488  ARG A N     1 
ATOM   3135 C CA    . ARG C 3 314 ? 9.350   9.981   24.432  1.00 38.33 ? 488  ARG A CA    1 
ATOM   3136 C C     . ARG C 3 314 ? 9.337   10.182  25.941  1.00 35.57 ? 488  ARG A C     1 
ATOM   3137 O O     . ARG C 3 314 ? 9.218   11.316  26.434  1.00 38.10 ? 488  ARG A O     1 
ATOM   3138 C CB    . ARG C 3 314 ? 10.795  9.843   23.911  1.00 40.21 ? 488  ARG A CB    1 
ATOM   3139 C CG    . ARG C 3 314 ? 10.888  8.955   22.669  1.00 43.48 ? 488  ARG A CG    1 
ATOM   3140 C CD    . ARG C 3 314 ? 12.307  8.814   22.103  1.00 47.31 ? 488  ARG A CD    1 
ATOM   3141 N NE    . ARG C 3 314 ? 12.613  9.868   21.135  1.00 51.98 ? 488  ARG A NE    1 
ATOM   3142 C CZ    . ARG C 3 314 ? 12.851  9.677   19.842  1.00 45.31 ? 488  ARG A CZ    1 
ATOM   3143 N NH1   . ARG C 3 314 ? 12.830  8.466   19.310  1.00 49.68 ? 488  ARG A NH1   1 
ATOM   3144 N NH2   . ARG C 3 314 ? 13.120  10.714  19.075  1.00 44.69 ? 488  ARG A NH2   1 
ATOM   3145 N N     . ALA C 3 315 ? 9.437   9.089   26.687  1.00 30.72 ? 489  ALA A N     1 
ATOM   3146 C CA    . ALA C 3 315 ? 9.391   9.157   28.139  1.00 31.29 ? 489  ALA A CA    1 
ATOM   3147 C C     . ALA C 3 315 ? 10.251  10.264  28.760  1.00 31.70 ? 489  ALA A C     1 
ATOM   3148 O O     . ALA C 3 315 ? 9.776   11.019  29.585  1.00 35.23 ? 489  ALA A O     1 
ATOM   3149 C CB    . ALA C 3 315 ? 9.716   7.791   28.758  1.00 28.36 ? 489  ALA A CB    1 
ATOM   3150 N N     . GLY C 3 316 ? 11.497  10.382  28.331  1.00 30.41 ? 490  GLY A N     1 
ATOM   3151 C CA    . GLY C 3 316 ? 12.357  11.402  28.890  1.00 23.53 ? 490  GLY A CA    1 
ATOM   3152 C C     . GLY C 3 316 ? 13.039  11.073  30.220  1.00 28.80 ? 490  GLY A C     1 
ATOM   3153 O O     . GLY C 3 316 ? 12.686  11.635  31.243  1.00 30.51 ? 490  GLY A O     1 
ATOM   3154 N N     . ASN C 3 317 ? 13.934  10.090  30.212  1.00 28.33 ? 491  ASN A N     1 
ATOM   3155 C CA    . ASN C 3 317 ? 14.733  9.708   31.379  1.00 30.07 ? 491  ASN A CA    1 
ATOM   3156 C C     . ASN C 3 317 ? 15.827  10.740  31.649  1.00 34.68 ? 491  ASN A C     1 
ATOM   3157 O O     . ASN C 3 317 ? 16.536  11.176  30.752  1.00 35.62 ? 491  ASN A O     1 
ATOM   3158 C CB    . ASN C 3 317 ? 15.467  8.408   31.110  1.00 30.99 ? 491  ASN A CB    1 
ATOM   3159 C CG    . ASN C 3 317 ? 14.574  7.230   31.160  1.00 38.25 ? 491  ASN A CG    1 
ATOM   3160 O OD1   . ASN C 3 317 ? 14.414  6.640   32.218  1.00 37.24 ? 491  ASN A OD1   1 
ATOM   3161 N ND2   . ASN C 3 317 ? 13.980  6.863   30.007  1.00 33.19 ? 491  ASN A ND2   1 
ATOM   3162 N N     . GLU C 3 318 ? 16.053  11.027  32.916  1.00 30.84 ? 492  GLU A N     1 
ATOM   3163 C CA    . GLU C 3 318 ? 17.067  11.984  33.284  1.00 32.17 ? 492  GLU A CA    1 
ATOM   3164 C C     . GLU C 3 318 ? 18.455  11.534  32.864  1.00 30.24 ? 492  GLU A C     1 
ATOM   3165 O O     . GLU C 3 318 ? 18.822  10.397  33.062  1.00 30.75 ? 492  GLU A O     1 
ATOM   3166 C CB    . GLU C 3 318 ? 17.010  12.217  34.789  1.00 38.61 ? 492  GLU A CB    1 
ATOM   3167 C CG    . GLU C 3 318 ? 18.066  13.157  35.336  1.00 47.38 ? 492  GLU A CG    1 
ATOM   3168 C CD    . GLU C 3 318 ? 17.793  13.570  36.790  1.00 53.86 ? 492  GLU A CD    1 
ATOM   3169 O OE1   . GLU C 3 318 ? 17.768  12.692  37.674  1.00 54.88 ? 492  GLU A OE1   1 
ATOM   3170 O OE2   . GLU C 3 318 ? 17.607  14.780  37.061  1.00 57.98 ? 492  GLU A OE2   1 
ATOM   3171 N N     . LYS C 3 319 ? 19.251  12.475  32.364  1.00 34.30 ? 493  LYS A N     1 
ATOM   3172 C CA    . LYS C 3 319 ? 20.618  12.231  31.901  1.00 31.82 ? 493  LYS A CA    1 
ATOM   3173 C C     . LYS C 3 319 ? 21.613  12.964  32.786  1.00 37.59 ? 493  LYS A C     1 
ATOM   3174 O O     . LYS C 3 319 ? 21.309  14.013  33.348  1.00 36.58 ? 493  LYS A O     1 
ATOM   3175 C CB    . LYS C 3 319 ? 20.760  12.725  30.474  1.00 31.88 ? 493  LYS A CB    1 
ATOM   3176 C CG    . LYS C 3 319 ? 19.790  12.071  29.506  1.00 34.61 ? 493  LYS A CG    1 
ATOM   3177 C CD    . LYS C 3 319 ? 19.951  12.628  28.101  1.00 42.89 ? 493  LYS A CD    1 
ATOM   3178 C CE    . LYS C 3 319 ? 21.405  12.579  27.606  1.00 41.71 ? 493  LYS A CE    1 
ATOM   3179 N NZ    . LYS C 3 319 ? 21.580  12.816  26.116  1.00 46.86 ? 493  LYS A NZ    1 
ATOM   3180 N N     . GLU C 3 320 ? 22.812  12.406  32.900  1.00 44.11 ? 494  GLU A N     1 
ATOM   3181 C CA    . GLU C 3 320 ? 23.890  12.940  33.734  1.00 48.09 ? 494  GLU A CA    1 
ATOM   3182 C C     . GLU C 3 320 ? 24.403  14.317  33.379  1.00 48.61 ? 494  GLU A C     1 
ATOM   3183 O O     . GLU C 3 320 ? 25.267  14.493  32.515  1.00 46.57 ? 494  GLU A O     1 
ATOM   3184 C CB    . GLU C 3 320 ? 25.075  11.991  33.762  1.00 53.54 ? 494  GLU A CB    1 
ATOM   3185 C CG    . GLU C 3 320 ? 26.158  12.440  34.720  1.00 67.09 ? 494  GLU A CG    1 
ATOM   3186 C CD    . GLU C 3 320 ? 25.950  11.921  36.127  1.00 74.12 ? 494  GLU A CD    1 
ATOM   3187 O OE1   . GLU C 3 320 ? 25.460  10.773  36.255  1.00 82.10 ? 494  GLU A OE1   1 
ATOM   3188 O OE2   . GLU C 3 320 ? 26.296  12.635  37.099  1.00 77.75 ? 494  GLU A OE2   1 
ATOM   3189 N N     . GLU C 3 321 ? 23.999  15.240  34.232  1.00 49.80 ? 495  GLU A N     1 
ATOM   3190 C CA    . GLU C 3 321 ? 24.328  16.648  34.128  1.00 49.93 ? 495  GLU A CA    1 
ATOM   3191 C C     . GLU C 3 321 ? 25.831  16.871  34.080  1.00 49.12 ? 495  GLU A C     1 
ATOM   3192 O O     . GLU C 3 321 ? 26.507  16.845  35.090  1.00 50.56 ? 495  GLU A O     1 
ATOM   3193 C CB    . GLU C 3 321 ? 23.739  17.344  35.336  1.00 54.06 ? 495  GLU A CB    1 
ATOM   3194 C CG    . GLU C 3 321 ? 22.449  16.687  35.785  1.00 61.76 ? 495  GLU A CG    1 
ATOM   3195 C CD    . GLU C 3 321 ? 22.492  16.277  37.226  1.00 66.64 ? 495  GLU A CD    1 
ATOM   3196 O OE1   . GLU C 3 321 ? 23.000  15.166  37.493  1.00 69.71 ? 495  GLU A OE1   1 
ATOM   3197 O OE2   . GLU C 3 321 ? 22.022  17.063  38.088  1.00 69.72 ? 495  GLU A OE2   1 
ATOM   3198 N N     . GLY C 3 322 ? 26.362  17.072  32.885  1.00 48.20 ? 496  GLY A N     1 
ATOM   3199 C CA    . GLY C 3 322 ? 27.788  17.310  32.783  1.00 48.13 ? 496  GLY A CA    1 
ATOM   3200 C C     . GLY C 3 322 ? 28.549  16.169  32.146  1.00 51.15 ? 496  GLY A C     1 
ATOM   3201 O O     . GLY C 3 322 ? 29.712  16.317  31.792  1.00 50.49 ? 496  GLY A O     1 
ATOM   3202 N N     . GLU C 3 323 ? 27.892  15.025  31.947  1.00 47.12 ? 497  GLU A N     1 
ATOM   3203 C CA    . GLU C 3 323 ? 28.570  13.892  31.354  1.00 42.08 ? 497  GLU A CA    1 
ATOM   3204 C C     . GLU C 3 323 ? 27.975  13.513  30.014  1.00 37.06 ? 497  GLU A C     1 
ATOM   3205 O O     . GLU C 3 323 ? 28.560  12.731  29.275  1.00 35.11 ? 497  GLU A O     1 
ATOM   3206 C CB    . GLU C 3 323 ? 28.523  12.702  32.302  1.00 51.96 ? 497  GLU A CB    1 
ATOM   3207 C CG    . GLU C 3 323 ? 29.133  12.992  33.682  1.00 66.78 ? 497  GLU A CG    1 
ATOM   3208 C CD    . GLU C 3 323 ? 30.380  12.149  34.008  1.00 75.61 ? 497  GLU A CD    1 
ATOM   3209 O OE1   . GLU C 3 323 ? 30.818  11.318  33.164  1.00 82.70 ? 497  GLU A OE1   1 
ATOM   3210 O OE2   . GLU C 3 323 ? 30.926  12.320  35.132  1.00 80.25 ? 497  GLU A OE2   1 
ATOM   3211 N N     . THR C 3 324 ? 26.856  14.108  29.688  1.00 32.42 ? 498  THR A N     1 
ATOM   3212 C CA    . THR C 3 324 ? 26.179  13.806  28.432  1.00 35.41 ? 498  THR A CA    1 
ATOM   3213 C C     . THR C 3 324 ? 25.722  15.072  27.696  1.00 38.30 ? 498  THR A C     1 
ATOM   3214 O O     . THR C 3 324 ? 26.015  16.191  28.119  1.00 38.27 ? 498  THR A O     1 
ATOM   3215 C CB    . THR C 3 324 ? 24.967  12.918  28.703  1.00 34.07 ? 498  THR A CB    1 
ATOM   3216 O OG1   . THR C 3 324 ? 24.117  13.565  29.653  1.00 30.50 ? 498  THR A OG1   1 
ATOM   3217 C CG2   . THR C 3 324 ? 25.405  11.599  29.293  1.00 29.33 ? 498  THR A CG2   1 
ATOM   3218 N N     . ALA C 3 325 ? 25.132  14.883  26.523  1.00 34.79 ? 499  ALA A N     1 
ATOM   3219 C CA    . ALA C 3 325 ? 24.619  15.986  25.744  1.00 37.78 ? 499  ALA A CA    1 
ATOM   3220 C C     . ALA C 3 325 ? 23.166  16.171  26.180  1.00 38.88 ? 499  ALA A C     1 
ATOM   3221 O O     . ALA C 3 325 ? 22.354  15.249  26.115  1.00 40.40 ? 499  ALA A O     1 
ATOM   3222 C CB    . ALA C 3 325 ? 24.704  15.674  24.276  1.00 38.55 ? 499  ALA A CB    1 
ATOM   3223 N N     . ASP C 3 326 ? 22.833  17.382  26.585  1.00 41.19 ? 500  ASP A N     1 
ATOM   3224 C CA    . ASP C 3 326 ? 21.504  17.699  27.068  1.00 43.25 ? 500  ASP A CA    1 
ATOM   3225 C C     . ASP C 3 326 ? 20.357  17.622  26.059  1.00 43.56 ? 500  ASP A C     1 
ATOM   3226 O O     . ASP C 3 326 ? 20.146  18.520  25.262  1.00 44.79 ? 500  ASP A O     1 
ATOM   3227 C CB    . ASP C 3 326 ? 21.560  19.082  27.735  1.00 49.31 ? 500  ASP A CB    1 
ATOM   3228 C CG    . ASP C 3 326 ? 20.215  19.550  28.314  1.00 53.43 ? 500  ASP A CG    1 
ATOM   3229 O OD1   . ASP C 3 326 ? 19.299  18.743  28.604  1.00 53.65 ? 500  ASP A OD1   1 
ATOM   3230 O OD2   . ASP C 3 326 ? 20.097  20.775  28.506  1.00 56.62 ? 500  ASP A OD2   1 
ATOM   3231 N N     . THR C 3 327 ? 19.621  16.519  26.091  1.00 44.36 ? 501  THR A N     1 
ATOM   3232 C CA    . THR C 3 327 ? 18.438  16.356  25.248  1.00 42.34 ? 501  THR A CA    1 
ATOM   3233 C C     . THR C 3 327 ? 17.357  15.944  26.233  1.00 41.93 ? 501  THR A C     1 
ATOM   3234 O O     . THR C 3 327 ? 17.668  15.475  27.327  1.00 40.55 ? 501  THR A O     1 
ATOM   3235 C CB    . THR C 3 327 ? 18.594  15.276  24.166  1.00 44.55 ? 501  THR A CB    1 
ATOM   3236 O OG1   . THR C 3 327 ? 19.041  14.042  24.746  1.00 44.33 ? 501  THR A OG1   1 
ATOM   3237 C CG2   . THR C 3 327 ? 19.573  15.726  23.136  1.00 45.09 ? 501  THR A CG2   1 
ATOM   3238 N N     . VAL C 3 328 ? 16.098  16.193  25.910  1.00 36.26 ? 502  VAL A N     1 
ATOM   3239 C CA    . VAL C 3 328 ? 15.059  15.817  26.849  1.00 35.30 ? 502  VAL A CA    1 
ATOM   3240 C C     . VAL C 3 328 ? 13.891  15.105  26.188  1.00 36.75 ? 502  VAL A C     1 
ATOM   3241 O O     . VAL C 3 328 ? 13.683  15.223  24.971  1.00 32.77 ? 502  VAL A O     1 
ATOM   3242 C CB    . VAL C 3 328 ? 14.505  17.048  27.598  1.00 38.37 ? 502  VAL A CB    1 
ATOM   3243 C CG1   . VAL C 3 328 ? 15.583  17.685  28.440  1.00 35.05 ? 502  VAL A CG1   1 
ATOM   3244 C CG2   . VAL C 3 328 ? 13.937  18.049  26.603  1.00 37.75 ? 502  VAL A CG2   1 
ATOM   3245 N N     . GLY C 3 329 ? 13.061  14.513  27.043  1.00 37.95 ? 503  GLY A N     1 
ATOM   3246 C CA    . GLY C 3 329 ? 11.873  13.791  26.637  1.00 34.38 ? 503  GLY A CA    1 
ATOM   3247 C C     . GLY C 3 329 ? 10.750  14.269  27.539  1.00 34.37 ? 503  GLY A C     1 
ATOM   3248 O O     . GLY C 3 329 ? 10.964  15.083  28.426  1.00 33.01 ? 503  GLY A O     1 
ATOM   3249 N N     . CYS C 3 330 ? 9.562   13.736  27.353  1.00 30.60 ? 504  CYS A N     1 
ATOM   3250 C CA    . CYS C 3 330 ? 8.453   14.191  28.135  1.00 29.45 ? 504  CYS A CA    1 
ATOM   3251 C C     . CYS C 3 330 ? 8.696   14.430  29.633  1.00 30.40 ? 504  CYS A C     1 
ATOM   3252 O O     . CYS C 3 330 ? 8.617   15.554  30.117  1.00 34.03 ? 504  CYS A O     1 
ATOM   3253 C CB    . CYS C 3 330 ? 7.263   13.269  27.930  1.00 30.15 ? 504  CYS A CB    1 
ATOM   3254 S SG    . CYS C 3 330 ? 5.760   13.967  28.641  1.00 36.10 ? 504  CYS A SG    1 
ATOM   3255 N N     . CYS C 3 331 ? 8.992   13.378  30.367  1.00 28.82 ? 505  CYS A N     1 
ATOM   3256 C CA    . CYS C 3 331 ? 9.175   13.499  31.799  1.00 29.39 ? 505  CYS A CA    1 
ATOM   3257 C C     . CYS C 3 331 ? 10.245  14.437  32.209  1.00 36.16 ? 505  CYS A C     1 
ATOM   3258 O O     . CYS C 3 331 ? 10.203  14.942  33.322  1.00 38.75 ? 505  CYS A O     1 
ATOM   3259 C CB    . CYS C 3 331 ? 9.477   12.156  32.425  1.00 31.77 ? 505  CYS A CB    1 
ATOM   3260 S SG    . CYS C 3 331 ? 8.074   11.057  32.456  1.00 39.64 ? 505  CYS A SG    1 
ATOM   3261 N N     . SER C 3 332 ? 11.222  14.650  31.344  1.00 36.33 ? 506  SER A N     1 
ATOM   3262 C CA    . SER C 3 332 ? 12.335  15.513  31.705  1.00 37.12 ? 506  SER A CA    1 
ATOM   3263 C C     . SER C 3 332 ? 12.237  16.939  31.160  1.00 38.66 ? 506  SER A C     1 
ATOM   3264 O O     . SER C 3 332 ? 13.182  17.730  31.295  1.00 38.71 ? 506  SER A O     1 
ATOM   3265 C CB    . SER C 3 332 ? 13.655  14.850  31.286  1.00 35.36 ? 506  SER A CB    1 
ATOM   3266 O OG    . SER C 3 332 ? 13.634  14.544  29.903  1.00 33.51 ? 506  SER A OG    1 
ATOM   3267 N N     . LEU C 3 333 ? 11.120  17.274  30.523  1.00 38.45 ? 507  LEU A N     1 
ATOM   3268 C CA    . LEU C 3 333 ? 10.955  18.616  29.979  1.00 36.36 ? 507  LEU A CA    1 
ATOM   3269 C C     . LEU C 3 333 ? 11.202  19.677  31.037  1.00 38.95 ? 507  LEU A C     1 
ATOM   3270 O O     . LEU C 3 333 ? 10.856  19.510  32.201  1.00 35.73 ? 507  LEU A O     1 
ATOM   3271 C CB    . LEU C 3 333 ? 9.544   18.824  29.465  1.00 34.42 ? 507  LEU A CB    1 
ATOM   3272 C CG    . LEU C 3 333 ? 9.127   18.192  28.148  1.00 35.41 ? 507  LEU A CG    1 
ATOM   3273 C CD1   . LEU C 3 333 ? 7.639   18.393  28.025  1.00 33.39 ? 507  LEU A CD1   1 
ATOM   3274 C CD2   . LEU C 3 333 ? 9.874   18.802  26.958  1.00 33.31 ? 507  LEU A CD2   1 
ATOM   3275 N N     . ARG C 3 334 ? 11.776  20.795  30.609  1.00 41.96 ? 508  ARG A N     1 
ATOM   3276 C CA    . ARG C 3 334 ? 12.021  21.898  31.523  1.00 45.25 ? 508  ARG A CA    1 
ATOM   3277 C C     . ARG C 3 334 ? 11.166  23.100  31.123  1.00 44.91 ? 508  ARG A C     1 
ATOM   3278 O O     . ARG C 3 334 ? 10.744  23.241  29.962  1.00 42.18 ? 508  ARG A O     1 
ATOM   3279 C CB    . ARG C 3 334 ? 13.515  22.267  31.597  1.00 45.00 ? 508  ARG A CB    1 
ATOM   3280 C CG    . ARG C 3 334 ? 14.383  21.193  32.252  1.00 45.08 ? 508  ARG A CG    1 
ATOM   3281 C CD    . ARG C 3 334 ? 15.838  21.621  32.420  1.00 47.19 ? 508  ARG A CD    1 
ATOM   3282 N NE    . ARG C 3 334 ? 16.486  22.057  31.178  1.00 45.49 ? 508  ARG A NE    1 
ATOM   3283 C CZ    . ARG C 3 334 ? 17.408  21.367  30.499  1.00 46.47 ? 508  ARG A CZ    1 
ATOM   3284 N NH1   . ARG C 3 334 ? 17.822  20.173  30.912  1.00 42.18 ? 508  ARG A NH1   1 
ATOM   3285 N NH2   . ARG C 3 334 ? 17.915  21.891  29.393  1.00 45.18 ? 508  ARG A NH2   1 
ATOM   3286 N N     . VAL C 3 335 ? 10.863  23.909  32.126  1.00 43.31 ? 509  VAL A N     1 
ATOM   3287 C CA    . VAL C 3 335 ? 10.063  25.118  31.989  1.00 48.04 ? 509  VAL A CA    1 
ATOM   3288 C C     . VAL C 3 335 ? 10.455  25.881  30.733  1.00 47.13 ? 509  VAL A C     1 
ATOM   3289 O O     . VAL C 3 335 ? 9.605   26.316  29.968  1.00 46.18 ? 509  VAL A O     1 
ATOM   3290 C CB    . VAL C 3 335 ? 10.236  26.032  33.252  1.00 49.78 ? 509  VAL A CB    1 
ATOM   3291 C CG1   . VAL C 3 335 ? 9.731   27.438  32.993  1.00 48.74 ? 509  VAL A CG1   1 
ATOM   3292 C CG2   . VAL C 3 335 ? 9.485   25.425  34.442  1.00 48.52 ? 509  VAL A CG2   1 
ATOM   3293 N N     . GLU C 3 336 ? 11.749  26.005  30.524  1.00 49.33 ? 510  GLU A N     1 
ATOM   3294 C CA    . GLU C 3 336 ? 12.262  26.711  29.370  1.00 52.07 ? 510  GLU A CA    1 
ATOM   3295 C C     . GLU C 3 336 ? 11.902  26.108  28.029  1.00 51.75 ? 510  GLU A C     1 
ATOM   3296 O O     . GLU C 3 336 ? 12.038  26.772  27.018  1.00 54.98 ? 510  GLU A O     1 
ATOM   3297 C CB    . GLU C 3 336 ? 13.777  26.815  29.467  1.00 58.02 ? 510  GLU A CB    1 
ATOM   3298 C CG    . GLU C 3 336 ? 14.470  25.516  29.878  1.00 64.94 ? 510  GLU A CG    1 
ATOM   3299 C CD    . GLU C 3 336 ? 15.963  25.705  30.159  1.00 68.24 ? 510  GLU A CD    1 
ATOM   3300 O OE1   . GLU C 3 336 ? 16.453  26.860  30.141  1.00 70.94 ? 510  GLU A OE1   1 
ATOM   3301 O OE2   . GLU C 3 336 ? 16.659  24.696  30.400  1.00 70.83 ? 510  GLU A OE2   1 
ATOM   3302 N N     . HIS C 3 337 ? 11.452  24.870  28.001  1.00 48.83 ? 511  HIS A N     1 
ATOM   3303 C CA    . HIS C 3 337 ? 11.139  24.265  26.705  1.00 48.24 ? 511  HIS A CA    1 
ATOM   3304 C C     . HIS C 3 337 ? 9.734   24.485  26.271  1.00 43.83 ? 511  HIS A C     1 
ATOM   3305 O O     . HIS C 3 337 ? 9.327   24.041  25.208  1.00 43.56 ? 511  HIS A O     1 
ATOM   3306 C CB    . HIS C 3 337 ? 11.441  22.780  26.757  1.00 46.59 ? 511  HIS A CB    1 
ATOM   3307 C CG    . HIS C 3 337 ? 12.849  22.500  27.147  1.00 46.28 ? 511  HIS A CG    1 
ATOM   3308 N ND1   . HIS C 3 337 ? 13.181  21.796  28.281  1.00 47.28 ? 511  HIS A ND1   1 
ATOM   3309 C CD2   . HIS C 3 337 ? 14.014  22.922  26.606  1.00 41.21 ? 511  HIS A CD2   1 
ATOM   3310 C CE1   . HIS C 3 337 ? 14.497  21.801  28.423  1.00 45.71 ? 511  HIS A CE1   1 
ATOM   3311 N NE2   . HIS C 3 337 ? 15.025  22.478  27.424  1.00 44.84 ? 511  HIS A NE2   1 
ATOM   3312 N N     . ILE C 3 338 ? 8.958   25.034  27.182  1.00 47.12 ? 512  ILE A N     1 
ATOM   3313 C CA    . ILE C 3 338 ? 7.565   25.289  26.942  1.00 48.09 ? 512  ILE A CA    1 
ATOM   3314 C C     . ILE C 3 338 ? 7.338   26.771  27.072  1.00 49.02 ? 512  ILE A C     1 
ATOM   3315 O O     . ILE C 3 338 ? 7.979   27.441  27.882  1.00 40.70 ? 512  ILE A O     1 
ATOM   3316 C CB    . ILE C 3 338 ? 6.685   24.558  27.987  1.00 51.23 ? 512  ILE A CB    1 
ATOM   3317 C CG1   . ILE C 3 338 ? 6.968   23.064  27.953  1.00 56.62 ? 512  ILE A CG1   1 
ATOM   3318 C CG2   . ILE C 3 338 ? 5.210   24.748  27.679  1.00 55.85 ? 512  ILE A CG2   1 
ATOM   3319 C CD1   . ILE C 3 338 ? 6.563   22.430  26.649  1.00 63.31 ? 512  ILE A CD1   1 
ATOM   3320 N N     . ASN C 3 339 ? 6.430   27.269  26.237  1.00 53.28 ? 513  ASN A N     1 
ATOM   3321 C CA    . ASN C 3 339 ? 6.027   28.676  26.233  1.00 55.50 ? 513  ASN A CA    1 
ATOM   3322 C C     . ASN C 3 339 ? 4.571   28.639  25.829  1.00 53.69 ? 513  ASN A C     1 
ATOM   3323 O O     . ASN C 3 339 ? 4.235   28.064  24.804  1.00 52.62 ? 513  ASN A O     1 
ATOM   3324 C CB    . ASN C 3 339 ? 6.886   29.525  25.280  1.00 56.69 ? 513  ASN A CB    1 
ATOM   3325 C CG    . ASN C 3 339 ? 8.282   29.835  25.869  1.00 58.15 ? 513  ASN A CG    1 
ATOM   3326 O OD1   . ASN C 3 339 ? 8.407   30.428  26.950  1.00 54.57 ? 513  ASN A OD1   1 
ATOM   3327 N ND2   . ASN C 3 339 ? 9.328   29.432  25.158  1.00 57.56 ? 513  ASN A ND2   1 
ATOM   3328 N N     . LEU C 3 340 ? 3.716   29.115  26.736  1.00 54.78 ? 514  LEU A N     1 
ATOM   3329 C CA    . LEU C 3 340 ? 2.261   29.138  26.559  1.00 55.24 ? 514  LEU A CA    1 
ATOM   3330 C C     . LEU C 3 340 ? 1.729   30.387  25.882  1.00 56.33 ? 514  LEU A C     1 
ATOM   3331 O O     . LEU C 3 340 ? 2.221   31.488  26.103  1.00 58.15 ? 514  LEU A O     1 
ATOM   3332 C CB    . LEU C 3 340 ? 1.594   28.993  27.919  1.00 56.23 ? 514  LEU A CB    1 
ATOM   3333 C CG    . LEU C 3 340 ? 1.483   27.603  28.569  1.00 57.91 ? 514  LEU A CG    1 
ATOM   3334 C CD1   . LEU C 3 340 ? 2.522   26.634  28.018  1.00 54.97 ? 514  LEU A CD1   1 
ATOM   3335 C CD2   . LEU C 3 340 ? 1.566   27.747  30.084  1.00 53.10 ? 514  LEU A CD2   1 
ATOM   3336 N N     . HIS C 3 341 ? 0.672   30.220  25.097  1.00 59.95 ? 515  HIS A N     1 
ATOM   3337 C CA    . HIS C 3 341 ? 0.068   31.326  24.371  1.00 61.60 ? 515  HIS A CA    1 
ATOM   3338 C C     . HIS C 3 341 ? -1.431  31.183  24.479  1.00 62.24 ? 515  HIS A C     1 
ATOM   3339 O O     . HIS C 3 341 ? -2.030  30.321  23.823  1.00 60.75 ? 515  HIS A O     1 
ATOM   3340 C CB    . HIS C 3 341 ? 0.495   31.291  22.894  1.00 65.09 ? 515  HIS A CB    1 
ATOM   3341 C CG    . HIS C 3 341 ? 1.963   31.572  22.681  1.00 67.88 ? 515  HIS A CG    1 
ATOM   3342 N ND1   . HIS C 3 341 ? 2.494   32.840  22.773  1.00 71.48 ? 515  HIS A ND1   1 
ATOM   3343 C CD2   . HIS C 3 341 ? 2.998   30.746  22.400  1.00 66.13 ? 515  HIS A CD2   1 
ATOM   3344 C CE1   . HIS C 3 341 ? 3.798   32.782  22.560  1.00 68.80 ? 515  HIS A CE1   1 
ATOM   3345 N NE2   . HIS C 3 341 ? 4.126   31.528  22.334  1.00 65.75 ? 515  HIS A NE2   1 
ATOM   3346 N N     . PRO C 3 342 ? -2.066  32.023  25.328  1.00 63.52 ? 516  PRO A N     1 
ATOM   3347 C CA    . PRO C 3 342 ? -3.519  31.972  25.529  1.00 61.40 ? 516  PRO A CA    1 
ATOM   3348 C C     . PRO C 3 342 ? -4.249  31.877  24.190  1.00 59.35 ? 516  PRO A C     1 
ATOM   3349 O O     . PRO C 3 342 ? -5.232  31.149  24.065  1.00 60.58 ? 516  PRO A O     1 
ATOM   3350 C CB    . PRO C 3 342 ? -3.832  33.292  26.232  1.00 60.00 ? 516  PRO A CB    1 
ATOM   3351 C CG    . PRO C 3 342 ? -2.541  33.703  26.877  1.00 57.81 ? 516  PRO A CG    1 
ATOM   3352 C CD    . PRO C 3 342 ? -1.439  33.169  26.022  1.00 61.72 ? 516  PRO A CD    1 
ATOM   3353 N N     . GLU C 3 343 ? -3.750  32.595  23.206  1.00 59.34 ? 517  GLU A N     1 
ATOM   3354 C CA    . GLU C 3 343 ? -4.355  32.587  21.876  1.00 58.62 ? 517  GLU A CA    1 
ATOM   3355 C C     . GLU C 3 343 ? -3.233  32.750  20.913  1.00 58.08 ? 517  GLU A C     1 
ATOM   3356 O O     . GLU C 3 343 ? -2.248  33.455  21.195  1.00 58.83 ? 517  GLU A O     1 
ATOM   3357 C CB    . GLU C 3 343 ? -5.319  33.763  21.696  1.00 57.89 ? 517  GLU A CB    1 
ATOM   3358 N N     . LEU C 3 344 ? -3.338  32.074  19.790  1.00 59.85 ? 518  LEU A N     1 
ATOM   3359 C CA    . LEU C 3 344 ? -2.296  32.225  18.817  1.00 64.74 ? 518  LEU A CA    1 
ATOM   3360 C C     . LEU C 3 344 ? -2.635  31.791  17.424  1.00 66.35 ? 518  LEU A C     1 
ATOM   3361 O O     . LEU C 3 344 ? -3.052  30.655  17.175  1.00 67.48 ? 518  LEU A O     1 
ATOM   3362 C CB    . LEU C 3 344 ? -0.980  31.580  19.264  1.00 64.68 ? 518  LEU A CB    1 
ATOM   3363 C CG    . LEU C 3 344 ? 0.166   32.150  18.423  1.00 67.16 ? 518  LEU A CG    1 
ATOM   3364 C CD1   . LEU C 3 344 ? 0.297   33.652  18.733  1.00 71.72 ? 518  LEU A CD1   1 
ATOM   3365 C CD2   . LEU C 3 344 ? 1.475   31.419  18.704  1.00 65.20 ? 518  LEU A CD2   1 
ATOM   3366 N N     . ASP C 3 345 ? -2.356  32.700  16.514  1.00 68.18 ? 519  ASP A N     1 
ATOM   3367 C CA    . ASP C 3 345 ? -2.584  32.466  15.110  1.00 68.97 ? 519  ASP A CA    1 
ATOM   3368 C C     . ASP C 3 345 ? -4.001  31.939  14.964  1.00 69.80 ? 519  ASP A C     1 
ATOM   3369 O O     . ASP C 3 345 ? -4.243  30.888  14.353  1.00 71.55 ? 519  ASP A O     1 
ATOM   3370 C CB    . ASP C 3 345 ? -1.544  31.472  14.576  1.00 70.24 ? 519  ASP A CB    1 
ATOM   3371 N N     . GLY C 3 346 ? -4.929  32.651  15.589  1.00 69.39 ? 520  GLY A N     1 
ATOM   3372 C CA    . GLY C 3 346 ? -6.325  32.264  15.515  1.00 71.33 ? 520  GLY A CA    1 
ATOM   3373 C C     . GLY C 3 346 ? -6.575  31.018  16.337  1.00 73.62 ? 520  GLY A C     1 
ATOM   3374 O O     . GLY C 3 346 ? -7.731  30.646  16.589  1.00 74.37 ? 520  GLY A O     1 
ATOM   3375 N N     . GLN C 3 347 ? -5.495  30.348  16.712  1.00 73.54 ? 521  GLN A N     1 
ATOM   3376 C CA    . GLN C 3 347 ? -5.594  29.155  17.530  1.00 71.30 ? 521  GLN A CA    1 
ATOM   3377 C C     . GLN C 3 347 ? -5.708  29.637  18.989  1.00 70.52 ? 521  GLN A C     1 
ATOM   3378 O O     . GLN C 3 347 ? -5.177  30.703  19.346  1.00 64.99 ? 521  GLN A O     1 
ATOM   3379 C CB    . GLN C 3 347 ? -4.374  28.253  17.311  1.00 67.93 ? 521  GLN A CB    1 
ATOM   3380 N N     . GLU C 3 348 ? -6.499  28.907  19.774  1.00 72.48 ? 522  GLU A N     1 
ATOM   3381 C CA    . GLU C 3 348 ? -6.740  29.209  21.193  1.00 73.14 ? 522  GLU A CA    1 
ATOM   3382 C C     . GLU C 3 348 ? -6.135  28.135  22.114  1.00 74.97 ? 522  GLU A C     1 
ATOM   3383 O O     . GLU C 3 348 ? -6.457  26.939  21.967  1.00 76.62 ? 522  GLU A O     1 
ATOM   3384 C CB    . GLU C 3 348 ? -8.249  29.319  21.470  1.00 73.02 ? 522  GLU A CB    1 
ATOM   3385 N N     . TYR C 3 349 ? -5.304  28.568  23.071  1.00 72.90 ? 523  TYR A N     1 
ATOM   3386 C CA    . TYR C 3 349 ? -4.639  27.675  24.043  1.00 69.87 ? 523  TYR A CA    1 
ATOM   3387 C C     . TYR C 3 349 ? -3.486  26.888  23.397  1.00 67.70 ? 523  TYR A C     1 
ATOM   3388 O O     . TYR C 3 349 ? -3.495  25.643  23.351  1.00 66.67 ? 523  TYR A O     1 
ATOM   3389 C CB    . TYR C 3 349 ? -5.644  26.685  24.660  1.00 72.43 ? 523  TYR A CB    1 
ATOM   3390 C CG    . TYR C 3 349 ? -6.652  27.282  25.602  1.00 74.02 ? 523  TYR A CG    1 
ATOM   3391 C CD1   . TYR C 3 349 ? -6.242  27.874  26.789  1.00 75.84 ? 523  TYR A CD1   1 
ATOM   3392 C CD2   . TYR C 3 349 ? -8.024  27.226  25.325  1.00 77.25 ? 523  TYR A CD2   1 
ATOM   3393 C CE1   . TYR C 3 349 ? -7.163  28.398  27.690  1.00 80.40 ? 523  TYR A CE1   1 
ATOM   3394 C CE2   . TYR C 3 349 ? -8.967  27.746  26.219  1.00 81.43 ? 523  TYR A CE2   1 
ATOM   3395 C CZ    . TYR C 3 349 ? -8.525  28.333  27.404  1.00 82.99 ? 523  TYR A CZ    1 
ATOM   3396 O OH    . TYR C 3 349 ? -9.436  28.860  28.303  1.00 89.58 ? 523  TYR A OH    1 
ATOM   3397 N N     . VAL C 3 350 ? -2.468  27.597  22.933  1.00 63.85 ? 524  VAL A N     1 
ATOM   3398 C CA    . VAL C 3 350 ? -1.350  26.938  22.285  1.00 56.81 ? 524  VAL A CA    1 
ATOM   3399 C C     . VAL C 3 350 ? -0.107  26.789  23.144  1.00 55.23 ? 524  VAL A C     1 
ATOM   3400 O O     . VAL C 3 350 ? 0.346   27.745  23.788  1.00 52.96 ? 524  VAL A O     1 
ATOM   3401 C CB    . VAL C 3 350 ? -0.977  27.649  20.979  1.00 55.63 ? 524  VAL A CB    1 
ATOM   3402 C CG1   . VAL C 3 350 ? 0.154   26.920  20.294  1.00 55.52 ? 524  VAL A CG1   1 
ATOM   3403 C CG2   . VAL C 3 350 ? -2.201  27.720  20.064  1.00 54.85 ? 524  VAL A CG2   1 
ATOM   3404 N N     . VAL C 3 351 ? 0.419   25.570  23.153  1.00 54.16 ? 525  VAL A N     1 
ATOM   3405 C CA    . VAL C 3 351 ? 1.634   25.216  23.882  1.00 51.21 ? 525  VAL A CA    1 
ATOM   3406 C C     . VAL C 3 351 ? 2.761   25.209  22.838  1.00 49.83 ? 525  VAL A C     1 
ATOM   3407 O O     . VAL C 3 351 ? 2.653   24.549  21.799  1.00 48.95 ? 525  VAL A O     1 
ATOM   3408 C CB    . VAL C 3 351 ? 1.515   23.815  24.513  1.00 51.81 ? 525  VAL A CB    1 
ATOM   3409 C CG1   . VAL C 3 351 ? 2.743   23.519  25.355  1.00 49.37 ? 525  VAL A CG1   1 
ATOM   3410 C CG2   . VAL C 3 351 ? 0.245   23.711  25.345  1.00 48.04 ? 525  VAL A CG2   1 
ATOM   3411 N N     . GLU C 3 352 ? 3.818   25.976  23.087  1.00 51.32 ? 526  GLU A N     1 
ATOM   3412 C CA    . GLU C 3 352 ? 4.929   26.075  22.138  1.00 50.18 ? 526  GLU A CA    1 
ATOM   3413 C C     . GLU C 3 352 ? 6.143   25.309  22.613  1.00 49.81 ? 526  GLU A C     1 
ATOM   3414 O O     . GLU C 3 352 ? 6.946   25.830  23.395  1.00 46.37 ? 526  GLU A O     1 
ATOM   3415 C CB    . GLU C 3 352 ? 5.319   27.533  21.934  1.00 53.90 ? 526  GLU A CB    1 
ATOM   3416 C CG    . GLU C 3 352 ? 6.216   27.772  20.756  1.00 57.89 ? 526  GLU A CG    1 
ATOM   3417 C CD    . GLU C 3 352 ? 7.195   28.897  21.017  1.00 63.86 ? 526  GLU A CD    1 
ATOM   3418 O OE1   . GLU C 3 352 ? 6.921   29.754  21.908  1.00 64.10 ? 526  GLU A OE1   1 
ATOM   3419 O OE2   . GLU C 3 352 ? 8.253   28.909  20.343  1.00 64.79 ? 526  GLU A OE2   1 
ATOM   3420 N N     . PHE C 3 353 ? 6.245   24.071  22.132  1.00 46.11 ? 527  PHE A N     1 
ATOM   3421 C CA    . PHE C 3 353 ? 7.342   23.185  22.458  1.00 43.48 ? 527  PHE A CA    1 
ATOM   3422 C C     . PHE C 3 353 ? 8.585   23.491  21.640  1.00 44.16 ? 527  PHE A C     1 
ATOM   3423 O O     . PHE C 3 353 ? 8.561   23.527  20.418  1.00 41.96 ? 527  PHE A O     1 
ATOM   3424 C CB    . PHE C 3 353 ? 6.978   21.754  22.130  1.00 44.13 ? 527  PHE A CB    1 
ATOM   3425 C CG    . PHE C 3 353 ? 5.888   21.184  22.967  1.00 42.07 ? 527  PHE A CG    1 
ATOM   3426 C CD1   . PHE C 3 353 ? 6.186   20.526  24.161  1.00 39.81 ? 527  PHE A CD1   1 
ATOM   3427 C CD2   . PHE C 3 353 ? 4.571   21.200  22.515  1.00 44.51 ? 527  PHE A CD2   1 
ATOM   3428 C CE1   . PHE C 3 353 ? 5.191   19.888  24.898  1.00 38.31 ? 527  PHE A CE1   1 
ATOM   3429 C CE2   . PHE C 3 353 ? 3.551   20.563  23.240  1.00 45.19 ? 527  PHE A CE2   1 
ATOM   3430 C CZ    . PHE C 3 353 ? 3.864   19.902  24.437  1.00 46.48 ? 527  PHE A CZ    1 
ATOM   3431 N N     . ASP C 3 354 ? 9.697   23.646  22.312  1.00 47.31 ? 528  ASP A N     1 
ATOM   3432 C CA    . ASP C 3 354 ? 10.935  23.887  21.603  1.00 49.65 ? 528  ASP A CA    1 
ATOM   3433 C C     . ASP C 3 354 ? 12.078  23.324  22.433  1.00 47.78 ? 528  ASP A C     1 
ATOM   3434 O O     . ASP C 3 354 ? 12.471  23.882  23.459  1.00 47.42 ? 528  ASP A O     1 
ATOM   3435 C CB    . ASP C 3 354 ? 11.144  25.372  21.292  1.00 53.83 ? 528  ASP A CB    1 
ATOM   3436 C CG    . ASP C 3 354 ? 12.190  25.589  20.203  1.00 58.60 ? 528  ASP A CG    1 
ATOM   3437 O OD1   . ASP C 3 354 ? 12.163  24.836  19.206  1.00 63.44 ? 528  ASP A OD1   1 
ATOM   3438 O OD2   . ASP C 3 354 ? 13.041  26.499  20.335  1.00 60.04 ? 528  ASP A OD2   1 
ATOM   3439 N N     . PHE C 3 355 ? 12.552  22.161  22.020  1.00 43.61 ? 529  PHE A N     1 
ATOM   3440 C CA    . PHE C 3 355 ? 13.641  21.502  22.720  1.00 44.44 ? 529  PHE A CA    1 
ATOM   3441 C C     . PHE C 3 355 ? 14.362  20.479  21.825  1.00 46.97 ? 529  PHE A C     1 
ATOM   3442 O O     . PHE C 3 355 ? 13.992  20.271  20.661  1.00 47.30 ? 529  PHE A O     1 
ATOM   3443 C CB    . PHE C 3 355 ? 13.102  20.812  23.970  1.00 38.64 ? 529  PHE A CB    1 
ATOM   3444 C CG    . PHE C 3 355 ? 12.226  19.640  23.678  1.00 39.66 ? 529  PHE A CG    1 
ATOM   3445 C CD1   . PHE C 3 355 ? 12.772  18.362  23.544  1.00 38.10 ? 529  PHE A CD1   1 
ATOM   3446 C CD2   . PHE C 3 355 ? 10.857  19.802  23.548  1.00 39.81 ? 529  PHE A CD2   1 
ATOM   3447 C CE1   . PHE C 3 355 ? 11.978  17.254  23.297  1.00 40.53 ? 529  PHE A CE1   1 
ATOM   3448 C CE2   . PHE C 3 355 ? 10.038  18.696  23.295  1.00 44.94 ? 529  PHE A CE2   1 
ATOM   3449 C CZ    . PHE C 3 355 ? 10.607  17.407  23.170  1.00 43.26 ? 529  PHE A CZ    1 
ATOM   3450 N N     . LEU C 3 356 ? 15.401  19.858  22.385  1.00 45.29 ? 530  LEU A N     1 
ATOM   3451 C CA    . LEU C 3 356 ? 16.196  18.844  21.704  1.00 42.19 ? 530  LEU A CA    1 
ATOM   3452 C C     . LEU C 3 356 ? 15.873  17.492  22.250  1.00 38.99 ? 530  LEU A C     1 
ATOM   3453 O O     . LEU C 3 356 ? 16.171  17.204  23.405  1.00 35.61 ? 530  LEU A O     1 
ATOM   3454 C CB    . LEU C 3 356 ? 17.684  19.078  21.913  1.00 39.90 ? 530  LEU A CB    1 
ATOM   3455 C CG    . LEU C 3 356 ? 18.136  20.431  21.402  1.00 42.82 ? 530  LEU A CG    1 
ATOM   3456 C CD1   . LEU C 3 356 ? 19.607  20.544  21.626  1.00 43.94 ? 530  LEU A CD1   1 
ATOM   3457 C CD2   . LEU C 3 356 ? 17.802  20.586  19.927  1.00 39.28 ? 530  LEU A CD2   1 
ATOM   3458 N N     . GLY C 3 357 ? 15.308  16.657  21.397  1.00 40.59 ? 531  GLY A N     1 
ATOM   3459 C CA    . GLY C 3 357 ? 14.953  15.314  21.799  1.00 40.24 ? 531  GLY A CA    1 
ATOM   3460 C C     . GLY C 3 357 ? 16.077  14.324  21.614  1.00 40.28 ? 531  GLY A C     1 
ATOM   3461 O O     . GLY C 3 357 ? 17.257  14.658  21.748  1.00 42.29 ? 531  GLY A O     1 
ATOM   3462 N N     . LYS C 3 358 ? 15.722  13.092  21.296  1.00 40.71 ? 532  LYS A N     1 
ATOM   3463 C CA    . LYS C 3 358 ? 16.712  12.064  21.096  1.00 40.34 ? 532  LYS A CA    1 
ATOM   3464 C C     . LYS C 3 358 ? 17.659  12.465  19.976  1.00 42.08 ? 532  LYS A C     1 
ATOM   3465 O O     . LYS C 3 358 ? 17.234  13.010  18.955  1.00 39.01 ? 532  LYS A O     1 
ATOM   3466 C CB    . LYS C 3 358 ? 16.052  10.742  20.757  1.00 37.89 ? 532  LYS A CB    1 
ATOM   3467 C CG    . LYS C 3 358 ? 17.044  9.631   20.806  1.00 40.26 ? 532  LYS A CG    1 
ATOM   3468 C CD    . LYS C 3 358 ? 16.537  8.357   20.218  1.00 41.12 ? 532  LYS A CD    1 
ATOM   3469 C CE    . LYS C 3 358 ? 17.604  7.301   20.391  1.00 43.04 ? 532  LYS A CE    1 
ATOM   3470 N NZ    . LYS C 3 358 ? 17.382  6.106   19.548  1.00 39.39 ? 532  LYS A NZ    1 
ATOM   3471 N N     . ASP C 3 359 ? 18.941  12.177  20.165  1.00 42.84 ? 533  ASP A N     1 
ATOM   3472 C CA    . ASP C 3 359 ? 19.968  12.492  19.169  1.00 46.81 ? 533  ASP A CA    1 
ATOM   3473 C C     . ASP C 3 359 ? 20.129  13.989  18.908  1.00 48.73 ? 533  ASP A C     1 
ATOM   3474 O O     . ASP C 3 359 ? 20.588  14.383  17.830  1.00 52.47 ? 533  ASP A O     1 
ATOM   3475 C CB    . ASP C 3 359 ? 19.656  11.811  17.822  1.00 52.66 ? 533  ASP A CB    1 
ATOM   3476 C CG    . ASP C 3 359 ? 19.469  10.309  17.939  1.00 58.27 ? 533  ASP A CG    1 
ATOM   3477 O OD1   . ASP C 3 359 ? 20.370  9.667   18.527  1.00 64.41 ? 533  ASP A OD1   1 
ATOM   3478 O OD2   . ASP C 3 359 ? 18.421  9.782   17.454  1.00 59.87 ? 533  ASP A OD2   1 
ATOM   3479 N N     . SER C 3 360 ? 19.693  14.825  19.841  1.00 46.60 ? 534  SER A N     1 
ATOM   3480 C CA    . SER C 3 360 ? 19.813  16.273  19.677  1.00 42.60 ? 534  SER A CA    1 
ATOM   3481 C C     . SER C 3 360 ? 19.001  16.847  18.526  1.00 43.16 ? 534  SER A C     1 
ATOM   3482 O O     . SER C 3 360 ? 19.279  17.929  18.015  1.00 43.30 ? 534  SER A O     1 
ATOM   3483 C CB    . SER C 3 360 ? 21.263  16.657  19.532  1.00 38.82 ? 534  SER A CB    1 
ATOM   3484 O OG    . SER C 3 360 ? 21.949  16.194  20.660  1.00 40.31 ? 534  SER A OG    1 
ATOM   3485 N N     . ILE C 3 361 ? 17.993  16.096  18.122  1.00 42.09 ? 535  ILE A N     1 
ATOM   3486 C CA    . ILE C 3 361 ? 17.102  16.525  17.081  1.00 45.19 ? 535  ILE A CA    1 
ATOM   3487 C C     . ILE C 3 361 ? 16.032  17.437  17.711  1.00 48.88 ? 535  ILE A C     1 
ATOM   3488 O O     . ILE C 3 361 ? 15.365  17.083  18.694  1.00 43.18 ? 535  ILE A O     1 
ATOM   3489 C CB    . ILE C 3 361 ? 16.475  15.317  16.427  1.00 47.91 ? 535  ILE A CB    1 
ATOM   3490 C CG1   . ILE C 3 361 ? 17.588  14.461  15.813  1.00 46.65 ? 535  ILE A CG1   1 
ATOM   3491 C CG2   . ILE C 3 361 ? 15.421  15.750  15.417  1.00 46.31 ? 535  ILE A CG2   1 
ATOM   3492 C CD1   . ILE C 3 361 ? 17.126  13.112  15.316  1.00 54.09 ? 535  ILE A CD1   1 
ATOM   3493 N N     . ARG C 3 362 ? 15.937  18.647  17.179  1.00 52.47 ? 536  ARG A N     1 
ATOM   3494 C CA    . ARG C 3 362 ? 14.984  19.643  17.668  1.00 54.86 ? 536  ARG A CA    1 
ATOM   3495 C C     . ARG C 3 362 ? 13.534  19.315  17.344  1.00 55.74 ? 536  ARG A C     1 
ATOM   3496 O O     . ARG C 3 362 ? 13.200  19.021  16.189  1.00 57.82 ? 536  ARG A O     1 
ATOM   3497 C CB    . ARG C 3 362 ? 15.305  21.035  17.099  1.00 53.57 ? 536  ARG A CB    1 
ATOM   3498 N N     . TYR C 3 363 ? 12.681  19.413  18.377  1.00 51.04 ? 537  TYR A N     1 
ATOM   3499 C CA    . TYR C 3 363 ? 11.247  19.193  18.242  1.00 47.84 ? 537  TYR A CA    1 
ATOM   3500 C C     . TYR C 3 363 ? 10.532  20.510  18.481  1.00 49.35 ? 537  TYR A C     1 
ATOM   3501 O O     . TYR C 3 363 ? 10.380  20.933  19.630  1.00 49.36 ? 537  TYR A O     1 
ATOM   3502 C CB    . TYR C 3 363 ? 10.733  18.199  19.283  1.00 44.77 ? 537  TYR A CB    1 
ATOM   3503 C CG    . TYR C 3 363 ? 9.214   18.023  19.288  1.00 43.78 ? 537  TYR A CG    1 
ATOM   3504 C CD1   . TYR C 3 363 ? 8.394   18.819  20.091  1.00 42.73 ? 537  TYR A CD1   1 
ATOM   3505 C CD2   . TYR C 3 363 ? 8.600   17.028  18.510  1.00 44.40 ? 537  TYR A CD2   1 
ATOM   3506 C CE1   . TYR C 3 363 ? 6.999   18.625  20.126  1.00 44.24 ? 537  TYR A CE1   1 
ATOM   3507 C CE2   . TYR C 3 363 ? 7.203   16.825  18.544  1.00 43.95 ? 537  TYR A CE2   1 
ATOM   3508 C CZ    . TYR C 3 363 ? 6.417   17.627  19.354  1.00 44.11 ? 537  TYR A CZ    1 
ATOM   3509 O OH    . TYR C 3 363 ? 5.070   17.433  19.434  1.00 43.46 ? 537  TYR A OH    1 
ATOM   3510 N N     . TYR C 3 364 ? 10.136  21.183  17.413  1.00 48.38 ? 538  TYR A N     1 
ATOM   3511 C CA    . TYR C 3 364 ? 9.402   22.418  17.551  1.00 46.53 ? 538  TYR A CA    1 
ATOM   3512 C C     . TYR C 3 364 ? 7.965   22.110  17.160  1.00 46.63 ? 538  TYR A C     1 
ATOM   3513 O O     . TYR C 3 364 ? 7.700   21.489  16.123  1.00 45.03 ? 538  TYR A O     1 
ATOM   3514 C CB    . TYR C 3 364 ? 9.956   23.512  16.658  1.00 51.65 ? 538  TYR A CB    1 
ATOM   3515 C CG    . TYR C 3 364 ? 9.147   24.791  16.751  1.00 59.66 ? 538  TYR A CG    1 
ATOM   3516 C CD1   . TYR C 3 364 ? 7.998   24.981  15.963  1.00 59.73 ? 538  TYR A CD1   1 
ATOM   3517 C CD2   . TYR C 3 364 ? 9.488   25.783  17.677  1.00 63.74 ? 538  TYR A CD2   1 
ATOM   3518 C CE1   . TYR C 3 364 ? 7.200   26.126  16.107  1.00 65.57 ? 538  TYR A CE1   1 
ATOM   3519 C CE2   . TYR C 3 364 ? 8.697   26.938  17.829  1.00 68.76 ? 538  TYR A CE2   1 
ATOM   3520 C CZ    . TYR C 3 364 ? 7.550   27.103  17.041  1.00 68.60 ? 538  TYR A CZ    1 
ATOM   3521 O OH    . TYR C 3 364 ? 6.735   28.215  17.217  1.00 72.46 ? 538  TYR A OH    1 
ATOM   3522 N N     . ASN C 3 365 ? 7.040   22.624  17.957  1.00 46.09 ? 539  ASN A N     1 
ATOM   3523 C CA    . ASN C 3 365 ? 5.636   22.394  17.713  1.00 47.72 ? 539  ASN A CA    1 
ATOM   3524 C C     . ASN C 3 365 ? 4.726   23.371  18.456  1.00 49.79 ? 539  ASN A C     1 
ATOM   3525 O O     . ASN C 3 365 ? 5.046   23.836  19.561  1.00 46.91 ? 539  ASN A O     1 
ATOM   3526 C CB    . ASN C 3 365 ? 5.296   20.974  18.148  1.00 50.55 ? 539  ASN A CB    1 
ATOM   3527 C CG    . ASN C 3 365 ? 4.085   20.406  17.416  1.00 57.59 ? 539  ASN A CG    1 
ATOM   3528 O OD1   . ASN C 3 365 ? 3.423   21.082  16.607  1.00 61.20 ? 539  ASN A OD1   1 
ATOM   3529 N ND2   . ASN C 3 365 ? 3.793   19.141  17.690  1.00 59.33 ? 539  ASN A ND2   1 
ATOM   3530 N N     . LYS C 3 366 ? 3.629   23.717  17.776  1.00 55.20 ? 540  LYS A N     1 
ATOM   3531 C CA    . LYS C 3 366 ? 2.542   24.578  18.277  1.00 57.86 ? 540  LYS A CA    1 
ATOM   3532 C C     . LYS C 3 366 ? 1.380   23.628  18.528  1.00 54.60 ? 540  LYS A C     1 
ATOM   3533 O O     . LYS C 3 366 ? 0.761   23.119  17.582  1.00 55.19 ? 540  LYS A O     1 
ATOM   3534 C CB    . LYS C 3 366 ? 2.083   25.562  17.212  1.00 65.62 ? 540  LYS A CB    1 
ATOM   3535 C CG    . LYS C 3 366 ? 2.764   26.913  17.253  1.00 76.65 ? 540  LYS A CG    1 
ATOM   3536 C CD    . LYS C 3 366 ? 2.421   27.718  15.987  1.00 84.28 ? 540  LYS A CD    1 
ATOM   3537 C CE    . LYS C 3 366 ? 2.552   26.851  14.701  1.00 87.29 ? 540  LYS A CE    1 
ATOM   3538 N NZ    . LYS C 3 366 ? 3.852   26.089  14.570  1.00 91.27 ? 540  LYS A NZ    1 
ATOM   3539 N N     . VAL C 3 367 ? 1.026   23.423  19.782  1.00 52.58 ? 541  VAL A N     1 
ATOM   3540 C CA    . VAL C 3 367 ? -0.018  22.475  20.035  1.00 51.44 ? 541  VAL A CA    1 
ATOM   3541 C C     . VAL C 3 367 ? -1.195  22.981  20.820  1.00 52.70 ? 541  VAL A C     1 
ATOM   3542 O O     . VAL C 3 367 ? -1.125  23.218  22.019  1.00 54.20 ? 541  VAL A O     1 
ATOM   3543 C CB    . VAL C 3 367 ? 0.542   21.247  20.715  1.00 53.76 ? 541  VAL A CB    1 
ATOM   3544 C CG1   . VAL C 3 367 ? -0.429  20.117  20.591  1.00 53.83 ? 541  VAL A CG1   1 
ATOM   3545 C CG2   . VAL C 3 367 ? 1.873   20.878  20.120  1.00 52.92 ? 541  VAL A CG2   1 
ATOM   3546 N N     . PRO C 3 368 ? -2.332  23.087  20.150  1.00 54.62 ? 542  PRO A N     1 
ATOM   3547 C CA    . PRO C 3 368 ? -3.552  23.559  20.794  1.00 54.56 ? 542  PRO A CA    1 
ATOM   3548 C C     . PRO C 3 368 ? -3.996  22.468  21.753  1.00 54.91 ? 542  PRO A C     1 
ATOM   3549 O O     . PRO C 3 368 ? -4.426  21.397  21.311  1.00 54.80 ? 542  PRO A O     1 
ATOM   3550 C CB    . PRO C 3 368 ? -4.550  23.659  19.627  1.00 57.45 ? 542  PRO A CB    1 
ATOM   3551 C CG    . PRO C 3 368 ? -3.687  23.590  18.359  1.00 57.64 ? 542  PRO A CG    1 
ATOM   3552 C CD    . PRO C 3 368 ? -2.574  22.667  18.760  1.00 57.53 ? 542  PRO A CD    1 
ATOM   3553 N N     . VAL C 3 369 ? -3.862  22.705  23.049  1.00 55.12 ? 543  VAL A N     1 
ATOM   3554 C CA    . VAL C 3 369 ? -4.274  21.700  24.024  1.00 55.83 ? 543  VAL A CA    1 
ATOM   3555 C C     . VAL C 3 369 ? -5.603  22.024  24.670  1.00 57.45 ? 543  VAL A C     1 
ATOM   3556 O O     . VAL C 3 369 ? -6.185  23.093  24.456  1.00 58.43 ? 543  VAL A O     1 
ATOM   3557 C CB    . VAL C 3 369 ? -3.254  21.547  25.135  1.00 55.37 ? 543  VAL A CB    1 
ATOM   3558 C CG1   . VAL C 3 369 ? -1.924  21.117  24.552  1.00 57.67 ? 543  VAL A CG1   1 
ATOM   3559 C CG2   . VAL C 3 369 ? -3.126  22.849  25.893  1.00 54.56 ? 543  VAL A CG2   1 
ATOM   3560 N N     . GLU C 3 370 ? -6.096  21.083  25.460  1.00 58.31 ? 544  GLU A N     1 
ATOM   3561 C CA    . GLU C 3 370 ? -7.336  21.300  26.145  1.00 59.73 ? 544  GLU A CA    1 
ATOM   3562 C C     . GLU C 3 370 ? -7.084  22.197  27.350  1.00 61.14 ? 544  GLU A C     1 
ATOM   3563 O O     . GLU C 3 370 ? -6.094  22.028  28.051  1.00 60.07 ? 544  GLU A O     1 
ATOM   3564 C CB    . GLU C 3 370 ? -7.942  19.968  26.508  1.00 61.80 ? 544  GLU A CB    1 
ATOM   3565 C CG    . GLU C 3 370 ? -8.462  19.279  25.262  1.00 67.82 ? 544  GLU A CG    1 
ATOM   3566 C CD    . GLU C 3 370 ? -8.521  17.784  25.406  1.00 73.09 ? 544  GLU A CD    1 
ATOM   3567 O OE1   . GLU C 3 370 ? -9.051  17.303  26.436  1.00 71.67 ? 544  GLU A OE1   1 
ATOM   3568 O OE2   . GLU C 3 370 ? -7.994  17.105  24.495  1.00 75.32 ? 544  GLU A OE2   1 
ATOM   3569 N N     . LYS C 3 371 ? -7.941  23.202  27.490  1.00 63.42 ? 545  LYS A N     1 
ATOM   3570 C CA    . LYS C 3 371 ? -7.904  24.217  28.554  1.00 62.88 ? 545  LYS A CA    1 
ATOM   3571 C C     . LYS C 3 371 ? -7.300  23.771  29.866  1.00 60.76 ? 545  LYS A C     1 
ATOM   3572 O O     . LYS C 3 371 ? -6.339  24.385  30.323  1.00 60.20 ? 545  LYS A O     1 
ATOM   3573 C CB    . LYS C 3 371 ? -9.312  24.766  28.837  1.00 64.00 ? 545  LYS A CB    1 
ATOM   3574 C CG    . LYS C 3 371 ? -9.351  25.843  29.915  1.00 64.88 ? 545  LYS A CG    1 
ATOM   3575 C CD    . LYS C 3 371 ? -10.766 26.321  30.166  1.00 73.15 ? 545  LYS A CD    1 
ATOM   3576 C CE    . LYS C 3 371 ? -10.805 27.427  31.225  1.00 83.02 ? 545  LYS A CE    1 
ATOM   3577 N NZ    . LYS C 3 371 ? -12.201 27.926  31.570  1.00 88.66 ? 545  LYS A NZ    1 
ATOM   3578 N N     . ARG C 3 372 ? -7.900  22.771  30.498  1.00 59.54 ? 546  ARG A N     1 
ATOM   3579 C CA    . ARG C 3 372 ? -7.386  22.288  31.782  1.00 58.91 ? 546  ARG A CA    1 
ATOM   3580 C C     . ARG C 3 372 ? -5.926  21.890  31.694  1.00 54.98 ? 546  ARG A C     1 
ATOM   3581 O O     . ARG C 3 372 ? -5.204  21.967  32.679  1.00 53.47 ? 546  ARG A O     1 
ATOM   3582 C CB    . ARG C 3 372 ? -8.228  21.135  32.304  1.00 63.93 ? 546  ARG A CB    1 
ATOM   3583 C CG    . ARG C 3 372 ? -9.595  21.562  32.820  1.00 70.02 ? 546  ARG A CG    1 
ATOM   3584 C CD    . ARG C 3 372 ? -10.449 20.354  33.221  1.00 73.53 ? 546  ARG A CD    1 
ATOM   3585 N NE    . ARG C 3 372 ? -11.666 20.773  33.915  1.00 76.31 ? 546  ARG A NE    1 
ATOM   3586 C CZ    . ARG C 3 372 ? -11.720 21.111  35.204  1.00 78.64 ? 546  ARG A CZ    1 
ATOM   3587 N NH1   . ARG C 3 372 ? -10.621 21.079  35.972  1.00 79.94 ? 546  ARG A NH1   1 
ATOM   3588 N NH2   . ARG C 3 372 ? -12.877 21.512  35.716  1.00 76.56 ? 546  ARG A NH2   1 
ATOM   3589 N N     . VAL C 3 373 ? -5.508  21.435  30.514  1.00 50.82 ? 547  VAL A N     1 
ATOM   3590 C CA    . VAL C 3 373 ? -4.122  21.056  30.291  1.00 45.67 ? 547  VAL A CA    1 
ATOM   3591 C C     . VAL C 3 373 ? -3.302  22.334  30.233  1.00 43.88 ? 547  VAL A C     1 
ATOM   3592 O O     . VAL C 3 373 ? -2.292  22.461  30.919  1.00 47.45 ? 547  VAL A O     1 
ATOM   3593 C CB    . VAL C 3 373 ? -3.948  20.294  28.958  1.00 49.28 ? 547  VAL A CB    1 
ATOM   3594 C CG1   . VAL C 3 373 ? -2.453  20.069  28.658  1.00 48.22 ? 547  VAL A CG1   1 
ATOM   3595 C CG2   . VAL C 3 373 ? -4.699  18.961  29.006  1.00 42.55 ? 547  VAL A CG2   1 
ATOM   3596 N N     . PHE C 3 374 ? -3.732  23.282  29.404  1.00 41.02 ? 548  PHE A N     1 
ATOM   3597 C CA    . PHE C 3 374 ? -3.024  24.546  29.259  1.00 42.62 ? 548  PHE A CA    1 
ATOM   3598 C C     . PHE C 3 374 ? -2.838  25.214  30.602  1.00 44.16 ? 548  PHE A C     1 
ATOM   3599 O O     . PHE C 3 374 ? -1.737  25.644  30.955  1.00 45.62 ? 548  PHE A O     1 
ATOM   3600 C CB    . PHE C 3 374 ? -3.798  25.480  28.339  1.00 44.74 ? 548  PHE A CB    1 
ATOM   3601 C CG    . PHE C 3 374 ? -3.151  26.829  28.162  1.00 48.16 ? 548  PHE A CG    1 
ATOM   3602 C CD1   . PHE C 3 374 ? -3.358  27.850  29.089  1.00 53.15 ? 548  PHE A CD1   1 
ATOM   3603 C CD2   . PHE C 3 374 ? -2.351  27.088  27.057  1.00 47.05 ? 548  PHE A CD2   1 
ATOM   3604 C CE1   . PHE C 3 374 ? -2.755  29.113  28.925  1.00 49.80 ? 548  PHE A CE1   1 
ATOM   3605 C CE2   . PHE C 3 374 ? -1.746  28.343  26.879  1.00 48.83 ? 548  PHE A CE2   1 
ATOM   3606 C CZ    . PHE C 3 374 ? -1.955  29.359  27.814  1.00 49.58 ? 548  PHE A CZ    1 
ATOM   3607 N N     . LYS C 3 375 ? -3.932  25.351  31.331  1.00 44.56 ? 549  LYS A N     1 
ATOM   3608 C CA    . LYS C 3 375 ? -3.873  25.993  32.630  1.00 47.77 ? 549  LYS A CA    1 
ATOM   3609 C C     . LYS C 3 375 ? -2.928  25.241  33.548  1.00 49.73 ? 549  LYS A C     1 
ATOM   3610 O O     . LYS C 3 375 ? -2.071  25.842  34.208  1.00 46.80 ? 549  LYS A O     1 
ATOM   3611 C CB    . LYS C 3 375 ? -5.271  26.072  33.241  1.00 51.97 ? 549  LYS A CB    1 
ATOM   3612 C CG    . LYS C 3 375 ? -6.213  27.019  32.498  1.00 55.02 ? 549  LYS A CG    1 
ATOM   3613 C CD    . LYS C 3 375 ? -5.570  28.392  32.303  1.00 59.04 ? 549  LYS A CD    1 
ATOM   3614 C CE    . LYS C 3 375 ? -6.471  29.355  31.533  1.00 64.47 ? 549  LYS A CE    1 
ATOM   3615 N NZ    . LYS C 3 375 ? -5.722  30.605  31.169  1.00 70.25 ? 549  LYS A NZ    1 
ATOM   3616 N N     . ASN C 3 376 ? -3.096  23.927  33.595  1.00 51.34 ? 550  ASN A N     1 
ATOM   3617 C CA    . ASN C 3 376 ? -2.243  23.096  34.436  1.00 51.02 ? 550  ASN A CA    1 
ATOM   3618 C C     . ASN C 3 376 ? -0.784  23.406  34.145  1.00 49.39 ? 550  ASN A C     1 
ATOM   3619 O O     . ASN C 3 376 ? 0.046   23.464  35.063  1.00 49.08 ? 550  ASN A O     1 
ATOM   3620 C CB    . ASN C 3 376 ? -2.534  21.616  34.203  1.00 53.88 ? 550  ASN A CB    1 
ATOM   3621 C CG    . ASN C 3 376 ? -3.615  21.092  35.135  1.00 57.56 ? 550  ASN A CG    1 
ATOM   3622 O OD1   . ASN C 3 376 ? -3.730  21.540  36.280  1.00 62.17 ? 550  ASN A OD1   1 
ATOM   3623 N ND2   . ASN C 3 376 ? -4.403  20.128  34.655  1.00 57.36 ? 550  ASN A ND2   1 
ATOM   3624 N N     . LEU C 3 377 ? -0.485  23.651  32.879  1.00 44.95 ? 551  LEU A N     1 
ATOM   3625 C CA    . LEU C 3 377 ? 0.873   23.979  32.499  1.00 45.18 ? 551  LEU A CA    1 
ATOM   3626 C C     . LEU C 3 377 ? 1.265   25.309  33.114  1.00 47.81 ? 551  LEU A C     1 
ATOM   3627 O O     . LEU C 3 377 ? 2.456   25.591  33.277  1.00 48.32 ? 551  LEU A O     1 
ATOM   3628 C CB    . LEU C 3 377 ? 1.024   24.037  30.975  1.00 41.66 ? 551  LEU A CB    1 
ATOM   3629 C CG    . LEU C 3 377 ? 0.882   22.722  30.210  1.00 40.44 ? 551  LEU A CG    1 
ATOM   3630 C CD1   . LEU C 3 377 ? 1.096   23.011  28.769  1.00 38.41 ? 551  LEU A CD1   1 
ATOM   3631 C CD2   . LEU C 3 377 ? 1.868   21.667  30.693  1.00 32.96 ? 551  LEU A CD2   1 
ATOM   3632 N N     . GLN C 3 378 ? 0.293   26.169  33.392  1.00 48.62 ? 552  GLN A N     1 
ATOM   3633 C CA    . GLN C 3 378 ? 0.644   27.441  34.005  1.00 50.88 ? 552  GLN A CA    1 
ATOM   3634 C C     . GLN C 3 378 ? 0.968   27.205  35.463  1.00 49.53 ? 552  GLN A C     1 
ATOM   3635 O O     . GLN C 3 378 ? 1.920   27.778  36.012  1.00 47.11 ? 552  GLN A O     1 
ATOM   3636 C CB    . GLN C 3 378 ? -0.487  28.434  33.885  1.00 55.26 ? 552  GLN A CB    1 
ATOM   3637 C CG    . GLN C 3 378 ? -0.842  28.713  32.452  1.00 68.46 ? 552  GLN A CG    1 
ATOM   3638 C CD    . GLN C 3 378 ? -1.671  29.981  32.296  1.00 75.28 ? 552  GLN A CD    1 
ATOM   3639 O OE1   . GLN C 3 378 ? -2.813  29.944  31.793  1.00 76.43 ? 552  GLN A OE1   1 
ATOM   3640 N NE2   . GLN C 3 378 ? -1.103  31.121  32.729  1.00 76.19 ? 552  GLN A NE2   1 
ATOM   3641 N N     . LEU C 3 379 ? 0.154   26.361  36.085  1.00 49.81 ? 553  LEU A N     1 
ATOM   3642 C CA    . LEU C 3 379 ? 0.331   26.024  37.476  1.00 50.30 ? 553  LEU A CA    1 
ATOM   3643 C C     . LEU C 3 379 ? 1.704   25.425  37.632  1.00 50.50 ? 553  LEU A C     1 
ATOM   3644 O O     . LEU C 3 379 ? 2.441   25.815  38.536  1.00 50.68 ? 553  LEU A O     1 
ATOM   3645 C CB    . LEU C 3 379 ? -0.718  25.014  37.917  1.00 53.18 ? 553  LEU A CB    1 
ATOM   3646 C CG    . LEU C 3 379 ? -0.870  24.853  39.430  1.00 58.17 ? 553  LEU A CG    1 
ATOM   3647 C CD1   . LEU C 3 379 ? -1.395  26.140  40.091  1.00 54.02 ? 553  LEU A CD1   1 
ATOM   3648 C CD2   . LEU C 3 379 ? -1.828  23.718  39.673  1.00 61.30 ? 553  LEU A CD2   1 
ATOM   3649 N N     . PHE C 3 380 ? 2.052   24.493  36.739  1.00 50.09 ? 554  PHE A N     1 
ATOM   3650 C CA    . PHE C 3 380 ? 3.364   23.835  36.795  1.00 49.65 ? 554  PHE A CA    1 
ATOM   3651 C C     . PHE C 3 380 ? 4.561   24.784  36.562  1.00 52.00 ? 554  PHE A C     1 
ATOM   3652 O O     . PHE C 3 380 ? 5.699   24.416  36.806  1.00 52.50 ? 554  PHE A O     1 
ATOM   3653 C CB    . PHE C 3 380 ? 3.486   22.690  35.773  1.00 42.75 ? 554  PHE A CB    1 
ATOM   3654 C CG    . PHE C 3 380 ? 2.458   21.603  35.918  1.00 41.27 ? 554  PHE A CG    1 
ATOM   3655 C CD1   . PHE C 3 380 ? 1.685   21.470  37.062  1.00 39.84 ? 554  PHE A CD1   1 
ATOM   3656 C CD2   . PHE C 3 380 ? 2.199   20.761  34.843  1.00 39.92 ? 554  PHE A CD2   1 
ATOM   3657 C CE1   . PHE C 3 380 ? 0.672   20.502  37.133  1.00 38.18 ? 554  PHE A CE1   1 
ATOM   3658 C CE2   . PHE C 3 380 ? 1.190   19.799  34.909  1.00 41.55 ? 554  PHE A CE2   1 
ATOM   3659 C CZ    . PHE C 3 380 ? 0.419   19.680  36.055  1.00 40.19 ? 554  PHE A CZ    1 
ATOM   3660 N N     . MET C 3 381 ? 4.316   25.974  36.034  1.00 53.01 ? 555  MET A N     1 
ATOM   3661 C CA    . MET C 3 381 ? 5.418   26.893  35.762  1.00 52.55 ? 555  MET A CA    1 
ATOM   3662 C C     . MET C 3 381 ? 5.510   28.019  36.785  1.00 55.69 ? 555  MET A C     1 
ATOM   3663 O O     . MET C 3 381 ? 6.411   28.869  36.719  1.00 52.84 ? 555  MET A O     1 
ATOM   3664 C CB    . MET C 3 381 ? 5.228   27.494  34.365  1.00 55.20 ? 555  MET A CB    1 
ATOM   3665 C CG    . MET C 3 381 ? 5.210   26.473  33.231  1.00 52.59 ? 555  MET A CG    1 
ATOM   3666 S SD    . MET C 3 381 ? 5.130   27.192  31.600  1.00 51.49 ? 555  MET A SD    1 
ATOM   3667 C CE    . MET C 3 381 ? 4.507   25.901  30.719  1.00 50.06 ? 555  MET A CE    1 
ATOM   3668 N N     . GLU C 3 382 ? 4.539   28.020  37.691  1.00 60.27 ? 556  GLU A N     1 
ATOM   3669 C CA    . GLU C 3 382 ? 4.396   29.035  38.733  1.00 62.99 ? 556  GLU A CA    1 
ATOM   3670 C C     . GLU C 3 382 ? 5.505   29.083  39.766  1.00 65.49 ? 556  GLU A C     1 
ATOM   3671 O O     . GLU C 3 382 ? 5.633   28.199  40.607  1.00 71.42 ? 556  GLU A O     1 
ATOM   3672 C CB    . GLU C 3 382 ? 3.034   28.875  39.444  1.00 65.57 ? 556  GLU A CB    1 
ATOM   3673 N N     . ASN C 3 383 ? 6.249   30.191  39.759  1.00 64.58 ? 557  ASN A N     1 
ATOM   3674 C CA    . ASN C 3 383 ? 7.355   30.429  40.698  1.00 63.00 ? 557  ASN A CA    1 
ATOM   3675 C C     . ASN C 3 383 ? 8.611   29.602  40.439  1.00 61.58 ? 557  ASN A C     1 
ATOM   3676 O O     . ASN C 3 383 ? 9.496   29.484  41.303  1.00 60.39 ? 557  ASN A O     1 
ATOM   3677 C CB    . ASN C 3 383 ? 6.911   30.254  42.159  1.00 62.34 ? 557  ASN A CB    1 
ATOM   3678 C CG    . ASN C 3 383 ? 5.782   31.186  42.531  1.00 60.88 ? 557  ASN A CG    1 
ATOM   3679 O OD1   . ASN C 3 383 ? 5.961   32.400  42.588  1.00 65.18 ? 557  ASN A OD1   1 
ATOM   3680 N ND2   . ASN C 3 383 ? 4.600   30.623  42.759  1.00 62.41 ? 557  ASN A ND2   1 
ATOM   3681 N N     . LYS C 3 384 ? 8.699   29.058  39.229  1.00 61.94 ? 558  LYS A N     1 
ATOM   3682 C CA    . LYS C 3 384 ? 9.851   28.259  38.829  1.00 59.70 ? 558  LYS A CA    1 
ATOM   3683 C C     . LYS C 3 384 ? 10.744  29.079  37.919  1.00 55.70 ? 558  LYS A C     1 
ATOM   3684 O O     . LYS C 3 384 ? 10.301  30.043  37.310  1.00 53.07 ? 558  LYS A O     1 
ATOM   3685 C CB    . LYS C 3 384 ? 9.416   27.000  38.058  1.00 59.36 ? 558  LYS A CB    1 
ATOM   3686 C CG    . LYS C 3 384 ? 8.758   25.901  38.872  1.00 58.66 ? 558  LYS A CG    1 
ATOM   3687 C CD    . LYS C 3 384 ? 8.467   24.675  37.984  1.00 59.49 ? 558  LYS A CD    1 
ATOM   3688 C CE    . LYS C 3 384 ? 7.804   23.516  38.760  1.00 60.98 ? 558  LYS A CE    1 
ATOM   3689 N NZ    . LYS C 3 384 ? 7.476   22.322  37.914  1.00 56.16 ? 558  LYS A NZ    1 
ATOM   3690 N N     . GLN C 3 385 ? 11.993  28.659  37.804  1.00 55.41 ? 559  GLN A N     1 
ATOM   3691 C CA    . GLN C 3 385 ? 12.933  29.328  36.932  1.00 55.78 ? 559  GLN A CA    1 
ATOM   3692 C C     . GLN C 3 385 ? 13.050  28.440  35.675  1.00 55.65 ? 559  GLN A C     1 
ATOM   3693 O O     . GLN C 3 385 ? 12.747  27.242  35.719  1.00 55.71 ? 559  GLN A O     1 
ATOM   3694 C CB    . GLN C 3 385 ? 14.277  29.472  37.646  1.00 57.80 ? 559  GLN A CB    1 
ATOM   3695 C CG    . GLN C 3 385 ? 14.202  30.053  39.073  1.00 64.53 ? 559  GLN A CG    1 
ATOM   3696 C CD    . GLN C 3 385 ? 13.779  31.525  39.133  1.00 68.97 ? 559  GLN A CD    1 
ATOM   3697 O OE1   . GLN C 3 385 ? 14.373  32.383  38.465  1.00 68.39 ? 559  GLN A OE1   1 
ATOM   3698 N NE2   . GLN C 3 385 ? 12.771  31.823  39.965  1.00 69.49 ? 559  GLN A NE2   1 
ATOM   3699 N N     . PRO C 3 386 ? 13.505  29.013  34.550  1.00 54.85 ? 560  PRO A N     1 
ATOM   3700 C CA    . PRO C 3 386 ? 13.659  28.276  33.291  1.00 53.79 ? 560  PRO A CA    1 
ATOM   3701 C C     . PRO C 3 386 ? 14.372  26.946  33.448  1.00 54.68 ? 560  PRO A C     1 
ATOM   3702 O O     . PRO C 3 386 ? 13.924  25.920  32.932  1.00 50.16 ? 560  PRO A O     1 
ATOM   3703 C CB    . PRO C 3 386 ? 14.523  29.212  32.454  1.00 54.61 ? 560  PRO A CB    1 
ATOM   3704 C CG    . PRO C 3 386 ? 14.079  30.556  32.905  1.00 54.85 ? 560  PRO A CG    1 
ATOM   3705 C CD    . PRO C 3 386 ? 14.008  30.391  34.406  1.00 55.99 ? 560  PRO A CD    1 
ATOM   3706 N N     . GLU C 3 387 ? 15.527  26.996  34.106  1.00 55.65 ? 561  GLU A N     1 
ATOM   3707 C CA    . GLU C 3 387 ? 16.339  25.806  34.309  1.00 61.51 ? 561  GLU A CA    1 
ATOM   3708 C C     . GLU C 3 387 ? 15.646  24.783  35.182  1.00 61.05 ? 561  GLU A C     1 
ATOM   3709 O O     . GLU C 3 387 ? 16.306  23.948  35.808  1.00 63.08 ? 561  GLU A O     1 
ATOM   3710 C CB    . GLU C 3 387 ? 17.693  26.131  34.961  1.00 66.63 ? 561  GLU A CB    1 
ATOM   3711 C CG    . GLU C 3 387 ? 18.243  27.542  34.737  1.00 74.78 ? 561  GLU A CG    1 
ATOM   3712 C CD    . GLU C 3 387 ? 17.604  28.590  35.654  1.00 76.15 ? 561  GLU A CD    1 
ATOM   3713 O OE1   . GLU C 3 387 ? 17.225  28.266  36.810  1.00 73.59 ? 561  GLU A OE1   1 
ATOM   3714 O OE2   . GLU C 3 387 ? 17.492  29.751  35.206  1.00 81.86 ? 561  GLU A OE2   1 
ATOM   3715 N N     . ASP C 3 388 ? 14.329  24.870  35.272  1.00 58.48 ? 562  ASP A N     1 
ATOM   3716 C CA    . ASP C 3 388 ? 13.626  23.919  36.099  1.00 58.14 ? 562  ASP A CA    1 
ATOM   3717 C C     . ASP C 3 388 ? 12.742  22.909  35.406  1.00 53.46 ? 562  ASP A C     1 
ATOM   3718 O O     . ASP C 3 388 ? 12.291  23.127  34.295  1.00 55.27 ? 562  ASP A O     1 
ATOM   3719 C CB    . ASP C 3 388 ? 12.871  24.655  37.185  1.00 62.81 ? 562  ASP A CB    1 
ATOM   3720 C CG    . ASP C 3 388 ? 13.797  25.177  38.250  1.00 68.52 ? 562  ASP A CG    1 
ATOM   3721 O OD1   . ASP C 3 388 ? 15.031  24.944  38.154  1.00 72.68 ? 562  ASP A OD1   1 
ATOM   3722 O OD2   . ASP C 3 388 ? 13.290  25.813  39.195  1.00 73.05 ? 562  ASP A OD2   1 
ATOM   3723 N N     . ASP C 3 389 ? 12.543  21.777  36.061  1.00 47.67 ? 563  ASP A N     1 
ATOM   3724 C CA    . ASP C 3 389 ? 11.699  20.735  35.531  1.00 46.71 ? 563  ASP A CA    1 
ATOM   3725 C C     . ASP C 3 389 ? 10.282  21.254  35.468  1.00 44.22 ? 563  ASP A C     1 
ATOM   3726 O O     . ASP C 3 389 ? 9.815   21.903  36.397  1.00 44.08 ? 563  ASP A O     1 
ATOM   3727 C CB    . ASP C 3 389 ? 11.692  19.522  36.460  1.00 50.82 ? 563  ASP A CB    1 
ATOM   3728 C CG    . ASP C 3 389 ? 13.008  18.778  36.475  1.00 55.76 ? 563  ASP A CG    1 
ATOM   3729 O OD1   . ASP C 3 389 ? 13.678  18.732  35.415  1.00 51.41 ? 563  ASP A OD1   1 
ATOM   3730 O OD2   . ASP C 3 389 ? 13.354  18.226  37.555  1.00 55.23 ? 563  ASP A OD2   1 
ATOM   3731 N N     . LEU C 3 390 ? 9.615   20.977  34.366  1.00 40.93 ? 564  LEU A N     1 
ATOM   3732 C CA    . LEU C 3 390 ? 8.239   21.367  34.191  1.00 39.86 ? 564  LEU A CA    1 
ATOM   3733 C C     . LEU C 3 390 ? 7.461   20.425  35.106  1.00 42.22 ? 564  LEU A C     1 
ATOM   3734 O O     . LEU C 3 390 ? 6.623   20.836  35.893  1.00 42.22 ? 564  LEU A O     1 
ATOM   3735 C CB    . LEU C 3 390 ? 7.852   21.126  32.729  1.00 36.47 ? 564  LEU A CB    1 
ATOM   3736 C CG    . LEU C 3 390 ? 6.398   21.327  32.315  1.00 42.35 ? 564  LEU A CG    1 
ATOM   3737 C CD1   . LEU C 3 390 ? 6.075   22.803  32.314  1.00 40.78 ? 564  LEU A CD1   1 
ATOM   3738 C CD2   . LEU C 3 390 ? 6.166   20.750  30.935  1.00 41.90 ? 564  LEU A CD2   1 
ATOM   3739 N N     . PHE C 3 391 ? 7.753   19.140  34.988  1.00 40.89 ? 565  PHE A N     1 
ATOM   3740 C CA    . PHE C 3 391 ? 7.081   18.139  35.778  1.00 39.67 ? 565  PHE A CA    1 
ATOM   3741 C C     . PHE C 3 391 ? 7.940   17.768  36.975  1.00 44.95 ? 565  PHE A C     1 
ATOM   3742 O O     . PHE C 3 391 ? 8.362   16.622  37.154  1.00 46.54 ? 565  PHE A O     1 
ATOM   3743 C CB    . PHE C 3 391 ? 6.760   16.938  34.899  1.00 42.51 ? 565  PHE A CB    1 
ATOM   3744 C CG    . PHE C 3 391 ? 5.913   17.275  33.688  1.00 50.38 ? 565  PHE A CG    1 
ATOM   3745 C CD1   . PHE C 3 391 ? 4.567   17.621  33.841  1.00 53.32 ? 565  PHE A CD1   1 
ATOM   3746 C CD2   . PHE C 3 391 ? 6.451   17.241  32.399  1.00 50.50 ? 565  PHE A CD2   1 
ATOM   3747 C CE1   . PHE C 3 391 ? 3.766   17.918  32.734  1.00 53.83 ? 565  PHE A CE1   1 
ATOM   3748 C CE2   . PHE C 3 391 ? 5.655   17.532  31.281  1.00 53.79 ? 565  PHE A CE2   1 
ATOM   3749 C CZ    . PHE C 3 391 ? 4.312   17.872  31.451  1.00 51.72 ? 565  PHE A CZ    1 
ATOM   3750 N N     . ASP C 3 392 ? 8.125   18.760  37.840  1.00 48.59 ? 566  ASP A N     1 
ATOM   3751 C CA    . ASP C 3 392 ? 8.919   18.637  39.059  1.00 49.24 ? 566  ASP A CA    1 
ATOM   3752 C C     . ASP C 3 392 ? 8.650   17.448  39.950  1.00 48.40 ? 566  ASP A C     1 
ATOM   3753 O O     . ASP C 3 392 ? 9.547   17.007  40.657  1.00 51.20 ? 566  ASP A O     1 
ATOM   3754 C CB    . ASP C 3 392 ? 8.769   19.891  39.916  1.00 54.94 ? 566  ASP A CB    1 
ATOM   3755 C CG    . ASP C 3 392 ? 7.351   20.091  40.416  1.00 57.99 ? 566  ASP A CG    1 
ATOM   3756 O OD1   . ASP C 3 392 ? 6.491   20.432  39.580  1.00 60.26 ? 566  ASP A OD1   1 
ATOM   3757 O OD2   . ASP C 3 392 ? 7.110   19.921  41.637  1.00 62.15 ? 566  ASP A OD2   1 
ATOM   3758 N N     . ARG C 3 393 ? 7.408   17.017  40.052  1.00 43.67 ? 567  ARG A N     1 
ATOM   3759 C CA    . ARG C 3 393 ? 7.153   15.886  40.899  1.00 45.58 ? 567  ARG A CA    1 
ATOM   3760 C C     . ARG C 3 393 ? 6.984   14.614  40.075  1.00 47.79 ? 567  ARG A C     1 
ATOM   3761 O O     . ARG C 3 393 ? 6.325   13.676  40.531  1.00 52.36 ? 567  ARG A O     1 
ATOM   3762 C CB    . ARG C 3 393 ? 5.917   16.142  41.762  1.00 51.67 ? 567  ARG A CB    1 
ATOM   3763 N N     . LEU C 3 394 ? 7.607   14.546  38.898  1.00 44.00 ? 568  LEU A N     1 
ATOM   3764 C CA    . LEU C 3 394 ? 7.457   13.357  38.049  1.00 41.50 ? 568  LEU A CA    1 
ATOM   3765 C C     . LEU C 3 394 ? 8.740   12.815  37.426  1.00 39.51 ? 568  LEU A C     1 
ATOM   3766 O O     . LEU C 3 394 ? 9.671   13.565  37.207  1.00 38.97 ? 568  LEU A O     1 
ATOM   3767 C CB    . LEU C 3 394 ? 6.497   13.684  36.913  1.00 39.82 ? 568  LEU A CB    1 
ATOM   3768 C CG    . LEU C 3 394 ? 5.644   12.599  36.256  1.00 40.76 ? 568  LEU A CG    1 
ATOM   3769 C CD1   . LEU C 3 394 ? 5.773   12.744  34.757  1.00 36.96 ? 568  LEU A CD1   1 
ATOM   3770 C CD2   . LEU C 3 394 ? 5.989   11.188  36.707  1.00 33.61 ? 568  LEU A CD2   1 
ATOM   3771 N N     . ASN C 3 395 ? 8.772   11.503  37.188  1.00 36.53 ? 569  ASN A N     1 
ATOM   3772 C CA    . ASN C 3 395 ? 9.880   10.836  36.494  1.00 32.74 ? 569  ASN A CA    1 
ATOM   3773 C C     . ASN C 3 395 ? 9.365   9.580   35.808  1.00 31.00 ? 569  ASN A C     1 
ATOM   3774 O O     . ASN C 3 395 ? 8.214   9.199   36.009  1.00 33.12 ? 569  ASN A O     1 
ATOM   3775 C CB    . ASN C 3 395 ? 11.107  10.580  37.366  1.00 34.58 ? 569  ASN A CB    1 
ATOM   3776 C CG    . ASN C 3 395 ? 10.848  9.632   38.500  1.00 37.14 ? 569  ASN A CG    1 
ATOM   3777 O OD1   . ASN C 3 395 ? 10.077  8.694   38.367  1.00 44.43 ? 569  ASN A OD1   1 
ATOM   3778 N ND2   . ASN C 3 395 ? 11.468  9.888   39.638  1.00 36.40 ? 569  ASN A ND2   1 
ATOM   3779 N N     . THR C 3 396 ? 10.148  9.032   34.895  1.00 35.38 ? 570  THR A N     1 
ATOM   3780 C CA    . THR C 3 396 ? 9.744   7.861   34.108  1.00 35.45 ? 570  THR A CA    1 
ATOM   3781 C C     . THR C 3 396 ? 9.403   6.663   34.954  1.00 32.26 ? 570  THR A C     1 
ATOM   3782 O O     . THR C 3 396 ? 8.445   5.945   34.663  1.00 31.43 ? 570  THR A O     1 
ATOM   3783 C CB    . THR C 3 396 ? 10.811  7.484   33.032  1.00 36.89 ? 570  THR A CB    1 
ATOM   3784 O OG1   . THR C 3 396 ? 12.103  7.481   33.627  1.00 34.12 ? 570  THR A OG1   1 
ATOM   3785 C CG2   . THR C 3 396 ? 10.817  8.514   31.890  1.00 35.88 ? 570  THR A CG2   1 
ATOM   3786 N N     . GLY C 3 397 ? 10.142  6.509   36.045  1.00 29.49 ? 571  GLY A N     1 
ATOM   3787 C CA    . GLY C 3 397 ? 9.883   5.411   36.947  1.00 27.99 ? 571  GLY A CA    1 
ATOM   3788 C C     . GLY C 3 397 ? 8.480   5.582   37.482  1.00 28.17 ? 571  GLY A C     1 
ATOM   3789 O O     . GLY C 3 397 ? 7.619   4.732   37.354  1.00 29.94 ? 571  GLY A O     1 
ATOM   3790 N N     . ILE C 3 398 ? 8.214   6.732   38.066  1.00 28.36 ? 572  ILE A N     1 
ATOM   3791 C CA    . ILE C 3 398 ? 6.890   6.981   38.583  1.00 33.01 ? 572  ILE A CA    1 
ATOM   3792 C C     . ILE C 3 398 ? 5.841   6.736   37.518  1.00 34.13 ? 572  ILE A C     1 
ATOM   3793 O O     . ILE C 3 398 ? 4.962   5.898   37.683  1.00 37.60 ? 572  ILE A O     1 
ATOM   3794 C CB    . ILE C 3 398 ? 6.773   8.412   39.081  1.00 33.63 ? 572  ILE A CB    1 
ATOM   3795 C CG1   . ILE C 3 398 ? 7.604   8.569   40.351  1.00 35.52 ? 572  ILE A CG1   1 
ATOM   3796 C CG2   . ILE C 3 398 ? 5.330   8.769   39.339  1.00 30.84 ? 572  ILE A CG2   1 
ATOM   3797 C CD1   . ILE C 3 398 ? 7.804   10.015  40.755  1.00 45.70 ? 572  ILE A CD1   1 
ATOM   3798 N N     . LEU C 3 399 ? 5.971   7.433   36.394  1.00 34.47 ? 573  LEU A N     1 
ATOM   3799 C CA    . LEU C 3 399 ? 4.996   7.288   35.327  1.00 36.22 ? 573  LEU A CA    1 
ATOM   3800 C C     . LEU C 3 399 ? 4.760   5.848   34.905  1.00 38.74 ? 573  LEU A C     1 
ATOM   3801 O O     . LEU C 3 399 ? 3.618   5.381   34.865  1.00 40.06 ? 573  LEU A O     1 
ATOM   3802 C CB    . LEU C 3 399 ? 5.384   8.117   34.107  1.00 39.63 ? 573  LEU A CB    1 
ATOM   3803 C CG    . LEU C 3 399 ? 4.306   8.102   33.014  1.00 36.29 ? 573  LEU A CG    1 
ATOM   3804 C CD1   . LEU C 3 399 ? 2.995   8.602   33.564  1.00 36.86 ? 573  LEU A CD1   1 
ATOM   3805 C CD2   . LEU C 3 399 ? 4.715   8.946   31.854  1.00 37.45 ? 573  LEU A CD2   1 
ATOM   3806 N N     . ASN C 3 400 ? 5.841   5.152   34.576  1.00 38.55 ? 574  ASN A N     1 
ATOM   3807 C CA    . ASN C 3 400 ? 5.721   3.778   34.138  1.00 40.18 ? 574  ASN A CA    1 
ATOM   3808 C C     . ASN C 3 400 ? 5.117   2.846   35.184  1.00 41.74 ? 574  ASN A C     1 
ATOM   3809 O O     . ASN C 3 400 ? 4.357   1.925   34.853  1.00 41.15 ? 574  ASN A O     1 
ATOM   3810 C CB    . ASN C 3 400 ? 7.063   3.296   33.622  1.00 41.75 ? 574  ASN A CB    1 
ATOM   3811 C CG    . ASN C 3 400 ? 7.312   3.730   32.195  1.00 41.96 ? 574  ASN A CG    1 
ATOM   3812 O OD1   . ASN C 3 400 ? 6.368   3.871   31.413  1.00 39.20 ? 574  ASN A OD1   1 
ATOM   3813 N ND2   . ASN C 3 400 ? 8.564   3.955   31.827  1.00 40.42 ? 574  ASN A ND2   1 
ATOM   3814 N N     . LYS C 3 401 ? 5.379   3.144   36.445  1.00 40.38 ? 575  LYS A N     1 
ATOM   3815 C CA    . LYS C 3 401 ? 4.832   2.360   37.533  1.00 41.54 ? 575  LYS A CA    1 
ATOM   3816 C C     . LYS C 3 401 ? 3.328   2.462   37.399  1.00 38.68 ? 575  LYS A C     1 
ATOM   3817 O O     . LYS C 3 401 ? 2.632   1.454   37.394  1.00 42.16 ? 575  LYS A O     1 
ATOM   3818 C CB    . LYS C 3 401 ? 5.269   2.934   38.880  1.00 44.96 ? 575  LYS A CB    1 
ATOM   3819 C CG    . LYS C 3 401 ? 4.412   2.494   40.077  1.00 57.06 ? 575  LYS A CG    1 
ATOM   3820 C CD    . LYS C 3 401 ? 4.441   0.985   40.335  1.00 66.71 ? 575  LYS A CD    1 
ATOM   3821 C CE    . LYS C 3 401 ? 5.819   0.506   40.818  1.00 74.55 ? 575  LYS A CE    1 
ATOM   3822 N NZ    . LYS C 3 401 ? 5.961   -0.999  40.863  1.00 81.70 ? 575  LYS A NZ    1 
ATOM   3823 N N     . HIS C 3 402 ? 2.849   3.679   37.209  1.00 38.84 ? 576  HIS A N     1 
ATOM   3824 C CA    . HIS C 3 402 ? 1.428   3.921   37.078  1.00 41.68 ? 576  HIS A CA    1 
ATOM   3825 C C     . HIS C 3 402 ? 0.841   3.209   35.856  1.00 41.29 ? 576  HIS A C     1 
ATOM   3826 O O     . HIS C 3 402 ? -0.231  2.605   35.921  1.00 41.07 ? 576  HIS A O     1 
ATOM   3827 C CB    . HIS C 3 402 ? 1.186   5.423   37.015  1.00 41.76 ? 576  HIS A CB    1 
ATOM   3828 C CG    . HIS C 3 402 ? -0.254  5.790   36.809  1.00 48.15 ? 576  HIS A CG    1 
ATOM   3829 N ND1   . HIS C 3 402 ? -1.252  5.412   37.685  1.00 50.95 ? 576  HIS A ND1   1 
ATOM   3830 C CD2   . HIS C 3 402 ? -0.862  6.513   35.841  1.00 45.65 ? 576  HIS A CD2   1 
ATOM   3831 C CE1   . HIS C 3 402 ? -2.404  5.888   37.264  1.00 51.75 ? 576  HIS A CE1   1 
ATOM   3832 N NE2   . HIS C 3 402 ? -2.192  6.562   36.145  1.00 51.26 ? 576  HIS A NE2   1 
ATOM   3833 N N     . LEU C 3 403 ? 1.512   3.329   34.725  1.00 40.22 ? 577  LEU A N     1 
ATOM   3834 C CA    . LEU C 3 403 ? 1.049   2.694   33.495  1.00 39.30 ? 577  LEU A CA    1 
ATOM   3835 C C     . LEU C 3 403 ? 0.917   1.193   33.697  1.00 42.51 ? 577  LEU A C     1 
ATOM   3836 O O     . LEU C 3 403 ? -0.040  0.582   33.242  1.00 40.65 ? 577  LEU A O     1 
ATOM   3837 C CB    . LEU C 3 403 ? 2.023   2.968   32.364  1.00 35.58 ? 577  LEU A CB    1 
ATOM   3838 C CG    . LEU C 3 403 ? 1.914   4.390   31.858  1.00 36.65 ? 577  LEU A CG    1 
ATOM   3839 C CD1   . LEU C 3 403 ? 3.029   4.649   30.867  1.00 41.02 ? 577  LEU A CD1   1 
ATOM   3840 C CD2   . LEU C 3 403 ? 0.577   4.597   31.218  1.00 35.83 ? 577  LEU A CD2   1 
ATOM   3841 N N     . GLN C 3 404 ? 1.891   0.617   34.379  1.00 42.45 ? 578  GLN A N     1 
ATOM   3842 C CA    . GLN C 3 404 ? 1.879   -0.796  34.655  1.00 46.59 ? 578  GLN A CA    1 
ATOM   3843 C C     . GLN C 3 404 ? 0.647   -1.143  35.476  1.00 49.10 ? 578  GLN A C     1 
ATOM   3844 O O     . GLN C 3 404 ? -0.015  -2.166  35.252  1.00 51.81 ? 578  GLN A O     1 
ATOM   3845 C CB    . GLN C 3 404 ? 3.132   -1.171  35.423  1.00 44.77 ? 578  GLN A CB    1 
ATOM   3846 C CG    . GLN C 3 404 ? 4.292   -1.504  34.515  1.00 50.21 ? 578  GLN A CG    1 
ATOM   3847 C CD    . GLN C 3 404 ? 4.086   -2.811  33.760  1.00 53.02 ? 578  GLN A CD    1 
ATOM   3848 O OE1   . GLN C 3 404 ? 3.141   -3.579  34.034  1.00 50.30 ? 578  GLN A OE1   1 
ATOM   3849 N NE2   . GLN C 3 404 ? 4.971   -3.092  32.800  1.00 51.69 ? 578  GLN A NE2   1 
ATOM   3850 N N     . ASP C 3 405 ? 0.327   -0.263  36.405  1.00 51.60 ? 579  ASP A N     1 
ATOM   3851 C CA    . ASP C 3 405 ? -0.807  -0.471  37.279  1.00 54.97 ? 579  ASP A CA    1 
ATOM   3852 C C     . ASP C 3 405 ? -2.071  -0.425  36.455  1.00 53.78 ? 579  ASP A C     1 
ATOM   3853 O O     . ASP C 3 405 ? -3.063  -1.055  36.824  1.00 56.00 ? 579  ASP A O     1 
ATOM   3854 C CB    . ASP C 3 405 ? -0.824  0.595   38.394  1.00 62.49 ? 579  ASP A CB    1 
ATOM   3855 C CG    . ASP C 3 405 ? -1.777  0.256   39.550  1.00 68.04 ? 579  ASP A CG    1 
ATOM   3856 O OD1   . ASP C 3 405 ? -2.522  -0.746  39.453  1.00 74.52 ? 579  ASP A OD1   1 
ATOM   3857 O OD2   . ASP C 3 405 ? -1.786  0.997   40.562  1.00 72.53 ? 579  ASP A OD2   1 
ATOM   3858 N N     . LEU C 3 406 ? -2.037  0.294   35.341  1.00 49.72 ? 580  LEU A N     1 
ATOM   3859 C CA    . LEU C 3 406 ? -3.218  0.412   34.489  1.00 49.51 ? 580  LEU A CA    1 
ATOM   3860 C C     . LEU C 3 406 ? -3.353  -0.764  33.539  1.00 49.84 ? 580  LEU A C     1 
ATOM   3861 O O     . LEU C 3 406 ? -4.453  -1.114  33.077  1.00 48.44 ? 580  LEU A O     1 
ATOM   3862 C CB    . LEU C 3 406 ? -3.180  1.716   33.690  1.00 49.70 ? 580  LEU A CB    1 
ATOM   3863 C CG    . LEU C 3 406 ? -3.076  3.034   34.455  1.00 48.28 ? 580  LEU A CG    1 
ATOM   3864 C CD1   . LEU C 3 406 ? -3.692  4.158   33.613  1.00 45.30 ? 580  LEU A CD1   1 
ATOM   3865 C CD2   . LEU C 3 406 ? -3.797  2.914   35.795  1.00 50.64 ? 580  LEU A CD2   1 
ATOM   3866 N N     . MET C 3 407 ? -2.219  -1.349  33.213  1.00 48.22 ? 581  MET A N     1 
ATOM   3867 C CA    . MET C 3 407 ? -2.209  -2.469  32.312  1.00 47.08 ? 581  MET A CA    1 
ATOM   3868 C C     . MET C 3 407 ? -0.818  -3.056  32.310  1.00 46.55 ? 581  MET A C     1 
ATOM   3869 O O     . MET C 3 407 ? 0.154   -2.382  31.968  1.00 44.18 ? 581  MET A O     1 
ATOM   3870 C CB    . MET C 3 407 ? -2.612  -2.032  30.907  1.00 40.52 ? 581  MET A CB    1 
ATOM   3871 C CG    . MET C 3 407 ? -2.509  -3.139  29.886  1.00 46.52 ? 581  MET A CG    1 
ATOM   3872 S SD    . MET C 3 407 ? -2.113  -2.516  28.221  1.00 53.77 ? 581  MET A SD    1 
ATOM   3873 C CE    . MET C 3 407 ? -0.874  -3.664  27.654  1.00 51.90 ? 581  MET A CE    1 
ATOM   3874 N N     . GLU C 3 408 ? -0.748  -4.327  32.670  1.00 47.17 ? 582  GLU A N     1 
ATOM   3875 C CA    . GLU C 3 408 ? 0.504   -5.067  32.727  1.00 47.59 ? 582  GLU A CA    1 
ATOM   3876 C C     . GLU C 3 408 ? 1.230   -5.021  31.390  1.00 46.30 ? 582  GLU A C     1 
ATOM   3877 O O     . GLU C 3 408 ? 0.673   -5.390  30.362  1.00 47.41 ? 582  GLU A O     1 
ATOM   3878 C CB    . GLU C 3 408 ? 0.242   -6.521  33.133  1.00 47.57 ? 582  GLU A CB    1 
ATOM   3879 N N     . GLY C 3 409 ? 2.472   -4.583  31.414  1.00 42.77 ? 583  GLY A N     1 
ATOM   3880 C CA    . GLY C 3 409 ? 3.240   -4.506  30.193  1.00 42.91 ? 583  GLY A CA    1 
ATOM   3881 C C     . GLY C 3 409 ? 3.195   -3.128  29.561  1.00 41.12 ? 583  GLY A C     1 
ATOM   3882 O O     . GLY C 3 409 ? 3.911   -2.883  28.593  1.00 44.11 ? 583  GLY A O     1 
ATOM   3883 N N     . LEU C 3 410 ? 2.384   -2.228  30.093  1.00 37.73 ? 584  LEU A N     1 
ATOM   3884 C CA    . LEU C 3 410 ? 2.286   -0.900  29.517  1.00 38.39 ? 584  LEU A CA    1 
ATOM   3885 C C     . LEU C 3 410 ? 3.357   0.084   29.996  1.00 41.13 ? 584  LEU A C     1 
ATOM   3886 O O     . LEU C 3 410 ? 3.411   0.406   31.195  1.00 45.52 ? 584  LEU A O     1 
ATOM   3887 C CB    . LEU C 3 410 ? 0.891   -0.303  29.764  1.00 40.36 ? 584  LEU A CB    1 
ATOM   3888 C CG    . LEU C 3 410 ? 0.688   1.102   29.165  1.00 37.58 ? 584  LEU A CG    1 
ATOM   3889 C CD1   . LEU C 3 410 ? 0.694   1.005   27.655  1.00 38.10 ? 584  LEU A CD1   1 
ATOM   3890 C CD2   . LEU C 3 410 ? -0.587  1.769   29.625  1.00 35.14 ? 584  LEU A CD2   1 
ATOM   3891 N N     . THR C 3 411 ? 4.190   0.558   29.070  1.00 37.63 ? 585  THR A N     1 
ATOM   3892 C CA    . THR C 3 411 ? 5.213   1.562   29.370  1.00 34.77 ? 585  THR A CA    1 
ATOM   3893 C C     . THR C 3 411 ? 5.003   2.676   28.377  1.00 28.68 ? 585  THR A C     1 
ATOM   3894 O O     . THR C 3 411 ? 4.245   2.524   27.421  1.00 30.34 ? 585  THR A O     1 
ATOM   3895 C CB    . THR C 3 411 ? 6.663   1.048   29.250  1.00 37.88 ? 585  THR A CB    1 
ATOM   3896 O OG1   . THR C 3 411 ? 6.954   0.718   27.891  1.00 41.55 ? 585  THR A OG1   1 
ATOM   3897 C CG2   . THR C 3 411 ? 6.884   -0.176  30.150  1.00 37.40 ? 585  THR A CG2   1 
ATOM   3898 N N     . ALA C 3 412 ? 5.648   3.797   28.606  1.00 25.24 ? 586  ALA A N     1 
ATOM   3899 C CA    . ALA C 3 412 ? 5.490   4.947   27.741  1.00 26.73 ? 586  ALA A CA    1 
ATOM   3900 C C     . ALA C 3 412 ? 5.687   4.657   26.268  1.00 29.27 ? 586  ALA A C     1 
ATOM   3901 O O     . ALA C 3 412 ? 4.843   4.994   25.430  1.00 35.49 ? 586  ALA A O     1 
ATOM   3902 C CB    . ALA C 3 412 ? 6.429   6.021   28.165  1.00 33.37 ? 586  ALA A CB    1 
ATOM   3903 N N     . LYS C 3 413 ? 6.763   3.967   25.957  1.00 28.41 ? 587  LYS A N     1 
ATOM   3904 C CA    . LYS C 3 413 ? 7.071   3.701   24.584  1.00 28.06 ? 587  LYS A CA    1 
ATOM   3905 C C     . LYS C 3 413 ? 6.009   2.955   23.862  1.00 28.82 ? 587  LYS A C     1 
ATOM   3906 O O     . LYS C 3 413 ? 5.948   3.009   22.646  1.00 32.05 ? 587  LYS A O     1 
ATOM   3907 C CB    . LYS C 3 413 ? 8.366   2.954   24.501  1.00 33.93 ? 587  LYS A CB    1 
ATOM   3908 C CG    . LYS C 3 413 ? 8.277   1.504   24.794  1.00 44.12 ? 587  LYS A CG    1 
ATOM   3909 C CD    . LYS C 3 413 ? 9.502   0.835   24.179  1.00 54.69 ? 587  LYS A CD    1 
ATOM   3910 C CE    . LYS C 3 413 ? 9.242   -0.644  23.877  1.00 67.25 ? 587  LYS A CE    1 
ATOM   3911 N NZ    . LYS C 3 413 ? 10.289  -1.326  23.040  1.00 72.03 ? 587  LYS A NZ    1 
ATOM   3912 N N     . VAL C 3 414 ? 5.139   2.271   24.596  1.00 27.58 ? 588  VAL A N     1 
ATOM   3913 C CA    . VAL C 3 414 ? 4.078   1.527   23.928  1.00 30.93 ? 588  VAL A CA    1 
ATOM   3914 C C     . VAL C 3 414 ? 3.121   2.489   23.203  1.00 32.81 ? 588  VAL A C     1 
ATOM   3915 O O     . VAL C 3 414 ? 2.514   2.154   22.176  1.00 32.02 ? 588  VAL A O     1 
ATOM   3916 C CB    . VAL C 3 414 ? 3.325   0.619   24.901  1.00 30.16 ? 588  VAL A CB    1 
ATOM   3917 C CG1   . VAL C 3 414 ? 2.343   -0.278  24.142  1.00 29.27 ? 588  VAL A CG1   1 
ATOM   3918 C CG2   . VAL C 3 414 ? 4.333   -0.245  25.656  1.00 30.53 ? 588  VAL A CG2   1 
ATOM   3919 N N     . PHE C 3 415 ? 2.996   3.699   23.718  1.00 29.09 ? 589  PHE A N     1 
ATOM   3920 C CA    . PHE C 3 415 ? 2.131   4.651   23.056  1.00 37.87 ? 589  PHE A CA    1 
ATOM   3921 C C     . PHE C 3 415 ? 2.628   5.016   21.654  1.00 41.29 ? 589  PHE A C     1 
ATOM   3922 O O     . PHE C 3 415 ? 1.833   5.281   20.746  1.00 45.59 ? 589  PHE A O     1 
ATOM   3923 C CB    . PHE C 3 415 ? 1.953   5.890   23.923  1.00 36.00 ? 589  PHE A CB    1 
ATOM   3924 C CG    . PHE C 3 415 ? 0.948   5.706   25.036  1.00 40.74 ? 589  PHE A CG    1 
ATOM   3925 C CD1   . PHE C 3 415 ? 1.246   4.914   26.134  1.00 44.88 ? 589  PHE A CD1   1 
ATOM   3926 C CD2   . PHE C 3 415 ? -0.277  6.361   25.004  1.00 42.34 ? 589  PHE A CD2   1 
ATOM   3927 C CE1   . PHE C 3 415 ? 0.325   4.758   27.177  1.00 48.42 ? 589  PHE A CE1   1 
ATOM   3928 C CE2   . PHE C 3 415 ? -1.200  6.211   26.040  1.00 43.19 ? 589  PHE A CE2   1 
ATOM   3929 C CZ    . PHE C 3 415 ? -0.893  5.417   27.134  1.00 44.97 ? 589  PHE A CZ    1 
ATOM   3930 N N     . ARG C 3 416 ? 3.944   5.001   21.459  1.00 41.10 ? 590  ARG A N     1 
ATOM   3931 C CA    . ARG C 3 416 ? 4.500   5.336   20.151  1.00 40.43 ? 590  ARG A CA    1 
ATOM   3932 C C     . ARG C 3 416 ? 4.219   4.221   19.182  1.00 39.22 ? 590  ARG A C     1 
ATOM   3933 O O     . ARG C 3 416 ? 3.934   4.476   18.019  1.00 39.60 ? 590  ARG A O     1 
ATOM   3934 C CB    . ARG C 3 416 ? 6.004   5.543   20.210  1.00 41.11 ? 590  ARG A CB    1 
ATOM   3935 C CG    . ARG C 3 416 ? 6.463   6.465   21.302  1.00 49.59 ? 590  ARG A CG    1 
ATOM   3936 C CD    . ARG C 3 416 ? 7.898   6.877   21.056  1.00 55.26 ? 590  ARG A CD    1 
ATOM   3937 N NE    . ARG C 3 416 ? 7.989   7.837   19.960  1.00 57.85 ? 590  ARG A NE    1 
ATOM   3938 C CZ    . ARG C 3 416 ? 9.126   8.237   19.416  1.00 60.71 ? 590  ARG A CZ    1 
ATOM   3939 N NH1   . ARG C 3 416 ? 10.265  7.743   19.864  1.00 66.34 ? 590  ARG A NH1   1 
ATOM   3940 N NH2   . ARG C 3 416 ? 9.132   9.162   18.464  1.00 61.63 ? 590  ARG A NH2   1 
ATOM   3941 N N     . THR C 3 417 ? 4.348   2.989   19.645  1.00 32.88 ? 591  THR A N     1 
ATOM   3942 C CA    . THR C 3 417 ? 4.093   1.860   18.770  1.00 36.96 ? 591  THR A CA    1 
ATOM   3943 C C     . THR C 3 417 ? 2.604   1.880   18.410  1.00 42.11 ? 591  THR A C     1 
ATOM   3944 O O     . THR C 3 417 ? 2.221   1.888   17.225  1.00 46.25 ? 591  THR A O     1 
ATOM   3945 C CB    . THR C 3 417 ? 4.422   0.512   19.465  1.00 32.09 ? 591  THR A CB    1 
ATOM   3946 O OG1   . THR C 3 417 ? 5.738   0.559   19.969  1.00 27.55 ? 591  THR A OG1   1 
ATOM   3947 C CG2   . THR C 3 417 ? 4.367   -0.640  18.496  1.00 24.95 ? 591  THR A CG2   1 
ATOM   3948 N N     . TYR C 3 418 ? 1.773   1.930   19.439  1.00 43.75 ? 592  TYR A N     1 
ATOM   3949 C CA    . TYR C 3 418 ? 0.343   1.914   19.240  1.00 46.08 ? 592  TYR A CA    1 
ATOM   3950 C C     . TYR C 3 418 ? -0.157  3.014   18.316  1.00 43.55 ? 592  TYR A C     1 
ATOM   3951 O O     . TYR C 3 418 ? -0.964  2.755   17.415  1.00 42.98 ? 592  TYR A O     1 
ATOM   3952 C CB    . TYR C 3 418 ? -0.384  1.940   20.591  1.00 52.78 ? 592  TYR A CB    1 
ATOM   3953 C CG    . TYR C 3 418 ? -1.776  2.533   20.521  1.00 56.83 ? 592  TYR A CG    1 
ATOM   3954 C CD1   . TYR C 3 418 ? -2.888  1.742   20.189  1.00 56.19 ? 592  TYR A CD1   1 
ATOM   3955 C CD2   . TYR C 3 418 ? -1.962  3.899   20.730  1.00 57.10 ? 592  TYR A CD2   1 
ATOM   3956 C CE1   . TYR C 3 418 ? -4.151  2.311   20.064  1.00 56.97 ? 592  TYR A CE1   1 
ATOM   3957 C CE2   . TYR C 3 418 ? -3.205  4.477   20.607  1.00 60.50 ? 592  TYR A CE2   1 
ATOM   3958 C CZ    . TYR C 3 418 ? -4.301  3.684   20.276  1.00 61.16 ? 592  TYR A CZ    1 
ATOM   3959 O OH    . TYR C 3 418 ? -5.529  4.299   20.172  1.00 66.81 ? 592  TYR A OH    1 
ATOM   3960 N N     . ASN C 3 419 ? 0.280   4.240   18.574  1.00 37.82 ? 593  ASN A N     1 
ATOM   3961 C CA    . ASN C 3 419 ? -0.158  5.358   17.752  1.00 39.89 ? 593  ASN A CA    1 
ATOM   3962 C C     . ASN C 3 419 ? 0.251   5.212   16.320  1.00 38.83 ? 593  ASN A C     1 
ATOM   3963 O O     . ASN C 3 419 ? -0.495  5.552   15.432  1.00 38.44 ? 593  ASN A O     1 
ATOM   3964 C CB    . ASN C 3 419 ? 0.382   6.667   18.278  1.00 46.09 ? 593  ASN A CB    1 
ATOM   3965 C CG    . ASN C 3 419 ? -0.403  7.176   19.454  1.00 50.54 ? 593  ASN A CG    1 
ATOM   3966 O OD1   . ASN C 3 419 ? -0.802  6.421   20.341  1.00 56.18 ? 593  ASN A OD1   1 
ATOM   3967 N ND2   . ASN C 3 419 ? -0.638  8.468   19.464  1.00 51.83 ? 593  ASN A ND2   1 
ATOM   3968 N N     . ALA C 3 420 ? 1.451   4.721   16.106  1.00 37.51 ? 594  ALA A N     1 
ATOM   3969 C CA    . ALA C 3 420 ? 1.952   4.549   14.759  1.00 39.48 ? 594  ALA A CA    1 
ATOM   3970 C C     . ALA C 3 420 ? 1.260   3.416   14.027  1.00 39.67 ? 594  ALA A C     1 
ATOM   3971 O O     . ALA C 3 420 ? 0.916   3.528   12.840  1.00 39.74 ? 594  ALA A O     1 
ATOM   3972 C CB    . ALA C 3 420 ? 3.471   4.290   14.790  1.00 38.56 ? 594  ALA A CB    1 
ATOM   3973 N N     . SER C 3 421 ? 1.082   2.312   14.719  1.00 37.76 ? 595  SER A N     1 
ATOM   3974 C CA    . SER C 3 421 ? 0.484   1.178   14.071  1.00 41.52 ? 595  SER A CA    1 
ATOM   3975 C C     . SER C 3 421 ? -0.953  1.424   13.641  1.00 43.28 ? 595  SER A C     1 
ATOM   3976 O O     . SER C 3 421 ? -1.308  1.197   12.482  1.00 44.77 ? 595  SER A O     1 
ATOM   3977 C CB    . SER C 3 421 ? 0.629   -0.068  14.941  1.00 43.72 ? 595  SER A CB    1 
ATOM   3978 O OG    . SER C 3 421 ? 1.994   -0.499  15.014  1.00 40.54 ? 595  SER A OG    1 
ATOM   3979 N N     . ILE C 3 422 ? -1.753  1.967   14.546  1.00 44.54 ? 596  ILE A N     1 
ATOM   3980 C CA    . ILE C 3 422 ? -3.150  2.231   14.261  1.00 46.44 ? 596  ILE A CA    1 
ATOM   3981 C C     . ILE C 3 422 ? -3.367  3.198   13.098  1.00 46.97 ? 596  ILE A C     1 
ATOM   3982 O O     . ILE C 3 422 ? -4.259  3.005   12.258  1.00 49.85 ? 596  ILE A O     1 
ATOM   3983 C CB    . ILE C 3 422 ? -3.887  2.728   15.527  1.00 47.58 ? 596  ILE A CB    1 
ATOM   3984 C CG1   . ILE C 3 422 ? -5.393  2.494   15.368  1.00 52.25 ? 596  ILE A CG1   1 
ATOM   3985 C CG2   . ILE C 3 422 ? -3.601  4.198   15.781  1.00 42.75 ? 596  ILE A CG2   1 
ATOM   3986 C CD1   . ILE C 3 422 ? -5.778  1.033   15.026  1.00 52.19 ? 596  ILE A CD1   1 
ATOM   3987 N N     . THR C 3 423 ? -2.527  4.214   13.038  1.00 46.09 ? 597  THR A N     1 
ATOM   3988 C CA    . THR C 3 423 ? -2.629  5.221   12.002  1.00 45.98 ? 597  THR A CA    1 
ATOM   3989 C C     . THR C 3 423 ? -2.439  4.646   10.627  1.00 47.61 ? 597  THR A C     1 
ATOM   3990 O O     . THR C 3 423 ? -3.201  4.945   9.708   1.00 46.43 ? 597  THR A O     1 
ATOM   3991 C CB    . THR C 3 423 ? -1.577  6.264   12.202  1.00 46.25 ? 597  THR A CB    1 
ATOM   3992 O OG1   . THR C 3 423 ? -1.768  6.860   13.488  1.00 45.57 ? 597  THR A OG1   1 
ATOM   3993 C CG2   . THR C 3 423 ? -1.668  7.321   11.120  1.00 45.07 ? 597  THR A CG2   1 
ATOM   3994 N N     . LEU C 3 424 ? -1.364  3.885   10.475  1.00 47.11 ? 598  LEU A N     1 
ATOM   3995 C CA    . LEU C 3 424 ? -1.094  3.279   9.205   1.00 45.28 ? 598  LEU A CA    1 
ATOM   3996 C C     . LEU C 3 424 ? -2.250  2.357   8.874   1.00 43.14 ? 598  LEU A C     1 
ATOM   3997 O O     . LEU C 3 424 ? -2.720  2.358   7.751   1.00 46.77 ? 598  LEU A O     1 
ATOM   3998 C CB    . LEU C 3 424 ? 0.208   2.485   9.235   1.00 48.76 ? 598  LEU A CB    1 
ATOM   3999 C CG    . LEU C 3 424 ? 0.561   1.824   7.892   1.00 50.97 ? 598  LEU A CG    1 
ATOM   4000 C CD1   . LEU C 3 424 ? 1.122   2.869   6.925   1.00 50.85 ? 598  LEU A CD1   1 
ATOM   4001 C CD2   . LEU C 3 424 ? 1.552   0.678   8.094   1.00 49.79 ? 598  LEU A CD2   1 
ATOM   4002 N N     . GLN C 3 425 ? -2.733  1.591   9.848   1.00 38.43 ? 599  GLN A N     1 
ATOM   4003 C CA    . GLN C 3 425 ? -3.828  0.683   9.557   1.00 40.15 ? 599  GLN A CA    1 
ATOM   4004 C C     . GLN C 3 425 ? -5.042  1.394   9.027   1.00 43.54 ? 599  GLN A C     1 
ATOM   4005 O O     . GLN C 3 425 ? -5.616  1.010   8.023   1.00 44.14 ? 599  GLN A O     1 
ATOM   4006 C CB    . GLN C 3 425 ? -4.244  -0.125  10.771  1.00 36.43 ? 599  GLN A CB    1 
ATOM   4007 C CG    . GLN C 3 425 ? -5.355  -1.093  10.425  1.00 36.93 ? 599  GLN A CG    1 
ATOM   4008 C CD    . GLN C 3 425 ? -5.354  -2.317  11.291  1.00 37.12 ? 599  GLN A CD    1 
ATOM   4009 O OE1   . GLN C 3 425 ? -5.872  -2.300  12.403  1.00 43.18 ? 599  GLN A OE1   1 
ATOM   4010 N NE2   . GLN C 3 425 ? -4.786  -3.403  10.785  1.00 37.87 ? 599  GLN A NE2   1 
ATOM   4011 N N     . GLN C 3 426 ? -5.452  2.437   9.720   1.00 44.99 ? 600  GLN A N     1 
ATOM   4012 C CA    . GLN C 3 426 ? -6.619  3.164   9.295   1.00 48.25 ? 600  GLN A CA    1 
ATOM   4013 C C     . GLN C 3 426 ? -6.404  4.000   8.030   1.00 48.41 ? 600  GLN A C     1 
ATOM   4014 O O     . GLN C 3 426 ? -7.320  4.148   7.229   1.00 51.16 ? 600  GLN A O     1 
ATOM   4015 C CB    . GLN C 3 426 ? -7.131  3.971   10.470  1.00 49.29 ? 600  GLN A CB    1 
ATOM   4016 C CG    . GLN C 3 426 ? -8.185  4.951   10.131  1.00 57.86 ? 600  GLN A CG    1 
ATOM   4017 C CD    . GLN C 3 426 ? -7.607  6.342   9.916   1.00 64.15 ? 600  GLN A CD    1 
ATOM   4018 O OE1   . GLN C 3 426 ? -6.438  6.617   10.254  1.00 67.47 ? 600  GLN A OE1   1 
ATOM   4019 N NE2   . GLN C 3 426 ? -8.428  7.240   9.387   1.00 68.90 ? 600  GLN A NE2   1 
ATOM   4020 N N     . GLN C 3 427 ? -5.202  4.546   7.847   1.00 48.96 ? 601  GLN A N     1 
ATOM   4021 C CA    . GLN C 3 427 ? -4.912  5.337   6.656   1.00 47.95 ? 601  GLN A CA    1 
ATOM   4022 C C     . GLN C 3 427 ? -4.789  4.423   5.446   1.00 49.43 ? 601  GLN A C     1 
ATOM   4023 O O     . GLN C 3 427 ? -4.827  4.870   4.313   1.00 50.67 ? 601  GLN A O     1 
ATOM   4024 C CB    . GLN C 3 427 ? -3.619  6.113   6.819   1.00 48.08 ? 601  GLN A CB    1 
ATOM   4025 C CG    . GLN C 3 427 ? -3.717  7.247   7.771   1.00 52.87 ? 601  GLN A CG    1 
ATOM   4026 C CD    . GLN C 3 427 ? -4.717  8.281   7.331   1.00 57.12 ? 601  GLN A CD    1 
ATOM   4027 O OE1   . GLN C 3 427 ? -4.514  8.978   6.335   1.00 61.58 ? 601  GLN A OE1   1 
ATOM   4028 N NE2   . GLN C 3 427 ? -5.807  8.411   8.082   1.00 60.83 ? 601  GLN A NE2   1 
ATOM   4029 N N     . LEU C 3 428 ? -4.535  3.152   5.692   1.00 51.43 ? 602  LEU A N     1 
ATOM   4030 C CA    . LEU C 3 428 ? -4.427  2.205   4.596   1.00 56.33 ? 602  LEU A CA    1 
ATOM   4031 C C     . LEU C 3 428 ? -5.810  1.827   4.112   1.00 59.38 ? 602  LEU A C     1 
ATOM   4032 O O     . LEU C 3 428 ? -6.019  1.590   2.920   1.00 65.44 ? 602  LEU A O     1 
ATOM   4033 C CB    . LEU C 3 428 ? -3.670  0.943   5.020   1.00 56.12 ? 602  LEU A CB    1 
ATOM   4034 C CG    . LEU C 3 428 ? -2.157  1.007   4.805   1.00 57.22 ? 602  LEU A CG    1 
ATOM   4035 C CD1   . LEU C 3 428 ? -1.497  -0.297  5.255   1.00 57.56 ? 602  LEU A CD1   1 
ATOM   4036 C CD2   . LEU C 3 428 ? -1.864  1.285   3.339   1.00 56.94 ? 602  LEU A CD2   1 
ATOM   4037 N N     . LYS C 3 429 ? -6.772  1.802   5.018   1.00 56.79 ? 603  LYS A N     1 
ATOM   4038 C CA    . LYS C 3 429 ? -8.086  1.431   4.585   1.00 55.50 ? 603  LYS A CA    1 
ATOM   4039 C C     . LYS C 3 429 ? -8.620  2.628   3.837   1.00 55.65 ? 603  LYS A C     1 
ATOM   4040 O O     . LYS C 3 429 ? -9.014  2.514   2.679   1.00 55.56 ? 603  LYS A O     1 
ATOM   4041 C CB    . LYS C 3 429 ? -8.985  1.095   5.762   1.00 55.90 ? 603  LYS A CB    1 
ATOM   4042 C CG    . LYS C 3 429 ? -9.760  -0.195  5.553   1.00 60.62 ? 603  LYS A CG    1 
ATOM   4043 C CD    . LYS C 3 429 ? -11.158 -0.091  6.071   1.00 63.71 ? 603  LYS A CD    1 
ATOM   4044 C CE    . LYS C 3 429 ? -11.178 0.570   7.422   1.00 70.31 ? 603  LYS A CE    1 
ATOM   4045 N NZ    . LYS C 3 429 ? -11.929 1.833   7.293   1.00 74.79 ? 603  LYS A NZ    1 
ATOM   4046 N N     . GLU C 3 430 ? -8.497  3.795   4.466   1.00 55.01 ? 604  GLU A N     1 
ATOM   4047 C CA    . GLU C 3 430 ? -9.005  5.042   3.909   1.00 55.35 ? 604  GLU A CA    1 
ATOM   4048 C C     . GLU C 3 430 ? -8.395  5.506   2.597   1.00 55.00 ? 604  GLU A C     1 
ATOM   4049 O O     . GLU C 3 430 ? -9.067  6.140   1.783   1.00 60.58 ? 604  GLU A O     1 
ATOM   4050 C CB    . GLU C 3 430 ? -8.919  6.184   4.936   1.00 53.72 ? 604  GLU A CB    1 
ATOM   4051 C CG    . GLU C 3 430 ? -9.463  7.526   4.409   1.00 57.91 ? 604  GLU A CG    1 
ATOM   4052 C CD    . GLU C 3 430 ? -9.363  8.679   5.402   1.00 61.69 ? 604  GLU A CD    1 
ATOM   4053 O OE1   . GLU C 3 430 ? -8.888  8.446   6.538   1.00 68.19 ? 604  GLU A OE1   1 
ATOM   4054 O OE2   . GLU C 3 430 ? -9.749  9.822   5.056   1.00 58.52 ? 604  GLU A OE2   1 
ATOM   4055 N N     . LEU C 3 431 ? -7.127  5.215   2.369   1.00 52.77 ? 605  LEU A N     1 
ATOM   4056 C CA    . LEU C 3 431 ? -6.521  5.701   1.146   1.00 55.50 ? 605  LEU A CA    1 
ATOM   4057 C C     . LEU C 3 431 ? -6.335  4.693   0.043   1.00 55.38 ? 605  LEU A C     1 
ATOM   4058 O O     . LEU C 3 431 ? -6.138  5.065   -1.109  1.00 55.49 ? 605  LEU A O     1 
ATOM   4059 C CB    . LEU C 3 431 ? -5.208  6.399   1.464   1.00 58.87 ? 605  LEU A CB    1 
ATOM   4060 C CG    . LEU C 3 431 ? -5.415  7.586   2.405   1.00 63.43 ? 605  LEU A CG    1 
ATOM   4061 C CD1   . LEU C 3 431 ? -4.079  8.094   2.883   1.00 64.45 ? 605  LEU A CD1   1 
ATOM   4062 C CD2   . LEU C 3 431 ? -6.191  8.679   1.694   1.00 64.64 ? 605  LEU A CD2   1 
ATOM   4063 N N     . THR C 3 432 ? -6.403  3.420   0.373   1.00 55.49 ? 606  THR A N     1 
ATOM   4064 C CA    . THR C 3 432 ? -6.219  2.428   -0.656  1.00 55.79 ? 606  THR A CA    1 
ATOM   4065 C C     . THR C 3 432 ? -7.360  2.484   -1.647  1.00 59.77 ? 606  THR A C     1 
ATOM   4066 O O     . THR C 3 432 ? -8.528  2.401   -1.273  1.00 63.60 ? 606  THR A O     1 
ATOM   4067 C CB    . THR C 3 432 ? -6.093  1.041   -0.057  1.00 54.93 ? 606  THR A CB    1 
ATOM   4068 O OG1   . THR C 3 432 ? -4.817  0.941   0.573   1.00 54.74 ? 606  THR A OG1   1 
ATOM   4069 C CG2   . THR C 3 432 ? -6.187  -0.020  -1.128  1.00 49.97 ? 606  THR A CG2   1 
ATOM   4070 N N     . ALA C 3 433 ? -7.021  2.705   -2.911  1.00 60.20 ? 607  ALA A N     1 
ATOM   4071 C CA    . ALA C 3 433 ? -8.005  2.760   -3.977  1.00 63.24 ? 607  ALA A CA    1 
ATOM   4072 C C     . ALA C 3 433 ? -8.396  1.320   -4.334  1.00 66.91 ? 607  ALA A C     1 
ATOM   4073 O O     . ALA C 3 433 ? -7.603  0.601   -4.941  1.00 70.42 ? 607  ALA A O     1 
ATOM   4074 C CB    . ALA C 3 433 ? -7.410  3.441   -5.189  1.00 62.43 ? 607  ALA A CB    1 
ATOM   4075 N N     . PRO C 3 434 ? -9.646  0.899   -4.006  1.00 69.12 ? 608  PRO A N     1 
ATOM   4076 C CA    . PRO C 3 434 ? -10.138 -0.467  -4.269  1.00 68.54 ? 608  PRO A CA    1 
ATOM   4077 C C     . PRO C 3 434 ? -10.085 -0.969  -5.703  1.00 68.77 ? 608  PRO A C     1 
ATOM   4078 O O     . PRO C 3 434 ? -10.410 -2.137  -5.946  1.00 71.30 ? 608  PRO A O     1 
ATOM   4079 C CB    . PRO C 3 434 ? -11.588 -0.461  -3.778  1.00 68.94 ? 608  PRO A CB    1 
ATOM   4080 C CG    . PRO C 3 434 ? -11.874 0.911   -3.285  1.00 70.41 ? 608  PRO A CG    1 
ATOM   4081 C CD    . PRO C 3 434 ? -10.691 1.796   -3.475  1.00 70.60 ? 608  PRO A CD    1 
ATOM   4082 N N     . ASP C 3 435 ? -9.699  -0.110  -6.631  1.00 69.44 ? 609  ASP A N     1 
ATOM   4083 C CA    . ASP C 3 435 ? -9.629  -0.471  -8.046  1.00 73.18 ? 609  ASP A CA    1 
ATOM   4084 C C     . ASP C 3 435 ? -8.339  0.141   -8.577  1.00 73.01 ? 609  ASP A C     1 
ATOM   4085 O O     . ASP C 3 435 ? -8.302  0.775   -9.649  1.00 68.85 ? 609  ASP A O     1 
ATOM   4086 C CB    . ASP C 3 435 ? -10.846 0.102   -8.800  1.00 79.14 ? 609  ASP A CB    1 
ATOM   4087 C CG    . ASP C 3 435 ? -12.177 -0.045  -8.020  1.00 82.92 ? 609  ASP A CG    1 
ATOM   4088 O OD1   . ASP C 3 435 ? -12.530 0.866   -7.220  1.00 85.60 ? 609  ASP A OD1   1 
ATOM   4089 O OD2   . ASP C 3 435 ? -12.885 -1.061  -8.228  1.00 84.11 ? 609  ASP A OD2   1 
ATOM   4090 N N     . GLU C 3 436 ? -7.263  -0.154  -7.869  1.00 76.06 ? 610  GLU A N     1 
ATOM   4091 C CA    . GLU C 3 436 ? -5.980  0.406   -8.213  1.00 77.93 ? 610  GLU A CA    1 
ATOM   4092 C C     . GLU C 3 436 ? -4.993  -0.413  -9.020  1.00 79.37 ? 610  GLU A C     1 
ATOM   4093 O O     . GLU C 3 436 ? -5.212  -1.597  -9.343  1.00 81.26 ? 610  GLU A O     1 
ATOM   4094 C CB    . GLU C 3 436 ? -5.294  0.875   -6.946  1.00 80.55 ? 610  GLU A CB    1 
ATOM   4095 N N     . ASN C 3 437 ? -3.924  0.283   -9.385  1.00 79.80 ? 611  ASN A N     1 
ATOM   4096 C CA    . ASN C 3 437 ? -2.807  -0.276  -10.122 1.00 78.70 ? 611  ASN A CA    1 
ATOM   4097 C C     . ASN C 3 437 ? -1.675  -0.459  -9.106  1.00 76.80 ? 611  ASN A C     1 
ATOM   4098 O O     . ASN C 3 437 ? -1.276  0.466   -8.359  1.00 73.49 ? 611  ASN A O     1 
ATOM   4099 C CB    . ASN C 3 437 ? -2.386  0.608   -11.308 1.00 80.84 ? 611  ASN A CB    1 
ATOM   4100 C CG    . ASN C 3 437 ? -2.034  2.023   -10.908 1.00 85.65 ? 611  ASN A CG    1 
ATOM   4101 O OD1   . ASN C 3 437 ? -2.698  2.635   -10.057 1.00 90.25 ? 611  ASN A OD1   1 
ATOM   4102 N ND2   . ASN C 3 437 ? -1.015  2.597   -11.547 1.00 85.74 ? 611  ASN A ND2   1 
ATOM   4103 N N     . ILE C 3 438 ? -1.248  -1.704  -9.049  1.00 73.78 ? 612  ILE A N     1 
ATOM   4104 C CA    . ILE C 3 438 ? -0.207  -2.165  -8.161  1.00 72.08 ? 612  ILE A CA    1 
ATOM   4105 C C     . ILE C 3 438 ? 0.787   -1.046  -7.767  1.00 72.14 ? 612  ILE A C     1 
ATOM   4106 O O     . ILE C 3 438 ? 0.945   -0.775  -6.575  1.00 72.66 ? 612  ILE A O     1 
ATOM   4107 C CB    . ILE C 3 438 ? 0.395   -3.489  -8.750  1.00 69.94 ? 612  ILE A CB    1 
ATOM   4108 C CG1   . ILE C 3 438 ? -0.748  -4.369  -9.301  1.00 67.38 ? 612  ILE A CG1   1 
ATOM   4109 C CG2   . ILE C 3 438 ? 1.087   -4.316  -7.679  1.00 73.29 ? 612  ILE A CG2   1 
ATOM   4110 C CD1   . ILE C 3 438 ? -1.935  -4.564  -8.357  1.00 59.26 ? 612  ILE A CD1   1 
ATOM   4111 N N     . PRO C 3 439 ? 1.360   -0.282  -8.741  1.00 71.94 ? 613  PRO A N     1 
ATOM   4112 C CA    . PRO C 3 439 ? 2.296   0.776   -8.334  1.00 73.16 ? 613  PRO A CA    1 
ATOM   4113 C C     . PRO C 3 439 ? 1.683   1.978   -7.581  1.00 73.87 ? 613  PRO A C     1 
ATOM   4114 O O     . PRO C 3 439 ? 2.304   2.507   -6.627  1.00 77.36 ? 613  PRO A O     1 
ATOM   4115 C CB    . PRO C 3 439 ? 2.968   1.240   -9.638  1.00 71.43 ? 613  PRO A CB    1 
ATOM   4116 C CG    . PRO C 3 439 ? 2.312   0.533   -10.720 1.00 72.96 ? 613  PRO A CG    1 
ATOM   4117 C CD    . PRO C 3 439 ? 1.326   -0.482  -10.203 1.00 72.13 ? 613  PRO A CD    1 
ATOM   4118 N N     . ALA C 3 440 ? 0.511   2.437   -8.028  1.00 70.17 ? 614  ALA A N     1 
ATOM   4119 C CA    . ALA C 3 440 ? -0.159  3.586   -7.383  1.00 66.89 ? 614  ALA A CA    1 
ATOM   4120 C C     . ALA C 3 440 ? -0.616  3.243   -5.987  1.00 63.12 ? 614  ALA A C     1 
ATOM   4121 O O     . ALA C 3 440 ? -0.663  4.107   -5.103  1.00 62.41 ? 614  ALA A O     1 
ATOM   4122 C CB    . ALA C 3 440 ? -1.323  4.025   -8.175  1.00 65.77 ? 614  ALA A CB    1 
ATOM   4123 N N     . LYS C 3 441 ? -1.060  2.011   -5.836  1.00 59.06 ? 615  LYS A N     1 
ATOM   4124 C CA    . LYS C 3 441 ? -1.478  1.540   -4.533  1.00 58.58 ? 615  LYS A CA    1 
ATOM   4125 C C     . LYS C 3 441 ? -0.278  1.606   -3.616  1.00 59.14 ? 615  LYS A C     1 
ATOM   4126 O O     . LYS C 3 441 ? -0.413  1.869   -2.417  1.00 61.69 ? 615  LYS A O     1 
ATOM   4127 C CB    . LYS C 3 441 ? -1.966  0.116   -4.621  1.00 53.18 ? 615  LYS A CB    1 
ATOM   4128 C CG    . LYS C 3 441 ? -3.450  0.092   -4.713  1.00 52.88 ? 615  LYS A CG    1 
ATOM   4129 C CD    . LYS C 3 441 ? -4.036  -1.258  -4.426  1.00 53.12 ? 615  LYS A CD    1 
ATOM   4130 C CE    . LYS C 3 441 ? -5.556  -1.205  -4.512  1.00 60.50 ? 615  LYS A CE    1 
ATOM   4131 N NZ    . LYS C 3 441 ? -6.236  -2.523  -4.310  1.00 65.35 ? 615  LYS A NZ    1 
ATOM   4132 N N     . ILE C 3 442 ? 0.878   1.273   -4.173  1.00 57.41 ? 616  ILE A N     1 
ATOM   4133 C CA    . ILE C 3 442 ? 2.114   1.332   -3.432  1.00 58.17 ? 616  ILE A CA    1 
ATOM   4134 C C     . ILE C 3 442 ? 2.273   2.798   -3.040  1.00 59.04 ? 616  ILE A C     1 
ATOM   4135 O O     . ILE C 3 442 ? 2.836   3.119   -1.991  1.00 62.80 ? 616  ILE A O     1 
ATOM   4136 C CB    . ILE C 3 442 ? 3.283   0.806   -4.295  1.00 58.43 ? 616  ILE A CB    1 
ATOM   4137 C CG1   . ILE C 3 442 ? 3.149   -0.708  -4.455  1.00 59.60 ? 616  ILE A CG1   1 
ATOM   4138 C CG2   . ILE C 3 442 ? 4.627   1.099   -3.667  1.00 59.41 ? 616  ILE A CG2   1 
ATOM   4139 C CD1   . ILE C 3 442 ? 4.327   -1.372  -5.180  1.00 63.45 ? 616  ILE A CD1   1 
ATOM   4140 N N     . LEU C 3 443 ? 1.729   3.689   -3.860  1.00 59.23 ? 617  LEU A N     1 
ATOM   4141 C CA    . LEU C 3 443 ? 1.788   5.103   -3.543  1.00 62.49 ? 617  LEU A CA    1 
ATOM   4142 C C     . LEU C 3 443 ? 0.872   5.274   -2.358  1.00 62.69 ? 617  LEU A C     1 
ATOM   4143 O O     . LEU C 3 443 ? 1.220   5.934   -1.375  1.00 63.89 ? 617  LEU A O     1 
ATOM   4144 C CB    . LEU C 3 443 ? 1.302   5.973   -4.707  1.00 70.66 ? 617  LEU A CB    1 
ATOM   4145 C CG    . LEU C 3 443 ? 2.308   6.249   -5.839  1.00 77.86 ? 617  LEU A CG    1 
ATOM   4146 C CD1   . LEU C 3 443 ? 1.841   7.448   -6.703  1.00 82.53 ? 617  LEU A CD1   1 
ATOM   4147 C CD2   . LEU C 3 443 ? 3.684   6.557   -5.221  1.00 81.66 ? 617  LEU A CD2   1 
ATOM   4148 N N     . SER C 3 444 ? -0.313  4.697   -2.481  1.00 59.26 ? 618  SER A N     1 
ATOM   4149 C CA    . SER C 3 444 ? -1.280  4.753   -1.409  1.00 57.78 ? 618  SER A CA    1 
ATOM   4150 C C     . SER C 3 444 ? -0.563  4.288   -0.176  1.00 57.12 ? 618  SER A C     1 
ATOM   4151 O O     . SER C 3 444 ? -0.699  4.891   0.881   1.00 61.25 ? 618  SER A O     1 
ATOM   4152 C CB    . SER C 3 444 ? -2.449  3.829   -1.687  1.00 59.00 ? 618  SER A CB    1 
ATOM   4153 O OG    . SER C 3 444 ? -3.304  4.422   -2.639  1.00 63.27 ? 618  SER A OG    1 
ATOM   4154 N N     . TYR C 3 445 ? 0.243   3.247   -0.325  1.00 54.30 ? 619  TYR A N     1 
ATOM   4155 C CA    . TYR C 3 445 ? 0.983   2.742   0.800   1.00 54.45 ? 619  TYR A CA    1 
ATOM   4156 C C     . TYR C 3 445 ? 1.867   3.854   1.358   1.00 53.21 ? 619  TYR A C     1 
ATOM   4157 O O     . TYR C 3 445 ? 1.926   4.044   2.566   1.00 52.87 ? 619  TYR A O     1 
ATOM   4158 C CB    . TYR C 3 445 ? 1.817   1.517   0.411   1.00 55.84 ? 619  TYR A CB    1 
ATOM   4159 C CG    . TYR C 3 445 ? 2.447   0.840   1.609   1.00 61.54 ? 619  TYR A CG    1 
ATOM   4160 C CD1   . TYR C 3 445 ? 1.744   -0.118  2.341   1.00 62.89 ? 619  TYR A CD1   1 
ATOM   4161 C CD2   . TYR C 3 445 ? 3.738   1.166   2.024   1.00 62.26 ? 619  TYR A CD2   1 
ATOM   4162 C CE1   . TYR C 3 445 ? 2.316   -0.735  3.460   1.00 63.35 ? 619  TYR A CE1   1 
ATOM   4163 C CE2   . TYR C 3 445 ? 4.314   0.562   3.134   1.00 65.14 ? 619  TYR A CE2   1 
ATOM   4164 C CZ    . TYR C 3 445 ? 3.603   -0.388  3.840   1.00 66.04 ? 619  TYR A CZ    1 
ATOM   4165 O OH    . TYR C 3 445 ? 4.219   -1.002  4.893   1.00 70.53 ? 619  TYR A OH    1 
ATOM   4166 N N     . ASN C 3 446 ? 2.524   4.596   0.483   1.00 52.94 ? 620  ASN A N     1 
ATOM   4167 C CA    . ASN C 3 446 ? 3.392   5.676   0.926   1.00 53.88 ? 620  ASN A CA    1 
ATOM   4168 C C     . ASN C 3 446 ? 2.604   6.813   1.520   1.00 53.79 ? 620  ASN A C     1 
ATOM   4169 O O     . ASN C 3 446 ? 3.060   7.506   2.434   1.00 50.21 ? 620  ASN A O     1 
ATOM   4170 C CB    . ASN C 3 446 ? 4.230   6.195   -0.235  1.00 57.26 ? 620  ASN A CB    1 
ATOM   4171 C CG    . ASN C 3 446 ? 5.457   5.353   -0.475  1.00 59.87 ? 620  ASN A CG    1 
ATOM   4172 O OD1   . ASN C 3 446 ? 5.477   4.157   -0.146  1.00 57.25 ? 620  ASN A OD1   1 
ATOM   4173 N ND2   . ASN C 3 446 ? 6.508   5.972   -1.031  1.00 63.35 ? 620  ASN A ND2   1 
ATOM   4174 N N     . ARG C 3 447 ? 1.435   7.047   0.951   1.00 54.03 ? 621  ARG A N     1 
ATOM   4175 C CA    . ARG C 3 447 ? 0.627   8.118   1.459   1.00 56.20 ? 621  ARG A CA    1 
ATOM   4176 C C     . ARG C 3 447 ? 0.172   7.738   2.840   1.00 53.01 ? 621  ARG A C     1 
ATOM   4177 O O     . ARG C 3 447 ? 0.304   8.535   3.756   1.00 55.16 ? 621  ARG A O     1 
ATOM   4178 C CB    . ARG C 3 447 ? -0.524  8.454   0.505   1.00 60.56 ? 621  ARG A CB    1 
ATOM   4179 C CG    . ARG C 3 447 ? -0.015  9.181   -0.746  1.00 67.85 ? 621  ARG A CG    1 
ATOM   4180 C CD    . ARG C 3 447 ? -1.135  9.620   -1.670  1.00 74.22 ? 621  ARG A CD    1 
ATOM   4181 N NE    . ARG C 3 447 ? -2.136  8.560   -1.853  1.00 83.55 ? 621  ARG A NE    1 
ATOM   4182 C CZ    . ARG C 3 447 ? -2.834  8.367   -2.969  1.00 87.57 ? 621  ARG A CZ    1 
ATOM   4183 N NH1   . ARG C 3 447 ? -2.644  9.156   -4.025  1.00 94.35 ? 621  ARG A NH1   1 
ATOM   4184 N NH2   . ARG C 3 447 ? -3.755  7.402   -3.027  1.00 88.30 ? 621  ARG A NH2   1 
ATOM   4185 N N     . ALA C 3 448 ? -0.268  6.501   3.011   1.00 53.09 ? 622  ALA A N     1 
ATOM   4186 C CA    . ALA C 3 448 ? -0.729  6.057   4.323   1.00 53.41 ? 622  ALA A CA    1 
ATOM   4187 C C     . ALA C 3 448 ? 0.494   6.099   5.203   1.00 55.58 ? 622  ALA A C     1 
ATOM   4188 O O     . ALA C 3 448 ? 0.477   6.591   6.337   1.00 54.20 ? 622  ALA A O     1 
ATOM   4189 C CB    . ALA C 3 448 ? -1.266  4.647   4.247   1.00 49.93 ? 622  ALA A CB    1 
ATOM   4190 N N     . ASN C 3 449 ? 1.579   5.671   4.609   1.00 55.98 ? 623  ASN A N     1 
ATOM   4191 C CA    . ASN C 3 449 ? 2.824   5.603   5.292   1.00 59.06 ? 623  ASN A CA    1 
ATOM   4192 C C     . ASN C 3 449 ? 3.384   6.982   5.554   1.00 64.09 ? 623  ASN A C     1 
ATOM   4193 O O     . ASN C 3 449 ? 4.450   7.094   6.166   1.00 67.81 ? 623  ASN A O     1 
ATOM   4194 C CB    . ASN C 3 449 ? 3.794   4.794   4.457   1.00 64.17 ? 623  ASN A CB    1 
ATOM   4195 C CG    . ASN C 3 449 ? 4.916   4.216   5.258   1.00 68.45 ? 623  ASN A CG    1 
ATOM   4196 O OD1   . ASN C 3 449 ? 4.730   3.264   6.036   1.00 69.51 ? 623  ASN A OD1   1 
ATOM   4197 N ND2   . ASN C 3 449 ? 6.131   4.741   5.046   1.00 72.90 ? 623  ASN A ND2   1 
ATOM   4198 N N     . ARG C 3 450 ? 2.710   8.035   5.088   1.00 65.61 ? 624  ARG A N     1 
ATOM   4199 C CA    . ARG C 3 450 ? 3.242   9.378   5.335   1.00 65.77 ? 624  ARG A CA    1 
ATOM   4200 C C     . ARG C 3 450 ? 2.859   9.948   6.691   1.00 66.64 ? 624  ARG A C     1 
ATOM   4201 O O     . ARG C 3 450 ? 3.732   10.275  7.485   1.00 68.45 ? 624  ARG A O     1 
ATOM   4202 C CB    . ARG C 3 450 ? 2.859   10.354  4.228   1.00 64.95 ? 624  ARG A CB    1 
ATOM   4203 N N     . ALA C 3 451 ? 1.565   10.105  6.946   1.00 67.53 ? 625  ALA A N     1 
ATOM   4204 C CA    . ALA C 3 451 ? 1.098   10.653  8.227   1.00 68.40 ? 625  ALA A CA    1 
ATOM   4205 C C     . ALA C 3 451 ? 1.573   9.874   9.453   1.00 69.14 ? 625  ALA A C     1 
ATOM   4206 O O     . ALA C 3 451 ? 1.541   10.410  10.565  1.00 68.24 ? 625  ALA A O     1 
ATOM   4207 C CB    . ALA C 3 451 ? -0.413  10.794  8.241   1.00 70.82 ? 625  ALA A CB    1 
ATOM   4208 N N     . VAL C 3 452 ? 1.881   8.596   9.272   1.00 70.20 ? 626  VAL A N     1 
ATOM   4209 C CA    . VAL C 3 452 ? 2.441   7.777   10.356  1.00 72.47 ? 626  VAL A CA    1 
ATOM   4210 C C     . VAL C 3 452 ? 3.814   8.499   10.572  1.00 73.73 ? 626  VAL A C     1 
ATOM   4211 O O     . VAL C 3 452 ? 4.260   8.951   11.670  1.00 77.59 ? 626  VAL A O     1 
ATOM   4212 C CB    . VAL C 3 452 ? 2.562   6.304   9.804   1.00 72.74 ? 626  VAL A CB    1 
ATOM   4213 C CG1   . VAL C 3 452 ? 3.923   6.032   9.170   1.00 75.82 ? 626  VAL A CG1   1 
ATOM   4214 C CG2   . VAL C 3 452 ? 2.198   5.292   10.850  1.00 74.29 ? 626  VAL A CG2   1 
ATOM   4215 N N     . LYS C 3 546 ? 8.256   3.974   10.381  1.00 68.84 ? 720  LYS A N     1 
ATOM   4216 C CA    . LYS C 3 546 ? 9.560   3.242   10.458  1.00 69.71 ? 720  LYS A CA    1 
ATOM   4217 C C     . LYS C 3 546 ? 9.348   1.777   10.839  1.00 66.69 ? 720  LYS A C     1 
ATOM   4218 O O     . LYS C 3 546 ? 8.407   1.440   11.571  1.00 68.88 ? 720  LYS A O     1 
ATOM   4219 C CB    . LYS C 3 546 ? 10.522  3.917   11.456  1.00 71.35 ? 720  LYS A CB    1 
ATOM   4220 N N     . LEU C 3 547 ? 10.255  0.933   10.347  1.00 61.91 ? 721  LEU A N     1 
ATOM   4221 C CA    . LEU C 3 547 ? 10.228  -0.499  10.584  1.00 54.88 ? 721  LEU A CA    1 
ATOM   4222 C C     . LEU C 3 547 ? 10.258  -0.842  12.067  1.00 52.08 ? 721  LEU A C     1 
ATOM   4223 O O     . LEU C 3 547 ? 10.439  -1.994  12.413  1.00 56.29 ? 721  LEU A O     1 
ATOM   4224 C CB    . LEU C 3 547 ? 11.442  -1.149  9.911   1.00 57.72 ? 721  LEU A CB    1 
ATOM   4225 N N     . ASN C 3 548 ? 10.178  0.165   12.934  1.00 45.57 ? 722  ASN A N     1 
ATOM   4226 C CA    . ASN C 3 548 ? 10.232  -0.101  14.354  1.00 42.30 ? 722  ASN A CA    1 
ATOM   4227 C C     . ASN C 3 548 ? 8.945   0.093   15.089  1.00 42.06 ? 722  ASN A C     1 
ATOM   4228 O O     . ASN C 3 548 ? 8.712   -0.568  16.074  1.00 40.44 ? 722  ASN A O     1 
ATOM   4229 C CB    . ASN C 3 548 ? 11.319  0.741   15.039  1.00 44.06 ? 722  ASN A CB    1 
ATOM   4230 C CG    . ASN C 3 548 ? 12.732  0.274   14.703  1.00 46.51 ? 722  ASN A CG    1 
ATOM   4231 O OD1   . ASN C 3 548 ? 13.244  -0.684  15.283  1.00 46.91 ? 722  ASN A OD1   1 
ATOM   4232 N ND2   . ASN C 3 548 ? 13.388  0.989   13.785  1.00 49.10 ? 722  ASN A ND2   1 
HETATM 4233 N N     . PTR C 3 549 ? 8.096   1.029   14.648  1.00 40.91 ? 723  PTR A N     1 
HETATM 4234 C CA    . PTR C 3 549 ? 6.862   1.254   15.380  1.00 39.12 ? 723  PTR A CA    1 
HETATM 4235 C C     . PTR C 3 549 ? 5.616   0.757   14.692  1.00 36.53 ? 723  PTR A C     1 
HETATM 4236 O O     . PTR C 3 549 ? 4.508   1.018   15.134  1.00 36.31 ? 723  PTR A O     1 
HETATM 4237 C CB    . PTR C 3 549 ? 6.710   2.745   15.699  1.00 41.80 ? 723  PTR A CB    1 
HETATM 4238 C CG    . PTR C 3 549 ? 7.851   3.305   16.527  1.00 45.61 ? 723  PTR A CG    1 
HETATM 4239 C CD1   . PTR C 3 549 ? 8.947   3.918   15.927  1.00 46.15 ? 723  PTR A CD1   1 
HETATM 4240 C CD2   . PTR C 3 549 ? 7.845   3.196   17.913  1.00 48.96 ? 723  PTR A CD2   1 
HETATM 4241 C CE1   . PTR C 3 549 ? 10.016  4.402   16.696  1.00 48.42 ? 723  PTR A CE1   1 
HETATM 4242 C CE2   . PTR C 3 549 ? 8.894   3.676   18.684  1.00 50.57 ? 723  PTR A CE2   1 
HETATM 4243 C CZ    . PTR C 3 549 ? 9.980   4.271   18.082  1.00 50.49 ? 723  PTR A CZ    1 
HETATM 4244 O OH    . PTR C 3 549 ? 10.988  4.667   18.942  1.00 50.29 ? 723  PTR A OH    1 
HETATM 4245 P P     . PTR C 3 549 ? 12.156  5.486   18.535  1.00 50.60 ? 723  PTR A P     1 
HETATM 4246 O O1P   . PTR C 3 549 ? 11.457  6.540   17.719  1.00 48.43 ? 723  PTR A O1P   1 
HETATM 4247 O O2P   . PTR C 3 549 ? 12.640  5.906   19.875  1.00 46.15 ? 723  PTR A O2P   1 
HETATM 4248 O O3P   . PTR C 3 549 ? 13.106  4.489   17.705  1.00 43.02 ? 723  PTR A O3P   1 
ATOM   4249 N N     . LEU C 3 550 ? 5.813   -0.005  13.626  1.00 38.50 ? 724  LEU A N     1 
ATOM   4250 C CA    . LEU C 3 550 ? 4.711   -0.499  12.827  1.00 34.79 ? 724  LEU A CA    1 
ATOM   4251 C C     . LEU C 3 550 ? 4.554   -2.002  12.825  1.00 37.38 ? 724  LEU A C     1 
ATOM   4252 O O     . LEU C 3 550 ? 5.446   -2.713  12.410  1.00 33.84 ? 724  LEU A O     1 
ATOM   4253 C CB    . LEU C 3 550 ? 4.910   -0.016  11.395  1.00 38.26 ? 724  LEU A CB    1 
ATOM   4254 C CG    . LEU C 3 550 ? 5.066   1.506   11.262  1.00 40.67 ? 724  LEU A CG    1 
ATOM   4255 C CD1   . LEU C 3 550 ? 5.475   1.852   9.851   1.00 43.55 ? 724  LEU A CD1   1 
ATOM   4256 C CD2   . LEU C 3 550 ? 3.786   2.229   11.666  1.00 34.45 ? 724  LEU A CD2   1 
ATOM   4257 N N     . ASP C 3 551 ? 3.418   -2.499  13.308  1.00 37.01 ? 725  ASP A N     1 
ATOM   4258 C CA    . ASP C 3 551 ? 3.212   -3.931  13.295  1.00 34.79 ? 725  ASP A CA    1 
ATOM   4259 C C     . ASP C 3 551 ? 3.215   -4.319  11.838  1.00 35.49 ? 725  ASP A C     1 
ATOM   4260 O O     . ASP C 3 551 ? 2.260   -4.093  11.129  1.00 39.26 ? 725  ASP A O     1 
ATOM   4261 C CB    . ASP C 3 551 ? 1.876   -4.298  13.912  1.00 38.60 ? 725  ASP A CB    1 
ATOM   4262 C CG    . ASP C 3 551 ? 1.645   -5.813  13.971  1.00 45.66 ? 725  ASP A CG    1 
ATOM   4263 O OD1   . ASP C 3 551 ? 2.293   -6.571  13.216  1.00 46.61 ? 725  ASP A OD1   1 
ATOM   4264 O OD2   . ASP C 3 551 ? 0.804   -6.259  14.784  1.00 45.23 ? 725  ASP A OD2   1 
ATOM   4265 N N     . PRO C 3 552 ? 4.217   -5.068  11.434  1.00 36.18 ? 726  PRO A N     1 
ATOM   4266 C CA    . PRO C 3 552 ? 4.381   -5.535  10.055  1.00 36.68 ? 726  PRO A CA    1 
ATOM   4267 C C     . PRO C 3 552 ? 3.189   -6.323  9.508   1.00 35.99 ? 726  PRO A C     1 
ATOM   4268 O O     . PRO C 3 552 ? 2.961   -6.387  8.301   1.00 31.81 ? 726  PRO A O     1 
ATOM   4269 C CB    . PRO C 3 552 ? 5.641   -6.396  10.154  1.00 42.19 ? 726  PRO A CB    1 
ATOM   4270 C CG    . PRO C 3 552 ? 5.566   -6.928  11.577  1.00 37.34 ? 726  PRO A CG    1 
ATOM   4271 C CD    . PRO C 3 552 ? 5.179   -5.704  12.343  1.00 32.98 ? 726  PRO A CD    1 
ATOM   4272 N N     . ARG C 3 553 ? 2.487   -7.008  10.406  1.00 36.36 ? 727  ARG A N     1 
ATOM   4273 C CA    . ARG C 3 553 ? 1.326   -7.797  10.029  1.00 36.46 ? 727  ARG A CA    1 
ATOM   4274 C C     . ARG C 3 553 ? 0.347   -6.916  9.302   1.00 41.56 ? 727  ARG A C     1 
ATOM   4275 O O     . ARG C 3 553 ? -0.374  -7.375  8.437   1.00 48.52 ? 727  ARG A O     1 
ATOM   4276 C CB    . ARG C 3 553 ? 0.647   -8.397  11.263  1.00 32.83 ? 727  ARG A CB    1 
ATOM   4277 C CG    . ARG C 3 553 ? 1.397   -9.573  11.873  1.00 37.16 ? 727  ARG A CG    1 
ATOM   4278 C CD    . ARG C 3 553 ? 0.782   -10.045 13.188  1.00 38.44 ? 727  ARG A CD    1 
ATOM   4279 N NE    . ARG C 3 553 ? 0.927   -9.065  14.257  1.00 32.82 ? 727  ARG A NE    1 
ATOM   4280 C CZ    . ARG C 3 553 ? 0.768   -9.331  15.542  1.00 30.75 ? 727  ARG A CZ    1 
ATOM   4281 N NH1   . ARG C 3 553 ? 0.457   -10.542 15.957  1.00 30.77 ? 727  ARG A NH1   1 
ATOM   4282 N NH2   . ARG C 3 553 ? 0.908   -8.365  16.422  1.00 37.08 ? 727  ARG A NH2   1 
ATOM   4283 N N     . ILE C 3 554 ? 0.302   -5.662  9.686   1.00 42.82 ? 728  ILE A N     1 
ATOM   4284 C CA    . ILE C 3 554 ? -0.608  -4.726  9.060   1.00 44.10 ? 728  ILE A CA    1 
ATOM   4285 C C     . ILE C 3 554 ? -0.320  -4.612  7.559   1.00 45.67 ? 728  ILE A C     1 
ATOM   4286 O O     . ILE C 3 554 ? -1.220  -4.660  6.730   1.00 44.97 ? 728  ILE A O     1 
ATOM   4287 C CB    . ILE C 3 554 ? -0.490  -3.345  9.735   1.00 46.89 ? 728  ILE A CB    1 
ATOM   4288 C CG1   . ILE C 3 554 ? -0.945  -3.426  11.197  1.00 47.07 ? 728  ILE A CG1   1 
ATOM   4289 C CG2   . ILE C 3 554 ? -1.312  -2.306  8.979   1.00 49.55 ? 728  ILE A CG2   1 
ATOM   4290 C CD1   . ILE C 3 554 ? -0.729  -2.141  11.982  1.00 45.93 ? 728  ILE A CD1   1 
ATOM   4291 N N     . THR C 3 555 ? 0.945   -4.483  7.214   1.00 45.18 ? 729  THR A N     1 
ATOM   4292 C CA    . THR C 3 555 ? 1.311   -4.354  5.825   1.00 43.75 ? 729  THR A CA    1 
ATOM   4293 C C     . THR C 3 555 ? 1.197   -5.689  5.179   1.00 45.20 ? 729  THR A C     1 
ATOM   4294 O O     . THR C 3 555 ? 1.001   -5.782  3.965   1.00 45.69 ? 729  THR A O     1 
ATOM   4295 C CB    . THR C 3 555 ? 2.723   -3.822  5.689   1.00 45.16 ? 729  THR A CB    1 
ATOM   4296 O OG1   . THR C 3 555 ? 2.696   -2.441  6.036   1.00 48.34 ? 729  THR A OG1   1 
ATOM   4297 C CG2   . THR C 3 555 ? 3.230   -3.949  4.265   1.00 46.20 ? 729  THR A CG2   1 
ATOM   4298 N N     . VAL C 3 556 ? 1.342   -6.731  5.984   1.00 48.81 ? 730  VAL A N     1 
ATOM   4299 C CA    . VAL C 3 556 ? 1.247   -8.083  5.464   1.00 53.30 ? 730  VAL A CA    1 
ATOM   4300 C C     . VAL C 3 556 ? -0.194  -8.314  5.024   1.00 57.89 ? 730  VAL A C     1 
ATOM   4301 O O     . VAL C 3 556 ? -0.433  -8.853  3.932   1.00 59.82 ? 730  VAL A O     1 
ATOM   4302 C CB    . VAL C 3 556 ? 1.699   -9.145  6.504   1.00 54.07 ? 730  VAL A CB    1 
ATOM   4303 C CG1   . VAL C 3 556 ? 1.209   -10.533 6.119   1.00 50.40 ? 730  VAL A CG1   1 
ATOM   4304 C CG2   . VAL C 3 556 ? 3.222   -9.169  6.586   1.00 56.97 ? 730  VAL A CG2   1 
ATOM   4305 N N     . ALA C 3 557 ? -1.145  -7.836  5.826   1.00 57.53 ? 731  ALA A N     1 
ATOM   4306 C CA    . ALA C 3 557 ? -2.571  -8.015  5.512   1.00 60.29 ? 731  ALA A CA    1 
ATOM   4307 C C     . ALA C 3 557 ? -2.949  -7.312  4.218   1.00 59.55 ? 731  ALA A C     1 
ATOM   4308 O O     . ALA C 3 557 ? -3.422  -7.933  3.270   1.00 61.28 ? 731  ALA A O     1 
ATOM   4309 C CB    . ALA C 3 557 ? -3.461  -7.514  6.663   1.00 62.03 ? 731  ALA A CB    1 
ATOM   4310 N N     . TRP C 3 558 ? -2.656  -6.026  4.168   1.00 57.59 ? 732  TRP A N     1 
ATOM   4311 C CA    . TRP C 3 558 ? -2.961  -5.205  3.019   1.00 58.13 ? 732  TRP A CA    1 
ATOM   4312 C C     . TRP C 3 558 ? -2.428  -5.765  1.691   1.00 61.05 ? 732  TRP A C     1 
ATOM   4313 O O     . TRP C 3 558 ? -3.133  -5.745  0.672   1.00 63.10 ? 732  TRP A O     1 
ATOM   4314 C CB    . TRP C 3 558 ? -2.393  -3.829  3.286   1.00 54.33 ? 732  TRP A CB    1 
ATOM   4315 C CG    . TRP C 3 558 ? -2.647  -2.836  2.266   1.00 46.03 ? 732  TRP A CG    1 
ATOM   4316 C CD1   . TRP C 3 558 ? -3.702  -2.003  2.203   1.00 46.14 ? 732  TRP A CD1   1 
ATOM   4317 C CD2   . TRP C 3 558 ? -1.735  -2.423  1.253   1.00 46.07 ? 732  TRP A CD2   1 
ATOM   4318 N NE1   . TRP C 3 558 ? -3.505  -1.073  1.223   1.00 48.22 ? 732  TRP A NE1   1 
ATOM   4319 C CE2   . TRP C 3 558 ? -2.304  -1.313  0.614   1.00 43.22 ? 732  TRP A CE2   1 
ATOM   4320 C CE3   . TRP C 3 558 ? -0.493  -2.890  0.816   1.00 45.48 ? 732  TRP A CE3   1 
ATOM   4321 C CZ2   . TRP C 3 558 ? -1.660  -0.624  -0.415  1.00 44.42 ? 732  TRP A CZ2   1 
ATOM   4322 C CZ3   . TRP C 3 558 ? 0.154   -2.205  -0.208  1.00 45.97 ? 732  TRP A CZ3   1 
ATOM   4323 C CH2   . TRP C 3 558 ? -0.439  -1.089  -0.823  1.00 45.78 ? 732  TRP A CH2   1 
ATOM   4324 N N     . CYS C 3 559 ? -1.181  -6.224  1.695   1.00 60.93 ? 733  CYS A N     1 
ATOM   4325 C CA    . CYS C 3 559 ? -0.561  -6.784  0.497   1.00 61.54 ? 733  CYS A CA    1 
ATOM   4326 C C     . CYS C 3 559 ? -1.256  -8.022  -0.073  1.00 62.47 ? 733  CYS A C     1 
ATOM   4327 O O     . CYS C 3 559 ? -1.216  -8.278  -1.284  1.00 63.18 ? 733  CYS A O     1 
ATOM   4328 C CB    . CYS C 3 559 ? 0.892   -7.118  0.782   1.00 60.69 ? 733  CYS A CB    1 
ATOM   4329 S SG    . CYS C 3 559 ? 2.022   -5.822  0.322   1.00 63.77 ? 733  CYS A SG    1 
ATOM   4330 N N     . LYS C 3 560 ? -1.824  -8.829  0.815   1.00 62.20 ? 734  LYS A N     1 
ATOM   4331 C CA    . LYS C 3 560 ? -2.528  -10.044 0.411   1.00 64.68 ? 734  LYS A CA    1 
ATOM   4332 C C     . LYS C 3 560 ? -3.926  -9.713  -0.113  1.00 64.25 ? 734  LYS A C     1 
ATOM   4333 O O     . LYS C 3 560 ? -4.346  -10.193 -1.172  1.00 64.63 ? 734  LYS A O     1 
ATOM   4334 C CB    . LYS C 3 560 ? -2.669  -11.000 1.596   1.00 63.47 ? 734  LYS A CB    1 
ATOM   4335 C CG    . LYS C 3 560 ? -1.475  -11.901 1.859   1.00 66.87 ? 734  LYS A CG    1 
ATOM   4336 C CD    . LYS C 3 560 ? -1.751  -12.786 3.083   1.00 68.22 ? 734  LYS A CD    1 
ATOM   4337 C CE    . LYS C 3 560 ? -0.604  -13.772 3.382   1.00 70.46 ? 734  LYS A CE    1 
ATOM   4338 N NZ    . LYS C 3 560 ? 0.713   -13.126 3.730   1.00 72.18 ? 734  LYS A NZ    1 
ATOM   4339 N N     . LYS C 3 561 ? -4.668  -8.978  0.701   1.00 63.08 ? 735  LYS A N     1 
ATOM   4340 C CA    . LYS C 3 561 ? -6.019  -8.566  0.366   1.00 64.10 ? 735  LYS A CA    1 
ATOM   4341 C C     . LYS C 3 561 ? -6.015  -7.910  -0.990  1.00 62.83 ? 735  LYS A C     1 
ATOM   4342 O O     . LYS C 3 561 ? -6.935  -8.060  -1.797  1.00 63.37 ? 735  LYS A O     1 
ATOM   4343 C CB    . LYS C 3 561 ? -6.521  -7.547  1.385   1.00 66.78 ? 735  LYS A CB    1 
ATOM   4344 N N     . TRP C 3 562 ? -4.966  -7.158  -1.236  1.00 61.56 ? 736  TRP A N     1 
ATOM   4345 C CA    . TRP C 3 562 ? -4.884  -6.462  -2.487  1.00 64.46 ? 736  TRP A CA    1 
ATOM   4346 C C     . TRP C 3 562 ? -3.984  -7.138  -3.511  1.00 62.00 ? 736  TRP A C     1 
ATOM   4347 O O     . TRP C 3 562 ? -3.705  -6.567  -4.570  1.00 59.86 ? 736  TRP A O     1 
ATOM   4348 C CB    . TRP C 3 562 ? -4.474  -5.024  -2.206  1.00 68.03 ? 736  TRP A CB    1 
ATOM   4349 C CG    . TRP C 3 562 ? -5.439  -4.321  -1.287  1.00 72.40 ? 736  TRP A CG    1 
ATOM   4350 C CD1   . TRP C 3 562 ? -5.122  -3.470  -0.269  1.00 72.84 ? 736  TRP A CD1   1 
ATOM   4351 C CD2   . TRP C 3 562 ? -6.877  -4.347  -1.353  1.00 75.58 ? 736  TRP A CD2   1 
ATOM   4352 N NE1   . TRP C 3 562 ? -6.263  -2.946  0.286   1.00 75.63 ? 736  TRP A NE1   1 
ATOM   4353 C CE2   . TRP C 3 562 ? -7.356  -3.460  -0.359  1.00 77.92 ? 736  TRP A CE2   1 
ATOM   4354 C CE3   . TRP C 3 562 ? -7.809  -5.013  -2.172  1.00 79.75 ? 736  TRP A CE3   1 
ATOM   4355 C CZ2   . TRP C 3 562 ? -8.732  -3.231  -0.146  1.00 80.20 ? 736  TRP A CZ2   1 
ATOM   4356 C CZ3   . TRP C 3 562 ? -9.189  -4.783  -1.961  1.00 81.26 ? 736  TRP A CZ3   1 
ATOM   4357 C CH2   . TRP C 3 562 ? -9.628  -3.895  -0.958  1.00 81.68 ? 736  TRP A CH2   1 
ATOM   4358 N N     . GLY C 3 563 ? -3.560  -8.364  -3.217  1.00 58.78 ? 737  GLY A N     1 
ATOM   4359 C CA    . GLY C 3 563 ? -2.706  -9.097  -4.136  1.00 58.05 ? 737  GLY A CA    1 
ATOM   4360 C C     . GLY C 3 563 ? -1.397  -8.426  -4.510  1.00 60.98 ? 737  GLY A C     1 
ATOM   4361 O O     . GLY C 3 563 ? -0.790  -8.745  -5.541  1.00 61.39 ? 737  GLY A O     1 
ATOM   4362 N N     . VAL C 3 564 ? -0.975  -7.457  -3.713  1.00 62.14 ? 738  VAL A N     1 
ATOM   4363 C CA    . VAL C 3 564 ? 0.288   -6.788  -3.963  1.00 62.07 ? 738  VAL A CA    1 
ATOM   4364 C C     . VAL C 3 564 ? 1.385   -7.657  -3.354  1.00 61.10 ? 738  VAL A C     1 
ATOM   4365 O O     . VAL C 3 564 ? 1.410   -7.900  -2.145  1.00 57.76 ? 738  VAL A O     1 
ATOM   4366 C CB    . VAL C 3 564 ? 0.301   -5.411  -3.342  1.00 62.76 ? 738  VAL A CB    1 
ATOM   4367 C CG1   . VAL C 3 564 ? 1.600   -4.679  -3.699  1.00 61.75 ? 738  VAL A CG1   1 
ATOM   4368 C CG2   . VAL C 3 564 ? -0.931  -4.642  -3.811  1.00 64.19 ? 738  VAL A CG2   1 
ATOM   4369 N N     . PRO C 3 565 ? 2.301   -8.154  -4.193  1.00 62.30 ? 739  PRO A N     1 
ATOM   4370 C CA    . PRO C 3 565 ? 3.368   -9.002  -3.664  1.00 61.51 ? 739  PRO A CA    1 
ATOM   4371 C C     . PRO C 3 565 ? 4.084   -8.315  -2.544  1.00 59.00 ? 739  PRO A C     1 
ATOM   4372 O O     . PRO C 3 565 ? 4.456   -7.143  -2.663  1.00 58.60 ? 739  PRO A O     1 
ATOM   4373 C CB    . PRO C 3 565 ? 4.296   -9.184  -4.868  1.00 63.70 ? 739  PRO A CB    1 
ATOM   4374 C CG    . PRO C 3 565 ? 4.091   -7.913  -5.673  1.00 61.74 ? 739  PRO A CG    1 
ATOM   4375 C CD    . PRO C 3 565 ? 2.574   -7.765  -5.589  1.00 64.32 ? 739  PRO A CD    1 
ATOM   4376 N N     . ILE C 3 566 ? 4.262   -9.055  -1.457  1.00 57.50 ? 740  ILE A N     1 
ATOM   4377 C CA    . ILE C 3 566 ? 4.960   -8.538  -0.290  1.00 54.73 ? 740  ILE A CA    1 
ATOM   4378 C C     . ILE C 3 566 ? 6.321   -8.036  -0.746  1.00 51.86 ? 740  ILE A C     1 
ATOM   4379 O O     . ILE C 3 566 ? 6.820   -7.020  -0.268  1.00 51.30 ? 740  ILE A O     1 
ATOM   4380 C CB    . ILE C 3 566 ? 5.116   -9.642  0.751   1.00 53.85 ? 740  ILE A CB    1 
ATOM   4381 C CG1   . ILE C 3 566 ? 3.730   -10.117 1.168   1.00 56.47 ? 740  ILE A CG1   1 
ATOM   4382 C CG2   . ILE C 3 566 ? 5.855   -9.122  1.949   1.00 58.24 ? 740  ILE A CG2   1 
ATOM   4383 C CD1   . ILE C 3 566 ? 3.685   -10.928 2.442   1.00 62.35 ? 740  ILE A CD1   1 
ATOM   4384 N N     . GLU C 3 567 ? 6.876   -8.736  -1.721  1.00 49.95 ? 741  GLU A N     1 
ATOM   4385 C CA    . GLU C 3 567 ? 8.168   -8.391  -2.278  1.00 51.38 ? 741  GLU A CA    1 
ATOM   4386 C C     . GLU C 3 567 ? 8.210   -6.951  -2.761  1.00 51.85 ? 741  GLU A C     1 
ATOM   4387 O O     . GLU C 3 567 ? 9.285   -6.357  -2.860  1.00 53.97 ? 741  GLU A O     1 
ATOM   4388 C CB    . GLU C 3 567 ? 8.475   -9.333  -3.439  1.00 54.55 ? 741  GLU A CB    1 
ATOM   4389 N N     . LYS C 3 568 ? 7.049   -6.409  -3.100  1.00 51.62 ? 742  LYS A N     1 
ATOM   4390 C CA    . LYS C 3 568 ? 6.938   -5.046  -3.600  1.00 51.78 ? 742  LYS A CA    1 
ATOM   4391 C C     . LYS C 3 568 ? 7.131   -3.985  -2.535  1.00 53.68 ? 742  LYS A C     1 
ATOM   4392 O O     . LYS C 3 568 ? 7.458   -2.835  -2.853  1.00 52.76 ? 742  LYS A O     1 
ATOM   4393 C CB    . LYS C 3 568 ? 5.578   -4.836  -4.259  1.00 51.38 ? 742  LYS A CB    1 
ATOM   4394 N N     . ILE C 3 569 ? 6.887   -4.352  -1.278  1.00 54.45 ? 743  ILE A N     1 
ATOM   4395 C CA    . ILE C 3 569 ? 7.025   -3.414  -0.152  1.00 53.17 ? 743  ILE A CA    1 
ATOM   4396 C C     . ILE C 3 569 ? 8.211   -3.740  0.750   1.00 50.71 ? 743  ILE A C     1 
ATOM   4397 O O     . ILE C 3 569 ? 8.955   -2.859  1.172   1.00 49.40 ? 743  ILE A O     1 
ATOM   4398 C CB    . ILE C 3 569 ? 5.759   -3.411  0.709   1.00 54.82 ? 743  ILE A CB    1 
ATOM   4399 C CG1   . ILE C 3 569 ? 4.567   -3.040  -0.158  1.00 57.59 ? 743  ILE A CG1   1 
ATOM   4400 C CG2   . ILE C 3 569 ? 5.890   -2.427  1.851   1.00 56.20 ? 743  ILE A CG2   1 
ATOM   4401 C CD1   . ILE C 3 569 ? 3.270   -3.092  0.572   1.00 65.95 ? 743  ILE A CD1   1 
ATOM   4402 N N     . TYR C 3 570 ? 8.346   -5.011  1.085   1.00 48.69 ? 744  TYR A N     1 
ATOM   4403 C CA    . TYR C 3 570 ? 9.425   -5.440  1.935   1.00 47.69 ? 744  TYR A CA    1 
ATOM   4404 C C     . TYR C 3 570 ? 10.514  -6.095  1.108   1.00 51.55 ? 744  TYR A C     1 
ATOM   4405 O O     . TYR C 3 570 ? 10.219  -6.957  0.271   1.00 53.97 ? 744  TYR A O     1 
ATOM   4406 C CB    . TYR C 3 570 ? 8.897   -6.462  2.924   1.00 42.02 ? 744  TYR A CB    1 
ATOM   4407 C CG    . TYR C 3 570 ? 7.956   -5.927  3.967   1.00 39.08 ? 744  TYR A CG    1 
ATOM   4408 C CD1   . TYR C 3 570 ? 8.037   -4.614  4.427   1.00 38.73 ? 744  TYR A CD1   1 
ATOM   4409 C CD2   . TYR C 3 570 ? 7.014   -6.766  4.552   1.00 35.52 ? 744  TYR A CD2   1 
ATOM   4410 C CE1   . TYR C 3 570 ? 7.197   -4.164  5.449   1.00 36.66 ? 744  TYR A CE1   1 
ATOM   4411 C CE2   . TYR C 3 570 ? 6.187   -6.330  5.558   1.00 35.07 ? 744  TYR A CE2   1 
ATOM   4412 C CZ    . TYR C 3 570 ? 6.283   -5.045  6.000   1.00 32.80 ? 744  TYR A CZ    1 
ATOM   4413 O OH    . TYR C 3 570 ? 5.459   -4.704  7.016   1.00 39.37 ? 744  TYR A OH    1 
ATOM   4414 N N     . ASN C 3 571 ? 11.764  -5.712  1.336   1.00 50.74 ? 745  ASN A N     1 
ATOM   4415 C CA    . ASN C 3 571 ? 12.865  -6.338  0.611   1.00 50.41 ? 745  ASN A CA    1 
ATOM   4416 C C     . ASN C 3 571 ? 13.226  -7.706  1.212   1.00 53.21 ? 745  ASN A C     1 
ATOM   4417 O O     . ASN C 3 571 ? 12.612  -8.162  2.187   1.00 52.98 ? 745  ASN A O     1 
ATOM   4418 C CB    . ASN C 3 571 ? 14.099  -5.432  0.569   1.00 45.70 ? 745  ASN A CB    1 
ATOM   4419 C CG    . ASN C 3 571 ? 14.748  -5.203  1.943   1.00 49.18 ? 745  ASN A CG    1 
ATOM   4420 O OD1   . ASN C 3 571 ? 14.549  -5.964  2.893   1.00 46.58 ? 745  ASN A OD1   1 
ATOM   4421 N ND2   . ASN C 3 571 ? 15.557  -4.164  2.024   1.00 44.73 ? 745  ASN A ND2   1 
ATOM   4422 N N     . LYS C 3 572 ? 14.225  -8.356  0.615   1.00 53.53 ? 746  LYS A N     1 
ATOM   4423 C CA    . LYS C 3 572 ? 14.688  -9.660  1.069   1.00 54.54 ? 746  LYS A CA    1 
ATOM   4424 C C     . LYS C 3 572 ? 14.863  -9.728  2.588   1.00 53.73 ? 746  LYS A C     1 
ATOM   4425 O O     . LYS C 3 572 ? 14.305  -10.585 3.271   1.00 54.62 ? 746  LYS A O     1 
ATOM   4426 C CB    . LYS C 3 572 ? 16.019  -9.997  0.385   1.00 57.55 ? 746  LYS A CB    1 
ATOM   4427 N N     . THR C 3 573 ? 15.620  -8.795  3.111   1.00 50.94 ? 747  THR A N     1 
ATOM   4428 C CA    . THR C 3 573 ? 15.885  -8.785  4.517   1.00 51.13 ? 747  THR A CA    1 
ATOM   4429 C C     . THR C 3 573 ? 14.704  -8.512  5.403   1.00 48.48 ? 747  THR A C     1 
ATOM   4430 O O     . THR C 3 573 ? 14.604  -9.055  6.500   1.00 47.81 ? 747  THR A O     1 
ATOM   4431 C CB    . THR C 3 573 ? 16.990  -7.826  4.788   1.00 54.94 ? 747  THR A CB    1 
ATOM   4432 O OG1   . THR C 3 573 ? 18.119  -8.231  4.001   1.00 65.67 ? 747  THR A OG1   1 
ATOM   4433 C CG2   . THR C 3 573 ? 17.378  -7.871  6.247   1.00 59.11 ? 747  THR A CG2   1 
ATOM   4434 N N     . GLN C 3 574 ? 13.825  -7.643  4.954   1.00 48.47 ? 748  GLN A N     1 
ATOM   4435 C CA    . GLN C 3 574 ? 12.661  -7.315  5.742   1.00 47.28 ? 748  GLN A CA    1 
ATOM   4436 C C     . GLN C 3 574 ? 11.823  -8.549  5.770   1.00 47.89 ? 748  GLN A C     1 
ATOM   4437 O O     . GLN C 3 574 ? 11.220  -8.870  6.782   1.00 50.01 ? 748  GLN A O     1 
ATOM   4438 C CB    . GLN C 3 574 ? 11.908  -6.160  5.118   1.00 49.50 ? 748  GLN A CB    1 
ATOM   4439 C CG    . GLN C 3 574 ? 12.637  -4.855  5.265   1.00 50.22 ? 748  GLN A CG    1 
ATOM   4440 C CD    . GLN C 3 574 ? 12.089  -3.808  4.358   1.00 52.90 ? 748  GLN A CD    1 
ATOM   4441 O OE1   . GLN C 3 574 ? 12.834  -3.133  3.661   1.00 57.21 ? 748  GLN A OE1   1 
ATOM   4442 N NE2   . GLN C 3 574 ? 10.761  -3.660  4.350   1.00 57.29 ? 748  GLN A NE2   1 
ATOM   4443 N N     . ARG C 3 575 ? 11.795  -9.249  4.654   1.00 46.42 ? 749  ARG A N     1 
ATOM   4444 C CA    . ARG C 3 575 ? 11.033  -10.475 4.608   1.00 49.05 ? 749  ARG A CA    1 
ATOM   4445 C C     . ARG C 3 575 ? 11.722  -11.449 5.540   1.00 50.81 ? 749  ARG A C     1 
ATOM   4446 O O     . ARG C 3 575 ? 11.079  -12.300 6.140   1.00 51.70 ? 749  ARG A O     1 
ATOM   4447 C CB    . ARG C 3 575 ? 10.999  -11.039 3.198   1.00 50.54 ? 749  ARG A CB    1 
ATOM   4448 C CG    . ARG C 3 575 ? 10.424  -10.083 2.210   1.00 55.54 ? 749  ARG A CG    1 
ATOM   4449 C CD    . ARG C 3 575 ? 9.912   -10.818 1.009   1.00 58.27 ? 749  ARG A CD    1 
ATOM   4450 N NE    . ARG C 3 575 ? 10.972  -11.334 0.160   1.00 59.21 ? 749  ARG A NE    1 
ATOM   4451 C CZ    . ARG C 3 575 ? 11.647  -10.593 -0.714  1.00 62.64 ? 749  ARG A CZ    1 
ATOM   4452 N NH1   . ARG C 3 575 ? 11.382  -9.296  -0.832  1.00 63.38 ? 749  ARG A NH1   1 
ATOM   4453 N NH2   . ARG C 3 575 ? 12.521  -11.165 -1.537  1.00 62.96 ? 749  ARG A NH2   1 
ATOM   4454 N N     . GLU C 3 576 ? 13.042  -11.352 5.618   1.00 53.29 ? 750  GLU A N     1 
ATOM   4455 C CA    . GLU C 3 576 ? 13.799  -12.216 6.502   1.00 55.23 ? 750  GLU A CA    1 
ATOM   4456 C C     . GLU C 3 576 ? 13.323  -11.897 7.893   1.00 55.77 ? 750  GLU A C     1 
ATOM   4457 O O     . GLU C 3 576 ? 12.820  -12.752 8.614   1.00 58.03 ? 750  GLU A O     1 
ATOM   4458 C CB    . GLU C 3 576 ? 15.272  -11.859 6.445   1.00 60.40 ? 750  GLU A CB    1 
ATOM   4459 C CG    . GLU C 3 576 ? 15.916  -12.149 5.138   1.00 66.10 ? 750  GLU A CG    1 
ATOM   4460 C CD    . GLU C 3 576 ? 15.998  -13.615 4.887   1.00 69.04 ? 750  GLU A CD    1 
ATOM   4461 O OE1   . GLU C 3 576 ? 15.992  -14.370 5.890   1.00 75.37 ? 750  GLU A OE1   1 
ATOM   4462 O OE2   . GLU C 3 576 ? 16.062  -14.006 3.700   1.00 74.26 ? 750  GLU A OE2   1 
ATOM   4463 N N     . LYS C 3 577 ? 13.472  -10.631 8.249   1.00 52.36 ? 751  LYS A N     1 
ATOM   4464 C CA    . LYS C 3 577 ? 13.086  -10.171 9.559   1.00 49.72 ? 751  LYS A CA    1 
ATOM   4465 C C     . LYS C 3 577 ? 11.616  -10.380 9.883   1.00 50.98 ? 751  LYS A C     1 
ATOM   4466 O O     . LYS C 3 577 ? 11.295  -10.822 10.969  1.00 49.82 ? 751  LYS A O     1 
ATOM   4467 C CB    . LYS C 3 577 ? 13.455  -8.699  9.726   1.00 47.82 ? 751  LYS A CB    1 
ATOM   4468 C CG    . LYS C 3 577 ? 12.941  -8.101  11.023  1.00 51.01 ? 751  LYS A CG    1 
ATOM   4469 C CD    . LYS C 3 577 ? 13.420  -6.675  11.253  1.00 52.84 ? 751  LYS A CD    1 
ATOM   4470 C CE    . LYS C 3 577 ? 12.773  -6.111  12.516  1.00 59.46 ? 751  LYS A CE    1 
ATOM   4471 N NZ    . LYS C 3 577 ? 13.570  -5.028  13.174  1.00 64.05 ? 751  LYS A NZ    1 
ATOM   4472 N N     . PHE C 3 578 ? 10.726  -10.070 8.935   1.00 50.00 ? 752  PHE A N     1 
ATOM   4473 C CA    . PHE C 3 578 ? 9.289   -10.177 9.179   1.00 51.23 ? 752  PHE A CA    1 
ATOM   4474 C C     . PHE C 3 578 ? 8.624   -11.466 8.751   1.00 48.42 ? 752  PHE A C     1 
ATOM   4475 O O     . PHE C 3 578 ? 7.396   -11.521 8.600   1.00 45.31 ? 752  PHE A O     1 
ATOM   4476 C CB    . PHE C 3 578 ? 8.548   -8.997  8.545   1.00 58.51 ? 752  PHE A CB    1 
ATOM   4477 C CG    . PHE C 3 578 ? 8.921   -7.656  9.132   1.00 68.17 ? 752  PHE A CG    1 
ATOM   4478 C CD1   . PHE C 3 578 ? 9.209   -7.520  10.496  1.00 71.86 ? 752  PHE A CD1   1 
ATOM   4479 C CD2   . PHE C 3 578 ? 8.986   -6.524  8.317   1.00 70.36 ? 752  PHE A CD2   1 
ATOM   4480 C CE1   . PHE C 3 578 ? 9.546   -6.276  11.041  1.00 73.75 ? 752  PHE A CE1   1 
ATOM   4481 C CE2   . PHE C 3 578 ? 9.320   -5.278  8.842   1.00 70.72 ? 752  PHE A CE2   1 
ATOM   4482 C CZ    . PHE C 3 578 ? 9.606   -5.151  10.208  1.00 75.01 ? 752  PHE A CZ    1 
ATOM   4483 N N     . ALA C 3 579 ? 9.428   -12.495 8.595   1.00 47.42 ? 753  ALA A N     1 
ATOM   4484 C CA    . ALA C 3 579 ? 8.934   -13.800 8.176   1.00 46.98 ? 753  ALA A CA    1 
ATOM   4485 C C     . ALA C 3 579 ? 7.733   -14.279 8.994   1.00 45.56 ? 753  ALA A C     1 
ATOM   4486 O O     . ALA C 3 579 ? 6.804   -14.906 8.463   1.00 46.99 ? 753  ALA A O     1 
ATOM   4487 C CB    . ALA C 3 579 ? 10.065  -14.814 8.255   1.00 46.27 ? 753  ALA A CB    1 
ATOM   4488 N N     . TRP C 3 580 ? 7.755   -13.937 10.272  1.00 45.05 ? 754  TRP A N     1 
ATOM   4489 C CA    . TRP C 3 580 ? 6.730   -14.332 11.222  1.00 44.74 ? 754  TRP A CA    1 
ATOM   4490 C C     . TRP C 3 580 ? 5.414   -13.645 10.997  1.00 43.20 ? 754  TRP A C     1 
ATOM   4491 O O     . TRP C 3 580 ? 4.366   -14.229 11.223  1.00 42.65 ? 754  TRP A O     1 
ATOM   4492 C CB    . TRP C 3 580 ? 7.226   -14.106 12.668  1.00 47.13 ? 754  TRP A CB    1 
ATOM   4493 C CG    . TRP C 3 580 ? 7.513   -12.675 13.077  1.00 44.82 ? 754  TRP A CG    1 
ATOM   4494 C CD1   . TRP C 3 580 ? 8.741   -12.072 13.125  1.00 44.19 ? 754  TRP A CD1   1 
ATOM   4495 C CD2   . TRP C 3 580 ? 6.575   -11.717 13.544  1.00 43.08 ? 754  TRP A CD2   1 
ATOM   4496 N NE1   . TRP C 3 580 ? 8.602   -10.785 13.599  1.00 46.31 ? 754  TRP A NE1   1 
ATOM   4497 C CE2   . TRP C 3 580 ? 7.289   -10.543 13.853  1.00 44.78 ? 754  TRP A CE2   1 
ATOM   4498 C CE3   . TRP C 3 580 ? 5.184   -11.725 13.723  1.00 43.43 ? 754  TRP A CE3   1 
ATOM   4499 C CZ2   . TRP C 3 580 ? 6.670   -9.389  14.346  1.00 45.87 ? 754  TRP A CZ2   1 
ATOM   4500 C CZ3   . TRP C 3 580 ? 4.563   -10.589 14.209  1.00 45.83 ? 754  TRP A CZ3   1 
ATOM   4501 C CH2   . TRP C 3 580 ? 5.310   -9.433  14.506  1.00 46.28 ? 754  TRP A CH2   1 
ATOM   4502 N N     . ALA C 3 581 ? 5.480   -12.381 10.635  1.00 43.85 ? 755  ALA A N     1 
ATOM   4503 C CA    . ALA C 3 581 ? 4.280   -11.613 10.382  1.00 45.82 ? 755  ALA A CA    1 
ATOM   4504 C C     . ALA C 3 581 ? 3.745   -12.061 9.022   1.00 49.00 ? 755  ALA A C     1 
ATOM   4505 O O     . ALA C 3 581 ? 2.528   -12.178 8.819   1.00 47.09 ? 755  ALA A O     1 
ATOM   4506 C CB    . ALA C 3 581 ? 4.617   -10.147 10.361  1.00 42.77 ? 755  ALA A CB    1 
ATOM   4507 N N     . ILE C 3 582 ? 4.674   -12.309 8.111   1.00 48.70 ? 756  ILE A N     1 
ATOM   4508 C CA    . ILE C 3 582 ? 4.372   -12.726 6.760   1.00 52.48 ? 756  ILE A CA    1 
ATOM   4509 C C     . ILE C 3 582 ? 3.641   -14.063 6.711   1.00 55.31 ? 756  ILE A C     1 
ATOM   4510 O O     . ILE C 3 582 ? 2.780   -14.293 5.844   1.00 56.34 ? 756  ILE A O     1 
ATOM   4511 C CB    . ILE C 3 582 ? 5.660   -12.804 5.938   1.00 50.16 ? 756  ILE A CB    1 
ATOM   4512 C CG1   . ILE C 3 582 ? 6.146   -11.400 5.583   1.00 48.63 ? 756  ILE A CG1   1 
ATOM   4513 C CG2   . ILE C 3 582 ? 5.447   -13.608 4.696   1.00 52.25 ? 756  ILE A CG2   1 
ATOM   4514 C CD1   . ILE C 3 582 ? 7.419   -11.390 4.776   1.00 45.00 ? 756  ILE A CD1   1 
ATOM   4515 N N     . ASP C 3 583 ? 3.972   -14.939 7.637   1.00 56.74 ? 757  ASP A N     1 
ATOM   4516 C CA    . ASP C 3 583 ? 3.349   -16.233 7.639   1.00 61.69 ? 757  ASP A CA    1 
ATOM   4517 C C     . ASP C 3 583 ? 2.191   -16.419 8.605   1.00 64.57 ? 757  ASP A C     1 
ATOM   4518 O O     . ASP C 3 583 ? 1.363   -17.318 8.413   1.00 68.65 ? 757  ASP A O     1 
ATOM   4519 C CB    . ASP C 3 583 ? 4.393   -17.307 7.868   1.00 66.14 ? 757  ASP A CB    1 
ATOM   4520 C CG    . ASP C 3 583 ? 3.830   -18.690 7.691   1.00 73.12 ? 757  ASP A CG    1 
ATOM   4521 O OD1   . ASP C 3 583 ? 3.792   -19.148 6.521   1.00 81.56 ? 757  ASP A OD1   1 
ATOM   4522 O OD2   . ASP C 3 583 ? 3.395   -19.295 8.711   1.00 73.21 ? 757  ASP A OD2   1 
ATOM   4523 N N     . MET C 3 584 ? 2.110   -15.602 9.647   1.00 65.13 ? 758  MET A N     1 
ATOM   4524 C CA    . MET C 3 584 ? 1.018   -15.782 10.600  1.00 68.77 ? 758  MET A CA    1 
ATOM   4525 C C     . MET C 3 584 ? -0.110  -14.756 10.499  1.00 68.15 ? 758  MET A C     1 
ATOM   4526 O O     . MET C 3 584 ? -0.932  -14.626 11.414  1.00 69.39 ? 758  MET A O     1 
ATOM   4527 C CB    . MET C 3 584 ? 1.560   -15.830 12.039  1.00 70.40 ? 758  MET A CB    1 
ATOM   4528 C CG    . MET C 3 584 ? 1.876   -14.465 12.645  1.00 73.51 ? 758  MET A CG    1 
ATOM   4529 S SD    . MET C 3 584 ? 2.589   -14.519 14.318  1.00 73.33 ? 758  MET A SD    1 
ATOM   4530 C CE    . MET C 3 584 ? 1.042   -14.602 15.265  1.00 71.50 ? 758  MET A CE    1 
ATOM   4531 N N     . ALA C 3 585 ? -0.171  -14.029 9.387   1.00 69.66 ? 759  ALA A N     1 
ATOM   4532 C CA    . ALA C 3 585 ? -1.212  -13.010 9.220   1.00 70.48 ? 759  ALA A CA    1 
ATOM   4533 C C     . ALA C 3 585 ? -1.871  -13.069 7.856   1.00 68.68 ? 759  ALA A C     1 
ATOM   4534 O O     . ALA C 3 585 ? -1.186  -13.265 6.847   1.00 68.53 ? 759  ALA A O     1 
ATOM   4535 C CB    . ALA C 3 585 ? -0.630  -11.625 9.448   1.00 72.25 ? 759  ALA A CB    1 
ATOM   4536 N N     . ASP C 3 586 ? -3.195  -12.877 7.827   1.00 68.98 ? 760  ASP A N     1 
ATOM   4537 C CA    . ASP C 3 586 ? -3.960  -12.914 6.576   1.00 68.06 ? 760  ASP A CA    1 
ATOM   4538 C C     . ASP C 3 586 ? -4.648  -11.598 6.216   1.00 68.26 ? 760  ASP A C     1 
ATOM   4539 O O     . ASP C 3 586 ? -4.736  -10.683 7.044   1.00 66.42 ? 760  ASP A O     1 
ATOM   4540 C CB    . ASP C 3 586 ? -5.000  -14.037 6.619   1.00 66.80 ? 760  ASP A CB    1 
ATOM   4541 N N     . GLU C 3 587 ? -5.155  -11.540 4.987   1.00 69.06 ? 761  GLU A N     1 
ATOM   4542 C CA    . GLU C 3 587 ? -5.863  -10.373 4.432   1.00 68.20 ? 761  GLU A CA    1 
ATOM   4543 C C     . GLU C 3 587 ? -6.952  -9.888  5.402   1.00 66.47 ? 761  GLU A C     1 
ATOM   4544 O O     . GLU C 3 587 ? -7.575  -8.837  5.224   1.00 66.97 ? 761  GLU A O     1 
ATOM   4545 C CB    . GLU C 3 587 ? -6.495  -10.755 3.082   1.00 68.50 ? 761  GLU A CB    1 
ATOM   4546 N N     . ASP C 3 588 ? -7.175  -10.689 6.418   1.00 65.34 ? 762  ASP A N     1 
ATOM   4547 C CA    . ASP C 3 588 ? -8.158  -10.398 7.427   1.00 65.21 ? 762  ASP A CA    1 
ATOM   4548 C C     . ASP C 3 588 ? -7.543  -9.662  8.624   1.00 64.82 ? 762  ASP A C     1 
ATOM   4549 O O     . ASP C 3 588 ? -8.278  -9.269  9.538   1.00 67.34 ? 762  ASP A O     1 
ATOM   4550 C CB    . ASP C 3 588 ? -8.724  -11.727 7.899   1.00 69.99 ? 762  ASP A CB    1 
ATOM   4551 C CG    . ASP C 3 588 ? -7.638  -12.663 8.457   1.00 72.01 ? 762  ASP A CG    1 
ATOM   4552 O OD1   . ASP C 3 588 ? -6.447  -12.295 8.537   1.00 73.87 ? 762  ASP A OD1   1 
ATOM   4553 O OD2   . ASP C 3 588 ? -7.976  -13.794 8.830   1.00 79.71 ? 762  ASP A OD2   1 
ATOM   4554 N N     . TYR C 3 589 ? -6.214  -9.541  8.671   1.00 62.38 ? 763  TYR A N     1 
ATOM   4555 C CA    . TYR C 3 589 ? -5.555  -8.895  9.810   1.00 58.56 ? 763  TYR A CA    1 
ATOM   4556 C C     . TYR C 3 589 ? -5.975  -7.479  10.134  1.00 56.77 ? 763  TYR A C     1 
ATOM   4557 O O     . TYR C 3 589 ? -6.063  -6.608  9.263   1.00 56.47 ? 763  TYR A O     1 
ATOM   4558 C CB    . TYR C 3 589 ? -4.033  -8.914  9.727   1.00 58.46 ? 763  TYR A CB    1 
ATOM   4559 C CG    . TYR C 3 589 ? -3.401  -8.410  11.019  1.00 57.98 ? 763  TYR A CG    1 
ATOM   4560 C CD1   . TYR C 3 589 ? -3.279  -9.261  12.119  1.00 59.21 ? 763  TYR A CD1   1 
ATOM   4561 C CD2   . TYR C 3 589 ? -2.951  -7.092  11.156  1.00 55.31 ? 763  TYR A CD2   1 
ATOM   4562 C CE1   . TYR C 3 589 ? -2.731  -8.826  13.319  1.00 55.75 ? 763  TYR A CE1   1 
ATOM   4563 C CE2   . TYR C 3 589 ? -2.399  -6.647  12.370  1.00 53.45 ? 763  TYR A CE2   1 
ATOM   4564 C CZ    . TYR C 3 589 ? -2.298  -7.530  13.440  1.00 53.73 ? 763  TYR A CZ    1 
ATOM   4565 O OH    . TYR C 3 589 ? -1.753  -7.163  14.645  1.00 56.46 ? 763  TYR A OH    1 
ATOM   4566 N N     . GLU C 3 590 ? -6.158  -7.268  11.427  1.00 56.38 ? 764  GLU A N     1 
ATOM   4567 C CA    . GLU C 3 590 ? -6.549  -5.980  11.975  1.00 54.82 ? 764  GLU A CA    1 
ATOM   4568 C C     . GLU C 3 590 ? -5.831  -5.842  13.308  1.00 51.77 ? 764  GLU A C     1 
ATOM   4569 O O     . GLU C 3 590 ? -6.045  -6.638  14.228  1.00 47.00 ? 764  GLU A O     1 
ATOM   4570 C CB    . GLU C 3 590 ? -8.072  -5.887  12.163  1.00 53.00 ? 764  GLU A CB    1 
ATOM   4571 N N     . PHE C 3 591 ? -4.909  -4.892  13.333  1.00 49.63 ? 765  PHE A N     1 
ATOM   4572 C CA    . PHE C 3 591 ? -4.099  -4.570  14.500  1.00 48.59 ? 765  PHE A CA    1 
ATOM   4573 C C     . PHE C 3 591 ? -4.986  -4.395  15.695  1.00 50.63 ? 765  PHE A C     1 
ATOM   4574 O O     . PHE C 3 591 ? -4.655  -4.977  16.744  1.00 54.21 ? 765  PHE A O     1 
ATOM   4575 C CB    . PHE C 3 591 ? -3.362  -3.266  14.235  1.00 49.03 ? 765  PHE A CB    1 
ATOM   4576 C CG    . PHE C 3 591 ? -2.633  -2.709  15.409  1.00 47.09 ? 765  PHE A CG    1 
ATOM   4577 C CD1   . PHE C 3 591 ? -1.445  -3.274  15.830  1.00 52.24 ? 765  PHE A CD1   1 
ATOM   4578 C CD2   . PHE C 3 591 ? -3.119  -1.593  16.072  1.00 48.35 ? 765  PHE A CD2   1 
ATOM   4579 C CE1   . PHE C 3 591 ? -0.735  -2.733  16.889  1.00 54.49 ? 765  PHE A CE1   1 
ATOM   4580 C CE2   . PHE C 3 591 ? -2.426  -1.041  17.124  1.00 53.31 ? 765  PHE A CE2   1 
ATOM   4581 C CZ    . PHE C 3 591 ? -1.227  -1.615  17.547  1.00 55.98 ? 765  PHE A CZ    1 
ATOM   4582 O OXT   . PHE C 3 591 ? -5.985  -3.658  15.560  1.00 54.40 ? 765  PHE A OXT   1 
HETATM 4583 O O     . HOH D 4 .   ? 23.711  -1.081  40.984  1.00 36.46 ? 1005 HOH C O     1 
HETATM 4584 O O     . HOH D 4 .   ? 18.757  -4.766  34.021  1.00 52.80 ? 1014 HOH C O     1 
HETATM 4585 O O     . HOH D 4 .   ? 15.139  -2.452  26.158  1.00 39.22 ? 1019 HOH C O     1 
HETATM 4586 O O     . HOH D 4 .   ? 24.542  -1.776  28.731  1.00 45.86 ? 1022 HOH C O     1 
HETATM 4587 O O     . HOH D 4 .   ? 24.643  -2.107  25.114  1.00 62.14 ? 1027 HOH C O     1 
HETATM 4588 O O     . HOH D 4 .   ? 20.364  4.617   34.048  1.00 35.13 ? 1031 HOH C O     1 
HETATM 4589 O O     . HOH D 4 .   ? 17.595  -4.991  18.548  1.00 50.08 ? 1050 HOH C O     1 
HETATM 4590 O O     . HOH D 4 .   ? 20.685  -0.215  -6.087  1.00 44.97 ? 1052 HOH C O     1 
HETATM 4591 O O     . HOH D 4 .   ? 23.430  2.628   43.905  1.00 57.73 ? 1057 HOH C O     1 
HETATM 4592 O O     . HOH D 4 .   ? 21.027  -2.815  17.760  1.00 64.24 ? 1070 HOH C O     1 
HETATM 4593 O O     . HOH D 4 .   ? 33.354  1.932   0.244   1.00 61.10 ? 1081 HOH C O     1 
HETATM 4594 O O     . HOH D 4 .   ? 23.027  -2.273  20.944  1.00 58.74 ? 1097 HOH C O     1 
HETATM 4595 O O     . HOH D 4 .   ? 30.930  -4.644  34.866  1.00 75.34 ? 1105 HOH C O     1 
HETATM 4596 O O     . HOH D 4 .   ? 27.021  -8.588  32.164  1.00 49.49 ? 1106 HOH C O     1 
HETATM 4597 O O     . HOH D 4 .   ? 20.000  12.591  44.021  1.00 70.79 ? 1108 HOH C O     1 
HETATM 4598 O O     . HOH D 4 .   ? 11.275  8.537   42.622  1.00 60.62 ? 1122 HOH C O     1 
HETATM 4599 O O     . HOH D 4 .   ? 17.731  5.047   37.323  1.00 67.88 ? 1128 HOH C O     1 
HETATM 4600 O O     . HOH D 4 .   ? 21.738  3.086   31.566  1.00 46.26 ? 1130 HOH C O     1 
HETATM 4601 O O     . HOH D 4 .   ? 27.388  -8.066  35.909  1.00 68.79 ? 1134 HOH C O     1 
HETATM 4602 O O     . HOH D 4 .   ? 26.898  2.053   35.406  1.00 82.88 ? 1148 HOH C O     1 
HETATM 4603 O O     . HOH D 4 .   ? 21.120  3.770   -9.720  1.00 56.53 ? 1159 HOH C O     1 
HETATM 4604 O O     . HOH D 4 .   ? 24.418  6.616   37.872  1.00 55.67 ? 1163 HOH C O     1 
HETATM 4605 O O     . HOH D 4 .   ? 20.200  5.517   -12.222 1.00 67.71 ? 1167 HOH C O     1 
HETATM 4606 O O     . HOH D 4 .   ? 23.970  1.483   32.414  1.00 66.70 ? 1170 HOH C O     1 
HETATM 4607 O O     . HOH D 4 .   ? 18.678  7.492   47.319  1.00 68.63 ? 1183 HOH C O     1 
HETATM 4608 O O     . HOH D 4 .   ? 23.768  -4.573  -0.458  1.00 78.25 ? 1188 HOH C O     1 
HETATM 4609 O O     . HOH D 4 .   ? 18.692  -2.268  13.646  1.00 82.36 ? 1190 HOH C O     1 
HETATM 4610 O O     . HOH D 4 .   ? 12.615  2.804   43.141  1.00 71.67 ? 1198 HOH C O     1 
HETATM 4611 O O     . HOH D 4 .   ? 29.042  8.358   41.286  1.00 68.81 ? 1201 HOH C O     1 
HETATM 4612 O O     . HOH D 4 .   ? 21.679  -10.028 33.714  1.00 58.26 ? 1208 HOH C O     1 
HETATM 4613 O O     . HOH D 4 .   ? 27.593  -3.564  2.946   1.00 75.48 ? 1215 HOH C O     1 
HETATM 4614 O O     . HOH D 4 .   ? 23.245  -5.401  21.709  1.00 51.70 ? 1254 HOH C O     1 
HETATM 4615 O O     . HOH D 4 .   ? 17.745  -8.102  33.510  1.00 77.70 ? 1267 HOH C O     1 
HETATM 4616 O O     . HOH D 4 .   ? 29.664  9.608   38.994  1.00 46.95 ? 1268 HOH C O     1 
HETATM 4617 O O     . HOH D 4 .   ? 24.068  -4.048  39.900  1.00 67.76 ? 1269 HOH C O     1 
HETATM 4618 O O     . HOH D 4 .   ? 28.160  -6.367  3.564   1.00 53.08 ? 1271 HOH C O     1 
HETATM 4619 O O     . HOH D 4 .   ? 29.722  10.157  12.281  1.00 67.42 ? 1276 HOH C O     1 
HETATM 4620 O O     . HOH D 4 .   ? 25.528  4.852   34.443  1.00 70.82 ? 1297 HOH C O     1 
HETATM 4621 O O     . HOH D 4 .   ? 21.502  -6.478  19.250  1.00 57.12 ? 1327 HOH C O     1 
HETATM 4622 O O     . HOH D 4 .   ? 18.182  7.702   8.715   1.00 76.48 ? 1330 HOH C O     1 
HETATM 4623 O O     . HOH D 4 .   ? 14.184  -5.469  25.759  1.00 71.52 ? 1341 HOH C O     1 
HETATM 4624 O O     . HOH D 4 .   ? 20.464  5.763   37.405  1.00 80.56 ? 1353 HOH C O     1 
HETATM 4625 O O     . HOH D 4 .   ? 18.350  8.854   -21.870 1.00 76.34 ? 1371 HOH C O     1 
HETATM 4626 O O     . HOH D 4 .   ? 8.706   2.174   21.116  1.00 94.83 ? 1385 HOH C O     1 
HETATM 4627 O O     . HOH D 4 .   ? 18.509  4.233   9.848   1.00 95.52 ? 1389 HOH C O     1 
HETATM 4628 O O     . HOH D 4 .   ? 32.307  10.606  6.612   1.00 86.42 ? 1403 HOH C O     1 
HETATM 4629 O O     . HOH D 4 .   ? 17.082  -6.851  31.345  1.00 89.45 ? 1408 HOH C O     1 
HETATM 4630 O O     . HOH E 4 .   ? 11.886  4.992   30.687  1.00 24.88 ? 1002 HOH D O     1 
HETATM 4631 O O     . HOH E 4 .   ? 28.152  4.430   22.575  1.00 45.35 ? 1008 HOH D O     1 
HETATM 4632 O O     . HOH E 4 .   ? 11.477  -1.269  35.929  1.00 32.07 ? 1010 HOH D O     1 
HETATM 4633 O O     . HOH E 4 .   ? 21.250  -3.996  37.603  1.00 38.94 ? 1012 HOH D O     1 
HETATM 4634 O O     . HOH E 4 .   ? 16.064  3.388   22.481  1.00 49.61 ? 1015 HOH D O     1 
HETATM 4635 O O     . HOH E 4 .   ? 17.815  5.941   32.684  1.00 31.03 ? 1020 HOH D O     1 
HETATM 4636 O O     . HOH E 4 .   ? 32.114  6.911   18.377  1.00 33.82 ? 1021 HOH D O     1 
HETATM 4637 O O     . HOH E 4 .   ? 24.302  12.856  21.863  1.00 35.19 ? 1024 HOH D O     1 
HETATM 4638 O O     . HOH E 4 .   ? 26.268  6.850   24.226  1.00 33.61 ? 1036 HOH D O     1 
HETATM 4639 O O     . HOH E 4 .   ? 16.890  -0.518  3.337   1.00 66.11 ? 1037 HOH D O     1 
HETATM 4640 O O     . HOH E 4 .   ? 14.962  2.127   39.364  1.00 49.46 ? 1041 HOH D O     1 
HETATM 4641 O O     . HOH E 4 .   ? 22.305  -2.213  -2.286  1.00 52.61 ? 1043 HOH D O     1 
HETATM 4642 O O     . HOH E 4 .   ? 14.101  -2.532  29.310  1.00 44.98 ? 1044 HOH D O     1 
HETATM 4643 O O     . HOH E 4 .   ? 16.699  10.059  27.958  1.00 59.29 ? 1049 HOH D O     1 
HETATM 4644 O O     . HOH E 4 .   ? 13.111  -5.383  39.263  1.00 48.04 ? 1051 HOH D O     1 
HETATM 4645 O O     . HOH E 4 .   ? 13.083  2.888   22.996  1.00 72.97 ? 1061 HOH D O     1 
HETATM 4646 O O     . HOH E 4 .   ? 25.496  -2.605  1.392   1.00 48.08 ? 1065 HOH D O     1 
HETATM 4647 O O     . HOH E 4 .   ? 21.112  9.035   26.453  1.00 55.59 ? 1066 HOH D O     1 
HETATM 4648 O O     . HOH E 4 .   ? 23.183  5.207   27.118  1.00 40.96 ? 1067 HOH D O     1 
HETATM 4649 O O     . HOH E 4 .   ? 20.280  7.069   19.314  1.00 80.33 ? 1071 HOH D O     1 
HETATM 4650 O O     . HOH E 4 .   ? 26.512  5.141   16.194  1.00 51.49 ? 1074 HOH D O     1 
HETATM 4651 O O     . HOH E 4 .   ? 15.836  4.078   35.107  1.00 45.11 ? 1079 HOH D O     1 
HETATM 4652 O O     . HOH E 4 .   ? 32.777  -3.461  14.788  1.00 52.26 ? 1082 HOH D O     1 
HETATM 4653 O O     . HOH E 4 .   ? 30.083  -5.806  14.342  1.00 59.33 ? 1103 HOH D O     1 
HETATM 4654 O O     . HOH E 4 .   ? 29.491  -1.686  16.593  1.00 49.14 ? 1117 HOH D O     1 
HETATM 4655 O O     . HOH E 4 .   ? 32.811  5.746   -11.125 1.00 69.76 ? 1120 HOH D O     1 
HETATM 4656 O O     . HOH E 4 .   ? 20.007  -0.230  9.336   1.00 45.61 ? 1136 HOH D O     1 
HETATM 4657 O O     . HOH E 4 .   ? 31.406  -4.945  -19.589 1.00 52.62 ? 1141 HOH D O     1 
HETATM 4658 O O     . HOH E 4 .   ? 13.859  -0.957  42.087  1.00 56.96 ? 1143 HOH D O     1 
HETATM 4659 O O     . HOH E 4 .   ? 24.906  0.441   23.866  1.00 41.70 ? 1147 HOH D O     1 
HETATM 4660 O O     . HOH E 4 .   ? 17.713  2.320   -9.031  1.00 65.86 ? 1149 HOH D O     1 
HETATM 4661 O O     . HOH E 4 .   ? 20.947  -6.073  47.108  1.00 79.62 ? 1150 HOH D O     1 
HETATM 4662 O O     . HOH E 4 .   ? 21.274  4.947   29.748  1.00 41.91 ? 1154 HOH D O     1 
HETATM 4663 O O     . HOH E 4 .   ? 10.089  1.613   33.866  1.00 54.49 ? 1168 HOH D O     1 
HETATM 4664 O O     . HOH E 4 .   ? 13.749  0.698   24.651  1.00 71.27 ? 1175 HOH D O     1 
HETATM 4665 O O     . HOH E 4 .   ? 13.373  11.257  25.423  1.00 82.44 ? 1180 HOH D O     1 
HETATM 4666 O O     . HOH E 4 .   ? 24.243  -5.434  11.107  1.00 92.78 ? 1189 HOH D O     1 
HETATM 4667 O O     . HOH E 4 .   ? 22.399  -2.953  12.549  1.00 59.79 ? 1194 HOH D O     1 
HETATM 4668 O O     . HOH E 4 .   ? 26.033  3.066   23.390  1.00 86.60 ? 1224 HOH D O     1 
HETATM 4669 O O     . HOH E 4 .   ? 15.272  -2.156  45.910  1.00 62.80 ? 1226 HOH D O     1 
HETATM 4670 O O     . HOH E 4 .   ? 17.642  2.901   -6.378  1.00 64.11 ? 1230 HOH D O     1 
HETATM 4671 O O     . HOH E 4 .   ? 19.035  8.523   28.205  1.00 33.57 ? 1241 HOH D O     1 
HETATM 4672 O O     . HOH E 4 .   ? 13.274  4.852   35.846  1.00 44.56 ? 1243 HOH D O     1 
HETATM 4673 O O     . HOH E 4 .   ? 20.413  -6.338  36.100  1.00 63.60 ? 1262 HOH D O     1 
HETATM 4674 O O     . HOH E 4 .   ? 27.827  -3.581  14.778  1.00 60.27 ? 1264 HOH D O     1 
HETATM 4675 O O     . HOH E 4 .   ? 33.949  -4.979  -22.115 1.00 62.97 ? 1273 HOH D O     1 
HETATM 4676 O O     . HOH E 4 .   ? 20.070  2.694   6.055   1.00 54.48 ? 1277 HOH D O     1 
HETATM 4677 O O     . HOH E 4 .   ? 11.901  -3.307  40.980  1.00 53.09 ? 1278 HOH D O     1 
HETATM 4678 O O     . HOH E 4 .   ? 26.826  6.906   -15.144 1.00 80.37 ? 1281 HOH D O     1 
HETATM 4679 O O     . HOH E 4 .   ? 28.686  6.676   14.902  1.00 54.45 ? 1283 HOH D O     1 
HETATM 4680 O O     . HOH E 4 .   ? 33.032  4.690   -20.065 1.00 75.05 ? 1288 HOH D O     1 
HETATM 4681 O O     . HOH E 4 .   ? 7.938   -4.169  34.905  1.00 70.66 ? 1295 HOH D O     1 
HETATM 4682 O O     . HOH E 4 .   ? 29.056  -0.965  -10.660 1.00 78.29 ? 1305 HOH D O     1 
HETATM 4683 O O     . HOH E 4 .   ? 28.081  -2.309  -18.530 1.00 65.47 ? 1314 HOH D O     1 
HETATM 4684 O O     . HOH E 4 .   ? 22.043  -8.614  36.623  1.00 67.47 ? 1317 HOH D O     1 
HETATM 4685 O O     . HOH E 4 .   ? 28.469  -7.141  10.609  1.00 80.89 ? 1321 HOH D O     1 
HETATM 4686 O O     . HOH E 4 .   ? 10.245  -3.236  37.522  1.00 68.81 ? 1331 HOH D O     1 
HETATM 4687 O O     . HOH E 4 .   ? 34.370  1.325   12.935  1.00 51.17 ? 1339 HOH D O     1 
HETATM 4688 O O     . HOH E 4 .   ? 21.150  -6.960  8.238   1.00 67.39 ? 1342 HOH D O     1 
HETATM 4689 O O     . HOH E 4 .   ? 31.712  6.108   15.669  1.00 80.11 ? 1344 HOH D O     1 
HETATM 4690 O O     . HOH E 4 .   ? 21.166  7.253   30.484  1.00 66.05 ? 1356 HOH D O     1 
HETATM 4691 O O     . HOH E 4 .   ? 24.074  7.627   26.817  1.00 74.04 ? 1369 HOH D O     1 
HETATM 4692 O O     . HOH E 4 .   ? 28.096  4.236   12.010  1.00 86.48 ? 1388 HOH D O     1 
HETATM 4693 O O     . HOH E 4 .   ? 21.584  5.639   3.589   1.00 91.10 ? 1395 HOH D O     1 
HETATM 4694 O O     . HOH E 4 .   ? 23.188  8.780   29.564  1.00 82.28 ? 1402 HOH D O     1 
HETATM 4695 O O     . HOH E 4 .   ? 23.563  -8.017  38.544  1.00 91.44 ? 1406 HOH D O     1 
HETATM 4696 O O     . HOH F 4 .   ? 13.236  12.672  22.820  1.00 36.36 ? 1001 HOH A O     1 
HETATM 4697 O O     . HOH F 4 .   ? 21.812  13.554  21.709  1.00 35.20 ? 1003 HOH A O     1 
HETATM 4698 O O     . HOH F 4 .   ? 24.534  12.776  25.554  1.00 37.37 ? 1004 HOH A O     1 
HETATM 4699 O O     . HOH F 4 .   ? 25.854  9.792   25.536  1.00 32.63 ? 1006 HOH A O     1 
HETATM 4700 O O     . HOH F 4 .   ? 6.862   0.017   22.420  1.00 38.52 ? 1007 HOH A O     1 
HETATM 4701 O O     . HOH F 4 .   ? 6.497   7.274   24.241  1.00 39.60 ? 1009 HOH A O     1 
HETATM 4702 O O     . HOH F 4 .   ? 38.493  4.175   14.526  1.00 41.10 ? 1011 HOH A O     1 
HETATM 4703 O O     . HOH F 4 .   ? 35.415  -17.922 33.746  1.00 41.55 ? 1013 HOH A O     1 
HETATM 4704 O O     . HOH F 4 .   ? 40.164  -5.496  19.278  1.00 52.69 ? 1016 HOH A O     1 
HETATM 4705 O O     . HOH F 4 .   ? 9.660   6.942   25.301  1.00 35.20 ? 1017 HOH A O     1 
HETATM 4706 O O     . HOH F 4 .   ? 8.530   2.639   37.075  1.00 46.41 ? 1018 HOH A O     1 
HETATM 4707 O O     . HOH F 4 .   ? 23.826  -23.358 30.224  1.00 41.09 ? 1023 HOH A O     1 
HETATM 4708 O O     . HOH F 4 .   ? 39.601  8.470   12.751  1.00 35.18 ? 1025 HOH A O     1 
HETATM 4709 O O     . HOH F 4 .   ? 26.787  0.542   21.009  1.00 40.96 ? 1026 HOH A O     1 
HETATM 4710 O O     . HOH F 4 .   ? 30.934  -11.318 0.622   1.00 56.53 ? 1028 HOH A O     1 
HETATM 4711 O O     . HOH F 4 .   ? 34.988  -0.556  23.828  1.00 59.37 ? 1029 HOH A O     1 
HETATM 4712 O O     . HOH F 4 .   ? 31.652  -24.021 34.600  1.00 59.89 ? 1030 HOH A O     1 
HETATM 4713 O O     . HOH F 4 .   ? 39.761  -15.783 20.112  1.00 63.91 ? 1032 HOH A O     1 
HETATM 4714 O O     . HOH F 4 .   ? 16.624  13.815  30.062  1.00 42.97 ? 1033 HOH A O     1 
HETATM 4715 O O     . HOH F 4 .   ? 4.762   25.506  40.246  1.00 60.50 ? 1034 HOH A O     1 
HETATM 4716 O O     . HOH F 4 .   ? 14.504  9.754   35.295  1.00 40.45 ? 1035 HOH A O     1 
HETATM 4717 O O     . HOH F 4 .   ? 40.015  8.242   26.630  1.00 44.32 ? 1038 HOH A O     1 
HETATM 4718 O O     . HOH F 4 .   ? 23.008  16.388  30.420  1.00 44.88 ? 1039 HOH A O     1 
HETATM 4719 O O     . HOH F 4 .   ? 41.440  -3.651  -3.715  1.00 66.98 ? 1040 HOH A O     1 
HETATM 4720 O O     . HOH F 4 .   ? 10.045  -8.488  13.399  1.00 59.43 ? 1042 HOH A O     1 
HETATM 4721 O O     . HOH F 4 .   ? 46.849  14.894  28.683  1.00 54.01 ? 1045 HOH A O     1 
HETATM 4722 O O     . HOH F 4 .   ? 44.666  8.514   26.509  1.00 49.53 ? 1046 HOH A O     1 
HETATM 4723 O O     . HOH F 4 .   ? 54.167  4.065   21.656  1.00 44.90 ? 1047 HOH A O     1 
HETATM 4724 O O     . HOH F 4 .   ? 54.142  21.903  11.968  1.00 43.33 ? 1048 HOH A O     1 
HETATM 4725 O O     . HOH F 4 .   ? 15.528  11.653  37.604  1.00 36.45 ? 1053 HOH A O     1 
HETATM 4726 O O     . HOH F 4 .   ? 31.104  -15.096 16.600  1.00 62.12 ? 1054 HOH A O     1 
HETATM 4727 O O     . HOH F 4 .   ? 40.612  -17.645 28.917  1.00 31.55 ? 1055 HOH A O     1 
HETATM 4728 O O     . HOH F 4 .   ? 39.223  -2.505  20.040  1.00 40.67 ? 1056 HOH A O     1 
HETATM 4729 O O     . HOH F 4 .   ? 46.817  19.021  10.254  1.00 45.89 ? 1058 HOH A O     1 
HETATM 4730 O O     . HOH F 4 .   ? 40.945  1.475   15.003  1.00 43.24 ? 1059 HOH A O     1 
HETATM 4731 O O     . HOH F 4 .   ? 35.173  -7.935  -8.629  1.00 50.78 ? 1060 HOH A O     1 
HETATM 4732 O O     . HOH F 4 .   ? 19.248  8.387   31.486  1.00 64.31 ? 1062 HOH A O     1 
HETATM 4733 O O     . HOH F 4 .   ? 6.201   -2.151  8.407   1.00 57.04 ? 1063 HOH A O     1 
HETATM 4734 O O     . HOH F 4 .   ? 16.852  20.747  24.869  1.00 46.76 ? 1064 HOH A O     1 
HETATM 4735 O O     . HOH F 4 .   ? 24.929  -11.930 32.941  1.00 46.86 ? 1068 HOH A O     1 
HETATM 4736 O O     . HOH F 4 .   ? 20.266  -11.787 20.738  1.00 59.21 ? 1069 HOH A O     1 
HETATM 4737 O O     . HOH F 4 .   ? 10.325  13.171  22.484  1.00 42.06 ? 1072 HOH A O     1 
HETATM 4738 O O     . HOH F 4 .   ? 17.285  -17.238 18.739  1.00 41.27 ? 1073 HOH A O     1 
HETATM 4739 O O     . HOH F 4 .   ? 6.587   0.435   5.956   1.00 59.05 ? 1075 HOH A O     1 
HETATM 4740 O O     . HOH F 4 .   ? 26.241  -3.110  22.505  1.00 50.91 ? 1076 HOH A O     1 
HETATM 4741 O O     . HOH F 4 .   ? 30.087  -17.713 16.493  1.00 56.91 ? 1077 HOH A O     1 
HETATM 4742 O O     . HOH F 4 .   ? 55.333  8.709   13.386  1.00 43.54 ? 1078 HOH A O     1 
HETATM 4743 O O     . HOH F 4 .   ? 4.614   15.165  17.869  1.00 58.83 ? 1080 HOH A O     1 
HETATM 4744 O O     . HOH F 4 .   ? 33.815  9.427   8.703   1.00 52.01 ? 1083 HOH A O     1 
HETATM 4745 O O     . HOH F 4 .   ? 21.236  19.359  36.050  1.00 68.23 ? 1084 HOH A O     1 
HETATM 4746 O O     . HOH F 4 .   ? 13.118  15.255  18.415  1.00 50.59 ? 1085 HOH A O     1 
HETATM 4747 O O     . HOH F 4 .   ? 10.114  17.835  33.998  1.00 57.65 ? 1086 HOH A O     1 
HETATM 4748 O O     . HOH F 4 .   ? 32.974  -22.680 20.618  1.00 53.12 ? 1087 HOH A O     1 
HETATM 4749 O O     . HOH F 4 .   ? 29.043  -22.381 2.650   1.00 54.56 ? 1088 HOH A O     1 
HETATM 4750 O O     . HOH F 4 .   ? 47.510  17.710  28.246  1.00 55.38 ? 1089 HOH A O     1 
HETATM 4751 O O     . HOH F 4 .   ? 45.464  6.206   -4.420  1.00 60.01 ? 1090 HOH A O     1 
HETATM 4752 O O     . HOH F 4 .   ? 4.907   -2.506  23.247  1.00 45.17 ? 1091 HOH A O     1 
HETATM 4753 O O     . HOH F 4 .   ? 13.712  -21.583 16.354  1.00 54.37 ? 1092 HOH A O     1 
HETATM 4754 O O     . HOH F 4 .   ? 26.534  -11.143 10.735  1.00 65.14 ? 1093 HOH A O     1 
HETATM 4755 O O     . HOH F 4 .   ? 11.588  26.145  24.395  1.00 50.64 ? 1094 HOH A O     1 
HETATM 4756 O O     . HOH F 4 .   ? 26.604  -0.953  31.933  1.00 63.42 ? 1095 HOH A O     1 
HETATM 4757 O O     . HOH F 4 .   ? 16.963  -3.707  4.437   1.00 57.55 ? 1096 HOH A O     1 
HETATM 4758 O O     . HOH F 4 .   ? 42.611  21.389  12.305  1.00 59.01 ? 1098 HOH A O     1 
HETATM 4759 O O     . HOH F 4 .   ? 35.232  -5.576  30.053  1.00 59.71 ? 1099 HOH A O     1 
HETATM 4760 O O     . HOH F 4 .   ? 23.253  18.553  21.896  1.00 44.14 ? 1100 HOH A O     1 
HETATM 4761 O O     . HOH F 4 .   ? 40.182  -12.327 16.415  1.00 53.89 ? 1101 HOH A O     1 
HETATM 4762 O O     . HOH F 4 .   ? 54.079  6.506   23.304  1.00 50.40 ? 1102 HOH A O     1 
HETATM 4763 O O     . HOH F 4 .   ? -5.825  -1.332  7.143   1.00 44.22 ? 1104 HOH A O     1 
HETATM 4764 O O     . HOH F 4 .   ? 48.476  3.655   10.026  1.00 54.76 ? 1107 HOH A O     1 
HETATM 4765 O O     . HOH F 4 .   ? 30.366  -21.561 23.511  1.00 63.59 ? 1109 HOH A O     1 
HETATM 4766 O O     . HOH F 4 .   ? 20.460  16.890  30.032  1.00 59.19 ? 1110 HOH A O     1 
HETATM 4767 O O     . HOH F 4 .   ? 18.687  22.196  26.640  1.00 70.59 ? 1111 HOH A O     1 
HETATM 4768 O O     . HOH F 4 .   ? 43.311  25.939  27.342  1.00 73.56 ? 1112 HOH A O     1 
HETATM 4769 O O     . HOH F 4 .   ? 7.563   -2.802  10.745  1.00 47.92 ? 1113 HOH A O     1 
HETATM 4770 O O     . HOH F 4 .   ? 28.078  12.028  13.980  1.00 60.85 ? 1114 HOH A O     1 
HETATM 4771 O O     . HOH F 4 .   ? 32.729  1.191   22.985  1.00 42.00 ? 1115 HOH A O     1 
HETATM 4772 O O     . HOH F 4 .   ? 44.567  1.486   14.687  1.00 74.23 ? 1116 HOH A O     1 
HETATM 4773 O O     . HOH F 4 .   ? 8.338   0.190   18.347  1.00 53.28 ? 1118 HOH A O     1 
HETATM 4774 O O     . HOH F 4 .   ? 47.325  4.284   20.404  1.00 43.25 ? 1119 HOH A O     1 
HETATM 4775 O O     . HOH F 4 .   ? -5.842  -5.418  4.890   1.00 52.20 ? 1121 HOH A O     1 
HETATM 4776 O O     . HOH F 4 .   ? 54.888  25.322  25.013  1.00 67.12 ? 1123 HOH A O     1 
HETATM 4777 O O     . HOH F 4 .   ? 39.646  10.610  -5.596  1.00 59.42 ? 1124 HOH A O     1 
HETATM 4778 O O     . HOH F 4 .   ? 42.955  3.502   21.206  1.00 75.23 ? 1125 HOH A O     1 
HETATM 4779 O O     . HOH F 4 .   ? 1.871   2.369   -13.250 1.00 79.68 ? 1126 HOH A O     1 
HETATM 4780 O O     . HOH F 4 .   ? 34.562  -19.633 7.403   1.00 62.64 ? 1127 HOH A O     1 
HETATM 4781 O O     . HOH F 4 .   ? 55.057  25.186  20.491  1.00 75.06 ? 1129 HOH A O     1 
HETATM 4782 O O     . HOH F 4 .   ? 32.394  4.173   23.390  1.00 44.82 ? 1131 HOH A O     1 
HETATM 4783 O O     . HOH F 4 .   ? 46.461  -0.075  10.424  1.00 55.08 ? 1132 HOH A O     1 
HETATM 4784 O O     . HOH F 4 .   ? 30.860  -28.430 19.233  1.00 74.96 ? 1133 HOH A O     1 
HETATM 4785 O O     . HOH F 4 .   ? 33.730  18.701  27.726  1.00 54.99 ? 1135 HOH A O     1 
HETATM 4786 O O     . HOH F 4 .   ? 58.170  13.048  1.908   1.00 88.49 ? 1137 HOH A O     1 
HETATM 4787 O O     . HOH F 4 .   ? -3.607  -3.456  6.252   1.00 67.88 ? 1138 HOH A O     1 
HETATM 4788 O O     . HOH F 4 .   ? -0.022  7.523   42.464  1.00 68.49 ? 1139 HOH A O     1 
HETATM 4789 O O     . HOH F 4 .   ? 39.699  9.275   -0.964  1.00 81.04 ? 1140 HOH A O     1 
HETATM 4790 O O     . HOH F 4 .   ? 56.503  11.840  11.040  1.00 58.81 ? 1142 HOH A O     1 
HETATM 4791 O O     . HOH F 4 .   ? 5.937   -1.745  37.740  1.00 51.28 ? 1144 HOH A O     1 
HETATM 4792 O O     . HOH F 4 .   ? 27.252  5.543   31.285  1.00 51.70 ? 1145 HOH A O     1 
HETATM 4793 O O     . HOH F 4 .   ? 39.234  20.163  10.086  1.00 76.44 ? 1146 HOH A O     1 
HETATM 4794 O O     . HOH F 4 .   ? 38.489  7.377   15.514  1.00 54.21 ? 1151 HOH A O     1 
HETATM 4795 O O     . HOH F 4 .   ? 39.147  8.852   3.032   1.00 51.63 ? 1152 HOH A O     1 
HETATM 4796 O O     . HOH F 4 .   ? 29.115  19.741  25.688  1.00 56.18 ? 1153 HOH A O     1 
HETATM 4797 O O     . HOH F 4 .   ? 34.571  -11.048 34.366  1.00 52.13 ? 1155 HOH A O     1 
HETATM 4798 O O     . HOH F 4 .   ? 14.450  -22.444 20.682  1.00 58.51 ? 1156 HOH A O     1 
HETATM 4799 O O     . HOH F 4 .   ? 11.006  -5.497  19.713  1.00 59.03 ? 1157 HOH A O     1 
HETATM 4800 O O     . HOH F 4 .   ? 13.213  -23.053 13.537  1.00 63.57 ? 1158 HOH A O     1 
HETATM 4801 O O     . HOH F 4 .   ? 13.206  -26.883 17.615  1.00 59.89 ? 1160 HOH A O     1 
HETATM 4802 O O     . HOH F 4 .   ? 32.515  -10.399 7.570   1.00 84.21 ? 1161 HOH A O     1 
HETATM 4803 O O     . HOH F 4 .   ? 2.523   -8.466  24.821  1.00 78.60 ? 1162 HOH A O     1 
HETATM 4804 O O     . HOH F 4 .   ? 47.882  -2.960  17.162  1.00 51.13 ? 1164 HOH A O     1 
HETATM 4805 O O     . HOH F 4 .   ? 38.473  6.963   29.420  1.00 87.30 ? 1165 HOH A O     1 
HETATM 4806 O O     . HOH F 4 .   ? 3.043   -2.326  8.803   1.00 57.81 ? 1166 HOH A O     1 
HETATM 4807 O O     . HOH F 4 .   ? 58.730  4.620   2.835   1.00 46.25 ? 1169 HOH A O     1 
HETATM 4808 O O     . HOH F 4 .   ? 31.549  -10.149 -7.319  1.00 53.68 ? 1171 HOH A O     1 
HETATM 4809 O O     . HOH F 4 .   ? 34.744  2.153   17.245  1.00 65.04 ? 1172 HOH A O     1 
HETATM 4810 O O     . HOH F 4 .   ? 36.177  -15.475 19.328  1.00 61.04 ? 1173 HOH A O     1 
HETATM 4811 O O     . HOH F 4 .   ? 42.515  -19.615 19.591  1.00 54.51 ? 1174 HOH A O     1 
HETATM 4812 O O     . HOH F 4 .   ? 50.859  14.372  8.664   1.00 55.51 ? 1176 HOH A O     1 
HETATM 4813 O O     . HOH F 4 .   ? 12.279  -11.897 13.261  1.00 77.40 ? 1177 HOH A O     1 
HETATM 4814 O O     . HOH F 4 .   ? -11.782 5.806   32.855  1.00 54.67 ? 1178 HOH A O     1 
HETATM 4815 O O     . HOH F 4 .   ? 17.575  -20.601 17.852  1.00 62.48 ? 1179 HOH A O     1 
HETATM 4816 O O     . HOH F 4 .   ? 37.592  10.142  5.941   1.00 61.38 ? 1181 HOH A O     1 
HETATM 4817 O O     . HOH F 4 .   ? 56.362  6.827   9.518   1.00 60.69 ? 1182 HOH A O     1 
HETATM 4818 O O     . HOH F 4 .   ? 38.063  -22.921 25.019  1.00 68.96 ? 1184 HOH A O     1 
HETATM 4819 O O     . HOH F 4 .   ? 51.312  30.526  18.916  1.00 59.07 ? 1185 HOH A O     1 
HETATM 4820 O O     . HOH F 4 .   ? 12.393  11.262  34.009  1.00 47.15 ? 1186 HOH A O     1 
HETATM 4821 O O     . HOH F 4 .   ? 3.628   5.868   40.186  1.00 75.11 ? 1187 HOH A O     1 
HETATM 4822 O O     . HOH F 4 .   ? 31.239  -16.923 35.580  1.00 48.98 ? 1191 HOH A O     1 
HETATM 4823 O O     . HOH F 4 .   ? 37.016  -0.114  21.498  1.00 55.04 ? 1192 HOH A O     1 
HETATM 4824 O O     . HOH F 4 .   ? 27.762  9.494   16.088  1.00 68.96 ? 1193 HOH A O     1 
HETATM 4825 O O     . HOH F 4 .   ? -0.096  -12.853 17.668  1.00 51.75 ? 1195 HOH A O     1 
HETATM 4826 O O     . HOH F 4 .   ? 30.233  -4.889  18.435  1.00 48.10 ? 1196 HOH A O     1 
HETATM 4827 O O     . HOH F 4 .   ? 37.259  -2.526  -11.870 1.00 76.69 ? 1197 HOH A O     1 
HETATM 4828 O O     . HOH F 4 .   ? 30.334  -25.520 32.032  1.00 71.62 ? 1199 HOH A O     1 
HETATM 4829 O O     . HOH F 4 .   ? 28.764  -31.400 26.372  1.00 78.50 ? 1200 HOH A O     1 
HETATM 4830 O O     . HOH F 4 .   ? 15.564  17.951  33.343  1.00 57.36 ? 1202 HOH A O     1 
HETATM 4831 O O     . HOH F 4 .   ? 40.518  -14.607 -0.472  1.00 59.78 ? 1203 HOH A O     1 
HETATM 4832 O O     . HOH F 4 .   ? 25.350  19.522  34.212  1.00 65.54 ? 1204 HOH A O     1 
HETATM 4833 O O     . HOH F 4 .   ? 38.200  23.993  23.148  1.00 67.96 ? 1205 HOH A O     1 
HETATM 4834 O O     . HOH F 4 .   ? 53.197  11.254  1.844   1.00 86.02 ? 1206 HOH A O     1 
HETATM 4835 O O     . HOH F 4 .   ? 17.175  13.157  40.511  1.00 70.14 ? 1207 HOH A O     1 
HETATM 4836 O O     . HOH F 4 .   ? 20.186  15.454  39.322  1.00 64.02 ? 1209 HOH A O     1 
HETATM 4837 O O     . HOH F 4 .   ? 59.269  10.708  3.452   1.00 84.44 ? 1210 HOH A O     1 
HETATM 4838 O O     . HOH F 4 .   ? -13.185 24.321  35.728  1.00 57.83 ? 1211 HOH A O     1 
HETATM 4839 O O     . HOH F 4 .   ? 33.462  18.104  4.763   1.00 63.49 ? 1212 HOH A O     1 
HETATM 4840 O O     . HOH F 4 .   ? 40.882  -8.454  32.974  1.00 75.54 ? 1213 HOH A O     1 
HETATM 4841 O O     . HOH F 4 .   ? 0.232   3.589   39.989  1.00 58.27 ? 1214 HOH A O     1 
HETATM 4842 O O     . HOH F 4 .   ? 13.698  -15.606 8.356   1.00 69.48 ? 1216 HOH A O     1 
HETATM 4843 O O     . HOH F 4 .   ? 25.619  -11.433 35.776  1.00 75.39 ? 1217 HOH A O     1 
HETATM 4844 O O     . HOH F 4 .   ? 14.942  12.138  28.781  1.00 81.31 ? 1218 HOH A O     1 
HETATM 4845 O O     . HOH F 4 .   ? 15.185  5.736   20.859  1.00 67.77 ? 1219 HOH A O     1 
HETATM 4846 O O     . HOH F 4 .   ? -6.198  -5.618  27.882  1.00 68.11 ? 1220 HOH A O     1 
HETATM 4847 O O     . HOH F 4 .   ? -5.245  8.230   39.256  1.00 55.77 ? 1221 HOH A O     1 
HETATM 4848 O O     . HOH F 4 .   ? 14.969  -10.202 25.900  1.00 63.16 ? 1222 HOH A O     1 
HETATM 4849 O O     . HOH F 4 .   ? 0.474   15.746  45.000  1.00 54.71 ? 1223 HOH A O     1 
HETATM 4850 O O     . HOH F 4 .   ? -10.160 -8.682  3.883   1.00 61.22 ? 1225 HOH A O     1 
HETATM 4851 O O     . HOH F 4 .   ? 29.723  -7.048  30.671  1.00 73.69 ? 1227 HOH A O     1 
HETATM 4852 O O     . HOH F 4 .   ? 19.855  -15.366 12.499  1.00 49.82 ? 1228 HOH A O     1 
HETATM 4853 O O     . HOH F 4 .   ? 29.999  -8.862  34.514  1.00 63.66 ? 1229 HOH A O     1 
HETATM 4854 O O     . HOH F 4 .   ? -4.767  3.166   -4.680  1.00 59.23 ? 1231 HOH A O     1 
HETATM 4855 O O     . HOH F 4 .   ? 25.409  2.330   26.958  1.00 68.97 ? 1232 HOH A O     1 
HETATM 4856 O O     . HOH F 4 .   ? 35.400  7.728   15.171  1.00 76.55 ? 1233 HOH A O     1 
HETATM 4857 O O     . HOH F 4 .   ? 22.096  -20.543 32.737  1.00 54.83 ? 1234 HOH A O     1 
HETATM 4858 O O     . HOH F 4 .   ? 34.811  6.148   32.442  1.00 69.08 ? 1235 HOH A O     1 
HETATM 4859 O O     . HOH F 4 .   ? -6.937  -1.092  2.713   1.00 60.11 ? 1236 HOH A O     1 
HETATM 4860 O O     . HOH F 4 .   ? 23.609  10.242  31.894  1.00 81.91 ? 1237 HOH A O     1 
HETATM 4861 O O     . HOH F 4 .   ? 42.784  6.697   -8.698  1.00 64.99 ? 1238 HOH A O     1 
HETATM 4862 O O     . HOH F 4 .   ? 32.488  22.207  20.643  1.00 53.17 ? 1239 HOH A O     1 
HETATM 4863 O O     . HOH F 4 .   ? 11.242  5.505   23.079  1.00 42.68 ? 1240 HOH A O     1 
HETATM 4864 O O     . HOH F 4 .   ? 11.674  4.105   33.542  1.00 61.43 ? 1242 HOH A O     1 
HETATM 4865 O O     . HOH F 4 .   ? 46.000  2.784   10.761  1.00 36.62 ? 1244 HOH A O     1 
HETATM 4866 O O     . HOH F 4 .   ? 16.453  12.830  25.927  1.00 45.24 ? 1245 HOH A O     1 
HETATM 4867 O O     . HOH F 4 .   ? 17.685  25.128  26.427  1.00 56.53 ? 1246 HOH A O     1 
HETATM 4868 O O     . HOH F 4 .   ? 40.301  5.258   12.078  1.00 57.99 ? 1247 HOH A O     1 
HETATM 4869 O O     . HOH F 4 .   ? 41.237  -1.505  13.826  1.00 60.27 ? 1248 HOH A O     1 
HETATM 4870 O O     . HOH F 4 .   ? 59.892  11.433  10.530  1.00 48.69 ? 1249 HOH A O     1 
HETATM 4871 O O     . HOH F 4 .   ? 45.722  27.285  26.388  1.00 53.97 ? 1250 HOH A O     1 
HETATM 4872 O O     . HOH F 4 .   ? 23.179  20.373  19.479  1.00 62.92 ? 1251 HOH A O     1 
HETATM 4873 O O     . HOH F 4 .   ? 18.078  15.517  31.690  1.00 66.24 ? 1252 HOH A O     1 
HETATM 4874 O O     . HOH F 4 .   ? 40.691  8.723   5.850   1.00 59.93 ? 1253 HOH A O     1 
HETATM 4875 O O     . HOH F 4 .   ? 10.961  1.175   37.937  1.00 52.49 ? 1255 HOH A O     1 
HETATM 4876 O O     . HOH F 4 .   ? 31.680  20.664  27.172  1.00 47.08 ? 1256 HOH A O     1 
HETATM 4877 O O     . HOH F 4 .   ? 42.021  4.845   4.831   1.00 63.97 ? 1257 HOH A O     1 
HETATM 4878 O O     . HOH F 4 .   ? 38.602  12.831  -4.079  1.00 59.08 ? 1258 HOH A O     1 
HETATM 4879 O O     . HOH F 4 .   ? 24.083  1.269   29.128  1.00 49.71 ? 1259 HOH A O     1 
HETATM 4880 O O     . HOH F 4 .   ? 10.704  -4.820  22.756  1.00 76.41 ? 1260 HOH A O     1 
HETATM 4881 O O     . HOH F 4 .   ? 32.705  24.424  18.304  1.00 51.46 ? 1261 HOH A O     1 
HETATM 4882 O O     . HOH F 4 .   ? 38.411  -20.543 26.907  1.00 69.10 ? 1263 HOH A O     1 
HETATM 4883 O O     . HOH F 4 .   ? 9.197   13.339  19.927  1.00 60.18 ? 1265 HOH A O     1 
HETATM 4884 O O     . HOH F 4 .   ? 7.026   -3.263  25.087  1.00 57.18 ? 1266 HOH A O     1 
HETATM 4885 O O     . HOH F 4 .   ? 19.422  18.581  33.889  1.00 64.31 ? 1270 HOH A O     1 
HETATM 4886 O O     . HOH F 4 .   ? 7.045   0.382   35.873  1.00 52.20 ? 1272 HOH A O     1 
HETATM 4887 O O     . HOH F 4 .   ? 33.813  -8.947  -6.178  1.00 59.09 ? 1274 HOH A O     1 
HETATM 4888 O O     . HOH F 4 .   ? 44.891  19.987  13.185  1.00 60.99 ? 1275 HOH A O     1 
HETATM 4889 O O     . HOH F 4 .   ? 35.831  -23.050 19.791  1.00 67.66 ? 1279 HOH A O     1 
HETATM 4890 O O     . HOH F 4 .   ? 32.114  -24.310 18.129  1.00 79.19 ? 1280 HOH A O     1 
HETATM 4891 O O     . HOH F 4 .   ? 10.795  -14.931 12.412  1.00 61.06 ? 1282 HOH A O     1 
HETATM 4892 O O     . HOH F 4 .   ? 30.009  -6.564  20.449  1.00 74.14 ? 1284 HOH A O     1 
HETATM 4893 O O     . HOH F 4 .   ? 30.257  -24.213 28.063  1.00 56.63 ? 1285 HOH A O     1 
HETATM 4894 O O     . HOH F 4 .   ? 48.257  -19.547 33.061  1.00 63.05 ? 1286 HOH A O     1 
HETATM 4895 O O     . HOH F 4 .   ? 59.373  8.165   9.961   1.00 81.05 ? 1287 HOH A O     1 
HETATM 4896 O O     . HOH F 4 .   ? 41.529  -7.964  -11.948 1.00 61.89 ? 1289 HOH A O     1 
HETATM 4897 O O     . HOH F 4 .   ? 29.325  21.249  20.275  1.00 62.83 ? 1290 HOH A O     1 
HETATM 4898 O O     . HOH F 4 .   ? 59.439  22.263  19.610  1.00 63.83 ? 1291 HOH A O     1 
HETATM 4899 O O     . HOH F 4 .   ? 28.979  4.620   25.313  1.00 85.00 ? 1292 HOH A O     1 
HETATM 4900 O O     . HOH F 4 .   ? 52.636  32.150  16.690  1.00 68.67 ? 1293 HOH A O     1 
HETATM 4901 O O     . HOH F 4 .   ? 19.525  15.905  35.635  1.00 87.60 ? 1294 HOH A O     1 
HETATM 4902 O O     . HOH F 4 .   ? 36.547  -26.066 24.758  1.00 77.18 ? 1296 HOH A O     1 
HETATM 4903 O O     . HOH F 4 .   ? 58.278  11.645  18.525  1.00 68.43 ? 1298 HOH A O     1 
HETATM 4904 O O     . HOH F 4 .   ? 45.064  4.199   -6.608  1.00 66.00 ? 1299 HOH A O     1 
HETATM 4905 O O     . HOH F 4 .   ? 42.127  -19.352 16.560  1.00 76.88 ? 1300 HOH A O     1 
HETATM 4906 O O     . HOH F 4 .   ? 35.237  -17.456 1.239   1.00 80.70 ? 1301 HOH A O     1 
HETATM 4907 O O     . HOH F 4 .   ? 34.546  -6.191  -3.298  1.00 56.59 ? 1302 HOH A O     1 
HETATM 4908 O O     . HOH F 4 .   ? 33.642  -27.257 17.521  1.00 55.47 ? 1303 HOH A O     1 
HETATM 4909 O O     . HOH F 4 .   ? 37.282  8.142   10.913  1.00 80.55 ? 1304 HOH A O     1 
HETATM 4910 O O     . HOH F 4 .   ? -13.990 1.770   4.750   1.00 79.22 ? 1306 HOH A O     1 
HETATM 4911 O O     . HOH F 4 .   ? -10.242 -0.090  1.177   1.00 60.87 ? 1307 HOH A O     1 
HETATM 4912 O O     . HOH F 4 .   ? 32.780  -8.238  35.517  1.00 69.92 ? 1308 HOH A O     1 
HETATM 4913 O O     . HOH F 4 .   ? 30.269  -9.519  5.461   1.00 65.90 ? 1309 HOH A O     1 
HETATM 4914 O O     . HOH F 4 .   ? 34.939  -8.599  7.320   1.00 57.62 ? 1310 HOH A O     1 
HETATM 4915 O O     . HOH F 4 .   ? 36.766  -20.556 18.185  1.00 61.31 ? 1311 HOH A O     1 
HETATM 4916 O O     . HOH F 4 .   ? 30.519  20.645  30.357  1.00 57.23 ? 1312 HOH A O     1 
HETATM 4917 O O     . HOH F 4 .   ? 15.539  26.493  25.052  1.00 65.71 ? 1313 HOH A O     1 
HETATM 4918 O O     . HOH F 4 .   ? 31.545  16.172  8.340   1.00 58.80 ? 1315 HOH A O     1 
HETATM 4919 O O     . HOH F 4 .   ? 8.352   -7.236  23.516  1.00 55.20 ? 1316 HOH A O     1 
HETATM 4920 O O     . HOH F 4 .   ? 40.222  -9.964  -14.067 1.00 79.99 ? 1318 HOH A O     1 
HETATM 4921 O O     . HOH F 4 .   ? 36.506  -25.265 17.626  1.00 69.09 ? 1319 HOH A O     1 
HETATM 4922 O O     . HOH F 4 .   ? 14.678  12.603  18.083  1.00 54.66 ? 1320 HOH A O     1 
HETATM 4923 O O     . HOH F 4 .   ? 27.099  19.535  28.066  1.00 74.48 ? 1322 HOH A O     1 
HETATM 4924 O O     . HOH F 4 .   ? -10.183 2.291   -7.195  1.00 64.15 ? 1323 HOH A O     1 
HETATM 4925 O O     . HOH F 4 .   ? 44.280  2.956   4.823   1.00 84.13 ? 1324 HOH A O     1 
HETATM 4926 O O     . HOH F 4 .   ? 36.591  18.958  25.523  1.00 65.14 ? 1325 HOH A O     1 
HETATM 4927 O O     . HOH F 4 .   ? -12.578 13.260  32.090  1.00 64.97 ? 1326 HOH A O     1 
HETATM 4928 O O     . HOH F 4 .   ? 59.619  10.449  21.951  1.00 71.26 ? 1328 HOH A O     1 
HETATM 4929 O O     . HOH F 4 .   ? 37.436  -3.927  31.583  1.00 72.25 ? 1329 HOH A O     1 
HETATM 4930 O O     . HOH F 4 .   ? 61.174  15.815  26.285  1.00 57.57 ? 1332 HOH A O     1 
HETATM 4931 O O     . HOH F 4 .   ? 20.893  -13.000 34.543  1.00 71.24 ? 1333 HOH A O     1 
HETATM 4932 O O     . HOH F 4 .   ? 25.173  19.886  17.168  1.00 73.05 ? 1334 HOH A O     1 
HETATM 4933 O O     . HOH F 4 .   ? 49.755  28.539  15.713  1.00 71.10 ? 1335 HOH A O     1 
HETATM 4934 O O     . HOH F 4 .   ? 39.442  -16.632 -2.718  1.00 73.27 ? 1336 HOH A O     1 
HETATM 4935 O O     . HOH F 4 .   ? 44.184  3.463   23.858  1.00 63.27 ? 1337 HOH A O     1 
HETATM 4936 O O     . HOH F 4 .   ? 40.986  13.821  5.920   1.00 61.58 ? 1338 HOH A O     1 
HETATM 4937 O O     . HOH F 4 .   ? -7.741  12.377  41.137  1.00 60.31 ? 1340 HOH A O     1 
HETATM 4938 O O     . HOH F 4 .   ? 49.310  2.634   7.524   1.00 75.63 ? 1343 HOH A O     1 
HETATM 4939 O O     . HOH F 4 .   ? 12.912  -16.830 13.119  1.00 71.89 ? 1345 HOH A O     1 
HETATM 4940 O O     . HOH F 4 .   ? 36.612  -5.084  14.245  1.00 76.86 ? 1346 HOH A O     1 
HETATM 4941 O O     . HOH F 4 .   ? 21.922  20.332  23.890  1.00 65.81 ? 1347 HOH A O     1 
HETATM 4942 O O     . HOH F 4 .   ? 0.848   13.236  16.903  1.00 75.27 ? 1348 HOH A O     1 
HETATM 4943 O O     . HOH F 4 .   ? 15.249  -22.680 25.034  1.00 56.27 ? 1349 HOH A O     1 
HETATM 4944 O O     . HOH F 4 .   ? 14.878  -21.066 14.185  1.00 58.85 ? 1350 HOH A O     1 
HETATM 4945 O O     . HOH F 4 .   ? 33.047  14.505  5.175   1.00 61.88 ? 1351 HOH A O     1 
HETATM 4946 O O     . HOH F 4 .   ? 41.928  10.897  5.827   1.00 73.50 ? 1352 HOH A O     1 
HETATM 4947 O O     . HOH F 4 .   ? 41.978  -13.197 32.401  1.00 75.83 ? 1354 HOH A O     1 
HETATM 4948 O O     . HOH F 4 .   ? 43.775  -1.514  14.042  1.00 94.53 ? 1355 HOH A O     1 
HETATM 4949 O O     . HOH F 4 .   ? -12.597 6.338   21.022  1.00 84.24 ? 1357 HOH A O     1 
HETATM 4950 O O     . HOH F 4 .   ? 14.162  24.388  16.945  1.00 70.23 ? 1358 HOH A O     1 
HETATM 4951 O O     . HOH F 4 .   ? 13.299  7.655   36.558  1.00 68.71 ? 1359 HOH A O     1 
HETATM 4952 O O     . HOH F 4 .   ? 38.434  3.642   10.307  1.00 62.57 ? 1360 HOH A O     1 
HETATM 4953 O O     . HOH F 4 .   ? 16.022  -17.893 12.629  1.00 80.92 ? 1361 HOH A O     1 
HETATM 4954 O O     . HOH F 4 .   ? 17.623  20.148  36.028  1.00 71.16 ? 1362 HOH A O     1 
HETATM 4955 O O     . HOH F 4 .   ? 44.197  0.853   23.821  1.00 77.24 ? 1363 HOH A O     1 
HETATM 4956 O O     . HOH F 4 .   ? 9.733   18.971  15.081  1.00 87.51 ? 1364 HOH A O     1 
HETATM 4957 O O     . HOH F 4 .   ? 30.241  -7.797  12.560  1.00 72.91 ? 1365 HOH A O     1 
HETATM 4958 O O     . HOH F 4 .   ? 36.964  2.559   12.741  1.00 71.94 ? 1366 HOH A O     1 
HETATM 4959 O O     . HOH F 4 .   ? 32.703  -20.252 33.639  1.00 80.71 ? 1367 HOH A O     1 
HETATM 4960 O O     . HOH F 4 .   ? 39.894  -13.254 -7.395  1.00 91.06 ? 1368 HOH A O     1 
HETATM 4961 O O     . HOH F 4 .   ? 9.810   -3.891  14.331  1.00 67.03 ? 1370 HOH A O     1 
HETATM 4962 O O     . HOH F 4 .   ? 33.811  25.749  15.564  1.00 70.86 ? 1372 HOH A O     1 
HETATM 4963 O O     . HOH F 4 .   ? 42.553  -8.296  -3.056  1.00 81.77 ? 1373 HOH A O     1 
HETATM 4964 O O     . HOH F 4 .   ? 39.051  -4.241  -11.904 1.00 70.07 ? 1374 HOH A O     1 
HETATM 4965 O O     . HOH F 4 .   ? 21.680  -19.338 10.458  1.00 77.11 ? 1375 HOH A O     1 
HETATM 4966 O O     . HOH F 4 .   ? 31.852  6.978   33.512  1.00 72.33 ? 1376 HOH A O     1 
HETATM 4967 O O     . HOH F 4 .   ? 18.029  -12.316 7.922   1.00 67.79 ? 1377 HOH A O     1 
HETATM 4968 O O     . HOH F 4 .   ? 14.358  7.056   39.549  1.00 65.78 ? 1378 HOH A O     1 
HETATM 4969 O O     . HOH F 4 .   ? 11.099  -17.640 15.215  1.00 78.56 ? 1379 HOH A O     1 
HETATM 4970 O O     . HOH F 4 .   ? 44.658  -12.503 32.187  1.00 71.00 ? 1380 HOH A O     1 
HETATM 4971 O O     . HOH F 4 .   ? 11.368  -21.973 11.145  1.00 63.14 ? 1381 HOH A O     1 
HETATM 4972 O O     . HOH F 4 .   ? 20.574  10.809  35.646  1.00 90.70 ? 1382 HOH A O     1 
HETATM 4973 O O     . HOH F 4 .   ? 3.425   -13.756 20.983  1.00 56.62 ? 1383 HOH A O     1 
HETATM 4974 O O     . HOH F 4 .   ? 28.715  16.528  9.106   1.00 81.01 ? 1384 HOH A O     1 
HETATM 4975 O O     . HOH F 4 .   ? 36.891  -3.069  12.211  1.00 84.53 ? 1386 HOH A O     1 
HETATM 4976 O O     . HOH F 4 .   ? -9.216  4.933   34.957  1.00 52.66 ? 1387 HOH A O     1 
HETATM 4977 O O     . HOH F 4 .   ? 38.413  21.262  27.003  1.00 87.10 ? 1390 HOH A O     1 
HETATM 4978 O O     . HOH F 4 .   ? 36.835  -23.091 15.951  1.00 75.52 ? 1391 HOH A O     1 
HETATM 4979 O O     . HOH F 4 .   ? 41.996  -11.817 -14.116 1.00 86.33 ? 1392 HOH A O     1 
HETATM 4980 O O     . HOH F 4 .   ? 33.568  -21.773 32.030  1.00 81.26 ? 1393 HOH A O     1 
HETATM 4981 O O     . HOH F 4 .   ? 30.957  1.141   34.535  1.00 77.91 ? 1394 HOH A O     1 
HETATM 4982 O O     . HOH F 4 .   ? 19.252  -13.643 36.383  1.00 84.88 ? 1396 HOH A O     1 
HETATM 4983 O O     . HOH F 4 .   ? -9.350  1.347   20.108  1.00 65.20 ? 1397 HOH A O     1 
HETATM 4984 O O     . HOH F 4 .   ? 35.972  21.557  26.908  1.00 87.19 ? 1398 HOH A O     1 
HETATM 4985 O O     . HOH F 4 .   ? 2.075   -11.564 24.332  1.00 84.93 ? 1399 HOH A O     1 
HETATM 4986 O O     . HOH F 4 .   ? 30.570  -15.262 -3.277  1.00 87.33 ? 1400 HOH A O     1 
HETATM 4987 O O     . HOH F 4 .   ? 13.952  -23.353 26.992  1.00 81.20 ? 1401 HOH A O     1 
HETATM 4988 O O     . HOH F 4 .   ? 32.317  18.061  32.158  1.00 89.39 ? 1404 HOH A O     1 
HETATM 4989 O O     . HOH F 4 .   ? 45.102  0.993   20.291  1.00 72.47 ? 1405 HOH A O     1 
HETATM 4990 O O     . HOH F 4 .   ? 55.621  5.275   15.222  1.00 69.78 ? 1407 HOH A O     1 
HETATM 4991 O O     . HOH F 4 .   ? 38.352  24.561  15.976  1.00 78.75 ? 1409 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DA  4   4   4   DA  A   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DG  6   6   6   DG  G   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DC  8   8   8   DC  C   C . n 
A 1 9   5IU 9   9   9   5IU 5IU C . n 
A 1 10  5IU 10  10  10  5IU 5IU C . n 
A 1 11  DT  11  11  11  DT  T   C . n 
A 1 12  DG  12  12  12  DG  G   C . n 
A 1 13  DA  13  13  13  DA  A   C . n 
A 1 14  DA  14  14  14  DA  A   C . n 
A 1 15  DA  15  15  15  DA  A   C . n 
A 1 16  DA  16  16  16  DA  A   C . n 
A 1 17  DA  17  17  17  DA  A   C . n 
A 1 18  5IU 18  18  18  5IU 5IU C . n 
A 1 19  5IU 19  19  19  5IU 5IU C . n 
A 1 20  5IU 20  20  20  5IU 5IU C . n 
A 1 21  5IU 21  21  21  5IU 5IU C . n 
A 1 22  DT  22  22  22  DT  T   C . n 
B 2 1   DA  1   101 101 DA  A   D . n 
B 2 2   DA  2   102 102 DA  A   D . n 
B 2 3   DA  3   103 103 DA  A   D . n 
B 2 4   DA  4   104 104 DA  A   D . n 
B 2 5   DA  5   105 105 DA  A   D . n 
B 2 6   DT  6   106 106 DT  T   D . n 
B 2 7   5IU 7   107 107 5IU 5IU D . n 
B 2 8   5IU 8   108 108 5IU 5IU D . n 
B 2 9   5IU 9   109 109 5IU 5IU D . n 
B 2 10  5IU 10  110 110 5IU 5IU D . n 
B 2 11  DC  11  111 111 DC  C   D . n 
B 2 12  DA  12  112 112 DA  A   D . n 
B 2 13  DA  13  113 113 DA  A   D . n 
B 2 14  DA  14  114 114 DA  A   D . n 
B 2 15  DG  15  115 115 DG  G   D . n 
B 2 16  DT  16  116 116 DT  T   D . n 
B 2 17  DC  17  117 117 DC  C   D . n 
B 2 18  DT  18  118 118 DT  T   D . n 
B 2 19  DT  19  119 119 DT  T   D . n 
B 2 20  DT  20  120 120 DT  T   D . n 
B 2 21  DT  21  121 121 DT  T   D . n 
B 2 22  DT  22  122 122 DT  T   D . n 
C 3 1   LYS 1   175 ?   ?   ?   A . n 
C 3 2   PRO 2   176 ?   ?   ?   A . n 
C 3 3   LYS 3   177 ?   ?   ?   A . n 
C 3 4   ASN 4   178 ?   ?   ?   A . n 
C 3 5   LYS 5   179 ?   ?   ?   A . n 
C 3 6   ASP 6   180 ?   ?   ?   A . n 
C 3 7   LYS 7   181 ?   ?   ?   A . n 
C 3 8   ASP 8   182 ?   ?   ?   A . n 
C 3 9   LYS 9   183 ?   ?   ?   A . n 
C 3 10  LYS 10  184 ?   ?   ?   A . n 
C 3 11  VAL 11  185 ?   ?   ?   A . n 
C 3 12  PRO 12  186 ?   ?   ?   A . n 
C 3 13  GLU 13  187 ?   ?   ?   A . n 
C 3 14  PRO 14  188 ?   ?   ?   A . n 
C 3 15  ASP 15  189 ?   ?   ?   A . n 
C 3 16  ASN 16  190 ?   ?   ?   A . n 
C 3 17  LYS 17  191 ?   ?   ?   A . n 
C 3 18  LYS 18  192 ?   ?   ?   A . n 
C 3 19  LYS 19  193 ?   ?   ?   A . n 
C 3 20  LYS 20  194 ?   ?   ?   A . n 
C 3 21  PRO 21  195 ?   ?   ?   A . n 
C 3 22  LYS 22  196 ?   ?   ?   A . n 
C 3 23  LYS 23  197 ?   ?   ?   A . n 
C 3 24  GLU 24  198 ?   ?   ?   A . n 
C 3 25  GLU 25  199 ?   ?   ?   A . n 
C 3 26  GLU 26  200 ?   ?   ?   A . n 
C 3 27  GLN 27  201 ?   ?   ?   A . n 
C 3 28  LYS 28  202 ?   ?   ?   A . n 
C 3 29  TRP 29  203 ?   ?   ?   A . n 
C 3 30  LYS 30  204 ?   ?   ?   A . n 
C 3 31  TRP 31  205 ?   ?   ?   A . n 
C 3 32  TRP 32  206 ?   ?   ?   A . n 
C 3 33  GLU 33  207 ?   ?   ?   A . n 
C 3 34  GLU 34  208 ?   ?   ?   A . n 
C 3 35  GLU 35  209 ?   ?   ?   A . n 
C 3 36  ARG 36  210 ?   ?   ?   A . n 
C 3 37  TYR 37  211 ?   ?   ?   A . n 
C 3 38  PRO 38  212 ?   ?   ?   A . n 
C 3 39  GLU 39  213 ?   ?   ?   A . n 
C 3 40  GLY 40  214 ?   ?   ?   A . n 
C 3 41  ILE 41  215 215 ILE ILE A . n 
C 3 42  LYS 42  216 216 LYS LYS A . n 
C 3 43  TRP 43  217 217 TRP TRP A . n 
C 3 44  LYS 44  218 218 LYS LYS A . n 
C 3 45  PHE 45  219 219 PHE PHE A . n 
C 3 46  LEU 46  220 220 LEU LEU A . n 
C 3 47  GLU 47  221 221 GLU GLU A . n 
C 3 48  HIS 48  222 222 HIS HIS A . n 
C 3 49  LYS 49  223 223 LYS LYS A . n 
C 3 50  GLY 50  224 224 GLY GLY A . n 
C 3 51  PRO 51  225 225 PRO PRO A . n 
C 3 52  VAL 52  226 226 VAL VAL A . n 
C 3 53  PHE 53  227 227 PHE PHE A . n 
C 3 54  ALA 54  228 228 ALA ALA A . n 
C 3 55  PRO 55  229 229 PRO PRO A . n 
C 3 56  PRO 56  230 230 PRO PRO A . n 
C 3 57  TYR 57  231 231 TYR TYR A . n 
C 3 58  GLU 58  232 232 GLU GLU A . n 
C 3 59  PRO 59  233 233 PRO PRO A . n 
C 3 60  LEU 60  234 234 LEU LEU A . n 
C 3 61  PRO 61  235 235 PRO PRO A . n 
C 3 62  GLU 62  236 236 GLU GLU A . n 
C 3 63  ASN 63  237 237 ASN ASN A . n 
C 3 64  VAL 64  238 238 VAL VAL A . n 
C 3 65  LYS 65  239 239 LYS LYS A . n 
C 3 66  PHE 66  240 240 PHE PHE A . n 
C 3 67  TYR 67  241 241 TYR TYR A . n 
C 3 68  TYR 68  242 242 TYR TYR A . n 
C 3 69  ASP 69  243 243 ASP ASP A . n 
C 3 70  GLY 70  244 244 GLY GLY A . n 
C 3 71  LYS 71  245 245 LYS LYS A . n 
C 3 72  VAL 72  246 246 VAL VAL A . n 
C 3 73  MET 73  247 247 MET MET A . n 
C 3 74  LYS 74  248 248 LYS LYS A . n 
C 3 75  LEU 75  249 249 LEU LEU A . n 
C 3 76  SER 76  250 250 SER SER A . n 
C 3 77  PRO 77  251 251 PRO PRO A . n 
C 3 78  LYS 78  252 252 LYS LYS A . n 
C 3 79  ALA 79  253 253 ALA ALA A . n 
C 3 80  GLU 80  254 254 GLU GLU A . n 
C 3 81  GLU 81  255 255 GLU GLU A . n 
C 3 82  VAL 82  256 256 VAL VAL A . n 
C 3 83  ALA 83  257 257 ALA ALA A . n 
C 3 84  THR 84  258 258 THR THR A . n 
C 3 85  PHE 85  259 259 PHE PHE A . n 
C 3 86  PHE 86  260 260 PHE PHE A . n 
C 3 87  ALA 87  261 261 ALA ALA A . n 
C 3 88  LYS 88  262 262 LYS LYS A . n 
C 3 89  MET 89  263 263 MET MET A . n 
C 3 90  LEU 90  264 264 LEU LEU A . n 
C 3 91  ASP 91  265 265 ASP ASP A . n 
C 3 92  HIS 92  266 266 HIS HIS A . n 
C 3 93  GLU 93  267 267 GLU GLU A . n 
C 3 94  TYR 94  268 268 TYR TYR A . n 
C 3 95  THR 95  269 269 THR THR A . n 
C 3 96  THR 96  270 270 THR THR A . n 
C 3 97  LYS 97  271 271 LYS LYS A . n 
C 3 98  GLU 98  272 272 GLU GLU A . n 
C 3 99  ILE 99  273 273 ILE ILE A . n 
C 3 100 PHE 100 274 274 PHE PHE A . n 
C 3 101 ARG 101 275 275 ARG ARG A . n 
C 3 102 LYS 102 276 276 LYS LYS A . n 
C 3 103 ASN 103 277 277 ASN ASN A . n 
C 3 104 PHE 104 278 278 PHE PHE A . n 
C 3 105 PHE 105 279 279 PHE PHE A . n 
C 3 106 LYS 106 280 280 LYS LYS A . n 
C 3 107 ASP 107 281 281 ASP ASP A . n 
C 3 108 TRP 108 282 282 TRP TRP A . n 
C 3 109 ARG 109 283 283 ARG ARG A . n 
C 3 110 LYS 110 284 284 LYS LYS A . n 
C 3 111 GLU 111 285 285 GLU GLU A . n 
C 3 112 MET 112 286 286 MET MET A . n 
C 3 113 THR 113 287 287 THR THR A . n 
C 3 114 ASN 114 288 288 ASN ASN A . n 
C 3 115 GLU 115 289 289 GLU GLU A . n 
C 3 116 GLU 116 290 290 GLU GLU A . n 
C 3 117 LYS 117 291 291 LYS LYS A . n 
C 3 118 ASN 118 292 292 ASN ASN A . n 
C 3 119 ILE 119 293 293 ILE ILE A . n 
C 3 120 ILE 120 294 294 ILE ILE A . n 
C 3 121 THR 121 295 295 THR THR A . n 
C 3 122 ASN 122 296 296 ASN ASN A . n 
C 3 123 LEU 123 297 297 LEU LEU A . n 
C 3 124 SER 124 298 298 SER SER A . n 
C 3 125 LYS 125 299 299 LYS LYS A . n 
C 3 126 CYS 126 300 300 CYS CYS A . n 
C 3 127 ASP 127 301 301 ASP ASP A . n 
C 3 128 PHE 128 302 302 PHE PHE A . n 
C 3 129 THR 129 303 303 THR THR A . n 
C 3 130 GLN 130 304 304 GLN GLN A . n 
C 3 131 MET 131 305 305 MET MET A . n 
C 3 132 SER 132 306 306 SER SER A . n 
C 3 133 GLN 133 307 307 GLN GLN A . n 
C 3 134 TYR 134 308 308 TYR TYR A . n 
C 3 135 PHE 135 309 309 PHE PHE A . n 
C 3 136 LYS 136 310 310 LYS LYS A . n 
C 3 137 ALA 137 311 311 ALA ALA A . n 
C 3 138 GLN 138 312 312 GLN GLN A . n 
C 3 139 THR 139 313 313 THR THR A . n 
C 3 140 GLU 140 314 314 GLU GLU A . n 
C 3 141 ALA 141 315 315 ALA ALA A . n 
C 3 142 ARG 142 316 316 ARG ARG A . n 
C 3 143 LYS 143 317 317 LYS LYS A . n 
C 3 144 GLN 144 318 318 GLN GLN A . n 
C 3 145 MET 145 319 319 MET MET A . n 
C 3 146 SER 146 320 320 SER SER A . n 
C 3 147 LYS 147 321 321 LYS LYS A . n 
C 3 148 GLU 148 322 322 GLU GLU A . n 
C 3 149 GLU 149 323 323 GLU GLU A . n 
C 3 150 LYS 150 324 324 LYS LYS A . n 
C 3 151 LEU 151 325 325 LEU LEU A . n 
C 3 152 LYS 152 326 326 LYS LYS A . n 
C 3 153 ILE 153 327 327 ILE ILE A . n 
C 3 154 LYS 154 328 328 LYS LYS A . n 
C 3 155 GLU 155 329 329 GLU GLU A . n 
C 3 156 GLU 156 330 330 GLU GLU A . n 
C 3 157 ASN 157 331 331 ASN ASN A . n 
C 3 158 GLU 158 332 332 GLU GLU A . n 
C 3 159 LYS 159 333 333 LYS LYS A . n 
C 3 160 LEU 160 334 334 LEU LEU A . n 
C 3 161 LEU 161 335 335 LEU LEU A . n 
C 3 162 LYS 162 336 336 LYS LYS A . n 
C 3 163 GLU 163 337 337 GLU GLU A . n 
C 3 164 TYR 164 338 338 TYR TYR A . n 
C 3 165 GLY 165 339 339 GLY GLY A . n 
C 3 166 PHE 166 340 340 PHE PHE A . n 
C 3 167 CYS 167 341 341 CYS CYS A . n 
C 3 168 ILE 168 342 342 ILE ILE A . n 
C 3 169 MET 169 343 343 MET MET A . n 
C 3 170 ASP 170 344 344 ASP ASP A . n 
C 3 171 ASN 171 345 345 ASN ASN A . n 
C 3 172 HIS 172 346 346 HIS HIS A . n 
C 3 173 LYS 173 347 347 LYS LYS A . n 
C 3 174 GLU 174 348 348 GLU GLU A . n 
C 3 175 ARG 175 349 349 ARG ARG A . n 
C 3 176 ILE 176 350 350 ILE ILE A . n 
C 3 177 ALA 177 351 351 ALA ALA A . n 
C 3 178 ASN 178 352 352 ASN ASN A . n 
C 3 179 PHE 179 353 353 PHE PHE A . n 
C 3 180 LYS 180 354 354 LYS LYS A . n 
C 3 181 ILE 181 355 355 ILE ILE A . n 
C 3 182 GLU 182 356 356 GLU GLU A . n 
C 3 183 PRO 183 357 357 PRO PRO A . n 
C 3 184 PRO 184 358 358 PRO PRO A . n 
C 3 185 GLY 185 359 359 GLY GLY A . n 
C 3 186 LEU 186 360 360 LEU LEU A . n 
C 3 187 PHE 187 361 361 PHE PHE A . n 
C 3 188 ARG 188 362 362 ARG ARG A . n 
C 3 189 GLY 189 363 363 GLY GLY A . n 
C 3 190 ARG 190 364 364 ARG ARG A . n 
C 3 191 GLY 191 365 365 GLY GLY A . n 
C 3 192 ASN 192 366 366 ASN ASN A . n 
C 3 193 HIS 193 367 367 HIS HIS A . n 
C 3 194 PRO 194 368 368 PRO PRO A . n 
C 3 195 LYS 195 369 369 LYS LYS A . n 
C 3 196 MET 196 370 370 MET MET A . n 
C 3 197 GLY 197 371 371 GLY GLY A . n 
C 3 198 MET 198 372 372 MET MET A . n 
C 3 199 LEU 199 373 373 LEU LEU A . n 
C 3 200 LYS 200 374 374 LYS LYS A . n 
C 3 201 ARG 201 375 375 ARG ARG A . n 
C 3 202 ARG 202 376 376 ARG ARG A . n 
C 3 203 ILE 203 377 377 ILE ILE A . n 
C 3 204 MET 204 378 378 MET MET A . n 
C 3 205 PRO 205 379 379 PRO PRO A . n 
C 3 206 GLU 206 380 380 GLU GLU A . n 
C 3 207 ASP 207 381 381 ASP ASP A . n 
C 3 208 ILE 208 382 382 ILE ILE A . n 
C 3 209 ILE 209 383 383 ILE ILE A . n 
C 3 210 ILE 210 384 384 ILE ILE A . n 
C 3 211 ASN 211 385 385 ASN ASN A . n 
C 3 212 CYS 212 386 386 CYS CYS A . n 
C 3 213 SER 213 387 387 SER SER A . n 
C 3 214 LYS 214 388 388 LYS LYS A . n 
C 3 215 ASP 215 389 389 ASP ASP A . n 
C 3 216 ALA 216 390 390 ALA ALA A . n 
C 3 217 LYS 217 391 391 LYS LYS A . n 
C 3 218 VAL 218 392 392 VAL VAL A . n 
C 3 219 PRO 219 393 393 PRO PRO A . n 
C 3 220 SER 220 394 394 SER SER A . n 
C 3 221 PRO 221 395 395 PRO PRO A . n 
C 3 222 PRO 222 396 396 PRO PRO A . n 
C 3 223 PRO 223 397 397 PRO PRO A . n 
C 3 224 GLY 224 398 398 GLY GLY A . n 
C 3 225 HIS 225 399 399 HIS HIS A . n 
C 3 226 LYS 226 400 400 LYS LYS A . n 
C 3 227 TRP 227 401 401 TRP TRP A . n 
C 3 228 LYS 228 402 402 LYS LYS A . n 
C 3 229 GLU 229 403 403 GLU GLU A . n 
C 3 230 VAL 230 404 404 VAL VAL A . n 
C 3 231 ARG 231 405 405 ARG ARG A . n 
C 3 232 HIS 232 406 406 HIS HIS A . n 
C 3 233 ASP 233 407 407 ASP ASP A . n 
C 3 234 ASN 234 408 408 ASN ASN A . n 
C 3 235 LYS 235 409 409 LYS LYS A . n 
C 3 236 VAL 236 410 410 VAL VAL A . n 
C 3 237 THR 237 411 411 THR THR A . n 
C 3 238 TRP 238 412 412 TRP TRP A . n 
C 3 239 LEU 239 413 413 LEU LEU A . n 
C 3 240 VAL 240 414 414 VAL VAL A . n 
C 3 241 SER 241 415 415 SER SER A . n 
C 3 242 TRP 242 416 416 TRP TRP A . n 
C 3 243 THR 243 417 417 THR THR A . n 
C 3 244 GLU 244 418 418 GLU GLU A . n 
C 3 245 ASN 245 419 419 ASN ASN A . n 
C 3 246 ILE 246 420 420 ILE ILE A . n 
C 3 247 GLN 247 421 421 GLN GLN A . n 
C 3 248 GLY 248 422 422 GLY GLY A . n 
C 3 249 SER 249 423 423 SER SER A . n 
C 3 250 ILE 250 424 424 ILE ILE A . n 
C 3 251 LYS 251 425 425 LYS LYS A . n 
C 3 252 TYR 252 426 426 TYR TYR A . n 
C 3 253 ILE 253 427 427 ILE ILE A . n 
C 3 254 MET 254 428 428 MET MET A . n 
C 3 255 LEU 255 429 429 LEU LEU A . n 
C 3 256 ASN 256 430 430 ASN ASN A . n 
C 3 257 PRO 257 431 431 PRO PRO A . n 
C 3 258 SER 258 432 432 SER SER A . n 
C 3 259 SER 259 433 433 SER SER A . n 
C 3 260 ARG 260 434 434 ARG ARG A . n 
C 3 261 ILE 261 435 435 ILE ILE A . n 
C 3 262 LYS 262 436 436 LYS LYS A . n 
C 3 263 GLY 263 437 437 GLY GLY A . n 
C 3 264 GLU 264 438 438 GLU GLU A . n 
C 3 265 LYS 265 439 439 LYS LYS A . n 
C 3 266 ASP 266 440 440 ASP ASP A . n 
C 3 267 TRP 267 441 441 TRP TRP A . n 
C 3 268 GLN 268 442 442 GLN GLN A . n 
C 3 269 LYS 269 443 443 LYS LYS A . n 
C 3 270 TYR 270 444 444 TYR TYR A . n 
C 3 271 GLU 271 445 445 GLU GLU A . n 
C 3 272 THR 272 446 446 THR THR A . n 
C 3 273 ALA 273 447 447 ALA ALA A . n 
C 3 274 ARG 274 448 448 ARG ARG A . n 
C 3 275 ARG 275 449 449 ARG ARG A . n 
C 3 276 LEU 276 450 450 LEU LEU A . n 
C 3 277 LYS 277 451 451 LYS LYS A . n 
C 3 278 LYS 278 452 452 LYS LYS A . n 
C 3 279 CYS 279 453 453 CYS CYS A . n 
C 3 280 VAL 280 454 454 VAL VAL A . n 
C 3 281 ASP 281 455 455 ASP ASP A . n 
C 3 282 LYS 282 456 456 LYS LYS A . n 
C 3 283 ILE 283 457 457 ILE ILE A . n 
C 3 284 ARG 284 458 458 ARG ARG A . n 
C 3 285 ASN 285 459 459 ASN ASN A . n 
C 3 286 GLN 286 460 460 GLN GLN A . n 
C 3 287 TYR 287 461 461 TYR TYR A . n 
C 3 288 ARG 288 462 462 ARG ARG A . n 
C 3 289 GLU 289 463 463 GLU GLU A . n 
C 3 290 ASP 290 464 464 ASP ASP A . n 
C 3 291 TRP 291 465 465 TRP TRP A . n 
C 3 292 LYS 292 466 466 LYS LYS A . n 
C 3 293 SER 293 467 467 SER SER A . n 
C 3 294 LYS 294 468 468 LYS LYS A . n 
C 3 295 GLU 295 469 469 GLU GLU A . n 
C 3 296 MET 296 470 470 MET MET A . n 
C 3 297 LYS 297 471 471 LYS LYS A . n 
C 3 298 VAL 298 472 472 VAL VAL A . n 
C 3 299 ARG 299 473 473 ARG ARG A . n 
C 3 300 GLN 300 474 474 GLN GLN A . n 
C 3 301 ARG 301 475 475 ARG ARG A . n 
C 3 302 ALA 302 476 476 ALA ALA A . n 
C 3 303 VAL 303 477 477 VAL VAL A . n 
C 3 304 ALA 304 478 478 ALA ALA A . n 
C 3 305 LEU 305 479 479 LEU LEU A . n 
C 3 306 TYR 306 480 480 TYR TYR A . n 
C 3 307 PHE 307 481 481 PHE PHE A . n 
C 3 308 ILE 308 482 482 ILE ILE A . n 
C 3 309 ASP 309 483 483 ASP ASP A . n 
C 3 310 LYS 310 484 484 LYS LYS A . n 
C 3 311 LEU 311 485 485 LEU LEU A . n 
C 3 312 ALA 312 486 486 ALA ALA A . n 
C 3 313 LEU 313 487 487 LEU LEU A . n 
C 3 314 ARG 314 488 488 ARG ARG A . n 
C 3 315 ALA 315 489 489 ALA ALA A . n 
C 3 316 GLY 316 490 490 GLY GLY A . n 
C 3 317 ASN 317 491 491 ASN ASN A . n 
C 3 318 GLU 318 492 492 GLU GLU A . n 
C 3 319 LYS 319 493 493 LYS LYS A . n 
C 3 320 GLU 320 494 494 GLU GLU A . n 
C 3 321 GLU 321 495 495 GLU GLU A . n 
C 3 322 GLY 322 496 496 GLY GLY A . n 
C 3 323 GLU 323 497 497 GLU GLU A . n 
C 3 324 THR 324 498 498 THR THR A . n 
C 3 325 ALA 325 499 499 ALA ALA A . n 
C 3 326 ASP 326 500 500 ASP ASP A . n 
C 3 327 THR 327 501 501 THR THR A . n 
C 3 328 VAL 328 502 502 VAL VAL A . n 
C 3 329 GLY 329 503 503 GLY GLY A . n 
C 3 330 CYS 330 504 504 CYS CYS A . n 
C 3 331 CYS 331 505 505 CYS CYS A . n 
C 3 332 SER 332 506 506 SER SER A . n 
C 3 333 LEU 333 507 507 LEU LEU A . n 
C 3 334 ARG 334 508 508 ARG ARG A . n 
C 3 335 VAL 335 509 509 VAL VAL A . n 
C 3 336 GLU 336 510 510 GLU GLU A . n 
C 3 337 HIS 337 511 511 HIS HIS A . n 
C 3 338 ILE 338 512 512 ILE ILE A . n 
C 3 339 ASN 339 513 513 ASN ASN A . n 
C 3 340 LEU 340 514 514 LEU LEU A . n 
C 3 341 HIS 341 515 515 HIS HIS A . n 
C 3 342 PRO 342 516 516 PRO PRO A . n 
C 3 343 GLU 343 517 517 GLU GLU A . n 
C 3 344 LEU 344 518 518 LEU LEU A . n 
C 3 345 ASP 345 519 519 ASP ASP A . n 
C 3 346 GLY 346 520 520 GLY GLY A . n 
C 3 347 GLN 347 521 521 GLN GLN A . n 
C 3 348 GLU 348 522 522 GLU GLU A . n 
C 3 349 TYR 349 523 523 TYR TYR A . n 
C 3 350 VAL 350 524 524 VAL VAL A . n 
C 3 351 VAL 351 525 525 VAL VAL A . n 
C 3 352 GLU 352 526 526 GLU GLU A . n 
C 3 353 PHE 353 527 527 PHE PHE A . n 
C 3 354 ASP 354 528 528 ASP ASP A . n 
C 3 355 PHE 355 529 529 PHE PHE A . n 
C 3 356 LEU 356 530 530 LEU LEU A . n 
C 3 357 GLY 357 531 531 GLY GLY A . n 
C 3 358 LYS 358 532 532 LYS LYS A . n 
C 3 359 ASP 359 533 533 ASP ASP A . n 
C 3 360 SER 360 534 534 SER SER A . n 
C 3 361 ILE 361 535 535 ILE ILE A . n 
C 3 362 ARG 362 536 536 ARG ARG A . n 
C 3 363 TYR 363 537 537 TYR TYR A . n 
C 3 364 TYR 364 538 538 TYR TYR A . n 
C 3 365 ASN 365 539 539 ASN ASN A . n 
C 3 366 LYS 366 540 540 LYS LYS A . n 
C 3 367 VAL 367 541 541 VAL VAL A . n 
C 3 368 PRO 368 542 542 PRO PRO A . n 
C 3 369 VAL 369 543 543 VAL VAL A . n 
C 3 370 GLU 370 544 544 GLU GLU A . n 
C 3 371 LYS 371 545 545 LYS LYS A . n 
C 3 372 ARG 372 546 546 ARG ARG A . n 
C 3 373 VAL 373 547 547 VAL VAL A . n 
C 3 374 PHE 374 548 548 PHE PHE A . n 
C 3 375 LYS 375 549 549 LYS LYS A . n 
C 3 376 ASN 376 550 550 ASN ASN A . n 
C 3 377 LEU 377 551 551 LEU LEU A . n 
C 3 378 GLN 378 552 552 GLN GLN A . n 
C 3 379 LEU 379 553 553 LEU LEU A . n 
C 3 380 PHE 380 554 554 PHE PHE A . n 
C 3 381 MET 381 555 555 MET MET A . n 
C 3 382 GLU 382 556 556 GLU GLU A . n 
C 3 383 ASN 383 557 557 ASN ASN A . n 
C 3 384 LYS 384 558 558 LYS LYS A . n 
C 3 385 GLN 385 559 559 GLN GLN A . n 
C 3 386 PRO 386 560 560 PRO PRO A . n 
C 3 387 GLU 387 561 561 GLU GLU A . n 
C 3 388 ASP 388 562 562 ASP ASP A . n 
C 3 389 ASP 389 563 563 ASP ASP A . n 
C 3 390 LEU 390 564 564 LEU LEU A . n 
C 3 391 PHE 391 565 565 PHE PHE A . n 
C 3 392 ASP 392 566 566 ASP ASP A . n 
C 3 393 ARG 393 567 567 ARG ARG A . n 
C 3 394 LEU 394 568 568 LEU LEU A . n 
C 3 395 ASN 395 569 569 ASN ASN A . n 
C 3 396 THR 396 570 570 THR THR A . n 
C 3 397 GLY 397 571 571 GLY GLY A . n 
C 3 398 ILE 398 572 572 ILE ILE A . n 
C 3 399 LEU 399 573 573 LEU LEU A . n 
C 3 400 ASN 400 574 574 ASN ASN A . n 
C 3 401 LYS 401 575 575 LYS LYS A . n 
C 3 402 HIS 402 576 576 HIS HIS A . n 
C 3 403 LEU 403 577 577 LEU LEU A . n 
C 3 404 GLN 404 578 578 GLN GLN A . n 
C 3 405 ASP 405 579 579 ASP ASP A . n 
C 3 406 LEU 406 580 580 LEU LEU A . n 
C 3 407 MET 407 581 581 MET MET A . n 
C 3 408 GLU 408 582 582 GLU GLU A . n 
C 3 409 GLY 409 583 583 GLY GLY A . n 
C 3 410 LEU 410 584 584 LEU LEU A . n 
C 3 411 THR 411 585 585 THR THR A . n 
C 3 412 ALA 412 586 586 ALA ALA A . n 
C 3 413 LYS 413 587 587 LYS LYS A . n 
C 3 414 VAL 414 588 588 VAL VAL A . n 
C 3 415 PHE 415 589 589 PHE PHE A . n 
C 3 416 ARG 416 590 590 ARG ARG A . n 
C 3 417 THR 417 591 591 THR THR A . n 
C 3 418 TYR 418 592 592 TYR TYR A . n 
C 3 419 ASN 419 593 593 ASN ASN A . n 
C 3 420 ALA 420 594 594 ALA ALA A . n 
C 3 421 SER 421 595 595 SER SER A . n 
C 3 422 ILE 422 596 596 ILE ILE A . n 
C 3 423 THR 423 597 597 THR THR A . n 
C 3 424 LEU 424 598 598 LEU LEU A . n 
C 3 425 GLN 425 599 599 GLN GLN A . n 
C 3 426 GLN 426 600 600 GLN GLN A . n 
C 3 427 GLN 427 601 601 GLN GLN A . n 
C 3 428 LEU 428 602 602 LEU LEU A . n 
C 3 429 LYS 429 603 603 LYS LYS A . n 
C 3 430 GLU 430 604 604 GLU GLU A . n 
C 3 431 LEU 431 605 605 LEU LEU A . n 
C 3 432 THR 432 606 606 THR THR A . n 
C 3 433 ALA 433 607 607 ALA ALA A . n 
C 3 434 PRO 434 608 608 PRO PRO A . n 
C 3 435 ASP 435 609 609 ASP ASP A . n 
C 3 436 GLU 436 610 610 GLU GLU A . n 
C 3 437 ASN 437 611 611 ASN ASN A . n 
C 3 438 ILE 438 612 612 ILE ILE A . n 
C 3 439 PRO 439 613 613 PRO PRO A . n 
C 3 440 ALA 440 614 614 ALA ALA A . n 
C 3 441 LYS 441 615 615 LYS LYS A . n 
C 3 442 ILE 442 616 616 ILE ILE A . n 
C 3 443 LEU 443 617 617 LEU LEU A . n 
C 3 444 SER 444 618 618 SER SER A . n 
C 3 445 TYR 445 619 619 TYR TYR A . n 
C 3 446 ASN 446 620 620 ASN ASN A . n 
C 3 447 ARG 447 621 621 ARG ARG A . n 
C 3 448 ALA 448 622 622 ALA ALA A . n 
C 3 449 ASN 449 623 623 ASN ASN A . n 
C 3 450 ARG 450 624 624 ARG ARG A . n 
C 3 451 ALA 451 625 625 ALA ALA A . n 
C 3 452 VAL 452 626 626 VAL VAL A . n 
C 3 453 ALA 453 627 ?   ?   ?   A . n 
C 3 454 ILE 454 628 ?   ?   ?   A . n 
C 3 455 LEU 455 629 ?   ?   ?   A . n 
C 3 456 CYS 456 630 ?   ?   ?   A . n 
C 3 457 ASN 457 631 ?   ?   ?   A . n 
C 3 458 HIS 458 632 ?   ?   ?   A . n 
C 3 459 GLN 459 633 ?   ?   ?   A . n 
C 3 460 ARG 460 634 ?   ?   ?   A . n 
C 3 461 ALA 461 635 ?   ?   ?   A . n 
C 3 462 PRO 462 636 ?   ?   ?   A . n 
C 3 463 PRO 463 637 ?   ?   ?   A . n 
C 3 464 LYS 464 638 ?   ?   ?   A . n 
C 3 465 THR 465 639 ?   ?   ?   A . n 
C 3 466 PHE 466 640 ?   ?   ?   A . n 
C 3 467 GLU 467 641 ?   ?   ?   A . n 
C 3 468 LYS 468 642 ?   ?   ?   A . n 
C 3 469 SER 469 643 ?   ?   ?   A . n 
C 3 470 MET 470 644 ?   ?   ?   A . n 
C 3 471 MET 471 645 ?   ?   ?   A . n 
C 3 472 ASN 472 646 ?   ?   ?   A . n 
C 3 473 LEU 473 647 ?   ?   ?   A . n 
C 3 474 GLN 474 648 ?   ?   ?   A . n 
C 3 475 THR 475 649 ?   ?   ?   A . n 
C 3 476 LYS 476 650 ?   ?   ?   A . n 
C 3 477 ILE 477 651 ?   ?   ?   A . n 
C 3 478 ASP 478 652 ?   ?   ?   A . n 
C 3 479 ALA 479 653 ?   ?   ?   A . n 
C 3 480 LYS 480 654 ?   ?   ?   A . n 
C 3 481 LYS 481 655 ?   ?   ?   A . n 
C 3 482 GLU 482 656 ?   ?   ?   A . n 
C 3 483 GLN 483 657 ?   ?   ?   A . n 
C 3 484 LEU 484 658 ?   ?   ?   A . n 
C 3 485 ALA 485 659 ?   ?   ?   A . n 
C 3 486 ASP 486 660 ?   ?   ?   A . n 
C 3 487 ALA 487 661 ?   ?   ?   A . n 
C 3 488 ARG 488 662 ?   ?   ?   A . n 
C 3 489 ARG 489 663 ?   ?   ?   A . n 
C 3 490 ASP 490 664 ?   ?   ?   A . n 
C 3 491 LEU 491 665 ?   ?   ?   A . n 
C 3 492 LYS 492 666 ?   ?   ?   A . n 
C 3 493 SER 493 667 ?   ?   ?   A . n 
C 3 494 ALA 494 668 ?   ?   ?   A . n 
C 3 495 LYS 495 669 ?   ?   ?   A . n 
C 3 496 ALA 496 670 ?   ?   ?   A . n 
C 3 497 ASP 497 671 ?   ?   ?   A . n 
C 3 498 ALA 498 672 ?   ?   ?   A . n 
C 3 499 LYS 499 673 ?   ?   ?   A . n 
C 3 500 VAL 500 674 ?   ?   ?   A . n 
C 3 501 MET 501 675 ?   ?   ?   A . n 
C 3 502 LYS 502 676 ?   ?   ?   A . n 
C 3 503 ASP 503 677 ?   ?   ?   A . n 
C 3 504 ALA 504 678 ?   ?   ?   A . n 
C 3 505 LYS 505 679 ?   ?   ?   A . n 
C 3 506 THR 506 680 ?   ?   ?   A . n 
C 3 507 LYS 507 681 ?   ?   ?   A . n 
C 3 508 LYS 508 682 ?   ?   ?   A . n 
C 3 509 VAL 509 683 ?   ?   ?   A . n 
C 3 510 VAL 510 684 ?   ?   ?   A . n 
C 3 511 GLU 511 685 ?   ?   ?   A . n 
C 3 512 SER 512 686 ?   ?   ?   A . n 
C 3 513 LYS 513 687 ?   ?   ?   A . n 
C 3 514 LYS 514 688 ?   ?   ?   A . n 
C 3 515 LYS 515 689 ?   ?   ?   A . n 
C 3 516 ALA 516 690 ?   ?   ?   A . n 
C 3 517 VAL 517 691 ?   ?   ?   A . n 
C 3 518 GLN 518 692 ?   ?   ?   A . n 
C 3 519 ARG 519 693 ?   ?   ?   A . n 
C 3 520 LEU 520 694 ?   ?   ?   A . n 
C 3 521 GLU 521 695 ?   ?   ?   A . n 
C 3 522 GLU 522 696 ?   ?   ?   A . n 
C 3 523 GLN 523 697 ?   ?   ?   A . n 
C 3 524 LEU 524 698 ?   ?   ?   A . n 
C 3 525 MET 525 699 ?   ?   ?   A . n 
C 3 526 LYS 526 700 ?   ?   ?   A . n 
C 3 527 LEU 527 701 ?   ?   ?   A . n 
C 3 528 GLU 528 702 ?   ?   ?   A . n 
C 3 529 VAL 529 703 ?   ?   ?   A . n 
C 3 530 GLN 530 704 ?   ?   ?   A . n 
C 3 531 ALA 531 705 ?   ?   ?   A . n 
C 3 532 THR 532 706 ?   ?   ?   A . n 
C 3 533 ASP 533 707 ?   ?   ?   A . n 
C 3 534 ARG 534 708 ?   ?   ?   A . n 
C 3 535 GLU 535 709 ?   ?   ?   A . n 
C 3 536 GLU 536 710 ?   ?   ?   A . n 
C 3 537 ASN 537 711 ?   ?   ?   A . n 
C 3 538 LYS 538 712 ?   ?   ?   A . n 
C 3 539 GLN 539 713 ?   ?   ?   A . n 
C 3 540 ILE 540 714 ?   ?   ?   A . n 
C 3 541 ALA 541 715 ?   ?   ?   A . n 
C 3 542 LEU 542 716 ?   ?   ?   A . n 
C 3 543 GLY 543 717 ?   ?   ?   A . n 
C 3 544 THR 544 718 ?   ?   ?   A . n 
C 3 545 SER 545 719 ?   ?   ?   A . n 
C 3 546 LYS 546 720 720 LYS LYS A . n 
C 3 547 LEU 547 721 721 LEU LEU A . n 
C 3 548 ASN 548 722 722 ASN ASN A . n 
C 3 549 PTR 549 723 723 PTR PTR A . n 
C 3 550 LEU 550 724 724 LEU LEU A . n 
C 3 551 ASP 551 725 725 ASP ASP A . n 
C 3 552 PRO 552 726 726 PRO PRO A . n 
C 3 553 ARG 553 727 727 ARG ARG A . n 
C 3 554 ILE 554 728 728 ILE ILE A . n 
C 3 555 THR 555 729 729 THR THR A . n 
C 3 556 VAL 556 730 730 VAL VAL A . n 
C 3 557 ALA 557 731 731 ALA ALA A . n 
C 3 558 TRP 558 732 732 TRP TRP A . n 
C 3 559 CYS 559 733 733 CYS CYS A . n 
C 3 560 LYS 560 734 734 LYS LYS A . n 
C 3 561 LYS 561 735 735 LYS LYS A . n 
C 3 562 TRP 562 736 736 TRP TRP A . n 
C 3 563 GLY 563 737 737 GLY GLY A . n 
C 3 564 VAL 564 738 738 VAL VAL A . n 
C 3 565 PRO 565 739 739 PRO PRO A . n 
C 3 566 ILE 566 740 740 ILE ILE A . n 
C 3 567 GLU 567 741 741 GLU GLU A . n 
C 3 568 LYS 568 742 742 LYS LYS A . n 
C 3 569 ILE 569 743 743 ILE ILE A . n 
C 3 570 TYR 570 744 744 TYR TYR A . n 
C 3 571 ASN 571 745 745 ASN ASN A . n 
C 3 572 LYS 572 746 746 LYS LYS A . n 
C 3 573 THR 573 747 747 THR THR A . n 
C 3 574 GLN 574 748 748 GLN GLN A . n 
C 3 575 ARG 575 749 749 ARG ARG A . n 
C 3 576 GLU 576 750 750 GLU GLU A . n 
C 3 577 LYS 577 751 751 LYS LYS A . n 
C 3 578 PHE 578 752 752 PHE PHE A . n 
C 3 579 ALA 579 753 753 ALA ALA A . n 
C 3 580 TRP 580 754 754 TRP TRP A . n 
C 3 581 ALA 581 755 755 ALA ALA A . n 
C 3 582 ILE 582 756 756 ILE ILE A . n 
C 3 583 ASP 583 757 757 ASP ASP A . n 
C 3 584 MET 584 758 758 MET MET A . n 
C 3 585 ALA 585 759 759 ALA ALA A . n 
C 3 586 ASP 586 760 760 ASP ASP A . n 
C 3 587 GLU 587 761 761 GLU GLU A . n 
C 3 588 ASP 588 762 762 ASP ASP A . n 
C 3 589 TYR 589 763 763 TYR TYR A . n 
C 3 590 GLU 590 764 764 GLU GLU A . n 
C 3 591 PHE 591 765 765 PHE PHE A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A 5IU 9   C 5IU 9   ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
2  A 5IU 10  C 5IU 10  ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
3  A 5IU 18  C 5IU 18  ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
4  A 5IU 19  C 5IU 19  ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
5  A 5IU 20  C 5IU 20  ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
6  A 5IU 21  C 5IU 21  ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
7  B 5IU 7   D 5IU 107 ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
8  B 5IU 8   D 5IU 108 ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
9  B 5IU 9   D 5IU 109 ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
10 B 5IU 10  D 5IU 110 ? DU  "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
11 C PTR 549 A PTR 723 ? TYR O-PHOSPHOTYROSINE                         
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-08-28 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHARP     phasing          .   ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_entry_details.entry_id             1A31 
_pdbx_entry_details.compound_details     
;RESIDUES 215-635 OF CHAIN A COMPRISE THE CORE DOMAIN OF
THE MOLECULE.  RESIDUES 715-765 OF CHAIN A COMPRISE THE
C-TERMINAL DOMAIN.  1-22 OF CHAIN C COMPRISE THE SCISSILE
STRAND OF THE DNA, 101-122 OF CHAIN D THE INTACT DNA
STRAND.

NOTE THAT THE LINKER DOMAIN (636-714) IS NOT
PRESENT IN THE CONSTRUCT OF THIS RECONSTITUTED ENZYME.
THE RECONSTITUTED ENZYME IS MADE UP OF RESIDUES 175-659 OF
THE CORE (EXPRESSED IN BACULOVIRUS) AND RESIDUES 713-765 OF
THE C-TERMINAL DOMAIN (EXPRESSED IN E. COLI).

CHAIN A RESIDUES 175-214 AND 627-659 OF THE CORE AND
713-719 OF THE C-TERMINAL DOMAIN ARE DISORDERED AND NOT
PRESENT IN THE STRUCTURE.

TER
ALA 635 A IS THE TERMINAL RESIDUE OF THE CORE DOMAIN.
PHE 765 A IS THE TERMINAL RESIDUE OF THE C-TERMINAL DOMAIN.
THY 22 C IS THE 3' TERMINAL NUCLEOTIDE OF THE SCISSILE
STRAND OF THE DNA DUPLEX.
THY 122 D IS THE 3' TERMINAL NUCLEOTIDE OF THE INTACT
STRAND OF THE DNA DUPLEX.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 247 ? ? -166.41 115.43  
2  1 ASP A 344 ? ? 55.00   -125.32 
3  1 ASN A 366 ? ? -96.33  52.39   
4  1 LYS A 468 ? ? -91.58  34.69   
5  1 GLU A 495 ? ? -56.10  99.57   
6  1 ASP A 500 ? ? -66.19  99.60   
7  1 TYR A 523 ? ? 74.60   63.19   
8  1 LYS A 545 ? ? -28.71  -61.34  
9  1 GLU A 561 ? ? -64.86  21.24   
10 1 MET A 581 ? ? -170.91 121.28  
11 1 PRO A 608 ? ? -56.21  -5.13   
12 1 ILE A 612 ? ? -26.40  -50.79  
13 1 LEU A 721 ? ? -57.57  6.10    
14 1 GLU A 761 ? ? -49.76  -9.20   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC C 8   ? ? 0.078 'SIDE CHAIN' 
2 1 DA C 13  ? ? 0.067 'SIDE CHAIN' 
3 1 DA D 112 ? ? 0.066 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 C DT  11  ? P   ? A DT  11  P   
2   1 Y 1 C DT  11  ? OP1 ? A DT  11  OP1 
3   1 Y 1 C DT  11  ? OP2 ? A DT  11  OP2 
4   1 Y 1 A GLU 267 ? CG  ? C GLU 93  CG  
5   1 Y 1 A GLU 267 ? CD  ? C GLU 93  CD  
6   1 Y 1 A GLU 267 ? OE1 ? C GLU 93  OE1 
7   1 Y 1 A GLU 267 ? OE2 ? C GLU 93  OE2 
8   1 Y 1 A GLU 289 ? CG  ? C GLU 115 CG  
9   1 Y 1 A GLU 289 ? CD  ? C GLU 115 CD  
10  1 Y 1 A GLU 289 ? OE1 ? C GLU 115 OE1 
11  1 Y 1 A GLU 289 ? OE2 ? C GLU 115 OE2 
12  1 Y 1 A ARG 316 ? CG  ? C ARG 142 CG  
13  1 Y 1 A ARG 316 ? CD  ? C ARG 142 CD  
14  1 Y 1 A ARG 316 ? NE  ? C ARG 142 NE  
15  1 Y 1 A ARG 316 ? CZ  ? C ARG 142 CZ  
16  1 Y 1 A ARG 316 ? NH1 ? C ARG 142 NH1 
17  1 Y 1 A ARG 316 ? NH2 ? C ARG 142 NH2 
18  1 Y 1 A LYS 317 ? CG  ? C LYS 143 CG  
19  1 Y 1 A LYS 317 ? CD  ? C LYS 143 CD  
20  1 Y 1 A LYS 317 ? CE  ? C LYS 143 CE  
21  1 Y 1 A LYS 317 ? NZ  ? C LYS 143 NZ  
22  1 Y 1 A MET 319 ? CG  ? C MET 145 CG  
23  1 Y 1 A MET 319 ? SD  ? C MET 145 SD  
24  1 Y 1 A MET 319 ? CE  ? C MET 145 CE  
25  1 Y 1 A LYS 326 ? CG  ? C LYS 152 CG  
26  1 Y 1 A LYS 326 ? CD  ? C LYS 152 CD  
27  1 Y 1 A LYS 326 ? CE  ? C LYS 152 CE  
28  1 Y 1 A LYS 326 ? NZ  ? C LYS 152 NZ  
29  1 Y 1 A GLU 330 ? CG  ? C GLU 156 CG  
30  1 Y 1 A GLU 330 ? CD  ? C GLU 156 CD  
31  1 Y 1 A GLU 330 ? OE1 ? C GLU 156 OE1 
32  1 Y 1 A GLU 330 ? OE2 ? C GLU 156 OE2 
33  1 Y 1 A LYS 333 ? CG  ? C LYS 159 CG  
34  1 Y 1 A LYS 333 ? CD  ? C LYS 159 CD  
35  1 Y 1 A LYS 333 ? CE  ? C LYS 159 CE  
36  1 Y 1 A LYS 333 ? NZ  ? C LYS 159 NZ  
37  1 Y 1 A GLU 337 ? CG  ? C GLU 163 CG  
38  1 Y 1 A GLU 337 ? CD  ? C GLU 163 CD  
39  1 Y 1 A GLU 337 ? OE1 ? C GLU 163 OE1 
40  1 Y 1 A GLU 337 ? OE2 ? C GLU 163 OE2 
41  1 Y 1 A LYS 347 ? CG  ? C LYS 173 CG  
42  1 Y 1 A LYS 347 ? CD  ? C LYS 173 CD  
43  1 Y 1 A LYS 347 ? CE  ? C LYS 173 CE  
44  1 Y 1 A LYS 347 ? NZ  ? C LYS 173 NZ  
45  1 Y 1 A GLU 463 ? CG  ? C GLU 289 CG  
46  1 Y 1 A GLU 463 ? CD  ? C GLU 289 CD  
47  1 Y 1 A GLU 463 ? OE1 ? C GLU 289 OE1 
48  1 Y 1 A GLU 463 ? OE2 ? C GLU 289 OE2 
49  1 Y 1 A LYS 466 ? CG  ? C LYS 292 CG  
50  1 Y 1 A LYS 466 ? CD  ? C LYS 292 CD  
51  1 Y 1 A LYS 466 ? CE  ? C LYS 292 CE  
52  1 Y 1 A LYS 466 ? NZ  ? C LYS 292 NZ  
53  1 Y 1 A LYS 468 ? CG  ? C LYS 294 CG  
54  1 Y 1 A LYS 468 ? CD  ? C LYS 294 CD  
55  1 Y 1 A LYS 468 ? CE  ? C LYS 294 CE  
56  1 Y 1 A LYS 468 ? NZ  ? C LYS 294 NZ  
57  1 Y 1 A LYS 471 ? CG  ? C LYS 297 CG  
58  1 Y 1 A LYS 471 ? CD  ? C LYS 297 CD  
59  1 Y 1 A LYS 471 ? CE  ? C LYS 297 CE  
60  1 Y 1 A LYS 471 ? NZ  ? C LYS 297 NZ  
61  1 Y 1 A LYS 484 ? CG  ? C LYS 310 CG  
62  1 Y 1 A LYS 484 ? CD  ? C LYS 310 CD  
63  1 Y 1 A LYS 484 ? CE  ? C LYS 310 CE  
64  1 Y 1 A LYS 484 ? NZ  ? C LYS 310 NZ  
65  1 Y 1 A GLU 517 ? CG  ? C GLU 343 CG  
66  1 Y 1 A GLU 517 ? CD  ? C GLU 343 CD  
67  1 Y 1 A GLU 517 ? OE1 ? C GLU 343 OE1 
68  1 Y 1 A GLU 517 ? OE2 ? C GLU 343 OE2 
69  1 Y 1 A ASP 519 ? CG  ? C ASP 345 CG  
70  1 Y 1 A ASP 519 ? OD1 ? C ASP 345 OD1 
71  1 Y 1 A ASP 519 ? OD2 ? C ASP 345 OD2 
72  1 Y 1 A GLN 521 ? CG  ? C GLN 347 CG  
73  1 Y 1 A GLN 521 ? CD  ? C GLN 347 CD  
74  1 Y 1 A GLN 521 ? OE1 ? C GLN 347 OE1 
75  1 Y 1 A GLN 521 ? NE2 ? C GLN 347 NE2 
76  1 Y 1 A GLU 522 ? CG  ? C GLU 348 CG  
77  1 Y 1 A GLU 522 ? CD  ? C GLU 348 CD  
78  1 Y 1 A GLU 522 ? OE1 ? C GLU 348 OE1 
79  1 Y 1 A GLU 522 ? OE2 ? C GLU 348 OE2 
80  1 Y 1 A ARG 536 ? CG  ? C ARG 362 CG  
81  1 Y 1 A ARG 536 ? CD  ? C ARG 362 CD  
82  1 Y 1 A ARG 536 ? NE  ? C ARG 362 NE  
83  1 Y 1 A ARG 536 ? CZ  ? C ARG 362 CZ  
84  1 Y 1 A ARG 536 ? NH1 ? C ARG 362 NH1 
85  1 Y 1 A ARG 536 ? NH2 ? C ARG 362 NH2 
86  1 Y 1 A GLU 556 ? CG  ? C GLU 382 CG  
87  1 Y 1 A GLU 556 ? CD  ? C GLU 382 CD  
88  1 Y 1 A GLU 556 ? OE1 ? C GLU 382 OE1 
89  1 Y 1 A GLU 556 ? OE2 ? C GLU 382 OE2 
90  1 Y 1 A ARG 567 ? CG  ? C ARG 393 CG  
91  1 Y 1 A ARG 567 ? CD  ? C ARG 393 CD  
92  1 Y 1 A ARG 567 ? NE  ? C ARG 393 NE  
93  1 Y 1 A ARG 567 ? CZ  ? C ARG 393 CZ  
94  1 Y 1 A ARG 567 ? NH1 ? C ARG 393 NH1 
95  1 Y 1 A ARG 567 ? NH2 ? C ARG 393 NH2 
96  1 Y 1 A GLU 582 ? CG  ? C GLU 408 CG  
97  1 Y 1 A GLU 582 ? CD  ? C GLU 408 CD  
98  1 Y 1 A GLU 582 ? OE1 ? C GLU 408 OE1 
99  1 Y 1 A GLU 582 ? OE2 ? C GLU 408 OE2 
100 1 Y 1 A GLU 610 ? CG  ? C GLU 436 CG  
101 1 Y 1 A GLU 610 ? CD  ? C GLU 436 CD  
102 1 Y 1 A GLU 610 ? OE1 ? C GLU 436 OE1 
103 1 Y 1 A GLU 610 ? OE2 ? C GLU 436 OE2 
104 1 Y 1 A ARG 624 ? CG  ? C ARG 450 CG  
105 1 Y 1 A ARG 624 ? CD  ? C ARG 450 CD  
106 1 Y 1 A ARG 624 ? NE  ? C ARG 450 NE  
107 1 Y 1 A ARG 624 ? CZ  ? C ARG 450 CZ  
108 1 Y 1 A ARG 624 ? NH1 ? C ARG 450 NH1 
109 1 Y 1 A ARG 624 ? NH2 ? C ARG 450 NH2 
110 1 Y 1 A LYS 720 ? CG  ? C LYS 546 CG  
111 1 Y 1 A LYS 720 ? CD  ? C LYS 546 CD  
112 1 Y 1 A LYS 720 ? CE  ? C LYS 546 CE  
113 1 Y 1 A LYS 720 ? NZ  ? C LYS 546 NZ  
114 1 Y 1 A LEU 721 ? CG  ? C LEU 547 CG  
115 1 Y 1 A LEU 721 ? CD1 ? C LEU 547 CD1 
116 1 Y 1 A LEU 721 ? CD2 ? C LEU 547 CD2 
117 1 Y 1 A LYS 735 ? CG  ? C LYS 561 CG  
118 1 Y 1 A LYS 735 ? CD  ? C LYS 561 CD  
119 1 Y 1 A LYS 735 ? CE  ? C LYS 561 CE  
120 1 Y 1 A LYS 735 ? NZ  ? C LYS 561 NZ  
121 1 Y 1 A GLU 741 ? CG  ? C GLU 567 CG  
122 1 Y 1 A GLU 741 ? CD  ? C GLU 567 CD  
123 1 Y 1 A GLU 741 ? OE1 ? C GLU 567 OE1 
124 1 Y 1 A GLU 741 ? OE2 ? C GLU 567 OE2 
125 1 Y 1 A LYS 742 ? CG  ? C LYS 568 CG  
126 1 Y 1 A LYS 742 ? CD  ? C LYS 568 CD  
127 1 Y 1 A LYS 742 ? CE  ? C LYS 568 CE  
128 1 Y 1 A LYS 742 ? NZ  ? C LYS 568 NZ  
129 1 Y 1 A LYS 746 ? CG  ? C LYS 572 CG  
130 1 Y 1 A LYS 746 ? CD  ? C LYS 572 CD  
131 1 Y 1 A LYS 746 ? CE  ? C LYS 572 CE  
132 1 Y 1 A LYS 746 ? NZ  ? C LYS 572 NZ  
133 1 Y 1 A ASP 760 ? CG  ? C ASP 586 CG  
134 1 Y 1 A ASP 760 ? OD1 ? C ASP 586 OD1 
135 1 Y 1 A ASP 760 ? OD2 ? C ASP 586 OD2 
136 1 Y 1 A GLU 761 ? CG  ? C GLU 587 CG  
137 1 Y 1 A GLU 761 ? CD  ? C GLU 587 CD  
138 1 Y 1 A GLU 761 ? OE1 ? C GLU 587 OE1 
139 1 Y 1 A GLU 761 ? OE2 ? C GLU 587 OE2 
140 1 Y 1 A GLU 764 ? CG  ? C GLU 590 CG  
141 1 Y 1 A GLU 764 ? CD  ? C GLU 590 CD  
142 1 Y 1 A GLU 764 ? OE1 ? C GLU 590 OE1 
143 1 Y 1 A GLU 764 ? OE2 ? C GLU 590 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A LYS 175 ? C LYS 1   
2   1 Y 1 A PRO 176 ? C PRO 2   
3   1 Y 1 A LYS 177 ? C LYS 3   
4   1 Y 1 A ASN 178 ? C ASN 4   
5   1 Y 1 A LYS 179 ? C LYS 5   
6   1 Y 1 A ASP 180 ? C ASP 6   
7   1 Y 1 A LYS 181 ? C LYS 7   
8   1 Y 1 A ASP 182 ? C ASP 8   
9   1 Y 1 A LYS 183 ? C LYS 9   
10  1 Y 1 A LYS 184 ? C LYS 10  
11  1 Y 1 A VAL 185 ? C VAL 11  
12  1 Y 1 A PRO 186 ? C PRO 12  
13  1 Y 1 A GLU 187 ? C GLU 13  
14  1 Y 1 A PRO 188 ? C PRO 14  
15  1 Y 1 A ASP 189 ? C ASP 15  
16  1 Y 1 A ASN 190 ? C ASN 16  
17  1 Y 1 A LYS 191 ? C LYS 17  
18  1 Y 1 A LYS 192 ? C LYS 18  
19  1 Y 1 A LYS 193 ? C LYS 19  
20  1 Y 1 A LYS 194 ? C LYS 20  
21  1 Y 1 A PRO 195 ? C PRO 21  
22  1 Y 1 A LYS 196 ? C LYS 22  
23  1 Y 1 A LYS 197 ? C LYS 23  
24  1 Y 1 A GLU 198 ? C GLU 24  
25  1 Y 1 A GLU 199 ? C GLU 25  
26  1 Y 1 A GLU 200 ? C GLU 26  
27  1 Y 1 A GLN 201 ? C GLN 27  
28  1 Y 1 A LYS 202 ? C LYS 28  
29  1 Y 1 A TRP 203 ? C TRP 29  
30  1 Y 1 A LYS 204 ? C LYS 30  
31  1 Y 1 A TRP 205 ? C TRP 31  
32  1 Y 1 A TRP 206 ? C TRP 32  
33  1 Y 1 A GLU 207 ? C GLU 33  
34  1 Y 1 A GLU 208 ? C GLU 34  
35  1 Y 1 A GLU 209 ? C GLU 35  
36  1 Y 1 A ARG 210 ? C ARG 36  
37  1 Y 1 A TYR 211 ? C TYR 37  
38  1 Y 1 A PRO 212 ? C PRO 38  
39  1 Y 1 A GLU 213 ? C GLU 39  
40  1 Y 1 A GLY 214 ? C GLY 40  
41  1 Y 1 A ALA 627 ? C ALA 453 
42  1 Y 1 A ILE 628 ? C ILE 454 
43  1 Y 1 A LEU 629 ? C LEU 455 
44  1 Y 1 A CYS 630 ? C CYS 456 
45  1 Y 1 A ASN 631 ? C ASN 457 
46  1 Y 1 A HIS 632 ? C HIS 458 
47  1 Y 1 A GLN 633 ? C GLN 459 
48  1 Y 1 A ARG 634 ? C ARG 460 
49  1 Y 1 A ALA 635 ? C ALA 461 
50  1 Y 1 A PRO 636 ? C PRO 462 
51  1 Y 1 A PRO 637 ? C PRO 463 
52  1 Y 1 A LYS 638 ? C LYS 464 
53  1 Y 1 A THR 639 ? C THR 465 
54  1 Y 1 A PHE 640 ? C PHE 466 
55  1 Y 1 A GLU 641 ? C GLU 467 
56  1 Y 1 A LYS 642 ? C LYS 468 
57  1 Y 1 A SER 643 ? C SER 469 
58  1 Y 1 A MET 644 ? C MET 470 
59  1 Y 1 A MET 645 ? C MET 471 
60  1 Y 1 A ASN 646 ? C ASN 472 
61  1 Y 1 A LEU 647 ? C LEU 473 
62  1 Y 1 A GLN 648 ? C GLN 474 
63  1 Y 1 A THR 649 ? C THR 475 
64  1 Y 1 A LYS 650 ? C LYS 476 
65  1 Y 1 A ILE 651 ? C ILE 477 
66  1 Y 1 A ASP 652 ? C ASP 478 
67  1 Y 1 A ALA 653 ? C ALA 479 
68  1 Y 1 A LYS 654 ? C LYS 480 
69  1 Y 1 A LYS 655 ? C LYS 481 
70  1 Y 1 A GLU 656 ? C GLU 482 
71  1 Y 1 A GLN 657 ? C GLN 483 
72  1 Y 1 A LEU 658 ? C LEU 484 
73  1 Y 1 A ALA 659 ? C ALA 485 
74  1 Y 1 A ASP 660 ? C ASP 486 
75  1 Y 1 A ALA 661 ? C ALA 487 
76  1 Y 1 A ARG 662 ? C ARG 488 
77  1 Y 1 A ARG 663 ? C ARG 489 
78  1 Y 1 A ASP 664 ? C ASP 490 
79  1 Y 1 A LEU 665 ? C LEU 491 
80  1 Y 1 A LYS 666 ? C LYS 492 
81  1 Y 1 A SER 667 ? C SER 493 
82  1 Y 1 A ALA 668 ? C ALA 494 
83  1 Y 1 A LYS 669 ? C LYS 495 
84  1 Y 1 A ALA 670 ? C ALA 496 
85  1 Y 1 A ASP 671 ? C ASP 497 
86  1 Y 1 A ALA 672 ? C ALA 498 
87  1 Y 1 A LYS 673 ? C LYS 499 
88  1 Y 1 A VAL 674 ? C VAL 500 
89  1 Y 1 A MET 675 ? C MET 501 
90  1 Y 1 A LYS 676 ? C LYS 502 
91  1 Y 1 A ASP 677 ? C ASP 503 
92  1 Y 1 A ALA 678 ? C ALA 504 
93  1 Y 1 A LYS 679 ? C LYS 505 
94  1 Y 1 A THR 680 ? C THR 506 
95  1 Y 1 A LYS 681 ? C LYS 507 
96  1 Y 1 A LYS 682 ? C LYS 508 
97  1 Y 1 A VAL 683 ? C VAL 509 
98  1 Y 1 A VAL 684 ? C VAL 510 
99  1 Y 1 A GLU 685 ? C GLU 511 
100 1 Y 1 A SER 686 ? C SER 512 
101 1 Y 1 A LYS 687 ? C LYS 513 
102 1 Y 1 A LYS 688 ? C LYS 514 
103 1 Y 1 A LYS 689 ? C LYS 515 
104 1 Y 1 A ALA 690 ? C ALA 516 
105 1 Y 1 A VAL 691 ? C VAL 517 
106 1 Y 1 A GLN 692 ? C GLN 518 
107 1 Y 1 A ARG 693 ? C ARG 519 
108 1 Y 1 A LEU 694 ? C LEU 520 
109 1 Y 1 A GLU 695 ? C GLU 521 
110 1 Y 1 A GLU 696 ? C GLU 522 
111 1 Y 1 A GLN 697 ? C GLN 523 
112 1 Y 1 A LEU 698 ? C LEU 524 
113 1 Y 1 A MET 699 ? C MET 525 
114 1 Y 1 A LYS 700 ? C LYS 526 
115 1 Y 1 A LEU 701 ? C LEU 527 
116 1 Y 1 A GLU 702 ? C GLU 528 
117 1 Y 1 A VAL 703 ? C VAL 529 
118 1 Y 1 A GLN 704 ? C GLN 530 
119 1 Y 1 A ALA 705 ? C ALA 531 
120 1 Y 1 A THR 706 ? C THR 532 
121 1 Y 1 A ASP 707 ? C ASP 533 
122 1 Y 1 A ARG 708 ? C ARG 534 
123 1 Y 1 A GLU 709 ? C GLU 535 
124 1 Y 1 A GLU 710 ? C GLU 536 
125 1 Y 1 A ASN 711 ? C ASN 537 
126 1 Y 1 A LYS 712 ? C LYS 538 
127 1 Y 1 A GLN 713 ? C GLN 539 
128 1 Y 1 A ILE 714 ? C ILE 540 
129 1 Y 1 A ALA 715 ? C ALA 541 
130 1 Y 1 A LEU 716 ? C LEU 542 
131 1 Y 1 A GLY 717 ? C GLY 543 
132 1 Y 1 A THR 718 ? C THR 544 
133 1 Y 1 A SER 719 ? C SER 545 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1A31 'double helix'        
1A31 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA  1  1_555 B DT  22 1_555 -0.446 -0.474 -0.268 11.321  -24.027 -1.500 1  C_DA1:DT122_D   C 1  ? D 122 ? 20 1 
1 A DA  2  1_555 B DT  21 1_555 0.294  -0.161 0.057  17.239  -11.074 0.784  2  C_DA2:DT121_D   C 2  ? D 121 ? 20 1 
1 A DA  3  1_555 B DT  20 1_555 0.118  -0.234 -0.025 10.455  -17.923 1.843  3  C_DA3:DT120_D   C 3  ? D 120 ? 20 1 
1 A DA  4  1_555 B DT  19 1_555 0.165  -0.294 -0.014 3.916   -23.101 1.086  4  C_DA4:DT119_D   C 4  ? D 119 ? 20 1 
1 A DA  5  1_555 B DT  18 1_555 0.165  0.021  0.009  -0.413  -20.701 3.564  5  C_DA5:DT118_D   C 5  ? D 118 ? 20 1 
1 A DG  6  1_555 B DC  17 1_555 -0.267 -0.022 -0.075 -8.375  -14.062 -0.019 6  C_DG6:DC117_D   C 6  ? D 117 ? 19 1 
1 A DA  7  1_555 B DT  16 1_555 0.242  -0.173 -0.547 -5.205  -12.513 -4.289 7  C_DA7:DT116_D   C 7  ? D 116 ? 20 1 
1 A DC  8  1_555 B DG  15 1_555 0.211  -0.270 0.375  1.920   -21.701 -0.403 8  C_DC8:DG115_D   C 8  ? D 115 ? 19 1 
1 A 5IU 9  1_555 B DA  14 1_555 -0.386 -0.169 0.034  -11.490 -16.004 -0.734 9  C_5IU9:DA114_D  C 9  ? D 114 ? 20 1 
1 A 5IU 10 1_555 B DA  13 1_555 -0.024 -0.155 0.278  -16.795 -17.851 -0.087 10 C_5IU10:DA113_D C 10 ? D 113 ? 20 1 
1 A DT  11 1_555 B DA  12 1_555 0.244  0.169  0.081  -15.233 0.340   7.099  11 C_DT11:DA112_D  C 11 ? D 112 ? 20 1 
1 A DG  12 1_555 B DC  11 1_555 -0.599 0.105  0.014  8.360   -6.759  6.681  12 C_DG12:DC111_D  C 12 ? D 111 ? 19 1 
1 A DA  13 1_555 B 5IU 10 1_555 0.494  -0.060 -0.525 5.761   -7.961  -1.857 13 C_DA13:5IU110_D C 13 ? D 110 ? 20 1 
1 A DA  14 1_555 B 5IU 9  1_555 1.223  -0.585 -0.770 -1.159  -16.550 -6.839 14 C_DA14:5IU109_D C 14 ? D 109 ? 20 1 
1 A DA  15 1_555 B 5IU 8  1_555 0.490  -0.137 0.283  8.236   -19.664 -1.005 15 C_DA15:5IU108_D C 15 ? D 108 ? 20 1 
1 A DA  16 1_555 B 5IU 7  1_555 0.571  -0.178 -0.271 -4.591  -24.769 1.282  16 C_DA16:5IU107_D C 16 ? D 107 ? 20 1 
1 A DA  17 1_555 B DT  6  1_555 -0.134 0.005  -0.353 -5.929  -15.267 15.272 17 C_DA17:DT106_D  C 17 ? D 106 ? 20 1 
1 A 5IU 18 1_555 B DA  5  1_555 0.133  -0.014 0.246  -4.962  -22.547 14.808 18 C_5IU18:DA105_D C 18 ? D 105 ? ?  1 
1 A 5IU 19 1_555 B DA  4  1_555 -0.459 0.282  -0.773 3.303   -22.630 6.477  19 C_5IU19:DA104_D C 19 ? D 104 ? 20 1 
1 A 5IU 20 1_555 B DA  3  1_555 1.228  0.097  0.157  -5.425  -15.969 14.446 20 C_5IU20:DA103_D C 20 ? D 103 ? ?  1 
1 A 5IU 21 1_555 B DA  2  1_555 1.029  -0.369 -0.140 -1.788  -8.428  7.994  21 C_5IU21:DA102_D C 21 ? D 102 ? 20 1 
1 A DT  22 1_555 B DA  1  1_555 -0.254 -0.083 -0.075 -2.926  -10.883 0.539  22 C_DT22:DA101_D  C 22 ? D 101 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA  1  1_555 B DT  22 1_555 A DA  2  1_555 B DT  21 1_555 0.313  -0.290 3.079 -0.598 8.610  31.940 -1.865 -0.644 2.899 15.300 
1.062  33.056 1  CC_DA1DA2:DT121DT122_DD     C 1  ? D 122 ? C 2  ? D 121 ? 
1 A DA  2  1_555 B DT  21 1_555 A DA  3  1_555 B DT  20 1_555 -0.174 0.024  3.290 -2.251 -1.430 40.466 0.195  -0.002 3.292 -2.064 
3.249  40.550 2  CC_DA2DA3:DT120DT121_DD     C 2  ? D 121 ? C 3  ? D 120 ? 
1 A DA  3  1_555 B DT  20 1_555 A DA  4  1_555 B DT  19 1_555 -0.020 -0.286 3.319 0.977  0.459  35.611 -0.536 0.176  3.313 0.751  
-1.597 35.626 3  CC_DA3DA4:DT119DT120_DD     C 3  ? D 120 ? C 4  ? D 119 ? 
1 A DA  4  1_555 B DT  19 1_555 A DA  5  1_555 B DT  18 1_555 0.282  -0.262 3.335 0.053  -2.711 37.097 -0.043 -0.435 3.346 -4.255 
-0.083 37.192 4  CC_DA4DA5:DT118DT119_DD     C 4  ? D 119 ? C 5  ? D 118 ? 
1 A DA  5  1_555 B DT  18 1_555 A DG  6  1_555 B DC  17 1_555 0.314  -0.824 3.405 0.157  4.847  32.322 -2.323 -0.530 3.252 8.646  
-0.280 32.674 5  CC_DA5DG6:DC117DT118_DD     C 5  ? D 118 ? C 6  ? D 117 ? 
1 A DG  6  1_555 B DC  17 1_555 A DA  7  1_555 B DT  16 1_555 -0.399 -0.320 3.440 3.181  5.196  32.061 -1.508 1.285  3.296 9.303  
-5.695 32.620 6  CC_DG6DA7:DT116DC117_DD     C 6  ? D 117 ? C 7  ? D 116 ? 
1 A DA  7  1_555 B DT  16 1_555 A DC  8  1_555 B DG  15 1_555 0.720  -0.769 3.084 -7.088 -0.104 32.034 -1.346 -2.397 2.866 -0.186 
12.652 32.789 7  CC_DA7DC8:DG115DT116_DD     C 7  ? D 116 ? C 8  ? D 115 ? 
1 A DC  8  1_555 B DG  15 1_555 A 5IU 9  1_555 B DA  14 1_555 -0.433 -0.602 3.617 5.762  -1.856 39.152 -0.650 1.383  3.545 -2.749 
-8.536 39.599 8  CC_DC85IU9:DA114DG115_DD    C 8  ? D 115 ? C 9  ? D 114 ? 
1 A 5IU 9  1_555 B DA  14 1_555 A 5IU 10 1_555 B DA  13 1_555 -0.196 -0.577 3.508 -0.483 -4.164 36.323 -0.299 0.241  3.553 -6.651 
0.772  36.556 9  CC_5IU95IU10:DA113DA114_DD  C 9  ? D 114 ? C 10 ? D 113 ? 
1 A 5IU 10 1_555 B DA  13 1_555 A DT  11 1_555 B DA  12 1_555 1.398  -0.086 3.359 2.245  -4.311 37.770 0.437  -1.846 3.422 -6.626 
-3.451 38.070 10 CC_5IU10DT11:DA112DA113_DD  C 10 ? D 113 ? C 11 ? D 112 ? 
1 A DT  11 1_555 B DA  12 1_555 A DG  12 1_555 B DC  11 1_555 -1.117 0.237  2.906 2.886  4.260  27.877 -0.379 2.867  2.783 8.749  
-5.927 28.338 11 CC_DT11DG12:DC111DA112_DD   C 11 ? D 112 ? C 12 ? D 111 ? 
1 A DG  12 1_555 B DC  11 1_555 A DA  13 1_555 B 5IU 10 1_555 -0.402 -0.170 3.345 3.204  6.906  32.149 -1.485 1.258  3.187 12.257 
-5.687 33.015 12 CC_DG12DA13:5IU110DC111_DD  C 12 ? D 111 ? C 13 ? D 110 ? 
1 A DA  13 1_555 B 5IU 10 1_555 A DA  14 1_555 B 5IU 9  1_555 -0.643 0.025  3.621 1.990  1.900  41.548 -0.186 1.137  3.585 2.675  
-2.801 41.635 13 CC_DA13DA14:5IU1095IU110_DD C 13 ? D 110 ? C 14 ? D 109 ? 
1 A DA  14 1_555 B 5IU 9  1_555 A DA  15 1_555 B 5IU 8  1_555 0.457  -0.469 2.734 -7.943 -5.108 36.658 -0.176 -1.556 2.622 -7.960 
12.379 37.815 14 CC_DA14DA15:5IU1085IU109_DD C 14 ? D 109 ? C 15 ? D 108 ? 
1 A DA  15 1_555 B 5IU 8  1_555 A DA  16 1_555 B 5IU 7  1_555 0.160  -0.421 3.478 5.628  -2.428 37.083 -0.314 0.538  3.484 -3.785 
-8.775 37.569 15 CC_DA15DA16:5IU1075IU108_DD C 15 ? D 108 ? C 16 ? D 107 ? 
1 A DA  16 1_555 B 5IU 7  1_555 A DA  17 1_555 B DT  6  1_555 0.425  -0.462 3.208 1.116  1.691  31.829 -1.141 -0.576 3.193 3.080  
-2.033 31.892 16 CC_DA16DA17:DT1065IU107_DD  C 16 ? D 107 ? C 17 ? D 106 ? 
1 A DA  17 1_555 B DT  6  1_555 A 5IU 18 1_555 B DA  5  1_555 0.276  0.058  3.302 -1.824 -0.777 32.700 0.237  -0.806 3.280 -1.379 
3.236  32.758 17 CC_DA175IU18:DA105DT106_DD  C 17 ? D 106 ? C 18 ? D 105 ? 
1 A 5IU 18 1_555 B DA  5  1_555 A 5IU 19 1_555 B DA  4  1_555 -0.672 -0.119 2.801 2.672  1.220  35.746 -0.342 1.417  2.740 1.983  
-4.344 35.862 18 CC_5IU185IU19:DA104DA105_DD C 18 ? D 105 ? C 19 ? D 104 ? 
1 A 5IU 19 1_555 B DA  4  1_555 A 5IU 20 1_555 B DA  3  1_555 0.811  0.179  3.452 -2.438 3.276  44.032 -0.084 -1.316 3.408 4.358  
3.244  44.211 19 CC_5IU195IU20:DA103DA104_DD C 19 ? D 104 ? C 20 ? D 103 ? 
1 A 5IU 20 1_555 B DA  3  1_555 A 5IU 21 1_555 B DA  2  1_555 -0.553 0.053  3.080 -1.037 -0.492 33.756 0.167  0.793  3.094 -0.848 
1.786  33.775 20 CC_5IU205IU21:DA102DA103_DD C 20 ? D 103 ? C 21 ? D 102 ? 
1 A 5IU 21 1_555 B DA  2  1_555 A DT  22 1_555 B DA  1  1_555 -0.991 -0.134 3.191 -1.857 1.544  29.633 -0.580 1.548  3.235 3.013  
3.623  29.729 21 CC_5IU21DT22:DA101DA102_DD  C 21 ? D 102 ? C 22 ? D 101 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   1005 1005 HOH HOH C . 
D 4 HOH 2   1014 1014 HOH HOH C . 
D 4 HOH 3   1019 1019 HOH HOH C . 
D 4 HOH 4   1022 1022 HOH HOH C . 
D 4 HOH 5   1027 1027 HOH HOH C . 
D 4 HOH 6   1031 1031 HOH HOH C . 
D 4 HOH 7   1050 1050 HOH HOH C . 
D 4 HOH 8   1052 1052 HOH HOH C . 
D 4 HOH 9   1057 1057 HOH HOH C . 
D 4 HOH 10  1070 1070 HOH HOH C . 
D 4 HOH 11  1081 1081 HOH HOH C . 
D 4 HOH 12  1097 1097 HOH HOH C . 
D 4 HOH 13  1105 1105 HOH HOH C . 
D 4 HOH 14  1106 1106 HOH HOH C . 
D 4 HOH 15  1108 1108 HOH HOH C . 
D 4 HOH 16  1122 1122 HOH HOH C . 
D 4 HOH 17  1128 1128 HOH HOH C . 
D 4 HOH 18  1130 1130 HOH HOH C . 
D 4 HOH 19  1134 1134 HOH HOH C . 
D 4 HOH 20  1148 1148 HOH HOH C . 
D 4 HOH 21  1159 1159 HOH HOH C . 
D 4 HOH 22  1163 1163 HOH HOH C . 
D 4 HOH 23  1167 1167 HOH HOH C . 
D 4 HOH 24  1170 1170 HOH HOH C . 
D 4 HOH 25  1183 1183 HOH HOH C . 
D 4 HOH 26  1188 1188 HOH HOH C . 
D 4 HOH 27  1190 1190 HOH HOH C . 
D 4 HOH 28  1198 1198 HOH HOH C . 
D 4 HOH 29  1201 1201 HOH HOH C . 
D 4 HOH 30  1208 1208 HOH HOH C . 
D 4 HOH 31  1215 1215 HOH HOH C . 
D 4 HOH 32  1254 1254 HOH HOH C . 
D 4 HOH 33  1267 1267 HOH HOH C . 
D 4 HOH 34  1268 1268 HOH HOH C . 
D 4 HOH 35  1269 1269 HOH HOH C . 
D 4 HOH 36  1271 1271 HOH HOH C . 
D 4 HOH 37  1276 1276 HOH HOH C . 
D 4 HOH 38  1297 1297 HOH HOH C . 
D 4 HOH 39  1327 1327 HOH HOH C . 
D 4 HOH 40  1330 1330 HOH HOH C . 
D 4 HOH 41  1341 1341 HOH HOH C . 
D 4 HOH 42  1353 1353 HOH HOH C . 
D 4 HOH 43  1371 1371 HOH HOH C . 
D 4 HOH 44  1385 1385 HOH HOH C . 
D 4 HOH 45  1389 1389 HOH HOH C . 
D 4 HOH 46  1403 1403 HOH HOH C . 
D 4 HOH 47  1408 1408 HOH HOH C . 
E 4 HOH 1   1002 1002 HOH HOH D . 
E 4 HOH 2   1008 1008 HOH HOH D . 
E 4 HOH 3   1010 1010 HOH HOH D . 
E 4 HOH 4   1012 1012 HOH HOH D . 
E 4 HOH 5   1015 1015 HOH HOH D . 
E 4 HOH 6   1020 1020 HOH HOH D . 
E 4 HOH 7   1021 1021 HOH HOH D . 
E 4 HOH 8   1024 1024 HOH HOH D . 
E 4 HOH 9   1036 1036 HOH HOH D . 
E 4 HOH 10  1037 1037 HOH HOH D . 
E 4 HOH 11  1041 1041 HOH HOH D . 
E 4 HOH 12  1043 1043 HOH HOH D . 
E 4 HOH 13  1044 1044 HOH HOH D . 
E 4 HOH 14  1049 1049 HOH HOH D . 
E 4 HOH 15  1051 1051 HOH HOH D . 
E 4 HOH 16  1061 1061 HOH HOH D . 
E 4 HOH 17  1065 1065 HOH HOH D . 
E 4 HOH 18  1066 1066 HOH HOH D . 
E 4 HOH 19  1067 1067 HOH HOH D . 
E 4 HOH 20  1071 1071 HOH HOH D . 
E 4 HOH 21  1074 1074 HOH HOH D . 
E 4 HOH 22  1079 1079 HOH HOH D . 
E 4 HOH 23  1082 1082 HOH HOH D . 
E 4 HOH 24  1103 1103 HOH HOH D . 
E 4 HOH 25  1117 1117 HOH HOH D . 
E 4 HOH 26  1120 1120 HOH HOH D . 
E 4 HOH 27  1136 1136 HOH HOH D . 
E 4 HOH 28  1141 1141 HOH HOH D . 
E 4 HOH 29  1143 1143 HOH HOH D . 
E 4 HOH 30  1147 1147 HOH HOH D . 
E 4 HOH 31  1149 1149 HOH HOH D . 
E 4 HOH 32  1150 1150 HOH HOH D . 
E 4 HOH 33  1154 1154 HOH HOH D . 
E 4 HOH 34  1168 1168 HOH HOH D . 
E 4 HOH 35  1175 1175 HOH HOH D . 
E 4 HOH 36  1180 1180 HOH HOH D . 
E 4 HOH 37  1189 1189 HOH HOH D . 
E 4 HOH 38  1194 1194 HOH HOH D . 
E 4 HOH 39  1224 1224 HOH HOH D . 
E 4 HOH 40  1226 1226 HOH HOH D . 
E 4 HOH 41  1230 1230 HOH HOH D . 
E 4 HOH 42  1241 1241 HOH HOH D . 
E 4 HOH 43  1243 1243 HOH HOH D . 
E 4 HOH 44  1262 1262 HOH HOH D . 
E 4 HOH 45  1264 1264 HOH HOH D . 
E 4 HOH 46  1273 1273 HOH HOH D . 
E 4 HOH 47  1277 1277 HOH HOH D . 
E 4 HOH 48  1278 1278 HOH HOH D . 
E 4 HOH 49  1281 1281 HOH HOH D . 
E 4 HOH 50  1283 1283 HOH HOH D . 
E 4 HOH 51  1288 1288 HOH HOH D . 
E 4 HOH 52  1295 1295 HOH HOH D . 
E 4 HOH 53  1305 1305 HOH HOH D . 
E 4 HOH 54  1314 1314 HOH HOH D . 
E 4 HOH 55  1317 1317 HOH HOH D . 
E 4 HOH 56  1321 1321 HOH HOH D . 
E 4 HOH 57  1331 1331 HOH HOH D . 
E 4 HOH 58  1339 1339 HOH HOH D . 
E 4 HOH 59  1342 1342 HOH HOH D . 
E 4 HOH 60  1344 1344 HOH HOH D . 
E 4 HOH 61  1356 1356 HOH HOH D . 
E 4 HOH 62  1369 1369 HOH HOH D . 
E 4 HOH 63  1388 1388 HOH HOH D . 
E 4 HOH 64  1395 1395 HOH HOH D . 
E 4 HOH 65  1402 1402 HOH HOH D . 
E 4 HOH 66  1406 1406 HOH HOH D . 
F 4 HOH 1   1001 1001 HOH HOH A . 
F 4 HOH 2   1003 1003 HOH HOH A . 
F 4 HOH 3   1004 1004 HOH HOH A . 
F 4 HOH 4   1006 1006 HOH HOH A . 
F 4 HOH 5   1007 1007 HOH HOH A . 
F 4 HOH 6   1009 1009 HOH HOH A . 
F 4 HOH 7   1011 1011 HOH HOH A . 
F 4 HOH 8   1013 1013 HOH HOH A . 
F 4 HOH 9   1016 1016 HOH HOH A . 
F 4 HOH 10  1017 1017 HOH HOH A . 
F 4 HOH 11  1018 1018 HOH HOH A . 
F 4 HOH 12  1023 1023 HOH HOH A . 
F 4 HOH 13  1025 1025 HOH HOH A . 
F 4 HOH 14  1026 1026 HOH HOH A . 
F 4 HOH 15  1028 1028 HOH HOH A . 
F 4 HOH 16  1029 1029 HOH HOH A . 
F 4 HOH 17  1030 1030 HOH HOH A . 
F 4 HOH 18  1032 1032 HOH HOH A . 
F 4 HOH 19  1033 1033 HOH HOH A . 
F 4 HOH 20  1034 1034 HOH HOH A . 
F 4 HOH 21  1035 1035 HOH HOH A . 
F 4 HOH 22  1038 1038 HOH HOH A . 
F 4 HOH 23  1039 1039 HOH HOH A . 
F 4 HOH 24  1040 1040 HOH HOH A . 
F 4 HOH 25  1042 1042 HOH HOH A . 
F 4 HOH 26  1045 1045 HOH HOH A . 
F 4 HOH 27  1046 1046 HOH HOH A . 
F 4 HOH 28  1047 1047 HOH HOH A . 
F 4 HOH 29  1048 1048 HOH HOH A . 
F 4 HOH 30  1053 1053 HOH HOH A . 
F 4 HOH 31  1054 1054 HOH HOH A . 
F 4 HOH 32  1055 1055 HOH HOH A . 
F 4 HOH 33  1056 1056 HOH HOH A . 
F 4 HOH 34  1058 1058 HOH HOH A . 
F 4 HOH 35  1059 1059 HOH HOH A . 
F 4 HOH 36  1060 1060 HOH HOH A . 
F 4 HOH 37  1062 1062 HOH HOH A . 
F 4 HOH 38  1063 1063 HOH HOH A . 
F 4 HOH 39  1064 1064 HOH HOH A . 
F 4 HOH 40  1068 1068 HOH HOH A . 
F 4 HOH 41  1069 1069 HOH HOH A . 
F 4 HOH 42  1072 1072 HOH HOH A . 
F 4 HOH 43  1073 1073 HOH HOH A . 
F 4 HOH 44  1075 1075 HOH HOH A . 
F 4 HOH 45  1076 1076 HOH HOH A . 
F 4 HOH 46  1077 1077 HOH HOH A . 
F 4 HOH 47  1078 1078 HOH HOH A . 
F 4 HOH 48  1080 1080 HOH HOH A . 
F 4 HOH 49  1083 1083 HOH HOH A . 
F 4 HOH 50  1084 1084 HOH HOH A . 
F 4 HOH 51  1085 1085 HOH HOH A . 
F 4 HOH 52  1086 1086 HOH HOH A . 
F 4 HOH 53  1087 1087 HOH HOH A . 
F 4 HOH 54  1088 1088 HOH HOH A . 
F 4 HOH 55  1089 1089 HOH HOH A . 
F 4 HOH 56  1090 1090 HOH HOH A . 
F 4 HOH 57  1091 1091 HOH HOH A . 
F 4 HOH 58  1092 1092 HOH HOH A . 
F 4 HOH 59  1093 1093 HOH HOH A . 
F 4 HOH 60  1094 1094 HOH HOH A . 
F 4 HOH 61  1095 1095 HOH HOH A . 
F 4 HOH 62  1096 1096 HOH HOH A . 
F 4 HOH 63  1098 1098 HOH HOH A . 
F 4 HOH 64  1099 1099 HOH HOH A . 
F 4 HOH 65  1100 1100 HOH HOH A . 
F 4 HOH 66  1101 1101 HOH HOH A . 
F 4 HOH 67  1102 1102 HOH HOH A . 
F 4 HOH 68  1104 1104 HOH HOH A . 
F 4 HOH 69  1107 1107 HOH HOH A . 
F 4 HOH 70  1109 1109 HOH HOH A . 
F 4 HOH 71  1110 1110 HOH HOH A . 
F 4 HOH 72  1111 1111 HOH HOH A . 
F 4 HOH 73  1112 1112 HOH HOH A . 
F 4 HOH 74  1113 1113 HOH HOH A . 
F 4 HOH 75  1114 1114 HOH HOH A . 
F 4 HOH 76  1115 1115 HOH HOH A . 
F 4 HOH 77  1116 1116 HOH HOH A . 
F 4 HOH 78  1118 1118 HOH HOH A . 
F 4 HOH 79  1119 1119 HOH HOH A . 
F 4 HOH 80  1121 1121 HOH HOH A . 
F 4 HOH 81  1123 1123 HOH HOH A . 
F 4 HOH 82  1124 1124 HOH HOH A . 
F 4 HOH 83  1125 1125 HOH HOH A . 
F 4 HOH 84  1126 1126 HOH HOH A . 
F 4 HOH 85  1127 1127 HOH HOH A . 
F 4 HOH 86  1129 1129 HOH HOH A . 
F 4 HOH 87  1131 1131 HOH HOH A . 
F 4 HOH 88  1132 1132 HOH HOH A . 
F 4 HOH 89  1133 1133 HOH HOH A . 
F 4 HOH 90  1135 1135 HOH HOH A . 
F 4 HOH 91  1137 1137 HOH HOH A . 
F 4 HOH 92  1138 1138 HOH HOH A . 
F 4 HOH 93  1139 1139 HOH HOH A . 
F 4 HOH 94  1140 1140 HOH HOH A . 
F 4 HOH 95  1142 1142 HOH HOH A . 
F 4 HOH 96  1144 1144 HOH HOH A . 
F 4 HOH 97  1145 1145 HOH HOH A . 
F 4 HOH 98  1146 1146 HOH HOH A . 
F 4 HOH 99  1151 1151 HOH HOH A . 
F 4 HOH 100 1152 1152 HOH HOH A . 
F 4 HOH 101 1153 1153 HOH HOH A . 
F 4 HOH 102 1155 1155 HOH HOH A . 
F 4 HOH 103 1156 1156 HOH HOH A . 
F 4 HOH 104 1157 1157 HOH HOH A . 
F 4 HOH 105 1158 1158 HOH HOH A . 
F 4 HOH 106 1160 1160 HOH HOH A . 
F 4 HOH 107 1161 1161 HOH HOH A . 
F 4 HOH 108 1162 1162 HOH HOH A . 
F 4 HOH 109 1164 1164 HOH HOH A . 
F 4 HOH 110 1165 1165 HOH HOH A . 
F 4 HOH 111 1166 1166 HOH HOH A . 
F 4 HOH 112 1169 1169 HOH HOH A . 
F 4 HOH 113 1171 1171 HOH HOH A . 
F 4 HOH 114 1172 1172 HOH HOH A . 
F 4 HOH 115 1173 1173 HOH HOH A . 
F 4 HOH 116 1174 1174 HOH HOH A . 
F 4 HOH 117 1176 1176 HOH HOH A . 
F 4 HOH 118 1177 1177 HOH HOH A . 
F 4 HOH 119 1178 1178 HOH HOH A . 
F 4 HOH 120 1179 1179 HOH HOH A . 
F 4 HOH 121 1181 1181 HOH HOH A . 
F 4 HOH 122 1182 1182 HOH HOH A . 
F 4 HOH 123 1184 1184 HOH HOH A . 
F 4 HOH 124 1185 1185 HOH HOH A . 
F 4 HOH 125 1186 1186 HOH HOH A . 
F 4 HOH 126 1187 1187 HOH HOH A . 
F 4 HOH 127 1191 1191 HOH HOH A . 
F 4 HOH 128 1192 1192 HOH HOH A . 
F 4 HOH 129 1193 1193 HOH HOH A . 
F 4 HOH 130 1195 1195 HOH HOH A . 
F 4 HOH 131 1196 1196 HOH HOH A . 
F 4 HOH 132 1197 1197 HOH HOH A . 
F 4 HOH 133 1199 1199 HOH HOH A . 
F 4 HOH 134 1200 1200 HOH HOH A . 
F 4 HOH 135 1202 1202 HOH HOH A . 
F 4 HOH 136 1203 1203 HOH HOH A . 
F 4 HOH 137 1204 1204 HOH HOH A . 
F 4 HOH 138 1205 1205 HOH HOH A . 
F 4 HOH 139 1206 1206 HOH HOH A . 
F 4 HOH 140 1207 1207 HOH HOH A . 
F 4 HOH 141 1209 1209 HOH HOH A . 
F 4 HOH 142 1210 1210 HOH HOH A . 
F 4 HOH 143 1211 1211 HOH HOH A . 
F 4 HOH 144 1212 1212 HOH HOH A . 
F 4 HOH 145 1213 1213 HOH HOH A . 
F 4 HOH 146 1214 1214 HOH HOH A . 
F 4 HOH 147 1216 1216 HOH HOH A . 
F 4 HOH 148 1217 1217 HOH HOH A . 
F 4 HOH 149 1218 1218 HOH HOH A . 
F 4 HOH 150 1219 1219 HOH HOH A . 
F 4 HOH 151 1220 1220 HOH HOH A . 
F 4 HOH 152 1221 1221 HOH HOH A . 
F 4 HOH 153 1222 1222 HOH HOH A . 
F 4 HOH 154 1223 1223 HOH HOH A . 
F 4 HOH 155 1225 1225 HOH HOH A . 
F 4 HOH 156 1227 1227 HOH HOH A . 
F 4 HOH 157 1228 1228 HOH HOH A . 
F 4 HOH 158 1229 1229 HOH HOH A . 
F 4 HOH 159 1231 1231 HOH HOH A . 
F 4 HOH 160 1232 1232 HOH HOH A . 
F 4 HOH 161 1233 1233 HOH HOH A . 
F 4 HOH 162 1234 1234 HOH HOH A . 
F 4 HOH 163 1235 1235 HOH HOH A . 
F 4 HOH 164 1236 1236 HOH HOH A . 
F 4 HOH 165 1237 1237 HOH HOH A . 
F 4 HOH 166 1238 1238 HOH HOH A . 
F 4 HOH 167 1239 1239 HOH HOH A . 
F 4 HOH 168 1240 1240 HOH HOH A . 
F 4 HOH 169 1242 1242 HOH HOH A . 
F 4 HOH 170 1244 1244 HOH HOH A . 
F 4 HOH 171 1245 1245 HOH HOH A . 
F 4 HOH 172 1246 1246 HOH HOH A . 
F 4 HOH 173 1247 1247 HOH HOH A . 
F 4 HOH 174 1248 1248 HOH HOH A . 
F 4 HOH 175 1249 1249 HOH HOH A . 
F 4 HOH 176 1250 1250 HOH HOH A . 
F 4 HOH 177 1251 1251 HOH HOH A . 
F 4 HOH 178 1252 1252 HOH HOH A . 
F 4 HOH 179 1253 1253 HOH HOH A . 
F 4 HOH 180 1255 1255 HOH HOH A . 
F 4 HOH 181 1256 1256 HOH HOH A . 
F 4 HOH 182 1257 1257 HOH HOH A . 
F 4 HOH 183 1258 1258 HOH HOH A . 
F 4 HOH 184 1259 1259 HOH HOH A . 
F 4 HOH 185 1260 1260 HOH HOH A . 
F 4 HOH 186 1261 1261 HOH HOH A . 
F 4 HOH 187 1263 1263 HOH HOH A . 
F 4 HOH 188 1265 1265 HOH HOH A . 
F 4 HOH 189 1266 1266 HOH HOH A . 
F 4 HOH 190 1270 1270 HOH HOH A . 
F 4 HOH 191 1272 1272 HOH HOH A . 
F 4 HOH 192 1274 1274 HOH HOH A . 
F 4 HOH 193 1275 1275 HOH HOH A . 
F 4 HOH 194 1279 1279 HOH HOH A . 
F 4 HOH 195 1280 1280 HOH HOH A . 
F 4 HOH 196 1282 1282 HOH HOH A . 
F 4 HOH 197 1284 1284 HOH HOH A . 
F 4 HOH 198 1285 1285 HOH HOH A . 
F 4 HOH 199 1286 1286 HOH HOH A . 
F 4 HOH 200 1287 1287 HOH HOH A . 
F 4 HOH 201 1289 1289 HOH HOH A . 
F 4 HOH 202 1290 1290 HOH HOH A . 
F 4 HOH 203 1291 1291 HOH HOH A . 
F 4 HOH 204 1292 1292 HOH HOH A . 
F 4 HOH 205 1293 1293 HOH HOH A . 
F 4 HOH 206 1294 1294 HOH HOH A . 
F 4 HOH 207 1296 1296 HOH HOH A . 
F 4 HOH 208 1298 1298 HOH HOH A . 
F 4 HOH 209 1299 1299 HOH HOH A . 
F 4 HOH 210 1300 1300 HOH HOH A . 
F 4 HOH 211 1301 1301 HOH HOH A . 
F 4 HOH 212 1302 1302 HOH HOH A . 
F 4 HOH 213 1303 1303 HOH HOH A . 
F 4 HOH 214 1304 1304 HOH HOH A . 
F 4 HOH 215 1306 1306 HOH HOH A . 
F 4 HOH 216 1307 1307 HOH HOH A . 
F 4 HOH 217 1308 1308 HOH HOH A . 
F 4 HOH 218 1309 1309 HOH HOH A . 
F 4 HOH 219 1310 1310 HOH HOH A . 
F 4 HOH 220 1311 1311 HOH HOH A . 
F 4 HOH 221 1312 1312 HOH HOH A . 
F 4 HOH 222 1313 1313 HOH HOH A . 
F 4 HOH 223 1315 1315 HOH HOH A . 
F 4 HOH 224 1316 1316 HOH HOH A . 
F 4 HOH 225 1318 1318 HOH HOH A . 
F 4 HOH 226 1319 1319 HOH HOH A . 
F 4 HOH 227 1320 1320 HOH HOH A . 
F 4 HOH 228 1322 1322 HOH HOH A . 
F 4 HOH 229 1323 1323 HOH HOH A . 
F 4 HOH 230 1324 1324 HOH HOH A . 
F 4 HOH 231 1325 1325 HOH HOH A . 
F 4 HOH 232 1326 1326 HOH HOH A . 
F 4 HOH 233 1328 1328 HOH HOH A . 
F 4 HOH 234 1329 1329 HOH HOH A . 
F 4 HOH 235 1332 1332 HOH HOH A . 
F 4 HOH 236 1333 1333 HOH HOH A . 
F 4 HOH 237 1334 1334 HOH HOH A . 
F 4 HOH 238 1335 1335 HOH HOH A . 
F 4 HOH 239 1336 1336 HOH HOH A . 
F 4 HOH 240 1337 1337 HOH HOH A . 
F 4 HOH 241 1338 1338 HOH HOH A . 
F 4 HOH 242 1340 1340 HOH HOH A . 
F 4 HOH 243 1343 1343 HOH HOH A . 
F 4 HOH 244 1345 1345 HOH HOH A . 
F 4 HOH 245 1346 1346 HOH HOH A . 
F 4 HOH 246 1347 1347 HOH HOH A . 
F 4 HOH 247 1348 1348 HOH HOH A . 
F 4 HOH 248 1349 1349 HOH HOH A . 
F 4 HOH 249 1350 1350 HOH HOH A . 
F 4 HOH 250 1351 1351 HOH HOH A . 
F 4 HOH 251 1352 1352 HOH HOH A . 
F 4 HOH 252 1354 1354 HOH HOH A . 
F 4 HOH 253 1355 1355 HOH HOH A . 
F 4 HOH 254 1357 1357 HOH HOH A . 
F 4 HOH 255 1358 1358 HOH HOH A . 
F 4 HOH 256 1359 1359 HOH HOH A . 
F 4 HOH 257 1360 1360 HOH HOH A . 
F 4 HOH 258 1361 1361 HOH HOH A . 
F 4 HOH 259 1362 1362 HOH HOH A . 
F 4 HOH 260 1363 1363 HOH HOH A . 
F 4 HOH 261 1364 1364 HOH HOH A . 
F 4 HOH 262 1365 1365 HOH HOH A . 
F 4 HOH 263 1366 1366 HOH HOH A . 
F 4 HOH 264 1367 1367 HOH HOH A . 
F 4 HOH 265 1368 1368 HOH HOH A . 
F 4 HOH 266 1370 1370 HOH HOH A . 
F 4 HOH 267 1372 1372 HOH HOH A . 
F 4 HOH 268 1373 1373 HOH HOH A . 
F 4 HOH 269 1374 1374 HOH HOH A . 
F 4 HOH 270 1375 1375 HOH HOH A . 
F 4 HOH 271 1376 1376 HOH HOH A . 
F 4 HOH 272 1377 1377 HOH HOH A . 
F 4 HOH 273 1378 1378 HOH HOH A . 
F 4 HOH 274 1379 1379 HOH HOH A . 
F 4 HOH 275 1380 1380 HOH HOH A . 
F 4 HOH 276 1381 1381 HOH HOH A . 
F 4 HOH 277 1382 1382 HOH HOH A . 
F 4 HOH 278 1383 1383 HOH HOH A . 
F 4 HOH 279 1384 1384 HOH HOH A . 
F 4 HOH 280 1386 1386 HOH HOH A . 
F 4 HOH 281 1387 1387 HOH HOH A . 
F 4 HOH 282 1390 1390 HOH HOH A . 
F 4 HOH 283 1391 1391 HOH HOH A . 
F 4 HOH 284 1392 1392 HOH HOH A . 
F 4 HOH 285 1393 1393 HOH HOH A . 
F 4 HOH 286 1394 1394 HOH HOH A . 
F 4 HOH 287 1396 1396 HOH HOH A . 
F 4 HOH 288 1397 1397 HOH HOH A . 
F 4 HOH 289 1398 1398 HOH HOH A . 
F 4 HOH 290 1399 1399 HOH HOH A . 
F 4 HOH 291 1400 1400 HOH HOH A . 
F 4 HOH 292 1401 1401 HOH HOH A . 
F 4 HOH 293 1404 1404 HOH HOH A . 
F 4 HOH 294 1405 1405 HOH HOH A . 
F 4 HOH 295 1407 1407 HOH HOH A . 
F 4 HOH 296 1409 1409 HOH HOH A . 
#