data_1A35
# 
_entry.id   1A35 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1A35         pdb_00001a35 10.2210/pdb1a35/pdb 
RCSB  PDE0143      ?            ?                   
WWPDB D_1000170333 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A35 
_pdbx_database_status.recvd_initial_deposition_date   1998-01-29 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Redinbo, M.R.'  1 
'Stewart, L.'    2 
'Kuhn, P.'       3 
'Champoux, J.J.' 4 
'Hol, W.G.'      5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structures of human topoisomerase I in covalent and noncovalent complexes with DNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            279 
_citation.page_first                1504 
_citation.page_last                 1513 
_citation.year                      1998 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9488644 
_citation.pdbx_database_id_DOI      10.1126/science.279.5356.1504 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Redinbo, M.R.'  1 ? 
primary 'Stewart, L.'    2 ? 
primary 'Kuhn, P.'       3 ? 
primary 'Champoux, J.J.' 4 ? 
primary 'Hol, W.G.'      5 ? 
# 
_cell.entry_id           1A35 
_cell.length_a           71.800 
_cell.length_b           66.300 
_cell.length_c           71.800 
_cell.angle_alpha        90.00 
_cell.angle_beta         98.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1A35 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*TP*TP*AP*GP*AP*AP*AP*AP*AP*(BRU)P*(BRU)P*TP*TP*T)-3')
;
6920.208  1   ?        ?     ?                                   ? 
2 polymer syn 
;DNA (5'-D(*AP*AP*AP*AP*AP*TP*+UP*+UP*+UP*+UP*CP*+UP*AP*AP*GP*TP*CP*TP*TP*TP*+ UP*T)-3')
;
7094.593  1   ?        ?     ?                                   ? 
3 polymer man 'PROTEIN (DNA TOPOISOMERASE I)'                                                            70022.859 1   5.99.1.2 
Y723F 'CORE DOMAIN AND C-TERMINAL DOMAIN' ? 
4 water   nat water                                                                                      18.015    273 ?        ? 
?                                   ? 
# 
_entity_name_sys.entity_id   3 
_entity_name_sys.name        E.C.5.99.1.2 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DA)(DA)(DA)(DA)(DA)(DG)(DA)(DC)(DT)(DT)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(BRU)(BRU)
(DT)(DT)(DT)
;
AAAAAGACTTAGAAAAAUUTTT C ? 
2 polydeoxyribonucleotide no yes 
;(DA)(DA)(DA)(DA)(DA)(DT)(BRU)(BRU)(BRU)(BRU)(DC)(BRU)(DA)(DA)(DG)(DT)(DC)(DT)
(DT)(DT)(BRU)(DT)
;
AAAAATUUUUCUAAGTCTTTUT D ? 
3 'polypeptide(L)'        no no  
;KPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAE
EVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKL
LKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLV
SWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILN
KHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAK
KEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWCK
KWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
;KPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAE
EVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKL
LKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLV
SWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKE
EGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILN
KHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAK
KEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNFLDPRITVAWCK
KWGVPIEKIYNKTQREKFAWAIDMADEDYEF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DC  n 
1 9   DT  n 
1 10  DT  n 
1 11  DA  n 
1 12  DG  n 
1 13  DA  n 
1 14  DA  n 
1 15  DA  n 
1 16  DA  n 
1 17  DA  n 
1 18  BRU n 
1 19  BRU n 
1 20  DT  n 
1 21  DT  n 
1 22  DT  n 
2 1   DA  n 
2 2   DA  n 
2 3   DA  n 
2 4   DA  n 
2 5   DA  n 
2 6   DT  n 
2 7   BRU n 
2 8   BRU n 
2 9   BRU n 
2 10  BRU n 
2 11  DC  n 
2 12  BRU n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DC  n 
2 18  DT  n 
2 19  DT  n 
2 20  DT  n 
2 21  BRU n 
2 22  DT  n 
3 1   LYS n 
3 2   PRO n 
3 3   LYS n 
3 4   ASN n 
3 5   LYS n 
3 6   ASP n 
3 7   LYS n 
3 8   ASP n 
3 9   LYS n 
3 10  LYS n 
3 11  VAL n 
3 12  PRO n 
3 13  GLU n 
3 14  PRO n 
3 15  ASP n 
3 16  ASN n 
3 17  LYS n 
3 18  LYS n 
3 19  LYS n 
3 20  LYS n 
3 21  PRO n 
3 22  LYS n 
3 23  LYS n 
3 24  GLU n 
3 25  GLU n 
3 26  GLU n 
3 27  GLN n 
3 28  LYS n 
3 29  TRP n 
3 30  LYS n 
3 31  TRP n 
3 32  TRP n 
3 33  GLU n 
3 34  GLU n 
3 35  GLU n 
3 36  ARG n 
3 37  TYR n 
3 38  PRO n 
3 39  GLU n 
3 40  GLY n 
3 41  ILE n 
3 42  LYS n 
3 43  TRP n 
3 44  LYS n 
3 45  PHE n 
3 46  LEU n 
3 47  GLU n 
3 48  HIS n 
3 49  LYS n 
3 50  GLY n 
3 51  PRO n 
3 52  VAL n 
3 53  PHE n 
3 54  ALA n 
3 55  PRO n 
3 56  PRO n 
3 57  TYR n 
3 58  GLU n 
3 59  PRO n 
3 60  LEU n 
3 61  PRO n 
3 62  GLU n 
3 63  ASN n 
3 64  VAL n 
3 65  LYS n 
3 66  PHE n 
3 67  TYR n 
3 68  TYR n 
3 69  ASP n 
3 70  GLY n 
3 71  LYS n 
3 72  VAL n 
3 73  MET n 
3 74  LYS n 
3 75  LEU n 
3 76  SER n 
3 77  PRO n 
3 78  LYS n 
3 79  ALA n 
3 80  GLU n 
3 81  GLU n 
3 82  VAL n 
3 83  ALA n 
3 84  THR n 
3 85  PHE n 
3 86  PHE n 
3 87  ALA n 
3 88  LYS n 
3 89  MET n 
3 90  LEU n 
3 91  ASP n 
3 92  HIS n 
3 93  GLU n 
3 94  TYR n 
3 95  THR n 
3 96  THR n 
3 97  LYS n 
3 98  GLU n 
3 99  ILE n 
3 100 PHE n 
3 101 ARG n 
3 102 LYS n 
3 103 ASN n 
3 104 PHE n 
3 105 PHE n 
3 106 LYS n 
3 107 ASP n 
3 108 TRP n 
3 109 ARG n 
3 110 LYS n 
3 111 GLU n 
3 112 MET n 
3 113 THR n 
3 114 ASN n 
3 115 GLU n 
3 116 GLU n 
3 117 LYS n 
3 118 ASN n 
3 119 ILE n 
3 120 ILE n 
3 121 THR n 
3 122 ASN n 
3 123 LEU n 
3 124 SER n 
3 125 LYS n 
3 126 CYS n 
3 127 ASP n 
3 128 PHE n 
3 129 THR n 
3 130 GLN n 
3 131 MET n 
3 132 SER n 
3 133 GLN n 
3 134 TYR n 
3 135 PHE n 
3 136 LYS n 
3 137 ALA n 
3 138 GLN n 
3 139 THR n 
3 140 GLU n 
3 141 ALA n 
3 142 ARG n 
3 143 LYS n 
3 144 GLN n 
3 145 MET n 
3 146 SER n 
3 147 LYS n 
3 148 GLU n 
3 149 GLU n 
3 150 LYS n 
3 151 LEU n 
3 152 LYS n 
3 153 ILE n 
3 154 LYS n 
3 155 GLU n 
3 156 GLU n 
3 157 ASN n 
3 158 GLU n 
3 159 LYS n 
3 160 LEU n 
3 161 LEU n 
3 162 LYS n 
3 163 GLU n 
3 164 TYR n 
3 165 GLY n 
3 166 PHE n 
3 167 CYS n 
3 168 ILE n 
3 169 MET n 
3 170 ASP n 
3 171 ASN n 
3 172 HIS n 
3 173 LYS n 
3 174 GLU n 
3 175 ARG n 
3 176 ILE n 
3 177 ALA n 
3 178 ASN n 
3 179 PHE n 
3 180 LYS n 
3 181 ILE n 
3 182 GLU n 
3 183 PRO n 
3 184 PRO n 
3 185 GLY n 
3 186 LEU n 
3 187 PHE n 
3 188 ARG n 
3 189 GLY n 
3 190 ARG n 
3 191 GLY n 
3 192 ASN n 
3 193 HIS n 
3 194 PRO n 
3 195 LYS n 
3 196 MET n 
3 197 GLY n 
3 198 MET n 
3 199 LEU n 
3 200 LYS n 
3 201 ARG n 
3 202 ARG n 
3 203 ILE n 
3 204 MET n 
3 205 PRO n 
3 206 GLU n 
3 207 ASP n 
3 208 ILE n 
3 209 ILE n 
3 210 ILE n 
3 211 ASN n 
3 212 CYS n 
3 213 SER n 
3 214 LYS n 
3 215 ASP n 
3 216 ALA n 
3 217 LYS n 
3 218 VAL n 
3 219 PRO n 
3 220 SER n 
3 221 PRO n 
3 222 PRO n 
3 223 PRO n 
3 224 GLY n 
3 225 HIS n 
3 226 LYS n 
3 227 TRP n 
3 228 LYS n 
3 229 GLU n 
3 230 VAL n 
3 231 ARG n 
3 232 HIS n 
3 233 ASP n 
3 234 ASN n 
3 235 LYS n 
3 236 VAL n 
3 237 THR n 
3 238 TRP n 
3 239 LEU n 
3 240 VAL n 
3 241 SER n 
3 242 TRP n 
3 243 THR n 
3 244 GLU n 
3 245 ASN n 
3 246 ILE n 
3 247 GLN n 
3 248 GLY n 
3 249 SER n 
3 250 ILE n 
3 251 LYS n 
3 252 TYR n 
3 253 ILE n 
3 254 MET n 
3 255 LEU n 
3 256 ASN n 
3 257 PRO n 
3 258 SER n 
3 259 SER n 
3 260 ARG n 
3 261 ILE n 
3 262 LYS n 
3 263 GLY n 
3 264 GLU n 
3 265 LYS n 
3 266 ASP n 
3 267 TRP n 
3 268 GLN n 
3 269 LYS n 
3 270 TYR n 
3 271 GLU n 
3 272 THR n 
3 273 ALA n 
3 274 ARG n 
3 275 ARG n 
3 276 LEU n 
3 277 LYS n 
3 278 LYS n 
3 279 CYS n 
3 280 VAL n 
3 281 ASP n 
3 282 LYS n 
3 283 ILE n 
3 284 ARG n 
3 285 ASN n 
3 286 GLN n 
3 287 TYR n 
3 288 ARG n 
3 289 GLU n 
3 290 ASP n 
3 291 TRP n 
3 292 LYS n 
3 293 SER n 
3 294 LYS n 
3 295 GLU n 
3 296 MET n 
3 297 LYS n 
3 298 VAL n 
3 299 ARG n 
3 300 GLN n 
3 301 ARG n 
3 302 ALA n 
3 303 VAL n 
3 304 ALA n 
3 305 LEU n 
3 306 TYR n 
3 307 PHE n 
3 308 ILE n 
3 309 ASP n 
3 310 LYS n 
3 311 LEU n 
3 312 ALA n 
3 313 LEU n 
3 314 ARG n 
3 315 ALA n 
3 316 GLY n 
3 317 ASN n 
3 318 GLU n 
3 319 LYS n 
3 320 GLU n 
3 321 GLU n 
3 322 GLY n 
3 323 GLU n 
3 324 THR n 
3 325 ALA n 
3 326 ASP n 
3 327 THR n 
3 328 VAL n 
3 329 GLY n 
3 330 CYS n 
3 331 CYS n 
3 332 SER n 
3 333 LEU n 
3 334 ARG n 
3 335 VAL n 
3 336 GLU n 
3 337 HIS n 
3 338 ILE n 
3 339 ASN n 
3 340 LEU n 
3 341 HIS n 
3 342 PRO n 
3 343 GLU n 
3 344 LEU n 
3 345 ASP n 
3 346 GLY n 
3 347 GLN n 
3 348 GLU n 
3 349 TYR n 
3 350 VAL n 
3 351 VAL n 
3 352 GLU n 
3 353 PHE n 
3 354 ASP n 
3 355 PHE n 
3 356 LEU n 
3 357 GLY n 
3 358 LYS n 
3 359 ASP n 
3 360 SER n 
3 361 ILE n 
3 362 ARG n 
3 363 TYR n 
3 364 TYR n 
3 365 ASN n 
3 366 LYS n 
3 367 VAL n 
3 368 PRO n 
3 369 VAL n 
3 370 GLU n 
3 371 LYS n 
3 372 ARG n 
3 373 VAL n 
3 374 PHE n 
3 375 LYS n 
3 376 ASN n 
3 377 LEU n 
3 378 GLN n 
3 379 LEU n 
3 380 PHE n 
3 381 MET n 
3 382 GLU n 
3 383 ASN n 
3 384 LYS n 
3 385 GLN n 
3 386 PRO n 
3 387 GLU n 
3 388 ASP n 
3 389 ASP n 
3 390 LEU n 
3 391 PHE n 
3 392 ASP n 
3 393 ARG n 
3 394 LEU n 
3 395 ASN n 
3 396 THR n 
3 397 GLY n 
3 398 ILE n 
3 399 LEU n 
3 400 ASN n 
3 401 LYS n 
3 402 HIS n 
3 403 LEU n 
3 404 GLN n 
3 405 ASP n 
3 406 LEU n 
3 407 MET n 
3 408 GLU n 
3 409 GLY n 
3 410 LEU n 
3 411 THR n 
3 412 ALA n 
3 413 LYS n 
3 414 VAL n 
3 415 PHE n 
3 416 ARG n 
3 417 THR n 
3 418 TYR n 
3 419 ASN n 
3 420 ALA n 
3 421 SER n 
3 422 ILE n 
3 423 THR n 
3 424 LEU n 
3 425 GLN n 
3 426 GLN n 
3 427 GLN n 
3 428 LEU n 
3 429 LYS n 
3 430 GLU n 
3 431 LEU n 
3 432 THR n 
3 433 ALA n 
3 434 PRO n 
3 435 ASP n 
3 436 GLU n 
3 437 ASN n 
3 438 ILE n 
3 439 PRO n 
3 440 ALA n 
3 441 LYS n 
3 442 ILE n 
3 443 LEU n 
3 444 SER n 
3 445 TYR n 
3 446 ASN n 
3 447 ARG n 
3 448 ALA n 
3 449 ASN n 
3 450 ARG n 
3 451 ALA n 
3 452 VAL n 
3 453 ALA n 
3 454 ILE n 
3 455 LEU n 
3 456 CYS n 
3 457 ASN n 
3 458 HIS n 
3 459 GLN n 
3 460 ARG n 
3 461 ALA n 
3 462 PRO n 
3 463 PRO n 
3 464 LYS n 
3 465 THR n 
3 466 PHE n 
3 467 GLU n 
3 468 LYS n 
3 469 SER n 
3 470 MET n 
3 471 MET n 
3 472 ASN n 
3 473 LEU n 
3 474 GLN n 
3 475 THR n 
3 476 LYS n 
3 477 ILE n 
3 478 ASP n 
3 479 ALA n 
3 480 LYS n 
3 481 LYS n 
3 482 GLU n 
3 483 GLN n 
3 484 LEU n 
3 485 ALA n 
3 486 ASP n 
3 487 ALA n 
3 488 ARG n 
3 489 ARG n 
3 490 ASP n 
3 491 LEU n 
3 492 LYS n 
3 493 SER n 
3 494 ALA n 
3 495 LYS n 
3 496 ALA n 
3 497 ASP n 
3 498 ALA n 
3 499 LYS n 
3 500 VAL n 
3 501 MET n 
3 502 LYS n 
3 503 ASP n 
3 504 ALA n 
3 505 LYS n 
3 506 THR n 
3 507 LYS n 
3 508 LYS n 
3 509 VAL n 
3 510 VAL n 
3 511 GLU n 
3 512 SER n 
3 513 LYS n 
3 514 LYS n 
3 515 LYS n 
3 516 ALA n 
3 517 VAL n 
3 518 GLN n 
3 519 ARG n 
3 520 LEU n 
3 521 GLU n 
3 522 GLU n 
3 523 GLN n 
3 524 LEU n 
3 525 MET n 
3 526 LYS n 
3 527 LEU n 
3 528 GLU n 
3 529 VAL n 
3 530 GLN n 
3 531 ALA n 
3 532 THR n 
3 533 ASP n 
3 534 ARG n 
3 535 GLU n 
3 536 GLU n 
3 537 ASN n 
3 538 LYS n 
3 539 GLN n 
3 540 ILE n 
3 541 ALA n 
3 542 LEU n 
3 543 GLY n 
3 544 THR n 
3 545 SER n 
3 546 LYS n 
3 547 LEU n 
3 548 ASN n 
3 549 PHE n 
3 550 LEU n 
3 551 ASP n 
3 552 PRO n 
3 553 ARG n 
3 554 ILE n 
3 555 THR n 
3 556 VAL n 
3 557 ALA n 
3 558 TRP n 
3 559 CYS n 
3 560 LYS n 
3 561 LYS n 
3 562 TRP n 
3 563 GLY n 
3 564 VAL n 
3 565 PRO n 
3 566 ILE n 
3 567 GLU n 
3 568 LYS n 
3 569 ILE n 
3 570 TYR n 
3 571 ASN n 
3 572 LYS n 
3 573 THR n 
3 574 GLN n 
3 575 ARG n 
3 576 GLU n 
3 577 LYS n 
3 578 PHE n 
3 579 ALA n 
3 580 TRP n 
3 581 ALA n 
3 582 ILE n 
3 583 ASP n 
3 584 MET n 
3 585 ALA n 
3 586 ASP n 
3 587 GLU n 
3 588 ASP n 
3 589 TYR n 
3 590 GLU n 
3 591 PHE n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEUS 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP TOP1_HUMAN 3 P11387 ? ? ? 
2 PDB 1A35       1 1A35   ? ? ? 
3 PDB 1A35       2 1A35   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A35 A 1 ? 591 ? P11387 175 ? 765 ? 175 765 
2 2 1A35 C 1 ? 22  ? 1A35   1   ? 22  ? 1   22  
3 3 1A35 D 1 ? 22  ? 1A35   101 ? 122 ? 101 122 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1A35 
_struct_ref_seq_dif.mon_id                       PHE 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      549 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P11387 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          723 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            723 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O8 P' 387.078 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1A35 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.01 
_exptl_crystal.density_percent_sol   38.91 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            295.00 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.70 
_exptl_crystal_grow.pdbx_details    'pH 7.70, VAPOR DIFFUSION, SITTING DROP, temperature 295.00K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1  1 TRIS-HCL  ? ? ? 
1 2  1 EDTA      ? ? ? 
1 3  1 DTT       ? ? ? 
1 4  1 MGCL2     ? ? ? 
1 5  1 'PEG 400' ? ? ? 
1 6  2 TRIS-HCL  ? ? ? 
1 7  2 MGCL2     ? ? ? 
1 8  2 DTT       ? ? ? 
1 9  2 'PEG 400' ? ? ? 
1 10 3 TRIS-HCL  ? ? ? 
1 11 3 MGCL2     ? ? ? 
1 12 3 'PEG 400' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1996-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A35 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.000 
_reflns.d_resolution_high            2.500 
_reflns.number_obs                   18834 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         83.900 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.200 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.500 
_reflns_shell.d_res_low              2.600 
_reflns_shell.percent_possible_all   87.70 
_reflns_shell.Rmerge_I_obs           0.269 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.200 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1A35 
_refine.ls_number_reflns_obs                     20807 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               10000000.000 
_refine.pdbx_data_cutoff_low_absF                0.0010 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.000 
_refine.ls_d_res_high                            2.500 
_refine.ls_percent_reflns_obs                    87.000 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.308 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.000 
_refine.ls_number_reflns_R_free                  1467 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -2.350 
_refine.aniso_B[2][2]                            4.7060 
_refine.aniso_B[3][3]                            -2.350 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.7530 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      
'RECONSTITUTED HUMAN TOPOISOMERASE I COVALENT COMPLEX WITH 22 BASE PAIR DUPLEX DNA' 
_refine.pdbx_method_to_determine_struct          'RIGID BODY REFINEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3778 
_refine_hist.pdbx_number_atoms_nucleic_acid   888 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               4947 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        20.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.47  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      22.3  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.46  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.59 
_refine_ls_shell.number_reflns_R_work             1261 
_refine_ls_shell.R_factor_R_work                  0.315 
_refine_ls_shell.percent_reflns_obs               55.40 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            6.00 
_refine_ls_shell.number_reflns_R_free             81 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO   TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM_NDBX.DNA TOP_NDBX.DNA 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1A35 
_struct.title                     'HUMAN TOPOISOMERASE I/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A35 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA 
_struct_keywords.text            'TOPOISOMERASE I/DNA), DNA, TOPOISOMERASE I, ISOMERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO C 77  ? MET C 89  ? PRO A 251 MET A 263 1 ? 13 
HELX_P HELX_P2  2  GLU C 93  ? THR C 95  ? GLU A 267 THR A 269 5 ? 3  
HELX_P HELX_P3  3  GLU C 98  ? GLU C 111 ? GLU A 272 GLU A 285 1 ? 14 
HELX_P HELX_P4  4  GLU C 116 ? ILE C 119 ? GLU A 290 ILE A 293 1 ? 4  
HELX_P HELX_P5  5  THR C 129 ? LYS C 143 ? THR A 303 LYS A 317 1 ? 15 
HELX_P HELX_P6  6  LYS C 147 ? TYR C 164 ? LYS A 321 TYR A 338 1 ? 18 
HELX_P HELX_P7  7  PRO C 205 ? ASP C 207 ? PRO A 379 ASP A 381 5 ? 3  
HELX_P HELX_P8  8  ARG C 260 ? ASP C 290 ? ARG A 434 ASP A 464 1 ? 31 
HELX_P HELX_P9  9  VAL C 298 ? LEU C 311 ? VAL A 472 LEU A 485 1 ? 14 
HELX_P HELX_P10 10 VAL C 335 ? HIS C 337 ? VAL A 509 HIS A 511 5 ? 3  
HELX_P HELX_P11 11 LYS C 358 ? SER C 360 ? LYS A 532 SER A 534 5 ? 3  
HELX_P HELX_P12 12 LYS C 371 ? MET C 381 ? LYS A 545 MET A 555 1 ? 11 
HELX_P HELX_P13 13 THR C 396 ? LEU C 406 ? THR A 570 LEU A 580 1 ? 11 
HELX_P HELX_P14 14 ALA C 412 ? GLU C 430 ? ALA A 586 GLU A 604 1 ? 19 
HELX_P HELX_P15 15 ILE C 438 ? LEU C 455 ? ILE A 612 LEU A 629 1 ? 18 
HELX_P HELX_P16 16 PRO C 552 ? LYS C 561 ? PRO A 726 LYS A 735 1 ? 10 
HELX_P HELX_P17 17 ILE C 566 ? LYS C 568 ? ILE A 740 LYS A 742 5 ? 3  
HELX_P HELX_P18 18 LYS C 572 ? MET C 584 ? LYS A 746 MET A 758 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? A DA  17 "O3'" ? ? ? 1_555 A BRU 18 P  ? ? C DA  17  C BRU 18  1_555 ? ? ? ? ? ? ?            1.600 ? ? 
covale2  covale both ? A BRU 18 "O3'" ? ? ? 1_555 A BRU 19 P  ? ? C BRU 18  C BRU 19  1_555 ? ? ? ? ? ? ?            1.595 ? ? 
covale3  covale both ? A BRU 19 "O3'" ? ? ? 1_555 A DT  20 P  ? ? C BRU 19  C DT  20  1_555 ? ? ? ? ? ? ?            1.592 ? ? 
covale4  covale both ? B DT  6  "O3'" ? ? ? 1_555 B BRU 7  P  ? ? D DT  106 D BRU 107 1_555 ? ? ? ? ? ? ?            1.618 ? ? 
covale5  covale both ? B BRU 7  "O3'" ? ? ? 1_555 B BRU 8  P  ? ? D BRU 107 D BRU 108 1_555 ? ? ? ? ? ? ?            1.597 ? ? 
covale6  covale both ? B BRU 8  "O3'" ? ? ? 1_555 B BRU 9  P  ? ? D BRU 108 D BRU 109 1_555 ? ? ? ? ? ? ?            1.594 ? ? 
covale7  covale both ? B BRU 9  "O3'" ? ? ? 1_555 B BRU 10 P  ? ? D BRU 109 D BRU 110 1_555 ? ? ? ? ? ? ?            1.608 ? ? 
covale8  covale both ? B BRU 10 "O3'" ? ? ? 1_555 B DC  11 P  ? ? D BRU 110 D DC  111 1_555 ? ? ? ? ? ? ?            1.615 ? ? 
covale9  covale both ? B DC  11 "O3'" ? ? ? 1_555 B BRU 12 P  ? ? D DC  111 D BRU 112 1_555 ? ? ? ? ? ? ?            1.619 ? ? 
covale10 covale both ? B BRU 12 "O3'" ? ? ? 1_555 B DA  13 P  ? ? D BRU 112 D DA  113 1_555 ? ? ? ? ? ? ?            1.604 ? ? 
covale11 covale both ? B DT  20 "O3'" ? ? ? 1_555 B BRU 21 P  ? ? D DT  120 D BRU 121 1_555 ? ? ? ? ? ? ?            1.611 ? ? 
covale12 covale both ? B BRU 21 "O3'" ? ? ? 1_555 B DT  22 P  ? ? D BRU 121 D DT  122 1_555 ? ? ? ? ? ? ?            1.607 ? ? 
hydrog1  hydrog ?    ? A DA  1  N1    ? ? ? 1_555 B DT  22 N3 ? ? C DA  1   D DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ?    ? A DA  1  N6    ? ? ? 1_555 B DT  22 O4 ? ? C DA  1   D DT  122 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ?    ? A DA  2  N1    ? ? ? 1_555 B BRU 21 N3 ? ? C DA  2   D BRU 121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ?    ? A DA  2  N6    ? ? ? 1_555 B BRU 21 O4 ? ? C DA  2   D BRU 121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ?    ? A DA  3  N1    ? ? ? 1_555 B DT  20 N3 ? ? C DA  3   D DT  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ?    ? A DA  3  N6    ? ? ? 1_555 B DT  20 O4 ? ? C DA  3   D DT  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ?    ? A DA  4  N1    ? ? ? 1_555 B DT  19 N3 ? ? C DA  4   D DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ?    ? A DA  4  N6    ? ? ? 1_555 B DT  19 O4 ? ? C DA  4   D DT  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ?    ? A DA  5  N1    ? ? ? 1_555 B DT  18 N3 ? ? C DA  5   D DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ?    ? A DA  5  N6    ? ? ? 1_555 B DT  18 O4 ? ? C DA  5   D DT  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ?    ? A DG  6  N1    ? ? ? 1_555 B DC  17 N3 ? ? C DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ?    ? A DG  6  N2    ? ? ? 1_555 B DC  17 O2 ? ? C DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ?    ? A DG  6  O6    ? ? ? 1_555 B DC  17 N4 ? ? C DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ?    ? A DA  7  N1    ? ? ? 1_555 B DT  16 N3 ? ? C DA  7   D DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ?    ? A DA  7  N6    ? ? ? 1_555 B DT  16 O4 ? ? C DA  7   D DT  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ?    ? A DC  8  N3    ? ? ? 1_555 B DG  15 N1 ? ? C DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ?    ? A DC  8  N4    ? ? ? 1_555 B DG  15 O6 ? ? C DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ?    ? A DC  8  O2    ? ? ? 1_555 B DG  15 N2 ? ? C DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ?    ? A DT  9  N3    ? ? ? 1_555 B DA  14 N1 ? ? C DT  9   D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ?    ? A DT  9  O4    ? ? ? 1_555 B DA  14 N6 ? ? C DT  9   D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ?    ? A DT  10 N3    ? ? ? 1_555 B DA  13 N1 ? ? C DT  10  D DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ?    ? A DT  10 O4    ? ? ? 1_555 B DA  13 N6 ? ? C DT  10  D DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ?    ? A DA  11 N1    ? ? ? 1_555 B BRU 12 N3 ? ? C DA  11  D BRU 112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ?    ? A DA  11 N6    ? ? ? 1_555 B BRU 12 O4 ? ? C DA  11  D BRU 112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ?    ? A DG  12 N1    ? ? ? 1_555 B DC  11 N3 ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ?    ? A DG  12 N2    ? ? ? 1_555 B DC  11 O2 ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ?    ? A DG  12 O6    ? ? ? 1_555 B DC  11 N4 ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ?    ? A DA  13 N1    ? ? ? 1_555 B BRU 10 N3 ? ? C DA  13  D BRU 110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ?    ? A DA  13 N6    ? ? ? 1_555 B BRU 10 O4 ? ? C DA  13  D BRU 110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ?    ? A DA  14 N1    ? ? ? 1_555 B BRU 9  N3 ? ? C DA  14  D BRU 109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ?    ? A DA  14 N6    ? ? ? 1_555 B BRU 9  O4 ? ? C DA  14  D BRU 109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ?    ? A DA  15 N1    ? ? ? 1_555 B BRU 8  N3 ? ? C DA  15  D BRU 108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ?    ? A DA  15 N6    ? ? ? 1_555 B BRU 8  O4 ? ? C DA  15  D BRU 108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ?    ? A DA  16 N1    ? ? ? 1_555 B BRU 7  N3 ? ? C DA  16  D BRU 107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ?    ? A DA  16 N6    ? ? ? 1_555 B BRU 7  O4 ? ? C DA  16  D BRU 107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ?    ? A DA  17 N1    ? ? ? 1_555 B DT  6  N3 ? ? C DA  17  D DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ?    ? A DA  17 N6    ? ? ? 1_555 B DT  6  O4 ? ? C DA  17  D DT  106 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ?    ? A BRU 18 N3    ? ? ? 1_555 B DA  5  N1 ? ? C BRU 18  D DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ?    ? A BRU 18 O4    ? ? ? 1_555 B DA  5  N6 ? ? C BRU 18  D DA  105 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ?    ? A BRU 19 N3    ? ? ? 1_555 B DA  4  N1 ? ? C BRU 19  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ?    ? A BRU 19 O4    ? ? ? 1_555 B DA  4  N6 ? ? C BRU 19  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ?    ? A DT  20 N3    ? ? ? 1_555 B DA  3  N1 ? ? C DT  20  D DA  103 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ?     ? ? 
hydrog43 hydrog ?    ? A DT  21 N3    ? ? ? 1_555 B DA  2  N1 ? ? C DT  21  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ?    ? A DT  21 O4    ? ? ? 1_555 B DA  2  N6 ? ? C DT  21  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ?    ? A DT  22 N3    ? ? ? 1_555 B DA  1  N1 ? ? C DT  22  D DA  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ?    ? A DT  22 O4    ? ? ? 1_555 B DA  1  N6 ? ? C DT  22  D DA  101 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
D ? 4 ? 
E ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU C 46  ? HIS C 48  ? LEU A 220 HIS A 222 
A 2 PHE C 166 ? MET C 169 ? PHE A 340 MET A 343 
A 3 HIS C 172 ? ARG C 175 ? HIS A 346 ARG A 349 
B 1 LYS C 71  ? VAL C 72  ? LYS A 245 VAL A 246 
B 2 TYR C 67  ? TYR C 68  ? TYR A 241 TYR A 242 
B 3 CYS C 126 ? ASP C 127 ? CYS A 300 ASP A 301 
C 1 GLY C 185 ? LEU C 186 ? GLY A 359 LEU A 360 
C 2 LEU C 199 ? LYS C 200 ? LEU A 373 LYS A 374 
D 1 GLU C 229 ? ARG C 231 ? GLU A 403 ARG A 405 
D 2 ILE C 209 ? ASN C 211 ? ILE A 383 ASN A 385 
D 3 VAL C 240 ? THR C 243 ? VAL A 414 THR A 417 
D 4 ILE C 250 ? ILE C 253 ? ILE A 424 ILE A 427 
E 1 ILE C 338 ? LEU C 344 ? ILE A 512 LEU A 518 
E 2 GLN C 347 ? LEU C 356 ? GLN A 521 LEU A 530 
E 3 ARG C 362 ? PRO C 368 ? ARG A 536 PRO A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU C 47  ? N GLU A 221 O ILE C 168 ? O ILE A 342 
A 2 3 N MET C 169 ? N MET A 343 O HIS C 172 ? O HIS A 346 
B 1 2 O LYS C 71  ? O LYS A 245 N TYR C 68  ? N TYR A 242 
B 2 3 O TYR C 67  ? O TYR A 241 N ASP C 127 ? N ASP A 301 
C 1 2 O GLY C 185 ? O GLY A 359 N LYS C 200 ? N LYS A 374 
D 1 2 N ARG C 231 ? N ARG A 405 O ILE C 210 ? O ILE A 384 
D 2 3 N ILE C 209 ? N ILE A 383 O SER C 241 ? O SER A 415 
D 3 4 O TRP C 242 ? O TRP A 416 N LYS C 251 ? N LYS A 425 
E 1 2 N LEU C 344 ? N LEU A 518 O GLN C 347 ? O GLN A 521 
E 2 3 O PHE C 355 ? O PHE A 529 N TYR C 363 ? N TYR A 537 
# 
_database_PDB_matrix.entry_id          1A35 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A35 
_atom_sites.fract_transf_matrix[1][1]   0.013928 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002057 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015083 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014079 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O  "O5'" . DA  A 1 1   ? 10.933  5.402   46.896  1.00 76.34 ? 1    DA  C "O5'" 1 
ATOM   2    C  "C5'" . DA  A 1 1   ? 10.834  6.116   48.158  1.00 76.59 ? 1    DA  C "C5'" 1 
ATOM   3    C  "C4'" . DA  A 1 1   ? 12.016  7.042   48.312  1.00 72.05 ? 1    DA  C "C4'" 1 
ATOM   4    O  "O4'" . DA  A 1 1   ? 13.183  6.282   48.708  1.00 68.74 ? 1    DA  C "O4'" 1 
ATOM   5    C  "C3'" . DA  A 1 1   ? 12.382  7.689   46.989  1.00 71.35 ? 1    DA  C "C3'" 1 
ATOM   6    O  "O3'" . DA  A 1 1   ? 12.932  8.985   47.200  1.00 74.25 ? 1    DA  C "O3'" 1 
ATOM   7    C  "C2'" . DA  A 1 1   ? 13.390  6.719   46.392  1.00 67.89 ? 1    DA  C "C2'" 1 
ATOM   8    C  "C1'" . DA  A 1 1   ? 14.084  6.132   47.613  1.00 61.34 ? 1    DA  C "C1'" 1 
ATOM   9    N  N9    . DA  A 1 1   ? 14.414  4.707   47.516  1.00 48.95 ? 1    DA  C N9    1 
ATOM   10   C  C8    . DA  A 1 1   ? 13.593  3.662   47.148  1.00 43.13 ? 1    DA  C C8    1 
ATOM   11   N  N7    . DA  A 1 1   ? 14.162  2.483   47.253  1.00 38.39 ? 1    DA  C N7    1 
ATOM   12   C  C5    . DA  A 1 1   ? 15.446  2.774   47.701  1.00 41.20 ? 1    DA  C C5    1 
ATOM   13   C  C6    . DA  A 1 1   ? 16.549  1.955   48.027  1.00 44.84 ? 1    DA  C C6    1 
ATOM   14   N  N6    . DA  A 1 1   ? 16.518  0.621   47.985  1.00 45.83 ? 1    DA  C N6    1 
ATOM   15   N  N1    . DA  A 1 1   ? 17.694  2.565   48.415  1.00 39.94 ? 1    DA  C N1    1 
ATOM   16   C  C2    . DA  A 1 1   ? 17.714  3.903   48.489  1.00 43.85 ? 1    DA  C C2    1 
ATOM   17   N  N3    . DA  A 1 1   ? 16.739  4.780   48.229  1.00 42.10 ? 1    DA  C N3    1 
ATOM   18   C  C4    . DA  A 1 1   ? 15.622  4.141   47.836  1.00 44.15 ? 1    DA  C C4    1 
ATOM   19   P  P     . DA  A 1 2   ? 13.364  9.859   45.931  1.00 78.44 ? 2    DA  C P     1 
ATOM   20   O  OP1   . DA  A 1 2   ? 13.693  11.253  46.371  1.00 78.22 ? 2    DA  C OP1   1 
ATOM   21   O  OP2   . DA  A 1 2   ? 12.325  9.643   44.881  1.00 78.37 ? 2    DA  C OP2   1 
ATOM   22   O  "O5'" . DA  A 1 2   ? 14.706  9.147   45.440  1.00 75.25 ? 2    DA  C "O5'" 1 
ATOM   23   C  "C5'" . DA  A 1 2   ? 15.967  9.424   46.083  1.00 70.48 ? 2    DA  C "C5'" 1 
ATOM   24   C  "C4'" . DA  A 1 2   ? 17.109  8.777   45.329  1.00 65.24 ? 2    DA  C "C4'" 1 
ATOM   25   O  "O4'" . DA  A 1 2   ? 17.133  7.342   45.520  1.00 61.34 ? 2    DA  C "O4'" 1 
ATOM   26   C  "C3'" . DA  A 1 2   ? 17.147  8.995   43.815  1.00 63.14 ? 2    DA  C "C3'" 1 
ATOM   27   O  "O3'" . DA  A 1 2   ? 18.517  9.175   43.451  1.00 68.00 ? 2    DA  C "O3'" 1 
ATOM   28   C  "C2'" . DA  A 1 2   ? 16.630  7.672   43.269  1.00 55.89 ? 2    DA  C "C2'" 1 
ATOM   29   C  "C1'" . DA  A 1 2   ? 17.260  6.715   44.254  1.00 51.37 ? 2    DA  C "C1'" 1 
ATOM   30   N  N9    . DA  A 1 2   ? 16.664  5.383   44.342  1.00 38.23 ? 2    DA  C N9    1 
ATOM   31   C  C8    . DA  A 1 2   ? 15.378  5.000   44.072  1.00 35.96 ? 2    DA  C C8    1 
ATOM   32   N  N7    . DA  A 1 2   ? 15.176  3.712   44.205  1.00 33.45 ? 2    DA  C N7    1 
ATOM   33   C  C5    . DA  A 1 2   ? 16.407  3.215   44.600  1.00 23.06 ? 2    DA  C C5    1 
ATOM   34   C  C6    . DA  A 1 2   ? 16.851  1.913   44.889  1.00 20.56 ? 2    DA  C C6    1 
ATOM   35   N  N6    . DA  A 1 2   ? 16.063  0.832   44.853  1.00 14.51 ? 2    DA  C N6    1 
ATOM   36   N  N1    . DA  A 1 2   ? 18.149  1.757   45.228  1.00 19.38 ? 2    DA  C N1    1 
ATOM   37   C  C2    . DA  A 1 2   ? 18.932  2.841   45.287  1.00 25.21 ? 2    DA  C C2    1 
ATOM   38   N  N3    . DA  A 1 2   ? 18.627  4.115   45.053  1.00 26.40 ? 2    DA  C N3    1 
ATOM   39   C  C4    . DA  A 1 2   ? 17.330  4.233   44.701  1.00 28.08 ? 2    DA  C C4    1 
ATOM   40   P  P     . DA  A 1 3   ? 18.917  9.448   41.921  1.00 70.20 ? 3    DA  C P     1 
ATOM   41   O  OP1   . DA  A 1 3   ? 19.029  10.920  41.735  1.00 72.32 ? 3    DA  C OP1   1 
ATOM   42   O  OP2   . DA  A 1 3   ? 18.010  8.661   41.044  1.00 77.26 ? 3    DA  C OP2   1 
ATOM   43   O  "O5'" . DA  A 1 3   ? 20.368  8.815   41.821  1.00 65.69 ? 3    DA  C "O5'" 1 
ATOM   44   C  "C5'" . DA  A 1 3   ? 21.233  8.823   42.964  1.00 61.31 ? 3    DA  C "C5'" 1 
ATOM   45   C  "C4'" . DA  A 1 3   ? 22.202  7.669   42.894  1.00 55.55 ? 3    DA  C "C4'" 1 
ATOM   46   O  "O4'" . DA  A 1 3   ? 21.511  6.423   43.137  1.00 53.11 ? 3    DA  C "O4'" 1 
ATOM   47   C  "C3'" . DA  A 1 3   ? 22.872  7.520   41.537  1.00 53.63 ? 3    DA  C "C3'" 1 
ATOM   48   O  "O3'" . DA  A 1 3   ? 24.236  7.172   41.740  1.00 56.36 ? 3    DA  C "O3'" 1 
ATOM   49   C  "C2'" . DA  A 1 3   ? 22.077  6.416   40.860  1.00 46.87 ? 3    DA  C "C2'" 1 
ATOM   50   C  "C1'" . DA  A 1 3   ? 21.632  5.547   42.029  1.00 44.76 ? 3    DA  C "C1'" 1 
ATOM   51   N  N9    . DA  A 1 3   ? 20.339  4.872   41.854  1.00 35.48 ? 3    DA  C N9    1 
ATOM   52   C  C8    . DA  A 1 3   ? 19.134  5.456   41.539  1.00 32.25 ? 3    DA  C C8    1 
ATOM   53   N  N7    . DA  A 1 3   ? 18.138  4.599   41.430  1.00 29.37 ? 3    DA  C N7    1 
ATOM   54   C  C5    . DA  A 1 3   ? 18.727  3.371   41.688  1.00 23.22 ? 3    DA  C C5    1 
ATOM   55   C  C6    . DA  A 1 3   ? 18.206  2.068   41.709  1.00 24.72 ? 3    DA  C C6    1 
ATOM   56   N  N6    . DA  A 1 3   ? 16.914  1.782   41.502  1.00 19.30 ? 3    DA  C N6    1 
ATOM   57   N  N1    . DA  A 1 3   ? 19.064  1.057   41.973  1.00 23.45 ? 3    DA  C N1    1 
ATOM   58   C  C2    . DA  A 1 3   ? 20.350  1.354   42.235  1.00 22.18 ? 3    DA  C C2    1 
ATOM   59   N  N3    . DA  A 1 3   ? 20.951  2.540   42.266  1.00 26.47 ? 3    DA  C N3    1 
ATOM   60   C  C4    . DA  A 1 3   ? 20.079  3.520   41.965  1.00 27.14 ? 3    DA  C C4    1 
ATOM   61   P  P     . DA  A 1 4   ? 25.204  7.003   40.475  1.00 60.22 ? 4    DA  C P     1 
ATOM   62   O  OP1   . DA  A 1 4   ? 26.540  7.462   40.893  1.00 61.05 ? 4    DA  C OP1   1 
ATOM   63   O  OP2   . DA  A 1 4   ? 24.542  7.585   39.263  1.00 62.05 ? 4    DA  C OP2   1 
ATOM   64   O  "O5'" . DA  A 1 4   ? 25.272  5.435   40.331  1.00 54.94 ? 4    DA  C "O5'" 1 
ATOM   65   C  "C5'" . DA  A 1 4   ? 25.403  4.650   41.496  1.00 47.63 ? 4    DA  C "C5'" 1 
ATOM   66   C  "C4'" . DA  A 1 4   ? 25.474  3.200   41.115  1.00 45.79 ? 4    DA  C "C4'" 1 
ATOM   67   O  "O4'" . DA  A 1 4   ? 24.147  2.672   40.908  1.00 39.76 ? 4    DA  C "O4'" 1 
ATOM   68   C  "C3'" . DA  A 1 4   ? 26.251  2.977   39.822  1.00 43.11 ? 4    DA  C "C3'" 1 
ATOM   69   O  "O3'" . DA  A 1 4   ? 27.182  1.910   40.035  1.00 45.56 ? 4    DA  C "O3'" 1 
ATOM   70   C  "C2'" . DA  A 1 4   ? 25.162  2.700   38.795  1.00 36.20 ? 4    DA  C "C2'" 1 
ATOM   71   C  "C1'" . DA  A 1 4   ? 24.018  2.125   39.617  1.00 32.84 ? 4    DA  C "C1'" 1 
ATOM   72   N  N9    . DA  A 1 4   ? 22.687  2.484   39.152  1.00 30.13 ? 4    DA  C N9    1 
ATOM   73   C  C8    . DA  A 1 4   ? 22.251  3.697   38.715  1.00 23.86 ? 4    DA  C C8    1 
ATOM   74   N  N7    . DA  A 1 4   ? 20.975  3.725   38.434  1.00 24.91 ? 4    DA  C N7    1 
ATOM   75   C  C5    . DA  A 1 4   ? 20.540  2.437   38.690  1.00 20.54 ? 4    DA  C C5    1 
ATOM   76   C  C6    . DA  A 1 4   ? 19.286  1.814   38.583  1.00 18.41 ? 4    DA  C C6    1 
ATOM   77   N  N6    . DA  A 1 4   ? 18.164  2.427   38.233  1.00 24.27 ? 4    DA  C N6    1 
ATOM   78   N  N1    . DA  A 1 4   ? 19.215  0.510   38.876  1.00 21.14 ? 4    DA  C N1    1 
ATOM   79   C  C2    . DA  A 1 4   ? 20.314  -0.113  39.263  1.00 25.65 ? 4    DA  C C2    1 
ATOM   80   N  N3    . DA  A 1 4   ? 21.539  0.359   39.426  1.00 29.58 ? 4    DA  C N3    1 
ATOM   81   C  C4    . DA  A 1 4   ? 21.590  1.656   39.114  1.00 26.89 ? 4    DA  C C4    1 
ATOM   82   P  P     . DA  A 1 5   ? 28.088  1.390   38.827  1.00 47.49 ? 5    DA  C P     1 
ATOM   83   O  OP1   . DA  A 1 5   ? 29.421  0.988   39.328  1.00 49.26 ? 5    DA  C OP1   1 
ATOM   84   O  OP2   . DA  A 1 5   ? 27.994  2.378   37.731  1.00 52.04 ? 5    DA  C OP2   1 
ATOM   85   O  "O5'" . DA  A 1 5   ? 27.304  0.085   38.402  1.00 45.98 ? 5    DA  C "O5'" 1 
ATOM   86   C  "C5'" . DA  A 1 5   ? 26.655  -0.713  39.397  1.00 38.21 ? 5    DA  C "C5'" 1 
ATOM   87   C  "C4'" . DA  A 1 5   ? 25.787  -1.747  38.729  1.00 36.09 ? 5    DA  C "C4'" 1 
ATOM   88   O  "O4'" . DA  A 1 5   ? 24.516  -1.175  38.358  1.00 37.19 ? 5    DA  C "O4'" 1 
ATOM   89   C  "C3'" . DA  A 1 5   ? 26.402  -2.290  37.441  1.00 36.02 ? 5    DA  C "C3'" 1 
ATOM   90   O  "O3'" . DA  A 1 5   ? 26.267  -3.703  37.423  1.00 41.36 ? 5    DA  C "O3'" 1 
ATOM   91   C  "C2'" . DA  A 1 5   ? 25.575  -1.642  36.342  1.00 37.16 ? 5    DA  C "C2'" 1 
ATOM   92   C  "C1'" . DA  A 1 5   ? 24.227  -1.529  37.015  1.00 31.08 ? 5    DA  C "C1'" 1 
ATOM   93   N  N9    . DA  A 1 5   ? 23.327  -0.515  36.477  1.00 20.65 ? 5    DA  C N9    1 
ATOM   94   C  C8    . DA  A 1 5   ? 23.602  0.782   36.142  1.00 22.52 ? 5    DA  C C8    1 
ATOM   95   N  N7    . DA  A 1 5   ? 22.542  1.471   35.789  1.00 24.37 ? 5    DA  C N7    1 
ATOM   96   C  C5    . DA  A 1 5   ? 21.501  0.550   35.870  1.00 22.11 ? 5    DA  C C5    1 
ATOM   97   C  C6    . DA  A 1 5   ? 20.117  0.649   35.624  1.00 19.14 ? 5    DA  C C6    1 
ATOM   98   N  N6    . DA  A 1 5   ? 19.519  1.767   35.269  1.00 18.50 ? 5    DA  C N6    1 
ATOM   99   N  N1    . DA  A 1 5   ? 19.367  -0.458  35.762  1.00 21.99 ? 5    DA  C N1    1 
ATOM   100  C  C2    . DA  A 1 5   ? 19.971  -1.587  36.150  1.00 24.60 ? 5    DA  C C2    1 
ATOM   101  N  N3    . DA  A 1 5   ? 21.258  -1.805  36.427  1.00 23.85 ? 5    DA  C N3    1 
ATOM   102  C  C4    . DA  A 1 5   ? 21.977  -0.682  36.267  1.00 21.91 ? 5    DA  C C4    1 
ATOM   103  P  P     . DG  A 1 6   ? 26.850  -4.539  36.191  1.00 44.62 ? 6    DG  C P     1 
ATOM   104  O  OP1   . DG  A 1 6   ? 27.414  -5.820  36.702  1.00 45.87 ? 6    DG  C OP1   1 
ATOM   105  O  OP2   . DG  A 1 6   ? 27.702  -3.624  35.387  1.00 51.13 ? 6    DG  C OP2   1 
ATOM   106  O  "O5'" . DG  A 1 6   ? 25.540  -4.855  35.348  1.00 47.88 ? 6    DG  C "O5'" 1 
ATOM   107  C  "C5'" . DG  A 1 6   ? 24.423  -5.481  35.993  1.00 41.04 ? 6    DG  C "C5'" 1 
ATOM   108  C  "C4'" . DG  A 1 6   ? 23.328  -5.754  34.998  1.00 32.57 ? 6    DG  C "C4'" 1 
ATOM   109  O  "O4'" . DG  A 1 6   ? 22.617  -4.524  34.752  1.00 28.31 ? 6    DG  C "O4'" 1 
ATOM   110  C  "C3'" . DG  A 1 6   ? 23.820  -6.260  33.642  1.00 33.22 ? 6    DG  C "C3'" 1 
ATOM   111  O  "O3'" . DG  A 1 6   ? 23.101  -7.445  33.280  1.00 30.30 ? 6    DG  C "O3'" 1 
ATOM   112  C  "C2'" . DG  A 1 6   ? 23.532  -5.091  32.708  1.00 32.02 ? 6    DG  C "C2'" 1 
ATOM   113  C  "C1'" . DG  A 1 6   ? 22.358  -4.404  33.383  1.00 23.86 ? 6    DG  C "C1'" 1 
ATOM   114  N  N9    . DG  A 1 6   ? 22.196  -2.985  33.091  1.00 17.31 ? 6    DG  C N9    1 
ATOM   115  C  C8    . DG  A 1 6   ? 23.176  -2.028  33.022  1.00 13.54 ? 6    DG  C C8    1 
ATOM   116  N  N7    . DG  A 1 6   ? 22.713  -0.841  32.745  1.00 12.89 ? 6    DG  C N7    1 
ATOM   117  C  C5    . DG  A 1 6   ? 21.346  -1.026  32.629  1.00 10.60 ? 6    DG  C C5    1 
ATOM   118  C  C6    . DG  A 1 6   ? 20.333  -0.101  32.346  1.00 12.85 ? 6    DG  C C6    1 
ATOM   119  O  O6    . DG  A 1 6   ? 20.444  1.127   32.160  1.00 15.85 ? 6    DG  C O6    1 
ATOM   120  N  N1    . DG  A 1 6   ? 19.080  -0.721  32.282  1.00 17.04 ? 6    DG  C N1    1 
ATOM   121  C  C2    . DG  A 1 6   ? 18.848  -2.063  32.479  1.00 14.12 ? 6    DG  C C2    1 
ATOM   122  N  N2    . DG  A 1 6   ? 17.585  -2.480  32.335  1.00 6.74  ? 6    DG  C N2    1 
ATOM   123  N  N3    . DG  A 1 6   ? 19.792  -2.931  32.780  1.00 12.23 ? 6    DG  C N3    1 
ATOM   124  C  C4    . DG  A 1 6   ? 21.008  -2.343  32.832  1.00 13.43 ? 6    DG  C C4    1 
ATOM   125  P  P     . DA  A 1 7   ? 23.525  -8.288  31.978  1.00 25.64 ? 7    DA  C P     1 
ATOM   126  O  OP1   . DA  A 1 7   ? 23.495  -9.725  32.308  1.00 28.49 ? 7    DA  C OP1   1 
ATOM   127  O  OP2   . DA  A 1 7   ? 24.761  -7.706  31.382  1.00 23.48 ? 7    DA  C OP2   1 
ATOM   128  O  "O5'" . DA  A 1 7   ? 22.258  -8.027  31.062  1.00 28.75 ? 7    DA  C "O5'" 1 
ATOM   129  C  "C5'" . DA  A 1 7   ? 20.954  -8.146  31.643  1.00 26.43 ? 7    DA  C "C5'" 1 
ATOM   130  C  "C4'" . DA  A 1 7   ? 19.897  -7.694  30.669  1.00 27.00 ? 7    DA  C "C4'" 1 
ATOM   131  O  "O4'" . DA  A 1 7   ? 19.834  -6.248  30.644  1.00 28.84 ? 7    DA  C "O4'" 1 
ATOM   132  C  "C3'" . DA  A 1 7   ? 20.133  -8.132  29.228  1.00 27.52 ? 7    DA  C "C3'" 1 
ATOM   133  O  "O3'" . DA  A 1 7   ? 18.895  -8.538  28.658  1.00 27.38 ? 7    DA  C "O3'" 1 
ATOM   134  C  "C2'" . DA  A 1 7   ? 20.668  -6.873  28.564  1.00 25.50 ? 7    DA  C "C2'" 1 
ATOM   135  C  "C1'" . DA  A 1 7   ? 19.886  -5.805  29.305  1.00 26.27 ? 7    DA  C "C1'" 1 
ATOM   136  N  N9    . DA  A 1 7   ? 20.414  -4.436  29.297  1.00 27.39 ? 7    DA  C N9    1 
ATOM   137  C  C8    . DA  A 1 7   ? 21.712  -3.977  29.386  1.00 24.86 ? 7    DA  C C8    1 
ATOM   138  N  N7    . DA  A 1 7   ? 21.816  -2.669  29.282  1.00 25.87 ? 7    DA  C N7    1 
ATOM   139  C  C5    . DA  A 1 7   ? 20.498  -2.235  29.142  1.00 21.58 ? 7    DA  C C5    1 
ATOM   140  C  C6    . DA  A 1 7   ? 19.918  -0.952  28.977  1.00 18.51 ? 7    DA  C C6    1 
ATOM   141  N  N6    . DA  A 1 7   ? 20.604  0.182   28.948  1.00 14.52 ? 7    DA  C N6    1 
ATOM   142  N  N1    . DA  A 1 7   ? 18.583  -0.882  28.843  1.00 22.64 ? 7    DA  C N1    1 
ATOM   143  C  C2    . DA  A 1 7   ? 17.872  -2.015  28.873  1.00 24.44 ? 7    DA  C C2    1 
ATOM   144  N  N3    . DA  A 1 7   ? 18.291  -3.267  29.024  1.00 24.33 ? 7    DA  C N3    1 
ATOM   145  C  C4    . DA  A 1 7   ? 19.627  -3.312  29.155  1.00 23.84 ? 7    DA  C C4    1 
ATOM   146  P  P     . DC  A 1 8   ? 18.898  -9.467  27.360  1.00 31.82 ? 8    DC  C P     1 
ATOM   147  O  OP1   . DC  A 1 8   ? 17.851  -10.460 27.617  1.00 29.87 ? 8    DC  C OP1   1 
ATOM   148  O  OP2   . DC  A 1 8   ? 20.288  -9.909  27.108  1.00 36.68 ? 8    DC  C OP2   1 
ATOM   149  O  "O5'" . DC  A 1 8   ? 18.418  -8.486  26.198  1.00 36.19 ? 8    DC  C "O5'" 1 
ATOM   150  C  "C5'" . DC  A 1 8   ? 17.038  -8.117  26.145  1.00 39.33 ? 8    DC  C "C5'" 1 
ATOM   151  C  "C4'" . DC  A 1 8   ? 16.836  -6.749  25.542  1.00 37.85 ? 8    DC  C "C4'" 1 
ATOM   152  O  "O4'" . DC  A 1 8   ? 17.667  -5.707  26.138  1.00 36.04 ? 8    DC  C "O4'" 1 
ATOM   153  C  "C3'" . DC  A 1 8   ? 17.071  -6.671  24.041  1.00 38.71 ? 8    DC  C "C3'" 1 
ATOM   154  O  "O3'" . DC  A 1 8   ? 15.962  -6.019  23.449  1.00 45.04 ? 8    DC  C "O3'" 1 
ATOM   155  C  "C2'" . DC  A 1 8   ? 18.239  -5.714  23.935  1.00 40.96 ? 8    DC  C "C2'" 1 
ATOM   156  C  "C1'" . DC  A 1 8   ? 17.896  -4.806  25.085  1.00 33.65 ? 8    DC  C "C1'" 1 
ATOM   157  N  N1    . DC  A 1 8   ? 18.953  -3.846  25.448  1.00 25.88 ? 8    DC  C N1    1 
ATOM   158  C  C2    . DC  A 1 8   ? 18.617  -2.473  25.513  1.00 24.45 ? 8    DC  C C2    1 
ATOM   159  O  O2    . DC  A 1 8   ? 17.433  -2.141  25.471  1.00 25.21 ? 8    DC  C O2    1 
ATOM   160  N  N3    . DC  A 1 8   ? 19.595  -1.552  25.621  1.00 21.08 ? 8    DC  C N3    1 
ATOM   161  C  C4    . DC  A 1 8   ? 20.875  -1.943  25.691  1.00 22.44 ? 8    DC  C C4    1 
ATOM   162  N  N4    . DC  A 1 8   ? 21.813  -0.986  25.678  1.00 16.65 ? 8    DC  C N4    1 
ATOM   163  C  C5    . DC  A 1 8   ? 21.243  -3.332  25.743  1.00 12.70 ? 8    DC  C C5    1 
ATOM   164  C  C6    . DC  A 1 8   ? 20.251  -4.244  25.629  1.00 21.05 ? 8    DC  C C6    1 
ATOM   165  P  P     . DT  A 1 9   ? 15.746  -6.099  21.862  1.00 51.73 ? 9    DT  C P     1 
ATOM   166  O  OP1   . DT  A 1 9   ? 14.872  -7.275  21.607  1.00 46.55 ? 9    DT  C OP1   1 
ATOM   167  O  OP2   . DT  A 1 9   ? 17.049  -5.963  21.133  1.00 45.56 ? 9    DT  C OP2   1 
ATOM   168  O  "O5'" . DT  A 1 9   ? 14.901  -4.787  21.567  1.00 48.91 ? 9    DT  C "O5'" 1 
ATOM   169  C  "C5'" . DT  A 1 9   ? 13.824  -4.413  22.438  1.00 42.15 ? 9    DT  C "C5'" 1 
ATOM   170  C  "C4'" . DT  A 1 9   ? 13.575  -2.931  22.332  1.00 36.95 ? 9    DT  C "C4'" 1 
ATOM   171  O  "O4'" . DT  A 1 9   ? 14.791  -2.264  22.729  1.00 34.01 ? 9    DT  C "O4'" 1 
ATOM   172  C  "C3'" . DT  A 1 9   ? 13.280  -2.452  20.910  1.00 33.53 ? 9    DT  C "C3'" 1 
ATOM   173  O  "O3'" . DT  A 1 9   ? 12.296  -1.415  20.963  1.00 32.94 ? 9    DT  C "O3'" 1 
ATOM   174  C  "C2'" . DT  A 1 9   ? 14.622  -1.925  20.433  1.00 33.28 ? 9    DT  C "C2'" 1 
ATOM   175  C  "C1'" . DT  A 1 9   ? 15.248  -1.399  21.708  1.00 30.09 ? 9    DT  C "C1'" 1 
ATOM   176  N  N1    . DT  A 1 9   ? 16.712  -1.448  21.727  1.00 26.42 ? 9    DT  C N1    1 
ATOM   177  C  C2    . DT  A 1 9   ? 17.444  -0.282  21.722  1.00 22.01 ? 9    DT  C C2    1 
ATOM   178  O  O2    . DT  A 1 9   ? 16.955  0.829   21.638  1.00 17.91 ? 9    DT  C O2    1 
ATOM   179  N  N3    . DT  A 1 9   ? 18.787  -0.461  21.828  1.00 16.93 ? 9    DT  C N3    1 
ATOM   180  C  C4    . DT  A 1 9   ? 19.462  -1.642  21.935  1.00 16.84 ? 9    DT  C C4    1 
ATOM   181  O  O4    . DT  A 1 9   ? 20.677  -1.635  22.077  1.00 19.84 ? 9    DT  C O4    1 
ATOM   182  C  C5    . DT  A 1 9   ? 18.645  -2.823  21.889  1.00 17.27 ? 9    DT  C C5    1 
ATOM   183  C  C7    . DT  A 1 9   ? 19.301  -4.160  21.949  1.00 17.21 ? 9    DT  C C7    1 
ATOM   184  C  C6    . DT  A 1 9   ? 17.328  -2.671  21.789  1.00 24.54 ? 9    DT  C C6    1 
ATOM   185  P  P     . DT  A 1 10  ? 11.612  -0.869  19.612  1.00 35.19 ? 10   DT  C P     1 
ATOM   186  O  OP1   . DT  A 1 10  ? 10.253  -0.464  20.038  1.00 26.48 ? 10   DT  C OP1   1 
ATOM   187  O  OP2   . DT  A 1 10  ? 11.808  -1.839  18.478  1.00 32.38 ? 10   DT  C OP2   1 
ATOM   188  O  "O5'" . DT  A 1 10  ? 12.454  0.430   19.261  1.00 33.63 ? 10   DT  C "O5'" 1 
ATOM   189  C  "C5'" . DT  A 1 10  ? 12.704  1.398   20.281  1.00 31.84 ? 10   DT  C "C5'" 1 
ATOM   190  C  "C4'" . DT  A 1 10  ? 13.715  2.418   19.822  1.00 34.24 ? 10   DT  C "C4'" 1 
ATOM   191  O  "O4'" . DT  A 1 10  ? 15.073  1.939   19.920  1.00 33.37 ? 10   DT  C "O4'" 1 
ATOM   192  C  "C3'" . DT  A 1 10  ? 13.563  2.938   18.396  1.00 39.33 ? 10   DT  C "C3'" 1 
ATOM   193  O  "O3'" . DT  A 1 10  ? 13.828  4.338   18.462  1.00 48.67 ? 10   DT  C "O3'" 1 
ATOM   194  C  "C2'" . DT  A 1 10  ? 14.697  2.246   17.658  1.00 36.24 ? 10   DT  C "C2'" 1 
ATOM   195  C  "C1'" . DT  A 1 10  ? 15.749  2.313   18.742  1.00 31.86 ? 10   DT  C "C1'" 1 
ATOM   196  N  N1    . DT  A 1 10  ? 16.921  1.441   18.605  1.00 35.31 ? 10   DT  C N1    1 
ATOM   197  C  C2    . DT  A 1 10  ? 18.157  2.027   18.790  1.00 31.23 ? 10   DT  C C2    1 
ATOM   198  O  O2    . DT  A 1 10  ? 18.284  3.213   19.008  1.00 36.61 ? 10   DT  C O2    1 
ATOM   199  N  N3    . DT  A 1 10  ? 19.233  1.165   18.710  1.00 27.70 ? 10   DT  C N3    1 
ATOM   200  C  C4    . DT  A 1 10  ? 19.188  -0.202  18.481  1.00 30.42 ? 10   DT  C C4    1 
ATOM   201  O  O4    . DT  A 1 10  ? 20.233  -0.860  18.485  1.00 26.95 ? 10   DT  C O4    1 
ATOM   202  C  C5    . DT  A 1 10  ? 17.840  -0.746  18.267  1.00 30.37 ? 10   DT  C C5    1 
ATOM   203  C  C7    . DT  A 1 10  ? 17.670  -2.209  18.006  1.00 33.34 ? 10   DT  C C7    1 
ATOM   204  C  C6    . DT  A 1 10  ? 16.797  0.096   18.329  1.00 33.66 ? 10   DT  C C6    1 
ATOM   205  P  P     . DA  A 1 11  ? 13.085  5.328   17.463  1.00 53.65 ? 11   DA  C P     1 
ATOM   206  O  OP1   . DA  A 1 11  ? 12.407  6.375   18.269  1.00 49.91 ? 11   DA  C OP1   1 
ATOM   207  O  OP2   . DA  A 1 11  ? 12.303  4.461   16.533  1.00 53.75 ? 11   DA  C OP2   1 
ATOM   208  O  "O5'" . DA  A 1 11  ? 14.270  5.946   16.592  1.00 50.63 ? 11   DA  C "O5'" 1 
ATOM   209  C  "C5'" . DA  A 1 11  ? 15.134  6.944   17.127  1.00 41.79 ? 11   DA  C "C5'" 1 
ATOM   210  C  "C4'" . DA  A 1 11  ? 16.435  6.974   16.361  1.00 39.12 ? 11   DA  C "C4'" 1 
ATOM   211  O  "O4'" . DA  A 1 11  ? 17.222  5.802   16.634  1.00 36.42 ? 11   DA  C "O4'" 1 
ATOM   212  C  "C3'" . DA  A 1 11  ? 16.356  7.037   14.843  1.00 36.30 ? 11   DA  C "C3'" 1 
ATOM   213  O  "O3'" . DA  A 1 11  ? 16.091  8.400   14.469  1.00 34.29 ? 11   DA  C "O3'" 1 
ATOM   214  C  "C2'" . DA  A 1 11  ? 17.752  6.582   14.450  1.00 33.61 ? 11   DA  C "C2'" 1 
ATOM   215  C  "C1'" . DA  A 1 11  ? 18.187  5.664   15.606  1.00 31.01 ? 11   DA  C "C1'" 1 
ATOM   216  N  N9    . DA  A 1 11  ? 18.348  4.235   15.338  1.00 28.24 ? 11   DA  C N9    1 
ATOM   217  C  C8    . DA  A 1 11  ? 17.410  3.309   14.927  1.00 26.53 ? 11   DA  C C8    1 
ATOM   218  N  N7    . DA  A 1 11  ? 17.888  2.094   14.817  1.00 23.12 ? 11   DA  C N7    1 
ATOM   219  C  C5    . DA  A 1 11  ? 19.225  2.226   15.162  1.00 19.62 ? 11   DA  C C5    1 
ATOM   220  C  C6    . DA  A 1 11  ? 20.269  1.299   15.266  1.00 25.30 ? 11   DA  C C6    1 
ATOM   221  N  N6    . DA  A 1 11  ? 20.131  0.002   14.977  1.00 33.39 ? 11   DA  C N6    1 
ATOM   222  N  N1    . DA  A 1 11  ? 21.474  1.745   15.676  1.00 21.61 ? 11   DA  C N1    1 
ATOM   223  C  C2    . DA  A 1 11  ? 21.617  3.043   15.949  1.00 22.23 ? 11   DA  C C2    1 
ATOM   224  N  N3    . DA  A 1 11  ? 20.715  4.020   15.881  1.00 25.81 ? 11   DA  C N3    1 
ATOM   225  C  C4    . DA  A 1 11  ? 19.522  3.535   15.483  1.00 23.07 ? 11   DA  C C4    1 
ATOM   226  P  P     . DG  A 1 12  ? 15.946  8.806   12.924  1.00 32.04 ? 12   DG  C P     1 
ATOM   227  O  OP1   . DG  A 1 12  ? 15.082  10.000  12.895  1.00 32.68 ? 12   DG  C OP1   1 
ATOM   228  O  OP2   . DG  A 1 12  ? 15.595  7.621   12.130  1.00 36.04 ? 12   DG  C OP2   1 
ATOM   229  O  "O5'" . DG  A 1 12  ? 17.411  9.275   12.544  1.00 34.34 ? 12   DG  C "O5'" 1 
ATOM   230  C  "C5'" . DG  A 1 12  ? 18.109  10.155  13.411  1.00 38.11 ? 12   DG  C "C5'" 1 
ATOM   231  C  "C4'" . DG  A 1 12  ? 19.581  10.099  13.116  1.00 38.48 ? 12   DG  C "C4'" 1 
ATOM   232  O  "O4'" . DG  A 1 12  ? 20.051  8.746   13.331  1.00 40.25 ? 12   DG  C "O4'" 1 
ATOM   233  C  "C3'" . DG  A 1 12  ? 19.914  10.427  11.667  1.00 44.24 ? 12   DG  C "C3'" 1 
ATOM   234  O  "O3'" . DG  A 1 12  ? 21.155  11.142  11.660  1.00 51.30 ? 12   DG  C "O3'" 1 
ATOM   235  C  "C2'" . DG  A 1 12  ? 20.039  9.059   11.012  1.00 38.52 ? 12   DG  C "C2'" 1 
ATOM   236  C  "C1'" . DG  A 1 12  ? 20.660  8.250   12.144  1.00 36.16 ? 12   DG  C "C1'" 1 
ATOM   237  N  N9    . DG  A 1 12  ? 20.454  6.801   12.101  1.00 27.05 ? 12   DG  C N9    1 
ATOM   238  C  C8    . DG  A 1 12  ? 19.286  6.142   11.812  1.00 25.12 ? 12   DG  C C8    1 
ATOM   239  N  N7    . DG  A 1 12  ? 19.401  4.843   11.879  1.00 29.15 ? 12   DG  C N7    1 
ATOM   240  C  C5    . DG  A 1 12  ? 20.728  4.626   12.216  1.00 18.14 ? 12   DG  C C5    1 
ATOM   241  C  C6    . DG  A 1 12  ? 21.439  3.402   12.430  1.00 18.29 ? 12   DG  C C6    1 
ATOM   242  O  O6    . DG  A 1 12  ? 21.017  2.242   12.387  1.00 10.92 ? 12   DG  C O6    1 
ATOM   243  N  N1    . DG  A 1 12  ? 22.774  3.639   12.743  1.00 19.87 ? 12   DG  C N1    1 
ATOM   244  C  C2    . DG  A 1 12  ? 23.338  4.890   12.862  1.00 24.68 ? 12   DG  C C2    1 
ATOM   245  N  N2    . DG  A 1 12  ? 24.617  4.912   13.185  1.00 19.17 ? 12   DG  C N2    1 
ATOM   246  N  N3    . DG  A 1 12  ? 22.682  6.037   12.680  1.00 24.60 ? 12   DG  C N3    1 
ATOM   247  C  C4    . DG  A 1 12  ? 21.393  5.828   12.355  1.00 18.77 ? 12   DG  C C4    1 
ATOM   248  P  P     . DA  A 1 13  ? 21.740  11.718  10.280  1.00 54.32 ? 13   DA  C P     1 
ATOM   249  O  OP1   . DA  A 1 13  ? 22.067  13.153  10.525  1.00 57.50 ? 13   DA  C OP1   1 
ATOM   250  O  OP2   . DA  A 1 13  ? 20.825  11.337  9.163   1.00 50.24 ? 13   DA  C OP2   1 
ATOM   251  O  "O5'" . DA  A 1 13  ? 23.127  10.955  10.113  1.00 49.99 ? 13   DA  C "O5'" 1 
ATOM   252  C  "C5'" . DA  A 1 13  ? 24.114  11.002  11.154  1.00 46.04 ? 13   DA  C "C5'" 1 
ATOM   253  C  "C4'" . DA  A 1 13  ? 25.266  10.099  10.799  1.00 43.12 ? 13   DA  C "C4'" 1 
ATOM   254  O  "O4'" . DA  A 1 13  ? 24.854  8.713   10.860  1.00 40.60 ? 13   DA  C "O4'" 1 
ATOM   255  C  "C3'" . DA  A 1 13  ? 25.756  10.313  9.371   1.00 44.64 ? 13   DA  C "C3'" 1 
ATOM   256  O  "O3'" . DA  A 1 13  ? 27.088  9.863   9.363   1.00 47.97 ? 13   DA  C "O3'" 1 
ATOM   257  C  "C2'" . DA  A 1 13  ? 24.950  9.290   8.593   1.00 41.83 ? 13   DA  C "C2'" 1 
ATOM   258  C  "C1'" . DA  A 1 13  ? 25.021  8.132   9.572   1.00 39.72 ? 13   DA  C "C1'" 1 
ATOM   259  N  N9    . DA  A 1 13  ? 23.995  7.117   9.391   1.00 33.49 ? 13   DA  C N9    1 
ATOM   260  C  C8    . DA  A 1 13  ? 22.685  7.305   9.066   1.00 34.79 ? 13   DA  C C8    1 
ATOM   261  N  N7    . DA  A 1 13  ? 22.007  6.196   8.944   1.00 35.92 ? 13   DA  C N7    1 
ATOM   262  C  C5    . DA  A 1 13  ? 22.935  5.209   9.211   1.00 29.17 ? 13   DA  C C5    1 
ATOM   263  C  C6    . DA  A 1 13  ? 22.840  3.817   9.233   1.00 30.37 ? 13   DA  C C6    1 
ATOM   264  N  N6    . DA  A 1 13  ? 21.713  3.157   8.993   1.00 32.09 ? 13   DA  C N6    1 
ATOM   265  N  N1    . DA  A 1 13  ? 23.953  3.118   9.522   1.00 30.34 ? 13   DA  C N1    1 
ATOM   266  C  C2    . DA  A 1 13  ? 25.076  3.796   9.795   1.00 29.65 ? 13   DA  C C2    1 
ATOM   267  N  N3    . DA  A 1 13  ? 25.281  5.107   9.816   1.00 28.95 ? 13   DA  C N3    1 
ATOM   268  C  C4    . DA  A 1 13  ? 24.160  5.763   9.504   1.00 28.97 ? 13   DA  C C4    1 
ATOM   269  P  P     . DA  A 1 14  ? 28.255  10.781  8.805   1.00 45.93 ? 14   DA  C P     1 
ATOM   270  O  OP1   . DA  A 1 14  ? 28.530  11.748  9.906   1.00 43.85 ? 14   DA  C OP1   1 
ATOM   271  O  OP2   . DA  A 1 14  ? 27.875  11.259  7.452   1.00 45.45 ? 14   DA  C OP2   1 
ATOM   272  O  "O5'" . DA  A 1 14  ? 29.393  9.686   8.659   1.00 43.30 ? 14   DA  C "O5'" 1 
ATOM   273  C  "C5'" . DA  A 1 14  ? 29.416  8.566   9.565   1.00 41.10 ? 14   DA  C "C5'" 1 
ATOM   274  C  "C4'" . DA  A 1 14  ? 29.462  7.256   8.809   1.00 40.80 ? 14   DA  C "C4'" 1 
ATOM   275  O  "O4'" . DA  A 1 14  ? 28.159  6.677   8.539   1.00 36.13 ? 14   DA  C "O4'" 1 
ATOM   276  C  "C3'" . DA  A 1 14  ? 30.210  7.272   7.475   1.00 41.17 ? 14   DA  C "C3'" 1 
ATOM   277  O  "O3'" . DA  A 1 14  ? 31.186  6.235   7.467   1.00 43.57 ? 14   DA  C "O3'" 1 
ATOM   278  C  "C2'" . DA  A 1 14  ? 29.130  6.919   6.469   1.00 39.90 ? 14   DA  C "C2'" 1 
ATOM   279  C  "C1'" . DA  A 1 14  ? 28.256  6.007   7.297   1.00 35.14 ? 14   DA  C "C1'" 1 
ATOM   280  N  N9    . DA  A 1 14  ? 26.899  5.762   6.798   1.00 32.90 ? 14   DA  C N9    1 
ATOM   281  C  C8    . DA  A 1 14  ? 25.939  6.670   6.434   1.00 32.02 ? 14   DA  C C8    1 
ATOM   282  N  N7    . DA  A 1 14  ? 24.781  6.124   6.122   1.00 32.97 ? 14   DA  C N7    1 
ATOM   283  C  C5    . DA  A 1 14  ? 25.003  4.756   6.264   1.00 21.85 ? 14   DA  C C5    1 
ATOM   284  C  C6    . DA  A 1 14  ? 24.161  3.617   6.100   1.00 17.57 ? 14   DA  C C6    1 
ATOM   285  N  N6    . DA  A 1 14  ? 22.867  3.671   5.751   1.00 7.22  ? 14   DA  C N6    1 
ATOM   286  N  N1    . DA  A 1 14  ? 24.711  2.403   6.320   1.00 17.57 ? 14   DA  C N1    1 
ATOM   287  C  C2    . DA  A 1 14  ? 26.003  2.330   6.680   1.00 15.35 ? 14   DA  C C2    1 
ATOM   288  N  N3    . DA  A 1 14  ? 26.881  3.315   6.872   1.00 25.84 ? 14   DA  C N3    1 
ATOM   289  C  C4    . DA  A 1 14  ? 26.315  4.517   6.651   1.00 27.79 ? 14   DA  C C4    1 
ATOM   290  P  P     . DA  A 1 15  ? 32.195  6.102   6.229   1.00 50.42 ? 15   DA  C P     1 
ATOM   291  O  OP1   . DA  A 1 15  ? 33.593  6.160   6.743   1.00 52.28 ? 15   DA  C OP1   1 
ATOM   292  O  OP2   . DA  A 1 15  ? 31.770  7.025   5.133   1.00 46.19 ? 15   DA  C OP2   1 
ATOM   293  O  "O5'" . DA  A 1 15  ? 31.954  4.605   5.759   1.00 49.12 ? 15   DA  C "O5'" 1 
ATOM   294  C  "C5'" . DA  A 1 15  ? 31.885  3.561   6.745   1.00 47.52 ? 15   DA  C "C5'" 1 
ATOM   295  C  "C4'" . DA  A 1 15  ? 31.507  2.253   6.099   1.00 46.30 ? 15   DA  C "C4'" 1 
ATOM   296  O  "O4'" . DA  A 1 15  ? 30.107  2.257   5.747   1.00 45.12 ? 15   DA  C "O4'" 1 
ATOM   297  C  "C3'" . DA  A 1 15  ? 32.276  1.948   4.815   1.00 48.00 ? 15   DA  C "C3'" 1 
ATOM   298  O  "O3'" . DA  A 1 15  ? 32.685  0.583   4.870   1.00 50.26 ? 15   DA  C "O3'" 1 
ATOM   299  C  "C2'" . DA  A 1 15  ? 31.269  2.235   3.708   1.00 43.52 ? 15   DA  C "C2'" 1 
ATOM   300  C  "C1'" . DA  A 1 15  ? 29.937  1.931   4.373   1.00 41.52 ? 15   DA  C "C1'" 1 
ATOM   301  N  N9    . DA  A 1 15  ? 28.793  2.701   3.875   1.00 33.58 ? 15   DA  C N9    1 
ATOM   302  C  C8    . DA  A 1 15  ? 28.754  4.011   3.463   1.00 29.55 ? 15   DA  C C8    1 
ATOM   303  N  N7    . DA  A 1 15  ? 27.556  4.423   3.120   1.00 27.31 ? 15   DA  C N7    1 
ATOM   304  C  C5    . DA  A 1 15  ? 26.754  3.304   3.296   1.00 24.28 ? 15   DA  C C5    1 
ATOM   305  C  C6    . DA  A 1 15  ? 25.377  3.079   3.098   1.00 27.37 ? 15   DA  C C6    1 
ATOM   306  N  N6    . DA  A 1 15  ? 24.532  4.018   2.662   1.00 27.59 ? 15   DA  C N6    1 
ATOM   307  N  N1    . DA  A 1 15  ? 24.894  1.845   3.369   1.00 30.74 ? 15   DA  C N1    1 
ATOM   308  C  C2    . DA  A 1 15  ? 25.744  0.909   3.824   1.00 32.45 ? 15   DA  C C2    1 
ATOM   309  N  N3    . DA  A 1 15  ? 27.057  1.001   4.052   1.00 34.07 ? 15   DA  C N3    1 
ATOM   310  C  C4    . DA  A 1 15  ? 27.504  2.236   3.762   1.00 28.91 ? 15   DA  C C4    1 
ATOM   311  P  P     . DA  A 1 16  ? 33.369  -0.101  3.602   1.00 51.15 ? 16   DA  C P     1 
ATOM   312  O  OP1   . DA  A 1 16  ? 34.283  -1.138  4.154   1.00 49.10 ? 16   DA  C OP1   1 
ATOM   313  O  OP2   . DA  A 1 16  ? 33.891  0.976   2.726   1.00 49.35 ? 16   DA  C OP2   1 
ATOM   314  O  "O5'" . DA  A 1 16  ? 32.145  -0.848  2.943   1.00 50.97 ? 16   DA  C "O5'" 1 
ATOM   315  C  "C5'" . DA  A 1 16  ? 31.278  -1.606  3.779   1.00 51.47 ? 16   DA  C "C5'" 1 
ATOM   316  C  "C4'" . DA  A 1 16  ? 30.143  -2.174  2.970   1.00 52.94 ? 16   DA  C "C4'" 1 
ATOM   317  O  "O4'" . DA  A 1 16  ? 29.198  -1.139  2.611   1.00 47.54 ? 16   DA  C "O4'" 1 
ATOM   318  C  "C3'" . DA  A 1 16  ? 30.589  -2.830  1.664   1.00 55.04 ? 16   DA  C "C3'" 1 
ATOM   319  O  "O3'" . DA  A 1 16  ? 29.887  -4.078  1.528   1.00 64.68 ? 16   DA  C "O3'" 1 
ATOM   320  C  "C2'" . DA  A 1 16  ? 30.185  -1.809  0.609   1.00 47.93 ? 16   DA  C "C2'" 1 
ATOM   321  C  "C1'" . DA  A 1 16  ? 28.927  -1.224  1.231   1.00 43.56 ? 16   DA  C "C1'" 1 
ATOM   322  N  N9    . DA  A 1 16  ? 28.539  0.104   0.775   1.00 34.95 ? 16   DA  C N9    1 
ATOM   323  C  C8    . DA  A 1 16  ? 29.333  1.201   0.613   1.00 31.59 ? 16   DA  C C8    1 
ATOM   324  N  N7    . DA  A 1 16  ? 28.685  2.265   0.211   1.00 35.03 ? 16   DA  C N7    1 
ATOM   325  C  C5    . DA  A 1 16  ? 27.366  1.837   0.103   1.00 26.29 ? 16   DA  C C5    1 
ATOM   326  C  C6    . DA  A 1 16  ? 26.161  2.503   -0.247  1.00 28.13 ? 16   DA  C C6    1 
ATOM   327  N  N6    . DA  A 1 16  ? 26.089  3.807   -0.562  1.00 28.34 ? 16   DA  C N6    1 
ATOM   328  N  N1    . DA  A 1 16  ? 25.023  1.777   -0.253  1.00 20.72 ? 16   DA  C N1    1 
ATOM   329  C  C2    . DA  A 1 16  ? 25.091  0.489   0.081   1.00 20.63 ? 16   DA  C C2    1 
ATOM   330  N  N3    . DA  A 1 16  ? 26.151  -0.240  0.441   1.00 21.09 ? 16   DA  C N3    1 
ATOM   331  C  C4    . DA  A 1 16  ? 27.267  0.505   0.436   1.00 25.91 ? 16   DA  C C4    1 
ATOM   332  P  P     . DA  A 1 17  ? 30.345  -5.149  0.420   1.00 66.44 ? 17   DA  C P     1 
ATOM   333  O  OP1   . DA  A 1 17  ? 30.600  -6.460  1.094   1.00 66.84 ? 17   DA  C OP1   1 
ATOM   334  O  OP2   . DA  A 1 17  ? 31.384  -4.534  -0.445  1.00 67.24 ? 17   DA  C OP2   1 
ATOM   335  O  "O5'" . DA  A 1 17  ? 29.037  -5.325  -0.461  1.00 65.72 ? 17   DA  C "O5'" 1 
ATOM   336  C  "C5'" . DA  A 1 17  ? 28.136  -4.225  -0.644  1.00 64.39 ? 17   DA  C "C5'" 1 
ATOM   337  C  "C4'" . DA  A 1 17  ? 26.844  -4.718  -1.240  1.00 58.43 ? 17   DA  C "C4'" 1 
ATOM   338  O  "O4'" . DA  A 1 17  ? 25.957  -3.597  -1.427  1.00 53.95 ? 17   DA  C "O4'" 1 
ATOM   339  C  "C3'" . DA  A 1 17  ? 27.043  -5.330  -2.615  1.00 62.43 ? 17   DA  C "C3'" 1 
ATOM   340  O  "O3'" . DA  A 1 17  ? 26.206  -6.481  -2.735  1.00 70.97 ? 17   DA  C "O3'" 1 
ATOM   341  C  "C2'" . DA  A 1 17  ? 26.740  -4.185  -3.573  1.00 56.44 ? 17   DA  C "C2'" 1 
ATOM   342  C  "C1'" . DA  A 1 17  ? 25.881  -3.200  -2.780  1.00 46.45 ? 17   DA  C "C1'" 1 
ATOM   343  N  N9    . DA  A 1 17  ? 26.409  -1.839  -2.849  1.00 36.34 ? 17   DA  C N9    1 
ATOM   344  C  C8    . DA  A 1 17  ? 27.735  -1.496  -2.706  1.00 31.99 ? 17   DA  C C8    1 
ATOM   345  N  N7    . DA  A 1 17  ? 27.969  -0.214  -2.842  1.00 27.33 ? 17   DA  C N7    1 
ATOM   346  C  C5    . DA  A 1 17  ? 26.715  0.335   -3.070  1.00 21.11 ? 17   DA  C C5    1 
ATOM   347  C  C6    . DA  A 1 17  ? 26.295  1.650   -3.298  1.00 21.53 ? 17   DA  C C6    1 
ATOM   348  N  N6    . DA  A 1 17  ? 27.133  2.687   -3.301  1.00 26.36 ? 17   DA  C N6    1 
ATOM   349  N  N1    . DA  A 1 17  ? 24.978  1.864   -3.519  1.00 20.31 ? 17   DA  C N1    1 
ATOM   350  C  C2    . DA  A 1 17  ? 24.147  0.816   -3.499  1.00 20.37 ? 17   DA  C C2    1 
ATOM   351  N  N3    . DA  A 1 17  ? 24.424  -0.476  -3.286  1.00 23.19 ? 17   DA  C N3    1 
ATOM   352  C  C4    . DA  A 1 17  ? 25.740  -0.654  -3.075  1.00 26.50 ? 17   DA  C C4    1 
HETATM 353  N  N1    . BRU A 1 18  ? 24.773  -2.005  -6.345  1.00 51.55 ? 18   BRU C N1    1 
HETATM 354  C  C2    . BRU A 1 18  ? 24.466  -0.683  -6.589  1.00 46.73 ? 18   BRU C C2    1 
HETATM 355  N  N3    . BRU A 1 18  ? 25.536  0.169   -6.539  1.00 39.44 ? 18   BRU C N3    1 
HETATM 356  C  C4    . BRU A 1 18  ? 26.848  -0.153  -6.277  1.00 41.90 ? 18   BRU C C4    1 
HETATM 357  C  C5    . BRU A 1 18  ? 27.111  -1.570  -6.058  1.00 43.90 ? 18   BRU C C5    1 
HETATM 358  C  C6    . BRU A 1 18  ? 26.071  -2.414  -6.112  1.00 43.05 ? 18   BRU C C6    1 
HETATM 359  O  O2    . BRU A 1 18  ? 23.328  -0.293  -6.840  1.00 38.68 ? 18   BRU C O2    1 
HETATM 360  O  O4    . BRU A 1 18  ? 27.691  0.737   -6.216  1.00 37.98 ? 18   BRU C O4    1 
HETATM 361  BR BR    . BRU A 1 18  ? 29.072  -2.194  -5.660  0.25 55.78 ? 18   BRU C BR    1 
HETATM 362  C  "C1'" . BRU A 1 18  ? 23.655  -2.960  -6.316  1.00 61.70 ? 18   BRU C "C1'" 1 
HETATM 363  C  "C2'" . BRU A 1 18  ? 23.863  -4.254  -7.080  1.00 66.09 ? 18   BRU C "C2'" 1 
HETATM 364  C  "C3'" . BRU A 1 18  ? 22.871  -5.167  -6.379  1.00 69.19 ? 18   BRU C "C3'" 1 
HETATM 365  C  "C4'" . BRU A 1 18  ? 22.914  -4.690  -4.930  1.00 69.30 ? 18   BRU C "C4'" 1 
HETATM 366  O  "O3'" . BRU A 1 18  ? 21.561  -4.951  -6.869  1.00 69.80 ? 18   BRU C "O3'" 1 
HETATM 367  O  "O4'" . BRU A 1 18  ? 23.450  -3.347  -4.966  1.00 67.62 ? 18   BRU C "O4'" 1 
HETATM 368  C  "C5'" . BRU A 1 18  ? 23.764  -5.574  -4.060  1.00 70.19 ? 18   BRU C "C5'" 1 
HETATM 369  O  "O5'" . BRU A 1 18  ? 24.924  -5.989  -4.791  1.00 75.18 ? 18   BRU C "O5'" 1 
HETATM 370  P  P     . BRU A 1 18  ? 25.889  -7.090  -4.180  1.00 78.66 ? 18   BRU C P     1 
HETATM 371  O  OP1   . BRU A 1 18  ? 25.074  -8.325  -3.956  1.00 78.27 ? 18   BRU C OP1   1 
HETATM 372  O  OP2   . BRU A 1 18  ? 27.148  -7.154  -4.999  1.00 78.14 ? 18   BRU C OP2   1 
HETATM 373  N  N1    . BRU A 1 19  ? 22.629  -0.880  -9.960  1.00 44.55 ? 19   BRU C N1    1 
HETATM 374  C  C2    . BRU A 1 19  ? 23.129  0.404   -10.037 1.00 36.57 ? 19   BRU C C2    1 
HETATM 375  N  N3    . BRU A 1 19  ? 24.485  0.478   -9.975  1.00 28.91 ? 19   BRU C N3    1 
HETATM 376  C  C4    . BRU A 1 19  ? 25.383  -0.563  -9.855  1.00 33.03 ? 19   BRU C C4    1 
HETATM 377  C  C5    . BRU A 1 19  ? 24.796  -1.881  -9.816  1.00 35.92 ? 19   BRU C C5    1 
HETATM 378  C  C6    . BRU A 1 19  ? 23.462  -1.973  -9.880  1.00 40.57 ? 19   BRU C C6    1 
HETATM 379  O  O2    . BRU A 1 19  ? 22.429  1.402   -10.152 1.00 28.68 ? 19   BRU C O2    1 
HETATM 380  O  O4    . BRU A 1 19  ? 26.581  -0.324  -9.776  1.00 28.58 ? 19   BRU C O4    1 
HETATM 381  BR BR    . BRU A 1 19  ? 26.053  -3.557  -9.642  0.29 50.66 ? 19   BRU C BR    1 
HETATM 382  C  "C1'" . BRU A 1 19  ? 21.176  -1.045  -9.925  1.00 53.60 ? 19   BRU C "C1'" 1 
HETATM 383  C  "C2'" . BRU A 1 19  ? 20.598  -2.029  -10.915 1.00 58.31 ? 19   BRU C "C2'" 1 
HETATM 384  C  "C3'" . BRU A 1 19  ? 19.294  -2.421  -10.228 1.00 66.53 ? 19   BRU C "C3'" 1 
HETATM 385  C  "C4'" . BRU A 1 19  ? 19.588  -2.261  -8.741  1.00 63.60 ? 19   BRU C "C4'" 1 
HETATM 386  O  "O3'" . BRU A 1 19  ? 18.201  -1.577  -10.573 1.00 71.12 ? 19   BRU C "O3'" 1 
HETATM 387  O  "O4'" . BRU A 1 19  ? 20.842  -1.556  -8.650  1.00 59.41 ? 19   BRU C "O4'" 1 
HETATM 388  C  "C5'" . BRU A 1 19  ? 19.625  -3.564  -7.989  1.00 62.56 ? 19   BRU C "C5'" 1 
HETATM 389  O  "O5'" . BRU A 1 19  ? 20.151  -4.586  -8.821  1.00 66.35 ? 19   BRU C "O5'" 1 
HETATM 390  P  P     . BRU A 1 19  ? 21.061  -5.702  -8.184  1.00 70.64 ? 19   BRU C P     1 
HETATM 391  O  OP1   . BRU A 1 19  ? 20.177  -6.822  -7.765  1.00 70.93 ? 19   BRU C OP1   1 
HETATM 392  O  OP2   . BRU A 1 19  ? 22.213  -5.960  -9.102  1.00 72.61 ? 19   BRU C OP2   1 
ATOM   393  P  P     . DT  A 1 20  ? 17.866  -1.317  -12.108 1.00 73.92 ? 20   DT  C P     1 
ATOM   394  O  OP1   . DT  A 1 20  ? 16.440  -0.913  -12.162 1.00 70.85 ? 20   DT  C OP1   1 
ATOM   395  O  OP2   . DT  A 1 20  ? 18.333  -2.480  -12.915 1.00 74.80 ? 20   DT  C OP2   1 
ATOM   396  O  "O5'" . DT  A 1 20  ? 18.819  -0.080  -12.408 1.00 76.60 ? 20   DT  C "O5'" 1 
ATOM   397  C  "C5'" . DT  A 1 20  ? 18.916  1.008   -11.460 1.00 76.30 ? 20   DT  C "C5'" 1 
ATOM   398  C  "C4'" . DT  A 1 20  ? 19.214  2.297   -12.185 1.00 74.99 ? 20   DT  C "C4'" 1 
ATOM   399  O  "O4'" . DT  A 1 20  ? 20.637  2.501   -12.303 1.00 72.57 ? 20   DT  C "O4'" 1 
ATOM   400  C  "C3'" . DT  A 1 20  ? 18.676  2.285   -13.603 1.00 76.19 ? 20   DT  C "C3'" 1 
ATOM   401  O  "O3'" . DT  A 1 20  ? 18.195  3.571   -13.948 1.00 81.02 ? 20   DT  C "O3'" 1 
ATOM   402  C  "C2'" . DT  A 1 20  ? 19.870  1.844   -14.434 1.00 71.44 ? 20   DT  C "C2'" 1 
ATOM   403  C  "C1'" . DT  A 1 20  ? 21.084  2.297   -13.632 1.00 66.56 ? 20   DT  C "C1'" 1 
ATOM   404  N  N1    . DT  A 1 20  ? 22.137  1.265   -13.574 1.00 61.48 ? 20   DT  C N1    1 
ATOM   405  C  C2    . DT  A 1 20  ? 23.475  1.640   -13.486 1.00 56.56 ? 20   DT  C C2    1 
ATOM   406  O  O2    . DT  A 1 20  ? 23.854  2.802   -13.430 1.00 55.48 ? 20   DT  C O2    1 
ATOM   407  N  N3    . DT  A 1 20  ? 24.359  0.590   -13.448 1.00 48.92 ? 20   DT  C N3    1 
ATOM   408  C  C4    . DT  A 1 20  ? 24.056  -0.758  -13.460 1.00 51.68 ? 20   DT  C C4    1 
ATOM   409  O  O4    . DT  A 1 20  ? 24.959  -1.590  -13.421 1.00 49.01 ? 20   DT  C O4    1 
ATOM   410  C  C5    . DT  A 1 20  ? 22.638  -1.074  -13.523 1.00 55.57 ? 20   DT  C C5    1 
ATOM   411  C  C7    . DT  A 1 20  ? 22.210  -2.507  -13.491 1.00 56.47 ? 20   DT  C C7    1 
ATOM   412  C  C6    . DT  A 1 20  ? 21.767  -0.061  -13.592 1.00 56.98 ? 20   DT  C C6    1 
ATOM   413  P  P     . DT  A 1 21  ? 17.745  3.862   -15.456 1.00 86.50 ? 21   DT  C P     1 
ATOM   414  O  OP1   . DT  A 1 21  ? 16.588  4.799   -15.349 1.00 87.65 ? 21   DT  C OP1   1 
ATOM   415  O  OP2   . DT  A 1 21  ? 17.568  2.553   -16.145 1.00 84.08 ? 21   DT  C OP2   1 
ATOM   416  O  "O5'" . DT  A 1 21  ? 19.014  4.637   -16.033 1.00 84.43 ? 21   DT  C "O5'" 1 
ATOM   417  C  "C5'" . DT  A 1 21  ? 19.612  5.688   -15.247 1.00 81.70 ? 21   DT  C "C5'" 1 
ATOM   418  C  "C4'" . DT  A 1 21  ? 20.933  6.133   -15.830 1.00 79.41 ? 21   DT  C "C4'" 1 
ATOM   419  O  "O4'" . DT  A 1 21  ? 21.980  5.160   -15.587 1.00 73.62 ? 21   DT  C "O4'" 1 
ATOM   420  C  "C3'" . DT  A 1 21  ? 20.966  6.441   -17.327 1.00 80.74 ? 21   DT  C "C3'" 1 
ATOM   421  O  "O3'" . DT  A 1 21  ? 21.672  7.674   -17.511 1.00 85.87 ? 21   DT  C "O3'" 1 
ATOM   422  C  "C2'" . DT  A 1 21  ? 21.763  5.279   -17.908 1.00 74.17 ? 21   DT  C "C2'" 1 
ATOM   423  C  "C1'" . DT  A 1 21  ? 22.731  4.973   -16.776 1.00 65.00 ? 21   DT  C "C1'" 1 
ATOM   424  N  N1    . DT  A 1 21  ? 23.258  3.607   -16.751 1.00 48.51 ? 21   DT  C N1    1 
ATOM   425  C  C2    . DT  A 1 21  ? 24.620  3.417   -16.657 1.00 45.38 ? 21   DT  C C2    1 
ATOM   426  O  O2    . DT  A 1 21  ? 25.424  4.336   -16.627 1.00 41.90 ? 21   DT  C O2    1 
ATOM   427  N  N3    . DT  A 1 21  ? 25.011  2.100   -16.600 1.00 42.35 ? 21   DT  C N3    1 
ATOM   428  C  C4    . DT  A 1 21  ? 24.189  0.977   -16.638 1.00 46.97 ? 21   DT  C C4    1 
ATOM   429  O  O4    . DT  A 1 21  ? 24.680  -0.166  -16.590 1.00 43.98 ? 21   DT  C O4    1 
ATOM   430  C  C5    . DT  A 1 21  ? 22.770  1.265   -16.740 1.00 43.60 ? 21   DT  C C5    1 
ATOM   431  C  C7    . DT  A 1 21  ? 21.797  0.125   -16.768 1.00 48.46 ? 21   DT  C C7    1 
ATOM   432  C  C6    . DT  A 1 21  ? 22.387  2.543   -16.800 1.00 44.99 ? 21   DT  C C6    1 
ATOM   433  P  P     . DT  A 1 22  ? 21.467  8.528   -18.855 1.00 91.65 ? 22   DT  C P     1 
ATOM   434  O  OP1   . DT  A 1 22  ? 21.023  9.895   -18.435 1.00 91.85 ? 22   DT  C OP1   1 
ATOM   435  O  OP2   . DT  A 1 22  ? 20.643  7.747   -19.839 1.00 91.24 ? 22   DT  C OP2   1 
ATOM   436  O  "O5'" . DT  A 1 22  ? 22.957  8.659   -19.396 1.00 86.77 ? 22   DT  C "O5'" 1 
ATOM   437  C  "C5'" . DT  A 1 22  ? 23.976  9.234   -18.555 1.00 79.26 ? 22   DT  C "C5'" 1 
ATOM   438  C  "C4'" . DT  A 1 22  ? 25.362  8.826   -19.009 1.00 71.17 ? 22   DT  C "C4'" 1 
ATOM   439  O  "O4'" . DT  A 1 22  ? 25.655  7.448   -18.671 1.00 62.31 ? 22   DT  C "O4'" 1 
ATOM   440  C  "C3'" . DT  A 1 22  ? 25.676  8.993   -20.501 1.00 70.02 ? 22   DT  C "C3'" 1 
ATOM   441  O  "O3'" . DT  A 1 22  ? 26.769  9.913   -20.743 1.00 75.05 ? 22   DT  C "O3'" 1 
ATOM   442  C  "C2'" . DT  A 1 22  ? 25.970  7.579   -20.976 1.00 64.94 ? 22   DT  C "C2'" 1 
ATOM   443  C  "C1'" . DT  A 1 22  ? 26.443  6.891   -19.708 1.00 57.26 ? 22   DT  C "C1'" 1 
ATOM   444  N  N1    . DT  A 1 22  ? 26.221  5.440   -19.722 1.00 45.54 ? 22   DT  C N1    1 
ATOM   445  C  C2    . DT  A 1 22  ? 27.305  4.587   -19.572 1.00 40.86 ? 22   DT  C C2    1 
ATOM   446  O  O2    . DT  A 1 22  ? 28.467  4.978   -19.437 1.00 39.26 ? 22   DT  C O2    1 
ATOM   447  N  N3    . DT  A 1 22  ? 26.979  3.251   -19.597 1.00 28.94 ? 22   DT  C N3    1 
ATOM   448  C  C4    . DT  A 1 22  ? 25.721  2.702   -19.771 1.00 27.11 ? 22   DT  C C4    1 
ATOM   449  O  O4    . DT  A 1 22  ? 25.579  1.477   -19.775 1.00 24.21 ? 22   DT  C O4    1 
ATOM   450  C  C5    . DT  A 1 22  ? 24.642  3.666   -19.942 1.00 28.81 ? 22   DT  C C5    1 
ATOM   451  C  C7    . DT  A 1 22  ? 23.248  3.177   -20.181 1.00 28.69 ? 22   DT  C C7    1 
ATOM   452  C  C6    . DT  A 1 22  ? 24.945  4.960   -19.894 1.00 33.84 ? 22   DT  C C6    1 
ATOM   453  O  "O5'" . DA  B 2 1   ? 33.592  -3.756  -17.960 1.00 72.60 ? 101  DA  D "O5'" 1 
ATOM   454  C  "C5'" . DA  B 2 1   ? 34.702  -3.652  -18.889 1.00 72.23 ? 101  DA  D "C5'" 1 
ATOM   455  C  "C4'" . DA  B 2 1   ? 35.195  -2.227  -18.992 1.00 69.95 ? 101  DA  D "C4'" 1 
ATOM   456  O  "O4'" . DA  B 2 1   ? 34.113  -1.405  -19.477 1.00 64.97 ? 101  DA  D "O4'" 1 
ATOM   457  C  "C3'" . DA  B 2 1   ? 35.583  -1.622  -17.646 1.00 72.50 ? 101  DA  D "C3'" 1 
ATOM   458  O  "O3'" . DA  B 2 1   ? 36.631  -0.650  -17.811 1.00 79.15 ? 101  DA  D "O3'" 1 
ATOM   459  C  "C2'" . DA  B 2 1   ? 34.282  -1.011  -17.154 1.00 64.38 ? 101  DA  D "C2'" 1 
ATOM   460  C  "C1'" . DA  B 2 1   ? 33.614  -0.565  -18.442 1.00 56.87 ? 101  DA  D "C1'" 1 
ATOM   461  N  N9    . DA  B 2 1   ? 32.160  -0.665  -18.473 1.00 43.19 ? 101  DA  D N9    1 
ATOM   462  C  C8    . DA  B 2 1   ? 31.378  -1.785  -18.323 1.00 34.80 ? 101  DA  D C8    1 
ATOM   463  N  N7    . DA  B 2 1   ? 30.099  -1.558  -18.492 1.00 32.61 ? 101  DA  D N7    1 
ATOM   464  C  C5    . DA  B 2 1   ? 30.033  -0.196  -18.750 1.00 23.85 ? 101  DA  D C5    1 
ATOM   465  C  C6    . DA  B 2 1   ? 28.978  0.651   -19.027 1.00 23.98 ? 101  DA  D C6    1 
ATOM   466  N  N6    . DA  B 2 1   ? 27.715  0.232   -19.136 1.00 24.28 ? 101  DA  D N6    1 
ATOM   467  N  N1    . DA  B 2 1   ? 29.250  1.960   -19.218 1.00 24.67 ? 101  DA  D N1    1 
ATOM   468  C  C2    . DA  B 2 1   ? 30.522  2.367   -19.152 1.00 22.07 ? 101  DA  D C2    1 
ATOM   469  N  N3    . DA  B 2 1   ? 31.609  1.659   -18.922 1.00 21.78 ? 101  DA  D N3    1 
ATOM   470  C  C4    . DA  B 2 1   ? 31.292  0.368   -18.721 1.00 30.11 ? 101  DA  D C4    1 
ATOM   471  P  P     . DA  B 2 2   ? 37.148  0.186   -16.537 1.00 84.00 ? 102  DA  D P     1 
ATOM   472  O  OP1   . DA  B 2 2   ? 38.442  0.802   -16.883 1.00 80.24 ? 102  DA  D OP1   1 
ATOM   473  O  OP2   . DA  B 2 2   ? 37.080  -0.722  -15.359 1.00 86.98 ? 102  DA  D OP2   1 
ATOM   474  O  "O5'" . DA  B 2 2   ? 36.021  1.304   -16.345 1.00 81.24 ? 102  DA  D "O5'" 1 
ATOM   475  C  "C5'" . DA  B 2 2   ? 35.833  2.346   -17.325 1.00 76.14 ? 102  DA  D "C5'" 1 
ATOM   476  C  "C4'" . DA  B 2 2   ? 35.010  3.476   -16.750 1.00 72.39 ? 102  DA  D "C4'" 1 
ATOM   477  O  "O4'" . DA  B 2 2   ? 33.590  3.213   -16.867 1.00 68.42 ? 102  DA  D "O4'" 1 
ATOM   478  C  "C3'" . DA  B 2 2   ? 35.270  3.790   -15.279 1.00 73.95 ? 102  DA  D "C3'" 1 
ATOM   479  O  "O3'" . DA  B 2 2   ? 35.445  5.200   -15.100 1.00 81.43 ? 102  DA  D "O3'" 1 
ATOM   480  C  "C2'" . DA  B 2 2   ? 34.015  3.289   -14.574 1.00 70.30 ? 102  DA  D "C2'" 1 
ATOM   481  C  "C1'" . DA  B 2 2   ? 32.926  3.418   -15.628 1.00 60.36 ? 102  DA  D "C1'" 1 
ATOM   482  N  N9    . DA  B 2 2   ? 31.877  2.401   -15.532 1.00 47.73 ? 102  DA  D N9    1 
ATOM   483  C  C8    . DA  B 2 2   ? 32.070  1.066   -15.272 1.00 42.37 ? 102  DA  D C8    1 
ATOM   484  N  N7    . DA  B 2 2   ? 30.976  0.352   -15.338 1.00 40.06 ? 102  DA  D N7    1 
ATOM   485  C  C5    . DA  B 2 2   ? 29.988  1.278   -15.643 1.00 27.87 ? 102  DA  D C5    1 
ATOM   486  C  C6    . DA  B 2 2   ? 28.616  1.135   -15.861 1.00 24.65 ? 102  DA  D C6    1 
ATOM   487  N  N6    . DA  B 2 2   ? 28.004  -0.044  -15.818 1.00 21.82 ? 102  DA  D N6    1 
ATOM   488  N  N1    . DA  B 2 2   ? 27.891  2.252   -16.140 1.00 23.22 ? 102  DA  D N1    1 
ATOM   489  C  C2    . DA  B 2 2   ? 28.537  3.431   -16.191 1.00 23.55 ? 102  DA  D C2    1 
ATOM   490  N  N3    . DA  B 2 2   ? 29.839  3.687   -16.007 1.00 31.58 ? 102  DA  D N3    1 
ATOM   491  C  C4    . DA  B 2 2   ? 30.518  2.551   -15.736 1.00 36.04 ? 102  DA  D C4    1 
ATOM   492  P  P     . DA  B 2 3   ? 35.529  5.814   -13.614 1.00 88.51 ? 103  DA  D P     1 
ATOM   493  O  OP1   . DA  B 2 3   ? 36.474  6.968   -13.646 1.00 88.35 ? 103  DA  D OP1   1 
ATOM   494  O  OP2   . DA  B 2 3   ? 35.737  4.705   -12.633 1.00 89.21 ? 103  DA  D OP2   1 
ATOM   495  O  "O5'" . DA  B 2 3   ? 34.071  6.402   -13.387 1.00 84.75 ? 103  DA  D "O5'" 1 
ATOM   496  C  "C5'" . DA  B 2 3   ? 33.422  7.102   -14.440 1.00 79.95 ? 103  DA  D "C5'" 1 
ATOM   497  C  "C4'" . DA  B 2 3   ? 31.968  7.294   -14.104 1.00 78.55 ? 103  DA  D "C4'" 1 
ATOM   498  O  "O4'" . DA  B 2 3   ? 31.282  6.019   -14.107 1.00 73.95 ? 103  DA  D "O4'" 1 
ATOM   499  C  "C3'" . DA  B 2 3   ? 31.704  7.907   -12.727 1.00 79.42 ? 103  DA  D "C3'" 1 
ATOM   500  O  "O3'" . DA  B 2 3   ? 30.607  8.819   -12.844 1.00 84.87 ? 103  DA  D "O3'" 1 
ATOM   501  C  "C2'" . DA  B 2 3   ? 31.273  6.708   -11.897 1.00 73.68 ? 103  DA  D "C2'" 1 
ATOM   502  C  "C1'" . DA  B 2 3   ? 30.472  5.986   -12.949 1.00 65.39 ? 103  DA  D "C1'" 1 
ATOM   503  N  N9    . DA  B 2 3   ? 30.082  4.605   -12.711 1.00 50.77 ? 103  DA  D N9    1 
ATOM   504  C  C8    . DA  B 2 3   ? 30.824  3.524   -12.307 1.00 46.88 ? 103  DA  D C8    1 
ATOM   505  N  N7    . DA  B 2 3   ? 30.136  2.406   -12.253 1.00 40.48 ? 103  DA  D N7    1 
ATOM   506  C  C5    . DA  B 2 3   ? 28.853  2.787   -12.639 1.00 40.88 ? 103  DA  D C5    1 
ATOM   507  C  C6    . DA  B 2 3   ? 27.653  2.059   -12.834 1.00 40.69 ? 103  DA  D C6    1 
ATOM   508  N  N6    . DA  B 2 3   ? 27.561  0.736   -12.691 1.00 38.66 ? 103  DA  D N6    1 
ATOM   509  N  N1    . DA  B 2 3   ? 26.548  2.751   -13.217 1.00 38.26 ? 103  DA  D N1    1 
ATOM   510  C  C2    . DA  B 2 3   ? 26.662  4.069   -13.434 1.00 34.94 ? 103  DA  D C2    1 
ATOM   511  N  N3    . DA  B 2 3   ? 27.741  4.856   -13.322 1.00 38.26 ? 103  DA  D N3    1 
ATOM   512  C  C4    . DA  B 2 3   ? 28.808  4.141   -12.909 1.00 43.10 ? 103  DA  D C4    1 
ATOM   513  P  P     . DA  B 2 4   ? 30.392  9.961   -11.740 1.00 90.42 ? 104  DA  D P     1 
ATOM   514  O  OP1   . DA  B 2 4   ? 30.835  11.260  -12.335 1.00 90.80 ? 104  DA  D OP1   1 
ATOM   515  O  OP2   . DA  B 2 4   ? 30.978  9.500   -10.446 1.00 91.78 ? 104  DA  D OP2   1 
ATOM   516  O  "O5'" . DA  B 2 4   ? 28.814  10.000  -11.568 1.00 90.23 ? 104  DA  D "O5'" 1 
ATOM   517  C  "C5'" . DA  B 2 4   ? 27.956  10.104  -12.709 1.00 88.57 ? 104  DA  D "C5'" 1 
ATOM   518  C  "C4'" . DA  B 2 4   ? 26.580  9.587   -12.365 1.00 87.35 ? 104  DA  D "C4'" 1 
ATOM   519  O  "O4'" . DA  B 2 4   ? 26.620  8.143   -12.230 1.00 84.93 ? 104  DA  D "O4'" 1 
ATOM   520  C  "C3'" . DA  B 2 4   ? 26.008  10.127  -11.051 1.00 87.01 ? 104  DA  D "C3'" 1 
ATOM   521  O  "O3'" . DA  B 2 4   ? 24.603  10.377  -11.191 1.00 91.15 ? 104  DA  D "O3'" 1 
ATOM   522  C  "C2'" . DA  B 2 4   ? 26.242  8.986   -10.074 1.00 83.16 ? 104  DA  D "C2'" 1 
ATOM   523  C  "C1'" . DA  B 2 4   ? 26.062  7.772   -10.974 1.00 79.21 ? 104  DA  D "C1'" 1 
ATOM   524  N  N9    . DA  B 2 4   ? 26.727  6.545   -10.522 1.00 69.49 ? 104  DA  D N9    1 
ATOM   525  C  C8    . DA  B 2 4   ? 28.038  6.386   -10.125 1.00 64.64 ? 104  DA  D C8    1 
ATOM   526  N  N7    . DA  B 2 4   ? 28.346  5.153   -9.788  1.00 53.05 ? 104  DA  D N7    1 
ATOM   527  C  C5    . DA  B 2 4   ? 27.160  4.454   -9.971  1.00 47.41 ? 104  DA  D C5    1 
ATOM   528  C  C6    . DA  B 2 4   ? 26.832  3.111   -9.794  1.00 39.52 ? 104  DA  D C6    1 
ATOM   529  N  N6    . DA  B 2 4   ? 27.704  2.188   -9.379  1.00 29.18 ? 104  DA  D N6    1 
ATOM   530  N  N1    . DA  B 2 4   ? 25.562  2.735   -10.072 1.00 41.56 ? 104  DA  D N1    1 
ATOM   531  C  C2    . DA  B 2 4   ? 24.687  3.660   -10.500 1.00 38.98 ? 104  DA  D C2    1 
ATOM   532  N  N3    . DA  B 2 4   ? 24.876  4.955   -10.707 1.00 45.07 ? 104  DA  D N3    1 
ATOM   533  C  C4    . DA  B 2 4   ? 26.150  5.297   -10.419 1.00 56.56 ? 104  DA  D C4    1 
ATOM   534  P  P     . DA  B 2 5   ? 23.903  11.558  -10.343 1.00 94.95 ? 105  DA  D P     1 
ATOM   535  O  OP1   . DA  B 2 5   ? 23.002  12.302  -11.282 1.00 98.19 ? 105  DA  D OP1   1 
ATOM   536  O  OP2   . DA  B 2 5   ? 24.944  12.296  -9.572  1.00 97.07 ? 105  DA  D OP2   1 
ATOM   537  O  "O5'" . DA  B 2 5   ? 22.989  10.789  -9.294  1.00 90.06 ? 105  DA  D "O5'" 1 
ATOM   538  C  "C5'" . DA  B 2 5   ? 23.225  9.408   -9.024  1.00 82.00 ? 105  DA  D "C5'" 1 
ATOM   539  C  "C4'" . DA  B 2 5   ? 21.948  8.621   -9.180  1.00 74.78 ? 105  DA  D "C4'" 1 
ATOM   540  O  "O4'" . DA  B 2 5   ? 22.285  7.218   -9.186  1.00 70.28 ? 105  DA  D "O4'" 1 
ATOM   541  C  "C3'" . DA  B 2 5   ? 20.971  8.804   -8.031  1.00 71.35 ? 105  DA  D "C3'" 1 
ATOM   542  O  "O3'" . DA  B 2 5   ? 19.633  8.638   -8.531  1.00 75.46 ? 105  DA  D "O3'" 1 
ATOM   543  C  "C2'" . DA  B 2 5   ? 21.424  7.739   -7.040  1.00 67.16 ? 105  DA  D "C2'" 1 
ATOM   544  C  "C1'" . DA  B 2 5   ? 22.053  6.640   -7.912  1.00 60.46 ? 105  DA  D "C1'" 1 
ATOM   545  N  N9    . DA  B 2 5   ? 23.339  6.091   -7.453  1.00 47.35 ? 105  DA  D N9    1 
ATOM   546  C  C8    . DA  B 2 5   ? 24.473  6.789   -7.084  1.00 38.66 ? 105  DA  D C8    1 
ATOM   547  N  N7    . DA  B 2 5   ? 25.490  6.021   -6.767  1.00 30.79 ? 105  DA  D N7    1 
ATOM   548  C  C5    . DA  B 2 5   ? 24.993  4.733   -6.931  1.00 29.36 ? 105  DA  D C5    1 
ATOM   549  C  C6    . DA  B 2 5   ? 25.576  3.469   -6.745  1.00 26.25 ? 105  DA  D C6    1 
ATOM   550  N  N6    . DA  B 2 5   ? 26.838  3.289   -6.385  1.00 27.52 ? 105  DA  D N6    1 
ATOM   551  N  N1    . DA  B 2 5   ? 24.801  2.384   -6.959  1.00 26.98 ? 105  DA  D N1    1 
ATOM   552  C  C2    . DA  B 2 5   ? 23.540  2.560   -7.352  1.00 30.40 ? 105  DA  D C2    1 
ATOM   553  N  N3    . DA  B 2 5   ? 22.878  3.697   -7.580  1.00 35.04 ? 105  DA  D N3    1 
ATOM   554  C  C4    . DA  B 2 5   ? 23.669  4.759   -7.340  1.00 34.91 ? 105  DA  D C4    1 
ATOM   555  P  P     . DT  B 2 6   ? 18.369  9.025   -7.608  1.00 81.16 ? 106  DT  D P     1 
ATOM   556  O  OP1   . DT  B 2 6   ? 17.219  9.486   -8.440  1.00 78.38 ? 106  DT  D OP1   1 
ATOM   557  O  OP2   . DT  B 2 6   ? 18.860  9.890   -6.505  1.00 83.98 ? 106  DT  D OP2   1 
ATOM   558  O  "O5'" . DT  B 2 6   ? 17.978  7.618   -6.988  1.00 79.17 ? 106  DT  D "O5'" 1 
ATOM   559  C  "C5'" . DT  B 2 6   ? 19.001  6.651   -6.735  1.00 72.14 ? 106  DT  D "C5'" 1 
ATOM   560  C  "C4'" . DT  B 2 6   ? 18.395  5.291   -6.506  1.00 68.26 ? 106  DT  D "C4'" 1 
ATOM   561  O  "O4'" . DT  B 2 6   ? 19.501  4.371   -6.376  1.00 63.41 ? 106  DT  D "O4'" 1 
ATOM   562  C  "C3'" . DT  B 2 6   ? 17.582  5.194   -5.212  1.00 67.39 ? 106  DT  D "C3'" 1 
ATOM   563  O  "O3'" . DT  B 2 6   ? 16.377  4.412   -5.410  1.00 70.59 ? 106  DT  D "O3'" 1 
ATOM   564  C  "C2'" . DT  B 2 6   ? 18.579  4.629   -4.209  1.00 62.27 ? 106  DT  D "C2'" 1 
ATOM   565  C  "C1'" . DT  B 2 6   ? 19.621  3.885   -5.051  1.00 55.65 ? 106  DT  D "C1'" 1 
ATOM   566  N  N1    . DT  B 2 6   ? 21.036  4.064   -4.636  1.00 40.90 ? 106  DT  D N1    1 
ATOM   567  C  C2    . DT  B 2 6   ? 21.800  2.927   -4.455  1.00 38.69 ? 106  DT  D C2    1 
ATOM   568  O  O2    . DT  B 2 6   ? 21.360  1.805   -4.625  1.00 44.28 ? 106  DT  D O2    1 
ATOM   569  N  N3    . DT  B 2 6   ? 23.098  3.154   -4.067  1.00 25.56 ? 106  DT  D N3    1 
ATOM   570  C  C4    . DT  B 2 6   ? 23.697  4.370   -3.846  1.00 28.70 ? 106  DT  D C4    1 
ATOM   571  O  O4    . DT  B 2 6   ? 24.867  4.418   -3.487  1.00 32.51 ? 106  DT  D O4    1 
ATOM   572  C  C5    . DT  B 2 6   ? 22.851  5.527   -4.061  1.00 27.06 ? 106  DT  D C5    1 
ATOM   573  C  C7    . DT  B 2 6   ? 23.430  6.885   -3.854  1.00 20.98 ? 106  DT  D C7    1 
ATOM   574  C  C6    . DT  B 2 6   ? 21.576  5.320   -4.438  1.00 30.72 ? 106  DT  D C6    1 
HETATM 575  N  N1    . BRU B 2 7   ? 20.276  1.784   -1.250  1.00 45.69 ? 107  BRU D N1    1 
HETATM 576  C  C2    . BRU B 2 7   ? 21.488  1.150   -1.064  1.00 38.34 ? 107  BRU D C2    1 
HETATM 577  N  N3    . BRU B 2 7   ? 22.542  1.987   -0.829  1.00 35.53 ? 107  BRU D N3    1 
HETATM 578  C  C4    . BRU B 2 7   ? 22.516  3.359   -0.739  1.00 36.82 ? 107  BRU D C4    1 
HETATM 579  C  C5    . BRU B 2 7   ? 21.222  3.957   -0.889  1.00 36.95 ? 107  BRU D C5    1 
HETATM 580  C  C6    . BRU B 2 7   ? 20.170  3.151   -1.128  1.00 42.29 ? 107  BRU D C6    1 
HETATM 581  O  O2    . BRU B 2 7   ? 21.627  -0.051  -1.100  1.00 37.08 ? 107  BRU D O2    1 
HETATM 582  O  O4    . BRU B 2 7   ? 23.554  3.993   -0.547  1.00 32.04 ? 107  BRU D O4    1 
HETATM 583  BR BR    . BRU B 2 7   ? 21.076  6.034   -0.735  0.27 48.08 ? 107  BRU D BR    1 
HETATM 584  C  "C1'" . BRU B 2 7   ? 19.107  0.952   -1.634  1.00 53.63 ? 107  BRU D "C1'" 1 
HETATM 585  C  "C2'" . BRU B 2 7   ? 17.772  1.160   -0.931  1.00 56.06 ? 107  BRU D "C2'" 1 
HETATM 586  C  "C3'" . BRU B 2 7   ? 16.787  0.593   -1.950  1.00 59.50 ? 107  BRU D "C3'" 1 
HETATM 587  C  "C4'" . BRU B 2 7   ? 17.460  0.892   -3.285  1.00 63.09 ? 107  BRU D "C4'" 1 
HETATM 588  O  "O3'" . BRU B 2 7   ? 16.684  -0.831  -1.911  1.00 60.23 ? 107  BRU D "O3'" 1 
HETATM 589  O  "O4'" . BRU B 2 7   ? 18.837  1.218   -2.997  1.00 60.53 ? 107  BRU D "O4'" 1 
HETATM 590  C  "C5'" . BRU B 2 7   ? 16.796  1.909   -4.177  1.00 67.92 ? 107  BRU D "C5'" 1 
HETATM 591  O  "O5'" . BRU B 2 7   ? 16.220  2.964   -3.404  1.00 72.78 ? 107  BRU D "O5'" 1 
HETATM 592  P  P     . BRU B 2 7   ? 15.399  4.093   -4.161  1.00 75.11 ? 107  BRU D P     1 
HETATM 593  O  OP1   . BRU B 2 7   ? 14.171  3.433   -4.687  1.00 71.70 ? 107  BRU D OP1   1 
HETATM 594  O  OP2   . BRU B 2 7   ? 15.270  5.276   -3.261  1.00 73.44 ? 107  BRU D OP2   1 
HETATM 595  N  N1    . BRU B 2 8   ? 20.954  -0.293  2.154   1.00 34.00 ? 108  BRU D N1    1 
HETATM 596  C  C2    . BRU B 2 8   ? 22.252  -0.050  2.566   1.00 34.91 ? 108  BRU D C2    1 
HETATM 597  N  N3    . BRU B 2 8   ? 22.550  1.271   2.808   1.00 33.77 ? 108  BRU D N3    1 
HETATM 598  C  C4    . BRU B 2 8   ? 21.695  2.349   2.689   1.00 36.55 ? 108  BRU D C4    1 
HETATM 599  C  C5    . BRU B 2 8   ? 20.345  2.029   2.298   1.00 32.88 ? 108  BRU D C5    1 
HETATM 600  C  C6    . BRU B 2 8   ? 20.037  0.737   2.056   1.00 33.91 ? 108  BRU D C6    1 
HETATM 601  O  O2    . BRU B 2 8   ? 23.078  -0.937  2.712   1.00 32.32 ? 108  BRU D O2    1 
HETATM 602  O  O4    . BRU B 2 8   ? 22.106  3.490   2.892   1.00 29.61 ? 108  BRU D O4    1 
HETATM 603  BR BR    . BRU B 2 8   ? 18.971  3.595   2.141   0.24 46.77 ? 108  BRU D BR    1 
HETATM 604  C  "C1'" . BRU B 2 8   ? 20.634  -1.696  1.800   1.00 34.07 ? 108  BRU D "C1'" 1 
HETATM 605  C  "C2'" . BRU B 2 8   ? 19.525  -2.421  2.525   1.00 35.64 ? 108  BRU D "C2'" 1 
HETATM 606  C  "C3'" . BRU B 2 8   ? 19.296  -3.589  1.572   1.00 39.19 ? 108  BRU D "C3'" 1 
HETATM 607  C  "C4'" . BRU B 2 8   ? 19.571  -2.977  0.199   1.00 41.44 ? 108  BRU D "C4'" 1 
HETATM 608  O  "O3'" . BRU B 2 8   ? 20.249  -4.626  1.811   1.00 41.34 ? 108  BRU D "O3'" 1 
HETATM 609  O  "O4'" . BRU B 2 8   ? 20.262  -1.734  0.443   1.00 36.25 ? 108  BRU D "O4'" 1 
HETATM 610  C  "C5'" . BRU B 2 8   ? 18.356  -2.746  -0.666  1.00 48.71 ? 108  BRU D "C5'" 1 
HETATM 611  O  "O5'" . BRU B 2 8   ? 17.297  -2.119  0.091   1.00 57.49 ? 108  BRU D "O5'" 1 
HETATM 612  P  P     . BRU B 2 8   ? 16.012  -1.571  -0.666  1.00 59.45 ? 108  BRU D P     1 
HETATM 613  O  OP1   . BRU B 2 8   ? 15.309  -2.737  -1.247  1.00 59.42 ? 108  BRU D OP1   1 
HETATM 614  O  OP2   . BRU B 2 8   ? 15.279  -0.625  0.226   1.00 58.87 ? 108  BRU D OP2   1 
HETATM 615  N  N1    . BRU B 2 9   ? 22.659  -1.834  5.620   1.00 35.28 ? 109  BRU D N1    1 
HETATM 616  C  C2    . BRU B 2 9   ? 23.437  -0.692  5.819   1.00 33.19 ? 109  BRU D C2    1 
HETATM 617  N  N3    . BRU B 2 9   ? 22.730  0.495   5.841   1.00 23.05 ? 109  BRU D N3    1 
HETATM 618  C  C4    . BRU B 2 9   ? 21.369  0.657   5.711   1.00 21.80 ? 109  BRU D C4    1 
HETATM 619  C  C5    . BRU B 2 9   ? 20.616  -0.571  5.516   1.00 21.49 ? 109  BRU D C5    1 
HETATM 620  C  C6    . BRU B 2 9   ? 21.289  -1.736  5.479   1.00 27.07 ? 109  BRU D C6    1 
HETATM 621  O  O2    . BRU B 2 9   ? 24.655  -0.721  5.969   1.00 36.27 ? 109  BRU D O2    1 
HETATM 622  O  O4    . BRU B 2 9   ? 20.883  1.786   5.771   1.00 16.65 ? 109  BRU D O4    1 
HETATM 623  BR BR    . BRU B 2 9   ? 18.536  -0.454  5.311   0.18 31.02 ? 109  BRU D BR    1 
HETATM 624  C  "C1'" . BRU B 2 9   ? 23.358  -3.154  5.548   1.00 39.88 ? 109  BRU D "C1'" 1 
HETATM 625  C  "C2'" . BRU B 2 9   ? 22.726  -4.330  6.273   1.00 42.73 ? 109  BRU D "C2'" 1 
HETATM 626  C  "C3'" . BRU B 2 9   ? 23.357  -5.513  5.547   1.00 47.32 ? 109  BRU D "C3'" 1 
HETATM 627  C  "C4'" . BRU B 2 9   ? 23.523  -5.001  4.119   1.00 47.16 ? 109  BRU D "C4'" 1 
HETATM 628  O  "O3'" . BRU B 2 9   ? 24.641  -5.807  6.093   1.00 56.06 ? 109  BRU D "O3'" 1 
HETATM 629  O  "O4'" . BRU B 2 9   ? 23.391  -3.560  4.189   1.00 44.73 ? 109  BRU D "O4'" 1 
HETATM 630  C  "C5'" . BRU B 2 9   ? 22.560  -5.600  3.123   1.00 43.20 ? 109  BRU D "C5'" 1 
HETATM 631  O  "O5'" . BRU B 2 9   ? 21.305  -5.820  3.749   1.00 40.75 ? 109  BRU D "O5'" 1 
HETATM 632  P  P     . BRU B 2 9   ? 19.953  -5.727  2.925   1.00 43.13 ? 109  BRU D P     1 
HETATM 633  O  OP1   . BRU B 2 9   ? 19.712  -7.003  2.219   1.00 44.00 ? 109  BRU D OP1   1 
HETATM 634  O  OP2   . BRU B 2 9   ? 18.934  -5.176  3.847   1.00 46.24 ? 109  BRU D OP2   1 
HETATM 635  N  N1    . BRU B 2 10  ? 25.444  -1.754  9.186   1.00 43.29 ? 110  BRU D N1    1 
HETATM 636  C  C2    . BRU B 2 10  ? 25.363  -0.364  9.276   1.00 37.34 ? 110  BRU D C2    1 
HETATM 637  N  N3    . BRU B 2 10  ? 24.089  0.137   9.297   1.00 21.46 ? 110  BRU D N3    1 
HETATM 638  C  C4    . BRU B 2 10  ? 22.920  -0.582  9.275   1.00 29.07 ? 110  BRU D C4    1 
HETATM 639  C  C5    . BRU B 2 10  ? 23.073  -2.019  9.212   1.00 34.48 ? 110  BRU D C5    1 
HETATM 640  C  C6    . BRU B 2 10  ? 24.308  -2.526  9.167   1.00 40.24 ? 110  BRU D C6    1 
HETATM 641  O  O2    . BRU B 2 10  ? 26.327  0.371   9.351   1.00 42.80 ? 110  BRU D O2    1 
HETATM 642  O  O4    . BRU B 2 10  ? 21.850  0.002   9.311   1.00 25.69 ? 110  BRU D O4    1 
HETATM 643  BR BR    . BRU B 2 10  ? 21.355  -3.219  9.203   0.29 57.12 ? 110  BRU D BR    1 
HETATM 644  C  "C1'" . BRU B 2 10  ? 26.770  -2.422  9.085   1.00 48.26 ? 110  BRU D "C1'" 1 
HETATM 645  C  "C2'" . BRU B 2 10  ? 27.055  -3.487  10.134  1.00 48.69 ? 110  BRU D "C2'" 1 
HETATM 646  C  "C3'" . BRU B 2 10  ? 28.073  -4.377  9.432   1.00 53.60 ? 110  BRU D "C3'" 1 
HETATM 647  C  "C4'" . BRU B 2 10  ? 27.715  -4.242  7.948   1.00 55.06 ? 110  BRU D "C4'" 1 
HETATM 648  O  "O3'" . BRU B 2 10  ? 29.406  -3.890  9.625   1.00 57.45 ? 110  BRU D "O3'" 1 
HETATM 649  O  "O4'" . BRU B 2 10  ? 26.817  -3.112  7.843   1.00 52.52 ? 110  BRU D "O4'" 1 
HETATM 650  C  "C5'" . BRU B 2 10  ? 27.117  -5.466  7.294   1.00 58.17 ? 110  BRU D "C5'" 1 
HETATM 651  O  "O5'" . BRU B 2 10  ? 26.089  -6.035  8.122   1.00 61.44 ? 110  BRU D "O5'" 1 
HETATM 652  P  P     . BRU B 2 10  ? 24.761  -6.625  7.472   1.00 63.32 ? 110  BRU D P     1 
HETATM 653  O  OP1   . BRU B 2 10  ? 24.919  -8.075  7.139   1.00 63.27 ? 110  BRU D OP1   1 
HETATM 654  O  OP2   . BRU B 2 10  ? 23.639  -6.202  8.347   1.00 64.59 ? 110  BRU D OP2   1 
ATOM   655  P  P     . DC  B 2 11  ? 30.140  -4.069  11.052  1.00 61.45 ? 111  DC  D P     1 
ATOM   656  O  OP1   . DC  B 2 11  ? 31.523  -4.570  10.761  1.00 60.69 ? 111  DC  D OP1   1 
ATOM   657  O  OP2   . DC  B 2 11  ? 29.212  -4.843  11.937  1.00 63.14 ? 111  DC  D OP2   1 
ATOM   658  O  "O5'" . DC  B 2 11  ? 30.252  -2.586  11.600  1.00 51.12 ? 111  DC  D "O5'" 1 
ATOM   659  C  "C5'" . DC  B 2 11  ? 29.156  -1.714  11.428  1.00 40.97 ? 111  DC  D "C5'" 1 
ATOM   660  C  "C4'" . DC  B 2 11  ? 29.466  -0.367  12.014  1.00 33.95 ? 111  DC  D "C4'" 1 
ATOM   661  O  "O4'" . DC  B 2 11  ? 28.278  0.416   11.780  1.00 29.11 ? 111  DC  D "O4'" 1 
ATOM   662  C  "C3'" . DC  B 2 11  ? 29.677  -0.405  13.526  1.00 32.19 ? 111  DC  D "C3'" 1 
ATOM   663  O  "O3'" . DC  B 2 11  ? 30.724  0.489   13.925  1.00 31.69 ? 111  DC  D "O3'" 1 
ATOM   664  C  "C2'" . DC  B 2 11  ? 28.318  -0.026  14.084  1.00 26.57 ? 111  DC  D "C2'" 1 
ATOM   665  C  "C1'" . DC  B 2 11  ? 27.658  0.785   12.979  1.00 23.99 ? 111  DC  D "C1'" 1 
ATOM   666  N  N1    . DC  B 2 11  ? 26.237  0.491   12.834  1.00 18.62 ? 111  DC  D N1    1 
ATOM   667  C  C2    . DC  B 2 11  ? 25.324  1.541   12.894  1.00 22.58 ? 111  DC  D C2    1 
ATOM   668  O  O2    . DC  B 2 11  ? 25.761  2.690   13.015  1.00 23.94 ? 111  DC  D O2    1 
ATOM   669  N  N3    . DC  B 2 11  ? 23.988  1.274   12.814  1.00 17.48 ? 111  DC  D N3    1 
ATOM   670  C  C4    . DC  B 2 11  ? 23.574  0.000   12.675  1.00 23.19 ? 111  DC  D C4    1 
ATOM   671  N  N4    . DC  B 2 11  ? 22.243  -0.247  12.614  1.00 16.52 ? 111  DC  D N4    1 
ATOM   672  C  C5    . DC  B 2 11  ? 24.499  -1.083  12.594  1.00 13.58 ? 111  DC  D C5    1 
ATOM   673  C  C6    . DC  B 2 11  ? 25.808  -0.793  12.671  1.00 19.97 ? 111  DC  D C6    1 
HETATM 674  N  N1    . BRU B 2 12  ? 26.245  1.292   16.878  1.00 27.22 ? 112  BRU D N1    1 
HETATM 675  C  C2    . BRU B 2 12  ? 25.107  1.977   16.526  1.00 24.98 ? 112  BRU D C2    1 
HETATM 676  N  N3    . BRU B 2 12  ? 24.056  1.185   16.195  1.00 19.22 ? 112  BRU D N3    1 
HETATM 677  C  C4    . BRU B 2 12  ? 24.029  -0.187  16.167  1.00 23.44 ? 112  BRU D C4    1 
HETATM 678  C  C5    . BRU B 2 12  ? 25.260  -0.831  16.475  1.00 23.47 ? 112  BRU D C5    1 
HETATM 679  C  C6    . BRU B 2 12  ? 26.302  -0.075  16.803  1.00 28.52 ? 112  BRU D C6    1 
HETATM 680  O  O2    . BRU B 2 12  ? 25.031  3.195   16.502  1.00 33.49 ? 112  BRU D O2    1 
HETATM 681  O  O4    . BRU B 2 12  ? 22.996  -0.769  15.910  1.00 24.58 ? 112  BRU D O4    1 
HETATM 682  BR BR    . BRU B 2 12  ? 25.355  -2.918  16.400  0.44 69.17 ? 112  BRU D BR    1 
HETATM 683  C  "C1'" . BRU B 2 12  ? 27.377  2.070   17.403  1.00 29.59 ? 112  BRU D "C1'" 1 
HETATM 684  C  "C2'" . BRU B 2 12  ? 28.333  1.392   18.354  1.00 25.95 ? 112  BRU D "C2'" 1 
HETATM 685  C  "C3'" . BRU B 2 12  ? 29.386  2.484   18.394  1.00 26.06 ? 112  BRU D "C3'" 1 
HETATM 686  C  "C4'" . BRU B 2 12  ? 29.427  2.955   16.939  1.00 27.69 ? 112  BRU D "C4'" 1 
HETATM 687  O  "O3'" . BRU B 2 12  ? 28.859  3.549   19.183  1.00 28.89 ? 112  BRU D "O3'" 1 
HETATM 688  O  "O4'" . BRU B 2 12  ? 28.190  2.502   16.336  1.00 28.50 ? 112  BRU D "O4'" 1 
HETATM 689  C  "C5'" . BRU B 2 12  ? 30.624  2.469   16.161  1.00 31.46 ? 112  BRU D "C5'" 1 
HETATM 690  O  "O5'" . BRU B 2 12  ? 30.819  1.060   16.372  1.00 37.42 ? 112  BRU D "O5'" 1 
HETATM 691  P  P     . BRU B 2 12  ? 31.567  0.190   15.275  1.00 38.14 ? 112  BRU D P     1 
HETATM 692  O  OP1   . BRU B 2 12  ? 32.920  0.778   15.087  1.00 31.30 ? 112  BRU D OP1   1 
HETATM 693  O  OP2   . BRU B 2 12  ? 31.440  -1.231  15.661  1.00 38.88 ? 112  BRU D OP2   1 
ATOM   694  P  P     . DA  B 2 13  ? 29.741  4.224   20.340  1.00 27.79 ? 113  DA  D P     1 
ATOM   695  O  OP1   . DA  B 2 13  ? 31.059  4.493   19.782  1.00 27.16 ? 113  DA  D OP1   1 
ATOM   696  O  OP2   . DA  B 2 13  ? 29.627  3.427   21.540  1.00 19.88 ? 113  DA  D OP2   1 
ATOM   697  O  "O5'" . DA  B 2 13  ? 29.000  5.612   20.541  1.00 26.28 ? 113  DA  D "O5'" 1 
ATOM   698  C  "C5'" . DA  B 2 13  ? 28.780  6.468   19.406  1.00 21.27 ? 113  DA  D "C5'" 1 
ATOM   699  C  "C4'" . DA  B 2 13  ? 27.357  6.969   19.407  1.00 19.80 ? 113  DA  D "C4'" 1 
ATOM   700  O  "O4'" . DA  B 2 13  ? 26.413  5.949   18.981  1.00 19.11 ? 113  DA  D "O4'" 1 
ATOM   701  C  "C3'" . DA  B 2 13  ? 26.893  7.430   20.786  1.00 19.63 ? 113  DA  D "C3'" 1 
ATOM   702  O  "O3'" . DA  B 2 13  ? 26.147  8.628   20.609  1.00 22.06 ? 113  DA  D "O3'" 1 
ATOM   703  C  "C2'" . DA  B 2 13  ? 25.992  6.300   21.254  1.00 18.96 ? 113  DA  D "C2'" 1 
ATOM   704  C  "C1'" . DA  B 2 13  ? 25.374  5.828   19.954  1.00 19.91 ? 113  DA  D "C1'" 1 
ATOM   705  N  N9    . DA  B 2 13  ? 24.911  4.436   19.955  1.00 17.84 ? 113  DA  D N9    1 
ATOM   706  C  C8    . DA  B 2 13  ? 25.617  3.310   20.280  1.00 17.52 ? 113  DA  D C8    1 
ATOM   707  N  N7    . DA  B 2 13  ? 24.940  2.192   20.110  1.00 19.38 ? 113  DA  D N7    1 
ATOM   708  C  C5    . DA  B 2 13  ? 23.696  2.621   19.664  1.00 12.53 ? 113  DA  D C5    1 
ATOM   709  C  C6    . DA  B 2 13  ? 22.521  1.912   19.281  1.00 19.04 ? 113  DA  D C6    1 
ATOM   710  N  N6    . DA  B 2 13  ? 22.427  0.593   19.271  1.00 18.33 ? 113  DA  D N6    1 
ATOM   711  N  N1    . DA  B 2 13  ? 21.438  2.634   18.895  1.00 11.02 ? 113  DA  D N1    1 
ATOM   712  C  C2    . DA  B 2 13  ? 21.549  3.970   18.881  1.00 18.31 ? 113  DA  D C2    1 
ATOM   713  N  N3    . DA  B 2 13  ? 22.607  4.744   19.198  1.00 23.34 ? 113  DA  D N3    1 
ATOM   714  C  C4    . DA  B 2 13  ? 23.657  3.998   19.584  1.00 19.40 ? 113  DA  D C4    1 
ATOM   715  P  P     . DA  B 2 14  ? 25.572  9.400   21.884  1.00 26.36 ? 114  DA  D P     1 
ATOM   716  O  OP1   . DA  B 2 14  ? 25.490  10.783  21.463  1.00 28.52 ? 114  DA  D OP1   1 
ATOM   717  O  OP2   . DA  B 2 14  ? 26.351  9.062   23.092  1.00 28.44 ? 114  DA  D OP2   1 
ATOM   718  O  "O5'" . DA  B 2 14  ? 24.103  8.821   21.989  1.00 21.31 ? 114  DA  D "O5'" 1 
ATOM   719  C  "C5'" . DA  B 2 14  ? 23.139  9.124   20.998  1.00 21.16 ? 114  DA  D "C5'" 1 
ATOM   720  C  "C4'" . DA  B 2 14  ? 21.778  8.725   21.506  1.00 25.48 ? 114  DA  D "C4'" 1 
ATOM   721  O  "O4'" . DA  B 2 14  ? 21.635  7.288   21.433  1.00 27.45 ? 114  DA  D "O4'" 1 
ATOM   722  C  "C3'" . DA  B 2 14  ? 21.569  9.084   22.981  1.00 31.27 ? 114  DA  D "C3'" 1 
ATOM   723  O  "O3'" . DA  B 2 14  ? 20.160  9.306   23.196  1.00 33.95 ? 114  DA  D "O3'" 1 
ATOM   724  C  "C2'" . DA  B 2 14  ? 22.012  7.812   23.693  1.00 23.25 ? 114  DA  D "C2'" 1 
ATOM   725  C  "C1'" . DA  B 2 14  ? 21.403  6.788   22.745  1.00 26.76 ? 114  DA  D "C1'" 1 
ATOM   726  N  N9    . DA  B 2 14  ? 21.917  5.423   22.813  1.00 20.53 ? 114  DA  D N9    1 
ATOM   727  C  C8    . DA  B 2 14  ? 23.167  5.006   23.153  1.00 14.71 ? 114  DA  D C8    1 
ATOM   728  N  N7    . DA  B 2 14  ? 23.293  3.708   23.183  1.00 15.67 ? 114  DA  D N7    1 
ATOM   729  C  C5    . DA  B 2 14  ? 22.045  3.236   22.825  1.00 12.22 ? 114  DA  D C5    1 
ATOM   730  C  C6    . DA  B 2 14  ? 21.535  1.930   22.669  1.00 17.94 ? 114  DA  D C6    1 
ATOM   731  N  N6    . DA  B 2 14  ? 22.253  0.838   22.878  1.00 15.26 ? 114  DA  D N6    1 
ATOM   732  N  N1    . DA  B 2 14  ? 20.239  1.793   22.284  1.00 18.70 ? 114  DA  D N1    1 
ATOM   733  C  C2    . DA  B 2 14  ? 19.520  2.905   22.074  1.00 19.70 ? 114  DA  D C2    1 
ATOM   734  N  N3    . DA  B 2 14  ? 19.896  4.187   22.191  1.00 20.62 ? 114  DA  D N3    1 
ATOM   735  C  C4    . DA  B 2 14  ? 21.187  4.280   22.576  1.00 16.88 ? 114  DA  D C4    1 
ATOM   736  P  P     . DG  B 2 15  ? 19.656  10.591  24.020  1.00 25.32 ? 115  DG  D P     1 
ATOM   737  O  OP1   . DG  B 2 15  ? 19.555  11.717  23.028  1.00 26.89 ? 115  DG  D OP1   1 
ATOM   738  O  OP2   . DG  B 2 15  ? 20.513  10.731  25.232  1.00 25.87 ? 115  DG  D OP2   1 
ATOM   739  O  "O5'" . DG  B 2 15  ? 18.188  10.157  24.444  1.00 25.43 ? 115  DG  D "O5'" 1 
ATOM   740  C  "C5'" . DG  B 2 15  ? 17.984  8.997   25.251  1.00 24.97 ? 115  DG  D "C5'" 1 
ATOM   741  C  "C4'" . DG  B 2 15  ? 16.913  8.125   24.642  1.00 17.10 ? 115  DG  D "C4'" 1 
ATOM   742  O  "O4'" . DG  B 2 15  ? 17.578  7.012   24.000  1.00 15.24 ? 115  DG  D "O4'" 1 
ATOM   743  C  "C3'" . DG  B 2 15  ? 16.035  7.527   25.716  1.00 15.68 ? 115  DG  D "C3'" 1 
ATOM   744  O  "O3'" . DG  B 2 15  ? 14.679  7.836   25.559  1.00 15.58 ? 115  DG  D "O3'" 1 
ATOM   745  C  "C2'" . DG  B 2 15  ? 16.227  6.024   25.645  1.00 19.66 ? 115  DG  D "C2'" 1 
ATOM   746  C  "C1'" . DG  B 2 15  ? 17.093  5.751   24.444  1.00 15.14 ? 115  DG  D "C1'" 1 
ATOM   747  N  N9    . DG  B 2 15  ? 18.242  4.946   24.879  1.00 19.65 ? 115  DG  D N9    1 
ATOM   748  C  C8    . DG  B 2 15  ? 19.484  5.407   25.281  1.00 18.19 ? 115  DG  D C8    1 
ATOM   749  N  N7    . DG  B 2 15  ? 20.287  4.454   25.684  1.00 10.90 ? 115  DG  D N7    1 
ATOM   750  C  C5    . DG  B 2 15  ? 19.553  3.291   25.510  1.00 9.06  ? 115  DG  D C5    1 
ATOM   751  C  C6    . DG  B 2 15  ? 19.913  1.949   25.748  1.00 14.77 ? 115  DG  D C6    1 
ATOM   752  O  O6    . DG  B 2 15  ? 20.998  1.495   26.151  1.00 22.13 ? 115  DG  D O6    1 
ATOM   753  N  N1    . DG  B 2 15  ? 18.860  1.080   25.461  1.00 15.37 ? 115  DG  D N1    1 
ATOM   754  C  C2    . DG  B 2 15  ? 17.626  1.459   24.992  1.00 14.17 ? 115  DG  D C2    1 
ATOM   755  N  N2    . DG  B 2 15  ? 16.757  0.475   24.821  1.00 16.05 ? 115  DG  D N2    1 
ATOM   756  N  N3    . DG  B 2 15  ? 17.288  2.707   24.729  1.00 19.87 ? 115  DG  D N3    1 
ATOM   757  C  C4    . DG  B 2 15  ? 18.288  3.567   25.012  1.00 16.76 ? 115  DG  D C4    1 
ATOM   758  P  P     . DT  B 2 16  ? 13.764  7.811   26.860  1.00 21.91 ? 116  DT  D P     1 
ATOM   759  O  OP1   . DT  B 2 16  ? 12.481  8.507   26.594  1.00 26.51 ? 116  DT  D OP1   1 
ATOM   760  O  OP2   . DT  B 2 16  ? 14.569  8.157   27.999  1.00 17.69 ? 116  DT  D OP2   1 
ATOM   761  O  "O5'" . DT  B 2 16  ? 13.411  6.279   27.008  1.00 19.82 ? 116  DT  D "O5'" 1 
ATOM   762  C  "C5'" . DT  B 2 16  ? 12.745  5.626   25.950  1.00 19.10 ? 116  DT  D "C5'" 1 
ATOM   763  C  "C4'" . DT  B 2 16  ? 12.372  4.230   26.363  1.00 19.72 ? 116  DT  D "C4'" 1 
ATOM   764  O  "O4'" . DT  B 2 16  ? 13.559  3.423   26.452  1.00 22.86 ? 116  DT  D "O4'" 1 
ATOM   765  C  "C3'" . DT  B 2 16  ? 11.705  4.139   27.718  1.00 21.71 ? 116  DT  D "C3'" 1 
ATOM   766  O  "O3'" . DT  B 2 16  ? 10.679  3.184   27.603  1.00 23.58 ? 116  DT  D "O3'" 1 
ATOM   767  C  "C2'" . DT  B 2 16  ? 12.811  3.677   28.653  1.00 20.92 ? 116  DT  D "C2'" 1 
ATOM   768  C  "C1'" . DT  B 2 16  ? 13.663  2.825   27.725  1.00 24.36 ? 116  DT  D "C1'" 1 
ATOM   769  N  N1    . DT  B 2 16  ? 15.100  2.748   28.055  1.00 26.00 ? 116  DT  D N1    1 
ATOM   770  C  C2    . DT  B 2 16  ? 15.707  1.504   28.147  1.00 23.58 ? 116  DT  D C2    1 
ATOM   771  O  O2    . DT  B 2 16  ? 15.125  0.469   28.019  1.00 25.13 ? 116  DT  D O2    1 
ATOM   772  N  N3    . DT  B 2 16  ? 17.042  1.529   28.408  1.00 20.68 ? 116  DT  D N3    1 
ATOM   773  C  C4    . DT  B 2 16  ? 17.808  2.633   28.626  1.00 22.37 ? 116  DT  D C4    1 
ATOM   774  O  O4    . DT  B 2 16  ? 18.998  2.514   28.853  1.00 24.51 ? 116  DT  D O4    1 
ATOM   775  C  C5    . DT  B 2 16  ? 17.125  3.885   28.560  1.00 18.12 ? 116  DT  D C5    1 
ATOM   776  C  C7    . DT  B 2 16  ? 17.913  5.108   28.855  1.00 11.90 ? 116  DT  D C7    1 
ATOM   777  C  C6    . DT  B 2 16  ? 15.823  3.901   28.264  1.00 20.58 ? 116  DT  D C6    1 
ATOM   778  P  P     . DC  B 2 17  ? 9.515   3.152   28.691  1.00 24.50 ? 117  DC  D P     1 
ATOM   779  O  OP1   . DC  B 2 17  ? 8.288   2.795   27.945  1.00 29.71 ? 117  DC  D OP1   1 
ATOM   780  O  OP2   . DC  B 2 17  ? 9.550   4.370   29.516  1.00 25.80 ? 117  DC  D OP2   1 
ATOM   781  O  "O5'" . DC  B 2 17  ? 9.936   1.902   29.561  1.00 24.17 ? 117  DC  D "O5'" 1 
ATOM   782  C  "C5'" . DC  B 2 17  ? 10.107  0.656   28.921  1.00 24.81 ? 117  DC  D "C5'" 1 
ATOM   783  C  "C4'" . DC  B 2 17  ? 10.894  -0.280  29.796  1.00 20.86 ? 117  DC  D "C4'" 1 
ATOM   784  O  "O4'" . DC  B 2 17  ? 12.270  0.147   29.851  1.00 22.72 ? 117  DC  D "O4'" 1 
ATOM   785  C  "C3'" . DC  B 2 17  ? 10.416  -0.346  31.242  1.00 21.77 ? 117  DC  D "C3'" 1 
ATOM   786  O  "O3'" . DC  B 2 17  ? 10.174  -1.705  31.556  1.00 32.78 ? 117  DC  D "O3'" 1 
ATOM   787  C  "C2'" . DC  B 2 17  ? 11.603  0.166   32.042  1.00 18.90 ? 117  DC  D "C2'" 1 
ATOM   788  C  "C1'" . DC  B 2 17  ? 12.755  -0.174  31.132  1.00 18.81 ? 117  DC  D "C1'" 1 
ATOM   789  N  N1    . DC  B 2 17  ? 14.005  0.573   31.355  1.00 21.54 ? 117  DC  D N1    1 
ATOM   790  C  C2    . DC  B 2 17  ? 15.211  -0.144  31.502  1.00 22.81 ? 117  DC  D C2    1 
ATOM   791  O  O2    . DC  B 2 17  ? 15.201  -1.380  31.436  1.00 30.57 ? 117  DC  D O2    1 
ATOM   792  N  N3    . DC  B 2 17  ? 16.350  0.527   31.717  1.00 16.18 ? 117  DC  D N3    1 
ATOM   793  C  C4    . DC  B 2 17  ? 16.333  1.856   31.790  1.00 16.60 ? 117  DC  D C4    1 
ATOM   794  N  N4    . DC  B 2 17  ? 17.493  2.474   31.998  1.00 11.39 ? 117  DC  D N4    1 
ATOM   795  C  C5    . DC  B 2 17  ? 15.136  2.608   31.650  1.00 13.89 ? 117  DC  D C5    1 
ATOM   796  C  C6    . DC  B 2 17  ? 14.005  1.936   31.427  1.00 22.26 ? 117  DC  D C6    1 
ATOM   797  P  P     . DT  B 2 18  ? 9.761   -2.125  33.052  1.00 43.31 ? 118  DT  D P     1 
ATOM   798  O  OP1   . DT  B 2 18  ? 8.628   -3.075  32.972  1.00 44.80 ? 118  DT  D OP1   1 
ATOM   799  O  OP2   . DT  B 2 18  ? 9.671   -0.947  33.972  1.00 39.26 ? 118  DT  D OP2   1 
ATOM   800  O  "O5'" . DT  B 2 18  ? 11.003  -3.010  33.479  1.00 40.77 ? 118  DT  D "O5'" 1 
ATOM   801  C  "C5'" . DT  B 2 18  ? 11.426  -4.048  32.613  1.00 38.21 ? 118  DT  D "C5'" 1 
ATOM   802  C  "C4'" . DT  B 2 18  ? 12.626  -4.734  33.199  1.00 39.87 ? 118  DT  D "C4'" 1 
ATOM   803  O  "O4'" . DT  B 2 18  ? 13.694  -3.773  33.293  1.00 35.25 ? 118  DT  D "O4'" 1 
ATOM   804  C  "C3'" . DT  B 2 18  ? 12.400  -5.243  34.619  1.00 41.95 ? 118  DT  D "C3'" 1 
ATOM   805  O  "O3'" . DT  B 2 18  ? 13.100  -6.485  34.737  1.00 49.61 ? 118  DT  D "O3'" 1 
ATOM   806  C  "C2'" . DT  B 2 18  ? 13.016  -4.146  35.479  1.00 35.71 ? 118  DT  D "C2'" 1 
ATOM   807  C  "C1'" . DT  B 2 18  ? 14.183  -3.749  34.611  1.00 31.29 ? 118  DT  D "C1'" 1 
ATOM   808  N  N1    . DT  B 2 18  ? 14.772  -2.433  34.839  1.00 29.54 ? 118  DT  D N1    1 
ATOM   809  C  C2    . DT  B 2 18  ? 16.141  -2.365  35.093  1.00 28.56 ? 118  DT  D C2    1 
ATOM   810  O  O2    . DT  B 2 18  ? 16.840  -3.344  35.229  1.00 27.92 ? 118  DT  D O2    1 
ATOM   811  N  N3    . DT  B 2 18  ? 16.648  -1.101  35.210  1.00 22.05 ? 118  DT  D N3    1 
ATOM   812  C  C4    . DT  B 2 18  ? 15.949  0.075   35.143  1.00 27.91 ? 118  DT  D C4    1 
ATOM   813  O  O4    . DT  B 2 18  ? 16.549  1.148   35.267  1.00 25.24 ? 118  DT  D O4    1 
ATOM   814  C  C5    . DT  B 2 18  ? 14.506  -0.067  34.927  1.00 26.45 ? 118  DT  D C5    1 
ATOM   815  C  C7    . DT  B 2 18  ? 13.657  1.156   34.891  1.00 19.27 ? 118  DT  D C7    1 
ATOM   816  C  C6    . DT  B 2 18  ? 13.998  -1.301  34.777  1.00 22.25 ? 118  DT  D C6    1 
ATOM   817  P  P     . DT  B 2 19  ? 12.735  -7.519  35.913  1.00 54.31 ? 119  DT  D P     1 
ATOM   818  O  OP1   . DT  B 2 19  ? 12.397  -8.829  35.268  1.00 55.22 ? 119  DT  D OP1   1 
ATOM   819  O  OP2   . DT  B 2 19  ? 11.792  -6.895  36.887  1.00 46.59 ? 119  DT  D OP2   1 
ATOM   820  O  "O5'" . DT  B 2 19  ? 14.130  -7.676  36.648  1.00 53.51 ? 119  DT  D "O5'" 1 
ATOM   821  C  "C5'" . DT  B 2 19  ? 14.978  -6.545  36.738  1.00 49.70 ? 119  DT  D "C5'" 1 
ATOM   822  C  "C4'" . DT  B 2 19  ? 16.302  -6.934  37.328  1.00 44.87 ? 119  DT  D "C4'" 1 
ATOM   823  O  "O4'" . DT  B 2 19  ? 17.080  -5.729  37.329  1.00 42.97 ? 119  DT  D "O4'" 1 
ATOM   824  C  "C3'" . DT  B 2 19  ? 16.215  -7.382  38.780  1.00 47.06 ? 119  DT  D "C3'" 1 
ATOM   825  O  "O3'" . DT  B 2 19  ? 17.229  -8.365  39.018  1.00 54.67 ? 119  DT  D "O3'" 1 
ATOM   826  C  "C2'" . DT  B 2 19  ? 16.444  -6.094  39.553  1.00 43.36 ? 119  DT  D "C2'" 1 
ATOM   827  C  "C1'" . DT  B 2 19  ? 17.328  -5.270  38.636  1.00 37.84 ? 119  DT  D "C1'" 1 
ATOM   828  N  N1    . DT  B 2 19  ? 16.987  -3.858  38.644  1.00 32.67 ? 119  DT  D N1    1 
ATOM   829  C  C2    . DT  B 2 19  ? 17.994  -2.910  38.676  1.00 30.09 ? 119  DT  D C2    1 
ATOM   830  O  O2    . DT  B 2 19  ? 19.175  -3.183  38.718  1.00 29.52 ? 119  DT  D O2    1 
ATOM   831  N  N3    . DT  B 2 19  ? 17.560  -1.620  38.659  1.00 22.51 ? 119  DT  D N3    1 
ATOM   832  C  C4    . DT  B 2 19  ? 16.257  -1.179  38.627  1.00 22.31 ? 119  DT  D C4    1 
ATOM   833  O  O4    . DT  B 2 19  ? 16.034  0.029   38.617  1.00 19.81 ? 119  DT  D O4    1 
ATOM   834  C  C5    . DT  B 2 19  ? 15.246  -2.236  38.613  1.00 27.34 ? 119  DT  D C5    1 
ATOM   835  C  C7    . DT  B 2 19  ? 13.789  -1.872  38.600  1.00 24.65 ? 119  DT  D C7    1 
ATOM   836  C  C6    . DT  B 2 19  ? 15.662  -3.500  38.612  1.00 31.95 ? 119  DT  D C6    1 
ATOM   837  P  P     . DT  B 2 20  ? 17.624  -8.774  40.527  1.00 63.29 ? 120  DT  D P     1 
ATOM   838  O  OP1   . DT  B 2 20  ? 18.369  -10.068 40.384  1.00 60.87 ? 120  DT  D OP1   1 
ATOM   839  O  OP2   . DT  B 2 20  ? 16.411  -8.682  41.421  1.00 59.22 ? 120  DT  D OP2   1 
ATOM   840  O  "O5'" . DT  B 2 20  ? 18.728  -7.714  40.952  1.00 56.05 ? 120  DT  D "O5'" 1 
ATOM   841  C  "C5'" . DT  B 2 20  ? 19.972  -7.705  40.265  1.00 45.65 ? 120  DT  D "C5'" 1 
ATOM   842  C  "C4'" . DT  B 2 20  ? 20.876  -6.665  40.857  1.00 40.45 ? 120  DT  D "C4'" 1 
ATOM   843  O  "O4'" . DT  B 2 20  ? 20.195  -5.399  40.760  1.00 33.37 ? 120  DT  D "O4'" 1 
ATOM   844  C  "C3'" . DT  B 2 20  ? 21.213  -6.858  42.335  1.00 43.82 ? 120  DT  D "C3'" 1 
ATOM   845  O  "O3'" . DT  B 2 20  ? 22.612  -6.578  42.478  1.00 51.81 ? 120  DT  D "O3'" 1 
ATOM   846  C  "C2'" . DT  B 2 20  ? 20.348  -5.814  43.032  1.00 38.76 ? 120  DT  D "C2'" 1 
ATOM   847  C  "C1'" . DT  B 2 20  ? 20.307  -4.726  41.991  1.00 29.13 ? 120  DT  D "C1'" 1 
ATOM   848  N  N1    . DT  B 2 20  ? 19.219  -3.750  42.064  1.00 24.00 ? 120  DT  D N1    1 
ATOM   849  C  C2    . DT  B 2 20  ? 19.562  -2.410  42.133  1.00 23.68 ? 120  DT  D C2    1 
ATOM   850  O  O2    . DT  B 2 20  ? 20.720  -2.010  42.190  1.00 25.38 ? 120  DT  D O2    1 
ATOM   851  N  N3    . DT  B 2 20  ? 18.506  -1.547  42.143  1.00 8.56  ? 120  DT  D N3    1 
ATOM   852  C  C4    . DT  B 2 20  ? 17.186  -1.860  42.116  1.00 14.02 ? 120  DT  D C4    1 
ATOM   853  O  O4    . DT  B 2 20  ? 16.366  -0.957  42.139  1.00 22.07 ? 120  DT  D O4    1 
ATOM   854  C  C5    . DT  B 2 20  ? 16.884  -3.293  42.067  1.00 14.58 ? 120  DT  D C5    1 
ATOM   855  C  C7    . DT  B 2 20  ? 15.458  -3.746  42.036  1.00 14.40 ? 120  DT  D C7    1 
ATOM   856  C  C6    . DT  B 2 20  ? 17.907  -4.150  42.046  1.00 22.09 ? 120  DT  D C6    1 
HETATM 857  N  N1    . BRU B 2 21  ? 21.243  -2.106  45.344  1.00 20.02 ? 121  BRU D N1    1 
HETATM 858  C  C2    . BRU B 2 21  ? 20.580  -0.898  45.399  1.00 20.81 ? 121  BRU D C2    1 
HETATM 859  N  N3    . BRU B 2 21  ? 19.221  -0.993  45.456  1.00 16.26 ? 121  BRU D N3    1 
HETATM 860  C  C4    . BRU B 2 21  ? 18.463  -2.143  45.469  1.00 33.22 ? 121  BRU D C4    1 
HETATM 861  C  C5    . BRU B 2 21  ? 19.232  -3.384  45.418  1.00 34.35 ? 121  BRU D C5    1 
HETATM 862  C  C6    . BRU B 2 21  ? 20.566  -3.296  45.359  1.00 23.09 ? 121  BRU D C6    1 
HETATM 863  O  O2    . BRU B 2 21  ? 21.148  0.183   45.394  1.00 20.14 ? 121  BRU D O2    1 
HETATM 864  O  O4    . BRU B 2 21  ? 17.222  -2.062  45.518  1.00 33.64 ? 121  BRU D O4    1 
HETATM 865  BR BR    . BRU B 2 21  ? 18.215  -5.221  45.440  0.43 65.58 ? 121  BRU D BR    1 
HETATM 866  C  "C1'" . BRU B 2 21  ? 22.698  -2.093  45.254  1.00 29.51 ? 121  BRU D "C1'" 1 
HETATM 867  C  "C2'" . BRU B 2 21  ? 23.420  -2.914  46.292  1.00 39.10 ? 121  BRU D "C2'" 1 
HETATM 868  C  "C3'" . BRU B 2 21  ? 24.743  -3.212  45.603  1.00 43.51 ? 121  BRU D "C3'" 1 
HETATM 869  C  "C4'" . BRU B 2 21  ? 24.375  -3.239  44.122  1.00 43.39 ? 121  BRU D "C4'" 1 
HETATM 870  O  "O3'" . BRU B 2 21  ? 25.678  -2.161  45.809  1.00 53.47 ? 121  BRU D "O3'" 1 
HETATM 871  O  "O4'" . BRU B 2 21  ? 23.044  -2.687  44.026  1.00 36.86 ? 121  BRU D "O4'" 1 
HETATM 872  C  "C5'" . BRU B 2 21  ? 24.443  -4.607  43.492  1.00 44.57 ? 121  BRU D "C5'" 1 
HETATM 873  O  "O5'" . BRU B 2 21  ? 23.877  -5.579  44.374  1.00 52.34 ? 121  BRU D "O5'" 1 
HETATM 874  P  P     . BRU B 2 21  ? 23.409  -6.988  43.817  1.00 56.42 ? 121  BRU D P     1 
HETATM 875  O  OP1   . BRU B 2 21  ? 24.622  -7.728  43.341  1.00 52.80 ? 121  BRU D OP1   1 
HETATM 876  O  OP2   . BRU B 2 21  ? 22.526  -7.612  44.830  1.00 56.17 ? 121  BRU D OP2   1 
ATOM   877  P  P     . DT  B 2 22  ? 26.566  -2.114  47.148  1.00 62.10 ? 122  DT  D P     1 
ATOM   878  O  OP1   . DT  B 2 22  ? 27.990  -2.041  46.679  1.00 62.27 ? 122  DT  D OP1   1 
ATOM   879  O  OP2   . DT  B 2 22  ? 26.172  -3.178  48.107  1.00 61.10 ? 122  DT  D OP2   1 
ATOM   880  O  "O5'" . DT  B 2 22  ? 26.145  -0.699  47.768  1.00 63.62 ? 122  DT  D "O5'" 1 
ATOM   881  C  "C5'" . DT  B 2 22  ? 26.071  0.473   46.910  1.00 61.35 ? 122  DT  D "C5'" 1 
ATOM   882  C  "C4'" . DT  B 2 22  ? 25.300  1.605   47.558  1.00 57.71 ? 122  DT  D "C4'" 1 
ATOM   883  O  "O4'" . DT  B 2 22  ? 23.873  1.481   47.366  1.00 53.78 ? 122  DT  D "O4'" 1 
ATOM   884  C  "C3'" . DT  B 2 22  ? 25.517  1.851   49.052  1.00 58.10 ? 122  DT  D "C3'" 1 
ATOM   885  O  "O3'" . DT  B 2 22  ? 25.610  3.261   49.310  1.00 59.54 ? 122  DT  D "O3'" 1 
ATOM   886  C  "C2'" . DT  B 2 22  ? 24.214  1.360   49.663  1.00 55.19 ? 122  DT  D "C2'" 1 
ATOM   887  C  "C1'" . DT  B 2 22  ? 23.211  1.724   48.592  1.00 45.74 ? 122  DT  D "C1'" 1 
ATOM   888  N  N1    . DT  B 2 22  ? 22.025  0.887   48.616  1.00 36.36 ? 122  DT  D N1    1 
ATOM   889  C  C2    . DT  B 2 22  ? 20.797  1.486   48.421  1.00 36.11 ? 122  DT  D C2    1 
ATOM   890  O  O2    . DT  B 2 22  ? 20.673  2.679   48.184  1.00 39.02 ? 122  DT  D O2    1 
ATOM   891  N  N3    . DT  B 2 22  ? 19.723  0.632   48.498  1.00 29.77 ? 122  DT  D N3    1 
ATOM   892  C  C4    . DT  B 2 22  ? 19.760  -0.731  48.722  1.00 36.76 ? 122  DT  D C4    1 
ATOM   893  O  O4    . DT  B 2 22  ? 18.706  -1.370  48.786  1.00 35.86 ? 122  DT  D O4    1 
ATOM   894  C  C5    . DT  B 2 22  ? 21.107  -1.296  48.877  1.00 35.13 ? 122  DT  D C5    1 
ATOM   895  C  C7    . DT  B 2 22  ? 21.273  -2.769  49.076  1.00 41.35 ? 122  DT  D C7    1 
ATOM   896  C  C6    . DT  B 2 22  ? 22.147  -0.463  48.828  1.00 29.91 ? 122  DT  D C6    1 
ATOM   897  N  N     . ILE C 3 41  ? 13.877  -18.023 31.357  1.00 59.01 ? 215  ILE A N     1 
ATOM   898  C  CA    . ILE C 3 41  ? 14.855  -18.680 30.430  1.00 60.44 ? 215  ILE A CA    1 
ATOM   899  C  C     . ILE C 3 41  ? 14.719  -18.175 28.993  1.00 58.28 ? 215  ILE A C     1 
ATOM   900  O  O     . ILE C 3 41  ? 13.612  -17.857 28.534  1.00 58.48 ? 215  ILE A O     1 
ATOM   901  C  CB    . ILE C 3 41  ? 14.741  -20.238 30.476  1.00 63.01 ? 215  ILE A CB    1 
ATOM   902  C  CG1   . ILE C 3 41  ? 15.219  -20.755 31.835  1.00 65.27 ? 215  ILE A CG1   1 
ATOM   903  C  CG2   . ILE C 3 41  ? 15.554  -20.889 29.355  1.00 62.89 ? 215  ILE A CG2   1 
ATOM   904  C  CD1   . ILE C 3 41  ? 15.353  -22.273 31.917  1.00 65.50 ? 215  ILE A CD1   1 
ATOM   905  N  N     . LYS C 3 42  ? 15.856  -18.127 28.298  1.00 55.39 ? 216  LYS A N     1 
ATOM   906  C  CA    . LYS C 3 42  ? 15.951  -17.640 26.919  1.00 50.38 ? 216  LYS A CA    1 
ATOM   907  C  C     . LYS C 3 42  ? 16.448  -18.682 25.894  1.00 43.56 ? 216  LYS A C     1 
ATOM   908  O  O     . LYS C 3 42  ? 16.336  -18.479 24.685  1.00 42.40 ? 216  LYS A O     1 
ATOM   909  C  CB    . LYS C 3 42  ? 16.883  -16.418 26.889  1.00 50.26 ? 216  LYS A CB    1 
ATOM   910  C  CG    . LYS C 3 42  ? 16.505  -15.281 27.838  1.00 50.03 ? 216  LYS A CG    1 
ATOM   911  C  CD    . LYS C 3 42  ? 15.318  -14.504 27.357  1.00 51.71 ? 216  LYS A CD    1 
ATOM   912  C  CE    . LYS C 3 42  ? 15.373  -13.120 27.946  1.00 57.97 ? 216  LYS A CE    1 
ATOM   913  N  NZ    . LYS C 3 42  ? 14.600  -12.157 27.097  1.00 68.41 ? 216  LYS A NZ    1 
ATOM   914  N  N     . TRP C 3 43  ? 17.036  -19.763 26.385  1.00 38.60 ? 217  TRP A N     1 
ATOM   915  C  CA    . TRP C 3 43  ? 17.566  -20.824 25.538  1.00 34.97 ? 217  TRP A CA    1 
ATOM   916  C  C     . TRP C 3 43  ? 18.049  -21.978 26.385  1.00 31.25 ? 217  TRP A C     1 
ATOM   917  O  O     . TRP C 3 43  ? 18.417  -21.795 27.536  1.00 30.81 ? 217  TRP A O     1 
ATOM   918  C  CB    . TRP C 3 43  ? 18.746  -20.316 24.691  1.00 29.36 ? 217  TRP A CB    1 
ATOM   919  C  CG    . TRP C 3 43  ? 19.790  -19.563 25.460  1.00 30.66 ? 217  TRP A CG    1 
ATOM   920  C  CD1   . TRP C 3 43  ? 19.999  -18.211 25.428  1.00 33.01 ? 217  TRP A CD1   1 
ATOM   921  C  CD2   . TRP C 3 43  ? 20.764  -20.097 26.379  1.00 28.46 ? 217  TRP A CD2   1 
ATOM   922  N  NE1   . TRP C 3 43  ? 21.035  -17.866 26.263  1.00 27.64 ? 217  TRP A NE1   1 
ATOM   923  C  CE2   . TRP C 3 43  ? 21.525  -18.998 26.862  1.00 30.68 ? 217  TRP A CE2   1 
ATOM   924  C  CE3   . TRP C 3 43  ? 21.068  -21.389 26.842  1.00 23.36 ? 217  TRP A CE3   1 
ATOM   925  C  CZ2   . TRP C 3 43  ? 22.573  -19.153 27.789  1.00 26.30 ? 217  TRP A CZ2   1 
ATOM   926  C  CZ3   . TRP C 3 43  ? 22.100  -21.549 27.761  1.00 21.41 ? 217  TRP A CZ3   1 
ATOM   927  C  CH2   . TRP C 3 43  ? 22.842  -20.433 28.226  1.00 32.59 ? 217  TRP A CH2   1 
ATOM   928  N  N     . LYS C 3 44  ? 18.078  -23.168 25.819  1.00 32.09 ? 218  LYS A N     1 
ATOM   929  C  CA    . LYS C 3 44  ? 18.565  -24.298 26.567  1.00 35.09 ? 218  LYS A CA    1 
ATOM   930  C  C     . LYS C 3 44  ? 19.970  -24.627 26.149  1.00 32.50 ? 218  LYS A C     1 
ATOM   931  O  O     . LYS C 3 44  ? 20.763  -25.092 26.952  1.00 37.44 ? 218  LYS A O     1 
ATOM   932  C  CB    . LYS C 3 44  ? 17.644  -25.500 26.415  1.00 43.62 ? 218  LYS A CB    1 
ATOM   933  C  CG    . LYS C 3 44  ? 16.342  -25.360 27.215  1.00 52.28 ? 218  LYS A CG    1 
ATOM   934  C  CD    . LYS C 3 44  ? 16.504  -25.688 28.708  1.00 57.12 ? 218  LYS A CD    1 
ATOM   935  C  CE    . LYS C 3 44  ? 17.600  -24.885 29.419  1.00 59.66 ? 218  LYS A CE    1 
ATOM   936  N  NZ    . LYS C 3 44  ? 17.386  -23.414 29.360  1.00 64.61 ? 218  LYS A NZ    1 
ATOM   937  N  N     . PHE C 3 45  ? 20.286  -24.363 24.893  1.00 30.26 ? 219  PHE A N     1 
ATOM   938  C  CA    . PHE C 3 45  ? 21.617  -24.640 24.393  1.00 29.20 ? 219  PHE A CA    1 
ATOM   939  C  C     . PHE C 3 45  ? 22.126  -23.409 23.670  1.00 31.37 ? 219  PHE A C     1 
ATOM   940  O  O     . PHE C 3 45  ? 21.348  -22.697 23.059  1.00 33.32 ? 219  PHE A O     1 
ATOM   941  C  CB    . PHE C 3 45  ? 21.584  -25.830 23.445  1.00 25.59 ? 219  PHE A CB    1 
ATOM   942  C  CG    . PHE C 3 45  ? 22.899  -26.126 22.818  1.00 29.89 ? 219  PHE A CG    1 
ATOM   943  C  CD1   . PHE C 3 45  ? 23.900  -26.760 23.550  1.00 33.46 ? 219  PHE A CD1   1 
ATOM   944  C  CD2   . PHE C 3 45  ? 23.168  -25.706 21.513  1.00 30.00 ? 219  PHE A CD2   1 
ATOM   945  C  CE1   . PHE C 3 45  ? 25.158  -26.980 22.991  1.00 35.60 ? 219  PHE A CE1   1 
ATOM   946  C  CE2   . PHE C 3 45  ? 24.406  -25.916 20.941  1.00 28.94 ? 219  PHE A CE2   1 
ATOM   947  C  CZ    . PHE C 3 45  ? 25.413  -26.550 21.684  1.00 34.61 ? 219  PHE A CZ    1 
ATOM   948  N  N     . LEU C 3 46  ? 23.422  -23.152 23.770  1.00 30.79 ? 220  LEU A N     1 
ATOM   949  C  CA    . LEU C 3 46  ? 24.029  -22.002 23.125  1.00 31.90 ? 220  LEU A CA    1 
ATOM   950  C  C     . LEU C 3 46  ? 25.519  -22.226 22.874  1.00 35.35 ? 220  LEU A C     1 
ATOM   951  O  O     . LEU C 3 46  ? 26.311  -22.409 23.808  1.00 31.22 ? 220  LEU A O     1 
ATOM   952  C  CB    . LEU C 3 46  ? 23.859  -20.757 23.990  1.00 32.51 ? 220  LEU A CB    1 
ATOM   953  C  CG    . LEU C 3 46  ? 24.404  -19.465 23.357  1.00 30.77 ? 220  LEU A CG    1 
ATOM   954  C  CD1   . LEU C 3 46  ? 23.556  -19.108 22.152  1.00 27.91 ? 220  LEU A CD1   1 
ATOM   955  C  CD2   . LEU C 3 46  ? 24.393  -18.318 24.349  1.00 27.95 ? 220  LEU A CD2   1 
ATOM   956  N  N     . GLU C 3 47  ? 25.898  -22.169 21.607  1.00 35.06 ? 221  GLU A N     1 
ATOM   957  C  CA    . GLU C 3 47  ? 27.285  -22.362 21.235  1.00 36.03 ? 221  GLU A CA    1 
ATOM   958  C  C     . GLU C 3 47  ? 27.650  -21.343 20.176  1.00 35.11 ? 221  GLU A C     1 
ATOM   959  O  O     . GLU C 3 47  ? 26.825  -20.981 19.343  1.00 34.32 ? 221  GLU A O     1 
ATOM   960  C  CB    . GLU C 3 47  ? 27.494  -23.778 20.703  1.00 39.45 ? 221  GLU A CB    1 
ATOM   961  C  CG    . GLU C 3 47  ? 28.958  -24.228 20.670  1.00 42.41 ? 221  GLU A CG    1 
ATOM   962  C  CD    . GLU C 3 47  ? 29.105  -25.722 20.419  1.00 45.98 ? 221  GLU A CD    1 
ATOM   963  O  OE1   . GLU C 3 47  ? 28.906  -26.157 19.254  1.00 47.76 ? 221  GLU A OE1   1 
ATOM   964  O  OE2   . GLU C 3 47  ? 29.412  -26.448 21.398  1.00 40.95 ? 221  GLU A OE2   1 
ATOM   965  N  N     . HIS C 3 48  ? 28.872  -20.838 20.244  1.00 34.49 ? 222  HIS A N     1 
ATOM   966  C  CA    . HIS C 3 48  ? 29.330  -19.854 19.278  1.00 36.79 ? 222  HIS A CA    1 
ATOM   967  C  C     . HIS C 3 48  ? 30.829  -19.715 19.267  1.00 38.65 ? 222  HIS A C     1 
ATOM   968  O  O     . HIS C 3 48  ? 31.510  -20.219 20.151  1.00 43.58 ? 222  HIS A O     1 
ATOM   969  C  CB    . HIS C 3 48  ? 28.712  -18.498 19.552  1.00 38.12 ? 222  HIS A CB    1 
ATOM   970  C  CG    . HIS C 3 48  ? 28.989  -17.983 20.926  1.00 29.34 ? 222  HIS A CG    1 
ATOM   971  N  ND1   . HIS C 3 48  ? 30.032  -17.126 21.198  1.00 16.17 ? 222  HIS A ND1   1 
ATOM   972  C  CD2   . HIS C 3 48  ? 28.317  -18.152 22.085  1.00 21.60 ? 222  HIS A CD2   1 
ATOM   973  C  CE1   . HIS C 3 48  ? 29.984  -16.784 22.470  1.00 25.12 ? 222  HIS A CE1   1 
ATOM   974  N  NE2   . HIS C 3 48  ? 28.953  -17.390 23.031  1.00 27.02 ? 222  HIS A NE2   1 
ATOM   975  N  N     . LYS C 3 49  ? 31.322  -18.989 18.270  1.00 39.12 ? 223  LYS A N     1 
ATOM   976  C  CA    . LYS C 3 49  ? 32.744  -18.783 18.063  1.00 39.49 ? 223  LYS A CA    1 
ATOM   977  C  C     . LYS C 3 49  ? 33.336  -17.583 18.781  1.00 36.71 ? 223  LYS A C     1 
ATOM   978  O  O     . LYS C 3 49  ? 34.544  -17.432 18.812  1.00 39.12 ? 223  LYS A O     1 
ATOM   979  C  CB    . LYS C 3 49  ? 33.034  -18.662 16.562  1.00 45.99 ? 223  LYS A CB    1 
ATOM   980  C  CG    . LYS C 3 49  ? 32.479  -19.785 15.700  1.00 56.38 ? 223  LYS A CG    1 
ATOM   981  C  CD    . LYS C 3 49  ? 33.285  -21.069 15.816  1.00 69.15 ? 223  LYS A CD    1 
ATOM   982  C  CE    . LYS C 3 49  ? 32.653  -22.203 14.995  1.00 75.98 ? 223  LYS A CE    1 
ATOM   983  N  NZ    . LYS C 3 49  ? 33.439  -23.480 15.044  1.00 80.22 ? 223  LYS A NZ    1 
ATOM   984  N  N     . GLY C 3 50  ? 32.517  -16.780 19.435  1.00 35.66 ? 224  GLY A N     1 
ATOM   985  C  CA    . GLY C 3 50  ? 33.074  -15.609 20.088  1.00 35.28 ? 224  GLY A CA    1 
ATOM   986  C  C     . GLY C 3 50  ? 33.259  -14.436 19.115  1.00 34.32 ? 224  GLY A C     1 
ATOM   987  O  O     . GLY C 3 50  ? 33.090  -14.574 17.895  1.00 25.86 ? 224  GLY A O     1 
ATOM   988  N  N     . PRO C 3 51  ? 33.690  -13.275 19.637  1.00 30.66 ? 225  PRO A N     1 
ATOM   989  C  CA    . PRO C 3 51  ? 33.919  -12.033 18.895  1.00 32.99 ? 225  PRO A CA    1 
ATOM   990  C  C     . PRO C 3 51  ? 35.096  -12.064 17.960  1.00 34.22 ? 225  PRO A C     1 
ATOM   991  O  O     . PRO C 3 51  ? 36.029  -12.820 18.158  1.00 36.77 ? 225  PRO A O     1 
ATOM   992  C  CB    . PRO C 3 51  ? 34.203  -11.037 20.014  1.00 29.20 ? 225  PRO A CB    1 
ATOM   993  C  CG    . PRO C 3 51  ? 35.021  -11.847 20.942  1.00 20.41 ? 225  PRO A CG    1 
ATOM   994  C  CD    . PRO C 3 51  ? 34.228  -13.149 21.003  1.00 28.44 ? 225  PRO A CD    1 
ATOM   995  N  N     . VAL C 3 52  ? 35.073  -11.176 16.980  1.00 33.78 ? 226  VAL A N     1 
ATOM   996  C  CA    . VAL C 3 52  ? 36.183  -11.055 16.064  1.00 32.38 ? 226  VAL A CA    1 
ATOM   997  C  C     . VAL C 3 52  ? 36.850  -9.759  16.514  1.00 31.34 ? 226  VAL A C     1 
ATOM   998  O  O     . VAL C 3 52  ? 36.185  -8.727  16.632  1.00 32.00 ? 226  VAL A O     1 
ATOM   999  C  CB    . VAL C 3 52  ? 35.710  -10.947 14.611  1.00 33.69 ? 226  VAL A CB    1 
ATOM   1000 C  CG1   . VAL C 3 52  ? 36.898  -10.875 13.671  1.00 38.02 ? 226  VAL A CG1   1 
ATOM   1001 C  CG2   . VAL C 3 52  ? 34.827  -12.155 14.254  1.00 40.46 ? 226  VAL A CG2   1 
ATOM   1002 N  N     . PHE C 3 53  ? 38.124  -9.840  16.872  1.00 30.09 ? 227  PHE A N     1 
ATOM   1003 C  CA    . PHE C 3 53  ? 38.854  -8.669  17.323  1.00 32.84 ? 227  PHE A CA    1 
ATOM   1004 C  C     . PHE C 3 53  ? 39.316  -7.731  16.225  1.00 31.83 ? 227  PHE A C     1 
ATOM   1005 O  O     . PHE C 3 53  ? 39.497  -8.141  15.083  1.00 33.80 ? 227  PHE A O     1 
ATOM   1006 C  CB    . PHE C 3 53  ? 40.004  -9.088  18.217  1.00 33.77 ? 227  PHE A CB    1 
ATOM   1007 C  CG    . PHE C 3 53  ? 39.545  -9.635  19.526  1.00 33.27 ? 227  PHE A CG    1 
ATOM   1008 C  CD1   . PHE C 3 53  ? 39.138  -10.954 19.635  1.00 31.29 ? 227  PHE A CD1   1 
ATOM   1009 C  CD2   . PHE C 3 53  ? 39.468  -8.817  20.641  1.00 30.67 ? 227  PHE A CD2   1 
ATOM   1010 C  CE1   . PHE C 3 53  ? 38.657  -11.447 20.854  1.00 36.39 ? 227  PHE A CE1   1 
ATOM   1011 C  CE2   . PHE C 3 53  ? 38.988  -9.297  21.854  1.00 31.95 ? 227  PHE A CE2   1 
ATOM   1012 C  CZ    . PHE C 3 53  ? 38.581  -10.612 21.965  1.00 30.16 ? 227  PHE A CZ    1 
ATOM   1013 N  N     . ALA C 3 54  ? 39.432  -6.453  16.567  1.00 35.55 ? 228  ALA A N     1 
ATOM   1014 C  CA    . ALA C 3 54  ? 39.850  -5.420  15.624  1.00 36.32 ? 228  ALA A CA    1 
ATOM   1015 C  C     . ALA C 3 54  ? 41.241  -5.684  15.050  1.00 34.50 ? 228  ALA A C     1 
ATOM   1016 O  O     . ALA C 3 54  ? 42.078  -6.319  15.675  1.00 31.33 ? 228  ALA A O     1 
ATOM   1017 C  CB    . ALA C 3 54  ? 39.792  -4.048  16.284  1.00 35.67 ? 228  ALA A CB    1 
ATOM   1018 N  N     . PRO C 3 55  ? 41.469  -5.277  13.796  1.00 34.69 ? 229  PRO A N     1 
ATOM   1019 C  CA    . PRO C 3 55  ? 42.772  -5.499  13.180  1.00 34.74 ? 229  PRO A CA    1 
ATOM   1020 C  C     . PRO C 3 55  ? 43.806  -4.767  13.978  1.00 39.46 ? 229  PRO A C     1 
ATOM   1021 O  O     . PRO C 3 55  ? 43.551  -3.719  14.554  1.00 43.74 ? 229  PRO A O     1 
ATOM   1022 C  CB    . PRO C 3 55  ? 42.635  -4.833  11.822  1.00 34.17 ? 229  PRO A CB    1 
ATOM   1023 C  CG    . PRO C 3 55  ? 41.178  -4.879  11.550  1.00 40.14 ? 229  PRO A CG    1 
ATOM   1024 C  CD    . PRO C 3 55  ? 40.586  -4.534  12.888  1.00 37.52 ? 229  PRO A CD    1 
ATOM   1025 N  N     . PRO C 3 56  ? 44.994  -5.325  14.051  1.00 43.34 ? 230  PRO A N     1 
ATOM   1026 C  CA    . PRO C 3 56  ? 45.998  -4.601  14.825  1.00 42.86 ? 230  PRO A CA    1 
ATOM   1027 C  C     . PRO C 3 56  ? 46.375  -3.378  13.997  1.00 41.68 ? 230  PRO A C     1 
ATOM   1028 O  O     . PRO C 3 56  ? 46.267  -3.396  12.770  1.00 41.60 ? 230  PRO A O     1 
ATOM   1029 C  CB    . PRO C 3 56  ? 47.151  -5.596  14.893  1.00 42.99 ? 230  PRO A CB    1 
ATOM   1030 C  CG    . PRO C 3 56  ? 46.467  -6.932  14.691  1.00 47.55 ? 230  PRO A CG    1 
ATOM   1031 C  CD    . PRO C 3 56  ? 45.471  -6.645  13.628  1.00 43.00 ? 230  PRO A CD    1 
ATOM   1032 N  N     . TYR C 3 57  ? 46.818  -2.328  14.667  1.00 43.36 ? 231  TYR A N     1 
ATOM   1033 C  CA    . TYR C 3 57  ? 47.227  -1.091  14.014  1.00 40.98 ? 231  TYR A CA    1 
ATOM   1034 C  C     . TYR C 3 57  ? 48.428  -1.301  13.113  1.00 46.43 ? 231  TYR A C     1 
ATOM   1035 O  O     . TYR C 3 57  ? 49.429  -1.926  13.503  1.00 50.12 ? 231  TYR A O     1 
ATOM   1036 C  CB    . TYR C 3 57  ? 47.595  -0.056  15.073  1.00 31.52 ? 231  TYR A CB    1 
ATOM   1037 C  CG    . TYR C 3 57  ? 48.352  1.133   14.544  1.00 28.06 ? 231  TYR A CG    1 
ATOM   1038 C  CD1   . TYR C 3 57  ? 47.712  2.097   13.768  1.00 29.00 ? 231  TYR A CD1   1 
ATOM   1039 C  CD2   . TYR C 3 57  ? 49.708  1.304   14.840  1.00 27.21 ? 231  TYR A CD2   1 
ATOM   1040 C  CE1   . TYR C 3 57  ? 48.398  3.211   13.298  1.00 29.90 ? 231  TYR A CE1   1 
ATOM   1041 C  CE2   . TYR C 3 57  ? 50.407  2.404   14.379  1.00 25.63 ? 231  TYR A CE2   1 
ATOM   1042 C  CZ    . TYR C 3 57  ? 49.750  3.359   13.608  1.00 33.59 ? 231  TYR A CZ    1 
ATOM   1043 O  OH    . TYR C 3 57  ? 50.455  4.452   13.153  1.00 34.46 ? 231  TYR A OH    1 
ATOM   1044 N  N     . GLU C 3 58  ? 48.351  -0.763  11.907  1.00 46.84 ? 232  GLU A N     1 
ATOM   1045 C  CA    . GLU C 3 58  ? 49.481  -0.873  11.008  1.00 46.56 ? 232  GLU A CA    1 
ATOM   1046 C  C     . GLU C 3 58  ? 50.180  0.472   10.941  1.00 39.36 ? 232  GLU A C     1 
ATOM   1047 O  O     . GLU C 3 58  ? 49.607  1.462   10.562  1.00 35.32 ? 232  GLU A O     1 
ATOM   1048 C  CB    . GLU C 3 58  ? 49.049  -1.366  9.628   1.00 58.24 ? 232  GLU A CB    1 
ATOM   1049 C  CG    . GLU C 3 58  ? 48.766  -2.876  9.584   1.00 67.23 ? 232  GLU A CG    1 
ATOM   1050 C  CD    . GLU C 3 58  ? 49.988  -3.721  9.931   1.00 72.91 ? 232  GLU A CD    1 
ATOM   1051 O  OE1   . GLU C 3 58  ? 51.059  -3.491  9.320   1.00 74.93 ? 232  GLU A OE1   1 
ATOM   1052 O  OE2   . GLU C 3 58  ? 49.877  -4.605  10.817  1.00 70.99 ? 232  GLU A OE2   1 
ATOM   1053 N  N     . PRO C 3 59  ? 51.434  0.512   11.354  1.00 39.23 ? 233  PRO A N     1 
ATOM   1054 C  CA    . PRO C 3 59  ? 52.286  1.704   11.379  1.00 42.13 ? 233  PRO A CA    1 
ATOM   1055 C  C     . PRO C 3 59  ? 52.404  2.455   10.070  1.00 42.87 ? 233  PRO A C     1 
ATOM   1056 O  O     . PRO C 3 59  ? 52.410  1.866   8.996   1.00 44.84 ? 233  PRO A O     1 
ATOM   1057 C  CB    . PRO C 3 59  ? 53.632  1.142   11.794  1.00 41.69 ? 233  PRO A CB    1 
ATOM   1058 C  CG    . PRO C 3 59  ? 53.231  -0.002  12.684  1.00 46.32 ? 233  PRO A CG    1 
ATOM   1059 C  CD    . PRO C 3 59  ? 52.137  -0.656  11.896  1.00 39.22 ? 233  PRO A CD    1 
ATOM   1060 N  N     . LEU C 3 60  ? 52.587  3.762   10.181  1.00 46.85 ? 234  LEU A N     1 
ATOM   1061 C  CA    . LEU C 3 60  ? 52.727  4.622   9.018   1.00 50.03 ? 234  LEU A CA    1 
ATOM   1062 C  C     . LEU C 3 60  ? 54.009  4.429   8.246   1.00 50.36 ? 234  LEU A C     1 
ATOM   1063 O  O     . LEU C 3 60  ? 55.032  4.022   8.797   1.00 51.63 ? 234  LEU A O     1 
ATOM   1064 C  CB    . LEU C 3 60  ? 52.674  6.087   9.430   1.00 53.34 ? 234  LEU A CB    1 
ATOM   1065 C  CG    . LEU C 3 60  ? 51.293  6.683   9.622   1.00 57.02 ? 234  LEU A CG    1 
ATOM   1066 C  CD1   . LEU C 3 60  ? 51.464  8.166   9.926   1.00 53.02 ? 234  LEU A CD1   1 
ATOM   1067 C  CD2   . LEU C 3 60  ? 50.434  6.448   8.358   1.00 55.91 ? 234  LEU A CD2   1 
ATOM   1068 N  N     . PRO C 3 61  ? 53.963  4.726   6.945   1.00 49.92 ? 235  PRO A N     1 
ATOM   1069 C  CA    . PRO C 3 61  ? 55.132  4.602   6.084   1.00 46.66 ? 235  PRO A CA    1 
ATOM   1070 C  C     . PRO C 3 61  ? 56.147  5.631   6.532   1.00 45.40 ? 235  PRO A C     1 
ATOM   1071 O  O     . PRO C 3 61  ? 55.798  6.621   7.180   1.00 42.55 ? 235  PRO A O     1 
ATOM   1072 C  CB    . PRO C 3 61  ? 54.566  4.950   4.710   1.00 47.17 ? 235  PRO A CB    1 
ATOM   1073 C  CG    . PRO C 3 61  ? 53.163  4.465   4.794   1.00 42.16 ? 235  PRO A CG    1 
ATOM   1074 C  CD    . PRO C 3 61  ? 52.757  4.980   6.142   1.00 48.95 ? 235  PRO A CD    1 
ATOM   1075 N  N     . GLU C 3 62  ? 57.409  5.342   6.249   1.00 50.05 ? 236  GLU A N     1 
ATOM   1076 C  CA    . GLU C 3 62  ? 58.499  6.231   6.599   1.00 56.40 ? 236  GLU A CA    1 
ATOM   1077 C  C     . GLU C 3 62  ? 58.363  7.497   5.796   1.00 58.90 ? 236  GLU A C     1 
ATOM   1078 O  O     . GLU C 3 62  ? 58.768  8.570   6.240   1.00 64.03 ? 236  GLU A O     1 
ATOM   1079 C  CB    . GLU C 3 62  ? 59.854  5.586   6.302   1.00 62.48 ? 236  GLU A CB    1 
ATOM   1080 C  CG    . GLU C 3 62  ? 60.145  4.341   7.121   1.00 72.61 ? 236  GLU A CG    1 
ATOM   1081 C  CD    . GLU C 3 62  ? 59.913  4.561   8.607   1.00 80.31 ? 236  GLU A CD    1 
ATOM   1082 O  OE1   . GLU C 3 62  ? 60.520  5.496   9.182   1.00 83.57 ? 236  GLU A OE1   1 
ATOM   1083 O  OE2   . GLU C 3 62  ? 59.105  3.807   9.195   1.00 83.38 ? 236  GLU A OE2   1 
ATOM   1084 N  N     . ASN C 3 63  ? 57.791  7.377   4.610   1.00 56.27 ? 237  ASN A N     1 
ATOM   1085 C  CA    . ASN C 3 63  ? 57.639  8.545   3.789   1.00 55.39 ? 237  ASN A CA    1 
ATOM   1086 C  C     . ASN C 3 63  ? 56.554  9.479   4.317   1.00 54.64 ? 237  ASN A C     1 
ATOM   1087 O  O     . ASN C 3 63  ? 56.668  10.694  4.141   1.00 60.57 ? 237  ASN A O     1 
ATOM   1088 C  CB    . ASN C 3 63  ? 57.441  8.167   2.315   1.00 56.13 ? 237  ASN A CB    1 
ATOM   1089 C  CG    . ASN C 3 63  ? 56.387  7.109   2.113   1.00 50.68 ? 237  ASN A CG    1 
ATOM   1090 O  OD1   . ASN C 3 63  ? 56.594  5.934   2.403   1.00 43.12 ? 237  ASN A OD1   1 
ATOM   1091 N  ND2   . ASN C 3 63  ? 55.248  7.528   1.578   1.00 54.27 ? 237  ASN A ND2   1 
ATOM   1092 N  N     . VAL C 3 64  ? 55.554  8.947   5.025   1.00 50.93 ? 238  VAL A N     1 
ATOM   1093 C  CA    . VAL C 3 64  ? 54.470  9.783   5.558   1.00 45.36 ? 238  VAL A CA    1 
ATOM   1094 C  C     . VAL C 3 64  ? 54.859  10.367  6.913   1.00 42.73 ? 238  VAL A C     1 
ATOM   1095 O  O     . VAL C 3 64  ? 54.949  9.644   7.907   1.00 41.27 ? 238  VAL A O     1 
ATOM   1096 C  CB    . VAL C 3 64  ? 53.156  9.010   5.674   1.00 43.12 ? 238  VAL A CB    1 
ATOM   1097 C  CG1   . VAL C 3 64  ? 52.071  9.913   6.268   1.00 45.73 ? 238  VAL A CG1   1 
ATOM   1098 C  CG2   . VAL C 3 64  ? 52.733  8.495   4.310   1.00 32.53 ? 238  VAL A CG2   1 
ATOM   1099 N  N     . LYS C 3 65  ? 55.003  11.689  6.956   1.00 38.55 ? 239  LYS A N     1 
ATOM   1100 C  CA    . LYS C 3 65  ? 55.459  12.355  8.159   1.00 39.20 ? 239  LYS A CA    1 
ATOM   1101 C  C     . LYS C 3 65  ? 54.499  13.287  8.861   1.00 37.53 ? 239  LYS A C     1 
ATOM   1102 O  O     . LYS C 3 65  ? 53.540  13.761  8.262   1.00 40.25 ? 239  LYS A O     1 
ATOM   1103 C  CB    . LYS C 3 65  ? 56.768  13.085  7.854   1.00 43.25 ? 239  LYS A CB    1 
ATOM   1104 C  CG    . LYS C 3 65  ? 57.857  12.132  7.393   1.00 54.46 ? 239  LYS A CG    1 
ATOM   1105 C  CD    . LYS C 3 65  ? 59.247  12.742  7.404   1.00 66.46 ? 239  LYS A CD    1 
ATOM   1106 C  CE    . LYS C 3 65  ? 60.337  11.726  6.997   1.00 74.15 ? 239  LYS A CE    1 
ATOM   1107 N  NZ    . LYS C 3 65  ? 60.470  10.549  7.923   1.00 77.91 ? 239  LYS A NZ    1 
ATOM   1108 N  N     . PHE C 3 66  ? 54.804  13.559  10.129  1.00 33.20 ? 240  PHE A N     1 
ATOM   1109 C  CA    . PHE C 3 66  ? 54.023  14.439  10.998  1.00 34.50 ? 240  PHE A CA    1 
ATOM   1110 C  C     . PHE C 3 66  ? 54.853  15.664  11.326  1.00 34.04 ? 240  PHE A C     1 
ATOM   1111 O  O     . PHE C 3 66  ? 56.015  15.543  11.716  1.00 32.64 ? 240  PHE A O     1 
ATOM   1112 C  CB    . PHE C 3 66  ? 53.667  13.716  12.312  1.00 32.73 ? 240  PHE A CB    1 
ATOM   1113 C  CG    . PHE C 3 66  ? 53.060  14.619  13.381  1.00 33.51 ? 240  PHE A CG    1 
ATOM   1114 C  CD1   . PHE C 3 66  ? 51.714  14.995  13.327  1.00 24.16 ? 240  PHE A CD1   1 
ATOM   1115 C  CD2   . PHE C 3 66  ? 53.841  15.080  14.452  1.00 34.23 ? 240  PHE A CD2   1 
ATOM   1116 C  CE1   . PHE C 3 66  ? 51.151  15.819  14.326  1.00 25.88 ? 240  PHE A CE1   1 
ATOM   1117 C  CE2   . PHE C 3 66  ? 53.284  15.904  15.458  1.00 32.72 ? 240  PHE A CE2   1 
ATOM   1118 C  CZ    . PHE C 3 66  ? 51.932  16.271  15.388  1.00 28.04 ? 240  PHE A CZ    1 
ATOM   1119 N  N     . TYR C 3 67  ? 54.240  16.837  11.224  1.00 34.53 ? 241  TYR A N     1 
ATOM   1120 C  CA    . TYR C 3 67  ? 54.932  18.080  11.532  1.00 37.39 ? 241  TYR A CA    1 
ATOM   1121 C  C     . TYR C 3 67  ? 54.360  18.806  12.745  1.00 38.25 ? 241  TYR A C     1 
ATOM   1122 O  O     . TYR C 3 67  ? 53.141  18.831  12.973  1.00 35.72 ? 241  TYR A O     1 
ATOM   1123 C  CB    . TYR C 3 67  ? 54.910  19.027  10.326  1.00 42.05 ? 241  TYR A CB    1 
ATOM   1124 C  CG    . TYR C 3 67  ? 55.560  18.460  9.100   1.00 48.99 ? 241  TYR A CG    1 
ATOM   1125 C  CD1   . TYR C 3 67  ? 55.018  17.348  8.454   1.00 54.29 ? 241  TYR A CD1   1 
ATOM   1126 C  CD2   . TYR C 3 67  ? 56.742  18.989  8.615   1.00 50.80 ? 241  TYR A CD2   1 
ATOM   1127 C  CE1   . TYR C 3 67  ? 55.634  16.769  7.360   1.00 59.99 ? 241  TYR A CE1   1 
ATOM   1128 C  CE2   . TYR C 3 67  ? 57.374  18.419  7.516   1.00 62.98 ? 241  TYR A CE2   1 
ATOM   1129 C  CZ    . TYR C 3 67  ? 56.814  17.304  6.891   1.00 62.85 ? 241  TYR A CZ    1 
ATOM   1130 O  OH    . TYR C 3 67  ? 57.441  16.723  5.808   1.00 71.99 ? 241  TYR A OH    1 
ATOM   1131 N  N     . TYR C 3 68  ? 55.264  19.279  13.593  1.00 41.80 ? 242  TYR A N     1 
ATOM   1132 C  CA    . TYR C 3 68  ? 54.875  20.066  14.744  1.00 39.23 ? 242  TYR A CA    1 
ATOM   1133 C  C     . TYR C 3 68  ? 55.707  21.337  14.765  1.00 40.88 ? 242  TYR A C     1 
ATOM   1134 O  O     . TYR C 3 68  ? 56.935  21.295  14.885  1.00 36.61 ? 242  TYR A O     1 
ATOM   1135 C  CB    . TYR C 3 68  ? 55.038  19.340  16.076  1.00 32.26 ? 242  TYR A CB    1 
ATOM   1136 C  CG    . TYR C 3 68  ? 54.488  20.200  17.200  1.00 26.92 ? 242  TYR A CG    1 
ATOM   1137 C  CD1   . TYR C 3 68  ? 53.124  20.395  17.344  1.00 25.84 ? 242  TYR A CD1   1 
ATOM   1138 C  CD2   . TYR C 3 68  ? 55.326  20.902  18.039  1.00 29.35 ? 242  TYR A CD2   1 
ATOM   1139 C  CE1   . TYR C 3 68  ? 52.616  21.269  18.285  1.00 31.78 ? 242  TYR A CE1   1 
ATOM   1140 C  CE2   . TYR C 3 68  ? 54.825  21.795  18.991  1.00 31.95 ? 242  TYR A CE2   1 
ATOM   1141 C  CZ    . TYR C 3 68  ? 53.471  21.974  19.103  1.00 35.51 ? 242  TYR A CZ    1 
ATOM   1142 O  OH    . TYR C 3 68  ? 52.963  22.892  19.990  1.00 36.03 ? 242  TYR A OH    1 
ATOM   1143 N  N     . ASP C 3 69  ? 55.018  22.464  14.683  1.00 46.17 ? 243  ASP A N     1 
ATOM   1144 C  CA    . ASP C 3 69  ? 55.659  23.759  14.705  1.00 50.68 ? 243  ASP A CA    1 
ATOM   1145 C  C     . ASP C 3 69  ? 56.739  23.776  13.637  1.00 56.19 ? 243  ASP A C     1 
ATOM   1146 O  O     . ASP C 3 69  ? 57.868  24.209  13.885  1.00 62.89 ? 243  ASP A O     1 
ATOM   1147 C  CB    . ASP C 3 69  ? 56.255  24.009  16.095  1.00 57.42 ? 243  ASP A CB    1 
ATOM   1148 C  CG    . ASP C 3 69  ? 56.548  25.477  16.361  1.00 65.06 ? 243  ASP A CG    1 
ATOM   1149 O  OD1   . ASP C 3 69  ? 55.730  26.345  15.968  1.00 70.71 ? 243  ASP A OD1   1 
ATOM   1150 O  OD2   . ASP C 3 69  ? 57.602  25.756  16.974  1.00 65.40 ? 243  ASP A OD2   1 
ATOM   1151 N  N     . GLY C 3 70  ? 56.385  23.289  12.449  1.00 57.32 ? 244  GLY A N     1 
ATOM   1152 C  CA    . GLY C 3 70  ? 57.310  23.258  11.327  1.00 59.98 ? 244  GLY A CA    1 
ATOM   1153 C  C     . GLY C 3 70  ? 58.320  22.121  11.268  1.00 62.90 ? 244  GLY A C     1 
ATOM   1154 O  O     . GLY C 3 70  ? 58.911  21.870  10.215  1.00 66.11 ? 244  GLY A O     1 
ATOM   1155 N  N     . LYS C 3 71  ? 58.570  21.474  12.397  1.00 63.92 ? 245  LYS A N     1 
ATOM   1156 C  CA    . LYS C 3 71  ? 59.510  20.367  12.449  1.00 62.24 ? 245  LYS A CA    1 
ATOM   1157 C  C     . LYS C 3 71  ? 58.823  19.012  12.257  1.00 61.25 ? 245  LYS A C     1 
ATOM   1158 O  O     . LYS C 3 71  ? 57.627  18.856  12.497  1.00 59.56 ? 245  LYS A O     1 
ATOM   1159 C  CB    . LYS C 3 71  ? 60.257  20.369  13.787  1.00 65.88 ? 245  LYS A CB    1 
ATOM   1160 C  CG    . LYS C 3 71  ? 61.679  20.901  13.722  1.00 67.48 ? 245  LYS A CG    1 
ATOM   1161 C  CD    . LYS C 3 71  ? 62.492  20.429  14.927  1.00 70.52 ? 245  LYS A CD    1 
ATOM   1162 C  CE    . LYS C 3 71  ? 63.940  20.900  14.839  1.00 76.53 ? 245  LYS A CE    1 
ATOM   1163 N  NZ    . LYS C 3 71  ? 64.734  20.258  13.735  1.00 79.11 ? 245  LYS A NZ    1 
ATOM   1164 N  N     . VAL C 3 72  ? 59.583  18.041  11.774  1.00 59.58 ? 246  VAL A N     1 
ATOM   1165 C  CA    . VAL C 3 72  ? 59.060  16.699  11.591  1.00 57.26 ? 246  VAL A CA    1 
ATOM   1166 C  C     . VAL C 3 72  ? 59.115  16.014  12.965  1.00 58.40 ? 246  VAL A C     1 
ATOM   1167 O  O     . VAL C 3 72  ? 59.911  16.407  13.836  1.00 58.68 ? 246  VAL A O     1 
ATOM   1168 C  CB    . VAL C 3 72  ? 59.907  15.909  10.573  1.00 55.49 ? 246  VAL A CB    1 
ATOM   1169 C  CG1   . VAL C 3 72  ? 59.341  14.522  10.391  1.00 60.64 ? 246  VAL A CG1   1 
ATOM   1170 C  CG2   . VAL C 3 72  ? 59.931  16.617  9.244   1.00 53.08 ? 246  VAL A CG2   1 
ATOM   1171 N  N     . MET C 3 73  ? 58.305  14.973  13.158  1.00 57.31 ? 247  MET A N     1 
ATOM   1172 C  CA    . MET C 3 73  ? 58.283  14.266  14.432  1.00 54.47 ? 247  MET A CA    1 
ATOM   1173 C  C     . MET C 3 73  ? 57.866  12.815  14.291  1.00 55.38 ? 247  MET A C     1 
ATOM   1174 O  O     . MET C 3 73  ? 56.716  12.548  13.970  1.00 60.75 ? 247  MET A O     1 
ATOM   1175 C  CB    . MET C 3 73  ? 57.312  14.972  15.365  1.00 56.20 ? 247  MET A CB    1 
ATOM   1176 C  CG    . MET C 3 73  ? 57.445  14.576  16.804  1.00 54.61 ? 247  MET A CG    1 
ATOM   1177 S  SD    . MET C 3 73  ? 57.001  15.932  17.856  1.00 51.41 ? 247  MET A SD    1 
ATOM   1178 C  CE    . MET C 3 73  ? 57.928  17.247  17.083  1.00 50.00 ? 247  MET A CE    1 
ATOM   1179 N  N     . LYS C 3 74  ? 58.790  11.888  14.531  1.00 54.58 ? 248  LYS A N     1 
ATOM   1180 C  CA    . LYS C 3 74  ? 58.465  10.463  14.431  1.00 54.96 ? 248  LYS A CA    1 
ATOM   1181 C  C     . LYS C 3 74  ? 57.716  10.117  15.700  1.00 50.81 ? 248  LYS A C     1 
ATOM   1182 O  O     . LYS C 3 74  ? 58.349  9.754   16.691  1.00 54.29 ? 248  LYS A O     1 
ATOM   1183 C  CB    . LYS C 3 74  ? 59.725  9.588   14.402  1.00 60.86 ? 248  LYS A CB    1 
ATOM   1184 C  CG    . LYS C 3 74  ? 60.851  10.038  13.485  1.00 72.92 ? 248  LYS A CG    1 
ATOM   1185 C  CD    . LYS C 3 74  ? 62.099  9.162   13.711  1.00 80.76 ? 248  LYS A CD    1 
ATOM   1186 C  CE    . LYS C 3 74  ? 62.606  9.233   15.166  1.00 79.73 ? 248  LYS A CE    1 
ATOM   1187 N  NZ    . LYS C 3 74  ? 63.686  8.241   15.447  1.00 75.34 ? 248  LYS A NZ    1 
ATOM   1188 N  N     . LEU C 3 75  ? 56.391  10.180  15.672  1.00 42.94 ? 249  LEU A N     1 
ATOM   1189 C  CA    . LEU C 3 75  ? 55.597  9.875   16.863  1.00 41.68 ? 249  LEU A CA    1 
ATOM   1190 C  C     . LEU C 3 75  ? 55.671  8.406   17.309  1.00 40.21 ? 249  LEU A C     1 
ATOM   1191 O  O     . LEU C 3 75  ? 55.686  7.487   16.481  1.00 44.60 ? 249  LEU A O     1 
ATOM   1192 C  CB    . LEU C 3 75  ? 54.118  10.276  16.655  1.00 40.88 ? 249  LEU A CB    1 
ATOM   1193 C  CG    . LEU C 3 75  ? 53.692  11.720  16.314  1.00 36.45 ? 249  LEU A CG    1 
ATOM   1194 C  CD1   . LEU C 3 75  ? 52.196  11.800  16.094  1.00 34.76 ? 249  LEU A CD1   1 
ATOM   1195 C  CD2   . LEU C 3 75  ? 54.089  12.680  17.399  1.00 37.77 ? 249  LEU A CD2   1 
ATOM   1196 N  N     . SER C 3 76  ? 55.720  8.186   18.624  1.00 36.49 ? 250  SER A N     1 
ATOM   1197 C  CA    . SER C 3 76  ? 55.738  6.835   19.169  1.00 36.59 ? 250  SER A CA    1 
ATOM   1198 C  C     . SER C 3 76  ? 54.542  6.109   18.553  1.00 37.55 ? 250  SER A C     1 
ATOM   1199 O  O     . SER C 3 76  ? 53.562  6.742   18.173  1.00 36.29 ? 250  SER A O     1 
ATOM   1200 C  CB    . SER C 3 76  ? 55.650  6.855   20.705  1.00 41.06 ? 250  SER A CB    1 
ATOM   1201 O  OG    . SER C 3 76  ? 54.598  7.681   21.179  1.00 43.08 ? 250  SER A OG    1 
ATOM   1202 N  N     . PRO C 3 77  ? 54.635  4.783   18.384  1.00 41.83 ? 251  PRO A N     1 
ATOM   1203 C  CA    . PRO C 3 77  ? 53.532  4.014   17.787  1.00 43.05 ? 251  PRO A CA    1 
ATOM   1204 C  C     . PRO C 3 77  ? 52.150  4.246   18.384  1.00 40.55 ? 251  PRO A C     1 
ATOM   1205 O  O     . PRO C 3 77  ? 51.159  4.311   17.654  1.00 44.91 ? 251  PRO A O     1 
ATOM   1206 C  CB    . PRO C 3 77  ? 53.997  2.561   17.939  1.00 47.76 ? 251  PRO A CB    1 
ATOM   1207 C  CG    . PRO C 3 77  ? 54.958  2.614   19.120  1.00 48.57 ? 251  PRO A CG    1 
ATOM   1208 C  CD    . PRO C 3 77  ? 55.707  3.893   18.854  1.00 45.10 ? 251  PRO A CD    1 
ATOM   1209 N  N     . LYS C 3 78  ? 52.086  4.419   19.693  1.00 38.67 ? 252  LYS A N     1 
ATOM   1210 C  CA    . LYS C 3 78  ? 50.808  4.661   20.350  1.00 40.63 ? 252  LYS A CA    1 
ATOM   1211 C  C     . LYS C 3 78  ? 50.287  6.093   20.092  1.00 37.77 ? 252  LYS A C     1 
ATOM   1212 O  O     . LYS C 3 78  ? 49.091  6.314   19.969  1.00 39.78 ? 252  LYS A O     1 
ATOM   1213 C  CB    . LYS C 3 78  ? 50.934  4.362   21.846  1.00 45.59 ? 252  LYS A CB    1 
ATOM   1214 C  CG    . LYS C 3 78  ? 49.653  4.549   22.642  1.00 61.58 ? 252  LYS A CG    1 
ATOM   1215 C  CD    . LYS C 3 78  ? 48.578  3.480   22.371  1.00 70.75 ? 252  LYS A CD    1 
ATOM   1216 C  CE    . LYS C 3 78  ? 47.273  3.785   23.158  1.00 70.92 ? 252  LYS A CE    1 
ATOM   1217 N  NZ    . LYS C 3 78  ? 46.197  2.753   23.123  1.00 76.85 ? 252  LYS A NZ    1 
ATOM   1218 N  N     . ALA C 3 79  ? 51.189  7.067   20.032  1.00 37.47 ? 253  ALA A N     1 
ATOM   1219 C  CA    . ALA C 3 79  ? 50.815  8.455   19.770  1.00 33.28 ? 253  ALA A CA    1 
ATOM   1220 C  C     . ALA C 3 79  ? 50.592  8.608   18.275  1.00 33.06 ? 253  ALA A C     1 
ATOM   1221 O  O     . ALA C 3 79  ? 49.877  9.500   17.828  1.00 37.43 ? 253  ALA A O     1 
ATOM   1222 C  CB    . ALA C 3 79  ? 51.909  9.409   20.241  1.00 30.64 ? 253  ALA A CB    1 
ATOM   1223 N  N     . GLU C 3 80  ? 51.237  7.758   17.489  1.00 31.48 ? 254  GLU A N     1 
ATOM   1224 C  CA    . GLU C 3 80  ? 51.063  7.816   16.054  1.00 32.43 ? 254  GLU A CA    1 
ATOM   1225 C  C     . GLU C 3 80  ? 49.687  7.283   15.746  1.00 30.89 ? 254  GLU A C     1 
ATOM   1226 O  O     . GLU C 3 80  ? 48.962  7.844   14.930  1.00 34.74 ? 254  GLU A O     1 
ATOM   1227 C  CB    . GLU C 3 80  ? 52.101  6.960   15.351  1.00 36.46 ? 254  GLU A CB    1 
ATOM   1228 C  CG    . GLU C 3 80  ? 52.051  7.040   13.853  1.00 38.74 ? 254  GLU A CG    1 
ATOM   1229 C  CD    . GLU C 3 80  ? 53.112  6.180   13.202  1.00 44.00 ? 254  GLU A CD    1 
ATOM   1230 O  OE1   . GLU C 3 80  ? 54.306  6.499   13.366  1.00 50.27 ? 254  GLU A OE1   1 
ATOM   1231 O  OE2   . GLU C 3 80  ? 52.755  5.193   12.523  1.00 44.59 ? 254  GLU A OE2   1 
ATOM   1232 N  N     . GLU C 3 81  ? 49.303  6.235   16.449  1.00 23.30 ? 255  GLU A N     1 
ATOM   1233 C  CA    . GLU C 3 81  ? 48.012  5.645   16.210  1.00 25.73 ? 255  GLU A CA    1 
ATOM   1234 C  C     . GLU C 3 81  ? 46.880  6.618   16.476  1.00 22.09 ? 255  GLU A C     1 
ATOM   1235 O  O     . GLU C 3 81  ? 46.003  6.819   15.661  1.00 28.48 ? 255  GLU A O     1 
ATOM   1236 C  CB    . GLU C 3 81  ? 47.841  4.394   17.054  1.00 25.88 ? 255  GLU A CB    1 
ATOM   1237 C  CG    . GLU C 3 81  ? 46.545  3.657   16.751  1.00 32.91 ? 255  GLU A CG    1 
ATOM   1238 C  CD    . GLU C 3 81  ? 46.409  2.356   17.515  1.00 39.54 ? 255  GLU A CD    1 
ATOM   1239 O  OE1   . GLU C 3 81  ? 47.356  2.000   18.251  1.00 44.74 ? 255  GLU A OE1   1 
ATOM   1240 O  OE2   . GLU C 3 81  ? 45.361  1.684   17.375  1.00 40.04 ? 255  GLU A OE2   1 
ATOM   1241 N  N     . VAL C 3 82  ? 46.887  7.216   17.640  1.00 22.61 ? 256  VAL A N     1 
ATOM   1242 C  CA    . VAL C 3 82  ? 45.843  8.165   17.994  1.00 22.97 ? 256  VAL A CA    1 
ATOM   1243 C  C     . VAL C 3 82  ? 45.745  9.313   16.982  1.00 20.72 ? 256  VAL A C     1 
ATOM   1244 O  O     . VAL C 3 82  ? 44.656  9.767   16.620  1.00 19.71 ? 256  VAL A O     1 
ATOM   1245 C  CB    . VAL C 3 82  ? 46.147  8.737   19.373  1.00 24.18 ? 256  VAL A CB    1 
ATOM   1246 C  CG1   . VAL C 3 82  ? 45.099  9.717   19.767  1.00 27.45 ? 256  VAL A CG1   1 
ATOM   1247 C  CG2   . VAL C 3 82  ? 46.271  7.616   20.373  1.00 17.29 ? 256  VAL A CG2   1 
ATOM   1248 N  N     . ALA C 3 83  ? 46.903  9.800   16.558  1.00 22.17 ? 257  ALA A N     1 
ATOM   1249 C  CA    . ALA C 3 83  ? 46.981  10.885  15.608  1.00 21.21 ? 257  ALA A CA    1 
ATOM   1250 C  C     . ALA C 3 83  ? 46.282  10.506  14.315  1.00 21.72 ? 257  ALA A C     1 
ATOM   1251 O  O     . ALA C 3 83  ? 45.638  11.350  13.681  1.00 23.90 ? 257  ALA A O     1 
ATOM   1252 C  CB    . ALA C 3 83  ? 48.421  11.237  15.354  1.00 18.77 ? 257  ALA A CB    1 
ATOM   1253 N  N     . THR C 3 84  ? 46.411  9.242   13.922  1.00 21.18 ? 258  THR A N     1 
ATOM   1254 C  CA    . THR C 3 84  ? 45.776  8.766   12.694  1.00 18.49 ? 258  THR A CA    1 
ATOM   1255 C  C     . THR C 3 84  ? 44.270  8.800   12.806  1.00 20.89 ? 258  THR A C     1 
ATOM   1256 O  O     . THR C 3 84  ? 43.574  9.143   11.849  1.00 24.15 ? 258  THR A O     1 
ATOM   1257 C  CB    . THR C 3 84  ? 46.211  7.339   12.301  1.00 21.08 ? 258  THR A CB    1 
ATOM   1258 O  OG1   . THR C 3 84  ? 45.616  6.396   13.188  1.00 28.97 ? 258  THR A OG1   1 
ATOM   1259 C  CG2   . THR C 3 84  ? 47.722  7.185   12.389  1.00 20.28 ? 258  THR A CG2   1 
ATOM   1260 N  N     . PHE C 3 85  ? 43.756  8.468   13.983  1.00 20.34 ? 259  PHE A N     1 
ATOM   1261 C  CA    . PHE C 3 85  ? 42.322  8.494   14.180  1.00 19.33 ? 259  PHE A CA    1 
ATOM   1262 C  C     . PHE C 3 85  ? 41.869  9.895   13.822  1.00 18.79 ? 259  PHE A C     1 
ATOM   1263 O  O     . PHE C 3 85  ? 40.873  10.088  13.145  1.00 18.82 ? 259  PHE A O     1 
ATOM   1264 C  CB    . PHE C 3 85  ? 41.974  8.236   15.644  1.00 23.30 ? 259  PHE A CB    1 
ATOM   1265 C  CG    . PHE C 3 85  ? 42.250  6.837   16.121  1.00 21.97 ? 259  PHE A CG    1 
ATOM   1266 C  CD1   . PHE C 3 85  ? 42.229  5.763   15.242  1.00 25.23 ? 259  PHE A CD1   1 
ATOM   1267 C  CD2   . PHE C 3 85  ? 42.478  6.593   17.465  1.00 21.18 ? 259  PHE A CD2   1 
ATOM   1268 C  CE1   . PHE C 3 85  ? 42.435  4.462   15.698  1.00 23.38 ? 259  PHE A CE1   1 
ATOM   1269 C  CE2   . PHE C 3 85  ? 42.681  5.306   17.925  1.00 24.17 ? 259  PHE A CE2   1 
ATOM   1270 C  CZ    . PHE C 3 85  ? 42.656  4.231   17.037  1.00 22.91 ? 259  PHE A CZ    1 
ATOM   1271 N  N     . PHE C 3 86  ? 42.603  10.876  14.317  1.00 22.48 ? 260  PHE A N     1 
ATOM   1272 C  CA    . PHE C 3 86  ? 42.275  12.265  14.063  1.00 23.92 ? 260  PHE A CA    1 
ATOM   1273 C  C     . PHE C 3 86  ? 42.414  12.618  12.586  1.00 25.06 ? 260  PHE A C     1 
ATOM   1274 O  O     . PHE C 3 86  ? 41.606  13.361  12.039  1.00 27.12 ? 260  PHE A O     1 
ATOM   1275 C  CB    . PHE C 3 86  ? 43.186  13.170  14.884  1.00 19.63 ? 260  PHE A CB    1 
ATOM   1276 C  CG    . PHE C 3 86  ? 42.655  14.543  15.053  1.00 17.10 ? 260  PHE A CG    1 
ATOM   1277 C  CD1   . PHE C 3 86  ? 41.561  14.766  15.881  1.00 20.15 ? 260  PHE A CD1   1 
ATOM   1278 C  CD2   . PHE C 3 86  ? 43.237  15.611  14.391  1.00 10.97 ? 260  PHE A CD2   1 
ATOM   1279 C  CE1   . PHE C 3 86  ? 41.053  16.033  16.050  1.00 27.29 ? 260  PHE A CE1   1 
ATOM   1280 C  CE2   . PHE C 3 86  ? 42.742  16.891  14.545  1.00 20.37 ? 260  PHE A CE2   1 
ATOM   1281 C  CZ    . PHE C 3 86  ? 41.644  17.114  15.377  1.00 24.34 ? 260  PHE A CZ    1 
ATOM   1282 N  N     . ALA C 3 87  ? 43.504  12.171  11.981  1.00 27.27 ? 261  ALA A N     1 
ATOM   1283 C  CA    . ALA C 3 87  ? 43.773  12.446  10.577  1.00 27.57 ? 261  ALA A CA    1 
ATOM   1284 C  C     . ALA C 3 87  ? 42.669  11.957  9.654   1.00 29.41 ? 261  ALA A C     1 
ATOM   1285 O  O     . ALA C 3 87  ? 42.248  12.683  8.755   1.00 35.56 ? 261  ALA A O     1 
ATOM   1286 C  CB    . ALA C 3 87  ? 45.070  11.830  10.177  1.00 23.67 ? 261  ALA A CB    1 
ATOM   1287 N  N     . LYS C 3 88  ? 42.228  10.717  9.843   1.00 28.32 ? 262  LYS A N     1 
ATOM   1288 C  CA    . LYS C 3 88  ? 41.168  10.174  8.996   1.00 32.46 ? 262  LYS A CA    1 
ATOM   1289 C  C     . LYS C 3 88  ? 39.850  10.928  9.201   1.00 34.77 ? 262  LYS A C     1 
ATOM   1290 O  O     . LYS C 3 88  ? 38.836  10.626  8.581   1.00 40.31 ? 262  LYS A O     1 
ATOM   1291 C  CB    . LYS C 3 88  ? 40.955  8.692   9.287   1.00 31.70 ? 262  LYS A CB    1 
ATOM   1292 C  CG    . LYS C 3 88  ? 42.149  7.803   9.000   1.00 42.12 ? 262  LYS A CG    1 
ATOM   1293 C  CD    . LYS C 3 88  ? 41.864  6.359   9.417   1.00 44.11 ? 262  LYS A CD    1 
ATOM   1294 C  CE    . LYS C 3 88  ? 43.029  5.437   9.087   1.00 47.90 ? 262  LYS A CE    1 
ATOM   1295 N  NZ    . LYS C 3 88  ? 42.737  4.007   9.405   1.00 49.58 ? 262  LYS A NZ    1 
ATOM   1296 N  N     . MET C 3 89  ? 39.851  11.897  10.103  1.00 35.75 ? 263  MET A N     1 
ATOM   1297 C  CA    . MET C 3 89  ? 38.636  12.650  10.366  1.00 36.19 ? 263  MET A CA    1 
ATOM   1298 C  C     . MET C 3 89  ? 38.743  14.124  10.054  1.00 34.25 ? 263  MET A C     1 
ATOM   1299 O  O     . MET C 3 89  ? 37.798  14.857  10.297  1.00 34.86 ? 263  MET A O     1 
ATOM   1300 C  CB    . MET C 3 89  ? 38.209  12.469  11.820  1.00 36.02 ? 263  MET A CB    1 
ATOM   1301 C  CG    . MET C 3 89  ? 37.863  11.024  12.162  1.00 40.92 ? 263  MET A CG    1 
ATOM   1302 S  SD    . MET C 3 89  ? 37.252  10.807  13.844  1.00 48.70 ? 263  MET A SD    1 
ATOM   1303 C  CE    . MET C 3 89  ? 35.664  11.606  13.734  1.00 41.26 ? 263  MET A CE    1 
ATOM   1304 N  N     . LEU C 3 90  ? 39.890  14.548  9.521   1.00 35.78 ? 264  LEU A N     1 
ATOM   1305 C  CA    . LEU C 3 90  ? 40.144  15.946  9.177   1.00 30.45 ? 264  LEU A CA    1 
ATOM   1306 C  C     . LEU C 3 90  ? 39.219  16.475  8.110   1.00 33.40 ? 264  LEU A C     1 
ATOM   1307 O  O     . LEU C 3 90  ? 39.168  17.688  7.869   1.00 36.87 ? 264  LEU A O     1 
ATOM   1308 C  CB    . LEU C 3 90  ? 41.579  16.131  8.712   1.00 28.27 ? 264  LEU A CB    1 
ATOM   1309 C  CG    . LEU C 3 90  ? 42.615  16.127  9.827   1.00 27.61 ? 264  LEU A CG    1 
ATOM   1310 C  CD1   . LEU C 3 90  ? 43.812  16.919  9.358   1.00 28.52 ? 264  LEU A CD1   1 
ATOM   1311 C  CD2   . LEU C 3 90  ? 42.043  16.750  11.070  1.00 26.09 ? 264  LEU A CD2   1 
ATOM   1312 N  N     . ASP C 3 91  ? 38.537  15.560  7.438   1.00 30.29 ? 265  ASP A N     1 
ATOM   1313 C  CA    . ASP C 3 91  ? 37.601  15.927  6.410   1.00 27.44 ? 265  ASP A CA    1 
ATOM   1314 C  C     . ASP C 3 91  ? 36.226  15.915  7.021   1.00 27.42 ? 265  ASP A C     1 
ATOM   1315 O  O     . ASP C 3 91  ? 35.241  15.962  6.303   1.00 37.76 ? 265  ASP A O     1 
ATOM   1316 C  CB    . ASP C 3 91  ? 37.685  14.955  5.211   1.00 32.33 ? 265  ASP A CB    1 
ATOM   1317 C  CG    . ASP C 3 91  ? 37.316  13.505  5.556   1.00 33.94 ? 265  ASP A CG    1 
ATOM   1318 O  OD1   . ASP C 3 91  ? 37.125  13.155  6.747   1.00 39.90 ? 265  ASP A OD1   1 
ATOM   1319 O  OD2   . ASP C 3 91  ? 37.222  12.710  4.591   1.00 34.82 ? 265  ASP A OD2   1 
ATOM   1320 N  N     . HIS C 3 92  ? 36.157  15.833  8.344   1.00 22.56 ? 266  HIS A N     1 
ATOM   1321 C  CA    . HIS C 3 92  ? 34.877  15.775  9.041   1.00 25.38 ? 266  HIS A CA    1 
ATOM   1322 C  C     . HIS C 3 92  ? 34.572  16.926  10.024  1.00 26.15 ? 266  HIS A C     1 
ATOM   1323 O  O     . HIS C 3 92  ? 35.454  17.438  10.735  1.00 23.54 ? 266  HIS A O     1 
ATOM   1324 C  CB    . HIS C 3 92  ? 34.779  14.433  9.763   1.00 26.89 ? 266  HIS A CB    1 
ATOM   1325 C  CG    . HIS C 3 92  ? 33.379  13.979  10.046  1.00 30.46 ? 266  HIS A CG    1 
ATOM   1326 N  ND1   . HIS C 3 92  ? 32.592  14.531  11.039  1.00 31.25 ? 266  HIS A ND1   1 
ATOM   1327 C  CD2   . HIS C 3 92  ? 32.647  12.981  9.500   1.00 27.97 ? 266  HIS A CD2   1 
ATOM   1328 C  CE1   . HIS C 3 92  ? 31.439  13.887  11.093  1.00 30.14 ? 266  HIS A CE1   1 
ATOM   1329 N  NE2   . HIS C 3 92  ? 31.449  12.941  10.173  1.00 33.94 ? 266  HIS A NE2   1 
ATOM   1330 N  N     . GLU C 3 93  ? 33.291  17.298  10.067  1.00 26.20 ? 267  GLU A N     1 
ATOM   1331 C  CA    . GLU C 3 93  ? 32.787  18.354  10.952  1.00 30.72 ? 267  GLU A CA    1 
ATOM   1332 C  C     . GLU C 3 93  ? 33.243  18.195  12.400  1.00 27.98 ? 267  GLU A C     1 
ATOM   1333 O  O     . GLU C 3 93  ? 33.290  19.167  13.156  1.00 28.33 ? 267  GLU A O     1 
ATOM   1334 C  CB    . GLU C 3 93  ? 31.257  18.355  10.947  1.00 30.44 ? 267  GLU A CB    1 
ATOM   1335 N  N     . TYR C 3 94  ? 33.467  16.947  12.798  1.00 26.24 ? 268  TYR A N     1 
ATOM   1336 C  CA    . TYR C 3 94  ? 33.897  16.648  14.144  1.00 25.37 ? 268  TYR A CA    1 
ATOM   1337 C  C     . TYR C 3 94  ? 35.171  17.367  14.506  1.00 31.57 ? 268  TYR A C     1 
ATOM   1338 O  O     . TYR C 3 94  ? 35.284  17.874  15.617  1.00 38.90 ? 268  TYR A O     1 
ATOM   1339 C  CB    . TYR C 3 94  ? 34.071  15.149  14.335  1.00 18.15 ? 268  TYR A CB    1 
ATOM   1340 C  CG    . TYR C 3 94  ? 32.820  14.478  14.811  1.00 20.14 ? 268  TYR A CG    1 
ATOM   1341 C  CD1   . TYR C 3 94  ? 32.292  14.770  16.066  1.00 19.20 ? 268  TYR A CD1   1 
ATOM   1342 C  CD2   . TYR C 3 94  ? 32.135  13.585  13.990  1.00 29.12 ? 268  TYR A CD2   1 
ATOM   1343 C  CE1   . TYR C 3 94  ? 31.106  14.189  16.483  1.00 24.06 ? 268  TYR A CE1   1 
ATOM   1344 C  CE2   . TYR C 3 94  ? 30.929  12.991  14.397  1.00 27.57 ? 268  TYR A CE2   1 
ATOM   1345 C  CZ    . TYR C 3 94  ? 30.431  13.305  15.642  1.00 26.16 ? 268  TYR A CZ    1 
ATOM   1346 O  OH    . TYR C 3 94  ? 29.264  12.748  16.051  1.00 27.55 ? 268  TYR A OH    1 
ATOM   1347 N  N     . THR C 3 95  ? 36.127  17.423  13.580  1.00 39.20 ? 269  THR A N     1 
ATOM   1348 C  CA    . THR C 3 95  ? 37.415  18.076  13.854  1.00 40.12 ? 269  THR A CA    1 
ATOM   1349 C  C     . THR C 3 95  ? 37.352  19.594  13.922  1.00 39.40 ? 269  THR A C     1 
ATOM   1350 O  O     . THR C 3 95  ? 38.356  20.245  14.196  1.00 40.52 ? 269  THR A O     1 
ATOM   1351 C  CB    . THR C 3 95  ? 38.513  17.665  12.836  1.00 39.58 ? 269  THR A CB    1 
ATOM   1352 O  OG1   . THR C 3 95  ? 38.014  17.827  11.507  1.00 39.09 ? 269  THR A OG1   1 
ATOM   1353 C  CG2   . THR C 3 95  ? 38.964  16.215  13.073  1.00 38.92 ? 269  THR A CG2   1 
ATOM   1354 N  N     . THR C 3 96  ? 36.185  20.161  13.662  1.00 41.30 ? 270  THR A N     1 
ATOM   1355 C  CA    . THR C 3 96  ? 36.037  21.609  13.723  1.00 42.22 ? 270  THR A CA    1 
ATOM   1356 C  C     . THR C 3 96  ? 35.430  22.055  15.070  1.00 40.24 ? 270  THR A C     1 
ATOM   1357 O  O     . THR C 3 96  ? 35.555  23.214  15.475  1.00 42.58 ? 270  THR A O     1 
ATOM   1358 C  CB    . THR C 3 96  ? 35.229  22.150  12.499  1.00 44.70 ? 270  THR A CB    1 
ATOM   1359 O  OG1   . THR C 3 96  ? 33.842  21.786  12.600  1.00 42.55 ? 270  THR A OG1   1 
ATOM   1360 C  CG2   . THR C 3 96  ? 35.802  21.571  11.211  1.00 36.11 ? 270  THR A CG2   1 
ATOM   1361 N  N     . LYS C 3 97  ? 34.811  21.108  15.771  1.00 38.10 ? 271  LYS A N     1 
ATOM   1362 C  CA    . LYS C 3 97  ? 34.199  21.361  17.066  1.00 29.02 ? 271  LYS A CA    1 
ATOM   1363 C  C     . LYS C 3 97  ? 35.287  21.478  18.110  1.00 27.91 ? 271  LYS A C     1 
ATOM   1364 O  O     . LYS C 3 97  ? 36.230  20.694  18.167  1.00 22.82 ? 271  LYS A O     1 
ATOM   1365 C  CB    . LYS C 3 97  ? 33.259  20.221  17.422  1.00 24.66 ? 271  LYS A CB    1 
ATOM   1366 C  CG    . LYS C 3 97  ? 32.282  19.972  16.341  1.00 22.47 ? 271  LYS A CG    1 
ATOM   1367 C  CD    . LYS C 3 97  ? 31.278  18.939  16.723  1.00 25.34 ? 271  LYS A CD    1 
ATOM   1368 C  CE    . LYS C 3 97  ? 30.210  18.921  15.663  1.00 32.06 ? 271  LYS A CE    1 
ATOM   1369 N  NZ    . LYS C 3 97  ? 29.148  17.969  15.997  1.00 26.91 ? 271  LYS A NZ    1 
ATOM   1370 N  N     . GLU C 3 98  ? 35.169  22.500  18.925  1.00 33.32 ? 272  GLU A N     1 
ATOM   1371 C  CA    . GLU C 3 98  ? 36.153  22.723  19.951  1.00 38.92 ? 272  GLU A CA    1 
ATOM   1372 C  C     . GLU C 3 98  ? 36.135  21.709  21.088  1.00 37.96 ? 272  GLU A C     1 
ATOM   1373 O  O     . GLU C 3 98  ? 37.159  21.515  21.754  1.00 42.37 ? 272  GLU A O     1 
ATOM   1374 C  CB    . GLU C 3 98  ? 36.109  24.176  20.441  1.00 41.69 ? 272  GLU A CB    1 
ATOM   1375 C  CG    . GLU C 3 98  ? 36.606  25.183  19.372  1.00 55.62 ? 272  GLU A CG    1 
ATOM   1376 C  CD    . GLU C 3 98  ? 38.025  24.871  18.822  1.00 63.79 ? 272  GLU A CD    1 
ATOM   1377 O  OE1   . GLU C 3 98  ? 38.897  24.363  19.579  1.00 71.18 ? 272  GLU A OE1   1 
ATOM   1378 O  OE2   . GLU C 3 98  ? 38.273  25.144  17.623  1.00 69.00 ? 272  GLU A OE2   1 
ATOM   1379 N  N     . ILE C 3 99  ? 35.007  21.030  21.283  1.00 32.67 ? 273  ILE A N     1 
ATOM   1380 C  CA    . ILE C 3 99  ? 34.914  20.013  22.335  1.00 30.69 ? 273  ILE A CA    1 
ATOM   1381 C  C     . ILE C 3 99  ? 35.693  18.769  21.918  1.00 28.51 ? 273  ILE A C     1 
ATOM   1382 O  O     . ILE C 3 99  ? 36.401  18.153  22.712  1.00 32.99 ? 273  ILE A O     1 
ATOM   1383 C  CB    . ILE C 3 99  ? 33.458  19.596  22.582  1.00 32.85 ? 273  ILE A CB    1 
ATOM   1384 C  CG1   . ILE C 3 99  ? 32.583  20.832  22.799  1.00 39.03 ? 273  ILE A CG1   1 
ATOM   1385 C  CG2   . ILE C 3 99  ? 33.374  18.625  23.746  1.00 26.21 ? 273  ILE A CG2   1 
ATOM   1386 C  CD1   . ILE C 3 99  ? 33.094  21.794  23.866  1.00 46.00 ? 273  ILE A CD1   1 
ATOM   1387 N  N     . PHE C 3 100 ? 35.562  18.428  20.647  1.00 26.27 ? 274  PHE A N     1 
ATOM   1388 C  CA    . PHE C 3 100 ? 36.212  17.270  20.058  1.00 30.24 ? 274  PHE A CA    1 
ATOM   1389 C  C     . PHE C 3 100 ? 37.741  17.421  20.115  1.00 29.09 ? 274  PHE A C     1 
ATOM   1390 O  O     . PHE C 3 100 ? 38.470  16.530  20.561  1.00 26.33 ? 274  PHE A O     1 
ATOM   1391 C  CB    . PHE C 3 100 ? 35.719  17.142  18.601  1.00 26.84 ? 274  PHE A CB    1 
ATOM   1392 C  CG    . PHE C 3 100 ? 36.056  15.839  17.939  1.00 26.43 ? 274  PHE A CG    1 
ATOM   1393 C  CD1   . PHE C 3 100 ? 37.288  15.653  17.321  1.00 29.90 ? 274  PHE A CD1   1 
ATOM   1394 C  CD2   . PHE C 3 100 ? 35.138  14.795  17.925  1.00 28.58 ? 274  PHE A CD2   1 
ATOM   1395 C  CE1   . PHE C 3 100 ? 37.592  14.449  16.695  1.00 28.82 ? 274  PHE A CE1   1 
ATOM   1396 C  CE2   . PHE C 3 100 ? 35.434  13.593  17.306  1.00 22.13 ? 274  PHE A CE2   1 
ATOM   1397 C  CZ    . PHE C 3 100 ? 36.659  13.420  16.695  1.00 25.38 ? 274  PHE A CZ    1 
ATOM   1398 N  N     . ARG C 3 101 ? 38.202  18.573  19.650  1.00 32.00 ? 275  ARG A N     1 
ATOM   1399 C  CA    . ARG C 3 101 ? 39.615  18.913  19.589  1.00 30.06 ? 275  ARG A CA    1 
ATOM   1400 C  C     . ARG C 3 101 ? 40.276  18.876  20.957  1.00 29.37 ? 275  ARG A C     1 
ATOM   1401 O  O     . ARG C 3 101 ? 41.387  18.369  21.096  1.00 32.77 ? 275  ARG A O     1 
ATOM   1402 C  CB    . ARG C 3 101 ? 39.763  20.296  18.943  1.00 31.43 ? 275  ARG A CB    1 
ATOM   1403 C  CG    . ARG C 3 101 ? 39.071  20.397  17.562  1.00 29.83 ? 275  ARG A CG    1 
ATOM   1404 C  CD    . ARG C 3 101 ? 39.137  21.796  16.960  1.00 29.50 ? 275  ARG A CD    1 
ATOM   1405 N  NE    . ARG C 3 101 ? 40.512  22.284  16.875  1.00 36.07 ? 275  ARG A NE    1 
ATOM   1406 C  CZ    . ARG C 3 101 ? 41.280  22.245  15.785  1.00 39.43 ? 275  ARG A CZ    1 
ATOM   1407 N  NH1   . ARG C 3 101 ? 40.822  21.743  14.642  1.00 29.01 ? 275  ARG A NH1   1 
ATOM   1408 N  NH2   . ARG C 3 101 ? 42.543  22.668  15.860  1.00 45.18 ? 275  ARG A NH2   1 
ATOM   1409 N  N     . LYS C 3 102 ? 39.588  19.423  21.955  1.00 27.98 ? 276  LYS A N     1 
ATOM   1410 C  CA    . LYS C 3 102 ? 40.108  19.461  23.322  1.00 29.75 ? 276  LYS A CA    1 
ATOM   1411 C  C     . LYS C 3 102 ? 40.096  18.074  23.939  1.00 28.70 ? 276  LYS A C     1 
ATOM   1412 O  O     . LYS C 3 102 ? 41.010  17.689  24.670  1.00 31.80 ? 276  LYS A O     1 
ATOM   1413 C  CB    . LYS C 3 102 ? 39.302  20.433  24.208  1.00 26.16 ? 276  LYS A CB    1 
ATOM   1414 N  N     . ASN C 3 103 ? 39.030  17.336  23.691  1.00 28.03 ? 277  ASN A N     1 
ATOM   1415 C  CA    . ASN C 3 103 ? 38.953  16.002  24.241  1.00 26.61 ? 277  ASN A CA    1 
ATOM   1416 C  C     . ASN C 3 103 ? 40.006  15.151  23.592  1.00 26.13 ? 277  ASN A C     1 
ATOM   1417 O  O     . ASN C 3 103 ? 40.741  14.419  24.265  1.00 24.79 ? 277  ASN A O     1 
ATOM   1418 C  CB    . ASN C 3 103 ? 37.574  15.399  24.017  1.00 27.19 ? 277  ASN A CB    1 
ATOM   1419 C  CG    . ASN C 3 103 ? 36.625  15.733  25.131  1.00 23.39 ? 277  ASN A CG    1 
ATOM   1420 O  OD1   . ASN C 3 103 ? 37.030  16.311  26.162  1.00 27.90 ? 277  ASN A OD1   1 
ATOM   1421 N  ND2   . ASN C 3 103 ? 35.363  15.375  24.952  1.00 22.96 ? 277  ASN A ND2   1 
ATOM   1422 N  N     . PHE C 3 104 ? 40.077  15.261  22.273  1.00 27.72 ? 278  PHE A N     1 
ATOM   1423 C  CA    . PHE C 3 104 ? 41.036  14.498  21.522  1.00 25.56 ? 278  PHE A CA    1 
ATOM   1424 C  C     . PHE C 3 104 ? 42.438  14.862  21.976  1.00 24.84 ? 278  PHE A C     1 
ATOM   1425 O  O     . PHE C 3 104 ? 43.251  13.985  22.225  1.00 23.66 ? 278  PHE A O     1 
ATOM   1426 C  CB    . PHE C 3 104 ? 40.911  14.770  20.022  1.00 25.00 ? 278  PHE A CB    1 
ATOM   1427 C  CG    . PHE C 3 104 ? 42.171  14.474  19.270  1.00 24.62 ? 278  PHE A CG    1 
ATOM   1428 C  CD1   . PHE C 3 104 ? 42.442  13.197  18.825  1.00 23.18 ? 278  PHE A CD1   1 
ATOM   1429 C  CD2   . PHE C 3 104 ? 43.152  15.457  19.119  1.00 30.22 ? 278  PHE A CD2   1 
ATOM   1430 C  CE1   . PHE C 3 104 ? 43.667  12.897  18.249  1.00 25.63 ? 278  PHE A CE1   1 
ATOM   1431 C  CE2   . PHE C 3 104 ? 44.387  15.164  18.543  1.00 23.78 ? 278  PHE A CE2   1 
ATOM   1432 C  CZ    . PHE C 3 104 ? 44.644  13.884  18.112  1.00 24.20 ? 278  PHE A CZ    1 
ATOM   1433 N  N     . PHE C 3 105 ? 42.738  16.159  22.001  1.00 24.83 ? 279  PHE A N     1 
ATOM   1434 C  CA    . PHE C 3 105 ? 44.069  16.616  22.381  1.00 25.66 ? 279  PHE A CA    1 
ATOM   1435 C  C     . PHE C 3 105 ? 44.515  16.099  23.749  1.00 26.32 ? 279  PHE A C     1 
ATOM   1436 O  O     . PHE C 3 105 ? 45.611  15.551  23.884  1.00 33.45 ? 279  PHE A O     1 
ATOM   1437 C  CB    . PHE C 3 105 ? 44.188  18.147  22.296  1.00 26.18 ? 279  PHE A CB    1 
ATOM   1438 C  CG    . PHE C 3 105 ? 45.629  18.655  22.292  1.00 25.23 ? 279  PHE A CG    1 
ATOM   1439 C  CD1   . PHE C 3 105 ? 46.456  18.420  21.205  1.00 27.69 ? 279  PHE A CD1   1 
ATOM   1440 C  CD2   . PHE C 3 105 ? 46.152  19.344  23.372  1.00 20.74 ? 279  PHE A CD2   1 
ATOM   1441 C  CE1   . PHE C 3 105 ? 47.773  18.858  21.193  1.00 29.18 ? 279  PHE A CE1   1 
ATOM   1442 C  CE2   . PHE C 3 105 ? 47.456  19.781  23.366  1.00 23.99 ? 279  PHE A CE2   1 
ATOM   1443 C  CZ    . PHE C 3 105 ? 48.271  19.536  22.271  1.00 28.50 ? 279  PHE A CZ    1 
ATOM   1444 N  N     . LYS C 3 106 ? 43.669  16.258  24.750  1.00 24.83 ? 280  LYS A N     1 
ATOM   1445 C  CA    . LYS C 3 106 ? 43.966  15.786  26.099  1.00 27.61 ? 280  LYS A CA    1 
ATOM   1446 C  C     . LYS C 3 106 ? 44.278  14.280  26.137  1.00 24.51 ? 280  LYS A C     1 
ATOM   1447 O  O     . LYS C 3 106 ? 45.297  13.857  26.658  1.00 24.60 ? 280  LYS A O     1 
ATOM   1448 C  CB    . LYS C 3 106 ? 42.759  16.107  26.990  1.00 33.73 ? 280  LYS A CB    1 
ATOM   1449 C  CG    . LYS C 3 106 ? 42.769  15.469  28.373  1.00 41.90 ? 280  LYS A CG    1 
ATOM   1450 C  CD    . LYS C 3 106 ? 41.339  15.399  28.963  1.00 47.25 ? 280  LYS A CD    1 
ATOM   1451 C  CE    . LYS C 3 106 ? 40.512  14.179  28.442  1.00 51.50 ? 280  LYS A CE    1 
ATOM   1452 N  NZ    . LYS C 3 106 ? 40.081  14.157  26.988  1.00 50.77 ? 280  LYS A NZ    1 
ATOM   1453 N  N     . ASP C 3 107 ? 43.378  13.483  25.565  1.00 28.84 ? 281  ASP A N     1 
ATOM   1454 C  CA    . ASP C 3 107 ? 43.510  12.029  25.530  1.00 32.02 ? 281  ASP A CA    1 
ATOM   1455 C  C     . ASP C 3 107 ? 44.718  11.567  24.736  1.00 30.09 ? 281  ASP A C     1 
ATOM   1456 O  O     . ASP C 3 107 ? 45.295  10.533  25.027  1.00 28.25 ? 281  ASP A O     1 
ATOM   1457 C  CB    . ASP C 3 107 ? 42.214  11.381  24.983  1.00 32.56 ? 281  ASP A CB    1 
ATOM   1458 C  CG    . ASP C 3 107 ? 41.153  11.067  26.093  1.00 33.06 ? 281  ASP A CG    1 
ATOM   1459 O  OD1   . ASP C 3 107 ? 41.402  11.292  27.317  1.00 30.26 ? 281  ASP A OD1   1 
ATOM   1460 O  OD2   . ASP C 3 107 ? 40.066  10.560  25.728  1.00 28.11 ? 281  ASP A OD2   1 
ATOM   1461 N  N     . TRP C 3 108 ? 45.081  12.327  23.711  1.00 30.82 ? 282  TRP A N     1 
ATOM   1462 C  CA    . TRP C 3 108 ? 46.233  11.995  22.883  1.00 28.27 ? 282  TRP A CA    1 
ATOM   1463 C  C     . TRP C 3 108 ? 47.458  12.105  23.772  1.00 29.26 ? 282  TRP A C     1 
ATOM   1464 O  O     . TRP C 3 108 ? 48.270  11.191  23.826  1.00 30.97 ? 282  TRP A O     1 
ATOM   1465 C  CB    . TRP C 3 108 ? 46.322  12.959  21.682  1.00 32.37 ? 282  TRP A CB    1 
ATOM   1466 C  CG    . TRP C 3 108 ? 47.406  12.671  20.630  1.00 27.00 ? 282  TRP A CG    1 
ATOM   1467 C  CD1   . TRP C 3 108 ? 47.982  11.466  20.336  1.00 27.06 ? 282  TRP A CD1   1 
ATOM   1468 C  CD2   . TRP C 3 108 ? 48.036  13.630  19.764  1.00 29.78 ? 282  TRP A CD2   1 
ATOM   1469 N  NE1   . TRP C 3 108 ? 48.938  11.613  19.353  1.00 21.87 ? 282  TRP A NE1   1 
ATOM   1470 C  CE2   . TRP C 3 108 ? 48.991  12.928  18.979  1.00 27.74 ? 282  TRP A CE2   1 
ATOM   1471 C  CE3   . TRP C 3 108 ? 47.884  15.011  19.571  1.00 26.22 ? 282  TRP A CE3   1 
ATOM   1472 C  CZ2   . TRP C 3 108 ? 49.791  13.565  18.009  1.00 27.02 ? 282  TRP A CZ2   1 
ATOM   1473 C  CZ3   . TRP C 3 108 ? 48.680  15.645  18.601  1.00 32.79 ? 282  TRP A CZ3   1 
ATOM   1474 C  CH2   . TRP C 3 108 ? 49.621  14.914  17.833  1.00 27.92 ? 282  TRP A CH2   1 
ATOM   1475 N  N     . ARG C 3 109 ? 47.576  13.211  24.496  1.00 30.13 ? 283  ARG A N     1 
ATOM   1476 C  CA    . ARG C 3 109 ? 48.720  13.400  25.381  1.00 34.16 ? 283  ARG A CA    1 
ATOM   1477 C  C     . ARG C 3 109 ? 48.886  12.243  26.366  1.00 35.81 ? 283  ARG A C     1 
ATOM   1478 O  O     . ARG C 3 109 ? 49.998  11.762  26.575  1.00 38.01 ? 283  ARG A O     1 
ATOM   1479 C  CB    . ARG C 3 109 ? 48.606  14.719  26.131  1.00 34.64 ? 283  ARG A CB    1 
ATOM   1480 C  CG    . ARG C 3 109 ? 48.183  15.879  25.244  1.00 35.52 ? 283  ARG A CG    1 
ATOM   1481 C  CD    . ARG C 3 109 ? 48.343  17.219  25.950  1.00 35.71 ? 283  ARG A CD    1 
ATOM   1482 N  NE    . ARG C 3 109 ? 49.593  17.833  25.525  1.00 36.18 ? 283  ARG A NE    1 
ATOM   1483 C  CZ    . ARG C 3 109 ? 50.664  18.037  26.287  1.00 28.39 ? 283  ARG A CZ    1 
ATOM   1484 N  NH1   . ARG C 3 109 ? 50.671  17.690  27.568  1.00 17.51 ? 283  ARG A NH1   1 
ATOM   1485 N  NH2   . ARG C 3 109 ? 51.753  18.554  25.734  1.00 28.08 ? 283  ARG A NH2   1 
ATOM   1486 N  N     . LYS C 3 110 ? 47.786  11.775  26.947  1.00 36.92 ? 284  LYS A N     1 
ATOM   1487 C  CA    . LYS C 3 110 ? 47.852  10.658  27.882  1.00 36.72 ? 284  LYS A CA    1 
ATOM   1488 C  C     . LYS C 3 110 ? 48.525  9.441   27.250  1.00 37.77 ? 284  LYS A C     1 
ATOM   1489 O  O     . LYS C 3 110 ? 48.774  8.473   27.940  1.00 42.07 ? 284  LYS A O     1 
ATOM   1490 C  CB    . LYS C 3 110 ? 46.460  10.243  28.335  1.00 37.24 ? 284  LYS A CB    1 
ATOM   1491 C  CG    . LYS C 3 110 ? 45.615  11.339  28.957  1.00 46.57 ? 284  LYS A CG    1 
ATOM   1492 C  CD    . LYS C 3 110 ? 44.233  10.774  29.286  1.00 46.97 ? 284  LYS A CD    1 
ATOM   1493 C  CE    . LYS C 3 110 ? 43.277  11.805  29.843  1.00 47.63 ? 284  LYS A CE    1 
ATOM   1494 N  NZ    . LYS C 3 110 ? 41.912  11.209  30.059  1.00 53.28 ? 284  LYS A NZ    1 
ATOM   1495 N  N     . GLU C 3 111 ? 48.797  9.478   25.946  1.00 35.87 ? 285  GLU A N     1 
ATOM   1496 C  CA    . GLU C 3 111 ? 49.438  8.358   25.261  1.00 34.07 ? 285  GLU A CA    1 
ATOM   1497 C  C     . GLU C 3 111 ? 50.871  8.667   24.868  1.00 33.08 ? 285  GLU A C     1 
ATOM   1498 O  O     . GLU C 3 111 ? 51.661  7.758   24.668  1.00 40.23 ? 285  GLU A O     1 
ATOM   1499 C  CB    . GLU C 3 111 ? 48.685  7.985   23.982  1.00 33.30 ? 285  GLU A CB    1 
ATOM   1500 C  CG    . GLU C 3 111 ? 47.205  7.767   24.134  1.00 39.16 ? 285  GLU A CG    1 
ATOM   1501 C  CD    . GLU C 3 111 ? 46.837  6.593   25.033  1.00 46.87 ? 285  GLU A CD    1 
ATOM   1502 O  OE1   . GLU C 3 111 ? 47.689  5.713   25.266  1.00 51.02 ? 285  GLU A OE1   1 
ATOM   1503 O  OE2   . GLU C 3 111 ? 45.683  6.544   25.516  1.00 50.84 ? 285  GLU A OE2   1 
ATOM   1504 N  N     . MET C 3 112 ? 51.189  9.938   24.687  1.00 28.72 ? 286  MET A N     1 
ATOM   1505 C  CA    . MET C 3 112 ? 52.535  10.328  24.282  1.00 29.55 ? 286  MET A CA    1 
ATOM   1506 C  C     . MET C 3 112 ? 53.626  9.937   25.265  1.00 29.43 ? 286  MET A C     1 
ATOM   1507 O  O     . MET C 3 112 ? 53.351  9.545   26.392  1.00 36.88 ? 286  MET A O     1 
ATOM   1508 C  CB    . MET C 3 112 ? 52.601  11.832  24.071  1.00 24.54 ? 286  MET A CB    1 
ATOM   1509 C  CG    . MET C 3 112 ? 51.610  12.338  23.064  1.00 27.71 ? 286  MET A CG    1 
ATOM   1510 S  SD    . MET C 3 112 ? 51.706  14.102  23.035  1.00 33.46 ? 286  MET A SD    1 
ATOM   1511 C  CE    . MET C 3 112 ? 50.508  14.520  21.826  1.00 26.74 ? 286  MET A CE    1 
ATOM   1512 N  N     . THR C 3 113 ? 54.864  9.985   24.799  1.00 31.85 ? 287  THR A N     1 
ATOM   1513 C  CA    . THR C 3 113 ? 56.023  9.697   25.640  1.00 32.04 ? 287  THR A CA    1 
ATOM   1514 C  C     . THR C 3 113 ? 56.229  10.969  26.421  1.00 33.33 ? 287  THR A C     1 
ATOM   1515 O  O     . THR C 3 113 ? 55.656  12.004  26.068  1.00 34.80 ? 287  THR A O     1 
ATOM   1516 C  CB    . THR C 3 113 ? 57.283  9.496   24.816  1.00 30.70 ? 287  THR A CB    1 
ATOM   1517 O  OG1   . THR C 3 113 ? 57.496  10.651  24.003  1.00 27.68 ? 287  THR A OG1   1 
ATOM   1518 C  CG2   . THR C 3 113 ? 57.158  8.276   23.933  1.00 32.84 ? 287  THR A CG2   1 
ATOM   1519 N  N     . ASN C 3 114 ? 57.013  10.903  27.492  1.00 37.02 ? 288  ASN A N     1 
ATOM   1520 C  CA    . ASN C 3 114 ? 57.247  12.093  28.305  1.00 42.07 ? 288  ASN A CA    1 
ATOM   1521 C  C     . ASN C 3 114 ? 57.790  13.253  27.490  1.00 45.21 ? 288  ASN A C     1 
ATOM   1522 O  O     . ASN C 3 114 ? 57.551  14.420  27.833  1.00 51.95 ? 288  ASN A O     1 
ATOM   1523 C  CB    . ASN C 3 114 ? 58.199  11.801  29.453  1.00 45.00 ? 288  ASN A CB    1 
ATOM   1524 C  CG    . ASN C 3 114 ? 57.512  11.166  30.629  1.00 47.60 ? 288  ASN A CG    1 
ATOM   1525 O  OD1   . ASN C 3 114 ? 58.175  10.683  31.547  1.00 47.97 ? 288  ASN A OD1   1 
ATOM   1526 N  ND2   . ASN C 3 114 ? 56.177  11.197  30.637  1.00 50.39 ? 288  ASN A ND2   1 
ATOM   1527 N  N     . GLU C 3 115 ? 58.460  12.918  26.386  1.00 42.19 ? 289  GLU A N     1 
ATOM   1528 C  CA    . GLU C 3 115 ? 59.063  13.897  25.486  1.00 38.36 ? 289  GLU A CA    1 
ATOM   1529 C  C     . GLU C 3 115 ? 58.070  14.596  24.555  1.00 36.61 ? 289  GLU A C     1 
ATOM   1530 O  O     . GLU C 3 115 ? 58.255  15.772  24.221  1.00 38.25 ? 289  GLU A O     1 
ATOM   1531 C  CB    . GLU C 3 115 ? 60.156  13.239  24.635  1.00 35.52 ? 289  GLU A CB    1 
ATOM   1532 N  N     . GLU C 3 116 ? 57.065  13.860  24.075  1.00 37.08 ? 290  GLU A N     1 
ATOM   1533 C  CA    . GLU C 3 116 ? 56.058  14.432  23.162  1.00 34.89 ? 290  GLU A CA    1 
ATOM   1534 C  C     . GLU C 3 116 ? 55.178  15.429  23.922  1.00 31.59 ? 290  GLU A C     1 
ATOM   1535 O  O     . GLU C 3 116 ? 54.705  16.441  23.373  1.00 27.44 ? 290  GLU A O     1 
ATOM   1536 C  CB    . GLU C 3 116 ? 55.223  13.318  22.502  1.00 31.35 ? 290  GLU A CB    1 
ATOM   1537 C  CG    . GLU C 3 116 ? 55.947  12.622  21.345  1.00 31.03 ? 290  GLU A CG    1 
ATOM   1538 C  CD    . GLU C 3 116 ? 55.578  11.139  21.143  1.00 34.57 ? 290  GLU A CD    1 
ATOM   1539 O  OE1   . GLU C 3 116 ? 54.818  10.566  21.936  1.00 28.28 ? 290  GLU A OE1   1 
ATOM   1540 O  OE2   . GLU C 3 116 ? 56.090  10.511  20.193  1.00 44.35 ? 290  GLU A OE2   1 
ATOM   1541 N  N     . LYS C 3 117 ? 55.016  15.153  25.211  1.00 26.58 ? 291  LYS A N     1 
ATOM   1542 C  CA    . LYS C 3 117 ? 54.234  16.008  26.079  1.00 32.36 ? 291  LYS A CA    1 
ATOM   1543 C  C     . LYS C 3 117 ? 54.945  17.347  26.279  1.00 32.22 ? 291  LYS A C     1 
ATOM   1544 O  O     . LYS C 3 117 ? 54.320  18.356  26.569  1.00 32.40 ? 291  LYS A O     1 
ATOM   1545 C  CB    . LYS C 3 117 ? 54.028  15.329  27.430  1.00 29.10 ? 291  LYS A CB    1 
ATOM   1546 C  CG    . LYS C 3 117 ? 53.321  14.013  27.340  1.00 29.85 ? 291  LYS A CG    1 
ATOM   1547 C  CD    . LYS C 3 117 ? 53.147  13.399  28.706  1.00 30.32 ? 291  LYS A CD    1 
ATOM   1548 C  CE    . LYS C 3 117 ? 52.716  11.953  28.569  1.00 34.29 ? 291  LYS A CE    1 
ATOM   1549 N  NZ    . LYS C 3 117 ? 52.379  11.354  29.883  1.00 39.91 ? 291  LYS A NZ    1 
ATOM   1550 N  N     . ASN C 3 118 ? 56.267  17.336  26.180  1.00 36.51 ? 292  ASN A N     1 
ATOM   1551 C  CA    . ASN C 3 118 ? 57.049  18.545  26.372  1.00 36.82 ? 292  ASN A CA    1 
ATOM   1552 C  C     . ASN C 3 118 ? 57.000  19.363  25.103  1.00 37.59 ? 292  ASN A C     1 
ATOM   1553 O  O     . ASN C 3 118 ? 56.860  20.584  25.143  1.00 41.12 ? 292  ASN A O     1 
ATOM   1554 C  CB    . ASN C 3 118 ? 58.500  18.204  26.750  1.00 38.83 ? 292  ASN A CB    1 
ATOM   1555 C  CG    . ASN C 3 118 ? 58.634  17.700  28.186  1.00 39.65 ? 292  ASN A CG    1 
ATOM   1556 O  OD1   . ASN C 3 118 ? 57.653  17.634  28.943  1.00 41.18 ? 292  ASN A OD1   1 
ATOM   1557 N  ND2   . ASN C 3 118 ? 59.860  17.392  28.585  1.00 41.05 ? 292  ASN A ND2   1 
ATOM   1558 N  N     . ILE C 3 119 ? 57.058  18.672  23.972  1.00 38.97 ? 293  ILE A N     1 
ATOM   1559 C  CA    . ILE C 3 119 ? 57.033  19.325  22.672  1.00 40.93 ? 293  ILE A CA    1 
ATOM   1560 C  C     . ILE C 3 119 ? 55.630  19.689  22.176  1.00 38.92 ? 293  ILE A C     1 
ATOM   1561 O  O     . ILE C 3 119 ? 55.291  20.869  22.067  1.00 35.54 ? 293  ILE A O     1 
ATOM   1562 C  CB    . ILE C 3 119 ? 57.777  18.463  21.602  1.00 45.45 ? 293  ILE A CB    1 
ATOM   1563 C  CG1   . ILE C 3 119 ? 59.181  18.096  22.121  1.00 46.20 ? 293  ILE A CG1   1 
ATOM   1564 C  CG2   . ILE C 3 119 ? 57.871  19.228  20.271  1.00 44.26 ? 293  ILE A CG2   1 
ATOM   1565 C  CD1   . ILE C 3 119 ? 60.010  17.229  21.186  1.00 45.68 ? 293  ILE A CD1   1 
ATOM   1566 N  N     . ILE C 3 120 ? 54.823  18.674  21.884  1.00 35.23 ? 294  ILE A N     1 
ATOM   1567 C  CA    . ILE C 3 120 ? 53.481  18.902  21.369  1.00 36.92 ? 294  ILE A CA    1 
ATOM   1568 C  C     . ILE C 3 120 ? 52.517  19.496  22.411  1.00 38.64 ? 294  ILE A C     1 
ATOM   1569 O  O     . ILE C 3 120 ? 51.760  18.784  23.085  1.00 35.48 ? 294  ILE A O     1 
ATOM   1570 C  CB    . ILE C 3 120 ? 52.935  17.610  20.770  1.00 34.04 ? 294  ILE A CB    1 
ATOM   1571 C  CG1   . ILE C 3 120 ? 54.037  16.937  19.964  1.00 32.37 ? 294  ILE A CG1   1 
ATOM   1572 C  CG2   . ILE C 3 120 ? 51.768  17.905  19.822  1.00 33.82 ? 294  ILE A CG2   1 
ATOM   1573 C  CD1   . ILE C 3 120 ? 53.778  15.476  19.687  1.00 33.42 ? 294  ILE A CD1   1 
ATOM   1574 N  N     . THR C 3 121 ? 52.531  20.811  22.538  1.00 39.37 ? 295  THR A N     1 
ATOM   1575 C  CA    . THR C 3 121 ? 51.663  21.436  23.513  1.00 43.96 ? 295  THR A CA    1 
ATOM   1576 C  C     . THR C 3 121 ? 50.521  22.230  22.888  1.00 41.79 ? 295  THR A C     1 
ATOM   1577 O  O     . THR C 3 121 ? 49.584  22.614  23.579  1.00 42.95 ? 295  THR A O     1 
ATOM   1578 C  CB    . THR C 3 121 ? 52.463  22.314  24.504  1.00 46.93 ? 295  THR A CB    1 
ATOM   1579 O  OG1   . THR C 3 121 ? 53.042  23.421  23.809  1.00 53.39 ? 295  THR A OG1   1 
ATOM   1580 C  CG2   . THR C 3 121 ? 53.582  21.505  25.166  1.00 46.80 ? 295  THR A CG2   1 
ATOM   1581 N  N     . ASN C 3 122 ? 50.521  22.346  21.567  1.00 42.12 ? 296  ASN A N     1 
ATOM   1582 C  CA    . ASN C 3 122 ? 49.481  23.104  20.877  1.00 39.80 ? 296  ASN A CA    1 
ATOM   1583 C  C     . ASN C 3 122 ? 48.947  22.369  19.669  1.00 37.48 ? 296  ASN A C     1 
ATOM   1584 O  O     . ASN C 3 122 ? 49.689  22.075  18.732  1.00 39.04 ? 296  ASN A O     1 
ATOM   1585 C  CB    . ASN C 3 122 ? 50.048  24.457  20.426  1.00 50.82 ? 296  ASN A CB    1 
ATOM   1586 C  CG    . ASN C 3 122 ? 48.989  25.393  19.851  1.00 54.50 ? 296  ASN A CG    1 
ATOM   1587 O  OD1   . ASN C 3 122 ? 47.836  25.028  19.681  1.00 57.67 ? 296  ASN A OD1   1 
ATOM   1588 N  ND2   . ASN C 3 122 ? 49.391  26.626  19.567  1.00 59.45 ? 296  ASN A ND2   1 
ATOM   1589 N  N     . LEU C 3 123 ? 47.665  22.029  19.707  1.00 36.11 ? 297  LEU A N     1 
ATOM   1590 C  CA    . LEU C 3 123 ? 47.021  21.349  18.591  1.00 38.86 ? 297  LEU A CA    1 
ATOM   1591 C  C     . LEU C 3 123 ? 47.167  22.166  17.298  1.00 40.45 ? 297  LEU A C     1 
ATOM   1592 O  O     . LEU C 3 123 ? 47.493  21.626  16.236  1.00 38.89 ? 297  LEU A O     1 
ATOM   1593 C  CB    . LEU C 3 123 ? 45.548  21.121  18.914  1.00 32.63 ? 297  LEU A CB    1 
ATOM   1594 C  CG    . LEU C 3 123 ? 44.707  20.383  17.876  1.00 35.94 ? 297  LEU A CG    1 
ATOM   1595 C  CD1   . LEU C 3 123 ? 45.225  18.964  17.678  1.00 39.32 ? 297  LEU A CD1   1 
ATOM   1596 C  CD2   . LEU C 3 123 ? 43.256  20.363  18.326  1.00 37.40 ? 297  LEU A CD2   1 
ATOM   1597 N  N     . SER C 3 124 ? 47.004  23.478  17.435  1.00 43.88 ? 298  SER A N     1 
ATOM   1598 C  CA    . SER C 3 124 ? 47.102  24.414  16.326  1.00 46.62 ? 298  SER A CA    1 
ATOM   1599 C  C     . SER C 3 124 ? 48.479  24.334  15.663  1.00 48.80 ? 298  SER A C     1 
ATOM   1600 O  O     . SER C 3 124 ? 48.684  24.856  14.564  1.00 53.55 ? 298  SER A O     1 
ATOM   1601 C  CB    . SER C 3 124 ? 46.802  25.857  16.801  1.00 48.10 ? 298  SER A CB    1 
ATOM   1602 O  OG    . SER C 3 124 ? 47.977  26.611  17.114  1.00 45.66 ? 298  SER A OG    1 
ATOM   1603 N  N     . LYS C 3 125 ? 49.433  23.700  16.328  1.00 46.30 ? 299  LYS A N     1 
ATOM   1604 C  CA    . LYS C 3 125 ? 50.753  23.587  15.743  1.00 45.94 ? 299  LYS A CA    1 
ATOM   1605 C  C     . LYS C 3 125 ? 51.031  22.215  15.138  1.00 45.65 ? 299  LYS A C     1 
ATOM   1606 O  O     . LYS C 3 125 ? 52.114  21.973  14.608  1.00 45.75 ? 299  LYS A O     1 
ATOM   1607 C  CB    . LYS C 3 125 ? 51.815  23.957  16.771  1.00 46.70 ? 299  LYS A CB    1 
ATOM   1608 C  CG    . LYS C 3 125 ? 51.795  25.409  17.153  1.00 45.92 ? 299  LYS A CG    1 
ATOM   1609 C  CD    . LYS C 3 125 ? 53.051  25.821  17.876  1.00 42.52 ? 299  LYS A CD    1 
ATOM   1610 C  CE    . LYS C 3 125 ? 53.345  27.294  17.609  1.00 50.94 ? 299  LYS A CE    1 
ATOM   1611 N  NZ    . LYS C 3 125 ? 52.184  28.201  17.917  1.00 61.94 ? 299  LYS A NZ    1 
ATOM   1612 N  N     . CYS C 3 126 ? 50.067  21.309  15.235  1.00 45.61 ? 300  CYS A N     1 
ATOM   1613 C  CA    . CYS C 3 126 ? 50.241  19.973  14.687  1.00 36.99 ? 300  CYS A CA    1 
ATOM   1614 C  C     . CYS C 3 126 ? 49.782  19.944  13.248  1.00 34.85 ? 300  CYS A C     1 
ATOM   1615 O  O     . CYS C 3 126 ? 48.777  20.558  12.910  1.00 34.24 ? 300  CYS A O     1 
ATOM   1616 C  CB    . CYS C 3 126 ? 49.427  18.966  15.486  1.00 38.39 ? 300  CYS A CB    1 
ATOM   1617 S  SG    . CYS C 3 126 ? 49.902  18.744  17.225  1.00 35.83 ? 300  CYS A SG    1 
ATOM   1618 N  N     . ASP C 3 127 ? 50.543  19.267  12.400  1.00 36.14 ? 301  ASP A N     1 
ATOM   1619 C  CA    . ASP C 3 127 ? 50.181  19.148  10.995  1.00 35.20 ? 301  ASP A CA    1 
ATOM   1620 C  C     . ASP C 3 127 ? 49.916  17.697  10.669  1.00 33.20 ? 301  ASP A C     1 
ATOM   1621 O  O     . ASP C 3 127 ? 50.851  16.896  10.612  1.00 29.88 ? 301  ASP A O     1 
ATOM   1622 C  CB    . ASP C 3 127 ? 51.296  19.642  10.087  1.00 40.15 ? 301  ASP A CB    1 
ATOM   1623 C  CG    . ASP C 3 127 ? 50.911  19.579  8.615   1.00 47.57 ? 301  ASP A CG    1 
ATOM   1624 O  OD1   . ASP C 3 127 ? 49.742  19.893  8.304   1.00 46.02 ? 301  ASP A OD1   1 
ATOM   1625 O  OD2   . ASP C 3 127 ? 51.757  19.207  7.770   1.00 56.60 ? 301  ASP A OD2   1 
ATOM   1626 N  N     . PHE C 3 128 ? 48.639  17.365  10.494  1.00 28.91 ? 302  PHE A N     1 
ATOM   1627 C  CA    . PHE C 3 128 ? 48.210  16.006  10.166  1.00 33.31 ? 302  PHE A CA    1 
ATOM   1628 C  C     . PHE C 3 128 ? 47.864  15.844  8.667   1.00 34.88 ? 302  PHE A C     1 
ATOM   1629 O  O     . PHE C 3 128 ? 47.260  14.847  8.260   1.00 33.99 ? 302  PHE A O     1 
ATOM   1630 C  CB    . PHE C 3 128 ? 46.945  15.633  10.966  1.00 34.83 ? 302  PHE A CB    1 
ATOM   1631 C  CG    . PHE C 3 128 ? 47.070  15.784  12.460  1.00 32.30 ? 302  PHE A CG    1 
ATOM   1632 C  CD1   . PHE C 3 128 ? 47.741  14.825  13.223  1.00 30.11 ? 302  PHE A CD1   1 
ATOM   1633 C  CD2   . PHE C 3 128 ? 46.453  16.846  13.109  1.00 28.37 ? 302  PHE A CD2   1 
ATOM   1634 C  CE1   . PHE C 3 128 ? 47.796  14.926  14.606  1.00 33.40 ? 302  PHE A CE1   1 
ATOM   1635 C  CE2   . PHE C 3 128 ? 46.498  16.957  14.493  1.00 31.15 ? 302  PHE A CE2   1 
ATOM   1636 C  CZ    . PHE C 3 128 ? 47.169  15.995  15.245  1.00 32.64 ? 302  PHE A CZ    1 
ATOM   1637 N  N     . THR C 3 129 ? 48.185  16.845  7.861   1.00 34.98 ? 303  THR A N     1 
ATOM   1638 C  CA    . THR C 3 129 ? 47.866  16.807  6.442   1.00 39.26 ? 303  THR A CA    1 
ATOM   1639 C  C     . THR C 3 129 ? 48.495  15.672  5.586   1.00 41.25 ? 303  THR A C     1 
ATOM   1640 O  O     . THR C 3 129 ? 47.791  15.014  4.810   1.00 40.06 ? 303  THR A O     1 
ATOM   1641 C  CB    . THR C 3 129 ? 48.132  18.199  5.826   1.00 43.85 ? 303  THR A CB    1 
ATOM   1642 O  OG1   . THR C 3 129 ? 47.336  19.179  6.513   1.00 41.05 ? 303  THR A OG1   1 
ATOM   1643 C  CG2   . THR C 3 129 ? 47.799  18.224  4.335   1.00 44.74 ? 303  THR A CG2   1 
ATOM   1644 N  N     . GLN C 3 130 ? 49.813  15.492  5.656   1.00 40.06 ? 304  GLN A N     1 
ATOM   1645 C  CA    . GLN C 3 130 ? 50.471  14.440  4.883   1.00 34.59 ? 304  GLN A CA    1 
ATOM   1646 C  C     . GLN C 3 130 ? 49.803  13.120  5.197   1.00 33.52 ? 304  GLN A C     1 
ATOM   1647 O  O     . GLN C 3 130 ? 49.462  12.336  4.315   1.00 29.53 ? 304  GLN A O     1 
ATOM   1648 C  CB    . GLN C 3 130 ? 51.951  14.345  5.264   1.00 39.60 ? 304  GLN A CB    1 
ATOM   1649 C  CG    . GLN C 3 130 ? 52.850  15.298  4.512   1.00 39.20 ? 304  GLN A CG    1 
ATOM   1650 C  CD    . GLN C 3 130 ? 54.151  14.652  4.100   1.00 41.52 ? 304  GLN A CD    1 
ATOM   1651 O  OE1   . GLN C 3 130 ? 54.945  15.273  3.397   1.00 50.10 ? 304  GLN A OE1   1 
ATOM   1652 N  NE2   . GLN C 3 130 ? 54.377  13.394  4.520   1.00 37.08 ? 304  GLN A NE2   1 
ATOM   1653 N  N     . MET C 3 131 ? 49.686  12.889  6.495   1.00 31.59 ? 305  MET A N     1 
ATOM   1654 C  CA    . MET C 3 131 ? 49.085  11.730  7.111   1.00 32.00 ? 305  MET A CA    1 
ATOM   1655 C  C     . MET C 3 131 ? 47.628  11.619  6.619   1.00 33.73 ? 305  MET A C     1 
ATOM   1656 O  O     . MET C 3 131 ? 47.163  10.540  6.231   1.00 33.81 ? 305  MET A O     1 
ATOM   1657 C  CB    . MET C 3 131 ? 49.173  11.976  8.619   1.00 31.14 ? 305  MET A CB    1 
ATOM   1658 C  CG    . MET C 3 131 ? 48.535  10.970  9.547   1.00 42.20 ? 305  MET A CG    1 
ATOM   1659 S  SD    . MET C 3 131 ? 49.070  11.122  11.335  1.00 48.20 ? 305  MET A SD    1 
ATOM   1660 C  CE    . MET C 3 131 ? 50.621  12.009  11.215  1.00 32.24 ? 305  MET A CE    1 
ATOM   1661 N  N     . SER C 3 132 ? 46.938  12.754  6.613   1.00 32.45 ? 306  SER A N     1 
ATOM   1662 C  CA    . SER C 3 132 ? 45.549  12.848  6.189   1.00 32.01 ? 306  SER A CA    1 
ATOM   1663 C  C     . SER C 3 132 ? 45.395  12.413  4.744   1.00 34.98 ? 306  SER A C     1 
ATOM   1664 O  O     . SER C 3 132 ? 44.492  11.643  4.398   1.00 37.91 ? 306  SER A O     1 
ATOM   1665 C  CB    . SER C 3 132 ? 45.094  14.293  6.362   1.00 29.41 ? 306  SER A CB    1 
ATOM   1666 O  OG    . SER C 3 132 ? 43.976  14.604  5.559   1.00 42.51 ? 306  SER A OG    1 
ATOM   1667 N  N     . GLN C 3 133 ? 46.312  12.884  3.912   1.00 36.85 ? 307  GLN A N     1 
ATOM   1668 C  CA    . GLN C 3 133 ? 46.313  12.565  2.498   1.00 37.45 ? 307  GLN A CA    1 
ATOM   1669 C  C     . GLN C 3 133 ? 46.582  11.102  2.187   1.00 37.08 ? 307  GLN A C     1 
ATOM   1670 O  O     . GLN C 3 133 ? 46.032  10.572  1.218   1.00 37.03 ? 307  GLN A O     1 
ATOM   1671 C  CB    . GLN C 3 133 ? 47.327  13.441  1.775   1.00 44.24 ? 307  GLN A CB    1 
ATOM   1672 C  CG    . GLN C 3 133 ? 46.961  14.905  1.791   1.00 51.95 ? 307  GLN A CG    1 
ATOM   1673 C  CD    . GLN C 3 133 ? 45.577  15.163  1.207   1.00 59.10 ? 307  GLN A CD    1 
ATOM   1674 O  OE1   . GLN C 3 133 ? 45.290  14.775  0.074   1.00 62.65 ? 307  GLN A OE1   1 
ATOM   1675 N  NE2   . GLN C 3 133 ? 44.720  15.831  1.972   1.00 62.41 ? 307  GLN A NE2   1 
ATOM   1676 N  N     . TYR C 3 134 ? 47.427  10.459  2.996   1.00 36.20 ? 308  TYR A N     1 
ATOM   1677 C  CA    . TYR C 3 134 ? 47.757  9.048   2.804   1.00 36.22 ? 308  TYR A CA    1 
ATOM   1678 C  C     . TYR C 3 134 ? 46.537  8.148   2.906   1.00 34.18 ? 308  TYR A C     1 
ATOM   1679 O  O     . TYR C 3 134 ? 46.349  7.254   2.096   1.00 34.86 ? 308  TYR A O     1 
ATOM   1680 C  CB    . TYR C 3 134 ? 48.798  8.610   3.819   1.00 45.79 ? 308  TYR A CB    1 
ATOM   1681 C  CG    . TYR C 3 134 ? 49.051  7.110   3.872   1.00 50.88 ? 308  TYR A CG    1 
ATOM   1682 C  CD1   . TYR C 3 134 ? 49.822  6.471   2.902   1.00 52.50 ? 308  TYR A CD1   1 
ATOM   1683 C  CD2   . TYR C 3 134 ? 48.582  6.350   4.941   1.00 54.65 ? 308  TYR A CD2   1 
ATOM   1684 C  CE1   . TYR C 3 134 ? 50.129  5.115   3.002   1.00 54.15 ? 308  TYR A CE1   1 
ATOM   1685 C  CE2   . TYR C 3 134 ? 48.882  5.002   5.053   1.00 57.74 ? 308  TYR A CE2   1 
ATOM   1686 C  CZ    . TYR C 3 134 ? 49.658  4.388   4.089   1.00 57.86 ? 308  TYR A CZ    1 
ATOM   1687 O  OH    . TYR C 3 134 ? 49.983  3.055   4.247   1.00 61.27 ? 308  TYR A OH    1 
ATOM   1688 N  N     . PHE C 3 135 ? 45.725  8.355   3.927   1.00 31.81 ? 309  PHE A N     1 
ATOM   1689 C  CA    . PHE C 3 135 ? 44.522  7.559   4.086   1.00 34.20 ? 309  PHE A CA    1 
ATOM   1690 C  C     . PHE C 3 135 ? 43.507  7.860   3.002   1.00 34.51 ? 309  PHE A C     1 
ATOM   1691 O  O     . PHE C 3 135 ? 42.831  6.952   2.498   1.00 34.41 ? 309  PHE A O     1 
ATOM   1692 C  CB    . PHE C 3 135 ? 43.929  7.831   5.441   1.00 36.01 ? 309  PHE A CB    1 
ATOM   1693 C  CG    . PHE C 3 135 ? 44.847  7.488   6.546   1.00 33.65 ? 309  PHE A CG    1 
ATOM   1694 C  CD1   . PHE C 3 135 ? 45.305  6.187   6.688   1.00 29.23 ? 309  PHE A CD1   1 
ATOM   1695 C  CD2   . PHE C 3 135 ? 45.253  8.456   7.453   1.00 30.03 ? 309  PHE A CD2   1 
ATOM   1696 C  CE1   . PHE C 3 135 ? 46.146  5.856   7.715   1.00 28.11 ? 309  PHE A CE1   1 
ATOM   1697 C  CE2   . PHE C 3 135 ? 46.095  8.144   8.488   1.00 26.70 ? 309  PHE A CE2   1 
ATOM   1698 C  CZ    . PHE C 3 135 ? 46.548  6.842   8.626   1.00 30.45 ? 309  PHE A CZ    1 
ATOM   1699 N  N     . LYS C 3 136 ? 43.371  9.144   2.686   1.00 32.48 ? 310  LYS A N     1 
ATOM   1700 C  CA    . LYS C 3 136 ? 42.467  9.577   1.629   1.00 34.96 ? 310  LYS A CA    1 
ATOM   1701 C  C     . LYS C 3 136 ? 42.865  8.814   0.370   1.00 36.73 ? 310  LYS A C     1 
ATOM   1702 O  O     . LYS C 3 136 ? 42.030  8.418   -0.447  1.00 35.12 ? 310  LYS A O     1 
ATOM   1703 C  CB    . LYS C 3 136 ? 42.652  11.070  1.346   1.00 35.13 ? 310  LYS A CB    1 
ATOM   1704 C  CG    . LYS C 3 136 ? 41.951  12.024  2.295   1.00 37.75 ? 310  LYS A CG    1 
ATOM   1705 C  CD    . LYS C 3 136 ? 41.868  13.417  1.675   1.00 44.23 ? 310  LYS A CD    1 
ATOM   1706 C  CE    . LYS C 3 136 ? 41.164  14.445  2.564   1.00 49.61 ? 310  LYS A CE    1 
ATOM   1707 N  NZ    . LYS C 3 136 ? 41.942  14.825  3.798   1.00 52.03 ? 310  LYS A NZ    1 
ATOM   1708 N  N     . ALA C 3 137 ? 44.175  8.712   0.184   1.00 38.61 ? 311  ALA A N     1 
ATOM   1709 C  CA    . ALA C 3 137 ? 44.730  8.022   -0.957  1.00 38.77 ? 311  ALA A CA    1 
ATOM   1710 C  C     . ALA C 3 137 ? 44.244  6.598   -0.872  1.00 40.66 ? 311  ALA A C     1 
ATOM   1711 O  O     . ALA C 3 137 ? 43.523  6.134   -1.756  1.00 43.93 ? 311  ALA A O     1 
ATOM   1712 C  CB    . ALA C 3 137 ? 46.258  8.067   -0.911  1.00 34.00 ? 311  ALA A CB    1 
ATOM   1713 N  N     . GLN C 3 138 ? 44.574  5.951   0.243   1.00 37.78 ? 312  GLN A N     1 
ATOM   1714 C  CA    . GLN C 3 138 ? 44.200  4.571   0.457   1.00 36.04 ? 312  GLN A CA    1 
ATOM   1715 C  C     . GLN C 3 138 ? 42.740  4.310   0.110   1.00 35.35 ? 312  GLN A C     1 
ATOM   1716 O  O     . GLN C 3 138 ? 42.409  3.304   -0.531  1.00 33.09 ? 312  GLN A O     1 
ATOM   1717 C  CB    . GLN C 3 138 ? 44.522  4.147   1.883   1.00 32.60 ? 312  GLN A CB    1 
ATOM   1718 C  CG    . GLN C 3 138 ? 45.993  4.234   2.209   1.00 49.93 ? 312  GLN A CG    1 
ATOM   1719 C  CD    . GLN C 3 138 ? 46.904  3.793   1.051   1.00 61.18 ? 312  GLN A CD    1 
ATOM   1720 O  OE1   . GLN C 3 138 ? 47.030  2.590   0.763   1.00 69.35 ? 312  GLN A OE1   1 
ATOM   1721 N  NE2   . GLN C 3 138 ? 47.561  4.766   0.397   1.00 61.33 ? 312  GLN A NE2   1 
ATOM   1722 N  N     . THR C 3 139 ? 41.870  5.215   0.512   1.00 31.15 ? 313  THR A N     1 
ATOM   1723 C  CA    . THR C 3 139 ? 40.477  5.020   0.194   1.00 37.23 ? 313  THR A CA    1 
ATOM   1724 C  C     . THR C 3 139 ? 40.284  4.936   -1.313  1.00 37.02 ? 313  THR A C     1 
ATOM   1725 O  O     . THR C 3 139 ? 39.575  4.063   -1.823  1.00 32.48 ? 313  THR A O     1 
ATOM   1726 C  CB    . THR C 3 139 ? 39.626  6.147   0.750   1.00 39.83 ? 313  THR A CB    1 
ATOM   1727 O  OG1   . THR C 3 139 ? 39.634  6.062   2.174   1.00 41.56 ? 313  THR A OG1   1 
ATOM   1728 C  CG2   . THR C 3 139 ? 38.183  6.045   0.238   1.00 43.38 ? 313  THR A CG2   1 
ATOM   1729 N  N     . GLU C 3 140 ? 40.897  5.865   -2.026  1.00 38.76 ? 314  GLU A N     1 
ATOM   1730 C  CA    . GLU C 3 140 ? 40.759  5.868   -3.459  1.00 42.35 ? 314  GLU A CA    1 
ATOM   1731 C  C     . GLU C 3 140 ? 41.390  4.621   -4.052  1.00 42.40 ? 314  GLU A C     1 
ATOM   1732 O  O     . GLU C 3 140 ? 40.843  4.020   -4.970  1.00 40.77 ? 314  GLU A O     1 
ATOM   1733 C  CB    . GLU C 3 140 ? 41.369  7.132   -4.058  1.00 49.04 ? 314  GLU A CB    1 
ATOM   1734 C  CG    . GLU C 3 140 ? 40.950  7.404   -5.511  1.00 60.17 ? 314  GLU A CG    1 
ATOM   1735 C  CD    . GLU C 3 140 ? 39.437  7.578   -5.681  1.00 66.89 ? 314  GLU A CD    1 
ATOM   1736 O  OE1   . GLU C 3 140 ? 38.756  8.046   -4.735  1.00 69.47 ? 314  GLU A OE1   1 
ATOM   1737 O  OE2   . GLU C 3 140 ? 38.925  7.240   -6.771  1.00 71.61 ? 314  GLU A OE2   1 
ATOM   1738 N  N     . ALA C 3 141 ? 42.524  4.203   -3.508  1.00 44.75 ? 315  ALA A N     1 
ATOM   1739 C  CA    . ALA C 3 141 ? 43.189  3.019   -4.021  1.00 47.24 ? 315  ALA A CA    1 
ATOM   1740 C  C     . ALA C 3 141 ? 42.362  1.794   -3.693  1.00 54.04 ? 315  ALA A C     1 
ATOM   1741 O  O     . ALA C 3 141 ? 42.821  0.669   -3.844  1.00 60.12 ? 315  ALA A O     1 
ATOM   1742 C  CB    . ALA C 3 141 ? 44.570  2.894   -3.442  1.00 48.09 ? 315  ALA A CB    1 
ATOM   1743 N  N     . ARG C 3 142 ? 41.168  2.022   -3.156  1.00 55.92 ? 316  ARG A N     1 
ATOM   1744 C  CA    . ARG C 3 142 ? 40.253  0.944   -2.829  1.00 54.52 ? 316  ARG A CA    1 
ATOM   1745 C  C     . ARG C 3 142 ? 39.078  1.073   -3.768  1.00 52.64 ? 316  ARG A C     1 
ATOM   1746 O  O     . ARG C 3 142 ? 38.587  0.068   -4.274  1.00 51.11 ? 316  ARG A O     1 
ATOM   1747 C  CB    . ARG C 3 142 ? 39.810  1.007   -1.368  1.00 58.05 ? 316  ARG A CB    1 
ATOM   1748 C  CG    . ARG C 3 142 ? 40.690  0.179   -0.435  1.00 58.66 ? 316  ARG A CG    1 
ATOM   1749 C  CD    . ARG C 3 142 ? 40.155  0.177   0.997   1.00 63.51 ? 316  ARG A CD    1 
ATOM   1750 N  NE    . ARG C 3 142 ? 40.398  1.457   1.667   1.00 66.39 ? 316  ARG A NE    1 
ATOM   1751 C  CZ    . ARG C 3 142 ? 39.451  2.250   2.160   1.00 59.35 ? 316  ARG A CZ    1 
ATOM   1752 N  NH1   . ARG C 3 142 ? 38.172  1.908   2.068   1.00 60.68 ? 316  ARG A NH1   1 
ATOM   1753 N  NH2   . ARG C 3 142 ? 39.785  3.405   2.715   1.00 50.48 ? 316  ARG A NH2   1 
ATOM   1754 N  N     . LYS C 3 143 ? 38.623  2.308   -3.987  1.00 54.99 ? 317  LYS A N     1 
ATOM   1755 C  CA    . LYS C 3 143 ? 37.531  2.571   -4.919  1.00 58.47 ? 317  LYS A CA    1 
ATOM   1756 C  C     . LYS C 3 143 ? 38.030  2.118   -6.287  1.00 61.34 ? 317  LYS A C     1 
ATOM   1757 O  O     . LYS C 3 143 ? 37.243  1.715   -7.150  1.00 62.23 ? 317  LYS A O     1 
ATOM   1758 C  CB    . LYS C 3 143 ? 37.213  4.067   -5.013  1.00 57.36 ? 317  LYS A CB    1 
ATOM   1759 C  CG    . LYS C 3 143 ? 36.411  4.669   -3.882  1.00 66.52 ? 317  LYS A CG    1 
ATOM   1760 C  CD    . LYS C 3 143 ? 35.909  6.064   -4.297  1.00 71.17 ? 317  LYS A CD    1 
ATOM   1761 C  CE    . LYS C 3 143 ? 34.893  6.657   -3.299  1.00 76.10 ? 317  LYS A CE    1 
ATOM   1762 N  NZ    . LYS C 3 143 ? 34.263  7.931   -3.803  1.00 69.98 ? 317  LYS A NZ    1 
ATOM   1763 N  N     . GLN C 3 144 ? 39.352  2.164   -6.453  1.00 63.35 ? 318  GLN A N     1 
ATOM   1764 C  CA    . GLN C 3 144 ? 40.007  1.797   -7.697  1.00 65.85 ? 318  GLN A CA    1 
ATOM   1765 C  C     . GLN C 3 144 ? 40.765  0.466   -7.637  1.00 66.79 ? 318  GLN A C     1 
ATOM   1766 O  O     . GLN C 3 144 ? 41.930  0.389   -8.015  1.00 68.60 ? 318  GLN A O     1 
ATOM   1767 C  CB    . GLN C 3 144 ? 40.953  2.924   -8.150  1.00 67.60 ? 318  GLN A CB    1 
ATOM   1768 C  CG    . GLN C 3 144 ? 40.380  4.356   -8.045  1.00 73.24 ? 318  GLN A CG    1 
ATOM   1769 C  CD    . GLN C 3 144 ? 39.124  4.597   -8.897  1.00 74.37 ? 318  GLN A CD    1 
ATOM   1770 O  OE1   . GLN C 3 144 ? 39.158  4.474   -10.128 1.00 73.07 ? 318  GLN A OE1   1 
ATOM   1771 N  NE2   . GLN C 3 144 ? 38.021  4.978   -8.242  1.00 70.94 ? 318  GLN A NE2   1 
ATOM   1772 N  N     . MET C 3 145 ? 40.100  -0.576  -7.150  1.00 68.59 ? 319  MET A N     1 
ATOM   1773 C  CA    . MET C 3 145 ? 40.708  -1.900  -7.091  1.00 66.18 ? 319  MET A CA    1 
ATOM   1774 C  C     . MET C 3 145 ? 40.222  -2.691  -8.281  1.00 65.61 ? 319  MET A C     1 
ATOM   1775 O  O     . MET C 3 145 ? 39.119  -2.457  -8.804  1.00 65.93 ? 319  MET A O     1 
ATOM   1776 C  CB    . MET C 3 145 ? 40.288  -2.665  -5.843  1.00 69.74 ? 319  MET A CB    1 
ATOM   1777 C  CG    . MET C 3 145 ? 40.924  -2.218  -4.573  1.00 76.69 ? 319  MET A CG    1 
ATOM   1778 S  SD    . MET C 3 145 ? 40.864  -3.542  -3.366  1.00 84.13 ? 319  MET A SD    1 
ATOM   1779 C  CE    . MET C 3 145 ? 42.427  -3.265  -2.542  1.00 80.11 ? 319  MET A CE    1 
ATOM   1780 N  N     . SER C 3 146 ? 41.036  -3.648  -8.693  1.00 64.90 ? 320  SER A N     1 
ATOM   1781 C  CA    . SER C 3 146 ? 40.705  -4.513  -9.813  1.00 61.44 ? 320  SER A CA    1 
ATOM   1782 C  C     . SER C 3 146 ? 39.576  -5.458  -9.379  1.00 55.88 ? 320  SER A C     1 
ATOM   1783 O  O     . SER C 3 146 ? 39.362  -5.678  -8.182  1.00 52.37 ? 320  SER A O     1 
ATOM   1784 C  CB    . SER C 3 146 ? 41.958  -5.295  -10.253 1.00 61.30 ? 320  SER A CB    1 
ATOM   1785 O  OG    . SER C 3 146 ? 42.538  -6.053  -9.192  1.00 65.29 ? 320  SER A OG    1 
ATOM   1786 N  N     . LYS C 3 147 ? 38.816  -5.963  -10.346 1.00 49.93 ? 321  LYS A N     1 
ATOM   1787 C  CA    . LYS C 3 147 ? 37.723  -6.884  -10.041 1.00 45.66 ? 321  LYS A CA    1 
ATOM   1788 C  C     . LYS C 3 147 ? 38.262  -8.090  -9.292  1.00 39.68 ? 321  LYS A C     1 
ATOM   1789 O  O     . LYS C 3 147 ? 37.609  -8.612  -8.401  1.00 36.37 ? 321  LYS A O     1 
ATOM   1790 C  CB    . LYS C 3 147 ? 36.998  -7.330  -11.325 1.00 52.91 ? 321  LYS A CB    1 
ATOM   1791 C  CG    . LYS C 3 147 ? 36.167  -6.230  -12.002 1.00 51.66 ? 321  LYS A CG    1 
ATOM   1792 C  CD    . LYS C 3 147 ? 35.488  -6.690  -13.290 1.00 55.45 ? 321  LYS A CD    1 
ATOM   1793 C  CE    . LYS C 3 147 ? 34.775  -5.513  -13.977 1.00 63.40 ? 321  LYS A CE    1 
ATOM   1794 N  NZ    . LYS C 3 147 ? 34.081  -5.858  -15.264 1.00 65.87 ? 321  LYS A NZ    1 
ATOM   1795 N  N     . GLU C 3 148 ? 39.449  -8.534  -9.683  1.00 37.01 ? 322  GLU A N     1 
ATOM   1796 C  CA    . GLU C 3 148 ? 40.100  -9.673  -9.042  1.00 42.31 ? 322  GLU A CA    1 
ATOM   1797 C  C     . GLU C 3 148 ? 40.409  -9.331  -7.596  1.00 40.24 ? 322  GLU A C     1 
ATOM   1798 O  O     . GLU C 3 148 ? 40.344  -10.190 -6.719  1.00 36.00 ? 322  GLU A O     1 
ATOM   1799 C  CB    . GLU C 3 148 ? 41.411  -10.024 -9.763  1.00 45.98 ? 322  GLU A CB    1 
ATOM   1800 N  N     . GLU C 3 149 ? 40.853  -8.099  -7.379  1.00 41.60 ? 323  GLU A N     1 
ATOM   1801 C  CA    . GLU C 3 149 ? 41.160  -7.631  -6.044  1.00 40.35 ? 323  GLU A CA    1 
ATOM   1802 C  C     . GLU C 3 149 ? 39.840  -7.634  -5.248  1.00 40.11 ? 323  GLU A C     1 
ATOM   1803 O  O     . GLU C 3 149 ? 39.697  -8.343  -4.258  1.00 38.69 ? 323  GLU A O     1 
ATOM   1804 C  CB    . GLU C 3 149 ? 41.772  -6.228  -6.110  1.00 36.48 ? 323  GLU A CB    1 
ATOM   1805 N  N     . LYS C 3 150 ? 38.855  -6.888  -5.727  1.00 40.93 ? 324  LYS A N     1 
ATOM   1806 C  CA    . LYS C 3 150 ? 37.575  -6.823  -5.053  1.00 39.82 ? 324  LYS A CA    1 
ATOM   1807 C  C     . LYS C 3 150 ? 37.072  -8.227  -4.740  1.00 40.06 ? 324  LYS A C     1 
ATOM   1808 O  O     . LYS C 3 150 ? 36.811  -8.544  -3.585  1.00 41.66 ? 324  LYS A O     1 
ATOM   1809 C  CB    . LYS C 3 150 ? 36.561  -6.063  -5.911  1.00 44.75 ? 324  LYS A CB    1 
ATOM   1810 C  CG    . LYS C 3 150 ? 36.965  -4.619  -6.224  1.00 55.92 ? 324  LYS A CG    1 
ATOM   1811 C  CD    . LYS C 3 150 ? 35.844  -3.828  -6.909  1.00 64.96 ? 324  LYS A CD    1 
ATOM   1812 C  CE    . LYS C 3 150 ? 35.371  -4.509  -8.205  1.00 73.64 ? 324  LYS A CE    1 
ATOM   1813 N  NZ    . LYS C 3 150 ? 34.310  -3.744  -8.944  1.00 74.25 ? 324  LYS A NZ    1 
ATOM   1814 N  N     . LEU C 3 151 ? 36.992  -9.088  -5.754  1.00 39.07 ? 325  LEU A N     1 
ATOM   1815 C  CA    . LEU C 3 151 ? 36.511  -10.453 -5.550  1.00 34.14 ? 325  LEU A CA    1 
ATOM   1816 C  C     . LEU C 3 151 ? 37.255  -11.169 -4.449  1.00 31.96 ? 325  LEU A C     1 
ATOM   1817 O  O     . LEU C 3 151 ? 36.665  -11.909 -3.679  1.00 34.93 ? 325  LEU A O     1 
ATOM   1818 C  CB    . LEU C 3 151 ? 36.598  -11.280 -6.837  1.00 32.55 ? 325  LEU A CB    1 
ATOM   1819 C  CG    . LEU C 3 151 ? 36.235  -12.769 -6.701  1.00 32.50 ? 325  LEU A CG    1 
ATOM   1820 C  CD1   . LEU C 3 151 ? 34.856  -12.955 -6.097  1.00 32.14 ? 325  LEU A CD1   1 
ATOM   1821 C  CD2   . LEU C 3 151 ? 36.315  -13.465 -8.032  1.00 33.59 ? 325  LEU A CD2   1 
ATOM   1822 N  N     . LYS C 3 152 ? 38.561  -10.994 -4.403  1.00 32.72 ? 326  LYS A N     1 
ATOM   1823 C  CA    . LYS C 3 152 ? 39.333  -11.650 -3.379  1.00 39.83 ? 326  LYS A CA    1 
ATOM   1824 C  C     . LYS C 3 152 ? 38.884  -11.238 -1.976  1.00 42.52 ? 326  LYS A C     1 
ATOM   1825 O  O     . LYS C 3 152 ? 38.668  -12.088 -1.111  1.00 45.04 ? 326  LYS A O     1 
ATOM   1826 C  CB    . LYS C 3 152 ? 40.816  -11.368 -3.559  1.00 43.09 ? 326  LYS A CB    1 
ATOM   1827 C  CG    . LYS C 3 152 ? 41.639  -12.147 -2.566  1.00 59.89 ? 326  LYS A CG    1 
ATOM   1828 C  CD    . LYS C 3 152 ? 43.121  -11.851 -2.652  1.00 71.62 ? 326  LYS A CD    1 
ATOM   1829 C  CE    . LYS C 3 152 ? 43.854  -12.694 -1.623  1.00 76.51 ? 326  LYS A CE    1 
ATOM   1830 N  NZ    . LYS C 3 152 ? 43.213  -12.569 -0.267  1.00 84.65 ? 326  LYS A NZ    1 
ATOM   1831 N  N     . ILE C 3 153 ? 38.735  -9.937  -1.749  1.00 41.66 ? 327  ILE A N     1 
ATOM   1832 C  CA    . ILE C 3 153 ? 38.325  -9.480  -0.433  1.00 42.30 ? 327  ILE A CA    1 
ATOM   1833 C  C     . ILE C 3 153 ? 36.874  -9.823  -0.111  1.00 44.59 ? 327  ILE A C     1 
ATOM   1834 O  O     . ILE C 3 153 ? 36.555  -10.133 1.038   1.00 46.41 ? 327  ILE A O     1 
ATOM   1835 C  CB    . ILE C 3 153 ? 38.616  -7.963  -0.196  1.00 43.22 ? 327  ILE A CB    1 
ATOM   1836 C  CG1   . ILE C 3 153 ? 37.699  -7.078  -1.039  1.00 41.44 ? 327  ILE A CG1   1 
ATOM   1837 C  CG2   . ILE C 3 153 ? 40.111  -7.653  -0.407  1.00 39.98 ? 327  ILE A CG2   1 
ATOM   1838 C  CD1   . ILE C 3 153 ? 36.657  -6.350  -0.222  1.00 31.60 ? 327  ILE A CD1   1 
ATOM   1839 N  N     . LYS C 3 154 ? 36.004  -9.790  -1.114  1.00 41.96 ? 328  LYS A N     1 
ATOM   1840 C  CA    . LYS C 3 154 ? 34.604  -10.131 -0.885  1.00 45.25 ? 328  LYS A CA    1 
ATOM   1841 C  C     . LYS C 3 154 ? 34.562  -11.531 -0.263  1.00 48.16 ? 328  LYS A C     1 
ATOM   1842 O  O     . LYS C 3 154 ? 33.796  -11.807 0.667   1.00 45.74 ? 328  LYS A O     1 
ATOM   1843 C  CB    . LYS C 3 154 ? 33.813  -10.108 -2.206  1.00 46.11 ? 328  LYS A CB    1 
ATOM   1844 C  CG    . LYS C 3 154 ? 32.524  -10.901 -2.141  1.00 51.38 ? 328  LYS A CG    1 
ATOM   1845 C  CD    . LYS C 3 154 ? 31.619  -10.729 -3.329  1.00 58.70 ? 328  LYS A CD    1 
ATOM   1846 C  CE    . LYS C 3 154 ? 30.333  -11.552 -3.099  1.00 65.69 ? 328  LYS A CE    1 
ATOM   1847 N  NZ    . LYS C 3 154 ? 29.208  -11.226 -4.025  1.00 67.96 ? 328  LYS A NZ    1 
ATOM   1848 N  N     . GLU C 3 155 ? 35.434  -12.399 -0.754  1.00 49.59 ? 329  GLU A N     1 
ATOM   1849 C  CA    . GLU C 3 155 ? 35.461  -13.743 -0.264  1.00 54.77 ? 329  GLU A CA    1 
ATOM   1850 C  C     . GLU C 3 155 ? 36.202  -13.875 1.060   1.00 53.93 ? 329  GLU A C     1 
ATOM   1851 O  O     . GLU C 3 155 ? 35.947  -14.815 1.813   1.00 53.08 ? 329  GLU A O     1 
ATOM   1852 C  CB    . GLU C 3 155 ? 35.934  -14.696 -1.370  1.00 62.68 ? 329  GLU A CB    1 
ATOM   1853 C  CG    . GLU C 3 155 ? 34.838  -14.968 -2.441  1.00 75.57 ? 329  GLU A CG    1 
ATOM   1854 C  CD    . GLU C 3 155 ? 33.887  -16.140 -2.092  1.00 85.39 ? 329  GLU A CD    1 
ATOM   1855 O  OE1   . GLU C 3 155 ? 34.384  -17.209 -1.668  1.00 93.81 ? 329  GLU A OE1   1 
ATOM   1856 O  OE2   . GLU C 3 155 ? 32.649  -16.015 -2.270  1.00 83.86 ? 329  GLU A OE2   1 
ATOM   1857 N  N     . GLU C 3 156 ? 37.072  -12.919 1.371   1.00 55.56 ? 330  GLU A N     1 
ATOM   1858 C  CA    . GLU C 3 156 ? 37.792  -12.926 2.650   1.00 55.87 ? 330  GLU A CA    1 
ATOM   1859 C  C     . GLU C 3 156 ? 36.724  -12.664 3.733   1.00 54.20 ? 330  GLU A C     1 
ATOM   1860 O  O     . GLU C 3 156 ? 36.759  -13.230 4.818   1.00 50.35 ? 330  GLU A O     1 
ATOM   1861 C  CB    . GLU C 3 156 ? 38.873  -11.822 2.667   1.00 60.70 ? 330  GLU A CB    1 
ATOM   1862 C  CG    . GLU C 3 156 ? 40.033  -12.012 3.676   1.00 72.42 ? 330  GLU A CG    1 
ATOM   1863 C  CD    . GLU C 3 156 ? 41.331  -11.189 3.332   1.00 82.76 ? 330  GLU A CD    1 
ATOM   1864 O  OE1   . GLU C 3 156 ? 41.323  -10.386 2.356   1.00 84.05 ? 330  GLU A OE1   1 
ATOM   1865 O  OE2   . GLU C 3 156 ? 42.371  -11.361 4.033   1.00 79.43 ? 330  GLU A OE2   1 
ATOM   1866 N  N     . ASN C 3 157 ? 35.718  -11.870 3.367   1.00 53.83 ? 331  ASN A N     1 
ATOM   1867 C  CA    . ASN C 3 157 ? 34.593  -11.515 4.243   1.00 52.52 ? 331  ASN A CA    1 
ATOM   1868 C  C     . ASN C 3 157 ? 33.672  -12.674 4.425   1.00 49.62 ? 331  ASN A C     1 
ATOM   1869 O  O     . ASN C 3 157 ? 33.136  -12.896 5.507   1.00 51.02 ? 331  ASN A O     1 
ATOM   1870 C  CB    . ASN C 3 157 ? 33.718  -10.456 3.593   1.00 54.17 ? 331  ASN A CB    1 
ATOM   1871 C  CG    . ASN C 3 157 ? 34.322  -9.076  3.637   1.00 63.27 ? 331  ASN A CG    1 
ATOM   1872 O  OD1   . ASN C 3 157 ? 34.744  -8.613  4.699   1.00 65.89 ? 331  ASN A OD1   1 
ATOM   1873 N  ND2   . ASN C 3 157 ? 34.357  -8.399  2.495   1.00 69.47 ? 331  ASN A ND2   1 
ATOM   1874 N  N     . GLU C 3 158 ? 33.348  -13.299 3.315   1.00 45.75 ? 332  GLU A N     1 
ATOM   1875 C  CA    . GLU C 3 158 ? 32.450  -14.407 3.318   1.00 41.46 ? 332  GLU A CA    1 
ATOM   1876 C  C     . GLU C 3 158 ? 32.928  -15.473 4.275   1.00 37.80 ? 332  GLU A C     1 
ATOM   1877 O  O     . GLU C 3 158 ? 32.113  -16.167 4.857   1.00 38.91 ? 332  GLU A O     1 
ATOM   1878 C  CB    . GLU C 3 158 ? 32.313  -14.964 1.892   1.00 47.77 ? 332  GLU A CB    1 
ATOM   1879 N  N     . LYS C 3 159 ? 34.240  -15.616 4.433   1.00 40.77 ? 333  LYS A N     1 
ATOM   1880 C  CA    . LYS C 3 159 ? 34.778  -16.647 5.340   1.00 45.69 ? 333  LYS A CA    1 
ATOM   1881 C  C     . LYS C 3 159 ? 34.673  -16.256 6.809   1.00 42.68 ? 333  LYS A C     1 
ATOM   1882 O  O     . LYS C 3 159 ? 34.486  -17.097 7.705   1.00 43.13 ? 333  LYS A O     1 
ATOM   1883 C  CB    . LYS C 3 159 ? 36.219  -17.026 4.976   1.00 49.16 ? 333  LYS A CB    1 
ATOM   1884 C  CG    . LYS C 3 159 ? 37.250  -15.970 5.258   1.00 61.64 ? 333  LYS A CG    1 
ATOM   1885 C  CD    . LYS C 3 159 ? 38.627  -16.468 4.871   1.00 76.71 ? 333  LYS A CD    1 
ATOM   1886 C  CE    . LYS C 3 159 ? 39.722  -15.481 5.276   1.00 85.30 ? 333  LYS A CE    1 
ATOM   1887 N  NZ    . LYS C 3 159 ? 41.110  -15.928 4.907   1.00 90.68 ? 333  LYS A NZ    1 
ATOM   1888 N  N     . LEU C 3 160 ? 34.753  -14.955 7.041   1.00 44.37 ? 334  LEU A N     1 
ATOM   1889 C  CA    . LEU C 3 160 ? 34.637  -14.412 8.379   1.00 38.50 ? 334  LEU A CA    1 
ATOM   1890 C  C     . LEU C 3 160 ? 33.177  -14.576 8.799   1.00 34.71 ? 334  LEU A C     1 
ATOM   1891 O  O     . LEU C 3 160 ? 32.880  -15.109 9.863   1.00 33.80 ? 334  LEU A O     1 
ATOM   1892 C  CB    . LEU C 3 160 ? 35.009  -12.932 8.355   1.00 40.22 ? 334  LEU A CB    1 
ATOM   1893 C  CG    . LEU C 3 160 ? 35.609  -12.374 9.635   1.00 42.99 ? 334  LEU A CG    1 
ATOM   1894 C  CD1   . LEU C 3 160 ? 37.122  -12.314 9.492   1.00 45.04 ? 334  LEU A CD1   1 
ATOM   1895 C  CD2   . LEU C 3 160 ? 35.043  -10.990 9.885   1.00 45.06 ? 334  LEU A CD2   1 
ATOM   1896 N  N     . LEU C 3 161 ? 32.277  -14.159 7.914   1.00 33.15 ? 335  LEU A N     1 
ATOM   1897 C  CA    . LEU C 3 161 ? 30.830  -14.225 8.133   1.00 35.34 ? 335  LEU A CA    1 
ATOM   1898 C  C     . LEU C 3 161 ? 30.289  -15.640 8.332   1.00 35.18 ? 335  LEU A C     1 
ATOM   1899 O  O     . LEU C 3 161 ? 29.400  -15.880 9.152   1.00 37.22 ? 335  LEU A O     1 
ATOM   1900 C  CB    . LEU C 3 161 ? 30.109  -13.551 6.954   1.00 33.11 ? 335  LEU A CB    1 
ATOM   1901 C  CG    . LEU C 3 161 ? 28.592  -13.334 6.941   1.00 35.31 ? 335  LEU A CG    1 
ATOM   1902 C  CD1   . LEU C 3 161 ? 27.839  -14.545 6.443   1.00 42.72 ? 335  LEU A CD1   1 
ATOM   1903 C  CD2   . LEU C 3 161 ? 28.121  -12.913 8.322   1.00 46.35 ? 335  LEU A CD2   1 
ATOM   1904 N  N     . LYS C 3 162 ? 30.753  -16.556 7.502   1.00 36.66 ? 336  LYS A N     1 
ATOM   1905 C  CA    . LYS C 3 162 ? 30.310  -17.924 7.587   1.00 36.25 ? 336  LYS A CA    1 
ATOM   1906 C  C     . LYS C 3 162 ? 30.913  -18.599 8.828   1.00 39.43 ? 336  LYS A C     1 
ATOM   1907 O  O     . LYS C 3 162 ? 30.352  -19.579 9.339   1.00 44.42 ? 336  LYS A O     1 
ATOM   1908 C  CB    . LYS C 3 162 ? 30.673  -18.662 6.296   1.00 32.10 ? 336  LYS A CB    1 
ATOM   1909 N  N     . GLU C 3 163 ? 32.013  -18.052 9.342   1.00 35.46 ? 337  GLU A N     1 
ATOM   1910 C  CA    . GLU C 3 163 ? 32.660  -18.629 10.517  1.00 33.56 ? 337  GLU A CA    1 
ATOM   1911 C  C     . GLU C 3 163 ? 32.218  -18.051 11.870  1.00 30.07 ? 337  GLU A C     1 
ATOM   1912 O  O     . GLU C 3 163 ? 31.927  -18.797 12.780  1.00 33.81 ? 337  GLU A O     1 
ATOM   1913 C  CB    . GLU C 3 163 ? 34.174  -18.539 10.377  1.00 30.90 ? 337  GLU A CB    1 
ATOM   1914 N  N     . TYR C 3 164 ? 32.205  -16.728 12.003  1.00 25.44 ? 338  TYR A N     1 
ATOM   1915 C  CA    . TYR C 3 164 ? 31.811  -16.065 13.243  1.00 26.79 ? 338  TYR A CA    1 
ATOM   1916 C  C     . TYR C 3 164 ? 30.490  -15.359 13.105  1.00 21.75 ? 338  TYR A C     1 
ATOM   1917 O  O     . TYR C 3 164 ? 30.067  -14.667 13.999  1.00 23.11 ? 338  TYR A O     1 
ATOM   1918 C  CB    . TYR C 3 164 ? 32.858  -15.024 13.643  1.00 31.46 ? 338  TYR A CB    1 
ATOM   1919 C  CG    . TYR C 3 164 ? 34.259  -15.583 13.749  1.00 40.96 ? 338  TYR A CG    1 
ATOM   1920 C  CD1   . TYR C 3 164 ? 34.733  -16.113 14.954  1.00 46.67 ? 338  TYR A CD1   1 
ATOM   1921 C  CD2   . TYR C 3 164 ? 35.113  -15.604 12.642  1.00 42.36 ? 338  TYR A CD2   1 
ATOM   1922 C  CE1   . TYR C 3 164 ? 36.033  -16.660 15.058  1.00 48.52 ? 338  TYR A CE1   1 
ATOM   1923 C  CE2   . TYR C 3 164 ? 36.414  -16.149 12.733  1.00 46.40 ? 338  TYR A CE2   1 
ATOM   1924 C  CZ    . TYR C 3 164 ? 36.861  -16.676 13.946  1.00 48.47 ? 338  TYR A CZ    1 
ATOM   1925 O  OH    . TYR C 3 164 ? 38.110  -17.247 14.036  1.00 49.24 ? 338  TYR A OH    1 
ATOM   1926 N  N     . GLY C 3 165 ? 29.891  -15.433 11.928  1.00 30.96 ? 339  GLY A N     1 
ATOM   1927 C  CA    . GLY C 3 165 ? 28.616  -14.778 11.693  1.00 26.16 ? 339  GLY A CA    1 
ATOM   1928 C  C     . GLY C 3 165 ? 27.417  -15.551 12.209  1.00 30.67 ? 339  GLY A C     1 
ATOM   1929 O  O     . GLY C 3 165 ? 26.304  -15.037 12.198  1.00 35.30 ? 339  GLY A O     1 
ATOM   1930 N  N     . PHE C 3 166 ? 27.627  -16.786 12.650  1.00 30.63 ? 340  PHE A N     1 
ATOM   1931 C  CA    . PHE C 3 166 ? 26.539  -17.618 13.161  1.00 28.86 ? 340  PHE A CA    1 
ATOM   1932 C  C     . PHE C 3 166 ? 26.844  -18.322 14.475  1.00 33.32 ? 340  PHE A C     1 
ATOM   1933 O  O     . PHE C 3 166 ? 27.993  -18.516 14.854  1.00 30.45 ? 340  PHE A O     1 
ATOM   1934 C  CB    . PHE C 3 166 ? 26.172  -18.677 12.137  1.00 26.59 ? 340  PHE A CB    1 
ATOM   1935 C  CG    . PHE C 3 166 ? 25.651  -18.114 10.868  1.00 39.68 ? 340  PHE A CG    1 
ATOM   1936 C  CD1   . PHE C 3 166 ? 26.520  -17.758 9.830   1.00 38.33 ? 340  PHE A CD1   1 
ATOM   1937 C  CD2   . PHE C 3 166 ? 24.277  -17.923 10.690  1.00 42.79 ? 340  PHE A CD2   1 
ATOM   1938 C  CE1   . PHE C 3 166 ? 26.013  -17.214 8.616   1.00 40.54 ? 340  PHE A CE1   1 
ATOM   1939 C  CE2   . PHE C 3 166 ? 23.762  -17.381 9.483   1.00 39.72 ? 340  PHE A CE2   1 
ATOM   1940 C  CZ    . PHE C 3 166 ? 24.630  -17.028 8.444   1.00 32.30 ? 340  PHE A CZ    1 
ATOM   1941 N  N     . CYS C 3 167 ? 25.782  -18.724 15.159  1.00 34.65 ? 341  CYS A N     1 
ATOM   1942 C  CA    . CYS C 3 167 ? 25.908  -19.454 16.410  1.00 32.07 ? 341  CYS A CA    1 
ATOM   1943 C  C     . CYS C 3 167 ? 24.843  -20.563 16.421  1.00 31.34 ? 341  CYS A C     1 
ATOM   1944 O  O     . CYS C 3 167 ? 24.012  -20.674 15.512  1.00 31.87 ? 341  CYS A O     1 
ATOM   1945 C  CB    . CYS C 3 167 ? 25.699  -18.519 17.600  1.00 31.66 ? 341  CYS A CB    1 
ATOM   1946 S  SG    . CYS C 3 167 ? 23.963  -18.154 17.941  1.00 33.63 ? 341  CYS A SG    1 
ATOM   1947 N  N     . ILE C 3 168 ? 24.926  -21.446 17.395  1.00 32.44 ? 342  ILE A N     1 
ATOM   1948 C  CA    . ILE C 3 168 ? 23.932  -22.483 17.497  1.00 36.48 ? 342  ILE A CA    1 
ATOM   1949 C  C     . ILE C 3 168 ? 23.231  -22.174 18.778  1.00 35.73 ? 342  ILE A C     1 
ATOM   1950 O  O     . ILE C 3 168 ? 23.866  -22.013 19.819  1.00 32.47 ? 342  ILE A O     1 
ATOM   1951 C  CB    . ILE C 3 168 ? 24.525  -23.898 17.605  1.00 40.36 ? 342  ILE A CB    1 
ATOM   1952 C  CG1   . ILE C 3 168 ? 25.265  -24.265 16.323  1.00 36.91 ? 342  ILE A CG1   1 
ATOM   1953 C  CG2   . ILE C 3 168 ? 23.400  -24.915 17.844  1.00 39.71 ? 342  ILE A CG2   1 
ATOM   1954 C  CD1   . ILE C 3 168 ? 26.042  -25.534 16.453  1.00 32.74 ? 342  ILE A CD1   1 
ATOM   1955 N  N     . MET C 3 169 ? 21.937  -21.943 18.665  1.00 38.54 ? 343  MET A N     1 
ATOM   1956 C  CA    . MET C 3 169 ? 21.126  -21.688 19.832  1.00 39.16 ? 343  MET A CA    1 
ATOM   1957 C  C     . MET C 3 169 ? 20.126  -22.824 19.784  1.00 40.14 ? 343  MET A C     1 
ATOM   1958 O  O     . MET C 3 169 ? 19.494  -23.042 18.761  1.00 43.70 ? 343  MET A O     1 
ATOM   1959 C  CB    . MET C 3 169 ? 20.437  -20.323 19.757  1.00 39.70 ? 343  MET A CB    1 
ATOM   1960 C  CG    . MET C 3 169 ? 19.806  -19.930 21.085  1.00 43.17 ? 343  MET A CG    1 
ATOM   1961 S  SD    . MET C 3 169 ? 18.937  -18.397 21.113  1.00 50.04 ? 343  MET A SD    1 
ATOM   1962 C  CE    . MET C 3 169 ? 20.118  -17.306 21.951  1.00 46.29 ? 343  MET A CE    1 
ATOM   1963 N  N     . ASP C 3 170 ? 20.034  -23.576 20.875  1.00 40.03 ? 344  ASP A N     1 
ATOM   1964 C  CA    . ASP C 3 170 ? 19.143  -24.716 20.930  1.00 39.90 ? 344  ASP A CA    1 
ATOM   1965 C  C     . ASP C 3 170 ? 19.486  -25.569 19.714  1.00 41.27 ? 344  ASP A C     1 
ATOM   1966 O  O     . ASP C 3 170 ? 20.668  -25.843 19.474  1.00 45.10 ? 344  ASP A O     1 
ATOM   1967 C  CB    . ASP C 3 170 ? 17.679  -24.270 20.985  1.00 39.52 ? 344  ASP A CB    1 
ATOM   1968 C  CG    . ASP C 3 170 ? 17.324  -23.592 22.317  1.00 45.27 ? 344  ASP A CG    1 
ATOM   1969 O  OD1   . ASP C 3 170 ? 18.185  -23.538 23.221  1.00 42.39 ? 344  ASP A OD1   1 
ATOM   1970 O  OD2   . ASP C 3 170 ? 16.180  -23.111 22.467  1.00 48.95 ? 344  ASP A OD2   1 
ATOM   1971 N  N     . ASN C 3 171 ? 18.508  -25.937 18.901  1.00 43.76 ? 345  ASN A N     1 
ATOM   1972 C  CA    . ASN C 3 171 ? 18.810  -26.787 17.753  1.00 45.97 ? 345  ASN A CA    1 
ATOM   1973 C  C     . ASN C 3 171 ? 19.034  -26.154 16.375  1.00 45.29 ? 345  ASN A C     1 
ATOM   1974 O  O     . ASN C 3 171 ? 19.200  -26.892 15.408  1.00 52.30 ? 345  ASN A O     1 
ATOM   1975 C  CB    . ASN C 3 171 ? 17.751  -27.886 17.630  1.00 45.95 ? 345  ASN A CB    1 
ATOM   1976 N  N     . HIS C 3 172 ? 19.033  -24.827 16.252  1.00 44.11 ? 346  HIS A N     1 
ATOM   1977 C  CA    . HIS C 3 172 ? 19.229  -24.199 14.943  1.00 39.49 ? 346  HIS A CA    1 
ATOM   1978 C  C     . HIS C 3 172 ? 20.382  -23.203 14.905  1.00 38.06 ? 346  HIS A C     1 
ATOM   1979 O  O     . HIS C 3 172 ? 20.818  -22.690 15.939  1.00 36.57 ? 346  HIS A O     1 
ATOM   1980 C  CB    . HIS C 3 172 ? 17.956  -23.487 14.481  1.00 38.63 ? 346  HIS A CB    1 
ATOM   1981 C  CG    . HIS C 3 172 ? 16.722  -24.337 14.525  1.00 39.88 ? 346  HIS A CG    1 
ATOM   1982 N  ND1   . HIS C 3 172 ? 16.359  -25.182 13.498  1.00 48.08 ? 346  HIS A ND1   1 
ATOM   1983 C  CD2   . HIS C 3 172 ? 15.738  -24.427 15.449  1.00 46.33 ? 346  HIS A CD2   1 
ATOM   1984 C  CE1   . HIS C 3 172 ? 15.203  -25.756 13.788  1.00 47.12 ? 346  HIS A CE1   1 
ATOM   1985 N  NE2   . HIS C 3 172 ? 14.806  -25.317 14.967  1.00 49.34 ? 346  HIS A NE2   1 
ATOM   1986 N  N     . LYS C 3 173 ? 20.902  -22.964 13.703  1.00 39.57 ? 347  LYS A N     1 
ATOM   1987 C  CA    . LYS C 3 173 ? 21.997  -22.006 13.527  1.00 42.70 ? 347  LYS A CA    1 
ATOM   1988 C  C     . LYS C 3 173 ? 21.375  -20.636 13.328  1.00 43.15 ? 347  LYS A C     1 
ATOM   1989 O  O     . LYS C 3 173 ? 20.496  -20.468 12.482  1.00 48.34 ? 347  LYS A O     1 
ATOM   1990 C  CB    . LYS C 3 173 ? 22.871  -22.354 12.315  1.00 38.21 ? 347  LYS A CB    1 
ATOM   1991 N  N     . GLU C 3 174 ? 21.806  -19.664 14.121  1.00 43.79 ? 348  GLU A N     1 
ATOM   1992 C  CA    . GLU C 3 174 ? 21.263  -18.315 14.017  1.00 39.81 ? 348  GLU A CA    1 
ATOM   1993 C  C     . GLU C 3 174 ? 22.310  -17.346 13.539  1.00 35.89 ? 348  GLU A C     1 
ATOM   1994 O  O     . GLU C 3 174 ? 23.502  -17.625 13.599  1.00 35.18 ? 348  GLU A O     1 
ATOM   1995 C  CB    . GLU C 3 174 ? 20.719  -17.850 15.375  1.00 41.64 ? 348  GLU A CB    1 
ATOM   1996 C  CG    . GLU C 3 174 ? 19.635  -18.755 15.983  1.00 46.76 ? 348  GLU A CG    1 
ATOM   1997 C  CD    . GLU C 3 174 ? 18.247  -18.620 15.319  1.00 53.42 ? 348  GLU A CD    1 
ATOM   1998 O  OE1   . GLU C 3 174 ? 18.170  -18.512 14.070  1.00 53.34 ? 348  GLU A OE1   1 
ATOM   1999 O  OE2   . GLU C 3 174 ? 17.229  -18.626 16.060  1.00 55.22 ? 348  GLU A OE2   1 
ATOM   2000 N  N     . ARG C 3 175 ? 21.850  -16.223 13.021  1.00 37.77 ? 349  ARG A N     1 
ATOM   2001 C  CA    . ARG C 3 175 ? 22.727  -15.168 12.551  1.00 39.23 ? 349  ARG A CA    1 
ATOM   2002 C  C     . ARG C 3 175 ? 23.051  -14.215 13.723  1.00 35.18 ? 349  ARG A C     1 
ATOM   2003 O  O     . ARG C 3 175 ? 22.197  -13.879 14.542  1.00 32.93 ? 349  ARG A O     1 
ATOM   2004 C  CB    . ARG C 3 175 ? 22.055  -14.427 11.385  1.00 44.62 ? 349  ARG A CB    1 
ATOM   2005 C  CG    . ARG C 3 175 ? 22.855  -13.297 10.731  1.00 51.91 ? 349  ARG A CG    1 
ATOM   2006 C  CD    . ARG C 3 175 ? 24.245  -13.742 10.310  1.00 62.87 ? 349  ARG A CD    1 
ATOM   2007 N  NE    . ARG C 3 175 ? 24.629  -13.250 8.988   1.00 73.34 ? 349  ARG A NE    1 
ATOM   2008 C  CZ    . ARG C 3 175 ? 24.664  -11.966 8.632   1.00 82.18 ? 349  ARG A CZ    1 
ATOM   2009 N  NH1   . ARG C 3 175 ? 24.340  -11.010 9.500   1.00 84.37 ? 349  ARG A NH1   1 
ATOM   2010 N  NH2   . ARG C 3 175 ? 25.013  -11.636 7.390   1.00 87.38 ? 349  ARG A NH2   1 
ATOM   2011 N  N     . ILE C 3 176 ? 24.322  -13.872 13.851  1.00 32.57 ? 350  ILE A N     1 
ATOM   2012 C  CA    . ILE C 3 176 ? 24.791  -12.966 14.898  1.00 35.25 ? 350  ILE A CA    1 
ATOM   2013 C  C     . ILE C 3 176 ? 24.910  -11.580 14.255  1.00 33.00 ? 350  ILE A C     1 
ATOM   2014 O  O     . ILE C 3 176 ? 25.433  -11.459 13.143  1.00 38.32 ? 350  ILE A O     1 
ATOM   2015 C  CB    . ILE C 3 176 ? 26.207  -13.399 15.440  1.00 35.72 ? 350  ILE A CB    1 
ATOM   2016 C  CG1   . ILE C 3 176 ? 26.162  -14.825 16.006  1.00 32.00 ? 350  ILE A CG1   1 
ATOM   2017 C  CG2   . ILE C 3 176 ? 26.713  -12.425 16.507  1.00 27.05 ? 350  ILE A CG2   1 
ATOM   2018 C  CD1   . ILE C 3 176 ? 27.565  -15.392 16.327  1.00 31.90 ? 350  ILE A CD1   1 
ATOM   2019 N  N     . ALA C 3 177 ? 24.425  -10.553 14.946  1.00 30.15 ? 351  ALA A N     1 
ATOM   2020 C  CA    . ALA C 3 177 ? 24.469  -9.188  14.433  1.00 28.77 ? 351  ALA A CA    1 
ATOM   2021 C  C     . ALA C 3 177 ? 25.873  -8.567  14.385  1.00 31.51 ? 351  ALA A C     1 
ATOM   2022 O  O     . ALA C 3 177 ? 26.531  -8.556  13.338  1.00 35.90 ? 351  ALA A O     1 
ATOM   2023 C  CB    . ALA C 3 177 ? 23.546  -8.320  15.236  1.00 25.95 ? 351  ALA A CB    1 
ATOM   2024 N  N     . ASN C 3 178 ? 26.315  -8.041  15.520  1.00 30.85 ? 352  ASN A N     1 
ATOM   2025 C  CA    . ASN C 3 178 ? 27.625  -7.398  15.617  1.00 31.44 ? 352  ASN A CA    1 
ATOM   2026 C  C     . ASN C 3 178 ? 28.631  -8.410  16.098  1.00 32.45 ? 352  ASN A C     1 
ATOM   2027 O  O     . ASN C 3 178 ? 28.876  -8.523  17.304  1.00 34.73 ? 352  ASN A O     1 
ATOM   2028 C  CB    . ASN C 3 178 ? 27.586  -6.191  16.584  1.00 32.17 ? 352  ASN A CB    1 
ATOM   2029 C  CG    . ASN C 3 178 ? 26.904  -6.513  17.919  1.00 32.83 ? 352  ASN A CG    1 
ATOM   2030 O  OD1   . ASN C 3 178 ? 26.048  -7.408  18.022  1.00 36.34 ? 352  ASN A OD1   1 
ATOM   2031 N  ND2   . ASN C 3 178 ? 27.249  -5.756  18.941  1.00 32.06 ? 352  ASN A ND2   1 
ATOM   2032 N  N     . PHE C 3 179 ? 29.162  -9.218  15.192  1.00 28.31 ? 353  PHE A N     1 
ATOM   2033 C  CA    . PHE C 3 179 ? 30.130  -10.196 15.633  1.00 27.79 ? 353  PHE A CA    1 
ATOM   2034 C  C     . PHE C 3 179 ? 31.563  -9.675  15.831  1.00 29.53 ? 353  PHE A C     1 
ATOM   2035 O  O     . PHE C 3 179 ? 32.402  -10.375 16.419  1.00 31.77 ? 353  PHE A O     1 
ATOM   2036 C  CB    . PHE C 3 179 ? 30.081  -11.450 14.775  1.00 23.42 ? 353  PHE A CB    1 
ATOM   2037 C  CG    . PHE C 3 179 ? 30.378  -11.215 13.354  1.00 20.03 ? 353  PHE A CG    1 
ATOM   2038 C  CD1   . PHE C 3 179 ? 31.673  -11.233 12.902  1.00 24.00 ? 353  PHE A CD1   1 
ATOM   2039 C  CD2   . PHE C 3 179 ? 29.354  -11.061 12.444  1.00 27.56 ? 353  PHE A CD2   1 
ATOM   2040 C  CE1   . PHE C 3 179 ? 31.945  -11.099 11.553  1.00 26.62 ? 353  PHE A CE1   1 
ATOM   2041 C  CE2   . PHE C 3 179 ? 29.614  -10.926 11.088  1.00 24.48 ? 353  PHE A CE2   1 
ATOM   2042 C  CZ    . PHE C 3 179 ? 30.908  -10.950 10.642  1.00 22.87 ? 353  PHE A CZ    1 
ATOM   2043 N  N     . LYS C 3 180 ? 31.837  -8.454  15.376  1.00 25.92 ? 354  LYS A N     1 
ATOM   2044 C  CA    . LYS C 3 180 ? 33.158  -7.853  15.533  1.00 27.23 ? 354  LYS A CA    1 
ATOM   2045 C  C     . LYS C 3 180 ? 33.213  -6.743  16.604  1.00 27.78 ? 354  LYS A C     1 
ATOM   2046 O  O     . LYS C 3 180 ? 32.347  -5.902  16.714  1.00 25.47 ? 354  LYS A O     1 
ATOM   2047 C  CB    . LYS C 3 180 ? 33.649  -7.285  14.212  1.00 27.14 ? 354  LYS A CB    1 
ATOM   2048 C  CG    . LYS C 3 180 ? 32.935  -7.810  13.018  1.00 29.86 ? 354  LYS A CG    1 
ATOM   2049 C  CD    . LYS C 3 180 ? 33.397  -7.087  11.796  1.00 28.95 ? 354  LYS A CD    1 
ATOM   2050 C  CE    . LYS C 3 180 ? 32.688  -7.576  10.563  1.00 28.21 ? 354  LYS A CE    1 
ATOM   2051 N  NZ    . LYS C 3 180 ? 33.350  -7.015  9.340   1.00 39.50 ? 354  LYS A NZ    1 
ATOM   2052 N  N     . ILE C 3 181 ? 34.282  -6.724  17.377  1.00 32.66 ? 355  ILE A N     1 
ATOM   2053 C  CA    . ILE C 3 181 ? 34.418  -5.716  18.405  1.00 33.13 ? 355  ILE A CA    1 
ATOM   2054 C  C     . ILE C 3 181 ? 34.677  -4.356  17.760  1.00 34.78 ? 355  ILE A C     1 
ATOM   2055 O  O     . ILE C 3 181 ? 35.454  -4.257  16.788  1.00 34.59 ? 355  ILE A O     1 
ATOM   2056 C  CB    . ILE C 3 181 ? 35.611  -6.035  19.339  1.00 34.56 ? 355  ILE A CB    1 
ATOM   2057 C  CG1   . ILE C 3 181 ? 35.507  -7.458  19.881  1.00 28.89 ? 355  ILE A CG1   1 
ATOM   2058 C  CG2   . ILE C 3 181 ? 35.648  -5.040  20.494  1.00 36.24 ? 355  ILE A CG2   1 
ATOM   2059 C  CD1   . ILE C 3 181 ? 34.342  -7.652  20.828  1.00 31.19 ? 355  ILE A CD1   1 
ATOM   2060 N  N     . GLU C 3 182 ? 34.059  -3.318  18.336  1.00 37.09 ? 356  GLU A N     1 
ATOM   2061 C  CA    . GLU C 3 182 ? 34.211  -1.937  17.883  1.00 34.00 ? 356  GLU A CA    1 
ATOM   2062 C  C     . GLU C 3 182 ? 35.665  -1.581  18.013  1.00 30.91 ? 356  GLU A C     1 
ATOM   2063 O  O     . GLU C 3 182 ? 36.247  -1.742  19.064  1.00 31.25 ? 356  GLU A O     1 
ATOM   2064 C  CB    . GLU C 3 182 ? 33.433  -0.992  18.761  1.00 35.82 ? 356  GLU A CB    1 
ATOM   2065 C  CG    . GLU C 3 182 ? 31.968  -1.251  18.742  1.00 48.88 ? 356  GLU A CG    1 
ATOM   2066 C  CD    . GLU C 3 182 ? 31.242  -0.566  19.889  1.00 55.25 ? 356  GLU A CD    1 
ATOM   2067 O  OE1   . GLU C 3 182 ? 31.863  0.281   20.583  1.00 56.79 ? 356  GLU A OE1   1 
ATOM   2068 O  OE2   . GLU C 3 182 ? 30.048  -0.893  20.103  1.00 51.89 ? 356  GLU A OE2   1 
ATOM   2069 N  N     . PRO C 3 183 ? 36.268  -1.127  16.923  1.00 27.20 ? 357  PRO A N     1 
ATOM   2070 C  CA    . PRO C 3 183 ? 37.669  -0.726  16.799  1.00 26.97 ? 357  PRO A CA    1 
ATOM   2071 C  C     . PRO C 3 183 ? 38.036  0.497   17.634  1.00 29.10 ? 357  PRO A C     1 
ATOM   2072 O  O     . PRO C 3 183 ? 37.160  1.305   17.977  1.00 31.98 ? 357  PRO A O     1 
ATOM   2073 C  CB    . PRO C 3 183 ? 37.779  -0.408  15.312  1.00 23.54 ? 357  PRO A CB    1 
ATOM   2074 C  CG    . PRO C 3 183 ? 36.717  -1.324  14.684  1.00 21.21 ? 357  PRO A CG    1 
ATOM   2075 C  CD    . PRO C 3 183 ? 35.588  -1.100  15.616  1.00 25.40 ? 357  PRO A CD    1 
ATOM   2076 N  N     . PRO C 3 184 ? 39.325  0.630   18.020  1.00 28.84 ? 358  PRO A N     1 
ATOM   2077 C  CA    . PRO C 3 184 ? 39.672  1.820   18.807  1.00 30.64 ? 358  PRO A CA    1 
ATOM   2078 C  C     . PRO C 3 184 ? 39.520  3.041   17.895  1.00 31.94 ? 358  PRO A C     1 
ATOM   2079 O  O     . PRO C 3 184 ? 39.806  2.968   16.710  1.00 30.90 ? 358  PRO A O     1 
ATOM   2080 C  CB    . PRO C 3 184 ? 41.144  1.582   19.190  1.00 25.76 ? 358  PRO A CB    1 
ATOM   2081 C  CG    . PRO C 3 184 ? 41.642  0.623   18.168  1.00 21.44 ? 358  PRO A CG    1 
ATOM   2082 C  CD    . PRO C 3 184 ? 40.463  -0.300  17.949  1.00 24.06 ? 358  PRO A CD    1 
ATOM   2083 N  N     . GLY C 3 185 ? 39.087  4.161   18.457  1.00 32.48 ? 359  GLY A N     1 
ATOM   2084 C  CA    . GLY C 3 185 ? 38.914  5.369   17.660  1.00 33.62 ? 359  GLY A CA    1 
ATOM   2085 C  C     . GLY C 3 185 ? 38.519  6.540   18.545  1.00 35.47 ? 359  GLY A C     1 
ATOM   2086 O  O     . GLY C 3 185 ? 38.679  6.436   19.770  1.00 35.43 ? 359  GLY A O     1 
ATOM   2087 N  N     . LEU C 3 186 ? 38.089  7.667   17.961  1.00 34.84 ? 360  LEU A N     1 
ATOM   2088 C  CA    . LEU C 3 186 ? 37.685  8.844   18.760  1.00 32.76 ? 360  LEU A CA    1 
ATOM   2089 C  C     . LEU C 3 186 ? 36.162  8.807   18.928  1.00 28.63 ? 360  LEU A C     1 
ATOM   2090 O  O     . LEU C 3 186 ? 35.461  8.425   17.990  1.00 28.41 ? 360  LEU A O     1 
ATOM   2091 C  CB    . LEU C 3 186 ? 38.167  10.155  18.112  1.00 26.48 ? 360  LEU A CB    1 
ATOM   2092 C  CG    . LEU C 3 186 ? 39.662  10.273  17.763  1.00 21.98 ? 360  LEU A CG    1 
ATOM   2093 C  CD1   . LEU C 3 186 ? 39.945  11.608  17.061  1.00 19.45 ? 360  LEU A CD1   1 
ATOM   2094 C  CD2   . LEU C 3 186 ? 40.540  10.094  18.999  1.00 19.98 ? 360  LEU A CD2   1 
ATOM   2095 N  N     . PHE C 3 187 ? 35.669  9.171   20.114  1.00 23.55 ? 361  PHE A N     1 
ATOM   2096 C  CA    . PHE C 3 187 ? 34.241  9.109   20.398  1.00 21.20 ? 361  PHE A CA    1 
ATOM   2097 C  C     . PHE C 3 187 ? 33.424  10.092  19.616  1.00 23.97 ? 361  PHE A C     1 
ATOM   2098 O  O     . PHE C 3 187 ? 33.693  11.283  19.628  1.00 26.93 ? 361  PHE A O     1 
ATOM   2099 C  CB    . PHE C 3 187 ? 33.943  9.288   21.880  1.00 21.07 ? 361  PHE A CB    1 
ATOM   2100 C  CG    . PHE C 3 187 ? 32.504  9.001   22.233  1.00 24.45 ? 361  PHE A CG    1 
ATOM   2101 C  CD1   . PHE C 3 187 ? 31.964  7.718   22.049  1.00 21.70 ? 361  PHE A CD1   1 
ATOM   2102 C  CD2   . PHE C 3 187 ? 31.667  10.022  22.711  1.00 23.08 ? 361  PHE A CD2   1 
ATOM   2103 C  CE1   . PHE C 3 187 ? 30.611  7.452   22.333  1.00 21.74 ? 361  PHE A CE1   1 
ATOM   2104 C  CE2   . PHE C 3 187 ? 30.302  9.771   22.999  1.00 24.51 ? 361  PHE A CE2   1 
ATOM   2105 C  CZ    . PHE C 3 187 ? 29.774  8.476   22.806  1.00 22.93 ? 361  PHE A CZ    1 
ATOM   2106 N  N     . ARG C 3 188 ? 32.386  9.593   18.971  1.00 25.80 ? 362  ARG A N     1 
ATOM   2107 C  CA    . ARG C 3 188 ? 31.545  10.443  18.168  1.00 26.87 ? 362  ARG A CA    1 
ATOM   2108 C  C     . ARG C 3 188 ? 30.181  10.582  18.794  1.00 27.81 ? 362  ARG A C     1 
ATOM   2109 O  O     . ARG C 3 188 ? 29.208  9.963   18.375  1.00 26.63 ? 362  ARG A O     1 
ATOM   2110 C  CB    . ARG C 3 188 ? 31.495  9.913   16.733  1.00 31.13 ? 362  ARG A CB    1 
ATOM   2111 C  CG    . ARG C 3 188 ? 32.858  10.043  16.056  1.00 34.45 ? 362  ARG A CG    1 
ATOM   2112 C  CD    . ARG C 3 188 ? 32.976  9.206   14.816  1.00 33.46 ? 362  ARG A CD    1 
ATOM   2113 N  NE    . ARG C 3 188 ? 32.231  9.746   13.691  1.00 38.74 ? 362  ARG A NE    1 
ATOM   2114 C  CZ    . ARG C 3 188 ? 32.652  9.683   12.430  1.00 40.60 ? 362  ARG A CZ    1 
ATOM   2115 N  NH1   . ARG C 3 188 ? 33.815  9.115   12.136  1.00 37.23 ? 362  ARG A NH1   1 
ATOM   2116 N  NH2   . ARG C 3 188 ? 31.900  10.158  11.451  1.00 47.41 ? 362  ARG A NH2   1 
ATOM   2117 N  N     . GLY C 3 189 ? 30.148  11.326  19.892  1.00 31.24 ? 363  GLY A N     1 
ATOM   2118 C  CA    . GLY C 3 189 ? 28.897  11.567  20.576  1.00 34.20 ? 363  GLY A CA    1 
ATOM   2119 C  C     . GLY C 3 189 ? 28.120  12.558  19.732  1.00 36.75 ? 363  GLY A C     1 
ATOM   2120 O  O     . GLY C 3 189 ? 28.702  13.502  19.183  1.00 38.24 ? 363  GLY A O     1 
ATOM   2121 N  N     . ARG C 3 190 ? 26.822  12.313  19.591  1.00 36.49 ? 364  ARG A N     1 
ATOM   2122 C  CA    . ARG C 3 190 ? 25.967  13.186  18.800  1.00 36.56 ? 364  ARG A CA    1 
ATOM   2123 C  C     . ARG C 3 190 ? 25.624  14.469  19.583  1.00 38.08 ? 364  ARG A C     1 
ATOM   2124 O  O     . ARG C 3 190 ? 25.724  14.482  20.806  1.00 42.77 ? 364  ARG A O     1 
ATOM   2125 C  CB    . ARG C 3 190 ? 24.713  12.422  18.370  1.00 40.93 ? 364  ARG A CB    1 
ATOM   2126 C  CG    . ARG C 3 190 ? 24.993  10.986  17.863  1.00 51.12 ? 364  ARG A CG    1 
ATOM   2127 C  CD    . ARG C 3 190 ? 23.989  10.537  16.773  1.00 54.94 ? 364  ARG A CD    1 
ATOM   2128 N  NE    . ARG C 3 190 ? 23.689  9.099   16.799  1.00 59.92 ? 364  ARG A NE    1 
ATOM   2129 C  CZ    . ARG C 3 190 ? 23.276  8.395   15.746  1.00 67.65 ? 364  ARG A CZ    1 
ATOM   2130 N  NH1   . ARG C 3 190 ? 23.124  8.991   14.563  1.00 67.36 ? 364  ARG A NH1   1 
ATOM   2131 N  NH2   . ARG C 3 190 ? 22.936  7.113   15.883  1.00 65.83 ? 364  ARG A NH2   1 
ATOM   2132 N  N     . GLY C 3 191 ? 25.350  15.572  18.882  1.00 35.59 ? 365  GLY A N     1 
ATOM   2133 C  CA    . GLY C 3 191 ? 25.012  16.823  19.545  1.00 32.79 ? 365  GLY A CA    1 
ATOM   2134 C  C     . GLY C 3 191 ? 26.134  17.590  20.214  1.00 32.51 ? 365  GLY A C     1 
ATOM   2135 O  O     . GLY C 3 191 ? 27.146  17.882  19.601  1.00 37.33 ? 365  GLY A O     1 
ATOM   2136 N  N     . ASN C 3 192 ? 25.888  18.058  21.429  1.00 36.22 ? 366  ASN A N     1 
ATOM   2137 C  CA    . ASN C 3 192 ? 26.921  18.785  22.162  1.00 42.96 ? 366  ASN A CA    1 
ATOM   2138 C  C     . ASN C 3 192 ? 27.590  17.817  23.112  1.00 42.07 ? 366  ASN A C     1 
ATOM   2139 O  O     . ASN C 3 192 ? 28.126  18.226  24.150  1.00 44.46 ? 366  ASN A O     1 
ATOM   2140 C  CB    . ASN C 3 192 ? 26.368  20.040  22.918  1.00 50.47 ? 366  ASN A CB    1 
ATOM   2141 C  CG    . ASN C 3 192 ? 25.560  19.717  24.248  1.00 59.97 ? 366  ASN A CG    1 
ATOM   2142 O  OD1   . ASN C 3 192 ? 24.724  20.527  24.675  1.00 63.49 ? 366  ASN A OD1   1 
ATOM   2143 N  ND2   . ASN C 3 192 ? 25.851  18.598  24.909  1.00 62.84 ? 366  ASN A ND2   1 
ATOM   2144 N  N     . HIS C 3 193 ? 27.595  16.536  22.750  1.00 37.14 ? 367  HIS A N     1 
ATOM   2145 C  CA    . HIS C 3 193 ? 28.173  15.557  23.644  1.00 34.08 ? 367  HIS A CA    1 
ATOM   2146 C  C     . HIS C 3 193 ? 29.531  16.008  24.139  1.00 31.11 ? 367  HIS A C     1 
ATOM   2147 O  O     . HIS C 3 193 ? 30.469  16.205  23.369  1.00 35.60 ? 367  HIS A O     1 
ATOM   2148 C  CB    . HIS C 3 193 ? 28.236  14.168  23.039  1.00 32.62 ? 367  HIS A CB    1 
ATOM   2149 C  CG    . HIS C 3 193 ? 28.219  13.083  24.071  1.00 30.32 ? 367  HIS A CG    1 
ATOM   2150 N  ND1   . HIS C 3 193 ? 29.048  13.094  25.173  1.00 27.25 ? 367  HIS A ND1   1 
ATOM   2151 C  CD2   . HIS C 3 193 ? 27.451  11.975  24.193  1.00 29.83 ? 367  HIS A CD2   1 
ATOM   2152 C  CE1   . HIS C 3 193 ? 28.792  12.042  25.927  1.00 25.68 ? 367  HIS A CE1   1 
ATOM   2153 N  NE2   . HIS C 3 193 ? 27.829  11.346  25.354  1.00 26.72 ? 367  HIS A NE2   1 
ATOM   2154 N  N     . PRO C 3 194 ? 29.622  16.241  25.443  1.00 24.87 ? 368  PRO A N     1 
ATOM   2155 C  CA    . PRO C 3 194 ? 30.828  16.691  26.119  1.00 25.41 ? 368  PRO A CA    1 
ATOM   2156 C  C     . PRO C 3 194 ? 31.979  15.694  26.092  1.00 28.91 ? 368  PRO A C     1 
ATOM   2157 O  O     . PRO C 3 194 ? 33.087  16.003  26.531  1.00 25.40 ? 368  PRO A O     1 
ATOM   2158 C  CB    . PRO C 3 194 ? 30.325  16.943  27.538  1.00 28.65 ? 368  PRO A CB    1 
ATOM   2159 C  CG    . PRO C 3 194 ? 29.261  15.925  27.705  1.00 19.24 ? 368  PRO A CG    1 
ATOM   2160 C  CD    . PRO C 3 194 ? 28.534  16.001  26.407  1.00 17.48 ? 368  PRO A CD    1 
ATOM   2161 N  N     . LYS C 3 195 ? 31.705  14.490  25.619  1.00 30.66 ? 369  LYS A N     1 
ATOM   2162 C  CA    . LYS C 3 195 ? 32.742  13.484  25.570  1.00 28.64 ? 369  LYS A CA    1 
ATOM   2163 C  C     . LYS C 3 195 ? 33.215  13.143  24.172  1.00 27.86 ? 369  LYS A C     1 
ATOM   2164 O  O     . LYS C 3 195 ? 34.064  12.261  24.001  1.00 37.67 ? 369  LYS A O     1 
ATOM   2165 C  CB    . LYS C 3 195 ? 32.301  12.242  26.327  1.00 30.18 ? 369  LYS A CB    1 
ATOM   2166 C  CG    . LYS C 3 195 ? 32.232  12.486  27.828  1.00 39.97 ? 369  LYS A CG    1 
ATOM   2167 C  CD    . LYS C 3 195 ? 32.156  11.182  28.590  1.00 41.63 ? 369  LYS A CD    1 
ATOM   2168 C  CE    . LYS C 3 195 ? 31.886  11.404  30.047  1.00 40.40 ? 369  LYS A CE    1 
ATOM   2169 N  NZ    . LYS C 3 195 ? 31.425  10.137  30.661  1.00 41.82 ? 369  LYS A NZ    1 
ATOM   2170 N  N     . MET C 3 196 ? 32.685  13.836  23.167  1.00 17.97 ? 370  MET A N     1 
ATOM   2171 C  CA    . MET C 3 196 ? 33.112  13.581  21.795  1.00 17.06 ? 370  MET A CA    1 
ATOM   2172 C  C     . MET C 3 196 ? 34.620  13.816  21.633  1.00 17.44 ? 370  MET A C     1 
ATOM   2173 O  O     . MET C 3 196 ? 35.186  14.698  22.261  1.00 22.24 ? 370  MET A O     1 
ATOM   2174 C  CB    . MET C 3 196 ? 32.356  14.483  20.844  1.00 15.65 ? 370  MET A CB    1 
ATOM   2175 C  CG    . MET C 3 196 ? 32.599  15.951  21.092  1.00 20.20 ? 370  MET A CG    1 
ATOM   2176 S  SD    . MET C 3 196 ? 31.823  16.892  19.772  1.00 32.11 ? 370  MET A SD    1 
ATOM   2177 C  CE    . MET C 3 196 ? 30.066  16.693  20.229  1.00 34.95 ? 370  MET A CE    1 
ATOM   2178 N  N     . GLY C 3 197 ? 35.278  13.014  20.803  1.00 19.30 ? 371  GLY A N     1 
ATOM   2179 C  CA    . GLY C 3 197 ? 36.702  13.188  20.597  1.00 14.87 ? 371  GLY A CA    1 
ATOM   2180 C  C     . GLY C 3 197 ? 37.557  12.446  21.593  1.00 18.91 ? 371  GLY A C     1 
ATOM   2181 O  O     . GLY C 3 197 ? 38.782  12.392  21.433  1.00 22.01 ? 371  GLY A O     1 
ATOM   2182 N  N     . MET C 3 198 ? 36.933  11.911  22.640  1.00 20.64 ? 372  MET A N     1 
ATOM   2183 C  CA    . MET C 3 198 ? 37.666  11.143  23.637  1.00 20.83 ? 372  MET A CA    1 
ATOM   2184 C  C     . MET C 3 198 ? 38.057  9.825   23.011  1.00 27.96 ? 372  MET A C     1 
ATOM   2185 O  O     . MET C 3 198 ? 37.360  9.321   22.141  1.00 30.10 ? 372  MET A O     1 
ATOM   2186 C  CB    . MET C 3 198 ? 36.812  10.898  24.864  1.00 19.92 ? 372  MET A CB    1 
ATOM   2187 C  CG    . MET C 3 198 ? 36.833  12.067  25.785  1.00 36.58 ? 372  MET A CG    1 
ATOM   2188 S  SD    . MET C 3 198 ? 36.009  11.779  27.342  1.00 43.86 ? 372  MET A SD    1 
ATOM   2189 C  CE    . MET C 3 198 ? 36.873  10.326  27.960  1.00 43.86 ? 372  MET A CE    1 
ATOM   2190 N  N     . LEU C 3 199 ? 39.182  9.273   23.427  1.00 32.77 ? 373  LEU A N     1 
ATOM   2191 C  CA    . LEU C 3 199 ? 39.640  8.023   22.861  1.00 33.97 ? 373  LEU A CA    1 
ATOM   2192 C  C     . LEU C 3 199 ? 38.888  6.789   23.365  1.00 37.91 ? 373  LEU A C     1 
ATOM   2193 O  O     . LEU C 3 199 ? 38.691  6.595   24.565  1.00 37.78 ? 373  LEU A O     1 
ATOM   2194 C  CB    . LEU C 3 199 ? 41.144  7.858   23.086  1.00 41.93 ? 373  LEU A CB    1 
ATOM   2195 C  CG    . LEU C 3 199 ? 41.795  6.576   22.531  1.00 43.39 ? 373  LEU A CG    1 
ATOM   2196 C  CD1   . LEU C 3 199 ? 41.793  6.554   21.004  1.00 41.70 ? 373  LEU A CD1   1 
ATOM   2197 C  CD2   . LEU C 3 199 ? 43.204  6.456   23.072  1.00 37.04 ? 373  LEU A CD2   1 
ATOM   2198 N  N     . LYS C 3 200 ? 38.503  5.954   22.405  1.00 37.11 ? 374  LYS A N     1 
ATOM   2199 C  CA    . LYS C 3 200 ? 37.796  4.703   22.635  1.00 37.50 ? 374  LYS A CA    1 
ATOM   2200 C  C     . LYS C 3 200 ? 38.877  3.627   22.464  1.00 38.67 ? 374  LYS A C     1 
ATOM   2201 O  O     . LYS C 3 200 ? 39.356  3.367   21.355  1.00 42.31 ? 374  LYS A O     1 
ATOM   2202 C  CB    . LYS C 3 200 ? 36.681  4.566   21.592  1.00 37.71 ? 374  LYS A CB    1 
ATOM   2203 C  CG    . LYS C 3 200 ? 35.869  3.307   21.684  1.00 43.30 ? 374  LYS A CG    1 
ATOM   2204 C  CD    . LYS C 3 200 ? 34.529  3.436   20.963  1.00 40.71 ? 374  LYS A CD    1 
ATOM   2205 C  CE    . LYS C 3 200 ? 34.636  3.186   19.472  1.00 49.41 ? 374  LYS A CE    1 
ATOM   2206 N  NZ    . LYS C 3 200 ? 33.275  3.060   18.820  1.00 44.60 ? 374  LYS A NZ    1 
ATOM   2207 N  N     . ARG C 3 201 ? 39.326  3.070   23.583  1.00 38.71 ? 375  ARG A N     1 
ATOM   2208 C  CA    . ARG C 3 201 ? 40.385  2.077   23.563  1.00 35.67 ? 375  ARG A CA    1 
ATOM   2209 C  C     . ARG C 3 201 ? 40.070  0.745   22.900  1.00 33.61 ? 375  ARG A C     1 
ATOM   2210 O  O     . ARG C 3 201 ? 38.920  0.363   22.756  1.00 34.34 ? 375  ARG A O     1 
ATOM   2211 C  CB    . ARG C 3 201 ? 40.893  1.833   24.971  1.00 38.38 ? 375  ARG A CB    1 
ATOM   2212 C  CG    . ARG C 3 201 ? 39.843  1.324   25.888  1.00 53.17 ? 375  ARG A CG    1 
ATOM   2213 C  CD    . ARG C 3 201 ? 40.470  0.515   27.003  1.00 69.02 ? 375  ARG A CD    1 
ATOM   2214 N  NE    . ARG C 3 201 ? 40.028  -0.876  26.951  1.00 78.67 ? 375  ARG A NE    1 
ATOM   2215 C  CZ    . ARG C 3 201 ? 38.851  -1.308  27.401  1.00 86.70 ? 375  ARG A CZ    1 
ATOM   2216 N  NH1   . ARG C 3 201 ? 37.983  -0.455  27.950  1.00 87.37 ? 375  ARG A NH1   1 
ATOM   2217 N  NH2   . ARG C 3 201 ? 38.538  -2.594  27.287  1.00 90.54 ? 375  ARG A NH2   1 
ATOM   2218 N  N     . ARG C 3 202 ? 41.136  0.050   22.524  1.00 29.04 ? 376  ARG A N     1 
ATOM   2219 C  CA    . ARG C 3 202 ? 41.083  -1.251  21.873  1.00 23.04 ? 376  ARG A CA    1 
ATOM   2220 C  C     . ARG C 3 202 ? 40.697  -2.279  22.913  1.00 27.69 ? 376  ARG A C     1 
ATOM   2221 O  O     . ARG C 3 202 ? 41.318  -2.349  23.973  1.00 31.39 ? 376  ARG A O     1 
ATOM   2222 C  CB    . ARG C 3 202 ? 42.480  -1.574  21.353  1.00 24.33 ? 376  ARG A CB    1 
ATOM   2223 C  CG    . ARG C 3 202 ? 42.639  -2.844  20.548  1.00 29.41 ? 376  ARG A CG    1 
ATOM   2224 C  CD    . ARG C 3 202 ? 44.047  -3.005  19.982  1.00 26.68 ? 376  ARG A CD    1 
ATOM   2225 N  NE    . ARG C 3 202 ? 44.323  -2.163  18.806  1.00 33.51 ? 376  ARG A NE    1 
ATOM   2226 C  CZ    . ARG C 3 202 ? 43.780  -2.327  17.597  1.00 32.81 ? 376  ARG A CZ    1 
ATOM   2227 N  NH1   . ARG C 3 202 ? 42.914  -3.303  17.386  1.00 37.98 ? 376  ARG A NH1   1 
ATOM   2228 N  NH2   . ARG C 3 202 ? 44.129  -1.529  16.588  1.00 30.82 ? 376  ARG A NH2   1 
ATOM   2229 N  N     . ILE C 3 203 ? 39.694  -3.093  22.604  1.00 33.46 ? 377  ILE A N     1 
ATOM   2230 C  CA    . ILE C 3 203 ? 39.197  -4.133  23.519  1.00 36.22 ? 377  ILE A CA    1 
ATOM   2231 C  C     . ILE C 3 203 ? 40.016  -5.448  23.491  1.00 38.17 ? 377  ILE A C     1 
ATOM   2232 O  O     . ILE C 3 203 ? 40.096  -6.109  22.460  1.00 35.82 ? 377  ILE A O     1 
ATOM   2233 C  CB    . ILE C 3 203 ? 37.685  -4.426  23.217  1.00 37.59 ? 377  ILE A CB    1 
ATOM   2234 C  CG1   . ILE C 3 203 ? 36.888  -3.111  23.202  1.00 35.81 ? 377  ILE A CG1   1 
ATOM   2235 C  CG2   . ILE C 3 203 ? 37.090  -5.437  24.214  1.00 36.36 ? 377  ILE A CG2   1 
ATOM   2236 C  CD1   . ILE C 3 203 ? 37.081  -2.251  24.436  1.00 35.90 ? 377  ILE A CD1   1 
ATOM   2237 N  N     . MET C 3 204 ? 40.623  -5.822  24.620  1.00 37.46 ? 378  MET A N     1 
ATOM   2238 C  CA    . MET C 3 204 ? 41.409  -7.052  24.679  1.00 36.32 ? 378  MET A CA    1 
ATOM   2239 C  C     . MET C 3 204 ? 40.542  -8.252  25.020  1.00 35.79 ? 378  MET A C     1 
ATOM   2240 O  O     . MET C 3 204 ? 39.418  -8.095  25.490  1.00 36.88 ? 378  MET A O     1 
ATOM   2241 C  CB    . MET C 3 204 ? 42.517  -6.919  25.709  1.00 45.71 ? 378  MET A CB    1 
ATOM   2242 C  CG    . MET C 3 204 ? 43.450  -5.770  25.426  1.00 59.68 ? 378  MET A CG    1 
ATOM   2243 S  SD    . MET C 3 204 ? 43.879  -5.726  23.669  1.00 69.00 ? 378  MET A SD    1 
ATOM   2244 C  CE    . MET C 3 204 ? 45.180  -6.999  23.629  1.00 71.83 ? 378  MET A CE    1 
ATOM   2245 N  N     . PRO C 3 205 ? 41.017  -9.471  24.709  1.00 32.33 ? 379  PRO A N     1 
ATOM   2246 C  CA    . PRO C 3 205 ? 40.210  -10.653 25.031  1.00 32.02 ? 379  PRO A CA    1 
ATOM   2247 C  C     . PRO C 3 205 ? 39.977  -10.732 26.531  1.00 34.49 ? 379  PRO A C     1 
ATOM   2248 O  O     . PRO C 3 205 ? 39.022  -11.357 26.978  1.00 36.27 ? 379  PRO A O     1 
ATOM   2249 C  CB    . PRO C 3 205 ? 41.080  -11.803 24.533  1.00 32.22 ? 379  PRO A CB    1 
ATOM   2250 C  CG    . PRO C 3 205 ? 41.719  -11.207 23.310  1.00 31.66 ? 379  PRO A CG    1 
ATOM   2251 C  CD    . PRO C 3 205 ? 42.121  -9.821  23.797  1.00 30.66 ? 379  PRO A CD    1 
ATOM   2252 N  N     . GLU C 3 206 ? 40.851  -10.067 27.282  1.00 34.67 ? 380  GLU A N     1 
ATOM   2253 C  CA    . GLU C 3 206 ? 40.795  -10.012 28.738  1.00 34.37 ? 380  GLU A CA    1 
ATOM   2254 C  C     . GLU C 3 206 ? 39.703  -9.092  29.241  1.00 35.39 ? 380  GLU A C     1 
ATOM   2255 O  O     . GLU C 3 206 ? 39.585  -8.854  30.440  1.00 35.95 ? 380  GLU A O     1 
ATOM   2256 C  CB    . GLU C 3 206 ? 42.126  -9.532  29.294  1.00 40.48 ? 380  GLU A CB    1 
ATOM   2257 C  CG    . GLU C 3 206 ? 43.218  -10.599 29.345  1.00 50.59 ? 380  GLU A CG    1 
ATOM   2258 C  CD    . GLU C 3 206 ? 43.791  -11.002 27.979  1.00 57.01 ? 380  GLU A CD    1 
ATOM   2259 O  OE1   . GLU C 3 206 ? 43.553  -10.308 26.963  1.00 60.58 ? 380  GLU A OE1   1 
ATOM   2260 O  OE2   . GLU C 3 206 ? 44.514  -12.022 27.932  1.00 58.53 ? 380  GLU A OE2   1 
ATOM   2261 N  N     . ASP C 3 207 ? 38.966  -8.489  28.317  1.00 36.18 ? 381  ASP A N     1 
ATOM   2262 C  CA    . ASP C 3 207 ? 37.862  -7.601  28.673  1.00 33.17 ? 381  ASP A CA    1 
ATOM   2263 C  C     . ASP C 3 207 ? 36.555  -8.294  28.339  1.00 30.54 ? 381  ASP A C     1 
ATOM   2264 O  O     . ASP C 3 207 ? 35.502  -7.927  28.825  1.00 33.98 ? 381  ASP A O     1 
ATOM   2265 C  CB    . ASP C 3 207 ? 37.944  -6.312  27.867  1.00 32.91 ? 381  ASP A CB    1 
ATOM   2266 C  CG    . ASP C 3 207 ? 39.259  -5.597  28.048  1.00 39.19 ? 381  ASP A CG    1 
ATOM   2267 O  OD1   . ASP C 3 207 ? 39.536  -5.162  29.185  1.00 42.83 ? 381  ASP A OD1   1 
ATOM   2268 O  OD2   . ASP C 3 207 ? 40.009  -5.458  27.055  1.00 41.06 ? 381  ASP A OD2   1 
ATOM   2269 N  N     . ILE C 3 208 ? 36.655  -9.350  27.545  1.00 31.28 ? 382  ILE A N     1 
ATOM   2270 C  CA    . ILE C 3 208 ? 35.507  -10.110 27.068  1.00 25.77 ? 382  ILE A CA    1 
ATOM   2271 C  C     . ILE C 3 208 ? 34.949  -11.196 27.976  1.00 22.47 ? 382  ILE A C     1 
ATOM   2272 O  O     . ILE C 3 208 ? 35.657  -12.089 28.408  1.00 20.72 ? 382  ILE A O     1 
ATOM   2273 C  CB    . ILE C 3 208 ? 35.853  -10.758 25.720  1.00 26.87 ? 382  ILE A CB    1 
ATOM   2274 C  CG1   . ILE C 3 208 ? 36.287  -9.681  24.726  1.00 24.93 ? 382  ILE A CG1   1 
ATOM   2275 C  CG2   . ILE C 3 208 ? 34.721  -11.630 25.233  1.00 24.57 ? 382  ILE A CG2   1 
ATOM   2276 C  CD1   . ILE C 3 208 ? 35.294  -8.573  24.578  1.00 24.00 ? 382  ILE A CD1   1 
ATOM   2277 N  N     . ILE C 3 209 ? 33.645  -11.131 28.188  1.00 20.29 ? 383  ILE A N     1 
ATOM   2278 C  CA    . ILE C 3 209 ? 32.922  -12.103 28.979  1.00 18.08 ? 383  ILE A CA    1 
ATOM   2279 C  C     . ILE C 3 209 ? 32.138  -12.903 27.948  1.00 27.01 ? 383  ILE A C     1 
ATOM   2280 O  O     . ILE C 3 209 ? 31.424  -12.330 27.122  1.00 27.20 ? 383  ILE A O     1 
ATOM   2281 C  CB    . ILE C 3 209 ? 31.921  -11.410 29.911  1.00 20.89 ? 383  ILE A CB    1 
ATOM   2282 C  CG1   . ILE C 3 209 ? 32.650  -10.456 30.859  1.00 31.34 ? 383  ILE A CG1   1 
ATOM   2283 C  CG2   . ILE C 3 209 ? 31.107  -12.427 30.682  1.00 22.30 ? 383  ILE A CG2   1 
ATOM   2284 C  CD1   . ILE C 3 209 ? 31.771  -9.900  31.973  1.00 32.67 ? 383  ILE A CD1   1 
ATOM   2285 N  N     . ILE C 3 210 ? 32.333  -14.217 27.941  1.00 31.84 ? 384  ILE A N     1 
ATOM   2286 C  CA    . ILE C 3 210 ? 31.640  -15.101 27.005  1.00 27.39 ? 384  ILE A CA    1 
ATOM   2287 C  C     . ILE C 3 210 ? 30.411  -15.715 27.663  1.00 28.29 ? 384  ILE A C     1 
ATOM   2288 O  O     . ILE C 3 210 ? 30.432  -16.038 28.845  1.00 29.28 ? 384  ILE A O     1 
ATOM   2289 C  CB    . ILE C 3 210 ? 32.573  -16.233 26.541  1.00 24.96 ? 384  ILE A CB    1 
ATOM   2290 C  CG1   . ILE C 3 210 ? 33.721  -15.648 25.733  1.00 27.19 ? 384  ILE A CG1   1 
ATOM   2291 C  CG2   . ILE C 3 210 ? 31.804  -17.253 25.714  1.00 20.55 ? 384  ILE A CG2   1 
ATOM   2292 C  CD1   . ILE C 3 210 ? 33.268  -15.054 24.406  1.00 30.78 ? 384  ILE A CD1   1 
ATOM   2293 N  N     . ASN C 3 211 ? 29.347  -15.888 26.893  1.00 29.42 ? 385  ASN A N     1 
ATOM   2294 C  CA    . ASN C 3 211 ? 28.119  -16.487 27.409  1.00 29.27 ? 385  ASN A CA    1 
ATOM   2295 C  C     . ASN C 3 211 ? 27.761  -17.650 26.481  1.00 29.14 ? 385  ASN A C     1 
ATOM   2296 O  O     . ASN C 3 211 ? 27.765  -17.506 25.250  1.00 25.19 ? 385  ASN A O     1 
ATOM   2297 C  CB    . ASN C 3 211 ? 26.978  -15.443 27.408  1.00 34.58 ? 385  ASN A CB    1 
ATOM   2298 C  CG    . ASN C 3 211 ? 25.759  -15.864 28.273  1.00 31.17 ? 385  ASN A CG    1 
ATOM   2299 O  OD1   . ASN C 3 211 ? 25.906  -16.420 29.355  1.00 33.83 ? 385  ASN A OD1   1 
ATOM   2300 N  ND2   . ASN C 3 211 ? 24.562  -15.555 27.797  1.00 27.08 ? 385  ASN A ND2   1 
ATOM   2301 N  N     . CYS C 3 212 ? 27.529  -18.816 27.071  1.00 29.70 ? 386  CYS A N     1 
ATOM   2302 C  CA    . CYS C 3 212 ? 27.134  -20.010 26.324  1.00 33.76 ? 386  CYS A CA    1 
ATOM   2303 C  C     . CYS C 3 212 ? 26.618  -21.078 27.275  1.00 32.56 ? 386  CYS A C     1 
ATOM   2304 O  O     . CYS C 3 212 ? 26.771  -20.957 28.492  1.00 36.89 ? 386  CYS A O     1 
ATOM   2305 C  CB    . CYS C 3 212 ? 28.294  -20.559 25.483  1.00 40.65 ? 386  CYS A CB    1 
ATOM   2306 S  SG    . CYS C 3 212 ? 29.764  -21.116 26.402  1.00 37.72 ? 386  CYS A SG    1 
ATOM   2307 N  N     . SER C 3 213 ? 25.914  -22.066 26.743  1.00 28.73 ? 387  SER A N     1 
ATOM   2308 C  CA    . SER C 3 213 ? 25.402  -23.110 27.604  1.00 27.32 ? 387  SER A CA    1 
ATOM   2309 C  C     . SER C 3 213 ? 26.550  -23.869 28.252  1.00 32.17 ? 387  SER A C     1 
ATOM   2310 O  O     . SER C 3 213 ? 27.682  -23.833 27.769  1.00 27.10 ? 387  SER A O     1 
ATOM   2311 C  CB    . SER C 3 213 ? 24.492  -24.059 26.837  1.00 25.78 ? 387  SER A CB    1 
ATOM   2312 O  OG    . SER C 3 213 ? 25.089  -24.469 25.622  1.00 35.47 ? 387  SER A OG    1 
ATOM   2313 N  N     . LYS C 3 214 ? 26.247  -24.480 29.392  1.00 35.67 ? 388  LYS A N     1 
ATOM   2314 C  CA    . LYS C 3 214 ? 27.192  -25.258 30.172  1.00 36.17 ? 388  LYS A CA    1 
ATOM   2315 C  C     . LYS C 3 214 ? 27.743  -26.444 29.391  1.00 39.42 ? 388  LYS A C     1 
ATOM   2316 O  O     . LYS C 3 214 ? 28.851  -26.895 29.638  1.00 42.13 ? 388  LYS A O     1 
ATOM   2317 C  CB    . LYS C 3 214 ? 26.485  -25.765 31.420  1.00 35.06 ? 388  LYS A CB    1 
ATOM   2318 N  N     . ASP C 3 215 ? 26.909  -27.022 28.539  1.00 42.89 ? 389  ASP A N     1 
ATOM   2319 C  CA    . ASP C 3 215 ? 27.299  -28.169 27.727  1.00 46.21 ? 389  ASP A CA    1 
ATOM   2320 C  C     . ASP C 3 215 ? 27.970  -27.789 26.404  1.00 46.30 ? 389  ASP A C     1 
ATOM   2321 O  O     . ASP C 3 215 ? 28.173  -28.641 25.536  1.00 48.62 ? 389  ASP A O     1 
ATOM   2322 C  CB    . ASP C 3 215 ? 26.050  -29.021 27.435  1.00 52.33 ? 389  ASP A CB    1 
ATOM   2323 C  CG    . ASP C 3 215 ? 24.900  -28.217 26.780  1.00 54.79 ? 389  ASP A CG    1 
ATOM   2324 O  OD1   . ASP C 3 215 ? 25.130  -27.071 26.345  1.00 58.35 ? 389  ASP A OD1   1 
ATOM   2325 O  OD2   . ASP C 3 215 ? 23.759  -28.739 26.696  1.00 59.09 ? 389  ASP A OD2   1 
ATOM   2326 N  N     . ALA C 3 216 ? 28.296  -26.520 26.234  1.00 45.28 ? 390  ALA A N     1 
ATOM   2327 C  CA    . ALA C 3 216 ? 28.870  -26.068 24.982  1.00 43.77 ? 390  ALA A CA    1 
ATOM   2328 C  C     . ALA C 3 216 ? 30.386  -25.959 24.928  1.00 45.51 ? 390  ALA A C     1 
ATOM   2329 O  O     . ALA C 3 216 ? 31.056  -25.858 25.958  1.00 46.11 ? 390  ALA A O     1 
ATOM   2330 C  CB    . ALA C 3 216 ? 28.236  -24.746 24.594  1.00 47.22 ? 390  ALA A CB    1 
ATOM   2331 N  N     . LYS C 3 217 ? 30.933  -26.044 23.714  1.00 41.14 ? 391  LYS A N     1 
ATOM   2332 C  CA    . LYS C 3 217 ? 32.365  -25.896 23.527  1.00 39.82 ? 391  LYS A CA    1 
ATOM   2333 C  C     . LYS C 3 217 ? 32.663  -24.411 23.671  1.00 41.28 ? 391  LYS A C     1 
ATOM   2334 O  O     . LYS C 3 217 ? 32.245  -23.614 22.838  1.00 44.50 ? 391  LYS A O     1 
ATOM   2335 C  CB    . LYS C 3 217 ? 32.777  -26.343 22.134  1.00 44.45 ? 391  LYS A CB    1 
ATOM   2336 C  CG    . LYS C 3 217 ? 34.271  -26.261 21.886  1.00 54.23 ? 391  LYS A CG    1 
ATOM   2337 C  CD    . LYS C 3 217 ? 34.579  -26.199 20.396  1.00 66.10 ? 391  LYS A CD    1 
ATOM   2338 C  CE    . LYS C 3 217 ? 34.141  -27.471 19.671  1.00 77.02 ? 391  LYS A CE    1 
ATOM   2339 N  NZ    . LYS C 3 217 ? 34.197  -27.371 18.169  1.00 83.46 ? 391  LYS A NZ    1 
ATOM   2340 N  N     . VAL C 3 218 ? 33.417  -24.043 24.704  1.00 43.15 ? 392  VAL A N     1 
ATOM   2341 C  CA    . VAL C 3 218 ? 33.754  -22.637 24.936  1.00 39.69 ? 392  VAL A CA    1 
ATOM   2342 C  C     . VAL C 3 218 ? 34.659  -22.088 23.833  1.00 38.01 ? 392  VAL A C     1 
ATOM   2343 O  O     . VAL C 3 218 ? 35.654  -22.708 23.486  1.00 39.23 ? 392  VAL A O     1 
ATOM   2344 C  CB    . VAL C 3 218 ? 34.443  -22.423 26.323  1.00 30.52 ? 392  VAL A CB    1 
ATOM   2345 C  CG1   . VAL C 3 218 ? 34.852  -20.962 26.501  1.00 35.00 ? 392  VAL A CG1   1 
ATOM   2346 C  CG2   . VAL C 3 218 ? 33.509  -22.819 27.429  1.00 28.91 ? 392  VAL A CG2   1 
ATOM   2347 N  N     . PRO C 3 219 ? 34.288  -20.951 23.222  1.00 38.57 ? 393  PRO A N     1 
ATOM   2348 C  CA    . PRO C 3 219 ? 35.140  -20.385 22.168  1.00 38.04 ? 393  PRO A CA    1 
ATOM   2349 C  C     . PRO C 3 219 ? 36.528  -20.021 22.726  1.00 38.71 ? 393  PRO A C     1 
ATOM   2350 O  O     . PRO C 3 219 ? 36.664  -19.344 23.750  1.00 42.15 ? 393  PRO A O     1 
ATOM   2351 C  CB    . PRO C 3 219 ? 34.369  -19.135 21.733  1.00 34.12 ? 393  PRO A CB    1 
ATOM   2352 C  CG    . PRO C 3 219 ? 33.534  -18.804 22.937  1.00 37.73 ? 393  PRO A CG    1 
ATOM   2353 C  CD    . PRO C 3 219 ? 33.068  -20.152 23.400  1.00 31.16 ? 393  PRO A CD    1 
ATOM   2354 N  N     . SER C 3 220 ? 37.554  -20.542 22.087  1.00 32.17 ? 394  SER A N     1 
ATOM   2355 C  CA    . SER C 3 220 ? 38.895  -20.278 22.516  1.00 34.98 ? 394  SER A CA    1 
ATOM   2356 C  C     . SER C 3 220 ? 39.372  -18.899 22.091  1.00 37.28 ? 394  SER A C     1 
ATOM   2357 O  O     . SER C 3 220 ? 39.237  -18.513 20.950  1.00 41.37 ? 394  SER A O     1 
ATOM   2358 C  CB    . SER C 3 220 ? 39.820  -21.363 21.964  1.00 34.55 ? 394  SER A CB    1 
ATOM   2359 O  OG    . SER C 3 220 ? 39.380  -21.817 20.691  1.00 37.41 ? 394  SER A OG    1 
ATOM   2360 N  N     . PRO C 3 221 ? 39.957  -18.142 23.021  1.00 41.68 ? 395  PRO A N     1 
ATOM   2361 C  CA    . PRO C 3 221 ? 40.453  -16.810 22.701  1.00 44.00 ? 395  PRO A CA    1 
ATOM   2362 C  C     . PRO C 3 221 ? 41.653  -16.941 21.798  1.00 49.53 ? 395  PRO A C     1 
ATOM   2363 O  O     . PRO C 3 221 ? 42.089  -18.057 21.508  1.00 48.57 ? 395  PRO A O     1 
ATOM   2364 C  CB    . PRO C 3 221 ? 40.850  -16.267 24.074  1.00 41.86 ? 395  PRO A CB    1 
ATOM   2365 C  CG    . PRO C 3 221 ? 41.205  -17.480 24.837  1.00 40.26 ? 395  PRO A CG    1 
ATOM   2366 C  CD    . PRO C 3 221 ? 40.124  -18.431 24.455  1.00 44.09 ? 395  PRO A CD    1 
ATOM   2367 N  N     . PRO C 3 222 ? 42.185  -15.800 21.307  1.00 56.68 ? 396  PRO A N     1 
ATOM   2368 C  CA    . PRO C 3 222 ? 43.361  -15.844 20.429  1.00 58.07 ? 396  PRO A CA    1 
ATOM   2369 C  C     . PRO C 3 222 ? 44.484  -16.432 21.259  1.00 58.61 ? 396  PRO A C     1 
ATOM   2370 O  O     . PRO C 3 222 ? 44.517  -16.233 22.472  1.00 60.55 ? 396  PRO A O     1 
ATOM   2371 C  CB    . PRO C 3 222 ? 43.636  -14.367 20.145  1.00 58.97 ? 396  PRO A CB    1 
ATOM   2372 C  CG    . PRO C 3 222 ? 42.275  -13.741 20.242  1.00 59.67 ? 396  PRO A CG    1 
ATOM   2373 C  CD    . PRO C 3 222 ? 41.694  -14.418 21.459  1.00 58.55 ? 396  PRO A CD    1 
ATOM   2374 N  N     . PRO C 3 223 ? 45.406  -17.176 20.627  1.00 62.42 ? 397  PRO A N     1 
ATOM   2375 C  CA    . PRO C 3 223 ? 46.542  -17.803 21.311  1.00 61.81 ? 397  PRO A CA    1 
ATOM   2376 C  C     . PRO C 3 223 ? 47.355  -16.893 22.241  1.00 59.24 ? 397  PRO A C     1 
ATOM   2377 O  O     . PRO C 3 223 ? 47.909  -15.875 21.815  1.00 57.90 ? 397  PRO A O     1 
ATOM   2378 C  CB    . PRO C 3 223 ? 47.371  -18.346 20.146  1.00 65.68 ? 397  PRO A CB    1 
ATOM   2379 C  CG    . PRO C 3 223 ? 46.300  -18.773 19.170  1.00 62.42 ? 397  PRO A CG    1 
ATOM   2380 C  CD    . PRO C 3 223 ? 45.370  -17.575 19.205  1.00 66.13 ? 397  PRO A CD    1 
ATOM   2381 N  N     . GLY C 3 224 ? 47.419  -17.283 23.512  1.00 56.90 ? 398  GLY A N     1 
ATOM   2382 C  CA    . GLY C 3 224 ? 48.154  -16.519 24.500  1.00 54.32 ? 398  GLY A CA    1 
ATOM   2383 C  C     . GLY C 3 224 ? 47.315  -15.505 25.255  1.00 51.55 ? 398  GLY A C     1 
ATOM   2384 O  O     . GLY C 3 224 ? 47.869  -14.613 25.898  1.00 52.44 ? 398  GLY A O     1 
ATOM   2385 N  N     . HIS C 3 225 ? 45.995  -15.630 25.170  1.00 47.74 ? 399  HIS A N     1 
ATOM   2386 C  CA    . HIS C 3 225 ? 45.083  -14.725 25.860  1.00 44.55 ? 399  HIS A CA    1 
ATOM   2387 C  C     . HIS C 3 225 ? 44.001  -15.508 26.543  1.00 47.99 ? 399  HIS A C     1 
ATOM   2388 O  O     . HIS C 3 225 ? 43.841  -16.695 26.294  1.00 52.21 ? 399  HIS A O     1 
ATOM   2389 C  CB    . HIS C 3 225 ? 44.441  -13.736 24.891  1.00 38.72 ? 399  HIS A CB    1 
ATOM   2390 C  CG    . HIS C 3 225 ? 45.378  -12.674 24.411  1.00 42.11 ? 399  HIS A CG    1 
ATOM   2391 N  ND1   . HIS C 3 225 ? 45.647  -11.532 25.139  1.00 39.42 ? 399  HIS A ND1   1 
ATOM   2392 C  CD2   . HIS C 3 225 ? 46.134  -12.590 23.289  1.00 41.92 ? 399  HIS A CD2   1 
ATOM   2393 C  CE1   . HIS C 3 225 ? 46.534  -10.795 24.489  1.00 39.72 ? 399  HIS A CE1   1 
ATOM   2394 N  NE2   . HIS C 3 225 ? 46.843  -11.412 23.361  1.00 42.72 ? 399  HIS A NE2   1 
ATOM   2395 N  N     . LYS C 3 226 ? 43.275  -14.844 27.435  1.00 52.92 ? 400  LYS A N     1 
ATOM   2396 C  CA    . LYS C 3 226 ? 42.169  -15.464 28.172  1.00 55.98 ? 400  LYS A CA    1 
ATOM   2397 C  C     . LYS C 3 226 ? 40.965  -14.533 28.160  1.00 52.42 ? 400  LYS A C     1 
ATOM   2398 O  O     . LYS C 3 226 ? 41.101  -13.311 27.986  1.00 50.34 ? 400  LYS A O     1 
ATOM   2399 C  CB    . LYS C 3 226 ? 42.552  -15.748 29.635  1.00 63.37 ? 400  LYS A CB    1 
ATOM   2400 C  CG    . LYS C 3 226 ? 43.195  -17.110 29.894  1.00 73.20 ? 400  LYS A CG    1 
ATOM   2401 C  CD    . LYS C 3 226 ? 43.737  -17.216 31.329  1.00 76.41 ? 400  LYS A CD    1 
ATOM   2402 C  CE    . LYS C 3 226 ? 45.264  -17.150 31.369  1.00 76.99 ? 400  LYS A CE    1 
ATOM   2403 N  NZ    . LYS C 3 226 ? 45.797  -17.196 32.764  1.00 75.58 ? 400  LYS A NZ    1 
ATOM   2404 N  N     . TRP C 3 227 ? 39.782  -15.122 28.277  1.00 44.87 ? 401  TRP A N     1 
ATOM   2405 C  CA    . TRP C 3 227 ? 38.578  -14.318 28.318  1.00 40.75 ? 401  TRP A CA    1 
ATOM   2406 C  C     . TRP C 3 227 ? 38.537  -13.751 29.717  1.00 36.29 ? 401  TRP A C     1 
ATOM   2407 O  O     . TRP C 3 227 ? 39.168  -14.291 30.620  1.00 44.91 ? 401  TRP A O     1 
ATOM   2408 C  CB    . TRP C 3 227 ? 37.330  -15.172 28.102  1.00 39.05 ? 401  TRP A CB    1 
ATOM   2409 C  CG    . TRP C 3 227 ? 37.312  -15.906 26.828  1.00 35.94 ? 401  TRP A CG    1 
ATOM   2410 C  CD1   . TRP C 3 227 ? 37.259  -17.262 26.663  1.00 35.35 ? 401  TRP A CD1   1 
ATOM   2411 C  CD2   . TRP C 3 227 ? 37.326  -15.339 25.520  1.00 31.81 ? 401  TRP A CD2   1 
ATOM   2412 N  NE1   . TRP C 3 227 ? 37.232  -17.571 25.329  1.00 29.04 ? 401  TRP A NE1   1 
ATOM   2413 C  CE2   . TRP C 3 227 ? 37.273  -16.409 24.604  1.00 31.50 ? 401  TRP A CE2   1 
ATOM   2414 C  CE3   . TRP C 3 227 ? 37.388  -14.033 25.032  1.00 29.88 ? 401  TRP A CE3   1 
ATOM   2415 C  CZ2   . TRP C 3 227 ? 37.279  -16.209 23.220  1.00 31.80 ? 401  TRP A CZ2   1 
ATOM   2416 C  CZ3   . TRP C 3 227 ? 37.401  -13.834 23.657  1.00 32.20 ? 401  TRP A CZ3   1 
ATOM   2417 C  CH2   . TRP C 3 227 ? 37.346  -14.918 22.768  1.00 27.79 ? 401  TRP A CH2   1 
ATOM   2418 N  N     . LYS C 3 228 ? 37.782  -12.682 29.893  1.00 31.84 ? 402  LYS A N     1 
ATOM   2419 C  CA    . LYS C 3 228 ? 37.625  -12.059 31.186  1.00 34.63 ? 402  LYS A CA    1 
ATOM   2420 C  C     . LYS C 3 228 ? 36.856  -13.039 32.067  1.00 36.10 ? 402  LYS A C     1 
ATOM   2421 O  O     . LYS C 3 228 ? 37.170  -13.220 33.232  1.00 37.77 ? 402  LYS A O     1 
ATOM   2422 C  CB    . LYS C 3 228 ? 36.819  -10.775 31.022  1.00 35.80 ? 402  LYS A CB    1 
ATOM   2423 C  CG    . LYS C 3 228 ? 36.526  -10.035 32.276  1.00 33.37 ? 402  LYS A CG    1 
ATOM   2424 C  CD    . LYS C 3 228 ? 35.816  -8.755  31.934  1.00 38.28 ? 402  LYS A CD    1 
ATOM   2425 C  CE    . LYS C 3 228 ? 35.458  -7.966  33.171  1.00 44.89 ? 402  LYS A CE    1 
ATOM   2426 N  NZ    . LYS C 3 228 ? 34.697  -6.720  32.815  1.00 56.10 ? 402  LYS A NZ    1 
ATOM   2427 N  N     . GLU C 3 229 ? 35.904  -13.737 31.468  1.00 37.68 ? 403  GLU A N     1 
ATOM   2428 C  CA    . GLU C 3 229 ? 35.065  -14.673 32.190  1.00 33.49 ? 403  GLU A CA    1 
ATOM   2429 C  C     . GLU C 3 229 ? 34.237  -15.486 31.202  1.00 32.49 ? 403  GLU A C     1 
ATOM   2430 O  O     . GLU C 3 229 ? 34.163  -15.158 30.014  1.00 33.30 ? 403  GLU A O     1 
ATOM   2431 C  CB    . GLU C 3 229 ? 34.135  -13.865 33.093  1.00 37.22 ? 403  GLU A CB    1 
ATOM   2432 C  CG    . GLU C 3 229 ? 32.983  -14.620 33.724  1.00 51.03 ? 403  GLU A CG    1 
ATOM   2433 C  CD    . GLU C 3 229 ? 32.041  -13.706 34.514  1.00 61.36 ? 403  GLU A CD    1 
ATOM   2434 O  OE1   . GLU C 3 229 ? 32.395  -12.529 34.767  1.00 65.84 ? 403  GLU A OE1   1 
ATOM   2435 O  OE2   . GLU C 3 229 ? 30.939  -14.170 34.887  1.00 66.87 ? 403  GLU A OE2   1 
ATOM   2436 N  N     . VAL C 3 230 ? 33.622  -16.548 31.691  1.00 28.34 ? 404  VAL A N     1 
ATOM   2437 C  CA    . VAL C 3 230 ? 32.787  -17.367 30.867  1.00 25.09 ? 404  VAL A CA    1 
ATOM   2438 C  C     . VAL C 3 230 ? 31.582  -17.706 31.695  1.00 26.98 ? 404  VAL A C     1 
ATOM   2439 O  O     . VAL C 3 230 ? 31.685  -18.406 32.685  1.00 29.85 ? 404  VAL A O     1 
ATOM   2440 C  CB    . VAL C 3 230 ? 33.480  -18.682 30.426  1.00 26.79 ? 404  VAL A CB    1 
ATOM   2441 C  CG1   . VAL C 3 230 ? 32.586  -19.435 29.433  1.00 26.82 ? 404  VAL A CG1   1 
ATOM   2442 C  CG2   . VAL C 3 230 ? 34.805  -18.403 29.768  1.00 28.82 ? 404  VAL A CG2   1 
ATOM   2443 N  N     . ARG C 3 231 ? 30.431  -17.147 31.360  1.00 30.84 ? 405  ARG A N     1 
ATOM   2444 C  CA    . ARG C 3 231 ? 29.260  -17.533 32.128  1.00 35.90 ? 405  ARG A CA    1 
ATOM   2445 C  C     . ARG C 3 231 ? 28.239  -18.338 31.324  1.00 34.17 ? 405  ARG A C     1 
ATOM   2446 O  O     . ARG C 3 231 ? 28.300  -18.418 30.097  1.00 31.49 ? 405  ARG A O     1 
ATOM   2447 C  CB    . ARG C 3 231 ? 28.629  -16.365 32.883  1.00 40.51 ? 405  ARG A CB    1 
ATOM   2448 C  CG    . ARG C 3 231 ? 27.789  -15.427 32.074  1.00 41.60 ? 405  ARG A CG    1 
ATOM   2449 C  CD    . ARG C 3 231 ? 27.266  -14.334 32.990  1.00 44.62 ? 405  ARG A CD    1 
ATOM   2450 N  NE    . ARG C 3 231 ? 28.357  -13.607 33.635  1.00 41.24 ? 405  ARG A NE    1 
ATOM   2451 C  CZ    . ARG C 3 231 ? 28.360  -12.294 33.854  1.00 40.23 ? 405  ARG A CZ    1 
ATOM   2452 N  NH1   . ARG C 3 231 ? 27.330  -11.543 33.483  1.00 38.78 ? 405  ARG A NH1   1 
ATOM   2453 N  NH2   . ARG C 3 231 ? 29.405  -11.729 34.440  1.00 31.12 ? 405  ARG A NH2   1 
ATOM   2454 N  N     . HIS C 3 232 ? 27.418  -19.076 32.062  1.00 32.79 ? 406  HIS A N     1 
ATOM   2455 C  CA    . HIS C 3 232 ? 26.408  -19.926 31.481  1.00 34.78 ? 406  HIS A CA    1 
ATOM   2456 C  C     . HIS C 3 232 ? 25.127  -19.410 32.077  1.00 37.97 ? 406  HIS A C     1 
ATOM   2457 O  O     . HIS C 3 232 ? 24.609  -19.976 33.040  1.00 44.21 ? 406  HIS A O     1 
ATOM   2458 C  CB    . HIS C 3 232 ? 26.647  -21.395 31.878  1.00 35.16 ? 406  HIS A CB    1 
ATOM   2459 C  CG    . HIS C 3 232 ? 28.039  -21.883 31.597  1.00 37.97 ? 406  HIS A CG    1 
ATOM   2460 N  ND1   . HIS C 3 232 ? 28.600  -21.853 30.336  1.00 37.79 ? 406  HIS A ND1   1 
ATOM   2461 C  CD2   . HIS C 3 232 ? 29.015  -22.325 32.429  1.00 35.63 ? 406  HIS A CD2   1 
ATOM   2462 C  CE1   . HIS C 3 232 ? 29.863  -22.245 30.405  1.00 37.47 ? 406  HIS A CE1   1 
ATOM   2463 N  NE2   . HIS C 3 232 ? 30.137  -22.536 31.664  1.00 38.21 ? 406  HIS A NE2   1 
ATOM   2464 N  N     . ASP C 3 233 ? 24.724  -18.236 31.602  1.00 40.05 ? 407  ASP A N     1 
ATOM   2465 C  CA    . ASP C 3 233 ? 23.504  -17.574 32.051  1.00 38.47 ? 407  ASP A CA    1 
ATOM   2466 C  C     . ASP C 3 233 ? 22.445  -17.749 30.993  1.00 33.93 ? 407  ASP A C     1 
ATOM   2467 O  O     . ASP C 3 233 ? 22.573  -17.205 29.910  1.00 37.94 ? 407  ASP A O     1 
ATOM   2468 C  CB    . ASP C 3 233 ? 23.742  -16.081 32.260  1.00 36.19 ? 407  ASP A CB    1 
ATOM   2469 C  CG    . ASP C 3 233 ? 22.632  -15.424 33.049  1.00 41.15 ? 407  ASP A CG    1 
ATOM   2470 O  OD1   . ASP C 3 233 ? 21.452  -15.866 32.967  1.00 33.21 ? 407  ASP A OD1   1 
ATOM   2471 O  OD2   . ASP C 3 233 ? 22.960  -14.473 33.780  1.00 46.99 ? 407  ASP A OD2   1 
ATOM   2472 N  N     . ASN C 3 234 ? 21.387  -18.475 31.304  1.00 30.54 ? 408  ASN A N     1 
ATOM   2473 C  CA    . ASN C 3 234 ? 20.372  -18.677 30.292  1.00 32.76 ? 408  ASN A CA    1 
ATOM   2474 C  C     . ASN C 3 234 ? 19.164  -17.782 30.471  1.00 32.70 ? 408  ASN A C     1 
ATOM   2475 O  O     . ASN C 3 234 ? 18.105  -18.026 29.882  1.00 29.53 ? 408  ASN A O     1 
ATOM   2476 C  CB    . ASN C 3 234 ? 19.986  -20.158 30.156  1.00 35.10 ? 408  ASN A CB    1 
ATOM   2477 C  CG    . ASN C 3 234 ? 19.454  -20.740 31.433  1.00 41.37 ? 408  ASN A CG    1 
ATOM   2478 O  OD1   . ASN C 3 234 ? 18.596  -21.632 31.404  1.00 39.34 ? 408  ASN A OD1   1 
ATOM   2479 N  ND2   . ASN C 3 234 ? 19.953  -20.244 32.574  1.00 41.17 ? 408  ASN A ND2   1 
ATOM   2480 N  N     . LYS C 3 235 ? 19.337  -16.741 31.282  1.00 31.22 ? 409  LYS A N     1 
ATOM   2481 C  CA    . LYS C 3 235 ? 18.277  -15.763 31.500  1.00 33.36 ? 409  LYS A CA    1 
ATOM   2482 C  C     . LYS C 3 235 ? 18.532  -14.508 30.644  1.00 35.99 ? 409  LYS A C     1 
ATOM   2483 O  O     . LYS C 3 235 ? 17.760  -13.545 30.680  1.00 40.02 ? 409  LYS A O     1 
ATOM   2484 C  CB    . LYS C 3 235 ? 18.238  -15.365 32.962  1.00 38.91 ? 409  LYS A CB    1 
ATOM   2485 C  CG    . LYS C 3 235 ? 18.274  -16.539 33.883  1.00 49.54 ? 409  LYS A CG    1 
ATOM   2486 C  CD    . LYS C 3 235 ? 17.050  -17.389 33.697  1.00 60.49 ? 409  LYS A CD    1 
ATOM   2487 C  CE    . LYS C 3 235 ? 17.296  -18.781 34.253  1.00 66.17 ? 409  LYS A CE    1 
ATOM   2488 N  NZ    . LYS C 3 235 ? 17.693  -18.744 35.690  1.00 71.86 ? 409  LYS A NZ    1 
ATOM   2489 N  N     . VAL C 3 236 ? 19.633  -14.510 29.900  1.00 33.30 ? 410  VAL A N     1 
ATOM   2490 C  CA    . VAL C 3 236 ? 20.017  -13.390 29.048  1.00 28.18 ? 410  VAL A CA    1 
ATOM   2491 C  C     . VAL C 3 236 ? 20.129  -13.794 27.573  1.00 28.37 ? 410  VAL A C     1 
ATOM   2492 O  O     . VAL C 3 236 ? 20.243  -14.968 27.250  1.00 26.31 ? 410  VAL A O     1 
ATOM   2493 C  CB    . VAL C 3 236 ? 21.338  -12.742 29.541  1.00 31.06 ? 410  VAL A CB    1 
ATOM   2494 C  CG1   . VAL C 3 236 ? 21.187  -12.321 30.994  1.00 17.23 ? 410  VAL A CG1   1 
ATOM   2495 C  CG2   . VAL C 3 236 ? 22.523  -13.700 29.366  1.00 24.92 ? 410  VAL A CG2   1 
ATOM   2496 N  N     . THR C 3 237 ? 20.121  -12.809 26.687  1.00 29.12 ? 411  THR A N     1 
ATOM   2497 C  CA    . THR C 3 237 ? 20.147  -13.067 25.257  1.00 27.38 ? 411  THR A CA    1 
ATOM   2498 C  C     . THR C 3 237 ? 21.489  -12.804 24.578  1.00 27.21 ? 411  THR A C     1 
ATOM   2499 O  O     . THR C 3 237 ? 21.684  -13.138 23.408  1.00 25.48 ? 411  THR A O     1 
ATOM   2500 C  CB    . THR C 3 237 ? 19.021  -12.243 24.564  1.00 31.46 ? 411  THR A CB    1 
ATOM   2501 O  OG1   . THR C 3 237 ? 19.287  -10.843 24.718  1.00 41.05 ? 411  THR A OG1   1 
ATOM   2502 C  CG2   . THR C 3 237 ? 17.665  -12.526 25.229  1.00 24.89 ? 411  THR A CG2   1 
ATOM   2503 N  N     . TRP C 3 238 ? 22.432  -12.250 25.322  1.00 23.60 ? 412  TRP A N     1 
ATOM   2504 C  CA    . TRP C 3 238 ? 23.728  -11.945 24.749  1.00 24.59 ? 412  TRP A CA    1 
ATOM   2505 C  C     . TRP C 3 238 ? 24.735  -13.081 24.759  1.00 24.79 ? 412  TRP A C     1 
ATOM   2506 O  O     . TRP C 3 238 ? 24.736  -13.930 25.645  1.00 23.29 ? 412  TRP A O     1 
ATOM   2507 C  CB    . TRP C 3 238 ? 24.323  -10.693 25.400  1.00 25.16 ? 412  TRP A CB    1 
ATOM   2508 C  CG    . TRP C 3 238 ? 24.441  -10.750 26.891  1.00 23.34 ? 412  TRP A CG    1 
ATOM   2509 C  CD1   . TRP C 3 238 ? 23.505  -10.342 27.825  1.00 17.38 ? 412  TRP A CD1   1 
ATOM   2510 C  CD2   . TRP C 3 238 ? 25.595  -11.164 27.628  1.00 14.71 ? 412  TRP A CD2   1 
ATOM   2511 N  NE1   . TRP C 3 238 ? 24.027  -10.464 29.092  1.00 21.12 ? 412  TRP A NE1   1 
ATOM   2512 C  CE2   . TRP C 3 238 ? 25.307  -10.966 29.001  1.00 20.56 ? 412  TRP A CE2   1 
ATOM   2513 C  CE3   . TRP C 3 238 ? 26.854  -11.674 27.259  1.00 13.12 ? 412  TRP A CE3   1 
ATOM   2514 C  CZ2   . TRP C 3 238 ? 26.248  -11.266 30.022  1.00 16.88 ? 412  TRP A CZ2   1 
ATOM   2515 C  CZ3   . TRP C 3 238 ? 27.786  -11.968 28.265  1.00 9.23  ? 412  TRP A CZ3   1 
ATOM   2516 C  CH2   . TRP C 3 238 ? 27.474  -11.761 29.631  1.00 12.15 ? 412  TRP A CH2   1 
ATOM   2517 N  N     . LEU C 3 239 ? 25.623  -13.056 23.770  1.00 25.90 ? 413  LEU A N     1 
ATOM   2518 C  CA    . LEU C 3 239 ? 26.642  -14.080 23.602  1.00 23.34 ? 413  LEU A CA    1 
ATOM   2519 C  C     . LEU C 3 239 ? 27.951  -13.559 24.145  1.00 24.14 ? 413  LEU A C     1 
ATOM   2520 O  O     . LEU C 3 239 ? 28.805  -14.321 24.588  1.00 24.57 ? 413  LEU A O     1 
ATOM   2521 C  CB    . LEU C 3 239 ? 26.838  -14.410 22.109  1.00 21.17 ? 413  LEU A CB    1 
ATOM   2522 C  CG    . LEU C 3 239 ? 25.694  -14.594 21.096  1.00 18.86 ? 413  LEU A CG    1 
ATOM   2523 C  CD1   . LEU C 3 239 ? 26.271  -15.142 19.820  1.00 20.34 ? 413  LEU A CD1   1 
ATOM   2524 C  CD2   . LEU C 3 239 ? 24.657  -15.552 21.609  1.00 13.25 ? 413  LEU A CD2   1 
ATOM   2525 N  N     . VAL C 3 240 ? 28.134  -12.254 24.017  1.00 24.64 ? 414  VAL A N     1 
ATOM   2526 C  CA    . VAL C 3 240 ? 29.358  -11.605 24.459  1.00 22.34 ? 414  VAL A CA    1 
ATOM   2527 C  C     . VAL C 3 240 ? 29.078  -10.228 25.052  1.00 20.50 ? 414  VAL A C     1 
ATOM   2528 O  O     . VAL C 3 240 ? 28.052  -9.607  24.762  1.00 18.79 ? 414  VAL A O     1 
ATOM   2529 C  CB    . VAL C 3 240 ? 30.327  -11.384 23.261  1.00 27.59 ? 414  VAL A CB    1 
ATOM   2530 C  CG1   . VAL C 3 240 ? 31.735  -11.081 23.745  1.00 18.17 ? 414  VAL A CG1   1 
ATOM   2531 C  CG2   . VAL C 3 240 ? 30.336  -12.596 22.320  1.00 31.86 ? 414  VAL A CG2   1 
ATOM   2532 N  N     . SER C 3 241 ? 29.959  -9.783  25.936  1.00 20.17 ? 415  SER A N     1 
ATOM   2533 C  CA    . SER C 3 241 ? 29.830  -8.452  26.489  1.00 19.44 ? 415  SER A CA    1 
ATOM   2534 C  C     . SER C 3 241 ? 31.151  -7.979  27.027  1.00 20.54 ? 415  SER A C     1 
ATOM   2535 O  O     . SER C 3 241 ? 32.039  -8.768  27.266  1.00 26.14 ? 415  SER A O     1 
ATOM   2536 C  CB    . SER C 3 241 ? 28.705  -8.328  27.506  1.00 15.47 ? 415  SER A CB    1 
ATOM   2537 O  OG    . SER C 3 241 ? 28.999  -8.960  28.728  1.00 32.99 ? 415  SER A OG    1 
ATOM   2538 N  N     . TRP C 3 242 ? 31.313  -6.674  27.078  1.00 25.16 ? 416  TRP A N     1 
ATOM   2539 C  CA    . TRP C 3 242 ? 32.535  -6.048  27.547  1.00 22.34 ? 416  TRP A CA    1 
ATOM   2540 C  C     . TRP C 3 242 ? 32.137  -4.643  27.991  1.00 28.16 ? 416  TRP A C     1 
ATOM   2541 O  O     . TRP C 3 242 ? 31.137  -4.093  27.484  1.00 28.09 ? 416  TRP A O     1 
ATOM   2542 C  CB    . TRP C 3 242 ? 33.521  -5.960  26.372  1.00 19.30 ? 416  TRP A CB    1 
ATOM   2543 C  CG    . TRP C 3 242 ? 33.171  -4.949  25.250  1.00 17.44 ? 416  TRP A CG    1 
ATOM   2544 C  CD1   . TRP C 3 242 ? 33.550  -3.636  25.185  1.00 20.46 ? 416  TRP A CD1   1 
ATOM   2545 C  CD2   . TRP C 3 242 ? 32.523  -5.227  24.001  1.00 16.43 ? 416  TRP A CD2   1 
ATOM   2546 N  NE1   . TRP C 3 242 ? 33.212  -3.086  23.971  1.00 21.95 ? 416  TRP A NE1   1 
ATOM   2547 C  CE2   . TRP C 3 242 ? 32.582  -4.039  23.222  1.00 21.28 ? 416  TRP A CE2   1 
ATOM   2548 C  CE3   . TRP C 3 242 ? 31.922  -6.362  23.456  1.00 18.36 ? 416  TRP A CE3   1 
ATOM   2549 C  CZ2   . TRP C 3 242 ? 32.065  -3.956  21.932  1.00 22.14 ? 416  TRP A CZ2   1 
ATOM   2550 C  CZ3   . TRP C 3 242 ? 31.406  -6.281  22.168  1.00 30.86 ? 416  TRP A CZ3   1 
ATOM   2551 C  CH2   . TRP C 3 242 ? 31.482  -5.080  21.420  1.00 26.57 ? 416  TRP A CH2   1 
ATOM   2552 N  N     . THR C 3 243 ? 32.887  -4.061  28.924  1.00 28.78 ? 417  THR A N     1 
ATOM   2553 C  CA    . THR C 3 243 ? 32.584  -2.707  29.376  1.00 24.95 ? 417  THR A CA    1 
ATOM   2554 C  C     . THR C 3 243 ? 33.277  -1.674  28.505  1.00 25.44 ? 417  THR A C     1 
ATOM   2555 O  O     . THR C 3 243 ? 34.465  -1.757  28.218  1.00 26.09 ? 417  THR A O     1 
ATOM   2556 C  CB    . THR C 3 243 ? 32.944  -2.482  30.840  1.00 25.13 ? 417  THR A CB    1 
ATOM   2557 O  OG1   . THR C 3 243 ? 31.972  -3.123  31.666  1.00 32.47 ? 417  THR A OG1   1 
ATOM   2558 C  CG2   . THR C 3 243 ? 32.904  -1.015  31.167  1.00 28.93 ? 417  THR A CG2   1 
ATOM   2559 N  N     . GLU C 3 244 ? 32.494  -0.732  28.019  1.00 27.84 ? 418  GLU A N     1 
ATOM   2560 C  CA    . GLU C 3 244 ? 32.985  0.336   27.181  1.00 30.77 ? 418  GLU A CA    1 
ATOM   2561 C  C     . GLU C 3 244 ? 33.622  1.387   28.126  1.00 34.22 ? 418  GLU A C     1 
ATOM   2562 O  O     . GLU C 3 244 ? 33.045  1.759   29.141  1.00 35.53 ? 418  GLU A O     1 
ATOM   2563 C  CB    . GLU C 3 244 ? 31.790  0.874   26.400  1.00 34.89 ? 418  GLU A CB    1 
ATOM   2564 C  CG    . GLU C 3 244 ? 32.036  2.124   25.601  1.00 53.35 ? 418  GLU A CG    1 
ATOM   2565 C  CD    . GLU C 3 244 ? 31.520  3.373   26.301  1.00 55.63 ? 418  GLU A CD    1 
ATOM   2566 O  OE1   . GLU C 3 244 ? 30.810  3.239   27.324  1.00 55.84 ? 418  GLU A OE1   1 
ATOM   2567 O  OE2   . GLU C 3 244 ? 31.827  4.488   25.824  1.00 64.61 ? 418  GLU A OE2   1 
ATOM   2568 N  N     . ASN C 3 245 ? 34.825  1.846   27.802  1.00 37.05 ? 419  ASN A N     1 
ATOM   2569 C  CA    . ASN C 3 245 ? 35.568  2.801   28.637  1.00 37.42 ? 419  ASN A CA    1 
ATOM   2570 C  C     . ASN C 3 245 ? 35.104  4.249   28.763  1.00 39.12 ? 419  ASN A C     1 
ATOM   2571 O  O     . ASN C 3 245 ? 35.289  4.877   29.813  1.00 42.03 ? 419  ASN A O     1 
ATOM   2572 C  CB    . ASN C 3 245 ? 37.044  2.811   28.226  1.00 33.27 ? 419  ASN A CB    1 
ATOM   2573 C  CG    . ASN C 3 245 ? 37.263  3.313   26.801  1.00 34.46 ? 419  ASN A CG    1 
ATOM   2574 O  OD1   . ASN C 3 245 ? 36.442  3.099   25.903  1.00 38.17 ? 419  ASN A OD1   1 
ATOM   2575 N  ND2   . ASN C 3 245 ? 38.396  3.947   26.585  1.00 31.03 ? 419  ASN A ND2   1 
ATOM   2576 N  N     . ILE C 3 246 ? 34.545  4.803   27.699  1.00 38.35 ? 420  ILE A N     1 
ATOM   2577 C  CA    . ILE C 3 246 ? 34.130  6.193   27.753  1.00 40.07 ? 420  ILE A CA    1 
ATOM   2578 C  C     . ILE C 3 246 ? 32.931  6.510   28.651  1.00 40.86 ? 420  ILE A C     1 
ATOM   2579 O  O     . ILE C 3 246 ? 32.944  7.532   29.332  1.00 47.66 ? 420  ILE A O     1 
ATOM   2580 C  CB    . ILE C 3 246 ? 34.003  6.789   26.330  1.00 37.97 ? 420  ILE A CB    1 
ATOM   2581 C  CG1   . ILE C 3 246 ? 35.396  6.792   25.690  1.00 34.00 ? 420  ILE A CG1   1 
ATOM   2582 C  CG2   . ILE C 3 246 ? 33.441  8.213   26.386  1.00 34.57 ? 420  ILE A CG2   1 
ATOM   2583 C  CD1   . ILE C 3 246 ? 35.429  7.229   24.296  1.00 41.61 ? 420  ILE A CD1   1 
ATOM   2584 N  N     . GLN C 3 247 ? 31.901  5.665   28.647  1.00 37.56 ? 421  GLN A N     1 
ATOM   2585 C  CA    . GLN C 3 247 ? 30.724  5.876   29.499  1.00 39.21 ? 421  GLN A CA    1 
ATOM   2586 C  C     . GLN C 3 247 ? 30.794  4.935   30.701  1.00 43.70 ? 421  GLN A C     1 
ATOM   2587 O  O     . GLN C 3 247 ? 30.250  5.239   31.762  1.00 46.36 ? 421  GLN A O     1 
ATOM   2588 C  CB    . GLN C 3 247 ? 29.410  5.562   28.760  1.00 42.90 ? 421  GLN A CB    1 
ATOM   2589 C  CG    . GLN C 3 247 ? 29.086  6.414   27.551  1.00 46.16 ? 421  GLN A CG    1 
ATOM   2590 C  CD    . GLN C 3 247 ? 28.868  7.862   27.916  1.00 50.79 ? 421  GLN A CD    1 
ATOM   2591 O  OE1   . GLN C 3 247 ? 29.286  8.761   27.178  1.00 55.59 ? 421  GLN A OE1   1 
ATOM   2592 N  NE2   . GLN C 3 247 ? 28.298  8.105   29.106  1.00 53.52 ? 421  GLN A NE2   1 
ATOM   2593 N  N     . GLY C 3 248 ? 31.436  3.781   30.511  1.00 41.35 ? 422  GLY A N     1 
ATOM   2594 C  CA    . GLY C 3 248 ? 31.538  2.785   31.563  1.00 37.58 ? 422  GLY A CA    1 
ATOM   2595 C  C     . GLY C 3 248 ? 30.307  1.886   31.539  1.00 40.23 ? 422  GLY A C     1 
ATOM   2596 O  O     . GLY C 3 248 ? 29.876  1.375   32.581  1.00 41.09 ? 422  GLY A O     1 
ATOM   2597 N  N     . SER C 3 249 ? 29.717  1.742   30.351  1.00 36.51 ? 423  SER A N     1 
ATOM   2598 C  CA    . SER C 3 249 ? 28.530  0.916   30.131  1.00 34.81 ? 423  SER A CA    1 
ATOM   2599 C  C     . SER C 3 249 ? 28.918  -0.437  29.495  1.00 33.55 ? 423  SER A C     1 
ATOM   2600 O  O     . SER C 3 249 ? 29.995  -0.579  28.907  1.00 31.70 ? 423  SER A O     1 
ATOM   2601 C  CB    . SER C 3 249 ? 27.566  1.657   29.200  1.00 39.05 ? 423  SER A CB    1 
ATOM   2602 O  OG    . SER C 3 249 ? 28.093  1.727   27.882  1.00 37.56 ? 423  SER A OG    1 
ATOM   2603 N  N     . ILE C 3 250 ? 28.042  -1.427  29.613  1.00 30.48 ? 424  ILE A N     1 
ATOM   2604 C  CA    . ILE C 3 250 ? 28.320  -2.748  29.055  1.00 29.50 ? 424  ILE A CA    1 
ATOM   2605 C  C     . ILE C 3 250 ? 27.874  -2.833  27.588  1.00 27.93 ? 424  ILE A C     1 
ATOM   2606 O  O     . ILE C 3 250 ? 26.779  -2.396  27.255  1.00 25.37 ? 424  ILE A O     1 
ATOM   2607 C  CB    . ILE C 3 250 ? 27.593  -3.879  29.866  1.00 29.37 ? 424  ILE A CB    1 
ATOM   2608 C  CG1   . ILE C 3 250 ? 27.764  -3.674  31.369  1.00 26.24 ? 424  ILE A CG1   1 
ATOM   2609 C  CG2   . ILE C 3 250 ? 28.165  -5.252  29.517  1.00 30.08 ? 424  ILE A CG2   1 
ATOM   2610 C  CD1   . ILE C 3 250 ? 27.058  -4.712  32.184  1.00 27.73 ? 424  ILE A CD1   1 
ATOM   2611 N  N     . LYS C 3 251 ? 28.741  -3.355  26.723  1.00 24.82 ? 425  LYS A N     1 
ATOM   2612 C  CA    . LYS C 3 251 ? 28.405  -3.545  25.311  1.00 25.47 ? 425  LYS A CA    1 
ATOM   2613 C  C     . LYS C 3 251 ? 28.191  -5.026  25.088  1.00 24.16 ? 425  LYS A C     1 
ATOM   2614 O  O     . LYS C 3 251 ? 28.909  -5.844  25.646  1.00 29.46 ? 425  LYS A O     1 
ATOM   2615 C  CB    . LYS C 3 251 ? 29.529  -3.080  24.394  1.00 30.06 ? 425  LYS A CB    1 
ATOM   2616 C  CG    . LYS C 3 251 ? 29.648  -1.577  24.268  1.00 34.85 ? 425  LYS A CG    1 
ATOM   2617 C  CD    . LYS C 3 251 ? 28.298  -0.931  23.976  1.00 40.41 ? 425  LYS A CD    1 
ATOM   2618 C  CE    . LYS C 3 251 ? 28.449  0.535   23.578  1.00 38.68 ? 425  LYS A CE    1 
ATOM   2619 N  NZ    . LYS C 3 251 ? 29.144  0.698   22.265  1.00 41.95 ? 425  LYS A NZ    1 
ATOM   2620 N  N     . TYR C 3 252 ? 27.223  -5.384  24.256  1.00 24.33 ? 426  TYR A N     1 
ATOM   2621 C  CA    . TYR C 3 252 ? 26.955  -6.791  24.001  1.00 23.44 ? 426  TYR A CA    1 
ATOM   2622 C  C     . TYR C 3 252 ? 26.970  -7.124  22.526  1.00 24.71 ? 426  TYR A C     1 
ATOM   2623 O  O     . TYR C 3 252 ? 26.864  -6.250  21.664  1.00 29.09 ? 426  TYR A O     1 
ATOM   2624 C  CB    . TYR C 3 252 ? 25.569  -7.192  24.520  1.00 21.59 ? 426  TYR A CB    1 
ATOM   2625 C  CG    . TYR C 3 252 ? 25.232  -6.782  25.925  1.00 25.46 ? 426  TYR A CG    1 
ATOM   2626 C  CD1   . TYR C 3 252 ? 24.657  -5.538  26.191  1.00 25.53 ? 426  TYR A CD1   1 
ATOM   2627 C  CD2   . TYR C 3 252 ? 25.477  -7.643  26.996  1.00 24.59 ? 426  TYR A CD2   1 
ATOM   2628 C  CE1   . TYR C 3 252 ? 24.336  -5.166  27.493  1.00 26.73 ? 426  TYR A CE1   1 
ATOM   2629 C  CE2   . TYR C 3 252 ? 25.160  -7.275  28.300  1.00 21.91 ? 426  TYR A CE2   1 
ATOM   2630 C  CZ    . TYR C 3 252 ? 24.588  -6.043  28.543  1.00 22.11 ? 426  TYR A CZ    1 
ATOM   2631 O  OH    . TYR C 3 252 ? 24.235  -5.707  29.831  1.00 21.21 ? 426  TYR A OH    1 
ATOM   2632 N  N     . ILE C 3 253 ? 27.124  -8.405  22.247  1.00 22.75 ? 427  ILE A N     1 
ATOM   2633 C  CA    . ILE C 3 253 ? 27.050  -8.867  20.885  1.00 25.51 ? 427  ILE A CA    1 
ATOM   2634 C  C     . ILE C 3 253 ? 25.824  -9.756  20.875  1.00 25.62 ? 427  ILE A C     1 
ATOM   2635 O  O     . ILE C 3 253 ? 25.801  -10.783 21.543  1.00 30.23 ? 427  ILE A O     1 
ATOM   2636 C  CB    . ILE C 3 253 ? 28.274  -9.651  20.493  1.00 28.27 ? 427  ILE A CB    1 
ATOM   2637 C  CG1   . ILE C 3 253 ? 29.475  -8.686  20.397  1.00 19.62 ? 427  ILE A CG1   1 
ATOM   2638 C  CG2   . ILE C 3 253 ? 27.954  -10.464 19.218  1.00 24.72 ? 427  ILE A CG2   1 
ATOM   2639 C  CD1   . ILE C 3 253 ? 30.731  -9.296  19.881  1.00 17.29 ? 427  ILE A CD1   1 
ATOM   2640 N  N     . MET C 3 254 ? 24.775  -9.327  20.187  1.00 30.07 ? 428  MET A N     1 
ATOM   2641 C  CA    . MET C 3 254 ? 23.539  -10.097 20.167  1.00 28.25 ? 428  MET A CA    1 
ATOM   2642 C  C     . MET C 3 254 ? 23.095  -10.642 18.824  1.00 26.62 ? 428  MET A C     1 
ATOM   2643 O  O     . MET C 3 254 ? 23.650  -10.331 17.784  1.00 25.20 ? 428  MET A O     1 
ATOM   2644 C  CB    . MET C 3 254 ? 22.409  -9.281  20.796  1.00 29.25 ? 428  MET A CB    1 
ATOM   2645 C  CG    . MET C 3 254 ? 22.614  -9.035  22.266  1.00 35.59 ? 428  MET A CG    1 
ATOM   2646 S  SD    . MET C 3 254 ? 21.362  -7.995  22.991  1.00 50.12 ? 428  MET A SD    1 
ATOM   2647 C  CE    . MET C 3 254 ? 21.799  -8.023  24.668  1.00 48.30 ? 428  MET A CE    1 
ATOM   2648 N  N     . LEU C 3 255 ? 22.050  -11.446 18.868  1.00 30.33 ? 429  LEU A N     1 
ATOM   2649 C  CA    . LEU C 3 255 ? 21.525  -12.050 17.677  1.00 27.28 ? 429  LEU A CA    1 
ATOM   2650 C  C     . LEU C 3 255 ? 20.855  -11.078 16.756  1.00 28.13 ? 429  LEU A C     1 
ATOM   2651 O  O     . LEU C 3 255 ? 20.593  -9.915  17.102  1.00 23.94 ? 429  LEU A O     1 
ATOM   2652 C  CB    . LEU C 3 255 ? 20.550  -13.171 18.036  1.00 27.16 ? 429  LEU A CB    1 
ATOM   2653 C  CG    . LEU C 3 255 ? 21.241  -14.370 18.669  1.00 28.80 ? 429  LEU A CG    1 
ATOM   2654 C  CD1   . LEU C 3 255 ? 20.294  -15.556 18.727  1.00 34.17 ? 429  LEU A CD1   1 
ATOM   2655 C  CD2   . LEU C 3 255 ? 22.468  -14.717 17.838  1.00 28.73 ? 429  LEU A CD2   1 
ATOM   2656 N  N     . ASN C 3 256 ? 20.540  -11.634 15.595  1.00 32.71 ? 430  ASN A N     1 
ATOM   2657 C  CA    . ASN C 3 256 ? 19.881  -10.986 14.476  1.00 34.61 ? 430  ASN A CA    1 
ATOM   2658 C  C     . ASN C 3 256 ? 18.372  -10.849 14.628  1.00 34.09 ? 430  ASN A C     1 
ATOM   2659 O  O     . ASN C 3 256 ? 17.732  -11.668 15.255  1.00 36.33 ? 430  ASN A O     1 
ATOM   2660 C  CB    . ASN C 3 256 ? 20.126  -11.822 13.247  1.00 38.30 ? 430  ASN A CB    1 
ATOM   2661 C  CG    . ASN C 3 256 ? 20.423  -10.997 12.069  1.00 48.71 ? 430  ASN A CG    1 
ATOM   2662 O  OD1   . ASN C 3 256 ? 21.248  -10.079 12.129  1.00 57.16 ? 430  ASN A OD1   1 
ATOM   2663 N  ND2   . ASN C 3 256 ? 19.726  -11.253 10.990  1.00 57.63 ? 430  ASN A ND2   1 
ATOM   2664 N  N     . PRO C 3 257 ? 17.779  -9.833  14.001  1.00 34.79 ? 431  PRO A N     1 
ATOM   2665 C  CA    . PRO C 3 257 ? 16.335  -9.604  14.068  1.00 37.33 ? 431  PRO A CA    1 
ATOM   2666 C  C     . PRO C 3 257 ? 15.528  -10.849 13.666  1.00 39.75 ? 431  PRO A C     1 
ATOM   2667 O  O     . PRO C 3 257 ? 14.430  -11.095 14.168  1.00 47.01 ? 431  PRO A O     1 
ATOM   2668 C  CB    . PRO C 3 257 ? 16.129  -8.502  13.035  1.00 36.67 ? 431  PRO A CB    1 
ATOM   2669 C  CG    . PRO C 3 257 ? 17.367  -7.739  13.114  1.00 41.33 ? 431  PRO A CG    1 
ATOM   2670 C  CD    . PRO C 3 257 ? 18.429  -8.803  13.182  1.00 38.66 ? 431  PRO A CD    1 
ATOM   2671 N  N     . SER C 3 258 ? 16.061  -11.605 12.717  1.00 37.92 ? 432  SER A N     1 
ATOM   2672 C  CA    . SER C 3 258 ? 15.387  -12.805 12.243  1.00 33.60 ? 432  SER A CA    1 
ATOM   2673 C  C     . SER C 3 258 ? 15.569  -13.977 13.211  1.00 33.61 ? 432  SER A C     1 
ATOM   2674 O  O     . SER C 3 258 ? 14.958  -15.039 13.047  1.00 35.65 ? 432  SER A O     1 
ATOM   2675 C  CB    . SER C 3 258 ? 15.905  -13.157 10.857  1.00 33.24 ? 432  SER A CB    1 
ATOM   2676 O  OG    . SER C 3 258 ? 17.318  -13.207 10.866  1.00 38.58 ? 432  SER A OG    1 
ATOM   2677 N  N     . SER C 3 259 ? 16.399  -13.792 14.229  1.00 33.69 ? 433  SER A N     1 
ATOM   2678 C  CA    . SER C 3 259 ? 16.604  -14.863 15.189  1.00 30.60 ? 433  SER A CA    1 
ATOM   2679 C  C     . SER C 3 259 ? 15.293  -15.071 15.911  1.00 32.11 ? 433  SER A C     1 
ATOM   2680 O  O     . SER C 3 259 ? 14.406  -14.213 15.881  1.00 36.91 ? 433  SER A O     1 
ATOM   2681 C  CB    . SER C 3 259 ? 17.701  -14.506 16.194  1.00 33.42 ? 433  SER A CB    1 
ATOM   2682 O  OG    . SER C 3 259 ? 17.303  -13.480 17.100  1.00 34.84 ? 433  SER A OG    1 
ATOM   2683 N  N     . ARG C 3 260 ? 15.134  -16.243 16.501  1.00 31.84 ? 434  ARG A N     1 
ATOM   2684 C  CA    . ARG C 3 260 ? 13.925  -16.532 17.247  1.00 31.69 ? 434  ARG A CA    1 
ATOM   2685 C  C     . ARG C 3 260 ? 13.811  -15.576 18.426  1.00 29.52 ? 434  ARG A C     1 
ATOM   2686 O  O     . ARG C 3 260 ? 12.784  -14.923 18.626  1.00 27.88 ? 434  ARG A O     1 
ATOM   2687 C  CB    . ARG C 3 260 ? 13.999  -17.946 17.787  1.00 37.92 ? 434  ARG A CB    1 
ATOM   2688 C  CG    . ARG C 3 260 ? 12.814  -18.343 18.621  1.00 43.15 ? 434  ARG A CG    1 
ATOM   2689 C  CD    . ARG C 3 260 ? 13.257  -19.127 19.850  1.00 47.31 ? 434  ARG A CD    1 
ATOM   2690 N  NE    . ARG C 3 260 ? 13.167  -18.332 21.064  1.00 45.99 ? 434  ARG A NE    1 
ATOM   2691 C  CZ    . ARG C 3 260 ? 14.128  -18.255 21.974  1.00 52.06 ? 434  ARG A CZ    1 
ATOM   2692 N  NH1   . ARG C 3 260 ? 15.264  -18.924 21.805  1.00 47.96 ? 434  ARG A NH1   1 
ATOM   2693 N  NH2   . ARG C 3 260 ? 13.939  -17.518 23.057  1.00 55.28 ? 434  ARG A NH2   1 
ATOM   2694 N  N     . ILE C 3 261 ? 14.875  -15.545 19.214  1.00 23.38 ? 435  ILE A N     1 
ATOM   2695 C  CA    . ILE C 3 261 ? 14.960  -14.733 20.394  1.00 26.29 ? 435  ILE A CA    1 
ATOM   2696 C  C     . ILE C 3 261 ? 14.580  -13.287 20.119  1.00 31.84 ? 435  ILE A C     1 
ATOM   2697 O  O     . ILE C 3 261 ? 13.960  -12.639 20.945  1.00 35.76 ? 435  ILE A O     1 
ATOM   2698 C  CB    . ILE C 3 261 ? 16.377  -14.812 20.969  1.00 31.80 ? 435  ILE A CB    1 
ATOM   2699 C  CG1   . ILE C 3 261 ? 16.401  -14.314 22.405  1.00 40.54 ? 435  ILE A CG1   1 
ATOM   2700 C  CG2   . ILE C 3 261 ? 17.343  -14.010 20.135  1.00 30.99 ? 435  ILE A CG2   1 
ATOM   2701 C  CD1   . ILE C 3 261 ? 15.668  -15.221 23.360  1.00 43.93 ? 435  ILE A CD1   1 
ATOM   2702 N  N     . LYS C 3 262 ? 14.932  -12.782 18.950  1.00 34.55 ? 436  LYS A N     1 
ATOM   2703 C  CA    . LYS C 3 262 ? 14.601  -11.409 18.622  1.00 31.12 ? 436  LYS A CA    1 
ATOM   2704 C  C     . LYS C 3 262 ? 13.167  -11.318 18.093  1.00 31.63 ? 436  LYS A C     1 
ATOM   2705 O  O     . LYS C 3 262 ? 12.371  -10.516 18.592  1.00 33.41 ? 436  LYS A O     1 
ATOM   2706 C  CB    . LYS C 3 262 ? 15.618  -10.853 17.626  1.00 39.14 ? 436  LYS A CB    1 
ATOM   2707 C  CG    . LYS C 3 262 ? 16.996  -10.497 18.255  1.00 50.51 ? 436  LYS A CG    1 
ATOM   2708 C  CD    . LYS C 3 262 ? 16.974  -9.150  19.045  1.00 53.08 ? 436  LYS A CD    1 
ATOM   2709 C  CE    . LYS C 3 262 ? 18.226  -8.914  19.938  1.00 53.15 ? 436  LYS A CE    1 
ATOM   2710 N  NZ    . LYS C 3 262 ? 18.164  -9.553  21.326  1.00 48.21 ? 436  LYS A NZ    1 
ATOM   2711 N  N     . GLY C 3 263 ? 12.811  -12.193 17.155  1.00 30.88 ? 437  GLY A N     1 
ATOM   2712 C  CA    . GLY C 3 263 ? 11.471  -12.179 16.590  1.00 25.21 ? 437  GLY A CA    1 
ATOM   2713 C  C     . GLY C 3 263 ? 10.356  -12.381 17.604  1.00 31.80 ? 437  GLY A C     1 
ATOM   2714 O  O     . GLY C 3 263 ? 9.292   -11.748 17.525  1.00 28.40 ? 437  GLY A O     1 
ATOM   2715 N  N     . GLU C 3 264 ? 10.572  -13.291 18.548  1.00 29.44 ? 438  GLU A N     1 
ATOM   2716 C  CA    . GLU C 3 264 ? 9.557   -13.544 19.542  1.00 35.93 ? 438  GLU A CA    1 
ATOM   2717 C  C     . GLU C 3 264 ? 9.254   -12.263 20.320  1.00 36.50 ? 438  GLU A C     1 
ATOM   2718 O  O     . GLU C 3 264 ? 8.098   -11.889 20.485  1.00 40.36 ? 438  GLU A O     1 
ATOM   2719 C  CB    . GLU C 3 264 ? 9.983   -14.712 20.442  1.00 42.67 ? 438  GLU A CB    1 
ATOM   2720 C  CG    . GLU C 3 264 ? 10.307  -14.380 21.910  1.00 61.52 ? 438  GLU A CG    1 
ATOM   2721 C  CD    . GLU C 3 264 ? 11.035  -15.521 22.675  1.00 66.31 ? 438  GLU A CD    1 
ATOM   2722 O  OE1   . GLU C 3 264 ? 11.227  -16.630 22.120  1.00 67.97 ? 438  GLU A OE1   1 
ATOM   2723 O  OE2   . GLU C 3 264 ? 11.426  -15.301 23.847  1.00 73.88 ? 438  GLU A OE2   1 
ATOM   2724 N  N     . LYS C 3 265 ? 10.294  -11.530 20.690  1.00 36.91 ? 439  LYS A N     1 
ATOM   2725 C  CA    . LYS C 3 265 ? 10.111  -10.296 21.446  1.00 37.43 ? 439  LYS A CA    1 
ATOM   2726 C  C     . LYS C 3 265 ? 9.294   -9.293  20.650  1.00 35.74 ? 439  LYS A C     1 
ATOM   2727 O  O     . LYS C 3 265 ? 8.343   -8.703  21.149  1.00 30.19 ? 439  LYS A O     1 
ATOM   2728 C  CB    . LYS C 3 265 ? 11.468  -9.706  21.814  1.00 40.16 ? 439  LYS A CB    1 
ATOM   2729 C  CG    . LYS C 3 265 ? 11.820  -9.846  23.288  1.00 50.43 ? 439  LYS A CG    1 
ATOM   2730 C  CD    . LYS C 3 265 ? 11.617  -8.537  24.066  1.00 59.18 ? 439  LYS A CD    1 
ATOM   2731 C  CE    . LYS C 3 265 ? 12.950  -7.951  24.557  1.00 69.42 ? 439  LYS A CE    1 
ATOM   2732 N  NZ    . LYS C 3 265 ? 13.266  -6.580  24.044  1.00 70.81 ? 439  LYS A NZ    1 
ATOM   2733 N  N     . ASP C 3 266 ? 9.641   -9.183  19.375  1.00 35.17 ? 440  ASP A N     1 
ATOM   2734 C  CA    . ASP C 3 266 ? 8.991   -8.274  18.437  1.00 31.96 ? 440  ASP A CA    1 
ATOM   2735 C  C     . ASP C 3 266 ? 7.501   -8.556  18.326  1.00 29.81 ? 440  ASP A C     1 
ATOM   2736 O  O     . ASP C 3 266 ? 6.675   -7.641  18.269  1.00 27.71 ? 440  ASP A O     1 
ATOM   2737 C  CB    . ASP C 3 266 ? 9.633   -8.453  17.068  1.00 35.21 ? 440  ASP A CB    1 
ATOM   2738 C  CG    . ASP C 3 266 ? 9.626   -7.198  16.263  1.00 35.78 ? 440  ASP A CG    1 
ATOM   2739 O  OD1   . ASP C 3 266 ? 9.824   -6.112  16.843  1.00 36.51 ? 440  ASP A OD1   1 
ATOM   2740 O  OD2   . ASP C 3 266 ? 9.450   -7.302  15.041  1.00 42.27 ? 440  ASP A OD2   1 
ATOM   2741 N  N     . TRP C 3 267 ? 7.177   -9.842  18.224  1.00 32.60 ? 441  TRP A N     1 
ATOM   2742 C  CA    . TRP C 3 267 ? 5.800   -10.298 18.124  1.00 31.58 ? 441  TRP A CA    1 
ATOM   2743 C  C     . TRP C 3 267 ? 5.083   -9.889  19.373  1.00 29.09 ? 441  TRP A C     1 
ATOM   2744 O  O     . TRP C 3 267 ? 3.966   -9.374  19.334  1.00 29.04 ? 441  TRP A O     1 
ATOM   2745 C  CB    . TRP C 3 267 ? 5.740   -11.821 18.033  1.00 34.62 ? 441  TRP A CB    1 
ATOM   2746 C  CG    . TRP C 3 267 ? 4.341   -12.357 18.121  1.00 39.60 ? 441  TRP A CG    1 
ATOM   2747 C  CD1   . TRP C 3 267 ? 3.456   -12.444 17.106  1.00 40.58 ? 441  TRP A CD1   1 
ATOM   2748 C  CD2   . TRP C 3 267 ? 3.681   -12.921 19.275  1.00 46.79 ? 441  TRP A CD2   1 
ATOM   2749 N  NE1   . TRP C 3 267 ? 2.292   -13.039 17.528  1.00 40.93 ? 441  TRP A NE1   1 
ATOM   2750 C  CE2   . TRP C 3 267 ? 2.398   -13.338 18.858  1.00 44.03 ? 441  TRP A CE2   1 
ATOM   2751 C  CE3   . TRP C 3 267 ? 4.049   -13.109 20.622  1.00 49.98 ? 441  TRP A CE3   1 
ATOM   2752 C  CZ2   . TRP C 3 267 ? 1.475   -13.936 19.732  1.00 46.60 ? 441  TRP A CZ2   1 
ATOM   2753 C  CZ3   . TRP C 3 267 ? 3.128   -13.700 21.495  1.00 48.86 ? 441  TRP A CZ3   1 
ATOM   2754 C  CH2   . TRP C 3 267 ? 1.854   -14.108 21.040  1.00 48.94 ? 441  TRP A CH2   1 
ATOM   2755 N  N     . GLN C 3 268 ? 5.721   -10.184 20.495  1.00 29.35 ? 442  GLN A N     1 
ATOM   2756 C  CA    . GLN C 3 268 ? 5.157   -9.866  21.789  1.00 33.56 ? 442  GLN A CA    1 
ATOM   2757 C  C     . GLN C 3 268 ? 4.863   -8.357  21.894  1.00 35.11 ? 442  GLN A C     1 
ATOM   2758 O  O     . GLN C 3 268 ? 3.756   -7.959  22.269  1.00 34.93 ? 442  GLN A O     1 
ATOM   2759 C  CB    . GLN C 3 268 ? 6.118   -10.323 22.874  1.00 33.11 ? 442  GLN A CB    1 
ATOM   2760 C  CG    . GLN C 3 268 ? 5.440   -10.658 24.174  1.00 43.96 ? 442  GLN A CG    1 
ATOM   2761 C  CD    . GLN C 3 268 ? 6.418   -10.725 25.346  1.00 52.83 ? 442  GLN A CD    1 
ATOM   2762 O  OE1   . GLN C 3 268 ? 7.646   -10.668 25.176  1.00 55.54 ? 442  GLN A OE1   1 
ATOM   2763 N  NE2   . GLN C 3 268 ? 5.864   -10.828 26.555  1.00 61.18 ? 442  GLN A NE2   1 
ATOM   2764 N  N     . LYS C 3 269 ? 5.836   -7.546  21.479  1.00 35.83 ? 443  LYS A N     1 
ATOM   2765 C  CA    . LYS C 3 269 ? 5.771   -6.086  21.487  1.00 30.59 ? 443  LYS A CA    1 
ATOM   2766 C  C     . LYS C 3 269 ? 4.504   -5.555  20.824  1.00 29.79 ? 443  LYS A C     1 
ATOM   2767 O  O     . LYS C 3 269 ? 3.899   -4.587  21.282  1.00 33.57 ? 443  LYS A O     1 
ATOM   2768 C  CB    . LYS C 3 269 ? 7.000   -5.530  20.751  1.00 38.38 ? 443  LYS A CB    1 
ATOM   2769 C  CG    . LYS C 3 269 ? 7.301   -4.015  20.935  1.00 39.58 ? 443  LYS A CG    1 
ATOM   2770 C  CD    . LYS C 3 269 ? 8.557   -3.538  20.130  1.00 33.43 ? 443  LYS A CD    1 
ATOM   2771 C  CE    . LYS C 3 269 ? 8.260   -3.392  18.610  1.00 34.95 ? 443  LYS A CE    1 
ATOM   2772 N  NZ    . LYS C 3 269 ? 9.454   -2.992  17.782  1.00 28.94 ? 443  LYS A NZ    1 
ATOM   2773 N  N     . TYR C 3 270 ? 4.120   -6.148  19.702  1.00 25.72 ? 444  TYR A N     1 
ATOM   2774 C  CA    . TYR C 3 270 ? 2.909   -5.689  19.034  1.00 26.71 ? 444  TYR A CA    1 
ATOM   2775 C  C     . TYR C 3 270 ? 1.636   -6.169  19.719  1.00 25.54 ? 444  TYR A C     1 
ATOM   2776 O  O     . TYR C 3 270 ? 0.591   -5.517  19.689  1.00 23.09 ? 444  TYR A O     1 
ATOM   2777 C  CB    . TYR C 3 270 ? 2.968   -6.085  17.577  1.00 23.88 ? 444  TYR A CB    1 
ATOM   2778 C  CG    . TYR C 3 270 ? 4.005   -5.261  16.891  1.00 27.15 ? 444  TYR A CG    1 
ATOM   2779 C  CD1   . TYR C 3 270 ? 3.792   -3.901  16.688  1.00 30.02 ? 444  TYR A CD1   1 
ATOM   2780 C  CD2   . TYR C 3 270 ? 5.222   -5.812  16.507  1.00 25.11 ? 444  TYR A CD2   1 
ATOM   2781 C  CE1   . TYR C 3 270 ? 4.763   -3.108  16.124  1.00 31.58 ? 444  TYR A CE1   1 
ATOM   2782 C  CE2   . TYR C 3 270 ? 6.198   -5.030  15.944  1.00 28.93 ? 444  TYR A CE2   1 
ATOM   2783 C  CZ    . TYR C 3 270 ? 5.960   -3.673  15.756  1.00 30.12 ? 444  TYR A CZ    1 
ATOM   2784 O  OH    . TYR C 3 270 ? 6.896   -2.856  15.212  1.00 32.07 ? 444  TYR A OH    1 
ATOM   2785 N  N     . GLU C 3 271 ? 1.741   -7.337  20.323  1.00 27.15 ? 445  GLU A N     1 
ATOM   2786 C  CA    . GLU C 3 271 ? 0.637   -7.904  21.046  1.00 32.17 ? 445  GLU A CA    1 
ATOM   2787 C  C     . GLU C 3 271 ? 0.303   -6.944  22.164  1.00 31.06 ? 445  GLU A C     1 
ATOM   2788 O  O     . GLU C 3 271 ? -0.846  -6.564  22.341  1.00 37.47 ? 445  GLU A O     1 
ATOM   2789 C  CB    . GLU C 3 271 ? 1.044   -9.263  21.621  1.00 35.15 ? 445  GLU A CB    1 
ATOM   2790 C  CG    . GLU C 3 271 ? 0.966   -10.378 20.608  1.00 36.42 ? 445  GLU A CG    1 
ATOM   2791 C  CD    . GLU C 3 271 ? -0.391  -10.404 19.908  1.00 39.43 ? 445  GLU A CD    1 
ATOM   2792 O  OE1   . GLU C 3 271 ? -1.417  -10.649 20.594  1.00 43.95 ? 445  GLU A OE1   1 
ATOM   2793 O  OE2   . GLU C 3 271 ? -0.433  -10.163 18.678  1.00 38.74 ? 445  GLU A OE2   1 
ATOM   2794 N  N     . THR C 3 272 ? 1.332   -6.551  22.895  1.00 28.85 ? 446  THR A N     1 
ATOM   2795 C  CA    . THR C 3 272 ? 1.197   -5.644  24.019  1.00 32.71 ? 446  THR A CA    1 
ATOM   2796 C  C     . THR C 3 272 ? 0.529   -4.330  23.620  1.00 33.21 ? 446  THR A C     1 
ATOM   2797 O  O     . THR C 3 272 ? -0.244  -3.759  24.387  1.00 32.73 ? 446  THR A O     1 
ATOM   2798 C  CB    . THR C 3 272 ? 2.575   -5.389  24.639  1.00 38.95 ? 446  THR A CB    1 
ATOM   2799 O  OG1   . THR C 3 272 ? 3.155   -6.646  25.034  1.00 46.19 ? 446  THR A OG1   1 
ATOM   2800 C  CG2   . THR C 3 272 ? 2.460   -4.482  25.862  1.00 36.85 ? 446  THR A CG2   1 
ATOM   2801 N  N     . ALA C 3 273 ? 0.835   -3.866  22.414  1.00 34.94 ? 447  ALA A N     1 
ATOM   2802 C  CA    . ALA C 3 273 ? 0.270   -2.646  21.854  1.00 32.08 ? 447  ALA A CA    1 
ATOM   2803 C  C     . ALA C 3 273 ? -1.171  -2.891  21.401  1.00 30.22 ? 447  ALA A C     1 
ATOM   2804 O  O     . ALA C 3 273 ? -1.950  -1.949  21.256  1.00 28.42 ? 447  ALA A O     1 
ATOM   2805 C  CB    . ALA C 3 273 ? 1.104   -2.197  20.669  1.00 29.02 ? 447  ALA A CB    1 
ATOM   2806 N  N     . ARG C 3 274 ? -1.481  -4.138  21.059  1.00 29.24 ? 448  ARG A N     1 
ATOM   2807 C  CA    . ARG C 3 274 ? -2.831  -4.502  20.642  1.00 31.44 ? 448  ARG A CA    1 
ATOM   2808 C  C     . ARG C 3 274 ? -3.746  -4.526  21.840  1.00 33.25 ? 448  ARG A C     1 
ATOM   2809 O  O     . ARG C 3 274 ? -4.934  -4.204  21.724  1.00 37.68 ? 448  ARG A O     1 
ATOM   2810 C  CB    . ARG C 3 274 ? -2.854  -5.867  19.984  1.00 28.79 ? 448  ARG A CB    1 
ATOM   2811 C  CG    . ARG C 3 274 ? -2.222  -5.859  18.643  1.00 33.14 ? 448  ARG A CG    1 
ATOM   2812 C  CD    . ARG C 3 274 ? -2.385  -7.173  17.989  1.00 34.73 ? 448  ARG A CD    1 
ATOM   2813 N  NE    . ARG C 3 274 ? -3.728  -7.340  17.468  1.00 38.31 ? 448  ARG A NE    1 
ATOM   2814 C  CZ    . ARG C 3 274 ? -4.263  -8.521  17.183  1.00 42.92 ? 448  ARG A CZ    1 
ATOM   2815 N  NH1   . ARG C 3 274 ? -3.576  -9.635  17.399  1.00 45.05 ? 448  ARG A NH1   1 
ATOM   2816 N  NH2   . ARG C 3 274 ? -5.416  -8.583  16.532  1.00 45.44 ? 448  ARG A NH2   1 
ATOM   2817 N  N     . ARG C 3 275 ? -3.203  -4.948  22.978  1.00 31.96 ? 449  ARG A N     1 
ATOM   2818 C  CA    . ARG C 3 275 ? -3.959  -5.005  24.211  1.00 34.52 ? 449  ARG A CA    1 
ATOM   2819 C  C     . ARG C 3 275 ? -4.280  -3.587  24.684  1.00 35.21 ? 449  ARG A C     1 
ATOM   2820 O  O     . ARG C 3 275 ? -5.294  -3.367  25.349  1.00 40.22 ? 449  ARG A O     1 
ATOM   2821 C  CB    . ARG C 3 275 ? -3.179  -5.761  25.284  1.00 41.94 ? 449  ARG A CB    1 
ATOM   2822 C  CG    . ARG C 3 275 ? -2.850  -7.204  24.915  1.00 55.08 ? 449  ARG A CG    1 
ATOM   2823 C  CD    . ARG C 3 275 ? -1.897  -7.856  25.937  1.00 60.51 ? 449  ARG A CD    1 
ATOM   2824 N  NE    . ARG C 3 275 ? -1.256  -9.067  25.407  1.00 65.97 ? 449  ARG A NE    1 
ATOM   2825 C  CZ    . ARG C 3 275 ? 0.062   -9.260  25.330  1.00 67.37 ? 449  ARG A CZ    1 
ATOM   2826 N  NH1   . ARG C 3 275 ? 0.903   -8.325  25.752  1.00 75.11 ? 449  ARG A NH1   1 
ATOM   2827 N  NH2   . ARG C 3 275 ? 0.546   -10.385 24.816  1.00 68.13 ? 449  ARG A NH2   1 
ATOM   2828 N  N     . LEU C 3 276 ? -3.399  -2.639  24.374  1.00 32.00 ? 450  LEU A N     1 
ATOM   2829 C  CA    . LEU C 3 276 ? -3.616  -1.256  24.746  1.00 34.01 ? 450  LEU A CA    1 
ATOM   2830 C  C     . LEU C 3 276 ? -4.771  -0.701  23.939  1.00 41.29 ? 450  LEU A C     1 
ATOM   2831 O  O     . LEU C 3 276 ? -5.507  0.167   24.413  1.00 46.82 ? 450  LEU A O     1 
ATOM   2832 C  CB    . LEU C 3 276 ? -2.373  -0.411  24.474  1.00 33.30 ? 450  LEU A CB    1 
ATOM   2833 C  CG    . LEU C 3 276 ? -2.517  1.124   24.497  1.00 27.94 ? 450  LEU A CG    1 
ATOM   2834 C  CD1   . LEU C 3 276 ? -3.098  1.616   25.795  1.00 27.36 ? 450  LEU A CD1   1 
ATOM   2835 C  CD2   . LEU C 3 276 ? -1.186  1.767   24.264  1.00 28.45 ? 450  LEU A CD2   1 
ATOM   2836 N  N     . LYS C 3 277 ? -4.916  -1.200  22.712  1.00 45.98 ? 451  LYS A N     1 
ATOM   2837 C  CA    . LYS C 3 277 ? -5.975  -0.746  21.827  1.00 43.25 ? 451  LYS A CA    1 
ATOM   2838 C  C     . LYS C 3 277 ? -7.300  -0.933  22.521  1.00 41.52 ? 451  LYS A C     1 
ATOM   2839 O  O     . LYS C 3 277 ? -8.219  -0.132  22.366  1.00 46.39 ? 451  LYS A O     1 
ATOM   2840 C  CB    . LYS C 3 277 ? -5.952  -1.523  20.508  1.00 43.74 ? 451  LYS A CB    1 
ATOM   2841 C  CG    . LYS C 3 277 ? -6.675  -0.796  19.373  1.00 46.66 ? 451  LYS A CG    1 
ATOM   2842 C  CD    . LYS C 3 277 ? -6.996  -1.720  18.204  1.00 47.46 ? 451  LYS A CD    1 
ATOM   2843 C  CE    . LYS C 3 277 ? -8.246  -1.240  17.466  1.00 46.55 ? 451  LYS A CE    1 
ATOM   2844 N  NZ    . LYS C 3 277 ? -8.717  -2.191  16.421  1.00 48.64 ? 451  LYS A NZ    1 
ATOM   2845 N  N     . LYS C 3 278 ? -7.355  -1.941  23.374  1.00 39.73 ? 452  LYS A N     1 
ATOM   2846 C  CA    . LYS C 3 278 ? -8.580  -2.242  24.078  1.00 45.97 ? 452  LYS A CA    1 
ATOM   2847 C  C     . LYS C 3 278 ? -8.935  -1.369  25.267  1.00 46.83 ? 452  LYS A C     1 
ATOM   2848 O  O     . LYS C 3 278 ? -10.116 -1.152  25.542  1.00 46.23 ? 452  LYS A O     1 
ATOM   2849 C  CB    . LYS C 3 278 ? -8.570  -3.704  24.504  1.00 49.28 ? 452  LYS A CB    1 
ATOM   2850 C  CG    . LYS C 3 278 ? -8.343  -4.644  23.339  1.00 55.30 ? 452  LYS A CG    1 
ATOM   2851 C  CD    . LYS C 3 278 ? -8.438  -6.087  23.774  1.00 62.05 ? 452  LYS A CD    1 
ATOM   2852 C  CE    . LYS C 3 278 ? -8.202  -7.028  22.596  1.00 67.23 ? 452  LYS A CE    1 
ATOM   2853 N  NZ    . LYS C 3 278 ? -6.850  -6.867  21.960  1.00 62.33 ? 452  LYS A NZ    1 
ATOM   2854 N  N     . CYS C 3 279 ? -7.931  -0.917  26.008  1.00 47.00 ? 453  CYS A N     1 
ATOM   2855 C  CA    . CYS C 3 279 ? -8.202  -0.105  27.190  1.00 50.14 ? 453  CYS A CA    1 
ATOM   2856 C  C     . CYS C 3 279 ? -7.702  1.338   27.140  1.00 48.37 ? 453  CYS A C     1 
ATOM   2857 O  O     . CYS C 3 279 ? -7.588  2.011   28.179  1.00 45.38 ? 453  CYS A O     1 
ATOM   2858 C  CB    . CYS C 3 279 ? -7.630  -0.804  28.413  1.00 52.77 ? 453  CYS A CB    1 
ATOM   2859 S  SG    . CYS C 3 279 ? -5.944  -1.330  28.120  1.00 56.69 ? 453  CYS A SG    1 
ATOM   2860 N  N     . VAL C 3 280 ? -7.375  1.811   25.946  1.00 47.81 ? 454  VAL A N     1 
ATOM   2861 C  CA    . VAL C 3 280 ? -6.894  3.171   25.820  1.00 47.36 ? 454  VAL A CA    1 
ATOM   2862 C  C     . VAL C 3 280 ? -8.012  4.139   26.147  1.00 44.31 ? 454  VAL A C     1 
ATOM   2863 O  O     . VAL C 3 280 ? -7.779  5.185   26.735  1.00 40.27 ? 454  VAL A O     1 
ATOM   2864 C  CB    . VAL C 3 280 ? -6.330  3.471   24.414  1.00 46.14 ? 454  VAL A CB    1 
ATOM   2865 C  CG1   . VAL C 3 280 ? -7.455  3.632   23.385  1.00 42.80 ? 454  VAL A CG1   1 
ATOM   2866 C  CG2   . VAL C 3 280 ? -5.467  4.713   24.474  1.00 46.36 ? 454  VAL A CG2   1 
ATOM   2867 N  N     . ASP C 3 281 ? -9.227  3.767   25.770  1.00 45.32 ? 455  ASP A N     1 
ATOM   2868 C  CA    . ASP C 3 281 ? -10.399 4.589   26.013  1.00 51.52 ? 455  ASP A CA    1 
ATOM   2869 C  C     . ASP C 3 281 ? -10.648 4.754   27.501  1.00 51.94 ? 455  ASP A C     1 
ATOM   2870 O  O     . ASP C 3 281 ? -11.051 5.826   27.955  1.00 53.16 ? 455  ASP A O     1 
ATOM   2871 C  CB    . ASP C 3 281 ? -11.606 3.972   25.333  1.00 56.28 ? 455  ASP A CB    1 
ATOM   2872 C  CG    . ASP C 3 281 ? -11.399 3.809   23.846  1.00 61.61 ? 455  ASP A CG    1 
ATOM   2873 O  OD1   . ASP C 3 281 ? -10.462 3.073   23.463  1.00 67.88 ? 455  ASP A OD1   1 
ATOM   2874 O  OD2   . ASP C 3 281 ? -12.158 4.429   23.063  1.00 61.38 ? 455  ASP A OD2   1 
ATOM   2875 N  N     . LYS C 3 282 ? -10.430 3.674   28.241  1.00 48.44 ? 456  LYS A N     1 
ATOM   2876 C  CA    . LYS C 3 282 ? -10.577 3.679   29.679  1.00 46.53 ? 456  LYS A CA    1 
ATOM   2877 C  C     . LYS C 3 282 ? -9.482  4.590   30.188  1.00 43.91 ? 456  LYS A C     1 
ATOM   2878 O  O     . LYS C 3 282 ? -9.714  5.476   31.012  1.00 40.37 ? 456  LYS A O     1 
ATOM   2879 C  CB    . LYS C 3 282 ? -10.344 2.263   30.207  1.00 55.65 ? 456  LYS A CB    1 
ATOM   2880 C  CG    . LYS C 3 282 ? -9.976  2.191   31.681  1.00 62.86 ? 456  LYS A CG    1 
ATOM   2881 C  CD    . LYS C 3 282 ? -8.606  1.557   31.861  1.00 67.79 ? 456  LYS A CD    1 
ATOM   2882 C  CE    . LYS C 3 282 ? -8.115  1.720   33.294  1.00 70.03 ? 456  LYS A CE    1 
ATOM   2883 N  NZ    . LYS C 3 282 ? -6.762  1.123   33.464  1.00 67.42 ? 456  LYS A NZ    1 
ATOM   2884 N  N     . ILE C 3 283 ? -8.280  4.339   29.672  1.00 41.59 ? 457  ILE A N     1 
ATOM   2885 C  CA    . ILE C 3 283 ? -7.088  5.087   30.027  1.00 35.62 ? 457  ILE A CA    1 
ATOM   2886 C  C     . ILE C 3 283 ? -7.142  6.565   29.658  1.00 36.74 ? 457  ILE A C     1 
ATOM   2887 O  O     . ILE C 3 283 ? -6.656  7.414   30.413  1.00 41.42 ? 457  ILE A O     1 
ATOM   2888 C  CB    . ILE C 3 283 ? -5.819  4.421   29.438  1.00 31.74 ? 457  ILE A CB    1 
ATOM   2889 C  CG1   . ILE C 3 283 ? -5.548  3.116   30.196  1.00 31.12 ? 457  ILE A CG1   1 
ATOM   2890 C  CG2   . ILE C 3 283 ? -4.596  5.359   29.538  1.00 29.83 ? 457  ILE A CG2   1 
ATOM   2891 C  CD1   . ILE C 3 283 ? -4.278  2.389   29.773  1.00 26.12 ? 457  ILE A CD1   1 
ATOM   2892 N  N     . ARG C 3 284 ? -7.695  6.891   28.500  1.00 32.08 ? 458  ARG A N     1 
ATOM   2893 C  CA    . ARG C 3 284 ? -7.764  8.286   28.110  1.00 29.88 ? 458  ARG A CA    1 
ATOM   2894 C  C     . ARG C 3 284 ? -8.805  9.038   28.933  1.00 34.74 ? 458  ARG A C     1 
ATOM   2895 O  O     . ARG C 3 284 ? -8.621  10.211  29.257  1.00 36.91 ? 458  ARG A O     1 
ATOM   2896 C  CB    . ARG C 3 284 ? -8.028  8.409   26.621  1.00 29.94 ? 458  ARG A CB    1 
ATOM   2897 C  CG    . ARG C 3 284 ? -6.859  7.954   25.757  1.00 27.09 ? 458  ARG A CG    1 
ATOM   2898 C  CD    . ARG C 3 284 ? -7.235  7.944   24.256  1.00 33.29 ? 458  ARG A CD    1 
ATOM   2899 N  NE    . ARG C 3 284 ? -6.062  7.774   23.404  1.00 28.62 ? 458  ARG A NE    1 
ATOM   2900 C  CZ    . ARG C 3 284 ? -6.065  7.172   22.225  1.00 23.41 ? 458  ARG A CZ    1 
ATOM   2901 N  NH1   . ARG C 3 284 ? -7.194  6.686   21.736  1.00 20.90 ? 458  ARG A NH1   1 
ATOM   2902 N  NH2   . ARG C 3 284 ? -4.913  6.969   21.600  1.00 23.99 ? 458  ARG A NH2   1 
ATOM   2903 N  N     . ASN C 3 285 ? -9.875  8.348   29.306  1.00 35.12 ? 459  ASN A N     1 
ATOM   2904 C  CA    . ASN C 3 285 ? -10.927 8.949   30.116  1.00 35.77 ? 459  ASN A CA    1 
ATOM   2905 C  C     . ASN C 3 285 ? -10.417 9.199   31.517  1.00 39.09 ? 459  ASN A C     1 
ATOM   2906 O  O     . ASN C 3 285 ? -10.661 10.247  32.109  1.00 42.84 ? 459  ASN A O     1 
ATOM   2907 C  CB    . ASN C 3 285 ? -12.126 8.020   30.217  1.00 36.46 ? 459  ASN A CB    1 
ATOM   2908 C  CG    . ASN C 3 285 ? -12.989 8.043   28.983  1.00 40.99 ? 459  ASN A CG    1 
ATOM   2909 O  OD1   . ASN C 3 285 ? -12.881 8.934   28.145  1.00 41.20 ? 459  ASN A OD1   1 
ATOM   2910 N  ND2   . ASN C 3 285 ? -13.865 7.057   28.867  1.00 38.00 ? 459  ASN A ND2   1 
ATOM   2911 N  N     . GLN C 3 286 ? -9.718  8.216   32.057  1.00 43.07 ? 460  GLN A N     1 
ATOM   2912 C  CA    . GLN C 3 286 ? -9.188  8.325   33.403  1.00 48.19 ? 460  GLN A CA    1 
ATOM   2913 C  C     . GLN C 3 286 ? -8.173  9.455   33.615  1.00 47.01 ? 460  GLN A C     1 
ATOM   2914 O  O     . GLN C 3 286 ? -8.237  10.155  34.634  1.00 47.49 ? 460  GLN A O     1 
ATOM   2915 C  CB    . GLN C 3 286 ? -8.595  6.995   33.844  1.00 57.00 ? 460  GLN A CB    1 
ATOM   2916 C  CG    . GLN C 3 286 ? -8.292  6.944   35.322  1.00 71.96 ? 460  GLN A CG    1 
ATOM   2917 C  CD    . GLN C 3 286 ? -7.696  5.621   35.733  1.00 80.06 ? 460  GLN A CD    1 
ATOM   2918 O  OE1   . GLN C 3 286 ? -6.861  5.055   35.024  1.00 86.01 ? 460  GLN A OE1   1 
ATOM   2919 N  NE2   . GLN C 3 286 ? -8.112  5.122   36.890  1.00 85.58 ? 460  GLN A NE2   1 
ATOM   2920 N  N     . TYR C 3 287 ? -7.199  9.608   32.722  1.00 41.08 ? 461  TYR A N     1 
ATOM   2921 C  CA    . TYR C 3 287 ? -6.260  10.692  32.930  1.00 33.98 ? 461  TYR A CA    1 
ATOM   2922 C  C     . TYR C 3 287 ? -6.918  12.004  32.583  1.00 33.87 ? 461  TYR A C     1 
ATOM   2923 O  O     . TYR C 3 287 ? -6.565  13.029  33.151  1.00 29.90 ? 461  TYR A O     1 
ATOM   2924 C  CB    . TYR C 3 287 ? -4.915  10.486  32.204  1.00 34.61 ? 461  TYR A CB    1 
ATOM   2925 C  CG    . TYR C 3 287 ? -4.895  10.539  30.684  1.00 35.61 ? 461  TYR A CG    1 
ATOM   2926 C  CD1   . TYR C 3 287 ? -5.265  11.688  29.995  1.00 41.05 ? 461  TYR A CD1   1 
ATOM   2927 C  CD2   . TYR C 3 287 ? -4.469  9.435   29.934  1.00 39.62 ? 461  TYR A CD2   1 
ATOM   2928 C  CE1   . TYR C 3 287 ? -5.226  11.745  28.600  1.00 42.21 ? 461  TYR A CE1   1 
ATOM   2929 C  CE2   . TYR C 3 287 ? -4.413  9.480   28.542  1.00 36.53 ? 461  TYR A CE2   1 
ATOM   2930 C  CZ    . TYR C 3 287 ? -4.799  10.639  27.879  1.00 41.69 ? 461  TYR A CZ    1 
ATOM   2931 O  OH    . TYR C 3 287 ? -4.775  10.701  26.496  1.00 40.39 ? 461  TYR A OH    1 
ATOM   2932 N  N     . ARG C 3 288 ? -7.908  11.961  31.690  1.00 31.17 ? 462  ARG A N     1 
ATOM   2933 C  CA    . ARG C 3 288 ? -8.612  13.167  31.287  1.00 36.83 ? 462  ARG A CA    1 
ATOM   2934 C  C     . ARG C 3 288 ? -9.344  13.800  32.454  1.00 40.96 ? 462  ARG A C     1 
ATOM   2935 O  O     . ARG C 3 288 ? -9.612  15.001  32.465  1.00 46.79 ? 462  ARG A O     1 
ATOM   2936 C  CB    . ARG C 3 288 ? -9.563  12.884  30.138  1.00 39.87 ? 462  ARG A CB    1 
ATOM   2937 C  CG    . ARG C 3 288 ? -9.127  13.582  28.894  1.00 41.25 ? 462  ARG A CG    1 
ATOM   2938 C  CD    . ARG C 3 288 ? -9.529  12.851  27.658  1.00 42.11 ? 462  ARG A CD    1 
ATOM   2939 N  NE    . ARG C 3 288 ? -9.140  13.634  26.490  1.00 45.96 ? 462  ARG A NE    1 
ATOM   2940 C  CZ    . ARG C 3 288 ? -8.434  13.173  25.463  1.00 51.83 ? 462  ARG A CZ    1 
ATOM   2941 N  NH1   . ARG C 3 288 ? -8.028  11.915  25.441  1.00 55.65 ? 462  ARG A NH1   1 
ATOM   2942 N  NH2   . ARG C 3 288 ? -8.148  13.973  24.442  1.00 57.17 ? 462  ARG A NH2   1 
ATOM   2943 N  N     . GLU C 3 289 ? -9.677  12.976  33.436  1.00 43.13 ? 463  GLU A N     1 
ATOM   2944 C  CA    . GLU C 3 289 ? -10.347 13.443  34.641  1.00 42.81 ? 463  GLU A CA    1 
ATOM   2945 C  C     . GLU C 3 289 ? -9.283  13.770  35.720  1.00 44.04 ? 463  GLU A C     1 
ATOM   2946 O  O     . GLU C 3 289 ? -9.519  14.586  36.626  1.00 39.43 ? 463  GLU A O     1 
ATOM   2947 C  CB    . GLU C 3 289 ? -11.348 12.382  35.126  1.00 43.97 ? 463  GLU A CB    1 
ATOM   2948 N  N     . ASP C 3 290 ? -8.122  13.122  35.632  1.00 42.70 ? 464  ASP A N     1 
ATOM   2949 C  CA    . ASP C 3 290 ? -7.047  13.395  36.572  1.00 46.14 ? 464  ASP A CA    1 
ATOM   2950 C  C     . ASP C 3 290 ? -6.524  14.821  36.360  1.00 46.93 ? 464  ASP A C     1 
ATOM   2951 O  O     . ASP C 3 290 ? -5.780  15.350  37.199  1.00 46.26 ? 464  ASP A O     1 
ATOM   2952 C  CB    . ASP C 3 290 ? -5.910  12.390  36.390  1.00 53.59 ? 464  ASP A CB    1 
ATOM   2953 C  CG    . ASP C 3 290 ? -6.334  10.964  36.684  1.00 63.83 ? 464  ASP A CG    1 
ATOM   2954 O  OD1   . ASP C 3 290 ? -7.511  10.759  37.066  1.00 70.22 ? 464  ASP A OD1   1 
ATOM   2955 O  OD2   . ASP C 3 290 ? -5.484  10.048  36.542  1.00 66.28 ? 464  ASP A OD2   1 
ATOM   2956 N  N     . TRP C 3 291 ? -6.901  15.430  35.226  1.00 46.65 ? 465  TRP A N     1 
ATOM   2957 C  CA    . TRP C 3 291 ? -6.483  16.797  34.889  1.00 46.79 ? 465  TRP A CA    1 
ATOM   2958 C  C     . TRP C 3 291 ? -7.075  17.744  35.898  1.00 49.14 ? 465  TRP A C     1 
ATOM   2959 O  O     . TRP C 3 291 ? -6.665  18.895  35.993  1.00 54.18 ? 465  TRP A O     1 
ATOM   2960 C  CB    . TRP C 3 291 ? -6.967  17.221  33.499  1.00 39.66 ? 465  TRP A CB    1 
ATOM   2961 C  CG    . TRP C 3 291 ? -6.270  16.576  32.346  1.00 37.90 ? 465  TRP A CG    1 
ATOM   2962 C  CD1   . TRP C 3 291 ? -5.148  15.806  32.393  1.00 35.87 ? 465  TRP A CD1   1 
ATOM   2963 C  CD2   . TRP C 3 291 ? -6.671  16.615  30.968  1.00 40.67 ? 465  TRP A CD2   1 
ATOM   2964 N  NE1   . TRP C 3 291 ? -4.825  15.352  31.128  1.00 29.32 ? 465  TRP A NE1   1 
ATOM   2965 C  CE2   . TRP C 3 291 ? -5.744  15.833  30.236  1.00 37.88 ? 465  TRP A CE2   1 
ATOM   2966 C  CE3   . TRP C 3 291 ? -7.729  17.232  30.276  1.00 40.47 ? 465  TRP A CE3   1 
ATOM   2967 C  CZ2   . TRP C 3 291 ? -5.844  15.651  28.847  1.00 40.94 ? 465  TRP A CZ2   1 
ATOM   2968 C  CZ3   . TRP C 3 291 ? -7.826  17.052  28.891  1.00 41.40 ? 465  TRP A CZ3   1 
ATOM   2969 C  CH2   . TRP C 3 291 ? -6.889  16.269  28.195  1.00 38.23 ? 465  TRP A CH2   1 
ATOM   2970 N  N     . LYS C 3 292 ? -8.084  17.264  36.614  1.00 50.84 ? 466  LYS A N     1 
ATOM   2971 C  CA    . LYS C 3 292 ? -8.747  18.062  37.628  1.00 54.47 ? 466  LYS A CA    1 
ATOM   2972 C  C     . LYS C 3 292 ? -8.530  17.505  39.044  1.00 56.75 ? 466  LYS A C     1 
ATOM   2973 O  O     . LYS C 3 292 ? -9.266  17.850  39.972  1.00 60.93 ? 466  LYS A O     1 
ATOM   2974 C  CB    . LYS C 3 292 ? -10.240 18.174  37.310  1.00 55.32 ? 466  LYS A CB    1 
ATOM   2975 N  N     . SER C 3 293 ? -7.509  16.666  39.211  1.00 53.80 ? 467  SER A N     1 
ATOM   2976 C  CA    . SER C 3 293 ? -7.214  16.090  40.511  1.00 49.87 ? 467  SER A CA    1 
ATOM   2977 C  C     . SER C 3 293 ? -6.871  17.252  41.412  1.00 51.96 ? 467  SER A C     1 
ATOM   2978 O  O     . SER C 3 293 ? -6.448  18.300  40.939  1.00 49.47 ? 467  SER A O     1 
ATOM   2979 C  CB    . SER C 3 293 ? -6.013  15.154  40.416  1.00 51.28 ? 467  SER A CB    1 
ATOM   2980 O  OG    . SER C 3 293 ? -6.117  14.069  41.327  1.00 55.20 ? 467  SER A OG    1 
ATOM   2981 N  N     . LYS C 3 294 ? -7.127  17.101  42.704  1.00 55.78 ? 468  LYS A N     1 
ATOM   2982 C  CA    . LYS C 3 294 ? -6.801  18.151  43.656  1.00 57.88 ? 468  LYS A CA    1 
ATOM   2983 C  C     . LYS C 3 294 ? -5.358  17.892  44.087  1.00 59.60 ? 468  LYS A C     1 
ATOM   2984 O  O     . LYS C 3 294 ? -4.940  18.326  45.156  1.00 63.10 ? 468  LYS A O     1 
ATOM   2985 C  CB    . LYS C 3 294 ? -7.754  18.116  44.864  1.00 60.42 ? 468  LYS A CB    1 
ATOM   2986 C  CG    . LYS C 3 294 ? -9.245  18.127  44.490  1.00 61.71 ? 468  LYS A CG    1 
ATOM   2987 C  CD    . LYS C 3 294 ? -10.167 18.111  45.710  1.00 64.23 ? 468  LYS A CD    1 
ATOM   2988 C  CE    . LYS C 3 294 ? -10.416 19.519  46.247  1.00 66.34 ? 468  LYS A CE    1 
ATOM   2989 N  NZ    . LYS C 3 294 ? -11.437 19.571  47.340  1.00 66.17 ? 468  LYS A NZ    1 
ATOM   2990 N  N     . GLU C 3 295 ? -4.632  17.127  43.270  1.00 57.67 ? 469  GLU A N     1 
ATOM   2991 C  CA    . GLU C 3 295 ? -3.236  16.786  43.519  1.00 54.72 ? 469  GLU A CA    1 
ATOM   2992 C  C     . GLU C 3 295 ? -2.414  17.057  42.265  1.00 54.56 ? 469  GLU A C     1 
ATOM   2993 O  O     . GLU C 3 295 ? -2.656  16.469  41.215  1.00 54.59 ? 469  GLU A O     1 
ATOM   2994 C  CB    . GLU C 3 295 ? -3.111  15.318  43.928  1.00 53.24 ? 469  GLU A CB    1 
ATOM   2995 N  N     . MET C 3 296 ? -1.430  17.936  42.389  1.00 55.18 ? 470  MET A N     1 
ATOM   2996 C  CA    . MET C 3 296 ? -0.591  18.282  41.261  1.00 55.29 ? 470  MET A CA    1 
ATOM   2997 C  C     . MET C 3 296 ? 0.197   17.095  40.718  1.00 54.78 ? 470  MET A C     1 
ATOM   2998 O  O     . MET C 3 296 ? 0.335   16.974  39.507  1.00 53.39 ? 470  MET A O     1 
ATOM   2999 C  CB    . MET C 3 296 ? 0.329   19.426  41.632  1.00 57.91 ? 470  MET A CB    1 
ATOM   3000 C  CG    . MET C 3 296 ? 0.275   20.550  40.648  1.00 65.28 ? 470  MET A CG    1 
ATOM   3001 S  SD    . MET C 3 296 ? 1.571   21.723  41.007  1.00 80.22 ? 470  MET A SD    1 
ATOM   3002 C  CE    . MET C 3 296 ? 0.840   23.209  40.434  1.00 78.85 ? 470  MET A CE    1 
ATOM   3003 N  N     . LYS C 3 297 ? 0.654   16.200  41.597  1.00 53.77 ? 471  LYS A N     1 
ATOM   3004 C  CA    . LYS C 3 297 ? 1.403   15.022  41.165  1.00 53.93 ? 471  LYS A CA    1 
ATOM   3005 C  C     . LYS C 3 297 ? 0.564   14.302  40.125  1.00 52.80 ? 471  LYS A C     1 
ATOM   3006 O  O     . LYS C 3 297 ? 1.019   13.977  39.019  1.00 53.93 ? 471  LYS A O     1 
ATOM   3007 C  CB    . LYS C 3 297 ? 1.647   14.053  42.330  1.00 58.60 ? 471  LYS A CB    1 
ATOM   3008 C  CG    . LYS C 3 297 ? 2.152   12.681  41.850  1.00 68.28 ? 471  LYS A CG    1 
ATOM   3009 C  CD    . LYS C 3 297 ? 2.320   11.623  42.934  1.00 75.43 ? 471  LYS A CD    1 
ATOM   3010 C  CE    . LYS C 3 297 ? 2.859   10.324  42.315  1.00 79.60 ? 471  LYS A CE    1 
ATOM   3011 N  NZ    . LYS C 3 297 ? 3.157   9.265   43.322  1.00 85.05 ? 471  LYS A NZ    1 
ATOM   3012 N  N     . VAL C 3 298 ? -0.686  14.070  40.508  1.00 47.37 ? 472  VAL A N     1 
ATOM   3013 C  CA    . VAL C 3 298 ? -1.633  13.373  39.659  1.00 42.64 ? 472  VAL A CA    1 
ATOM   3014 C  C     . VAL C 3 298 ? -1.875  14.117  38.353  1.00 38.06 ? 472  VAL A C     1 
ATOM   3015 O  O     . VAL C 3 298 ? -2.086  13.509  37.305  1.00 39.32 ? 472  VAL A O     1 
ATOM   3016 C  CB    . VAL C 3 298 ? -2.949  13.082  40.439  1.00 42.24 ? 472  VAL A CB    1 
ATOM   3017 C  CG1   . VAL C 3 298 ? -4.030  12.549  39.521  1.00 37.35 ? 472  VAL A CG1   1 
ATOM   3018 C  CG2   . VAL C 3 298 ? -2.666  12.063  41.523  1.00 33.87 ? 472  VAL A CG2   1 
ATOM   3019 N  N     . ARG C 3 299 ? -1.817  15.434  38.414  1.00 37.55 ? 473  ARG A N     1 
ATOM   3020 C  CA    . ARG C 3 299 ? -2.022  16.235  37.220  1.00 38.69 ? 473  ARG A CA    1 
ATOM   3021 C  C     . ARG C 3 299 ? -0.790  16.253  36.340  1.00 37.45 ? 473  ARG A C     1 
ATOM   3022 O  O     . ARG C 3 299 ? -0.912  16.175  35.122  1.00 44.92 ? 473  ARG A O     1 
ATOM   3023 C  CB    . ARG C 3 299 ? -2.411  17.662  37.574  1.00 36.91 ? 473  ARG A CB    1 
ATOM   3024 C  CG    . ARG C 3 299 ? -3.791  17.798  38.139  1.00 31.14 ? 473  ARG A CG    1 
ATOM   3025 C  CD    . ARG C 3 299 ? -4.139  19.228  38.142  1.00 31.38 ? 473  ARG A CD    1 
ATOM   3026 N  NE    . ARG C 3 299 ? -5.207  19.507  39.074  1.00 32.19 ? 473  ARG A NE    1 
ATOM   3027 C  CZ    . ARG C 3 299 ? -5.893  20.637  39.084  1.00 31.88 ? 473  ARG A CZ    1 
ATOM   3028 N  NH1   . ARG C 3 299 ? -5.639  21.594  38.202  1.00 33.61 ? 473  ARG A NH1   1 
ATOM   3029 N  NH2   . ARG C 3 299 ? -6.795  20.837  40.021  1.00 36.02 ? 473  ARG A NH2   1 
ATOM   3030 N  N     . GLN C 3 300 ? 0.383   16.411  36.947  1.00 31.57 ? 474  GLN A N     1 
ATOM   3031 C  CA    . GLN C 3 300 ? 1.629   16.435  36.196  1.00 27.60 ? 474  GLN A CA    1 
ATOM   3032 C  C     . GLN C 3 300 ? 1.741   15.168  35.379  1.00 28.22 ? 474  GLN A C     1 
ATOM   3033 O  O     . GLN C 3 300 ? 2.102   15.211  34.202  1.00 27.87 ? 474  GLN A O     1 
ATOM   3034 C  CB    . GLN C 3 300 ? 2.827   16.511  37.124  1.00 27.92 ? 474  GLN A CB    1 
ATOM   3035 C  CG    . GLN C 3 300 ? 2.777   17.637  38.116  1.00 31.23 ? 474  GLN A CG    1 
ATOM   3036 C  CD    . GLN C 3 300 ? 3.858   18.645  37.891  1.00 27.29 ? 474  GLN A CD    1 
ATOM   3037 O  OE1   . GLN C 3 300 ? 4.628   18.962  38.775  1.00 36.71 ? 474  GLN A OE1   1 
ATOM   3038 N  NE2   . GLN C 3 300 ? 3.916   19.166  36.694  1.00 47.53 ? 474  GLN A NE2   1 
ATOM   3039 N  N     . ARG C 3 301 ? 1.404   14.037  35.988  1.00 29.85 ? 475  ARG A N     1 
ATOM   3040 C  CA    . ARG C 3 301 ? 1.511   12.784  35.264  1.00 33.50 ? 475  ARG A CA    1 
ATOM   3041 C  C     . ARG C 3 301 ? 0.417   12.576  34.216  1.00 33.70 ? 475  ARG A C     1 
ATOM   3042 O  O     . ARG C 3 301 ? 0.639   11.901  33.194  1.00 38.51 ? 475  ARG A O     1 
ATOM   3043 C  CB    . ARG C 3 301 ? 1.607   11.587  36.217  1.00 32.92 ? 475  ARG A CB    1 
ATOM   3044 C  CG    . ARG C 3 301 ? 0.361   11.288  36.964  1.00 39.40 ? 475  ARG A CG    1 
ATOM   3045 C  CD    . ARG C 3 301 ? 0.228   9.795   37.240  1.00 36.31 ? 475  ARG A CD    1 
ATOM   3046 N  NE    . ARG C 3 301 ? -1.093  9.509   37.789  1.00 38.99 ? 475  ARG A NE    1 
ATOM   3047 C  CZ    . ARG C 3 301 ? -1.304  8.984   38.993  1.00 48.69 ? 475  ARG A CZ    1 
ATOM   3048 N  NH1   . ARG C 3 301 ? -0.287  8.661   39.793  1.00 51.80 ? 475  ARG A NH1   1 
ATOM   3049 N  NH2   . ARG C 3 301 ? -2.544  8.809   39.415  1.00 57.45 ? 475  ARG A NH2   1 
ATOM   3050 N  N     . ALA C 3 302 ? -0.756  13.150  34.448  1.00 29.80 ? 476  ALA A N     1 
ATOM   3051 C  CA    . ALA C 3 302 ? -1.848  12.997  33.487  1.00 23.65 ? 476  ALA A CA    1 
ATOM   3052 C  C     . ALA C 3 302 ? -1.631  13.874  32.260  1.00 22.52 ? 476  ALA A C     1 
ATOM   3053 O  O     . ALA C 3 302 ? -2.110  13.552  31.166  1.00 30.89 ? 476  ALA A O     1 
ATOM   3054 C  CB    . ALA C 3 302 ? -3.178  13.293  34.127  1.00 17.64 ? 476  ALA A CB    1 
ATOM   3055 N  N     . VAL C 3 303 ? -0.961  15.007  32.448  1.00 20.28 ? 477  VAL A N     1 
ATOM   3056 C  CA    . VAL C 3 303 ? -0.668  15.889  31.329  1.00 19.39 ? 477  VAL A CA    1 
ATOM   3057 C  C     . VAL C 3 303 ? 0.485   15.266  30.544  1.00 22.45 ? 477  VAL A C     1 
ATOM   3058 O  O     . VAL C 3 303 ? 0.558   15.374  29.310  1.00 21.27 ? 477  VAL A O     1 
ATOM   3059 C  CB    . VAL C 3 303 ? -0.297  17.290  31.809  1.00 19.04 ? 477  VAL A CB    1 
ATOM   3060 C  CG1   . VAL C 3 303 ? 0.087   18.191  30.617  1.00 22.58 ? 477  VAL A CG1   1 
ATOM   3061 C  CG2   . VAL C 3 303 ? -1.484  17.886  32.521  1.00 14.49 ? 477  VAL A CG2   1 
ATOM   3062 N  N     . ALA C 3 304 ? 1.393   14.636  31.281  1.00 20.84 ? 478  ALA A N     1 
ATOM   3063 C  CA    . ALA C 3 304 ? 2.519   13.969  30.676  1.00 16.41 ? 478  ALA A CA    1 
ATOM   3064 C  C     . ALA C 3 304 ? 1.968   12.772  29.897  1.00 17.22 ? 478  ALA A C     1 
ATOM   3065 O  O     . ALA C 3 304 ? 2.279   12.586  28.730  1.00 18.81 ? 478  ALA A O     1 
ATOM   3066 C  CB    . ALA C 3 304 ? 3.459   13.509  31.734  1.00 15.36 ? 478  ALA A CB    1 
ATOM   3067 N  N     . LEU C 3 305 ? 1.147   11.949  30.535  1.00 16.01 ? 479  LEU A N     1 
ATOM   3068 C  CA    . LEU C 3 305 ? 0.591   10.810  29.819  1.00 20.81 ? 479  LEU A CA    1 
ATOM   3069 C  C     . LEU C 3 305 ? -0.202  11.315  28.617  1.00 23.46 ? 479  LEU A C     1 
ATOM   3070 O  O     . LEU C 3 305 ? -0.272  10.660  27.575  1.00 25.86 ? 479  LEU A O     1 
ATOM   3071 C  CB    . LEU C 3 305 ? -0.282  9.951   30.719  1.00 17.41 ? 479  LEU A CB    1 
ATOM   3072 C  CG    . LEU C 3 305 ? -0.732  8.669   30.003  1.00 25.06 ? 479  LEU A CG    1 
ATOM   3073 C  CD1   . LEU C 3 305 ? 0.439   7.899   29.363  1.00 18.39 ? 479  LEU A CD1   1 
ATOM   3074 C  CD2   . LEU C 3 305 ? -1.460  7.789   31.000  1.00 25.50 ? 479  LEU A CD2   1 
ATOM   3075 N  N     . TYR C 3 306 ? -0.755  12.508  28.748  1.00 26.19 ? 480  TYR A N     1 
ATOM   3076 C  CA    . TYR C 3 306 ? -1.501  13.120  27.661  1.00 24.86 ? 480  TYR A CA    1 
ATOM   3077 C  C     . TYR C 3 306 ? -0.602  13.322  26.445  1.00 27.09 ? 480  TYR A C     1 
ATOM   3078 O  O     . TYR C 3 306 ? -0.935  12.913  25.338  1.00 30.14 ? 480  TYR A O     1 
ATOM   3079 C  CB    . TYR C 3 306 ? -2.043  14.477  28.105  1.00 20.44 ? 480  TYR A CB    1 
ATOM   3080 C  CG    . TYR C 3 306 ? -2.661  15.297  26.998  1.00 23.72 ? 480  TYR A CG    1 
ATOM   3081 C  CD1   . TYR C 3 306 ? -3.729  14.804  26.245  1.00 31.46 ? 480  TYR A CD1   1 
ATOM   3082 C  CD2   . TYR C 3 306 ? -2.220  16.585  26.725  1.00 24.97 ? 480  TYR A CD2   1 
ATOM   3083 C  CE1   . TYR C 3 306 ? -4.352  15.584  25.246  1.00 26.61 ? 480  TYR A CE1   1 
ATOM   3084 C  CE2   . TYR C 3 306 ? -2.838  17.372  25.729  1.00 24.53 ? 480  TYR A CE2   1 
ATOM   3085 C  CZ    . TYR C 3 306 ? -3.905  16.860  25.004  1.00 26.87 ? 480  TYR A CZ    1 
ATOM   3086 O  OH    . TYR C 3 306 ? -4.570  17.639  24.090  1.00 33.36 ? 480  TYR A OH    1 
ATOM   3087 N  N     . PHE C 3 307 ? 0.509   14.018  26.650  1.00 29.42 ? 481  PHE A N     1 
ATOM   3088 C  CA    . PHE C 3 307 ? 1.449   14.302  25.568  1.00 32.10 ? 481  PHE A CA    1 
ATOM   3089 C  C     . PHE C 3 307 ? 2.033   13.062  24.947  1.00 29.65 ? 481  PHE A C     1 
ATOM   3090 O  O     . PHE C 3 307 ? 2.209   12.968  23.728  1.00 25.70 ? 481  PHE A O     1 
ATOM   3091 C  CB    . PHE C 3 307 ? 2.573   15.183  26.085  1.00 29.70 ? 481  PHE A CB    1 
ATOM   3092 C  CG    . PHE C 3 307 ? 2.108   16.522  26.525  1.00 33.76 ? 481  PHE A CG    1 
ATOM   3093 C  CD1   . PHE C 3 307 ? 0.984   17.094  25.934  1.00 34.48 ? 481  PHE A CD1   1 
ATOM   3094 C  CD2   . PHE C 3 307 ? 2.757   17.202  27.550  1.00 32.44 ? 481  PHE A CD2   1 
ATOM   3095 C  CE1   . PHE C 3 307 ? 0.512   18.311  26.364  1.00 34.15 ? 481  PHE A CE1   1 
ATOM   3096 C  CE2   . PHE C 3 307 ? 2.294   18.417  27.984  1.00 35.48 ? 481  PHE A CE2   1 
ATOM   3097 C  CZ    . PHE C 3 307 ? 1.165   18.976  27.389  1.00 36.50 ? 481  PHE A CZ    1 
ATOM   3098 N  N     . ILE C 3 308 ? 2.378   12.130  25.809  1.00 31.79 ? 482  ILE A N     1 
ATOM   3099 C  CA    . ILE C 3 308 ? 2.966   10.900  25.361  1.00 33.46 ? 482  ILE A CA    1 
ATOM   3100 C  C     . ILE C 3 308 ? 1.988   10.222  24.435  1.00 32.48 ? 482  ILE A C     1 
ATOM   3101 O  O     . ILE C 3 308 ? 2.352   9.817   23.342  1.00 35.56 ? 482  ILE A O     1 
ATOM   3102 C  CB    . ILE C 3 308 ? 3.329   10.016  26.565  1.00 33.84 ? 482  ILE A CB    1 
ATOM   3103 C  CG1   . ILE C 3 308 ? 4.520   10.640  27.301  1.00 29.38 ? 482  ILE A CG1   1 
ATOM   3104 C  CG2   . ILE C 3 308 ? 3.676   8.614   26.110  1.00 36.55 ? 482  ILE A CG2   1 
ATOM   3105 C  CD1   . ILE C 3 308 ? 4.982   9.860   28.495  1.00 21.41 ? 482  ILE A CD1   1 
ATOM   3106 N  N     . ASP C 3 309 ? 0.733   10.176  24.863  1.00 31.25 ? 483  ASP A N     1 
ATOM   3107 C  CA    . ASP C 3 309 ? -0.315  9.538   24.103  1.00 28.64 ? 483  ASP A CA    1 
ATOM   3108 C  C     . ASP C 3 309 ? -0.614  10.286  22.828  1.00 33.67 ? 483  ASP A C     1 
ATOM   3109 O  O     . ASP C 3 309 ? -0.526  9.716   21.754  1.00 42.46 ? 483  ASP A O     1 
ATOM   3110 C  CB    . ASP C 3 309 ? -1.567  9.423   24.963  1.00 28.39 ? 483  ASP A CB    1 
ATOM   3111 C  CG    . ASP C 3 309 ? -2.788  8.852   24.208  1.00 32.51 ? 483  ASP A CG    1 
ATOM   3112 O  OD1   . ASP C 3 309 ? -2.669  8.301   23.080  1.00 28.00 ? 483  ASP A OD1   1 
ATOM   3113 O  OD2   . ASP C 3 309 ? -3.895  8.948   24.779  1.00 30.97 ? 483  ASP A OD2   1 
ATOM   3114 N  N     . LYS C 3 310 ? -1.003  11.548  22.942  1.00 33.97 ? 484  LYS A N     1 
ATOM   3115 C  CA    . LYS C 3 310 ? -1.334  12.319  21.757  1.00 32.97 ? 484  LYS A CA    1 
ATOM   3116 C  C     . LYS C 3 310 ? -0.148  12.620  20.847  1.00 33.35 ? 484  LYS A C     1 
ATOM   3117 O  O     . LYS C 3 310 ? -0.238  12.405  19.647  1.00 34.59 ? 484  LYS A O     1 
ATOM   3118 C  CB    . LYS C 3 310 ? -2.050  13.625  22.143  1.00 35.96 ? 484  LYS A CB    1 
ATOM   3119 N  N     . LEU C 3 311 ? 0.964   13.093  21.411  1.00 30.84 ? 485  LEU A N     1 
ATOM   3120 C  CA    . LEU C 3 311 ? 2.128   13.478  20.612  1.00 27.29 ? 485  LEU A CA    1 
ATOM   3121 C  C     . LEU C 3 311 ? 3.212   12.461  20.286  1.00 31.03 ? 485  LEU A C     1 
ATOM   3122 O  O     . LEU C 3 311 ? 4.080   12.724  19.431  1.00 31.84 ? 485  LEU A O     1 
ATOM   3123 C  CB    . LEU C 3 311 ? 2.784   14.666  21.261  1.00 26.87 ? 485  LEU A CB    1 
ATOM   3124 C  CG    . LEU C 3 311 ? 1.830   15.818  21.435  1.00 28.30 ? 485  LEU A CG    1 
ATOM   3125 C  CD1   . LEU C 3 311 ? 2.474   16.816  22.350  1.00 31.28 ? 485  LEU A CD1   1 
ATOM   3126 C  CD2   . LEU C 3 311 ? 1.522   16.420  20.065  1.00 27.71 ? 485  LEU A CD2   1 
ATOM   3127 N  N     . ALA C 3 312 ? 3.197   11.341  21.000  1.00 32.13 ? 486  ALA A N     1 
ATOM   3128 C  CA    . ALA C 3 312 ? 4.175   10.252  20.836  1.00 30.13 ? 486  ALA A CA    1 
ATOM   3129 C  C     . ALA C 3 312 ? 5.532   10.598  21.394  1.00 26.75 ? 486  ALA A C     1 
ATOM   3130 O  O     . ALA C 3 312 ? 6.526   10.101  20.907  1.00 27.74 ? 486  ALA A O     1 
ATOM   3131 C  CB    . ALA C 3 312 ? 4.317   9.822   19.368  1.00 24.96 ? 486  ALA A CB    1 
ATOM   3132 N  N     . LEU C 3 313 ? 5.571   11.480  22.387  1.00 26.06 ? 487  LEU A N     1 
ATOM   3133 C  CA    . LEU C 3 313 ? 6.814   11.890  23.019  1.00 23.51 ? 487  LEU A CA    1 
ATOM   3134 C  C     . LEU C 3 313 ? 7.390   10.703  23.785  1.00 26.78 ? 487  LEU A C     1 
ATOM   3135 O  O     . LEU C 3 313 ? 6.638   9.876   24.266  1.00 30.19 ? 487  LEU A O     1 
ATOM   3136 C  CB    . LEU C 3 313 ? 6.534   13.046  23.985  1.00 18.21 ? 487  LEU A CB    1 
ATOM   3137 C  CG    . LEU C 3 313 ? 5.877   14.286  23.364  1.00 20.78 ? 487  LEU A CG    1 
ATOM   3138 C  CD1   . LEU C 3 313 ? 6.114   15.530  24.207  1.00 16.90 ? 487  LEU A CD1   1 
ATOM   3139 C  CD2   . LEU C 3 313 ? 6.447   14.522  21.998  1.00 13.35 ? 487  LEU A CD2   1 
ATOM   3140 N  N     . ARG C 3 314 ? 8.712   10.612  23.886  1.00 28.67 ? 488  ARG A N     1 
ATOM   3141 C  CA    . ARG C 3 314 ? 9.355   9.520   24.612  1.00 30.33 ? 488  ARG A CA    1 
ATOM   3142 C  C     . ARG C 3 314 ? 9.292   9.775   26.106  1.00 30.47 ? 488  ARG A C     1 
ATOM   3143 O  O     . ARG C 3 314 ? 9.268   10.928  26.552  1.00 34.08 ? 488  ARG A O     1 
ATOM   3144 C  CB    . ARG C 3 314 ? 10.808  9.392   24.217  1.00 23.55 ? 488  ARG A CB    1 
ATOM   3145 C  CG    . ARG C 3 314 ? 10.998  9.089   22.798  1.00 29.34 ? 488  ARG A CG    1 
ATOM   3146 C  CD    . ARG C 3 314 ? 12.423  8.651   22.543  1.00 30.95 ? 488  ARG A CD    1 
ATOM   3147 N  NE    . ARG C 3 314 ? 12.654  8.483   21.114  1.00 38.69 ? 488  ARG A NE    1 
ATOM   3148 C  CZ    . ARG C 3 314 ? 12.782  9.490   20.253  1.00 42.37 ? 488  ARG A CZ    1 
ATOM   3149 N  NH1   . ARG C 3 314 ? 12.719  10.749  20.684  1.00 40.86 ? 488  ARG A NH1   1 
ATOM   3150 N  NH2   . ARG C 3 314 ? 12.903  9.240   18.953  1.00 44.37 ? 488  ARG A NH2   1 
ATOM   3151 N  N     . ALA C 3 315 ? 9.286   8.694   26.881  1.00 26.64 ? 489  ALA A N     1 
ATOM   3152 C  CA    . ALA C 3 315 ? 9.222   8.772   28.334  1.00 27.10 ? 489  ALA A CA    1 
ATOM   3153 C  C     . ALA C 3 315 ? 10.026  9.954   28.875  1.00 25.03 ? 489  ALA A C     1 
ATOM   3154 O  O     . ALA C 3 315 ? 9.495   10.786  29.588  1.00 29.39 ? 489  ALA A O     1 
ATOM   3155 C  CB    . ALA C 3 315 ? 9.714   7.460   28.945  1.00 25.56 ? 489  ALA A CB    1 
ATOM   3156 N  N     . GLY C 3 316 ? 11.287  10.050  28.484  1.00 23.12 ? 490  GLY A N     1 
ATOM   3157 C  CA    . GLY C 3 316 ? 12.110  11.137  28.934  1.00 18.65 ? 490  GLY A CA    1 
ATOM   3158 C  C     . GLY C 3 316 ? 12.754  10.855  30.270  1.00 28.55 ? 490  GLY A C     1 
ATOM   3159 O  O     . GLY C 3 316 ? 12.288  11.340  31.307  1.00 37.42 ? 490  GLY A O     1 
ATOM   3160 N  N     . ASN C 3 317 ? 13.743  9.973   30.259  1.00 28.75 ? 491  ASN A N     1 
ATOM   3161 C  CA    . ASN C 3 317 ? 14.513  9.611   31.447  1.00 26.63 ? 491  ASN A CA    1 
ATOM   3162 C  C     . ASN C 3 317 ? 15.567  10.686  31.752  1.00 27.65 ? 491  ASN A C     1 
ATOM   3163 O  O     . ASN C 3 317 ? 15.998  11.423  30.887  1.00 31.60 ? 491  ASN A O     1 
ATOM   3164 C  CB    . ASN C 3 317 ? 15.217  8.263   31.221  1.00 26.00 ? 491  ASN A CB    1 
ATOM   3165 C  CG    . ASN C 3 317 ? 14.246  7.096   31.108  1.00 29.53 ? 491  ASN A CG    1 
ATOM   3166 O  OD1   . ASN C 3 317 ? 14.052  6.377   32.068  1.00 30.98 ? 491  ASN A OD1   1 
ATOM   3167 N  ND2   . ASN C 3 317 ? 13.630  6.906   29.937  1.00 38.90 ? 491  ASN A ND2   1 
ATOM   3168 N  N     . GLU C 3 318 ? 16.032  10.748  32.986  1.00 37.66 ? 492  GLU A N     1 
ATOM   3169 C  CA    . GLU C 3 318 ? 17.020  11.752  33.326  1.00 42.79 ? 492  GLU A CA    1 
ATOM   3170 C  C     . GLU C 3 318 ? 18.432  11.401  32.878  1.00 42.46 ? 492  GLU A C     1 
ATOM   3171 O  O     . GLU C 3 318 ? 18.902  10.285  33.068  1.00 44.24 ? 492  GLU A O     1 
ATOM   3172 C  CB    . GLU C 3 318 ? 16.971  12.046  34.819  1.00 52.60 ? 492  GLU A CB    1 
ATOM   3173 C  CG    . GLU C 3 318 ? 15.584  12.520  35.295  1.00 68.05 ? 492  GLU A CG    1 
ATOM   3174 C  CD    . GLU C 3 318 ? 15.177  13.911  34.775  1.00 73.43 ? 492  GLU A CD    1 
ATOM   3175 O  OE1   . GLU C 3 318 ? 16.062  14.659  34.308  1.00 78.90 ? 492  GLU A OE1   1 
ATOM   3176 O  OE2   . GLU C 3 318 ? 13.971  14.266  34.847  1.00 73.72 ? 492  GLU A OE2   1 
ATOM   3177 N  N     . LYS C 3 319 ? 19.118  12.389  32.320  1.00 44.61 ? 493  LYS A N     1 
ATOM   3178 C  CA    . LYS C 3 319 ? 20.478  12.241  31.821  1.00 46.56 ? 493  LYS A CA    1 
ATOM   3179 C  C     . LYS C 3 319 ? 21.469  12.865  32.802  1.00 51.89 ? 493  LYS A C     1 
ATOM   3180 O  O     . LYS C 3 319 ? 21.200  13.935  33.357  1.00 51.84 ? 493  LYS A O     1 
ATOM   3181 C  CB    . LYS C 3 319 ? 20.602  12.927  30.454  1.00 44.22 ? 493  LYS A CB    1 
ATOM   3182 C  CG    . LYS C 3 319 ? 19.826  12.246  29.346  1.00 42.24 ? 493  LYS A CG    1 
ATOM   3183 C  CD    . LYS C 3 319 ? 20.158  10.755  29.311  1.00 52.43 ? 493  LYS A CD    1 
ATOM   3184 C  CE    . LYS C 3 319 ? 18.995  9.915   28.773  1.00 53.90 ? 493  LYS A CE    1 
ATOM   3185 N  NZ    . LYS C 3 319 ? 19.205  8.453   28.973  1.00 40.64 ? 493  LYS A NZ    1 
ATOM   3186 N  N     . GLU C 3 320 ? 22.601  12.192  33.027  1.00 58.27 ? 494  GLU A N     1 
ATOM   3187 C  CA    . GLU C 3 320 ? 23.622  12.689  33.951  1.00 63.40 ? 494  GLU A CA    1 
ATOM   3188 C  C     . GLU C 3 320 ? 24.103  14.106  33.635  1.00 64.37 ? 494  GLU A C     1 
ATOM   3189 O  O     . GLU C 3 320 ? 24.639  14.390  32.562  1.00 61.89 ? 494  GLU A O     1 
ATOM   3190 C  CB    . GLU C 3 320 ? 24.799  11.697  34.053  1.00 70.79 ? 494  GLU A CB    1 
ATOM   3191 C  CG    . GLU C 3 320 ? 26.078  12.190  34.806  1.00 77.31 ? 494  GLU A CG    1 
ATOM   3192 C  CD    . GLU C 3 320 ? 25.905  12.413  36.318  1.00 79.12 ? 494  GLU A CD    1 
ATOM   3193 O  OE1   . GLU C 3 320 ? 25.170  11.637  36.982  1.00 82.00 ? 494  GLU A OE1   1 
ATOM   3194 O  OE2   . GLU C 3 320 ? 26.544  13.360  36.843  1.00 80.51 ? 494  GLU A OE2   1 
ATOM   3195 N  N     . GLU C 3 321 ? 23.872  14.977  34.610  1.00 71.83 ? 495  GLU A N     1 
ATOM   3196 C  CA    . GLU C 3 321 ? 24.231  16.400  34.571  1.00 75.60 ? 495  GLU A CA    1 
ATOM   3197 C  C     . GLU C 3 321 ? 25.688  16.718  34.162  1.00 73.65 ? 495  GLU A C     1 
ATOM   3198 O  O     . GLU C 3 321 ? 26.614  16.638  34.969  1.00 72.94 ? 495  GLU A O     1 
ATOM   3199 C  CB    . GLU C 3 321 ? 23.901  17.023  35.941  1.00 82.06 ? 495  GLU A CB    1 
ATOM   3200 N  N     . GLY C 3 322 ? 25.876  17.096  32.901  1.00 69.25 ? 496  GLY A N     1 
ATOM   3201 C  CA    . GLY C 3 322 ? 27.208  17.422  32.415  1.00 64.11 ? 496  GLY A CA    1 
ATOM   3202 C  C     . GLY C 3 322 ? 28.044  16.244  31.938  1.00 60.74 ? 496  GLY A C     1 
ATOM   3203 O  O     . GLY C 3 322 ? 29.278  16.319  31.928  1.00 57.22 ? 496  GLY A O     1 
ATOM   3204 N  N     . GLU C 3 323 ? 27.384  15.180  31.490  1.00 56.45 ? 497  GLU A N     1 
ATOM   3205 C  CA    . GLU C 3 323 ? 28.090  13.997  31.009  1.00 49.37 ? 497  GLU A CA    1 
ATOM   3206 C  C     . GLU C 3 323 ? 27.513  13.444  29.715  1.00 43.99 ? 497  GLU A C     1 
ATOM   3207 O  O     . GLU C 3 323 ? 28.128  12.583  29.098  1.00 41.81 ? 497  GLU A O     1 
ATOM   3208 C  CB    . GLU C 3 323 ? 28.113  12.913  32.079  1.00 52.53 ? 497  GLU A CB    1 
ATOM   3209 N  N     . THR C 3 324 ? 26.367  13.982  29.301  1.00 43.03 ? 498  THR A N     1 
ATOM   3210 C  CA    . THR C 3 324 ? 25.659  13.604  28.054  1.00 40.68 ? 498  THR A CA    1 
ATOM   3211 C  C     . THR C 3 324 ? 25.256  14.906  27.335  1.00 38.35 ? 498  THR A C     1 
ATOM   3212 O  O     . THR C 3 324 ? 25.571  15.999  27.810  1.00 41.70 ? 498  THR A O     1 
ATOM   3213 C  CB    . THR C 3 324 ? 24.329  12.799  28.344  1.00 43.86 ? 498  THR A CB    1 
ATOM   3214 O  OG1   . THR C 3 324 ? 23.522  13.506  29.299  1.00 42.12 ? 498  THR A OG1   1 
ATOM   3215 C  CG2   . THR C 3 324 ? 24.624  11.411  28.907  1.00 40.74 ? 498  THR A CG2   1 
ATOM   3216 N  N     . ALA C 3 325 ? 24.654  14.803  26.157  1.00 37.66 ? 499  ALA A N     1 
ATOM   3217 C  CA    . ALA C 3 325 ? 24.187  16.007  25.468  1.00 37.48 ? 499  ALA A CA    1 
ATOM   3218 C  C     . ALA C 3 325 ? 22.884  16.364  26.164  1.00 38.80 ? 499  ALA A C     1 
ATOM   3219 O  O     . ALA C 3 325 ? 22.258  15.522  26.792  1.00 38.59 ? 499  ALA A O     1 
ATOM   3220 C  CB    . ALA C 3 325 ? 23.923  15.741  24.012  1.00 38.06 ? 499  ALA A CB    1 
ATOM   3221 N  N     . ASP C 3 326 ? 22.462  17.611  26.049  1.00 41.87 ? 500  ASP A N     1 
ATOM   3222 C  CA    . ASP C 3 326 ? 21.233  18.022  26.707  1.00 40.55 ? 500  ASP A CA    1 
ATOM   3223 C  C     . ASP C 3 326 ? 20.025  17.783  25.802  1.00 36.78 ? 500  ASP A C     1 
ATOM   3224 O  O     . ASP C 3 326 ? 19.687  18.614  24.966  1.00 37.35 ? 500  ASP A O     1 
ATOM   3225 C  CB    . ASP C 3 326 ? 21.346  19.499  27.109  1.00 47.01 ? 500  ASP A CB    1 
ATOM   3226 C  CG    . ASP C 3 326 ? 20.249  19.959  28.081  1.00 50.20 ? 500  ASP A CG    1 
ATOM   3227 O  OD1   . ASP C 3 326 ? 19.345  19.175  28.455  1.00 47.48 ? 500  ASP A OD1   1 
ATOM   3228 O  OD2   . ASP C 3 326 ? 20.310  21.148  28.473  1.00 55.45 ? 500  ASP A OD2   1 
ATOM   3229 N  N     . THR C 3 327 ? 19.454  16.596  25.896  1.00 34.46 ? 501  THR A N     1 
ATOM   3230 C  CA    . THR C 3 327 ? 18.258  16.249  25.135  1.00 32.38 ? 501  THR A CA    1 
ATOM   3231 C  C     . THR C 3 327 ? 17.190  15.968  26.182  1.00 30.41 ? 501  THR A C     1 
ATOM   3232 O  O     . THR C 3 327 ? 17.524  15.781  27.350  1.00 34.58 ? 501  THR A O     1 
ATOM   3233 C  CB    . THR C 3 327 ? 18.498  15.036  24.278  1.00 31.43 ? 501  THR A CB    1 
ATOM   3234 O  OG1   . THR C 3 327 ? 19.211  14.060  25.042  1.00 39.35 ? 501  THR A OG1   1 
ATOM   3235 C  CG2   . THR C 3 327 ? 19.335  15.421  23.083  1.00 32.69 ? 501  THR A CG2   1 
ATOM   3236 N  N     . VAL C 3 328 ? 15.919  16.115  25.824  1.00 24.77 ? 502  VAL A N     1 
ATOM   3237 C  CA    . VAL C 3 328 ? 14.867  15.870  26.804  1.00 19.12 ? 502  VAL A CA    1 
ATOM   3238 C  C     . VAL C 3 328 ? 13.715  15.116  26.204  1.00 20.82 ? 502  VAL A C     1 
ATOM   3239 O  O     . VAL C 3 328 ? 13.446  15.253  25.018  1.00 25.63 ? 502  VAL A O     1 
ATOM   3240 C  CB    . VAL C 3 328 ? 14.288  17.192  27.422  1.00 21.59 ? 502  VAL A CB    1 
ATOM   3241 C  CG1   . VAL C 3 328 ? 15.310  17.885  28.285  1.00 11.67 ? 502  VAL A CG1   1 
ATOM   3242 C  CG2   . VAL C 3 328 ? 13.807  18.115  26.343  1.00 14.19 ? 502  VAL A CG2   1 
ATOM   3243 N  N     . GLY C 3 329 ? 12.958  14.457  27.073  1.00 20.08 ? 503  GLY A N     1 
ATOM   3244 C  CA    . GLY C 3 329 ? 11.793  13.693  26.674  1.00 22.63 ? 503  GLY A CA    1 
ATOM   3245 C  C     . GLY C 3 329 ? 10.573  14.322  27.314  1.00 25.51 ? 503  GLY A C     1 
ATOM   3246 O  O     . GLY C 3 329 ? 10.598  15.490  27.688  1.00 37.21 ? 503  GLY A O     1 
ATOM   3247 N  N     . CYS C 3 330 ? 9.496   13.580  27.457  1.00 20.44 ? 504  CYS A N     1 
ATOM   3248 C  CA    . CYS C 3 330 ? 8.335   14.184  28.034  1.00 25.01 ? 504  CYS A CA    1 
ATOM   3249 C  C     . CYS C 3 330 ? 8.547   14.563  29.498  1.00 29.46 ? 504  CYS A C     1 
ATOM   3250 O  O     . CYS C 3 330 ? 8.389   15.729  29.875  1.00 33.70 ? 504  CYS A O     1 
ATOM   3251 C  CB    . CYS C 3 330 ? 7.129   13.265  27.866  1.00 26.71 ? 504  CYS A CB    1 
ATOM   3252 S  SG    . CYS C 3 330 ? 5.567   13.951  28.504  1.00 35.29 ? 504  CYS A SG    1 
ATOM   3253 N  N     . CYS C 3 331 ? 8.919   13.587  30.317  1.00 27.29 ? 505  CYS A N     1 
ATOM   3254 C  CA    . CYS C 3 331 ? 9.097   13.815  31.739  1.00 29.20 ? 505  CYS A CA    1 
ATOM   3255 C  C     . CYS C 3 331 ? 10.132  14.846  32.127  1.00 28.79 ? 505  CYS A C     1 
ATOM   3256 O  O     . CYS C 3 331 ? 9.922   15.655  33.019  1.00 32.35 ? 505  CYS A O     1 
ATOM   3257 C  CB    . CYS C 3 331 ? 9.400   12.494  32.426  1.00 26.87 ? 505  CYS A CB    1 
ATOM   3258 S  SG    . CYS C 3 331 ? 7.917   11.483  32.479  1.00 38.22 ? 505  CYS A SG    1 
ATOM   3259 N  N     . SER C 3 332 ? 11.233  14.829  31.406  1.00 29.79 ? 506  SER A N     1 
ATOM   3260 C  CA    . SER C 3 332 ? 12.356  15.706  31.662  1.00 27.46 ? 506  SER A CA    1 
ATOM   3261 C  C     . SER C 3 332 ? 12.203  17.112  31.102  1.00 24.03 ? 506  SER A C     1 
ATOM   3262 O  O     . SER C 3 332 ? 13.107  17.939  31.251  1.00 32.32 ? 506  SER A O     1 
ATOM   3263 C  CB    . SER C 3 332 ? 13.577  15.064  31.031  1.00 28.21 ? 506  SER A CB    1 
ATOM   3264 O  OG    . SER C 3 332 ? 13.295  14.909  29.649  1.00 39.75 ? 506  SER A OG    1 
ATOM   3265 N  N     . LEU C 3 333 ? 11.141  17.371  30.358  1.00 17.40 ? 507  LEU A N     1 
ATOM   3266 C  CA    . LEU C 3 333 ? 10.972  18.708  29.807  1.00 20.74 ? 507  LEU A CA    1 
ATOM   3267 C  C     . LEU C 3 333 ? 11.198  19.808  30.845  1.00 23.34 ? 507  LEU A C     1 
ATOM   3268 O  O     . LEU C 3 333 ? 10.748  19.718  31.988  1.00 19.24 ? 507  LEU A O     1 
ATOM   3269 C  CB    . LEU C 3 333 ? 9.576   18.901  29.229  1.00 13.50 ? 507  LEU A CB    1 
ATOM   3270 C  CG    . LEU C 3 333 ? 9.205   18.084  28.008  1.00 15.81 ? 507  LEU A CG    1 
ATOM   3271 C  CD1   . LEU C 3 333 ? 7.676   18.050  27.927  1.00 11.68 ? 507  LEU A CD1   1 
ATOM   3272 C  CD2   . LEU C 3 333 ? 9.852   18.683  26.741  1.00 12.15 ? 507  LEU A CD2   1 
ATOM   3273 N  N     . ARG C 3 334 ? 11.864  20.871  30.425  1.00 23.15 ? 508  ARG A N     1 
ATOM   3274 C  CA    . ARG C 3 334 ? 12.088  21.988  31.316  1.00 28.36 ? 508  ARG A CA    1 
ATOM   3275 C  C     . ARG C 3 334 ? 11.171  23.154  30.953  1.00 28.12 ? 508  ARG A C     1 
ATOM   3276 O  O     . ARG C 3 334 ? 10.659  23.211  29.842  1.00 29.31 ? 508  ARG A O     1 
ATOM   3277 C  CB    . ARG C 3 334 ? 13.551  22.400  31.284  1.00 25.63 ? 508  ARG A CB    1 
ATOM   3278 C  CG    . ARG C 3 334 ? 14.440  21.279  31.715  1.00 22.22 ? 508  ARG A CG    1 
ATOM   3279 C  CD    . ARG C 3 334 ? 15.844  21.770  31.886  1.00 23.63 ? 508  ARG A CD    1 
ATOM   3280 N  NE    . ARG C 3 334 ? 16.438  22.147  30.613  1.00 27.66 ? 508  ARG A NE    1 
ATOM   3281 C  CZ    . ARG C 3 334 ? 17.211  21.355  29.878  1.00 27.56 ? 508  ARG A CZ    1 
ATOM   3282 N  NH1   . ARG C 3 334 ? 17.496  20.118  30.275  1.00 30.97 ? 508  ARG A NH1   1 
ATOM   3283 N  NH2   . ARG C 3 334 ? 17.720  21.819  28.753  1.00 28.83 ? 508  ARG A NH2   1 
ATOM   3284 N  N     . VAL C 3 335 ? 10.961  24.062  31.900  1.00 30.35 ? 509  VAL A N     1 
ATOM   3285 C  CA    . VAL C 3 335 ? 10.114  25.235  31.723  1.00 35.54 ? 509  VAL A CA    1 
ATOM   3286 C  C     . VAL C 3 335 ? 10.390  25.977  30.431  1.00 39.64 ? 509  VAL A C     1 
ATOM   3287 O  O     . VAL C 3 335 ? 9.462   26.459  29.778  1.00 44.78 ? 509  VAL A O     1 
ATOM   3288 C  CB    . VAL C 3 335 ? 10.271  26.231  32.917  1.00 36.80 ? 509  VAL A CB    1 
ATOM   3289 C  CG1   . VAL C 3 335 ? 10.039  27.656  32.475  1.00 36.96 ? 509  VAL A CG1   1 
ATOM   3290 C  CG2   . VAL C 3 335 ? 9.295   25.881  34.035  1.00 33.44 ? 509  VAL A CG2   1 
ATOM   3291 N  N     . GLU C 3 336 ? 11.663  26.101  30.088  1.00 39.58 ? 510  GLU A N     1 
ATOM   3292 C  CA    . GLU C 3 336 ? 12.053  26.804  28.883  1.00 41.53 ? 510  GLU A CA    1 
ATOM   3293 C  C     . GLU C 3 336 ? 11.637  26.126  27.568  1.00 43.96 ? 510  GLU A C     1 
ATOM   3294 O  O     . GLU C 3 336 ? 11.715  26.755  26.514  1.00 49.51 ? 510  GLU A O     1 
ATOM   3295 C  CB    . GLU C 3 336 ? 13.557  26.984  28.909  1.00 45.86 ? 510  GLU A CB    1 
ATOM   3296 C  CG    . GLU C 3 336 ? 14.279  25.670  29.197  1.00 57.11 ? 510  GLU A CG    1 
ATOM   3297 C  CD    . GLU C 3 336 ? 15.715  25.850  29.666  1.00 66.08 ? 510  GLU A CD    1 
ATOM   3298 O  OE1   . GLU C 3 336 ? 16.313  26.910  29.394  1.00 71.58 ? 510  GLU A OE1   1 
ATOM   3299 O  OE2   . GLU C 3 336 ? 16.256  24.928  30.314  1.00 69.16 ? 510  GLU A OE2   1 
ATOM   3300 N  N     . HIS C 3 337 ? 11.201  24.864  27.614  1.00 41.86 ? 511  HIS A N     1 
ATOM   3301 C  CA    . HIS C 3 337 ? 10.835  24.123  26.395  1.00 33.29 ? 511  HIS A CA    1 
ATOM   3302 C  C     . HIS C 3 337 ? 9.452   24.292  25.843  1.00 32.46 ? 511  HIS A C     1 
ATOM   3303 O  O     . HIS C 3 337 ? 9.122   23.680  24.833  1.00 32.49 ? 511  HIS A O     1 
ATOM   3304 C  CB    . HIS C 3 337 ? 11.083  22.629  26.573  1.00 33.01 ? 511  HIS A CB    1 
ATOM   3305 C  CG    . HIS C 3 337 ? 12.502  22.293  26.898  1.00 27.75 ? 511  HIS A CG    1 
ATOM   3306 N  ND1   . HIS C 3 337 ? 12.854  21.534  27.990  1.00 28.06 ? 511  HIS A ND1   1 
ATOM   3307 C  CD2   . HIS C 3 337 ? 13.659  22.643  26.294  1.00 23.98 ? 511  HIS A CD2   1 
ATOM   3308 C  CE1   . HIS C 3 337 ? 14.170  21.433  28.048  1.00 30.91 ? 511  HIS A CE1   1 
ATOM   3309 N  NE2   . HIS C 3 337 ? 14.682  22.098  27.031  1.00 26.73 ? 511  HIS A NE2   1 
ATOM   3310 N  N     . ILE C 3 338 ? 8.581   24.960  26.577  1.00 34.08 ? 512  ILE A N     1 
ATOM   3311 C  CA    . ILE C 3 338 ? 7.254   25.177  26.049  1.00 41.69 ? 512  ILE A CA    1 
ATOM   3312 C  C     . ILE C 3 338 ? 6.820   26.596  26.272  1.00 45.63 ? 512  ILE A C     1 
ATOM   3313 O  O     . ILE C 3 338 ? 7.204   27.224  27.261  1.00 49.36 ? 512  ILE A O     1 
ATOM   3314 C  CB    . ILE C 3 338 ? 6.172   24.234  26.614  1.00 41.18 ? 512  ILE A CB    1 
ATOM   3315 C  CG1   . ILE C 3 338 ? 6.130   24.288  28.131  1.00 38.18 ? 512  ILE A CG1   1 
ATOM   3316 C  CG2   . ILE C 3 338 ? 6.367   22.831  26.099  1.00 40.97 ? 512  ILE A CG2   1 
ATOM   3317 C  CD1   . ILE C 3 338 ? 4.878   23.619  28.676  1.00 40.36 ? 512  ILE A CD1   1 
ATOM   3318 N  N     . ASN C 3 339 ? 6.077   27.106  25.300  1.00 46.51 ? 513  ASN A N     1 
ATOM   3319 C  CA    . ASN C 3 339 ? 5.555   28.445  25.350  1.00 46.49 ? 513  ASN A CA    1 
ATOM   3320 C  C     . ASN C 3 339 ? 4.088   28.302  25.082  1.00 47.38 ? 513  ASN A C     1 
ATOM   3321 O  O     . ASN C 3 339 ? 3.684   27.605  24.154  1.00 43.51 ? 513  ASN A O     1 
ATOM   3322 C  CB    . ASN C 3 339 ? 6.202   29.314  24.286  1.00 50.34 ? 513  ASN A CB    1 
ATOM   3323 C  CG    . ASN C 3 339 ? 7.623   29.664  24.628  1.00 56.34 ? 513  ASN A CG    1 
ATOM   3324 O  OD1   . ASN C 3 339 ? 7.888   30.688  25.252  1.00 65.86 ? 513  ASN A OD1   1 
ATOM   3325 N  ND2   . ASN C 3 339 ? 8.549   28.810  24.236  1.00 62.19 ? 513  ASN A ND2   1 
ATOM   3326 N  N     . LEU C 3 340 ? 3.299   28.881  25.976  1.00 48.40 ? 514  LEU A N     1 
ATOM   3327 C  CA    . LEU C 3 340 ? 1.855   28.857  25.898  1.00 45.84 ? 514  LEU A CA    1 
ATOM   3328 C  C     . LEU C 3 340 ? 1.398   30.137  25.250  1.00 46.63 ? 514  LEU A C     1 
ATOM   3329 O  O     . LEU C 3 340 ? 2.011   31.193  25.416  1.00 47.55 ? 514  LEU A O     1 
ATOM   3330 C  CB    . LEU C 3 340 ? 1.264   28.793  27.299  1.00 41.98 ? 514  LEU A CB    1 
ATOM   3331 C  CG    . LEU C 3 340 ? 1.343   27.500  28.098  1.00 44.46 ? 514  LEU A CG    1 
ATOM   3332 C  CD1   . LEU C 3 340 ? 2.323   26.492  27.508  1.00 43.23 ? 514  LEU A CD1   1 
ATOM   3333 C  CD2   . LEU C 3 340 ? 1.709   27.881  29.510  1.00 41.29 ? 514  LEU A CD2   1 
ATOM   3334 N  N     . HIS C 3 341 ? 0.304   30.051  24.519  1.00 47.32 ? 515  HIS A N     1 
ATOM   3335 C  CA    . HIS C 3 341 ? -0.254  31.220  23.871  1.00 52.08 ? 515  HIS A CA    1 
ATOM   3336 C  C     . HIS C 3 341 ? -1.760  31.075  23.876  1.00 53.33 ? 515  HIS A C     1 
ATOM   3337 O  O     . HIS C 3 341 ? -2.314  30.154  23.276  1.00 55.11 ? 515  HIS A O     1 
ATOM   3338 C  CB    . HIS C 3 341 ? 0.289   31.370  22.454  1.00 55.98 ? 515  HIS A CB    1 
ATOM   3339 C  CG    . HIS C 3 341 ? 1.776   31.506  22.404  1.00 57.76 ? 515  HIS A CG    1 
ATOM   3340 N  ND1   . HIS C 3 341 ? 2.593   30.538  21.861  1.00 56.04 ? 515  HIS A ND1   1 
ATOM   3341 C  CD2   . HIS C 3 341 ? 2.598   32.455  22.912  1.00 58.20 ? 515  HIS A CD2   1 
ATOM   3342 C  CE1   . HIS C 3 341 ? 3.856   30.878  22.049  1.00 58.36 ? 515  HIS A CE1   1 
ATOM   3343 N  NE2   . HIS C 3 341 ? 3.887   32.037  22.684  1.00 61.32 ? 515  HIS A NE2   1 
ATOM   3344 N  N     . PRO C 3 342 ? -2.442  31.943  24.631  1.00 53.26 ? 516  PRO A N     1 
ATOM   3345 C  CA    . PRO C 3 342 ? -3.896  31.912  24.724  1.00 52.96 ? 516  PRO A CA    1 
ATOM   3346 C  C     . PRO C 3 342 ? -4.529  31.746  23.354  1.00 53.45 ? 516  PRO A C     1 
ATOM   3347 O  O     . PRO C 3 342 ? -5.500  31.009  23.198  1.00 57.16 ? 516  PRO A O     1 
ATOM   3348 C  CB    . PRO C 3 342 ? -4.204  33.263  25.352  1.00 54.25 ? 516  PRO A CB    1 
ATOM   3349 C  CG    . PRO C 3 342 ? -3.069  33.419  26.313  1.00 54.12 ? 516  PRO A CG    1 
ATOM   3350 C  CD    . PRO C 3 342 ? -1.894  33.038  25.450  1.00 55.98 ? 516  PRO A CD    1 
ATOM   3351 N  N     . GLU C 3 343 ? -3.971  32.439  22.373  1.00 52.80 ? 517  GLU A N     1 
ATOM   3352 C  CA    . GLU C 3 343 ? -4.453  32.371  21.006  1.00 52.83 ? 517  GLU A CA    1 
ATOM   3353 C  C     . GLU C 3 343 ? -3.210  32.579  20.203  1.00 57.38 ? 517  GLU A C     1 
ATOM   3354 O  O     . GLU C 3 343 ? -2.369  33.402  20.580  1.00 60.58 ? 517  GLU A O     1 
ATOM   3355 C  CB    . GLU C 3 343 ? -5.449  33.490  20.716  1.00 48.59 ? 517  GLU A CB    1 
ATOM   3356 N  N     . LEU C 3 344 ? -3.037  31.768  19.170  1.00 61.50 ? 518  LEU A N     1 
ATOM   3357 C  CA    . LEU C 3 344 ? -1.870  31.863  18.309  1.00 65.38 ? 518  LEU A CA    1 
ATOM   3358 C  C     . LEU C 3 344 ? -2.250  31.509  16.894  1.00 65.64 ? 518  LEU A C     1 
ATOM   3359 O  O     . LEU C 3 344 ? -2.699  30.390  16.629  1.00 62.53 ? 518  LEU A O     1 
ATOM   3360 C  CB    . LEU C 3 344 ? -0.772  30.915  18.785  1.00 69.64 ? 518  LEU A CB    1 
ATOM   3361 C  CG    . LEU C 3 344 ? 0.498   30.901  17.935  1.00 75.76 ? 518  LEU A CG    1 
ATOM   3362 C  CD1   . LEU C 3 344 ? 1.092   32.296  17.898  1.00 81.35 ? 518  LEU A CD1   1 
ATOM   3363 C  CD2   . LEU C 3 344 ? 1.499   29.933  18.520  1.00 81.46 ? 518  LEU A CD2   1 
ATOM   3364 N  N     . ASP C 3 345 ? -1.966  32.428  15.977  1.00 70.71 ? 519  ASP A N     1 
ATOM   3365 C  CA    . ASP C 3 345 ? -2.271  32.250  14.553  1.00 76.59 ? 519  ASP A CA    1 
ATOM   3366 C  C     . ASP C 3 345 ? -3.746  31.857  14.354  1.00 77.46 ? 519  ASP A C     1 
ATOM   3367 O  O     . ASP C 3 345 ? -4.095  31.102  13.424  1.00 76.33 ? 519  ASP A O     1 
ATOM   3368 C  CB    . ASP C 3 345 ? -1.331  31.209  13.916  1.00 75.27 ? 519  ASP A CB    1 
ATOM   3369 N  N     . GLY C 3 346 ? -4.597  32.413  15.215  1.00 77.01 ? 520  GLY A N     1 
ATOM   3370 C  CA    . GLY C 3 346 ? -6.022  32.138  15.174  1.00 76.33 ? 520  GLY A CA    1 
ATOM   3371 C  C     . GLY C 3 346 ? -6.413  31.069  16.175  1.00 74.90 ? 520  GLY A C     1 
ATOM   3372 O  O     . GLY C 3 346 ? -7.461  31.163  16.836  1.00 74.52 ? 520  GLY A O     1 
ATOM   3373 N  N     . GLN C 3 347 ? -5.581  30.035  16.253  1.00 71.66 ? 521  GLN A N     1 
ATOM   3374 C  CA    . GLN C 3 347 ? -5.800  28.927  17.161  1.00 69.36 ? 521  GLN A CA    1 
ATOM   3375 C  C     . GLN C 3 347 ? -5.844  29.418  18.616  1.00 68.86 ? 521  GLN A C     1 
ATOM   3376 O  O     . GLN C 3 347 ? -5.286  30.463  18.952  1.00 67.10 ? 521  GLN A O     1 
ATOM   3377 C  CB    . GLN C 3 347 ? -4.702  27.883  16.967  1.00 70.00 ? 521  GLN A CB    1 
ATOM   3378 N  N     . GLU C 3 348 ? -6.536  28.662  19.465  1.00 66.83 ? 522  GLU A N     1 
ATOM   3379 C  CA    . GLU C 3 348 ? -6.674  29.012  20.875  1.00 63.09 ? 522  GLU A CA    1 
ATOM   3380 C  C     . GLU C 3 348 ? -6.191  27.883  21.778  1.00 61.72 ? 522  GLU A C     1 
ATOM   3381 O  O     . GLU C 3 348 ? -6.600  26.725  21.614  1.00 61.15 ? 522  GLU A O     1 
ATOM   3382 C  CB    . GLU C 3 348 ? -8.136  29.334  21.190  1.00 64.32 ? 522  GLU A CB    1 
ATOM   3383 N  N     . TYR C 3 349 ? -5.393  28.256  22.781  1.00 60.41 ? 523  TYR A N     1 
ATOM   3384 C  CA    . TYR C 3 349 ? -4.798  27.331  23.756  1.00 57.22 ? 523  TYR A CA    1 
ATOM   3385 C  C     . TYR C 3 349 ? -3.679  26.525  23.086  1.00 51.75 ? 523  TYR A C     1 
ATOM   3386 O  O     . TYR C 3 349 ? -3.687  25.294  23.053  1.00 47.82 ? 523  TYR A O     1 
ATOM   3387 C  CB    . TYR C 3 349 ? -5.864  26.413  24.401  1.00 63.98 ? 523  TYR A CB    1 
ATOM   3388 C  CG    . TYR C 3 349 ? -6.902  27.151  25.240  1.00 65.52 ? 523  TYR A CG    1 
ATOM   3389 C  CD1   . TYR C 3 349 ? -6.518  27.934  26.335  1.00 67.04 ? 523  TYR A CD1   1 
ATOM   3390 C  CD2   . TYR C 3 349 ? -8.252  27.106  24.911  1.00 68.18 ? 523  TYR A CD2   1 
ATOM   3391 C  CE1   . TYR C 3 349 ? -7.449  28.658  27.071  1.00 64.98 ? 523  TYR A CE1   1 
ATOM   3392 C  CE2   . TYR C 3 349 ? -9.191  27.825  25.640  1.00 70.95 ? 523  TYR A CE2   1 
ATOM   3393 C  CZ    . TYR C 3 349 ? -8.782  28.598  26.715  1.00 71.17 ? 523  TYR A CZ    1 
ATOM   3394 O  OH    . TYR C 3 349 ? -9.731  29.302  27.413  1.00 76.81 ? 523  TYR A OH    1 
ATOM   3395 N  N     . VAL C 3 350 ? -2.691  27.252  22.583  1.00 45.28 ? 524  VAL A N     1 
ATOM   3396 C  CA    . VAL C 3 350 ? -1.577  26.651  21.886  1.00 39.19 ? 524  VAL A CA    1 
ATOM   3397 C  C     . VAL C 3 350 ? -0.310  26.563  22.704  1.00 39.00 ? 524  VAL A C     1 
ATOM   3398 O  O     . VAL C 3 350 ? 0.224   27.565  23.192  1.00 37.09 ? 524  VAL A O     1 
ATOM   3399 C  CB    . VAL C 3 350 ? -1.278  27.427  20.615  1.00 40.85 ? 524  VAL A CB    1 
ATOM   3400 C  CG1   . VAL C 3 350 ? -0.257  26.692  19.765  1.00 40.34 ? 524  VAL A CG1   1 
ATOM   3401 C  CG2   . VAL C 3 350 ? -2.563  27.630  19.847  1.00 38.07 ? 524  VAL A CG2   1 
ATOM   3402 N  N     . VAL C 3 351 ? 0.154   25.332  22.864  1.00 39.79 ? 525  VAL A N     1 
ATOM   3403 C  CA    . VAL C 3 351 ? 1.371   25.044  23.586  1.00 35.98 ? 525  VAL A CA    1 
ATOM   3404 C  C     . VAL C 3 351 ? 2.400   24.868  22.513  1.00 34.65 ? 525  VAL A C     1 
ATOM   3405 O  O     . VAL C 3 351 ? 2.210   24.067  21.603  1.00 33.31 ? 525  VAL A O     1 
ATOM   3406 C  CB    . VAL C 3 351 ? 1.253   23.733  24.341  1.00 41.41 ? 525  VAL A CB    1 
ATOM   3407 C  CG1   . VAL C 3 351 ? 2.577   23.413  25.030  1.00 41.22 ? 525  VAL A CG1   1 
ATOM   3408 C  CG2   . VAL C 3 351 ? 0.094   23.815  25.351  1.00 40.55 ? 525  VAL A CG2   1 
ATOM   3409 N  N     . GLU C 3 352 ? 3.481   25.628  22.598  1.00 39.67 ? 526  GLU A N     1 
ATOM   3410 C  CA    . GLU C 3 352 ? 4.530   25.537  21.596  1.00 44.52 ? 526  GLU A CA    1 
ATOM   3411 C  C     . GLU C 3 352 ? 5.757   24.832  22.158  1.00 42.72 ? 526  GLU A C     1 
ATOM   3412 O  O     . GLU C 3 352 ? 6.403   25.344  23.075  1.00 44.87 ? 526  GLU A O     1 
ATOM   3413 C  CB    . GLU C 3 352 ? 4.902   26.933  21.096  1.00 49.68 ? 526  GLU A CB    1 
ATOM   3414 C  CG    . GLU C 3 352 ? 5.961   26.949  20.011  1.00 62.12 ? 526  GLU A CG    1 
ATOM   3415 C  CD    . GLU C 3 352 ? 7.062   27.954  20.316  1.00 72.56 ? 526  GLU A CD    1 
ATOM   3416 O  OE1   . GLU C 3 352 ? 6.730   29.105  20.687  1.00 77.25 ? 526  GLU A OE1   1 
ATOM   3417 O  OE2   . GLU C 3 352 ? 8.258   27.589  20.209  1.00 76.69 ? 526  GLU A OE2   1 
ATOM   3418 N  N     . PHE C 3 353 ? 6.036   23.639  21.631  1.00 38.82 ? 527  PHE A N     1 
ATOM   3419 C  CA    . PHE C 3 353 ? 7.192   22.843  22.049  1.00 32.35 ? 527  PHE A CA    1 
ATOM   3420 C  C     . PHE C 3 353 ? 8.421   23.146  21.196  1.00 26.25 ? 527  PHE A C     1 
ATOM   3421 O  O     . PHE C 3 353 ? 8.361   23.211  19.984  1.00 31.48 ? 527  PHE A O     1 
ATOM   3422 C  CB    . PHE C 3 353 ? 6.912   21.344  21.910  1.00 30.61 ? 527  PHE A CB    1 
ATOM   3423 C  CG    . PHE C 3 353 ? 5.776   20.841  22.743  1.00 30.60 ? 527  PHE A CG    1 
ATOM   3424 C  CD1   . PHE C 3 353 ? 4.468   20.871  22.255  1.00 29.17 ? 527  PHE A CD1   1 
ATOM   3425 C  CD2   . PHE C 3 353 ? 6.020   20.280  24.001  1.00 28.83 ? 527  PHE A CD2   1 
ATOM   3426 C  CE1   . PHE C 3 353 ? 3.406   20.339  23.015  1.00 31.32 ? 527  PHE A CE1   1 
ATOM   3427 C  CE2   . PHE C 3 353 ? 4.974   19.746  24.770  1.00 25.10 ? 527  PHE A CE2   1 
ATOM   3428 C  CZ    . PHE C 3 353 ? 3.665   19.776  24.278  1.00 29.73 ? 527  PHE A CZ    1 
ATOM   3429 N  N     . ASP C 3 354 ? 9.554   23.294  21.833  1.00 27.67 ? 528  ASP A N     1 
ATOM   3430 C  CA    . ASP C 3 354 ? 10.771  23.525  21.102  1.00 36.16 ? 528  ASP A CA    1 
ATOM   3431 C  C     . ASP C 3 354 ? 11.878  22.947  21.974  1.00 38.49 ? 528  ASP A C     1 
ATOM   3432 O  O     . ASP C 3 354 ? 12.172  23.483  23.054  1.00 37.64 ? 528  ASP A O     1 
ATOM   3433 C  CB    . ASP C 3 354 ? 10.988  25.013  20.832  1.00 41.77 ? 528  ASP A CB    1 
ATOM   3434 C  CG    . ASP C 3 354 ? 12.040  25.268  19.733  1.00 48.55 ? 528  ASP A CG    1 
ATOM   3435 O  OD1   . ASP C 3 354 ? 12.819  24.342  19.394  1.00 49.90 ? 528  ASP A OD1   1 
ATOM   3436 O  OD2   . ASP C 3 354 ? 12.081  26.401  19.195  1.00 52.76 ? 528  ASP A OD2   1 
ATOM   3437 N  N     . PHE C 3 355 ? 12.387  21.781  21.555  1.00 42.68 ? 529  PHE A N     1 
ATOM   3438 C  CA    . PHE C 3 355 ? 13.458  21.051  22.258  1.00 40.12 ? 529  PHE A CA    1 
ATOM   3439 C  C     . PHE C 3 355 ? 14.197  20.028  21.369  1.00 38.84 ? 529  PHE A C     1 
ATOM   3440 O  O     . PHE C 3 355 ? 13.769  19.736  20.244  1.00 39.81 ? 529  PHE A O     1 
ATOM   3441 C  CB    . PHE C 3 355 ? 12.913  20.364  23.547  1.00 35.99 ? 529  PHE A CB    1 
ATOM   3442 C  CG    . PHE C 3 355 ? 11.932  19.226  23.305  1.00 30.12 ? 529  PHE A CG    1 
ATOM   3443 C  CD1   . PHE C 3 355 ? 10.563  19.470  23.218  1.00 29.30 ? 529  PHE A CD1   1 
ATOM   3444 C  CD2   . PHE C 3 355 ? 12.378  17.896  23.237  1.00 30.34 ? 529  PHE A CD2   1 
ATOM   3445 C  CE1   . PHE C 3 355 ? 9.645   18.407  23.073  1.00 32.55 ? 529  PHE A CE1   1 
ATOM   3446 C  CE2   . PHE C 3 355 ? 11.471  16.818  23.090  1.00 26.95 ? 529  PHE A CE2   1 
ATOM   3447 C  CZ    . PHE C 3 355 ? 10.105  17.070  23.009  1.00 25.95 ? 529  PHE A CZ    1 
ATOM   3448 N  N     . LEU C 3 356 ? 15.320  19.509  21.871  1.00 38.40 ? 530  LEU A N     1 
ATOM   3449 C  CA    . LEU C 3 356 ? 16.101  18.517  21.136  1.00 34.77 ? 530  LEU A CA    1 
ATOM   3450 C  C     . LEU C 3 356 ? 15.840  17.166  21.740  1.00 32.00 ? 530  LEU A C     1 
ATOM   3451 O  O     . LEU C 3 356 ? 16.126  16.940  22.913  1.00 29.42 ? 530  LEU A O     1 
ATOM   3452 C  CB    . LEU C 3 356 ? 17.588  18.832  21.192  1.00 31.48 ? 530  LEU A CB    1 
ATOM   3453 C  CG    . LEU C 3 356 ? 17.939  20.178  20.570  1.00 30.25 ? 530  LEU A CG    1 
ATOM   3454 C  CD1   . LEU C 3 356 ? 19.391  20.392  20.791  1.00 38.97 ? 530  LEU A CD1   1 
ATOM   3455 C  CD2   . LEU C 3 356 ? 17.614  20.240  19.082  1.00 24.53 ? 530  LEU A CD2   1 
ATOM   3456 N  N     . GLY C 3 357 ? 15.189  16.320  20.967  1.00 33.34 ? 531  GLY A N     1 
ATOM   3457 C  CA    . GLY C 3 357 ? 14.880  14.986  21.427  1.00 37.61 ? 531  GLY A CA    1 
ATOM   3458 C  C     . GLY C 3 357 ? 16.118  14.131  21.309  1.00 38.58 ? 531  GLY A C     1 
ATOM   3459 O  O     . GLY C 3 357 ? 17.233  14.676  21.229  1.00 32.60 ? 531  GLY A O     1 
ATOM   3460 N  N     . LYS C 3 358 ? 15.916  12.808  21.286  1.00 41.23 ? 532  LYS A N     1 
ATOM   3461 C  CA    . LYS C 3 358 ? 16.984  11.815  21.173  1.00 42.33 ? 532  LYS A CA    1 
ATOM   3462 C  C     . LYS C 3 358 ? 17.874  12.156  19.987  1.00 41.04 ? 532  LYS A C     1 
ATOM   3463 O  O     . LYS C 3 358 ? 17.385  12.586  18.958  1.00 43.09 ? 532  LYS A O     1 
ATOM   3464 C  CB    . LYS C 3 358 ? 16.380  10.419  21.003  1.00 41.76 ? 532  LYS A CB    1 
ATOM   3465 C  CG    . LYS C 3 358 ? 17.396  9.315   20.882  1.00 39.78 ? 532  LYS A CG    1 
ATOM   3466 C  CD    . LYS C 3 358 ? 16.724  7.989   20.685  1.00 38.31 ? 532  LYS A CD    1 
ATOM   3467 C  CE    . LYS C 3 358 ? 17.740  6.904   20.355  1.00 41.34 ? 532  LYS A CE    1 
ATOM   3468 N  NZ    . LYS C 3 358 ? 17.076  5.572   20.271  1.00 43.53 ? 532  LYS A NZ    1 
ATOM   3469 N  N     . ASP C 3 359 ? 19.181  11.947  20.130  1.00 44.86 ? 533  ASP A N     1 
ATOM   3470 C  CA    . ASP C 3 359 ? 20.157  12.260  19.074  1.00 47.15 ? 533  ASP A CA    1 
ATOM   3471 C  C     . ASP C 3 359 ? 20.239  13.763  18.791  1.00 46.14 ? 533  ASP A C     1 
ATOM   3472 O  O     . ASP C 3 359 ? 20.710  14.175  17.731  1.00 49.78 ? 533  ASP A O     1 
ATOM   3473 C  CB    . ASP C 3 359 ? 19.825  11.537  17.760  1.00 54.48 ? 533  ASP A CB    1 
ATOM   3474 C  CG    . ASP C 3 359 ? 19.853  10.034  17.891  1.00 66.88 ? 533  ASP A CG    1 
ATOM   3475 O  OD1   . ASP C 3 359 ? 20.965  9.472   17.921  1.00 71.53 ? 533  ASP A OD1   1 
ATOM   3476 O  OD2   . ASP C 3 359 ? 18.765  9.415   17.955  1.00 75.77 ? 533  ASP A OD2   1 
ATOM   3477 N  N     . SER C 3 360 ? 19.731  14.576  19.711  1.00 42.33 ? 534  SER A N     1 
ATOM   3478 C  CA    . SER C 3 360 ? 19.753  16.016  19.552  1.00 35.07 ? 534  SER A CA    1 
ATOM   3479 C  C     . SER C 3 360 ? 18.978  16.500  18.355  1.00 32.96 ? 534  SER A C     1 
ATOM   3480 O  O     . SER C 3 360 ? 19.223  17.591  17.832  1.00 34.02 ? 534  SER A O     1 
ATOM   3481 C  CB    . SER C 3 360 ? 21.181  16.522  19.515  1.00 35.28 ? 534  SER A CB    1 
ATOM   3482 O  OG    . SER C 3 360 ? 21.749  16.437  20.816  1.00 40.81 ? 534  SER A OG    1 
ATOM   3483 N  N     . ILE C 3 361 ? 18.075  15.654  17.893  1.00 26.85 ? 535  ILE A N     1 
ATOM   3484 C  CA    . ILE C 3 361 ? 17.203  15.996  16.796  1.00 30.06 ? 535  ILE A CA    1 
ATOM   3485 C  C     . ILE C 3 361 ? 16.148  16.939  17.389  1.00 32.34 ? 535  ILE A C     1 
ATOM   3486 O  O     . ILE C 3 361 ? 15.691  16.767  18.511  1.00 33.10 ? 535  ILE A O     1 
ATOM   3487 C  CB    . ILE C 3 361 ? 16.525  14.735  16.219  1.00 31.87 ? 535  ILE A CB    1 
ATOM   3488 C  CG1   . ILE C 3 361 ? 17.566  13.836  15.546  1.00 33.47 ? 535  ILE A CG1   1 
ATOM   3489 C  CG2   . ILE C 3 361 ? 15.451  15.113  15.217  1.00 30.29 ? 535  ILE A CG2   1 
ATOM   3490 C  CD1   . ILE C 3 361 ? 16.984  12.585  14.932  1.00 31.75 ? 535  ILE A CD1   1 
ATOM   3491 N  N     . ARG C 3 362 ? 15.807  17.971  16.647  1.00 34.95 ? 536  ARG A N     1 
ATOM   3492 C  CA    . ARG C 3 362 ? 14.836  18.936  17.128  1.00 37.81 ? 536  ARG A CA    1 
ATOM   3493 C  C     . ARG C 3 362 ? 13.381  18.572  16.939  1.00 35.75 ? 536  ARG A C     1 
ATOM   3494 O  O     . ARG C 3 362 ? 12.961  18.223  15.834  1.00 37.05 ? 536  ARG A O     1 
ATOM   3495 C  CB    . ARG C 3 362 ? 15.077  20.268  16.436  1.00 45.27 ? 536  ARG A CB    1 
ATOM   3496 C  CG    . ARG C 3 362 ? 14.115  21.355  16.820  1.00 50.48 ? 536  ARG A CG    1 
ATOM   3497 C  CD    . ARG C 3 362 ? 14.408  22.571  16.008  1.00 59.59 ? 536  ARG A CD    1 
ATOM   3498 N  NE    . ARG C 3 362 ? 13.919  23.778  16.659  1.00 74.63 ? 536  ARG A NE    1 
ATOM   3499 C  CZ    . ARG C 3 362 ? 13.543  24.875  16.009  1.00 78.21 ? 536  ARG A CZ    1 
ATOM   3500 N  NH1   . ARG C 3 362 ? 13.595  24.914  14.685  1.00 82.06 ? 536  ARG A NH1   1 
ATOM   3501 N  NH2   . ARG C 3 362 ? 13.119  25.936  16.685  1.00 82.24 ? 536  ARG A NH2   1 
ATOM   3502 N  N     . TYR C 3 363 ? 12.605  18.724  18.007  1.00 33.06 ? 537  TYR A N     1 
ATOM   3503 C  CA    . TYR C 3 363 ? 11.172  18.494  17.924  1.00 30.42 ? 537  TYR A CA    1 
ATOM   3504 C  C     . TYR C 3 363 ? 10.522  19.864  18.078  1.00 29.68 ? 537  TYR A C     1 
ATOM   3505 O  O     . TYR C 3 363 ? 10.536  20.447  19.154  1.00 31.32 ? 537  TYR A O     1 
ATOM   3506 C  CB    . TYR C 3 363 ? 10.656  17.548  19.017  1.00 24.20 ? 537  TYR A CB    1 
ATOM   3507 C  CG    . TYR C 3 363 ? 9.139   17.380  18.976  1.00 27.30 ? 537  TYR A CG    1 
ATOM   3508 C  CD1   . TYR C 3 363 ? 8.292   18.307  19.582  1.00 30.77 ? 537  TYR A CD1   1 
ATOM   3509 C  CD2   . TYR C 3 363 ? 8.548   16.323  18.288  1.00 26.54 ? 537  TYR A CD2   1 
ATOM   3510 C  CE1   . TYR C 3 363 ? 6.885   18.192  19.502  1.00 27.66 ? 537  TYR A CE1   1 
ATOM   3511 C  CE2   . TYR C 3 363 ? 7.149   16.201  18.204  1.00 28.71 ? 537  TYR A CE2   1 
ATOM   3512 C  CZ    . TYR C 3 363 ? 6.328   17.139  18.814  1.00 26.20 ? 537  TYR A CZ    1 
ATOM   3513 O  OH    . TYR C 3 363 ? 4.955   17.012  18.750  1.00 30.28 ? 537  TYR A OH    1 
ATOM   3514 N  N     . TYR C 3 364 ? 10.018  20.426  16.992  1.00 34.71 ? 538  TYR A N     1 
ATOM   3515 C  CA    . TYR C 3 364 ? 9.361   21.722  17.108  1.00 35.00 ? 538  TYR A CA    1 
ATOM   3516 C  C     . TYR C 3 364 ? 7.904   21.516  16.763  1.00 34.85 ? 538  TYR A C     1 
ATOM   3517 O  O     . TYR C 3 364 ? 7.608   20.782  15.830  1.00 41.09 ? 538  TYR A O     1 
ATOM   3518 C  CB    . TYR C 3 364 ? 9.962   22.754  16.157  1.00 36.79 ? 538  TYR A CB    1 
ATOM   3519 C  CG    . TYR C 3 364 ? 9.284   24.080  16.322  1.00 44.62 ? 538  TYR A CG    1 
ATOM   3520 C  CD1   . TYR C 3 364 ? 8.062   24.336  15.704  1.00 49.29 ? 538  TYR A CD1   1 
ATOM   3521 C  CD2   . TYR C 3 364 ? 9.782   25.030  17.203  1.00 45.80 ? 538  TYR A CD2   1 
ATOM   3522 C  CE1   . TYR C 3 364 ? 7.343   25.494  15.972  1.00 53.43 ? 538  TYR A CE1   1 
ATOM   3523 C  CE2   . TYR C 3 364 ? 9.072   26.193  17.475  1.00 51.74 ? 538  TYR A CE2   1 
ATOM   3524 C  CZ    . TYR C 3 364 ? 7.854   26.417  16.860  1.00 53.79 ? 538  TYR A CZ    1 
ATOM   3525 O  OH    . TYR C 3 364 ? 7.143   27.560  17.150  1.00 59.47 ? 538  TYR A OH    1 
ATOM   3526 N  N     . ASN C 3 365 ? 6.999   22.160  17.485  1.00 29.15 ? 539  ASN A N     1 
ATOM   3527 C  CA    . ASN C 3 365 ? 5.590   21.999  17.172  1.00 32.24 ? 539  ASN A CA    1 
ATOM   3528 C  C     . ASN C 3 365 ? 4.712   22.916  17.995  1.00 34.00 ? 539  ASN A C     1 
ATOM   3529 O  O     . ASN C 3 365 ? 5.082   23.307  19.095  1.00 35.23 ? 539  ASN A O     1 
ATOM   3530 C  CB    . ASN C 3 365 ? 5.161   20.544  17.366  1.00 34.19 ? 539  ASN A CB    1 
ATOM   3531 C  CG    . ASN C 3 365 ? 3.793   20.235  16.745  1.00 38.50 ? 539  ASN A CG    1 
ATOM   3532 O  OD1   . ASN C 3 365 ? 3.301   20.956  15.869  1.00 43.11 ? 539  ASN A OD1   1 
ATOM   3533 N  ND2   . ASN C 3 365 ? 3.199   19.129  17.171  1.00 37.18 ? 539  ASN A ND2   1 
ATOM   3534 N  N     . LYS C 3 366 ? 3.600   23.336  17.388  1.00 37.24 ? 540  LYS A N     1 
ATOM   3535 C  CA    . LYS C 3 366 ? 2.583   24.202  18.006  1.00 41.09 ? 540  LYS A CA    1 
ATOM   3536 C  C     . LYS C 3 366 ? 1.337   23.333  18.095  1.00 41.60 ? 540  LYS A C     1 
ATOM   3537 O  O     . LYS C 3 366 ? 0.752   22.949  17.074  1.00 42.60 ? 540  LYS A O     1 
ATOM   3538 C  CB    . LYS C 3 366 ? 2.315   25.425  17.132  1.00 45.80 ? 540  LYS A CB    1 
ATOM   3539 C  CG    . LYS C 3 366 ? 3.491   26.380  17.088  1.00 55.62 ? 540  LYS A CG    1 
ATOM   3540 C  CD    . LYS C 3 366 ? 3.442   27.275  15.863  1.00 64.97 ? 540  LYS A CD    1 
ATOM   3541 C  CE    . LYS C 3 366 ? 3.958   26.582  14.595  1.00 69.16 ? 540  LYS A CE    1 
ATOM   3542 N  NZ    . LYS C 3 366 ? 3.032   25.571  13.993  1.00 75.49 ? 540  LYS A NZ    1 
ATOM   3543 N  N     . VAL C 3 367 ? 0.923   23.030  19.317  1.00 38.38 ? 541  VAL A N     1 
ATOM   3544 C  CA    . VAL C 3 367 ? -0.196  22.138  19.509  1.00 38.12 ? 541  VAL A CA    1 
ATOM   3545 C  C     . VAL C 3 367 ? -1.392  22.772  20.181  1.00 39.17 ? 541  VAL A C     1 
ATOM   3546 O  O     . VAL C 3 367 ? -1.285  23.409  21.222  1.00 37.44 ? 541  VAL A O     1 
ATOM   3547 C  CB    . VAL C 3 367 ? 0.230   20.909  20.354  1.00 43.43 ? 541  VAL A CB    1 
ATOM   3548 C  CG1   . VAL C 3 367 ? -0.810  19.820  20.272  1.00 45.91 ? 541  VAL A CG1   1 
ATOM   3549 C  CG2   . VAL C 3 367 ? 1.581   20.385  19.921  1.00 39.92 ? 541  VAL A CG2   1 
ATOM   3550 N  N     . PRO C 3 368 ? -2.546  22.676  19.539  1.00 40.64 ? 542  PRO A N     1 
ATOM   3551 C  CA    . PRO C 3 368 ? -3.758  23.249  20.122  1.00 42.33 ? 542  PRO A CA    1 
ATOM   3552 C  C     . PRO C 3 368 ? -4.281  22.254  21.162  1.00 42.42 ? 542  PRO A C     1 
ATOM   3553 O  O     . PRO C 3 368 ? -4.838  21.220  20.815  1.00 40.30 ? 542  PRO A O     1 
ATOM   3554 C  CB    . PRO C 3 368 ? -4.700  23.358  18.921  1.00 42.76 ? 542  PRO A CB    1 
ATOM   3555 C  CG    . PRO C 3 368 ? -3.742  23.394  17.712  1.00 43.01 ? 542  PRO A CG    1 
ATOM   3556 C  CD    . PRO C 3 368 ? -2.724  22.374  18.107  1.00 41.25 ? 542  PRO A CD    1 
ATOM   3557 N  N     . VAL C 3 369 ? -4.072  22.553  22.440  1.00 44.58 ? 543  VAL A N     1 
ATOM   3558 C  CA    . VAL C 3 369 ? -4.522  21.668  23.511  1.00 45.30 ? 543  VAL A CA    1 
ATOM   3559 C  C     . VAL C 3 369 ? -5.865  22.053  24.153  1.00 52.68 ? 543  VAL A C     1 
ATOM   3560 O  O     . VAL C 3 369 ? -6.404  23.146  23.929  1.00 57.78 ? 543  VAL A O     1 
ATOM   3561 C  CB    . VAL C 3 369 ? -3.473  21.578  24.611  1.00 40.39 ? 543  VAL A CB    1 
ATOM   3562 C  CG1   . VAL C 3 369 ? -2.159  21.101  24.029  1.00 41.46 ? 543  VAL A CG1   1 
ATOM   3563 C  CG2   . VAL C 3 369 ? -3.315  22.934  25.295  1.00 36.11 ? 543  VAL A CG2   1 
ATOM   3564 N  N     . GLU C 3 370 ? -6.406  21.140  24.954  1.00 54.80 ? 544  GLU A N     1 
ATOM   3565 C  CA    . GLU C 3 370 ? -7.671  21.361  25.639  1.00 51.97 ? 544  GLU A CA    1 
ATOM   3566 C  C     . GLU C 3 370 ? -7.438  22.304  26.816  1.00 50.18 ? 544  GLU A C     1 
ATOM   3567 O  O     . GLU C 3 370 ? -6.502  22.110  27.590  1.00 50.62 ? 544  GLU A O     1 
ATOM   3568 C  CB    . GLU C 3 370 ? -8.251  20.016  26.095  1.00 53.99 ? 544  GLU A CB    1 
ATOM   3569 C  CG    . GLU C 3 370 ? -8.537  19.059  24.928  1.00 55.77 ? 544  GLU A CG    1 
ATOM   3570 C  CD    . GLU C 3 370 ? -8.930  17.660  25.381  1.00 57.89 ? 544  GLU A CD    1 
ATOM   3571 O  OE1   . GLU C 3 370 ? -10.079 17.478  25.826  1.00 56.35 ? 544  GLU A OE1   1 
ATOM   3572 O  OE2   . GLU C 3 370 ? -8.092  16.739  25.280  1.00 60.03 ? 544  GLU A OE2   1 
ATOM   3573 N  N     . LYS C 3 371 ? -8.259  23.352  26.885  1.00 50.63 ? 545  LYS A N     1 
ATOM   3574 C  CA    . LYS C 3 371 ? -8.194  24.386  27.926  1.00 51.03 ? 545  LYS A CA    1 
ATOM   3575 C  C     . LYS C 3 371 ? -7.652  23.937  29.274  1.00 48.37 ? 545  LYS A C     1 
ATOM   3576 O  O     . LYS C 3 371 ? -6.701  24.543  29.773  1.00 44.80 ? 545  LYS A O     1 
ATOM   3577 C  CB    . LYS C 3 371 ? -9.569  25.052  28.137  1.00 44.57 ? 545  LYS A CB    1 
ATOM   3578 N  N     . ARG C 3 372 ? -8.268  22.903  29.857  1.00 45.76 ? 546  ARG A N     1 
ATOM   3579 C  CA    . ARG C 3 372 ? -7.873  22.387  31.171  1.00 43.78 ? 546  ARG A CA    1 
ATOM   3580 C  C     . ARG C 3 372 ? -6.398  22.020  31.223  1.00 42.56 ? 546  ARG A C     1 
ATOM   3581 O  O     . ARG C 3 372 ? -5.717  22.248  32.218  1.00 42.73 ? 546  ARG A O     1 
ATOM   3582 C  CB    . ARG C 3 372 ? -8.738  21.186  31.571  1.00 46.37 ? 546  ARG A CB    1 
ATOM   3583 N  N     . VAL C 3 373 ? -5.904  21.445  30.137  1.00 38.24 ? 547  VAL A N     1 
ATOM   3584 C  CA    . VAL C 3 373 ? -4.519  21.072  30.067  1.00 34.08 ? 547  VAL A CA    1 
ATOM   3585 C  C     . VAL C 3 373 ? -3.661  22.317  29.911  1.00 34.04 ? 547  VAL A C     1 
ATOM   3586 O  O     . VAL C 3 373 ? -2.617  22.452  30.552  1.00 36.33 ? 547  VAL A O     1 
ATOM   3587 C  CB    . VAL C 3 373 ? -4.314  20.067  28.931  1.00 37.89 ? 547  VAL A CB    1 
ATOM   3588 C  CG1   . VAL C 3 373 ? -2.964  20.261  28.224  1.00 34.81 ? 547  VAL A CG1   1 
ATOM   3589 C  CG2   . VAL C 3 373 ? -4.401  18.689  29.515  1.00 36.93 ? 547  VAL A CG2   1 
ATOM   3590 N  N     . PHE C 3 374 ? -4.102  23.231  29.063  1.00 35.63 ? 548  PHE A N     1 
ATOM   3591 C  CA    . PHE C 3 374 ? -3.367  24.467  28.846  1.00 38.09 ? 548  PHE A CA    1 
ATOM   3592 C  C     . PHE C 3 374 ? -3.148  25.198  30.171  1.00 40.70 ? 548  PHE A C     1 
ATOM   3593 O  O     . PHE C 3 374 ? -2.067  25.725  30.429  1.00 42.96 ? 548  PHE A O     1 
ATOM   3594 C  CB    . PHE C 3 374 ? -4.146  25.357  27.881  1.00 42.63 ? 548  PHE A CB    1 
ATOM   3595 C  CG    . PHE C 3 374 ? -3.529  26.707  27.670  1.00 41.20 ? 548  PHE A CG    1 
ATOM   3596 C  CD1   . PHE C 3 374 ? -3.833  27.764  28.519  1.00 40.35 ? 548  PHE A CD1   1 
ATOM   3597 C  CD2   . PHE C 3 374 ? -2.642  26.921  26.624  1.00 45.35 ? 548  PHE A CD2   1 
ATOM   3598 C  CE1   . PHE C 3 374 ? -3.267  29.008  28.330  1.00 43.16 ? 548  PHE A CE1   1 
ATOM   3599 C  CE2   . PHE C 3 374 ? -2.062  28.178  26.421  1.00 46.94 ? 548  PHE A CE2   1 
ATOM   3600 C  CZ    . PHE C 3 374 ? -2.376  29.223  27.278  1.00 46.76 ? 548  PHE A CZ    1 
ATOM   3601 N  N     . LYS C 3 375 ? -4.209  25.259  30.974  1.00 44.53 ? 549  LYS A N     1 
ATOM   3602 C  CA    . LYS C 3 375 ? -4.196  25.913  32.286  1.00 42.76 ? 549  LYS A CA    1 
ATOM   3603 C  C     . LYS C 3 375 ? -3.300  25.192  33.280  1.00 38.44 ? 549  LYS A C     1 
ATOM   3604 O  O     . LYS C 3 375 ? -2.573  25.824  34.057  1.00 34.73 ? 549  LYS A O     1 
ATOM   3605 C  CB    . LYS C 3 375 ? -5.619  26.013  32.852  1.00 48.38 ? 549  LYS A CB    1 
ATOM   3606 C  CG    . LYS C 3 375 ? -6.494  27.042  32.144  1.00 57.94 ? 549  LYS A CG    1 
ATOM   3607 C  CD    . LYS C 3 375 ? -5.830  28.409  32.167  1.00 63.11 ? 549  LYS A CD    1 
ATOM   3608 C  CE    . LYS C 3 375 ? -6.671  29.479  31.509  1.00 66.68 ? 549  LYS A CE    1 
ATOM   3609 N  NZ    . LYS C 3 375 ? -5.917  30.776  31.503  1.00 73.66 ? 549  LYS A NZ    1 
ATOM   3610 N  N     . ASN C 3 376 ? -3.412  23.871  33.311  1.00 35.86 ? 550  ASN A N     1 
ATOM   3611 C  CA    . ASN C 3 376 ? -2.579  23.081  34.205  1.00 32.46 ? 550  ASN A CA    1 
ATOM   3612 C  C     . ASN C 3 376 ? -1.145  23.459  33.867  1.00 30.68 ? 550  ASN A C     1 
ATOM   3613 O  O     . ASN C 3 376 ? -0.352  23.738  34.761  1.00 29.98 ? 550  ASN A O     1 
ATOM   3614 C  CB    . ASN C 3 376 ? -2.790  21.572  33.986  1.00 31.17 ? 550  ASN A CB    1 
ATOM   3615 C  CG    . ASN C 3 376 ? -3.973  21.018  34.767  1.00 29.19 ? 550  ASN A CG    1 
ATOM   3616 O  OD1   . ASN C 3 376 ? -4.241  21.449  35.889  1.00 39.64 ? 550  ASN A OD1   1 
ATOM   3617 N  ND2   . ASN C 3 376 ? -4.647  20.018  34.203  1.00 28.01 ? 550  ASN A ND2   1 
ATOM   3618 N  N     . LEU C 3 377 ? -0.839  23.534  32.575  1.00 27.96 ? 551  LEU A N     1 
ATOM   3619 C  CA    . LEU C 3 377 ? 0.506   23.874  32.151  1.00 29.78 ? 551  LEU A CA    1 
ATOM   3620 C  C     . LEU C 3 377 ? 0.976   25.205  32.691  1.00 33.95 ? 551  LEU A C     1 
ATOM   3621 O  O     . LEU C 3 377 ? 2.173   25.387  32.915  1.00 36.74 ? 551  LEU A O     1 
ATOM   3622 C  CB    . LEU C 3 377 ? 0.646   23.828  30.636  1.00 30.38 ? 551  LEU A CB    1 
ATOM   3623 C  CG    . LEU C 3 377 ? 0.785   22.432  30.022  1.00 25.94 ? 551  LEU A CG    1 
ATOM   3624 C  CD1   . LEU C 3 377 ? 0.850   22.609  28.530  1.00 20.73 ? 551  LEU A CD1   1 
ATOM   3625 C  CD2   . LEU C 3 377 ? 2.011   21.698  30.535  1.00 24.04 ? 551  LEU A CD2   1 
ATOM   3626 N  N     . GLN C 3 378 ? 0.054   26.134  32.909  1.00 36.48 ? 552  GLN A N     1 
ATOM   3627 C  CA    . GLN C 3 378 ? 0.430   27.436  33.455  1.00 40.01 ? 552  GLN A CA    1 
ATOM   3628 C  C     . GLN C 3 378 ? 0.668   27.292  34.945  1.00 39.28 ? 552  GLN A C     1 
ATOM   3629 O  O     . GLN C 3 378 ? 1.527   27.949  35.524  1.00 44.33 ? 552  GLN A O     1 
ATOM   3630 C  CB    . GLN C 3 378 ? -0.674  28.454  33.238  1.00 44.73 ? 552  GLN A CB    1 
ATOM   3631 C  CG    . GLN C 3 378 ? -1.131  28.611  31.804  1.00 54.19 ? 552  GLN A CG    1 
ATOM   3632 C  CD    . GLN C 3 378 ? -2.132  29.740  31.659  1.00 57.14 ? 552  GLN A CD    1 
ATOM   3633 O  OE1   . GLN C 3 378 ? -3.232  29.570  31.112  1.00 55.30 ? 552  GLN A OE1   1 
ATOM   3634 N  NE2   . GLN C 3 378 ? -1.753  30.911  32.159  1.00 63.87 ? 552  GLN A NE2   1 
ATOM   3635 N  N     . LEU C 3 379 ? -0.141  26.449  35.567  1.00 38.77 ? 553  LEU A N     1 
ATOM   3636 C  CA    . LEU C 3 379 ? -0.057  26.176  36.996  1.00 38.79 ? 553  LEU A CA    1 
ATOM   3637 C  C     . LEU C 3 379 ? 1.305   25.576  37.308  1.00 36.63 ? 553  LEU A C     1 
ATOM   3638 O  O     . LEU C 3 379 ? 1.903   25.847  38.346  1.00 34.60 ? 553  LEU A O     1 
ATOM   3639 C  CB    . LEU C 3 379 ? -1.179  25.201  37.369  1.00 42.36 ? 553  LEU A CB    1 
ATOM   3640 C  CG    . LEU C 3 379 ? -1.451  24.707  38.784  1.00 45.31 ? 553  LEU A CG    1 
ATOM   3641 C  CD1   . LEU C 3 379 ? -1.569  25.872  39.765  1.00 48.43 ? 553  LEU A CD1   1 
ATOM   3642 C  CD2   . LEU C 3 379 ? -2.710  23.877  38.751  1.00 43.50 ? 553  LEU A CD2   1 
ATOM   3643 N  N     . PHE C 3 380 ? 1.788   24.760  36.388  1.00 37.21 ? 554  PHE A N     1 
ATOM   3644 C  CA    . PHE C 3 380 ? 3.076   24.107  36.525  1.00 38.10 ? 554  PHE A CA    1 
ATOM   3645 C  C     . PHE C 3 380 ? 4.260   25.034  36.276  1.00 42.66 ? 554  PHE A C     1 
ATOM   3646 O  O     . PHE C 3 380 ? 5.363   24.731  36.697  1.00 41.64 ? 554  PHE A O     1 
ATOM   3647 C  CB    . PHE C 3 380 ? 3.165   22.907  35.581  1.00 37.63 ? 554  PHE A CB    1 
ATOM   3648 C  CG    . PHE C 3 380 ? 2.122   21.846  35.837  1.00 33.22 ? 554  PHE A CG    1 
ATOM   3649 C  CD1   . PHE C 3 380 ? 1.526   21.717  37.085  1.00 29.18 ? 554  PHE A CD1   1 
ATOM   3650 C  CD2   . PHE C 3 380 ? 1.735   20.974  34.820  1.00 33.65 ? 554  PHE A CD2   1 
ATOM   3651 C  CE1   . PHE C 3 380 ? 0.557   20.737  37.327  1.00 33.69 ? 554  PHE A CE1   1 
ATOM   3652 C  CE2   . PHE C 3 380 ? 0.765   19.986  35.042  1.00 34.81 ? 554  PHE A CE2   1 
ATOM   3653 C  CZ    . PHE C 3 380 ? 0.175   19.869  36.304  1.00 36.52 ? 554  PHE A CZ    1 
ATOM   3654 N  N     . MET C 3 381 ? 4.040   26.162  35.602  1.00 48.04 ? 555  MET A N     1 
ATOM   3655 C  CA    . MET C 3 381 ? 5.137   27.103  35.315  1.00 49.59 ? 555  MET A CA    1 
ATOM   3656 C  C     . MET C 3 381 ? 5.379   28.151  36.380  1.00 48.71 ? 555  MET A C     1 
ATOM   3657 O  O     . MET C 3 381 ? 6.416   28.800  36.403  1.00 49.69 ? 555  MET A O     1 
ATOM   3658 C  CB    . MET C 3 381 ? 4.881   27.848  34.005  1.00 48.56 ? 555  MET A CB    1 
ATOM   3659 C  CG    . MET C 3 381 ? 4.433   26.957  32.906  1.00 45.70 ? 555  MET A CG    1 
ATOM   3660 S  SD    . MET C 3 381 ? 4.757   27.603  31.315  1.00 47.31 ? 555  MET A SD    1 
ATOM   3661 C  CE    . MET C 3 381 ? 4.433   26.233  30.447  1.00 45.79 ? 555  MET A CE    1 
ATOM   3662 N  N     . GLU C 3 382 ? 4.372   28.377  37.197  1.00 54.03 ? 556  GLU A N     1 
ATOM   3663 C  CA    . GLU C 3 382 ? 4.456   29.387  38.221  1.00 62.84 ? 556  GLU A CA    1 
ATOM   3664 C  C     . GLU C 3 382 ? 5.660   29.257  39.151  1.00 66.41 ? 556  GLU A C     1 
ATOM   3665 O  O     . GLU C 3 382 ? 6.000   28.158  39.595  1.00 71.08 ? 556  GLU A O     1 
ATOM   3666 C  CB    . GLU C 3 382 ? 3.153   29.400  39.020  1.00 63.73 ? 556  GLU A CB    1 
ATOM   3667 N  N     . ASN C 3 383 ? 6.296   30.401  39.419  1.00 68.97 ? 557  ASN A N     1 
ATOM   3668 C  CA    . ASN C 3 383 ? 7.453   30.525  40.324  1.00 67.45 ? 557  ASN A CA    1 
ATOM   3669 C  C     . ASN C 3 383 ? 8.701   29.724  39.932  1.00 66.49 ? 557  ASN A C     1 
ATOM   3670 O  O     . ASN C 3 383 ? 9.635   29.579  40.737  1.00 66.69 ? 557  ASN A O     1 
ATOM   3671 C  CB    . ASN C 3 383 ? 7.045   30.190  41.771  1.00 68.51 ? 557  ASN A CB    1 
ATOM   3672 C  CG    . ASN C 3 383 ? 5.797   30.947  42.227  1.00 70.11 ? 557  ASN A CG    1 
ATOM   3673 O  OD1   . ASN C 3 383 ? 5.670   32.159  42.030  1.00 66.89 ? 557  ASN A OD1   1 
ATOM   3674 N  ND2   . ASN C 3 383 ? 4.869   30.223  42.839  1.00 73.23 ? 557  ASN A ND2   1 
ATOM   3675 N  N     . LYS C 3 384 ? 8.731   29.239  38.692  1.00 62.98 ? 558  LYS A N     1 
ATOM   3676 C  CA    . LYS C 3 384 ? 9.857   28.455  38.200  1.00 57.89 ? 558  LYS A CA    1 
ATOM   3677 C  C     . LYS C 3 384 ? 10.781  29.244  37.284  1.00 56.30 ? 558  LYS A C     1 
ATOM   3678 O  O     . LYS C 3 384 ? 10.375  30.202  36.624  1.00 53.63 ? 558  LYS A O     1 
ATOM   3679 C  CB    . LYS C 3 384 ? 9.364   27.198  37.477  1.00 57.50 ? 558  LYS A CB    1 
ATOM   3680 C  CG    . LYS C 3 384 ? 8.775   26.131  38.389  1.00 57.34 ? 558  LYS A CG    1 
ATOM   3681 C  CD    . LYS C 3 384 ? 8.222   24.973  37.575  1.00 57.07 ? 558  LYS A CD    1 
ATOM   3682 C  CE    . LYS C 3 384 ? 7.496   23.967  38.452  1.00 58.86 ? 558  LYS A CE    1 
ATOM   3683 N  NZ    . LYS C 3 384 ? 6.775   22.917  37.666  1.00 54.27 ? 558  LYS A NZ    1 
ATOM   3684 N  N     . GLN C 3 385 ? 12.041  28.833  37.264  1.00 56.37 ? 559  GLN A N     1 
ATOM   3685 C  CA    . GLN C 3 385 ? 13.042  29.467  36.421  1.00 56.55 ? 559  GLN A CA    1 
ATOM   3686 C  C     . GLN C 3 385 ? 13.098  28.683  35.115  1.00 51.12 ? 559  GLN A C     1 
ATOM   3687 O  O     . GLN C 3 385 ? 12.716  27.521  35.081  1.00 50.47 ? 559  GLN A O     1 
ATOM   3688 C  CB    . GLN C 3 385 ? 14.402  29.448  37.126  1.00 64.03 ? 559  GLN A CB    1 
ATOM   3689 C  CG    . GLN C 3 385 ? 14.392  30.068  38.527  1.00 70.27 ? 559  GLN A CG    1 
ATOM   3690 C  CD    . GLN C 3 385 ? 13.875  31.505  38.550  1.00 72.07 ? 559  GLN A CD    1 
ATOM   3691 O  OE1   . GLN C 3 385 ? 14.134  32.288  37.630  1.00 74.45 ? 559  GLN A OE1   1 
ATOM   3692 N  NE2   . GLN C 3 385 ? 13.158  31.860  39.616  1.00 73.03 ? 559  GLN A NE2   1 
ATOM   3693 N  N     . PRO C 3 386 ? 13.587  29.301  34.027  1.00 49.00 ? 560  PRO A N     1 
ATOM   3694 C  CA    . PRO C 3 386 ? 13.682  28.634  32.720  1.00 48.98 ? 560  PRO A CA    1 
ATOM   3695 C  C     . PRO C 3 386 ? 14.315  27.243  32.770  1.00 45.82 ? 560  PRO A C     1 
ATOM   3696 O  O     . PRO C 3 386 ? 13.884  26.335  32.071  1.00 45.11 ? 560  PRO A O     1 
ATOM   3697 C  CB    . PRO C 3 386 ? 14.529  29.609  31.906  1.00 48.56 ? 560  PRO A CB    1 
ATOM   3698 C  CG    . PRO C 3 386 ? 14.112  30.938  32.461  1.00 48.09 ? 560  PRO A CG    1 
ATOM   3699 C  CD    . PRO C 3 386 ? 14.118  30.673  33.949  1.00 45.95 ? 560  PRO A CD    1 
ATOM   3700 N  N     . GLU C 3 387 ? 15.341  27.101  33.599  1.00 43.60 ? 561  GLU A N     1 
ATOM   3701 C  CA    . GLU C 3 387 ? 16.049  25.845  33.757  1.00 49.30 ? 561  GLU A CA    1 
ATOM   3702 C  C     . GLU C 3 387 ? 15.302  24.856  34.636  1.00 48.92 ? 561  GLU A C     1 
ATOM   3703 O  O     . GLU C 3 387 ? 15.814  23.779  34.913  1.00 51.08 ? 561  GLU A O     1 
ATOM   3704 C  CB    . GLU C 3 387 ? 17.417  26.064  34.413  1.00 57.94 ? 561  GLU A CB    1 
ATOM   3705 C  CG    . GLU C 3 387 ? 18.183  27.302  33.988  1.00 68.00 ? 561  GLU A CG    1 
ATOM   3706 C  CD    . GLU C 3 387 ? 17.711  28.551  34.706  1.00 74.39 ? 561  GLU A CD    1 
ATOM   3707 O  OE1   . GLU C 3 387 ? 17.791  28.604  35.960  1.00 76.16 ? 561  GLU A OE1   1 
ATOM   3708 O  OE2   . GLU C 3 387 ? 17.253  29.479  34.007  1.00 80.77 ? 561  GLU A OE2   1 
ATOM   3709 N  N     . ASP C 3 388 ? 14.155  25.248  35.168  1.00 46.10 ? 562  ASP A N     1 
ATOM   3710 C  CA    . ASP C 3 388 ? 13.399  24.348  36.035  1.00 44.59 ? 562  ASP A CA    1 
ATOM   3711 C  C     . ASP C 3 388 ? 12.622  23.288  35.268  1.00 40.00 ? 562  ASP A C     1 
ATOM   3712 O  O     . ASP C 3 388 ? 12.391  23.434  34.076  1.00 37.61 ? 562  ASP A O     1 
ATOM   3713 C  CB    . ASP C 3 388 ? 12.440  25.140  36.939  1.00 51.11 ? 562  ASP A CB    1 
ATOM   3714 C  CG    . ASP C 3 388 ? 13.150  25.826  38.111  1.00 60.24 ? 562  ASP A CG    1 
ATOM   3715 O  OD1   . ASP C 3 388 ? 14.396  25.686  38.247  1.00 65.25 ? 562  ASP A OD1   1 
ATOM   3716 O  OD2   . ASP C 3 388 ? 12.454  26.505  38.902  1.00 63.77 ? 562  ASP A OD2   1 
ATOM   3717 N  N     . ASP C 3 389 ? 12.233  22.223  35.970  1.00 37.82 ? 563  ASP A N     1 
ATOM   3718 C  CA    . ASP C 3 389 ? 11.455  21.131  35.388  1.00 36.56 ? 563  ASP A CA    1 
ATOM   3719 C  C     . ASP C 3 389 ? 9.985   21.464  35.297  1.00 32.45 ? 563  ASP A C     1 
ATOM   3720 O  O     . ASP C 3 389 ? 9.400   22.008  36.229  1.00 33.00 ? 563  ASP A O     1 
ATOM   3721 C  CB    . ASP C 3 389 ? 11.603  19.848  36.207  1.00 46.71 ? 563  ASP A CB    1 
ATOM   3722 C  CG    . ASP C 3 389 ? 12.880  19.081  35.887  1.00 59.00 ? 563  ASP A CG    1 
ATOM   3723 O  OD1   . ASP C 3 389 ? 13.750  19.617  35.147  1.00 60.72 ? 563  ASP A OD1   1 
ATOM   3724 O  OD2   . ASP C 3 389 ? 13.006  17.932  36.379  1.00 66.78 ? 563  ASP A OD2   1 
ATOM   3725 N  N     . LEU C 3 390 ? 9.386   21.138  34.168  1.00 28.63 ? 564  LEU A N     1 
ATOM   3726 C  CA    . LEU C 3 390 ? 7.986   21.399  33.982  1.00 28.57 ? 564  LEU A CA    1 
ATOM   3727 C  C     . LEU C 3 390 ? 7.257   20.484  34.935  1.00 29.00 ? 564  LEU A C     1 
ATOM   3728 O  O     . LEU C 3 390 ? 6.510   20.926  35.803  1.00 28.07 ? 564  LEU A O     1 
ATOM   3729 C  CB    . LEU C 3 390 ? 7.594   21.080  32.540  1.00 31.61 ? 564  LEU A CB    1 
ATOM   3730 C  CG    . LEU C 3 390 ? 6.130   21.183  32.081  1.00 32.05 ? 564  LEU A CG    1 
ATOM   3731 C  CD1   . LEU C 3 390 ? 5.613   22.589  32.240  1.00 36.34 ? 564  LEU A CD1   1 
ATOM   3732 C  CD2   . LEU C 3 390 ? 6.013   20.786  30.639  1.00 32.65 ? 564  LEU A CD2   1 
ATOM   3733 N  N     . PHE C 3 391 ? 7.523   19.202  34.777  1.00 29.91 ? 565  PHE A N     1 
ATOM   3734 C  CA    . PHE C 3 391 ? 6.881   18.190  35.569  1.00 31.05 ? 565  PHE A CA    1 
ATOM   3735 C  C     . PHE C 3 391 ? 7.681   17.781  36.767  1.00 39.09 ? 565  PHE A C     1 
ATOM   3736 O  O     . PHE C 3 391 ? 8.003   16.608  36.923  1.00 44.57 ? 565  PHE A O     1 
ATOM   3737 C  CB    . PHE C 3 391 ? 6.587   16.959  34.713  1.00 29.18 ? 565  PHE A CB    1 
ATOM   3738 C  CG    . PHE C 3 391 ? 5.752   17.249  33.495  1.00 31.22 ? 565  PHE A CG    1 
ATOM   3739 C  CD1   . PHE C 3 391 ? 4.436   17.689  33.625  1.00 22.03 ? 565  PHE A CD1   1 
ATOM   3740 C  CD2   . PHE C 3 391 ? 6.284   17.069  32.215  1.00 28.54 ? 565  PHE A CD2   1 
ATOM   3741 C  CE1   . PHE C 3 391 ? 3.676   17.940  32.513  1.00 26.64 ? 565  PHE A CE1   1 
ATOM   3742 C  CE2   . PHE C 3 391 ? 5.527   17.316  31.088  1.00 25.36 ? 565  PHE A CE2   1 
ATOM   3743 C  CZ    . PHE C 3 391 ? 4.224   17.751  31.230  1.00 26.03 ? 565  PHE A CZ    1 
ATOM   3744 N  N     . ASP C 3 392 ? 7.999   18.735  37.632  1.00 43.90 ? 566  ASP A N     1 
ATOM   3745 C  CA    . ASP C 3 392 ? 8.709   18.393  38.854  1.00 47.16 ? 566  ASP A CA    1 
ATOM   3746 C  C     . ASP C 3 392 ? 7.730   17.450  39.562  1.00 49.71 ? 566  ASP A C     1 
ATOM   3747 O  O     . ASP C 3 392 ? 6.581   17.322  39.142  1.00 51.25 ? 566  ASP A O     1 
ATOM   3748 C  CB    . ASP C 3 392 ? 8.925   19.646  39.700  1.00 52.16 ? 566  ASP A CB    1 
ATOM   3749 C  CG    . ASP C 3 392 ? 7.611   20.239  40.222  1.00 63.81 ? 566  ASP A CG    1 
ATOM   3750 O  OD1   . ASP C 3 392 ? 6.771   20.654  39.384  1.00 68.13 ? 566  ASP A OD1   1 
ATOM   3751 O  OD2   . ASP C 3 392 ? 7.412   20.276  41.465  1.00 65.99 ? 566  ASP A OD2   1 
ATOM   3752 N  N     . ARG C 3 393 ? 8.153   16.798  40.637  1.00 52.61 ? 567  ARG A N     1 
ATOM   3753 C  CA    . ARG C 3 393 ? 7.252   15.888  41.336  1.00 59.12 ? 567  ARG A CA    1 
ATOM   3754 C  C     . ARG C 3 393 ? 6.770   14.739  40.440  1.00 57.67 ? 567  ARG A C     1 
ATOM   3755 O  O     . ARG C 3 393 ? 5.784   14.075  40.769  1.00 60.05 ? 567  ARG A O     1 
ATOM   3756 C  CB    . ARG C 3 393 ? 6.033   16.659  41.887  1.00 66.54 ? 567  ARG A CB    1 
ATOM   3757 N  N     . LEU C 3 394 ? 7.500   14.472  39.353  1.00 53.63 ? 568  LEU A N     1 
ATOM   3758 C  CA    . LEU C 3 394 ? 7.128   13.409  38.416  1.00 44.88 ? 568  LEU A CA    1 
ATOM   3759 C  C     . LEU C 3 394 ? 8.285   12.847  37.594  1.00 42.68 ? 568  LEU A C     1 
ATOM   3760 O  O     . LEU C 3 394 ? 9.149   13.582  37.135  1.00 45.10 ? 568  LEU A O     1 
ATOM   3761 C  CB    . LEU C 3 394 ? 6.020   13.905  37.474  1.00 40.38 ? 568  LEU A CB    1 
ATOM   3762 C  CG    . LEU C 3 394 ? 5.335   12.963  36.476  1.00 40.13 ? 568  LEU A CG    1 
ATOM   3763 C  CD1   . LEU C 3 394 ? 5.987   13.093  35.129  1.00 41.41 ? 568  LEU A CD1   1 
ATOM   3764 C  CD2   . LEU C 3 394 ? 5.352   11.509  36.958  1.00 37.36 ? 568  LEU A CD2   1 
ATOM   3765 N  N     . ASN C 3 395 ? 8.307   11.529  37.435  1.00 38.98 ? 569  ASN A N     1 
ATOM   3766 C  CA    . ASN C 3 395 ? 9.336   10.889  36.628  1.00 32.77 ? 569  ASN A CA    1 
ATOM   3767 C  C     . ASN C 3 395 ? 8.798   9.671   35.924  1.00 29.66 ? 569  ASN A C     1 
ATOM   3768 O  O     . ASN C 3 395 ? 7.627   9.320   36.073  1.00 28.68 ? 569  ASN A O     1 
ATOM   3769 C  CB    . ASN C 3 395 ? 10.607  10.563  37.426  1.00 34.08 ? 569  ASN A CB    1 
ATOM   3770 C  CG    . ASN C 3 395 ? 10.386  9.535   38.525  1.00 35.22 ? 569  ASN A CG    1 
ATOM   3771 O  OD1   . ASN C 3 395 ? 9.821   8.465   38.313  1.00 38.10 ? 569  ASN A OD1   1 
ATOM   3772 N  ND2   . ASN C 3 395 ? 10.861  9.854   39.712  1.00 32.28 ? 569  ASN A ND2   1 
ATOM   3773 N  N     . THR C 3 396 ? 9.639   9.102   35.080  1.00 31.89 ? 570  THR A N     1 
ATOM   3774 C  CA    . THR C 3 396 ? 9.318   7.927   34.278  1.00 34.35 ? 570  THR A CA    1 
ATOM   3775 C  C     . THR C 3 396 ? 9.019   6.703   35.161  1.00 35.85 ? 570  THR A C     1 
ATOM   3776 O  O     . THR C 3 396 ? 8.175   5.873   34.817  1.00 32.73 ? 570  THR A O     1 
ATOM   3777 C  CB    . THR C 3 396 ? 10.481  7.638   33.307  1.00 35.58 ? 570  THR A CB    1 
ATOM   3778 O  OG1   . THR C 3 396 ? 11.722  7.673   34.034  1.00 40.66 ? 570  THR A OG1   1 
ATOM   3779 C  CG2   . THR C 3 396 ? 10.543  8.706   32.231  1.00 35.37 ? 570  THR A CG2   1 
ATOM   3780 N  N     . GLY C 3 397 ? 9.712   6.600   36.294  1.00 32.68 ? 571  GLY A N     1 
ATOM   3781 C  CA    . GLY C 3 397 ? 9.465   5.495   37.200  1.00 32.42 ? 571  GLY A CA    1 
ATOM   3782 C  C     . GLY C 3 397 ? 8.049   5.597   37.734  1.00 34.38 ? 571  GLY A C     1 
ATOM   3783 O  O     . GLY C 3 397 ? 7.298   4.624   37.807  1.00 33.73 ? 571  GLY A O     1 
ATOM   3784 N  N     . ILE C 3 398 ? 7.682   6.813   38.102  1.00 31.47 ? 572  ILE A N     1 
ATOM   3785 C  CA    . ILE C 3 398 ? 6.357   7.090   38.615  1.00 32.90 ? 572  ILE A CA    1 
ATOM   3786 C  C     . ILE C 3 398 ? 5.310   6.833   37.547  1.00 31.59 ? 572  ILE A C     1 
ATOM   3787 O  O     . ILE C 3 398 ? 4.327   6.129   37.782  1.00 34.79 ? 572  ILE A O     1 
ATOM   3788 C  CB    . ILE C 3 398 ? 6.274   8.566   39.092  1.00 36.01 ? 572  ILE A CB    1 
ATOM   3789 C  CG1   . ILE C 3 398 ? 7.076   8.713   40.392  1.00 37.06 ? 572  ILE A CG1   1 
ATOM   3790 C  CG2   . ILE C 3 398 ? 4.818   9.020   39.243  1.00 33.74 ? 572  ILE A CG2   1 
ATOM   3791 C  CD1   . ILE C 3 398 ? 7.348   10.139  40.815  1.00 36.86 ? 572  ILE A CD1   1 
ATOM   3792 N  N     . LEU C 3 399 ? 5.527   7.414   36.375  1.00 29.87 ? 573  LEU A N     1 
ATOM   3793 C  CA    . LEU C 3 399 ? 4.593   7.289   35.274  1.00 28.49 ? 573  LEU A CA    1 
ATOM   3794 C  C     . LEU C 3 399 ? 4.310   5.866   34.845  1.00 31.82 ? 573  LEU A C     1 
ATOM   3795 O  O     . LEU C 3 399 ? 3.152   5.471   34.732  1.00 31.23 ? 573  LEU A O     1 
ATOM   3796 C  CB    . LEU C 3 399 ? 5.110   8.054   34.087  1.00 25.69 ? 573  LEU A CB    1 
ATOM   3797 C  CG    . LEU C 3 399 ? 4.108   8.004   32.954  1.00 32.51 ? 573  LEU A CG    1 
ATOM   3798 C  CD1   . LEU C 3 399 ? 2.868   8.790   33.348  1.00 32.33 ? 573  LEU A CD1   1 
ATOM   3799 C  CD2   . LEU C 3 399 ? 4.738   8.545   31.682  1.00 27.06 ? 573  LEU A CD2   1 
ATOM   3800 N  N     . ASN C 3 400 ? 5.371   5.129   34.538  1.00 33.22 ? 574  ASN A N     1 
ATOM   3801 C  CA    . ASN C 3 400 ? 5.252   3.738   34.106  1.00 36.43 ? 574  ASN A CA    1 
ATOM   3802 C  C     . ASN C 3 400 ? 4.693   2.831   35.197  1.00 36.69 ? 574  ASN A C     1 
ATOM   3803 O  O     . ASN C 3 400 ? 3.963   1.868   34.909  1.00 36.86 ? 574  ASN A O     1 
ATOM   3804 C  CB    . ASN C 3 400 ? 6.604   3.212   33.617  1.00 36.67 ? 574  ASN A CB    1 
ATOM   3805 C  CG    . ASN C 3 400 ? 6.858   3.530   32.158  1.00 31.59 ? 574  ASN A CG    1 
ATOM   3806 O  OD1   . ASN C 3 400 ? 6.242   4.429   31.590  1.00 32.42 ? 574  ASN A OD1   1 
ATOM   3807 N  ND2   . ASN C 3 400 ? 7.730   2.760   31.530  1.00 36.42 ? 574  ASN A ND2   1 
ATOM   3808 N  N     . LYS C 3 401 ? 5.048   3.144   36.444  1.00 37.38 ? 575  LYS A N     1 
ATOM   3809 C  CA    . LYS C 3 401 ? 4.581   2.403   37.601  1.00 33.68 ? 575  LYS A CA    1 
ATOM   3810 C  C     . LYS C 3 401 ? 3.062   2.479   37.564  1.00 30.18 ? 575  LYS A C     1 
ATOM   3811 O  O     . LYS C 3 401 ? 2.337   1.505   37.791  1.00 30.47 ? 575  LYS A O     1 
ATOM   3812 C  CB    . LYS C 3 401 ? 5.094   3.077   38.868  1.00 38.39 ? 575  LYS A CB    1 
ATOM   3813 C  CG    . LYS C 3 401 ? 4.554   2.498   40.173  1.00 49.05 ? 575  LYS A CG    1 
ATOM   3814 C  CD    . LYS C 3 401 ? 5.068   1.080   40.446  1.00 57.74 ? 575  LYS A CD    1 
ATOM   3815 C  CE    . LYS C 3 401 ? 6.605   1.021   40.560  1.00 61.90 ? 575  LYS A CE    1 
ATOM   3816 N  NZ    . LYS C 3 401 ? 7.149   -0.333  40.941  1.00 69.84 ? 575  LYS A NZ    1 
ATOM   3817 N  N     . HIS C 3 402 ? 2.591   3.670   37.272  1.00 29.05 ? 576  HIS A N     1 
ATOM   3818 C  CA    . HIS C 3 402 ? 1.184   3.905   37.205  1.00 31.95 ? 576  HIS A CA    1 
ATOM   3819 C  C     . HIS C 3 402 ? 0.563   3.122   36.057  1.00 34.85 ? 576  HIS A C     1 
ATOM   3820 O  O     . HIS C 3 402 ? -0.462  2.457   36.231  1.00 42.14 ? 576  HIS A O     1 
ATOM   3821 C  CB    . HIS C 3 402 ? 0.930   5.397   37.038  1.00 33.15 ? 576  HIS A CB    1 
ATOM   3822 C  CG    . HIS C 3 402 ? -0.512  5.734   36.880  1.00 39.41 ? 576  HIS A CG    1 
ATOM   3823 N  ND1   . HIS C 3 402 ? -1.048  6.164   35.685  1.00 42.50 ? 576  HIS A ND1   1 
ATOM   3824 C  CD2   . HIS C 3 402 ? -1.545  5.650   37.751  1.00 41.11 ? 576  HIS A CD2   1 
ATOM   3825 C  CE1   . HIS C 3 402 ? -2.352  6.329   35.825  1.00 44.92 ? 576  HIS A CE1   1 
ATOM   3826 N  NE2   . HIS C 3 402 ? -2.679  6.024   37.069  1.00 40.17 ? 576  HIS A NE2   1 
ATOM   3827 N  N     . LEU C 3 403 ? 1.170   3.244   34.876  1.00 36.56 ? 577  LEU A N     1 
ATOM   3828 C  CA    . LEU C 3 403 ? 0.707   2.572   33.661  1.00 32.07 ? 577  LEU A CA    1 
ATOM   3829 C  C     . LEU C 3 403 ? 0.542   1.087   33.864  1.00 32.08 ? 577  LEU A C     1 
ATOM   3830 O  O     . LEU C 3 403 ? -0.436  0.511   33.403  1.00 28.09 ? 577  LEU A O     1 
ATOM   3831 C  CB    . LEU C 3 403 ? 1.681   2.819   32.507  1.00 27.51 ? 577  LEU A CB    1 
ATOM   3832 C  CG    . LEU C 3 403 ? 1.702   4.236   31.947  1.00 18.39 ? 577  LEU A CG    1 
ATOM   3833 C  CD1   . LEU C 3 403 ? 2.705   4.291   30.837  1.00 18.74 ? 577  LEU A CD1   1 
ATOM   3834 C  CD2   . LEU C 3 403 ? 0.335   4.635   31.444  1.00 17.41 ? 577  LEU A CD2   1 
ATOM   3835 N  N     . GLN C 3 404 ? 1.523   0.479   34.527  1.00 35.80 ? 578  GLN A N     1 
ATOM   3836 C  CA    . GLN C 3 404 ? 1.506   -0.949  34.820  1.00 45.29 ? 578  GLN A CA    1 
ATOM   3837 C  C     . GLN C 3 404 ? 0.315   -1.360  35.696  1.00 50.11 ? 578  GLN A C     1 
ATOM   3838 O  O     . GLN C 3 404 ? -0.231  -2.461  35.546  1.00 56.50 ? 578  GLN A O     1 
ATOM   3839 C  CB    . GLN C 3 404 ? 2.824   -1.384  35.465  1.00 45.62 ? 578  GLN A CB    1 
ATOM   3840 C  CG    . GLN C 3 404 ? 4.001   -1.526  34.465  1.00 53.32 ? 578  GLN A CG    1 
ATOM   3841 C  CD    . GLN C 3 404 ? 3.899   -2.776  33.589  1.00 56.33 ? 578  GLN A CD    1 
ATOM   3842 O  OE1   . GLN C 3 404 ? 3.242   -3.761  33.961  1.00 61.62 ? 578  GLN A OE1   1 
ATOM   3843 N  NE2   . GLN C 3 404 ? 4.538   -2.739  32.418  1.00 52.89 ? 578  GLN A NE2   1 
ATOM   3844 N  N     . ASP C 3 405 ? -0.077  -0.492  36.625  1.00 49.95 ? 579  ASP A N     1 
ATOM   3845 C  CA    . ASP C 3 405 ? -1.217  -0.787  37.490  1.00 44.77 ? 579  ASP A CA    1 
ATOM   3846 C  C     . ASP C 3 405 ? -2.477  -0.816  36.655  1.00 43.46 ? 579  ASP A C     1 
ATOM   3847 O  O     . ASP C 3 405 ? -3.425  -1.521  36.987  1.00 43.87 ? 579  ASP A O     1 
ATOM   3848 C  CB    . ASP C 3 405 ? -1.365  0.264   38.592  1.00 46.65 ? 579  ASP A CB    1 
ATOM   3849 N  N     . LEU C 3 406 ? -2.478  -0.049  35.566  1.00 41.69 ? 580  LEU A N     1 
ATOM   3850 C  CA    . LEU C 3 406 ? -3.635  0.020   34.681  1.00 40.72 ? 580  LEU A CA    1 
ATOM   3851 C  C     . LEU C 3 406 ? -3.712  -1.135  33.671  1.00 40.07 ? 580  LEU A C     1 
ATOM   3852 O  O     . LEU C 3 406 ? -4.789  -1.524  33.211  1.00 39.24 ? 580  LEU A O     1 
ATOM   3853 C  CB    . LEU C 3 406 ? -3.648  1.352   33.943  1.00 41.50 ? 580  LEU A CB    1 
ATOM   3854 C  CG    . LEU C 3 406 ? -3.423  2.658   34.708  1.00 40.24 ? 580  LEU A CG    1 
ATOM   3855 C  CD1   . LEU C 3 406 ? -3.983  3.801   33.863  1.00 41.36 ? 580  LEU A CD1   1 
ATOM   3856 C  CD2   . LEU C 3 406 ? -4.098  2.650   36.062  1.00 38.24 ? 580  LEU A CD2   1 
ATOM   3857 N  N     . MET C 3 407 ? -2.556  -1.634  33.274  1.00 39.58 ? 581  MET A N     1 
ATOM   3858 C  CA    . MET C 3 407 ? -2.480  -2.744  32.345  1.00 35.73 ? 581  MET A CA    1 
ATOM   3859 C  C     . MET C 3 407 ? -1.092  -3.328  32.457  1.00 34.17 ? 581  MET A C     1 
ATOM   3860 O  O     . MET C 3 407 ? -0.089  -2.627  32.326  1.00 35.91 ? 581  MET A O     1 
ATOM   3861 C  CB    . MET C 3 407 ? -2.735  -2.300  30.906  1.00 33.81 ? 581  MET A CB    1 
ATOM   3862 C  CG    . MET C 3 407 ? -2.569  -3.439  29.888  1.00 28.34 ? 581  MET A CG    1 
ATOM   3863 S  SD    . MET C 3 407 ? -2.375  -2.782  28.253  1.00 35.53 ? 581  MET A SD    1 
ATOM   3864 C  CE    . MET C 3 407 ? -0.852  -3.363  27.717  1.00 17.57 ? 581  MET A CE    1 
ATOM   3865 N  N     . GLU C 3 408 ? -1.050  -4.632  32.671  1.00 33.10 ? 582  GLU A N     1 
ATOM   3866 C  CA    . GLU C 3 408 ? 0.201   -5.335  32.808  1.00 35.21 ? 582  GLU A CA    1 
ATOM   3867 C  C     . GLU C 3 408 ? 0.998   -5.243  31.506  1.00 34.33 ? 582  GLU A C     1 
ATOM   3868 O  O     . GLU C 3 408 ? 0.509   -5.625  30.447  1.00 37.78 ? 582  GLU A O     1 
ATOM   3869 C  CB    . GLU C 3 408 ? -0.074  -6.796  33.170  1.00 36.63 ? 582  GLU A CB    1 
ATOM   3870 N  N     . GLY C 3 409 ? 2.237   -4.775  31.603  1.00 32.91 ? 583  GLY A N     1 
ATOM   3871 C  CA    . GLY C 3 409 ? 3.107   -4.645  30.448  1.00 27.85 ? 583  GLY A CA    1 
ATOM   3872 C  C     . GLY C 3 409 ? 2.987   -3.306  29.759  1.00 28.44 ? 583  GLY A C     1 
ATOM   3873 O  O     . GLY C 3 409 ? 3.516   -3.118  28.670  1.00 33.40 ? 583  GLY A O     1 
ATOM   3874 N  N     . LEU C 3 410 ? 2.224   -2.395  30.332  1.00 24.38 ? 584  LEU A N     1 
ATOM   3875 C  CA    . LEU C 3 410 ? 2.069   -1.123  29.690  1.00 24.65 ? 584  LEU A CA    1 
ATOM   3876 C  C     . LEU C 3 410 ? 3.148   -0.168  30.144  1.00 28.44 ? 584  LEU A C     1 
ATOM   3877 O  O     . LEU C 3 410 ? 3.452   -0.071  31.333  1.00 25.61 ? 584  LEU A O     1 
ATOM   3878 C  CB    . LEU C 3 410 ? 0.689   -0.546  29.972  1.00 23.44 ? 584  LEU A CB    1 
ATOM   3879 C  CG    . LEU C 3 410 ? 0.447   0.855   29.400  1.00 26.51 ? 584  LEU A CG    1 
ATOM   3880 C  CD1   . LEU C 3 410 ? 0.575   0.867   27.889  1.00 22.26 ? 584  LEU A CD1   1 
ATOM   3881 C  CD2   . LEU C 3 410 ? -0.916  1.362   29.829  1.00 25.08 ? 584  LEU A CD2   1 
ATOM   3882 N  N     . THR C 3 411 ? 3.744   0.508   29.170  1.00 31.48 ? 585  THR A N     1 
ATOM   3883 C  CA    . THR C 3 411 ? 4.776   1.502   29.415  1.00 34.47 ? 585  THR A CA    1 
ATOM   3884 C  C     . THR C 3 411 ? 4.641   2.603   28.381  1.00 32.68 ? 585  THR A C     1 
ATOM   3885 O  O     . THR C 3 411 ? 3.899   2.470   27.404  1.00 38.37 ? 585  THR A O     1 
ATOM   3886 C  CB    . THR C 3 411 ? 6.237   0.925   29.389  1.00 40.04 ? 585  THR A CB    1 
ATOM   3887 O  OG1   . THR C 3 411 ? 6.543   0.361   28.103  1.00 35.48 ? 585  THR A OG1   1 
ATOM   3888 C  CG2   . THR C 3 411 ? 6.436   -0.110  30.507  1.00 40.21 ? 585  THR A CG2   1 
ATOM   3889 N  N     . ALA C 3 412 ? 5.303   3.717   28.656  1.00 29.74 ? 586  ALA A N     1 
ATOM   3890 C  CA    . ALA C 3 412 ? 5.299   4.892   27.794  1.00 27.21 ? 586  ALA A CA    1 
ATOM   3891 C  C     . ALA C 3 412 ? 5.494   4.554   26.327  1.00 26.73 ? 586  ALA A C     1 
ATOM   3892 O  O     . ALA C 3 412 ? 4.697   4.934   25.467  1.00 31.16 ? 586  ALA A O     1 
ATOM   3893 C  CB    . ALA C 3 412 ? 6.395   5.868   28.256  1.00 25.73 ? 586  ALA A CB    1 
ATOM   3894 N  N     . LYS C 3 413 ? 6.525   3.772   26.057  1.00 26.71 ? 587  LYS A N     1 
ATOM   3895 C  CA    . LYS C 3 413 ? 6.840   3.411   24.696  1.00 25.53 ? 587  LYS A CA    1 
ATOM   3896 C  C     . LYS C 3 413 ? 5.729   2.651   23.984  1.00 25.77 ? 587  LYS A C     1 
ATOM   3897 O  O     . LYS C 3 413 ? 5.527   2.845   22.783  1.00 28.04 ? 587  LYS A O     1 
ATOM   3898 C  CB    . LYS C 3 413 ? 8.153   2.647   24.672  1.00 29.06 ? 587  LYS A CB    1 
ATOM   3899 C  CG    . LYS C 3 413 ? 8.151   1.338   25.402  1.00 34.56 ? 587  LYS A CG    1 
ATOM   3900 C  CD    . LYS C 3 413 ? 9.532   0.748   25.382  1.00 42.34 ? 587  LYS A CD    1 
ATOM   3901 C  CE    . LYS C 3 413 ? 10.025  0.562   23.946  1.00 52.55 ? 587  LYS A CE    1 
ATOM   3902 N  NZ    . LYS C 3 413 ? 11.448  0.074   23.860  1.00 61.28 ? 587  LYS A NZ    1 
ATOM   3903 N  N     . VAL C 3 414 ? 4.936   1.889   24.738  1.00 21.24 ? 588  VAL A N     1 
ATOM   3904 C  CA    . VAL C 3 414 ? 3.857   1.119   24.129  1.00 21.58 ? 588  VAL A CA    1 
ATOM   3905 C  C     . VAL C 3 414 ? 2.881   2.045   23.410  1.00 25.81 ? 588  VAL A C     1 
ATOM   3906 O  O     . VAL C 3 414 ? 2.261   1.668   22.407  1.00 28.63 ? 588  VAL A O     1 
ATOM   3907 C  CB    . VAL C 3 414 ? 3.103   0.259   25.156  1.00 22.28 ? 588  VAL A CB    1 
ATOM   3908 C  CG1   . VAL C 3 414 ? 1.970   -0.546  24.464  1.00 15.25 ? 588  VAL A CG1   1 
ATOM   3909 C  CG2   . VAL C 3 414 ? 4.072   -0.683  25.839  1.00 14.04 ? 588  VAL A CG2   1 
ATOM   3910 N  N     . PHE C 3 415 ? 2.729   3.256   23.922  1.00 23.21 ? 589  PHE A N     1 
ATOM   3911 C  CA    . PHE C 3 415 ? 1.824   4.193   23.278  1.00 24.31 ? 589  PHE A CA    1 
ATOM   3912 C  C     . PHE C 3 415 ? 2.293   4.545   21.873  1.00 25.95 ? 589  PHE A C     1 
ATOM   3913 O  O     . PHE C 3 415 ? 1.500   4.553   20.939  1.00 33.09 ? 589  PHE A O     1 
ATOM   3914 C  CB    . PHE C 3 415 ? 1.658   5.454   24.125  1.00 21.36 ? 589  PHE A CB    1 
ATOM   3915 C  CG    . PHE C 3 415 ? 0.658   5.303   25.259  1.00 24.14 ? 589  PHE A CG    1 
ATOM   3916 C  CD1   . PHE C 3 415 ? 1.010   4.675   26.449  1.00 24.06 ? 589  PHE A CD1   1 
ATOM   3917 C  CD2   . PHE C 3 415 ? -0.619  5.843   25.156  1.00 21.57 ? 589  PHE A CD2   1 
ATOM   3918 C  CE1   . PHE C 3 415 ? 0.099   4.595   27.497  1.00 27.66 ? 589  PHE A CE1   1 
ATOM   3919 C  CE2   . PHE C 3 415 ? -1.519  5.759   26.205  1.00 19.41 ? 589  PHE A CE2   1 
ATOM   3920 C  CZ    . PHE C 3 415 ? -1.160  5.144   27.367  1.00 21.62 ? 589  PHE A CZ    1 
ATOM   3921 N  N     . ARG C 3 416 ? 3.588   4.796   21.725  1.00 26.64 ? 590  ARG A N     1 
ATOM   3922 C  CA    . ARG C 3 416 ? 4.160   5.141   20.428  1.00 27.75 ? 590  ARG A CA    1 
ATOM   3923 C  C     . ARG C 3 416 ? 3.937   4.062   19.354  1.00 28.63 ? 590  ARG A C     1 
ATOM   3924 O  O     . ARG C 3 416 ? 3.558   4.367   18.225  1.00 26.61 ? 590  ARG A O     1 
ATOM   3925 C  CB    . ARG C 3 416 ? 5.657   5.425   20.572  1.00 28.27 ? 590  ARG A CB    1 
ATOM   3926 C  CG    . ARG C 3 416 ? 6.032   6.622   21.468  1.00 28.07 ? 590  ARG A CG    1 
ATOM   3927 C  CD    . ARG C 3 416 ? 7.547   6.951   21.324  1.00 27.88 ? 590  ARG A CD    1 
ATOM   3928 N  NE    . ARG C 3 416 ? 7.854   7.600   20.038  1.00 33.59 ? 590  ARG A NE    1 
ATOM   3929 C  CZ    . ARG C 3 416 ? 9.054   7.647   19.455  1.00 28.94 ? 590  ARG A CZ    1 
ATOM   3930 N  NH1   . ARG C 3 416 ? 10.095  7.080   20.019  1.00 30.37 ? 590  ARG A NH1   1 
ATOM   3931 N  NH2   . ARG C 3 416 ? 9.224   8.303   18.320  1.00 30.19 ? 590  ARG A NH2   1 
ATOM   3932 N  N     . THR C 3 417 ? 4.250   2.815   19.698  1.00 32.97 ? 591  THR A N     1 
ATOM   3933 C  CA    . THR C 3 417 ? 4.078   1.663   18.812  1.00 30.97 ? 591  THR A CA    1 
ATOM   3934 C  C     . THR C 3 417 ? 2.616   1.599   18.403  1.00 35.55 ? 591  THR A C     1 
ATOM   3935 O  O     . THR C 3 417 ? 2.286   1.539   17.210  1.00 39.01 ? 591  THR A O     1 
ATOM   3936 C  CB    . THR C 3 417 ? 4.338   0.368   19.566  1.00 29.33 ? 591  THR A CB    1 
ATOM   3937 O  OG1   . THR C 3 417 ? 5.498   0.531   20.368  1.00 31.32 ? 591  THR A OG1   1 
ATOM   3938 C  CG2   . THR C 3 417 ? 4.548   -0.799  18.623  1.00 29.34 ? 591  THR A CG2   1 
ATOM   3939 N  N     . TYR C 3 418 ? 1.750   1.553   19.416  1.00 30.57 ? 592  TYR A N     1 
ATOM   3940 C  CA    . TYR C 3 418 ? 0.313   1.498   19.234  1.00 27.41 ? 592  TYR A CA    1 
ATOM   3941 C  C     . TYR C 3 418 ? -0.209  2.634   18.354  1.00 30.07 ? 592  TYR A C     1 
ATOM   3942 O  O     . TYR C 3 418 ? -1.012  2.417   17.444  1.00 33.07 ? 592  TYR A O     1 
ATOM   3943 C  CB    . TYR C 3 418 ? -0.367  1.554   20.600  1.00 33.45 ? 592  TYR A CB    1 
ATOM   3944 C  CG    . TYR C 3 418 ? -1.832  1.873   20.511  1.00 38.91 ? 592  TYR A CG    1 
ATOM   3945 C  CD1   . TYR C 3 418 ? -2.758  0.872   20.250  1.00 40.94 ? 592  TYR A CD1   1 
ATOM   3946 C  CD2   . TYR C 3 418 ? -2.287  3.201   20.573  1.00 41.01 ? 592  TYR A CD2   1 
ATOM   3947 C  CE1   . TYR C 3 418 ? -4.090  1.175   20.035  1.00 39.20 ? 592  TYR A CE1   1 
ATOM   3948 C  CE2   . TYR C 3 418 ? -3.629  3.514   20.360  1.00 39.46 ? 592  TYR A CE2   1 
ATOM   3949 C  CZ    . TYR C 3 418 ? -4.520  2.490   20.086  1.00 38.68 ? 592  TYR A CZ    1 
ATOM   3950 O  OH    . TYR C 3 418 ? -5.838  2.755   19.834  1.00 42.45 ? 592  TYR A OH    1 
ATOM   3951 N  N     . ASN C 3 419 ? 0.172   3.856   18.685  1.00 26.76 ? 593  ASN A N     1 
ATOM   3952 C  CA    . ASN C 3 419 ? -0.275  4.999   17.913  1.00 28.76 ? 593  ASN A CA    1 
ATOM   3953 C  C     . ASN C 3 419 ? 0.186   4.941   16.493  1.00 25.92 ? 593  ASN A C     1 
ATOM   3954 O  O     . ASN C 3 419 ? -0.504  5.411   15.614  1.00 28.52 ? 593  ASN A O     1 
ATOM   3955 C  CB    . ASN C 3 419 ? 0.209   6.296   18.529  1.00 37.07 ? 593  ASN A CB    1 
ATOM   3956 C  CG    . ASN C 3 419 ? -0.818  6.918   19.453  1.00 49.04 ? 593  ASN A CG    1 
ATOM   3957 O  OD1   . ASN C 3 419 ? -1.473  6.229   20.257  1.00 51.36 ? 593  ASN A OD1   1 
ATOM   3958 N  ND2   . ASN C 3 419 ? -0.995  8.229   19.318  1.00 55.87 ? 593  ASN A ND2   1 
ATOM   3959 N  N     . ALA C 3 420 ? 1.387   4.420   16.287  1.00 24.89 ? 594  ALA A N     1 
ATOM   3960 C  CA    . ALA C 3 420 ? 1.959   4.305   14.951  1.00 28.82 ? 594  ALA A CA    1 
ATOM   3961 C  C     . ALA C 3 420 ? 1.247   3.223   14.160  1.00 27.20 ? 594  ALA A C     1 
ATOM   3962 O  O     . ALA C 3 420 ? 0.901   3.408   12.986  1.00 28.68 ? 594  ALA A O     1 
ATOM   3963 C  CB    . ALA C 3 420 ? 3.448   3.976   15.042  1.00 22.59 ? 594  ALA A CB    1 
ATOM   3964 N  N     . SER C 3 421 ? 1.091   2.075   14.801  1.00 31.08 ? 595  SER A N     1 
ATOM   3965 C  CA    . SER C 3 421 ? 0.450   0.928   14.187  1.00 31.27 ? 595  SER A CA    1 
ATOM   3966 C  C     . SER C 3 421 ? -1.005  1.198   13.857  1.00 36.29 ? 595  SER A C     1 
ATOM   3967 O  O     . SER C 3 421 ? -1.463  0.845   12.772  1.00 35.10 ? 595  SER A O     1 
ATOM   3968 C  CB    . SER C 3 421 ? 0.582   -0.299  15.085  1.00 28.25 ? 595  SER A CB    1 
ATOM   3969 O  OG    . SER C 3 421 ? 1.932   -0.749  15.146  1.00 26.48 ? 595  SER A OG    1 
ATOM   3970 N  N     . ILE C 3 422 ? -1.736  1.805   14.793  1.00 37.44 ? 596  ILE A N     1 
ATOM   3971 C  CA    . ILE C 3 422 ? -3.141  2.122   14.575  1.00 37.98 ? 596  ILE A CA    1 
ATOM   3972 C  C     . ILE C 3 422 ? -3.325  3.171   13.458  1.00 39.61 ? 596  ILE A C     1 
ATOM   3973 O  O     . ILE C 3 422 ? -4.309  3.144   12.713  1.00 40.61 ? 596  ILE A O     1 
ATOM   3974 C  CB    . ILE C 3 422 ? -3.815  2.572   15.903  1.00 40.59 ? 596  ILE A CB    1 
ATOM   3975 C  CG1   . ILE C 3 422 ? -5.316  2.306   15.834  1.00 45.18 ? 596  ILE A CG1   1 
ATOM   3976 C  CG2   . ILE C 3 422 ? -3.579  4.045   16.172  1.00 34.85 ? 596  ILE A CG2   1 
ATOM   3977 C  CD1   . ILE C 3 422 ? -5.665  0.893   15.316  1.00 44.49 ? 596  ILE A CD1   1 
ATOM   3978 N  N     . THR C 3 423 ? -2.334  4.054   13.335  1.00 41.65 ? 597  THR A N     1 
ATOM   3979 C  CA    . THR C 3 423 ? -2.298  5.125   12.338  1.00 38.69 ? 597  THR A CA    1 
ATOM   3980 C  C     . THR C 3 423 ? -2.118  4.572   10.921  1.00 38.85 ? 597  THR A C     1 
ATOM   3981 O  O     . THR C 3 423 ? -2.857  4.946   10.005  1.00 40.24 ? 597  THR A O     1 
ATOM   3982 C  CB    . THR C 3 423 ? -1.146  6.122   12.669  1.00 41.69 ? 597  THR A CB    1 
ATOM   3983 O  OG1   . THR C 3 423 ? -1.460  6.840   13.873  1.00 42.63 ? 597  THR A OG1   1 
ATOM   3984 C  CG2   . THR C 3 423 ? -0.918  7.113   11.538  1.00 35.74 ? 597  THR A CG2   1 
ATOM   3985 N  N     . LEU C 3 424 ? -1.102  3.729   10.736  1.00 32.94 ? 598  LEU A N     1 
ATOM   3986 C  CA    . LEU C 3 424 ? -0.838  3.114   9.445   1.00 28.37 ? 598  LEU A CA    1 
ATOM   3987 C  C     . LEU C 3 424 ? -2.025  2.275   8.932   1.00 28.88 ? 598  LEU A C     1 
ATOM   3988 O  O     . LEU C 3 424 ? -2.329  2.308   7.757   1.00 30.18 ? 598  LEU A O     1 
ATOM   3989 C  CB    . LEU C 3 424 ? 0.387   2.220   9.536   1.00 21.38 ? 598  LEU A CB    1 
ATOM   3990 C  CG    . LEU C 3 424 ? 0.692   1.513   8.215   1.00 28.55 ? 598  LEU A CG    1 
ATOM   3991 C  CD1   . LEU C 3 424 ? 1.460   2.479   7.301   1.00 24.72 ? 598  LEU A CD1   1 
ATOM   3992 C  CD2   . LEU C 3 424 ? 1.469   0.208   8.452   1.00 23.16 ? 598  LEU A CD2   1 
ATOM   3993 N  N     . GLN C 3 425 ? -2.652  1.483   9.797   1.00 27.41 ? 599  GLN A N     1 
ATOM   3994 C  CA    . GLN C 3 425 ? -3.785  0.644   9.404   1.00 32.18 ? 599  GLN A CA    1 
ATOM   3995 C  C     . GLN C 3 425 ? -5.004  1.454   9.010   1.00 37.24 ? 599  GLN A C     1 
ATOM   3996 O  O     . GLN C 3 425 ? -5.791  1.061   8.148   1.00 38.42 ? 599  GLN A O     1 
ATOM   3997 C  CB    . GLN C 3 425 ? -4.179  -0.283  10.552  1.00 30.80 ? 599  GLN A CB    1 
ATOM   3998 C  CG    . GLN C 3 425 ? -5.389  -1.176  10.275  1.00 34.06 ? 599  GLN A CG    1 
ATOM   3999 C  CD    . GLN C 3 425 ? -5.655  -2.166  11.406  1.00 40.15 ? 599  GLN A CD    1 
ATOM   4000 O  OE1   . GLN C 3 425 ? -5.298  -3.351  11.318  1.00 46.16 ? 599  GLN A OE1   1 
ATOM   4001 N  NE2   . GLN C 3 425 ? -6.264  -1.680  12.487  1.00 36.63 ? 599  GLN A NE2   1 
ATOM   4002 N  N     . GLN C 3 426 ? -5.213  2.542   9.731   1.00 43.76 ? 600  GLN A N     1 
ATOM   4003 C  CA    . GLN C 3 426 ? -6.337  3.409   9.479   1.00 43.61 ? 600  GLN A CA    1 
ATOM   4004 C  C     . GLN C 3 426 ? -6.151  4.064   8.109   1.00 42.06 ? 600  GLN A C     1 
ATOM   4005 O  O     . GLN C 3 426 ? -7.081  4.105   7.308   1.00 39.90 ? 600  GLN A O     1 
ATOM   4006 C  CB    . GLN C 3 426 ? -6.422  4.436   10.609  1.00 51.87 ? 600  GLN A CB    1 
ATOM   4007 C  CG    . GLN C 3 426 ? -7.732  5.201   10.682  1.00 58.83 ? 600  GLN A CG    1 
ATOM   4008 C  CD    . GLN C 3 426 ? -7.706  6.480   9.871   1.00 59.25 ? 600  GLN A CD    1 
ATOM   4009 O  OE1   . GLN C 3 426 ? -6.799  7.295   10.017  1.00 61.83 ? 600  GLN A OE1   1 
ATOM   4010 N  NE2   . GLN C 3 426 ? -8.720  6.675   9.031   1.00 59.87 ? 600  GLN A NE2   1 
ATOM   4011 N  N     . GLN C 3 427 ? -4.929  4.516   7.836   1.00 43.54 ? 601  GLN A N     1 
ATOM   4012 C  CA    . GLN C 3 427 ? -4.576  5.175   6.572   1.00 44.39 ? 601  GLN A CA    1 
ATOM   4013 C  C     . GLN C 3 427 ? -4.522  4.246   5.363   1.00 42.30 ? 601  GLN A C     1 
ATOM   4014 O  O     . GLN C 3 427 ? -4.784  4.676   4.257   1.00 44.50 ? 601  GLN A O     1 
ATOM   4015 C  CB    . GLN C 3 427 ? -3.236  5.904   6.708   1.00 48.89 ? 601  GLN A CB    1 
ATOM   4016 C  CG    . GLN C 3 427 ? -3.263  7.088   7.656   1.00 52.94 ? 601  GLN A CG    1 
ATOM   4017 C  CD    . GLN C 3 427 ? -4.282  8.105   7.227   1.00 57.25 ? 601  GLN A CD    1 
ATOM   4018 O  OE1   . GLN C 3 427 ? -4.252  8.578   6.094   1.00 63.57 ? 601  GLN A OE1   1 
ATOM   4019 N  NE2   . GLN C 3 427 ? -5.214  8.421   8.111   1.00 61.45 ? 601  GLN A NE2   1 
ATOM   4020 N  N     . LEU C 3 428 ? -4.094  3.002   5.570   1.00 43.99 ? 602  LEU A N     1 
ATOM   4021 C  CA    . LEU C 3 428 ? -4.016  2.002   4.505   1.00 42.03 ? 602  LEU A CA    1 
ATOM   4022 C  C     . LEU C 3 428 ? -5.406  1.615   4.083   1.00 46.65 ? 602  LEU A C     1 
ATOM   4023 O  O     . LEU C 3 428 ? -5.634  1.092   2.994   1.00 50.15 ? 602  LEU A O     1 
ATOM   4024 C  CB    . LEU C 3 428 ? -3.304  0.746   4.982   1.00 36.19 ? 602  LEU A CB    1 
ATOM   4025 C  CG    . LEU C 3 428 ? -1.804  0.922   5.011   1.00 28.64 ? 602  LEU A CG    1 
ATOM   4026 C  CD1   . LEU C 3 428 ? -1.180  -0.402  5.309   1.00 33.59 ? 602  LEU A CD1   1 
ATOM   4027 C  CD2   . LEU C 3 428 ? -1.343  1.465   3.681   1.00 28.75 ? 602  LEU A CD2   1 
ATOM   4028 N  N     . LYS C 3 429 ? -6.342  1.828   4.987   1.00 47.99 ? 603  LYS A N     1 
ATOM   4029 C  CA    . LYS C 3 429 ? -7.703  1.514   4.674   1.00 51.87 ? 603  LYS A CA    1 
ATOM   4030 C  C     . LYS C 3 429 ? -8.366  2.767   4.099   1.00 52.08 ? 603  LYS A C     1 
ATOM   4031 O  O     . LYS C 3 429 ? -9.302  2.651   3.333   1.00 57.44 ? 603  LYS A O     1 
ATOM   4032 C  CB    . LYS C 3 429 ? -8.407  1.028   5.927   1.00 55.12 ? 603  LYS A CB    1 
ATOM   4033 C  CG    . LYS C 3 429 ? -9.604  0.167   5.675   1.00 61.39 ? 603  LYS A CG    1 
ATOM   4034 C  CD    . LYS C 3 429 ? -10.201 -0.205  6.995   1.00 69.12 ? 603  LYS A CD    1 
ATOM   4035 C  CE    . LYS C 3 429 ? -11.657 -0.519  6.845   1.00 76.32 ? 603  LYS A CE    1 
ATOM   4036 N  NZ    . LYS C 3 429 ? -12.411 0.164   7.935   1.00 81.40 ? 603  LYS A NZ    1 
ATOM   4037 N  N     . GLU C 3 430 ? -7.855  3.956   4.422   1.00 49.79 ? 604  GLU A N     1 
ATOM   4038 C  CA    . GLU C 3 430 ? -8.441  5.207   3.913   1.00 49.40 ? 604  GLU A CA    1 
ATOM   4039 C  C     . GLU C 3 430 ? -7.882  5.757   2.585   1.00 48.74 ? 604  GLU A C     1 
ATOM   4040 O  O     . GLU C 3 430 ? -8.596  6.368   1.795   1.00 50.77 ? 604  GLU A O     1 
ATOM   4041 C  CB    . GLU C 3 430 ? -8.366  6.311   4.969   1.00 51.53 ? 604  GLU A CB    1 
ATOM   4042 C  CG    . GLU C 3 430 ? -9.275  7.496   4.635   1.00 60.73 ? 604  GLU A CG    1 
ATOM   4043 C  CD    . GLU C 3 430 ? -9.042  8.728   5.494   1.00 66.16 ? 604  GLU A CD    1 
ATOM   4044 O  OE1   . GLU C 3 430 ? -9.340  8.688   6.708   1.00 70.44 ? 604  GLU A OE1   1 
ATOM   4045 O  OE2   . GLU C 3 430 ? -8.587  9.752   4.942   1.00 69.03 ? 604  GLU A OE2   1 
ATOM   4046 N  N     . LEU C 3 431 ? -6.590  5.602   2.366   1.00 47.09 ? 605  LEU A N     1 
ATOM   4047 C  CA    . LEU C 3 431 ? -5.985  6.107   1.151   1.00 47.49 ? 605  LEU A CA    1 
ATOM   4048 C  C     . LEU C 3 431 ? -5.843  5.064   0.054   1.00 48.80 ? 605  LEU A C     1 
ATOM   4049 O  O     . LEU C 3 431 ? -5.587  5.404   -1.087  1.00 54.55 ? 605  LEU A O     1 
ATOM   4050 C  CB    . LEU C 3 431 ? -4.605  6.675   1.453   1.00 50.35 ? 605  LEU A CB    1 
ATOM   4051 C  CG    . LEU C 3 431 ? -4.502  7.662   2.607   1.00 55.15 ? 605  LEU A CG    1 
ATOM   4052 C  CD1   . LEU C 3 431 ? -3.059  8.136   2.745   1.00 50.95 ? 605  LEU A CD1   1 
ATOM   4053 C  CD2   . LEU C 3 431 ? -5.463  8.818   2.371   1.00 59.32 ? 605  LEU A CD2   1 
ATOM   4054 N  N     . THR C 3 432 ? -5.974  3.795   0.390   1.00 49.29 ? 606  THR A N     1 
ATOM   4055 C  CA    . THR C 3 432 ? -5.811  2.771   -0.619  1.00 50.32 ? 606  THR A CA    1 
ATOM   4056 C  C     . THR C 3 432 ? -6.984  2.663   -1.570  1.00 53.09 ? 606  THR A C     1 
ATOM   4057 O  O     . THR C 3 432 ? -8.025  2.102   -1.226  1.00 55.44 ? 606  THR A O     1 
ATOM   4058 C  CB    . THR C 3 432 ? -5.532  1.417   0.019   1.00 50.49 ? 606  THR A CB    1 
ATOM   4059 O  OG1   . THR C 3 432 ? -4.240  1.460   0.633   1.00 54.57 ? 606  THR A OG1   1 
ATOM   4060 C  CG2   . THR C 3 432 ? -5.540  0.314   -1.020  1.00 50.61 ? 606  THR A CG2   1 
ATOM   4061 N  N     . ALA C 3 433 ? -6.802  3.195   -2.775  1.00 52.43 ? 607  ALA A N     1 
ATOM   4062 C  CA    . ALA C 3 433 ? -7.831  3.158   -3.806  1.00 52.90 ? 607  ALA A CA    1 
ATOM   4063 C  C     . ALA C 3 433 ? -8.112  1.709   -4.161  1.00 56.12 ? 607  ALA A C     1 
ATOM   4064 O  O     . ALA C 3 433 ? -7.185  0.953   -4.432  1.00 53.24 ? 607  ALA A O     1 
ATOM   4065 C  CB    . ALA C 3 433 ? -7.372  3.910   -5.024  1.00 51.84 ? 607  ALA A CB    1 
ATOM   4066 N  N     . PRO C 3 434 ? -9.407  1.312   -4.194  1.00 61.49 ? 608  PRO A N     1 
ATOM   4067 C  CA    . PRO C 3 434 ? -9.842  -0.055  -4.513  1.00 63.03 ? 608  PRO A CA    1 
ATOM   4068 C  C     . PRO C 3 434 ? -9.426  -0.522  -5.902  1.00 64.80 ? 608  PRO A C     1 
ATOM   4069 O  O     . PRO C 3 434 ? -8.959  -1.647  -6.073  1.00 67.29 ? 608  PRO A O     1 
ATOM   4070 C  CB    . PRO C 3 434 ? -11.373 0.025   -4.400  1.00 61.18 ? 608  PRO A CB    1 
ATOM   4071 C  CG    . PRO C 3 434 ? -11.610 1.160   -3.461  1.00 60.45 ? 608  PRO A CG    1 
ATOM   4072 C  CD    . PRO C 3 434 ? -10.575 2.170   -3.932  1.00 63.75 ? 608  PRO A CD    1 
ATOM   4073 N  N     . ASP C 3 435 ? -9.635  0.328   -6.896  1.00 65.28 ? 609  ASP A N     1 
ATOM   4074 C  CA    . ASP C 3 435 ? -9.285  -0.032  -8.260  1.00 67.13 ? 609  ASP A CA    1 
ATOM   4075 C  C     . ASP C 3 435 ? -7.995  0.637   -8.760  1.00 68.63 ? 609  ASP A C     1 
ATOM   4076 O  O     . ASP C 3 435 ? -7.852  0.933   -9.950  1.00 69.59 ? 609  ASP A O     1 
ATOM   4077 C  CB    . ASP C 3 435 ? -10.468 0.257   -9.192  1.00 66.20 ? 609  ASP A CB    1 
ATOM   4078 N  N     . GLU C 3 436 ? -7.070  0.907   -7.843  1.00 71.39 ? 610  GLU A N     1 
ATOM   4079 C  CA    . GLU C 3 436 ? -5.800  1.520   -8.214  1.00 70.87 ? 610  GLU A CA    1 
ATOM   4080 C  C     . GLU C 3 436 ? -4.884  0.425   -8.746  1.00 72.68 ? 610  GLU A C     1 
ATOM   4081 O  O     . GLU C 3 436 ? -5.319  -0.712  -8.970  1.00 78.05 ? 610  GLU A O     1 
ATOM   4082 C  CB    . GLU C 3 436 ? -5.149  2.211   -7.021  1.00 66.13 ? 610  GLU A CB    1 
ATOM   4083 N  N     . ASN C 3 437 ? -3.618  0.765   -8.937  1.00 70.83 ? 611  ASN A N     1 
ATOM   4084 C  CA    . ASN C 3 437 ? -2.637  -0.172  -9.467  1.00 67.56 ? 611  ASN A CA    1 
ATOM   4085 C  C     . ASN C 3 437 ? -1.485  -0.324  -8.503  1.00 64.51 ? 611  ASN A C     1 
ATOM   4086 O  O     . ASN C 3 437 ? -1.133  0.609   -7.796  1.00 64.68 ? 611  ASN A O     1 
ATOM   4087 C  CB    . ASN C 3 437 ? -2.116  0.328   -10.811 1.00 69.26 ? 611  ASN A CB    1 
ATOM   4088 C  CG    . ASN C 3 437 ? -1.648  1.769   -10.751 1.00 75.10 ? 611  ASN A CG    1 
ATOM   4089 O  OD1   . ASN C 3 437 ? -1.907  2.468   -9.785  1.00 81.59 ? 611  ASN A OD1   1 
ATOM   4090 N  ND2   . ASN C 3 437 ? -0.983  2.221   -11.795 1.00 77.65 ? 611  ASN A ND2   1 
ATOM   4091 N  N     . ILE C 3 438 ? -0.857  -1.494  -8.533  1.00 63.30 ? 612  ILE A N     1 
ATOM   4092 C  CA    . ILE C 3 438 ? 0.263   -1.805  -7.654  1.00 60.28 ? 612  ILE A CA    1 
ATOM   4093 C  C     . ILE C 3 438 ? 1.154   -0.604  -7.350  1.00 55.66 ? 612  ILE A C     1 
ATOM   4094 O  O     . ILE C 3 438 ? 1.348   -0.274  -6.190  1.00 57.81 ? 612  ILE A O     1 
ATOM   4095 C  CB    . ILE C 3 438 ? 1.112   -2.980  -8.208  1.00 61.93 ? 612  ILE A CB    1 
ATOM   4096 C  CG1   . ILE C 3 438 ? 0.212   -4.178  -8.544  1.00 65.17 ? 612  ILE A CG1   1 
ATOM   4097 C  CG2   . ILE C 3 438 ? 2.200   -3.373  -7.209  1.00 62.12 ? 612  ILE A CG2   1 
ATOM   4098 C  CD1   . ILE C 3 438 ? -0.534  -4.767  -7.358  1.00 65.37 ? 612  ILE A CD1   1 
ATOM   4099 N  N     . PRO C 3 439 ? 1.708   0.058   -8.382  1.00 50.77 ? 613  PRO A N     1 
ATOM   4100 C  CA    . PRO C 3 439 ? 2.568   1.217   -8.155  1.00 49.15 ? 613  PRO A CA    1 
ATOM   4101 C  C     . PRO C 3 439 ? 1.886   2.337   -7.366  1.00 50.20 ? 613  PRO A C     1 
ATOM   4102 O  O     . PRO C 3 439 ? 2.429   2.797   -6.355  1.00 51.57 ? 613  PRO A O     1 
ATOM   4103 C  CB    . PRO C 3 439 ? 2.913   1.652   -9.571  1.00 49.27 ? 613  PRO A CB    1 
ATOM   4104 C  CG    . PRO C 3 439 ? 2.944   0.367   -10.308 1.00 47.20 ? 613  PRO A CG    1 
ATOM   4105 C  CD    . PRO C 3 439 ? 1.689   -0.284  -9.813  1.00 51.79 ? 613  PRO A CD    1 
ATOM   4106 N  N     . ALA C 3 440 ? 0.701   2.763   -7.809  1.00 44.62 ? 614  ALA A N     1 
ATOM   4107 C  CA    . ALA C 3 440 ? -0.021  3.825   -7.107  1.00 44.13 ? 614  ALA A CA    1 
ATOM   4108 C  C     . ALA C 3 440 ? -0.457  3.388   -5.718  1.00 40.55 ? 614  ALA A C     1 
ATOM   4109 O  O     . ALA C 3 440 ? -0.483  4.185   -4.791  1.00 41.18 ? 614  ALA A O     1 
ATOM   4110 C  CB    . ALA C 3 440 ? -1.206  4.279   -7.900  1.00 48.91 ? 614  ALA A CB    1 
ATOM   4111 N  N     . LYS C 3 441 ? -0.842  2.127   -5.589  1.00 39.18 ? 615  LYS A N     1 
ATOM   4112 C  CA    . LYS C 3 441 ? -1.224  1.604   -4.289  1.00 39.03 ? 615  LYS A CA    1 
ATOM   4113 C  C     . LYS C 3 441 ? 0.027   1.532   -3.445  1.00 39.18 ? 615  LYS A C     1 
ATOM   4114 O  O     . LYS C 3 441 ? -0.052  1.373   -2.229  1.00 44.00 ? 615  LYS A O     1 
ATOM   4115 C  CB    . LYS C 3 441 ? -1.847  0.213   -4.395  1.00 36.19 ? 615  LYS A CB    1 
ATOM   4116 C  CG    . LYS C 3 441 ? -3.314  0.258   -4.695  1.00 39.28 ? 615  LYS A CG    1 
ATOM   4117 C  CD    . LYS C 3 441 ? -3.946  -1.100  -4.665  1.00 40.76 ? 615  LYS A CD    1 
ATOM   4118 C  CE    . LYS C 3 441 ? -5.394  -0.991  -5.088  1.00 42.12 ? 615  LYS A CE    1 
ATOM   4119 N  NZ    . LYS C 3 441 ? -6.091  -2.286  -5.110  1.00 49.56 ? 615  LYS A NZ    1 
ATOM   4120 N  N     . ILE C 3 442 ? 1.181   1.521   -4.106  1.00 36.73 ? 616  ILE A N     1 
ATOM   4121 C  CA    . ILE C 3 442 ? 2.448   1.501   -3.392  1.00 39.05 ? 616  ILE A CA    1 
ATOM   4122 C  C     . ILE C 3 442 ? 2.736   2.931   -2.929  1.00 42.24 ? 616  ILE A C     1 
ATOM   4123 O  O     . ILE C 3 442 ? 3.287   3.161   -1.839  1.00 44.59 ? 616  ILE A O     1 
ATOM   4124 C  CB    . ILE C 3 442 ? 3.592   0.909   -4.239  1.00 36.08 ? 616  ILE A CB    1 
ATOM   4125 C  CG1   . ILE C 3 442 ? 3.483   -0.614  -4.247  1.00 26.55 ? 616  ILE A CG1   1 
ATOM   4126 C  CG2   . ILE C 3 442 ? 4.948   1.281   -3.656  1.00 40.04 ? 616  ILE A CG2   1 
ATOM   4127 C  CD1   . ILE C 3 442 ? 4.497   -1.256  -5.116  1.00 20.96 ? 616  ILE A CD1   1 
ATOM   4128 N  N     . LEU C 3 443 ? 2.328   3.895   -3.737  1.00 44.63 ? 617  LEU A N     1 
ATOM   4129 C  CA    . LEU C 3 443 ? 2.502   5.280   -3.344  1.00 46.69 ? 617  LEU A CA    1 
ATOM   4130 C  C     . LEU C 3 443 ? 1.542   5.506   -2.187  1.00 48.81 ? 617  LEU A C     1 
ATOM   4131 O  O     . LEU C 3 443 ? 1.881   6.201   -1.232  1.00 54.79 ? 617  LEU A O     1 
ATOM   4132 C  CB    . LEU C 3 443 ? 2.168   6.224   -4.489  1.00 46.90 ? 617  LEU A CB    1 
ATOM   4133 C  CG    . LEU C 3 443 ? 3.024   6.080   -5.737  1.00 44.69 ? 617  LEU A CG    1 
ATOM   4134 C  CD1   . LEU C 3 443 ? 2.591   7.126   -6.715  1.00 52.16 ? 617  LEU A CD1   1 
ATOM   4135 C  CD2   . LEU C 3 443 ? 4.482   6.254   -5.405  1.00 44.09 ? 617  LEU A CD2   1 
ATOM   4136 N  N     . SER C 3 444 ? 0.349   4.919   -2.277  1.00 47.44 ? 618  SER A N     1 
ATOM   4137 C  CA    . SER C 3 444 ? -0.656  5.036   -1.219  1.00 50.89 ? 618  SER A CA    1 
ATOM   4138 C  C     . SER C 3 444 ? -0.007  4.578   0.085   1.00 53.37 ? 618  SER A C     1 
ATOM   4139 O  O     . SER C 3 444 ? -0.059  5.274   1.108   1.00 49.92 ? 618  SER A O     1 
ATOM   4140 C  CB    . SER C 3 444 ? -1.867  4.135   -1.500  1.00 54.09 ? 618  SER A CB    1 
ATOM   4141 O  OG    . SER C 3 444 ? -2.675  4.622   -2.552  1.00 54.99 ? 618  SER A OG    1 
ATOM   4142 N  N     . TYR C 3 445 ? 0.590   3.391   0.031   1.00 53.31 ? 619  TYR A N     1 
ATOM   4143 C  CA    . TYR C 3 445 ? 1.269   2.824   1.176   1.00 55.07 ? 619  TYR A CA    1 
ATOM   4144 C  C     . TYR C 3 445 ? 2.271   3.853   1.702   1.00 57.16 ? 619  TYR A C     1 
ATOM   4145 O  O     . TYR C 3 445 ? 2.238   4.226   2.881   1.00 59.30 ? 619  TYR A O     1 
ATOM   4146 C  CB    . TYR C 3 445 ? 1.995   1.522   0.803   1.00 49.61 ? 619  TYR A CB    1 
ATOM   4147 C  CG    . TYR C 3 445 ? 2.586   0.819   2.013   1.00 46.75 ? 619  TYR A CG    1 
ATOM   4148 C  CD1   . TYR C 3 445 ? 1.832   -0.081  2.773   1.00 45.05 ? 619  TYR A CD1   1 
ATOM   4149 C  CD2   . TYR C 3 445 ? 3.879   1.097   2.432   1.00 48.51 ? 619  TYR A CD2   1 
ATOM   4150 C  CE1   . TYR C 3 445 ? 2.354   -0.676  3.916   1.00 38.65 ? 619  TYR A CE1   1 
ATOM   4151 C  CE2   . TYR C 3 445 ? 4.406   0.503   3.575   1.00 44.67 ? 619  TYR A CE2   1 
ATOM   4152 C  CZ    . TYR C 3 445 ? 3.637   -0.376  4.304   1.00 42.16 ? 619  TYR A CZ    1 
ATOM   4153 O  OH    . TYR C 3 445 ? 4.159   -0.955  5.412   1.00 39.63 ? 619  TYR A OH    1 
ATOM   4154 N  N     . ASN C 3 446 ? 3.127   4.332   0.811   1.00 53.45 ? 620  ASN A N     1 
ATOM   4155 C  CA    . ASN C 3 446 ? 4.140   5.307   1.176   1.00 50.25 ? 620  ASN A CA    1 
ATOM   4156 C  C     . ASN C 3 446 ? 3.612   6.558   1.838   1.00 49.00 ? 620  ASN A C     1 
ATOM   4157 O  O     . ASN C 3 446 ? 4.323   7.175   2.625   1.00 53.04 ? 620  ASN A O     1 
ATOM   4158 C  CB    . ASN C 3 446 ? 4.951   5.704   -0.042  1.00 55.42 ? 620  ASN A CB    1 
ATOM   4159 C  CG    . ASN C 3 446 ? 5.997   4.689   -0.385  1.00 56.03 ? 620  ASN A CG    1 
ATOM   4160 O  OD1   . ASN C 3 446 ? 6.103   3.640   0.255   1.00 54.85 ? 620  ASN A OD1   1 
ATOM   4161 N  ND2   . ASN C 3 446 ? 6.797   4.996   -1.402  1.00 56.56 ? 620  ASN A ND2   1 
ATOM   4162 N  N     . ARG C 3 447 ? 2.428   7.008   1.428   1.00 47.79 ? 621  ARG A N     1 
ATOM   4163 C  CA    . ARG C 3 447 ? 1.822   8.196   2.020   1.00 48.13 ? 621  ARG A CA    1 
ATOM   4164 C  C     . ARG C 3 447 ? 1.350   7.831   3.434   1.00 48.01 ? 621  ARG A C     1 
ATOM   4165 O  O     . ARG C 3 447 ? 1.578   8.576   4.392   1.00 48.21 ? 621  ARG A O     1 
ATOM   4166 C  CB    . ARG C 3 447 ? 0.656   8.709   1.159   1.00 44.50 ? 621  ARG A CB    1 
ATOM   4167 N  N     . ALA C 3 448 ? 0.703   6.675   3.553   1.00 49.47 ? 622  ALA A N     1 
ATOM   4168 C  CA    . ALA C 3 448 ? 0.221   6.180   4.842   1.00 51.28 ? 622  ALA A CA    1 
ATOM   4169 C  C     . ALA C 3 448 ? 1.408   5.928   5.763   1.00 48.94 ? 622  ALA A C     1 
ATOM   4170 O  O     . ALA C 3 448 ? 1.333   6.122   6.973   1.00 54.00 ? 622  ALA A O     1 
ATOM   4171 C  CB    . ALA C 3 448 ? -0.564  4.898   4.647   1.00 48.25 ? 622  ALA A CB    1 
ATOM   4172 N  N     . ASN C 3 449 ? 2.484   5.457   5.161   1.00 47.07 ? 623  ASN A N     1 
ATOM   4173 C  CA    . ASN C 3 449 ? 3.730   5.149   5.834   1.00 47.42 ? 623  ASN A CA    1 
ATOM   4174 C  C     . ASN C 3 449 ? 4.388   6.436   6.343   1.00 47.20 ? 623  ASN A C     1 
ATOM   4175 O  O     . ASN C 3 449 ? 4.907   6.477   7.451   1.00 47.43 ? 623  ASN A O     1 
ATOM   4176 C  CB    . ASN C 3 449 ? 4.619   4.394   4.828   1.00 54.34 ? 623  ASN A CB    1 
ATOM   4177 C  CG    . ASN C 3 449 ? 6.041   4.208   5.296   1.00 57.52 ? 623  ASN A CG    1 
ATOM   4178 O  OD1   . ASN C 3 449 ? 6.545   3.082   5.385   1.00 55.98 ? 623  ASN A OD1   1 
ATOM   4179 N  ND2   . ASN C 3 449 ? 6.734   5.319   5.496   1.00 66.69 ? 623  ASN A ND2   1 
ATOM   4180 N  N     . ARG C 3 450 ? 4.332   7.505   5.553   1.00 48.92 ? 624  ARG A N     1 
ATOM   4181 C  CA    . ARG C 3 450 ? 4.936   8.778   5.941   1.00 44.13 ? 624  ARG A CA    1 
ATOM   4182 C  C     . ARG C 3 450 ? 4.154   9.525   7.010   1.00 45.96 ? 624  ARG A C     1 
ATOM   4183 O  O     . ARG C 3 450 ? 4.735   10.321  7.733   1.00 49.93 ? 624  ARG A O     1 
ATOM   4184 C  CB    . ARG C 3 450 ? 5.140   9.691   4.730   1.00 45.18 ? 624  ARG A CB    1 
ATOM   4185 N  N     . ALA C 3 451 ? 2.841   9.314   7.082   1.00 43.85 ? 625  ALA A N     1 
ATOM   4186 C  CA    . ALA C 3 451 ? 2.001   9.972   8.090   1.00 42.27 ? 625  ALA A CA    1 
ATOM   4187 C  C     . ALA C 3 451 ? 2.467   9.591   9.504   1.00 41.93 ? 625  ALA A C     1 
ATOM   4188 O  O     . ALA C 3 451 ? 2.281   10.320  10.485  1.00 45.97 ? 625  ALA A O     1 
ATOM   4189 C  CB    . ALA C 3 451 ? 0.532   9.554   7.898   1.00 38.98 ? 625  ALA A CB    1 
ATOM   4190 N  N     . VAL C 3 452 ? 3.059   8.420   9.579   1.00 36.79 ? 626  VAL A N     1 
ATOM   4191 C  CA    . VAL C 3 452 ? 3.546   7.865   10.810  1.00 38.69 ? 626  VAL A CA    1 
ATOM   4192 C  C     . VAL C 3 452 ? 4.925   8.430   11.182  1.00 36.32 ? 626  VAL A C     1 
ATOM   4193 O  O     . VAL C 3 452 ? 5.148   8.848   12.317  1.00 36.32 ? 626  VAL A O     1 
ATOM   4194 C  CB    . VAL C 3 452 ? 3.573   6.320   10.654  1.00 40.87 ? 626  VAL A CB    1 
ATOM   4195 C  CG1   . VAL C 3 452 ? 4.376   5.672   11.776  1.00 44.58 ? 626  VAL A CG1   1 
ATOM   4196 C  CG2   . VAL C 3 452 ? 2.140   5.773   10.591  1.00 32.43 ? 626  VAL A CG2   1 
ATOM   4197 N  N     . ALA C 3 453 ? 5.841   8.412   10.219  1.00 36.17 ? 627  ALA A N     1 
ATOM   4198 C  CA    . ALA C 3 453 ? 7.207   8.906   10.383  1.00 35.58 ? 627  ALA A CA    1 
ATOM   4199 C  C     . ALA C 3 453 ? 7.193   10.353  10.863  1.00 39.88 ? 627  ALA A C     1 
ATOM   4200 O  O     . ALA C 3 453 ? 8.173   10.854  11.414  1.00 46.46 ? 627  ALA A O     1 
ATOM   4201 C  CB    . ALA C 3 453 ? 7.944   8.798   9.055   1.00 24.89 ? 627  ALA A CB    1 
ATOM   4202 N  N     . ILE C 3 454 ? 6.080   11.028  10.609  1.00 45.18 ? 628  ILE A N     1 
ATOM   4203 C  CA    . ILE C 3 454 ? 5.893   12.411  11.001  1.00 48.02 ? 628  ILE A CA    1 
ATOM   4204 C  C     . ILE C 3 454 ? 5.465   12.455  12.461  1.00 47.19 ? 628  ILE A C     1 
ATOM   4205 O  O     . ILE C 3 454 ? 5.885   13.327  13.219  1.00 49.72 ? 628  ILE A O     1 
ATOM   4206 C  CB    . ILE C 3 454 ? 4.843   13.076  10.085  1.00 53.33 ? 628  ILE A CB    1 
ATOM   4207 C  CG1   . ILE C 3 454 ? 5.429   13.232  8.677   1.00 54.68 ? 628  ILE A CG1   1 
ATOM   4208 C  CG2   . ILE C 3 454 ? 4.414   14.430  10.627  1.00 59.60 ? 628  ILE A CG2   1 
ATOM   4209 C  CD1   . ILE C 3 454 ? 4.439   13.737  7.648   1.00 56.41 ? 628  ILE A CD1   1 
ATOM   4210 N  N     . LEU C 3 455 ? 4.646   11.490  12.859  1.00 47.65 ? 629  LEU A N     1 
ATOM   4211 C  CA    . LEU C 3 455 ? 4.176   11.406  14.231  1.00 47.16 ? 629  LEU A CA    1 
ATOM   4212 C  C     . LEU C 3 455 ? 5.349   11.188  15.193  1.00 47.70 ? 629  LEU A C     1 
ATOM   4213 O  O     . LEU C 3 455 ? 5.455   11.857  16.224  1.00 51.63 ? 629  LEU A O     1 
ATOM   4214 C  CB    . LEU C 3 455 ? 3.165   10.267  14.343  1.00 54.66 ? 629  LEU A CB    1 
ATOM   4215 C  CG    . LEU C 3 455 ? 2.405   10.015  15.658  1.00 61.23 ? 629  LEU A CG    1 
ATOM   4216 C  CD1   . LEU C 3 455 ? 1.752   11.304  16.161  1.00 63.48 ? 629  LEU A CD1   1 
ATOM   4217 C  CD2   . LEU C 3 455 ? 1.359   8.913   15.460  1.00 55.98 ? 629  LEU A CD2   1 
ATOM   4218 N  N     . CYS C 3 456 ? 6.235   10.263  14.841  1.00 47.51 ? 630  CYS A N     1 
ATOM   4219 C  CA    . CYS C 3 456 ? 7.408   9.942   15.662  1.00 48.93 ? 630  CYS A CA    1 
ATOM   4220 C  C     . CYS C 3 456 ? 8.542   10.954  15.560  1.00 46.49 ? 630  CYS A C     1 
ATOM   4221 O  O     . CYS C 3 456 ? 9.456   10.935  16.372  1.00 42.43 ? 630  CYS A O     1 
ATOM   4222 C  CB    . CYS C 3 456 ? 7.968   8.577   15.276  1.00 47.43 ? 630  CYS A CB    1 
ATOM   4223 S  SG    . CYS C 3 456 ? 6.815   7.217   15.403  1.00 56.79 ? 630  CYS A SG    1 
ATOM   4224 N  N     . ASN C 3 457 ? 8.511   11.780  14.521  1.00 46.23 ? 631  ASN A N     1 
ATOM   4225 C  CA    . ASN C 3 457 ? 9.532   12.797  14.283  1.00 49.83 ? 631  ASN A CA    1 
ATOM   4226 C  C     . ASN C 3 457 ? 10.810  12.131  13.803  1.00 51.63 ? 631  ASN A C     1 
ATOM   4227 O  O     . ASN C 3 457 ? 11.913  12.440  14.281  1.00 51.24 ? 631  ASN A O     1 
ATOM   4228 C  CB    . ASN C 3 457 ? 9.816   13.610  15.560  1.00 52.52 ? 631  ASN A CB    1 
ATOM   4229 C  CG    . ASN C 3 457 ? 10.501  14.943  15.269  1.00 51.83 ? 631  ASN A CG    1 
ATOM   4230 O  OD1   . ASN C 3 457 ? 10.061  15.700  14.393  1.00 53.34 ? 631  ASN A OD1   1 
ATOM   4231 N  ND2   . ASN C 3 457 ? 11.549  15.255  16.029  1.00 43.38 ? 631  ASN A ND2   1 
ATOM   4232 N  N     . HIS C 3 458 ? 10.659  11.201  12.868  1.00 51.56 ? 632  HIS A N     1 
ATOM   4233 C  CA    . HIS C 3 458 ? 11.812  10.491  12.322  1.00 52.74 ? 632  HIS A CA    1 
ATOM   4234 C  C     . HIS C 3 458 ? 12.469  11.309  11.221  1.00 50.98 ? 632  HIS A C     1 
ATOM   4235 O  O     . HIS C 3 458 ? 11.828  11.666  10.232  1.00 46.72 ? 632  HIS A O     1 
ATOM   4236 C  CB    . HIS C 3 458 ? 11.397  9.113   11.811  1.00 55.50 ? 632  HIS A CB    1 
ATOM   4237 C  CG    . HIS C 3 458 ? 11.029  8.155   12.903  1.00 56.86 ? 632  HIS A CG    1 
ATOM   4238 N  ND1   . HIS C 3 458 ? 9.889   7.380   12.869  1.00 53.31 ? 632  HIS A ND1   1 
ATOM   4239 C  CD2   . HIS C 3 458 ? 11.678  7.815   14.042  1.00 55.84 ? 632  HIS A CD2   1 
ATOM   4240 C  CE1   . HIS C 3 458 ? 9.861   6.596   13.932  1.00 56.40 ? 632  HIS A CE1   1 
ATOM   4241 N  NE2   . HIS C 3 458 ? 10.932  6.845   14.665  1.00 55.26 ? 632  HIS A NE2   1 
ATOM   4242 N  N     . GLN C 3 459 ? 13.731  11.664  11.440  1.00 51.52 ? 633  GLN A N     1 
ATOM   4243 C  CA    . GLN C 3 459 ? 14.485  12.469  10.492  1.00 53.18 ? 633  GLN A CA    1 
ATOM   4244 C  C     . GLN C 3 459 ? 15.841  11.897  10.100  1.00 52.52 ? 633  GLN A C     1 
ATOM   4245 O  O     . GLN C 3 459 ? 16.690  11.615  10.943  1.00 49.76 ? 633  GLN A O     1 
ATOM   4246 C  CB    . GLN C 3 459 ? 14.706  13.881  11.043  1.00 56.11 ? 633  GLN A CB    1 
ATOM   4247 C  CG    . GLN C 3 459 ? 13.439  14.701  11.297  1.00 64.89 ? 633  GLN A CG    1 
ATOM   4248 C  CD    . GLN C 3 459 ? 13.720  16.025  12.019  1.00 68.10 ? 633  GLN A CD    1 
ATOM   4249 O  OE1   . GLN C 3 459 ? 14.840  16.554  11.975  1.00 71.29 ? 633  GLN A OE1   1 
ATOM   4250 N  NE2   . GLN C 3 459 ? 12.704  16.562  12.683  1.00 69.35 ? 633  GLN A NE2   1 
ATOM   4251 N  N     . ARG C 3 460 ? 16.011  11.703  8.800   1.00 55.47 ? 634  ARG A N     1 
ATOM   4252 C  CA    . ARG C 3 460 ? 17.266  11.242  8.235   1.00 61.04 ? 634  ARG A CA    1 
ATOM   4253 C  C     . ARG C 3 460 ? 17.887  12.567  7.823   1.00 63.81 ? 634  ARG A C     1 
ATOM   4254 O  O     . ARG C 3 460 ? 17.420  13.627  8.236   1.00 68.82 ? 634  ARG A O     1 
ATOM   4255 C  CB    . ARG C 3 460 ? 17.021  10.386  6.984   1.00 59.06 ? 634  ARG A CB    1 
ATOM   4256 N  N     . ALA C 3 461 ? 18.911  12.529  6.991   1.00 65.57 ? 635  ALA A N     1 
ATOM   4257 C  CA    . ALA C 3 461 ? 19.533  13.761  6.527   1.00 68.78 ? 635  ALA A CA    1 
ATOM   4258 C  C     . ALA C 3 461 ? 20.209  13.483  5.200   1.00 70.98 ? 635  ALA A C     1 
ATOM   4259 O  O     . ALA C 3 461 ? 20.047  14.305  4.276   1.00 70.50 ? 635  ALA A O     1 
ATOM   4260 C  CB    . ALA C 3 461 ? 20.537  14.279  7.546   1.00 68.37 ? 635  ALA A CB    1 
ATOM   4261 N  N     . GLN C 3 539 ? 14.582  14.805  4.688   1.00 51.39 ? 713  GLN A N     1 
ATOM   4262 C  CA    . GLN C 3 539 ? 14.403  14.821  6.178   1.00 57.05 ? 713  GLN A CA    1 
ATOM   4263 C  C     . GLN C 3 539 ? 13.553  13.659  6.715   1.00 56.79 ? 713  GLN A C     1 
ATOM   4264 O  O     . GLN C 3 539 ? 14.071  12.782  7.402   1.00 57.38 ? 713  GLN A O     1 
ATOM   4265 C  CB    . GLN C 3 539 ? 13.800  16.151  6.640   1.00 58.14 ? 713  GLN A CB    1 
ATOM   4266 N  N     . ILE C 3 540 ? 12.259  13.652  6.391   1.00 57.78 ? 714  ILE A N     1 
ATOM   4267 C  CA    . ILE C 3 540 ? 11.348  12.598  6.847   1.00 57.26 ? 714  ILE A CA    1 
ATOM   4268 C  C     . ILE C 3 540 ? 11.786  11.186  6.454   1.00 55.16 ? 714  ILE A C     1 
ATOM   4269 O  O     . ILE C 3 540 ? 11.608  10.760  5.308   1.00 55.07 ? 714  ILE A O     1 
ATOM   4270 C  CB    . ILE C 3 540 ? 9.895   12.853  6.370   1.00 59.30 ? 714  ILE A CB    1 
ATOM   4271 C  CG1   . ILE C 3 540 ? 9.325   14.106  7.053   1.00 60.81 ? 714  ILE A CG1   1 
ATOM   4272 C  CG2   . ILE C 3 540 ? 9.006   11.642  6.680   1.00 60.09 ? 714  ILE A CG2   1 
ATOM   4273 C  CD1   . ILE C 3 540 ? 9.124   13.985  8.565   1.00 59.61 ? 714  ILE A CD1   1 
ATOM   4274 N  N     . ALA C 3 541 ? 12.352  10.486  7.435   1.00 53.49 ? 715  ALA A N     1 
ATOM   4275 C  CA    . ALA C 3 541 ? 12.841  9.126   7.283   1.00 53.34 ? 715  ALA A CA    1 
ATOM   4276 C  C     . ALA C 3 541 ? 11.700  8.171   7.604   1.00 53.90 ? 715  ALA A C     1 
ATOM   4277 O  O     . ALA C 3 541 ? 10.999  8.368   8.597   1.00 55.45 ? 715  ALA A O     1 
ATOM   4278 C  CB    . ALA C 3 541 ? 14.015  8.898   8.218   1.00 49.52 ? 715  ALA A CB    1 
ATOM   4279 N  N     . LEU C 3 542 ? 11.469  7.202   6.715   1.00 52.55 ? 716  LEU A N     1 
ATOM   4280 C  CA    . LEU C 3 542 ? 10.385  6.224   6.874   1.00 51.46 ? 716  LEU A CA    1 
ATOM   4281 C  C     . LEU C 3 542 ? 10.890  4.864   7.349   1.00 50.35 ? 716  LEU A C     1 
ATOM   4282 O  O     . LEU C 3 542 ? 10.111  3.989   7.711   1.00 46.12 ? 716  LEU A O     1 
ATOM   4283 C  CB    . LEU C 3 542 ? 9.644   6.027   5.538   1.00 57.48 ? 716  LEU A CB    1 
ATOM   4284 C  CG    . LEU C 3 542 ? 9.306   7.187   4.575   1.00 58.54 ? 716  LEU A CG    1 
ATOM   4285 C  CD1   . LEU C 3 542 ? 8.505   6.663   3.389   1.00 62.53 ? 716  LEU A CD1   1 
ATOM   4286 C  CD2   . LEU C 3 542 ? 8.518   8.283   5.271   1.00 59.57 ? 716  LEU A CD2   1 
ATOM   4287 N  N     . GLY C 3 543 ? 12.202  4.668   7.264   1.00 50.93 ? 717  GLY A N     1 
ATOM   4288 C  CA    . GLY C 3 543 ? 12.802  3.411   7.660   1.00 49.82 ? 717  GLY A CA    1 
ATOM   4289 C  C     . GLY C 3 543 ? 12.507  2.889   9.045   1.00 50.40 ? 717  GLY A C     1 
ATOM   4290 O  O     . GLY C 3 543 ? 12.123  1.727   9.175   1.00 51.55 ? 717  GLY A O     1 
ATOM   4291 N  N     . THR C 3 544 ? 12.735  3.699   10.071  1.00 52.82 ? 718  THR A N     1 
ATOM   4292 C  CA    . THR C 3 544 ? 12.509  3.242   11.432  1.00 59.06 ? 718  THR A CA    1 
ATOM   4293 C  C     . THR C 3 544 ? 11.097  2.811   11.758  1.00 59.08 ? 718  THR A C     1 
ATOM   4294 O  O     . THR C 3 544 ? 10.913  1.759   12.364  1.00 64.08 ? 718  THR A O     1 
ATOM   4295 C  CB    . THR C 3 544 ? 13.026  4.228   12.517  1.00 64.66 ? 718  THR A CB    1 
ATOM   4296 O  OG1   . THR C 3 544 ? 12.601  5.557   12.220  1.00 68.13 ? 718  THR A OG1   1 
ATOM   4297 C  CG2   . THR C 3 544 ? 14.554  4.187   12.625  1.00 63.64 ? 718  THR A CG2   1 
ATOM   4298 N  N     . SER C 3 545 ? 10.104  3.612   11.402  1.00 57.83 ? 719  SER A N     1 
ATOM   4299 C  CA    . SER C 3 545 ? 8.718   3.235   11.678  1.00 55.22 ? 719  SER A CA    1 
ATOM   4300 C  C     . SER C 3 545 ? 8.412   1.900   10.975  1.00 50.96 ? 719  SER A C     1 
ATOM   4301 O  O     . SER C 3 545 ? 7.882   0.968   11.592  1.00 40.87 ? 719  SER A O     1 
ATOM   4302 C  CB    . SER C 3 545 ? 7.745   4.350   11.236  1.00 55.91 ? 719  SER A CB    1 
ATOM   4303 O  OG    . SER C 3 545 ? 7.574   4.426   9.829   1.00 56.56 ? 719  SER A OG    1 
ATOM   4304 N  N     . LYS C 3 546 ? 8.821   1.818   9.711   1.00 47.09 ? 720  LYS A N     1 
ATOM   4305 C  CA    . LYS C 3 546 ? 8.633   0.643   8.882   1.00 49.49 ? 720  LYS A CA    1 
ATOM   4306 C  C     . LYS C 3 546 ? 9.314   -0.571  9.486   1.00 47.26 ? 720  LYS A C     1 
ATOM   4307 O  O     . LYS C 3 546 ? 8.982   -1.706  9.181   1.00 50.09 ? 720  LYS A O     1 
ATOM   4308 C  CB    . LYS C 3 546 ? 9.221   0.908   7.495   1.00 54.66 ? 720  LYS A CB    1 
ATOM   4309 C  CG    . LYS C 3 546 ? 9.221   -0.292  6.557   1.00 59.40 ? 720  LYS A CG    1 
ATOM   4310 C  CD    . LYS C 3 546 ? 9.568   0.109   5.116   1.00 67.32 ? 720  LYS A CD    1 
ATOM   4311 C  CE    . LYS C 3 546 ? 8.989   -0.875  4.084   1.00 68.62 ? 720  LYS A CE    1 
ATOM   4312 N  NZ    . LYS C 3 546 ? 9.140   -0.445  2.667   1.00 63.80 ? 720  LYS A NZ    1 
ATOM   4313 N  N     . LEU C 3 547 ? 10.350  -0.331  10.273  1.00 45.56 ? 721  LEU A N     1 
ATOM   4314 C  CA    . LEU C 3 547 ? 11.062  -1.440  10.869  1.00 40.95 ? 721  LEU A CA    1 
ATOM   4315 C  C     . LEU C 3 547 ? 10.854  -1.625  12.370  1.00 40.49 ? 721  LEU A C     1 
ATOM   4316 O  O     . LEU C 3 547 ? 11.052  -2.729  12.871  1.00 41.39 ? 721  LEU A O     1 
ATOM   4317 C  CB    . LEU C 3 547 ? 12.553  -1.286  10.583  1.00 39.46 ? 721  LEU A CB    1 
ATOM   4318 C  CG    . LEU C 3 547 ? 13.232  -2.546  10.054  1.00 44.40 ? 721  LEU A CG    1 
ATOM   4319 C  CD1   . LEU C 3 547 ? 12.519  -3.008  8.796   1.00 45.20 ? 721  LEU A CD1   1 
ATOM   4320 C  CD2   . LEU C 3 547 ? 14.691  -2.271  9.760   1.00 48.79 ? 721  LEU A CD2   1 
ATOM   4321 N  N     . ASN C 3 548 ? 10.493  -0.551  13.075  1.00 35.21 ? 722  ASN A N     1 
ATOM   4322 C  CA    . ASN C 3 548 ? 10.357  -0.594  14.515  1.00 29.87 ? 722  ASN A CA    1 
ATOM   4323 C  C     . ASN C 3 548 ? 9.029   -0.372  15.165  1.00 31.21 ? 722  ASN A C     1 
ATOM   4324 O  O     . ASN C 3 548 ? 8.861   -0.835  16.274  1.00 30.41 ? 722  ASN A O     1 
ATOM   4325 C  CB    . ASN C 3 548 ? 11.328  0.390   15.172  1.00 36.64 ? 722  ASN A CB    1 
ATOM   4326 C  CG    . ASN C 3 548 ? 12.772  -0.027  15.033  1.00 38.58 ? 722  ASN A CG    1 
ATOM   4327 O  OD1   . ASN C 3 548 ? 13.484  0.480   14.178  1.00 41.89 ? 722  ASN A OD1   1 
ATOM   4328 N  ND2   . ASN C 3 548 ? 13.230  -0.919  15.904  1.00 43.59 ? 722  ASN A ND2   1 
ATOM   4329 N  N     . PHE C 3 549 ? 8.135   0.410   14.556  1.00 33.70 ? 723  PHE A N     1 
ATOM   4330 C  CA    . PHE C 3 549 ? 6.820   0.711   15.177  1.00 32.35 ? 723  PHE A CA    1 
ATOM   4331 C  C     . PHE C 3 549 ? 5.542   0.183   14.570  1.00 30.95 ? 723  PHE A C     1 
ATOM   4332 O  O     . PHE C 3 549 ? 4.475   0.349   15.152  1.00 29.92 ? 723  PHE A O     1 
ATOM   4333 C  CB    . PHE C 3 549 ? 6.632   2.219   15.305  1.00 34.63 ? 723  PHE A CB    1 
ATOM   4334 C  CG    . PHE C 3 549 ? 7.654   2.857   16.154  1.00 37.74 ? 723  PHE A CG    1 
ATOM   4335 C  CD1   . PHE C 3 549 ? 8.938   3.059   15.659  1.00 37.61 ? 723  PHE A CD1   1 
ATOM   4336 C  CD2   . PHE C 3 549 ? 7.378   3.152   17.479  1.00 39.37 ? 723  PHE A CD2   1 
ATOM   4337 C  CE1   . PHE C 3 549 ? 9.929   3.519   16.468  1.00 42.78 ? 723  PHE A CE1   1 
ATOM   4338 C  CE2   . PHE C 3 549 ? 8.374   3.619   18.312  1.00 42.10 ? 723  PHE A CE2   1 
ATOM   4339 C  CZ    . PHE C 3 549 ? 9.659   3.806   17.806  1.00 45.00 ? 723  PHE A CZ    1 
ATOM   4340 N  N     . LEU C 3 550 ? 5.619   -0.323  13.353  1.00 31.68 ? 724  LEU A N     1 
ATOM   4341 C  CA    . LEU C 3 550 ? 4.428   -0.807  12.693  1.00 31.22 ? 724  LEU A CA    1 
ATOM   4342 C  C     . LEU C 3 550 ? 4.332   -2.327  12.656  1.00 30.49 ? 724  LEU A C     1 
ATOM   4343 O  O     . LEU C 3 550 ? 5.255   -3.023  12.248  1.00 28.90 ? 724  LEU A O     1 
ATOM   4344 C  CB    . LEU C 3 550 ? 4.347   -0.191  11.292  1.00 35.28 ? 724  LEU A CB    1 
ATOM   4345 C  CG    . LEU C 3 550 ? 4.516   1.341   11.303  1.00 32.21 ? 724  LEU A CG    1 
ATOM   4346 C  CD1   . LEU C 3 550 ? 5.112   1.818   10.008  1.00 31.60 ? 724  LEU A CD1   1 
ATOM   4347 C  CD2   . LEU C 3 550 ? 3.207   2.038   11.577  1.00 27.61 ? 724  LEU A CD2   1 
ATOM   4348 N  N     . ASP C 3 551 ? 3.222   -2.833  13.180  1.00 24.72 ? 725  ASP A N     1 
ATOM   4349 C  CA    . ASP C 3 551 ? 2.963   -4.250  13.222  1.00 25.53 ? 725  ASP A CA    1 
ATOM   4350 C  C     . ASP C 3 551 ? 3.012   -4.777  11.813  1.00 25.26 ? 725  ASP A C     1 
ATOM   4351 O  O     . ASP C 3 551 ? 2.087   -4.599  11.037  1.00 27.25 ? 725  ASP A O     1 
ATOM   4352 C  CB    . ASP C 3 551 ? 1.588   -4.520  13.825  1.00 32.23 ? 725  ASP A CB    1 
ATOM   4353 C  CG    . ASP C 3 551 ? 1.306   -6.012  14.010  1.00 33.29 ? 725  ASP A CG    1 
ATOM   4354 O  OD1   . ASP C 3 551 ? 1.742   -6.828  13.172  1.00 34.48 ? 725  ASP A OD1   1 
ATOM   4355 O  OD2   . ASP C 3 551 ? 0.636   -6.366  14.999  1.00 35.08 ? 725  ASP A OD2   1 
ATOM   4356 N  N     . PRO C 3 552 ? 4.020   -5.600  11.540  1.00 29.71 ? 726  PRO A N     1 
ATOM   4357 C  CA    . PRO C 3 552 ? 4.206   -6.192  10.212  1.00 30.06 ? 726  PRO A CA    1 
ATOM   4358 C  C     . PRO C 3 552 ? 2.963   -6.868  9.673   1.00 28.27 ? 726  PRO A C     1 
ATOM   4359 O  O     . PRO C 3 552 ? 2.723   -6.844  8.477   1.00 30.90 ? 726  PRO A O     1 
ATOM   4360 C  CB    . PRO C 3 552 ? 5.373   -7.173  10.423  1.00 27.95 ? 726  PRO A CB    1 
ATOM   4361 C  CG    . PRO C 3 552 ? 5.354   -7.435  11.907  1.00 29.31 ? 726  PRO A CG    1 
ATOM   4362 C  CD    . PRO C 3 552 ? 5.003   -6.111  12.507  1.00 29.75 ? 726  PRO A CD    1 
ATOM   4363 N  N     . ARG C 3 553 ? 2.198   -7.509  10.552  1.00 26.65 ? 727  ARG A N     1 
ATOM   4364 C  CA    . ARG C 3 553 ? 0.975   -8.176  10.135  1.00 26.69 ? 727  ARG A CA    1 
ATOM   4365 C  C     . ARG C 3 553 ? 0.031   -7.220  9.435   1.00 29.87 ? 727  ARG A C     1 
ATOM   4366 O  O     . ARG C 3 553 ? -0.844  -7.657  8.689   1.00 35.60 ? 727  ARG A O     1 
ATOM   4367 C  CB    . ARG C 3 553 ? 0.259   -8.784  11.323  1.00 22.83 ? 727  ARG A CB    1 
ATOM   4368 C  CG    . ARG C 3 553 ? 0.999   -9.948  11.931  1.00 25.13 ? 727  ARG A CG    1 
ATOM   4369 C  CD    . ARG C 3 553 ? 0.352   -10.377 13.249  1.00 28.30 ? 727  ARG A CD    1 
ATOM   4370 N  NE    . ARG C 3 553 ? 0.453   -9.351  14.297  1.00 23.38 ? 727  ARG A NE    1 
ATOM   4371 C  CZ    . ARG C 3 553 ? 0.383   -9.595  15.602  1.00 18.91 ? 727  ARG A CZ    1 
ATOM   4372 N  NH1   . ARG C 3 553 ? 0.219   -10.829 16.032  1.00 17.85 ? 727  ARG A NH1   1 
ATOM   4373 N  NH2   . ARG C 3 553 ? 0.424   -8.598  16.475  1.00 21.79 ? 727  ARG A NH2   1 
ATOM   4374 N  N     . ILE C 3 554 ? 0.156   -5.933  9.737   1.00 32.60 ? 728  ILE A N     1 
ATOM   4375 C  CA    . ILE C 3 554 ? -0.681  -4.902  9.103   1.00 34.91 ? 728  ILE A CA    1 
ATOM   4376 C  C     . ILE C 3 554 ? -0.416  -4.785  7.590   1.00 34.37 ? 728  ILE A C     1 
ATOM   4377 O  O     . ILE C 3 554 ? -1.335  -4.762  6.776   1.00 30.40 ? 728  ILE A O     1 
ATOM   4378 C  CB    . ILE C 3 554 ? -0.476  -3.501  9.782   1.00 34.72 ? 728  ILE A CB    1 
ATOM   4379 C  CG1   . ILE C 3 554 ? -0.942  -3.559  11.247  1.00 30.68 ? 728  ILE A CG1   1 
ATOM   4380 C  CG2   . ILE C 3 554 ? -1.242  -2.397  9.016   1.00 29.93 ? 728  ILE A CG2   1 
ATOM   4381 C  CD1   . ILE C 3 554 ? -0.787  -2.267  12.010  1.00 20.75 ? 728  ILE A CD1   1 
ATOM   4382 N  N     . THR C 3 555 ? 0.853   -4.739  7.224   1.00 38.58 ? 729  THR A N     1 
ATOM   4383 C  CA    . THR C 3 555 ? 1.263   -4.626  5.838   1.00 35.80 ? 729  THR A CA    1 
ATOM   4384 C  C     . THR C 3 555 ? 1.077   -5.942  5.115   1.00 33.25 ? 729  THR A C     1 
ATOM   4385 O  O     . THR C 3 555 ? 0.719   -5.959  3.945   1.00 31.95 ? 729  THR A O     1 
ATOM   4386 C  CB    . THR C 3 555 ? 2.740   -4.203  5.766   1.00 38.36 ? 729  THR A CB    1 
ATOM   4387 O  OG1   . THR C 3 555 ? 2.852   -2.860  6.238   1.00 35.94 ? 729  THR A OG1   1 
ATOM   4388 C  CG2   . THR C 3 555 ? 3.280   -4.294  4.338   1.00 36.73 ? 729  THR A CG2   1 
ATOM   4389 N  N     . VAL C 3 556 ? 1.358   -7.040  5.805   1.00 34.99 ? 730  VAL A N     1 
ATOM   4390 C  CA    . VAL C 3 556 ? 1.240   -8.369  5.227   1.00 32.21 ? 730  VAL A CA    1 
ATOM   4391 C  C     . VAL C 3 556 ? -0.189  -8.561  4.769   1.00 33.95 ? 730  VAL A C     1 
ATOM   4392 O  O     . VAL C 3 556 ? -0.437  -8.951  3.621   1.00 33.97 ? 730  VAL A O     1 
ATOM   4393 C  CB    . VAL C 3 556 ? 1.650   -9.454  6.249   1.00 29.25 ? 730  VAL A CB    1 
ATOM   4394 C  CG1   . VAL C 3 556 ? 1.247   -10.831 5.775   1.00 26.74 ? 730  VAL A CG1   1 
ATOM   4395 C  CG2   . VAL C 3 556 ? 3.162   -9.397  6.473   1.00 26.67 ? 730  VAL A CG2   1 
ATOM   4396 N  N     . ALA C 3 557 ? -1.117  -8.217  5.655   1.00 32.37 ? 731  ALA A N     1 
ATOM   4397 C  CA    . ALA C 3 557 ? -2.535  -8.338  5.373   1.00 32.72 ? 731  ALA A CA    1 
ATOM   4398 C  C     . ALA C 3 557 ? -2.854  -7.547  4.114   1.00 34.10 ? 731  ALA A C     1 
ATOM   4399 O  O     . ALA C 3 557 ? -3.181  -8.115  3.073   1.00 40.00 ? 731  ALA A O     1 
ATOM   4400 C  CB    . ALA C 3 557 ? -3.330  -7.810  6.549   1.00 32.39 ? 731  ALA A CB    1 
ATOM   4401 N  N     . TRP C 3 558 ? -2.698  -6.236  4.224   1.00 34.77 ? 732  TRP A N     1 
ATOM   4402 C  CA    . TRP C 3 558 ? -2.927  -5.281  3.141   1.00 33.66 ? 732  TRP A CA    1 
ATOM   4403 C  C     . TRP C 3 558 ? -2.367  -5.789  1.796   1.00 36.13 ? 732  TRP A C     1 
ATOM   4404 O  O     . TRP C 3 558 ? -3.041  -5.708  0.755   1.00 36.98 ? 732  TRP A O     1 
ATOM   4405 C  CB    . TRP C 3 558 ? -2.275  -3.945  3.540   1.00 28.11 ? 732  TRP A CB    1 
ATOM   4406 C  CG    . TRP C 3 558 ? -2.430  -2.849  2.574   1.00 21.88 ? 732  TRP A CG    1 
ATOM   4407 C  CD1   . TRP C 3 558 ? -3.507  -2.036  2.427   1.00 25.96 ? 732  TRP A CD1   1 
ATOM   4408 C  CD2   . TRP C 3 558 ? -1.477  -2.443  1.586   1.00 26.91 ? 732  TRP A CD2   1 
ATOM   4409 N  NE1   . TRP C 3 558 ? -3.297  -1.147  1.401   1.00 28.11 ? 732  TRP A NE1   1 
ATOM   4410 C  CE2   . TRP C 3 558 ? -2.057  -1.371  0.867   1.00 23.61 ? 732  TRP A CE2   1 
ATOM   4411 C  CE3   . TRP C 3 558 ? -0.189  -2.888  1.229   1.00 23.95 ? 732  TRP A CE3   1 
ATOM   4412 C  CZ2   . TRP C 3 558 ? -1.406  -0.735  -0.180  1.00 24.42 ? 732  TRP A CZ2   1 
ATOM   4413 C  CZ3   . TRP C 3 558 ? 0.461   -2.257  0.184   1.00 21.48 ? 732  TRP A CZ3   1 
ATOM   4414 C  CH2   . TRP C 3 558 ? -0.151  -1.185  -0.512  1.00 28.01 ? 732  TRP A CH2   1 
ATOM   4415 N  N     . CYS C 3 559 ? -1.130  -6.280  1.821   1.00 38.12 ? 733  CYS A N     1 
ATOM   4416 C  CA    . CYS C 3 559 ? -0.488  -6.793  0.622   1.00 38.74 ? 733  CYS A CA    1 
ATOM   4417 C  C     . CYS C 3 559 ? -1.337  -7.914  0.090   1.00 42.16 ? 733  CYS A C     1 
ATOM   4418 O  O     . CYS C 3 559 ? -1.816  -7.856  -1.038  1.00 43.13 ? 733  CYS A O     1 
ATOM   4419 C  CB    . CYS C 3 559 ? 0.909   -7.314  0.939   1.00 37.09 ? 733  CYS A CB    1 
ATOM   4420 S  SG    . CYS C 3 559 ? 2.269   -6.137  0.609   1.00 40.82 ? 733  CYS A SG    1 
ATOM   4421 N  N     . LYS C 3 560 ? -1.551  -8.921  0.927   1.00 46.48 ? 734  LYS A N     1 
ATOM   4422 C  CA    . LYS C 3 560 ? -2.369  -10.063 0.551   1.00 55.95 ? 734  LYS A CA    1 
ATOM   4423 C  C     . LYS C 3 560 ? -3.756  -9.657  0.032   1.00 56.90 ? 734  LYS A C     1 
ATOM   4424 O  O     . LYS C 3 560 ? -4.205  -10.149 -1.012  1.00 57.69 ? 734  LYS A O     1 
ATOM   4425 C  CB    . LYS C 3 560 ? -2.507  -11.036 1.724   1.00 59.98 ? 734  LYS A CB    1 
ATOM   4426 C  CG    . LYS C 3 560 ? -1.330  -11.996 1.911   1.00 64.53 ? 734  LYS A CG    1 
ATOM   4427 C  CD    . LYS C 3 560 ? -1.676  -13.064 2.951   1.00 66.36 ? 734  LYS A CD    1 
ATOM   4428 C  CE    . LYS C 3 560 ? -0.600  -14.132 3.065   1.00 68.79 ? 734  LYS A CE    1 
ATOM   4429 N  NZ    . LYS C 3 560 ? 0.670   -13.564 3.607   1.00 73.91 ? 734  LYS A NZ    1 
ATOM   4430 N  N     . LYS C 3 561 ? -4.422  -8.758  0.750   1.00 55.84 ? 735  LYS A N     1 
ATOM   4431 C  CA    . LYS C 3 561 ? -5.737  -8.277  0.352   1.00 58.33 ? 735  LYS A CA    1 
ATOM   4432 C  C     . LYS C 3 561 ? -5.730  -7.626  -1.036  1.00 57.29 ? 735  LYS A C     1 
ATOM   4433 O  O     . LYS C 3 561 ? -6.580  -7.922  -1.873  1.00 56.60 ? 735  LYS A O     1 
ATOM   4434 C  CB    . LYS C 3 561 ? -6.275  -7.258  1.372   1.00 65.07 ? 735  LYS A CB    1 
ATOM   4435 C  CG    . LYS C 3 561 ? -6.365  -7.765  2.818   1.00 75.04 ? 735  LYS A CG    1 
ATOM   4436 C  CD    . LYS C 3 561 ? -7.083  -6.765  3.784   1.00 80.08 ? 735  LYS A CD    1 
ATOM   4437 C  CE    . LYS C 3 561 ? -6.901  -7.157  5.266   1.00 83.07 ? 735  LYS A CE    1 
ATOM   4438 N  NZ    . LYS C 3 561 ? -7.579  -6.313  6.290   1.00 78.79 ? 735  LYS A NZ    1 
ATOM   4439 N  N     . TRP C 3 562 ? -4.793  -6.709  -1.261  1.00 55.85 ? 736  TRP A N     1 
ATOM   4440 C  CA    . TRP C 3 562 ? -4.709  -5.984  -2.525  1.00 52.38 ? 736  TRP A CA    1 
ATOM   4441 C  C     . TRP C 3 562 ? -3.927  -6.647  -3.632  1.00 51.95 ? 736  TRP A C     1 
ATOM   4442 O  O     . TRP C 3 562 ? -3.858  -6.116  -4.754  1.00 51.01 ? 736  TRP A O     1 
ATOM   4443 C  CB    . TRP C 3 562 ? -4.167  -4.577  -2.291  1.00 48.94 ? 736  TRP A CB    1 
ATOM   4444 C  CG    . TRP C 3 562 ? -5.105  -3.749  -1.503  1.00 52.87 ? 736  TRP A CG    1 
ATOM   4445 C  CD1   . TRP C 3 562 ? -4.868  -3.171  -0.294  1.00 53.45 ? 736  TRP A CD1   1 
ATOM   4446 C  CD2   . TRP C 3 562 ? -6.464  -3.437  -1.842  1.00 53.37 ? 736  TRP A CD2   1 
ATOM   4447 N  NE1   . TRP C 3 562 ? -5.998  -2.522  0.148   1.00 54.06 ? 736  TRP A NE1   1 
ATOM   4448 C  CE2   . TRP C 3 562 ? -6.991  -2.671  -0.784  1.00 51.55 ? 736  TRP A CE2   1 
ATOM   4449 C  CE3   . TRP C 3 562 ? -7.292  -3.744  -2.931  1.00 52.55 ? 736  TRP A CE3   1 
ATOM   4450 C  CZ2   . TRP C 3 562 ? -8.309  -2.204  -0.784  1.00 47.71 ? 736  TRP A CZ2   1 
ATOM   4451 C  CZ3   . TRP C 3 562 ? -8.602  -3.279  -2.927  1.00 49.14 ? 736  TRP A CZ3   1 
ATOM   4452 C  CH2   . TRP C 3 562 ? -9.095  -2.519  -1.861  1.00 46.42 ? 736  TRP A CH2   1 
ATOM   4453 N  N     . GLY C 3 563 ? -3.359  -7.811  -3.331  1.00 49.16 ? 737  GLY A N     1 
ATOM   4454 C  CA    . GLY C 3 563 ? -2.579  -8.523  -4.326  1.00 46.45 ? 737  GLY A CA    1 
ATOM   4455 C  C     . GLY C 3 563 ? -1.280  -7.817  -4.652  1.00 46.42 ? 737  GLY A C     1 
ATOM   4456 O  O     . GLY C 3 563 ? -0.743  -7.947  -5.768  1.00 45.46 ? 737  GLY A O     1 
ATOM   4457 N  N     . VAL C 3 564 ? -0.814  -7.000  -3.711  1.00 46.90 ? 738  VAL A N     1 
ATOM   4458 C  CA    . VAL C 3 564 ? 0.454   -6.298  -3.863  1.00 49.77 ? 738  VAL A CA    1 
ATOM   4459 C  C     . VAL C 3 564 ? 1.482   -7.241  -3.245  1.00 52.68 ? 738  VAL A C     1 
ATOM   4460 O  O     . VAL C 3 564 ? 1.363   -7.618  -2.087  1.00 58.87 ? 738  VAL A O     1 
ATOM   4461 C  CB    . VAL C 3 564 ? 0.484   -4.944  -3.109  1.00 47.93 ? 738  VAL A CB    1 
ATOM   4462 C  CG1   . VAL C 3 564 ? 1.872   -4.317  -3.232  1.00 48.11 ? 738  VAL A CG1   1 
ATOM   4463 C  CG2   . VAL C 3 564 ? -0.563  -3.994  -3.664  1.00 45.82 ? 738  VAL A CG2   1 
ATOM   4464 N  N     . PRO C 3 565 ? 2.446   -7.718  -4.046  1.00 51.68 ? 739  PRO A N     1 
ATOM   4465 C  CA    . PRO C 3 565 ? 3.486   -8.632  -3.557  1.00 49.94 ? 739  PRO A CA    1 
ATOM   4466 C  C     . PRO C 3 565 ? 4.305   -8.001  -2.430  1.00 51.14 ? 739  PRO A C     1 
ATOM   4467 O  O     . PRO C 3 565 ? 4.769   -6.856  -2.540  1.00 51.98 ? 739  PRO A O     1 
ATOM   4468 C  CB    . PRO C 3 565 ? 4.321   -8.878  -4.808  1.00 54.24 ? 739  PRO A CB    1 
ATOM   4469 C  CG    . PRO C 3 565 ? 4.096   -7.600  -5.636  1.00 49.90 ? 739  PRO A CG    1 
ATOM   4470 C  CD    . PRO C 3 565 ? 2.633   -7.400  -5.469  1.00 49.05 ? 739  PRO A CD    1 
ATOM   4471 N  N     . ILE C 3 566 ? 4.490   -8.747  -1.348  1.00 49.59 ? 740  ILE A N     1 
ATOM   4472 C  CA    . ILE C 3 566 ? 5.219   -8.227  -0.191  1.00 49.17 ? 740  ILE A CA    1 
ATOM   4473 C  C     . ILE C 3 566 ? 6.630   -7.805  -0.523  1.00 43.06 ? 740  ILE A C     1 
ATOM   4474 O  O     . ILE C 3 566 ? 7.212   -6.953  0.138   1.00 40.77 ? 740  ILE A O     1 
ATOM   4475 C  CB    . ILE C 3 566 ? 5.199   -9.220  0.984   1.00 49.16 ? 740  ILE A CB    1 
ATOM   4476 C  CG1   . ILE C 3 566 ? 3.748   -9.597  1.276   1.00 51.22 ? 740  ILE A CG1   1 
ATOM   4477 C  CG2   . ILE C 3 566 ? 5.729   -8.553  2.245   1.00 48.18 ? 740  ILE A CG2   1 
ATOM   4478 C  CD1   . ILE C 3 566 ? 3.576   -10.633 2.356   1.00 59.84 ? 740  ILE A CD1   1 
ATOM   4479 N  N     . GLU C 3 567 ? 7.169   -8.407  -1.568  1.00 42.43 ? 741  GLU A N     1 
ATOM   4480 C  CA    . GLU C 3 567 ? 8.508   -8.104  -2.027  1.00 43.46 ? 741  GLU A CA    1 
ATOM   4481 C  C     . GLU C 3 567 ? 8.532   -6.678  -2.546  1.00 42.86 ? 741  GLU A C     1 
ATOM   4482 O  O     . GLU C 3 567 ? 9.590   -6.084  -2.692  1.00 43.99 ? 741  GLU A O     1 
ATOM   4483 C  CB    . GLU C 3 567 ? 8.887   -9.051  -3.163  1.00 47.30 ? 741  GLU A CB    1 
ATOM   4484 N  N     . LYS C 3 568 ? 7.367   -6.171  -2.917  1.00 42.15 ? 742  LYS A N     1 
ATOM   4485 C  CA    . LYS C 3 568 ? 7.269   -4.817  -3.425  1.00 43.56 ? 742  LYS A CA    1 
ATOM   4486 C  C     . LYS C 3 568 ? 7.382   -3.810  -2.285  1.00 44.02 ? 742  LYS A C     1 
ATOM   4487 O  O     . LYS C 3 568 ? 7.736   -2.648  -2.496  1.00 42.60 ? 742  LYS A O     1 
ATOM   4488 C  CB    . LYS C 3 568 ? 5.938   -4.632  -4.149  1.00 46.08 ? 742  LYS A CB    1 
ATOM   4489 N  N     . ILE C 3 569 ? 7.050   -4.248  -1.078  1.00 41.79 ? 743  ILE A N     1 
ATOM   4490 C  CA    . ILE C 3 569 ? 7.116   -3.363  0.070   1.00 45.14 ? 743  ILE A CA    1 
ATOM   4491 C  C     . ILE C 3 569 ? 8.288   -3.630  0.988   1.00 45.04 ? 743  ILE A C     1 
ATOM   4492 O  O     . ILE C 3 569 ? 9.022   -2.723  1.363   1.00 45.69 ? 743  ILE A O     1 
ATOM   4493 C  CB    . ILE C 3 569 ? 5.819   -3.410  0.863   1.00 45.98 ? 743  ILE A CB    1 
ATOM   4494 C  CG1   . ILE C 3 569 ? 4.722   -2.762  0.031   1.00 47.38 ? 743  ILE A CG1   1 
ATOM   4495 C  CG2   . ILE C 3 569 ? 5.987   -2.716  2.212   1.00 45.55 ? 743  ILE A CG2   1 
ATOM   4496 C  CD1   . ILE C 3 569 ? 3.449   -2.567  0.771   1.00 57.48 ? 743  ILE A CD1   1 
ATOM   4497 N  N     . TYR C 3 570 ? 8.417   -4.868  1.415   1.00 43.97 ? 744  TYR A N     1 
ATOM   4498 C  CA    . TYR C 3 570 ? 9.509   -5.209  2.283   1.00 45.77 ? 744  TYR A CA    1 
ATOM   4499 C  C     . TYR C 3 570 ? 10.578  -5.850  1.420   1.00 50.34 ? 744  TYR A C     1 
ATOM   4500 O  O     . TYR C 3 570 ? 10.259  -6.622  0.504   1.00 52.87 ? 744  TYR A O     1 
ATOM   4501 C  CB    . TYR C 3 570 ? 9.063   -6.230  3.325   1.00 43.12 ? 744  TYR A CB    1 
ATOM   4502 C  CG    . TYR C 3 570 ? 8.005   -5.799  4.325   1.00 40.17 ? 744  TYR A CG    1 
ATOM   4503 C  CD1   . TYR C 3 570 ? 8.157   -4.648  5.102   1.00 37.95 ? 744  TYR A CD1   1 
ATOM   4504 C  CD2   . TYR C 3 570 ? 6.920   -6.628  4.589   1.00 37.42 ? 744  TYR A CD2   1 
ATOM   4505 C  CE1   . TYR C 3 570 ? 7.267   -4.353  6.127   1.00 38.42 ? 744  TYR A CE1   1 
ATOM   4506 C  CE2   . TYR C 3 570 ? 6.031   -6.343  5.598   1.00 40.18 ? 744  TYR A CE2   1 
ATOM   4507 C  CZ    . TYR C 3 570 ? 6.207   -5.211  6.374   1.00 40.33 ? 744  TYR A CZ    1 
ATOM   4508 O  OH    . TYR C 3 570 ? 5.329   -5.013  7.416   1.00 46.61 ? 744  TYR A OH    1 
ATOM   4509 N  N     . ASN C 3 571 ? 11.839  -5.526  1.697   1.00 52.63 ? 745  ASN A N     1 
ATOM   4510 C  CA    . ASN C 3 571 ? 12.931  -6.143  0.964   1.00 54.20 ? 745  ASN A CA    1 
ATOM   4511 C  C     . ASN C 3 571 ? 13.263  -7.460  1.658   1.00 56.86 ? 745  ASN A C     1 
ATOM   4512 O  O     . ASN C 3 571 ? 12.706  -7.764  2.722   1.00 57.46 ? 745  ASN A O     1 
ATOM   4513 C  CB    . ASN C 3 571 ? 14.157  -5.222  0.856   1.00 56.62 ? 745  ASN A CB    1 
ATOM   4514 C  CG    . ASN C 3 571 ? 14.900  -5.040  2.172   1.00 57.54 ? 745  ASN A CG    1 
ATOM   4515 O  OD1   . ASN C 3 571 ? 15.325  -6.004  2.803   1.00 60.63 ? 745  ASN A OD1   1 
ATOM   4516 N  ND2   . ASN C 3 571 ? 15.138  -3.786  2.537   1.00 56.42 ? 745  ASN A ND2   1 
ATOM   4517 N  N     . LYS C 3 572 ? 14.138  -8.246  1.039   1.00 58.25 ? 746  LYS A N     1 
ATOM   4518 C  CA    . LYS C 3 572 ? 14.540  -9.555  1.559   1.00 58.56 ? 746  LYS A CA    1 
ATOM   4519 C  C     . LYS C 3 572 ? 14.858  -9.649  3.056   1.00 58.54 ? 746  LYS A C     1 
ATOM   4520 O  O     . LYS C 3 572 ? 14.483  -10.638 3.695   1.00 57.63 ? 746  LYS A O     1 
ATOM   4521 C  CB    . LYS C 3 572 ? 15.706  -10.112 0.743   1.00 62.61 ? 746  LYS A CB    1 
ATOM   4522 N  N     . THR C 3 573 ? 15.589  -8.670  3.594   1.00 53.22 ? 747  THR A N     1 
ATOM   4523 C  CA    . THR C 3 573 ? 15.927  -8.668  5.015   1.00 51.08 ? 747  THR A CA    1 
ATOM   4524 C  C     . THR C 3 573 ? 14.688  -8.380  5.833   1.00 47.63 ? 747  THR A C     1 
ATOM   4525 O  O     . THR C 3 573 ? 14.458  -8.997  6.871   1.00 46.88 ? 747  THR A O     1 
ATOM   4526 C  CB    . THR C 3 573 ? 16.998  -7.625  5.357   1.00 53.95 ? 747  THR A CB    1 
ATOM   4527 O  OG1   . THR C 3 573 ? 18.281  -8.063  4.880   1.00 61.80 ? 747  THR A OG1   1 
ATOM   4528 C  CG2   . THR C 3 573 ? 17.075  -7.429  6.845   1.00 59.20 ? 747  THR A CG2   1 
ATOM   4529 N  N     . GLN C 3 574 ? 13.922  -7.391  5.388   1.00 51.17 ? 748  GLN A N     1 
ATOM   4530 C  CA    . GLN C 3 574 ? 12.672  -7.011  6.046   1.00 50.99 ? 748  GLN A CA    1 
ATOM   4531 C  C     . GLN C 3 574 ? 11.781  -8.247  6.089   1.00 47.70 ? 748  GLN A C     1 
ATOM   4532 O  O     . GLN C 3 574 ? 11.035  -8.472  7.051   1.00 45.73 ? 748  GLN A O     1 
ATOM   4533 C  CB    . GLN C 3 574 ? 11.970  -5.891  5.267   1.00 49.71 ? 748  GLN A CB    1 
ATOM   4534 C  CG    . GLN C 3 574 ? 12.759  -4.589  5.188   1.00 52.45 ? 748  GLN A CG    1 
ATOM   4535 C  CD    . GLN C 3 574 ? 12.026  -3.510  4.405   1.00 51.77 ? 748  GLN A CD    1 
ATOM   4536 O  OE1   . GLN C 3 574 ? 12.625  -2.729  3.663   1.00 58.08 ? 748  GLN A OE1   1 
ATOM   4537 N  NE2   . GLN C 3 574 ? 10.718  -3.462  4.572   1.00 53.32 ? 748  GLN A NE2   1 
ATOM   4538 N  N     . ARG C 3 575 ? 11.838  -9.025  5.017   1.00 45.35 ? 749  ARG A N     1 
ATOM   4539 C  CA    . ARG C 3 575 ? 11.074  -10.251 4.941   1.00 43.33 ? 749  ARG A CA    1 
ATOM   4540 C  C     . ARG C 3 575 ? 11.657  -11.309 5.877   1.00 42.74 ? 749  ARG A C     1 
ATOM   4541 O  O     . ARG C 3 575 ? 10.926  -12.155 6.367   1.00 44.71 ? 749  ARG A O     1 
ATOM   4542 C  CB    . ARG C 3 575 ? 11.034  -10.740 3.511   1.00 42.13 ? 749  ARG A CB    1 
ATOM   4543 C  CG    . ARG C 3 575 ? 10.479  -9.696  2.573   1.00 49.63 ? 749  ARG A CG    1 
ATOM   4544 C  CD    . ARG C 3 575 ? 9.895   -10.315 1.306   1.00 52.13 ? 749  ARG A CD    1 
ATOM   4545 N  NE    . ARG C 3 575 ? 10.879  -11.103 0.578   1.00 52.59 ? 749  ARG A NE    1 
ATOM   4546 C  CZ    . ARG C 3 575 ? 11.709  -10.610 -0.328  1.00 53.02 ? 749  ARG A CZ    1 
ATOM   4547 N  NH1   . ARG C 3 575 ? 11.686  -9.317  -0.641  1.00 49.95 ? 749  ARG A NH1   1 
ATOM   4548 N  NH2   . ARG C 3 575 ? 12.575  -11.423 -0.906  1.00 59.53 ? 749  ARG A NH2   1 
ATOM   4549 N  N     . GLU C 3 576 ? 12.972  -11.284 6.098   1.00 44.03 ? 750  GLU A N     1 
ATOM   4550 C  CA    . GLU C 3 576 ? 13.608  -12.235 7.011   1.00 44.53 ? 750  GLU A CA    1 
ATOM   4551 C  C     . GLU C 3 576 ? 13.126  -11.886 8.403   1.00 44.06 ? 750  GLU A C     1 
ATOM   4552 O  O     . GLU C 3 576 ? 12.686  -12.745 9.162   1.00 46.99 ? 750  GLU A O     1 
ATOM   4553 C  CB    . GLU C 3 576 ? 15.121  -12.078 7.003   1.00 52.48 ? 750  GLU A CB    1 
ATOM   4554 C  CG    . GLU C 3 576 ? 15.801  -12.409 5.698   1.00 64.99 ? 750  GLU A CG    1 
ATOM   4555 C  CD    . GLU C 3 576 ? 15.749  -13.882 5.351   1.00 71.77 ? 750  GLU A CD    1 
ATOM   4556 O  OE1   . GLU C 3 576 ? 15.307  -14.695 6.196   1.00 72.64 ? 750  GLU A OE1   1 
ATOM   4557 O  OE2   . GLU C 3 576 ? 16.162  -14.223 4.221   1.00 78.81 ? 750  GLU A OE2   1 
ATOM   4558 N  N     . LYS C 3 577 ? 13.233  -10.607 8.732   1.00 37.63 ? 751  LYS A N     1 
ATOM   4559 C  CA    . LYS C 3 577 ? 12.796  -10.123 10.014  1.00 29.75 ? 751  LYS A CA    1 
ATOM   4560 C  C     . LYS C 3 577 ? 11.326  -10.444 10.272  1.00 28.73 ? 751  LYS A C     1 
ATOM   4561 O  O     . LYS C 3 577 ? 11.021  -11.193 11.185  1.00 31.10 ? 751  LYS A O     1 
ATOM   4562 C  CB    . LYS C 3 577 ? 13.007  -8.619  10.111  1.00 23.23 ? 751  LYS A CB    1 
ATOM   4563 C  CG    . LYS C 3 577 ? 12.480  -8.064  11.424  1.00 27.85 ? 751  LYS A CG    1 
ATOM   4564 C  CD    . LYS C 3 577 ? 12.724  -6.580  11.590  1.00 22.81 ? 751  LYS A CD    1 
ATOM   4565 C  CE    . LYS C 3 577 ? 12.398  -6.196  13.002  1.00 21.73 ? 751  LYS A CE    1 
ATOM   4566 N  NZ    . LYS C 3 577 ? 12.936  -4.870  13.356  1.00 25.51 ? 751  LYS A NZ    1 
ATOM   4567 N  N     . PHE C 3 578 ? 10.443  -9.909  9.426   1.00 29.39 ? 752  PHE A N     1 
ATOM   4568 C  CA    . PHE C 3 578 ? 8.981   -10.051 9.553   1.00 30.23 ? 752  PHE A CA    1 
ATOM   4569 C  C     . PHE C 3 578 ? 8.355   -11.357 9.080   1.00 30.38 ? 752  PHE A C     1 
ATOM   4570 O  O     . PHE C 3 578 ? 7.133   -11.473 8.954   1.00 27.53 ? 752  PHE A O     1 
ATOM   4571 C  CB    . PHE C 3 578 ? 8.297   -8.864  8.875   1.00 28.10 ? 752  PHE A CB    1 
ATOM   4572 C  CG    . PHE C 3 578 ? 8.696   -7.523  9.447   1.00 35.09 ? 752  PHE A CG    1 
ATOM   4573 C  CD1   . PHE C 3 578 ? 8.902   -7.368  10.819  1.00 39.78 ? 752  PHE A CD1   1 
ATOM   4574 C  CD2   . PHE C 3 578 ? 8.863   -6.419  8.628   1.00 30.62 ? 752  PHE A CD2   1 
ATOM   4575 C  CE1   . PHE C 3 578 ? 9.270   -6.133  11.362  1.00 36.10 ? 752  PHE A CE1   1 
ATOM   4576 C  CE2   . PHE C 3 578 ? 9.227   -5.184  9.154   1.00 28.66 ? 752  PHE A CE2   1 
ATOM   4577 C  CZ    . PHE C 3 578 ? 9.430   -5.037  10.521  1.00 37.13 ? 752  PHE A CZ    1 
ATOM   4578 N  N     . ALA C 3 579 ? 9.203   -12.337 8.834   1.00 32.08 ? 753  ALA A N     1 
ATOM   4579 C  CA    . ALA C 3 579 ? 8.790   -13.656 8.392   1.00 31.42 ? 753  ALA A CA    1 
ATOM   4580 C  C     . ALA C 3 579 ? 7.642   -14.215 9.231   1.00 32.34 ? 753  ALA A C     1 
ATOM   4581 O  O     . ALA C 3 579 ? 6.690   -14.789 8.702   1.00 36.48 ? 753  ALA A O     1 
ATOM   4582 C  CB    . ALA C 3 579 ? 9.987   -14.595 8.431   1.00 28.26 ? 753  ALA A CB    1 
ATOM   4583 N  N     . TRP C 3 580 ? 7.730   -14.046 10.539  1.00 34.37 ? 754  TRP A N     1 
ATOM   4584 C  CA    . TRP C 3 580 ? 6.691   -14.550 11.415  1.00 32.33 ? 754  TRP A CA    1 
ATOM   4585 C  C     . TRP C 3 580 ? 5.364   -13.954 11.017  1.00 33.30 ? 754  TRP A C     1 
ATOM   4586 O  O     . TRP C 3 580 ? 4.353   -14.654 11.008  1.00 35.18 ? 754  TRP A O     1 
ATOM   4587 C  CB    . TRP C 3 580 ? 7.010   -14.270 12.901  1.00 28.67 ? 754  TRP A CB    1 
ATOM   4588 C  CG    . TRP C 3 580 ? 7.261   -12.844 13.271  1.00 25.15 ? 754  TRP A CG    1 
ATOM   4589 C  CD1   . TRP C 3 580 ? 8.464   -12.200 13.281  1.00 19.60 ? 754  TRP A CD1   1 
ATOM   4590 C  CD2   . TRP C 3 580 ? 6.277   -11.874 13.696  1.00 28.05 ? 754  TRP A CD2   1 
ATOM   4591 N  NE1   . TRP C 3 580 ? 8.291   -10.888 13.677  1.00 25.44 ? 754  TRP A NE1   1 
ATOM   4592 C  CE2   . TRP C 3 580 ? 6.962   -10.661 13.930  1.00 24.43 ? 754  TRP A CE2   1 
ATOM   4593 C  CE3   . TRP C 3 580 ? 4.889   -11.916 13.903  1.00 24.70 ? 754  TRP A CE3   1 
ATOM   4594 C  CZ2   . TRP C 3 580 ? 6.303   -9.493  14.358  1.00 25.71 ? 754  TRP A CZ2   1 
ATOM   4595 C  CZ3   . TRP C 3 580 ? 4.233   -10.749 14.333  1.00 16.94 ? 754  TRP A CZ3   1 
ATOM   4596 C  CH2   . TRP C 3 580 ? 4.943   -9.560  14.553  1.00 16.27 ? 754  TRP A CH2   1 
ATOM   4597 N  N     . ALA C 3 581 ? 5.380   -12.673 10.662  1.00 36.33 ? 755  ALA A N     1 
ATOM   4598 C  CA    . ALA C 3 581 ? 4.166   -11.981 10.260  1.00 37.57 ? 755  ALA A CA    1 
ATOM   4599 C  C     . ALA C 3 581 ? 3.724   -12.404 8.859   1.00 41.37 ? 755  ALA A C     1 
ATOM   4600 O  O     . ALA C 3 581 ? 2.536   -12.623 8.606   1.00 45.75 ? 755  ALA A O     1 
ATOM   4601 C  CB    . ALA C 3 581 ? 4.378   -10.497 10.320  1.00 33.49 ? 755  ALA A CB    1 
ATOM   4602 N  N     . ILE C 3 582 ? 4.684   -12.533 7.953   1.00 41.40 ? 756  ILE A N     1 
ATOM   4603 C  CA    . ILE C 3 582 ? 4.386   -12.923 6.582   1.00 41.76 ? 756  ILE A CA    1 
ATOM   4604 C  C     . ILE C 3 582 ? 3.840   -14.337 6.474   1.00 42.60 ? 756  ILE A C     1 
ATOM   4605 O  O     . ILE C 3 582 ? 3.565   -14.837 5.398   1.00 46.61 ? 756  ILE A O     1 
ATOM   4606 C  CB    . ILE C 3 582 ? 5.617   -12.739 5.693   1.00 38.83 ? 756  ILE A CB    1 
ATOM   4607 C  CG1   . ILE C 3 582 ? 6.066   -11.279 5.756   1.00 42.46 ? 756  ILE A CG1   1 
ATOM   4608 C  CG2   . ILE C 3 582 ? 5.297   -13.066 4.264   1.00 41.82 ? 756  ILE A CG2   1 
ATOM   4609 C  CD1   . ILE C 3 582 ? 7.349   -10.996 5.001   1.00 44.46 ? 756  ILE A CD1   1 
ATOM   4610 N  N     . ASP C 3 583 ? 3.671   -14.999 7.597   1.00 47.41 ? 757  ASP A N     1 
ATOM   4611 C  CA    . ASP C 3 583 ? 3.127   -16.325 7.541   1.00 52.80 ? 757  ASP A CA    1 
ATOM   4612 C  C     . ASP C 3 583 ? 1.879   -16.433 8.384   1.00 56.92 ? 757  ASP A C     1 
ATOM   4613 O  O     . ASP C 3 583 ? 0.919   -17.092 8.000   1.00 60.62 ? 757  ASP A O     1 
ATOM   4614 C  CB    . ASP C 3 583 ? 4.149   -17.349 8.008   1.00 57.03 ? 757  ASP A CB    1 
ATOM   4615 C  CG    . ASP C 3 583 ? 3.616   -18.767 7.944   1.00 63.39 ? 757  ASP A CG    1 
ATOM   4616 O  OD1   . ASP C 3 583 ? 3.069   -19.129 6.883   1.00 72.39 ? 757  ASP A OD1   1 
ATOM   4617 O  OD2   . ASP C 3 583 ? 3.718   -19.514 8.945   1.00 61.94 ? 757  ASP A OD2   1 
ATOM   4618 N  N     . MET C 3 584 ? 1.883   -15.774 9.534   1.00 59.90 ? 758  MET A N     1 
ATOM   4619 C  CA    . MET C 3 584 ? 0.745   -15.865 10.431  1.00 65.02 ? 758  MET A CA    1 
ATOM   4620 C  C     . MET C 3 584 ? -0.321  -14.767 10.355  1.00 66.60 ? 758  MET A C     1 
ATOM   4621 O  O     . MET C 3 584 ? -1.160  -14.653 11.255  1.00 70.73 ? 758  MET A O     1 
ATOM   4622 C  CB    . MET C 3 584 ? 1.245   -16.001 11.866  1.00 63.94 ? 758  MET A CB    1 
ATOM   4623 C  CG    . MET C 3 584 ? 1.765   -14.714 12.447  1.00 68.50 ? 758  MET A CG    1 
ATOM   4624 S  SD    . MET C 3 584 ? 2.505   -14.945 14.057  1.00 75.32 ? 758  MET A SD    1 
ATOM   4625 C  CE    . MET C 3 584 ? 1.041   -14.748 15.148  1.00 77.01 ? 758  MET A CE    1 
ATOM   4626 N  N     . ALA C 3 585 ? -0.317  -13.962 9.303   1.00 67.21 ? 759  ALA A N     1 
ATOM   4627 C  CA    . ALA C 3 585 ? -1.323  -12.907 9.201   1.00 67.79 ? 759  ALA A CA    1 
ATOM   4628 C  C     . ALA C 3 585 ? -1.966  -12.927 7.838   1.00 66.82 ? 759  ALA A C     1 
ATOM   4629 O  O     . ALA C 3 585 ? -1.263  -12.957 6.830   1.00 70.34 ? 759  ALA A O     1 
ATOM   4630 C  CB    . ALA C 3 585 ? -0.699  -11.550 9.461   1.00 68.13 ? 759  ALA A CB    1 
ATOM   4631 N  N     . ASP C 3 586 ? -3.293  -12.878 7.799   1.00 65.51 ? 760  ASP A N     1 
ATOM   4632 C  CA    . ASP C 3 586 ? -3.984  -12.905 6.522   1.00 62.86 ? 760  ASP A CA    1 
ATOM   4633 C  C     . ASP C 3 586 ? -4.881  -11.715 6.250   1.00 59.13 ? 760  ASP A C     1 
ATOM   4634 O  O     . ASP C 3 586 ? -4.918  -10.752 7.015   1.00 53.61 ? 760  ASP A O     1 
ATOM   4635 C  CB    . ASP C 3 586 ? -4.772  -14.206 6.367   1.00 67.24 ? 760  ASP A CB    1 
ATOM   4636 N  N     . GLU C 3 587 ? -5.552  -11.789 5.108   1.00 59.36 ? 761  GLU A N     1 
ATOM   4637 C  CA    . GLU C 3 587 ? -6.463  -10.771 4.617   1.00 61.24 ? 761  GLU A CA    1 
ATOM   4638 C  C     . GLU C 3 587 ? -7.557  -10.367 5.604   1.00 64.04 ? 761  GLU A C     1 
ATOM   4639 O  O     . GLU C 3 587 ? -8.440  -9.561  5.274   1.00 69.30 ? 761  GLU A O     1 
ATOM   4640 C  CB    . GLU C 3 587 ? -7.097  -11.242 3.301   1.00 60.34 ? 761  GLU A CB    1 
ATOM   4641 N  N     . ASP C 3 588 ? -7.523  -10.925 6.802   1.00 64.24 ? 762  ASP A N     1 
ATOM   4642 C  CA    . ASP C 3 588 ? -8.524  -10.584 7.794   1.00 61.94 ? 762  ASP A CA    1 
ATOM   4643 C  C     . ASP C 3 588 ? -7.871  -10.009 9.035   1.00 59.64 ? 762  ASP A C     1 
ATOM   4644 O  O     . ASP C 3 588 ? -8.541  -9.879  10.054  1.00 58.55 ? 762  ASP A O     1 
ATOM   4645 C  CB    . ASP C 3 588 ? -9.375  -11.808 8.152   1.00 60.85 ? 762  ASP A CB    1 
ATOM   4646 N  N     . TYR C 3 589 ? -6.599  -9.601  8.926   1.00 58.52 ? 763  TYR A N     1 
ATOM   4647 C  CA    . TYR C 3 589 ? -5.871  -9.042  10.074  1.00 56.57 ? 763  TYR A CA    1 
ATOM   4648 C  C     . TYR C 3 589 ? -6.210  -7.608  10.403  1.00 57.73 ? 763  TYR A C     1 
ATOM   4649 O  O     . TYR C 3 589 ? -6.020  -6.696  9.592   1.00 62.40 ? 763  TYR A O     1 
ATOM   4650 C  CB    . TYR C 3 589 ? -4.350  -9.127  9.934   1.00 50.05 ? 763  TYR A CB    1 
ATOM   4651 C  CG    . TYR C 3 589 ? -3.661  -8.642  11.195  1.00 44.07 ? 763  TYR A CG    1 
ATOM   4652 C  CD1   . TYR C 3 589 ? -3.673  -9.421  12.355  1.00 40.84 ? 763  TYR A CD1   1 
ATOM   4653 C  CD2   . TYR C 3 589 ? -3.032  -7.397  11.246  1.00 42.86 ? 763  TYR A CD2   1 
ATOM   4654 C  CE1   . TYR C 3 589 ? -3.073  -8.969  13.532  1.00 35.94 ? 763  TYR A CE1   1 
ATOM   4655 C  CE2   . TYR C 3 589 ? -2.426  -6.935  12.429  1.00 34.13 ? 763  TYR A CE2   1 
ATOM   4656 C  CZ    . TYR C 3 589 ? -2.451  -7.728  13.560  1.00 33.54 ? 763  TYR A CZ    1 
ATOM   4657 O  OH    . TYR C 3 589 ? -1.834  -7.306  14.712  1.00 30.94 ? 763  TYR A OH    1 
ATOM   4658 N  N     . GLU C 3 590 ? -6.591  -7.411  11.651  1.00 56.02 ? 764  GLU A N     1 
ATOM   4659 C  CA    . GLU C 3 590 ? -6.960  -6.105  12.142  1.00 59.19 ? 764  GLU A CA    1 
ATOM   4660 C  C     . GLU C 3 590 ? -6.272  -5.938  13.485  1.00 58.71 ? 764  GLU A C     1 
ATOM   4661 O  O     . GLU C 3 590 ? -6.509  -6.710  14.413  1.00 59.40 ? 764  GLU A O     1 
ATOM   4662 C  CB    . GLU C 3 590 ? -8.493  -6.013  12.295  1.00 63.21 ? 764  GLU A CB    1 
ATOM   4663 N  N     . PHE C 3 591 ? -5.355  -4.982  13.549  1.00 56.91 ? 765  PHE A N     1 
ATOM   4664 C  CA    . PHE C 3 591 ? -4.640  -4.671  14.782  1.00 57.28 ? 765  PHE A CA    1 
ATOM   4665 C  C     . PHE C 3 591 ? -5.705  -4.224  15.808  1.00 61.02 ? 765  PHE A C     1 
ATOM   4666 O  O     . PHE C 3 591 ? -5.625  -4.635  16.998  1.00 61.82 ? 765  PHE A O     1 
ATOM   4667 C  CB    . PHE C 3 591 ? -3.611  -3.565  14.468  1.00 53.83 ? 765  PHE A CB    1 
ATOM   4668 C  CG    . PHE C 3 591 ? -2.900  -2.998  15.662  1.00 48.65 ? 765  PHE A CG    1 
ATOM   4669 C  CD1   . PHE C 3 591 ? -1.773  -3.613  16.183  1.00 50.78 ? 765  PHE A CD1   1 
ATOM   4670 C  CD2   . PHE C 3 591 ? -3.343  -1.812  16.239  1.00 52.08 ? 765  PHE A CD2   1 
ATOM   4671 C  CE1   . PHE C 3 591 ? -1.091  -3.050  17.272  1.00 51.86 ? 765  PHE A CE1   1 
ATOM   4672 C  CE2   . PHE C 3 591 ? -2.685  -1.239  17.317  1.00 52.03 ? 765  PHE A CE2   1 
ATOM   4673 C  CZ    . PHE C 3 591 ? -1.551  -1.856  17.841  1.00 54.87 ? 765  PHE A CZ    1 
ATOM   4674 O  OXT   . PHE C 3 591 ? -6.668  -3.530  15.382  1.00 61.90 ? 765  PHE A OXT   1 
HETATM 4675 O  O     . HOH D 4 .   ? 27.493  5.207   11.127  1.00 34.24 ? 1031 HOH C O     1 
HETATM 4676 O  O     . HOH D 4 .   ? 29.150  2.395   8.823   1.00 43.22 ? 1059 HOH C O     1 
HETATM 4677 O  O     . HOH D 4 .   ? 31.662  2.365   0.765   1.00 56.04 ? 1060 HOH C O     1 
HETATM 4678 O  O     . HOH D 4 .   ? 18.393  1.614   11.901  1.00 42.70 ? 1066 HOH C O     1 
HETATM 4679 O  O     . HOH D 4 .   ? 20.675  -3.515  18.333  1.00 35.38 ? 1067 HOH C O     1 
HETATM 4680 O  O     . HOH D 4 .   ? 16.974  -5.312  32.238  1.00 60.46 ? 1099 HOH C O     1 
HETATM 4681 O  O     . HOH D 4 .   ? 19.417  5.144   7.376   1.00 53.07 ? 1111 HOH C O     1 
HETATM 4682 O  O     . HOH D 4 .   ? 27.230  -1.611  4.887   1.00 69.29 ? 1114 HOH C O     1 
HETATM 4683 O  O     . HOH D 4 .   ? 17.248  7.809   10.177  1.00 38.60 ? 1123 HOH C O     1 
HETATM 4684 O  O     . HOH D 4 .   ? 33.044  5.314   9.291   1.00 53.16 ? 1132 HOH C O     1 
HETATM 4685 O  O     . HOH D 4 .   ? 28.631  9.220   40.659  1.00 57.29 ? 1167 HOH C O     1 
HETATM 4686 O  O     . HOH D 4 .   ? 21.467  -10.293 34.441  1.00 55.81 ? 1171 HOH C O     1 
HETATM 4687 O  O     . HOH D 4 .   ? 18.842  1.442   -17.884 1.00 57.75 ? 1178 HOH C O     1 
HETATM 4688 O  O     . HOH D 4 .   ? 19.279  5.601   37.645  1.00 75.68 ? 1180 HOH C O     1 
HETATM 4689 O  O     . HOH D 4 .   ? 29.615  13.850  7.107   1.00 53.70 ? 1203 HOH C O     1 
HETATM 4690 O  O     . HOH D 4 .   ? 28.756  -2.702  -9.335  1.00 60.04 ? 1214 HOH C O     1 
HETATM 4691 O  O     . HOH D 4 .   ? 20.714  4.629   34.479  1.00 51.58 ? 1216 HOH C O     1 
HETATM 4692 O  O     . HOH D 4 .   ? 14.810  -3.077  26.291  1.00 55.58 ? 1219 HOH C O     1 
HETATM 4693 O  O     . HOH D 4 .   ? 21.034  5.931   4.904   1.00 60.26 ? 1226 HOH C O     1 
HETATM 4694 O  O     . HOH D 4 .   ? 31.445  11.267  6.659   1.00 51.73 ? 1235 HOH C O     1 
HETATM 4695 O  O     . HOH D 4 .   ? 34.213  -3.869  0.984   1.00 48.98 ? 1255 HOH C O     1 
HETATM 4696 O  O     . HOH D 4 .   ? 18.059  7.732   -15.831 1.00 63.58 ? 1257 HOH C O     1 
HETATM 4697 O  O     . HOH D 4 .   ? 23.797  -4.168  39.800  1.00 51.42 ? 1268 HOH C O     1 
HETATM 4698 O  O     . HOH E 4 .   ? 26.291  6.294   23.748  1.00 27.57 ? 1001 HOH D O     1 
HETATM 4699 O  O     . HOH E 4 .   ? 11.659  4.807   31.152  1.00 27.97 ? 1002 HOH D O     1 
HETATM 4700 O  O     . HOH E 4 .   ? 31.974  6.590   18.358  1.00 26.76 ? 1005 HOH D O     1 
HETATM 4701 O  O     . HOH E 4 .   ? 31.900  4.819   -19.584 1.00 51.31 ? 1011 HOH D O     1 
HETATM 4702 O  O     . HOH E 4 .   ? 23.041  -1.241  41.332  1.00 24.54 ? 1015 HOH D O     1 
HETATM 4703 O  O     . HOH E 4 .   ? 21.173  -4.860  37.917  1.00 41.70 ? 1016 HOH D O     1 
HETATM 4704 O  O     . HOH E 4 .   ? 27.473  -3.979  14.265  1.00 32.32 ? 1025 HOH D O     1 
HETATM 4705 O  O     . HOH E 4 .   ? 16.610  3.768   22.613  1.00 53.55 ? 1037 HOH D O     1 
HETATM 4706 O  O     . HOH E 4 .   ? 21.909  12.849  21.813  1.00 44.62 ? 1041 HOH D O     1 
HETATM 4707 O  O     . HOH E 4 .   ? 32.694  -3.709  14.539  1.00 27.71 ? 1047 HOH D O     1 
HETATM 4708 O  O     . HOH E 4 .   ? 17.498  -7.748  44.198  1.00 61.37 ? 1062 HOH D O     1 
HETATM 4709 O  O     . HOH E 4 .   ? 14.043  0.639   24.657  1.00 42.44 ? 1070 HOH D O     1 
HETATM 4710 O  O     . HOH E 4 .   ? 12.489  -4.294  30.423  1.00 54.17 ? 1071 HOH D O     1 
HETATM 4711 O  O     . HOH E 4 .   ? 20.895  8.729   26.704  1.00 55.66 ? 1078 HOH D O     1 
HETATM 4712 O  O     . HOH E 4 .   ? 13.747  10.309  25.512  1.00 49.46 ? 1082 HOH D O     1 
HETATM 4713 O  O     . HOH E 4 .   ? 34.198  1.894   16.811  1.00 41.74 ? 1094 HOH D O     1 
HETATM 4714 O  O     . HOH E 4 .   ? 27.500  3.597   23.299  1.00 39.86 ? 1105 HOH D O     1 
HETATM 4715 O  O     . HOH E 4 .   ? 28.616  -1.802  16.736  1.00 65.91 ? 1107 HOH D O     1 
HETATM 4716 O  O     . HOH E 4 .   ? 19.025  -4.562  34.793  1.00 56.93 ? 1112 HOH D O     1 
HETATM 4717 O  O     . HOH E 4 .   ? 22.879  -3.801  15.935  1.00 48.46 ? 1115 HOH D O     1 
HETATM 4718 O  O     . HOH E 4 .   ? 23.662  -4.802  10.757  1.00 48.67 ? 1116 HOH D O     1 
HETATM 4719 O  O     . HOH E 4 .   ? 27.073  -8.000  6.030   1.00 59.90 ? 1117 HOH D O     1 
HETATM 4720 O  O     . HOH E 4 .   ? 7.809   -3.331  30.293  1.00 76.22 ? 1119 HOH D O     1 
HETATM 4721 O  O     . HOH E 4 .   ? 39.602  2.144   -18.336 1.00 47.17 ? 1121 HOH D O     1 
HETATM 4722 O  O     . HOH E 4 .   ? 15.020  -1.519  -4.121  1.00 48.41 ? 1122 HOH D O     1 
HETATM 4723 O  O     . HOH E 4 .   ? 19.095  -4.051  49.242  1.00 40.53 ? 1124 HOH D O     1 
HETATM 4724 O  O     . HOH E 4 .   ? 20.548  -6.230  8.131   1.00 69.49 ? 1140 HOH D O     1 
HETATM 4725 O  O     . HOH E 4 .   ? 24.931  -5.538  49.045  1.00 58.64 ? 1143 HOH D O     1 
HETATM 4726 O  O     . HOH E 4 .   ? 24.490  12.966  23.057  1.00 46.61 ? 1150 HOH D O     1 
HETATM 4727 O  O     . HOH E 4 .   ? 28.796  -0.185  7.708   1.00 42.02 ? 1153 HOH D O     1 
HETATM 4728 O  O     . HOH E 4 .   ? 24.506  -1.146  19.840  1.00 46.27 ? 1164 HOH D O     1 
HETATM 4729 O  O     . HOH E 4 .   ? 13.871  -1.751  29.375  1.00 51.88 ? 1193 HOH D O     1 
HETATM 4730 O  O     . HOH E 4 .   ? 15.881  -3.275  47.863  1.00 64.64 ? 1194 HOH D O     1 
HETATM 4731 O  O     . HOH E 4 .   ? 6.897   -3.756  35.335  1.00 58.12 ? 1196 HOH D O     1 
HETATM 4732 O  O     . HOH E 4 .   ? 30.081  -5.835  14.551  1.00 34.56 ? 1199 HOH D O     1 
HETATM 4733 O  O     . HOH E 4 .   ? 24.729  -2.699  1.447   1.00 62.36 ? 1205 HOH D O     1 
HETATM 4734 O  O     . HOH E 4 .   ? 22.423  -2.364  -1.843  1.00 77.71 ? 1206 HOH D O     1 
HETATM 4735 O  O     . HOH E 4 .   ? 24.982  1.815   23.850  1.00 58.54 ? 1207 HOH D O     1 
HETATM 4736 O  O     . HOH E 4 .   ? 20.908  -6.441  46.255  1.00 40.91 ? 1208 HOH D O     1 
HETATM 4737 O  O     . HOH E 4 .   ? 17.810  5.660   32.547  1.00 41.12 ? 1212 HOH D O     1 
HETATM 4738 O  O     . HOH E 4 .   ? 30.981  -2.084  7.412   1.00 49.26 ? 1242 HOH D O     1 
HETATM 4739 O  O     . HOH E 4 .   ? 21.441  4.507   29.395  1.00 43.83 ? 1246 HOH D O     1 
HETATM 4740 O  O     . HOH E 4 .   ? 12.642  -0.932  26.666  1.00 67.63 ? 1265 HOH D O     1 
HETATM 4741 O  O     . HOH E 4 .   ? 9.979   1.670   34.274  1.00 64.34 ? 1270 HOH D O     1 
HETATM 4742 O  O     . HOH F 4 .   ? 6.425   7.368   24.791  1.00 18.63 ? 1003 HOH A O     1 
HETATM 4743 O  O     . HOH F 4 .   ? 25.470  10.276  25.969  1.00 41.18 ? 1004 HOH A O     1 
HETATM 4744 O  O     . HOH F 4 .   ? 8.522   2.101   37.209  1.00 45.26 ? 1006 HOH A O     1 
HETATM 4745 O  O     . HOH F 4 .   ? 31.988  -24.482 33.154  1.00 39.88 ? 1007 HOH A O     1 
HETATM 4746 O  O     . HOH F 4 .   ? 31.205  -15.099 16.533  1.00 30.11 ? 1008 HOH A O     1 
HETATM 4747 O  O     . HOH F 4 .   ? 6.411   -1.946  9.519   1.00 35.39 ? 1009 HOH A O     1 
HETATM 4748 O  O     . HOH F 4 .   ? 39.858  -5.493  19.578  1.00 31.07 ? 1010 HOH A O     1 
HETATM 4749 O  O     . HOH F 4 .   ? 4.648   2.300   6.813   1.00 74.61 ? 1012 HOH A O     1 
HETATM 4750 O  O     . HOH F 4 .   ? 17.282  -17.302 18.865  1.00 37.23 ? 1013 HOH A O     1 
HETATM 4751 O  O     . HOH F 4 .   ? 40.108  -12.138 16.083  1.00 35.70 ? 1014 HOH A O     1 
HETATM 4752 O  O     . HOH F 4 .   ? -12.044 5.475   32.829  1.00 38.45 ? 1017 HOH A O     1 
HETATM 4753 O  O     . HOH F 4 .   ? 28.769  -8.520  34.719  1.00 47.49 ? 1018 HOH A O     1 
HETATM 4754 O  O     . HOH F 4 .   ? 19.651  16.875  3.008   1.00 31.52 ? 1019 HOH A O     1 
HETATM 4755 O  O     . HOH F 4 .   ? 35.413  -5.163  29.453  1.00 57.83 ? 1020 HOH A O     1 
HETATM 4756 O  O     . HOH F 4 .   ? 30.442  -14.377 -1.414  1.00 50.83 ? 1021 HOH A O     1 
HETATM 4757 O  O     . HOH F 4 .   ? 8.252   0.102   18.322  1.00 33.87 ? 1022 HOH A O     1 
HETATM 4758 O  O     . HOH F 4 .   ? 58.152  12.012  18.246  1.00 37.13 ? 1023 HOH A O     1 
HETATM 4759 O  O     . HOH F 4 .   ? 25.774  4.060   27.630  1.00 51.12 ? 1024 HOH A O     1 
HETATM 4760 O  O     . HOH F 4 .   ? -9.458  0.439   1.033   1.00 33.19 ? 1026 HOH A O     1 
HETATM 4761 O  O     . HOH F 4 .   ? 13.223  12.528  23.126  1.00 34.59 ? 1027 HOH A O     1 
HETATM 4762 O  O     . HOH F 4 .   ? 30.158  -21.411 22.835  1.00 53.21 ? 1028 HOH A O     1 
HETATM 4763 O  O     . HOH F 4 .   ? -0.993  7.374   -5.279  1.00 50.14 ? 1029 HOH A O     1 
HETATM 4764 O  O     . HOH F 4 .   ? 44.978  0.228   -6.272  1.00 56.91 ? 1030 HOH A O     1 
HETATM 4765 O  O     . HOH F 4 .   ? 29.184  -25.885 16.379  1.00 50.24 ? 1032 HOH A O     1 
HETATM 4766 O  O     . HOH F 4 .   ? 31.846  -5.806  32.274  1.00 64.29 ? 1033 HOH A O     1 
HETATM 4767 O  O     . HOH F 4 .   ? -5.889  5.854   19.440  1.00 42.37 ? 1034 HOH A O     1 
HETATM 4768 O  O     . HOH F 4 .   ? 17.451  -21.371 35.722  1.00 37.97 ? 1035 HOH A O     1 
HETATM 4769 O  O     . HOH F 4 .   ? 36.645  -0.054  21.393  1.00 30.57 ? 1036 HOH A O     1 
HETATM 4770 O  O     . HOH F 4 .   ? 9.510   6.492   25.538  1.00 47.35 ? 1038 HOH A O     1 
HETATM 4771 O  O     . HOH F 4 .   ? 54.347  3.830   21.711  1.00 37.22 ? 1039 HOH A O     1 
HETATM 4772 O  O     . HOH F 4 .   ? 40.648  1.553   14.331  1.00 31.13 ? 1040 HOH A O     1 
HETATM 4773 O  O     . HOH F 4 .   ? -3.498  -8.911  20.782  1.00 36.59 ? 1042 HOH A O     1 
HETATM 4774 O  O     . HOH F 4 .   ? 4.543   -2.838  23.135  1.00 36.26 ? 1043 HOH A O     1 
HETATM 4775 O  O     . HOH F 4 .   ? 10.482  6.157   10.662  1.00 48.53 ? 1044 HOH A O     1 
HETATM 4776 O  O     . HOH F 4 .   ? 4.108   29.803  28.060  1.00 38.75 ? 1045 HOH A O     1 
HETATM 4777 O  O     . HOH F 4 .   ? 30.112  -7.768  12.800  1.00 63.59 ? 1046 HOH A O     1 
HETATM 4778 O  O     . HOH F 4 .   ? 38.835  -2.602  19.221  1.00 42.24 ? 1048 HOH A O     1 
HETATM 4779 O  O     . HOH F 4 .   ? 53.867  21.474  11.494  1.00 29.66 ? 1049 HOH A O     1 
HETATM 4780 O  O     . HOH F 4 .   ? 46.652  19.353  10.482  1.00 31.52 ? 1050 HOH A O     1 
HETATM 4781 O  O     . HOH F 4 .   ? 41.903  20.999  11.955  1.00 31.45 ? 1051 HOH A O     1 
HETATM 4782 O  O     . HOH F 4 .   ? 42.557  25.757  15.606  1.00 48.34 ? 1052 HOH A O     1 
HETATM 4783 O  O     . HOH F 4 .   ? -4.586  3.723   -4.533  1.00 47.63 ? 1053 HOH A O     1 
HETATM 4784 O  O     . HOH F 4 .   ? 8.541   -1.351  -5.029  1.00 50.79 ? 1054 HOH A O     1 
HETATM 4785 O  O     . HOH F 4 .   ? 2.492   -2.786  9.363   1.00 63.50 ? 1055 HOH A O     1 
HETATM 4786 O  O     . HOH F 4 .   ? 13.111  -8.884  15.369  1.00 66.66 ? 1056 HOH A O     1 
HETATM 4787 O  O     . HOH F 4 .   ? 10.109  12.477  22.942  1.00 43.39 ? 1057 HOH A O     1 
HETATM 4788 O  O     . HOH F 4 .   ? 24.855  -12.229 33.403  1.00 46.95 ? 1058 HOH A O     1 
HETATM 4789 O  O     . HOH F 4 .   ? 36.511  -0.264  0.790   1.00 46.01 ? 1061 HOH A O     1 
HETATM 4790 O  O     . HOH F 4 .   ? 24.510  15.454  16.001  1.00 70.54 ? 1063 HOH A O     1 
HETATM 4791 O  O     . HOH F 4 .   ? 17.326  -21.284 17.876  1.00 45.05 ? 1064 HOH A O     1 
HETATM 4792 O  O     . HOH F 4 .   ? 15.444  -23.546 25.006  1.00 51.24 ? 1065 HOH A O     1 
HETATM 4793 O  O     . HOH F 4 .   ? 30.459  -5.369  18.839  1.00 35.32 ? 1068 HOH A O     1 
HETATM 4794 O  O     . HOH F 4 .   ? 24.380  -2.092  26.136  1.00 55.49 ? 1069 HOH A O     1 
HETATM 4795 O  O     . HOH F 4 .   ? 33.933  -10.374 34.882  1.00 55.44 ? 1072 HOH A O     1 
HETATM 4796 O  O     . HOH F 4 .   ? 46.457  -4.191  22.961  1.00 51.71 ? 1073 HOH A O     1 
HETATM 4797 O  O     . HOH F 4 .   ? 29.618  -17.626 16.507  1.00 24.06 ? 1074 HOH A O     1 
HETATM 4798 O  O     . HOH F 4 .   ? 32.492  -21.169 32.512  1.00 54.71 ? 1075 HOH A O     1 
HETATM 4799 O  O     . HOH F 4 .   ? 16.972  7.254   28.461  1.00 76.46 ? 1076 HOH A O     1 
HETATM 4800 O  O     . HOH F 4 .   ? 58.958  20.413  16.890  1.00 44.91 ? 1077 HOH A O     1 
HETATM 4801 O  O     . HOH F 4 .   ? 22.112  7.270   18.318  1.00 35.95 ? 1079 HOH A O     1 
HETATM 4802 O  O     . HOH F 4 .   ? 14.031  6.275   21.155  1.00 59.68 ? 1080 HOH A O     1 
HETATM 4803 O  O     . HOH F 4 .   ? 12.821  2.480   22.871  1.00 55.70 ? 1081 HOH A O     1 
HETATM 4804 O  O     . HOH F 4 .   ? 13.217  15.282  18.942  1.00 59.16 ? 1083 HOH A O     1 
HETATM 4805 O  O     . HOH F 4 .   ? 45.230  0.490   21.612  1.00 59.22 ? 1084 HOH A O     1 
HETATM 4806 O  O     . HOH F 4 .   ? 44.382  8.526   26.654  1.00 57.07 ? 1085 HOH A O     1 
HETATM 4807 O  O     . HOH F 4 .   ? 41.626  -1.596  14.051  1.00 39.28 ? 1086 HOH A O     1 
HETATM 4808 O  O     . HOH F 4 .   ? 50.382  1.264   18.511  1.00 45.77 ? 1087 HOH A O     1 
HETATM 4809 O  O     . HOH F 4 .   ? 9.612   4.797   20.484  1.00 52.20 ? 1088 HOH A O     1 
HETATM 4810 O  O     . HOH F 4 .   ? 10.658  -5.482  19.551  1.00 22.70 ? 1089 HOH A O     1 
HETATM 4811 O  O     . HOH F 4 .   ? 42.337  -5.758  17.975  1.00 35.93 ? 1090 HOH A O     1 
HETATM 4812 O  O     . HOH F 4 .   ? 30.777  -28.087 19.732  1.00 44.57 ? 1091 HOH A O     1 
HETATM 4813 O  O     . HOH F 4 .   ? 26.763  -9.649  10.942  1.00 46.90 ? 1092 HOH A O     1 
HETATM 4814 O  O     . HOH F 4 .   ? 38.655  -14.873 15.702  1.00 44.85 ? 1093 HOH A O     1 
HETATM 4815 O  O     . HOH F 4 .   ? 19.419  -15.141 13.402  1.00 39.17 ? 1095 HOH A O     1 
HETATM 4816 O  O     . HOH F 4 .   ? -10.968 1.260   26.738  1.00 49.39 ? 1096 HOH A O     1 
HETATM 4817 O  O     . HOH F 4 .   ? 48.216  25.212  24.778  1.00 57.96 ? 1097 HOH A O     1 
HETATM 4818 O  O     . HOH F 4 .   ? 16.953  12.772  24.775  1.00 70.67 ? 1098 HOH A O     1 
HETATM 4819 O  O     . HOH F 4 .   ? 39.145  8.388   26.630  1.00 43.84 ? 1100 HOH A O     1 
HETATM 4820 O  O     . HOH F 4 .   ? -4.095  34.442  17.418  1.00 48.12 ? 1101 HOH A O     1 
HETATM 4821 O  O     . HOH F 4 .   ? 7.889   -2.650  12.204  1.00 41.37 ? 1102 HOH A O     1 
HETATM 4822 O  O     . HOH F 4 .   ? 14.438  12.721  29.315  1.00 58.11 ? 1103 HOH A O     1 
HETATM 4823 O  O     . HOH F 4 .   ? 45.486  20.607  14.435  1.00 43.02 ? 1104 HOH A O     1 
HETATM 4824 O  O     . HOH F 4 .   ? 27.363  7.815   25.557  1.00 56.24 ? 1106 HOH A O     1 
HETATM 4825 O  O     . HOH F 4 .   ? 38.878  -13.243 6.736   1.00 50.12 ? 1108 HOH A O     1 
HETATM 4826 O  O     . HOH F 4 .   ? 32.505  22.070  19.998  1.00 54.22 ? 1109 HOH A O     1 
HETATM 4827 O  O     . HOH F 4 .   ? -5.789  -1.332  6.753   1.00 31.87 ? 1110 HOH A O     1 
HETATM 4828 O  O     . HOH F 4 .   ? 43.168  19.996  25.256  1.00 59.90 ? 1113 HOH A O     1 
HETATM 4829 O  O     . HOH F 4 .   ? 8.651   -7.385  23.566  1.00 51.76 ? 1118 HOH A O     1 
HETATM 4830 O  O     . HOH F 4 .   ? 9.551   -8.779  13.118  1.00 48.12 ? 1120 HOH A O     1 
HETATM 4831 O  O     . HOH F 4 .   ? 9.709   10.586  19.653  1.00 54.71 ? 1125 HOH A O     1 
HETATM 4832 O  O     . HOH F 4 .   ? 9.864   18.205  33.703  1.00 47.22 ? 1126 HOH A O     1 
HETATM 4833 O  O     . HOH F 4 .   ? 58.704  4.708   3.670   1.00 48.44 ? 1127 HOH A O     1 
HETATM 4834 O  O     . HOH F 4 .   ? 59.396  10.654  21.594  1.00 63.71 ? 1128 HOH A O     1 
HETATM 4835 O  O     . HOH F 4 .   ? 43.681  -3.651  -7.582  1.00 47.39 ? 1129 HOH A O     1 
HETATM 4836 O  O     . HOH F 4 .   ? 35.851  -20.029 7.672   1.00 56.54 ? 1130 HOH A O     1 
HETATM 4837 O  O     . HOH F 4 .   ? 30.458  -21.255 12.927  1.00 55.22 ? 1131 HOH A O     1 
HETATM 4838 O  O     . HOH F 4 .   ? 40.859  -10.961 32.435  1.00 45.93 ? 1133 HOH A O     1 
HETATM 4839 O  O     . HOH F 4 .   ? 35.599  -17.675 32.764  1.00 47.72 ? 1134 HOH A O     1 
HETATM 4840 O  O     . HOH F 4 .   ? -6.816  -13.355 8.416   1.00 51.24 ? 1135 HOH A O     1 
HETATM 4841 O  O     . HOH F 4 .   ? 18.543  -12.143 8.254   1.00 63.10 ? 1136 HOH A O     1 
HETATM 4842 O  O     . HOH F 4 .   ? 46.378  15.603  28.772  1.00 39.62 ? 1137 HOH A O     1 
HETATM 4843 O  O     . HOH F 4 .   ? 12.073  11.658  34.434  1.00 46.72 ? 1138 HOH A O     1 
HETATM 4844 O  O     . HOH F 4 .   ? 15.863  17.552  33.598  1.00 67.98 ? 1139 HOH A O     1 
HETATM 4845 O  O     . HOH F 4 .   ? 8.378   2.178   21.843  1.00 58.21 ? 1141 HOH A O     1 
HETATM 4846 O  O     . HOH F 4 .   ? 3.369   12.176  39.395  1.00 58.97 ? 1142 HOH A O     1 
HETATM 4847 O  O     . HOH F 4 .   ? 10.613  28.824  21.268  1.00 53.71 ? 1144 HOH A O     1 
HETATM 4848 O  O     . HOH F 4 .   ? 61.258  15.457  27.234  1.00 54.64 ? 1145 HOH A O     1 
HETATM 4849 O  O     . HOH F 4 .   ? 1.878   2.662   -13.199 1.00 50.56 ? 1146 HOH A O     1 
HETATM 4850 O  O     . HOH F 4 .   ? 7.000   -13.288 23.602  1.00 72.77 ? 1147 HOH A O     1 
HETATM 4851 O  O     . HOH F 4 .   ? 12.724  9.497   15.856  1.00 61.43 ? 1148 HOH A O     1 
HETATM 4852 O  O     . HOH F 4 .   ? 40.792  13.819  5.949   1.00 49.87 ? 1149 HOH A O     1 
HETATM 4853 O  O     . HOH F 4 .   ? 9.443   -4.430  14.869  1.00 53.20 ? 1151 HOH A O     1 
HETATM 4854 O  O     . HOH F 4 .   ? 40.348  -16.307 19.588  1.00 57.75 ? 1152 HOH A O     1 
HETATM 4855 O  O     . HOH F 4 .   ? 13.944  -23.547 20.434  1.00 38.02 ? 1154 HOH A O     1 
HETATM 4856 O  O     . HOH F 4 .   ? 43.225  24.207  18.009  1.00 45.65 ? 1155 HOH A O     1 
HETATM 4857 O  O     . HOH F 4 .   ? 2.911   -11.594 -1.009  1.00 66.03 ? 1156 HOH A O     1 
HETATM 4858 O  O     . HOH F 4 .   ? 8.278   3.329   2.974   1.00 51.71 ? 1157 HOH A O     1 
HETATM 4859 O  O     . HOH F 4 .   ? 21.812  21.520  31.156  1.00 38.31 ? 1158 HOH A O     1 
HETATM 4860 O  O     . HOH F 4 .   ? -11.196 7.907   1.359   1.00 46.76 ? 1159 HOH A O     1 
HETATM 4861 O  O     . HOH F 4 .   ? 44.409  1.393   15.118  1.00 47.21 ? 1160 HOH A O     1 
HETATM 4862 O  O     . HOH F 4 .   ? 11.110  15.600  36.983  1.00 57.06 ? 1161 HOH A O     1 
HETATM 4863 O  O     . HOH F 4 .   ? 5.059   3.427   -7.071  1.00 56.36 ? 1162 HOH A O     1 
HETATM 4864 O  O     . HOH F 4 .   ? 15.081  -12.617 -2.350  1.00 51.93 ? 1163 HOH A O     1 
HETATM 4865 O  O     . HOH F 4 .   ? 39.783  -14.531 -0.631  1.00 48.73 ? 1165 HOH A O     1 
HETATM 4866 O  O     . HOH F 4 .   ? -10.235 6.460   22.754  1.00 54.72 ? 1166 HOH A O     1 
HETATM 4867 O  O     . HOH F 4 .   ? -6.450  -14.418 3.604   1.00 67.32 ? 1168 HOH A O     1 
HETATM 4868 O  O     . HOH F 4 .   ? 13.826  -15.318 8.168   1.00 58.43 ? 1169 HOH A O     1 
HETATM 4869 O  O     . HOH F 4 .   ? 1.999   8.192   20.692  1.00 44.47 ? 1170 HOH A O     1 
HETATM 4870 O  O     . HOH F 4 .   ? 49.712  5.604   28.875  1.00 66.64 ? 1172 HOH A O     1 
HETATM 4871 O  O     . HOH F 4 .   ? 13.821  6.511   9.466   1.00 71.48 ? 1173 HOH A O     1 
HETATM 4872 O  O     . HOH F 4 .   ? 19.538  16.886  29.519  1.00 67.07 ? 1174 HOH A O     1 
HETATM 4873 O  O     . HOH F 4 .   ? -4.397  -11.820 15.991  1.00 50.90 ? 1175 HOH A O     1 
HETATM 4874 O  O     . HOH F 4 .   ? 6.914   -1.702  5.718   1.00 63.95 ? 1176 HOH A O     1 
HETATM 4875 O  O     . HOH F 4 .   ? 50.768  14.832  8.297   1.00 60.99 ? 1177 HOH A O     1 
HETATM 4876 O  O     . HOH F 4 .   ? 15.782  -10.530 22.689  1.00 38.59 ? 1179 HOH A O     1 
HETATM 4877 O  O     . HOH F 4 .   ? -2.662  -11.372 23.611  1.00 60.82 ? 1181 HOH A O     1 
HETATM 4878 O  O     . HOH F 4 .   ? 56.673  11.967  10.952  1.00 36.14 ? 1182 HOH A O     1 
HETATM 4879 O  O     . HOH F 4 .   ? 44.454  6.550   -4.531  1.00 41.00 ? 1183 HOH A O     1 
HETATM 4880 O  O     . HOH F 4 .   ? -10.310 21.539  28.515  1.00 51.84 ? 1184 HOH A O     1 
HETATM 4881 O  O     . HOH F 4 .   ? -6.596  -10.476 13.056  1.00 55.77 ? 1185 HOH A O     1 
HETATM 4882 O  O     . HOH F 4 .   ? 47.209  -3.318  17.975  1.00 51.26 ? 1186 HOH A O     1 
HETATM 4883 O  O     . HOH F 4 .   ? 66.208  7.441   14.000  1.00 40.78 ? 1187 HOH A O     1 
HETATM 4884 O  O     . HOH F 4 .   ? 16.331  -24.623 17.996  1.00 62.15 ? 1188 HOH A O     1 
HETATM 4885 O  O     . HOH F 4 .   ? 29.509  9.976   12.224  1.00 49.94 ? 1189 HOH A O     1 
HETATM 4886 O  O     . HOH F 4 .   ? 38.610  9.662   5.817   1.00 66.05 ? 1190 HOH A O     1 
HETATM 4887 O  O     . HOH F 4 .   ? 28.310  16.273  17.404  1.00 47.09 ? 1191 HOH A O     1 
HETATM 4888 O  O     . HOH F 4 .   ? 16.828  12.195  27.447  1.00 36.89 ? 1192 HOH A O     1 
HETATM 4889 O  O     . HOH F 4 .   ? 29.857  -24.860 27.966  1.00 41.86 ? 1195 HOH A O     1 
HETATM 4890 O  O     . HOH F 4 .   ? 32.283  3.829   23.173  1.00 38.18 ? 1197 HOH A O     1 
HETATM 4891 O  O     . HOH F 4 .   ? 33.173  0.347   22.908  1.00 52.37 ? 1198 HOH A O     1 
HETATM 4892 O  O     . HOH F 4 .   ? 5.342   15.708  26.795  1.00 63.83 ? 1200 HOH A O     1 
HETATM 4893 O  O     . HOH F 4 .   ? 12.440  7.293   3.752   1.00 51.32 ? 1201 HOH A O     1 
HETATM 4894 O  O     . HOH F 4 .   ? -6.084  11.294  6.338   1.00 48.88 ? 1202 HOH A O     1 
HETATM 4895 O  O     . HOH F 4 .   ? 14.964  12.048  18.204  1.00 63.15 ? 1204 HOH A O     1 
HETATM 4896 O  O     . HOH F 4 .   ? 25.314  -3.387  23.083  1.00 43.46 ? 1209 HOH A O     1 
HETATM 4897 O  O     . HOH F 4 .   ? 16.743  14.380  30.668  1.00 55.27 ? 1210 HOH A O     1 
HETATM 4898 O  O     . HOH F 4 .   ? 37.049  -15.726 19.525  1.00 56.05 ? 1211 HOH A O     1 
HETATM 4899 O  O     . HOH F 4 .   ? 14.059  9.498   35.470  1.00 40.75 ? 1213 HOH A O     1 
HETATM 4900 O  O     . HOH F 4 .   ? 22.731  13.872  2.737   1.00 50.48 ? 1215 HOH A O     1 
HETATM 4901 O  O     . HOH F 4 .   ? -3.563  21.094  41.463  1.00 49.59 ? 1217 HOH A O     1 
HETATM 4902 O  O     . HOH F 4 .   ? 62.705  6.671   17.306  1.00 65.33 ? 1218 HOH A O     1 
HETATM 4903 O  O     . HOH F 4 .   ? 32.750  -13.943 -4.060  1.00 49.31 ? 1220 HOH A O     1 
HETATM 4904 O  O     . HOH F 4 .   ? 35.211  14.095  27.832  1.00 75.20 ? 1221 HOH A O     1 
HETATM 4905 O  O     . HOH F 4 .   ? 15.598  23.513  20.575  1.00 43.63 ? 1222 HOH A O     1 
HETATM 4906 O  O     . HOH F 4 .   ? 40.222  13.300  31.324  1.00 56.48 ? 1223 HOH A O     1 
HETATM 4907 O  O     . HOH F 4 .   ? 50.982  11.659  1.654   1.00 60.63 ? 1224 HOH A O     1 
HETATM 4908 O  O     . HOH F 4 .   ? 44.320  4.274   12.427  1.00 43.41 ? 1225 HOH A O     1 
HETATM 4909 O  O     . HOH F 4 .   ? 48.130  3.349   9.787   1.00 64.57 ? 1227 HOH A O     1 
HETATM 4910 O  O     . HOH F 4 .   ? 45.216  23.901  20.926  1.00 61.95 ? 1228 HOH A O     1 
HETATM 4911 O  O     . HOH F 4 .   ? 31.171  -16.950 35.819  1.00 54.64 ? 1229 HOH A O     1 
HETATM 4912 O  O     . HOH F 4 .   ? -4.045  19.938  18.744  1.00 56.56 ? 1230 HOH A O     1 
HETATM 4913 O  O     . HOH F 4 .   ? 44.493  -19.820 33.371  1.00 49.37 ? 1231 HOH A O     1 
HETATM 4914 O  O     . HOH F 4 .   ? -5.094  -4.255  4.972   1.00 42.72 ? 1232 HOH A O     1 
HETATM 4915 O  O     . HOH F 4 .   ? 10.525  -14.354 12.219  1.00 50.76 ? 1233 HOH A O     1 
HETATM 4916 O  O     . HOH F 4 .   ? 2.819   18.395  41.300  1.00 53.70 ? 1234 HOH A O     1 
HETATM 4917 O  O     . HOH F 4 .   ? -11.909 17.605  41.034  1.00 55.64 ? 1236 HOH A O     1 
HETATM 4918 O  O     . HOH F 4 .   ? 53.910  4.912   0.925   1.00 64.08 ? 1237 HOH A O     1 
HETATM 4919 O  O     . HOH F 4 .   ? -11.127 10.808  26.380  1.00 48.73 ? 1238 HOH A O     1 
HETATM 4920 O  O     . HOH F 4 .   ? 46.808  4.600   20.188  1.00 52.87 ? 1239 HOH A O     1 
HETATM 4921 O  O     . HOH F 4 .   ? 27.583  11.864  14.074  1.00 62.34 ? 1240 HOH A O     1 
HETATM 4922 O  O     . HOH F 4 .   ? 65.512  19.727  16.798  1.00 57.36 ? 1241 HOH A O     1 
HETATM 4923 O  O     . HOH F 4 .   ? -8.381  22.288  34.217  1.00 57.10 ? 1243 HOH A O     1 
HETATM 4924 O  O     . HOH F 4 .   ? 55.657  9.223   13.100  1.00 50.99 ? 1244 HOH A O     1 
HETATM 4925 O  O     . HOH F 4 .   ? 8.489   -16.999 21.589  1.00 66.66 ? 1245 HOH A O     1 
HETATM 4926 O  O     . HOH F 4 .   ? -1.046  -17.090 5.416   1.00 60.04 ? 1247 HOH A O     1 
HETATM 4927 O  O     . HOH F 4 .   ? 17.418  21.434  25.252  1.00 37.96 ? 1248 HOH A O     1 
HETATM 4928 O  O     . HOH F 4 .   ? -4.704  33.494  32.650  1.00 46.78 ? 1249 HOH A O     1 
HETATM 4929 O  O     . HOH F 4 .   ? 34.421  -6.428  -3.188  1.00 43.71 ? 1250 HOH A O     1 
HETATM 4930 O  O     . HOH F 4 .   ? 6.982   -0.569  22.928  1.00 51.34 ? 1251 HOH A O     1 
HETATM 4931 O  O     . HOH F 4 .   ? 4.600   -15.222 18.074  1.00 62.94 ? 1252 HOH A O     1 
HETATM 4932 O  O     . HOH F 4 .   ? 54.382  25.816  20.716  1.00 56.74 ? 1253 HOH A O     1 
HETATM 4933 O  O     . HOH F 4 .   ? 12.589  -23.942 13.492  1.00 53.29 ? 1254 HOH A O     1 
HETATM 4934 O  O     . HOH F 4 .   ? 14.280  -10.656 25.264  1.00 56.21 ? 1256 HOH A O     1 
HETATM 4935 O  O     . HOH F 4 .   ? 16.070  9.992   29.008  1.00 56.71 ? 1258 HOH A O     1 
HETATM 4936 O  O     . HOH F 4 .   ? 44.525  -1.068  -2.374  1.00 71.55 ? 1259 HOH A O     1 
HETATM 4937 O  O     . HOH F 4 .   ? 38.347  4.235   14.707  1.00 51.75 ? 1261 HOH A O     1 
HETATM 4938 O  O     . HOH F 4 .   ? 18.617  -29.027 20.042  1.00 64.61 ? 1262 HOH A O     1 
HETATM 4939 O  O     . HOH F 4 .   ? 33.984  -17.220 0.968   1.00 55.50 ? 1263 HOH A O     1 
HETATM 4940 O  O     . HOH F 4 .   ? 44.519  -7.770  17.453  1.00 71.19 ? 1266 HOH A O     1 
HETATM 4941 O  O     . HOH F 4 .   ? 33.441  -1.082  -9.665  1.00 69.40 ? 1269 HOH A O     1 
HETATM 4942 O  O     . HOH F 4 .   ? 19.852  -11.821 21.223  1.00 63.24 ? 1271 HOH A O     1 
HETATM 4943 O  O     . HOH F 4 .   ? 26.588  0.167   21.347  1.00 58.92 ? 1272 HOH A O     1 
HETATM 4944 O  O     . HOH F 4 .   ? -1.876  -5.922  35.554  1.00 67.60 ? 1273 HOH A O     1 
HETATM 4945 O  O     . HOH F 4 .   ? 23.284  -23.504 30.180  1.00 49.65 ? 1274 HOH A O     1 
HETATM 4946 O  O     . HOH F 4 .   ? 5.986   0.036   7.871   1.00 58.80 ? 1275 HOH A O     1 
HETATM 4947 O  O     . HOH F 4 .   ? -8.023  31.611  29.074  1.00 70.24 ? 1276 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  A   C . n 
A 1 2   DA  2   2   2   DA  A   C . n 
A 1 3   DA  3   3   3   DA  A   C . n 
A 1 4   DA  4   4   4   DA  A   C . n 
A 1 5   DA  5   5   5   DA  A   C . n 
A 1 6   DG  6   6   6   DG  G   C . n 
A 1 7   DA  7   7   7   DA  A   C . n 
A 1 8   DC  8   8   8   DC  C   C . n 
A 1 9   DT  9   9   9   DT  T   C . n 
A 1 10  DT  10  10  10  DT  T   C . n 
A 1 11  DA  11  11  11  DA  A   C . n 
A 1 12  DG  12  12  12  DG  G   C . n 
A 1 13  DA  13  13  13  DA  A   C . n 
A 1 14  DA  14  14  14  DA  A   C . n 
A 1 15  DA  15  15  15  DA  A   C . n 
A 1 16  DA  16  16  16  DA  A   C . n 
A 1 17  DA  17  17  17  DA  A   C . n 
A 1 18  BRU 18  18  18  BRU +U  C . n 
A 1 19  BRU 19  19  19  BRU +U  C . n 
A 1 20  DT  20  20  20  DT  T   C . n 
A 1 21  DT  21  21  21  DT  T   C . n 
A 1 22  DT  22  22  22  DT  T   C . n 
B 2 1   DA  1   101 101 DA  A   D . n 
B 2 2   DA  2   102 102 DA  A   D . n 
B 2 3   DA  3   103 103 DA  A   D . n 
B 2 4   DA  4   104 104 DA  A   D . n 
B 2 5   DA  5   105 105 DA  A   D . n 
B 2 6   DT  6   106 106 DT  T   D . n 
B 2 7   BRU 7   107 107 BRU +U  D . n 
B 2 8   BRU 8   108 108 BRU +U  D . n 
B 2 9   BRU 9   109 109 BRU +U  D . n 
B 2 10  BRU 10  110 110 BRU +U  D . n 
B 2 11  DC  11  111 111 DC  C   D . n 
B 2 12  BRU 12  112 112 BRU +U  D . n 
B 2 13  DA  13  113 113 DA  A   D . n 
B 2 14  DA  14  114 114 DA  A   D . n 
B 2 15  DG  15  115 115 DG  G   D . n 
B 2 16  DT  16  116 116 DT  T   D . n 
B 2 17  DC  17  117 117 DC  C   D . n 
B 2 18  DT  18  118 118 DT  T   D . n 
B 2 19  DT  19  119 119 DT  T   D . n 
B 2 20  DT  20  120 120 DT  T   D . n 
B 2 21  BRU 21  121 121 BRU +U  D . n 
B 2 22  DT  22  122 122 DT  T   D . n 
C 3 1   LYS 1   175 ?   ?   ?   A . n 
C 3 2   PRO 2   176 ?   ?   ?   A . n 
C 3 3   LYS 3   177 ?   ?   ?   A . n 
C 3 4   ASN 4   178 ?   ?   ?   A . n 
C 3 5   LYS 5   179 ?   ?   ?   A . n 
C 3 6   ASP 6   180 ?   ?   ?   A . n 
C 3 7   LYS 7   181 ?   ?   ?   A . n 
C 3 8   ASP 8   182 ?   ?   ?   A . n 
C 3 9   LYS 9   183 ?   ?   ?   A . n 
C 3 10  LYS 10  184 ?   ?   ?   A . n 
C 3 11  VAL 11  185 ?   ?   ?   A . n 
C 3 12  PRO 12  186 ?   ?   ?   A . n 
C 3 13  GLU 13  187 ?   ?   ?   A . n 
C 3 14  PRO 14  188 ?   ?   ?   A . n 
C 3 15  ASP 15  189 ?   ?   ?   A . n 
C 3 16  ASN 16  190 ?   ?   ?   A . n 
C 3 17  LYS 17  191 ?   ?   ?   A . n 
C 3 18  LYS 18  192 ?   ?   ?   A . n 
C 3 19  LYS 19  193 ?   ?   ?   A . n 
C 3 20  LYS 20  194 ?   ?   ?   A . n 
C 3 21  PRO 21  195 ?   ?   ?   A . n 
C 3 22  LYS 22  196 ?   ?   ?   A . n 
C 3 23  LYS 23  197 ?   ?   ?   A . n 
C 3 24  GLU 24  198 ?   ?   ?   A . n 
C 3 25  GLU 25  199 ?   ?   ?   A . n 
C 3 26  GLU 26  200 ?   ?   ?   A . n 
C 3 27  GLN 27  201 ?   ?   ?   A . n 
C 3 28  LYS 28  202 ?   ?   ?   A . n 
C 3 29  TRP 29  203 ?   ?   ?   A . n 
C 3 30  LYS 30  204 ?   ?   ?   A . n 
C 3 31  TRP 31  205 ?   ?   ?   A . n 
C 3 32  TRP 32  206 ?   ?   ?   A . n 
C 3 33  GLU 33  207 ?   ?   ?   A . n 
C 3 34  GLU 34  208 ?   ?   ?   A . n 
C 3 35  GLU 35  209 ?   ?   ?   A . n 
C 3 36  ARG 36  210 ?   ?   ?   A . n 
C 3 37  TYR 37  211 ?   ?   ?   A . n 
C 3 38  PRO 38  212 ?   ?   ?   A . n 
C 3 39  GLU 39  213 ?   ?   ?   A . n 
C 3 40  GLY 40  214 ?   ?   ?   A . n 
C 3 41  ILE 41  215 215 ILE ILE A . n 
C 3 42  LYS 42  216 216 LYS LYS A . n 
C 3 43  TRP 43  217 217 TRP TRP A . n 
C 3 44  LYS 44  218 218 LYS LYS A . n 
C 3 45  PHE 45  219 219 PHE PHE A . n 
C 3 46  LEU 46  220 220 LEU LEU A . n 
C 3 47  GLU 47  221 221 GLU GLU A . n 
C 3 48  HIS 48  222 222 HIS HIS A . n 
C 3 49  LYS 49  223 223 LYS LYS A . n 
C 3 50  GLY 50  224 224 GLY GLY A . n 
C 3 51  PRO 51  225 225 PRO PRO A . n 
C 3 52  VAL 52  226 226 VAL VAL A . n 
C 3 53  PHE 53  227 227 PHE PHE A . n 
C 3 54  ALA 54  228 228 ALA ALA A . n 
C 3 55  PRO 55  229 229 PRO PRO A . n 
C 3 56  PRO 56  230 230 PRO PRO A . n 
C 3 57  TYR 57  231 231 TYR TYR A . n 
C 3 58  GLU 58  232 232 GLU GLU A . n 
C 3 59  PRO 59  233 233 PRO PRO A . n 
C 3 60  LEU 60  234 234 LEU LEU A . n 
C 3 61  PRO 61  235 235 PRO PRO A . n 
C 3 62  GLU 62  236 236 GLU GLU A . n 
C 3 63  ASN 63  237 237 ASN ASN A . n 
C 3 64  VAL 64  238 238 VAL VAL A . n 
C 3 65  LYS 65  239 239 LYS LYS A . n 
C 3 66  PHE 66  240 240 PHE PHE A . n 
C 3 67  TYR 67  241 241 TYR TYR A . n 
C 3 68  TYR 68  242 242 TYR TYR A . n 
C 3 69  ASP 69  243 243 ASP ASP A . n 
C 3 70  GLY 70  244 244 GLY GLY A . n 
C 3 71  LYS 71  245 245 LYS LYS A . n 
C 3 72  VAL 72  246 246 VAL VAL A . n 
C 3 73  MET 73  247 247 MET MET A . n 
C 3 74  LYS 74  248 248 LYS LYS A . n 
C 3 75  LEU 75  249 249 LEU LEU A . n 
C 3 76  SER 76  250 250 SER SER A . n 
C 3 77  PRO 77  251 251 PRO PRO A . n 
C 3 78  LYS 78  252 252 LYS LYS A . n 
C 3 79  ALA 79  253 253 ALA ALA A . n 
C 3 80  GLU 80  254 254 GLU GLU A . n 
C 3 81  GLU 81  255 255 GLU GLU A . n 
C 3 82  VAL 82  256 256 VAL VAL A . n 
C 3 83  ALA 83  257 257 ALA ALA A . n 
C 3 84  THR 84  258 258 THR THR A . n 
C 3 85  PHE 85  259 259 PHE PHE A . n 
C 3 86  PHE 86  260 260 PHE PHE A . n 
C 3 87  ALA 87  261 261 ALA ALA A . n 
C 3 88  LYS 88  262 262 LYS LYS A . n 
C 3 89  MET 89  263 263 MET MET A . n 
C 3 90  LEU 90  264 264 LEU LEU A . n 
C 3 91  ASP 91  265 265 ASP ASP A . n 
C 3 92  HIS 92  266 266 HIS HIS A . n 
C 3 93  GLU 93  267 267 GLU GLU A . n 
C 3 94  TYR 94  268 268 TYR TYR A . n 
C 3 95  THR 95  269 269 THR THR A . n 
C 3 96  THR 96  270 270 THR THR A . n 
C 3 97  LYS 97  271 271 LYS LYS A . n 
C 3 98  GLU 98  272 272 GLU GLU A . n 
C 3 99  ILE 99  273 273 ILE ILE A . n 
C 3 100 PHE 100 274 274 PHE PHE A . n 
C 3 101 ARG 101 275 275 ARG ARG A . n 
C 3 102 LYS 102 276 276 LYS LYS A . n 
C 3 103 ASN 103 277 277 ASN ASN A . n 
C 3 104 PHE 104 278 278 PHE PHE A . n 
C 3 105 PHE 105 279 279 PHE PHE A . n 
C 3 106 LYS 106 280 280 LYS LYS A . n 
C 3 107 ASP 107 281 281 ASP ASP A . n 
C 3 108 TRP 108 282 282 TRP TRP A . n 
C 3 109 ARG 109 283 283 ARG ARG A . n 
C 3 110 LYS 110 284 284 LYS LYS A . n 
C 3 111 GLU 111 285 285 GLU GLU A . n 
C 3 112 MET 112 286 286 MET MET A . n 
C 3 113 THR 113 287 287 THR THR A . n 
C 3 114 ASN 114 288 288 ASN ASN A . n 
C 3 115 GLU 115 289 289 GLU GLU A . n 
C 3 116 GLU 116 290 290 GLU GLU A . n 
C 3 117 LYS 117 291 291 LYS LYS A . n 
C 3 118 ASN 118 292 292 ASN ASN A . n 
C 3 119 ILE 119 293 293 ILE ILE A . n 
C 3 120 ILE 120 294 294 ILE ILE A . n 
C 3 121 THR 121 295 295 THR THR A . n 
C 3 122 ASN 122 296 296 ASN ASN A . n 
C 3 123 LEU 123 297 297 LEU LEU A . n 
C 3 124 SER 124 298 298 SER SER A . n 
C 3 125 LYS 125 299 299 LYS LYS A . n 
C 3 126 CYS 126 300 300 CYS CYS A . n 
C 3 127 ASP 127 301 301 ASP ASP A . n 
C 3 128 PHE 128 302 302 PHE PHE A . n 
C 3 129 THR 129 303 303 THR THR A . n 
C 3 130 GLN 130 304 304 GLN GLN A . n 
C 3 131 MET 131 305 305 MET MET A . n 
C 3 132 SER 132 306 306 SER SER A . n 
C 3 133 GLN 133 307 307 GLN GLN A . n 
C 3 134 TYR 134 308 308 TYR TYR A . n 
C 3 135 PHE 135 309 309 PHE PHE A . n 
C 3 136 LYS 136 310 310 LYS LYS A . n 
C 3 137 ALA 137 311 311 ALA ALA A . n 
C 3 138 GLN 138 312 312 GLN GLN A . n 
C 3 139 THR 139 313 313 THR THR A . n 
C 3 140 GLU 140 314 314 GLU GLU A . n 
C 3 141 ALA 141 315 315 ALA ALA A . n 
C 3 142 ARG 142 316 316 ARG ARG A . n 
C 3 143 LYS 143 317 317 LYS LYS A . n 
C 3 144 GLN 144 318 318 GLN GLN A . n 
C 3 145 MET 145 319 319 MET MET A . n 
C 3 146 SER 146 320 320 SER SER A . n 
C 3 147 LYS 147 321 321 LYS LYS A . n 
C 3 148 GLU 148 322 322 GLU GLU A . n 
C 3 149 GLU 149 323 323 GLU GLU A . n 
C 3 150 LYS 150 324 324 LYS LYS A . n 
C 3 151 LEU 151 325 325 LEU LEU A . n 
C 3 152 LYS 152 326 326 LYS LYS A . n 
C 3 153 ILE 153 327 327 ILE ILE A . n 
C 3 154 LYS 154 328 328 LYS LYS A . n 
C 3 155 GLU 155 329 329 GLU GLU A . n 
C 3 156 GLU 156 330 330 GLU GLU A . n 
C 3 157 ASN 157 331 331 ASN ASN A . n 
C 3 158 GLU 158 332 332 GLU GLU A . n 
C 3 159 LYS 159 333 333 LYS LYS A . n 
C 3 160 LEU 160 334 334 LEU LEU A . n 
C 3 161 LEU 161 335 335 LEU LEU A . n 
C 3 162 LYS 162 336 336 LYS LYS A . n 
C 3 163 GLU 163 337 337 GLU GLU A . n 
C 3 164 TYR 164 338 338 TYR TYR A . n 
C 3 165 GLY 165 339 339 GLY GLY A . n 
C 3 166 PHE 166 340 340 PHE PHE A . n 
C 3 167 CYS 167 341 341 CYS CYS A . n 
C 3 168 ILE 168 342 342 ILE ILE A . n 
C 3 169 MET 169 343 343 MET MET A . n 
C 3 170 ASP 170 344 344 ASP ASP A . n 
C 3 171 ASN 171 345 345 ASN ASN A . n 
C 3 172 HIS 172 346 346 HIS HIS A . n 
C 3 173 LYS 173 347 347 LYS LYS A . n 
C 3 174 GLU 174 348 348 GLU GLU A . n 
C 3 175 ARG 175 349 349 ARG ARG A . n 
C 3 176 ILE 176 350 350 ILE ILE A . n 
C 3 177 ALA 177 351 351 ALA ALA A . n 
C 3 178 ASN 178 352 352 ASN ASN A . n 
C 3 179 PHE 179 353 353 PHE PHE A . n 
C 3 180 LYS 180 354 354 LYS LYS A . n 
C 3 181 ILE 181 355 355 ILE ILE A . n 
C 3 182 GLU 182 356 356 GLU GLU A . n 
C 3 183 PRO 183 357 357 PRO PRO A . n 
C 3 184 PRO 184 358 358 PRO PRO A . n 
C 3 185 GLY 185 359 359 GLY GLY A . n 
C 3 186 LEU 186 360 360 LEU LEU A . n 
C 3 187 PHE 187 361 361 PHE PHE A . n 
C 3 188 ARG 188 362 362 ARG ARG A . n 
C 3 189 GLY 189 363 363 GLY GLY A . n 
C 3 190 ARG 190 364 364 ARG ARG A . n 
C 3 191 GLY 191 365 365 GLY GLY A . n 
C 3 192 ASN 192 366 366 ASN ASN A . n 
C 3 193 HIS 193 367 367 HIS HIS A . n 
C 3 194 PRO 194 368 368 PRO PRO A . n 
C 3 195 LYS 195 369 369 LYS LYS A . n 
C 3 196 MET 196 370 370 MET MET A . n 
C 3 197 GLY 197 371 371 GLY GLY A . n 
C 3 198 MET 198 372 372 MET MET A . n 
C 3 199 LEU 199 373 373 LEU LEU A . n 
C 3 200 LYS 200 374 374 LYS LYS A . n 
C 3 201 ARG 201 375 375 ARG ARG A . n 
C 3 202 ARG 202 376 376 ARG ARG A . n 
C 3 203 ILE 203 377 377 ILE ILE A . n 
C 3 204 MET 204 378 378 MET MET A . n 
C 3 205 PRO 205 379 379 PRO PRO A . n 
C 3 206 GLU 206 380 380 GLU GLU A . n 
C 3 207 ASP 207 381 381 ASP ASP A . n 
C 3 208 ILE 208 382 382 ILE ILE A . n 
C 3 209 ILE 209 383 383 ILE ILE A . n 
C 3 210 ILE 210 384 384 ILE ILE A . n 
C 3 211 ASN 211 385 385 ASN ASN A . n 
C 3 212 CYS 212 386 386 CYS CYS A . n 
C 3 213 SER 213 387 387 SER SER A . n 
C 3 214 LYS 214 388 388 LYS LYS A . n 
C 3 215 ASP 215 389 389 ASP ASP A . n 
C 3 216 ALA 216 390 390 ALA ALA A . n 
C 3 217 LYS 217 391 391 LYS LYS A . n 
C 3 218 VAL 218 392 392 VAL VAL A . n 
C 3 219 PRO 219 393 393 PRO PRO A . n 
C 3 220 SER 220 394 394 SER SER A . n 
C 3 221 PRO 221 395 395 PRO PRO A . n 
C 3 222 PRO 222 396 396 PRO PRO A . n 
C 3 223 PRO 223 397 397 PRO PRO A . n 
C 3 224 GLY 224 398 398 GLY GLY A . n 
C 3 225 HIS 225 399 399 HIS HIS A . n 
C 3 226 LYS 226 400 400 LYS LYS A . n 
C 3 227 TRP 227 401 401 TRP TRP A . n 
C 3 228 LYS 228 402 402 LYS LYS A . n 
C 3 229 GLU 229 403 403 GLU GLU A . n 
C 3 230 VAL 230 404 404 VAL VAL A . n 
C 3 231 ARG 231 405 405 ARG ARG A . n 
C 3 232 HIS 232 406 406 HIS HIS A . n 
C 3 233 ASP 233 407 407 ASP ASP A . n 
C 3 234 ASN 234 408 408 ASN ASN A . n 
C 3 235 LYS 235 409 409 LYS LYS A . n 
C 3 236 VAL 236 410 410 VAL VAL A . n 
C 3 237 THR 237 411 411 THR THR A . n 
C 3 238 TRP 238 412 412 TRP TRP A . n 
C 3 239 LEU 239 413 413 LEU LEU A . n 
C 3 240 VAL 240 414 414 VAL VAL A . n 
C 3 241 SER 241 415 415 SER SER A . n 
C 3 242 TRP 242 416 416 TRP TRP A . n 
C 3 243 THR 243 417 417 THR THR A . n 
C 3 244 GLU 244 418 418 GLU GLU A . n 
C 3 245 ASN 245 419 419 ASN ASN A . n 
C 3 246 ILE 246 420 420 ILE ILE A . n 
C 3 247 GLN 247 421 421 GLN GLN A . n 
C 3 248 GLY 248 422 422 GLY GLY A . n 
C 3 249 SER 249 423 423 SER SER A . n 
C 3 250 ILE 250 424 424 ILE ILE A . n 
C 3 251 LYS 251 425 425 LYS LYS A . n 
C 3 252 TYR 252 426 426 TYR TYR A . n 
C 3 253 ILE 253 427 427 ILE ILE A . n 
C 3 254 MET 254 428 428 MET MET A . n 
C 3 255 LEU 255 429 429 LEU LEU A . n 
C 3 256 ASN 256 430 430 ASN ASN A . n 
C 3 257 PRO 257 431 431 PRO PRO A . n 
C 3 258 SER 258 432 432 SER SER A . n 
C 3 259 SER 259 433 433 SER SER A . n 
C 3 260 ARG 260 434 434 ARG ARG A . n 
C 3 261 ILE 261 435 435 ILE ILE A . n 
C 3 262 LYS 262 436 436 LYS LYS A . n 
C 3 263 GLY 263 437 437 GLY GLY A . n 
C 3 264 GLU 264 438 438 GLU GLU A . n 
C 3 265 LYS 265 439 439 LYS LYS A . n 
C 3 266 ASP 266 440 440 ASP ASP A . n 
C 3 267 TRP 267 441 441 TRP TRP A . n 
C 3 268 GLN 268 442 442 GLN GLN A . n 
C 3 269 LYS 269 443 443 LYS LYS A . n 
C 3 270 TYR 270 444 444 TYR TYR A . n 
C 3 271 GLU 271 445 445 GLU GLU A . n 
C 3 272 THR 272 446 446 THR THR A . n 
C 3 273 ALA 273 447 447 ALA ALA A . n 
C 3 274 ARG 274 448 448 ARG ARG A . n 
C 3 275 ARG 275 449 449 ARG ARG A . n 
C 3 276 LEU 276 450 450 LEU LEU A . n 
C 3 277 LYS 277 451 451 LYS LYS A . n 
C 3 278 LYS 278 452 452 LYS LYS A . n 
C 3 279 CYS 279 453 453 CYS CYS A . n 
C 3 280 VAL 280 454 454 VAL VAL A . n 
C 3 281 ASP 281 455 455 ASP ASP A . n 
C 3 282 LYS 282 456 456 LYS LYS A . n 
C 3 283 ILE 283 457 457 ILE ILE A . n 
C 3 284 ARG 284 458 458 ARG ARG A . n 
C 3 285 ASN 285 459 459 ASN ASN A . n 
C 3 286 GLN 286 460 460 GLN GLN A . n 
C 3 287 TYR 287 461 461 TYR TYR A . n 
C 3 288 ARG 288 462 462 ARG ARG A . n 
C 3 289 GLU 289 463 463 GLU GLU A . n 
C 3 290 ASP 290 464 464 ASP ASP A . n 
C 3 291 TRP 291 465 465 TRP TRP A . n 
C 3 292 LYS 292 466 466 LYS LYS A . n 
C 3 293 SER 293 467 467 SER SER A . n 
C 3 294 LYS 294 468 468 LYS LYS A . n 
C 3 295 GLU 295 469 469 GLU GLU A . n 
C 3 296 MET 296 470 470 MET MET A . n 
C 3 297 LYS 297 471 471 LYS LYS A . n 
C 3 298 VAL 298 472 472 VAL VAL A . n 
C 3 299 ARG 299 473 473 ARG ARG A . n 
C 3 300 GLN 300 474 474 GLN GLN A . n 
C 3 301 ARG 301 475 475 ARG ARG A . n 
C 3 302 ALA 302 476 476 ALA ALA A . n 
C 3 303 VAL 303 477 477 VAL VAL A . n 
C 3 304 ALA 304 478 478 ALA ALA A . n 
C 3 305 LEU 305 479 479 LEU LEU A . n 
C 3 306 TYR 306 480 480 TYR TYR A . n 
C 3 307 PHE 307 481 481 PHE PHE A . n 
C 3 308 ILE 308 482 482 ILE ILE A . n 
C 3 309 ASP 309 483 483 ASP ASP A . n 
C 3 310 LYS 310 484 484 LYS LYS A . n 
C 3 311 LEU 311 485 485 LEU LEU A . n 
C 3 312 ALA 312 486 486 ALA ALA A . n 
C 3 313 LEU 313 487 487 LEU LEU A . n 
C 3 314 ARG 314 488 488 ARG ARG A . n 
C 3 315 ALA 315 489 489 ALA ALA A . n 
C 3 316 GLY 316 490 490 GLY GLY A . n 
C 3 317 ASN 317 491 491 ASN ASN A . n 
C 3 318 GLU 318 492 492 GLU GLU A . n 
C 3 319 LYS 319 493 493 LYS LYS A . n 
C 3 320 GLU 320 494 494 GLU GLU A . n 
C 3 321 GLU 321 495 495 GLU GLU A . n 
C 3 322 GLY 322 496 496 GLY GLY A . n 
C 3 323 GLU 323 497 497 GLU GLU A . n 
C 3 324 THR 324 498 498 THR THR A . n 
C 3 325 ALA 325 499 499 ALA ALA A . n 
C 3 326 ASP 326 500 500 ASP ASP A . n 
C 3 327 THR 327 501 501 THR THR A . n 
C 3 328 VAL 328 502 502 VAL VAL A . n 
C 3 329 GLY 329 503 503 GLY GLY A . n 
C 3 330 CYS 330 504 504 CYS CYS A . n 
C 3 331 CYS 331 505 505 CYS CYS A . n 
C 3 332 SER 332 506 506 SER SER A . n 
C 3 333 LEU 333 507 507 LEU LEU A . n 
C 3 334 ARG 334 508 508 ARG ARG A . n 
C 3 335 VAL 335 509 509 VAL VAL A . n 
C 3 336 GLU 336 510 510 GLU GLU A . n 
C 3 337 HIS 337 511 511 HIS HIS A . n 
C 3 338 ILE 338 512 512 ILE ILE A . n 
C 3 339 ASN 339 513 513 ASN ASN A . n 
C 3 340 LEU 340 514 514 LEU LEU A . n 
C 3 341 HIS 341 515 515 HIS HIS A . n 
C 3 342 PRO 342 516 516 PRO PRO A . n 
C 3 343 GLU 343 517 517 GLU GLU A . n 
C 3 344 LEU 344 518 518 LEU LEU A . n 
C 3 345 ASP 345 519 519 ASP ASP A . n 
C 3 346 GLY 346 520 520 GLY GLY A . n 
C 3 347 GLN 347 521 521 GLN GLN A . n 
C 3 348 GLU 348 522 522 GLU GLU A . n 
C 3 349 TYR 349 523 523 TYR TYR A . n 
C 3 350 VAL 350 524 524 VAL VAL A . n 
C 3 351 VAL 351 525 525 VAL VAL A . n 
C 3 352 GLU 352 526 526 GLU GLU A . n 
C 3 353 PHE 353 527 527 PHE PHE A . n 
C 3 354 ASP 354 528 528 ASP ASP A . n 
C 3 355 PHE 355 529 529 PHE PHE A . n 
C 3 356 LEU 356 530 530 LEU LEU A . n 
C 3 357 GLY 357 531 531 GLY GLY A . n 
C 3 358 LYS 358 532 532 LYS LYS A . n 
C 3 359 ASP 359 533 533 ASP ASP A . n 
C 3 360 SER 360 534 534 SER SER A . n 
C 3 361 ILE 361 535 535 ILE ILE A . n 
C 3 362 ARG 362 536 536 ARG ARG A . n 
C 3 363 TYR 363 537 537 TYR TYR A . n 
C 3 364 TYR 364 538 538 TYR TYR A . n 
C 3 365 ASN 365 539 539 ASN ASN A . n 
C 3 366 LYS 366 540 540 LYS LYS A . n 
C 3 367 VAL 367 541 541 VAL VAL A . n 
C 3 368 PRO 368 542 542 PRO PRO A . n 
C 3 369 VAL 369 543 543 VAL VAL A . n 
C 3 370 GLU 370 544 544 GLU GLU A . n 
C 3 371 LYS 371 545 545 LYS LYS A . n 
C 3 372 ARG 372 546 546 ARG ARG A . n 
C 3 373 VAL 373 547 547 VAL VAL A . n 
C 3 374 PHE 374 548 548 PHE PHE A . n 
C 3 375 LYS 375 549 549 LYS LYS A . n 
C 3 376 ASN 376 550 550 ASN ASN A . n 
C 3 377 LEU 377 551 551 LEU LEU A . n 
C 3 378 GLN 378 552 552 GLN GLN A . n 
C 3 379 LEU 379 553 553 LEU LEU A . n 
C 3 380 PHE 380 554 554 PHE PHE A . n 
C 3 381 MET 381 555 555 MET MET A . n 
C 3 382 GLU 382 556 556 GLU GLU A . n 
C 3 383 ASN 383 557 557 ASN ASN A . n 
C 3 384 LYS 384 558 558 LYS LYS A . n 
C 3 385 GLN 385 559 559 GLN GLN A . n 
C 3 386 PRO 386 560 560 PRO PRO A . n 
C 3 387 GLU 387 561 561 GLU GLU A . n 
C 3 388 ASP 388 562 562 ASP ASP A . n 
C 3 389 ASP 389 563 563 ASP ASP A . n 
C 3 390 LEU 390 564 564 LEU LEU A . n 
C 3 391 PHE 391 565 565 PHE PHE A . n 
C 3 392 ASP 392 566 566 ASP ASP A . n 
C 3 393 ARG 393 567 567 ARG ARG A . n 
C 3 394 LEU 394 568 568 LEU LEU A . n 
C 3 395 ASN 395 569 569 ASN ASN A . n 
C 3 396 THR 396 570 570 THR THR A . n 
C 3 397 GLY 397 571 571 GLY GLY A . n 
C 3 398 ILE 398 572 572 ILE ILE A . n 
C 3 399 LEU 399 573 573 LEU LEU A . n 
C 3 400 ASN 400 574 574 ASN ASN A . n 
C 3 401 LYS 401 575 575 LYS LYS A . n 
C 3 402 HIS 402 576 576 HIS HIS A . n 
C 3 403 LEU 403 577 577 LEU LEU A . n 
C 3 404 GLN 404 578 578 GLN GLN A . n 
C 3 405 ASP 405 579 579 ASP ASP A . n 
C 3 406 LEU 406 580 580 LEU LEU A . n 
C 3 407 MET 407 581 581 MET MET A . n 
C 3 408 GLU 408 582 582 GLU GLU A . n 
C 3 409 GLY 409 583 583 GLY GLY A . n 
C 3 410 LEU 410 584 584 LEU LEU A . n 
C 3 411 THR 411 585 585 THR THR A . n 
C 3 412 ALA 412 586 586 ALA ALA A . n 
C 3 413 LYS 413 587 587 LYS LYS A . n 
C 3 414 VAL 414 588 588 VAL VAL A . n 
C 3 415 PHE 415 589 589 PHE PHE A . n 
C 3 416 ARG 416 590 590 ARG ARG A . n 
C 3 417 THR 417 591 591 THR THR A . n 
C 3 418 TYR 418 592 592 TYR TYR A . n 
C 3 419 ASN 419 593 593 ASN ASN A . n 
C 3 420 ALA 420 594 594 ALA ALA A . n 
C 3 421 SER 421 595 595 SER SER A . n 
C 3 422 ILE 422 596 596 ILE ILE A . n 
C 3 423 THR 423 597 597 THR THR A . n 
C 3 424 LEU 424 598 598 LEU LEU A . n 
C 3 425 GLN 425 599 599 GLN GLN A . n 
C 3 426 GLN 426 600 600 GLN GLN A . n 
C 3 427 GLN 427 601 601 GLN GLN A . n 
C 3 428 LEU 428 602 602 LEU LEU A . n 
C 3 429 LYS 429 603 603 LYS LYS A . n 
C 3 430 GLU 430 604 604 GLU GLU A . n 
C 3 431 LEU 431 605 605 LEU LEU A . n 
C 3 432 THR 432 606 606 THR THR A . n 
C 3 433 ALA 433 607 607 ALA ALA A . n 
C 3 434 PRO 434 608 608 PRO PRO A . n 
C 3 435 ASP 435 609 609 ASP ASP A . n 
C 3 436 GLU 436 610 610 GLU GLU A . n 
C 3 437 ASN 437 611 611 ASN ASN A . n 
C 3 438 ILE 438 612 612 ILE ILE A . n 
C 3 439 PRO 439 613 613 PRO PRO A . n 
C 3 440 ALA 440 614 614 ALA ALA A . n 
C 3 441 LYS 441 615 615 LYS LYS A . n 
C 3 442 ILE 442 616 616 ILE ILE A . n 
C 3 443 LEU 443 617 617 LEU LEU A . n 
C 3 444 SER 444 618 618 SER SER A . n 
C 3 445 TYR 445 619 619 TYR TYR A . n 
C 3 446 ASN 446 620 620 ASN ASN A . n 
C 3 447 ARG 447 621 621 ARG ARG A . n 
C 3 448 ALA 448 622 622 ALA ALA A . n 
C 3 449 ASN 449 623 623 ASN ASN A . n 
C 3 450 ARG 450 624 624 ARG ARG A . n 
C 3 451 ALA 451 625 625 ALA ALA A . n 
C 3 452 VAL 452 626 626 VAL VAL A . n 
C 3 453 ALA 453 627 627 ALA ALA A . n 
C 3 454 ILE 454 628 628 ILE ILE A . n 
C 3 455 LEU 455 629 629 LEU LEU A . n 
C 3 456 CYS 456 630 630 CYS CYS A . n 
C 3 457 ASN 457 631 631 ASN ASN A . n 
C 3 458 HIS 458 632 632 HIS HIS A . n 
C 3 459 GLN 459 633 633 GLN GLN A . n 
C 3 460 ARG 460 634 634 ARG ARG A . n 
C 3 461 ALA 461 635 635 ALA ALA A . n 
C 3 462 PRO 462 636 ?   ?   ?   A . n 
C 3 463 PRO 463 637 ?   ?   ?   A . n 
C 3 464 LYS 464 638 ?   ?   ?   A . n 
C 3 465 THR 465 639 ?   ?   ?   A . n 
C 3 466 PHE 466 640 ?   ?   ?   A . n 
C 3 467 GLU 467 641 ?   ?   ?   A . n 
C 3 468 LYS 468 642 ?   ?   ?   A . n 
C 3 469 SER 469 643 ?   ?   ?   A . n 
C 3 470 MET 470 644 ?   ?   ?   A . n 
C 3 471 MET 471 645 ?   ?   ?   A . n 
C 3 472 ASN 472 646 ?   ?   ?   A . n 
C 3 473 LEU 473 647 ?   ?   ?   A . n 
C 3 474 GLN 474 648 ?   ?   ?   A . n 
C 3 475 THR 475 649 ?   ?   ?   A . n 
C 3 476 LYS 476 650 ?   ?   ?   A . n 
C 3 477 ILE 477 651 ?   ?   ?   A . n 
C 3 478 ASP 478 652 ?   ?   ?   A . n 
C 3 479 ALA 479 653 ?   ?   ?   A . n 
C 3 480 LYS 480 654 ?   ?   ?   A . n 
C 3 481 LYS 481 655 ?   ?   ?   A . n 
C 3 482 GLU 482 656 ?   ?   ?   A . n 
C 3 483 GLN 483 657 ?   ?   ?   A . n 
C 3 484 LEU 484 658 ?   ?   ?   A . n 
C 3 485 ALA 485 659 ?   ?   ?   A . n 
C 3 486 ASP 486 660 ?   ?   ?   A . n 
C 3 487 ALA 487 661 ?   ?   ?   A . n 
C 3 488 ARG 488 662 ?   ?   ?   A . n 
C 3 489 ARG 489 663 ?   ?   ?   A . n 
C 3 490 ASP 490 664 ?   ?   ?   A . n 
C 3 491 LEU 491 665 ?   ?   ?   A . n 
C 3 492 LYS 492 666 ?   ?   ?   A . n 
C 3 493 SER 493 667 ?   ?   ?   A . n 
C 3 494 ALA 494 668 ?   ?   ?   A . n 
C 3 495 LYS 495 669 ?   ?   ?   A . n 
C 3 496 ALA 496 670 ?   ?   ?   A . n 
C 3 497 ASP 497 671 ?   ?   ?   A . n 
C 3 498 ALA 498 672 ?   ?   ?   A . n 
C 3 499 LYS 499 673 ?   ?   ?   A . n 
C 3 500 VAL 500 674 ?   ?   ?   A . n 
C 3 501 MET 501 675 ?   ?   ?   A . n 
C 3 502 LYS 502 676 ?   ?   ?   A . n 
C 3 503 ASP 503 677 ?   ?   ?   A . n 
C 3 504 ALA 504 678 ?   ?   ?   A . n 
C 3 505 LYS 505 679 ?   ?   ?   A . n 
C 3 506 THR 506 680 ?   ?   ?   A . n 
C 3 507 LYS 507 681 ?   ?   ?   A . n 
C 3 508 LYS 508 682 ?   ?   ?   A . n 
C 3 509 VAL 509 683 ?   ?   ?   A . n 
C 3 510 VAL 510 684 ?   ?   ?   A . n 
C 3 511 GLU 511 685 ?   ?   ?   A . n 
C 3 512 SER 512 686 ?   ?   ?   A . n 
C 3 513 LYS 513 687 ?   ?   ?   A . n 
C 3 514 LYS 514 688 ?   ?   ?   A . n 
C 3 515 LYS 515 689 ?   ?   ?   A . n 
C 3 516 ALA 516 690 ?   ?   ?   A . n 
C 3 517 VAL 517 691 ?   ?   ?   A . n 
C 3 518 GLN 518 692 ?   ?   ?   A . n 
C 3 519 ARG 519 693 ?   ?   ?   A . n 
C 3 520 LEU 520 694 ?   ?   ?   A . n 
C 3 521 GLU 521 695 ?   ?   ?   A . n 
C 3 522 GLU 522 696 ?   ?   ?   A . n 
C 3 523 GLN 523 697 ?   ?   ?   A . n 
C 3 524 LEU 524 698 ?   ?   ?   A . n 
C 3 525 MET 525 699 ?   ?   ?   A . n 
C 3 526 LYS 526 700 ?   ?   ?   A . n 
C 3 527 LEU 527 701 ?   ?   ?   A . n 
C 3 528 GLU 528 702 ?   ?   ?   A . n 
C 3 529 VAL 529 703 ?   ?   ?   A . n 
C 3 530 GLN 530 704 ?   ?   ?   A . n 
C 3 531 ALA 531 705 ?   ?   ?   A . n 
C 3 532 THR 532 706 ?   ?   ?   A . n 
C 3 533 ASP 533 707 ?   ?   ?   A . n 
C 3 534 ARG 534 708 ?   ?   ?   A . n 
C 3 535 GLU 535 709 ?   ?   ?   A . n 
C 3 536 GLU 536 710 ?   ?   ?   A . n 
C 3 537 ASN 537 711 ?   ?   ?   A . n 
C 3 538 LYS 538 712 ?   ?   ?   A . n 
C 3 539 GLN 539 713 713 GLN GLN A . n 
C 3 540 ILE 540 714 714 ILE ILE A . n 
C 3 541 ALA 541 715 715 ALA ALA A . n 
C 3 542 LEU 542 716 716 LEU LEU A . n 
C 3 543 GLY 543 717 717 GLY GLY A . n 
C 3 544 THR 544 718 718 THR THR A . n 
C 3 545 SER 545 719 719 SER SER A . n 
C 3 546 LYS 546 720 720 LYS LYS A . n 
C 3 547 LEU 547 721 721 LEU LEU A . n 
C 3 548 ASN 548 722 722 ASN ASN A . n 
C 3 549 PHE 549 723 723 PHE PHE A . n 
C 3 550 LEU 550 724 724 LEU LEU A . n 
C 3 551 ASP 551 725 725 ASP ASP A . n 
C 3 552 PRO 552 726 726 PRO PRO A . n 
C 3 553 ARG 553 727 727 ARG ARG A . n 
C 3 554 ILE 554 728 728 ILE ILE A . n 
C 3 555 THR 555 729 729 THR THR A . n 
C 3 556 VAL 556 730 730 VAL VAL A . n 
C 3 557 ALA 557 731 731 ALA ALA A . n 
C 3 558 TRP 558 732 732 TRP TRP A . n 
C 3 559 CYS 559 733 733 CYS CYS A . n 
C 3 560 LYS 560 734 734 LYS LYS A . n 
C 3 561 LYS 561 735 735 LYS LYS A . n 
C 3 562 TRP 562 736 736 TRP TRP A . n 
C 3 563 GLY 563 737 737 GLY GLY A . n 
C 3 564 VAL 564 738 738 VAL VAL A . n 
C 3 565 PRO 565 739 739 PRO PRO A . n 
C 3 566 ILE 566 740 740 ILE ILE A . n 
C 3 567 GLU 567 741 741 GLU GLU A . n 
C 3 568 LYS 568 742 742 LYS LYS A . n 
C 3 569 ILE 569 743 743 ILE ILE A . n 
C 3 570 TYR 570 744 744 TYR TYR A . n 
C 3 571 ASN 571 745 745 ASN ASN A . n 
C 3 572 LYS 572 746 746 LYS LYS A . n 
C 3 573 THR 573 747 747 THR THR A . n 
C 3 574 GLN 574 748 748 GLN GLN A . n 
C 3 575 ARG 575 749 749 ARG ARG A . n 
C 3 576 GLU 576 750 750 GLU GLU A . n 
C 3 577 LYS 577 751 751 LYS LYS A . n 
C 3 578 PHE 578 752 752 PHE PHE A . n 
C 3 579 ALA 579 753 753 ALA ALA A . n 
C 3 580 TRP 580 754 754 TRP TRP A . n 
C 3 581 ALA 581 755 755 ALA ALA A . n 
C 3 582 ILE 582 756 756 ILE ILE A . n 
C 3 583 ASP 583 757 757 ASP ASP A . n 
C 3 584 MET 584 758 758 MET MET A . n 
C 3 585 ALA 585 759 759 ALA ALA A . n 
C 3 586 ASP 586 760 760 ASP ASP A . n 
C 3 587 GLU 587 761 761 GLU GLU A . n 
C 3 588 ASP 588 762 762 ASP ASP A . n 
C 3 589 TYR 589 763 763 TYR TYR A . n 
C 3 590 GLU 590 764 764 GLU GLU A . n 
C 3 591 PHE 591 765 765 PHE PHE A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   1031 1031 HOH HOH C . 
D 4 HOH 2   1059 1059 HOH HOH C . 
D 4 HOH 3   1060 1060 HOH HOH C . 
D 4 HOH 4   1066 1066 HOH HOH C . 
D 4 HOH 5   1067 1067 HOH HOH C . 
D 4 HOH 6   1099 1099 HOH HOH C . 
D 4 HOH 7   1111 1111 HOH HOH C . 
D 4 HOH 8   1114 1114 HOH HOH C . 
D 4 HOH 9   1123 1123 HOH HOH C . 
D 4 HOH 10  1132 1132 HOH HOH C . 
D 4 HOH 11  1167 1167 HOH HOH C . 
D 4 HOH 12  1171 1171 HOH HOH C . 
D 4 HOH 13  1178 1178 HOH HOH C . 
D 4 HOH 14  1180 1180 HOH HOH C . 
D 4 HOH 15  1203 1203 HOH HOH C . 
D 4 HOH 16  1214 1214 HOH HOH C . 
D 4 HOH 17  1216 1216 HOH HOH C . 
D 4 HOH 18  1219 1219 HOH HOH C . 
D 4 HOH 19  1226 1226 HOH HOH C . 
D 4 HOH 20  1235 1235 HOH HOH C . 
D 4 HOH 21  1255 1255 HOH HOH C . 
D 4 HOH 22  1257 1257 HOH HOH C . 
D 4 HOH 23  1268 1268 HOH HOH C . 
E 4 HOH 1   1001 1001 HOH HOH D . 
E 4 HOH 2   1002 1002 HOH HOH D . 
E 4 HOH 3   1005 1005 HOH HOH D . 
E 4 HOH 4   1011 1011 HOH HOH D . 
E 4 HOH 5   1015 1015 HOH HOH D . 
E 4 HOH 6   1016 1016 HOH HOH D . 
E 4 HOH 7   1025 1025 HOH HOH D . 
E 4 HOH 8   1037 1037 HOH HOH D . 
E 4 HOH 9   1041 1041 HOH HOH D . 
E 4 HOH 10  1047 1047 HOH HOH D . 
E 4 HOH 11  1062 1062 HOH HOH D . 
E 4 HOH 12  1070 1070 HOH HOH D . 
E 4 HOH 13  1071 1071 HOH HOH D . 
E 4 HOH 14  1078 1078 HOH HOH D . 
E 4 HOH 15  1082 1082 HOH HOH D . 
E 4 HOH 16  1094 1094 HOH HOH D . 
E 4 HOH 17  1105 1105 HOH HOH D . 
E 4 HOH 18  1107 1107 HOH HOH D . 
E 4 HOH 19  1112 1112 HOH HOH D . 
E 4 HOH 20  1115 1115 HOH HOH D . 
E 4 HOH 21  1116 1116 HOH HOH D . 
E 4 HOH 22  1117 1117 HOH HOH D . 
E 4 HOH 23  1119 1119 HOH HOH D . 
E 4 HOH 24  1121 1121 HOH HOH D . 
E 4 HOH 25  1122 1122 HOH HOH D . 
E 4 HOH 26  1124 1124 HOH HOH D . 
E 4 HOH 27  1140 1140 HOH HOH D . 
E 4 HOH 28  1143 1143 HOH HOH D . 
E 4 HOH 29  1150 1150 HOH HOH D . 
E 4 HOH 30  1153 1153 HOH HOH D . 
E 4 HOH 31  1164 1164 HOH HOH D . 
E 4 HOH 32  1193 1193 HOH HOH D . 
E 4 HOH 33  1194 1194 HOH HOH D . 
E 4 HOH 34  1196 1196 HOH HOH D . 
E 4 HOH 35  1199 1199 HOH HOH D . 
E 4 HOH 36  1205 1205 HOH HOH D . 
E 4 HOH 37  1206 1206 HOH HOH D . 
E 4 HOH 38  1207 1207 HOH HOH D . 
E 4 HOH 39  1208 1208 HOH HOH D . 
E 4 HOH 40  1212 1212 HOH HOH D . 
E 4 HOH 41  1242 1242 HOH HOH D . 
E 4 HOH 42  1246 1246 HOH HOH D . 
E 4 HOH 43  1265 1265 HOH HOH D . 
E 4 HOH 44  1270 1270 HOH HOH D . 
F 4 HOH 1   1003 1003 HOH HOH A . 
F 4 HOH 2   1004 1004 HOH HOH A . 
F 4 HOH 3   1006 1006 HOH HOH A . 
F 4 HOH 4   1007 1007 HOH HOH A . 
F 4 HOH 5   1008 1008 HOH HOH A . 
F 4 HOH 6   1009 1009 HOH HOH A . 
F 4 HOH 7   1010 1010 HOH HOH A . 
F 4 HOH 8   1012 1012 HOH HOH A . 
F 4 HOH 9   1013 1013 HOH HOH A . 
F 4 HOH 10  1014 1014 HOH HOH A . 
F 4 HOH 11  1017 1017 HOH HOH A . 
F 4 HOH 12  1018 1018 HOH HOH A . 
F 4 HOH 13  1019 1019 HOH HOH A . 
F 4 HOH 14  1020 1020 HOH HOH A . 
F 4 HOH 15  1021 1021 HOH HOH A . 
F 4 HOH 16  1022 1022 HOH HOH A . 
F 4 HOH 17  1023 1023 HOH HOH A . 
F 4 HOH 18  1024 1024 HOH HOH A . 
F 4 HOH 19  1026 1026 HOH HOH A . 
F 4 HOH 20  1027 1027 HOH HOH A . 
F 4 HOH 21  1028 1028 HOH HOH A . 
F 4 HOH 22  1029 1029 HOH HOH A . 
F 4 HOH 23  1030 1030 HOH HOH A . 
F 4 HOH 24  1032 1032 HOH HOH A . 
F 4 HOH 25  1033 1033 HOH HOH A . 
F 4 HOH 26  1034 1034 HOH HOH A . 
F 4 HOH 27  1035 1035 HOH HOH A . 
F 4 HOH 28  1036 1036 HOH HOH A . 
F 4 HOH 29  1038 1038 HOH HOH A . 
F 4 HOH 30  1039 1039 HOH HOH A . 
F 4 HOH 31  1040 1040 HOH HOH A . 
F 4 HOH 32  1042 1042 HOH HOH A . 
F 4 HOH 33  1043 1043 HOH HOH A . 
F 4 HOH 34  1044 1044 HOH HOH A . 
F 4 HOH 35  1045 1045 HOH HOH A . 
F 4 HOH 36  1046 1046 HOH HOH A . 
F 4 HOH 37  1048 1048 HOH HOH A . 
F 4 HOH 38  1049 1049 HOH HOH A . 
F 4 HOH 39  1050 1050 HOH HOH A . 
F 4 HOH 40  1051 1051 HOH HOH A . 
F 4 HOH 41  1052 1052 HOH HOH A . 
F 4 HOH 42  1053 1053 HOH HOH A . 
F 4 HOH 43  1054 1054 HOH HOH A . 
F 4 HOH 44  1055 1055 HOH HOH A . 
F 4 HOH 45  1056 1056 HOH HOH A . 
F 4 HOH 46  1057 1057 HOH HOH A . 
F 4 HOH 47  1058 1058 HOH HOH A . 
F 4 HOH 48  1061 1061 HOH HOH A . 
F 4 HOH 49  1063 1063 HOH HOH A . 
F 4 HOH 50  1064 1064 HOH HOH A . 
F 4 HOH 51  1065 1065 HOH HOH A . 
F 4 HOH 52  1068 1068 HOH HOH A . 
F 4 HOH 53  1069 1069 HOH HOH A . 
F 4 HOH 54  1072 1072 HOH HOH A . 
F 4 HOH 55  1073 1073 HOH HOH A . 
F 4 HOH 56  1074 1074 HOH HOH A . 
F 4 HOH 57  1075 1075 HOH HOH A . 
F 4 HOH 58  1076 1076 HOH HOH A . 
F 4 HOH 59  1077 1077 HOH HOH A . 
F 4 HOH 60  1079 1079 HOH HOH A . 
F 4 HOH 61  1080 1080 HOH HOH A . 
F 4 HOH 62  1081 1081 HOH HOH A . 
F 4 HOH 63  1083 1083 HOH HOH A . 
F 4 HOH 64  1084 1084 HOH HOH A . 
F 4 HOH 65  1085 1085 HOH HOH A . 
F 4 HOH 66  1086 1086 HOH HOH A . 
F 4 HOH 67  1087 1087 HOH HOH A . 
F 4 HOH 68  1088 1088 HOH HOH A . 
F 4 HOH 69  1089 1089 HOH HOH A . 
F 4 HOH 70  1090 1090 HOH HOH A . 
F 4 HOH 71  1091 1091 HOH HOH A . 
F 4 HOH 72  1092 1092 HOH HOH A . 
F 4 HOH 73  1093 1093 HOH HOH A . 
F 4 HOH 74  1095 1095 HOH HOH A . 
F 4 HOH 75  1096 1096 HOH HOH A . 
F 4 HOH 76  1097 1097 HOH HOH A . 
F 4 HOH 77  1098 1098 HOH HOH A . 
F 4 HOH 78  1100 1100 HOH HOH A . 
F 4 HOH 79  1101 1101 HOH HOH A . 
F 4 HOH 80  1102 1102 HOH HOH A . 
F 4 HOH 81  1103 1103 HOH HOH A . 
F 4 HOH 82  1104 1104 HOH HOH A . 
F 4 HOH 83  1106 1106 HOH HOH A . 
F 4 HOH 84  1108 1108 HOH HOH A . 
F 4 HOH 85  1109 1109 HOH HOH A . 
F 4 HOH 86  1110 1110 HOH HOH A . 
F 4 HOH 87  1113 1113 HOH HOH A . 
F 4 HOH 88  1118 1118 HOH HOH A . 
F 4 HOH 89  1120 1120 HOH HOH A . 
F 4 HOH 90  1125 1125 HOH HOH A . 
F 4 HOH 91  1126 1126 HOH HOH A . 
F 4 HOH 92  1127 1127 HOH HOH A . 
F 4 HOH 93  1128 1128 HOH HOH A . 
F 4 HOH 94  1129 1129 HOH HOH A . 
F 4 HOH 95  1130 1130 HOH HOH A . 
F 4 HOH 96  1131 1131 HOH HOH A . 
F 4 HOH 97  1133 1133 HOH HOH A . 
F 4 HOH 98  1134 1134 HOH HOH A . 
F 4 HOH 99  1135 1135 HOH HOH A . 
F 4 HOH 100 1136 1136 HOH HOH A . 
F 4 HOH 101 1137 1137 HOH HOH A . 
F 4 HOH 102 1138 1138 HOH HOH A . 
F 4 HOH 103 1139 1139 HOH HOH A . 
F 4 HOH 104 1141 1141 HOH HOH A . 
F 4 HOH 105 1142 1142 HOH HOH A . 
F 4 HOH 106 1144 1144 HOH HOH A . 
F 4 HOH 107 1145 1145 HOH HOH A . 
F 4 HOH 108 1146 1146 HOH HOH A . 
F 4 HOH 109 1147 1147 HOH HOH A . 
F 4 HOH 110 1148 1148 HOH HOH A . 
F 4 HOH 111 1149 1149 HOH HOH A . 
F 4 HOH 112 1151 1151 HOH HOH A . 
F 4 HOH 113 1152 1152 HOH HOH A . 
F 4 HOH 114 1154 1154 HOH HOH A . 
F 4 HOH 115 1155 1155 HOH HOH A . 
F 4 HOH 116 1156 1156 HOH HOH A . 
F 4 HOH 117 1157 1157 HOH HOH A . 
F 4 HOH 118 1158 1158 HOH HOH A . 
F 4 HOH 119 1159 1159 HOH HOH A . 
F 4 HOH 120 1160 1160 HOH HOH A . 
F 4 HOH 121 1161 1161 HOH HOH A . 
F 4 HOH 122 1162 1162 HOH HOH A . 
F 4 HOH 123 1163 1163 HOH HOH A . 
F 4 HOH 124 1165 1165 HOH HOH A . 
F 4 HOH 125 1166 1166 HOH HOH A . 
F 4 HOH 126 1168 1168 HOH HOH A . 
F 4 HOH 127 1169 1169 HOH HOH A . 
F 4 HOH 128 1170 1170 HOH HOH A . 
F 4 HOH 129 1172 1172 HOH HOH A . 
F 4 HOH 130 1173 1173 HOH HOH A . 
F 4 HOH 131 1174 1174 HOH HOH A . 
F 4 HOH 132 1175 1175 HOH HOH A . 
F 4 HOH 133 1176 1176 HOH HOH A . 
F 4 HOH 134 1177 1177 HOH HOH A . 
F 4 HOH 135 1179 1179 HOH HOH A . 
F 4 HOH 136 1181 1181 HOH HOH A . 
F 4 HOH 137 1182 1182 HOH HOH A . 
F 4 HOH 138 1183 1183 HOH HOH A . 
F 4 HOH 139 1184 1184 HOH HOH A . 
F 4 HOH 140 1185 1185 HOH HOH A . 
F 4 HOH 141 1186 1186 HOH HOH A . 
F 4 HOH 142 1187 1187 HOH HOH A . 
F 4 HOH 143 1188 1188 HOH HOH A . 
F 4 HOH 144 1189 1189 HOH HOH A . 
F 4 HOH 145 1190 1190 HOH HOH A . 
F 4 HOH 146 1191 1191 HOH HOH A . 
F 4 HOH 147 1192 1192 HOH HOH A . 
F 4 HOH 148 1195 1195 HOH HOH A . 
F 4 HOH 149 1197 1197 HOH HOH A . 
F 4 HOH 150 1198 1198 HOH HOH A . 
F 4 HOH 151 1200 1200 HOH HOH A . 
F 4 HOH 152 1201 1201 HOH HOH A . 
F 4 HOH 153 1202 1202 HOH HOH A . 
F 4 HOH 154 1204 1204 HOH HOH A . 
F 4 HOH 155 1209 1209 HOH HOH A . 
F 4 HOH 156 1210 1210 HOH HOH A . 
F 4 HOH 157 1211 1211 HOH HOH A . 
F 4 HOH 158 1213 1213 HOH HOH A . 
F 4 HOH 159 1215 1215 HOH HOH A . 
F 4 HOH 160 1217 1217 HOH HOH A . 
F 4 HOH 161 1218 1218 HOH HOH A . 
F 4 HOH 162 1220 1220 HOH HOH A . 
F 4 HOH 163 1221 1221 HOH HOH A . 
F 4 HOH 164 1222 1222 HOH HOH A . 
F 4 HOH 165 1223 1223 HOH HOH A . 
F 4 HOH 166 1224 1224 HOH HOH A . 
F 4 HOH 167 1225 1225 HOH HOH A . 
F 4 HOH 168 1227 1227 HOH HOH A . 
F 4 HOH 169 1228 1228 HOH HOH A . 
F 4 HOH 170 1229 1229 HOH HOH A . 
F 4 HOH 171 1230 1230 HOH HOH A . 
F 4 HOH 172 1231 1231 HOH HOH A . 
F 4 HOH 173 1232 1232 HOH HOH A . 
F 4 HOH 174 1233 1233 HOH HOH A . 
F 4 HOH 175 1234 1234 HOH HOH A . 
F 4 HOH 176 1236 1236 HOH HOH A . 
F 4 HOH 177 1237 1237 HOH HOH A . 
F 4 HOH 178 1238 1238 HOH HOH A . 
F 4 HOH 179 1239 1239 HOH HOH A . 
F 4 HOH 180 1240 1240 HOH HOH A . 
F 4 HOH 181 1241 1241 HOH HOH A . 
F 4 HOH 182 1243 1243 HOH HOH A . 
F 4 HOH 183 1244 1244 HOH HOH A . 
F 4 HOH 184 1245 1245 HOH HOH A . 
F 4 HOH 185 1247 1247 HOH HOH A . 
F 4 HOH 186 1248 1248 HOH HOH A . 
F 4 HOH 187 1249 1249 HOH HOH A . 
F 4 HOH 188 1250 1250 HOH HOH A . 
F 4 HOH 189 1251 1251 HOH HOH A . 
F 4 HOH 190 1252 1252 HOH HOH A . 
F 4 HOH 191 1253 1253 HOH HOH A . 
F 4 HOH 192 1254 1254 HOH HOH A . 
F 4 HOH 193 1256 1256 HOH HOH A . 
F 4 HOH 194 1258 1258 HOH HOH A . 
F 4 HOH 195 1259 1259 HOH HOH A . 
F 4 HOH 196 1261 1261 HOH HOH A . 
F 4 HOH 197 1262 1262 HOH HOH A . 
F 4 HOH 198 1263 1263 HOH HOH A . 
F 4 HOH 199 1266 1266 HOH HOH A . 
F 4 HOH 200 1269 1269 HOH HOH A . 
F 4 HOH 201 1271 1271 HOH HOH A . 
F 4 HOH 202 1272 1272 HOH HOH A . 
F 4 HOH 203 1273 1273 HOH HOH A . 
F 4 HOH 204 1274 1274 HOH HOH A . 
F 4 HOH 205 1275 1275 HOH HOH A . 
F 4 HOH 206 1276 1276 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A BRU 18 C BRU 18  ? DU ? 
2 A BRU 19 C BRU 19  ? DU ? 
3 B BRU 7  D BRU 107 ? DU ? 
4 B BRU 8  D BRU 108 ? DU ? 
5 B BRU 9  D BRU 109 ? DU ? 
6 B BRU 10 D BRU 110 ? DU ? 
7 B BRU 12 D BRU 112 ? DU ? 
8 B BRU 21 D BRU 121 ? DU ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-08-28 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_conn        
3 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
4 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' .   ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          .   ? 5 
# 
_pdbx_entry_details.entry_id                 1A35 
_pdbx_entry_details.compound_details         
;RESIDUES 215-635 OF CHAIN A COMPRISE THE CORE DOMAIN OF
THE MOLECULE.  RESIDUES 715-765 OF CHAIN A COMPRISE THE
C-TERMINAL DOMAIN.  1-22 OF CHAIN C COMPRISE THE SCISSILE
STRAND OF THE DNA, 101-122 OF CHAIN D THE INTACT DNA
STRAND.

NOTE THAT THE LINKER DOMAIN (636-714) IS NOT
PRESENT IN THE CONSTRUCT OF THIS RECONSTITUTED ENZYME.
THE RECONSTITUTED ENZYME IS MADE UP OF RESIDUES 175-659 OF
THE CORE (EXPRESSED IN BACULOVIRUS) AND RESIDUES 713-765 OF
THE C-TERMINAL DOMAIN (EXPRESSED IN E. COLI).

CHAIN A RESIDUES 175-214 AND 636-659 OF THE CORE
AND 713-719 OF THE C-TERMINAL DOMAIN ARE DISORDERED AND NOT
PRESENT IN THE STRUCTURE.

TER
ALA 635 A IS THE TERMINAL RESIDUE OF THE CORE DOMAIN.
PHE 765 A IS THE TERMINAL RESIDUE OF THE C-TERMINAL DOMAIN.

THY 22 C IS THE 3' TERMINAL NUCLEOTIDE OF THE SCISSILE
STRAND OF THE DNA DUPLEX.

THY 122 D IS THE 3' TERMINAL NUCLEOTIDE OF THE INTACT
STRAND OF THE DNA DUPLEX.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_1              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_2              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DC 
_pdbx_validate_rmsd_angle.auth_seq_id_3              8 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.50 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.20 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 284 ? ? -55.57  -8.24   
2  1 ILE A 294 ? ? -69.90  85.52   
3  1 ALA A 315 ? ? -69.04  6.91    
4  1 GLN A 318 ? ? -107.71 50.01   
5  1 ASP A 344 ? ? 52.97   -127.98 
6  1 ALA A 351 ? ? -70.47  -82.80  
7  1 ARG A 362 ? ? -111.48 72.01   
8  1 GLU A 495 ? ? -49.97  100.14  
9  1 TYR A 523 ? ? 72.88   59.23   
10 1 ASN A 539 ? ? -173.86 148.00  
11 1 LYS A 545 ? ? -28.87  -55.74  
12 1 PHE A 565 ? ? -95.06  58.06   
13 1 ASN A 631 ? ? 73.30   45.25   
14 1 ILE A 714 ? ? -56.62  102.06  
15 1 ILE A 756 ? ? -65.65  1.93    
16 1 GLU A 761 ? ? -53.39  3.21    
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DC 
_pdbx_validate_planes.auth_asym_id    C 
_pdbx_validate_planes.auth_seq_id     8 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.101 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 267 ? CG  ? C GLU 93  CG  
2   1 Y 1 A GLU 267 ? CD  ? C GLU 93  CD  
3   1 Y 1 A GLU 267 ? OE1 ? C GLU 93  OE1 
4   1 Y 1 A GLU 267 ? OE2 ? C GLU 93  OE2 
5   1 Y 1 A LYS 276 ? CG  ? C LYS 102 CG  
6   1 Y 1 A LYS 276 ? CD  ? C LYS 102 CD  
7   1 Y 1 A LYS 276 ? CE  ? C LYS 102 CE  
8   1 Y 1 A LYS 276 ? NZ  ? C LYS 102 NZ  
9   1 Y 1 A GLU 289 ? CG  ? C GLU 115 CG  
10  1 Y 1 A GLU 289 ? CD  ? C GLU 115 CD  
11  1 Y 1 A GLU 289 ? OE1 ? C GLU 115 OE1 
12  1 Y 1 A GLU 289 ? OE2 ? C GLU 115 OE2 
13  1 Y 1 A GLU 322 ? CG  ? C GLU 148 CG  
14  1 Y 1 A GLU 322 ? CD  ? C GLU 148 CD  
15  1 Y 1 A GLU 322 ? OE1 ? C GLU 148 OE1 
16  1 Y 1 A GLU 322 ? OE2 ? C GLU 148 OE2 
17  1 Y 1 A GLU 323 ? CG  ? C GLU 149 CG  
18  1 Y 1 A GLU 323 ? CD  ? C GLU 149 CD  
19  1 Y 1 A GLU 323 ? OE1 ? C GLU 149 OE1 
20  1 Y 1 A GLU 323 ? OE2 ? C GLU 149 OE2 
21  1 Y 1 A GLU 332 ? CG  ? C GLU 158 CG  
22  1 Y 1 A GLU 332 ? CD  ? C GLU 158 CD  
23  1 Y 1 A GLU 332 ? OE1 ? C GLU 158 OE1 
24  1 Y 1 A GLU 332 ? OE2 ? C GLU 158 OE2 
25  1 Y 1 A LYS 336 ? CG  ? C LYS 162 CG  
26  1 Y 1 A LYS 336 ? CD  ? C LYS 162 CD  
27  1 Y 1 A LYS 336 ? CE  ? C LYS 162 CE  
28  1 Y 1 A LYS 336 ? NZ  ? C LYS 162 NZ  
29  1 Y 1 A GLU 337 ? CG  ? C GLU 163 CG  
30  1 Y 1 A GLU 337 ? CD  ? C GLU 163 CD  
31  1 Y 1 A GLU 337 ? OE1 ? C GLU 163 OE1 
32  1 Y 1 A GLU 337 ? OE2 ? C GLU 163 OE2 
33  1 Y 1 A ASN 345 ? CG  ? C ASN 171 CG  
34  1 Y 1 A ASN 345 ? OD1 ? C ASN 171 OD1 
35  1 Y 1 A ASN 345 ? ND2 ? C ASN 171 ND2 
36  1 Y 1 A LYS 347 ? CG  ? C LYS 173 CG  
37  1 Y 1 A LYS 347 ? CD  ? C LYS 173 CD  
38  1 Y 1 A LYS 347 ? CE  ? C LYS 173 CE  
39  1 Y 1 A LYS 347 ? NZ  ? C LYS 173 NZ  
40  1 Y 1 A LYS 388 ? CG  ? C LYS 214 CG  
41  1 Y 1 A LYS 388 ? CD  ? C LYS 214 CD  
42  1 Y 1 A LYS 388 ? CE  ? C LYS 214 CE  
43  1 Y 1 A LYS 388 ? NZ  ? C LYS 214 NZ  
44  1 Y 1 A GLU 463 ? CG  ? C GLU 289 CG  
45  1 Y 1 A GLU 463 ? CD  ? C GLU 289 CD  
46  1 Y 1 A GLU 463 ? OE1 ? C GLU 289 OE1 
47  1 Y 1 A GLU 463 ? OE2 ? C GLU 289 OE2 
48  1 Y 1 A LYS 466 ? CG  ? C LYS 292 CG  
49  1 Y 1 A LYS 466 ? CD  ? C LYS 292 CD  
50  1 Y 1 A LYS 466 ? CE  ? C LYS 292 CE  
51  1 Y 1 A LYS 466 ? NZ  ? C LYS 292 NZ  
52  1 Y 1 A GLU 469 ? CG  ? C GLU 295 CG  
53  1 Y 1 A GLU 469 ? CD  ? C GLU 295 CD  
54  1 Y 1 A GLU 469 ? OE1 ? C GLU 295 OE1 
55  1 Y 1 A GLU 469 ? OE2 ? C GLU 295 OE2 
56  1 Y 1 A LYS 484 ? CG  ? C LYS 310 CG  
57  1 Y 1 A LYS 484 ? CD  ? C LYS 310 CD  
58  1 Y 1 A LYS 484 ? CE  ? C LYS 310 CE  
59  1 Y 1 A LYS 484 ? NZ  ? C LYS 310 NZ  
60  1 Y 1 A GLU 495 ? CG  ? C GLU 321 CG  
61  1 Y 1 A GLU 495 ? CD  ? C GLU 321 CD  
62  1 Y 1 A GLU 495 ? OE1 ? C GLU 321 OE1 
63  1 Y 1 A GLU 495 ? OE2 ? C GLU 321 OE2 
64  1 Y 1 A GLU 497 ? CG  ? C GLU 323 CG  
65  1 Y 1 A GLU 497 ? CD  ? C GLU 323 CD  
66  1 Y 1 A GLU 497 ? OE1 ? C GLU 323 OE1 
67  1 Y 1 A GLU 497 ? OE2 ? C GLU 323 OE2 
68  1 Y 1 A GLU 517 ? CG  ? C GLU 343 CG  
69  1 Y 1 A GLU 517 ? CD  ? C GLU 343 CD  
70  1 Y 1 A GLU 517 ? OE1 ? C GLU 343 OE1 
71  1 Y 1 A GLU 517 ? OE2 ? C GLU 343 OE2 
72  1 Y 1 A ASP 519 ? CG  ? C ASP 345 CG  
73  1 Y 1 A ASP 519 ? OD1 ? C ASP 345 OD1 
74  1 Y 1 A ASP 519 ? OD2 ? C ASP 345 OD2 
75  1 Y 1 A GLN 521 ? CG  ? C GLN 347 CG  
76  1 Y 1 A GLN 521 ? CD  ? C GLN 347 CD  
77  1 Y 1 A GLN 521 ? OE1 ? C GLN 347 OE1 
78  1 Y 1 A GLN 521 ? NE2 ? C GLN 347 NE2 
79  1 Y 1 A GLU 522 ? CG  ? C GLU 348 CG  
80  1 Y 1 A GLU 522 ? CD  ? C GLU 348 CD  
81  1 Y 1 A GLU 522 ? OE1 ? C GLU 348 OE1 
82  1 Y 1 A GLU 522 ? OE2 ? C GLU 348 OE2 
83  1 Y 1 A LYS 545 ? CG  ? C LYS 371 CG  
84  1 Y 1 A LYS 545 ? CD  ? C LYS 371 CD  
85  1 Y 1 A LYS 545 ? CE  ? C LYS 371 CE  
86  1 Y 1 A LYS 545 ? NZ  ? C LYS 371 NZ  
87  1 Y 1 A ARG 546 ? CG  ? C ARG 372 CG  
88  1 Y 1 A ARG 546 ? CD  ? C ARG 372 CD  
89  1 Y 1 A ARG 546 ? NE  ? C ARG 372 NE  
90  1 Y 1 A ARG 546 ? CZ  ? C ARG 372 CZ  
91  1 Y 1 A ARG 546 ? NH1 ? C ARG 372 NH1 
92  1 Y 1 A ARG 546 ? NH2 ? C ARG 372 NH2 
93  1 Y 1 A GLU 556 ? CG  ? C GLU 382 CG  
94  1 Y 1 A GLU 556 ? CD  ? C GLU 382 CD  
95  1 Y 1 A GLU 556 ? OE1 ? C GLU 382 OE1 
96  1 Y 1 A GLU 556 ? OE2 ? C GLU 382 OE2 
97  1 Y 1 A ARG 567 ? CG  ? C ARG 393 CG  
98  1 Y 1 A ARG 567 ? CD  ? C ARG 393 CD  
99  1 Y 1 A ARG 567 ? NE  ? C ARG 393 NE  
100 1 Y 1 A ARG 567 ? CZ  ? C ARG 393 CZ  
101 1 Y 1 A ARG 567 ? NH1 ? C ARG 393 NH1 
102 1 Y 1 A ARG 567 ? NH2 ? C ARG 393 NH2 
103 1 Y 1 A ASP 579 ? CG  ? C ASP 405 CG  
104 1 Y 1 A ASP 579 ? OD1 ? C ASP 405 OD1 
105 1 Y 1 A ASP 579 ? OD2 ? C ASP 405 OD2 
106 1 Y 1 A GLU 582 ? CG  ? C GLU 408 CG  
107 1 Y 1 A GLU 582 ? CD  ? C GLU 408 CD  
108 1 Y 1 A GLU 582 ? OE1 ? C GLU 408 OE1 
109 1 Y 1 A GLU 582 ? OE2 ? C GLU 408 OE2 
110 1 Y 1 A ASP 609 ? CG  ? C ASP 435 CG  
111 1 Y 1 A ASP 609 ? OD1 ? C ASP 435 OD1 
112 1 Y 1 A ASP 609 ? OD2 ? C ASP 435 OD2 
113 1 Y 1 A GLU 610 ? CG  ? C GLU 436 CG  
114 1 Y 1 A GLU 610 ? CD  ? C GLU 436 CD  
115 1 Y 1 A GLU 610 ? OE1 ? C GLU 436 OE1 
116 1 Y 1 A GLU 610 ? OE2 ? C GLU 436 OE2 
117 1 Y 1 A ARG 621 ? CG  ? C ARG 447 CG  
118 1 Y 1 A ARG 621 ? CD  ? C ARG 447 CD  
119 1 Y 1 A ARG 621 ? NE  ? C ARG 447 NE  
120 1 Y 1 A ARG 621 ? CZ  ? C ARG 447 CZ  
121 1 Y 1 A ARG 621 ? NH1 ? C ARG 447 NH1 
122 1 Y 1 A ARG 621 ? NH2 ? C ARG 447 NH2 
123 1 Y 1 A ARG 624 ? CG  ? C ARG 450 CG  
124 1 Y 1 A ARG 624 ? CD  ? C ARG 450 CD  
125 1 Y 1 A ARG 624 ? NE  ? C ARG 450 NE  
126 1 Y 1 A ARG 624 ? CZ  ? C ARG 450 CZ  
127 1 Y 1 A ARG 624 ? NH1 ? C ARG 450 NH1 
128 1 Y 1 A ARG 624 ? NH2 ? C ARG 450 NH2 
129 1 Y 1 A ARG 634 ? CG  ? C ARG 460 CG  
130 1 Y 1 A ARG 634 ? CD  ? C ARG 460 CD  
131 1 Y 1 A ARG 634 ? NE  ? C ARG 460 NE  
132 1 Y 1 A ARG 634 ? CZ  ? C ARG 460 CZ  
133 1 Y 1 A ARG 634 ? NH1 ? C ARG 460 NH1 
134 1 Y 1 A ARG 634 ? NH2 ? C ARG 460 NH2 
135 1 Y 1 A GLN 713 ? CG  ? C GLN 539 CG  
136 1 Y 1 A GLN 713 ? CD  ? C GLN 539 CD  
137 1 Y 1 A GLN 713 ? OE1 ? C GLN 539 OE1 
138 1 Y 1 A GLN 713 ? NE2 ? C GLN 539 NE2 
139 1 Y 1 A GLU 741 ? CG  ? C GLU 567 CG  
140 1 Y 1 A GLU 741 ? CD  ? C GLU 567 CD  
141 1 Y 1 A GLU 741 ? OE1 ? C GLU 567 OE1 
142 1 Y 1 A GLU 741 ? OE2 ? C GLU 567 OE2 
143 1 Y 1 A LYS 742 ? CG  ? C LYS 568 CG  
144 1 Y 1 A LYS 742 ? CD  ? C LYS 568 CD  
145 1 Y 1 A LYS 742 ? CE  ? C LYS 568 CE  
146 1 Y 1 A LYS 742 ? NZ  ? C LYS 568 NZ  
147 1 Y 1 A LYS 746 ? CG  ? C LYS 572 CG  
148 1 Y 1 A LYS 746 ? CD  ? C LYS 572 CD  
149 1 Y 1 A LYS 746 ? CE  ? C LYS 572 CE  
150 1 Y 1 A LYS 746 ? NZ  ? C LYS 572 NZ  
151 1 Y 1 A ASP 760 ? CG  ? C ASP 586 CG  
152 1 Y 1 A ASP 760 ? OD1 ? C ASP 586 OD1 
153 1 Y 1 A ASP 760 ? OD2 ? C ASP 586 OD2 
154 1 Y 1 A GLU 761 ? CG  ? C GLU 587 CG  
155 1 Y 1 A GLU 761 ? CD  ? C GLU 587 CD  
156 1 Y 1 A GLU 761 ? OE1 ? C GLU 587 OE1 
157 1 Y 1 A GLU 761 ? OE2 ? C GLU 587 OE2 
158 1 Y 1 A ASP 762 ? CG  ? C ASP 588 CG  
159 1 Y 1 A ASP 762 ? OD1 ? C ASP 588 OD1 
160 1 Y 1 A ASP 762 ? OD2 ? C ASP 588 OD2 
161 1 Y 1 A GLU 764 ? CG  ? C GLU 590 CG  
162 1 Y 1 A GLU 764 ? CD  ? C GLU 590 CD  
163 1 Y 1 A GLU 764 ? OE1 ? C GLU 590 OE1 
164 1 Y 1 A GLU 764 ? OE2 ? C GLU 590 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A LYS 175 ? C LYS 1   
2   1 Y 1 A PRO 176 ? C PRO 2   
3   1 Y 1 A LYS 177 ? C LYS 3   
4   1 Y 1 A ASN 178 ? C ASN 4   
5   1 Y 1 A LYS 179 ? C LYS 5   
6   1 Y 1 A ASP 180 ? C ASP 6   
7   1 Y 1 A LYS 181 ? C LYS 7   
8   1 Y 1 A ASP 182 ? C ASP 8   
9   1 Y 1 A LYS 183 ? C LYS 9   
10  1 Y 1 A LYS 184 ? C LYS 10  
11  1 Y 1 A VAL 185 ? C VAL 11  
12  1 Y 1 A PRO 186 ? C PRO 12  
13  1 Y 1 A GLU 187 ? C GLU 13  
14  1 Y 1 A PRO 188 ? C PRO 14  
15  1 Y 1 A ASP 189 ? C ASP 15  
16  1 Y 1 A ASN 190 ? C ASN 16  
17  1 Y 1 A LYS 191 ? C LYS 17  
18  1 Y 1 A LYS 192 ? C LYS 18  
19  1 Y 1 A LYS 193 ? C LYS 19  
20  1 Y 1 A LYS 194 ? C LYS 20  
21  1 Y 1 A PRO 195 ? C PRO 21  
22  1 Y 1 A LYS 196 ? C LYS 22  
23  1 Y 1 A LYS 197 ? C LYS 23  
24  1 Y 1 A GLU 198 ? C GLU 24  
25  1 Y 1 A GLU 199 ? C GLU 25  
26  1 Y 1 A GLU 200 ? C GLU 26  
27  1 Y 1 A GLN 201 ? C GLN 27  
28  1 Y 1 A LYS 202 ? C LYS 28  
29  1 Y 1 A TRP 203 ? C TRP 29  
30  1 Y 1 A LYS 204 ? C LYS 30  
31  1 Y 1 A TRP 205 ? C TRP 31  
32  1 Y 1 A TRP 206 ? C TRP 32  
33  1 Y 1 A GLU 207 ? C GLU 33  
34  1 Y 1 A GLU 208 ? C GLU 34  
35  1 Y 1 A GLU 209 ? C GLU 35  
36  1 Y 1 A ARG 210 ? C ARG 36  
37  1 Y 1 A TYR 211 ? C TYR 37  
38  1 Y 1 A PRO 212 ? C PRO 38  
39  1 Y 1 A GLU 213 ? C GLU 39  
40  1 Y 1 A GLY 214 ? C GLY 40  
41  1 Y 1 A PRO 636 ? C PRO 462 
42  1 Y 1 A PRO 637 ? C PRO 463 
43  1 Y 1 A LYS 638 ? C LYS 464 
44  1 Y 1 A THR 639 ? C THR 465 
45  1 Y 1 A PHE 640 ? C PHE 466 
46  1 Y 1 A GLU 641 ? C GLU 467 
47  1 Y 1 A LYS 642 ? C LYS 468 
48  1 Y 1 A SER 643 ? C SER 469 
49  1 Y 1 A MET 644 ? C MET 470 
50  1 Y 1 A MET 645 ? C MET 471 
51  1 Y 1 A ASN 646 ? C ASN 472 
52  1 Y 1 A LEU 647 ? C LEU 473 
53  1 Y 1 A GLN 648 ? C GLN 474 
54  1 Y 1 A THR 649 ? C THR 475 
55  1 Y 1 A LYS 650 ? C LYS 476 
56  1 Y 1 A ILE 651 ? C ILE 477 
57  1 Y 1 A ASP 652 ? C ASP 478 
58  1 Y 1 A ALA 653 ? C ALA 479 
59  1 Y 1 A LYS 654 ? C LYS 480 
60  1 Y 1 A LYS 655 ? C LYS 481 
61  1 Y 1 A GLU 656 ? C GLU 482 
62  1 Y 1 A GLN 657 ? C GLN 483 
63  1 Y 1 A LEU 658 ? C LEU 484 
64  1 Y 1 A ALA 659 ? C ALA 485 
65  1 Y 1 A ASP 660 ? C ASP 486 
66  1 Y 1 A ALA 661 ? C ALA 487 
67  1 Y 1 A ARG 662 ? C ARG 488 
68  1 Y 1 A ARG 663 ? C ARG 489 
69  1 Y 1 A ASP 664 ? C ASP 490 
70  1 Y 1 A LEU 665 ? C LEU 491 
71  1 Y 1 A LYS 666 ? C LYS 492 
72  1 Y 1 A SER 667 ? C SER 493 
73  1 Y 1 A ALA 668 ? C ALA 494 
74  1 Y 1 A LYS 669 ? C LYS 495 
75  1 Y 1 A ALA 670 ? C ALA 496 
76  1 Y 1 A ASP 671 ? C ASP 497 
77  1 Y 1 A ALA 672 ? C ALA 498 
78  1 Y 1 A LYS 673 ? C LYS 499 
79  1 Y 1 A VAL 674 ? C VAL 500 
80  1 Y 1 A MET 675 ? C MET 501 
81  1 Y 1 A LYS 676 ? C LYS 502 
82  1 Y 1 A ASP 677 ? C ASP 503 
83  1 Y 1 A ALA 678 ? C ALA 504 
84  1 Y 1 A LYS 679 ? C LYS 505 
85  1 Y 1 A THR 680 ? C THR 506 
86  1 Y 1 A LYS 681 ? C LYS 507 
87  1 Y 1 A LYS 682 ? C LYS 508 
88  1 Y 1 A VAL 683 ? C VAL 509 
89  1 Y 1 A VAL 684 ? C VAL 510 
90  1 Y 1 A GLU 685 ? C GLU 511 
91  1 Y 1 A SER 686 ? C SER 512 
92  1 Y 1 A LYS 687 ? C LYS 513 
93  1 Y 1 A LYS 688 ? C LYS 514 
94  1 Y 1 A LYS 689 ? C LYS 515 
95  1 Y 1 A ALA 690 ? C ALA 516 
96  1 Y 1 A VAL 691 ? C VAL 517 
97  1 Y 1 A GLN 692 ? C GLN 518 
98  1 Y 1 A ARG 693 ? C ARG 519 
99  1 Y 1 A LEU 694 ? C LEU 520 
100 1 Y 1 A GLU 695 ? C GLU 521 
101 1 Y 1 A GLU 696 ? C GLU 522 
102 1 Y 1 A GLN 697 ? C GLN 523 
103 1 Y 1 A LEU 698 ? C LEU 524 
104 1 Y 1 A MET 699 ? C MET 525 
105 1 Y 1 A LYS 700 ? C LYS 526 
106 1 Y 1 A LEU 701 ? C LEU 527 
107 1 Y 1 A GLU 702 ? C GLU 528 
108 1 Y 1 A VAL 703 ? C VAL 529 
109 1 Y 1 A GLN 704 ? C GLN 530 
110 1 Y 1 A ALA 705 ? C ALA 531 
111 1 Y 1 A THR 706 ? C THR 532 
112 1 Y 1 A ASP 707 ? C ASP 533 
113 1 Y 1 A ARG 708 ? C ARG 534 
114 1 Y 1 A GLU 709 ? C GLU 535 
115 1 Y 1 A GLU 710 ? C GLU 536 
116 1 Y 1 A ASN 711 ? C ASN 537 
117 1 Y 1 A LYS 712 ? C LYS 538 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1A35 'double helix'        
1A35 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA  1  1_555 B DT  22 1_555 -0.797 -0.314 -0.090 8.868  -16.371 5.517  1  C_DA1:DT122_D   C 1  ? D 122 ? 20 1 
1 A DA  2  1_555 B BRU 21 1_555 -0.355 0.023  0.299  16.704 -9.144  4.126  2  C_DA2:BRU121_D  C 2  ? D 121 ? 20 1 
1 A DA  3  1_555 B DT  20 1_555 0.190  -0.259 0.340  6.225  -12.580 1.782  3  C_DA3:DT120_D   C 3  ? D 120 ? 20 1 
1 A DA  4  1_555 B DT  19 1_555 0.493  -0.148 -0.051 2.170  -17.549 12.785 4  C_DA4:DT119_D   C 4  ? D 119 ? 20 1 
1 A DA  5  1_555 B DT  18 1_555 0.529  -0.067 0.016  2.192  -16.700 2.109  5  C_DA5:DT118_D   C 5  ? D 118 ? 20 1 
1 A DG  6  1_555 B DC  17 1_555 0.282  0.099  -0.031 -4.055 -12.918 4.073  6  C_DG6:DC117_D   C 6  ? D 117 ? 19 1 
1 A DA  7  1_555 B DT  16 1_555 0.358  -0.075 -0.117 -2.142 -9.819  -3.638 7  C_DA7:DT116_D   C 7  ? D 116 ? 20 1 
1 A DC  8  1_555 B DG  15 1_555 0.214  -0.331 0.115  7.379  -13.881 -3.752 8  C_DC8:DG115_D   C 8  ? D 115 ? 19 1 
1 A DT  9  1_555 B DA  14 1_555 -0.160 -0.182 0.438  -8.972 -8.416  4.582  9  C_DT9:DA114_D   C 9  ? D 114 ? 20 1 
1 A DT  10 1_555 B DA  13 1_555 0.350  -0.360 -0.065 -9.614 -16.473 0.535  10 C_DT10:DA113_D  C 10 ? D 113 ? 20 1 
1 A DA  11 1_555 B BRU 12 1_555 0.867  -0.252 -0.123 -5.477 -6.456  8.128  11 C_DA11:BRU112_D C 11 ? D 112 ? 20 1 
1 A DG  12 1_555 B DC  11 1_555 -0.637 -0.422 0.217  13.491 -2.813  2.350  12 C_DG12:DC111_D  C 12 ? D 111 ? 19 1 
1 A DA  13 1_555 B BRU 10 1_555 -0.051 0.049  0.014  7.210  -13.742 1.793  13 C_DA13:BRU110_D C 13 ? D 110 ? 20 1 
1 A DA  14 1_555 B BRU 9  1_555 -0.563 -0.320 0.114  2.968  -12.352 -2.861 14 C_DA14:BRU109_D C 14 ? D 109 ? 20 1 
1 A DA  15 1_555 B BRU 8  1_555 0.174  -0.482 0.273  11.946 -20.490 -4.548 15 C_DA15:BRU108_D C 15 ? D 108 ? 20 1 
1 A DA  16 1_555 B BRU 7  1_555 0.996  -0.465 -0.092 -5.862 -17.930 -3.410 16 C_DA16:BRU107_D C 16 ? D 107 ? 20 1 
1 A DA  17 1_555 B DT  6  1_555 1.001  -0.634 0.004  -2.270 -12.185 10.230 17 C_DA17:DT106_D  C 17 ? D 106 ? 20 1 
1 A BRU 18 1_555 B DA  5  1_555 0.138  -0.534 0.084  -5.618 -9.682  6.341  18 C_BRU18:DA105_D C 18 ? D 105 ? 20 1 
1 A BRU 19 1_555 B DA  4  1_555 -0.219 -0.410 0.139  1.201  -14.717 3.666  19 C_BRU19:DA104_D C 19 ? D 104 ? 20 1 
1 A DT  20 1_555 B DA  3  1_555 1.372  -0.179 0.364  -7.959 -12.447 10.012 20 C_DT20:DA103_D  C 20 ? D 103 ? ?  1 
1 A DT  21 1_555 B DA  2  1_555 0.479  -0.013 0.314  -6.446 -5.876  8.416  21 C_DT21:DA102_D  C 21 ? D 102 ? 20 1 
1 A DT  22 1_555 B DA  1  1_555 0.400  -0.484 0.140  -5.754 -8.098  -4.904 22 C_DT22:DA101_D  C 22 ? D 101 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA  1  1_555 B DT  22 1_555 A DA  2  1_555 B BRU 21 1_555 0.547  0.031  2.938 -3.510 3.448  34.643 -0.411 -1.381 2.860 5.754  
5.858  34.980 1  CC_DA1DA2:BRU121DT122_DD    C 1  ? D 122 ? C 2  ? D 121 ? 
1 A DA  2  1_555 B BRU 21 1_555 A DA  3  1_555 B DT  20 1_555 -0.357 -0.024 3.421 -1.348 -0.809 42.689 0.053  0.349  3.430 -1.111 
1.851  42.717 2  CC_DA2DA3:DT120BRU121_DD    C 2  ? D 121 ? C 3  ? D 120 ? 
1 A DA  3  1_555 B DT  20 1_555 A DA  4  1_555 B DT  19 1_555 0.199  -0.027 3.386 4.427  -2.590 37.230 0.309  0.291  3.381 -4.034 
-6.893 37.569 3  CC_DA3DA4:DT119DT120_DD     C 3  ? D 120 ? C 4  ? D 119 ? 
1 A DA  4  1_555 B DT  19 1_555 A DA  5  1_555 B DT  18 1_555 -0.214 -0.340 3.171 -2.826 -0.237 36.012 -0.516 -0.043 3.180 -0.383 
4.563  36.120 4  CC_DA4DA5:DT118DT119_DD     C 4  ? D 119 ? C 5  ? D 118 ? 
1 A DA  5  1_555 B DT  18 1_555 A DG  6  1_555 B DC  17 1_555 0.407  -0.705 3.410 1.701  2.234  33.919 -1.574 -0.413 3.374 3.821  
-2.910 34.032 5  CC_DA5DG6:DC117DT118_DD     C 5  ? D 118 ? C 6  ? D 117 ? 
1 A DG  6  1_555 B DC  17 1_555 A DA  7  1_555 B DT  16 1_555 -0.449 -0.309 3.307 1.163  2.251  30.032 -1.055 1.101  3.257 4.333  
-2.240 30.137 6  CC_DG6DA7:DT116DC117_DD     C 6  ? D 117 ? C 7  ? D 116 ? 
1 A DA  7  1_555 B DT  16 1_555 A DC  8  1_555 B DG  15 1_555 0.646  -0.740 3.109 -2.179 3.748  30.860 -2.043 -1.590 2.949 7.000  
4.070  31.156 7  CC_DA7DC8:DG115DT116_DD     C 7  ? D 116 ? C 8  ? D 115 ? 
1 A DC  8  1_555 B DG  15 1_555 A DT  9  1_555 B DA  14 1_555 -0.013 -0.564 3.681 0.348  -2.755 40.966 -0.465 0.062  3.710 -3.932 
-0.496 41.056 8  CC_DC8DT9:DA114DG115_DD     C 8  ? D 115 ? C 9  ? D 114 ? 
1 A DT  9  1_555 B DA  14 1_555 A DT  10 1_555 B DA  13 1_555 -0.301 -0.499 3.339 3.650  -2.964 35.643 -0.377 1.021  3.322 -4.816 
-5.931 35.942 9  CC_DT9DT10:DA113DA114_DD    C 9  ? D 114 ? C 10 ? D 113 ? 
1 A DT  10 1_555 B DA  13 1_555 A DA  11 1_555 B BRU 12 1_555 0.687  0.394  3.300 3.585  -2.557 43.341 0.781  -0.576 3.316 -3.451 
-4.839 43.554 10 CC_DT10DA11:BRU112DA113_DD  C 10 ? D 113 ? C 11 ? D 112 ? 
1 A DA  11 1_555 B BRU 12 1_555 A DG  12 1_555 B DC  11 1_555 -0.890 0.534  2.899 -3.718 7.132  17.188 -1.886 0.872  3.002 22.343 
11.648 18.964 11 CC_DA11DG12:DC111BRU112_DD  C 11 ? D 112 ? C 12 ? D 111 ? 
1 A DG  12 1_555 B DC  11 1_555 A DA  13 1_555 B BRU 10 1_555 -0.382 -0.476 3.492 0.979  2.116  37.497 -1.033 0.729  3.451 3.287  
-1.521 37.567 12 CC_DG12DA13:BRU110DC111_DD  C 12 ? D 111 ? C 13 ? D 110 ? 
1 A DA  13 1_555 B BRU 10 1_555 A DA  14 1_555 B BRU 9  1_555 0.157  -0.050 3.319 -1.359 -4.235 35.843 0.527  -0.449 3.295 -6.849 
2.198  36.109 13 CC_DA13DA14:BRU109BRU110_DD C 13 ? D 110 ? C 14 ? D 109 ? 
1 A DA  14 1_555 B BRU 9  1_555 A DA  15 1_555 B BRU 8  1_555 -0.141 -0.023 2.896 2.531  -5.832 43.930 0.449  0.395  2.865 -7.747 
-3.362 44.365 14 CC_DA14DA15:BRU108BRU109_DD C 14 ? D 109 ? C 15 ? D 108 ? 
1 A DA  15 1_555 B BRU 8  1_555 A DA  16 1_555 B BRU 7  1_555 0.061  -0.352 3.814 3.672  -0.001 37.920 -0.538 0.449  3.803 -0.002 
-5.634 38.090 15 CC_DA15DA16:BRU107BRU108_DD C 15 ? D 108 ? C 16 ? D 107 ? 
1 A DA  16 1_555 B BRU 7  1_555 A DA  17 1_555 B DT  6  1_555 0.056  -0.449 3.074 -0.783 3.296  35.367 -1.186 -0.199 3.019 5.410  
1.286  35.524 16 CC_DA16DA17:DT106BRU107_DD  C 16 ? D 107 ? C 17 ? D 106 ? 
1 A DA  17 1_555 B DT  6  1_555 A BRU 18 1_555 B DA  5  1_555 -0.036 -0.426 3.218 -1.561 0.405  26.201 -1.046 -0.334 3.208 0.893  
3.440  26.250 17 CC_DA17BRU18:DA105DT106_DD  C 17 ? D 106 ? C 18 ? D 105 ? 
1 A BRU 18 1_555 B DA  5  1_555 A BRU 19 1_555 B DA  4  1_555 -0.301 -0.186 3.132 -3.864 -3.529 36.249 0.172  -0.033 3.150 -5.635 
6.170  36.612 18 CC_BRU18BRU19:DA104DA105_DD C 18 ? D 105 ? C 19 ? D 104 ? 
1 A BRU 19 1_555 B DA  4  1_555 A DT  20 1_555 B DA  3  1_555 0.478  0.266  3.435 0.822  -1.842 50.163 0.452  -0.502 3.431 -2.172 
-0.969 50.201 19 CC_BRU19DT20:DA103DA104_DD  C 19 ? D 104 ? C 20 ? D 103 ? 
1 A DT  20 1_555 B DA  3  1_555 A DT  21 1_555 B DA  2  1_555 -0.382 -0.348 3.110 -1.857 -0.725 24.467 -0.604 0.351  3.139 -1.707 
4.373  24.547 20 CC_DT20DT21:DA102DA103_DD   C 20 ? D 103 ? C 21 ? D 102 ? 
1 A DT  21 1_555 B DA  2  1_555 A DT  22 1_555 B DA  1  1_555 -0.820 -0.425 3.143 0.538  0.394  37.060 -0.720 1.359  3.126 0.621  
-0.847 37.065 21 CC_DT21DT22:DA101DA102_DD   C 21 ? D 102 ? C 22 ? D 101 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#