data_1A7A
# 
_entry.id   1A7A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A7A         
WWPDB D_1000170481 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A7A 
_pdbx_database_status.recvd_initial_deposition_date   1998-03-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Turner, M.A.'     1 
'Yuan, C.-S.'      2 
'Borchardt, R.T.'  3 
'Hershfield, M.S.' 4 
'Smith, G.D.'      5 
'Howell, P.L.'     6 
# 
_citation.id                        primary 
_citation.title                     
'Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength.' 
_citation.journal_abbrev            Nat.Struct.Biol. 
_citation.journal_volume            5 
_citation.page_first                369 
_citation.page_last                 376 
_citation.year                      1998 
_citation.journal_id_ASTM           NSBIEW 
_citation.country                   US 
_citation.journal_id_ISSN           1072-8368 
_citation.journal_id_CSD            2024 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9586999 
_citation.pdbx_database_id_DOI      10.1038/nsb0598-369 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Turner, M.A.'     1 
primary 'Yuan, C.S.'       2 
primary 'Borchardt, R.T.'  3 
primary 'Hershfield, M.S.' 4 
primary 'Smith, G.D.'      5 
primary 'Howell, P.L.'     6 
# 
_cell.entry_id           1A7A 
_cell.length_a           91.930 
_cell.length_b           168.020 
_cell.length_c           137.770 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1A7A 
_symmetry.space_group_name_H-M             'C 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                21 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'S-ADENOSYLHOMOCYSTEINE HYDROLASE'                        48522.281 2  3.3.1.1 ? ? 
'SELENOMETHIONINE DERIVATIZED PROTEIN' 
2 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                         663.425   2  ?       ? ? ? 
3 non-polymer syn "(1'R,2'S)-9-(2-HYDROXY-3'-KETO-CYCLOPENTEN-1-YL)ADENINE" 233.227   2  ?       ? ? ? 
4 water       nat water                                                     18.015    46 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(MSE)SDKLPYKVADIGLAAWGRKALDIAENE(MSE)PGL(MSE)R(MSE)RERYSASKPLKGARIAGCLH(MSE)TVET
AVLIETLVTLGAEVQWSSCNIFSTQNHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLN(MSE)ILDDGGDLT
NLIHTKYPQLLPGIRGISEETTTGVHNLYK(MSE)(MSE)ANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATD
V(MSE)IAGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAA(MSE)EGYEVTT(MSE)DEACQEGNIFVTTT
GCIDIILGRHFEQ(MSE)KDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYRLKNGRRIILLAEGRLVNLGCA
(MSE)GHPSFV(MSE)SNSFTNQV(MSE)AQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLG
(MSE)SCDGPFKPDHYRY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN
IFSTQNHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTG
VHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MSE n 
1 2   SER n 
1 3   ASP n 
1 4   LYS n 
1 5   LEU n 
1 6   PRO n 
1 7   TYR n 
1 8   LYS n 
1 9   VAL n 
1 10  ALA n 
1 11  ASP n 
1 12  ILE n 
1 13  GLY n 
1 14  LEU n 
1 15  ALA n 
1 16  ALA n 
1 17  TRP n 
1 18  GLY n 
1 19  ARG n 
1 20  LYS n 
1 21  ALA n 
1 22  LEU n 
1 23  ASP n 
1 24  ILE n 
1 25  ALA n 
1 26  GLU n 
1 27  ASN n 
1 28  GLU n 
1 29  MSE n 
1 30  PRO n 
1 31  GLY n 
1 32  LEU n 
1 33  MSE n 
1 34  ARG n 
1 35  MSE n 
1 36  ARG n 
1 37  GLU n 
1 38  ARG n 
1 39  TYR n 
1 40  SER n 
1 41  ALA n 
1 42  SER n 
1 43  LYS n 
1 44  PRO n 
1 45  LEU n 
1 46  LYS n 
1 47  GLY n 
1 48  ALA n 
1 49  ARG n 
1 50  ILE n 
1 51  ALA n 
1 52  GLY n 
1 53  CYS n 
1 54  LEU n 
1 55  HIS n 
1 56  MSE n 
1 57  THR n 
1 58  VAL n 
1 59  GLU n 
1 60  THR n 
1 61  ALA n 
1 62  VAL n 
1 63  LEU n 
1 64  ILE n 
1 65  GLU n 
1 66  THR n 
1 67  LEU n 
1 68  VAL n 
1 69  THR n 
1 70  LEU n 
1 71  GLY n 
1 72  ALA n 
1 73  GLU n 
1 74  VAL n 
1 75  GLN n 
1 76  TRP n 
1 77  SER n 
1 78  SER n 
1 79  CYS n 
1 80  ASN n 
1 81  ILE n 
1 82  PHE n 
1 83  SER n 
1 84  THR n 
1 85  GLN n 
1 86  ASN n 
1 87  HIS n 
1 88  ALA n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  ILE n 
1 93  ALA n 
1 94  LYS n 
1 95  ALA n 
1 96  GLY n 
1 97  ILE n 
1 98  PRO n 
1 99  VAL n 
1 100 TYR n 
1 101 ALA n 
1 102 TRP n 
1 103 LYS n 
1 104 GLY n 
1 105 GLU n 
1 106 THR n 
1 107 ASP n 
1 108 GLU n 
1 109 GLU n 
1 110 TYR n 
1 111 LEU n 
1 112 TRP n 
1 113 CYS n 
1 114 ILE n 
1 115 GLU n 
1 116 GLN n 
1 117 THR n 
1 118 LEU n 
1 119 TYR n 
1 120 PHE n 
1 121 LYS n 
1 122 ASP n 
1 123 GLY n 
1 124 PRO n 
1 125 LEU n 
1 126 ASN n 
1 127 MSE n 
1 128 ILE n 
1 129 LEU n 
1 130 ASP n 
1 131 ASP n 
1 132 GLY n 
1 133 GLY n 
1 134 ASP n 
1 135 LEU n 
1 136 THR n 
1 137 ASN n 
1 138 LEU n 
1 139 ILE n 
1 140 HIS n 
1 141 THR n 
1 142 LYS n 
1 143 TYR n 
1 144 PRO n 
1 145 GLN n 
1 146 LEU n 
1 147 LEU n 
1 148 PRO n 
1 149 GLY n 
1 150 ILE n 
1 151 ARG n 
1 152 GLY n 
1 153 ILE n 
1 154 SER n 
1 155 GLU n 
1 156 GLU n 
1 157 THR n 
1 158 THR n 
1 159 THR n 
1 160 GLY n 
1 161 VAL n 
1 162 HIS n 
1 163 ASN n 
1 164 LEU n 
1 165 TYR n 
1 166 LYS n 
1 167 MSE n 
1 168 MSE n 
1 169 ALA n 
1 170 ASN n 
1 171 GLY n 
1 172 ILE n 
1 173 LEU n 
1 174 LYS n 
1 175 VAL n 
1 176 PRO n 
1 177 ALA n 
1 178 ILE n 
1 179 ASN n 
1 180 VAL n 
1 181 ASN n 
1 182 ASP n 
1 183 SER n 
1 184 VAL n 
1 185 THR n 
1 186 LYS n 
1 187 SER n 
1 188 LYS n 
1 189 PHE n 
1 190 ASP n 
1 191 ASN n 
1 192 LEU n 
1 193 TYR n 
1 194 GLY n 
1 195 CYS n 
1 196 ARG n 
1 197 GLU n 
1 198 SER n 
1 199 LEU n 
1 200 ILE n 
1 201 ASP n 
1 202 GLY n 
1 203 ILE n 
1 204 LYS n 
1 205 ARG n 
1 206 ALA n 
1 207 THR n 
1 208 ASP n 
1 209 VAL n 
1 210 MSE n 
1 211 ILE n 
1 212 ALA n 
1 213 GLY n 
1 214 LYS n 
1 215 VAL n 
1 216 ALA n 
1 217 VAL n 
1 218 VAL n 
1 219 ALA n 
1 220 GLY n 
1 221 TYR n 
1 222 GLY n 
1 223 ASP n 
1 224 VAL n 
1 225 GLY n 
1 226 LYS n 
1 227 GLY n 
1 228 CYS n 
1 229 ALA n 
1 230 GLN n 
1 231 ALA n 
1 232 LEU n 
1 233 ARG n 
1 234 GLY n 
1 235 PHE n 
1 236 GLY n 
1 237 ALA n 
1 238 ARG n 
1 239 VAL n 
1 240 ILE n 
1 241 ILE n 
1 242 THR n 
1 243 GLU n 
1 244 ILE n 
1 245 ASP n 
1 246 PRO n 
1 247 ILE n 
1 248 ASN n 
1 249 ALA n 
1 250 LEU n 
1 251 GLN n 
1 252 ALA n 
1 253 ALA n 
1 254 MSE n 
1 255 GLU n 
1 256 GLY n 
1 257 TYR n 
1 258 GLU n 
1 259 VAL n 
1 260 THR n 
1 261 THR n 
1 262 MSE n 
1 263 ASP n 
1 264 GLU n 
1 265 ALA n 
1 266 CYS n 
1 267 GLN n 
1 268 GLU n 
1 269 GLY n 
1 270 ASN n 
1 271 ILE n 
1 272 PHE n 
1 273 VAL n 
1 274 THR n 
1 275 THR n 
1 276 THR n 
1 277 GLY n 
1 278 CYS n 
1 279 ILE n 
1 280 ASP n 
1 281 ILE n 
1 282 ILE n 
1 283 LEU n 
1 284 GLY n 
1 285 ARG n 
1 286 HIS n 
1 287 PHE n 
1 288 GLU n 
1 289 GLN n 
1 290 MSE n 
1 291 LYS n 
1 292 ASP n 
1 293 ASP n 
1 294 ALA n 
1 295 ILE n 
1 296 VAL n 
1 297 CYS n 
1 298 ASN n 
1 299 ILE n 
1 300 GLY n 
1 301 HIS n 
1 302 PHE n 
1 303 ASP n 
1 304 VAL n 
1 305 GLU n 
1 306 ILE n 
1 307 ASP n 
1 308 VAL n 
1 309 LYS n 
1 310 TRP n 
1 311 LEU n 
1 312 ASN n 
1 313 GLU n 
1 314 ASN n 
1 315 ALA n 
1 316 VAL n 
1 317 GLU n 
1 318 LYS n 
1 319 VAL n 
1 320 ASN n 
1 321 ILE n 
1 322 LYS n 
1 323 PRO n 
1 324 GLN n 
1 325 VAL n 
1 326 ASP n 
1 327 ARG n 
1 328 TYR n 
1 329 ARG n 
1 330 LEU n 
1 331 LYS n 
1 332 ASN n 
1 333 GLY n 
1 334 ARG n 
1 335 ARG n 
1 336 ILE n 
1 337 ILE n 
1 338 LEU n 
1 339 LEU n 
1 340 ALA n 
1 341 GLU n 
1 342 GLY n 
1 343 ARG n 
1 344 LEU n 
1 345 VAL n 
1 346 ASN n 
1 347 LEU n 
1 348 GLY n 
1 349 CYS n 
1 350 ALA n 
1 351 MSE n 
1 352 GLY n 
1 353 HIS n 
1 354 PRO n 
1 355 SER n 
1 356 PHE n 
1 357 VAL n 
1 358 MSE n 
1 359 SER n 
1 360 ASN n 
1 361 SER n 
1 362 PHE n 
1 363 THR n 
1 364 ASN n 
1 365 GLN n 
1 366 VAL n 
1 367 MSE n 
1 368 ALA n 
1 369 GLN n 
1 370 ILE n 
1 371 GLU n 
1 372 LEU n 
1 373 TRP n 
1 374 THR n 
1 375 HIS n 
1 376 PRO n 
1 377 ASP n 
1 378 LYS n 
1 379 TYR n 
1 380 PRO n 
1 381 VAL n 
1 382 GLY n 
1 383 VAL n 
1 384 HIS n 
1 385 PHE n 
1 386 LEU n 
1 387 PRO n 
1 388 LYS n 
1 389 LYS n 
1 390 LEU n 
1 391 ASP n 
1 392 GLU n 
1 393 ALA n 
1 394 VAL n 
1 395 ALA n 
1 396 GLU n 
1 397 ALA n 
1 398 HIS n 
1 399 LEU n 
1 400 GLY n 
1 401 LYS n 
1 402 LEU n 
1 403 ASN n 
1 404 VAL n 
1 405 LYS n 
1 406 LEU n 
1 407 THR n 
1 408 LYS n 
1 409 LEU n 
1 410 THR n 
1 411 GLU n 
1 412 LYS n 
1 413 GLN n 
1 414 ALA n 
1 415 GLN n 
1 416 TYR n 
1 417 LEU n 
1 418 GLY n 
1 419 MSE n 
1 420 SER n 
1 421 CYS n 
1 422 ASP n 
1 423 GLY n 
1 424 PRO n 
1 425 PHE n 
1 426 LYS n 
1 427 PRO n 
1 428 ASP n 
1 429 HIS n 
1 430 TYR n 
1 431 ARG n 
1 432 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    PLACENTA 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               B834 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    CYTOPLASM 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAHH_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P23526 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN
IFSTQNHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTG
VHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1A7A A 2 ? 432 ? P23526 2 ? 432 ? 2 432 
2 1 1A7A B 2 ? 432 ? P23526 2 ? 432 ? 2 432 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1A7A MSE A 29  ? UNP P23526 MET 29  ENGINEERED 29  1  
1 1A7A MSE A 33  ? UNP P23526 MET 33  ENGINEERED 33  2  
1 1A7A MSE A 35  ? UNP P23526 MET 35  ENGINEERED 35  3  
1 1A7A MSE A 56  ? UNP P23526 MET 56  ENGINEERED 56  4  
1 1A7A MSE A 127 ? UNP P23526 MET 127 ENGINEERED 127 5  
1 1A7A MSE A 167 ? UNP P23526 MET 167 ENGINEERED 167 6  
1 1A7A MSE A 168 ? UNP P23526 MET 168 ENGINEERED 168 7  
1 1A7A MSE A 210 ? UNP P23526 MET 210 ENGINEERED 210 8  
1 1A7A MSE A 254 ? UNP P23526 MET 254 ENGINEERED 254 9  
1 1A7A MSE A 262 ? UNP P23526 MET 262 ENGINEERED 262 10 
1 1A7A MSE A 290 ? UNP P23526 MET 290 ENGINEERED 290 11 
1 1A7A MSE A 351 ? UNP P23526 MET 351 ENGINEERED 351 12 
1 1A7A MSE A 358 ? UNP P23526 MET 358 ENGINEERED 358 13 
1 1A7A MSE A 367 ? UNP P23526 MET 367 ENGINEERED 367 14 
1 1A7A MSE A 419 ? UNP P23526 MET 419 ENGINEERED 419 15 
2 1A7A MSE B 29  ? UNP P23526 MET 29  ENGINEERED 29  16 
2 1A7A MSE B 33  ? UNP P23526 MET 33  ENGINEERED 33  17 
2 1A7A MSE B 35  ? UNP P23526 MET 35  ENGINEERED 35  18 
2 1A7A MSE B 56  ? UNP P23526 MET 56  ENGINEERED 56  19 
2 1A7A MSE B 127 ? UNP P23526 MET 127 ENGINEERED 127 20 
2 1A7A MSE B 167 ? UNP P23526 MET 167 ENGINEERED 167 21 
2 1A7A MSE B 168 ? UNP P23526 MET 168 ENGINEERED 168 22 
2 1A7A MSE B 210 ? UNP P23526 MET 210 ENGINEERED 210 23 
2 1A7A MSE B 254 ? UNP P23526 MET 254 ENGINEERED 254 24 
2 1A7A MSE B 262 ? UNP P23526 MET 262 ENGINEERED 262 25 
2 1A7A MSE B 290 ? UNP P23526 MET 290 ENGINEERED 290 26 
2 1A7A MSE B 351 ? UNP P23526 MET 351 ENGINEERED 351 27 
2 1A7A MSE B 358 ? UNP P23526 MET 358 ENGINEERED 358 28 
2 1A7A MSE B 367 ? UNP P23526 MET 367 ENGINEERED 367 29 
2 1A7A MSE B 419 ? UNP P23526 MET 419 ENGINEERED 419 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADC non-polymer         . "(1'R,2'S)-9-(2-HYDROXY-3'-KETO-CYCLOPENTEN-1-YL)ADENINE" ? 'C10 H11 N5 O2'     233.227 
ALA 'L-peptide linking' y ALANINE                                                   ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                  ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                           ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                  ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                 ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                           ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                   ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                 ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                     ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                   ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                    ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                ? 'C5 H11 N O2 S'     149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE                                          ? 'C5 H11 N O2 Se'    196.106 
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE                         ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                                             ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                   ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                    ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                 ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                  ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                    ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1A7A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.74 
_exptl_crystal.density_percent_sol   55.11 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   BRANDEIS 
_diffrn_detector.pdbx_collection_date   1997-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength             0.95 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A7A 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   50613 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.0740000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.5 
_reflns.B_iso_Wilson_estimate        28.0 
_reflns.pdbx_redundancy              6.9 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.9 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1A7A 
_refine.ls_number_reflns_obs                     49460 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           5838962.45 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    97.5 
_refine.ls_R_factor_obs                          0.2270000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2270000 
_refine.ls_R_factor_R_free                       0.2470000 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.7 
_refine.ls_number_reflns_R_free                  4804 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               21.8 
_refine.aniso_B[1][1]                            -21.44 
_refine.aniso_B[2][2]                            13.55 
_refine.aniso_B[3][3]                            7.89 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAS 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1A7A 
_refine_analyze.Luzzati_coordinate_error_obs    0.36 
_refine_analyze.Luzzati_sigma_a_obs             0.42 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.46 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6666 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         122 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               6834 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.7   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.13  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             0.89  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.50  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.31  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.99  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   RESTRAINTS 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        2.97 
_refine_ls_shell.number_reflns_R_work             7294 
_refine_ls_shell.R_factor_R_work                  0.3110000 
_refine_ls_shell.percent_reflns_obs               95.3 
_refine_ls_shell.R_factor_R_free                  0.3320000 
_refine_ls_shell.R_factor_R_free_error            0.012 
_refine_ls_shell.percent_reflns_R_free            9.3 
_refine_ls_shell.number_reflns_R_free             751 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN_REP.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WAT_REP.TOP     'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.972000 
_struct_ncs_oper.matrix[1][2]   -0.234000 
_struct_ncs_oper.matrix[1][3]   -0.005000 
_struct_ncs_oper.matrix[2][1]   -0.234000 
_struct_ncs_oper.matrix[2][2]   0.972000 
_struct_ncs_oper.matrix[2][3]   -0.009000 
_struct_ncs_oper.matrix[3][1]   0.007000 
_struct_ncs_oper.matrix[3][2]   -0.008000 
_struct_ncs_oper.matrix[3][3]   -1.000000 
_struct_ncs_oper.vector[1]      55.24100 
_struct_ncs_oper.vector[2]      6.82200 
_struct_ncs_oper.vector[3]      70.19300 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1A7A 
_struct.title                     
;STRUCTURE OF HUMAN PLACENTAL S-ADENOSYLHOMOCYSTEINE HYDROLASE: DETERMINATION OF A 30 SELENIUM ATOM SUBSTRUCTURE FROM DATA AT A SINGLE WAVELENGTH
;
_struct.pdbx_descriptor           
;S-ADENOSYLHOMOCYSTEINE HYDROLASE, NICOTINAMIDE-ADENINE-DINUCLEOTIDE, (1'R,2'S)-9-(2-HYDROXY-3'-KETO-CYCLOPENTEN-1-YL)ADENINE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A7A 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, NAD BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ILE A 12  ? ASN A 27  ? ILE A 12  ASN A 27  5 ? 16 
HELX_P HELX_P2  2  PRO A 30  ? TYR A 39  ? PRO A 30  TYR A 39  1 ? 10 
HELX_P HELX_P3  2  VAL A 58  ? THR A 69  ? VAL A 58  THR A 69  1 ? 12 
HELX_P HELX_P4  3  ASN A 86  ? LYS A 94  ? ASN A 86  LYS A 94  1 ? 9  
HELX_P HELX_P5  4  ASP A 107 ? LEU A 118 ? ASP A 107 LEU A 118 1 ? 12 
HELX_P HELX_P6  5  ASP A 134 ? LYS A 142 ? ASP A 134 LYS A 142 1 ? 9  
HELX_P HELX_P7  6  PRO A 144 ? LEU A 147 ? PRO A 144 LEU A 147 1 ? 4  
HELX_P HELX_P8  7  THR A 158 ? MSE A 168 ? THR A 158 MSE A 168 1 ? 11 
HELX_P HELX_P9  8  VAL A 184 ? SER A 187 ? VAL A 184 SER A 187 1 ? 4  
HELX_P HELX_P10 9  ASP A 190 ? THR A 207 ? ASP A 190 THR A 207 1 ? 18 
HELX_P HELX_P11 10 ASP A 223 ? PHE A 235 ? ASP A 223 PHE A 235 1 ? 13 
HELX_P HELX_P12 11 PRO A 246 ? MSE A 254 ? PRO A 246 MSE A 254 1 ? 9  
HELX_P HELX_P13 12 MSE A 262 ? ALA A 265 ? MSE A 262 ALA A 265 5 ? 4  
HELX_P HELX_P14 13 GLY A 284 ? PHE A 287 ? GLY A 284 PHE A 287 1 ? 4  
HELX_P HELX_P15 14 VAL A 308 ? ASN A 314 ? VAL A 308 ASN A 314 1 ? 7  
HELX_P HELX_P16 15 ALA A 340 ? GLY A 342 ? ALA A 340 GLY A 342 5 ? 3  
HELX_P HELX_P17 16 VAL A 345 ? CYS A 349 ? VAL A 345 CYS A 349 1 ? 5  
HELX_P HELX_P18 17 PHE A 356 ? THR A 374 ? PHE A 356 THR A 374 5 ? 19 
HELX_P HELX_P19 19 LYS A 388 ? HIS A 398 ? LYS A 388 HIS A 398 1 ? 11 
HELX_P HELX_P20 20 GLU A 411 ? TYR A 416 ? GLU A 411 TYR A 416 1 ? 6  
HELX_P HELX_P21 21 ILE B 12  ? ASN B 27  ? ILE B 12  ASN B 27  5 ? 16 
HELX_P HELX_P22 22 PRO B 30  ? TYR B 39  ? PRO B 30  TYR B 39  1 ? 10 
HELX_P HELX_P23 23 VAL B 58  ? THR B 69  ? VAL B 58  THR B 69  1 ? 12 
HELX_P HELX_P24 24 ASN B 86  ? LYS B 94  ? ASN B 86  LYS B 94  1 ? 9  
HELX_P HELX_P25 25 ASP B 107 ? LEU B 118 ? ASP B 107 LEU B 118 1 ? 12 
HELX_P HELX_P26 26 ASP B 134 ? LYS B 142 ? ASP B 134 LYS B 142 1 ? 9  
HELX_P HELX_P27 27 PRO B 144 ? LEU B 147 ? PRO B 144 LEU B 147 1 ? 4  
HELX_P HELX_P28 28 THR B 158 ? MSE B 168 ? THR B 158 MSE B 168 1 ? 11 
HELX_P HELX_P29 29 VAL B 184 ? SER B 187 ? VAL B 184 SER B 187 1 ? 4  
HELX_P HELX_P30 30 ASP B 190 ? THR B 207 ? ASP B 190 THR B 207 1 ? 18 
HELX_P HELX_P31 31 ASP B 223 ? PHE B 235 ? ASP B 223 PHE B 235 1 ? 13 
HELX_P HELX_P32 32 PRO B 246 ? MSE B 254 ? PRO B 246 MSE B 254 1 ? 9  
HELX_P HELX_P33 33 MSE B 262 ? ALA B 265 ? MSE B 262 ALA B 265 5 ? 4  
HELX_P HELX_P34 34 GLY B 284 ? PHE B 287 ? GLY B 284 PHE B 287 1 ? 4  
HELX_P HELX_P35 35 VAL B 308 ? ASN B 314 ? VAL B 308 ASN B 314 1 ? 7  
HELX_P HELX_P36 36 ALA B 340 ? GLY B 342 ? ALA B 340 GLY B 342 5 ? 3  
HELX_P HELX_P37 37 VAL B 345 ? CYS B 349 ? VAL B 345 CYS B 349 1 ? 5  
HELX_P HELX_P38 38 PHE B 356 ? THR B 374 ? PHE B 356 THR B 374 5 ? 19 
HELX_P HELX_P39 39 LYS B 388 ? HIS B 398 ? LYS B 388 HIS B 398 1 ? 11 
HELX_P HELX_P40 40 GLU B 411 ? TYR B 416 ? GLU B 411 TYR B 416 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A MSE 29  N ? ? ? 1_555 A GLU 28  C ? ? A MSE 29  A GLU 28  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale2  covale ? ? A MSE 29  C ? ? ? 1_555 A PRO 30  N ? ? A MSE 29  A PRO 30  1_555 ? ? ? ? ? ? ? 1.344 ? 
covale3  covale ? ? A MSE 33  N ? ? ? 1_555 A LEU 32  C ? ? A MSE 33  A LEU 32  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4  covale ? ? A MSE 33  C ? ? ? 1_555 A ARG 34  N ? ? A MSE 33  A ARG 34  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale5  covale ? ? A MSE 35  N ? ? ? 1_555 A ARG 34  C ? ? A MSE 35  A ARG 34  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6  covale ? ? A MSE 35  C ? ? ? 1_555 A ARG 36  N ? ? A MSE 35  A ARG 36  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale7  covale ? ? A MSE 56  N ? ? ? 1_555 A HIS 55  C ? ? A MSE 56  A HIS 55  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale8  covale ? ? A MSE 56  C ? ? ? 1_555 A THR 57  N ? ? A MSE 56  A THR 57  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale9  covale ? ? A MSE 127 N ? ? ? 1_555 A ASN 126 C ? ? A MSE 127 A ASN 126 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale10 covale ? ? A MSE 127 C ? ? ? 1_555 A ILE 128 N ? ? A MSE 127 A ILE 128 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale11 covale ? ? A MSE 167 N ? ? ? 1_555 A LYS 166 C ? ? A MSE 167 A LYS 166 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale12 covale ? ? A MSE 167 C ? ? ? 1_555 A MSE 168 N ? ? A MSE 167 A MSE 168 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale13 covale ? ? A MSE 168 C ? ? ? 1_555 A ALA 169 N ? ? A MSE 168 A ALA 169 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale14 covale ? ? A MSE 210 N ? ? ? 1_555 A VAL 209 C ? ? A MSE 210 A VAL 209 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale15 covale ? ? A MSE 210 C ? ? ? 1_555 A ILE 211 N ? ? A MSE 210 A ILE 211 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale16 covale ? ? A MSE 254 N ? ? ? 1_555 A ALA 253 C ? ? A MSE 254 A ALA 253 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale17 covale ? ? A MSE 254 C ? ? ? 1_555 A GLU 255 N ? ? A MSE 254 A GLU 255 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale18 covale ? ? A MSE 262 N ? ? ? 1_555 A THR 261 C ? ? A MSE 262 A THR 261 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale19 covale ? ? A MSE 262 C ? ? ? 1_555 A ASP 263 N ? ? A MSE 262 A ASP 263 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale20 covale ? ? A MSE 290 N ? ? ? 1_555 A GLN 289 C ? ? A MSE 290 A GLN 289 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale21 covale ? ? A MSE 290 C ? ? ? 1_555 A LYS 291 N ? ? A MSE 290 A LYS 291 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale22 covale ? ? A MSE 351 N ? ? ? 1_555 A ALA 350 C ? ? A MSE 351 A ALA 350 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale23 covale ? ? A MSE 351 C ? ? ? 1_555 A GLY 352 N ? ? A MSE 351 A GLY 352 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale24 covale ? ? A MSE 358 N ? ? ? 1_555 A VAL 357 C ? ? A MSE 358 A VAL 357 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale25 covale ? ? A MSE 358 C ? ? ? 1_555 A SER 359 N ? ? A MSE 358 A SER 359 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale26 covale ? ? A MSE 367 N ? ? ? 1_555 A VAL 366 C ? ? A MSE 367 A VAL 366 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale27 covale ? ? A MSE 367 C ? ? ? 1_555 A ALA 368 N ? ? A MSE 367 A ALA 368 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale28 covale ? ? A MSE 419 N ? ? ? 1_555 A GLY 418 C ? ? A MSE 419 A GLY 418 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale29 covale ? ? A MSE 419 C ? ? ? 1_555 A SER 420 N ? ? A MSE 419 A SER 420 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale30 covale ? ? B MSE 29  N ? ? ? 1_555 B GLU 28  C ? ? B MSE 29  B GLU 28  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale31 covale ? ? B MSE 29  C ? ? ? 1_555 B PRO 30  N ? ? B MSE 29  B PRO 30  1_555 ? ? ? ? ? ? ? 1.339 ? 
covale32 covale ? ? B MSE 33  N ? ? ? 1_555 B LEU 32  C ? ? B MSE 33  B LEU 32  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale33 covale ? ? B MSE 33  C ? ? ? 1_555 B ARG 34  N ? ? B MSE 33  B ARG 34  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale34 covale ? ? B MSE 35  N ? ? ? 1_555 B ARG 34  C ? ? B MSE 35  B ARG 34  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale35 covale ? ? B MSE 35  C ? ? ? 1_555 B ARG 36  N ? ? B MSE 35  B ARG 36  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale36 covale ? ? B MSE 56  N ? ? ? 1_555 B HIS 55  C ? ? B MSE 56  B HIS 55  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale37 covale ? ? B MSE 56  C ? ? ? 1_555 B THR 57  N ? ? B MSE 56  B THR 57  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale38 covale ? ? B MSE 127 N ? ? ? 1_555 B ASN 126 C ? ? B MSE 127 B ASN 126 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale39 covale ? ? B MSE 127 C ? ? ? 1_555 B ILE 128 N ? ? B MSE 127 B ILE 128 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale40 covale ? ? B MSE 167 N ? ? ? 1_555 B LYS 166 C ? ? B MSE 167 B LYS 166 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale41 covale ? ? B MSE 167 C ? ? ? 1_555 B MSE 168 N ? ? B MSE 167 B MSE 168 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale42 covale ? ? B MSE 168 C ? ? ? 1_555 B ALA 169 N ? ? B MSE 168 B ALA 169 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale43 covale ? ? B MSE 210 N ? ? ? 1_555 B VAL 209 C ? ? B MSE 210 B VAL 209 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale44 covale ? ? B MSE 210 C ? ? ? 1_555 B ILE 211 N ? ? B MSE 210 B ILE 211 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale45 covale ? ? B MSE 254 N ? ? ? 1_555 B ALA 253 C ? ? B MSE 254 B ALA 253 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale46 covale ? ? B MSE 254 C ? ? ? 1_555 B GLU 255 N ? ? B MSE 254 B GLU 255 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale47 covale ? ? B MSE 262 N ? ? ? 1_555 B THR 261 C ? ? B MSE 262 B THR 261 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale48 covale ? ? B MSE 262 C ? ? ? 1_555 B ASP 263 N ? ? B MSE 262 B ASP 263 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale49 covale ? ? B MSE 290 N ? ? ? 1_555 B GLN 289 C ? ? B MSE 290 B GLN 289 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale50 covale ? ? B MSE 290 C ? ? ? 1_555 B LYS 291 N ? ? B MSE 290 B LYS 291 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale51 covale ? ? B MSE 351 N ? ? ? 1_555 B ALA 350 C ? ? B MSE 351 B ALA 350 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale52 covale ? ? B MSE 351 C ? ? ? 1_555 B GLY 352 N ? ? B MSE 351 B GLY 352 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale53 covale ? ? B MSE 358 N ? ? ? 1_555 B VAL 357 C ? ? B MSE 358 B VAL 357 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale54 covale ? ? B MSE 358 C ? ? ? 1_555 B SER 359 N ? ? B MSE 358 B SER 359 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale55 covale ? ? B MSE 367 N ? ? ? 1_555 B VAL 366 C ? ? B MSE 367 B VAL 366 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale56 covale ? ? B MSE 367 C ? ? ? 1_555 B ALA 368 N ? ? B MSE 367 B ALA 368 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale57 covale ? ? B MSE 419 N ? ? ? 1_555 B GLY 418 C ? ? B MSE 419 B GLY 418 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale58 covale ? ? B MSE 419 C ? ? ? 1_555 B SER 420 N ? ? B MSE 419 B SER 420 1_555 ? ? ? ? ? ? ? 1.327 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 4 ? 
AC ? 8 ? 
BA ? 3 ? 
BB ? 4 ? 
BC ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? parallel      
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AC 4 5 ? parallel      
AC 5 6 ? parallel      
AC 6 7 ? anti-parallel 
AC 7 8 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? parallel      
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BB 3 4 ? parallel      
BC 1 2 ? parallel      
BC 2 3 ? parallel      
BC 3 4 ? parallel      
BC 4 5 ? parallel      
BC 5 6 ? parallel      
BC 6 7 ? anti-parallel 
BC 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 49  ? CYS A 53  ? ARG A 49  CYS A 53  
AA 2 GLU A 73  ? SER A 77  ? GLU A 73  SER A 77  
AA 3 PRO A 98  ? ALA A 101 ? PRO A 98  ALA A 101 
AB 1 MSE A 127 ? ASP A 130 ? MSE A 127 ASP A 130 
AB 2 GLY A 152 ? GLU A 155 ? GLY A 152 GLU A 155 
AB 3 ALA A 177 ? ASN A 179 ? ALA A 177 ASN A 179 
AB 4 VAL A 383 ? PHE A 385 ? VAL A 383 PHE A 385 
AC 1 GLU A 258 ? THR A 260 ? GLU A 258 THR A 260 
AC 2 ARG A 238 ? THR A 242 ? ARG A 238 THR A 242 
AC 3 VAL A 215 ? ALA A 219 ? VAL A 215 ALA A 219 
AC 4 ILE A 271 ? THR A 274 ? ILE A 271 THR A 274 
AC 5 ALA A 294 ? ASN A 298 ? ALA A 294 ASN A 298 
AC 6 ARG A 335 ? LEU A 339 ? ARG A 335 LEU A 339 
AC 7 VAL A 325 ? ARG A 329 ? VAL A 325 ARG A 329 
AC 8 ALA A 315 ? LYS A 322 ? ALA A 315 LYS A 322 
BA 1 ARG B 49  ? CYS B 53  ? ARG B 49  CYS B 53  
BA 2 GLU B 73  ? SER B 77  ? GLU B 73  SER B 77  
BA 3 PRO B 98  ? ALA B 101 ? PRO B 98  ALA B 101 
BB 1 MSE B 127 ? ASP B 130 ? MSE B 127 ASP B 130 
BB 2 GLY B 152 ? GLU B 155 ? GLY B 152 GLU B 155 
BB 3 ALA B 177 ? ASN B 179 ? ALA B 177 ASN B 179 
BB 4 VAL B 383 ? PHE B 385 ? VAL B 383 PHE B 385 
BC 1 GLU B 258 ? THR B 260 ? GLU B 258 THR B 260 
BC 2 ARG B 238 ? THR B 242 ? ARG B 238 THR B 242 
BC 3 VAL B 215 ? ALA B 219 ? VAL B 215 ALA B 219 
BC 4 ILE B 271 ? THR B 274 ? ILE B 271 THR B 274 
BC 5 ALA B 294 ? ASN B 298 ? ALA B 294 ASN B 298 
BC 6 ARG B 335 ? LEU B 339 ? ARG B 335 LEU B 339 
BC 7 VAL B 325 ? ARG B 329 ? VAL B 325 ARG B 329 
BC 8 ALA B 315 ? LYS B 322 ? ALA B 315 LYS B 322 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 O ILE A 50  ? O ILE A 50  N GLU A 73  ? N GLU A 73  
AA 2 3 O TRP A 76  ? O TRP A 76  N PRO A 98  ? N PRO A 98  
AB 1 2 O ILE A 128 ? O ILE A 128 N SER A 154 ? N SER A 154 
AB 2 3 O ILE A 153 ? O ILE A 153 N ILE A 178 ? N ILE A 178 
AB 3 4 N ASN A 179 ? N ASN A 179 O HIS A 384 ? O HIS A 384 
AC 1 2 O GLU A 258 ? O GLU A 258 N ILE A 241 ? N ILE A 241 
AC 2 3 O ARG A 238 ? O ARG A 238 N ALA A 216 ? N ALA A 216 
AC 3 4 O VAL A 217 ? O VAL A 217 N ILE A 271 ? N ILE A 271 
AC 4 5 O PHE A 272 ? O PHE A 272 N ILE A 295 ? N ILE A 295 
AC 5 6 O ALA A 294 ? O ALA A 294 N ILE A 337 ? N ILE A 337 
AC 6 7 O ILE A 336 ? O ILE A 336 N TYR A 328 ? N TYR A 328 
AC 7 8 O ARG A 327 ? O ARG A 327 N VAL A 319 ? N VAL A 319 
BA 1 2 O ILE B 50  ? O ILE B 50  N GLU B 73  ? N GLU B 73  
BA 2 3 O TRP B 76  ? O TRP B 76  N PRO B 98  ? N PRO B 98  
BB 1 2 O ILE B 128 ? O ILE B 128 N SER B 154 ? N SER B 154 
BB 2 3 O ILE B 153 ? O ILE B 153 N ILE B 178 ? N ILE B 178 
BB 3 4 N ASN B 179 ? N ASN B 179 O HIS B 384 ? O HIS B 384 
BC 1 2 O GLU B 258 ? O GLU B 258 N ILE B 241 ? N ILE B 241 
BC 2 3 O ARG B 238 ? O ARG B 238 N ALA B 216 ? N ALA B 216 
BC 3 4 O VAL B 217 ? O VAL B 217 N ILE B 271 ? N ILE B 271 
BC 4 5 O PHE B 272 ? O PHE B 272 N ILE B 295 ? N ILE B 295 
BC 5 6 O ALA B 294 ? O ALA B 294 N ILE B 337 ? N ILE B 337 
BC 6 7 O ILE B 336 ? O ILE B 336 N TYR B 328 ? N TYR B 328 
BC 7 8 O ARG B 327 ? O ARG B 327 N VAL B 319 ? N VAL B 319 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 27 'BINDING SITE FOR RESIDUE NAD A 433' 
AC2 Software ? ? ? ? 26 'BINDING SITE FOR RESIDUE NAD B 434' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE ADC A 435' 
AC4 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE ADC B 436' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 27 THR A 157 ? THR A 157 . ? 1_555 ? 
2  AC1 27 THR A 158 ? THR A 158 . ? 1_555 ? 
3  AC1 27 THR A 159 ? THR A 159 . ? 1_555 ? 
4  AC1 27 ASP A 190 ? ASP A 190 . ? 1_555 ? 
5  AC1 27 ASN A 191 ? ASN A 191 . ? 1_555 ? 
6  AC1 27 GLY A 220 ? GLY A 220 . ? 1_555 ? 
7  AC1 27 GLY A 222 ? GLY A 222 . ? 1_555 ? 
8  AC1 27 ASP A 223 ? ASP A 223 . ? 1_555 ? 
9  AC1 27 VAL A 224 ? VAL A 224 . ? 1_555 ? 
10 AC1 27 GLU A 243 ? GLU A 243 . ? 1_555 ? 
11 AC1 27 ILE A 244 ? ILE A 244 . ? 1_555 ? 
12 AC1 27 ASP A 245 ? ASP A 245 . ? 1_555 ? 
13 AC1 27 ASN A 248 ? ASN A 248 . ? 1_555 ? 
14 AC1 27 THR A 275 ? THR A 275 . ? 1_555 ? 
15 AC1 27 THR A 276 ? THR A 276 . ? 1_555 ? 
16 AC1 27 CYS A 278 ? CYS A 278 . ? 1_555 ? 
17 AC1 27 ILE A 281 ? ILE A 281 . ? 1_555 ? 
18 AC1 27 ILE A 299 ? ILE A 299 . ? 1_555 ? 
19 AC1 27 GLY A 300 ? GLY A 300 . ? 1_555 ? 
20 AC1 27 HIS A 301 ? HIS A 301 . ? 1_555 ? 
21 AC1 27 ASN A 346 ? ASN A 346 . ? 1_555 ? 
22 AC1 27 HIS A 353 ? HIS A 353 . ? 1_555 ? 
23 AC1 27 ADC D .   ? ADC A 435 . ? 1_555 ? 
24 AC1 27 HOH G .   ? HOH A 459 . ? 1_555 ? 
25 AC1 27 GLN B 413 ? GLN B 413 . ? 1_555 ? 
26 AC1 27 LYS B 426 ? LYS B 426 . ? 1_555 ? 
27 AC1 27 TYR B 430 ? TYR B 430 . ? 1_555 ? 
28 AC2 26 GLN A 413 ? GLN A 413 . ? 1_555 ? 
29 AC2 26 LYS A 426 ? LYS A 426 . ? 1_555 ? 
30 AC2 26 TYR A 430 ? TYR A 430 . ? 1_555 ? 
31 AC2 26 THR B 157 ? THR B 157 . ? 1_555 ? 
32 AC2 26 THR B 158 ? THR B 158 . ? 1_555 ? 
33 AC2 26 THR B 159 ? THR B 159 . ? 1_555 ? 
34 AC2 26 ASN B 191 ? ASN B 191 . ? 1_555 ? 
35 AC2 26 GLY B 220 ? GLY B 220 . ? 1_555 ? 
36 AC2 26 GLY B 222 ? GLY B 222 . ? 1_555 ? 
37 AC2 26 ASP B 223 ? ASP B 223 . ? 1_555 ? 
38 AC2 26 VAL B 224 ? VAL B 224 . ? 1_555 ? 
39 AC2 26 GLU B 243 ? GLU B 243 . ? 1_555 ? 
40 AC2 26 ILE B 244 ? ILE B 244 . ? 1_555 ? 
41 AC2 26 ASP B 245 ? ASP B 245 . ? 1_555 ? 
42 AC2 26 ASN B 248 ? ASN B 248 . ? 1_555 ? 
43 AC2 26 THR B 275 ? THR B 275 . ? 1_555 ? 
44 AC2 26 THR B 276 ? THR B 276 . ? 1_555 ? 
45 AC2 26 CYS B 278 ? CYS B 278 . ? 1_555 ? 
46 AC2 26 ILE B 281 ? ILE B 281 . ? 1_555 ? 
47 AC2 26 ILE B 299 ? ILE B 299 . ? 1_555 ? 
48 AC2 26 GLY B 300 ? GLY B 300 . ? 1_555 ? 
49 AC2 26 HIS B 301 ? HIS B 301 . ? 1_555 ? 
50 AC2 26 ASN B 346 ? ASN B 346 . ? 1_555 ? 
51 AC2 26 HIS B 353 ? HIS B 353 . ? 1_555 ? 
52 AC2 26 ADC F .   ? ADC B 436 . ? 1_555 ? 
53 AC2 26 HOH H .   ? HOH B 440 . ? 1_555 ? 
54 AC3 15 LEU A 54  ? LEU A 54  . ? 1_555 ? 
55 AC3 15 HIS A 55  ? HIS A 55  . ? 1_555 ? 
56 AC3 15 THR A 57  ? THR A 57  . ? 1_555 ? 
57 AC3 15 GLU A 59  ? GLU A 59  . ? 1_555 ? 
58 AC3 15 THR A 60  ? THR A 60  . ? 1_555 ? 
59 AC3 15 GLU A 156 ? GLU A 156 . ? 1_555 ? 
60 AC3 15 THR A 157 ? THR A 157 . ? 1_555 ? 
61 AC3 15 LYS A 186 ? LYS A 186 . ? 1_555 ? 
62 AC3 15 ASP A 190 ? ASP A 190 . ? 1_555 ? 
63 AC3 15 LEU A 347 ? LEU A 347 . ? 1_555 ? 
64 AC3 15 MSE A 351 ? MSE A 351 . ? 1_555 ? 
65 AC3 15 HIS A 353 ? HIS A 353 . ? 1_555 ? 
66 AC3 15 MSE A 358 ? MSE A 358 . ? 1_555 ? 
67 AC3 15 NAD C .   ? NAD A 433 . ? 1_555 ? 
68 AC3 15 HOH G .   ? HOH A 436 . ? 1_555 ? 
69 AC4 13 HIS B 55  ? HIS B 55  . ? 1_555 ? 
70 AC4 13 THR B 57  ? THR B 57  . ? 1_555 ? 
71 AC4 13 GLU B 59  ? GLU B 59  . ? 1_555 ? 
72 AC4 13 THR B 60  ? THR B 60  . ? 1_555 ? 
73 AC4 13 GLU B 156 ? GLU B 156 . ? 1_555 ? 
74 AC4 13 THR B 157 ? THR B 157 . ? 1_555 ? 
75 AC4 13 LYS B 186 ? LYS B 186 . ? 1_555 ? 
76 AC4 13 ASP B 190 ? ASP B 190 . ? 1_555 ? 
77 AC4 13 MSE B 351 ? MSE B 351 . ? 1_555 ? 
78 AC4 13 HIS B 353 ? HIS B 353 . ? 1_555 ? 
79 AC4 13 MSE B 358 ? MSE B 358 . ? 1_555 ? 
80 AC4 13 NAD E .   ? NAD B 434 . ? 1_555 ? 
81 AC4 13 HOH H .   ? HOH B 454 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1A7A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A7A 
_atom_sites.fract_transf_matrix[1][1]   0.010878 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005952 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007258 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 2   ? 22.764  75.816 85.658  1.00 44.01 ? 2   SER A N     1 
ATOM   2    C  CA    . SER A 1 2   ? 22.658  74.966 84.431  1.00 43.09 ? 2   SER A CA    1 
ATOM   3    C  C     . SER A 1 2   ? 22.246  73.524 84.755  1.00 42.75 ? 2   SER A C     1 
ATOM   4    O  O     . SER A 1 2   ? 22.751  72.913 85.706  1.00 42.07 ? 2   SER A O     1 
ATOM   5    C  CB    . SER A 1 2   ? 23.996  74.962 83.676  1.00 43.92 ? 2   SER A CB    1 
ATOM   6    O  OG    . SER A 1 2   ? 23.957  74.088 82.558  1.00 42.98 ? 2   SER A OG    1 
ATOM   7    N  N     . ASP A 1 3   ? 21.312  72.997 83.967  1.00 41.38 ? 3   ASP A N     1 
ATOM   8    C  CA    . ASP A 1 3   ? 20.833  71.628 84.140  1.00 40.21 ? 3   ASP A CA    1 
ATOM   9    C  C     . ASP A 1 3   ? 21.187  70.873 82.876  1.00 37.51 ? 3   ASP A C     1 
ATOM   10   O  O     . ASP A 1 3   ? 21.564  69.702 82.913  1.00 37.74 ? 3   ASP A O     1 
ATOM   11   C  CB    . ASP A 1 3   ? 19.308  71.577 84.279  1.00 41.80 ? 3   ASP A CB    1 
ATOM   12   C  CG    . ASP A 1 3   ? 18.790  72.403 85.427  1.00 43.89 ? 3   ASP A CG    1 
ATOM   13   O  OD1   . ASP A 1 3   ? 19.613  73.005 86.155  1.00 44.02 ? 3   ASP A OD1   1 
ATOM   14   O  OD2   . ASP A 1 3   ? 17.548  72.445 85.594  1.00 44.48 ? 3   ASP A OD2   1 
ATOM   15   N  N     . LYS A 1 4   ? 21.053  71.578 81.758  1.00 34.32 ? 4   LYS A N     1 
ATOM   16   C  CA    . LYS A 1 4   ? 21.285  71.027 80.433  1.00 31.34 ? 4   LYS A CA    1 
ATOM   17   C  C     . LYS A 1 4   ? 22.335  69.930 80.402  1.00 29.73 ? 4   LYS A C     1 
ATOM   18   O  O     . LYS A 1 4   ? 23.511  70.170 80.674  1.00 29.86 ? 4   LYS A O     1 
ATOM   19   C  CB    . LYS A 1 4   ? 21.660  72.146 79.449  1.00 30.68 ? 4   LYS A CB    1 
ATOM   20   C  CG    . LYS A 1 4   ? 21.621  71.711 77.987  1.00 28.94 ? 4   LYS A CG    1 
ATOM   21   C  CD    . LYS A 1 4   ? 21.798  72.890 77.055  1.00 26.80 ? 4   LYS A CD    1 
ATOM   22   C  CE    . LYS A 1 4   ? 21.651  72.474 75.606  1.00 25.53 ? 4   LYS A CE    1 
ATOM   23   N  NZ    . LYS A 1 4   ? 21.824  73.644 74.702  1.00 24.69 ? 4   LYS A NZ    1 
ATOM   24   N  N     . LEU A 1 5   ? 21.884  68.722 80.075  1.00 27.76 ? 5   LEU A N     1 
ATOM   25   C  CA    . LEU A 1 5   ? 22.755  67.562 79.986  1.00 25.74 ? 5   LEU A CA    1 
ATOM   26   C  C     . LEU A 1 5   ? 23.788  67.839 78.897  1.00 25.33 ? 5   LEU A C     1 
ATOM   27   O  O     . LEU A 1 5   ? 23.462  68.409 77.855  1.00 24.79 ? 5   LEU A O     1 
ATOM   28   C  CB    . LEU A 1 5   ? 21.928  66.338 79.607  1.00 24.38 ? 5   LEU A CB    1 
ATOM   29   C  CG    . LEU A 1 5   ? 20.646  66.114 80.409  1.00 21.83 ? 5   LEU A CG    1 
ATOM   30   C  CD1   . LEU A 1 5   ? 19.931  64.873 79.897  1.00 20.87 ? 5   LEU A CD1   1 
ATOM   31   C  CD2   . LEU A 1 5   ? 20.988  65.960 81.873  1.00 21.32 ? 5   LEU A CD2   1 
ATOM   32   N  N     . PRO A 1 6   ? 25.053  67.452 79.127  1.00 24.68 ? 6   PRO A N     1 
ATOM   33   C  CA    . PRO A 1 6   ? 26.124  67.672 78.147  1.00 24.14 ? 6   PRO A CA    1 
ATOM   34   C  C     . PRO A 1 6   ? 25.908  66.822 76.897  1.00 24.05 ? 6   PRO A C     1 
ATOM   35   O  O     . PRO A 1 6   ? 26.653  66.925 75.922  1.00 23.55 ? 6   PRO A O     1 
ATOM   36   C  CB    . PRO A 1 6   ? 27.369  67.252 78.926  1.00 24.24 ? 6   PRO A CB    1 
ATOM   37   C  CG    . PRO A 1 6   ? 26.826  66.107 79.771  1.00 24.48 ? 6   PRO A CG    1 
ATOM   38   C  CD    . PRO A 1 6   ? 25.598  66.801 80.332  1.00 24.69 ? 6   PRO A CD    1 
ATOM   39   N  N     . TYR A 1 7   ? 24.871  65.989 76.947  1.00 24.30 ? 7   TYR A N     1 
ATOM   40   C  CA    . TYR A 1 7   ? 24.521  65.081 75.860  1.00 23.92 ? 7   TYR A CA    1 
ATOM   41   C  C     . TYR A 1 7   ? 23.591  64.017 76.438  1.00 24.22 ? 7   TYR A C     1 
ATOM   42   O  O     . TYR A 1 7   ? 23.290  64.037 77.630  1.00 24.37 ? 7   TYR A O     1 
ATOM   43   C  CB    . TYR A 1 7   ? 25.783  64.402 75.332  1.00 21.79 ? 7   TYR A CB    1 
ATOM   44   C  CG    . TYR A 1 7   ? 26.445  63.508 76.362  1.00 21.07 ? 7   TYR A CG    1 
ATOM   45   C  CD1   . TYR A 1 7   ? 25.893  62.268 76.708  1.00 19.95 ? 7   TYR A CD1   1 
ATOM   46   C  CD2   . TYR A 1 7   ? 27.614  63.908 77.009  1.00 20.20 ? 7   TYR A CD2   1 
ATOM   47   C  CE1   . TYR A 1 7   ? 26.490  61.454 77.670  1.00 19.51 ? 7   TYR A CE1   1 
ATOM   48   C  CE2   . TYR A 1 7   ? 28.218  63.101 77.971  1.00 18.57 ? 7   TYR A CE2   1 
ATOM   49   C  CZ    . TYR A 1 7   ? 27.652  61.879 78.295  1.00 19.24 ? 7   TYR A CZ    1 
ATOM   50   O  OH    . TYR A 1 7   ? 28.250  61.082 79.241  1.00 19.17 ? 7   TYR A OH    1 
ATOM   51   N  N     . LYS A 1 8   ? 23.153  63.083 75.597  1.00 24.92 ? 8   LYS A N     1 
ATOM   52   C  CA    . LYS A 1 8   ? 22.284  61.988 76.034  1.00 24.91 ? 8   LYS A CA    1 
ATOM   53   C  C     . LYS A 1 8   ? 22.302  60.851 75.017  1.00 25.09 ? 8   LYS A C     1 
ATOM   54   O  O     . LYS A 1 8   ? 21.806  61.005 73.901  1.00 26.61 ? 8   LYS A O     1 
ATOM   55   C  CB    . LYS A 1 8   ? 20.851  62.479 76.224  1.00 24.23 ? 8   LYS A CB    1 
ATOM   56   C  CG    . LYS A 1 8   ? 19.915  61.412 76.770  1.00 24.71 ? 8   LYS A CG    1 
ATOM   57   C  CD    . LYS A 1 8   ? 18.547  61.992 77.057  1.00 25.22 ? 8   LYS A CD    1 
ATOM   58   C  CE    . LYS A 1 8   ? 17.616  60.960 77.668  1.00 26.63 ? 8   LYS A CE    1 
ATOM   59   N  NZ    . LYS A 1 8   ? 16.238  61.516 77.881  1.00 27.38 ? 8   LYS A NZ    1 
ATOM   60   N  N     . VAL A 1 9   ? 22.881  59.717 75.394  1.00 24.47 ? 9   VAL A N     1 
ATOM   61   C  CA    . VAL A 1 9   ? 22.951  58.577 74.491  1.00 24.08 ? 9   VAL A CA    1 
ATOM   62   C  C     . VAL A 1 9   ? 22.512  57.304 75.215  1.00 25.17 ? 9   VAL A C     1 
ATOM   63   O  O     . VAL A 1 9   ? 22.364  57.292 76.440  1.00 24.77 ? 9   VAL A O     1 
ATOM   64   C  CB    . VAL A 1 9   ? 24.389  58.382 73.955  1.00 23.66 ? 9   VAL A CB    1 
ATOM   65   C  CG1   . VAL A 1 9   ? 24.894  59.682 73.356  1.00 23.39 ? 9   VAL A CG1   1 
ATOM   66   C  CG2   . VAL A 1 9   ? 25.311  57.915 75.067  1.00 22.75 ? 9   VAL A CG2   1 
ATOM   67   N  N     . ALA A 1 10  ? 22.303  56.231 74.458  1.00 25.59 ? 10  ALA A N     1 
ATOM   68   C  CA    . ALA A 1 10  ? 21.887  54.963 75.044  1.00 24.93 ? 10  ALA A CA    1 
ATOM   69   C  C     . ALA A 1 10  ? 22.890  54.432 76.074  1.00 25.35 ? 10  ALA A C     1 
ATOM   70   O  O     . ALA A 1 10  ? 22.492  54.072 77.178  1.00 25.78 ? 10  ALA A O     1 
ATOM   71   C  CB    . ALA A 1 10  ? 21.670  53.932 73.944  1.00 24.53 ? 10  ALA A CB    1 
ATOM   72   N  N     . ASP A 1 11  ? 24.178  54.386 75.718  1.00 25.43 ? 11  ASP A N     1 
ATOM   73   C  CA    . ASP A 1 11  ? 25.213  53.879 76.629  1.00 26.52 ? 11  ASP A CA    1 
ATOM   74   C  C     . ASP A 1 11  ? 26.623  54.357 76.277  1.00 26.13 ? 11  ASP A C     1 
ATOM   75   O  O     . ASP A 1 11  ? 27.262  53.831 75.361  1.00 26.84 ? 11  ASP A O     1 
ATOM   76   C  CB    . ASP A 1 11  ? 25.205  52.348 76.649  1.00 29.58 ? 11  ASP A CB    1 
ATOM   77   C  CG    . ASP A 1 11  ? 26.240  51.770 77.611  1.00 32.54 ? 11  ASP A CG    1 
ATOM   78   O  OD1   . ASP A 1 11  ? 26.147  52.056 78.824  1.00 34.70 ? 11  ASP A OD1   1 
ATOM   79   O  OD2   . ASP A 1 11  ? 27.147  51.029 77.164  1.00 34.86 ? 11  ASP A OD2   1 
ATOM   80   N  N     . ILE A 1 12  ? 27.113  55.337 77.028  1.00 25.24 ? 12  ILE A N     1 
ATOM   81   C  CA    . ILE A 1 12  ? 28.438  55.901 76.798  1.00 25.39 ? 12  ILE A CA    1 
ATOM   82   C  C     . ILE A 1 12  ? 29.503  54.800 76.761  1.00 25.82 ? 12  ILE A C     1 
ATOM   83   O  O     . ILE A 1 12  ? 30.573  54.983 76.178  1.00 26.31 ? 12  ILE A O     1 
ATOM   84   C  CB    . ILE A 1 12  ? 28.796  56.927 77.911  1.00 24.82 ? 12  ILE A CB    1 
ATOM   85   C  CG1   . ILE A 1 12  ? 30.028  57.750 77.528  1.00 24.50 ? 12  ILE A CG1   1 
ATOM   86   C  CG2   . ILE A 1 12  ? 29.076  56.200 79.198  1.00 22.91 ? 12  ILE A CG2   1 
ATOM   87   C  CD1   . ILE A 1 12  ? 29.814  58.695 76.363  1.00 25.14 ? 12  ILE A CD1   1 
ATOM   88   N  N     . GLY A 1 13  ? 29.202  53.659 77.375  1.00 25.87 ? 13  GLY A N     1 
ATOM   89   C  CA    . GLY A 1 13  ? 30.146  52.550 77.399  1.00 25.92 ? 13  GLY A CA    1 
ATOM   90   C  C     . GLY A 1 13  ? 30.589  52.049 76.032  1.00 26.59 ? 13  GLY A C     1 
ATOM   91   O  O     . GLY A 1 13  ? 31.697  51.520 75.869  1.00 26.68 ? 13  GLY A O     1 
ATOM   92   N  N     . LEU A 1 14  ? 29.719  52.212 75.041  1.00 26.78 ? 14  LEU A N     1 
ATOM   93   C  CA    . LEU A 1 14  ? 30.010  51.784 73.678  1.00 26.68 ? 14  LEU A CA    1 
ATOM   94   C  C     . LEU A 1 14  ? 31.084  52.649 73.016  1.00 26.56 ? 14  LEU A C     1 
ATOM   95   O  O     . LEU A 1 14  ? 31.539  52.342 71.919  1.00 28.26 ? 14  LEU A O     1 
ATOM   96   C  CB    . LEU A 1 14  ? 28.716  51.809 72.852  1.00 26.55 ? 14  LEU A CB    1 
ATOM   97   C  CG    . LEU A 1 14  ? 27.729  50.653 73.066  1.00 24.99 ? 14  LEU A CG    1 
ATOM   98   C  CD1   . LEU A 1 14  ? 27.707  50.233 74.502  1.00 24.15 ? 14  LEU A CD1   1 
ATOM   99   C  CD2   . LEU A 1 14  ? 26.345  51.070 72.589  1.00 23.50 ? 14  LEU A CD2   1 
ATOM   100  N  N     . ALA A 1 15  ? 31.493  53.720 73.687  1.00 25.46 ? 15  ALA A N     1 
ATOM   101  C  CA    . ALA A 1 15  ? 32.515  54.621 73.157  1.00 24.11 ? 15  ALA A CA    1 
ATOM   102  C  C     . ALA A 1 15  ? 33.683  53.877 72.519  1.00 23.42 ? 15  ALA A C     1 
ATOM   103  O  O     . ALA A 1 15  ? 34.074  54.178 71.394  1.00 23.61 ? 15  ALA A O     1 
ATOM   104  C  CB    . ALA A 1 15  ? 33.030  55.532 74.267  1.00 23.70 ? 15  ALA A CB    1 
ATOM   105  N  N     . ALA A 1 16  ? 34.244  52.911 73.239  1.00 22.99 ? 16  ALA A N     1 
ATOM   106  C  CA    . ALA A 1 16  ? 35.374  52.148 72.726  1.00 21.96 ? 16  ALA A CA    1 
ATOM   107  C  C     . ALA A 1 16  ? 35.066  51.611 71.330  1.00 22.06 ? 16  ALA A C     1 
ATOM   108  O  O     . ALA A 1 16  ? 35.719  51.980 70.348  1.00 21.62 ? 16  ALA A O     1 
ATOM   109  C  CB    . ALA A 1 16  ? 35.697  50.997 73.673  1.00 21.80 ? 16  ALA A CB    1 
ATOM   110  N  N     . TRP A 1 17  ? 34.064  50.741 71.251  1.00 22.39 ? 17  TRP A N     1 
ATOM   111  C  CA    . TRP A 1 17  ? 33.646  50.139 69.987  1.00 22.01 ? 17  TRP A CA    1 
ATOM   112  C  C     . TRP A 1 17  ? 33.271  51.214 68.967  1.00 20.96 ? 17  TRP A C     1 
ATOM   113  O  O     . TRP A 1 17  ? 33.377  51.015 67.754  1.00 19.65 ? 17  TRP A O     1 
ATOM   114  C  CB    . TRP A 1 17  ? 32.477  49.193 70.260  1.00 22.86 ? 17  TRP A CB    1 
ATOM   115  C  CG    . TRP A 1 17  ? 31.842  48.590 69.055  1.00 23.93 ? 17  TRP A CG    1 
ATOM   116  C  CD1   . TRP A 1 17  ? 32.469  48.138 67.931  1.00 24.70 ? 17  TRP A CD1   1 
ATOM   117  C  CD2   . TRP A 1 17  ? 30.457  48.255 68.906  1.00 24.46 ? 17  TRP A CD2   1 
ATOM   118  N  NE1   . TRP A 1 17  ? 31.560  47.536 67.091  1.00 24.96 ? 17  TRP A NE1   1 
ATOM   119  C  CE2   . TRP A 1 17  ? 30.317  47.591 67.667  1.00 24.96 ? 17  TRP A CE2   1 
ATOM   120  C  CE3   . TRP A 1 17  ? 29.320  48.444 69.704  1.00 24.48 ? 17  TRP A CE3   1 
ATOM   121  C  CZ2   . TRP A 1 17  ? 29.081  47.118 67.201  1.00 24.38 ? 17  TRP A CZ2   1 
ATOM   122  C  CZ3   . TRP A 1 17  ? 28.091  47.972 69.242  1.00 24.60 ? 17  TRP A CZ3   1 
ATOM   123  C  CH2   . TRP A 1 17  ? 27.985  47.314 68.001  1.00 23.72 ? 17  TRP A CH2   1 
ATOM   124  N  N     . GLY A 1 18  ? 32.832  52.359 69.479  1.00 21.12 ? 18  GLY A N     1 
ATOM   125  C  CA    . GLY A 1 18  ? 32.474  53.469 68.624  1.00 20.19 ? 18  GLY A CA    1 
ATOM   126  C  C     . GLY A 1 18  ? 33.710  53.809 67.819  1.00 20.60 ? 18  GLY A C     1 
ATOM   127  O  O     . GLY A 1 18  ? 33.675  53.749 66.591  1.00 21.87 ? 18  GLY A O     1 
ATOM   128  N  N     . ARG A 1 19  ? 34.808  54.151 68.495  1.00 19.40 ? 19  ARG A N     1 
ATOM   129  C  CA    . ARG A 1 19  ? 36.040  54.467 67.779  1.00 19.24 ? 19  ARG A CA    1 
ATOM   130  C  C     . ARG A 1 19  ? 36.407  53.391 66.770  1.00 18.94 ? 19  ARG A C     1 
ATOM   131  O  O     . ARG A 1 19  ? 36.703  53.699 65.619  1.00 18.85 ? 19  ARG A O     1 
ATOM   132  C  CB    . ARG A 1 19  ? 37.210  54.679 68.746  1.00 19.55 ? 19  ARG A CB    1 
ATOM   133  C  CG    . ARG A 1 19  ? 37.238  56.067 69.327  1.00 20.09 ? 19  ARG A CG    1 
ATOM   134  C  CD    . ARG A 1 19  ? 37.346  57.093 68.200  1.00 19.68 ? 19  ARG A CD    1 
ATOM   135  N  NE    . ARG A 1 19  ? 36.902  58.406 68.649  1.00 21.22 ? 19  ARG A NE    1 
ATOM   136  C  CZ    . ARG A 1 19  ? 36.713  59.447 67.848  1.00 20.98 ? 19  ARG A CZ    1 
ATOM   137  N  NH1   . ARG A 1 19  ? 36.930  59.328 66.545  1.00 20.83 ? 19  ARG A NH1   1 
ATOM   138  N  NH2   . ARG A 1 19  ? 36.295  60.606 68.353  1.00 22.11 ? 19  ARG A NH2   1 
ATOM   139  N  N     . LYS A 1 20  ? 36.383  52.132 67.203  1.00 18.77 ? 20  LYS A N     1 
ATOM   140  C  CA    . LYS A 1 20  ? 36.703  51.017 66.322  1.00 18.67 ? 20  LYS A CA    1 
ATOM   141  C  C     . LYS A 1 20  ? 36.056  51.287 64.965  1.00 18.24 ? 20  LYS A C     1 
ATOM   142  O  O     . LYS A 1 20  ? 36.746  51.395 63.947  1.00 18.87 ? 20  LYS A O     1 
ATOM   143  C  CB    . LYS A 1 20  ? 36.149  49.710 66.897  1.00 20.52 ? 20  LYS A CB    1 
ATOM   144  C  CG    . LYS A 1 20  ? 36.616  49.338 68.310  1.00 24.43 ? 20  LYS A CG    1 
ATOM   145  C  CD    . LYS A 1 20  ? 38.085  48.920 68.383  1.00 29.67 ? 20  LYS A CD    1 
ATOM   146  C  CE    . LYS A 1 20  ? 39.016  50.062 68.036  1.00 31.87 ? 20  LYS A CE    1 
ATOM   147  N  NZ    . LYS A 1 20  ? 40.455  49.690 68.130  1.00 34.03 ? 20  LYS A NZ    1 
ATOM   148  N  N     . ALA A 1 21  ? 34.728  51.419 64.969  1.00 17.61 ? 21  ALA A N     1 
ATOM   149  C  CA    . ALA A 1 21  ? 33.958  51.662 63.751  1.00 16.45 ? 21  ALA A CA    1 
ATOM   150  C  C     . ALA A 1 21  ? 34.349  52.960 63.027  1.00 15.95 ? 21  ALA A C     1 
ATOM   151  O  O     . ALA A 1 21  ? 34.631  52.934 61.828  1.00 14.52 ? 21  ALA A O     1 
ATOM   152  C  CB    . ALA A 1 21  ? 32.465  51.650 64.074  1.00 14.32 ? 21  ALA A CB    1 
ATOM   153  N  N     . LEU A 1 22  ? 34.374  54.086 63.738  1.00 16.27 ? 22  LEU A N     1 
ATOM   154  C  CA    . LEU A 1 22  ? 34.753  55.342 63.100  1.00 18.49 ? 22  LEU A CA    1 
ATOM   155  C  C     . LEU A 1 22  ? 36.115  55.130 62.436  1.00 19.92 ? 22  LEU A C     1 
ATOM   156  O  O     . LEU A 1 22  ? 36.286  55.381 61.242  1.00 20.84 ? 22  LEU A O     1 
ATOM   157  C  CB    . LEU A 1 22  ? 34.872  56.488 64.114  1.00 18.13 ? 22  LEU A CB    1 
ATOM   158  C  CG    . LEU A 1 22  ? 33.763  56.808 65.131  1.00 18.36 ? 22  LEU A CG    1 
ATOM   159  C  CD1   . LEU A 1 22  ? 33.961  58.247 65.582  1.00 15.54 ? 22  LEU A CD1   1 
ATOM   160  C  CD2   . LEU A 1 22  ? 32.381  56.668 64.525  1.00 17.76 ? 22  LEU A CD2   1 
ATOM   161  N  N     . ASP A 1 23  ? 37.074  54.652 63.225  1.00 21.11 ? 23  ASP A N     1 
ATOM   162  C  CA    . ASP A 1 23  ? 38.439  54.384 62.762  1.00 21.12 ? 23  ASP A CA    1 
ATOM   163  C  C     . ASP A 1 23  ? 38.465  53.697 61.410  1.00 20.36 ? 23  ASP A C     1 
ATOM   164  O  O     . ASP A 1 23  ? 39.240  54.071 60.526  1.00 20.81 ? 23  ASP A O     1 
ATOM   165  C  CB    . ASP A 1 23  ? 39.173  53.519 63.789  1.00 22.80 ? 23  ASP A CB    1 
ATOM   166  C  CG    . ASP A 1 23  ? 39.489  54.277 65.076  1.00 25.40 ? 23  ASP A CG    1 
ATOM   167  O  OD1   . ASP A 1 23  ? 39.581  55.529 65.034  1.00 25.02 ? 23  ASP A OD1   1 
ATOM   168  O  OD2   . ASP A 1 23  ? 39.667  53.617 66.129  1.00 27.02 ? 23  ASP A OD2   1 
ATOM   169  N  N     . ILE A 1 24  ? 37.617  52.693 61.243  1.00 19.17 ? 24  ILE A N     1 
ATOM   170  C  CA    . ILE A 1 24  ? 37.573  51.983 59.980  1.00 19.02 ? 24  ILE A CA    1 
ATOM   171  C  C     . ILE A 1 24  ? 36.818  52.773 58.912  1.00 19.24 ? 24  ILE A C     1 
ATOM   172  O  O     . ILE A 1 24  ? 37.230  52.801 57.744  1.00 20.17 ? 24  ILE A O     1 
ATOM   173  C  CB    . ILE A 1 24  ? 36.948  50.595 60.153  1.00 17.99 ? 24  ILE A CB    1 
ATOM   174  C  CG1   . ILE A 1 24  ? 37.872  49.733 61.013  1.00 18.88 ? 24  ILE A CG1   1 
ATOM   175  C  CG2   . ILE A 1 24  ? 36.751  49.948 58.813  1.00 19.29 ? 24  ILE A CG2   1 
ATOM   176  C  CD1   . ILE A 1 24  ? 37.341  48.364 61.334  1.00 17.82 ? 24  ILE A CD1   1 
ATOM   177  N  N     . ALA A 1 25  ? 35.734  53.433 59.310  1.00 17.74 ? 25  ALA A N     1 
ATOM   178  C  CA    . ALA A 1 25  ? 34.948  54.210 58.363  1.00 17.23 ? 25  ALA A CA    1 
ATOM   179  C  C     . ALA A 1 25  ? 35.759  55.349 57.770  1.00 17.10 ? 25  ALA A C     1 
ATOM   180  O  O     . ALA A 1 25  ? 35.565  55.729 56.612  1.00 17.95 ? 25  ALA A O     1 
ATOM   181  C  CB    . ALA A 1 25  ? 33.695  54.760 59.037  1.00 16.79 ? 25  ALA A CB    1 
ATOM   182  N  N     . GLU A 1 26  ? 36.679  55.894 58.553  1.00 17.80 ? 26  GLU A N     1 
ATOM   183  C  CA    . GLU A 1 26  ? 37.475  57.007 58.066  1.00 17.90 ? 26  GLU A CA    1 
ATOM   184  C  C     . GLU A 1 26  ? 38.342  56.571 56.900  1.00 18.07 ? 26  GLU A C     1 
ATOM   185  O  O     . GLU A 1 26  ? 38.601  57.362 55.987  1.00 18.96 ? 26  GLU A O     1 
ATOM   186  C  CB    . GLU A 1 26  ? 38.375  57.566 59.165  1.00 18.19 ? 26  GLU A CB    1 
ATOM   187  C  CG    . GLU A 1 26  ? 37.680  57.906 60.470  1.00 17.72 ? 26  GLU A CG    1 
ATOM   188  C  CD    . GLU A 1 26  ? 38.628  58.560 61.466  1.00 18.70 ? 26  GLU A CD    1 
ATOM   189  O  OE1   . GLU A 1 26  ? 39.814  58.146 61.525  1.00 20.61 ? 26  GLU A OE1   1 
ATOM   190  O  OE2   . GLU A 1 26  ? 38.187  59.473 62.202  1.00 17.06 ? 26  GLU A OE2   1 
ATOM   191  N  N     . ASN A 1 27  ? 38.788  55.318 56.923  1.00 17.16 ? 27  ASN A N     1 
ATOM   192  C  CA    . ASN A 1 27  ? 39.648  54.817 55.848  1.00 16.48 ? 27  ASN A CA    1 
ATOM   193  C  C     . ASN A 1 27  ? 38.840  54.487 54.581  1.00 15.74 ? 27  ASN A C     1 
ATOM   194  O  O     . ASN A 1 27  ? 39.385  54.087 53.550  1.00 14.70 ? 27  ASN A O     1 
ATOM   195  C  CB    . ASN A 1 27  ? 40.424  53.583 56.325  1.00 16.44 ? 27  ASN A CB    1 
ATOM   196  C  CG    . ASN A 1 27  ? 41.736  53.397 55.579  1.00 16.17 ? 27  ASN A CG    1 
ATOM   197  O  OD1   . ASN A 1 27  ? 42.401  52.379 55.727  1.00 15.52 ? 27  ASN A OD1   1 
ATOM   198  N  ND2   . ASN A 1 27  ? 42.121  54.393 54.787  1.00 17.14 ? 27  ASN A ND2   1 
ATOM   199  N  N     . GLU A 1 28  ? 37.527  54.658 54.675  1.00 16.43 ? 28  GLU A N     1 
ATOM   200  C  CA    . GLU A 1 28  ? 36.629  54.422 53.551  1.00 15.77 ? 28  GLU A CA    1 
ATOM   201  C  C     . GLU A 1 28  ? 36.086  55.744 53.036  1.00 15.99 ? 28  GLU A C     1 
ATOM   202  O  O     . GLU A 1 28  ? 35.401  55.775 52.008  1.00 17.12 ? 28  GLU A O     1 
ATOM   203  C  CB    . GLU A 1 28  ? 35.456  53.530 53.973  1.00 13.30 ? 28  GLU A CB    1 
ATOM   204  C  CG    . GLU A 1 28  ? 35.748  52.044 53.863  1.00 14.07 ? 28  GLU A CG    1 
ATOM   205  C  CD    . GLU A 1 28  ? 35.879  51.582 52.416  1.00 13.60 ? 28  GLU A CD    1 
ATOM   206  O  OE1   . GLU A 1 28  ? 34.853  51.560 51.694  1.00 12.03 ? 28  GLU A OE1   1 
ATOM   207  O  OE2   . GLU A 1 28  ? 37.017  51.258 52.001  1.00 15.21 ? 28  GLU A OE2   1 
HETATM 208  N  N     . MSE A 1 29  ? 36.401  56.830 53.744  1.00 15.54 ? 29  MSE A N     1 
HETATM 209  C  CA    . MSE A 1 29  ? 35.902  58.150 53.379  1.00 14.91 ? 29  MSE A CA    1 
HETATM 210  C  C     . MSE A 1 29  ? 37.006  59.130 53.024  1.00 14.90 ? 29  MSE A C     1 
HETATM 211  O  O     . MSE A 1 29  ? 37.188  60.146 53.691  1.00 13.37 ? 29  MSE A O     1 
HETATM 212  C  CB    . MSE A 1 29  ? 35.059  58.693 54.531  1.00 14.70 ? 29  MSE A CB    1 
HETATM 213  C  CG    . MSE A 1 29  ? 33.953  57.724 54.940  1.00 14.63 ? 29  MSE A CG    1 
HETATM 214  SE SE    . MSE A 1 29  ? 33.032  58.279 56.469  1.00 14.20 ? 29  MSE A SE    1 
HETATM 215  C  CE    . MSE A 1 29  ? 31.916  56.837 56.501  1.00 16.30 ? 29  MSE A CE    1 
ATOM   216  N  N     . PRO A 1 30  ? 37.745  58.846 51.938  1.00 15.35 ? 30  PRO A N     1 
ATOM   217  C  CA    . PRO A 1 30  ? 38.845  59.703 51.478  1.00 15.30 ? 30  PRO A CA    1 
ATOM   218  C  C     . PRO A 1 30  ? 38.397  61.144 51.291  1.00 15.34 ? 30  PRO A C     1 
ATOM   219  O  O     . PRO A 1 30  ? 39.200  62.065 51.357  1.00 15.54 ? 30  PRO A O     1 
ATOM   220  C  CB    . PRO A 1 30  ? 39.254  59.043 50.160  1.00 14.74 ? 30  PRO A CB    1 
ATOM   221  C  CG    . PRO A 1 30  ? 37.955  58.363 49.716  1.00 15.10 ? 30  PRO A CG    1 
ATOM   222  C  CD    . PRO A 1 30  ? 37.580  57.712 51.016  1.00 14.16 ? 30  PRO A CD    1 
ATOM   223  N  N     . GLY A 1 31  ? 37.105  61.328 51.057  1.00 16.14 ? 31  GLY A N     1 
ATOM   224  C  CA    . GLY A 1 31  ? 36.573  62.660 50.864  1.00 17.19 ? 31  GLY A CA    1 
ATOM   225  C  C     . GLY A 1 31  ? 36.719  63.498 52.114  1.00 18.82 ? 31  GLY A C     1 
ATOM   226  O  O     . GLY A 1 31  ? 37.534  64.416 52.147  1.00 19.06 ? 31  GLY A O     1 
ATOM   227  N  N     . LEU A 1 32  ? 35.936  63.185 53.146  1.00 20.68 ? 32  LEU A N     1 
ATOM   228  C  CA    . LEU A 1 32  ? 35.990  63.931 54.403  1.00 21.05 ? 32  LEU A CA    1 
ATOM   229  C  C     . LEU A 1 32  ? 37.425  64.026 54.890  1.00 21.55 ? 32  LEU A C     1 
ATOM   230  O  O     . LEU A 1 32  ? 37.869  65.077 55.352  1.00 20.71 ? 32  LEU A O     1 
ATOM   231  C  CB    . LEU A 1 32  ? 35.154  63.246 55.485  1.00 20.21 ? 32  LEU A CB    1 
ATOM   232  C  CG    . LEU A 1 32  ? 33.671  63.053 55.201  1.00 21.09 ? 32  LEU A CG    1 
ATOM   233  C  CD1   . LEU A 1 32  ? 33.002  62.410 56.413  1.00 21.13 ? 32  LEU A CD1   1 
ATOM   234  C  CD2   . LEU A 1 32  ? 33.036  64.395 54.891  1.00 21.29 ? 32  LEU A CD2   1 
HETATM 235  N  N     . MSE A 1 33  ? 38.153  62.922 54.785  1.00 23.28 ? 33  MSE A N     1 
HETATM 236  C  CA    . MSE A 1 33  ? 39.530  62.916 55.238  1.00 24.82 ? 33  MSE A CA    1 
HETATM 237  C  C     . MSE A 1 33  ? 40.384  63.875 54.414  1.00 26.68 ? 33  MSE A C     1 
HETATM 238  O  O     . MSE A 1 33  ? 41.353  64.441 54.926  1.00 25.30 ? 33  MSE A O     1 
HETATM 239  C  CB    . MSE A 1 33  ? 40.089  61.489 55.221  1.00 24.29 ? 33  MSE A CB    1 
HETATM 240  C  CG    . MSE A 1 33  ? 40.492  61.013 56.609  1.00 24.08 ? 33  MSE A CG    1 
HETATM 241  SE SE    . MSE A 1 33  ? 39.048  61.112 57.789  1.00 26.56 ? 33  MSE A SE    1 
HETATM 242  C  CE    . MSE A 1 33  ? 39.903  60.522 59.294  1.00 23.53 ? 33  MSE A CE    1 
ATOM   243  N  N     . ARG A 1 34  ? 40.019  64.076 53.149  1.00 28.84 ? 34  ARG A N     1 
ATOM   244  C  CA    . ARG A 1 34  ? 40.761  65.007 52.305  1.00 30.87 ? 34  ARG A CA    1 
ATOM   245  C  C     . ARG A 1 34  ? 40.464  66.427 52.774  1.00 29.99 ? 34  ARG A C     1 
ATOM   246  O  O     . ARG A 1 34  ? 41.357  67.279 52.838  1.00 30.41 ? 34  ARG A O     1 
ATOM   247  C  CB    . ARG A 1 34  ? 40.364  64.853 50.830  1.00 34.29 ? 34  ARG A CB    1 
ATOM   248  C  CG    . ARG A 1 34  ? 41.443  64.186 49.973  1.00 39.30 ? 34  ARG A CG    1 
ATOM   249  C  CD    . ARG A 1 34  ? 42.731  65.006 50.013  1.00 43.62 ? 34  ARG A CD    1 
ATOM   250  N  NE    . ARG A 1 34  ? 42.592  66.314 49.370  1.00 47.47 ? 34  ARG A NE    1 
ATOM   251  C  CZ    . ARG A 1 34  ? 43.491  67.298 49.454  1.00 49.71 ? 34  ARG A CZ    1 
ATOM   252  N  NH1   . ARG A 1 34  ? 44.605  67.134 50.162  1.00 49.77 ? 34  ARG A NH1   1 
ATOM   253  N  NH2   . ARG A 1 34  ? 43.287  68.446 48.811  1.00 50.27 ? 34  ARG A NH2   1 
HETATM 254  N  N     . MSE A 1 35  ? 39.201  66.665 53.117  1.00 28.33 ? 35  MSE A N     1 
HETATM 255  C  CA    . MSE A 1 35  ? 38.756  67.968 53.586  1.00 25.95 ? 35  MSE A CA    1 
HETATM 256  C  C     . MSE A 1 35  ? 39.503  68.325 54.876  1.00 25.52 ? 35  MSE A C     1 
HETATM 257  O  O     . MSE A 1 35  ? 39.952  69.454 55.040  1.00 26.08 ? 35  MSE A O     1 
HETATM 258  C  CB    . MSE A 1 35  ? 37.242  67.931 53.832  1.00 24.38 ? 35  MSE A CB    1 
HETATM 259  C  CG    . MSE A 1 35  ? 36.496  69.169 53.377  1.00 23.21 ? 35  MSE A CG    1 
HETATM 260  SE SE    . MSE A 1 35  ? 36.583  69.364 51.519  1.00 21.15 ? 35  MSE A SE    1 
HETATM 261  C  CE    . MSE A 1 35  ? 35.615  70.914 51.433  1.00 20.66 ? 35  MSE A CE    1 
ATOM   262  N  N     . ARG A 1 36  ? 39.646  67.359 55.782  1.00 24.87 ? 36  ARG A N     1 
ATOM   263  C  CA    . ARG A 1 36  ? 40.342  67.592 57.043  1.00 24.71 ? 36  ARG A CA    1 
ATOM   264  C  C     . ARG A 1 36  ? 41.798  68.023 56.891  1.00 26.54 ? 36  ARG A C     1 
ATOM   265  O  O     . ARG A 1 36  ? 42.228  68.986 57.516  1.00 27.09 ? 36  ARG A O     1 
ATOM   266  C  CB    . ARG A 1 36  ? 40.333  66.342 57.916  1.00 22.52 ? 36  ARG A CB    1 
ATOM   267  C  CG    . ARG A 1 36  ? 38.996  65.912 58.439  1.00 19.81 ? 36  ARG A CG    1 
ATOM   268  C  CD    . ARG A 1 36  ? 39.183  64.771 59.424  1.00 17.40 ? 36  ARG A CD    1 
ATOM   269  N  NE    . ARG A 1 36  ? 37.910  64.285 59.944  1.00 16.68 ? 36  ARG A NE    1 
ATOM   270  C  CZ    . ARG A 1 36  ? 37.794  63.333 60.864  1.00 15.83 ? 36  ARG A CZ    1 
ATOM   271  N  NH1   . ARG A 1 36  ? 38.881  62.756 61.373  1.00 16.02 ? 36  ARG A NH1   1 
ATOM   272  N  NH2   . ARG A 1 36  ? 36.592  62.952 61.271  1.00 13.59 ? 36  ARG A NH2   1 
ATOM   273  N  N     . GLU A 1 37  ? 42.567  67.300 56.085  1.00 27.84 ? 37  GLU A N     1 
ATOM   274  C  CA    . GLU A 1 37  ? 43.970  67.641 55.916  1.00 29.65 ? 37  GLU A CA    1 
ATOM   275  C  C     . GLU A 1 37  ? 44.199  68.890 55.071  1.00 29.61 ? 37  GLU A C     1 
ATOM   276  O  O     . GLU A 1 37  ? 45.333  69.327 54.885  1.00 30.52 ? 37  GLU A O     1 
ATOM   277  C  CB    . GLU A 1 37  ? 44.739  66.452 55.330  1.00 32.46 ? 37  GLU A CB    1 
ATOM   278  C  CG    . GLU A 1 37  ? 44.158  65.883 54.050  1.00 37.64 ? 37  GLU A CG    1 
ATOM   279  C  CD    . GLU A 1 37  ? 45.008  64.757 53.481  1.00 39.35 ? 37  GLU A CD    1 
ATOM   280  O  OE1   . GLU A 1 37  ? 46.169  65.040 53.104  1.00 41.09 ? 37  GLU A OE1   1 
ATOM   281  O  OE2   . GLU A 1 37  ? 44.518  63.599 53.416  1.00 39.96 ? 37  GLU A OE2   1 
ATOM   282  N  N     . ARG A 1 38  ? 43.121  69.476 54.574  1.00 28.69 ? 38  ARG A N     1 
ATOM   283  C  CA    . ARG A 1 38  ? 43.235  70.676 53.764  1.00 27.78 ? 38  ARG A CA    1 
ATOM   284  C  C     . ARG A 1 38  ? 42.730  71.902 54.525  1.00 26.77 ? 38  ARG A C     1 
ATOM   285  O  O     . ARG A 1 38  ? 43.107  73.031 54.205  1.00 27.00 ? 38  ARG A O     1 
ATOM   286  C  CB    . ARG A 1 38  ? 42.454  70.492 52.464  1.00 29.41 ? 38  ARG A CB    1 
ATOM   287  C  CG    . ARG A 1 38  ? 42.363  71.721 51.571  1.00 32.75 ? 38  ARG A CG    1 
ATOM   288  C  CD    . ARG A 1 38  ? 41.444  71.428 50.383  1.00 36.38 ? 38  ARG A CD    1 
ATOM   289  N  NE    . ARG A 1 38  ? 41.120  72.613 49.591  1.00 39.16 ? 38  ARG A NE    1 
ATOM   290  C  CZ    . ARG A 1 38  ? 40.212  72.630 48.615  1.00 41.40 ? 38  ARG A CZ    1 
ATOM   291  N  NH1   . ARG A 1 38  ? 39.537  71.523 48.309  1.00 41.60 ? 38  ARG A NH1   1 
ATOM   292  N  NH2   . ARG A 1 38  ? 39.971  73.755 47.944  1.00 41.50 ? 38  ARG A NH2   1 
ATOM   293  N  N     . TYR A 1 39  ? 41.890  71.693 55.537  1.00 24.39 ? 39  TYR A N     1 
ATOM   294  C  CA    . TYR A 1 39  ? 41.368  72.826 56.290  1.00 23.24 ? 39  TYR A CA    1 
ATOM   295  C  C     . TYR A 1 39  ? 41.606  72.784 57.783  1.00 23.93 ? 39  TYR A C     1 
ATOM   296  O  O     . TYR A 1 39  ? 41.242  73.729 58.491  1.00 23.91 ? 39  TYR A O     1 
ATOM   297  C  CB    . TYR A 1 39  ? 39.870  73.003 56.058  1.00 21.66 ? 39  TYR A CB    1 
ATOM   298  C  CG    . TYR A 1 39  ? 39.510  73.306 54.637  1.00 20.54 ? 39  TYR A CG    1 
ATOM   299  C  CD1   . TYR A 1 39  ? 39.483  74.623 54.175  1.00 20.09 ? 39  TYR A CD1   1 
ATOM   300  C  CD2   . TYR A 1 39  ? 39.229  72.280 53.733  1.00 19.92 ? 39  TYR A CD2   1 
ATOM   301  C  CE1   . TYR A 1 39  ? 39.185  74.916 52.841  1.00 20.54 ? 39  TYR A CE1   1 
ATOM   302  C  CE2   . TYR A 1 39  ? 38.928  72.560 52.395  1.00 20.49 ? 39  TYR A CE2   1 
ATOM   303  C  CZ    . TYR A 1 39  ? 38.909  73.880 51.958  1.00 20.81 ? 39  TYR A CZ    1 
ATOM   304  O  OH    . TYR A 1 39  ? 38.626  74.166 50.643  1.00 21.44 ? 39  TYR A OH    1 
ATOM   305  N  N     . SER A 1 40  ? 42.202  71.702 58.272  1.00 23.49 ? 40  SER A N     1 
ATOM   306  C  CA    . SER A 1 40  ? 42.456  71.587 59.703  1.00 23.09 ? 40  SER A CA    1 
ATOM   307  C  C     . SER A 1 40  ? 43.237  72.787 60.215  1.00 23.04 ? 40  SER A C     1 
ATOM   308  O  O     . SER A 1 40  ? 43.019  73.247 61.336  1.00 22.39 ? 40  SER A O     1 
ATOM   309  C  CB    . SER A 1 40  ? 43.239  70.314 60.014  1.00 23.80 ? 40  SER A CB    1 
ATOM   310  O  OG    . SER A 1 40  ? 43.476  70.212 61.407  1.00 23.30 ? 40  SER A OG    1 
ATOM   311  N  N     . ALA A 1 41  ? 44.148  73.294 59.391  1.00 22.71 ? 41  ALA A N     1 
ATOM   312  C  CA    . ALA A 1 41  ? 44.955  74.435 59.788  1.00 22.80 ? 41  ALA A CA    1 
ATOM   313  C  C     . ALA A 1 41  ? 44.158  75.729 59.725  1.00 22.65 ? 41  ALA A C     1 
ATOM   314  O  O     . ALA A 1 41  ? 43.927  76.369 60.750  1.00 21.91 ? 41  ALA A O     1 
ATOM   315  C  CB    . ALA A 1 41  ? 46.189  74.536 58.903  1.00 22.78 ? 41  ALA A CB    1 
ATOM   316  N  N     . SER A 1 42  ? 43.729  76.102 58.522  1.00 23.38 ? 42  SER A N     1 
ATOM   317  C  CA    . SER A 1 42  ? 42.973  77.340 58.322  1.00 23.77 ? 42  SER A CA    1 
ATOM   318  C  C     . SER A 1 42  ? 41.731  77.500 59.202  1.00 23.38 ? 42  SER A C     1 
ATOM   319  O  O     . SER A 1 42  ? 41.310  78.623 59.460  1.00 24.60 ? 42  SER A O     1 
ATOM   320  C  CB    . SER A 1 42  ? 42.570  77.480 56.849  1.00 23.47 ? 42  SER A CB    1 
ATOM   321  O  OG    . SER A 1 42  ? 41.686  76.445 56.459  1.00 26.39 ? 42  SER A OG    1 
ATOM   322  N  N     . LYS A 1 43  ? 41.147  76.388 59.653  1.00 22.99 ? 43  LYS A N     1 
ATOM   323  C  CA    . LYS A 1 43  ? 39.953  76.419 60.512  1.00 20.88 ? 43  LYS A CA    1 
ATOM   324  C  C     . LYS A 1 43  ? 38.865  77.320 59.913  1.00 19.42 ? 43  LYS A C     1 
ATOM   325  O  O     . LYS A 1 43  ? 38.295  78.163 60.606  1.00 18.23 ? 43  LYS A O     1 
ATOM   326  C  CB    . LYS A 1 43  ? 40.323  76.943 61.909  1.00 20.46 ? 43  LYS A CB    1 
ATOM   327  C  CG    . LYS A 1 43  ? 41.375  76.137 62.685  1.00 20.66 ? 43  LYS A CG    1 
ATOM   328  C  CD    . LYS A 1 43  ? 40.877  74.759 63.117  1.00 21.31 ? 43  LYS A CD    1 
ATOM   329  C  CE    . LYS A 1 43  ? 41.922  74.025 63.969  1.00 21.47 ? 43  LYS A CE    1 
ATOM   330  N  NZ    . LYS A 1 43  ? 41.496  72.643 64.359  1.00 22.43 ? 43  LYS A NZ    1 
ATOM   331  N  N     . PRO A 1 44  ? 38.535  77.122 58.628  1.00 18.71 ? 44  PRO A N     1 
ATOM   332  C  CA    . PRO A 1 44  ? 37.524  77.916 57.921  1.00 19.03 ? 44  PRO A CA    1 
ATOM   333  C  C     . PRO A 1 44  ? 36.160  78.034 58.587  1.00 19.34 ? 44  PRO A C     1 
ATOM   334  O  O     . PRO A 1 44  ? 35.455  79.015 58.363  1.00 18.89 ? 44  PRO A O     1 
ATOM   335  C  CB    . PRO A 1 44  ? 37.450  77.229 56.557  1.00 18.56 ? 44  PRO A CB    1 
ATOM   336  C  CG    . PRO A 1 44  ? 37.801  75.794 56.902  1.00 19.18 ? 44  PRO A CG    1 
ATOM   337  C  CD    . PRO A 1 44  ? 39.039  76.069 57.736  1.00 18.86 ? 44  PRO A CD    1 
ATOM   338  N  N     . LEU A 1 45  ? 35.788  77.044 59.397  1.00 20.33 ? 45  LEU A N     1 
ATOM   339  C  CA    . LEU A 1 45  ? 34.496  77.069 60.089  1.00 21.12 ? 45  LEU A CA    1 
ATOM   340  C  C     . LEU A 1 45  ? 34.573  77.674 61.480  1.00 21.21 ? 45  LEU A C     1 
ATOM   341  O  O     . LEU A 1 45  ? 33.645  77.542 62.278  1.00 20.53 ? 45  LEU A O     1 
ATOM   342  C  CB    . LEU A 1 45  ? 33.905  75.663 60.203  1.00 21.90 ? 45  LEU A CB    1 
ATOM   343  C  CG    . LEU A 1 45  ? 33.546  74.954 58.900  1.00 21.77 ? 45  LEU A CG    1 
ATOM   344  C  CD1   . LEU A 1 45  ? 32.946  73.606 59.240  1.00 21.55 ? 45  LEU A CD1   1 
ATOM   345  C  CD2   . LEU A 1 45  ? 32.564  75.795 58.092  1.00 21.09 ? 45  LEU A CD2   1 
ATOM   346  N  N     . LYS A 1 46  ? 35.684  78.331 61.773  1.00 22.65 ? 46  LYS A N     1 
ATOM   347  C  CA    . LYS A 1 46  ? 35.853  78.964 63.069  1.00 24.03 ? 46  LYS A CA    1 
ATOM   348  C  C     . LYS A 1 46  ? 34.695  79.929 63.343  1.00 23.83 ? 46  LYS A C     1 
ATOM   349  O  O     . LYS A 1 46  ? 34.312  80.720 62.479  1.00 23.67 ? 46  LYS A O     1 
ATOM   350  C  CB    . LYS A 1 46  ? 37.196  79.703 63.105  1.00 25.55 ? 46  LYS A CB    1 
ATOM   351  C  CG    . LYS A 1 46  ? 37.476  80.485 64.382  1.00 27.08 ? 46  LYS A CG    1 
ATOM   352  C  CD    . LYS A 1 46  ? 38.928  80.960 64.406  1.00 28.44 ? 46  LYS A CD    1 
ATOM   353  C  CE    . LYS A 1 46  ? 39.177  81.948 65.530  1.00 28.89 ? 46  LYS A CE    1 
ATOM   354  N  NZ    . LYS A 1 46  ? 38.337  83.173 65.341  1.00 28.48 ? 46  LYS A NZ    1 
ATOM   355  N  N     . GLY A 1 47  ? 34.121  79.843 64.537  1.00 23.19 ? 47  GLY A N     1 
ATOM   356  C  CA    . GLY A 1 47  ? 33.036  80.741 64.885  1.00 22.57 ? 47  GLY A CA    1 
ATOM   357  C  C     . GLY A 1 47  ? 31.660  80.213 64.551  1.00 22.26 ? 47  GLY A C     1 
ATOM   358  O  O     . GLY A 1 47  ? 30.652  80.708 65.060  1.00 23.03 ? 47  GLY A O     1 
ATOM   359  N  N     . ALA A 1 48  ? 31.606  79.214 63.686  1.00 21.07 ? 48  ALA A N     1 
ATOM   360  C  CA    . ALA A 1 48  ? 30.330  78.637 63.312  1.00 20.50 ? 48  ALA A CA    1 
ATOM   361  C  C     . ALA A 1 48  ? 29.763  77.764 64.438  1.00 20.14 ? 48  ALA A C     1 
ATOM   362  O  O     . ALA A 1 48  ? 30.489  77.024 65.097  1.00 19.98 ? 48  ALA A O     1 
ATOM   363  C  CB    . ALA A 1 48  ? 30.493  77.819 62.041  1.00 20.45 ? 48  ALA A CB    1 
ATOM   364  N  N     . ARG A 1 49  ? 28.461  77.881 64.669  1.00 20.32 ? 49  ARG A N     1 
ATOM   365  C  CA    . ARG A 1 49  ? 27.780  77.084 65.684  1.00 20.52 ? 49  ARG A CA    1 
ATOM   366  C  C     . ARG A 1 49  ? 26.753  76.266 64.919  1.00 19.93 ? 49  ARG A C     1 
ATOM   367  O  O     . ARG A 1 49  ? 25.619  76.698 64.726  1.00 20.38 ? 49  ARG A O     1 
ATOM   368  C  CB    . ARG A 1 49  ? 27.094  77.976 66.724  1.00 20.25 ? 49  ARG A CB    1 
ATOM   369  C  CG    . ARG A 1 49  ? 28.061  78.644 67.687  1.00 21.00 ? 49  ARG A CG    1 
ATOM   370  C  CD    . ARG A 1 49  ? 27.321  79.390 68.803  1.00 20.71 ? 49  ARG A CD    1 
ATOM   371  N  NE    . ARG A 1 49  ? 26.624  80.572 68.315  1.00 19.09 ? 49  ARG A NE    1 
ATOM   372  C  CZ    . ARG A 1 49  ? 27.238  81.672 67.896  1.00 18.96 ? 49  ARG A CZ    1 
ATOM   373  N  NH1   . ARG A 1 49  ? 28.567  81.731 67.915  1.00 19.99 ? 49  ARG A NH1   1 
ATOM   374  N  NH2   . ARG A 1 49  ? 26.530  82.702 67.440  1.00 16.51 ? 49  ARG A NH2   1 
ATOM   375  N  N     . ILE A 1 50  ? 27.181  75.087 64.473  1.00 18.62 ? 50  ILE A N     1 
ATOM   376  C  CA    . ILE A 1 50  ? 26.358  74.184 63.677  1.00 16.62 ? 50  ILE A CA    1 
ATOM   377  C  C     . ILE A 1 50  ? 25.396  73.285 64.452  1.00 15.94 ? 50  ILE A C     1 
ATOM   378  O  O     . ILE A 1 50  ? 25.796  72.538 65.343  1.00 15.21 ? 50  ILE A O     1 
ATOM   379  C  CB    . ILE A 1 50  ? 27.252  73.270 62.805  1.00 15.64 ? 50  ILE A CB    1 
ATOM   380  C  CG1   . ILE A 1 50  ? 28.207  74.120 61.962  1.00 14.72 ? 50  ILE A CG1   1 
ATOM   381  C  CG2   . ILE A 1 50  ? 26.390  72.413 61.906  1.00 14.08 ? 50  ILE A CG2   1 
ATOM   382  C  CD1   . ILE A 1 50  ? 29.210  73.310 61.177  1.00 13.81 ? 50  ILE A CD1   1 
ATOM   383  N  N     . ALA A 1 51  ? 24.119  73.366 64.094  1.00 16.27 ? 51  ALA A N     1 
ATOM   384  C  CA    . ALA A 1 51  ? 23.093  72.535 64.708  1.00 16.02 ? 51  ALA A CA    1 
ATOM   385  C  C     . ALA A 1 51  ? 22.775  71.468 63.661  1.00 16.02 ? 51  ALA A C     1 
ATOM   386  O  O     . ALA A 1 51  ? 22.170  71.758 62.624  1.00 15.34 ? 51  ALA A O     1 
ATOM   387  C  CB    . ALA A 1 51  ? 21.852  73.362 65.018  1.00 15.75 ? 51  ALA A CB    1 
ATOM   388  N  N     . GLY A 1 52  ? 23.208  70.240 63.926  1.00 15.93 ? 52  GLY A N     1 
ATOM   389  C  CA    . GLY A 1 52  ? 22.979  69.163 62.986  1.00 14.85 ? 52  GLY A CA    1 
ATOM   390  C  C     . GLY A 1 52  ? 21.812  68.289 63.368  1.00 15.30 ? 52  GLY A C     1 
ATOM   391  O  O     . GLY A 1 52  ? 21.587  68.000 64.549  1.00 15.78 ? 52  GLY A O     1 
ATOM   392  N  N     . CYS A 1 53  ? 21.050  67.886 62.360  1.00 15.93 ? 53  CYS A N     1 
ATOM   393  C  CA    . CYS A 1 53  ? 19.908  67.010 62.568  1.00 16.73 ? 53  CYS A CA    1 
ATOM   394  C  C     . CYS A 1 53  ? 19.922  65.987 61.442  1.00 17.06 ? 53  CYS A C     1 
ATOM   395  O  O     . CYS A 1 53  ? 19.135  66.072 60.492  1.00 16.34 ? 53  CYS A O     1 
ATOM   396  C  CB    . CYS A 1 53  ? 18.607  67.796 62.533  1.00 16.95 ? 53  CYS A CB    1 
ATOM   397  S  SG    . CYS A 1 53  ? 17.189  66.744 62.904  1.00 19.38 ? 53  CYS A SG    1 
ATOM   398  N  N     . LEU A 1 54  ? 20.838  65.031 61.557  1.00 17.35 ? 54  LEU A N     1 
ATOM   399  C  CA    . LEU A 1 54  ? 21.013  63.998 60.555  1.00 17.10 ? 54  LEU A CA    1 
ATOM   400  C  C     . LEU A 1 54  ? 21.360  62.670 61.226  1.00 16.62 ? 54  LEU A C     1 
ATOM   401  O  O     . LEU A 1 54  ? 22.164  62.623 62.152  1.00 15.84 ? 54  LEU A O     1 
ATOM   402  C  CB    . LEU A 1 54  ? 22.122  64.446 59.599  1.00 17.76 ? 54  LEU A CB    1 
ATOM   403  C  CG    . LEU A 1 54  ? 22.606  63.595 58.424  1.00 19.24 ? 54  LEU A CG    1 
ATOM   404  C  CD1   . LEU A 1 54  ? 23.535  64.454 57.579  1.00 19.38 ? 54  LEU A CD1   1 
ATOM   405  C  CD2   . LEU A 1 54  ? 23.322  62.338 58.912  1.00 19.36 ? 54  LEU A CD2   1 
ATOM   406  N  N     . HIS A 1 55  ? 20.731  61.600 60.758  1.00 17.60 ? 55  HIS A N     1 
ATOM   407  C  CA    . HIS A 1 55  ? 20.958  60.250 61.280  1.00 18.59 ? 55  HIS A CA    1 
ATOM   408  C  C     . HIS A 1 55  ? 22.297  60.122 62.008  1.00 18.59 ? 55  HIS A C     1 
ATOM   409  O  O     . HIS A 1 55  ? 23.353  60.275 61.392  1.00 19.35 ? 55  HIS A O     1 
ATOM   410  C  CB    . HIS A 1 55  ? 20.935  59.254 60.122  1.00 19.37 ? 55  HIS A CB    1 
ATOM   411  C  CG    . HIS A 1 55  ? 19.692  59.322 59.293  1.00 20.58 ? 55  HIS A CG    1 
ATOM   412  N  ND1   . HIS A 1 55  ? 18.445  58.997 59.787  1.00 20.25 ? 55  HIS A ND1   1 
ATOM   413  C  CD2   . HIS A 1 55  ? 19.503  59.677 58.000  1.00 20.39 ? 55  HIS A CD2   1 
ATOM   414  C  CE1   . HIS A 1 55  ? 17.544  59.144 58.833  1.00 21.12 ? 55  HIS A CE1   1 
ATOM   415  N  NE2   . HIS A 1 55  ? 18.160  59.557 57.739  1.00 21.39 ? 55  HIS A NE2   1 
HETATM 416  N  N     . MSE A 1 56  ? 22.268  59.839 63.310  1.00 17.66 ? 56  MSE A N     1 
HETATM 417  C  CA    . MSE A 1 56  ? 23.516  59.701 64.063  1.00 16.51 ? 56  MSE A CA    1 
HETATM 418  C  C     . MSE A 1 56  ? 24.172  58.336 63.823  1.00 15.12 ? 56  MSE A C     1 
HETATM 419  O  O     . MSE A 1 56  ? 24.023  57.415 64.626  1.00 14.95 ? 56  MSE A O     1 
HETATM 420  C  CB    . MSE A 1 56  ? 23.274  59.895 65.566  1.00 16.80 ? 56  MSE A CB    1 
HETATM 421  C  CG    . MSE A 1 56  ? 24.581  59.861 66.344  1.00 19.34 ? 56  MSE A CG    1 
HETATM 422  SE SE    . MSE A 1 56  ? 25.630  61.331 65.885  1.00 17.74 ? 56  MSE A SE    1 
HETATM 423  C  CE    . MSE A 1 56  ? 27.072  60.905 66.934  1.00 23.72 ? 56  MSE A CE    1 
ATOM   424  N  N     . THR A 1 57  ? 24.901  58.208 62.723  1.00 14.35 ? 57  THR A N     1 
ATOM   425  C  CA    . THR A 1 57  ? 25.547  56.940 62.393  1.00 14.37 ? 57  THR A CA    1 
ATOM   426  C  C     . THR A 1 57  ? 27.063  57.075 62.354  1.00 13.55 ? 57  THR A C     1 
ATOM   427  O  O     . THR A 1 57  ? 27.603  58.186 62.359  1.00 14.69 ? 57  THR A O     1 
ATOM   428  C  CB    . THR A 1 57  ? 25.139  56.461 61.013  1.00 14.87 ? 57  THR A CB    1 
ATOM   429  O  OG1   . THR A 1 57  ? 25.713  57.347 60.039  1.00 15.92 ? 57  THR A OG1   1 
ATOM   430  C  CG2   . THR A 1 57  ? 23.617  56.459 60.868  1.00 14.47 ? 57  THR A CG2   1 
ATOM   431  N  N     . VAL A 1 58  ? 27.745  55.938 62.293  1.00 11.83 ? 58  VAL A N     1 
ATOM   432  C  CA    . VAL A 1 58  ? 29.195  55.939 62.230  1.00 10.74 ? 58  VAL A CA    1 
ATOM   433  C  C     . VAL A 1 58  ? 29.661  56.990 61.221  1.00 10.64 ? 58  VAL A C     1 
ATOM   434  O  O     . VAL A 1 58  ? 30.434  57.888 61.567  1.00 11.35 ? 58  VAL A O     1 
ATOM   435  C  CB    . VAL A 1 58  ? 29.730  54.551 61.816  1.00 10.44 ? 58  VAL A CB    1 
ATOM   436  C  CG1   . VAL A 1 58  ? 31.229  54.623 61.512  1.00 9.60  ? 58  VAL A CG1   1 
ATOM   437  C  CG2   . VAL A 1 58  ? 29.473  53.553 62.933  1.00 10.01 ? 58  VAL A CG2   1 
ATOM   438  N  N     . GLU A 1 59  ? 29.180  56.893 59.985  1.00 9.54  ? 59  GLU A N     1 
ATOM   439  C  CA    . GLU A 1 59  ? 29.570  57.855 58.959  1.00 9.31  ? 59  GLU A CA    1 
ATOM   440  C  C     . GLU A 1 59  ? 29.382  59.284 59.467  1.00 9.55  ? 59  GLU A C     1 
ATOM   441  O  O     . GLU A 1 59  ? 30.321  60.086 59.445  1.00 10.24 ? 59  GLU A O     1 
ATOM   442  C  CB    . GLU A 1 59  ? 28.744  57.660 57.693  1.00 8.89  ? 59  GLU A CB    1 
ATOM   443  C  CG    . GLU A 1 59  ? 28.893  56.296 57.020  1.00 11.34 ? 59  GLU A CG    1 
ATOM   444  C  CD    . GLU A 1 59  ? 28.510  55.116 57.908  1.00 12.87 ? 59  GLU A CD    1 
ATOM   445  O  OE1   . GLU A 1 59  ? 27.430  55.148 58.546  1.00 13.90 ? 59  GLU A OE1   1 
ATOM   446  O  OE2   . GLU A 1 59  ? 29.284  54.132 57.942  1.00 16.13 ? 59  GLU A OE2   1 
ATOM   447  N  N     . THR A 1 60  ? 28.175  59.595 59.935  1.00 8.80  ? 60  THR A N     1 
ATOM   448  C  CA    . THR A 1 60  ? 27.862  60.932 60.441  1.00 8.15  ? 60  THR A CA    1 
ATOM   449  C  C     . THR A 1 60  ? 28.900  61.391 61.467  1.00 8.50  ? 60  THR A C     1 
ATOM   450  O  O     . THR A 1 60  ? 29.279  62.572 61.503  1.00 6.95  ? 60  THR A O     1 
ATOM   451  C  CB    . THR A 1 60  ? 26.477  60.951 61.108  1.00 8.74  ? 60  THR A CB    1 
ATOM   452  O  OG1   . THR A 1 60  ? 25.514  60.420 60.194  1.00 11.59 ? 60  THR A OG1   1 
ATOM   453  C  CG2   . THR A 1 60  ? 26.066  62.371 61.472  1.00 6.67  ? 60  THR A CG2   1 
ATOM   454  N  N     . ALA A 1 61  ? 29.357  60.452 62.298  1.00 8.48  ? 61  ALA A N     1 
ATOM   455  C  CA    . ALA A 1 61  ? 30.355  60.761 63.317  1.00 8.87  ? 61  ALA A CA    1 
ATOM   456  C  C     . ALA A 1 61  ? 31.630  61.291 62.672  1.00 8.58  ? 61  ALA A C     1 
ATOM   457  O  O     . ALA A 1 61  ? 32.213  62.261 63.154  1.00 8.93  ? 61  ALA A O     1 
ATOM   458  C  CB    . ALA A 1 61  ? 30.663  59.525 64.144  1.00 9.23  ? 61  ALA A CB    1 
ATOM   459  N  N     . VAL A 1 62  ? 32.061  60.663 61.582  1.00 8.24  ? 62  VAL A N     1 
ATOM   460  C  CA    . VAL A 1 62  ? 33.265  61.113 60.902  1.00 9.13  ? 62  VAL A CA    1 
ATOM   461  C  C     . VAL A 1 62  ? 33.053  62.535 60.387  1.00 10.50 ? 62  VAL A C     1 
ATOM   462  O  O     . VAL A 1 62  ? 33.975  63.354 60.388  1.00 10.74 ? 62  VAL A O     1 
ATOM   463  C  CB    . VAL A 1 62  ? 33.614  60.198 59.732  1.00 7.57  ? 62  VAL A CB    1 
ATOM   464  C  CG1   . VAL A 1 62  ? 34.875  60.693 59.048  1.00 8.38  ? 62  VAL A CG1   1 
ATOM   465  C  CG2   . VAL A 1 62  ? 33.798  58.788 60.238  1.00 8.27  ? 62  VAL A CG2   1 
ATOM   466  N  N     . LEU A 1 63  ? 31.831  62.819 59.945  1.00 12.33 ? 63  LEU A N     1 
ATOM   467  C  CA    . LEU A 1 63  ? 31.479  64.147 59.449  1.00 12.87 ? 63  LEU A CA    1 
ATOM   468  C  C     . LEU A 1 63  ? 31.559  65.116 60.611  1.00 13.40 ? 63  LEU A C     1 
ATOM   469  O  O     . LEU A 1 63  ? 32.232  66.146 60.536  1.00 13.20 ? 63  LEU A O     1 
ATOM   470  C  CB    . LEU A 1 63  ? 30.046  64.156 58.902  1.00 13.45 ? 63  LEU A CB    1 
ATOM   471  C  CG    . LEU A 1 63  ? 29.494  65.535 58.523  1.00 12.39 ? 63  LEU A CG    1 
ATOM   472  C  CD1   . LEU A 1 63  ? 30.349  66.138 57.412  1.00 12.41 ? 63  LEU A CD1   1 
ATOM   473  C  CD2   . LEU A 1 63  ? 28.047  65.414 58.088  1.00 11.43 ? 63  LEU A CD2   1 
ATOM   474  N  N     . ILE A 1 64  ? 30.859  64.774 61.688  1.00 13.99 ? 64  ILE A N     1 
ATOM   475  C  CA    . ILE A 1 64  ? 30.835  65.608 62.872  1.00 15.70 ? 64  ILE A CA    1 
ATOM   476  C  C     . ILE A 1 64  ? 32.240  66.021 63.312  1.00 16.97 ? 64  ILE A C     1 
ATOM   477  O  O     . ILE A 1 64  ? 32.504  67.202 63.550  1.00 17.53 ? 64  ILE A O     1 
ATOM   478  C  CB    . ILE A 1 64  ? 30.131  64.890 64.015  1.00 16.04 ? 64  ILE A CB    1 
ATOM   479  C  CG1   . ILE A 1 64  ? 28.689  64.574 63.591  1.00 15.75 ? 64  ILE A CG1   1 
ATOM   480  C  CG2   . ILE A 1 64  ? 30.156  65.761 65.268  1.00 14.98 ? 64  ILE A CG2   1 
ATOM   481  C  CD1   . ILE A 1 64  ? 27.869  63.844 64.639  1.00 13.21 ? 64  ILE A CD1   1 
ATOM   482  N  N     . GLU A 1 65  ? 33.150  65.062 63.414  1.00 18.15 ? 65  GLU A N     1 
ATOM   483  C  CA    . GLU A 1 65  ? 34.511  65.396 63.814  1.00 18.84 ? 65  GLU A CA    1 
ATOM   484  C  C     . GLU A 1 65  ? 35.210  66.224 62.749  1.00 18.49 ? 65  GLU A C     1 
ATOM   485  O  O     . GLU A 1 65  ? 36.071  67.038 63.060  1.00 20.17 ? 65  GLU A O     1 
ATOM   486  C  CB    . GLU A 1 65  ? 35.322  64.136 64.108  1.00 19.65 ? 65  GLU A CB    1 
ATOM   487  C  CG    . GLU A 1 65  ? 34.970  63.466 65.426  1.00 21.41 ? 65  GLU A CG    1 
ATOM   488  C  CD    . GLU A 1 65  ? 35.736  62.180 65.623  1.00 23.90 ? 65  GLU A CD    1 
ATOM   489  O  OE1   . GLU A 1 65  ? 36.983  62.201 65.546  1.00 26.29 ? 65  GLU A OE1   1 
ATOM   490  O  OE2   . GLU A 1 65  ? 35.097  61.138 65.851  1.00 26.42 ? 65  GLU A OE2   1 
ATOM   491  N  N     . THR A 1 66  ? 34.849  66.027 61.492  1.00 17.98 ? 66  THR A N     1 
ATOM   492  C  CA    . THR A 1 66  ? 35.477  66.802 60.432  1.00 16.85 ? 66  THR A CA    1 
ATOM   493  C  C     . THR A 1 66  ? 35.103  68.264 60.607  1.00 17.18 ? 66  THR A C     1 
ATOM   494  O  O     . THR A 1 66  ? 35.949  69.152 60.503  1.00 17.76 ? 66  THR A O     1 
ATOM   495  C  CB    . THR A 1 66  ? 35.014  66.348 59.047  1.00 15.26 ? 66  THR A CB    1 
ATOM   496  O  OG1   . THR A 1 66  ? 35.388  64.979 58.851  1.00 15.26 ? 66  THR A OG1   1 
ATOM   497  C  CG2   . THR A 1 66  ? 35.635  67.221 57.971  1.00 13.55 ? 66  THR A CG2   1 
ATOM   498  N  N     . LEU A 1 67  ? 33.825  68.512 60.868  1.00 16.80 ? 67  LEU A N     1 
ATOM   499  C  CA    . LEU A 1 67  ? 33.375  69.880 61.057  1.00 17.48 ? 67  LEU A CA    1 
ATOM   500  C  C     . LEU A 1 67  ? 34.189  70.492 62.187  1.00 17.79 ? 67  LEU A C     1 
ATOM   501  O  O     . LEU A 1 67  ? 34.642  71.635 62.088  1.00 18.76 ? 67  LEU A O     1 
ATOM   502  C  CB    . LEU A 1 67  ? 31.881  69.913 61.397  1.00 16.60 ? 67  LEU A CB    1 
ATOM   503  C  CG    . LEU A 1 67  ? 30.937  69.458 60.284  1.00 16.07 ? 67  LEU A CG    1 
ATOM   504  C  CD1   . LEU A 1 67  ? 29.500  69.423 60.794  1.00 16.44 ? 67  LEU A CD1   1 
ATOM   505  C  CD2   . LEU A 1 67  ? 31.064  70.410 59.105  1.00 15.25 ? 67  LEU A CD2   1 
ATOM   506  N  N     . VAL A 1 68  ? 34.374  69.716 63.253  1.00 17.43 ? 68  VAL A N     1 
ATOM   507  C  CA    . VAL A 1 68  ? 35.132  70.159 64.415  1.00 17.09 ? 68  VAL A CA    1 
ATOM   508  C  C     . VAL A 1 68  ? 36.577  70.467 64.064  1.00 17.92 ? 68  VAL A C     1 
ATOM   509  O  O     . VAL A 1 68  ? 37.093  71.515 64.451  1.00 18.96 ? 68  VAL A O     1 
ATOM   510  C  CB    . VAL A 1 68  ? 35.111  69.103 65.530  1.00 16.61 ? 68  VAL A CB    1 
ATOM   511  C  CG1   . VAL A 1 68  ? 36.114  69.465 66.602  1.00 16.32 ? 68  VAL A CG1   1 
ATOM   512  C  CG2   . VAL A 1 68  ? 33.711  69.017 66.132  1.00 16.13 ? 68  VAL A CG2   1 
ATOM   513  N  N     . THR A 1 69  ? 37.232  69.558 63.345  1.00 17.70 ? 69  THR A N     1 
ATOM   514  C  CA    . THR A 1 69  ? 38.612  69.768 62.946  1.00 18.39 ? 69  THR A CA    1 
ATOM   515  C  C     . THR A 1 69  ? 38.743  71.078 62.171  1.00 18.51 ? 69  THR A C     1 
ATOM   516  O  O     . THR A 1 69  ? 39.806  71.711 62.174  1.00 19.05 ? 69  THR A O     1 
ATOM   517  C  CB    . THR A 1 69  ? 39.117  68.605 62.083  1.00 20.15 ? 69  THR A CB    1 
ATOM   518  O  OG1   . THR A 1 69  ? 39.155  67.414 62.880  1.00 21.36 ? 69  THR A OG1   1 
ATOM   519  C  CG2   . THR A 1 69  ? 40.526  68.895 61.551  1.00 21.56 ? 69  THR A CG2   1 
ATOM   520  N  N     . LEU A 1 70  ? 37.665  71.484 61.505  1.00 17.22 ? 70  LEU A N     1 
ATOM   521  C  CA    . LEU A 1 70  ? 37.670  72.733 60.762  1.00 17.33 ? 70  LEU A CA    1 
ATOM   522  C  C     . LEU A 1 70  ? 37.353  73.911 61.686  1.00 18.75 ? 70  LEU A C     1 
ATOM   523  O  O     . LEU A 1 70  ? 37.341  75.076 61.264  1.00 19.80 ? 70  LEU A O     1 
ATOM   524  C  CB    . LEU A 1 70  ? 36.689  72.663 59.590  1.00 16.15 ? 70  LEU A CB    1 
ATOM   525  C  CG    . LEU A 1 70  ? 37.264  71.982 58.336  1.00 15.81 ? 70  LEU A CG    1 
ATOM   526  C  CD1   . LEU A 1 70  ? 37.794  70.596 58.669  1.00 15.62 ? 70  LEU A CD1   1 
ATOM   527  C  CD2   . LEU A 1 70  ? 36.197  71.910 57.261  1.00 15.89 ? 70  LEU A CD2   1 
ATOM   528  N  N     . GLY A 1 71  ? 37.096  73.594 62.953  1.00 19.40 ? 71  GLY A N     1 
ATOM   529  C  CA    . GLY A 1 71  ? 36.835  74.611 63.957  1.00 19.51 ? 71  GLY A CA    1 
ATOM   530  C  C     . GLY A 1 71  ? 35.436  75.156 64.146  1.00 19.53 ? 71  GLY A C     1 
ATOM   531  O  O     . GLY A 1 71  ? 35.271  76.352 64.388  1.00 20.82 ? 71  GLY A O     1 
ATOM   532  N  N     . ALA A 1 72  ? 34.422  74.308 64.056  1.00 19.50 ? 72  ALA A N     1 
ATOM   533  C  CA    . ALA A 1 72  ? 33.055  74.784 64.239  1.00 18.01 ? 72  ALA A CA    1 
ATOM   534  C  C     . ALA A 1 72  ? 32.479  74.112 65.463  1.00 17.87 ? 72  ALA A C     1 
ATOM   535  O  O     . ALA A 1 72  ? 32.645  72.902 65.624  1.00 17.72 ? 72  ALA A O     1 
ATOM   536  C  CB    . ALA A 1 72  ? 32.215  74.443 63.023  1.00 17.65 ? 72  ALA A CB    1 
ATOM   537  N  N     . GLU A 1 73  ? 31.830  74.879 66.340  1.00 17.51 ? 73  GLU A N     1 
ATOM   538  C  CA    . GLU A 1 73  ? 31.218  74.271 67.515  1.00 17.28 ? 73  GLU A CA    1 
ATOM   539  C  C     . GLU A 1 73  ? 30.083  73.459 66.904  1.00 16.06 ? 73  GLU A C     1 
ATOM   540  O  O     . GLU A 1 73  ? 29.499  73.878 65.906  1.00 15.46 ? 73  GLU A O     1 
ATOM   541  C  CB    . GLU A 1 73  ? 30.647  75.321 68.471  1.00 18.94 ? 73  GLU A CB    1 
ATOM   542  C  CG    . GLU A 1 73  ? 31.624  76.397 68.896  1.00 23.55 ? 73  GLU A CG    1 
ATOM   543  C  CD    . GLU A 1 73  ? 31.184  77.124 70.162  1.00 26.13 ? 73  GLU A CD    1 
ATOM   544  O  OE1   . GLU A 1 73  ? 30.016  77.565 70.239  1.00 27.54 ? 73  GLU A OE1   1 
ATOM   545  O  OE2   . GLU A 1 73  ? 32.018  77.259 71.085  1.00 27.97 ? 73  GLU A OE2   1 
ATOM   546  N  N     . VAL A 1 74  ? 29.774  72.300 67.471  1.00 15.18 ? 74  VAL A N     1 
ATOM   547  C  CA    . VAL A 1 74  ? 28.710  71.477 66.910  1.00 15.15 ? 74  VAL A CA    1 
ATOM   548  C  C     . VAL A 1 74  ? 27.863  70.778 67.965  1.00 15.13 ? 74  VAL A C     1 
ATOM   549  O  O     . VAL A 1 74  ? 28.380  70.287 68.974  1.00 14.99 ? 74  VAL A O     1 
ATOM   550  C  CB    . VAL A 1 74  ? 29.284  70.384 65.967  1.00 15.74 ? 74  VAL A CB    1 
ATOM   551  C  CG1   . VAL A 1 74  ? 28.147  69.585 65.342  1.00 14.23 ? 74  VAL A CG1   1 
ATOM   552  C  CG2   . VAL A 1 74  ? 30.156  71.017 64.888  1.00 15.09 ? 74  VAL A CG2   1 
ATOM   553  N  N     . GLN A 1 75  ? 26.555  70.746 67.723  1.00 15.36 ? 75  GLN A N     1 
ATOM   554  C  CA    . GLN A 1 75  ? 25.612  70.083 68.620  1.00 15.27 ? 75  GLN A CA    1 
ATOM   555  C  C     . GLN A 1 75  ? 24.745  69.267 67.684  1.00 14.51 ? 75  GLN A C     1 
ATOM   556  O  O     . GLN A 1 75  ? 24.310  69.767 66.644  1.00 12.81 ? 75  GLN A O     1 
ATOM   557  C  CB    . GLN A 1 75  ? 24.835  71.114 69.444  1.00 15.95 ? 75  GLN A CB    1 
ATOM   558  C  CG    . GLN A 1 75  ? 25.787  71.916 70.329  1.00 17.59 ? 75  GLN A CG    1 
ATOM   559  C  CD    . GLN A 1 75  ? 25.104  72.648 71.456  1.00 19.30 ? 75  GLN A CD    1 
ATOM   560  O  OE1   . GLN A 1 75  ? 25.763  73.305 72.268  1.00 20.83 ? 75  GLN A OE1   1 
ATOM   561  N  NE2   . GLN A 1 75  ? 23.780  72.536 71.526  1.00 19.75 ? 75  GLN A NE2   1 
ATOM   562  N  N     . TRP A 1 76  ? 24.489  68.014 68.054  1.00 14.70 ? 76  TRP A N     1 
ATOM   563  C  CA    . TRP A 1 76  ? 23.798  67.111 67.143  1.00 14.16 ? 76  TRP A CA    1 
ATOM   564  C  C     . TRP A 1 76  ? 22.659  66.240 67.672  1.00 13.36 ? 76  TRP A C     1 
ATOM   565  O  O     . TRP A 1 76  ? 22.575  65.930 68.864  1.00 12.74 ? 76  TRP A O     1 
ATOM   566  C  CB    . TRP A 1 76  ? 24.893  66.229 66.539  1.00 15.11 ? 76  TRP A CB    1 
ATOM   567  C  CG    . TRP A 1 76  ? 24.635  65.677 65.209  1.00 16.55 ? 76  TRP A CG    1 
ATOM   568  C  CD1   . TRP A 1 76  ? 23.955  64.535 64.898  1.00 16.73 ? 76  TRP A CD1   1 
ATOM   569  C  CD2   . TRP A 1 76  ? 25.079  66.240 63.970  1.00 17.24 ? 76  TRP A CD2   1 
ATOM   570  N  NE1   . TRP A 1 76  ? 23.952  64.348 63.530  1.00 17.47 ? 76  TRP A NE1   1 
ATOM   571  C  CE2   . TRP A 1 76  ? 24.633  65.380 62.937  1.00 17.10 ? 76  TRP A CE2   1 
ATOM   572  C  CE3   . TRP A 1 76  ? 25.810  67.390 63.631  1.00 15.29 ? 76  TRP A CE3   1 
ATOM   573  C  CZ2   . TRP A 1 76  ? 24.897  65.632 61.586  1.00 17.73 ? 76  TRP A CZ2   1 
ATOM   574  C  CZ3   . TRP A 1 76  ? 26.072  67.643 62.290  1.00 16.22 ? 76  TRP A CZ3   1 
ATOM   575  C  CH2   . TRP A 1 76  ? 25.616  66.766 61.281  1.00 16.84 ? 76  TRP A CH2   1 
ATOM   576  N  N     . SER A 1 77  ? 21.796  65.841 66.744  1.00 12.72 ? 77  SER A N     1 
ATOM   577  C  CA    . SER A 1 77  ? 20.652  64.972 67.023  1.00 12.43 ? 77  SER A CA    1 
ATOM   578  C  C     . SER A 1 77  ? 20.354  64.247 65.708  1.00 12.55 ? 77  SER A C     1 
ATOM   579  O  O     . SER A 1 77  ? 20.740  64.720 64.634  1.00 11.96 ? 77  SER A O     1 
ATOM   580  C  CB    . SER A 1 77  ? 19.422  65.785 67.456  1.00 11.73 ? 77  SER A CB    1 
ATOM   581  O  OG    . SER A 1 77  ? 18.925  66.592 66.396  1.00 10.28 ? 77  SER A OG    1 
ATOM   582  N  N     . SER A 1 78  ? 19.683  63.101 65.787  1.00 12.91 ? 78  SER A N     1 
ATOM   583  C  CA    . SER A 1 78  ? 19.360  62.348 64.587  1.00 12.91 ? 78  SER A CA    1 
ATOM   584  C  C     . SER A 1 78  ? 18.092  62.901 63.955  1.00 13.86 ? 78  SER A C     1 
ATOM   585  O  O     . SER A 1 78  ? 17.292  63.569 64.623  1.00 13.77 ? 78  SER A O     1 
ATOM   586  C  CB    . SER A 1 78  ? 19.154  60.881 64.922  1.00 12.73 ? 78  SER A CB    1 
ATOM   587  O  OG    . SER A 1 78  ? 18.899  60.163 63.736  1.00 14.29 ? 78  SER A OG    1 
ATOM   588  N  N     . CYS A 1 79  ? 17.912  62.630 62.665  1.00 14.02 ? 79  CYS A N     1 
ATOM   589  C  CA    . CYS A 1 79  ? 16.731  63.106 61.953  1.00 13.71 ? 79  CYS A CA    1 
ATOM   590  C  C     . CYS A 1 79  ? 15.684  61.997 61.882  1.00 13.59 ? 79  CYS A C     1 
ATOM   591  O  O     . CYS A 1 79  ? 14.717  62.084 61.115  1.00 12.54 ? 79  CYS A O     1 
ATOM   592  C  CB    . CYS A 1 79  ? 17.109  63.563 60.542  1.00 13.56 ? 79  CYS A CB    1 
ATOM   593  S  SG    . CYS A 1 79  ? 17.779  62.261 59.492  1.00 14.57 ? 79  CYS A SG    1 
ATOM   594  N  N     . ASN A 1 80  ? 15.892  60.955 62.686  1.00 14.46 ? 80  ASN A N     1 
ATOM   595  C  CA    . ASN A 1 80  ? 14.972  59.821 62.749  1.00 16.50 ? 80  ASN A CA    1 
ATOM   596  C  C     . ASN A 1 80  ? 15.187  59.055 64.051  1.00 16.86 ? 80  ASN A C     1 
ATOM   597  O  O     . ASN A 1 80  ? 16.325  58.849 64.489  1.00 16.46 ? 80  ASN A O     1 
ATOM   598  C  CB    . ASN A 1 80  ? 15.166  58.894 61.542  1.00 18.48 ? 80  ASN A CB    1 
ATOM   599  C  CG    . ASN A 1 80  ? 14.154  57.752 61.511  1.00 19.52 ? 80  ASN A CG    1 
ATOM   600  O  OD1   . ASN A 1 80  ? 14.211  56.823 62.329  1.00 18.75 ? 80  ASN A OD1   1 
ATOM   601  N  ND2   . ASN A 1 80  ? 13.209  57.827 60.573  1.00 20.80 ? 80  ASN A ND2   1 
ATOM   602  N  N     . ILE A 1 81  ? 14.085  58.624 64.661  1.00 17.43 ? 81  ILE A N     1 
ATOM   603  C  CA    . ILE A 1 81  ? 14.135  57.923 65.941  1.00 16.94 ? 81  ILE A CA    1 
ATOM   604  C  C     . ILE A 1 81  ? 14.755  56.529 65.962  1.00 17.54 ? 81  ILE A C     1 
ATOM   605  O  O     . ILE A 1 81  ? 15.133  56.053 67.033  1.00 18.27 ? 81  ILE A O     1 
ATOM   606  C  CB    . ILE A 1 81  ? 12.726  57.836 66.566  1.00 15.92 ? 81  ILE A CB    1 
ATOM   607  C  CG1   . ILE A 1 81  ? 11.796  57.022 65.672  1.00 16.16 ? 81  ILE A CG1   1 
ATOM   608  C  CG2   . ILE A 1 81  ? 12.141  59.223 66.729  1.00 16.13 ? 81  ILE A CG2   1 
ATOM   609  C  CD1   . ILE A 1 81  ? 10.376  56.955 66.190  1.00 14.10 ? 81  ILE A CD1   1 
ATOM   610  N  N     . PHE A 1 82  ? 14.869  55.877 64.802  1.00 18.03 ? 82  PHE A N     1 
ATOM   611  C  CA    . PHE A 1 82  ? 15.443  54.528 64.735  1.00 17.75 ? 82  PHE A CA    1 
ATOM   612  C  C     . PHE A 1 82  ? 16.824  54.437 64.078  1.00 17.73 ? 82  PHE A C     1 
ATOM   613  O  O     . PHE A 1 82  ? 17.544  53.446 64.260  1.00 17.37 ? 82  PHE A O     1 
ATOM   614  C  CB    . PHE A 1 82  ? 14.520  53.586 63.957  1.00 20.30 ? 82  PHE A CB    1 
ATOM   615  C  CG    . PHE A 1 82  ? 13.175  53.351 64.596  1.00 21.67 ? 82  PHE A CG    1 
ATOM   616  C  CD1   . PHE A 1 82  ? 13.074  52.953 65.928  1.00 22.16 ? 82  PHE A CD1   1 
ATOM   617  C  CD2   . PHE A 1 82  ? 12.014  53.441 63.837  1.00 22.37 ? 82  PHE A CD2   1 
ATOM   618  C  CE1   . PHE A 1 82  ? 11.841  52.645 66.492  1.00 21.85 ? 82  PHE A CE1   1 
ATOM   619  C  CE2   . PHE A 1 82  ? 10.774  53.133 64.391  1.00 23.79 ? 82  PHE A CE2   1 
ATOM   620  C  CZ    . PHE A 1 82  ? 10.686  52.733 65.721  1.00 23.37 ? 82  PHE A CZ    1 
ATOM   621  N  N     . SER A 1 83  ? 17.192  55.460 63.314  1.00 16.63 ? 83  SER A N     1 
ATOM   622  C  CA    . SER A 1 83  ? 18.452  55.448 62.581  1.00 15.18 ? 83  SER A CA    1 
ATOM   623  C  C     . SER A 1 83  ? 19.737  55.650 63.369  1.00 15.07 ? 83  SER A C     1 
ATOM   624  O  O     . SER A 1 83  ? 20.834  55.448 62.839  1.00 15.87 ? 83  SER A O     1 
ATOM   625  C  CB    . SER A 1 83  ? 18.391  56.476 61.454  1.00 14.53 ? 83  SER A CB    1 
ATOM   626  O  OG    . SER A 1 83  ? 18.068  57.751 61.966  1.00 14.43 ? 83  SER A OG    1 
ATOM   627  N  N     . THR A 1 84  ? 19.627  56.045 64.627  1.00 14.17 ? 84  THR A N     1 
ATOM   628  C  CA    . THR A 1 84  ? 20.837  56.258 65.414  1.00 11.26 ? 84  THR A CA    1 
ATOM   629  C  C     . THR A 1 84  ? 21.586  54.945 65.652  1.00 10.78 ? 84  THR A C     1 
ATOM   630  O  O     . THR A 1 84  ? 20.986  53.883 65.824  1.00 9.94  ? 84  THR A O     1 
ATOM   631  C  CB    . THR A 1 84  ? 20.518  56.911 66.788  1.00 11.06 ? 84  THR A CB    1 
ATOM   632  O  OG1   . THR A 1 84  ? 19.869  58.177 66.591  1.00 9.42  ? 84  THR A OG1   1 
ATOM   633  C  CG2   . THR A 1 84  ? 21.789  57.140 67.569  1.00 10.72 ? 84  THR A CG2   1 
ATOM   634  N  N     . GLN A 1 85  ? 22.910  55.024 65.612  1.00 11.18 ? 85  GLN A N     1 
ATOM   635  C  CA    . GLN A 1 85  ? 23.777  53.879 65.873  1.00 9.83  ? 85  GLN A CA    1 
ATOM   636  C  C     . GLN A 1 85  ? 24.414  54.279 67.197  1.00 8.77  ? 85  GLN A C     1 
ATOM   637  O  O     . GLN A 1 85  ? 25.198  55.227 67.254  1.00 8.39  ? 85  GLN A O     1 
ATOM   638  C  CB    . GLN A 1 85  ? 24.801  53.723 64.746  1.00 10.07 ? 85  GLN A CB    1 
ATOM   639  C  CG    . GLN A 1 85  ? 24.160  53.221 63.450  1.00 12.01 ? 85  GLN A CG    1 
ATOM   640  C  CD    . GLN A 1 85  ? 25.103  53.177 62.248  1.00 12.82 ? 85  GLN A CD    1 
ATOM   641  O  OE1   . GLN A 1 85  ? 24.711  52.728 61.170  1.00 13.14 ? 85  GLN A OE1   1 
ATOM   642  N  NE2   . GLN A 1 85  ? 26.339  53.651 62.423  1.00 12.62 ? 85  GLN A NE2   1 
ATOM   643  N  N     . ASN A 1 86  ? 24.049  53.575 68.263  1.00 8.09  ? 86  ASN A N     1 
ATOM   644  C  CA    . ASN A 1 86  ? 24.517  53.934 69.595  1.00 9.06  ? 86  ASN A CA    1 
ATOM   645  C  C     . ASN A 1 86  ? 26.020  54.057 69.834  1.00 11.36 ? 86  ASN A C     1 
ATOM   646  O  O     . ASN A 1 86  ? 26.466  55.068 70.386  1.00 11.93 ? 86  ASN A O     1 
ATOM   647  C  CB    . ASN A 1 86  ? 23.896  52.996 70.636  1.00 9.27  ? 86  ASN A CB    1 
ATOM   648  C  CG    . ASN A 1 86  ? 22.354  52.991 70.593  1.00 9.06  ? 86  ASN A CG    1 
ATOM   649  O  OD1   . ASN A 1 86  ? 21.698  54.035 70.674  1.00 7.59  ? 86  ASN A OD1   1 
ATOM   650  N  ND2   . ASN A 1 86  ? 21.782  51.803 70.473  1.00 8.82  ? 86  ASN A ND2   1 
ATOM   651  N  N     . HIS A 1 87  ? 26.808  53.057 69.434  1.00 13.00 ? 87  HIS A N     1 
ATOM   652  C  CA    . HIS A 1 87  ? 28.245  53.140 69.664  1.00 13.91 ? 87  HIS A CA    1 
ATOM   653  C  C     . HIS A 1 87  ? 28.836  54.361 68.974  1.00 15.82 ? 87  HIS A C     1 
ATOM   654  O  O     . HIS A 1 87  ? 29.769  54.987 69.487  1.00 16.69 ? 87  HIS A O     1 
ATOM   655  C  CB    . HIS A 1 87  ? 28.950  51.854 69.222  1.00 13.83 ? 87  HIS A CB    1 
ATOM   656  C  CG    . HIS A 1 87  ? 28.817  51.546 67.766  1.00 13.64 ? 87  HIS A CG    1 
ATOM   657  N  ND1   . HIS A 1 87  ? 27.608  51.575 67.105  1.00 15.09 ? 87  HIS A ND1   1 
ATOM   658  C  CD2   . HIS A 1 87  ? 29.729  51.114 66.863  1.00 12.85 ? 87  HIS A CD2   1 
ATOM   659  C  CE1   . HIS A 1 87  ? 27.781  51.174 65.858  1.00 14.33 ? 87  HIS A CE1   1 
ATOM   660  N  NE2   . HIS A 1 87  ? 29.059  50.888 65.685  1.00 13.39 ? 87  HIS A NE2   1 
ATOM   661  N  N     . ALA A 1 88  ? 28.290  54.716 67.819  1.00 16.96 ? 88  ALA A N     1 
ATOM   662  C  CA    . ALA A 1 88  ? 28.768  55.903 67.113  1.00 17.96 ? 88  ALA A CA    1 
ATOM   663  C  C     . ALA A 1 88  ? 28.282  57.126 67.897  1.00 18.30 ? 88  ALA A C     1 
ATOM   664  O  O     . ALA A 1 88  ? 28.981  58.134 68.006  1.00 18.92 ? 88  ALA A O     1 
ATOM   665  C  CB    . ALA A 1 88  ? 28.214  55.938 65.689  1.00 17.61 ? 88  ALA A CB    1 
ATOM   666  N  N     . ALA A 1 89  ? 27.071  57.026 68.439  1.00 18.33 ? 89  ALA A N     1 
ATOM   667  C  CA    . ALA A 1 89  ? 26.506  58.117 69.213  1.00 18.58 ? 89  ALA A CA    1 
ATOM   668  C  C     . ALA A 1 89  ? 27.412  58.345 70.411  1.00 18.47 ? 89  ALA A C     1 
ATOM   669  O  O     . ALA A 1 89  ? 27.838  59.470 70.669  1.00 18.18 ? 89  ALA A O     1 
ATOM   670  C  CB    . ALA A 1 89  ? 25.091  57.774 69.675  1.00 18.35 ? 89  ALA A CB    1 
ATOM   671  N  N     . ALA A 1 90  ? 27.723  57.269 71.126  1.00 18.43 ? 90  ALA A N     1 
ATOM   672  C  CA    . ALA A 1 90  ? 28.585  57.354 72.301  1.00 18.83 ? 90  ALA A CA    1 
ATOM   673  C  C     . ALA A 1 90  ? 29.979  57.896 71.985  1.00 18.87 ? 90  ALA A C     1 
ATOM   674  O  O     . ALA A 1 90  ? 30.456  58.818 72.649  1.00 20.01 ? 90  ALA A O     1 
ATOM   675  C  CB    . ALA A 1 90  ? 28.706  55.990 72.961  1.00 19.92 ? 90  ALA A CB    1 
ATOM   676  N  N     . ALA A 1 91  ? 30.643  57.330 70.982  1.00 18.84 ? 91  ALA A N     1 
ATOM   677  C  CA    . ALA A 1 91  ? 31.974  57.806 70.630  1.00 18.49 ? 91  ALA A CA    1 
ATOM   678  C  C     . ALA A 1 91  ? 31.969  59.326 70.601  1.00 18.18 ? 91  ALA A C     1 
ATOM   679  O  O     . ALA A 1 91  ? 32.814  59.965 71.219  1.00 19.34 ? 91  ALA A O     1 
ATOM   680  C  CB    . ALA A 1 91  ? 32.389  57.261 69.278  1.00 19.69 ? 91  ALA A CB    1 
ATOM   681  N  N     . ILE A 1 92  ? 30.997  59.903 69.904  1.00 17.54 ? 92  ILE A N     1 
ATOM   682  C  CA    . ILE A 1 92  ? 30.899  61.359 69.790  1.00 18.04 ? 92  ILE A CA    1 
ATOM   683  C  C     . ILE A 1 92  ? 30.637  62.061 71.120  1.00 18.35 ? 92  ILE A C     1 
ATOM   684  O  O     . ILE A 1 92  ? 31.192  63.133 71.379  1.00 18.15 ? 92  ILE A O     1 
ATOM   685  C  CB    . ILE A 1 92  ? 29.801  61.790 68.774  1.00 17.81 ? 92  ILE A CB    1 
ATOM   686  C  CG1   . ILE A 1 92  ? 30.190  61.373 67.350  1.00 18.28 ? 92  ILE A CG1   1 
ATOM   687  C  CG2   . ILE A 1 92  ? 29.657  63.301 68.787  1.00 19.31 ? 92  ILE A CG2   1 
ATOM   688  C  CD1   . ILE A 1 92  ? 31.466  62.064 66.817  1.00 17.36 ? 92  ILE A CD1   1 
ATOM   689  N  N     . ALA A 1 93  ? 29.773  61.478 71.948  1.00 19.60 ? 93  ALA A N     1 
ATOM   690  C  CA    . ALA A 1 93  ? 29.474  62.048 73.261  1.00 19.84 ? 93  ALA A CA    1 
ATOM   691  C  C     . ALA A 1 93  ? 30.782  62.084 74.039  1.00 21.54 ? 93  ALA A C     1 
ATOM   692  O  O     . ALA A 1 93  ? 31.177  63.134 74.560  1.00 22.63 ? 93  ALA A O     1 
ATOM   693  C  CB    . ALA A 1 93  ? 28.467  61.193 73.998  1.00 19.00 ? 93  ALA A CB    1 
ATOM   694  N  N     . LYS A 1 94  ? 31.461  60.940 74.101  1.00 21.84 ? 94  LYS A N     1 
ATOM   695  C  CA    . LYS A 1 94  ? 32.721  60.868 74.811  1.00 22.60 ? 94  LYS A CA    1 
ATOM   696  C  C     . LYS A 1 94  ? 33.722  61.888 74.283  1.00 21.89 ? 94  LYS A C     1 
ATOM   697  O  O     . LYS A 1 94  ? 34.620  62.304 75.021  1.00 22.64 ? 94  LYS A O     1 
ATOM   698  C  CB    . LYS A 1 94  ? 33.339  59.473 74.707  1.00 25.29 ? 94  LYS A CB    1 
ATOM   699  C  CG    . LYS A 1 94  ? 34.665  59.374 75.471  1.00 28.48 ? 94  LYS A CG    1 
ATOM   700  C  CD    . LYS A 1 94  ? 35.428  58.093 75.165  1.00 32.17 ? 94  LYS A CD    1 
ATOM   701  C  CE    . LYS A 1 94  ? 36.815  58.103 75.816  1.00 33.90 ? 94  LYS A CE    1 
ATOM   702  N  NZ    . LYS A 1 94  ? 37.625  56.902 75.434  1.00 35.24 ? 94  LYS A NZ    1 
ATOM   703  N  N     . ALA A 1 95  ? 33.579  62.284 73.017  1.00 20.41 ? 95  ALA A N     1 
ATOM   704  C  CA    . ALA A 1 95  ? 34.496  63.263 72.417  1.00 20.25 ? 95  ALA A CA    1 
ATOM   705  C  C     . ALA A 1 95  ? 34.224  64.683 72.908  1.00 20.56 ? 95  ALA A C     1 
ATOM   706  O  O     . ALA A 1 95  ? 34.917  65.625 72.514  1.00 20.16 ? 95  ALA A O     1 
ATOM   707  C  CB    . ALA A 1 95  ? 34.407  63.219 70.902  1.00 19.55 ? 95  ALA A CB    1 
ATOM   708  N  N     . GLY A 1 96  ? 33.211  64.829 73.765  1.00 20.76 ? 96  GLY A N     1 
ATOM   709  C  CA    . GLY A 1 96  ? 32.877  66.130 74.317  1.00 20.75 ? 96  GLY A CA    1 
ATOM   710  C  C     . GLY A 1 96  ? 32.023  66.966 73.393  1.00 21.50 ? 96  GLY A C     1 
ATOM   711  O  O     . GLY A 1 96  ? 32.004  68.200 73.475  1.00 20.95 ? 96  GLY A O     1 
ATOM   712  N  N     . ILE A 1 97  ? 31.315  66.286 72.502  1.00 22.13 ? 97  ILE A N     1 
ATOM   713  C  CA    . ILE A 1 97  ? 30.438  66.951 71.551  1.00 21.60 ? 97  ILE A CA    1 
ATOM   714  C  C     . ILE A 1 97  ? 29.018  66.597 71.946  1.00 21.32 ? 97  ILE A C     1 
ATOM   715  O  O     . ILE A 1 97  ? 28.680  65.425 72.064  1.00 22.83 ? 97  ILE A O     1 
ATOM   716  C  CB    . ILE A 1 97  ? 30.712  66.452 70.123  1.00 21.46 ? 97  ILE A CB    1 
ATOM   717  C  CG1   . ILE A 1 97  ? 32.176  66.727 69.772  1.00 21.47 ? 97  ILE A CG1   1 
ATOM   718  C  CG2   . ILE A 1 97  ? 29.767  67.119 69.141  1.00 17.97 ? 97  ILE A CG2   1 
ATOM   719  C  CD1   . ILE A 1 97  ? 32.596  66.171 68.431  1.00 23.74 ? 97  ILE A CD1   1 
ATOM   720  N  N     . PRO A 1 98  ? 28.170  67.606 72.177  1.00 20.99 ? 98  PRO A N     1 
ATOM   721  C  CA    . PRO A 1 98  ? 26.767  67.383 72.565  1.00 20.33 ? 98  PRO A CA    1 
ATOM   722  C  C     . PRO A 1 98  ? 25.955  66.589 71.536  1.00 19.45 ? 98  PRO A C     1 
ATOM   723  O  O     . PRO A 1 98  ? 25.647  67.075 70.442  1.00 18.94 ? 98  PRO A O     1 
ATOM   724  C  CB    . PRO A 1 98  ? 26.235  68.808 72.744  1.00 20.00 ? 98  PRO A CB    1 
ATOM   725  C  CG    . PRO A 1 98  ? 27.489  69.570 73.164  1.00 20.60 ? 98  PRO A CG    1 
ATOM   726  C  CD    . PRO A 1 98  ? 28.451  69.046 72.110  1.00 20.19 ? 98  PRO A CD    1 
ATOM   727  N  N     . VAL A 1 99  ? 25.617  65.360 71.892  1.00 19.42 ? 99  VAL A N     1 
ATOM   728  C  CA    . VAL A 1 99  ? 24.828  64.512 71.013  1.00 19.68 ? 99  VAL A CA    1 
ATOM   729  C  C     . VAL A 1 99  ? 23.556  64.157 71.752  1.00 19.46 ? 99  VAL A C     1 
ATOM   730  O  O     . VAL A 1 99  ? 23.577  63.921 72.963  1.00 19.87 ? 99  VAL A O     1 
ATOM   731  C  CB    . VAL A 1 99  ? 25.543  63.201 70.701  1.00 20.80 ? 99  VAL A CB    1 
ATOM   732  C  CG1   . VAL A 1 99  ? 24.744  62.407 69.673  1.00 21.49 ? 99  VAL A CG1   1 
ATOM   733  C  CG2   . VAL A 1 99  ? 26.940  63.481 70.218  1.00 22.31 ? 99  VAL A CG2   1 
ATOM   734  N  N     . TYR A 1 100 ? 22.440  64.130 71.038  1.00 19.16 ? 100 TYR A N     1 
ATOM   735  C  CA    . TYR A 1 100 ? 21.177  63.766 71.670  1.00 18.10 ? 100 TYR A CA    1 
ATOM   736  C  C     . TYR A 1 100 ? 20.461  62.844 70.721  1.00 17.49 ? 100 TYR A C     1 
ATOM   737  O  O     . TYR A 1 100 ? 19.671  63.283 69.882  1.00 17.40 ? 100 TYR A O     1 
ATOM   738  C  CB    . TYR A 1 100 ? 20.348  65.009 71.973  1.00 18.02 ? 100 TYR A CB    1 
ATOM   739  C  CG    . TYR A 1 100 ? 21.120  66.001 72.812  1.00 20.17 ? 100 TYR A CG    1 
ATOM   740  C  CD1   . TYR A 1 100 ? 22.095  66.816 72.238  1.00 20.84 ? 100 TYR A CD1   1 
ATOM   741  C  CD2   . TYR A 1 100 ? 20.932  66.074 74.189  1.00 19.87 ? 100 TYR A CD2   1 
ATOM   742  C  CE1   . TYR A 1 100 ? 22.859  67.674 73.010  1.00 21.59 ? 100 TYR A CE1   1 
ATOM   743  C  CE2   . TYR A 1 100 ? 21.697  66.930 74.973  1.00 20.42 ? 100 TYR A CE2   1 
ATOM   744  C  CZ    . TYR A 1 100 ? 22.656  67.725 74.377  1.00 21.47 ? 100 TYR A CZ    1 
ATOM   745  O  OH    . TYR A 1 100 ? 23.428  68.561 75.148  1.00 22.68 ? 100 TYR A OH    1 
ATOM   746  N  N     . ALA A 1 101 ? 20.776  61.556 70.848  1.00 16.62 ? 101 ALA A N     1 
ATOM   747  C  CA    . ALA A 1 101 ? 20.201  60.535 69.989  1.00 16.09 ? 101 ALA A CA    1 
ATOM   748  C  C     . ALA A 1 101 ? 20.492  59.147 70.528  1.00 15.42 ? 101 ALA A C     1 
ATOM   749  O  O     . ALA A 1 101 ? 21.467  58.937 71.240  1.00 16.40 ? 101 ALA A O     1 
ATOM   750  C  CB    . ALA A 1 101 ? 20.771  60.670 68.576  1.00 15.98 ? 101 ALA A CB    1 
ATOM   751  N  N     . TRP A 1 102 ? 19.633  58.201 70.175  1.00 14.79 ? 102 TRP A N     1 
ATOM   752  C  CA    . TRP A 1 102 ? 19.777  56.816 70.597  1.00 14.04 ? 102 TRP A CA    1 
ATOM   753  C  C     . TRP A 1 102 ? 18.749  56.020 69.800  1.00 14.50 ? 102 TRP A C     1 
ATOM   754  O  O     . TRP A 1 102 ? 17.664  56.531 69.504  1.00 14.94 ? 102 TRP A O     1 
ATOM   755  C  CB    . TRP A 1 102 ? 19.544  56.693 72.114  1.00 12.55 ? 102 TRP A CB    1 
ATOM   756  C  CG    . TRP A 1 102 ? 18.189  57.121 72.590  1.00 10.24 ? 102 TRP A CG    1 
ATOM   757  C  CD1   . TRP A 1 102 ? 17.013  56.409 72.511  1.00 10.88 ? 102 TRP A CD1   1 
ATOM   758  C  CD2   . TRP A 1 102 ? 17.858  58.370 73.204  1.00 9.82  ? 102 TRP A CD2   1 
ATOM   759  N  NE1   . TRP A 1 102 ? 15.971  57.143 73.043  1.00 9.11  ? 102 TRP A NE1   1 
ATOM   760  C  CE2   . TRP A 1 102 ? 16.460  58.351 73.473  1.00 9.71  ? 102 TRP A CE2   1 
ATOM   761  C  CE3   . TRP A 1 102 ? 18.601  59.508 73.552  1.00 7.92  ? 102 TRP A CE3   1 
ATOM   762  C  CZ2   . TRP A 1 102 ? 15.797  59.426 74.078  1.00 7.26  ? 102 TRP A CZ2   1 
ATOM   763  C  CZ3   . TRP A 1 102 ? 17.943  60.577 74.154  1.00 7.68  ? 102 TRP A CZ3   1 
ATOM   764  C  CH2   . TRP A 1 102 ? 16.551  60.527 74.410  1.00 8.28  ? 102 TRP A CH2   1 
ATOM   765  N  N     . LYS A 1 103 ? 19.090  54.786 69.430  1.00 14.20 ? 103 LYS A N     1 
ATOM   766  C  CA    . LYS A 1 103 ? 18.170  53.979 68.643  1.00 13.66 ? 103 LYS A CA    1 
ATOM   767  C  C     . LYS A 1 103 ? 16.902  53.690 69.446  1.00 15.66 ? 103 LYS A C     1 
ATOM   768  O  O     . LYS A 1 103 ? 16.969  53.157 70.555  1.00 16.87 ? 103 LYS A O     1 
ATOM   769  C  CB    . LYS A 1 103 ? 18.833  52.663 68.223  1.00 11.22 ? 103 LYS A CB    1 
ATOM   770  C  CG    . LYS A 1 103 ? 18.087  51.916 67.129  1.00 9.08  ? 103 LYS A CG    1 
ATOM   771  C  CD    . LYS A 1 103 ? 18.773  50.617 66.769  1.00 8.16  ? 103 LYS A CD    1 
ATOM   772  C  CE    . LYS A 1 103 ? 18.105  49.931 65.572  1.00 8.03  ? 103 LYS A CE    1 
ATOM   773  N  NZ    . LYS A 1 103 ? 18.209  50.754 64.324  1.00 5.36  ? 103 LYS A NZ    1 
ATOM   774  N  N     . GLY A 1 104 ? 15.749  54.058 68.893  1.00 16.25 ? 104 GLY A N     1 
ATOM   775  C  CA    . GLY A 1 104 ? 14.500  53.806 69.585  1.00 17.65 ? 104 GLY A CA    1 
ATOM   776  C  C     . GLY A 1 104 ? 13.943  54.964 70.394  1.00 18.09 ? 104 GLY A C     1 
ATOM   777  O  O     . GLY A 1 104 ? 13.435  54.775 71.499  1.00 17.96 ? 104 GLY A O     1 
ATOM   778  N  N     . GLU A 1 105 ? 14.041  56.169 69.851  1.00 18.61 ? 105 GLU A N     1 
ATOM   779  C  CA    . GLU A 1 105 ? 13.511  57.340 70.530  1.00 18.61 ? 105 GLU A CA    1 
ATOM   780  C  C     . GLU A 1 105 ? 11.996  57.330 70.350  1.00 19.12 ? 105 GLU A C     1 
ATOM   781  O  O     . GLU A 1 105 ? 11.457  56.522 69.582  1.00 18.64 ? 105 GLU A O     1 
ATOM   782  C  CB    . GLU A 1 105 ? 14.102  58.606 69.909  1.00 18.76 ? 105 GLU A CB    1 
ATOM   783  C  CG    . GLU A 1 105 ? 15.590  58.813 70.186  1.00 18.94 ? 105 GLU A CG    1 
ATOM   784  C  CD    . GLU A 1 105 ? 16.192  59.939 69.355  1.00 19.12 ? 105 GLU A CD    1 
ATOM   785  O  OE1   . GLU A 1 105 ? 15.484  60.939 69.094  1.00 19.52 ? 105 GLU A OE1   1 
ATOM   786  O  OE2   . GLU A 1 105 ? 17.380  59.838 68.983  1.00 18.25 ? 105 GLU A OE2   1 
ATOM   787  N  N     . THR A 1 106 ? 11.308  58.209 71.074  1.00 19.62 ? 106 THR A N     1 
ATOM   788  C  CA    . THR A 1 106 ? 9.856   58.326 70.949  1.00 18.95 ? 106 THR A CA    1 
ATOM   789  C  C     . THR A 1 106 ? 9.670   59.687 70.302  1.00 19.35 ? 106 THR A C     1 
ATOM   790  O  O     . THR A 1 106 ? 10.551  60.541 70.413  1.00 19.54 ? 106 THR A O     1 
ATOM   791  C  CB    . THR A 1 106 ? 9.136   58.338 72.313  1.00 18.56 ? 106 THR A CB    1 
ATOM   792  O  OG1   . THR A 1 106 ? 9.381   59.582 72.982  1.00 19.95 ? 106 THR A OG1   1 
ATOM   793  C  CG2   . THR A 1 106 ? 9.619   57.198 73.180  1.00 17.42 ? 106 THR A CG2   1 
ATOM   794  N  N     . ASP A 1 107 ? 8.543   59.894 69.627  1.00 20.80 ? 107 ASP A N     1 
ATOM   795  C  CA    . ASP A 1 107 ? 8.278   61.170 68.958  1.00 21.69 ? 107 ASP A CA    1 
ATOM   796  C  C     . ASP A 1 107 ? 8.615   62.376 69.837  1.00 22.06 ? 107 ASP A C     1 
ATOM   797  O  O     . ASP A 1 107 ? 9.149   63.380 69.355  1.00 21.17 ? 107 ASP A O     1 
ATOM   798  C  CB    . ASP A 1 107 ? 6.813   61.246 68.512  1.00 23.03 ? 107 ASP A CB    1 
ATOM   799  C  CG    . ASP A 1 107 ? 6.455   60.179 67.476  1.00 25.54 ? 107 ASP A CG    1 
ATOM   800  O  OD1   . ASP A 1 107 ? 7.094   60.150 66.398  1.00 26.57 ? 107 ASP A OD1   1 
ATOM   801  O  OD2   . ASP A 1 107 ? 5.532   59.367 67.734  1.00 27.97 ? 107 ASP A OD2   1 
ATOM   802  N  N     . GLU A 1 108 ? 8.314   62.272 71.129  1.00 23.06 ? 108 GLU A N     1 
ATOM   803  C  CA    . GLU A 1 108 ? 8.590   63.355 72.064  1.00 23.57 ? 108 GLU A CA    1 
ATOM   804  C  C     . GLU A 1 108 ? 10.097  63.473 72.243  1.00 22.24 ? 108 GLU A C     1 
ATOM   805  O  O     . GLU A 1 108 ? 10.662  64.547 72.086  1.00 23.33 ? 108 GLU A O     1 
ATOM   806  C  CB    . GLU A 1 108 ? 7.940   63.095 73.435  1.00 26.01 ? 108 GLU A CB    1 
ATOM   807  C  CG    . GLU A 1 108 ? 6.431   62.799 73.423  1.00 29.67 ? 108 GLU A CG    1 
ATOM   808  C  CD    . GLU A 1 108 ? 6.091   61.403 72.883  1.00 32.10 ? 108 GLU A CD    1 
ATOM   809  O  OE1   . GLU A 1 108 ? 6.366   61.130 71.696  1.00 33.83 ? 108 GLU A OE1   1 
ATOM   810  O  OE2   . GLU A 1 108 ? 5.554   60.565 73.647  1.00 33.92 ? 108 GLU A OE2   1 
ATOM   811  N  N     . GLU A 1 109 ? 10.750  62.364 72.565  1.00 20.20 ? 109 GLU A N     1 
ATOM   812  C  CA    . GLU A 1 109 ? 12.195  62.380 72.761  1.00 19.60 ? 109 GLU A CA    1 
ATOM   813  C  C     . GLU A 1 109 ? 12.895  62.919 71.508  1.00 19.03 ? 109 GLU A C     1 
ATOM   814  O  O     . GLU A 1 109 ? 13.869  63.676 71.590  1.00 17.77 ? 109 GLU A O     1 
ATOM   815  C  CB    . GLU A 1 109 ? 12.690  60.967 73.071  1.00 19.09 ? 109 GLU A CB    1 
ATOM   816  C  CG    . GLU A 1 109 ? 11.906  60.295 74.162  1.00 17.93 ? 109 GLU A CG    1 
ATOM   817  C  CD    . GLU A 1 109 ? 12.438  58.930 74.504  1.00 19.21 ? 109 GLU A CD    1 
ATOM   818  O  OE1   . GLU A 1 109 ? 12.564  58.086 73.582  1.00 18.70 ? 109 GLU A OE1   1 
ATOM   819  O  OE2   . GLU A 1 109 ? 12.724  58.700 75.704  1.00 21.77 ? 109 GLU A OE2   1 
ATOM   820  N  N     . TYR A 1 110 ? 12.388  62.520 70.347  1.00 18.74 ? 110 TYR A N     1 
ATOM   821  C  CA    . TYR A 1 110 ? 12.955  62.962 69.081  1.00 18.55 ? 110 TYR A CA    1 
ATOM   822  C  C     . TYR A 1 110 ? 13.020  64.475 69.097  1.00 18.66 ? 110 TYR A C     1 
ATOM   823  O  O     . TYR A 1 110 ? 14.090  65.063 68.983  1.00 19.81 ? 110 TYR A O     1 
ATOM   824  C  CB    . TYR A 1 110 ? 12.079  62.497 67.916  1.00 16.54 ? 110 TYR A CB    1 
ATOM   825  C  CG    . TYR A 1 110 ? 12.562  62.971 66.569  1.00 15.76 ? 110 TYR A CG    1 
ATOM   826  C  CD1   . TYR A 1 110 ? 13.796  62.566 66.066  1.00 16.33 ? 110 TYR A CD1   1 
ATOM   827  C  CD2   . TYR A 1 110 ? 11.797  63.848 65.803  1.00 15.15 ? 110 TYR A CD2   1 
ATOM   828  C  CE1   . TYR A 1 110 ? 14.258  63.031 64.827  1.00 16.49 ? 110 TYR A CE1   1 
ATOM   829  C  CE2   . TYR A 1 110 ? 12.246  64.319 64.568  1.00 15.13 ? 110 TYR A CE2   1 
ATOM   830  C  CZ    . TYR A 1 110 ? 13.475  63.911 64.087  1.00 15.29 ? 110 TYR A CZ    1 
ATOM   831  O  OH    . TYR A 1 110 ? 13.934  64.404 62.883  1.00 15.05 ? 110 TYR A OH    1 
ATOM   832  N  N     . LEU A 1 111 ? 11.853  65.088 69.248  1.00 19.72 ? 111 LEU A N     1 
ATOM   833  C  CA    . LEU A 1 111 ? 11.708  66.537 69.299  1.00 19.45 ? 111 LEU A CA    1 
ATOM   834  C  C     . LEU A 1 111 ? 12.535  67.150 70.423  1.00 19.67 ? 111 LEU A C     1 
ATOM   835  O  O     . LEU A 1 111 ? 13.043  68.267 70.298  1.00 18.97 ? 111 LEU A O     1 
ATOM   836  C  CB    . LEU A 1 111 ? 10.230  66.883 69.485  1.00 19.74 ? 111 LEU A CB    1 
ATOM   837  C  CG    . LEU A 1 111 ? 9.817   68.346 69.643  1.00 19.60 ? 111 LEU A CG    1 
ATOM   838  C  CD1   . LEU A 1 111 ? 10.209  68.858 71.013  1.00 20.26 ? 111 LEU A CD1   1 
ATOM   839  C  CD2   . LEU A 1 111 ? 10.448  69.166 68.532  1.00 19.90 ? 111 LEU A CD2   1 
ATOM   840  N  N     . TRP A 1 112 ? 12.659  66.414 71.525  1.00 20.71 ? 112 TRP A N     1 
ATOM   841  C  CA    . TRP A 1 112 ? 13.428  66.864 72.681  1.00 21.15 ? 112 TRP A CA    1 
ATOM   842  C  C     . TRP A 1 112 ? 14.907  67.016 72.297  1.00 20.93 ? 112 TRP A C     1 
ATOM   843  O  O     . TRP A 1 112 ? 15.550  68.024 72.607  1.00 21.25 ? 112 TRP A O     1 
ATOM   844  C  CB    . TRP A 1 112 ? 13.309  65.853 73.825  1.00 21.50 ? 112 TRP A CB    1 
ATOM   845  C  CG    . TRP A 1 112 ? 14.096  66.267 75.021  1.00 23.59 ? 112 TRP A CG    1 
ATOM   846  C  CD1   . TRP A 1 112 ? 13.756  67.223 75.935  1.00 23.22 ? 112 TRP A CD1   1 
ATOM   847  C  CD2   . TRP A 1 112 ? 15.421  65.832 75.368  1.00 24.87 ? 112 TRP A CD2   1 
ATOM   848  N  NE1   . TRP A 1 112 ? 14.784  67.415 76.828  1.00 23.94 ? 112 TRP A NE1   1 
ATOM   849  C  CE2   . TRP A 1 112 ? 15.820  66.576 76.505  1.00 25.31 ? 112 TRP A CE2   1 
ATOM   850  C  CE3   . TRP A 1 112 ? 16.311  64.888 74.826  1.00 24.86 ? 112 TRP A CE3   1 
ATOM   851  C  CZ2   . TRP A 1 112 ? 17.075  66.406 77.115  1.00 25.20 ? 112 TRP A CZ2   1 
ATOM   852  C  CZ3   . TRP A 1 112 ? 17.555  64.720 75.430  1.00 25.14 ? 112 TRP A CZ3   1 
ATOM   853  C  CH2   . TRP A 1 112 ? 17.924  65.480 76.567  1.00 25.27 ? 112 TRP A CH2   1 
ATOM   854  N  N     . CYS A 1 113 ? 15.441  66.007 71.622  1.00 19.59 ? 113 CYS A N     1 
ATOM   855  C  CA    . CYS A 1 113 ? 16.830  66.039 71.200  1.00 19.46 ? 113 CYS A CA    1 
ATOM   856  C  C     . CYS A 1 113 ? 17.154  67.262 70.342  1.00 19.44 ? 113 CYS A C     1 
ATOM   857  O  O     . CYS A 1 113 ? 18.047  68.030 70.686  1.00 20.17 ? 113 CYS A O     1 
ATOM   858  C  CB    . CYS A 1 113 ? 17.172  64.751 70.447  1.00 18.55 ? 113 CYS A CB    1 
ATOM   859  S  SG    . CYS A 1 113 ? 17.057  63.293 71.499  1.00 17.50 ? 113 CYS A SG    1 
ATOM   860  N  N     . ILE A 1 114 ? 16.439  67.439 69.234  1.00 19.23 ? 114 ILE A N     1 
ATOM   861  C  CA    . ILE A 1 114 ? 16.665  68.591 68.359  1.00 19.08 ? 114 ILE A CA    1 
ATOM   862  C  C     . ILE A 1 114 ? 16.816  69.863 69.185  1.00 18.77 ? 114 ILE A C     1 
ATOM   863  O  O     . ILE A 1 114 ? 17.795  70.599 69.058  1.00 17.90 ? 114 ILE A O     1 
ATOM   864  C  CB    . ILE A 1 114 ? 15.474  68.827 67.385  1.00 19.15 ? 114 ILE A CB    1 
ATOM   865  C  CG1   . ILE A 1 114 ? 15.311  67.638 66.435  1.00 19.62 ? 114 ILE A CG1   1 
ATOM   866  C  CG2   . ILE A 1 114 ? 15.698  70.102 66.598  1.00 18.48 ? 114 ILE A CG2   1 
ATOM   867  C  CD1   . ILE A 1 114 ? 14.170  67.806 65.440  1.00 17.38 ? 114 ILE A CD1   1 
ATOM   868  N  N     . GLU A 1 115 ? 15.830  70.114 70.037  1.00 19.92 ? 115 GLU A N     1 
ATOM   869  C  CA    . GLU A 1 115 ? 15.831  71.309 70.868  1.00 20.25 ? 115 GLU A CA    1 
ATOM   870  C  C     . GLU A 1 115 ? 17.116  71.493 71.669  1.00 19.48 ? 115 GLU A C     1 
ATOM   871  O  O     . GLU A 1 115 ? 17.634  72.604 71.757  1.00 19.93 ? 115 GLU A O     1 
ATOM   872  C  CB    . GLU A 1 115 ? 14.607  71.295 71.789  1.00 20.27 ? 115 GLU A CB    1 
ATOM   873  C  CG    . GLU A 1 115 ? 13.313  71.192 71.003  1.00 21.23 ? 115 GLU A CG    1 
ATOM   874  C  CD    . GLU A 1 115 ? 12.063  71.320 71.864  1.00 23.36 ? 115 GLU A CD    1 
ATOM   875  O  OE1   . GLU A 1 115 ? 11.957  70.604 72.892  1.00 24.68 ? 115 GLU A OE1   1 
ATOM   876  O  OE2   . GLU A 1 115 ? 11.172  72.124 71.495  1.00 21.66 ? 115 GLU A OE2   1 
ATOM   877  N  N     . GLN A 1 116 ? 17.638  70.410 72.236  1.00 18.38 ? 116 GLN A N     1 
ATOM   878  C  CA    . GLN A 1 116 ? 18.866  70.485 73.020  1.00 17.86 ? 116 GLN A CA    1 
ATOM   879  C  C     . GLN A 1 116 ? 20.086  70.976 72.211  1.00 17.43 ? 116 GLN A C     1 
ATOM   880  O  O     . GLN A 1 116 ? 21.116  71.341 72.794  1.00 17.86 ? 116 GLN A O     1 
ATOM   881  C  CB    . GLN A 1 116 ? 19.193  69.111 73.630  1.00 18.01 ? 116 GLN A CB    1 
ATOM   882  C  CG    . GLN A 1 116 ? 18.043  68.483 74.394  1.00 18.63 ? 116 GLN A CG    1 
ATOM   883  C  CD    . GLN A 1 116 ? 17.375  69.457 75.350  1.00 18.48 ? 116 GLN A CD    1 
ATOM   884  O  OE1   . GLN A 1 116 ? 17.997  69.983 76.270  1.00 17.47 ? 116 GLN A OE1   1 
ATOM   885  N  NE2   . GLN A 1 116 ? 16.092  69.699 75.129  1.00 20.17 ? 116 GLN A NE2   1 
ATOM   886  N  N     . THR A 1 117 ? 19.976  70.994 70.882  1.00 15.55 ? 117 THR A N     1 
ATOM   887  C  CA    . THR A 1 117 ? 21.100  71.421 70.050  1.00 13.78 ? 117 THR A CA    1 
ATOM   888  C  C     . THR A 1 117 ? 21.034  72.883 69.609  1.00 14.85 ? 117 THR A C     1 
ATOM   889  O  O     . THR A 1 117 ? 22.040  73.440 69.167  1.00 15.85 ? 117 THR A O     1 
ATOM   890  C  CB    . THR A 1 117 ? 21.229  70.552 68.769  1.00 10.82 ? 117 THR A CB    1 
ATOM   891  O  OG1   . THR A 1 117 ? 20.130  70.822 67.892  1.00 8.23  ? 117 THR A OG1   1 
ATOM   892  C  CG2   . THR A 1 117 ? 21.236  69.061 69.125  1.00 8.69  ? 117 THR A CG2   1 
ATOM   893  N  N     . LEU A 1 118 ? 19.860  73.497 69.735  1.00 14.80 ? 118 LEU A N     1 
ATOM   894  C  CA    . LEU A 1 118 ? 19.648  74.883 69.321  1.00 14.83 ? 118 LEU A CA    1 
ATOM   895  C  C     . LEU A 1 118 ? 20.543  75.908 70.016  1.00 16.81 ? 118 LEU A C     1 
ATOM   896  O  O     . LEU A 1 118 ? 21.090  76.805 69.361  1.00 18.25 ? 118 LEU A O     1 
ATOM   897  C  CB    . LEU A 1 118 ? 18.181  75.282 69.531  1.00 13.42 ? 118 LEU A CB    1 
ATOM   898  C  CG    . LEU A 1 118 ? 17.109  74.390 68.901  1.00 12.80 ? 118 LEU A CG    1 
ATOM   899  C  CD1   . LEU A 1 118 ? 15.750  74.951 69.220  1.00 11.68 ? 118 LEU A CD1   1 
ATOM   900  C  CD2   . LEU A 1 118 ? 17.297  74.296 67.398  1.00 12.60 ? 118 LEU A CD2   1 
ATOM   901  N  N     . TYR A 1 119 ? 20.699  75.798 71.332  1.00 17.25 ? 119 TYR A N     1 
ATOM   902  C  CA    . TYR A 1 119 ? 21.530  76.764 72.043  1.00 17.97 ? 119 TYR A CA    1 
ATOM   903  C  C     . TYR A 1 119 ? 22.901  76.277 72.496  1.00 19.09 ? 119 TYR A C     1 
ATOM   904  O  O     . TYR A 1 119 ? 23.029  75.216 73.118  1.00 19.21 ? 119 TYR A O     1 
ATOM   905  C  CB    . TYR A 1 119 ? 20.777  77.323 73.248  1.00 17.35 ? 119 TYR A CB    1 
ATOM   906  C  CG    . TYR A 1 119 ? 19.458  77.979 72.888  1.00 17.39 ? 119 TYR A CG    1 
ATOM   907  C  CD1   . TYR A 1 119 ? 18.293  77.218 72.731  1.00 17.05 ? 119 TYR A CD1   1 
ATOM   908  C  CD2   . TYR A 1 119 ? 19.382  79.355 72.672  1.00 15.78 ? 119 TYR A CD2   1 
ATOM   909  C  CE1   . TYR A 1 119 ? 17.089  77.813 72.374  1.00 15.10 ? 119 TYR A CE1   1 
ATOM   910  C  CE2   . TYR A 1 119 ? 18.191  79.957 72.312  1.00 15.62 ? 119 TYR A CE2   1 
ATOM   911  C  CZ    . TYR A 1 119 ? 17.041  79.185 72.164  1.00 16.13 ? 119 TYR A CZ    1 
ATOM   912  O  OH    . TYR A 1 119 ? 15.847  79.800 71.821  1.00 15.16 ? 119 TYR A OH    1 
ATOM   913  N  N     . PHE A 1 120 ? 23.917  77.081 72.183  1.00 20.52 ? 120 PHE A N     1 
ATOM   914  C  CA    . PHE A 1 120 ? 25.305  76.794 72.539  1.00 21.76 ? 120 PHE A CA    1 
ATOM   915  C  C     . PHE A 1 120 ? 25.774  77.645 73.728  1.00 23.49 ? 120 PHE A C     1 
ATOM   916  O  O     . PHE A 1 120 ? 25.093  78.591 74.146  1.00 23.45 ? 120 PHE A O     1 
ATOM   917  C  CB    . PHE A 1 120 ? 26.212  77.046 71.331  1.00 21.79 ? 120 PHE A CB    1 
ATOM   918  C  CG    . PHE A 1 120 ? 25.958  76.114 70.175  1.00 22.15 ? 120 PHE A CG    1 
ATOM   919  C  CD1   . PHE A 1 120 ? 24.697  76.029 69.588  1.00 21.58 ? 120 PHE A CD1   1 
ATOM   920  C  CD2   . PHE A 1 120 ? 26.979  75.310 69.676  1.00 22.00 ? 120 PHE A CD2   1 
ATOM   921  C  CE1   . PHE A 1 120 ? 24.455  75.159 68.526  1.00 20.79 ? 120 PHE A CE1   1 
ATOM   922  C  CE2   . PHE A 1 120 ? 26.745  74.433 68.610  1.00 21.98 ? 120 PHE A CE2   1 
ATOM   923  C  CZ    . PHE A 1 120 ? 25.482  74.358 68.037  1.00 20.75 ? 120 PHE A CZ    1 
ATOM   924  N  N     . LYS A 1 121 ? 26.946  77.312 74.263  1.00 25.01 ? 121 LYS A N     1 
ATOM   925  C  CA    . LYS A 1 121 ? 27.493  78.031 75.407  1.00 26.26 ? 121 LYS A CA    1 
ATOM   926  C  C     . LYS A 1 121 ? 27.714  79.507 75.127  1.00 25.67 ? 121 LYS A C     1 
ATOM   927  O  O     . LYS A 1 121 ? 27.828  80.311 76.042  1.00 25.66 ? 121 LYS A O     1 
ATOM   928  C  CB    . LYS A 1 121 ? 28.809  77.383 75.872  1.00 28.60 ? 121 LYS A CB    1 
ATOM   929  C  CG    . LYS A 1 121 ? 29.466  78.100 77.068  1.00 33.25 ? 121 LYS A CG    1 
ATOM   930  C  CD    . LYS A 1 121 ? 30.517  77.245 77.804  1.00 35.72 ? 121 LYS A CD    1 
ATOM   931  C  CE    . LYS A 1 121 ? 29.872  76.014 78.475  1.00 38.03 ? 121 LYS A CE    1 
ATOM   932  N  NZ    . LYS A 1 121 ? 30.826  75.173 79.276  1.00 37.31 ? 121 LYS A NZ    1 
ATOM   933  N  N     . ASP A 1 122 ? 27.758  79.872 73.860  1.00 25.97 ? 122 ASP A N     1 
ATOM   934  C  CA    . ASP A 1 122 ? 27.990  81.257 73.516  1.00 26.63 ? 122 ASP A CA    1 
ATOM   935  C  C     . ASP A 1 122 ? 26.934  81.827 72.579  1.00 27.14 ? 122 ASP A C     1 
ATOM   936  O  O     . ASP A 1 122 ? 27.210  82.729 71.790  1.00 27.79 ? 122 ASP A O     1 
ATOM   937  C  CB    . ASP A 1 122 ? 29.406  81.404 72.934  1.00 27.66 ? 122 ASP A CB    1 
ATOM   938  C  CG    . ASP A 1 122 ? 29.759  80.295 71.944  1.00 28.79 ? 122 ASP A CG    1 
ATOM   939  O  OD1   . ASP A 1 122 ? 29.684  79.099 72.315  1.00 28.52 ? 122 ASP A OD1   1 
ATOM   940  O  OD2   . ASP A 1 122 ? 30.125  80.619 70.791  1.00 31.00 ? 122 ASP A OD2   1 
ATOM   941  N  N     . GLY A 1 123 ? 25.714  81.301 72.688  1.00 26.94 ? 123 GLY A N     1 
ATOM   942  C  CA    . GLY A 1 123 ? 24.620  81.779 71.861  1.00 26.12 ? 123 GLY A CA    1 
ATOM   943  C  C     . GLY A 1 123 ? 23.985  80.736 70.956  1.00 26.03 ? 123 GLY A C     1 
ATOM   944  O  O     . GLY A 1 123 ? 24.391  79.572 70.956  1.00 25.74 ? 123 GLY A O     1 
ATOM   945  N  N     . PRO A 1 124 ? 22.957  81.128 70.184  1.00 25.71 ? 124 PRO A N     1 
ATOM   946  C  CA    . PRO A 1 124 ? 22.223  80.271 69.248  1.00 25.68 ? 124 PRO A CA    1 
ATOM   947  C  C     . PRO A 1 124 ? 23.026  79.925 67.988  1.00 25.13 ? 124 PRO A C     1 
ATOM   948  O  O     . PRO A 1 124 ? 23.989  80.613 67.630  1.00 24.77 ? 124 PRO A O     1 
ATOM   949  C  CB    . PRO A 1 124 ? 20.987  81.117 68.909  1.00 25.85 ? 124 PRO A CB    1 
ATOM   950  C  CG    . PRO A 1 124 ? 20.889  82.088 70.093  1.00 25.55 ? 124 PRO A CG    1 
ATOM   951  C  CD    . PRO A 1 124 ? 22.342  82.462 70.199  1.00 25.57 ? 124 PRO A CD    1 
ATOM   952  N  N     . LEU A 1 125 ? 22.593  78.860 67.322  1.00 23.78 ? 125 LEU A N     1 
ATOM   953  C  CA    . LEU A 1 125 ? 23.211  78.366 66.105  1.00 22.71 ? 125 LEU A CA    1 
ATOM   954  C  C     . LEU A 1 125 ? 23.452  79.424 65.022  1.00 22.23 ? 125 LEU A C     1 
ATOM   955  O  O     . LEU A 1 125 ? 22.672  80.366 64.874  1.00 22.05 ? 125 LEU A O     1 
ATOM   956  C  CB    . LEU A 1 125 ? 22.346  77.237 65.538  1.00 22.87 ? 125 LEU A CB    1 
ATOM   957  C  CG    . LEU A 1 125 ? 20.850  77.523 65.300  1.00 22.36 ? 125 LEU A CG    1 
ATOM   958  C  CD1   . LEU A 1 125 ? 20.234  76.356 64.554  1.00 20.55 ? 125 LEU A CD1   1 
ATOM   959  C  CD2   . LEU A 1 125 ? 20.116  77.749 66.622  1.00 21.12 ? 125 LEU A CD2   1 
ATOM   960  N  N     . ASN A 1 126 ? 24.550  79.263 64.279  1.00 21.75 ? 126 ASN A N     1 
ATOM   961  C  CA    . ASN A 1 126 ? 24.905  80.163 63.176  1.00 20.42 ? 126 ASN A CA    1 
ATOM   962  C  C     . ASN A 1 126 ? 24.520  79.451 61.893  1.00 19.28 ? 126 ASN A C     1 
ATOM   963  O  O     . ASN A 1 126 ? 24.190  80.076 60.883  1.00 17.90 ? 126 ASN A O     1 
ATOM   964  C  CB    . ASN A 1 126 ? 26.415  80.381 63.079  1.00 21.69 ? 126 ASN A CB    1 
ATOM   965  C  CG    . ASN A 1 126 ? 26.999  80.942 64.320  1.00 23.32 ? 126 ASN A CG    1 
ATOM   966  O  OD1   . ASN A 1 126 ? 26.510  81.934 64.854  1.00 25.28 ? 126 ASN A OD1   1 
ATOM   967  N  ND2   . ASN A 1 126 ? 28.071  80.330 64.791  1.00 25.84 ? 126 ASN A ND2   1 
HETATM 968  N  N     . MSE A 1 127 ? 24.592  78.125 61.955  1.00 18.44 ? 127 MSE A N     1 
HETATM 969  C  CA    . MSE A 1 127 ? 24.332  77.269 60.815  1.00 17.04 ? 127 MSE A CA    1 
HETATM 970  C  C     . MSE A 1 127 ? 23.392  76.097 61.089  1.00 16.45 ? 127 MSE A C     1 
HETATM 971  O  O     . MSE A 1 127 ? 23.216  75.652 62.238  1.00 15.49 ? 127 MSE A O     1 
HETATM 972  C  CB    . MSE A 1 127 ? 25.679  76.733 60.314  1.00 18.12 ? 127 MSE A CB    1 
HETATM 973  C  CG    . MSE A 1 127 ? 26.606  77.833 59.843  1.00 19.91 ? 127 MSE A CG    1 
HETATM 974  SE SE    . MSE A 1 127 ? 25.966  78.547 58.242  1.00 23.47 ? 127 MSE A SE    1 
HETATM 975  C  CE    . MSE A 1 127 ? 27.245  79.811 58.003  1.00 22.87 ? 127 MSE A CE    1 
ATOM   976  N  N     . ILE A 1 128 ? 22.792  75.604 60.012  1.00 15.39 ? 128 ILE A N     1 
ATOM   977  C  CA    . ILE A 1 128 ? 21.911  74.452 60.081  1.00 15.59 ? 128 ILE A CA    1 
ATOM   978  C  C     . ILE A 1 128 ? 22.351  73.419 59.060  1.00 15.08 ? 128 ILE A C     1 
ATOM   979  O  O     . ILE A 1 128 ? 22.401  73.707 57.867  1.00 14.63 ? 128 ILE A O     1 
ATOM   980  C  CB    . ILE A 1 128 ? 20.438  74.802 59.762  1.00 16.51 ? 128 ILE A CB    1 
ATOM   981  C  CG1   . ILE A 1 128 ? 19.861  75.721 60.839  1.00 17.19 ? 128 ILE A CG1   1 
ATOM   982  C  CG2   . ILE A 1 128 ? 19.607  73.524 59.706  1.00 16.17 ? 128 ILE A CG2   1 
ATOM   983  C  CD1   . ILE A 1 128 ? 18.410  76.085 60.601  1.00 16.77 ? 128 ILE A CD1   1 
ATOM   984  N  N     . LEU A 1 129 ? 22.698  72.227 59.533  1.00 15.12 ? 129 LEU A N     1 
ATOM   985  C  CA    . LEU A 1 129 ? 23.077  71.132 58.642  1.00 14.36 ? 129 LEU A CA    1 
ATOM   986  C  C     . LEU A 1 129 ? 21.895  70.199 58.880  1.00 14.18 ? 129 LEU A C     1 
ATOM   987  O  O     . LEU A 1 129 ? 21.785  69.559 59.936  1.00 14.20 ? 129 LEU A O     1 
ATOM   988  C  CB    . LEU A 1 129 ? 24.404  70.484 59.071  1.00 12.37 ? 129 LEU A CB    1 
ATOM   989  C  CG    . LEU A 1 129 ? 25.055  69.616 57.985  1.00 11.90 ? 129 LEU A CG    1 
ATOM   990  C  CD1   . LEU A 1 129 ? 26.486  69.289 58.377  1.00 12.47 ? 129 LEU A CD1   1 
ATOM   991  C  CD2   . LEU A 1 129 ? 24.239  68.359 57.748  1.00 11.66 ? 129 LEU A CD2   1 
ATOM   992  N  N     . ASP A 1 130 ? 20.999  70.142 57.902  1.00 13.53 ? 130 ASP A N     1 
ATOM   993  C  CA    . ASP A 1 130 ? 19.785  69.355 58.040  1.00 13.47 ? 130 ASP A CA    1 
ATOM   994  C  C     . ASP A 1 130 ? 19.655  68.218 57.033  1.00 13.69 ? 130 ASP A C     1 
ATOM   995  O  O     . ASP A 1 130 ? 20.219  68.275 55.939  1.00 13.49 ? 130 ASP A O     1 
ATOM   996  C  CB    . ASP A 1 130 ? 18.584  70.293 57.885  1.00 12.28 ? 130 ASP A CB    1 
ATOM   997  C  CG    . ASP A 1 130 ? 17.368  69.810 58.617  1.00 11.33 ? 130 ASP A CG    1 
ATOM   998  O  OD1   . ASP A 1 130 ? 17.277  68.596 58.894  1.00 14.04 ? 130 ASP A OD1   1 
ATOM   999  O  OD2   . ASP A 1 130 ? 16.489  70.644 58.904  1.00 11.74 ? 130 ASP A OD2   1 
ATOM   1000 N  N     . ASP A 1 131 ? 18.898  67.191 57.420  1.00 15.34 ? 131 ASP A N     1 
ATOM   1001 C  CA    . ASP A 1 131 ? 18.615  66.036 56.569  1.00 16.23 ? 131 ASP A CA    1 
ATOM   1002 C  C     . ASP A 1 131 ? 17.133  65.725 56.771  1.00 16.95 ? 131 ASP A C     1 
ATOM   1003 O  O     . ASP A 1 131 ? 16.773  65.038 57.726  1.00 16.56 ? 131 ASP A O     1 
ATOM   1004 C  CB    . ASP A 1 131 ? 19.431  64.822 56.999  1.00 17.11 ? 131 ASP A CB    1 
ATOM   1005 C  CG    . ASP A 1 131 ? 19.246  63.627 56.062  1.00 18.92 ? 131 ASP A CG    1 
ATOM   1006 O  OD1   . ASP A 1 131 ? 18.096  63.356 55.633  1.00 18.28 ? 131 ASP A OD1   1 
ATOM   1007 O  OD2   . ASP A 1 131 ? 20.253  62.940 55.771  1.00 20.62 ? 131 ASP A OD2   1 
ATOM   1008 N  N     . GLY A 1 132 ? 16.281  66.239 55.886  1.00 17.77 ? 132 GLY A N     1 
ATOM   1009 C  CA    . GLY A 1 132 ? 14.850  65.996 56.006  1.00 18.47 ? 132 GLY A CA    1 
ATOM   1010 C  C     . GLY A 1 132 ? 14.052  67.272 56.218  1.00 19.35 ? 132 GLY A C     1 
ATOM   1011 O  O     . GLY A 1 132 ? 12.844  67.319 55.958  1.00 19.12 ? 132 GLY A O     1 
ATOM   1012 N  N     . GLY A 1 133 ? 14.729  68.311 56.702  1.00 19.52 ? 133 GLY A N     1 
ATOM   1013 C  CA    . GLY A 1 133 ? 14.075  69.584 56.930  1.00 19.64 ? 133 GLY A CA    1 
ATOM   1014 C  C     . GLY A 1 133 ? 13.439  69.752 58.297  1.00 20.64 ? 133 GLY A C     1 
ATOM   1015 O  O     . GLY A 1 133 ? 12.847  70.797 58.566  1.00 21.21 ? 133 GLY A O     1 
ATOM   1016 N  N     . ASP A 1 134 ? 13.541  68.752 59.171  1.00 20.69 ? 134 ASP A N     1 
ATOM   1017 C  CA    . ASP A 1 134 ? 12.931  68.894 60.484  1.00 20.36 ? 134 ASP A CA    1 
ATOM   1018 C  C     . ASP A 1 134 ? 13.530  70.050 61.276  1.00 20.35 ? 134 ASP A C     1 
ATOM   1019 O  O     . ASP A 1 134 ? 12.796  70.823 61.897  1.00 20.48 ? 134 ASP A O     1 
ATOM   1020 C  CB    . ASP A 1 134 ? 13.043  67.608 61.313  1.00 21.43 ? 134 ASP A CB    1 
ATOM   1021 C  CG    . ASP A 1 134 ? 12.093  66.527 60.852  1.00 22.28 ? 134 ASP A CG    1 
ATOM   1022 O  OD1   . ASP A 1 134 ? 10.921  66.861 60.575  1.00 23.28 ? 134 ASP A OD1   1 
ATOM   1023 O  OD2   . ASP A 1 134 ? 12.503  65.344 60.796  1.00 23.50 ? 134 ASP A OD2   1 
ATOM   1024 N  N     . LEU A 1 135 ? 14.854  70.182 61.262  1.00 19.34 ? 135 LEU A N     1 
ATOM   1025 C  CA    . LEU A 1 135 ? 15.475  71.258 62.028  1.00 18.78 ? 135 LEU A CA    1 
ATOM   1026 C  C     . LEU A 1 135 ? 15.081  72.597 61.423  1.00 18.89 ? 135 LEU A C     1 
ATOM   1027 O  O     . LEU A 1 135 ? 14.517  73.461 62.098  1.00 19.90 ? 135 LEU A O     1 
ATOM   1028 C  CB    . LEU A 1 135 ? 17.002  71.133 62.020  1.00 17.77 ? 135 LEU A CB    1 
ATOM   1029 C  CG    . LEU A 1 135 ? 17.764  71.837 63.148  1.00 15.59 ? 135 LEU A CG    1 
ATOM   1030 C  CD1   . LEU A 1 135 ? 19.237  71.848 62.782  1.00 15.00 ? 135 LEU A CD1   1 
ATOM   1031 C  CD2   . LEU A 1 135 ? 17.275  73.251 63.356  1.00 14.85 ? 135 LEU A CD2   1 
ATOM   1032 N  N     . THR A 1 136 ? 15.379  72.767 60.145  1.00 19.30 ? 136 THR A N     1 
ATOM   1033 C  CA    . THR A 1 136 ? 15.059  74.015 59.482  1.00 21.20 ? 136 THR A CA    1 
ATOM   1034 C  C     . THR A 1 136 ? 13.571  74.333 59.604  1.00 21.52 ? 136 THR A C     1 
ATOM   1035 O  O     . THR A 1 136 ? 13.181  75.497 59.703  1.00 21.94 ? 136 THR A O     1 
ATOM   1036 C  CB    . THR A 1 136 ? 15.467  73.986 57.984  1.00 21.43 ? 136 THR A CB    1 
ATOM   1037 O  OG1   . THR A 1 136 ? 14.772  72.937 57.314  1.00 24.97 ? 136 THR A OG1   1 
ATOM   1038 C  CG2   . THR A 1 136 ? 16.946  73.732 57.840  1.00 22.18 ? 136 THR A CG2   1 
ATOM   1039 N  N     . ASN A 1 137 ? 12.739  73.300 59.623  1.00 22.06 ? 137 ASN A N     1 
ATOM   1040 C  CA    . ASN A 1 137 ? 11.298  73.516 59.721  1.00 22.59 ? 137 ASN A CA    1 
ATOM   1041 C  C     . ASN A 1 137 ? 10.914  73.966 61.130  1.00 21.39 ? 137 ASN A C     1 
ATOM   1042 O  O     . ASN A 1 137 ? 10.110  74.881 61.304  1.00 19.53 ? 137 ASN A O     1 
ATOM   1043 C  CB    . ASN A 1 137 ? 10.553  72.235 59.349  1.00 25.39 ? 137 ASN A CB    1 
ATOM   1044 C  CG    . ASN A 1 137 ? 9.074   72.461 59.161  1.00 27.83 ? 137 ASN A CG    1 
ATOM   1045 O  OD1   . ASN A 1 137 ? 8.346   72.739 60.117  1.00 29.14 ? 137 ASN A OD1   1 
ATOM   1046 N  ND2   . ASN A 1 137 ? 8.619   72.360 57.914  1.00 29.66 ? 137 ASN A ND2   1 
ATOM   1047 N  N     . LEU A 1 138 ? 11.506  73.317 62.131  1.00 21.26 ? 138 LEU A N     1 
ATOM   1048 C  CA    . LEU A 1 138 ? 11.250  73.643 63.533  1.00 20.04 ? 138 LEU A CA    1 
ATOM   1049 C  C     . LEU A 1 138 ? 11.610  75.105 63.803  1.00 19.88 ? 138 LEU A C     1 
ATOM   1050 O  O     . LEU A 1 138 ? 10.818  75.851 64.382  1.00 19.69 ? 138 LEU A O     1 
ATOM   1051 C  CB    . LEU A 1 138 ? 12.060  72.717 64.463  1.00 18.33 ? 138 LEU A CB    1 
ATOM   1052 C  CG    . LEU A 1 138 ? 11.980  72.960 65.983  1.00 17.65 ? 138 LEU A CG    1 
ATOM   1053 C  CD1   . LEU A 1 138 ? 10.527  72.988 66.451  1.00 15.20 ? 138 LEU A CD1   1 
ATOM   1054 C  CD2   . LEU A 1 138 ? 12.763  71.876 66.712  1.00 16.78 ? 138 LEU A CD2   1 
ATOM   1055 N  N     . ILE A 1 139 ? 12.796  75.524 63.377  1.00 18.44 ? 139 ILE A N     1 
ATOM   1056 C  CA    . ILE A 1 139 ? 13.188  76.905 63.608  1.00 17.95 ? 139 ILE A CA    1 
ATOM   1057 C  C     . ILE A 1 139 ? 12.243  77.899 62.951  1.00 17.48 ? 139 ILE A C     1 
ATOM   1058 O  O     . ILE A 1 139 ? 11.730  78.789 63.610  1.00 17.67 ? 139 ILE A O     1 
ATOM   1059 C  CB    . ILE A 1 139 ? 14.623  77.154 63.149  1.00 17.48 ? 139 ILE A CB    1 
ATOM   1060 C  CG1   . ILE A 1 139 ? 15.570  76.445 64.121  1.00 17.33 ? 139 ILE A CG1   1 
ATOM   1061 C  CG2   . ILE A 1 139 ? 14.898  78.642 63.062  1.00 15.33 ? 139 ILE A CG2   1 
ATOM   1062 C  CD1   . ILE A 1 139 ? 17.017  76.611 63.806  1.00 18.07 ? 139 ILE A CD1   1 
ATOM   1063 N  N     . HIS A 1 140 ? 12.001  77.752 61.658  1.00 18.59 ? 140 HIS A N     1 
ATOM   1064 C  CA    . HIS A 1 140 ? 11.089  78.664 60.978  1.00 19.01 ? 140 HIS A CA    1 
ATOM   1065 C  C     . HIS A 1 140 ? 9.709   78.725 61.642  1.00 19.82 ? 140 HIS A C     1 
ATOM   1066 O  O     . HIS A 1 140 ? 9.072   79.779 61.656  1.00 19.60 ? 140 HIS A O     1 
ATOM   1067 C  CB    . HIS A 1 140 ? 10.906  78.270 59.503  1.00 18.46 ? 140 HIS A CB    1 
ATOM   1068 C  CG    . HIS A 1 140 ? 11.982  78.776 58.593  1.00 18.34 ? 140 HIS A CG    1 
ATOM   1069 N  ND1   . HIS A 1 140 ? 13.272  78.288 58.609  1.00 18.82 ? 140 HIS A ND1   1 
ATOM   1070 C  CD2   . HIS A 1 140 ? 11.959  79.739 57.639  1.00 18.22 ? 140 HIS A CD2   1 
ATOM   1071 C  CE1   . HIS A 1 140 ? 13.995  78.926 57.706  1.00 17.56 ? 140 HIS A CE1   1 
ATOM   1072 N  NE2   . HIS A 1 140 ? 13.222  79.812 57.104  1.00 17.92 ? 140 HIS A NE2   1 
ATOM   1073 N  N     . THR A 1 141 ? 9.247   77.610 62.201  1.00 20.07 ? 141 THR A N     1 
ATOM   1074 C  CA    . THR A 1 141 ? 7.925   77.603 62.801  1.00 20.97 ? 141 THR A CA    1 
ATOM   1075 C  C     . THR A 1 141 ? 7.839   77.842 64.307  1.00 21.82 ? 141 THR A C     1 
ATOM   1076 O  O     . THR A 1 141 ? 6.858   78.421 64.769  1.00 22.56 ? 141 THR A O     1 
ATOM   1077 C  CB    . THR A 1 141 ? 7.173   76.299 62.442  1.00 21.64 ? 141 THR A CB    1 
ATOM   1078 O  OG1   . THR A 1 141 ? 7.804   75.170 63.060  1.00 23.83 ? 141 THR A OG1   1 
ATOM   1079 C  CG2   . THR A 1 141 ? 7.183   76.102 60.942  1.00 20.63 ? 141 THR A CG2   1 
ATOM   1080 N  N     . LYS A 1 142 ? 8.839   77.420 65.078  1.00 22.12 ? 142 LYS A N     1 
ATOM   1081 C  CA    . LYS A 1 142 ? 8.790   77.631 66.525  1.00 21.79 ? 142 LYS A CA    1 
ATOM   1082 C  C     . LYS A 1 142 ? 9.883   78.547 67.067  1.00 21.97 ? 142 LYS A C     1 
ATOM   1083 O  O     . LYS A 1 142 ? 9.830   78.942 68.232  1.00 23.08 ? 142 LYS A O     1 
ATOM   1084 C  CB    . LYS A 1 142 ? 8.853   76.300 67.275  1.00 22.63 ? 142 LYS A CB    1 
ATOM   1085 C  CG    . LYS A 1 142 ? 7.756   75.322 66.923  1.00 25.19 ? 142 LYS A CG    1 
ATOM   1086 C  CD    . LYS A 1 142 ? 6.369   75.864 67.221  1.00 26.16 ? 142 LYS A CD    1 
ATOM   1087 C  CE    . LYS A 1 142 ? 5.307   74.806 66.901  1.00 27.85 ? 142 LYS A CE    1 
ATOM   1088 N  NZ    . LYS A 1 142 ? 3.902   75.313 67.004  1.00 29.78 ? 142 LYS A NZ    1 
ATOM   1089 N  N     . TYR A 1 143 ? 10.880  78.877 66.252  1.00 20.87 ? 143 TYR A N     1 
ATOM   1090 C  CA    . TYR A 1 143 ? 11.953  79.755 66.721  1.00 20.07 ? 143 TYR A CA    1 
ATOM   1091 C  C     . TYR A 1 143 ? 12.308  80.823 65.697  1.00 19.86 ? 143 TYR A C     1 
ATOM   1092 O  O     . TYR A 1 143 ? 13.482  81.148 65.499  1.00 21.32 ? 143 TYR A O     1 
ATOM   1093 C  CB    . TYR A 1 143 ? 13.211  78.950 67.059  1.00 19.44 ? 143 TYR A CB    1 
ATOM   1094 C  CG    . TYR A 1 143 ? 13.016  77.917 68.148  1.00 20.05 ? 143 TYR A CG    1 
ATOM   1095 C  CD1   . TYR A 1 143 ? 12.260  76.773 67.922  1.00 19.66 ? 143 TYR A CD1   1 
ATOM   1096 C  CD2   . TYR A 1 143 ? 13.605  78.077 69.402  1.00 19.78 ? 143 TYR A CD2   1 
ATOM   1097 C  CE1   . TYR A 1 143 ? 12.097  75.810 68.907  1.00 19.78 ? 143 TYR A CE1   1 
ATOM   1098 C  CE2   . TYR A 1 143 ? 13.447  77.118 70.397  1.00 20.32 ? 143 TYR A CE2   1 
ATOM   1099 C  CZ    . TYR A 1 143 ? 12.691  75.984 70.139  1.00 20.27 ? 143 TYR A CZ    1 
ATOM   1100 O  OH    . TYR A 1 143 ? 12.546  75.011 71.104  1.00 19.56 ? 143 TYR A OH    1 
ATOM   1101 N  N     . PRO A 1 144 ? 11.292  81.417 65.059  1.00 18.90 ? 144 PRO A N     1 
ATOM   1102 C  CA    . PRO A 1 144 ? 11.527  82.449 64.050  1.00 18.54 ? 144 PRO A CA    1 
ATOM   1103 C  C     . PRO A 1 144 ? 12.482  83.560 64.461  1.00 18.82 ? 144 PRO A C     1 
ATOM   1104 O  O     . PRO A 1 144 ? 13.065  84.222 63.612  1.00 18.66 ? 144 PRO A O     1 
ATOM   1105 C  CB    . PRO A 1 144 ? 10.111  82.966 63.771  1.00 17.12 ? 144 PRO A CB    1 
ATOM   1106 C  CG    . PRO A 1 144 ? 9.376   82.657 65.065  1.00 16.57 ? 144 PRO A CG    1 
ATOM   1107 C  CD    . PRO A 1 144 ? 9.846   81.239 65.246  1.00 17.62 ? 144 PRO A CD    1 
ATOM   1108 N  N     . GLN A 1 145 ? 12.653  83.769 65.755  1.00 18.95 ? 145 GLN A N     1 
ATOM   1109 C  CA    . GLN A 1 145 ? 13.527  84.841 66.186  1.00 19.20 ? 145 GLN A CA    1 
ATOM   1110 C  C     . GLN A 1 145 ? 15.016  84.479 66.144  1.00 18.86 ? 145 GLN A C     1 
ATOM   1111 O  O     . GLN A 1 145 ? 15.867  85.372 66.056  1.00 16.90 ? 145 GLN A O     1 
ATOM   1112 C  CB    . GLN A 1 145 ? 13.066  85.314 67.562  1.00 21.34 ? 145 GLN A CB    1 
ATOM   1113 C  CG    . GLN A 1 145 ? 11.659  85.931 67.484  1.00 23.37 ? 145 GLN A CG    1 
ATOM   1114 C  CD    . GLN A 1 145 ? 10.798  85.688 68.723  1.00 24.18 ? 145 GLN A CD    1 
ATOM   1115 O  OE1   . GLN A 1 145 ? 9.662   86.151 68.785  1.00 25.39 ? 145 GLN A OE1   1 
ATOM   1116 N  NE2   . GLN A 1 145 ? 11.330  84.958 69.702  1.00 25.13 ? 145 GLN A NE2   1 
ATOM   1117 N  N     . LEU A 1 146 ? 15.322  83.176 66.189  1.00 17.99 ? 146 LEU A N     1 
ATOM   1118 C  CA    . LEU A 1 146 ? 16.706  82.697 66.111  1.00 16.68 ? 146 LEU A CA    1 
ATOM   1119 C  C     . LEU A 1 146 ? 17.129  82.806 64.643  1.00 17.27 ? 146 LEU A C     1 
ATOM   1120 O  O     . LEU A 1 146 ? 18.324  82.870 64.306  1.00 16.40 ? 146 LEU A O     1 
ATOM   1121 C  CB    . LEU A 1 146 ? 16.790  81.229 66.529  1.00 14.10 ? 146 LEU A CB    1 
ATOM   1122 C  CG    . LEU A 1 146 ? 16.324  80.853 67.929  1.00 13.15 ? 146 LEU A CG    1 
ATOM   1123 C  CD1   . LEU A 1 146 ? 16.422  79.349 68.102  1.00 12.36 ? 146 LEU A CD1   1 
ATOM   1124 C  CD2   . LEU A 1 146 ? 17.173  81.565 68.967  1.00 13.04 ? 146 LEU A CD2   1 
ATOM   1125 N  N     . LEU A 1 147 ? 16.114  82.835 63.786  1.00 17.54 ? 147 LEU A N     1 
ATOM   1126 C  CA    . LEU A 1 147 ? 16.276  82.895 62.343  1.00 17.88 ? 147 LEU A CA    1 
ATOM   1127 C  C     . LEU A 1 147 ? 17.279  83.961 61.876  1.00 18.08 ? 147 LEU A C     1 
ATOM   1128 O  O     . LEU A 1 147 ? 18.314  83.635 61.287  1.00 18.17 ? 147 LEU A O     1 
ATOM   1129 C  CB    . LEU A 1 147 ? 14.902  83.114 61.722  1.00 17.79 ? 147 LEU A CB    1 
ATOM   1130 C  CG    . LEU A 1 147 ? 14.589  82.365 60.437  1.00 18.55 ? 147 LEU A CG    1 
ATOM   1131 C  CD1   . LEU A 1 147 ? 15.013  80.902 60.572  1.00 17.45 ? 147 LEU A CD1   1 
ATOM   1132 C  CD2   . LEU A 1 147 ? 13.091  82.486 60.157  1.00 17.20 ? 147 LEU A CD2   1 
ATOM   1133 N  N     . PRO A 1 148 ? 16.981  85.254 62.107  1.00 17.61 ? 148 PRO A N     1 
ATOM   1134 C  CA    . PRO A 1 148 ? 17.923  86.299 61.681  1.00 15.39 ? 148 PRO A CA    1 
ATOM   1135 C  C     . PRO A 1 148 ? 19.314  86.150 62.320  1.00 14.19 ? 148 PRO A C     1 
ATOM   1136 O  O     . PRO A 1 148 ? 20.192  86.988 62.122  1.00 11.64 ? 148 PRO A O     1 
ATOM   1137 C  CB    . PRO A 1 148 ? 17.201  87.590 62.087  1.00 14.85 ? 148 PRO A CB    1 
ATOM   1138 C  CG    . PRO A 1 148 ? 16.340  87.137 63.257  1.00 16.60 ? 148 PRO A CG    1 
ATOM   1139 C  CD    . PRO A 1 148 ? 15.777  85.862 62.704  1.00 17.38 ? 148 PRO A CD    1 
ATOM   1140 N  N     . GLY A 1 149 ? 19.498  85.080 63.093  1.00 14.17 ? 149 GLY A N     1 
ATOM   1141 C  CA    . GLY A 1 149 ? 20.789  84.821 63.714  1.00 14.15 ? 149 GLY A CA    1 
ATOM   1142 C  C     . GLY A 1 149 ? 21.551  83.737 62.952  1.00 13.09 ? 149 GLY A C     1 
ATOM   1143 O  O     . GLY A 1 149 ? 22.758  83.565 63.126  1.00 13.16 ? 149 GLY A O     1 
ATOM   1144 N  N     . ILE A 1 150 ? 20.826  83.017 62.095  1.00 12.04 ? 150 ILE A N     1 
ATOM   1145 C  CA    . ILE A 1 150 ? 21.357  81.918 61.283  1.00 10.84 ? 150 ILE A CA    1 
ATOM   1146 C  C     . ILE A 1 150 ? 21.875  82.397 59.913  1.00 10.69 ? 150 ILE A C     1 
ATOM   1147 O  O     . ILE A 1 150 ? 21.182  83.114 59.181  1.00 9.48  ? 150 ILE A O     1 
ATOM   1148 C  CB    . ILE A 1 150 ? 20.260  80.846 61.080  1.00 10.19 ? 150 ILE A CB    1 
ATOM   1149 C  CG1   . ILE A 1 150 ? 19.852  80.280 62.438  1.00 11.16 ? 150 ILE A CG1   1 
ATOM   1150 C  CG2   . ILE A 1 150 ? 20.752  79.744 60.170  1.00 10.13 ? 150 ILE A CG2   1 
ATOM   1151 C  CD1   . ILE A 1 150 ? 18.669  79.335 62.374  1.00 11.00 ? 150 ILE A CD1   1 
ATOM   1152 N  N     . ARG A 1 151 ? 23.088  81.976 59.561  1.00 10.35 ? 151 ARG A N     1 
ATOM   1153 C  CA    . ARG A 1 151 ? 23.700  82.399 58.311  1.00 10.77 ? 151 ARG A CA    1 
ATOM   1154 C  C     . ARG A 1 151 ? 23.396  81.521 57.100  1.00 11.67 ? 151 ARG A C     1 
ATOM   1155 O  O     . ARG A 1 151 ? 23.436  82.001 55.960  1.00 10.92 ? 151 ARG A O     1 
ATOM   1156 C  CB    . ARG A 1 151 ? 25.209  82.515 58.502  1.00 11.23 ? 151 ARG A CB    1 
ATOM   1157 C  CG    . ARG A 1 151 ? 25.970  83.030 57.295  1.00 11.88 ? 151 ARG A CG    1 
ATOM   1158 C  CD    . ARG A 1 151 ? 27.409  83.328 57.674  1.00 12.76 ? 151 ARG A CD    1 
ATOM   1159 N  NE    . ARG A 1 151 ? 27.476  84.326 58.746  1.00 14.12 ? 151 ARG A NE    1 
ATOM   1160 C  CZ    . ARG A 1 151 ? 28.603  84.754 59.310  1.00 14.76 ? 151 ARG A CZ    1 
ATOM   1161 N  NH1   . ARG A 1 151 ? 29.781  84.279 58.910  1.00 16.99 ? 151 ARG A NH1   1 
ATOM   1162 N  NH2   . ARG A 1 151 ? 28.554  85.638 60.294  1.00 13.42 ? 151 ARG A NH2   1 
ATOM   1163 N  N     . GLY A 1 152 ? 23.093  80.246 57.325  1.00 11.44 ? 152 GLY A N     1 
ATOM   1164 C  CA    . GLY A 1 152 ? 22.790  79.395 56.191  1.00 12.91 ? 152 GLY A CA    1 
ATOM   1165 C  C     . GLY A 1 152 ? 22.292  78.004 56.518  1.00 14.61 ? 152 GLY A C     1 
ATOM   1166 O  O     . GLY A 1 152 ? 22.601  77.468 57.586  1.00 16.47 ? 152 GLY A O     1 
ATOM   1167 N  N     . ILE A 1 153 ? 21.502  77.438 55.603  1.00 15.35 ? 153 ILE A N     1 
ATOM   1168 C  CA    . ILE A 1 153 ? 20.961  76.083 55.738  1.00 15.66 ? 153 ILE A CA    1 
ATOM   1169 C  C     . ILE A 1 153 ? 21.637  75.195 54.697  1.00 15.82 ? 153 ILE A C     1 
ATOM   1170 O  O     . ILE A 1 153 ? 21.884  75.622 53.562  1.00 16.07 ? 153 ILE A O     1 
ATOM   1171 C  CB    . ILE A 1 153 ? 19.423  76.013 55.470  1.00 15.63 ? 153 ILE A CB    1 
ATOM   1172 C  CG1   . ILE A 1 153 ? 18.644  76.675 56.605  1.00 15.92 ? 153 ILE A CG1   1 
ATOM   1173 C  CG2   . ILE A 1 153 ? 18.987  74.557 55.308  1.00 14.59 ? 153 ILE A CG2   1 
ATOM   1174 C  CD1   . ILE A 1 153 ? 17.132  76.614 56.410  1.00 14.58 ? 153 ILE A CD1   1 
ATOM   1175 N  N     . SER A 1 154 ? 21.909  73.955 55.085  1.00 15.33 ? 154 SER A N     1 
ATOM   1176 C  CA    . SER A 1 154 ? 22.549  72.980 54.214  1.00 14.32 ? 154 SER A CA    1 
ATOM   1177 C  C     . SER A 1 154 ? 21.711  71.700 54.324  1.00 14.47 ? 154 SER A C     1 
ATOM   1178 O  O     . SER A 1 154 ? 21.800  70.988 55.330  1.00 14.13 ? 154 SER A O     1 
ATOM   1179 C  CB    . SER A 1 154 ? 23.977  72.746 54.715  1.00 14.26 ? 154 SER A CB    1 
ATOM   1180 O  OG    . SER A 1 154 ? 24.740  71.990 53.802  1.00 14.53 ? 154 SER A OG    1 
ATOM   1181 N  N     . GLU A 1 155 ? 20.897  71.420 53.301  1.00 15.36 ? 155 GLU A N     1 
ATOM   1182 C  CA    . GLU A 1 155 ? 20.005  70.242 53.291  1.00 16.50 ? 155 GLU A CA    1 
ATOM   1183 C  C     . GLU A 1 155 ? 20.584  69.092 52.491  1.00 16.66 ? 155 GLU A C     1 
ATOM   1184 O  O     . GLU A 1 155 ? 21.192  69.310 51.439  1.00 17.96 ? 155 GLU A O     1 
ATOM   1185 C  CB    . GLU A 1 155 ? 18.652  70.598 52.681  1.00 18.16 ? 155 GLU A CB    1 
ATOM   1186 C  CG    . GLU A 1 155 ? 17.438  70.129 53.478  1.00 20.11 ? 155 GLU A CG    1 
ATOM   1187 C  CD    . GLU A 1 155 ? 17.480  68.661 53.857  1.00 20.53 ? 155 GLU A CD    1 
ATOM   1188 O  OE1   . GLU A 1 155 ? 17.715  67.815 52.966  1.00 21.56 ? 155 GLU A OE1   1 
ATOM   1189 O  OE2   . GLU A 1 155 ? 17.258  68.358 55.048  1.00 20.11 ? 155 GLU A OE2   1 
ATOM   1190 N  N     . GLU A 1 156 ? 20.353  67.864 52.946  1.00 16.08 ? 156 GLU A N     1 
ATOM   1191 C  CA    . GLU A 1 156 ? 20.932  66.726 52.251  1.00 15.15 ? 156 GLU A CA    1 
ATOM   1192 C  C     . GLU A 1 156 ? 20.056  65.728 51.506  1.00 13.66 ? 156 GLU A C     1 
ATOM   1193 O  O     . GLU A 1 156 ? 20.519  65.118 50.541  1.00 13.19 ? 156 GLU A O     1 
ATOM   1194 C  CB    . GLU A 1 156 ? 21.809  65.925 53.205  1.00 16.22 ? 156 GLU A CB    1 
ATOM   1195 C  CG    . GLU A 1 156 ? 22.891  65.175 52.461  1.00 18.78 ? 156 GLU A CG    1 
ATOM   1196 C  CD    . GLU A 1 156 ? 23.357  63.951 53.195  1.00 19.85 ? 156 GLU A CD    1 
ATOM   1197 O  OE1   . GLU A 1 156 ? 23.680  64.071 54.389  1.00 21.53 ? 156 GLU A OE1   1 
ATOM   1198 O  OE2   . GLU A 1 156 ? 23.406  62.867 52.575  1.00 20.43 ? 156 GLU A OE2   1 
ATOM   1199 N  N     . THR A 1 157 ? 18.814  65.524 51.933  1.00 13.01 ? 157 THR A N     1 
ATOM   1200 C  CA    . THR A 1 157 ? 17.982  64.533 51.251  1.00 12.45 ? 157 THR A CA    1 
ATOM   1201 C  C     . THR A 1 157 ? 16.893  65.131 50.389  1.00 11.28 ? 157 THR A C     1 
ATOM   1202 O  O     . THR A 1 157 ? 16.509  66.279 50.565  1.00 11.02 ? 157 THR A O     1 
ATOM   1203 C  CB    . THR A 1 157 ? 17.334  63.555 52.248  1.00 13.13 ? 157 THR A CB    1 
ATOM   1204 O  OG1   . THR A 1 157 ? 16.795  62.439 51.535  1.00 14.84 ? 157 THR A OG1   1 
ATOM   1205 C  CG2   . THR A 1 157 ? 16.215  64.227 52.998  1.00 14.95 ? 157 THR A CG2   1 
ATOM   1206 N  N     . THR A 1 158 ? 16.388  64.333 49.460  1.00 11.62 ? 158 THR A N     1 
ATOM   1207 C  CA    . THR A 1 158 ? 15.346  64.781 48.539  1.00 14.01 ? 158 THR A CA    1 
ATOM   1208 C  C     . THR A 1 158 ? 14.075  65.390 49.189  1.00 14.20 ? 158 THR A C     1 
ATOM   1209 O  O     . THR A 1 158 ? 13.581  66.437 48.755  1.00 13.38 ? 158 THR A O     1 
ATOM   1210 C  CB    . THR A 1 158 ? 14.927  63.628 47.615  1.00 13.89 ? 158 THR A CB    1 
ATOM   1211 O  OG1   . THR A 1 158 ? 16.102  63.026 47.057  1.00 13.12 ? 158 THR A OG1   1 
ATOM   1212 C  CG2   . THR A 1 158 ? 14.057  64.152 46.479  1.00 13.10 ? 158 THR A CG2   1 
ATOM   1213 N  N     . THR A 1 159 ? 13.549  64.745 50.222  1.00 14.17 ? 159 THR A N     1 
ATOM   1214 C  CA    . THR A 1 159 ? 12.355  65.266 50.875  1.00 15.13 ? 159 THR A CA    1 
ATOM   1215 C  C     . THR A 1 159 ? 12.601  66.621 51.541  1.00 15.71 ? 159 THR A C     1 
ATOM   1216 O  O     . THR A 1 159 ? 11.715  67.484 51.569  1.00 16.75 ? 159 THR A O     1 
ATOM   1217 C  CB    . THR A 1 159 ? 11.837  64.279 51.935  1.00 15.51 ? 159 THR A CB    1 
ATOM   1218 O  OG1   . THR A 1 159 ? 11.467  63.052 51.293  1.00 16.35 ? 159 THR A OG1   1 
ATOM   1219 C  CG2   . THR A 1 159 ? 10.636  64.865 52.674  1.00 14.79 ? 159 THR A CG2   1 
ATOM   1220 N  N     . GLY A 1 160 ? 13.796  66.809 52.092  1.00 15.08 ? 160 GLY A N     1 
ATOM   1221 C  CA    . GLY A 1 160 ? 14.096  68.069 52.741  1.00 13.68 ? 160 GLY A CA    1 
ATOM   1222 C  C     . GLY A 1 160 ? 14.164  69.163 51.695  1.00 13.66 ? 160 GLY A C     1 
ATOM   1223 O  O     . GLY A 1 160 ? 13.512  70.198 51.804  1.00 14.21 ? 160 GLY A O     1 
ATOM   1224 N  N     . VAL A 1 161 ? 14.959  68.927 50.664  1.00 14.64 ? 161 VAL A N     1 
ATOM   1225 C  CA    . VAL A 1 161 ? 15.118  69.895 49.591  1.00 15.74 ? 161 VAL A CA    1 
ATOM   1226 C  C     . VAL A 1 161 ? 13.784  70.234 48.937  1.00 16.23 ? 161 VAL A C     1 
ATOM   1227 O  O     . VAL A 1 161 ? 13.552  71.369 48.522  1.00 15.29 ? 161 VAL A O     1 
ATOM   1228 C  CB    . VAL A 1 161 ? 16.106  69.366 48.547  1.00 14.46 ? 161 VAL A CB    1 
ATOM   1229 C  CG1   . VAL A 1 161 ? 16.114  70.250 47.348  1.00 14.20 ? 161 VAL A CG1   1 
ATOM   1230 C  CG2   . VAL A 1 161 ? 17.490  69.335 49.156  1.00 13.95 ? 161 VAL A CG2   1 
ATOM   1231 N  N     . HIS A 1 162 ? 12.899  69.252 48.853  1.00 18.36 ? 162 HIS A N     1 
ATOM   1232 C  CA    . HIS A 1 162 ? 11.598  69.498 48.264  1.00 20.32 ? 162 HIS A CA    1 
ATOM   1233 C  C     . HIS A 1 162 ? 10.906  70.603 49.072  1.00 21.51 ? 162 HIS A C     1 
ATOM   1234 O  O     . HIS A 1 162 ? 10.408  71.569 48.489  1.00 23.55 ? 162 HIS A O     1 
ATOM   1235 C  CB    . HIS A 1 162 ? 10.779  68.211 48.253  1.00 20.84 ? 162 HIS A CB    1 
ATOM   1236 C  CG    . HIS A 1 162 ? 9.462   68.329 47.549  1.00 23.68 ? 162 HIS A CG    1 
ATOM   1237 N  ND1   . HIS A 1 162 ? 8.415   69.083 48.037  1.00 25.31 ? 162 HIS A ND1   1 
ATOM   1238 C  CD2   . HIS A 1 162 ? 9.010   67.758 46.406  1.00 24.21 ? 162 HIS A CD2   1 
ATOM   1239 C  CE1   . HIS A 1 162 ? 7.375   68.970 47.229  1.00 24.78 ? 162 HIS A CE1   1 
ATOM   1240 N  NE2   . HIS A 1 162 ? 7.710   68.173 46.231  1.00 24.02 ? 162 HIS A NE2   1 
ATOM   1241 N  N     . ASN A 1 163 ? 10.889  70.493 50.402  1.00 21.53 ? 163 ASN A N     1 
ATOM   1242 C  CA    . ASN A 1 163 ? 10.260  71.540 51.217  1.00 22.56 ? 163 ASN A CA    1 
ATOM   1243 C  C     . ASN A 1 163 ? 10.967  72.891 51.116  1.00 22.14 ? 163 ASN A C     1 
ATOM   1244 O  O     . ASN A 1 163 ? 10.309  73.934 51.189  1.00 22.55 ? 163 ASN A O     1 
ATOM   1245 C  CB    . ASN A 1 163 ? 10.155  71.134 52.696  1.00 25.05 ? 163 ASN A CB    1 
ATOM   1246 C  CG    . ASN A 1 163 ? 8.921   70.268 52.986  1.00 29.51 ? 163 ASN A CG    1 
ATOM   1247 O  OD1   . ASN A 1 163 ? 8.822   69.099 52.559  1.00 30.16 ? 163 ASN A OD1   1 
ATOM   1248 N  ND2   . ASN A 1 163 ? 7.961   70.852 53.707  1.00 31.11 ? 163 ASN A ND2   1 
ATOM   1249 N  N     . LEU A 1 164 ? 12.294  72.889 50.961  1.00 20.10 ? 164 LEU A N     1 
ATOM   1250 C  CA    . LEU A 1 164 ? 13.018  74.153 50.836  1.00 17.63 ? 164 LEU A CA    1 
ATOM   1251 C  C     . LEU A 1 164 ? 12.470  74.940 49.648  1.00 17.32 ? 164 LEU A C     1 
ATOM   1252 O  O     . LEU A 1 164 ? 12.174  76.127 49.752  1.00 16.58 ? 164 LEU A O     1 
ATOM   1253 C  CB    . LEU A 1 164 ? 14.516  73.910 50.661  1.00 15.46 ? 164 LEU A CB    1 
ATOM   1254 C  CG    . LEU A 1 164 ? 15.256  73.462 51.919  1.00 14.68 ? 164 LEU A CG    1 
ATOM   1255 C  CD1   . LEU A 1 164 ? 16.715  73.146 51.604  1.00 13.52 ? 164 LEU A CD1   1 
ATOM   1256 C  CD2   . LEU A 1 164 ? 15.164  74.577 52.944  1.00 14.43 ? 164 LEU A CD2   1 
ATOM   1257 N  N     . TYR A 1 165 ? 12.321  74.270 48.515  1.00 17.50 ? 165 TYR A N     1 
ATOM   1258 C  CA    . TYR A 1 165 ? 11.788  74.927 47.334  1.00 17.08 ? 165 TYR A CA    1 
ATOM   1259 C  C     . TYR A 1 165 ? 10.360  75.391 47.585  1.00 17.33 ? 165 TYR A C     1 
ATOM   1260 O  O     . TYR A 1 165 ? 9.963   76.470 47.149  1.00 17.62 ? 165 TYR A O     1 
ATOM   1261 C  CB    . TYR A 1 165 ? 11.833  73.985 46.131  1.00 15.08 ? 165 TYR A CB    1 
ATOM   1262 C  CG    . TYR A 1 165 ? 13.238  73.723 45.611  1.00 13.96 ? 165 TYR A CG    1 
ATOM   1263 C  CD1   . TYR A 1 165 ? 13.976  74.740 45.019  1.00 12.28 ? 165 TYR A CD1   1 
ATOM   1264 C  CD2   . TYR A 1 165 ? 13.830  72.461 45.713  1.00 13.73 ? 165 TYR A CD2   1 
ATOM   1265 C  CE1   . TYR A 1 165 ? 15.264  74.515 44.543  1.00 11.51 ? 165 TYR A CE1   1 
ATOM   1266 C  CE2   . TYR A 1 165 ? 15.119  72.230 45.236  1.00 11.43 ? 165 TYR A CE2   1 
ATOM   1267 C  CZ    . TYR A 1 165 ? 15.828  73.263 44.657  1.00 12.27 ? 165 TYR A CZ    1 
ATOM   1268 O  OH    . TYR A 1 165 ? 17.116  73.062 44.208  1.00 15.55 ? 165 TYR A OH    1 
ATOM   1269 N  N     . LYS A 1 166 ? 9.590   74.577 48.298  1.00 18.59 ? 166 LYS A N     1 
ATOM   1270 C  CA    . LYS A 1 166 ? 8.204   74.922 48.607  1.00 19.68 ? 166 LYS A CA    1 
ATOM   1271 C  C     . LYS A 1 166 ? 8.186   76.182 49.471  1.00 20.84 ? 166 LYS A C     1 
ATOM   1272 O  O     . LYS A 1 166 ? 7.413   77.106 49.217  1.00 20.22 ? 166 LYS A O     1 
ATOM   1273 C  CB    . LYS A 1 166 ? 7.545   73.772 49.359  1.00 20.14 ? 166 LYS A CB    1 
ATOM   1274 C  CG    . LYS A 1 166 ? 6.068   73.936 49.612  1.00 23.62 ? 166 LYS A CG    1 
ATOM   1275 C  CD    . LYS A 1 166 ? 5.569   72.823 50.541  1.00 26.94 ? 166 LYS A CD    1 
ATOM   1276 C  CE    . LYS A 1 166 ? 4.065   72.874 50.748  1.00 27.06 ? 166 LYS A CE    1 
ATOM   1277 N  NZ    . LYS A 1 166 ? 3.358   72.630 49.450  1.00 31.64 ? 166 LYS A NZ    1 
HETATM 1278 N  N     . MSE A 1 167 ? 9.053   76.218 50.485  1.00 22.45 ? 167 MSE A N     1 
HETATM 1279 C  CA    . MSE A 1 167 ? 9.139   77.365 51.393  1.00 23.07 ? 167 MSE A CA    1 
HETATM 1280 C  C     . MSE A 1 167 ? 9.548   78.645 50.672  1.00 22.71 ? 167 MSE A C     1 
HETATM 1281 O  O     . MSE A 1 167 ? 8.905   79.691 50.833  1.00 22.85 ? 167 MSE A O     1 
HETATM 1282 C  CB    . MSE A 1 167 ? 10.135  77.096 52.528  1.00 23.69 ? 167 MSE A CB    1 
HETATM 1283 C  CG    . MSE A 1 167 ? 9.772   75.927 53.419  1.00 25.19 ? 167 MSE A CG    1 
HETATM 1284 SE SE    . MSE A 1 167 ? 10.958  75.814 54.839  1.00 25.51 ? 167 MSE A SE    1 
HETATM 1285 C  CE    . MSE A 1 167 ? 10.198  74.333 55.632  1.00 26.11 ? 167 MSE A CE    1 
HETATM 1286 N  N     . MSE A 1 168 ? 10.625  78.572 49.892  1.00 21.60 ? 168 MSE A N     1 
HETATM 1287 C  CA    . MSE A 1 168 ? 11.087  79.744 49.159  1.00 20.53 ? 168 MSE A CA    1 
HETATM 1288 C  C     . MSE A 1 168 ? 9.949   80.220 48.281  1.00 20.08 ? 168 MSE A C     1 
HETATM 1289 O  O     . MSE A 1 168 ? 9.643   81.405 48.231  1.00 19.32 ? 168 MSE A O     1 
HETATM 1290 C  CB    . MSE A 1 168 ? 12.291  79.400 48.281  1.00 19.70 ? 168 MSE A CB    1 
HETATM 1291 C  CG    . MSE A 1 168 ? 12.808  80.562 47.453  1.00 19.10 ? 168 MSE A CG    1 
HETATM 1292 SE SE    . MSE A 1 168 ? 13.406  81.949 48.548  1.00 25.35 ? 168 MSE A SE    1 
HETATM 1293 C  CE    . MSE A 1 168 ? 13.915  83.083 47.205  1.00 18.91 ? 168 MSE A CE    1 
ATOM   1294 N  N     . ALA A 1 169 ? 9.319   79.270 47.600  1.00 20.22 ? 169 ALA A N     1 
ATOM   1295 C  CA    . ALA A 1 169 ? 8.208   79.556 46.708  1.00 20.14 ? 169 ALA A CA    1 
ATOM   1296 C  C     . ALA A 1 169 ? 7.032   80.221 47.418  1.00 20.24 ? 169 ALA A C     1 
ATOM   1297 O  O     . ALA A 1 169 ? 6.189   80.829 46.771  1.00 20.77 ? 169 ALA A O     1 
ATOM   1298 C  CB    . ALA A 1 169 ? 7.749   78.275 46.039  1.00 19.71 ? 169 ALA A CB    1 
ATOM   1299 N  N     . ASN A 1 170 ? 6.968   80.106 48.740  1.00 20.60 ? 170 ASN A N     1 
ATOM   1300 C  CA    . ASN A 1 170 ? 5.882   80.724 49.489  1.00 20.68 ? 170 ASN A CA    1 
ATOM   1301 C  C     . ASN A 1 170 ? 6.391   81.808 50.426  1.00 20.35 ? 170 ASN A C     1 
ATOM   1302 O  O     . ASN A 1 170 ? 5.834   82.030 51.502  1.00 21.42 ? 170 ASN A O     1 
ATOM   1303 C  CB    . ASN A 1 170 ? 5.107   79.657 50.271  1.00 23.43 ? 170 ASN A CB    1 
ATOM   1304 C  CG    . ASN A 1 170 ? 4.458   78.625 49.349  1.00 25.32 ? 170 ASN A CG    1 
ATOM   1305 O  OD1   . ASN A 1 170 ? 3.844   78.990 48.339  1.00 25.98 ? 170 ASN A OD1   1 
ATOM   1306 N  ND2   . ASN A 1 170 ? 4.578   77.340 49.696  1.00 25.01 ? 170 ASN A ND2   1 
ATOM   1307 N  N     . GLY A 1 171 ? 7.459   82.478 50.005  1.00 19.04 ? 171 GLY A N     1 
ATOM   1308 C  CA    . GLY A 1 171 ? 8.048   83.538 50.798  1.00 18.11 ? 171 GLY A CA    1 
ATOM   1309 C  C     . GLY A 1 171 ? 8.291   83.198 52.255  1.00 18.46 ? 171 GLY A C     1 
ATOM   1310 O  O     . GLY A 1 171 ? 8.354   84.099 53.088  1.00 19.86 ? 171 GLY A O     1 
ATOM   1311 N  N     . ILE A 1 172 ? 8.444   81.919 52.577  1.00 17.43 ? 172 ILE A N     1 
ATOM   1312 C  CA    . ILE A 1 172 ? 8.668   81.530 53.959  1.00 18.02 ? 172 ILE A CA    1 
ATOM   1313 C  C     . ILE A 1 172 ? 10.139  81.253 54.280  1.00 18.49 ? 172 ILE A C     1 
ATOM   1314 O  O     . ILE A 1 172 ? 10.573  81.393 55.434  1.00 19.13 ? 172 ILE A O     1 
ATOM   1315 C  CB    . ILE A 1 172 ? 7.824   80.285 54.323  1.00 19.50 ? 172 ILE A CB    1 
ATOM   1316 C  CG1   . ILE A 1 172 ? 6.335   80.592 54.134  1.00 19.09 ? 172 ILE A CG1   1 
ATOM   1317 C  CG2   . ILE A 1 172 ? 8.084   79.880 55.783  1.00 20.23 ? 172 ILE A CG2   1 
ATOM   1318 C  CD1   . ILE A 1 172 ? 5.427   79.407 54.444  1.00 20.12 ? 172 ILE A CD1   1 
ATOM   1319 N  N     . LEU A 1 173 ? 10.909  80.861 53.271  1.00 17.91 ? 173 LEU A N     1 
ATOM   1320 C  CA    . LEU A 1 173 ? 12.321  80.580 53.491  1.00 17.34 ? 173 LEU A CA    1 
ATOM   1321 C  C     . LEU A 1 173 ? 12.974  81.896 53.865  1.00 17.31 ? 173 LEU A C     1 
ATOM   1322 O  O     . LEU A 1 173 ? 12.911  82.859 53.098  1.00 17.31 ? 173 LEU A O     1 
ATOM   1323 C  CB    . LEU A 1 173 ? 12.947  79.993 52.221  1.00 16.83 ? 173 LEU A CB    1 
ATOM   1324 C  CG    . LEU A 1 173 ? 14.340  79.384 52.352  1.00 14.90 ? 173 LEU A CG    1 
ATOM   1325 C  CD1   . LEU A 1 173 ? 15.331  80.475 52.635  1.00 18.01 ? 173 LEU A CD1   1 
ATOM   1326 C  CD2   . LEU A 1 173 ? 14.351  78.347 53.467  1.00 16.38 ? 173 LEU A CD2   1 
ATOM   1327 N  N     . LYS A 1 174 ? 13.589  81.940 55.045  1.00 17.90 ? 174 LYS A N     1 
ATOM   1328 C  CA    . LYS A 1 174 ? 14.227  83.168 55.535  1.00 18.86 ? 174 LYS A CA    1 
ATOM   1329 C  C     . LYS A 1 174 ? 15.752  83.153 55.658  1.00 19.12 ? 174 LYS A C     1 
ATOM   1330 O  O     . LYS A 1 174 ? 16.344  84.129 56.117  1.00 18.70 ? 174 LYS A O     1 
ATOM   1331 C  CB    . LYS A 1 174 ? 13.632  83.552 56.890  1.00 18.71 ? 174 LYS A CB    1 
ATOM   1332 C  CG    . LYS A 1 174 ? 12.138  83.767 56.859  1.00 18.89 ? 174 LYS A CG    1 
ATOM   1333 C  CD    . LYS A 1 174 ? 11.780  84.847 55.856  1.00 20.31 ? 174 LYS A CD    1 
ATOM   1334 C  CE    . LYS A 1 174 ? 10.271  85.039 55.745  1.00 21.72 ? 174 LYS A CE    1 
ATOM   1335 N  NZ    . LYS A 1 174 ? 9.925   86.053 54.707  1.00 21.05 ? 174 LYS A NZ    1 
ATOM   1336 N  N     . VAL A 1 175 ? 16.388  82.057 55.255  1.00 19.59 ? 175 VAL A N     1 
ATOM   1337 C  CA    . VAL A 1 175 ? 17.840  81.955 55.332  1.00 19.78 ? 175 VAL A CA    1 
ATOM   1338 C  C     . VAL A 1 175 ? 18.387  81.227 54.101  1.00 19.18 ? 175 VAL A C     1 
ATOM   1339 O  O     . VAL A 1 175 ? 17.773  80.284 53.597  1.00 18.79 ? 175 VAL A O     1 
ATOM   1340 C  CB    . VAL A 1 175 ? 18.273  81.225 56.635  1.00 20.36 ? 175 VAL A CB    1 
ATOM   1341 C  CG1   . VAL A 1 175 ? 17.611  79.877 56.715  1.00 22.08 ? 175 VAL A CG1   1 
ATOM   1342 C  CG2   . VAL A 1 175 ? 19.782  81.060 56.680  1.00 20.44 ? 175 VAL A CG2   1 
ATOM   1343 N  N     . PRO A 1 176 ? 19.556  81.663 53.596  1.00 18.21 ? 176 PRO A N     1 
ATOM   1344 C  CA    . PRO A 1 176 ? 20.136  81.017 52.419  1.00 16.76 ? 176 PRO A CA    1 
ATOM   1345 C  C     . PRO A 1 176 ? 20.393  79.539 52.676  1.00 16.14 ? 176 PRO A C     1 
ATOM   1346 O  O     . PRO A 1 176 ? 20.930  79.167 53.727  1.00 15.68 ? 176 PRO A O     1 
ATOM   1347 C  CB    . PRO A 1 176 ? 21.421  81.811 52.210  1.00 16.26 ? 176 PRO A CB    1 
ATOM   1348 C  CG    . PRO A 1 176 ? 21.037  83.176 52.734  1.00 16.89 ? 176 PRO A CG    1 
ATOM   1349 C  CD    . PRO A 1 176 ? 20.437  82.749 54.045  1.00 17.00 ? 176 PRO A CD    1 
ATOM   1350 N  N     . ALA A 1 177 ? 19.995  78.697 51.725  1.00 15.64 ? 177 ALA A N     1 
ATOM   1351 C  CA    . ALA A 1 177 ? 20.194  77.251 51.857  1.00 15.00 ? 177 ALA A CA    1 
ATOM   1352 C  C     . ALA A 1 177 ? 20.824  76.656 50.599  1.00 13.63 ? 177 ALA A C     1 
ATOM   1353 O  O     . ALA A 1 177 ? 20.599  77.145 49.487  1.00 13.81 ? 177 ALA A O     1 
ATOM   1354 C  CB    . ALA A 1 177 ? 18.844  76.549 52.151  1.00 15.01 ? 177 ALA A CB    1 
ATOM   1355 N  N     . ILE A 1 178 ? 21.624  75.609 50.779  1.00 11.77 ? 178 ILE A N     1 
ATOM   1356 C  CA    . ILE A 1 178 ? 22.249  74.943 49.647  1.00 10.41 ? 178 ILE A CA    1 
ATOM   1357 C  C     . ILE A 1 178 ? 21.650  73.559 49.473  1.00 11.02 ? 178 ILE A C     1 
ATOM   1358 O  O     . ILE A 1 178 ? 21.527  72.799 50.435  1.00 10.54 ? 178 ILE A O     1 
ATOM   1359 C  CB    . ILE A 1 178 ? 23.787  74.824 49.820  1.00 8.95  ? 178 ILE A CB    1 
ATOM   1360 C  CG1   . ILE A 1 178 ? 24.426  76.202 49.626  1.00 7.13  ? 178 ILE A CG1   1 
ATOM   1361 C  CG2   . ILE A 1 178 ? 24.349  73.800 48.839  1.00 7.18  ? 178 ILE A CG2   1 
ATOM   1362 C  CD1   . ILE A 1 178 ? 25.938  76.174 49.527  1.00 7.67  ? 178 ILE A CD1   1 
ATOM   1363 N  N     . ASN A 1 179 ? 21.267  73.239 48.242  1.00 12.17 ? 179 ASN A N     1 
ATOM   1364 C  CA    . ASN A 1 179 ? 20.679  71.937 47.948  1.00 13.57 ? 179 ASN A CA    1 
ATOM   1365 C  C     . ASN A 1 179 ? 21.754  70.880 47.690  1.00 14.88 ? 179 ASN A C     1 
ATOM   1366 O  O     . ASN A 1 179 ? 22.123  70.616 46.540  1.00 15.52 ? 179 ASN A O     1 
ATOM   1367 C  CB    . ASN A 1 179 ? 19.739  72.041 46.740  1.00 11.58 ? 179 ASN A CB    1 
ATOM   1368 C  CG    . ASN A 1 179 ? 19.134  70.704 46.363  1.00 10.45 ? 179 ASN A CG    1 
ATOM   1369 O  OD1   . ASN A 1 179 ? 19.322  69.706 47.064  1.00 11.60 ? 179 ASN A OD1   1 
ATOM   1370 N  ND2   . ASN A 1 179 ? 18.400  70.676 45.257  1.00 7.13  ? 179 ASN A ND2   1 
ATOM   1371 N  N     . VAL A 1 180 ? 22.255  70.280 48.768  1.00 15.79 ? 180 VAL A N     1 
ATOM   1372 C  CA    . VAL A 1 180 ? 23.290  69.254 48.667  1.00 16.83 ? 180 VAL A CA    1 
ATOM   1373 C  C     . VAL A 1 180 ? 22.812  67.983 47.968  1.00 17.26 ? 180 VAL A C     1 
ATOM   1374 O  O     . VAL A 1 180 ? 23.551  67.367 47.193  1.00 17.39 ? 180 VAL A O     1 
ATOM   1375 C  CB    . VAL A 1 180 ? 23.827  68.858 50.068  1.00 17.70 ? 180 VAL A CB    1 
ATOM   1376 C  CG1   . VAL A 1 180 ? 24.716  67.622 49.962  1.00 17.72 ? 180 VAL A CG1   1 
ATOM   1377 C  CG2   . VAL A 1 180 ? 24.623  70.015 50.669  1.00 18.38 ? 180 VAL A CG2   1 
ATOM   1378 N  N     . ASN A 1 181 ? 21.574  67.584 48.232  1.00 17.76 ? 181 ASN A N     1 
ATOM   1379 C  CA    . ASN A 1 181 ? 21.074  66.364 47.627  1.00 16.87 ? 181 ASN A CA    1 
ATOM   1380 C  C     . ASN A 1 181 ? 21.194  66.337 46.114  1.00 17.17 ? 181 ASN A C     1 
ATOM   1381 O  O     . ASN A 1 181 ? 21.642  65.345 45.539  1.00 17.22 ? 181 ASN A O     1 
ATOM   1382 C  CB    . ASN A 1 181 ? 19.630  66.112 48.026  1.00 15.43 ? 181 ASN A CB    1 
ATOM   1383 C  CG    . ASN A 1 181 ? 19.020  64.973 47.245  1.00 16.98 ? 181 ASN A CG    1 
ATOM   1384 O  OD1   . ASN A 1 181 ? 18.438  65.182 46.186  1.00 17.71 ? 181 ASN A OD1   1 
ATOM   1385 N  ND2   . ASN A 1 181 ? 19.188  63.752 47.740  1.00 16.96 ? 181 ASN A ND2   1 
ATOM   1386 N  N     . ASP A 1 182 ? 20.803  67.430 45.471  1.00 16.77 ? 182 ASP A N     1 
ATOM   1387 C  CA    . ASP A 1 182 ? 20.847  67.505 44.021  1.00 15.78 ? 182 ASP A CA    1 
ATOM   1388 C  C     . ASP A 1 182 ? 22.197  67.876 43.450  1.00 14.72 ? 182 ASP A C     1 
ATOM   1389 O  O     . ASP A 1 182 ? 22.318  68.303 42.300  1.00 13.49 ? 182 ASP A O     1 
ATOM   1390 C  CB    . ASP A 1 182 ? 19.748  68.440 43.533  1.00 16.84 ? 182 ASP A CB    1 
ATOM   1391 C  CG    . ASP A 1 182 ? 18.391  67.779 43.585  1.00 17.76 ? 182 ASP A CG    1 
ATOM   1392 O  OD1   . ASP A 1 182 ? 18.350  66.539 43.441  1.00 16.43 ? 182 ASP A OD1   1 
ATOM   1393 O  OD2   . ASP A 1 182 ? 17.372  68.481 43.747  1.00 21.00 ? 182 ASP A OD2   1 
ATOM   1394 N  N     . SER A 1 183 ? 23.212  67.706 44.282  1.00 13.61 ? 183 SER A N     1 
ATOM   1395 C  CA    . SER A 1 183 ? 24.589  67.930 43.885  1.00 13.47 ? 183 SER A CA    1 
ATOM   1396 C  C     . SER A 1 183 ? 24.838  66.609 43.135  1.00 13.07 ? 183 SER A C     1 
ATOM   1397 O  O     . SER A 1 183 ? 24.547  65.549 43.670  1.00 15.30 ? 183 SER A O     1 
ATOM   1398 C  CB    . SER A 1 183 ? 25.438  68.035 45.156  1.00 13.83 ? 183 SER A CB    1 
ATOM   1399 O  OG    . SER A 1 183 ? 26.796  68.295 44.885  1.00 16.28 ? 183 SER A OG    1 
ATOM   1400 N  N     . VAL A 1 184 ? 25.339  66.642 41.906  1.00 12.67 ? 184 VAL A N     1 
ATOM   1401 C  CA    . VAL A 1 184 ? 25.537  65.395 41.146  1.00 11.65 ? 184 VAL A CA    1 
ATOM   1402 C  C     . VAL A 1 184 ? 26.093  64.213 41.929  1.00 12.24 ? 184 VAL A C     1 
ATOM   1403 O  O     . VAL A 1 184 ? 25.482  63.150 41.970  1.00 13.33 ? 184 VAL A O     1 
ATOM   1404 C  CB    . VAL A 1 184 ? 26.453  65.588 39.941  1.00 10.67 ? 184 VAL A CB    1 
ATOM   1405 C  CG1   . VAL A 1 184 ? 26.564  64.277 39.182  1.00 9.47  ? 184 VAL A CG1   1 
ATOM   1406 C  CG2   . VAL A 1 184 ? 25.904  66.681 39.037  1.00 9.58  ? 184 VAL A CG2   1 
ATOM   1407 N  N     . THR A 1 185 ? 27.262  64.399 42.534  1.00 12.83 ? 185 THR A N     1 
ATOM   1408 C  CA    . THR A 1 185 ? 27.912  63.348 43.325  1.00 12.25 ? 185 THR A CA    1 
ATOM   1409 C  C     . THR A 1 185 ? 27.166  62.937 44.592  1.00 12.01 ? 185 THR A C     1 
ATOM   1410 O  O     . THR A 1 185 ? 27.746  62.294 45.478  1.00 11.56 ? 185 THR A O     1 
ATOM   1411 C  CB    . THR A 1 185 ? 29.297  63.776 43.764  1.00 11.37 ? 185 THR A CB    1 
ATOM   1412 O  OG1   . THR A 1 185 ? 29.197  65.034 44.445  1.00 10.53 ? 185 THR A OG1   1 
ATOM   1413 C  CG2   . THR A 1 185 ? 30.211  63.894 42.576  1.00 12.30 ? 185 THR A CG2   1 
ATOM   1414 N  N     . LYS A 1 186 ? 25.899  63.319 44.700  1.00 11.76 ? 186 LYS A N     1 
ATOM   1415 C  CA    . LYS A 1 186 ? 25.113  62.943 45.864  1.00 11.31 ? 186 LYS A CA    1 
ATOM   1416 C  C     . LYS A 1 186 ? 23.896  62.150 45.389  1.00 10.90 ? 186 LYS A C     1 
ATOM   1417 O  O     . LYS A 1 186 ? 23.811  60.937 45.603  1.00 9.34  ? 186 LYS A O     1 
ATOM   1418 C  CB    . LYS A 1 186 ? 24.692  64.193 46.642  1.00 12.07 ? 186 LYS A CB    1 
ATOM   1419 C  CG    . LYS A 1 186 ? 24.120  63.911 48.029  1.00 14.30 ? 186 LYS A CG    1 
ATOM   1420 C  CD    . LYS A 1 186 ? 22.761  63.240 47.970  1.00 16.73 ? 186 LYS A CD    1 
ATOM   1421 C  CE    . LYS A 1 186 ? 22.214  62.963 49.360  1.00 15.92 ? 186 LYS A CE    1 
ATOM   1422 N  NZ    . LYS A 1 186 ? 20.832  62.408 49.273  1.00 16.40 ? 186 LYS A NZ    1 
ATOM   1423 N  N     . SER A 1 187 ? 22.979  62.834 44.712  1.00 11.91 ? 187 SER A N     1 
ATOM   1424 C  CA    . SER A 1 187 ? 21.755  62.216 44.197  1.00 13.44 ? 187 SER A CA    1 
ATOM   1425 C  C     . SER A 1 187 ? 22.009  61.051 43.239  1.00 13.85 ? 187 SER A C     1 
ATOM   1426 O  O     . SER A 1 187 ? 21.253  60.069 43.215  1.00 14.42 ? 187 SER A O     1 
ATOM   1427 C  CB    . SER A 1 187 ? 20.919  63.258 43.461  1.00 14.33 ? 187 SER A CB    1 
ATOM   1428 O  OG    . SER A 1 187 ? 21.651  63.803 42.373  1.00 14.77 ? 187 SER A OG    1 
ATOM   1429 N  N     . LYS A 1 188 ? 23.056  61.172 42.432  1.00 12.66 ? 188 LYS A N     1 
ATOM   1430 C  CA    . LYS A 1 188 ? 23.378  60.127 41.479  1.00 11.29 ? 188 LYS A CA    1 
ATOM   1431 C  C     . LYS A 1 188 ? 24.318  59.062 42.004  1.00 10.58 ? 188 LYS A C     1 
ATOM   1432 O  O     . LYS A 1 188 ? 24.788  58.219 41.240  1.00 10.46 ? 188 LYS A O     1 
ATOM   1433 C  CB    . LYS A 1 188 ? 23.933  60.734 40.186  1.00 10.91 ? 188 LYS A CB    1 
ATOM   1434 C  CG    . LYS A 1 188 ? 22.850  60.932 39.126  1.00 10.63 ? 188 LYS A CG    1 
ATOM   1435 C  CD    . LYS A 1 188 ? 22.241  59.577 38.761  1.00 10.55 ? 188 LYS A CD    1 
ATOM   1436 C  CE    . LYS A 1 188 ? 21.171  59.683 37.698  1.00 10.91 ? 188 LYS A CE    1 
ATOM   1437 N  NZ    . LYS A 1 188 ? 21.719  60.160 36.386  1.00 12.69 ? 188 LYS A NZ    1 
ATOM   1438 N  N     . PHE A 1 189 ? 24.582  59.088 43.304  1.00 9.73  ? 189 PHE A N     1 
ATOM   1439 C  CA    . PHE A 1 189 ? 25.457  58.088 43.907  1.00 10.21 ? 189 PHE A CA    1 
ATOM   1440 C  C     . PHE A 1 189 ? 24.849  57.588 45.218  1.00 11.47 ? 189 PHE A C     1 
ATOM   1441 O  O     . PHE A 1 189 ? 24.411  56.433 45.301  1.00 12.05 ? 189 PHE A O     1 
ATOM   1442 C  CB    . PHE A 1 189 ? 26.859  58.664 44.145  1.00 8.44  ? 189 PHE A CB    1 
ATOM   1443 C  CG    . PHE A 1 189 ? 27.549  59.110 42.889  1.00 8.41  ? 189 PHE A CG    1 
ATOM   1444 C  CD1   . PHE A 1 189 ? 27.183  60.293 42.261  1.00 8.42  ? 189 PHE A CD1   1 
ATOM   1445 C  CD2   . PHE A 1 189 ? 28.553  58.336 42.319  1.00 8.46  ? 189 PHE A CD2   1 
ATOM   1446 C  CE1   . PHE A 1 189 ? 27.812  60.697 41.078  1.00 8.13  ? 189 PHE A CE1   1 
ATOM   1447 C  CE2   . PHE A 1 189 ? 29.184  58.730 41.142  1.00 7.66  ? 189 PHE A CE2   1 
ATOM   1448 C  CZ    . PHE A 1 189 ? 28.815  59.910 40.522  1.00 7.18  ? 189 PHE A CZ    1 
ATOM   1449 N  N     . ASP A 1 190 ? 24.824  58.459 46.230  1.00 11.32 ? 190 ASP A N     1 
ATOM   1450 C  CA    . ASP A 1 190 ? 24.244  58.150 47.534  1.00 10.33 ? 190 ASP A CA    1 
ATOM   1451 C  C     . ASP A 1 190 ? 22.852  57.541 47.340  1.00 10.21 ? 190 ASP A C     1 
ATOM   1452 O  O     . ASP A 1 190 ? 22.624  56.384 47.680  1.00 10.11 ? 190 ASP A O     1 
ATOM   1453 C  CB    . ASP A 1 190 ? 24.134  59.441 48.363  1.00 12.87 ? 190 ASP A CB    1 
ATOM   1454 C  CG    . ASP A 1 190 ? 23.245  59.290 49.609  1.00 14.73 ? 190 ASP A CG    1 
ATOM   1455 O  OD1   . ASP A 1 190 ? 22.088  58.834 49.485  1.00 17.17 ? 190 ASP A OD1   1 
ATOM   1456 O  OD2   . ASP A 1 190 ? 23.688  59.653 50.720  1.00 15.43 ? 190 ASP A OD2   1 
ATOM   1457 N  N     . ASN A 1 191 ? 21.928  58.327 46.784  1.00 9.93  ? 191 ASN A N     1 
ATOM   1458 C  CA    . ASN A 1 191 ? 20.557  57.880 46.561  1.00 9.25  ? 191 ASN A CA    1 
ATOM   1459 C  C     . ASN A 1 191 ? 20.434  56.561 45.807  1.00 9.41  ? 191 ASN A C     1 
ATOM   1460 O  O     . ASN A 1 191 ? 19.678  55.671 46.218  1.00 8.80  ? 191 ASN A O     1 
ATOM   1461 C  CB    . ASN A 1 191 ? 19.763  58.934 45.791  1.00 9.36  ? 191 ASN A CB    1 
ATOM   1462 C  CG    . ASN A 1 191 ? 19.663  60.256 46.525  1.00 9.45  ? 191 ASN A CG    1 
ATOM   1463 O  OD1   . ASN A 1 191 ? 18.734  61.044 46.279  1.00 10.33 ? 191 ASN A OD1   1 
ATOM   1464 N  ND2   . ASN A 1 191 ? 20.617  60.523 47.411  1.00 7.00  ? 191 ASN A ND2   1 
ATOM   1465 N  N     . LEU A 1 192 ? 21.166  56.457 44.698  1.00 9.43  ? 192 LEU A N     1 
ATOM   1466 C  CA    . LEU A 1 192 ? 21.149  55.274 43.839  1.00 9.38  ? 192 LEU A CA    1 
ATOM   1467 C  C     . LEU A 1 192 ? 21.981  54.117 44.375  1.00 9.77  ? 192 LEU A C     1 
ATOM   1468 O  O     . LEU A 1 192 ? 21.432  53.116 44.849  1.00 10.43 ? 192 LEU A O     1 
ATOM   1469 C  CB    . LEU A 1 192 ? 21.645  55.649 42.441  1.00 9.18  ? 192 LEU A CB    1 
ATOM   1470 C  CG    . LEU A 1 192 ? 21.783  54.559 41.373  1.00 9.11  ? 192 LEU A CG    1 
ATOM   1471 C  CD1   . LEU A 1 192 ? 20.437  53.903 41.116  1.00 9.51  ? 192 LEU A CD1   1 
ATOM   1472 C  CD2   . LEU A 1 192 ? 22.324  55.186 40.084  1.00 9.44  ? 192 LEU A CD2   1 
ATOM   1473 N  N     . TYR A 1 193 ? 23.304  54.255 44.291  1.00 9.09  ? 193 TYR A N     1 
ATOM   1474 C  CA    . TYR A 1 193 ? 24.233  53.222 44.754  1.00 7.75  ? 193 TYR A CA    1 
ATOM   1475 C  C     . TYR A 1 193 ? 24.056  52.882 46.231  1.00 7.50  ? 193 TYR A C     1 
ATOM   1476 O  O     . TYR A 1 193 ? 24.053  51.720 46.617  1.00 7.78  ? 193 TYR A O     1 
ATOM   1477 C  CB    . TYR A 1 193 ? 25.658  53.686 44.464  1.00 8.43  ? 193 TYR A CB    1 
ATOM   1478 C  CG    . TYR A 1 193 ? 25.883  53.884 42.986  1.00 9.06  ? 193 TYR A CG    1 
ATOM   1479 C  CD1   . TYR A 1 193 ? 25.184  53.119 42.056  1.00 9.99  ? 193 TYR A CD1   1 
ATOM   1480 C  CD2   . TYR A 1 193 ? 26.775  54.836 42.510  1.00 10.04 ? 193 TYR A CD2   1 
ATOM   1481 C  CE1   . TYR A 1 193 ? 25.364  53.296 40.694  1.00 11.57 ? 193 TYR A CE1   1 
ATOM   1482 C  CE2   . TYR A 1 193 ? 26.962  55.026 41.139  1.00 11.42 ? 193 TYR A CE2   1 
ATOM   1483 C  CZ    . TYR A 1 193 ? 26.250  54.248 40.235  1.00 12.05 ? 193 TYR A CZ    1 
ATOM   1484 O  OH    . TYR A 1 193 ? 26.421  54.413 38.871  1.00 11.15 ? 193 TYR A OH    1 
ATOM   1485 N  N     . GLY A 1 194 ? 23.900  53.903 47.057  1.00 7.66  ? 194 GLY A N     1 
ATOM   1486 C  CA    . GLY A 1 194 ? 23.700  53.665 48.471  1.00 8.33  ? 194 GLY A CA    1 
ATOM   1487 C  C     . GLY A 1 194 ? 22.548  52.707 48.744  1.00 8.56  ? 194 GLY A C     1 
ATOM   1488 O  O     . GLY A 1 194 ? 22.737  51.679 49.398  1.00 9.01  ? 194 GLY A O     1 
ATOM   1489 N  N     . CYS A 1 195 ? 21.355  53.024 48.250  1.00 8.27  ? 195 CYS A N     1 
ATOM   1490 C  CA    . CYS A 1 195 ? 20.221  52.141 48.489  1.00 9.44  ? 195 CYS A CA    1 
ATOM   1491 C  C     . CYS A 1 195 ? 20.453  50.771 47.880  1.00 10.04 ? 195 CYS A C     1 
ATOM   1492 O  O     . CYS A 1 195 ? 20.137  49.748 48.499  1.00 11.30 ? 195 CYS A O     1 
ATOM   1493 C  CB    . CYS A 1 195 ? 18.934  52.724 47.910  1.00 9.71  ? 195 CYS A CB    1 
ATOM   1494 S  SG    . CYS A 1 195 ? 18.401  54.255 48.695  1.00 12.34 ? 195 CYS A SG    1 
ATOM   1495 N  N     . ARG A 1 196 ? 21.013  50.745 46.675  1.00 9.50  ? 196 ARG A N     1 
ATOM   1496 C  CA    . ARG A 1 196 ? 21.248  49.479 46.012  1.00 9.00  ? 196 ARG A CA    1 
ATOM   1497 C  C     . ARG A 1 196 ? 21.890  48.478 46.975  1.00 9.96  ? 196 ARG A C     1 
ATOM   1498 O  O     . ARG A 1 196 ? 21.670  47.265 46.851  1.00 11.05 ? 196 ARG A O     1 
ATOM   1499 C  CB    . ARG A 1 196 ? 22.114  49.676 44.768  1.00 7.54  ? 196 ARG A CB    1 
ATOM   1500 C  CG    . ARG A 1 196 ? 22.146  48.450 43.853  1.00 8.44  ? 196 ARG A CG    1 
ATOM   1501 C  CD    . ARG A 1 196 ? 22.871  48.738 42.540  1.00 8.20  ? 196 ARG A CD    1 
ATOM   1502 N  NE    . ARG A 1 196 ? 24.289  49.007 42.743  1.00 9.77  ? 196 ARG A NE    1 
ATOM   1503 C  CZ    . ARG A 1 196 ? 25.132  49.338 41.774  1.00 10.69 ? 196 ARG A CZ    1 
ATOM   1504 N  NH1   . ARG A 1 196 ? 24.700  49.446 40.525  1.00 12.38 ? 196 ARG A NH1   1 
ATOM   1505 N  NH2   . ARG A 1 196 ? 26.412  49.546 42.053  1.00 10.69 ? 196 ARG A NH2   1 
ATOM   1506 N  N     . GLU A 1 197 ? 22.649  48.976 47.954  1.00 10.56 ? 197 GLU A N     1 
ATOM   1507 C  CA    . GLU A 1 197 ? 23.302  48.089 48.920  1.00 10.61 ? 197 GLU A CA    1 
ATOM   1508 C  C     . GLU A 1 197 ? 22.690  48.046 50.320  1.00 10.72 ? 197 GLU A C     1 
ATOM   1509 O  O     . GLU A 1 197 ? 22.724  47.002 50.975  1.00 10.62 ? 197 GLU A O     1 
ATOM   1510 C  CB    . GLU A 1 197 ? 24.798  48.420 49.019  1.00 9.73  ? 197 GLU A CB    1 
ATOM   1511 C  CG    . GLU A 1 197 ? 25.626  47.933 47.826  1.00 10.60 ? 197 GLU A CG    1 
ATOM   1512 C  CD    . GLU A 1 197 ? 27.120  48.276 47.927  1.00 10.07 ? 197 GLU A CD    1 
ATOM   1513 O  OE1   . GLU A 1 197 ? 27.713  48.114 49.019  1.00 9.98  ? 197 GLU A OE1   1 
ATOM   1514 O  OE2   . GLU A 1 197 ? 27.708  48.679 46.899  1.00 8.07  ? 197 GLU A OE2   1 
ATOM   1515 N  N     . SER A 1 198 ? 22.119  49.160 50.776  1.00 11.42 ? 198 SER A N     1 
ATOM   1516 C  CA    . SER A 1 198 ? 21.525  49.220 52.117  1.00 12.56 ? 198 SER A CA    1 
ATOM   1517 C  C     . SER A 1 198 ? 20.103  48.662 52.255  1.00 13.25 ? 198 SER A C     1 
ATOM   1518 O  O     . SER A 1 198 ? 19.749  48.140 53.313  1.00 13.40 ? 198 SER A O     1 
ATOM   1519 C  CB    . SER A 1 198 ? 21.541  50.661 52.638  1.00 13.27 ? 198 SER A CB    1 
ATOM   1520 O  OG    . SER A 1 198 ? 20.787  51.517 51.797  1.00 16.00 ? 198 SER A OG    1 
ATOM   1521 N  N     . LEU A 1 199 ? 19.282  48.773 51.211  1.00 13.14 ? 199 LEU A N     1 
ATOM   1522 C  CA    . LEU A 1 199 ? 17.920  48.252 51.293  1.00 11.84 ? 199 LEU A CA    1 
ATOM   1523 C  C     . LEU A 1 199 ? 17.892  46.765 51.600  1.00 12.49 ? 199 LEU A C     1 
ATOM   1524 O  O     . LEU A 1 199 ? 17.206  46.328 52.535  1.00 13.25 ? 199 LEU A O     1 
ATOM   1525 C  CB    . LEU A 1 199 ? 17.149  48.477 49.994  1.00 11.39 ? 199 LEU A CB    1 
ATOM   1526 C  CG    . LEU A 1 199 ? 15.833  47.682 49.931  1.00 9.90  ? 199 LEU A CG    1 
ATOM   1527 C  CD1   . LEU A 1 199 ? 14.868  48.158 51.015  1.00 9.16  ? 199 LEU A CD1   1 
ATOM   1528 C  CD2   . LEU A 1 199 ? 15.205  47.848 48.569  1.00 8.76  ? 199 LEU A CD2   1 
ATOM   1529 N  N     . ILE A 1 200 ? 18.616  45.979 50.803  1.00 12.30 ? 200 ILE A N     1 
ATOM   1530 C  CA    . ILE A 1 200 ? 18.627  44.531 51.011  1.00 12.09 ? 200 ILE A CA    1 
ATOM   1531 C  C     . ILE A 1 200 ? 19.149  44.239 52.408  1.00 11.51 ? 200 ILE A C     1 
ATOM   1532 O  O     . ILE A 1 200 ? 18.683  43.323 53.096  1.00 9.78  ? 200 ILE A O     1 
ATOM   1533 C  CB    . ILE A 1 200 ? 19.530  43.797 49.972  1.00 12.17 ? 200 ILE A CB    1 
ATOM   1534 C  CG1   . ILE A 1 200 ? 18.954  43.931 48.565  1.00 12.49 ? 200 ILE A CG1   1 
ATOM   1535 C  CG2   . ILE A 1 200 ? 19.625  42.318 50.312  1.00 12.67 ? 200 ILE A CG2   1 
ATOM   1536 C  CD1   . ILE A 1 200 ? 17.601  43.254 48.400  1.00 14.15 ? 200 ILE A CD1   1 
ATOM   1537 N  N     . ASP A 1 201 ? 20.112  45.053 52.818  1.00 11.12 ? 201 ASP A N     1 
ATOM   1538 C  CA    . ASP A 1 201 ? 20.747  44.902 54.112  1.00 11.15 ? 201 ASP A CA    1 
ATOM   1539 C  C     . ASP A 1 201 ? 19.660  44.949 55.185  1.00 9.58  ? 201 ASP A C     1 
ATOM   1540 O  O     . ASP A 1 201 ? 19.513  44.021 55.983  1.00 8.21  ? 201 ASP A O     1 
ATOM   1541 C  CB    . ASP A 1 201 ? 21.748  46.044 54.320  1.00 14.15 ? 201 ASP A CB    1 
ATOM   1542 C  CG    . ASP A 1 201 ? 22.859  45.681 55.290  1.00 16.76 ? 201 ASP A CG    1 
ATOM   1543 O  OD1   . ASP A 1 201 ? 22.578  44.985 56.294  1.00 17.63 ? 201 ASP A OD1   1 
ATOM   1544 O  OD2   . ASP A 1 201 ? 24.015  46.111 55.055  1.00 19.48 ? 201 ASP A OD2   1 
ATOM   1545 N  N     . GLY A 1 202 ? 18.898  46.038 55.187  1.00 8.36  ? 202 GLY A N     1 
ATOM   1546 C  CA    . GLY A 1 202 ? 17.823  46.198 56.155  1.00 8.59  ? 202 GLY A CA    1 
ATOM   1547 C  C     . GLY A 1 202 ? 16.828  45.051 56.127  1.00 8.43  ? 202 GLY A C     1 
ATOM   1548 O  O     . GLY A 1 202 ? 16.475  44.490 57.165  1.00 8.31  ? 202 GLY A O     1 
ATOM   1549 N  N     . ILE A 1 203 ? 16.373  44.685 54.935  1.00 9.12  ? 203 ILE A N     1 
ATOM   1550 C  CA    . ILE A 1 203 ? 15.428  43.587 54.826  1.00 10.28 ? 203 ILE A CA    1 
ATOM   1551 C  C     . ILE A 1 203 ? 16.002  42.288 55.417  1.00 11.49 ? 203 ILE A C     1 
ATOM   1552 O  O     . ILE A 1 203 ? 15.357  41.643 56.265  1.00 11.79 ? 203 ILE A O     1 
ATOM   1553 C  CB    . ILE A 1 203 ? 15.039  43.344 53.370  1.00 9.84  ? 203 ILE A CB    1 
ATOM   1554 C  CG1   . ILE A 1 203 ? 14.385  44.603 52.800  1.00 9.97  ? 203 ILE A CG1   1 
ATOM   1555 C  CG2   . ILE A 1 203 ? 14.089  42.160 53.282  1.00 9.58  ? 203 ILE A CG2   1 
ATOM   1556 C  CD1   . ILE A 1 203 ? 13.889  44.441 51.378  1.00 7.20  ? 203 ILE A CD1   1 
ATOM   1557 N  N     . LYS A 1 204 ? 17.209  41.916 54.970  1.00 11.63 ? 204 LYS A N     1 
ATOM   1558 C  CA    . LYS A 1 204 ? 17.901  40.705 55.435  1.00 10.14 ? 204 LYS A CA    1 
ATOM   1559 C  C     . LYS A 1 204 ? 18.070  40.623 56.949  1.00 9.80  ? 204 LYS A C     1 
ATOM   1560 O  O     . LYS A 1 204 ? 17.664  39.642 57.567  1.00 10.34 ? 204 LYS A O     1 
ATOM   1561 C  CB    . LYS A 1 204 ? 19.290  40.596 54.782  1.00 10.86 ? 204 LYS A CB    1 
ATOM   1562 C  CG    . LYS A 1 204 ? 19.308  40.100 53.331  1.00 9.12  ? 204 LYS A CG    1 
ATOM   1563 C  CD    . LYS A 1 204 ? 18.998  38.613 53.268  1.00 9.20  ? 204 LYS A CD    1 
ATOM   1564 C  CE    . LYS A 1 204 ? 18.998  38.113 51.834  1.00 6.89  ? 204 LYS A CE    1 
ATOM   1565 N  NZ    . LYS A 1 204 ? 18.717  36.653 51.771  1.00 5.65  ? 204 LYS A NZ    1 
ATOM   1566 N  N     . ARG A 1 205 ? 18.680  41.645 57.544  1.00 9.51  ? 205 ARG A N     1 
ATOM   1567 C  CA    . ARG A 1 205 ? 18.902  41.655 58.988  1.00 8.88  ? 205 ARG A CA    1 
ATOM   1568 C  C     . ARG A 1 205 ? 17.591  41.554 59.739  1.00 9.09  ? 205 ARG A C     1 
ATOM   1569 O  O     . ARG A 1 205 ? 17.523  40.953 60.812  1.00 8.82  ? 205 ARG A O     1 
ATOM   1570 C  CB    . ARG A 1 205 ? 19.649  42.928 59.414  1.00 9.28  ? 205 ARG A CB    1 
ATOM   1571 C  CG    . ARG A 1 205 ? 20.999  43.066 58.743  1.00 9.41  ? 205 ARG A CG    1 
ATOM   1572 C  CD    . ARG A 1 205 ? 21.856  44.149 59.335  1.00 9.99  ? 205 ARG A CD    1 
ATOM   1573 N  NE    . ARG A 1 205 ? 23.098  44.281 58.582  1.00 11.02 ? 205 ARG A NE    1 
ATOM   1574 C  CZ    . ARG A 1 205 ? 24.136  45.018 58.969  1.00 13.23 ? 205 ARG A CZ    1 
ATOM   1575 N  NH1   . ARG A 1 205 ? 24.083  45.689 60.114  1.00 16.10 ? 205 ARG A NH1   1 
ATOM   1576 N  NH2   . ARG A 1 205 ? 25.220  45.114 58.205  1.00 12.40 ? 205 ARG A NH2   1 
ATOM   1577 N  N     . ALA A 1 206 ? 16.546  42.138 59.165  1.00 10.42 ? 206 ALA A N     1 
ATOM   1578 C  CA    . ALA A 1 206 ? 15.228  42.108 59.788  1.00 10.54 ? 206 ALA A CA    1 
ATOM   1579 C  C     . ALA A 1 206 ? 14.452  40.812 59.525  1.00 11.06 ? 206 ALA A C     1 
ATOM   1580 O  O     . ALA A 1 206 ? 13.731  40.340 60.404  1.00 12.44 ? 206 ALA A O     1 
ATOM   1581 C  CB    . ALA A 1 206 ? 14.405  43.305 59.320  1.00 8.85  ? 206 ALA A CB    1 
ATOM   1582 N  N     . THR A 1 207 ? 14.611  40.212 58.346  1.00 10.49 ? 207 THR A N     1 
ATOM   1583 C  CA    . THR A 1 207 ? 13.846  39.009 58.029  1.00 10.49 ? 207 THR A CA    1 
ATOM   1584 C  C     . THR A 1 207 ? 14.598  37.772 57.528  1.00 10.31 ? 207 THR A C     1 
ATOM   1585 O  O     . THR A 1 207 ? 14.077  36.658 57.577  1.00 8.13  ? 207 THR A O     1 
ATOM   1586 C  CB    . THR A 1 207 ? 12.777  39.351 56.986  1.00 12.22 ? 207 THR A CB    1 
ATOM   1587 O  OG1   . THR A 1 207 ? 13.413  39.765 55.770  1.00 11.12 ? 207 THR A OG1   1 
ATOM   1588 C  CG2   . THR A 1 207 ? 11.901  40.502 57.484  1.00 13.93 ? 207 THR A CG2   1 
ATOM   1589 N  N     . ASP A 1 208 ? 15.814  37.958 57.038  1.00 11.59 ? 208 ASP A N     1 
ATOM   1590 C  CA    . ASP A 1 208 ? 16.584  36.833 56.506  1.00 12.53 ? 208 ASP A CA    1 
ATOM   1591 C  C     . ASP A 1 208 ? 15.842  36.033 55.427  1.00 12.03 ? 208 ASP A C     1 
ATOM   1592 O  O     . ASP A 1 208 ? 16.145  34.860 55.193  1.00 11.86 ? 208 ASP A O     1 
ATOM   1593 C  CB    . ASP A 1 208 ? 17.012  35.890 57.631  1.00 13.41 ? 208 ASP A CB    1 
ATOM   1594 C  CG    . ASP A 1 208 ? 18.177  36.429 58.420  1.00 15.61 ? 208 ASP A CG    1 
ATOM   1595 O  OD1   . ASP A 1 208 ? 19.208  36.749 57.786  1.00 17.44 ? 208 ASP A OD1   1 
ATOM   1596 O  OD2   . ASP A 1 208 ? 18.080  36.527 59.663  1.00 17.12 ? 208 ASP A OD2   1 
ATOM   1597 N  N     . VAL A 1 209 ? 14.874  36.668 54.774  1.00 11.42 ? 209 VAL A N     1 
ATOM   1598 C  CA    . VAL A 1 209 ? 14.105  36.021 53.719  1.00 11.05 ? 209 VAL A CA    1 
ATOM   1599 C  C     . VAL A 1 209 ? 14.902  35.973 52.410  1.00 11.47 ? 209 VAL A C     1 
ATOM   1600 O  O     . VAL A 1 209 ? 15.729  36.847 52.134  1.00 12.81 ? 209 VAL A O     1 
ATOM   1601 C  CB    . VAL A 1 209 ? 12.797  36.790 53.448  1.00 10.92 ? 209 VAL A CB    1 
ATOM   1602 C  CG1   . VAL A 1 209 ? 13.121  38.194 52.982  1.00 11.57 ? 209 VAL A CG1   1 
ATOM   1603 C  CG2   . VAL A 1 209 ? 11.970  36.075 52.396  1.00 10.30 ? 209 VAL A CG2   1 
HETATM 1604 N  N     . MSE A 1 210 ? 14.654  34.963 51.592  1.00 10.69 ? 210 MSE A N     1 
HETATM 1605 C  CA    . MSE A 1 210 ? 15.362  34.885 50.333  1.00 11.10 ? 210 MSE A CA    1 
HETATM 1606 C  C     . MSE A 1 210 ? 14.705  35.828 49.341  1.00 11.84 ? 210 MSE A C     1 
HETATM 1607 O  O     . MSE A 1 210 ? 13.464  35.866 49.234  1.00 12.33 ? 210 MSE A O     1 
HETATM 1608 C  CB    . MSE A 1 210 ? 15.322  33.470 49.792  1.00 12.27 ? 210 MSE A CB    1 
HETATM 1609 C  CG    . MSE A 1 210 ? 16.250  33.275 48.629  1.00 15.34 ? 210 MSE A CG    1 
HETATM 1610 SE SE    . MSE A 1 210 ? 16.390  31.472 48.267  1.00 20.39 ? 210 MSE A SE    1 
HETATM 1611 C  CE    . MSE A 1 210 ? 17.549  31.605 46.844  1.00 21.62 ? 210 MSE A CE    1 
ATOM   1612 N  N     . ILE A 1 211 ? 15.528  36.596 48.624  1.00 10.74 ? 211 ILE A N     1 
ATOM   1613 C  CA    . ILE A 1 211 ? 15.002  37.547 47.655  1.00 9.87  ? 211 ILE A CA    1 
ATOM   1614 C  C     . ILE A 1 211 ? 14.642  36.804 46.380  1.00 10.44 ? 211 ILE A C     1 
ATOM   1615 O  O     . ILE A 1 211 ? 13.512  36.925 45.875  1.00 12.76 ? 211 ILE A O     1 
ATOM   1616 C  CB    . ILE A 1 211 ? 16.024  38.662 47.319  1.00 7.90  ? 211 ILE A CB    1 
ATOM   1617 C  CG1   . ILE A 1 211 ? 16.467  39.383 48.598  1.00 6.71  ? 211 ILE A CG1   1 
ATOM   1618 C  CG2   . ILE A 1 211 ? 15.399  39.664 46.372  1.00 3.73  ? 211 ILE A CG2   1 
ATOM   1619 C  CD1   . ILE A 1 211 ? 15.360  40.096 49.317  1.00 6.68  ? 211 ILE A CD1   1 
ATOM   1620 N  N     . ALA A 1 212 ? 15.595  36.019 45.883  1.00 10.42 ? 212 ALA A N     1 
ATOM   1621 C  CA    . ALA A 1 212 ? 15.422  35.245 44.653  1.00 10.39 ? 212 ALA A CA    1 
ATOM   1622 C  C     . ALA A 1 212 ? 14.102  34.490 44.593  1.00 10.31 ? 212 ALA A C     1 
ATOM   1623 O  O     . ALA A 1 212 ? 13.592  34.009 45.605  1.00 10.01 ? 212 ALA A O     1 
ATOM   1624 C  CB    . ALA A 1 212 ? 16.584  34.261 44.476  1.00 9.72  ? 212 ALA A CB    1 
ATOM   1625 N  N     . GLY A 1 213 ? 13.552  34.398 43.387  1.00 10.74 ? 213 GLY A N     1 
ATOM   1626 C  CA    . GLY A 1 213 ? 12.301  33.691 43.188  1.00 11.21 ? 213 GLY A CA    1 
ATOM   1627 C  C     . GLY A 1 213 ? 11.044  34.386 43.696  1.00 10.93 ? 213 GLY A C     1 
ATOM   1628 O  O     . GLY A 1 213 ? 9.938   33.850 43.559  1.00 10.91 ? 213 GLY A O     1 
ATOM   1629 N  N     . LYS A 1 214 ? 11.187  35.565 44.288  1.00 9.86  ? 214 LYS A N     1 
ATOM   1630 C  CA    . LYS A 1 214 ? 10.011  36.261 44.780  1.00 9.84  ? 214 LYS A CA    1 
ATOM   1631 C  C     . LYS A 1 214 ? 9.652   37.442 43.912  1.00 10.59 ? 214 LYS A C     1 
ATOM   1632 O  O     . LYS A 1 214 ? 10.435  37.868 43.059  1.00 12.76 ? 214 LYS A O     1 
ATOM   1633 C  CB    . LYS A 1 214 ? 10.214  36.726 46.224  1.00 8.49  ? 214 LYS A CB    1 
ATOM   1634 C  CG    . LYS A 1 214 ? 10.321  35.570 47.189  1.00 9.17  ? 214 LYS A CG    1 
ATOM   1635 C  CD    . LYS A 1 214 ? 10.187  36.021 48.628  1.00 8.88  ? 214 LYS A CD    1 
ATOM   1636 C  CE    . LYS A 1 214 ? 10.221  34.818 49.567  1.00 8.17  ? 214 LYS A CE    1 
ATOM   1637 N  NZ    . LYS A 1 214 ? 11.523  34.107 49.468  1.00 7.37  ? 214 LYS A NZ    1 
ATOM   1638 N  N     . VAL A 1 215 ? 8.451   37.961 44.121  1.00 10.13 ? 215 VAL A N     1 
ATOM   1639 C  CA    . VAL A 1 215 ? 7.976   39.115 43.382  1.00 8.72  ? 215 VAL A CA    1 
ATOM   1640 C  C     . VAL A 1 215 ? 8.067   40.304 44.306  1.00 7.91  ? 215 VAL A C     1 
ATOM   1641 O  O     . VAL A 1 215 ? 7.403   40.347 45.339  1.00 9.89  ? 215 VAL A O     1 
ATOM   1642 C  CB    . VAL A 1 215 ? 6.505   38.944 42.946  1.00 7.90  ? 215 VAL A CB    1 
ATOM   1643 C  CG1   . VAL A 1 215 ? 5.956   40.266 42.418  1.00 8.08  ? 215 VAL A CG1   1 
ATOM   1644 C  CG2   . VAL A 1 215 ? 6.418   37.895 41.867  1.00 8.02  ? 215 VAL A CG2   1 
ATOM   1645 N  N     . ALA A 1 216 ? 8.893   41.272 43.951  1.00 6.58  ? 216 ALA A N     1 
ATOM   1646 C  CA    . ALA A 1 216 ? 9.027   42.458 44.786  1.00 5.97  ? 216 ALA A CA    1 
ATOM   1647 C  C     . ALA A 1 216 ? 8.335   43.614 44.083  1.00 5.52  ? 216 ALA A C     1 
ATOM   1648 O  O     . ALA A 1 216 ? 8.367   43.706 42.848  1.00 7.65  ? 216 ALA A O     1 
ATOM   1649 C  CB    . ALA A 1 216 ? 10.518  42.788 45.021  1.00 4.14  ? 216 ALA A CB    1 
ATOM   1650 N  N     . VAL A 1 217 ? 7.693   44.482 44.854  1.00 3.00  ? 217 VAL A N     1 
ATOM   1651 C  CA    . VAL A 1 217 ? 7.028   45.629 44.265  1.00 2.64  ? 217 VAL A CA    1 
ATOM   1652 C  C     . VAL A 1 217 ? 7.734   46.868 44.805  1.00 3.12  ? 217 VAL A C     1 
ATOM   1653 O  O     . VAL A 1 217 ? 7.903   47.033 46.024  1.00 2.07  ? 217 VAL A O     1 
ATOM   1654 C  CB    . VAL A 1 217 ? 5.496   45.671 44.632  1.00 2.51  ? 217 VAL A CB    1 
ATOM   1655 C  CG1   . VAL A 1 217 ? 4.834   46.910 44.050  1.00 2.00  ? 217 VAL A CG1   1 
ATOM   1656 C  CG2   . VAL A 1 217 ? 4.809   44.424 44.102  1.00 2.00  ? 217 VAL A CG2   1 
ATOM   1657 N  N     . VAL A 1 218 ? 8.157   47.733 43.895  1.00 2.14  ? 218 VAL A N     1 
ATOM   1658 C  CA    . VAL A 1 218 ? 8.844   48.944 44.291  1.00 2.00  ? 218 VAL A CA    1 
ATOM   1659 C  C     . VAL A 1 218 ? 8.097   50.158 43.768  1.00 3.92  ? 218 VAL A C     1 
ATOM   1660 O  O     . VAL A 1 218 ? 8.028   50.396 42.555  1.00 4.59  ? 218 VAL A O     1 
ATOM   1661 C  CB    . VAL A 1 218 ? 10.304  48.951 43.764  1.00 2.00  ? 218 VAL A CB    1 
ATOM   1662 C  CG1   . VAL A 1 218 ? 10.949  50.272 44.028  1.00 2.00  ? 218 VAL A CG1   1 
ATOM   1663 C  CG2   . VAL A 1 218 ? 11.103  47.861 44.447  1.00 2.00  ? 218 VAL A CG2   1 
ATOM   1664 N  N     . ALA A 1 219 ? 7.529   50.922 44.692  1.00 4.64  ? 219 ALA A N     1 
ATOM   1665 C  CA    . ALA A 1 219 ? 6.779   52.112 44.329  1.00 5.89  ? 219 ALA A CA    1 
ATOM   1666 C  C     . ALA A 1 219 ? 7.736   53.256 44.108  1.00 6.58  ? 219 ALA A C     1 
ATOM   1667 O  O     . ALA A 1 219 ? 8.431   53.696 45.030  1.00 5.22  ? 219 ALA A O     1 
ATOM   1668 C  CB    . ALA A 1 219 ? 5.775   52.476 45.427  1.00 7.34  ? 219 ALA A CB    1 
ATOM   1669 N  N     . GLY A 1 220 ? 7.767   53.733 42.871  1.00 8.45  ? 220 GLY A N     1 
ATOM   1670 C  CA    . GLY A 1 220 ? 8.636   54.841 42.532  1.00 9.77  ? 220 GLY A CA    1 
ATOM   1671 C  C     . GLY A 1 220 ? 9.895   54.366 41.848  1.00 10.13 ? 220 GLY A C     1 
ATOM   1672 O  O     . GLY A 1 220 ? 10.474  53.335 42.213  1.00 9.70  ? 220 GLY A O     1 
ATOM   1673 N  N     . TYR A 1 221 ? 10.328  55.121 40.850  1.00 10.52 ? 221 TYR A N     1 
ATOM   1674 C  CA    . TYR A 1 221 ? 11.521  54.750 40.130  1.00 11.23 ? 221 TYR A CA    1 
ATOM   1675 C  C     . TYR A 1 221 ? 12.439  55.951 39.990  1.00 12.40 ? 221 TYR A C     1 
ATOM   1676 O  O     . TYR A 1 221 ? 12.932  56.252 38.899  1.00 12.65 ? 221 TYR A O     1 
ATOM   1677 C  CB    . TYR A 1 221 ? 11.157  54.200 38.753  1.00 11.40 ? 221 TYR A CB    1 
ATOM   1678 C  CG    . TYR A 1 221 ? 12.290  53.448 38.097  1.00 11.00 ? 221 TYR A CG    1 
ATOM   1679 C  CD1   . TYR A 1 221 ? 12.774  52.270 38.651  1.00 11.06 ? 221 TYR A CD1   1 
ATOM   1680 C  CD2   . TYR A 1 221 ? 12.886  53.919 36.929  1.00 11.69 ? 221 TYR A CD2   1 
ATOM   1681 C  CE1   . TYR A 1 221 ? 13.828  51.571 38.054  1.00 11.84 ? 221 TYR A CE1   1 
ATOM   1682 C  CE2   . TYR A 1 221 ? 13.944  53.232 36.324  1.00 10.63 ? 221 TYR A CE2   1 
ATOM   1683 C  CZ    . TYR A 1 221 ? 14.409  52.059 36.889  1.00 10.36 ? 221 TYR A CZ    1 
ATOM   1684 O  OH    . TYR A 1 221 ? 15.439  51.360 36.284  1.00 9.00  ? 221 TYR A OH    1 
ATOM   1685 N  N     . GLY A 1 222 ? 12.641  56.654 41.098  1.00 12.83 ? 222 GLY A N     1 
ATOM   1686 C  CA    . GLY A 1 222 ? 13.548  57.784 41.085  1.00 14.31 ? 222 GLY A CA    1 
ATOM   1687 C  C     . GLY A 1 222 ? 14.931  57.241 41.429  1.00 14.38 ? 222 GLY A C     1 
ATOM   1688 O  O     . GLY A 1 222 ? 15.141  56.029 41.357  1.00 14.21 ? 222 GLY A O     1 
ATOM   1689 N  N     . ASP A 1 223 ? 15.877  58.097 41.805  1.00 14.03 ? 223 ASP A N     1 
ATOM   1690 C  CA    . ASP A 1 223 ? 17.198  57.587 42.138  1.00 13.30 ? 223 ASP A CA    1 
ATOM   1691 C  C     . ASP A 1 223 ? 17.082  56.431 43.134  1.00 11.77 ? 223 ASP A C     1 
ATOM   1692 O  O     . ASP A 1 223 ? 17.689  55.379 42.929  1.00 13.01 ? 223 ASP A O     1 
ATOM   1693 C  CB    . ASP A 1 223 ? 18.091  58.684 42.727  1.00 15.97 ? 223 ASP A CB    1 
ATOM   1694 C  CG    . ASP A 1 223 ? 18.271  59.861 41.790  1.00 16.82 ? 223 ASP A CG    1 
ATOM   1695 O  OD1   . ASP A 1 223 ? 18.605  59.643 40.603  1.00 18.92 ? 223 ASP A OD1   1 
ATOM   1696 O  OD2   . ASP A 1 223 ? 18.096  61.007 42.255  1.00 19.18 ? 223 ASP A OD2   1 
ATOM   1697 N  N     . VAL A 1 224 ? 16.299  56.619 44.197  1.00 8.99  ? 224 VAL A N     1 
ATOM   1698 C  CA    . VAL A 1 224 ? 16.120  55.576 45.209  1.00 7.63  ? 224 VAL A CA    1 
ATOM   1699 C  C     . VAL A 1 224 ? 15.388  54.335 44.668  1.00 7.90  ? 224 VAL A C     1 
ATOM   1700 O  O     . VAL A 1 224 ? 15.729  53.192 45.008  1.00 7.51  ? 224 VAL A O     1 
ATOM   1701 C  CB    . VAL A 1 224 ? 15.354  56.112 46.434  1.00 6.81  ? 224 VAL A CB    1 
ATOM   1702 C  CG1   . VAL A 1 224 ? 15.099  54.987 47.415  1.00 6.99  ? 224 VAL A CG1   1 
ATOM   1703 C  CG2   . VAL A 1 224 ? 16.162  57.199 47.113  1.00 7.04  ? 224 VAL A CG2   1 
ATOM   1704 N  N     . GLY A 1 225 ? 14.378  54.557 43.830  1.00 7.41  ? 225 GLY A N     1 
ATOM   1705 C  CA    . GLY A 1 225 ? 13.656  53.436 43.262  1.00 5.56  ? 225 GLY A CA    1 
ATOM   1706 C  C     . GLY A 1 225 ? 14.607  52.608 42.415  1.00 5.54  ? 225 GLY A C     1 
ATOM   1707 O  O     . GLY A 1 225 ? 14.744  51.395 42.601  1.00 5.27  ? 225 GLY A O     1 
ATOM   1708 N  N     . LYS A 1 226 ? 15.276  53.277 41.482  1.00 6.14  ? 226 LYS A N     1 
ATOM   1709 C  CA    . LYS A 1 226 ? 16.230  52.627 40.591  1.00 6.10  ? 226 LYS A CA    1 
ATOM   1710 C  C     . LYS A 1 226 ? 17.223  51.757 41.367  1.00 5.88  ? 226 LYS A C     1 
ATOM   1711 O  O     . LYS A 1 226 ? 17.505  50.621 40.971  1.00 5.64  ? 226 LYS A O     1 
ATOM   1712 C  CB    . LYS A 1 226 ? 16.970  53.690 39.769  1.00 6.97  ? 226 LYS A CB    1 
ATOM   1713 C  CG    . LYS A 1 226 ? 16.077  54.434 38.729  1.00 7.59  ? 226 LYS A CG    1 
ATOM   1714 C  CD    . LYS A 1 226 ? 16.869  55.531 38.011  1.00 8.77  ? 226 LYS A CD    1 
ATOM   1715 C  CE    . LYS A 1 226 ? 16.152  56.101 36.781  1.00 9.50  ? 226 LYS A CE    1 
ATOM   1716 N  NZ    . LYS A 1 226 ? 14.852  56.759 37.062  1.00 12.73 ? 226 LYS A NZ    1 
ATOM   1717 N  N     . GLY A 1 227 ? 17.733  52.277 42.483  1.00 5.55  ? 227 GLY A N     1 
ATOM   1718 C  CA    . GLY A 1 227 ? 18.685  51.514 43.274  1.00 6.42  ? 227 GLY A CA    1 
ATOM   1719 C  C     . GLY A 1 227 ? 18.059  50.268 43.869  1.00 7.06  ? 227 GLY A C     1 
ATOM   1720 O  O     . GLY A 1 227 ? 18.585  49.159 43.723  1.00 6.33  ? 227 GLY A O     1 
ATOM   1721 N  N     . CYS A 1 228 ? 16.924  50.452 44.537  1.00 7.58  ? 228 CYS A N     1 
ATOM   1722 C  CA    . CYS A 1 228 ? 16.218  49.341 45.161  1.00 7.88  ? 228 CYS A CA    1 
ATOM   1723 C  C     . CYS A 1 228 ? 15.835  48.251 44.167  1.00 7.71  ? 228 CYS A C     1 
ATOM   1724 O  O     . CYS A 1 228 ? 16.083  47.064 44.418  1.00 6.67  ? 228 CYS A O     1 
ATOM   1725 C  CB    . CYS A 1 228 ? 14.973  49.848 45.874  1.00 7.76  ? 228 CYS A CB    1 
ATOM   1726 S  SG    . CYS A 1 228 ? 15.349  51.017 47.189  1.00 8.54  ? 228 CYS A SG    1 
ATOM   1727 N  N     . ALA A 1 229 ? 15.230  48.657 43.050  1.00 7.92  ? 229 ALA A N     1 
ATOM   1728 C  CA    . ALA A 1 229 ? 14.809  47.717 42.003  1.00 8.56  ? 229 ALA A CA    1 
ATOM   1729 C  C     . ALA A 1 229 ? 15.974  46.858 41.512  1.00 9.31  ? 229 ALA A C     1 
ATOM   1730 O  O     . ALA A 1 229 ? 15.903  45.629 41.503  1.00 8.74  ? 229 ALA A O     1 
ATOM   1731 C  CB    . ALA A 1 229 ? 14.213  48.479 40.825  1.00 8.18  ? 229 ALA A CB    1 
ATOM   1732 N  N     . GLN A 1 230 ? 17.052  47.515 41.099  1.00 10.97 ? 230 GLN A N     1 
ATOM   1733 C  CA    . GLN A 1 230 ? 18.218  46.806 40.595  1.00 12.30 ? 230 GLN A CA    1 
ATOM   1734 C  C     . GLN A 1 230 ? 18.771  45.835 41.652  1.00 11.41 ? 230 GLN A C     1 
ATOM   1735 O  O     . GLN A 1 230 ? 19.116  44.688 41.344  1.00 9.93  ? 230 GLN A O     1 
ATOM   1736 C  CB    . GLN A 1 230 ? 19.280  47.822 40.175  1.00 14.79 ? 230 GLN A CB    1 
ATOM   1737 C  CG    . GLN A 1 230 ? 20.484  47.234 39.473  1.00 19.12 ? 230 GLN A CG    1 
ATOM   1738 C  CD    . GLN A 1 230 ? 21.497  48.309 39.086  1.00 22.89 ? 230 GLN A CD    1 
ATOM   1739 O  OE1   . GLN A 1 230 ? 21.975  49.072 39.937  1.00 22.70 ? 230 GLN A OE1   1 
ATOM   1740 N  NE2   . GLN A 1 230 ? 21.828  48.374 37.798  1.00 25.10 ? 230 GLN A NE2   1 
ATOM   1741 N  N     . ALA A 1 231 ? 18.839  46.298 42.898  1.00 10.86 ? 231 ALA A N     1 
ATOM   1742 C  CA    . ALA A 1 231 ? 19.344  45.479 43.995  1.00 9.91  ? 231 ALA A CA    1 
ATOM   1743 C  C     . ALA A 1 231 ? 18.525  44.200 44.116  1.00 10.59 ? 231 ALA A C     1 
ATOM   1744 O  O     . ALA A 1 231 ? 19.077  43.098 44.191  1.00 11.18 ? 231 ALA A O     1 
ATOM   1745 C  CB    . ALA A 1 231 ? 19.291  46.258 45.302  1.00 8.74  ? 231 ALA A CB    1 
ATOM   1746 N  N     . LEU A 1 232 ? 17.203  44.349 44.136  1.00 10.77 ? 232 LEU A N     1 
ATOM   1747 C  CA    . LEU A 1 232 ? 16.322  43.201 44.247  1.00 9.72  ? 232 LEU A CA    1 
ATOM   1748 C  C     . LEU A 1 232 ? 16.493  42.209 43.105  1.00 10.79 ? 232 LEU A C     1 
ATOM   1749 O  O     . LEU A 1 232 ? 16.790  41.035 43.349  1.00 11.95 ? 232 LEU A O     1 
ATOM   1750 C  CB    . LEU A 1 232 ? 14.867  43.653 44.344  1.00 7.49  ? 232 LEU A CB    1 
ATOM   1751 C  CG    . LEU A 1 232 ? 14.550  44.287 45.702  1.00 7.49  ? 232 LEU A CG    1 
ATOM   1752 C  CD1   . LEU A 1 232 ? 13.198  44.975 45.657  1.00 5.60  ? 232 LEU A CD1   1 
ATOM   1753 C  CD2   . LEU A 1 232 ? 14.600  43.208 46.797  1.00 4.88  ? 232 LEU A CD2   1 
ATOM   1754 N  N     . ARG A 1 233 ? 16.326  42.633 41.857  1.00 10.88 ? 233 ARG A N     1 
ATOM   1755 C  CA    . ARG A 1 233 ? 16.492  41.628 40.815  1.00 11.77 ? 233 ARG A CA    1 
ATOM   1756 C  C     . ARG A 1 233 ? 17.923  41.097 40.792  1.00 11.36 ? 233 ARG A C     1 
ATOM   1757 O  O     . ARG A 1 233 ? 18.166  39.952 40.399  1.00 11.51 ? 233 ARG A O     1 
ATOM   1758 C  CB    . ARG A 1 233 ? 16.100  42.149 39.435  1.00 12.48 ? 233 ARG A CB    1 
ATOM   1759 C  CG    . ARG A 1 233 ? 16.901  43.293 38.894  1.00 14.34 ? 233 ARG A CG    1 
ATOM   1760 C  CD    . ARG A 1 233 ? 16.600  43.385 37.414  1.00 16.41 ? 233 ARG A CD    1 
ATOM   1761 N  NE    . ARG A 1 233 ? 17.133  44.586 36.784  1.00 19.42 ? 233 ARG A NE    1 
ATOM   1762 C  CZ    . ARG A 1 233 ? 16.976  44.867 35.493  1.00 21.66 ? 233 ARG A CZ    1 
ATOM   1763 N  NH1   . ARG A 1 233 ? 16.305  44.026 34.703  1.00 22.41 ? 233 ARG A NH1   1 
ATOM   1764 N  NH2   . ARG A 1 233 ? 17.452  46.002 34.998  1.00 22.33 ? 233 ARG A NH2   1 
ATOM   1765 N  N     . GLY A 1 234 ? 18.872  41.917 41.220  1.00 9.69  ? 234 GLY A N     1 
ATOM   1766 C  CA    . GLY A 1 234 ? 20.234  41.441 41.245  1.00 9.39  ? 234 GLY A CA    1 
ATOM   1767 C  C     . GLY A 1 234 ? 20.300  40.100 41.959  1.00 9.49  ? 234 GLY A C     1 
ATOM   1768 O  O     . GLY A 1 234 ? 21.132  39.263 41.617  1.00 8.47  ? 234 GLY A O     1 
ATOM   1769 N  N     . PHE A 1 235 ? 19.427  39.898 42.951  1.00 10.33 ? 235 PHE A N     1 
ATOM   1770 C  CA    . PHE A 1 235 ? 19.393  38.645 43.706  1.00 12.34 ? 235 PHE A CA    1 
ATOM   1771 C  C     . PHE A 1 235 ? 18.407  37.598 43.184  1.00 13.81 ? 235 PHE A C     1 
ATOM   1772 O  O     . PHE A 1 235 ? 18.292  36.506 43.757  1.00 15.34 ? 235 PHE A O     1 
ATOM   1773 C  CB    . PHE A 1 235 ? 19.103  38.908 45.190  1.00 13.33 ? 235 PHE A CB    1 
ATOM   1774 C  CG    . PHE A 1 235 ? 20.279  39.438 45.944  1.00 14.89 ? 235 PHE A CG    1 
ATOM   1775 C  CD1   . PHE A 1 235 ? 21.459  38.712 45.999  1.00 15.26 ? 235 PHE A CD1   1 
ATOM   1776 C  CD2   . PHE A 1 235 ? 20.225  40.669 46.572  1.00 16.47 ? 235 PHE A CD2   1 
ATOM   1777 C  CE1   . PHE A 1 235 ? 22.573  39.201 46.663  1.00 15.43 ? 235 PHE A CE1   1 
ATOM   1778 C  CE2   . PHE A 1 235 ? 21.341  41.172 47.244  1.00 17.49 ? 235 PHE A CE2   1 
ATOM   1779 C  CZ    . PHE A 1 235 ? 22.519  40.431 47.286  1.00 15.42 ? 235 PHE A CZ    1 
ATOM   1780 N  N     . GLY A 1 236 ? 17.684  37.923 42.116  1.00 13.25 ? 236 GLY A N     1 
ATOM   1781 C  CA    . GLY A 1 236 ? 16.763  36.951 41.558  1.00 13.16 ? 236 GLY A CA    1 
ATOM   1782 C  C     . GLY A 1 236 ? 15.288  37.163 41.828  1.00 13.26 ? 236 GLY A C     1 
ATOM   1783 O  O     . GLY A 1 236 ? 14.512  36.218 41.728  1.00 13.25 ? 236 GLY A O     1 
ATOM   1784 N  N     . ALA A 1 237 ? 14.887  38.382 42.173  1.00 12.85 ? 237 ALA A N     1 
ATOM   1785 C  CA    . ALA A 1 237 ? 13.477  38.640 42.425  1.00 11.62 ? 237 ALA A CA    1 
ATOM   1786 C  C     . ALA A 1 237 ? 12.886  39.270 41.170  1.00 11.78 ? 237 ALA A C     1 
ATOM   1787 O  O     . ALA A 1 237 ? 13.606  39.914 40.402  1.00 12.79 ? 237 ALA A O     1 
ATOM   1788 C  CB    . ALA A 1 237 ? 13.326  39.575 43.595  1.00 11.90 ? 237 ALA A CB    1 
ATOM   1789 N  N     . ARG A 1 238 ? 11.590  39.072 40.943  1.00 10.55 ? 238 ARG A N     1 
ATOM   1790 C  CA    . ARG A 1 238 ? 10.933  39.664 39.779  1.00 9.62  ? 238 ARG A CA    1 
ATOM   1791 C  C     . ARG A 1 238 ? 10.355  40.991 40.244  1.00 10.29 ? 238 ARG A C     1 
ATOM   1792 O  O     . ARG A 1 238 ? 9.295   41.046 40.881  1.00 12.55 ? 238 ARG A O     1 
ATOM   1793 C  CB    . ARG A 1 238 ? 9.824   38.750 39.245  1.00 8.07  ? 238 ARG A CB    1 
ATOM   1794 C  CG    . ARG A 1 238 ? 9.141   39.247 37.967  1.00 4.43  ? 238 ARG A CG    1 
ATOM   1795 C  CD    . ARG A 1 238 ? 8.505   38.082 37.192  1.00 3.17  ? 238 ARG A CD    1 
ATOM   1796 N  NE    . ARG A 1 238 ? 7.411   37.444 37.918  1.00 4.65  ? 238 ARG A NE    1 
ATOM   1797 C  CZ    . ARG A 1 238 ? 6.202   37.983 38.066  1.00 3.60  ? 238 ARG A CZ    1 
ATOM   1798 N  NH1   . ARG A 1 238 ? 5.942   39.170 37.529  1.00 3.93  ? 238 ARG A NH1   1 
ATOM   1799 N  NH2   . ARG A 1 238 ? 5.264   37.351 38.764  1.00 2.00  ? 238 ARG A NH2   1 
ATOM   1800 N  N     . VAL A 1 239 ? 11.062  42.063 39.925  1.00 8.63  ? 239 VAL A N     1 
ATOM   1801 C  CA    . VAL A 1 239 ? 10.644  43.387 40.341  1.00 7.19  ? 239 VAL A CA    1 
ATOM   1802 C  C     . VAL A 1 239 ? 9.530   44.042 39.532  1.00 6.53  ? 239 VAL A C     1 
ATOM   1803 O  O     . VAL A 1 239 ? 9.645   44.200 38.317  1.00 6.54  ? 239 VAL A O     1 
ATOM   1804 C  CB    . VAL A 1 239 ? 11.853  44.320 40.353  1.00 6.32  ? 239 VAL A CB    1 
ATOM   1805 C  CG1   . VAL A 1 239 ? 11.433  45.729 40.729  1.00 5.97  ? 239 VAL A CG1   1 
ATOM   1806 C  CG2   . VAL A 1 239 ? 12.887  43.778 41.322  1.00 5.42  ? 239 VAL A CG2   1 
ATOM   1807 N  N     . ILE A 1 240 ? 8.451   44.411 40.220  1.00 6.30  ? 240 ILE A N     1 
ATOM   1808 C  CA    . ILE A 1 240 ? 7.329   45.113 39.600  1.00 7.49  ? 240 ILE A CA    1 
ATOM   1809 C  C     . ILE A 1 240 ? 7.415   46.547 40.126  1.00 8.91  ? 240 ILE A C     1 
ATOM   1810 O  O     . ILE A 1 240 ? 7.639   46.766 41.328  1.00 10.47 ? 240 ILE A O     1 
ATOM   1811 C  CB    . ILE A 1 240 ? 5.964   44.499 39.995  1.00 5.98  ? 240 ILE A CB    1 
ATOM   1812 C  CG1   . ILE A 1 240 ? 5.849   43.083 39.421  1.00 5.12  ? 240 ILE A CG1   1 
ATOM   1813 C  CG2   . ILE A 1 240 ? 4.827   45.381 39.479  1.00 4.88  ? 240 ILE A CG2   1 
ATOM   1814 C  CD1   . ILE A 1 240 ? 4.601   42.328 39.851  1.00 4.39  ? 240 ILE A CD1   1 
ATOM   1815 N  N     . ILE A 1 241 ? 7.219   47.514 39.235  1.00 10.01 ? 241 ILE A N     1 
ATOM   1816 C  CA    . ILE A 1 241 ? 7.328   48.934 39.576  1.00 10.20 ? 241 ILE A CA    1 
ATOM   1817 C  C     . ILE A 1 241 ? 6.093   49.803 39.335  1.00 10.82 ? 241 ILE A C     1 
ATOM   1818 O  O     . ILE A 1 241 ? 5.365   49.603 38.363  1.00 12.13 ? 241 ILE A O     1 
ATOM   1819 C  CB    . ILE A 1 241 ? 8.556   49.538 38.815  1.00 8.90  ? 241 ILE A CB    1 
ATOM   1820 C  CG1   . ILE A 1 241 ? 9.830   49.088 39.539  1.00 8.59  ? 241 ILE A CG1   1 
ATOM   1821 C  CG2   . ILE A 1 241 ? 8.430   51.060 38.648  1.00 5.92  ? 241 ILE A CG2   1 
ATOM   1822 C  CD1   . ILE A 1 241 ? 11.095  49.518 38.900  1.00 10.44 ? 241 ILE A CD1   1 
ATOM   1823 N  N     . THR A 1 242 ? 5.870   50.761 40.234  1.00 10.63 ? 242 THR A N     1 
ATOM   1824 C  CA    . THR A 1 242 ? 4.759   51.698 40.121  1.00 11.74 ? 242 THR A CA    1 
ATOM   1825 C  C     . THR A 1 242 ? 5.350   53.092 39.992  1.00 13.00 ? 242 THR A C     1 
ATOM   1826 O  O     . THR A 1 242 ? 6.376   53.399 40.598  1.00 14.62 ? 242 THR A O     1 
ATOM   1827 C  CB    . THR A 1 242 ? 3.854   51.695 41.367  1.00 12.76 ? 242 THR A CB    1 
ATOM   1828 O  OG1   . THR A 1 242 ? 4.594   52.160 42.506  1.00 11.86 ? 242 THR A OG1   1 
ATOM   1829 C  CG2   . THR A 1 242 ? 3.324   50.296 41.630  1.00 13.08 ? 242 THR A CG2   1 
ATOM   1830 N  N     . GLU A 1 243 ? 4.697   53.936 39.206  1.00 13.09 ? 243 GLU A N     1 
ATOM   1831 C  CA    . GLU A 1 243 ? 5.162   55.297 38.982  1.00 13.44 ? 243 GLU A CA    1 
ATOM   1832 C  C     . GLU A 1 243 ? 4.000   56.177 38.556  1.00 13.91 ? 243 GLU A C     1 
ATOM   1833 O  O     . GLU A 1 243 ? 2.982   55.693 38.046  1.00 14.31 ? 243 GLU A O     1 
ATOM   1834 C  CB    . GLU A 1 243 ? 6.222   55.328 37.870  1.00 14.37 ? 243 GLU A CB    1 
ATOM   1835 C  CG    . GLU A 1 243 ? 7.679   55.464 38.312  1.00 16.94 ? 243 GLU A CG    1 
ATOM   1836 C  CD    . GLU A 1 243 ? 7.958   56.785 39.029  1.00 19.00 ? 243 GLU A CD    1 
ATOM   1837 O  OE1   . GLU A 1 243 ? 7.418   57.830 38.607  1.00 21.00 ? 243 GLU A OE1   1 
ATOM   1838 O  OE2   . GLU A 1 243 ? 8.742   56.792 40.000  1.00 21.28 ? 243 GLU A OE2   1 
ATOM   1839 N  N     . ILE A 1 244 ? 4.167   57.478 38.755  1.00 13.34 ? 244 ILE A N     1 
ATOM   1840 C  CA    . ILE A 1 244 ? 3.150   58.442 38.369  1.00 12.90 ? 244 ILE A CA    1 
ATOM   1841 C  C     . ILE A 1 244 ? 3.726   59.295 37.246  1.00 12.92 ? 244 ILE A C     1 
ATOM   1842 O  O     . ILE A 1 244 ? 2.994   60.011 36.554  1.00 13.87 ? 244 ILE A O     1 
ATOM   1843 C  CB    . ILE A 1 244 ? 2.789   59.365 39.528  1.00 12.04 ? 244 ILE A CB    1 
ATOM   1844 C  CG1   . ILE A 1 244 ? 4.010   60.202 39.916  1.00 12.14 ? 244 ILE A CG1   1 
ATOM   1845 C  CG2   . ILE A 1 244 ? 2.299   58.545 40.705  1.00 10.24 ? 244 ILE A CG2   1 
ATOM   1846 C  CD1   . ILE A 1 244 ? 3.735   61.205 41.018  1.00 12.52 ? 244 ILE A CD1   1 
ATOM   1847 N  N     . ASP A 1 245 ? 5.041   59.199 37.064  1.00 11.10 ? 245 ASP A N     1 
ATOM   1848 C  CA    . ASP A 1 245 ? 5.746   59.968 36.043  1.00 11.20 ? 245 ASP A CA    1 
ATOM   1849 C  C     . ASP A 1 245 ? 6.058   59.140 34.790  1.00 11.21 ? 245 ASP A C     1 
ATOM   1850 O  O     . ASP A 1 245 ? 6.759   58.135 34.856  1.00 11.30 ? 245 ASP A O     1 
ATOM   1851 C  CB    . ASP A 1 245 ? 7.020   60.554 36.666  1.00 9.78  ? 245 ASP A CB    1 
ATOM   1852 C  CG    . ASP A 1 245 ? 7.775   61.457 35.722  1.00 9.32  ? 245 ASP A CG    1 
ATOM   1853 O  OD1   . ASP A 1 245 ? 7.683   61.262 34.485  1.00 8.81  ? 245 ASP A OD1   1 
ATOM   1854 O  OD2   . ASP A 1 245 ? 8.484   62.353 36.230  1.00 9.57  ? 245 ASP A OD2   1 
ATOM   1855 N  N     . PRO A 1 246 ? 5.575   59.591 33.616  1.00 12.17 ? 246 PRO A N     1 
ATOM   1856 C  CA    . PRO A 1 246 ? 5.787   58.889 32.344  1.00 12.33 ? 246 PRO A CA    1 
ATOM   1857 C  C     . PRO A 1 246 ? 7.239   58.526 32.085  1.00 12.50 ? 246 PRO A C     1 
ATOM   1858 O  O     . PRO A 1 246 ? 7.559   57.369 31.790  1.00 12.43 ? 246 PRO A O     1 
ATOM   1859 C  CB    . PRO A 1 246 ? 5.258   59.884 31.314  1.00 11.33 ? 246 PRO A CB    1 
ATOM   1860 C  CG    . PRO A 1 246 ? 4.140   60.546 32.066  1.00 14.36 ? 246 PRO A CG    1 
ATOM   1861 C  CD    . PRO A 1 246 ? 4.868   60.860 33.370  1.00 12.86 ? 246 PRO A CD    1 
ATOM   1862 N  N     . ILE A 1 247 ? 8.114   59.520 32.203  1.00 12.21 ? 247 ILE A N     1 
ATOM   1863 C  CA    . ILE A 1 247 ? 9.533   59.309 31.958  1.00 11.54 ? 247 ILE A CA    1 
ATOM   1864 C  C     . ILE A 1 247 ? 10.099  58.197 32.861  1.00 12.43 ? 247 ILE A C     1 
ATOM   1865 O  O     . ILE A 1 247 ? 10.596  57.182 32.367  1.00 12.89 ? 247 ILE A O     1 
ATOM   1866 C  CB    . ILE A 1 247 ? 10.301  60.627 32.152  1.00 10.21 ? 247 ILE A CB    1 
ATOM   1867 C  CG1   . ILE A 1 247 ? 9.685   61.707 31.262  1.00 8.20  ? 247 ILE A CG1   1 
ATOM   1868 C  CG2   . ILE A 1 247 ? 11.769  60.442 31.785  1.00 10.73 ? 247 ILE A CG2   1 
ATOM   1869 C  CD1   . ILE A 1 247 ? 10.340  63.061 31.397  1.00 6.80  ? 247 ILE A CD1   1 
ATOM   1870 N  N     . ASN A 1 248 ? 10.018  58.372 34.176  1.00 12.62 ? 248 ASN A N     1 
ATOM   1871 C  CA    . ASN A 1 248 ? 10.510  57.349 35.096  1.00 13.27 ? 248 ASN A CA    1 
ATOM   1872 C  C     . ASN A 1 248 ? 9.891   55.995 34.733  1.00 14.36 ? 248 ASN A C     1 
ATOM   1873 O  O     . ASN A 1 248 ? 10.564  54.950 34.740  1.00 14.77 ? 248 ASN A O     1 
ATOM   1874 C  CB    . ASN A 1 248 ? 10.121  57.711 36.526  1.00 13.21 ? 248 ASN A CB    1 
ATOM   1875 C  CG    . ASN A 1 248 ? 10.878  58.902 37.048  1.00 14.61 ? 248 ASN A CG    1 
ATOM   1876 O  OD1   . ASN A 1 248 ? 12.044  58.778 37.439  1.00 16.53 ? 248 ASN A OD1   1 
ATOM   1877 N  ND2   . ASN A 1 248 ? 10.235  60.075 37.041  1.00 12.80 ? 248 ASN A ND2   1 
ATOM   1878 N  N     . ALA A 1 249 ? 8.596   56.026 34.420  1.00 14.28 ? 249 ALA A N     1 
ATOM   1879 C  CA    . ALA A 1 249 ? 7.852   54.826 34.062  1.00 13.63 ? 249 ALA A CA    1 
ATOM   1880 C  C     . ALA A 1 249 ? 8.447   54.194 32.815  1.00 13.13 ? 249 ALA A C     1 
ATOM   1881 O  O     . ALA A 1 249 ? 8.719   52.992 32.782  1.00 13.21 ? 249 ALA A O     1 
ATOM   1882 C  CB    . ALA A 1 249 ? 6.387   55.178 33.818  1.00 13.26 ? 249 ALA A CB    1 
ATOM   1883 N  N     . LEU A 1 250 ? 8.654   55.009 31.789  1.00 13.19 ? 250 LEU A N     1 
ATOM   1884 C  CA    . LEU A 1 250 ? 9.201   54.497 30.550  1.00 13.88 ? 250 LEU A CA    1 
ATOM   1885 C  C     . LEU A 1 250 ? 10.571  53.894 30.791  1.00 14.83 ? 250 LEU A C     1 
ATOM   1886 O  O     . LEU A 1 250 ? 10.880  52.821 30.259  1.00 16.66 ? 250 LEU A O     1 
ATOM   1887 C  CB    . LEU A 1 250 ? 9.292   55.598 29.493  1.00 13.90 ? 250 LEU A CB    1 
ATOM   1888 C  CG    . LEU A 1 250 ? 9.675   55.082 28.102  1.00 14.56 ? 250 LEU A CG    1 
ATOM   1889 C  CD1   . LEU A 1 250 ? 8.675   54.007 27.672  1.00 13.32 ? 250 LEU A CD1   1 
ATOM   1890 C  CD2   . LEU A 1 250 ? 9.683   56.228 27.101  1.00 13.45 ? 250 LEU A CD2   1 
ATOM   1891 N  N     . GLN A 1 251 ? 11.389  54.568 31.599  1.00 14.41 ? 251 GLN A N     1 
ATOM   1892 C  CA    . GLN A 1 251 ? 12.726  54.063 31.904  1.00 14.64 ? 251 GLN A CA    1 
ATOM   1893 C  C     . GLN A 1 251 ? 12.611  52.651 32.495  1.00 15.34 ? 251 GLN A C     1 
ATOM   1894 O  O     . GLN A 1 251 ? 13.263  51.716 32.025  1.00 17.00 ? 251 GLN A O     1 
ATOM   1895 C  CB    . GLN A 1 251 ? 13.438  54.958 32.917  1.00 14.77 ? 251 GLN A CB    1 
ATOM   1896 C  CG    . GLN A 1 251 ? 13.478  56.436 32.579  1.00 13.54 ? 251 GLN A CG    1 
ATOM   1897 C  CD    . GLN A 1 251 ? 14.312  57.203 33.575  1.00 12.85 ? 251 GLN A CD    1 
ATOM   1898 O  OE1   . GLN A 1 251 ? 15.532  57.302 33.434  1.00 11.39 ? 251 GLN A OE1   1 
ATOM   1899 N  NE2   . GLN A 1 251 ? 13.665  57.716 34.616  1.00 12.78 ? 251 GLN A NE2   1 
ATOM   1900 N  N     . ALA A 1 252 ? 11.796  52.497 33.533  1.00 14.06 ? 252 ALA A N     1 
ATOM   1901 C  CA    . ALA A 1 252 ? 11.615  51.180 34.123  1.00 13.32 ? 252 ALA A CA    1 
ATOM   1902 C  C     . ALA A 1 252 ? 11.370  50.162 33.001  1.00 13.14 ? 252 ALA A C     1 
ATOM   1903 O  O     . ALA A 1 252 ? 12.155  49.227 32.811  1.00 10.83 ? 252 ALA A O     1 
ATOM   1904 C  CB    . ALA A 1 252 ? 10.432  51.193 35.102  1.00 13.02 ? 252 ALA A CB    1 
ATOM   1905 N  N     . ALA A 1 253 ? 10.290  50.357 32.246  1.00 14.67 ? 253 ALA A N     1 
ATOM   1906 C  CA    . ALA A 1 253 ? 9.950   49.437 31.158  1.00 15.78 ? 253 ALA A CA    1 
ATOM   1907 C  C     . ALA A 1 253 ? 11.145  49.159 30.235  1.00 16.19 ? 253 ALA A C     1 
ATOM   1908 O  O     . ALA A 1 253 ? 11.375  48.023 29.820  1.00 15.13 ? 253 ALA A O     1 
ATOM   1909 C  CB    . ALA A 1 253 ? 8.786   49.988 30.358  1.00 13.65 ? 253 ALA A CB    1 
HETATM 1910 N  N     . MSE A 1 254 ? 11.901  50.200 29.917  1.00 17.54 ? 254 MSE A N     1 
HETATM 1911 C  CA    . MSE A 1 254 ? 13.063  50.049 29.057  1.00 20.05 ? 254 MSE A CA    1 
HETATM 1912 C  C     . MSE A 1 254 ? 14.129  49.184 29.724  1.00 20.66 ? 254 MSE A C     1 
HETATM 1913 O  O     . MSE A 1 254 ? 14.939  48.565 29.039  1.00 20.58 ? 254 MSE A O     1 
HETATM 1914 C  CB    . MSE A 1 254 ? 13.664  51.417 28.728  1.00 22.03 ? 254 MSE A CB    1 
HETATM 1915 C  CG    . MSE A 1 254 ? 12.843  52.335 27.797  1.00 24.23 ? 254 MSE A CG    1 
HETATM 1916 SE SE    . MSE A 1 254 ? 12.780  51.671 26.056  1.00 26.77 ? 254 MSE A SE    1 
HETATM 1917 C  CE    . MSE A 1 254 ? 11.788  53.032 25.335  1.00 26.46 ? 254 MSE A CE    1 
ATOM   1918 N  N     . GLU A 1 255 ? 14.135  49.150 31.056  1.00 21.79 ? 255 GLU A N     1 
ATOM   1919 C  CA    . GLU A 1 255 ? 15.113  48.354 31.804  1.00 21.79 ? 255 GLU A CA    1 
ATOM   1920 C  C     . GLU A 1 255 ? 14.599  46.950 32.050  1.00 21.61 ? 255 GLU A C     1 
ATOM   1921 O  O     . GLU A 1 255 ? 15.268  46.154 32.699  1.00 22.79 ? 255 GLU A O     1 
ATOM   1922 C  CB    . GLU A 1 255 ? 15.439  49.015 33.145  1.00 22.95 ? 255 GLU A CB    1 
ATOM   1923 C  CG    . GLU A 1 255 ? 16.088  50.380 32.993  1.00 25.31 ? 255 GLU A CG    1 
ATOM   1924 C  CD    . GLU A 1 255 ? 17.517  50.311 32.460  1.00 25.44 ? 255 GLU A CD    1 
ATOM   1925 O  OE1   . GLU A 1 255 ? 17.897  49.283 31.848  1.00 26.64 ? 255 GLU A OE1   1 
ATOM   1926 O  OE2   . GLU A 1 255 ? 18.252  51.304 32.644  1.00 24.64 ? 255 GLU A OE2   1 
ATOM   1927 N  N     . GLY A 1 256 ? 13.400  46.658 31.558  1.00 20.29 ? 256 GLY A N     1 
ATOM   1928 C  CA    . GLY A 1 256 ? 12.854  45.329 31.722  1.00 19.04 ? 256 GLY A CA    1 
ATOM   1929 C  C     . GLY A 1 256 ? 11.897  45.080 32.873  1.00 18.66 ? 256 GLY A C     1 
ATOM   1930 O  O     . GLY A 1 256 ? 11.469  43.934 33.063  1.00 20.27 ? 256 GLY A O     1 
ATOM   1931 N  N     . TYR A 1 257 ? 11.550  46.107 33.645  1.00 17.35 ? 257 TYR A N     1 
ATOM   1932 C  CA    . TYR A 1 257 ? 10.616  45.895 34.752  1.00 15.42 ? 257 TYR A CA    1 
ATOM   1933 C  C     . TYR A 1 257 ? 9.195   46.130 34.316  1.00 14.64 ? 257 TYR A C     1 
ATOM   1934 O  O     . TYR A 1 257 ? 8.928   47.039 33.549  1.00 14.51 ? 257 TYR A O     1 
ATOM   1935 C  CB    . TYR A 1 257 ? 10.863  46.849 35.918  1.00 15.06 ? 257 TYR A CB    1 
ATOM   1936 C  CG    . TYR A 1 257 ? 12.268  46.878 36.459  1.00 15.22 ? 257 TYR A CG    1 
ATOM   1937 C  CD1   . TYR A 1 257 ? 12.701  45.915 37.365  1.00 13.96 ? 257 TYR A CD1   1 
ATOM   1938 C  CD2   . TYR A 1 257 ? 13.155  47.881 36.082  1.00 14.80 ? 257 TYR A CD2   1 
ATOM   1939 C  CE1   . TYR A 1 257 ? 13.977  45.944 37.886  1.00 14.65 ? 257 TYR A CE1   1 
ATOM   1940 C  CE2   . TYR A 1 257 ? 14.440  47.925 36.599  1.00 16.43 ? 257 TYR A CE2   1 
ATOM   1941 C  CZ    . TYR A 1 257 ? 14.849  46.948 37.508  1.00 15.54 ? 257 TYR A CZ    1 
ATOM   1942 O  OH    . TYR A 1 257 ? 16.126  46.967 38.038  1.00 14.95 ? 257 TYR A OH    1 
ATOM   1943 N  N     . GLU A 1 258 ? 8.283   45.309 34.817  1.00 15.47 ? 258 GLU A N     1 
ATOM   1944 C  CA    . GLU A 1 258 ? 6.863   45.465 34.525  1.00 15.24 ? 258 GLU A CA    1 
ATOM   1945 C  C     . GLU A 1 258 ? 6.389   46.657 35.359  1.00 14.44 ? 258 GLU A C     1 
ATOM   1946 O  O     . GLU A 1 258 ? 6.606   46.691 36.573  1.00 13.60 ? 258 GLU A O     1 
ATOM   1947 C  CB    . GLU A 1 258 ? 6.082   44.221 34.962  1.00 16.14 ? 258 GLU A CB    1 
ATOM   1948 C  CG    . GLU A 1 258 ? 4.570   44.382 34.819  1.00 16.57 ? 258 GLU A CG    1 
ATOM   1949 C  CD    . GLU A 1 258 ? 3.758   43.257 35.462  1.00 16.99 ? 258 GLU A CD    1 
ATOM   1950 O  OE1   . GLU A 1 258 ? 4.343   42.358 36.129  1.00 16.87 ? 258 GLU A OE1   1 
ATOM   1951 O  OE2   . GLU A 1 258 ? 2.517   43.292 35.300  1.00 17.37 ? 258 GLU A OE2   1 
ATOM   1952 N  N     . VAL A 1 259 ? 5.743   47.627 34.722  1.00 13.90 ? 259 VAL A N     1 
ATOM   1953 C  CA    . VAL A 1 259 ? 5.251   48.797 35.446  1.00 12.79 ? 259 VAL A CA    1 
ATOM   1954 C  C     . VAL A 1 259 ? 3.722   48.769 35.556  1.00 13.84 ? 259 VAL A C     1 
ATOM   1955 O  O     . VAL A 1 259 ? 3.025   48.689 34.543  1.00 14.39 ? 259 VAL A O     1 
ATOM   1956 C  CB    . VAL A 1 259 ? 5.669   50.109 34.732  1.00 10.76 ? 259 VAL A CB    1 
ATOM   1957 C  CG1   . VAL A 1 259 ? 5.135   51.318 35.500  1.00 7.15  ? 259 VAL A CG1   1 
ATOM   1958 C  CG2   . VAL A 1 259 ? 7.185   50.169 34.595  1.00 8.77  ? 259 VAL A CG2   1 
ATOM   1959 N  N     . THR A 1 260 ? 3.203   48.822 36.781  1.00 14.60 ? 260 THR A N     1 
ATOM   1960 C  CA    . THR A 1 260 ? 1.755   48.826 36.981  1.00 15.84 ? 260 THR A CA    1 
ATOM   1961 C  C     . THR A 1 260 ? 1.353   49.725 38.134  1.00 17.64 ? 260 THR A C     1 
ATOM   1962 O  O     . THR A 1 260 ? 2.134   50.546 38.631  1.00 18.51 ? 260 THR A O     1 
ATOM   1963 C  CB    . THR A 1 260 ? 1.192   47.464 37.348  1.00 14.72 ? 260 THR A CB    1 
ATOM   1964 O  OG1   . THR A 1 260 ? 2.030   46.433 36.819  1.00 15.14 ? 260 THR A OG1   1 
ATOM   1965 C  CG2   . THR A 1 260 ? -0.230  47.327 36.787  1.00 13.03 ? 260 THR A CG2   1 
ATOM   1966 N  N     . THR A 1 261 ? 0.114   49.533 38.566  1.00 18.93 ? 261 THR A N     1 
ATOM   1967 C  CA    . THR A 1 261 ? -0.455  50.291 39.662  1.00 19.71 ? 261 THR A CA    1 
ATOM   1968 C  C     . THR A 1 261 ? -0.376  49.443 40.925  1.00 20.00 ? 261 THR A C     1 
ATOM   1969 O  O     . THR A 1 261 ? -0.392  48.212 40.854  1.00 19.55 ? 261 THR A O     1 
ATOM   1970 C  CB    . THR A 1 261 ? -1.933  50.649 39.359  1.00 19.79 ? 261 THR A CB    1 
ATOM   1971 O  OG1   . THR A 1 261 ? -2.716  49.450 39.263  1.00 19.89 ? 261 THR A OG1   1 
ATOM   1972 C  CG2   . THR A 1 261 ? -2.030  51.409 38.040  1.00 17.63 ? 261 THR A CG2   1 
HETATM 1973 N  N     . MSE A 1 262 ? -0.286  50.093 42.081  1.00 20.74 ? 262 MSE A N     1 
HETATM 1974 C  CA    . MSE A 1 262 ? -0.206  49.352 43.333  1.00 20.02 ? 262 MSE A CA    1 
HETATM 1975 C  C     . MSE A 1 262 ? -1.425  48.448 43.486  1.00 20.59 ? 262 MSE A C     1 
HETATM 1976 O  O     . MSE A 1 262 ? -1.308  47.333 43.998  1.00 21.76 ? 262 MSE A O     1 
HETATM 1977 C  CB    . MSE A 1 262 ? -0.109  50.306 44.525  1.00 17.97 ? 262 MSE A CB    1 
HETATM 1978 C  CG    . MSE A 1 262 ? -0.024  49.598 45.870  1.00 18.34 ? 262 MSE A CG    1 
HETATM 1979 SE SE    . MSE A 1 262 ? 1.498   48.502 46.007  1.00 15.77 ? 262 MSE A SE    1 
HETATM 1980 C  CE    . MSE A 1 262 ? 1.146   47.901 47.695  1.00 18.92 ? 262 MSE A CE    1 
ATOM   1981 N  N     . ASP A 1 263 ? -2.586  48.915 43.025  1.00 20.60 ? 263 ASP A N     1 
ATOM   1982 C  CA    . ASP A 1 263 ? -3.811  48.121 43.142  1.00 20.20 ? 263 ASP A CA    1 
ATOM   1983 C  C     . ASP A 1 263 ? -3.650  46.744 42.522  1.00 19.94 ? 263 ASP A C     1 
ATOM   1984 O  O     . ASP A 1 263 ? -4.177  45.758 43.028  1.00 19.20 ? 263 ASP A O     1 
ATOM   1985 C  CB    . ASP A 1 263 ? -5.001  48.846 42.505  1.00 19.63 ? 263 ASP A CB    1 
ATOM   1986 C  CG    . ASP A 1 263 ? -5.347  50.140 43.228  1.00 19.63 ? 263 ASP A CG    1 
ATOM   1987 O  OD1   . ASP A 1 263 ? -5.152  50.190 44.460  1.00 17.78 ? 263 ASP A OD1   1 
ATOM   1988 O  OD2   . ASP A 1 263 ? -5.841  51.095 42.583  1.00 20.15 ? 263 ASP A OD2   1 
ATOM   1989 N  N     . GLU A 1 264 ? -2.909  46.689 41.422  1.00 20.61 ? 264 GLU A N     1 
ATOM   1990 C  CA    . GLU A 1 264 ? -2.642  45.439 40.722  1.00 20.74 ? 264 GLU A CA    1 
ATOM   1991 C  C     . GLU A 1 264 ? -1.551  44.651 41.434  1.00 20.45 ? 264 GLU A C     1 
ATOM   1992 O  O     . GLU A 1 264 ? -1.762  43.511 41.850  1.00 20.59 ? 264 GLU A O     1 
ATOM   1993 C  CB    . GLU A 1 264 ? -2.177  45.733 39.296  1.00 21.75 ? 264 GLU A CB    1 
ATOM   1994 C  CG    . GLU A 1 264 ? -3.225  46.390 38.433  1.00 24.61 ? 264 GLU A CG    1 
ATOM   1995 C  CD    . GLU A 1 264 ? -4.386  45.461 38.148  1.00 25.41 ? 264 GLU A CD    1 
ATOM   1996 O  OE1   . GLU A 1 264 ? -4.162  44.427 37.473  1.00 25.63 ? 264 GLU A OE1   1 
ATOM   1997 O  OE2   . GLU A 1 264 ? -5.514  45.763 38.603  1.00 26.26 ? 264 GLU A OE2   1 
ATOM   1998 N  N     . ALA A 1 265 ? -0.389  45.286 41.574  1.00 20.55 ? 265 ALA A N     1 
ATOM   1999 C  CA    . ALA A 1 265 ? 0.783   44.678 42.188  1.00 20.15 ? 265 ALA A CA    1 
ATOM   2000 C  C     . ALA A 1 265 ? 0.605   44.243 43.626  1.00 20.72 ? 265 ALA A C     1 
ATOM   2001 O  O     . ALA A 1 265 ? 1.312   43.340 44.080  1.00 21.52 ? 265 ALA A O     1 
ATOM   2002 C  CB    . ALA A 1 265 ? 1.963   45.617 42.086  1.00 19.55 ? 265 ALA A CB    1 
ATOM   2003 N  N     . CYS A 1 266 ? -0.326  44.858 44.351  1.00 19.97 ? 266 CYS A N     1 
ATOM   2004 C  CA    . CYS A 1 266 ? -0.517  44.476 45.743  1.00 19.60 ? 266 CYS A CA    1 
ATOM   2005 C  C     . CYS A 1 266 ? -0.938  43.017 45.853  1.00 19.88 ? 266 CYS A C     1 
ATOM   2006 O  O     . CYS A 1 266 ? -0.735  42.387 46.895  1.00 21.05 ? 266 CYS A O     1 
ATOM   2007 C  CB    . CYS A 1 266 ? -1.565  45.362 46.426  1.00 20.28 ? 266 CYS A CB    1 
ATOM   2008 S  SG    . CYS A 1 266 ? -3.278  45.086 45.922  1.00 19.68 ? 266 CYS A SG    1 
ATOM   2009 N  N     . GLN A 1 267 ? -1.497  42.472 44.774  1.00 19.55 ? 267 GLN A N     1 
ATOM   2010 C  CA    . GLN A 1 267 ? -1.961  41.085 44.768  1.00 19.15 ? 267 GLN A CA    1 
ATOM   2011 C  C     . GLN A 1 267 ? -0.851  40.114 44.362  1.00 19.16 ? 267 GLN A C     1 
ATOM   2012 O  O     . GLN A 1 267 ? -1.063  38.896 44.351  1.00 20.13 ? 267 GLN A O     1 
ATOM   2013 C  CB    . GLN A 1 267 ? -3.108  40.913 43.774  1.00 19.49 ? 267 GLN A CB    1 
ATOM   2014 C  CG    . GLN A 1 267 ? -4.018  42.119 43.617  1.00 20.32 ? 267 GLN A CG    1 
ATOM   2015 C  CD    . GLN A 1 267 ? -5.146  41.865 42.627  1.00 21.09 ? 267 GLN A CD    1 
ATOM   2016 O  OE1   . GLN A 1 267 ? -5.836  42.792 42.198  1.00 20.56 ? 267 GLN A OE1   1 
ATOM   2017 N  NE2   . GLN A 1 267 ? -5.350  40.598 42.274  1.00 21.65 ? 267 GLN A NE2   1 
ATOM   2018 N  N     . GLU A 1 268 ? 0.324   40.639 44.029  1.00 17.87 ? 268 GLU A N     1 
ATOM   2019 C  CA    . GLU A 1 268 ? 1.420   39.791 43.577  1.00 16.73 ? 268 GLU A CA    1 
ATOM   2020 C  C     . GLU A 1 268 ? 2.678   39.823 44.423  1.00 15.60 ? 268 GLU A C     1 
ATOM   2021 O  O     . GLU A 1 268 ? 3.363   38.814 44.581  1.00 14.77 ? 268 GLU A O     1 
ATOM   2022 C  CB    . GLU A 1 268 ? 1.800   40.178 42.155  1.00 17.95 ? 268 GLU A CB    1 
ATOM   2023 C  CG    . GLU A 1 268 ? 0.798   39.811 41.097  1.00 20.74 ? 268 GLU A CG    1 
ATOM   2024 C  CD    . GLU A 1 268 ? 1.232   40.310 39.735  1.00 23.65 ? 268 GLU A CD    1 
ATOM   2025 O  OE1   . GLU A 1 268 ? 1.105   41.536 39.481  1.00 25.22 ? 268 GLU A OE1   1 
ATOM   2026 O  OE2   . GLU A 1 268 ? 1.724   39.483 38.927  1.00 24.06 ? 268 GLU A OE2   1 
ATOM   2027 N  N     . GLY A 1 269 ? 2.982   40.998 44.951  1.00 15.11 ? 269 GLY A N     1 
ATOM   2028 C  CA    . GLY A 1 269 ? 4.176   41.166 45.747  1.00 13.49 ? 269 GLY A CA    1 
ATOM   2029 C  C     . GLY A 1 269 ? 4.336   40.312 46.989  1.00 12.49 ? 269 GLY A C     1 
ATOM   2030 O  O     . GLY A 1 269 ? 3.378   40.019 47.705  1.00 12.17 ? 269 GLY A O     1 
ATOM   2031 N  N     . ASN A 1 270 ? 5.581   39.907 47.218  1.00 11.46 ? 270 ASN A N     1 
ATOM   2032 C  CA    . ASN A 1 270 ? 5.969   39.124 48.376  1.00 9.77  ? 270 ASN A CA    1 
ATOM   2033 C  C     . ASN A 1 270 ? 6.777   40.105 49.210  1.00 9.73  ? 270 ASN A C     1 
ATOM   2034 O  O     . ASN A 1 270 ? 7.000   39.909 50.407  1.00 9.60  ? 270 ASN A O     1 
ATOM   2035 C  CB    . ASN A 1 270 ? 6.855   37.953 47.960  1.00 10.53 ? 270 ASN A CB    1 
ATOM   2036 C  CG    . ASN A 1 270 ? 6.143   36.980 47.043  1.00 11.25 ? 270 ASN A CG    1 
ATOM   2037 O  OD1   . ASN A 1 270 ? 5.027   36.557 47.335  1.00 14.52 ? 270 ASN A OD1   1 
ATOM   2038 N  ND2   . ASN A 1 270 ? 6.790   36.602 45.940  1.00 10.33 ? 270 ASN A ND2   1 
ATOM   2039 N  N     . ILE A 1 271 ? 7.211   41.177 48.554  1.00 8.72  ? 271 ILE A N     1 
ATOM   2040 C  CA    . ILE A 1 271 ? 7.991   42.212 49.208  1.00 7.46  ? 271 ILE A CA    1 
ATOM   2041 C  C     . ILE A 1 271 ? 7.545   43.547 48.628  1.00 7.56  ? 271 ILE A C     1 
ATOM   2042 O  O     . ILE A 1 271 ? 7.348   43.655 47.417  1.00 8.04  ? 271 ILE A O     1 
ATOM   2043 C  CB    . ILE A 1 271 ? 9.515   42.021 48.941  1.00 7.73  ? 271 ILE A CB    1 
ATOM   2044 C  CG1   . ILE A 1 271 ? 9.962   40.634 49.416  1.00 6.59  ? 271 ILE A CG1   1 
ATOM   2045 C  CG2   . ILE A 1 271 ? 10.321  43.101 49.671  1.00 5.15  ? 271 ILE A CG2   1 
ATOM   2046 C  CD1   . ILE A 1 271 ? 11.427  40.363 49.180  1.00 8.99  ? 271 ILE A CD1   1 
ATOM   2047 N  N     . PHE A 1 272 ? 7.364   44.554 49.480  1.00 6.97  ? 272 PHE A N     1 
ATOM   2048 C  CA    . PHE A 1 272 ? 6.958   45.868 49.004  1.00 9.22  ? 272 PHE A CA    1 
ATOM   2049 C  C     . PHE A 1 272 ? 7.889   46.920 49.570  1.00 11.06 ? 272 PHE A C     1 
ATOM   2050 O  O     . PHE A 1 272 ? 8.167   46.934 50.778  1.00 11.99 ? 272 PHE A O     1 
ATOM   2051 C  CB    . PHE A 1 272 ? 5.514   46.195 49.410  1.00 10.04 ? 272 PHE A CB    1 
ATOM   2052 C  CG    . PHE A 1 272 ? 4.492   45.236 48.859  1.00 10.10 ? 272 PHE A CG    1 
ATOM   2053 C  CD1   . PHE A 1 272 ? 4.314   43.982 49.427  1.00 10.29 ? 272 PHE A CD1   1 
ATOM   2054 C  CD2   . PHE A 1 272 ? 3.734   45.574 47.742  1.00 10.44 ? 272 PHE A CD2   1 
ATOM   2055 C  CE1   . PHE A 1 272 ? 3.392   43.072 48.892  1.00 11.33 ? 272 PHE A CE1   1 
ATOM   2056 C  CE2   . PHE A 1 272 ? 2.808   44.674 47.197  1.00 10.83 ? 272 PHE A CE2   1 
ATOM   2057 C  CZ    . PHE A 1 272 ? 2.639   43.417 47.775  1.00 11.31 ? 272 PHE A CZ    1 
ATOM   2058 N  N     . VAL A 1 273 ? 8.369   47.800 48.696  1.00 12.27 ? 273 VAL A N     1 
ATOM   2059 C  CA    . VAL A 1 273 ? 9.289   48.863 49.094  1.00 12.80 ? 273 VAL A CA    1 
ATOM   2060 C  C     . VAL A 1 273 ? 8.842   50.198 48.508  1.00 14.06 ? 273 VAL A C     1 
ATOM   2061 O  O     . VAL A 1 273 ? 8.773   50.369 47.282  1.00 15.40 ? 273 VAL A O     1 
ATOM   2062 C  CB    . VAL A 1 273 ? 10.715  48.559 48.598  1.00 11.95 ? 273 VAL A CB    1 
ATOM   2063 C  CG1   . VAL A 1 273 ? 11.680  49.641 49.065  1.00 10.28 ? 273 VAL A CG1   1 
ATOM   2064 C  CG2   . VAL A 1 273 ? 11.149  47.191 49.095  1.00 12.34 ? 273 VAL A CG2   1 
ATOM   2065 N  N     . THR A 1 274 ? 8.538   51.152 49.375  1.00 14.78 ? 274 THR A N     1 
ATOM   2066 C  CA    . THR A 1 274 ? 8.098   52.452 48.893  1.00 16.48 ? 274 THR A CA    1 
ATOM   2067 C  C     . THR A 1 274 ? 9.287   53.419 48.849  1.00 16.30 ? 274 THR A C     1 
ATOM   2068 O  O     . THR A 1 274 ? 9.944   53.648 49.874  1.00 16.70 ? 274 THR A O     1 
ATOM   2069 C  CB    . THR A 1 274 ? 6.996   53.002 49.805  1.00 16.96 ? 274 THR A CB    1 
ATOM   2070 O  OG1   . THR A 1 274 ? 7.498   53.102 51.145  1.00 20.33 ? 274 THR A OG1   1 
ATOM   2071 C  CG2   . THR A 1 274 ? 5.805   52.061 49.804  1.00 17.18 ? 274 THR A CG2   1 
ATOM   2072 N  N     . THR A 1 275 ? 9.576   53.952 47.660  1.00 15.30 ? 275 THR A N     1 
ATOM   2073 C  CA    . THR A 1 275 ? 10.679  54.891 47.485  1.00 14.79 ? 275 THR A CA    1 
ATOM   2074 C  C     . THR A 1 275 ? 10.085  56.219 47.034  1.00 15.02 ? 275 THR A C     1 
ATOM   2075 O  O     . THR A 1 275 ? 10.791  57.161 46.649  1.00 13.28 ? 275 THR A O     1 
ATOM   2076 C  CB    . THR A 1 275 ? 11.719  54.403 46.428  1.00 13.73 ? 275 THR A CB    1 
ATOM   2077 O  OG1   . THR A 1 275 ? 11.170  54.491 45.106  1.00 12.90 ? 275 THR A OG1   1 
ATOM   2078 C  CG2   . THR A 1 275 ? 12.123  52.971 46.719  1.00 12.43 ? 275 THR A CG2   1 
ATOM   2079 N  N     . THR A 1 276 ? 8.762   56.270 47.073  1.00 17.13 ? 276 THR A N     1 
ATOM   2080 C  CA    . THR A 1 276 ? 8.025   57.469 46.718  1.00 18.56 ? 276 THR A CA    1 
ATOM   2081 C  C     . THR A 1 276 ? 8.368   58.518 47.766  1.00 20.55 ? 276 THR A C     1 
ATOM   2082 O  O     . THR A 1 276 ? 9.037   58.236 48.769  1.00 22.53 ? 276 THR A O     1 
ATOM   2083 C  CB    . THR A 1 276 ? 6.526   57.198 46.780  1.00 17.63 ? 276 THR A CB    1 
ATOM   2084 O  OG1   . THR A 1 276 ? 6.162   56.335 45.700  1.00 19.51 ? 276 THR A OG1   1 
ATOM   2085 C  CG2   . THR A 1 276 ? 5.743   58.473 46.721  1.00 19.13 ? 276 THR A CG2   1 
ATOM   2086 N  N     . GLY A 1 277 ? 7.934   59.742 47.541  1.00 20.52 ? 277 GLY A N     1 
ATOM   2087 C  CA    . GLY A 1 277 ? 8.202   60.749 48.538  1.00 19.90 ? 277 GLY A CA    1 
ATOM   2088 C  C     . GLY A 1 277 ? 6.873   61.224 49.083  1.00 19.60 ? 277 GLY A C     1 
ATOM   2089 O  O     . GLY A 1 277 ? 6.832   62.263 49.749  1.00 18.65 ? 277 GLY A O     1 
ATOM   2090 N  N     . CYS A 1 278 ? 5.792   60.480 48.814  1.00 18.27 ? 278 CYS A N     1 
ATOM   2091 C  CA    . CYS A 1 278 ? 4.486   60.924 49.287  1.00 17.88 ? 278 CYS A CA    1 
ATOM   2092 C  C     . CYS A 1 278 ? 3.585   59.934 50.015  1.00 17.14 ? 278 CYS A C     1 
ATOM   2093 O  O     . CYS A 1 278 ? 3.847   58.737 50.083  1.00 15.49 ? 278 CYS A O     1 
ATOM   2094 C  CB    . CYS A 1 278 ? 3.693   61.580 48.140  1.00 18.63 ? 278 CYS A CB    1 
ATOM   2095 S  SG    . CYS A 1 278 ? 2.652   60.519 47.118  1.00 18.65 ? 278 CYS A SG    1 
ATOM   2096 N  N     . ILE A 1 279 ? 2.508   60.498 50.554  1.00 17.04 ? 279 ILE A N     1 
ATOM   2097 C  CA    . ILE A 1 279 ? 1.488   59.811 51.335  1.00 16.62 ? 279 ILE A CA    1 
ATOM   2098 C  C     . ILE A 1 279 ? 0.549   58.888 50.574  1.00 17.44 ? 279 ILE A C     1 
ATOM   2099 O  O     . ILE A 1 279 ? 0.302   59.060 49.377  1.00 17.04 ? 279 ILE A O     1 
ATOM   2100 C  CB    . ILE A 1 279 ? 0.596   60.838 52.016  1.00 16.58 ? 279 ILE A CB    1 
ATOM   2101 C  CG1   . ILE A 1 279 ? -0.059  61.703 50.939  1.00 17.24 ? 279 ILE A CG1   1 
ATOM   2102 C  CG2   . ILE A 1 279 ? 1.405   61.708 52.957  1.00 15.92 ? 279 ILE A CG2   1 
ATOM   2103 C  CD1   . ILE A 1 279 ? -0.844  62.883 51.483  1.00 20.58 ? 279 ILE A CD1   1 
ATOM   2104 N  N     . ASP A 1 280 ? 0.026   57.904 51.299  1.00 18.36 ? 280 ASP A N     1 
ATOM   2105 C  CA    . ASP A 1 280 ? -0.952  56.977 50.750  1.00 18.79 ? 280 ASP A CA    1 
ATOM   2106 C  C     . ASP A 1 280 ? -0.476  56.115 49.586  1.00 18.62 ? 280 ASP A C     1 
ATOM   2107 O  O     . ASP A 1 280 ? -1.060  56.158 48.498  1.00 19.38 ? 280 ASP A O     1 
ATOM   2108 C  CB    . ASP A 1 280 ? -2.177  57.784 50.328  1.00 18.93 ? 280 ASP A CB    1 
ATOM   2109 C  CG    . ASP A 1 280 ? -2.669  58.692 51.433  1.00 20.07 ? 280 ASP A CG    1 
ATOM   2110 O  OD1   . ASP A 1 280 ? -2.228  58.517 52.594  1.00 20.22 ? 280 ASP A OD1   1 
ATOM   2111 O  OD2   . ASP A 1 280 ? -3.502  59.576 51.146  1.00 21.99 ? 280 ASP A OD2   1 
ATOM   2112 N  N     . ILE A 1 281 ? 0.563   55.315 49.813  1.00 17.50 ? 281 ILE A N     1 
ATOM   2113 C  CA    . ILE A 1 281 ? 1.076   54.449 48.753  1.00 16.15 ? 281 ILE A CA    1 
ATOM   2114 C  C     . ILE A 1 281 ? 0.547   53.022 48.922  1.00 16.14 ? 281 ILE A C     1 
ATOM   2115 O  O     . ILE A 1 281 ? 0.130   52.380 47.946  1.00 15.40 ? 281 ILE A O     1 
ATOM   2116 C  CB    . ILE A 1 281 ? 2.616   54.420 48.758  1.00 14.19 ? 281 ILE A CB    1 
ATOM   2117 C  CG1   . ILE A 1 281 ? 3.158   55.846 48.659  1.00 13.03 ? 281 ILE A CG1   1 
ATOM   2118 C  CG2   . ILE A 1 281 ? 3.122   53.582 47.593  1.00 11.16 ? 281 ILE A CG2   1 
ATOM   2119 C  CD1   . ILE A 1 281 ? 2.751   56.583 47.386  1.00 13.33 ? 281 ILE A CD1   1 
ATOM   2120 N  N     . ILE A 1 282 ? 0.578   52.539 50.164  1.00 15.39 ? 282 ILE A N     1 
ATOM   2121 C  CA    . ILE A 1 282 ? 0.095   51.203 50.502  1.00 16.33 ? 282 ILE A CA    1 
ATOM   2122 C  C     . ILE A 1 282 ? -0.979  51.342 51.583  1.00 16.84 ? 282 ILE A C     1 
ATOM   2123 O  O     . ILE A 1 282 ? -0.673  51.662 52.736  1.00 17.36 ? 282 ILE A O     1 
ATOM   2124 C  CB    . ILE A 1 282 ? 1.236   50.319 51.023  1.00 15.70 ? 282 ILE A CB    1 
ATOM   2125 C  CG1   . ILE A 1 282 ? 2.312   50.185 49.943  1.00 15.79 ? 282 ILE A CG1   1 
ATOM   2126 C  CG2   . ILE A 1 282 ? 0.700   48.967 51.402  1.00 15.04 ? 282 ILE A CG2   1 
ATOM   2127 C  CD1   . ILE A 1 282 ? 3.463   49.294 50.329  1.00 18.05 ? 282 ILE A CD1   1 
ATOM   2128 N  N     . LEU A 1 283 ? -2.234  51.100 51.205  1.00 16.54 ? 283 LEU A N     1 
ATOM   2129 C  CA    . LEU A 1 283 ? -3.354  51.239 52.125  1.00 16.43 ? 283 LEU A CA    1 
ATOM   2130 C  C     . LEU A 1 283 ? -3.979  49.905 52.533  1.00 17.43 ? 283 LEU A C     1 
ATOM   2131 O  O     . LEU A 1 283 ? -3.510  48.824 52.140  1.00 16.51 ? 283 LEU A O     1 
ATOM   2132 C  CB    . LEU A 1 283 ? -4.442  52.100 51.483  1.00 17.53 ? 283 LEU A CB    1 
ATOM   2133 C  CG    . LEU A 1 283 ? -4.100  53.443 50.823  1.00 17.44 ? 283 LEU A CG    1 
ATOM   2134 C  CD1   . LEU A 1 283 ? -3.410  54.353 51.820  1.00 18.48 ? 283 LEU A CD1   1 
ATOM   2135 C  CD2   . LEU A 1 283 ? -3.217  53.213 49.616  1.00 17.09 ? 283 LEU A CD2   1 
ATOM   2136 N  N     . GLY A 1 284 ? -5.051  50.002 53.322  1.00 17.75 ? 284 GLY A N     1 
ATOM   2137 C  CA    . GLY A 1 284 ? -5.777  48.826 53.769  1.00 16.96 ? 284 GLY A CA    1 
ATOM   2138 C  C     . GLY A 1 284 ? -6.239  48.021 52.566  1.00 17.87 ? 284 GLY A C     1 
ATOM   2139 O  O     . GLY A 1 284 ? -6.162  46.796 52.590  1.00 18.66 ? 284 GLY A O     1 
ATOM   2140 N  N     . ARG A 1 285 ? -6.726  48.698 51.522  1.00 17.89 ? 285 ARG A N     1 
ATOM   2141 C  CA    . ARG A 1 285 ? -7.164  48.025 50.286  1.00 18.09 ? 285 ARG A CA    1 
ATOM   2142 C  C     . ARG A 1 285 ? -6.096  47.037 49.825  1.00 18.36 ? 285 ARG A C     1 
ATOM   2143 O  O     . ARG A 1 285 ? -6.381  45.906 49.421  1.00 17.90 ? 285 ARG A O     1 
ATOM   2144 C  CB    . ARG A 1 285 ? -7.334  49.037 49.156  1.00 18.39 ? 285 ARG A CB    1 
ATOM   2145 C  CG    . ARG A 1 285 ? -8.515  49.947 49.260  1.00 20.96 ? 285 ARG A CG    1 
ATOM   2146 C  CD    . ARG A 1 285 ? -8.172  51.258 48.574  1.00 22.53 ? 285 ARG A CD    1 
ATOM   2147 N  NE    . ARG A 1 285 ? -7.584  51.090 47.245  1.00 21.06 ? 285 ARG A NE    1 
ATOM   2148 C  CZ    . ARG A 1 285 ? -7.023  52.091 46.566  1.00 21.96 ? 285 ARG A CZ    1 
ATOM   2149 N  NH1   . ARG A 1 285 ? -6.979  53.310 47.096  1.00 20.10 ? 285 ARG A NH1   1 
ATOM   2150 N  NH2   . ARG A 1 285 ? -6.523  51.889 45.355  1.00 22.63 ? 285 ARG A NH2   1 
ATOM   2151 N  N     . HIS A 1 286 ? -4.858  47.517 49.880  1.00 19.05 ? 286 HIS A N     1 
ATOM   2152 C  CA    . HIS A 1 286 ? -3.676  46.787 49.468  1.00 17.92 ? 286 HIS A CA    1 
ATOM   2153 C  C     . HIS A 1 286 ? -3.312  45.704 50.472  1.00 18.44 ? 286 HIS A C     1 
ATOM   2154 O  O     . HIS A 1 286 ? -3.170  44.531 50.103  1.00 18.69 ? 286 HIS A O     1 
ATOM   2155 C  CB    . HIS A 1 286 ? -2.548  47.796 49.295  1.00 17.60 ? 286 HIS A CB    1 
ATOM   2156 C  CG    . HIS A 1 286 ? -2.880  48.887 48.321  1.00 17.73 ? 286 HIS A CG    1 
ATOM   2157 N  ND1   . HIS A 1 286 ? -2.253  50.115 48.326  1.00 17.07 ? 286 HIS A ND1   1 
ATOM   2158 C  CD2   . HIS A 1 286 ? -3.768  48.923 47.299  1.00 16.68 ? 286 HIS A CD2   1 
ATOM   2159 C  CE1   . HIS A 1 286 ? -2.743  50.860 47.351  1.00 16.65 ? 286 HIS A CE1   1 
ATOM   2160 N  NE2   . HIS A 1 286 ? -3.663  50.159 46.713  1.00 16.93 ? 286 HIS A NE2   1 
ATOM   2161 N  N     . PHE A 1 287 ? -3.166  46.084 51.738  1.00 17.32 ? 287 PHE A N     1 
ATOM   2162 C  CA    . PHE A 1 287 ? -2.833  45.107 52.763  1.00 18.06 ? 287 PHE A CA    1 
ATOM   2163 C  C     . PHE A 1 287 ? -3.705  43.864 52.682  1.00 18.94 ? 287 PHE A C     1 
ATOM   2164 O  O     . PHE A 1 287 ? -3.200  42.741 52.724  1.00 19.48 ? 287 PHE A O     1 
ATOM   2165 C  CB    . PHE A 1 287 ? -2.970  45.727 54.145  1.00 18.46 ? 287 PHE A CB    1 
ATOM   2166 C  CG    . PHE A 1 287 ? -1.816  46.597 54.532  1.00 19.79 ? 287 PHE A CG    1 
ATOM   2167 C  CD1   . PHE A 1 287 ? -0.503  46.192 54.278  1.00 19.15 ? 287 PHE A CD1   1 
ATOM   2168 C  CD2   . PHE A 1 287 ? -2.033  47.812 55.179  1.00 20.60 ? 287 PHE A CD2   1 
ATOM   2169 C  CE1   . PHE A 1 287 ? 0.574   46.983 54.666  1.00 19.10 ? 287 PHE A CE1   1 
ATOM   2170 C  CE2   . PHE A 1 287 ? -0.955  48.618 55.572  1.00 21.20 ? 287 PHE A CE2   1 
ATOM   2171 C  CZ    . PHE A 1 287 ? 0.352   48.200 55.313  1.00 20.02 ? 287 PHE A CZ    1 
ATOM   2172 N  N     . GLU A 1 288 ? -5.012  44.069 52.543  1.00 20.40 ? 288 GLU A N     1 
ATOM   2173 C  CA    . GLU A 1 288 ? -5.961  42.961 52.486  1.00 21.08 ? 288 GLU A CA    1 
ATOM   2174 C  C     . GLU A 1 288 ? -5.812  41.978 51.332  1.00 20.34 ? 288 GLU A C     1 
ATOM   2175 O  O     . GLU A 1 288 ? -6.250  40.839 51.454  1.00 21.25 ? 288 GLU A O     1 
ATOM   2176 C  CB    . GLU A 1 288 ? -7.391  43.495 52.529  1.00 22.93 ? 288 GLU A CB    1 
ATOM   2177 C  CG    . GLU A 1 288 ? -7.617  44.419 53.713  1.00 26.56 ? 288 GLU A CG    1 
ATOM   2178 C  CD    . GLU A 1 288 ? -9.077  44.762 53.943  1.00 29.09 ? 288 GLU A CD    1 
ATOM   2179 O  OE1   . GLU A 1 288 ? -9.768  45.124 52.957  1.00 30.91 ? 288 GLU A OE1   1 
ATOM   2180 O  OE2   . GLU A 1 288 ? -9.517  44.686 55.120  1.00 28.00 ? 288 GLU A OE2   1 
ATOM   2181 N  N     . GLN A 1 289 ? -5.194  42.390 50.227  1.00 19.48 ? 289 GLN A N     1 
ATOM   2182 C  CA    . GLN A 1 289 ? -5.015  41.478 49.094  1.00 18.96 ? 289 GLN A CA    1 
ATOM   2183 C  C     . GLN A 1 289 ? -3.626  40.838 48.996  1.00 18.64 ? 289 GLN A C     1 
ATOM   2184 O  O     . GLN A 1 289 ? -3.404  39.917 48.200  1.00 17.43 ? 289 GLN A O     1 
ATOM   2185 C  CB    . GLN A 1 289 ? -5.304  42.192 47.781  1.00 19.48 ? 289 GLN A CB    1 
ATOM   2186 C  CG    . GLN A 1 289 ? -6.710  42.727 47.632  1.00 20.32 ? 289 GLN A CG    1 
ATOM   2187 C  CD    . GLN A 1 289 ? -6.909  43.373 46.261  1.00 21.38 ? 289 GLN A CD    1 
ATOM   2188 O  OE1   . GLN A 1 289 ? -6.885  42.687 45.233  1.00 21.82 ? 289 GLN A OE1   1 
ATOM   2189 N  NE2   . GLN A 1 289 ? -7.070  44.700 46.238  1.00 20.04 ? 289 GLN A NE2   1 
HETATM 2190 N  N     . MSE A 1 290 ? -2.687  41.316 49.800  1.00 19.41 ? 290 MSE A N     1 
HETATM 2191 C  CA    . MSE A 1 290 ? -1.336  40.767 49.736  1.00 20.12 ? 290 MSE A CA    1 
HETATM 2192 C  C     . MSE A 1 290 ? -1.287  39.283 50.066  1.00 19.60 ? 290 MSE A C     1 
HETATM 2193 O  O     . MSE A 1 290 ? -2.171  38.750 50.741  1.00 19.91 ? 290 MSE A O     1 
HETATM 2194 C  CB    . MSE A 1 290 ? -0.391  41.531 50.666  1.00 20.86 ? 290 MSE A CB    1 
HETATM 2195 C  CG    . MSE A 1 290 ? -0.262  43.019 50.332  1.00 20.29 ? 290 MSE A CG    1 
HETATM 2196 SE SE    . MSE A 1 290 ? 0.899   43.806 51.541  1.00 19.44 ? 290 MSE A SE    1 
HETATM 2197 C  CE    . MSE A 1 290 ? 0.808   45.509 50.866  1.00 17.36 ? 290 MSE A CE    1 
ATOM   2198 N  N     . LYS A 1 291 ? -0.234  38.628 49.596  1.00 18.32 ? 291 LYS A N     1 
ATOM   2199 C  CA    . LYS A 1 291 ? -0.068  37.205 49.824  1.00 17.70 ? 291 LYS A CA    1 
ATOM   2200 C  C     . LYS A 1 291 ? 0.424   37.007 51.250  1.00 17.48 ? 291 LYS A C     1 
ATOM   2201 O  O     . LYS A 1 291 ? 0.937   37.939 51.875  1.00 17.34 ? 291 LYS A O     1 
ATOM   2202 C  CB    . LYS A 1 291 ? 0.912   36.652 48.789  1.00 17.74 ? 291 LYS A CB    1 
ATOM   2203 C  CG    . LYS A 1 291 ? 0.570   37.163 47.382  1.00 19.77 ? 291 LYS A CG    1 
ATOM   2204 C  CD    . LYS A 1 291 ? 1.491   36.629 46.297  1.00 21.60 ? 291 LYS A CD    1 
ATOM   2205 C  CE    . LYS A 1 291 ? 1.245   35.158 46.035  1.00 22.74 ? 291 LYS A CE    1 
ATOM   2206 N  NZ    . LYS A 1 291 ? -0.145  34.940 45.566  1.00 23.47 ? 291 LYS A NZ    1 
ATOM   2207 N  N     . ASP A 1 292 ? 0.245   35.805 51.779  1.00 17.36 ? 292 ASP A N     1 
ATOM   2208 C  CA    . ASP A 1 292 ? 0.658   35.517 53.151  1.00 16.47 ? 292 ASP A CA    1 
ATOM   2209 C  C     . ASP A 1 292 ? 2.105   35.938 53.374  1.00 16.13 ? 292 ASP A C     1 
ATOM   2210 O  O     . ASP A 1 292 ? 2.937   35.796 52.482  1.00 15.83 ? 292 ASP A O     1 
ATOM   2211 C  CB    . ASP A 1 292 ? 0.476   34.026 53.440  1.00 16.26 ? 292 ASP A CB    1 
ATOM   2212 C  CG    . ASP A 1 292 ? 0.627   33.687 54.910  1.00 16.31 ? 292 ASP A CG    1 
ATOM   2213 O  OD1   . ASP A 1 292 ? 0.160   34.485 55.750  1.00 16.26 ? 292 ASP A OD1   1 
ATOM   2214 O  OD2   . ASP A 1 292 ? 1.179   32.610 55.226  1.00 15.69 ? 292 ASP A OD2   1 
ATOM   2215 N  N     . ASP A 1 293 ? 2.383   36.481 54.557  1.00 16.02 ? 293 ASP A N     1 
ATOM   2216 C  CA    . ASP A 1 293 ? 3.721   36.951 54.933  1.00 15.11 ? 293 ASP A CA    1 
ATOM   2217 C  C     . ASP A 1 293 ? 4.439   37.926 53.996  1.00 15.44 ? 293 ASP A C     1 
ATOM   2218 O  O     . ASP A 1 293 ? 5.678   37.960 53.949  1.00 15.62 ? 293 ASP A O     1 
ATOM   2219 C  CB    . ASP A 1 293 ? 4.656   35.775 55.218  1.00 14.11 ? 293 ASP A CB    1 
ATOM   2220 C  CG    . ASP A 1 293 ? 4.544   35.284 56.645  1.00 15.09 ? 293 ASP A CG    1 
ATOM   2221 O  OD1   . ASP A 1 293 ? 4.593   36.140 57.557  1.00 14.52 ? 293 ASP A OD1   1 
ATOM   2222 O  OD2   . ASP A 1 293 ? 4.425   34.057 56.859  1.00 16.09 ? 293 ASP A OD2   1 
ATOM   2223 N  N     . ALA A 1 294 ? 3.678   38.721 53.252  1.00 14.83 ? 294 ALA A N     1 
ATOM   2224 C  CA    . ALA A 1 294 ? 4.291   39.696 52.366  1.00 13.82 ? 294 ALA A CA    1 
ATOM   2225 C  C     . ALA A 1 294 ? 5.089   40.631 53.267  1.00 13.92 ? 294 ALA A C     1 
ATOM   2226 O  O     . ALA A 1 294 ? 4.635   40.968 54.367  1.00 13.53 ? 294 ALA A O     1 
ATOM   2227 C  CB    . ALA A 1 294 ? 3.219   40.473 51.628  1.00 14.32 ? 294 ALA A CB    1 
ATOM   2228 N  N     . ILE A 1 295 ? 6.279   41.034 52.828  1.00 12.66 ? 295 ILE A N     1 
ATOM   2229 C  CA    . ILE A 1 295 ? 7.088   41.940 53.636  1.00 10.74 ? 295 ILE A CA    1 
ATOM   2230 C  C     . ILE A 1 295 ? 6.944   43.368 53.111  1.00 10.28 ? 295 ILE A C     1 
ATOM   2231 O  O     . ILE A 1 295 ? 7.256   43.655 51.959  1.00 11.39 ? 295 ILE A O     1 
ATOM   2232 C  CB    . ILE A 1 295 ? 8.561   41.523 53.626  1.00 10.72 ? 295 ILE A CB    1 
ATOM   2233 C  CG1   . ILE A 1 295 ? 8.709   40.149 54.291  1.00 10.03 ? 295 ILE A CG1   1 
ATOM   2234 C  CG2   . ILE A 1 295 ? 9.414   42.591 54.324  1.00 11.03 ? 295 ILE A CG2   1 
ATOM   2235 C  CD1   . ILE A 1 295 ? 10.140  39.646 54.353  1.00 8.94  ? 295 ILE A CD1   1 
ATOM   2236 N  N     . VAL A 1 296 ? 6.457   44.256 53.970  1.00 9.51  ? 296 VAL A N     1 
ATOM   2237 C  CA    . VAL A 1 296 ? 6.221   45.658 53.629  1.00 8.01  ? 296 VAL A CA    1 
ATOM   2238 C  C     . VAL A 1 296 ? 7.211   46.552 54.361  1.00 7.29  ? 296 VAL A C     1 
ATOM   2239 O  O     . VAL A 1 296 ? 7.406   46.416 55.574  1.00 9.06  ? 296 VAL A O     1 
ATOM   2240 C  CB    . VAL A 1 296 ? 4.769   46.089 54.038  1.00 8.06  ? 296 VAL A CB    1 
ATOM   2241 C  CG1   . VAL A 1 296 ? 4.522   47.542 53.693  1.00 6.90  ? 296 VAL A CG1   1 
ATOM   2242 C  CG2   . VAL A 1 296 ? 3.752   45.189 53.348  1.00 8.02  ? 296 VAL A CG2   1 
ATOM   2243 N  N     . CYS A 1 297 ? 7.848   47.456 53.631  1.00 4.71  ? 297 CYS A N     1 
ATOM   2244 C  CA    . CYS A 1 297 ? 8.794   48.367 54.255  1.00 5.06  ? 297 CYS A CA    1 
ATOM   2245 C  C     . CYS A 1 297 ? 8.887   49.617 53.410  1.00 5.34  ? 297 CYS A C     1 
ATOM   2246 O  O     . CYS A 1 297 ? 8.522   49.615 52.234  1.00 5.70  ? 297 CYS A O     1 
ATOM   2247 C  CB    . CYS A 1 297 ? 10.186  47.733 54.372  1.00 3.89  ? 297 CYS A CB    1 
ATOM   2248 S  SG    . CYS A 1 297 ? 10.984  47.413 52.763  1.00 3.60  ? 297 CYS A SG    1 
ATOM   2249 N  N     . ASN A 1 298 ? 9.377   50.683 54.023  1.00 5.55  ? 298 ASN A N     1 
ATOM   2250 C  CA    . ASN A 1 298 ? 9.527   51.958 53.349  1.00 6.28  ? 298 ASN A CA    1 
ATOM   2251 C  C     . ASN A 1 298 ? 10.986  52.422 53.439  1.00 8.23  ? 298 ASN A C     1 
ATOM   2252 O  O     . ASN A 1 298 ? 11.731  52.004 54.333  1.00 8.59  ? 298 ASN A O     1 
ATOM   2253 C  CB    . ASN A 1 298 ? 8.621   52.985 54.010  1.00 3.02  ? 298 ASN A CB    1 
ATOM   2254 C  CG    . ASN A 1 298 ? 9.052   54.404 53.716  1.00 2.59  ? 298 ASN A CG    1 
ATOM   2255 O  OD1   . ASN A 1 298 ? 9.070   54.835 52.555  1.00 2.00  ? 298 ASN A OD1   1 
ATOM   2256 N  ND2   . ASN A 1 298 ? 9.421   55.142 54.767  1.00 2.00  ? 298 ASN A ND2   1 
ATOM   2257 N  N     . ILE A 1 299 ? 11.403  53.275 52.507  1.00 9.26  ? 299 ILE A N     1 
ATOM   2258 C  CA    . ILE A 1 299 ? 12.765  53.785 52.547  1.00 10.19 ? 299 ILE A CA    1 
ATOM   2259 C  C     . ILE A 1 299 ? 12.770  55.283 52.258  1.00 10.39 ? 299 ILE A C     1 
ATOM   2260 O  O     . ILE A 1 299 ? 13.828  55.905 52.148  1.00 11.23 ? 299 ILE A O     1 
ATOM   2261 C  CB    . ILE A 1 299 ? 13.684  53.019 51.556  1.00 10.85 ? 299 ILE A CB    1 
ATOM   2262 C  CG1   . ILE A 1 299 ? 15.146  53.357 51.844  1.00 9.34  ? 299 ILE A CG1   1 
ATOM   2263 C  CG2   . ILE A 1 299 ? 13.300  53.350 50.117  1.00 11.38 ? 299 ILE A CG2   1 
ATOM   2264 C  CD1   . ILE A 1 299 ? 16.103  52.514 51.074  1.00 10.64 ? 299 ILE A CD1   1 
ATOM   2265 N  N     . GLY A 1 300 ? 11.572  55.853 52.129  1.00 10.96 ? 300 GLY A N     1 
ATOM   2266 C  CA    . GLY A 1 300 ? 11.444  57.286 51.917  1.00 10.49 ? 300 GLY A CA    1 
ATOM   2267 C  C     . GLY A 1 300 ? 11.825  57.926 53.250  1.00 11.02 ? 300 GLY A C     1 
ATOM   2268 O  O     . GLY A 1 300 ? 11.813  57.248 54.283  1.00 10.44 ? 300 GLY A O     1 
ATOM   2269 N  N     . HIS A 1 301 ? 12.151  59.213 53.254  1.00 11.08 ? 301 HIS A N     1 
ATOM   2270 C  CA    . HIS A 1 301 ? 12.568  59.854 54.494  1.00 12.81 ? 301 HIS A CA    1 
ATOM   2271 C  C     . HIS A 1 301 ? 11.538  59.796 55.614  1.00 13.61 ? 301 HIS A C     1 
ATOM   2272 O  O     . HIS A 1 301 ? 11.827  59.307 56.703  1.00 13.48 ? 301 HIS A O     1 
ATOM   2273 C  CB    . HIS A 1 301 ? 12.982  61.305 54.246  1.00 13.82 ? 301 HIS A CB    1 
ATOM   2274 C  CG    . HIS A 1 301 ? 13.431  62.009 55.486  1.00 16.47 ? 301 HIS A CG    1 
ATOM   2275 N  ND1   . HIS A 1 301 ? 14.488  61.564 56.250  1.00 18.98 ? 301 HIS A ND1   1 
ATOM   2276 C  CD2   . HIS A 1 301 ? 12.934  63.091 56.129  1.00 17.83 ? 301 HIS A CD2   1 
ATOM   2277 C  CE1   . HIS A 1 301 ? 14.622  62.341 57.312  1.00 18.03 ? 301 HIS A CE1   1 
ATOM   2278 N  NE2   . HIS A 1 301 ? 13.691  63.275 57.262  1.00 17.60 ? 301 HIS A NE2   1 
ATOM   2279 N  N     . PHE A 1 302 ? 10.337  60.296 55.352  1.00 16.48 ? 302 PHE A N     1 
ATOM   2280 C  CA    . PHE A 1 302 ? 9.271   60.289 56.356  1.00 18.63 ? 302 PHE A CA    1 
ATOM   2281 C  C     . PHE A 1 302 ? 8.439   59.032 56.256  1.00 19.32 ? 302 PHE A C     1 
ATOM   2282 O  O     . PHE A 1 302 ? 8.223   58.519 55.161  1.00 20.52 ? 302 PHE A O     1 
ATOM   2283 C  CB    . PHE A 1 302 ? 8.366   61.518 56.185  1.00 19.00 ? 302 PHE A CB    1 
ATOM   2284 C  CG    . PHE A 1 302 ? 9.010   62.819 56.622  1.00 20.68 ? 302 PHE A CG    1 
ATOM   2285 C  CD1   . PHE A 1 302 ? 9.959   62.841 57.644  1.00 20.56 ? 302 PHE A CD1   1 
ATOM   2286 C  CD2   . PHE A 1 302 ? 8.638   64.027 56.036  1.00 21.55 ? 302 PHE A CD2   1 
ATOM   2287 C  CE1   . PHE A 1 302 ? 10.523  64.040 58.075  1.00 20.14 ? 302 PHE A CE1   1 
ATOM   2288 C  CE2   . PHE A 1 302 ? 9.202   65.233 56.462  1.00 21.03 ? 302 PHE A CE2   1 
ATOM   2289 C  CZ    . PHE A 1 302 ? 10.144  65.236 57.482  1.00 20.64 ? 302 PHE A CZ    1 
ATOM   2290 N  N     . ASP A 1 303 ? 7.985   58.538 57.404  1.00 21.03 ? 303 ASP A N     1 
ATOM   2291 C  CA    . ASP A 1 303 ? 7.148   57.339 57.466  1.00 22.75 ? 303 ASP A CA    1 
ATOM   2292 C  C     . ASP A 1 303 ? 5.694   57.730 57.189  1.00 23.34 ? 303 ASP A C     1 
ATOM   2293 O  O     . ASP A 1 303 ? 4.863   57.766 58.094  1.00 25.07 ? 303 ASP A O     1 
ATOM   2294 C  CB    . ASP A 1 303 ? 7.270   56.679 58.852  1.00 24.12 ? 303 ASP A CB    1 
ATOM   2295 C  CG    . ASP A 1 303 ? 6.873   57.616 59.993  1.00 26.34 ? 303 ASP A CG    1 
ATOM   2296 O  OD1   . ASP A 1 303 ? 5.666   57.845 60.211  1.00 27.98 ? 303 ASP A OD1   1 
ATOM   2297 O  OD2   . ASP A 1 303 ? 7.778   58.146 60.673  1.00 30.34 ? 303 ASP A OD2   1 
ATOM   2298 N  N     . VAL A 1 304 ? 5.377   58.014 55.931  1.00 22.93 ? 304 VAL A N     1 
ATOM   2299 C  CA    . VAL A 1 304 ? 4.022   58.425 55.600  1.00 21.94 ? 304 VAL A CA    1 
ATOM   2300 C  C     . VAL A 1 304 ? 3.503   57.711 54.364  1.00 21.99 ? 304 VAL A C     1 
ATOM   2301 O  O     . VAL A 1 304 ? 2.376   57.948 53.924  1.00 23.32 ? 304 VAL A O     1 
ATOM   2302 C  CB    . VAL A 1 304 ? 3.968   59.940 55.334  1.00 21.20 ? 304 VAL A CB    1 
ATOM   2303 C  CG1   . VAL A 1 304 ? 4.623   60.690 56.477  1.00 21.29 ? 304 VAL A CG1   1 
ATOM   2304 C  CG2   . VAL A 1 304 ? 4.658   60.259 54.018  1.00 20.97 ? 304 VAL A CG2   1 
ATOM   2305 N  N     . GLU A 1 305 ? 4.317   56.824 53.811  1.00 21.62 ? 305 GLU A N     1 
ATOM   2306 C  CA    . GLU A 1 305 ? 3.930   56.120 52.598  1.00 21.91 ? 305 GLU A CA    1 
ATOM   2307 C  C     . GLU A 1 305 ? 3.135   54.841 52.799  1.00 21.31 ? 305 GLU A C     1 
ATOM   2308 O  O     . GLU A 1 305 ? 2.416   54.410 51.886  1.00 21.59 ? 305 GLU A O     1 
ATOM   2309 C  CB    . GLU A 1 305 ? 5.178   55.828 51.790  1.00 21.84 ? 305 GLU A CB    1 
ATOM   2310 C  CG    . GLU A 1 305 ? 5.952   57.082 51.532  1.00 24.15 ? 305 GLU A CG    1 
ATOM   2311 C  CD    . GLU A 1 305 ? 7.174   56.848 50.704  1.00 23.97 ? 305 GLU A CD    1 
ATOM   2312 O  OE1   . GLU A 1 305 ? 7.021   56.363 49.557  1.00 23.07 ? 305 GLU A OE1   1 
ATOM   2313 O  OE2   . GLU A 1 305 ? 8.282   57.152 51.206  1.00 26.04 ? 305 GLU A OE2   1 
ATOM   2314 N  N     . ILE A 1 306 ? 3.268   54.245 53.985  1.00 20.06 ? 306 ILE A N     1 
ATOM   2315 C  CA    . ILE A 1 306 ? 2.581   53.007 54.336  1.00 18.68 ? 306 ILE A CA    1 
ATOM   2316 C  C     . ILE A 1 306 ? 1.620   53.307 55.470  1.00 19.13 ? 306 ILE A C     1 
ATOM   2317 O  O     . ILE A 1 306 ? 2.049   53.769 56.529  1.00 20.52 ? 306 ILE A O     1 
ATOM   2318 C  CB    . ILE A 1 306 ? 3.564   51.963 54.865  1.00 18.40 ? 306 ILE A CB    1 
ATOM   2319 C  CG1   . ILE A 1 306 ? 4.690   51.734 53.855  1.00 18.94 ? 306 ILE A CG1   1 
ATOM   2320 C  CG2   . ILE A 1 306 ? 2.820   50.675 55.167  1.00 18.65 ? 306 ILE A CG2   1 
ATOM   2321 C  CD1   . ILE A 1 306 ? 5.808   50.843 54.376  1.00 17.36 ? 306 ILE A CD1   1 
ATOM   2322 N  N     . ASP A 1 307 ? 0.332   53.038 55.279  1.00 19.01 ? 307 ASP A N     1 
ATOM   2323 C  CA    . ASP A 1 307 ? -0.630  53.316 56.351  1.00 19.18 ? 307 ASP A CA    1 
ATOM   2324 C  C     . ASP A 1 307 ? -0.496  52.302 57.479  1.00 18.85 ? 307 ASP A C     1 
ATOM   2325 O  O     . ASP A 1 307 ? -1.321  51.409 57.623  1.00 20.31 ? 307 ASP A O     1 
ATOM   2326 C  CB    . ASP A 1 307 ? -2.072  53.338 55.806  1.00 17.89 ? 307 ASP A CB    1 
ATOM   2327 C  CG    . ASP A 1 307 ? -3.100  53.623 56.889  1.00 17.12 ? 307 ASP A CG    1 
ATOM   2328 O  OD1   . ASP A 1 307 ? -2.748  54.287 57.885  1.00 15.58 ? 307 ASP A OD1   1 
ATOM   2329 O  OD2   . ASP A 1 307 ? -4.270  53.210 56.736  1.00 19.62 ? 307 ASP A OD2   1 
ATOM   2330 N  N     . VAL A 1 308 ? 0.556   52.447 58.275  1.00 18.36 ? 308 VAL A N     1 
ATOM   2331 C  CA    . VAL A 1 308 ? 0.793   51.535 59.386  1.00 19.23 ? 308 VAL A CA    1 
ATOM   2332 C  C     . VAL A 1 308 ? -0.410  51.490 60.337  1.00 20.16 ? 308 VAL A C     1 
ATOM   2333 O  O     . VAL A 1 308 ? -0.860  50.402 60.735  1.00 19.98 ? 308 VAL A O     1 
ATOM   2334 C  CB    . VAL A 1 308 ? 2.065   51.937 60.185  1.00 18.46 ? 308 VAL A CB    1 
ATOM   2335 C  CG1   . VAL A 1 308 ? 2.250   51.009 61.375  1.00 18.64 ? 308 VAL A CG1   1 
ATOM   2336 C  CG2   . VAL A 1 308 ? 3.287   51.869 59.291  1.00 15.91 ? 308 VAL A CG2   1 
ATOM   2337 N  N     . LYS A 1 309 ? -0.930  52.666 60.694  1.00 20.54 ? 309 LYS A N     1 
ATOM   2338 C  CA    . LYS A 1 309 ? -2.078  52.745 61.594  1.00 21.54 ? 309 LYS A CA    1 
ATOM   2339 C  C     . LYS A 1 309 ? -3.227  51.794 61.223  1.00 21.81 ? 309 LYS A C     1 
ATOM   2340 O  O     . LYS A 1 309 ? -3.867  51.201 62.106  1.00 20.44 ? 309 LYS A O     1 
ATOM   2341 C  CB    . LYS A 1 309 ? -2.579  54.182 61.670  1.00 22.51 ? 309 LYS A CB    1 
ATOM   2342 C  CG    . LYS A 1 309 ? -1.580  55.098 62.344  1.00 25.62 ? 309 LYS A CG    1 
ATOM   2343 C  CD    . LYS A 1 309 ? -2.097  56.526 62.500  1.00 26.98 ? 309 LYS A CD    1 
ATOM   2344 C  CE    . LYS A 1 309 ? -1.076  57.374 63.258  1.00 29.26 ? 309 LYS A CE    1 
ATOM   2345 N  NZ    . LYS A 1 309 ? -1.471  58.808 63.407  1.00 30.44 ? 309 LYS A NZ    1 
ATOM   2346 N  N     . TRP A 1 310 ? -3.482  51.636 59.927  1.00 21.24 ? 310 TRP A N     1 
ATOM   2347 C  CA    . TRP A 1 310 ? -4.531  50.726 59.498  1.00 21.82 ? 310 TRP A CA    1 
ATOM   2348 C  C     . TRP A 1 310 ? -4.211  49.317 59.979  1.00 22.89 ? 310 TRP A C     1 
ATOM   2349 O  O     . TRP A 1 310 ? -5.115  48.530 60.255  1.00 23.30 ? 310 TRP A O     1 
ATOM   2350 C  CB    . TRP A 1 310 ? -4.641  50.686 57.984  1.00 20.98 ? 310 TRP A CB    1 
ATOM   2351 C  CG    . TRP A 1 310 ? -5.784  49.852 57.506  1.00 20.98 ? 310 TRP A CG    1 
ATOM   2352 C  CD1   . TRP A 1 310 ? -7.040  50.283 57.196  1.00 20.46 ? 310 TRP A CD1   1 
ATOM   2353 C  CD2   . TRP A 1 310 ? -5.787  48.426 57.304  1.00 21.79 ? 310 TRP A CD2   1 
ATOM   2354 N  NE1   . TRP A 1 310 ? -7.831  49.217 56.807  1.00 20.84 ? 310 TRP A NE1   1 
ATOM   2355 C  CE2   . TRP A 1 310 ? -7.088  48.067 56.863  1.00 21.32 ? 310 TRP A CE2   1 
ATOM   2356 C  CE3   . TRP A 1 310 ? -4.820  47.420 57.451  1.00 21.12 ? 310 TRP A CE3   1 
ATOM   2357 C  CZ2   . TRP A 1 310 ? -7.447  46.742 56.567  1.00 20.69 ? 310 TRP A CZ2   1 
ATOM   2358 C  CZ3   . TRP A 1 310 ? -5.179  46.101 57.156  1.00 22.18 ? 310 TRP A CZ3   1 
ATOM   2359 C  CH2   . TRP A 1 310 ? -6.485  45.778 56.718  1.00 21.28 ? 310 TRP A CH2   1 
ATOM   2360 N  N     . LEU A 1 311 ? -2.924  48.980 60.053  1.00 23.90 ? 311 LEU A N     1 
ATOM   2361 C  CA    . LEU A 1 311 ? -2.541  47.643 60.504  1.00 23.55 ? 311 LEU A CA    1 
ATOM   2362 C  C     . LEU A 1 311 ? -2.780  47.503 62.000  1.00 23.51 ? 311 LEU A C     1 
ATOM   2363 O  O     . LEU A 1 311 ? -3.342  46.505 62.462  1.00 22.13 ? 311 LEU A O     1 
ATOM   2364 C  CB    . LEU A 1 311 ? -1.075  47.343 60.169  1.00 22.60 ? 311 LEU A CB    1 
ATOM   2365 C  CG    . LEU A 1 311 ? -0.728  47.169 58.690  1.00 22.09 ? 311 LEU A CG    1 
ATOM   2366 C  CD1   . LEU A 1 311 ? 0.744   46.809 58.545  1.00 20.76 ? 311 LEU A CD1   1 
ATOM   2367 C  CD2   . LEU A 1 311 ? -1.596  46.074 58.088  1.00 21.79 ? 311 LEU A CD2   1 
ATOM   2368 N  N     . ASN A 1 312 ? -2.353  48.503 62.762  1.00 23.80 ? 312 ASN A N     1 
ATOM   2369 C  CA    . ASN A 1 312 ? -2.562  48.442 64.196  1.00 24.68 ? 312 ASN A CA    1 
ATOM   2370 C  C     . ASN A 1 312 ? -4.064  48.404 64.476  1.00 25.41 ? 312 ASN A C     1 
ATOM   2371 O  O     . ASN A 1 312 ? -4.519  47.715 65.394  1.00 25.31 ? 312 ASN A O     1 
ATOM   2372 C  CB    . ASN A 1 312 ? -1.943  49.652 64.892  1.00 23.42 ? 312 ASN A CB    1 
ATOM   2373 C  CG    . ASN A 1 312 ? -0.444  49.739 64.692  1.00 24.70 ? 312 ASN A CG    1 
ATOM   2374 O  OD1   . ASN A 1 312 ? 0.285   48.772 64.926  1.00 25.26 ? 312 ASN A OD1   1 
ATOM   2375 N  ND2   . ASN A 1 312 ? 0.030   50.911 64.277  1.00 25.40 ? 312 ASN A ND2   1 
ATOM   2376 N  N     . GLU A 1 313 ? -4.830  49.121 63.659  1.00 25.98 ? 313 GLU A N     1 
ATOM   2377 C  CA    . GLU A 1 313 ? -6.277  49.197 63.841  1.00 26.80 ? 313 GLU A CA    1 
ATOM   2378 C  C     . GLU A 1 313 ? -7.150  48.121 63.212  1.00 25.32 ? 313 GLU A C     1 
ATOM   2379 O  O     . GLU A 1 313 ? -8.349  48.102 63.453  1.00 25.85 ? 313 GLU A O     1 
ATOM   2380 C  CB    . GLU A 1 313 ? -6.791  50.563 63.373  1.00 29.67 ? 313 GLU A CB    1 
ATOM   2381 C  CG    . GLU A 1 313 ? -6.325  51.733 64.228  1.00 34.72 ? 313 GLU A CG    1 
ATOM   2382 C  CD    . GLU A 1 313 ? -6.879  53.078 63.751  1.00 38.16 ? 313 GLU A CD    1 
ATOM   2383 O  OE1   . GLU A 1 313 ? -8.121  53.197 63.595  1.00 40.45 ? 313 GLU A OE1   1 
ATOM   2384 O  OE2   . GLU A 1 313 ? -6.072  54.022 63.546  1.00 40.01 ? 313 GLU A OE2   1 
ATOM   2385 N  N     . ASN A 1 314 ? -6.581  47.212 62.433  1.00 23.89 ? 314 ASN A N     1 
ATOM   2386 C  CA    . ASN A 1 314 ? -7.413  46.200 61.792  1.00 22.15 ? 314 ASN A CA    1 
ATOM   2387 C  C     . ASN A 1 314 ? -6.847  44.796 61.856  1.00 21.46 ? 314 ASN A C     1 
ATOM   2388 O  O     . ASN A 1 314 ? -7.436  43.853 61.318  1.00 22.05 ? 314 ASN A O     1 
ATOM   2389 C  CB    . ASN A 1 314 ? -7.640  46.589 60.329  1.00 22.02 ? 314 ASN A CB    1 
ATOM   2390 C  CG    . ASN A 1 314 ? -8.338  47.930 60.187  1.00 22.65 ? 314 ASN A CG    1 
ATOM   2391 O  OD1   . ASN A 1 314 ? -9.510  48.070 60.533  1.00 23.53 ? 314 ASN A OD1   1 
ATOM   2392 N  ND2   . ASN A 1 314 ? -7.616  48.929 59.696  1.00 23.29 ? 314 ASN A ND2   1 
ATOM   2393 N  N     . ALA A 1 315 ? -5.709  44.648 62.516  1.00 21.15 ? 315 ALA A N     1 
ATOM   2394 C  CA    . ALA A 1 315 ? -5.071  43.347 62.601  1.00 21.48 ? 315 ALA A CA    1 
ATOM   2395 C  C     . ALA A 1 315 ? -5.582  42.563 63.785  1.00 21.42 ? 315 ALA A C     1 
ATOM   2396 O  O     . ALA A 1 315 ? -5.757  43.112 64.869  1.00 21.74 ? 315 ALA A O     1 
ATOM   2397 C  CB    . ALA A 1 315 ? -3.556  43.515 62.696  1.00 22.68 ? 315 ALA A CB    1 
ATOM   2398 N  N     . VAL A 1 316 ? -5.816  41.274 63.575  1.00 22.13 ? 316 VAL A N     1 
ATOM   2399 C  CA    . VAL A 1 316 ? -6.300  40.407 64.641  1.00 22.14 ? 316 VAL A CA    1 
ATOM   2400 C  C     . VAL A 1 316 ? -5.170  40.132 65.633  1.00 21.35 ? 316 VAL A C     1 
ATOM   2401 O  O     . VAL A 1 316 ? -5.410  39.758 66.778  1.00 21.63 ? 316 VAL A O     1 
ATOM   2402 C  CB    . VAL A 1 316 ? -6.841  39.087 64.055  1.00 22.47 ? 316 VAL A CB    1 
ATOM   2403 C  CG1   . VAL A 1 316 ? -7.231  38.127 65.170  1.00 23.82 ? 316 VAL A CG1   1 
ATOM   2404 C  CG2   . VAL A 1 316 ? -8.052  39.391 63.165  1.00 22.47 ? 316 VAL A CG2   1 
ATOM   2405 N  N     . GLU A 1 317 ? -3.936  40.336 65.188  1.00 20.95 ? 317 GLU A N     1 
ATOM   2406 C  CA    . GLU A 1 317 ? -2.767  40.125 66.035  1.00 20.12 ? 317 GLU A CA    1 
ATOM   2407 C  C     . GLU A 1 317 ? -1.628  41.013 65.600  1.00 18.46 ? 317 GLU A C     1 
ATOM   2408 O  O     . GLU A 1 317 ? -1.615  41.554 64.489  1.00 17.11 ? 317 GLU A O     1 
ATOM   2409 C  CB    . GLU A 1 317 ? -2.236  38.702 65.938  1.00 22.19 ? 317 GLU A CB    1 
ATOM   2410 C  CG    . GLU A 1 317 ? -3.205  37.617 66.231  1.00 25.91 ? 317 GLU A CG    1 
ATOM   2411 C  CD    . GLU A 1 317 ? -2.504  36.290 66.266  1.00 28.65 ? 317 GLU A CD    1 
ATOM   2412 O  OE1   . GLU A 1 317 ? -1.672  36.107 67.179  1.00 30.51 ? 317 GLU A OE1   1 
ATOM   2413 O  OE2   . GLU A 1 317 ? -2.762  35.442 65.383  1.00 30.58 ? 317 GLU A OE2   1 
ATOM   2414 N  N     . LYS A 1 318 ? -0.657  41.133 66.487  1.00 17.01 ? 318 LYS A N     1 
ATOM   2415 C  CA    . LYS A 1 318 ? 0.536   41.910 66.216  1.00 16.83 ? 318 LYS A CA    1 
ATOM   2416 C  C     . LYS A 1 318 ? 1.668   41.308 67.029  1.00 15.91 ? 318 LYS A C     1 
ATOM   2417 O  O     . LYS A 1 318 ? 1.985   41.785 68.115  1.00 16.11 ? 318 LYS A O     1 
ATOM   2418 C  CB    . LYS A 1 318 ? 0.356   43.379 66.606  1.00 16.57 ? 318 LYS A CB    1 
ATOM   2419 C  CG    . LYS A 1 318 ? 1.637   44.190 66.413  1.00 16.45 ? 318 LYS A CG    1 
ATOM   2420 C  CD    . LYS A 1 318 ? 1.501   45.604 66.930  1.00 18.14 ? 318 LYS A CD    1 
ATOM   2421 C  CE    . LYS A 1 318 ? 2.809   46.374 66.804  1.00 18.46 ? 318 LYS A CE    1 
ATOM   2422 N  NZ    . LYS A 1 318 ? 2.658   47.779 67.303  1.00 20.09 ? 318 LYS A NZ    1 
ATOM   2423 N  N     . VAL A 1 319 ? 2.260   40.237 66.524  1.00 14.90 ? 319 VAL A N     1 
ATOM   2424 C  CA    . VAL A 1 319 ? 3.351   39.622 67.251  1.00 16.17 ? 319 VAL A CA    1 
ATOM   2425 C  C     . VAL A 1 319 ? 4.641   40.306 66.845  1.00 16.71 ? 319 VAL A C     1 
ATOM   2426 O  O     . VAL A 1 319 ? 4.918   40.502 65.664  1.00 15.75 ? 319 VAL A O     1 
ATOM   2427 C  CB    . VAL A 1 319 ? 3.434   38.102 66.987  1.00 15.97 ? 319 VAL A CB    1 
ATOM   2428 C  CG1   . VAL A 1 319 ? 2.292   37.394 67.699  1.00 16.57 ? 319 VAL A CG1   1 
ATOM   2429 C  CG2   . VAL A 1 319 ? 3.333   37.825 65.489  1.00 19.83 ? 319 VAL A CG2   1 
ATOM   2430 N  N     . ASN A 1 320 ? 5.414   40.707 67.841  1.00 17.89 ? 320 ASN A N     1 
ATOM   2431 C  CA    . ASN A 1 320 ? 6.669   41.388 67.589  1.00 18.98 ? 320 ASN A CA    1 
ATOM   2432 C  C     . ASN A 1 320 ? 7.825   40.397 67.610  1.00 18.02 ? 320 ASN A C     1 
ATOM   2433 O  O     . ASN A 1 320 ? 8.215   39.899 68.663  1.00 17.96 ? 320 ASN A O     1 
ATOM   2434 C  CB    . ASN A 1 320 ? 6.875   42.487 68.628  1.00 20.90 ? 320 ASN A CB    1 
ATOM   2435 C  CG    . ASN A 1 320 ? 8.252   43.100 68.548  1.00 22.25 ? 320 ASN A CG    1 
ATOM   2436 O  OD1   . ASN A 1 320 ? 9.246   42.461 68.900  1.00 22.82 ? 320 ASN A OD1   1 
ATOM   2437 N  ND2   . ASN A 1 320 ? 8.326   44.338 68.060  1.00 23.46 ? 320 ASN A ND2   1 
ATOM   2438 N  N     . ILE A 1 321 ? 8.362   40.122 66.430  1.00 17.37 ? 321 ILE A N     1 
ATOM   2439 C  CA    . ILE A 1 321 ? 9.450   39.173 66.265  1.00 18.35 ? 321 ILE A CA    1 
ATOM   2440 C  C     . ILE A 1 321 ? 10.791  39.578 66.886  1.00 18.22 ? 321 ILE A C     1 
ATOM   2441 O  O     . ILE A 1 321 ? 11.491  38.748 67.476  1.00 17.06 ? 321 ILE A O     1 
ATOM   2442 C  CB    . ILE A 1 321 ? 9.662   38.861 64.764  1.00 19.04 ? 321 ILE A CB    1 
ATOM   2443 C  CG1   . ILE A 1 321 ? 8.570   37.902 64.268  1.00 19.03 ? 321 ILE A CG1   1 
ATOM   2444 C  CG2   . ILE A 1 321 ? 11.037  38.221 64.548  1.00 20.31 ? 321 ILE A CG2   1 
ATOM   2445 C  CD1   . ILE A 1 321 ? 7.158   38.408 64.415  1.00 20.18 ? 321 ILE A CD1   1 
ATOM   2446 N  N     . LYS A 1 322 ? 11.143  40.850 66.734  1.00 18.17 ? 322 LYS A N     1 
ATOM   2447 C  CA    . LYS A 1 322 ? 12.387  41.406 67.263  1.00 17.36 ? 322 LYS A CA    1 
ATOM   2448 C  C     . LYS A 1 322 ? 12.267  42.907 67.067  1.00 15.80 ? 322 LYS A C     1 
ATOM   2449 O  O     . LYS A 1 322 ? 11.353  43.368 66.389  1.00 15.41 ? 322 LYS A O     1 
ATOM   2450 C  CB    . LYS A 1 322 ? 13.596  40.864 66.488  1.00 18.68 ? 322 LYS A CB    1 
ATOM   2451 C  CG    . LYS A 1 322 ? 13.516  41.082 64.967  1.00 19.80 ? 322 LYS A CG    1 
ATOM   2452 C  CD    . LYS A 1 322 ? 14.715  40.486 64.217  1.00 20.90 ? 322 LYS A CD    1 
ATOM   2453 C  CE    . LYS A 1 322 ? 16.007  41.208 64.569  1.00 22.92 ? 322 LYS A CE    1 
ATOM   2454 N  NZ    . LYS A 1 322 ? 17.188  40.673 63.828  1.00 23.93 ? 322 LYS A NZ    1 
ATOM   2455 N  N     . PRO A 1 323 ? 13.191  43.690 67.645  1.00 15.37 ? 323 PRO A N     1 
ATOM   2456 C  CA    . PRO A 1 323 ? 13.114  45.147 67.488  1.00 15.23 ? 323 PRO A CA    1 
ATOM   2457 C  C     . PRO A 1 323 ? 12.975  45.542 66.026  1.00 15.29 ? 323 PRO A C     1 
ATOM   2458 O  O     . PRO A 1 323 ? 13.703  45.033 65.176  1.00 17.32 ? 323 PRO A O     1 
ATOM   2459 C  CB    . PRO A 1 323 ? 14.412  45.616 68.140  1.00 13.05 ? 323 PRO A CB    1 
ATOM   2460 C  CG    . PRO A 1 323 ? 14.543  44.611 69.274  1.00 12.89 ? 323 PRO A CG    1 
ATOM   2461 C  CD    . PRO A 1 323 ? 14.361  43.334 68.464  1.00 13.98 ? 323 PRO A CD    1 
ATOM   2462 N  N     . GLN A 1 324 ? 12.020  46.432 65.750  1.00 14.61 ? 324 GLN A N     1 
ATOM   2463 C  CA    . GLN A 1 324 ? 11.720  46.904 64.398  1.00 13.67 ? 324 GLN A CA    1 
ATOM   2464 C  C     . GLN A 1 324 ? 11.151  45.856 63.448  1.00 12.83 ? 324 GLN A C     1 
ATOM   2465 O  O     . GLN A 1 324 ? 11.213  46.028 62.230  1.00 13.55 ? 324 GLN A O     1 
ATOM   2466 C  CB    . GLN A 1 324 ? 12.944  47.555 63.752  1.00 14.40 ? 324 GLN A CB    1 
ATOM   2467 C  CG    . GLN A 1 324 ? 13.203  48.977 64.213  1.00 15.78 ? 324 GLN A CG    1 
ATOM   2468 C  CD    . GLN A 1 324 ? 13.438  49.075 65.706  1.00 16.71 ? 324 GLN A CD    1 
ATOM   2469 O  OE1   . GLN A 1 324 ? 14.434  48.551 66.232  1.00 17.83 ? 324 GLN A OE1   1 
ATOM   2470 N  NE2   . GLN A 1 324 ? 12.517  49.744 66.405  1.00 16.28 ? 324 GLN A NE2   1 
ATOM   2471 N  N     . VAL A 1 325 ? 10.596  44.774 63.989  1.00 11.25 ? 325 VAL A N     1 
ATOM   2472 C  CA    . VAL A 1 325 ? 9.992   43.740 63.142  1.00 11.72 ? 325 VAL A CA    1 
ATOM   2473 C  C     . VAL A 1 325 ? 8.689   43.210 63.768  1.00 13.34 ? 325 VAL A C     1 
ATOM   2474 O  O     . VAL A 1 325 ? 8.724   42.501 64.783  1.00 14.81 ? 325 VAL A O     1 
ATOM   2475 C  CB    . VAL A 1 325 ? 10.960  42.543 62.920  1.00 9.82  ? 325 VAL A CB    1 
ATOM   2476 C  CG1   . VAL A 1 325 ? 10.380  41.593 61.891  1.00 7.77  ? 325 VAL A CG1   1 
ATOM   2477 C  CG2   . VAL A 1 325 ? 12.314  43.033 62.472  1.00 8.09  ? 325 VAL A CG2   1 
ATOM   2478 N  N     . ASP A 1 326 ? 7.542   43.558 63.184  1.00 14.00 ? 326 ASP A N     1 
ATOM   2479 C  CA    . ASP A 1 326 ? 6.264   43.083 63.724  1.00 14.25 ? 326 ASP A CA    1 
ATOM   2480 C  C     . ASP A 1 326 ? 5.499   42.292 62.680  1.00 14.05 ? 326 ASP A C     1 
ATOM   2481 O  O     . ASP A 1 326 ? 5.357   42.724 61.534  1.00 14.35 ? 326 ASP A O     1 
ATOM   2482 C  CB    . ASP A 1 326 ? 5.384   44.239 64.188  1.00 15.42 ? 326 ASP A CB    1 
ATOM   2483 C  CG    . ASP A 1 326 ? 6.123   45.226 65.064  1.00 17.20 ? 326 ASP A CG    1 
ATOM   2484 O  OD1   . ASP A 1 326 ? 6.735   46.157 64.500  1.00 16.73 ? 326 ASP A OD1   1 
ATOM   2485 O  OD2   . ASP A 1 326 ? 6.102   45.064 66.307  1.00 18.16 ? 326 ASP A OD2   1 
ATOM   2486 N  N     . ARG A 1 327 ? 4.999   41.132 63.077  1.00 13.84 ? 327 ARG A N     1 
ATOM   2487 C  CA    . ARG A 1 327 ? 4.246   40.288 62.157  1.00 13.01 ? 327 ARG A CA    1 
ATOM   2488 C  C     . ARG A 1 327 ? 2.747   40.309 62.509  1.00 13.23 ? 327 ARG A C     1 
ATOM   2489 O  O     . ARG A 1 327 ? 2.327   39.798 63.551  1.00 12.15 ? 327 ARG A O     1 
ATOM   2490 C  CB    . ARG A 1 327 ? 4.786   38.863 62.228  1.00 11.76 ? 327 ARG A CB    1 
ATOM   2491 C  CG    . ARG A 1 327 ? 4.324   37.959 61.117  1.00 9.56  ? 327 ARG A CG    1 
ATOM   2492 C  CD    . ARG A 1 327 ? 4.770   36.560 61.407  1.00 8.89  ? 327 ARG A CD    1 
ATOM   2493 N  NE    . ARG A 1 327 ? 4.368   35.624 60.365  1.00 9.22  ? 327 ARG A NE    1 
ATOM   2494 C  CZ    . ARG A 1 327 ? 4.344   34.303 60.528  1.00 7.64  ? 327 ARG A CZ    1 
ATOM   2495 N  NH1   . ARG A 1 327 ? 4.700   33.778 61.696  1.00 5.78  ? 327 ARG A NH1   1 
ATOM   2496 N  NH2   . ARG A 1 327 ? 3.976   33.511 59.526  1.00 5.21  ? 327 ARG A NH2   1 
ATOM   2497 N  N     . TYR A 1 328 ? 1.954   40.910 61.628  1.00 14.09 ? 328 TYR A N     1 
ATOM   2498 C  CA    . TYR A 1 328 ? 0.511   41.023 61.820  1.00 15.78 ? 328 TYR A CA    1 
ATOM   2499 C  C     . TYR A 1 328 ? -0.246  39.858 61.207  1.00 16.08 ? 328 TYR A C     1 
ATOM   2500 O  O     . TYR A 1 328 ? 0.242   39.205 60.284  1.00 15.82 ? 328 TYR A O     1 
ATOM   2501 C  CB    . TYR A 1 328 ? -0.022  42.310 61.169  1.00 17.21 ? 328 TYR A CB    1 
ATOM   2502 C  CG    . TYR A 1 328 ? 0.547   43.586 61.725  1.00 18.16 ? 328 TYR A CG    1 
ATOM   2503 C  CD1   . TYR A 1 328 ? 1.896   43.890 61.586  1.00 19.03 ? 328 TYR A CD1   1 
ATOM   2504 C  CD2   . TYR A 1 328 ? -0.266  44.491 62.398  1.00 19.73 ? 328 TYR A CD2   1 
ATOM   2505 C  CE1   . TYR A 1 328 ? 2.428   45.069 62.108  1.00 20.78 ? 328 TYR A CE1   1 
ATOM   2506 C  CE2   . TYR A 1 328 ? 0.252   45.677 62.930  1.00 20.79 ? 328 TYR A CE2   1 
ATOM   2507 C  CZ    . TYR A 1 328 ? 1.601   45.958 62.781  1.00 21.27 ? 328 TYR A CZ    1 
ATOM   2508 O  OH    . TYR A 1 328 ? 2.122   47.114 63.317  1.00 21.05 ? 328 TYR A OH    1 
ATOM   2509 N  N     . ARG A 1 329 ? -1.445  39.613 61.727  1.00 17.09 ? 329 ARG A N     1 
ATOM   2510 C  CA    . ARG A 1 329 ? -2.317  38.572 61.195  1.00 17.54 ? 329 ARG A CA    1 
ATOM   2511 C  C     . ARG A 1 329 ? -3.648  39.278 60.973  1.00 18.12 ? 329 ARG A C     1 
ATOM   2512 O  O     . ARG A 1 329 ? -4.344  39.618 61.931  1.00 18.04 ? 329 ARG A O     1 
ATOM   2513 C  CB    . ARG A 1 329 ? -2.512  37.441 62.192  1.00 17.54 ? 329 ARG A CB    1 
ATOM   2514 C  CG    . ARG A 1 329 ? -3.125  36.203 61.561  1.00 18.06 ? 329 ARG A CG    1 
ATOM   2515 C  CD    . ARG A 1 329 ? -3.470  35.162 62.613  1.00 19.88 ? 329 ARG A CD    1 
ATOM   2516 N  NE    . ARG A 1 329 ? -3.874  33.903 61.997  1.00 23.24 ? 329 ARG A NE    1 
ATOM   2517 C  CZ    . ARG A 1 329 ? -3.034  33.064 61.394  1.00 26.45 ? 329 ARG A CZ    1 
ATOM   2518 N  NH1   . ARG A 1 329 ? -1.739  33.357 61.337  1.00 29.55 ? 329 ARG A NH1   1 
ATOM   2519 N  NH2   . ARG A 1 329 ? -3.489  31.950 60.821  1.00 26.27 ? 329 ARG A NH2   1 
ATOM   2520 N  N     . LEU A 1 330 ? -3.983  39.527 59.713  1.00 18.14 ? 330 LEU A N     1 
ATOM   2521 C  CA    . LEU A 1 330 ? -5.227  40.208 59.385  1.00 18.40 ? 330 LEU A CA    1 
ATOM   2522 C  C     . LEU A 1 330 ? -6.435  39.294 59.599  1.00 18.92 ? 330 LEU A C     1 
ATOM   2523 O  O     . LEU A 1 330 ? -6.283  38.093 59.861  1.00 18.51 ? 330 LEU A O     1 
ATOM   2524 C  CB    . LEU A 1 330 ? -5.184  40.676 57.936  1.00 17.37 ? 330 LEU A CB    1 
ATOM   2525 C  CG    . LEU A 1 330 ? -4.017  41.594 57.605  1.00 15.67 ? 330 LEU A CG    1 
ATOM   2526 C  CD1   . LEU A 1 330 ? -4.023  41.898 56.118  1.00 16.37 ? 330 LEU A CD1   1 
ATOM   2527 C  CD2   . LEU A 1 330 ? -4.125  42.858 58.430  1.00 15.90 ? 330 LEU A CD2   1 
ATOM   2528 N  N     . LYS A 1 331 ? -7.630  39.867 59.481  1.00 19.26 ? 331 LYS A N     1 
ATOM   2529 C  CA    . LYS A 1 331 ? -8.845  39.095 59.666  1.00 20.89 ? 331 LYS A CA    1 
ATOM   2530 C  C     . LYS A 1 331 ? -8.971  37.950 58.663  1.00 20.91 ? 331 LYS A C     1 
ATOM   2531 O  O     . LYS A 1 331 ? -9.567  36.917 58.979  1.00 21.25 ? 331 LYS A O     1 
ATOM   2532 C  CB    . LYS A 1 331 ? -10.075 39.999 59.582  1.00 22.53 ? 331 LYS A CB    1 
ATOM   2533 C  CG    . LYS A 1 331 ? -10.086 41.102 60.618  1.00 25.07 ? 331 LYS A CG    1 
ATOM   2534 C  CD    . LYS A 1 331 ? -11.420 41.805 60.636  1.00 26.89 ? 331 LYS A CD    1 
ATOM   2535 C  CE    . LYS A 1 331 ? -11.438 42.977 61.620  1.00 29.37 ? 331 LYS A CE    1 
ATOM   2536 N  NZ    . LYS A 1 331 ? -10.635 44.165 61.166  1.00 31.07 ? 331 LYS A NZ    1 
ATOM   2537 N  N     . ASN A 1 332 ? -8.413  38.116 57.465  1.00 20.54 ? 332 ASN A N     1 
ATOM   2538 C  CA    . ASN A 1 332 ? -8.492  37.052 56.466  1.00 20.21 ? 332 ASN A CA    1 
ATOM   2539 C  C     . ASN A 1 332 ? -7.613  35.870 56.837  1.00 20.03 ? 332 ASN A C     1 
ATOM   2540 O  O     . ASN A 1 332 ? -7.571  34.880 56.114  1.00 19.77 ? 332 ASN A O     1 
ATOM   2541 C  CB    . ASN A 1 332 ? -8.071  37.547 55.077  1.00 21.42 ? 332 ASN A CB    1 
ATOM   2542 C  CG    . ASN A 1 332 ? -6.671  38.122 55.059  1.00 22.01 ? 332 ASN A CG    1 
ATOM   2543 O  OD1   . ASN A 1 332 ? -5.750  37.575 55.677  1.00 20.76 ? 332 ASN A OD1   1 
ATOM   2544 N  ND2   . ASN A 1 332 ? -6.493  39.224 54.325  1.00 22.65 ? 332 ASN A ND2   1 
ATOM   2545 N  N     . GLY A 1 333 ? -6.900  35.974 57.954  1.00 20.36 ? 333 GLY A N     1 
ATOM   2546 C  CA    . GLY A 1 333 ? -6.031  34.885 58.362  1.00 20.95 ? 333 GLY A CA    1 
ATOM   2547 C  C     . GLY A 1 333 ? -4.578  35.008 57.907  1.00 21.35 ? 333 GLY A C     1 
ATOM   2548 O  O     . GLY A 1 333 ? -3.680  34.483 58.568  1.00 20.74 ? 333 GLY A O     1 
ATOM   2549 N  N     . ARG A 1 334 ? -4.334  35.688 56.785  1.00 21.85 ? 334 ARG A N     1 
ATOM   2550 C  CA    . ARG A 1 334 ? -2.969  35.853 56.291  1.00 21.69 ? 334 ARG A CA    1 
ATOM   2551 C  C     . ARG A 1 334 ? -2.166  36.804 57.159  1.00 21.49 ? 334 ARG A C     1 
ATOM   2552 O  O     . ARG A 1 334 ? -2.724  37.596 57.909  1.00 22.76 ? 334 ARG A O     1 
ATOM   2553 C  CB    . ARG A 1 334 ? -2.956  36.349 54.844  1.00 21.26 ? 334 ARG A CB    1 
ATOM   2554 C  CG    . ARG A 1 334 ? -3.403  35.312 53.839  1.00 22.47 ? 334 ARG A CG    1 
ATOM   2555 C  CD    . ARG A 1 334 ? -2.993  35.722 52.441  1.00 25.17 ? 334 ARG A CD    1 
ATOM   2556 N  NE    . ARG A 1 334 ? -3.656  36.944 52.010  1.00 26.20 ? 334 ARG A NE    1 
ATOM   2557 C  CZ    . ARG A 1 334 ? -4.955  37.022 51.745  1.00 27.30 ? 334 ARG A CZ    1 
ATOM   2558 N  NH1   . ARG A 1 334 ? -5.717  35.943 51.873  1.00 28.83 ? 334 ARG A NH1   1 
ATOM   2559 N  NH2   . ARG A 1 334 ? -5.493  38.172 51.351  1.00 27.22 ? 334 ARG A NH2   1 
ATOM   2560 N  N     . ARG A 1 335 ? -0.847  36.718 57.060  1.00 21.67 ? 335 ARG A N     1 
ATOM   2561 C  CA    . ARG A 1 335 ? 0.024   37.570 57.853  1.00 21.64 ? 335 ARG A CA    1 
ATOM   2562 C  C     . ARG A 1 335 ? 0.808   38.594 57.044  1.00 20.60 ? 335 ARG A C     1 
ATOM   2563 O  O     . ARG A 1 335 ? 0.959   38.466 55.826  1.00 21.29 ? 335 ARG A O     1 
ATOM   2564 C  CB    . ARG A 1 335 ? 0.968   36.696 58.679  1.00 22.15 ? 335 ARG A CB    1 
ATOM   2565 C  CG    . ARG A 1 335 ? 0.244   36.014 59.838  1.00 25.13 ? 335 ARG A CG    1 
ATOM   2566 C  CD    . ARG A 1 335 ? 0.870   34.685 60.230  1.00 27.41 ? 335 ARG A CD    1 
ATOM   2567 N  NE    . ARG A 1 335 ? 0.797   33.747 59.111  1.00 30.59 ? 335 ARG A NE    1 
ATOM   2568 C  CZ    . ARG A 1 335 ? 1.168   32.474 59.169  1.00 31.59 ? 335 ARG A CZ    1 
ATOM   2569 N  NH1   . ARG A 1 335 ? 1.644   31.967 60.305  1.00 32.55 ? 335 ARG A NH1   1 
ATOM   2570 N  NH2   . ARG A 1 335 ? 1.080   31.715 58.083  1.00 32.48 ? 335 ARG A NH2   1 
ATOM   2571 N  N     . ILE A 1 336 ? 1.275   39.630 57.734  1.00 18.41 ? 336 ILE A N     1 
ATOM   2572 C  CA    . ILE A 1 336 ? 2.053   40.682 57.104  1.00 17.27 ? 336 ILE A CA    1 
ATOM   2573 C  C     . ILE A 1 336 ? 3.185   41.129 58.015  1.00 16.43 ? 336 ILE A C     1 
ATOM   2574 O  O     . ILE A 1 336 ? 2.983   41.416 59.193  1.00 15.73 ? 336 ILE A O     1 
ATOM   2575 C  CB    . ILE A 1 336 ? 1.171   41.881 56.731  1.00 17.48 ? 336 ILE A CB    1 
ATOM   2576 C  CG1   . ILE A 1 336 ? 0.271   41.495 55.552  1.00 18.03 ? 336 ILE A CG1   1 
ATOM   2577 C  CG2   . ILE A 1 336 ? 2.036   43.090 56.390  1.00 17.51 ? 336 ILE A CG2   1 
ATOM   2578 C  CD1   . ILE A 1 336 ? -0.659  42.607 55.099  1.00 18.62 ? 336 ILE A CD1   1 
ATOM   2579 N  N     . ILE A 1 337 ? 4.386   41.170 57.450  1.00 15.77 ? 337 ILE A N     1 
ATOM   2580 C  CA    . ILE A 1 337 ? 5.577   41.552 58.185  1.00 14.74 ? 337 ILE A CA    1 
ATOM   2581 C  C     . ILE A 1 337 ? 5.914   43.002 57.878  1.00 13.99 ? 337 ILE A C     1 
ATOM   2582 O  O     . ILE A 1 337 ? 6.233   43.344 56.749  1.00 14.02 ? 337 ILE A O     1 
ATOM   2583 C  CB    . ILE A 1 337 ? 6.735   40.616 57.800  1.00 14.07 ? 337 ILE A CB    1 
ATOM   2584 C  CG1   . ILE A 1 337 ? 6.305   39.171 58.086  1.00 12.91 ? 337 ILE A CG1   1 
ATOM   2585 C  CG2   . ILE A 1 337 ? 7.981   40.952 58.600  1.00 14.36 ? 337 ILE A CG2   1 
ATOM   2586 C  CD1   . ILE A 1 337 ? 7.289   38.118 57.659  1.00 10.35 ? 337 ILE A CD1   1 
ATOM   2587 N  N     . LEU A 1 338 ? 5.825   43.851 58.896  1.00 14.01 ? 338 LEU A N     1 
ATOM   2588 C  CA    . LEU A 1 338 ? 6.091   45.281 58.754  1.00 14.22 ? 338 LEU A CA    1 
ATOM   2589 C  C     . LEU A 1 338 ? 7.426   45.581 59.425  1.00 15.23 ? 338 LEU A C     1 
ATOM   2590 O  O     . LEU A 1 338 ? 7.681   45.121 60.550  1.00 15.56 ? 338 LEU A O     1 
ATOM   2591 C  CB    . LEU A 1 338 ? 4.951   46.075 59.407  1.00 13.17 ? 338 LEU A CB    1 
ATOM   2592 C  CG    . LEU A 1 338 ? 4.882   47.592 59.264  1.00 11.98 ? 338 LEU A CG    1 
ATOM   2593 C  CD1   . LEU A 1 338 ? 5.994   48.230 60.046  1.00 13.12 ? 338 LEU A CD1   1 
ATOM   2594 C  CD2   . LEU A 1 338 ? 4.949   47.968 57.795  1.00 10.80 ? 338 LEU A CD2   1 
ATOM   2595 N  N     . LEU A 1 339 ? 8.271   46.359 58.745  1.00 15.33 ? 339 LEU A N     1 
ATOM   2596 C  CA    . LEU A 1 339 ? 9.605   46.676 59.260  1.00 14.79 ? 339 LEU A CA    1 
ATOM   2597 C  C     . LEU A 1 339 ? 9.790   48.118 59.707  1.00 15.13 ? 339 LEU A C     1 
ATOM   2598 O  O     . LEU A 1 339 ? 9.306   49.042 59.058  1.00 17.06 ? 339 LEU A O     1 
ATOM   2599 C  CB    . LEU A 1 339 ? 10.636  46.349 58.184  1.00 13.98 ? 339 LEU A CB    1 
ATOM   2600 C  CG    . LEU A 1 339 ? 10.448  44.989 57.488  1.00 14.62 ? 339 LEU A CG    1 
ATOM   2601 C  CD1   . LEU A 1 339 ? 11.617  44.760 56.538  1.00 14.88 ? 339 LEU A CD1   1 
ATOM   2602 C  CD2   . LEU A 1 339 ? 10.368  43.848 58.501  1.00 12.71 ? 339 LEU A CD2   1 
ATOM   2603 N  N     . ALA A 1 340 ? 10.500  48.307 60.817  1.00 14.96 ? 340 ALA A N     1 
ATOM   2604 C  CA    . ALA A 1 340 ? 10.778  49.646 61.362  1.00 14.43 ? 340 ALA A CA    1 
ATOM   2605 C  C     . ALA A 1 340 ? 9.554   50.563 61.470  1.00 14.83 ? 340 ALA A C     1 
ATOM   2606 O  O     . ALA A 1 340 ? 9.684   51.788 61.489  1.00 14.86 ? 340 ALA A O     1 
ATOM   2607 C  CB    . ALA A 1 340 ? 11.857  50.327 60.527  1.00 12.14 ? 340 ALA A CB    1 
ATOM   2608 N  N     . GLU A 1 341 ? 8.371   49.959 61.539  1.00 15.83 ? 341 GLU A N     1 
ATOM   2609 C  CA    . GLU A 1 341 ? 7.107   50.684 61.655  1.00 16.75 ? 341 GLU A CA    1 
ATOM   2610 C  C     . GLU A 1 341 ? 6.881   51.701 60.551  1.00 16.33 ? 341 GLU A C     1 
ATOM   2611 O  O     . GLU A 1 341 ? 6.304   52.759 60.788  1.00 15.99 ? 341 GLU A O     1 
ATOM   2612 C  CB    . GLU A 1 341 ? 7.012   51.373 63.015  1.00 18.17 ? 341 GLU A CB    1 
ATOM   2613 C  CG    . GLU A 1 341 ? 7.290   50.430 64.185  1.00 22.16 ? 341 GLU A CG    1 
ATOM   2614 C  CD    . GLU A 1 341 ? 6.933   51.029 65.537  1.00 24.47 ? 341 GLU A CD    1 
ATOM   2615 O  OE1   . GLU A 1 341 ? 5.723   51.121 65.848  1.00 27.05 ? 341 GLU A OE1   1 
ATOM   2616 O  OE2   . GLU A 1 341 ? 7.861   51.421 66.280  1.00 26.31 ? 341 GLU A OE2   1 
ATOM   2617 N  N     . GLY A 1 342 ? 7.328   51.371 59.343  1.00 16.08 ? 342 GLY A N     1 
ATOM   2618 C  CA    . GLY A 1 342 ? 7.158   52.272 58.218  1.00 15.27 ? 342 GLY A CA    1 
ATOM   2619 C  C     . GLY A 1 342 ? 8.298   53.262 58.042  1.00 15.58 ? 342 GLY A C     1 
ATOM   2620 O  O     . GLY A 1 342 ? 8.376   53.973 57.031  1.00 15.71 ? 342 GLY A O     1 
ATOM   2621 N  N     . ARG A 1 343 ? 9.198   53.311 59.018  1.00 15.43 ? 343 ARG A N     1 
ATOM   2622 C  CA    . ARG A 1 343 ? 10.325  54.233 58.950  1.00 14.71 ? 343 ARG A CA    1 
ATOM   2623 C  C     . ARG A 1 343 ? 11.470  53.647 58.111  1.00 13.30 ? 343 ARG A C     1 
ATOM   2624 O  O     . ARG A 1 343 ? 11.727  52.444 58.164  1.00 13.55 ? 343 ARG A O     1 
ATOM   2625 C  CB    . ARG A 1 343 ? 10.729  54.596 60.381  1.00 14.16 ? 343 ARG A CB    1 
ATOM   2626 C  CG    . ARG A 1 343 ? 9.539   55.246 61.077  1.00 15.56 ? 343 ARG A CG    1 
ATOM   2627 C  CD    . ARG A 1 343 ? 9.760   55.639 62.522  1.00 18.87 ? 343 ARG A CD    1 
ATOM   2628 N  NE    . ARG A 1 343 ? 8.587   56.318 63.102  1.00 19.92 ? 343 ARG A NE    1 
ATOM   2629 C  CZ    . ARG A 1 343 ? 7.368   55.781 63.217  1.00 20.07 ? 343 ARG A CZ    1 
ATOM   2630 N  NH1   . ARG A 1 343 ? 7.128   54.546 62.796  1.00 20.38 ? 343 ARG A NH1   1 
ATOM   2631 N  NH2   . ARG A 1 343 ? 6.381   56.478 63.765  1.00 20.24 ? 343 ARG A NH2   1 
ATOM   2632 N  N     . LEU A 1 344 ? 12.124  54.502 57.320  1.00 12.22 ? 344 LEU A N     1 
ATOM   2633 C  CA    . LEU A 1 344 ? 13.210  54.093 56.414  1.00 11.39 ? 344 LEU A CA    1 
ATOM   2634 C  C     . LEU A 1 344 ? 14.000  52.891 56.915  1.00 10.21 ? 344 LEU A C     1 
ATOM   2635 O  O     . LEU A 1 344 ? 14.831  52.972 57.831  1.00 9.15  ? 344 LEU A O     1 
ATOM   2636 C  CB    . LEU A 1 344 ? 14.130  55.278 56.085  1.00 11.86 ? 344 LEU A CB    1 
ATOM   2637 C  CG    . LEU A 1 344 ? 14.960  55.992 57.135  1.00 11.96 ? 344 LEU A CG    1 
ATOM   2638 C  CD1   . LEU A 1 344 ? 15.489  57.269 56.492  1.00 10.99 ? 344 LEU A CD1   1 
ATOM   2639 C  CD2   . LEU A 1 344 ? 14.115  56.341 58.352  1.00 14.66 ? 344 LEU A CD2   1 
ATOM   2640 N  N     . VAL A 1 345 ? 13.713  51.772 56.261  1.00 8.51  ? 345 VAL A N     1 
ATOM   2641 C  CA    . VAL A 1 345 ? 14.261  50.484 56.606  1.00 7.43  ? 345 VAL A CA    1 
ATOM   2642 C  C     . VAL A 1 345 ? 15.779  50.307 56.616  1.00 7.35  ? 345 VAL A C     1 
ATOM   2643 O  O     . VAL A 1 345 ? 16.297  49.646 57.522  1.00 5.51  ? 345 VAL A O     1 
ATOM   2644 C  CB    . VAL A 1 345 ? 13.602  49.399 55.725  1.00 5.66  ? 345 VAL A CB    1 
ATOM   2645 C  CG1   . VAL A 1 345 ? 14.055  49.540 54.300  1.00 4.48  ? 345 VAL A CG1   1 
ATOM   2646 C  CG2   . VAL A 1 345 ? 13.894  48.030 56.285  1.00 5.19  ? 345 VAL A CG2   1 
ATOM   2647 N  N     . ASN A 1 346 ? 16.492  50.885 55.645  1.00 7.45  ? 346 ASN A N     1 
ATOM   2648 C  CA    . ASN A 1 346 ? 17.952  50.724 55.600  1.00 8.02  ? 346 ASN A CA    1 
ATOM   2649 C  C     . ASN A 1 346 ? 18.639  51.172 56.891  1.00 8.18  ? 346 ASN A C     1 
ATOM   2650 O  O     . ASN A 1 346 ? 19.538  50.490 57.402  1.00 7.93  ? 346 ASN A O     1 
ATOM   2651 C  CB    . ASN A 1 346 ? 18.564  51.468 54.405  1.00 8.49  ? 346 ASN A CB    1 
ATOM   2652 C  CG    . ASN A 1 346 ? 18.238  52.942 54.402  1.00 8.04  ? 346 ASN A CG    1 
ATOM   2653 O  OD1   . ASN A 1 346 ? 18.846  53.720 53.669  1.00 8.69  ? 346 ASN A OD1   1 
ATOM   2654 N  ND2   . ASN A 1 346 ? 17.264  53.333 55.208  1.00 7.16  ? 346 ASN A ND2   1 
ATOM   2655 N  N     . LEU A 1 347 ? 18.210  52.309 57.422  1.00 8.46  ? 347 LEU A N     1 
ATOM   2656 C  CA    . LEU A 1 347 ? 18.772  52.827 58.665  1.00 9.73  ? 347 LEU A CA    1 
ATOM   2657 C  C     . LEU A 1 347 ? 18.101  52.178 59.877  1.00 11.63 ? 347 LEU A C     1 
ATOM   2658 O  O     . LEU A 1 347 ? 18.766  51.827 60.860  1.00 12.39 ? 347 LEU A O     1 
ATOM   2659 C  CB    . LEU A 1 347 ? 18.579  54.342 58.725  1.00 8.62  ? 347 LEU A CB    1 
ATOM   2660 C  CG    . LEU A 1 347 ? 19.400  55.114 57.694  1.00 8.87  ? 347 LEU A CG    1 
ATOM   2661 C  CD1   . LEU A 1 347 ? 18.849  56.519 57.515  1.00 7.87  ? 347 LEU A CD1   1 
ATOM   2662 C  CD2   . LEU A 1 347 ? 20.860  55.128 58.136  1.00 6.88  ? 347 LEU A CD2   1 
ATOM   2663 N  N     . GLY A 1 348 ? 16.779  52.020 59.797  1.00 13.28 ? 348 GLY A N     1 
ATOM   2664 C  CA    . GLY A 1 348 ? 16.025  51.439 60.895  1.00 12.70 ? 348 GLY A CA    1 
ATOM   2665 C  C     . GLY A 1 348 ? 16.355  49.988 61.180  1.00 12.70 ? 348 GLY A C     1 
ATOM   2666 O  O     . GLY A 1 348 ? 16.450  49.591 62.342  1.00 14.65 ? 348 GLY A O     1 
ATOM   2667 N  N     . CYS A 1 349 ? 16.545  49.189 60.136  1.00 11.51 ? 349 CYS A N     1 
ATOM   2668 C  CA    . CYS A 1 349 ? 16.839  47.774 60.335  1.00 10.60 ? 349 CYS A CA    1 
ATOM   2669 C  C     . CYS A 1 349 ? 18.252  47.353 60.000  1.00 10.23 ? 349 CYS A C     1 
ATOM   2670 O  O     . CYS A 1 349 ? 18.576  46.172 60.086  1.00 9.68  ? 349 CYS A O     1 
ATOM   2671 C  CB    . CYS A 1 349 ? 15.870  46.914 59.525  1.00 11.85 ? 349 CYS A CB    1 
ATOM   2672 S  SG    . CYS A 1 349 ? 14.120  47.050 60.008  1.00 9.96  ? 349 CYS A SG    1 
ATOM   2673 N  N     . ALA A 1 350 ? 19.098  48.298 59.611  1.00 11.09 ? 350 ALA A N     1 
ATOM   2674 C  CA    . ALA A 1 350 ? 20.470  47.947 59.282  1.00 11.27 ? 350 ALA A CA    1 
ATOM   2675 C  C     . ALA A 1 350 ? 21.407  49.054 59.720  1.00 12.20 ? 350 ALA A C     1 
ATOM   2676 O  O     . ALA A 1 350 ? 21.243  49.610 60.796  1.00 12.61 ? 350 ALA A O     1 
ATOM   2677 C  CB    . ALA A 1 350 ? 20.600  47.683 57.796  1.00 10.71 ? 350 ALA A CB    1 
HETATM 2678 N  N     . MSE A 1 351 ? 22.393  49.377 58.895  1.00 14.52 ? 351 MSE A N     1 
HETATM 2679 C  CA    . MSE A 1 351 ? 23.340  50.422 59.249  1.00 14.80 ? 351 MSE A CA    1 
HETATM 2680 C  C     . MSE A 1 351 ? 23.322  51.544 58.216  1.00 14.34 ? 351 MSE A C     1 
HETATM 2681 O  O     . MSE A 1 351 ? 24.195  52.420 58.205  1.00 14.93 ? 351 MSE A O     1 
HETATM 2682 C  CB    . MSE A 1 351 ? 24.744  49.822 59.377  1.00 14.95 ? 351 MSE A CB    1 
HETATM 2683 C  CG    . MSE A 1 351 ? 24.878  48.719 60.443  1.00 15.27 ? 351 MSE A CG    1 
HETATM 2684 SE SE    . MSE A 1 351 ? 24.626  49.379 62.182  1.00 15.57 ? 351 MSE A SE    1 
HETATM 2685 C  CE    . MSE A 1 351 ? 24.876  47.801 63.075  1.00 16.43 ? 351 MSE A CE    1 
ATOM   2686 N  N     . GLY A 1 352 ? 22.311  51.526 57.357  1.00 13.14 ? 352 GLY A N     1 
ATOM   2687 C  CA    . GLY A 1 352 ? 22.203  52.561 56.346  1.00 13.40 ? 352 GLY A CA    1 
ATOM   2688 C  C     . GLY A 1 352 ? 23.190  52.321 55.226  1.00 12.56 ? 352 GLY A C     1 
ATOM   2689 O  O     . GLY A 1 352 ? 23.581  51.179 54.991  1.00 11.41 ? 352 GLY A O     1 
ATOM   2690 N  N     . HIS A 1 353 ? 23.592  53.394 54.548  1.00 12.52 ? 353 HIS A N     1 
ATOM   2691 C  CA    . HIS A 1 353 ? 24.532  53.309 53.435  1.00 13.54 ? 353 HIS A CA    1 
ATOM   2692 C  C     . HIS A 1 353 ? 25.952  53.011 53.870  1.00 13.80 ? 353 HIS A C     1 
ATOM   2693 O  O     . HIS A 1 353 ? 26.370  53.362 54.973  1.00 14.19 ? 353 HIS A O     1 
ATOM   2694 C  CB    . HIS A 1 353 ? 24.538  54.611 52.641  1.00 14.96 ? 353 HIS A CB    1 
ATOM   2695 C  CG    . HIS A 1 353 ? 23.271  54.874 51.898  1.00 17.45 ? 353 HIS A CG    1 
ATOM   2696 N  ND1   . HIS A 1 353 ? 22.969  56.106 51.359  1.00 18.51 ? 353 HIS A ND1   1 
ATOM   2697 C  CD2   . HIS A 1 353 ? 22.233  54.060 51.588  1.00 18.09 ? 353 HIS A CD2   1 
ATOM   2698 C  CE1   . HIS A 1 353 ? 21.800  56.043 50.750  1.00 18.86 ? 353 HIS A CE1   1 
ATOM   2699 N  NE2   . HIS A 1 353 ? 21.332  54.813 50.874  1.00 19.60 ? 353 HIS A NE2   1 
ATOM   2700 N  N     . PRO A 1 354 ? 26.717  52.348 53.002  1.00 13.89 ? 354 PRO A N     1 
ATOM   2701 C  CA    . PRO A 1 354 ? 28.102  52.019 53.325  1.00 13.72 ? 354 PRO A CA    1 
ATOM   2702 C  C     . PRO A 1 354 ? 28.906  53.307 53.458  1.00 14.24 ? 354 PRO A C     1 
ATOM   2703 O  O     . PRO A 1 354 ? 28.558  54.338 52.874  1.00 13.24 ? 354 PRO A O     1 
ATOM   2704 C  CB    . PRO A 1 354 ? 28.532  51.182 52.125  1.00 14.07 ? 354 PRO A CB    1 
ATOM   2705 C  CG    . PRO A 1 354 ? 27.204  50.577 51.639  1.00 14.08 ? 354 PRO A CG    1 
ATOM   2706 C  CD    . PRO A 1 354 ? 26.373  51.833 51.669  1.00 13.74 ? 354 PRO A CD    1 
ATOM   2707 N  N     . SER A 1 355 ? 29.988  53.224 54.224  1.00 14.63 ? 355 SER A N     1 
ATOM   2708 C  CA    . SER A 1 355 ? 30.883  54.341 54.492  1.00 13.48 ? 355 SER A CA    1 
ATOM   2709 C  C     . SER A 1 355 ? 31.350  55.106 53.260  1.00 12.55 ? 355 SER A C     1 
ATOM   2710 O  O     . SER A 1 355 ? 31.251  56.328 53.205  1.00 12.42 ? 355 SER A O     1 
ATOM   2711 C  CB    . SER A 1 355 ? 32.100  53.814 55.234  1.00 15.69 ? 355 SER A CB    1 
ATOM   2712 O  OG    . SER A 1 355 ? 31.697  53.004 56.330  1.00 21.91 ? 355 SER A OG    1 
ATOM   2713 N  N     . PHE A 1 356 ? 31.857  54.383 52.269  1.00 12.86 ? 356 PHE A N     1 
ATOM   2714 C  CA    . PHE A 1 356 ? 32.380  55.000 51.057  1.00 12.87 ? 356 PHE A CA    1 
ATOM   2715 C  C     . PHE A 1 356 ? 31.461  55.988 50.347  1.00 13.61 ? 356 PHE A C     1 
ATOM   2716 O  O     . PHE A 1 356 ? 31.814  57.162 50.179  1.00 15.13 ? 356 PHE A O     1 
ATOM   2717 C  CB    . PHE A 1 356 ? 32.795  53.937 50.041  1.00 12.80 ? 356 PHE A CB    1 
ATOM   2718 C  CG    . PHE A 1 356 ? 33.560  54.491 48.868  1.00 12.44 ? 356 PHE A CG    1 
ATOM   2719 C  CD1   . PHE A 1 356 ? 34.893  54.865 49.011  1.00 12.31 ? 356 PHE A CD1   1 
ATOM   2720 C  CD2   . PHE A 1 356 ? 32.947  54.669 47.633  1.00 12.36 ? 356 PHE A CD2   1 
ATOM   2721 C  CE1   . PHE A 1 356 ? 35.606  55.408 47.945  1.00 11.07 ? 356 PHE A CE1   1 
ATOM   2722 C  CE2   . PHE A 1 356 ? 33.655  55.214 46.562  1.00 11.77 ? 356 PHE A CE2   1 
ATOM   2723 C  CZ    . PHE A 1 356 ? 34.985  55.585 46.719  1.00 11.67 ? 356 PHE A CZ    1 
ATOM   2724 N  N     . VAL A 1 357 ? 30.295  55.527 49.904  1.00 13.10 ? 357 VAL A N     1 
ATOM   2725 C  CA    . VAL A 1 357 ? 29.397  56.416 49.181  1.00 12.92 ? 357 VAL A CA    1 
ATOM   2726 C  C     . VAL A 1 357 ? 28.991  57.595 50.062  1.00 13.12 ? 357 VAL A C     1 
ATOM   2727 O  O     . VAL A 1 357 ? 28.697  58.693 49.568  1.00 12.72 ? 357 VAL A O     1 
ATOM   2728 C  CB    . VAL A 1 357 ? 28.122  55.695 48.721  1.00 13.02 ? 357 VAL A CB    1 
ATOM   2729 C  CG1   . VAL A 1 357 ? 27.267  55.329 49.926  1.00 13.79 ? 357 VAL A CG1   1 
ATOM   2730 C  CG2   . VAL A 1 357 ? 27.346  56.593 47.753  1.00 13.85 ? 357 VAL A CG2   1 
HETATM 2731 N  N     . MSE A 1 358 ? 28.997  57.384 51.371  1.00 12.92 ? 358 MSE A N     1 
HETATM 2732 C  CA    . MSE A 1 358 ? 28.598  58.469 52.228  1.00 14.08 ? 358 MSE A CA    1 
HETATM 2733 C  C     . MSE A 1 358 ? 29.625  59.582 52.271  1.00 15.77 ? 358 MSE A C     1 
HETATM 2734 O  O     . MSE A 1 358 ? 29.281  60.740 52.526  1.00 16.98 ? 358 MSE A O     1 
HETATM 2735 C  CB    . MSE A 1 358 ? 28.243  57.975 53.635  1.00 14.06 ? 358 MSE A CB    1 
HETATM 2736 C  CG    . MSE A 1 358 ? 26.998  58.718 54.026  1.00 15.21 ? 358 MSE A CG    1 
HETATM 2737 SE SE    . MSE A 1 358 ? 25.517  58.098 53.057  1.00 12.39 ? 358 MSE A SE    1 
HETATM 2738 C  CE    . MSE A 1 358 ? 24.440  59.363 53.763  1.00 14.55 ? 358 MSE A CE    1 
ATOM   2739 N  N     . SER A 1 359 ? 30.887  59.246 52.009  1.00 16.95 ? 359 SER A N     1 
ATOM   2740 C  CA    . SER A 1 359 ? 31.958  60.239 51.978  1.00 17.00 ? 359 SER A CA    1 
ATOM   2741 C  C     . SER A 1 359 ? 31.592  61.292 50.935  1.00 17.00 ? 359 SER A C     1 
ATOM   2742 O  O     . SER A 1 359 ? 31.889  62.473 51.106  1.00 18.05 ? 359 SER A O     1 
ATOM   2743 C  CB    . SER A 1 359 ? 33.285  59.586 51.591  1.00 18.25 ? 359 SER A CB    1 
ATOM   2744 O  OG    . SER A 1 359 ? 34.317  60.557 51.510  1.00 18.85 ? 359 SER A OG    1 
ATOM   2745 N  N     . ASN A 1 360 ? 30.967  60.851 49.848  1.00 16.12 ? 360 ASN A N     1 
ATOM   2746 C  CA    . ASN A 1 360 ? 30.540  61.776 48.807  1.00 15.40 ? 360 ASN A CA    1 
ATOM   2747 C  C     . ASN A 1 360 ? 29.525  62.734 49.385  1.00 14.99 ? 360 ASN A C     1 
ATOM   2748 O  O     . ASN A 1 360 ? 29.775  63.933 49.462  1.00 15.58 ? 360 ASN A O     1 
ATOM   2749 C  CB    . ASN A 1 360 ? 29.918  61.030 47.630  1.00 15.53 ? 360 ASN A CB    1 
ATOM   2750 C  CG    . ASN A 1 360 ? 30.948  60.559 46.631  1.00 16.23 ? 360 ASN A CG    1 
ATOM   2751 O  OD1   . ASN A 1 360 ? 31.917  59.879 46.977  1.00 17.41 ? 360 ASN A OD1   1 
ATOM   2752 N  ND2   . ASN A 1 360 ? 30.743  60.923 45.374  1.00 16.94 ? 360 ASN A ND2   1 
ATOM   2753 N  N     . SER A 1 361 ? 28.384  62.205 49.803  1.00 14.54 ? 361 SER A N     1 
ATOM   2754 C  CA    . SER A 1 361 ? 27.360  63.053 50.375  1.00 14.58 ? 361 SER A CA    1 
ATOM   2755 C  C     . SER A 1 361 ? 27.963  64.056 51.340  1.00 14.98 ? 361 SER A C     1 
ATOM   2756 O  O     . SER A 1 361 ? 27.894  65.275 51.117  1.00 15.45 ? 361 SER A O     1 
ATOM   2757 C  CB    . SER A 1 361 ? 26.308  62.221 51.095  1.00 15.26 ? 361 SER A CB    1 
ATOM   2758 O  OG    . SER A 1 361 ? 25.507  61.525 50.156  1.00 18.70 ? 361 SER A OG    1 
ATOM   2759 N  N     . PHE A 1 362 ? 28.580  63.551 52.400  1.00 13.73 ? 362 PHE A N     1 
ATOM   2760 C  CA    . PHE A 1 362 ? 29.162  64.434 53.392  1.00 12.72 ? 362 PHE A CA    1 
ATOM   2761 C  C     . PHE A 1 362 ? 30.236  65.418 52.921  1.00 13.05 ? 362 PHE A C     1 
ATOM   2762 O  O     . PHE A 1 362 ? 30.351  66.525 53.469  1.00 13.54 ? 362 PHE A O     1 
ATOM   2763 C  CB    . PHE A 1 362 ? 29.651  63.617 54.588  1.00 11.67 ? 362 PHE A CB    1 
ATOM   2764 C  CG    . PHE A 1 362 ? 28.533  62.957 55.348  1.00 10.50 ? 362 PHE A CG    1 
ATOM   2765 C  CD1   . PHE A 1 362 ? 27.254  63.526 55.357  1.00 8.63  ? 362 PHE A CD1   1 
ATOM   2766 C  CD2   . PHE A 1 362 ? 28.752  61.802 56.078  1.00 9.67  ? 362 PHE A CD2   1 
ATOM   2767 C  CE1   . PHE A 1 362 ? 26.213  62.955 56.085  1.00 7.16  ? 362 PHE A CE1   1 
ATOM   2768 C  CE2   . PHE A 1 362 ? 27.709  61.219 56.817  1.00 10.65 ? 362 PHE A CE2   1 
ATOM   2769 C  CZ    . PHE A 1 362 ? 26.432  61.804 56.816  1.00 8.91  ? 362 PHE A CZ    1 
ATOM   2770 N  N     . THR A 1 363 ? 31.026  65.057 51.915  1.00 12.94 ? 363 THR A N     1 
ATOM   2771 C  CA    . THR A 1 363 ? 32.035  66.001 51.446  1.00 12.75 ? 363 THR A CA    1 
ATOM   2772 C  C     . THR A 1 363 ? 31.309  67.226 50.898  1.00 13.14 ? 363 THR A C     1 
ATOM   2773 O  O     . THR A 1 363 ? 31.741  68.360 51.110  1.00 14.12 ? 363 THR A O     1 
ATOM   2774 C  CB    . THR A 1 363 ? 32.922  65.400 50.358  1.00 12.19 ? 363 THR A CB    1 
ATOM   2775 O  OG1   . THR A 1 363 ? 33.708  64.349 50.928  1.00 13.53 ? 363 THR A OG1   1 
ATOM   2776 C  CG2   . THR A 1 363 ? 33.838  66.456 49.778  1.00 10.45 ? 363 THR A CG2   1 
ATOM   2777 N  N     . ASN A 1 364 ? 30.204  66.987 50.196  1.00 12.69 ? 364 ASN A N     1 
ATOM   2778 C  CA    . ASN A 1 364 ? 29.393  68.073 49.642  1.00 12.74 ? 364 ASN A CA    1 
ATOM   2779 C  C     . ASN A 1 364 ? 28.843  68.889 50.805  1.00 12.72 ? 364 ASN A C     1 
ATOM   2780 O  O     . ASN A 1 364 ? 28.777  70.115 50.770  1.00 11.30 ? 364 ASN A O     1 
ATOM   2781 C  CB    . ASN A 1 364 ? 28.224  67.499 48.833  1.00 12.16 ? 364 ASN A CB    1 
ATOM   2782 C  CG    . ASN A 1 364 ? 28.641  67.006 47.460  1.00 11.58 ? 364 ASN A CG    1 
ATOM   2783 O  OD1   . ASN A 1 364 ? 28.863  67.804 46.557  1.00 10.83 ? 364 ASN A OD1   1 
ATOM   2784 N  ND2   . ASN A 1 364 ? 28.757  65.688 47.300  1.00 11.77 ? 364 ASN A ND2   1 
ATOM   2785 N  N     . GLN A 1 365 ? 28.460  68.171 51.847  1.00 14.77 ? 365 GLN A N     1 
ATOM   2786 C  CA    . GLN A 1 365 ? 27.885  68.766 53.032  1.00 16.01 ? 365 GLN A CA    1 
ATOM   2787 C  C     . GLN A 1 365 ? 28.878  69.730 53.701  1.00 16.73 ? 365 GLN A C     1 
ATOM   2788 O  O     . GLN A 1 365 ? 28.513  70.861 54.068  1.00 16.34 ? 365 GLN A O     1 
ATOM   2789 C  CB    . GLN A 1 365 ? 27.477  67.639 53.971  1.00 16.96 ? 365 GLN A CB    1 
ATOM   2790 C  CG    . GLN A 1 365 ? 26.507  68.051 55.034  1.00 19.42 ? 365 GLN A CG    1 
ATOM   2791 C  CD    . GLN A 1 365 ? 25.214  68.571 54.454  1.00 20.15 ? 365 GLN A CD    1 
ATOM   2792 O  OE1   . GLN A 1 365 ? 24.499  67.858 53.743  1.00 20.57 ? 365 GLN A OE1   1 
ATOM   2793 N  NE2   . GLN A 1 365 ? 24.900  69.822 54.760  1.00 21.03 ? 365 GLN A NE2   1 
ATOM   2794 N  N     . VAL A 1 366 ? 30.131  69.291 53.849  1.00 16.79 ? 366 VAL A N     1 
ATOM   2795 C  CA    . VAL A 1 366 ? 31.169  70.135 54.455  1.00 16.96 ? 366 VAL A CA    1 
ATOM   2796 C  C     . VAL A 1 366 ? 31.440  71.361 53.579  1.00 17.87 ? 366 VAL A C     1 
ATOM   2797 O  O     . VAL A 1 366 ? 31.583  72.474 54.090  1.00 19.02 ? 366 VAL A O     1 
ATOM   2798 C  CB    . VAL A 1 366 ? 32.503  69.371 54.632  1.00 16.58 ? 366 VAL A CB    1 
ATOM   2799 C  CG1   . VAL A 1 366 ? 33.544  70.276 55.263  1.00 17.23 ? 366 VAL A CG1   1 
ATOM   2800 C  CG2   . VAL A 1 366 ? 32.292  68.154 55.498  1.00 17.41 ? 366 VAL A CG2   1 
HETATM 2801 N  N     . MSE A 1 367 ? 31.522  71.146 52.265  1.00 18.18 ? 367 MSE A N     1 
HETATM 2802 C  CA    . MSE A 1 367 ? 31.766  72.227 51.310  1.00 17.70 ? 367 MSE A CA    1 
HETATM 2803 C  C     . MSE A 1 367 ? 30.645  73.256 51.426  1.00 16.63 ? 367 MSE A C     1 
HETATM 2804 O  O     . MSE A 1 367 ? 30.897  74.466 51.436  1.00 15.65 ? 367 MSE A O     1 
HETATM 2805 C  CB    . MSE A 1 367 ? 31.819  71.680 49.871  1.00 19.31 ? 367 MSE A CB    1 
HETATM 2806 C  CG    . MSE A 1 367 ? 33.000  70.757 49.551  1.00 20.73 ? 367 MSE A CG    1 
HETATM 2807 SE SE    . MSE A 1 367 ? 32.906  70.185 47.774  1.00 26.97 ? 367 MSE A SE    1 
HETATM 2808 C  CE    . MSE A 1 367 ? 34.421  69.156 47.733  1.00 24.38 ? 367 MSE A CE    1 
ATOM   2809 N  N     . ALA A 1 368 ? 29.409  72.762 51.519  1.00 15.29 ? 368 ALA A N     1 
ATOM   2810 C  CA    . ALA A 1 368 ? 28.237  73.622 51.642  1.00 14.13 ? 368 ALA A CA    1 
ATOM   2811 C  C     . ALA A 1 368 ? 28.393  74.494 52.873  1.00 14.09 ? 368 ALA A C     1 
ATOM   2812 O  O     . ALA A 1 368 ? 28.259  75.715 52.800  1.00 14.53 ? 368 ALA A O     1 
ATOM   2813 C  CB    . ALA A 1 368 ? 26.983  72.789 51.764  1.00 14.47 ? 368 ALA A CB    1 
ATOM   2814 N  N     . GLN A 1 369 ? 28.662  73.865 54.013  1.00 13.27 ? 369 GLN A N     1 
ATOM   2815 C  CA    . GLN A 1 369 ? 28.863  74.620 55.241  1.00 13.00 ? 369 GLN A CA    1 
ATOM   2816 C  C     . GLN A 1 369 ? 29.944  75.703 55.044  1.00 13.34 ? 369 GLN A C     1 
ATOM   2817 O  O     . GLN A 1 369 ? 29.717  76.882 55.366  1.00 14.31 ? 369 GLN A O     1 
ATOM   2818 C  CB    . GLN A 1 369 ? 29.256  73.677 56.375  1.00 12.65 ? 369 GLN A CB    1 
ATOM   2819 C  CG    . GLN A 1 369 ? 28.141  72.737 56.822  1.00 12.79 ? 369 GLN A CG    1 
ATOM   2820 C  CD    . GLN A 1 369 ? 26.992  73.472 57.521  1.00 12.81 ? 369 GLN A CD    1 
ATOM   2821 O  OE1   . GLN A 1 369 ? 27.210  74.217 58.479  1.00 12.40 ? 369 GLN A OE1   1 
ATOM   2822 N  NE2   . GLN A 1 369 ? 25.768  73.250 57.054  1.00 11.85 ? 369 GLN A NE2   1 
ATOM   2823 N  N     . ILE A 1 370 ? 31.105  75.325 54.504  1.00 11.53 ? 370 ILE A N     1 
ATOM   2824 C  CA    . ILE A 1 370 ? 32.161  76.311 54.288  1.00 11.35 ? 370 ILE A CA    1 
ATOM   2825 C  C     . ILE A 1 370 ? 31.655  77.464 53.419  1.00 11.81 ? 370 ILE A C     1 
ATOM   2826 O  O     . ILE A 1 370 ? 31.913  78.632 53.722  1.00 11.60 ? 370 ILE A O     1 
ATOM   2827 C  CB    . ILE A 1 370 ? 33.427  75.689 53.623  1.00 10.65 ? 370 ILE A CB    1 
ATOM   2828 C  CG1   . ILE A 1 370 ? 34.033  74.623 54.539  1.00 10.89 ? 370 ILE A CG1   1 
ATOM   2829 C  CG2   . ILE A 1 370 ? 34.468  76.762 53.369  1.00 6.92  ? 370 ILE A CG2   1 
ATOM   2830 C  CD1   . ILE A 1 370 ? 35.296  73.970 53.983  1.00 11.65 ? 370 ILE A CD1   1 
ATOM   2831 N  N     . GLU A 1 371 ? 30.935  77.143 52.345  1.00 12.90 ? 371 GLU A N     1 
ATOM   2832 C  CA    . GLU A 1 371 ? 30.401  78.176 51.450  1.00 13.78 ? 371 GLU A CA    1 
ATOM   2833 C  C     . GLU A 1 371 ? 29.523  79.194 52.161  1.00 15.00 ? 371 GLU A C     1 
ATOM   2834 O  O     . GLU A 1 371 ? 29.828  80.388 52.150  1.00 14.85 ? 371 GLU A O     1 
ATOM   2835 C  CB    . GLU A 1 371 ? 29.597  77.554 50.311  1.00 13.90 ? 371 GLU A CB    1 
ATOM   2836 C  CG    . GLU A 1 371 ? 30.433  76.968 49.193  1.00 14.52 ? 371 GLU A CG    1 
ATOM   2837 C  CD    . GLU A 1 371 ? 31.315  78.008 48.549  1.00 14.24 ? 371 GLU A CD    1 
ATOM   2838 O  OE1   . GLU A 1 371 ? 32.404  78.285 49.094  1.00 14.64 ? 371 GLU A OE1   1 
ATOM   2839 O  OE2   . GLU A 1 371 ? 30.900  78.569 47.514  1.00 14.22 ? 371 GLU A OE2   1 
ATOM   2840 N  N     . LEU A 1 372 ? 28.429  78.725 52.764  1.00 16.25 ? 372 LEU A N     1 
ATOM   2841 C  CA    . LEU A 1 372 ? 27.515  79.617 53.472  1.00 16.77 ? 372 LEU A CA    1 
ATOM   2842 C  C     . LEU A 1 372 ? 28.215  80.417 54.573  1.00 18.53 ? 372 LEU A C     1 
ATOM   2843 O  O     . LEU A 1 372 ? 27.970  81.618 54.725  1.00 18.39 ? 372 LEU A O     1 
ATOM   2844 C  CB    . LEU A 1 372 ? 26.337  78.845 54.105  1.00 15.13 ? 372 LEU A CB    1 
ATOM   2845 C  CG    . LEU A 1 372 ? 25.202  78.169 53.318  1.00 13.57 ? 372 LEU A CG    1 
ATOM   2846 C  CD1   . LEU A 1 372 ? 24.556  79.169 52.365  1.00 13.00 ? 372 LEU A CD1   1 
ATOM   2847 C  CD2   . LEU A 1 372 ? 25.736  76.994 52.560  1.00 14.31 ? 372 LEU A CD2   1 
ATOM   2848 N  N     . TRP A 1 373 ? 29.089  79.764 55.337  1.00 20.01 ? 373 TRP A N     1 
ATOM   2849 C  CA    . TRP A 1 373 ? 29.758  80.450 56.438  1.00 21.42 ? 373 TRP A CA    1 
ATOM   2850 C  C     . TRP A 1 373 ? 30.874  81.414 56.090  1.00 22.57 ? 373 TRP A C     1 
ATOM   2851 O  O     . TRP A 1 373 ? 31.013  82.453 56.747  1.00 22.88 ? 373 TRP A O     1 
ATOM   2852 C  CB    . TRP A 1 373 ? 30.269  79.439 57.459  1.00 21.42 ? 373 TRP A CB    1 
ATOM   2853 C  CG    . TRP A 1 373 ? 30.991  80.088 58.589  1.00 22.89 ? 373 TRP A CG    1 
ATOM   2854 C  CD1   . TRP A 1 373 ? 32.341  80.162 58.764  1.00 23.37 ? 373 TRP A CD1   1 
ATOM   2855 C  CD2   . TRP A 1 373 ? 30.403  80.783 59.701  1.00 23.99 ? 373 TRP A CD2   1 
ATOM   2856 N  NE1   . TRP A 1 373 ? 32.635  80.855 59.916  1.00 23.88 ? 373 TRP A NE1   1 
ATOM   2857 C  CE2   . TRP A 1 373 ? 31.466  81.246 60.511  1.00 23.80 ? 373 TRP A CE2   1 
ATOM   2858 C  CE3   . TRP A 1 373 ? 29.082  81.057 60.092  1.00 24.90 ? 373 TRP A CE3   1 
ATOM   2859 C  CZ2   . TRP A 1 373 ? 31.252  81.968 61.689  1.00 24.49 ? 373 TRP A CZ2   1 
ATOM   2860 C  CZ3   . TRP A 1 373 ? 28.869  81.775 61.266  1.00 25.45 ? 373 TRP A CZ3   1 
ATOM   2861 C  CH2   . TRP A 1 373 ? 29.953  82.222 62.051  1.00 24.97 ? 373 TRP A CH2   1 
ATOM   2862 N  N     . THR A 1 374 ? 31.660  81.085 55.068  1.00 23.54 ? 374 THR A N     1 
ATOM   2863 C  CA    . THR A 1 374 ? 32.777  81.930 54.666  1.00 25.40 ? 374 THR A CA    1 
ATOM   2864 C  C     . THR A 1 374 ? 32.440  82.930 53.560  1.00 25.87 ? 374 THR A C     1 
ATOM   2865 O  O     . THR A 1 374 ? 33.125  83.942 53.410  1.00 25.63 ? 374 THR A O     1 
ATOM   2866 C  CB    . THR A 1 374 ? 33.971  81.062 54.233  1.00 26.58 ? 374 THR A CB    1 
ATOM   2867 O  OG1   . THR A 1 374 ? 34.370  80.236 55.334  1.00 27.80 ? 374 THR A OG1   1 
ATOM   2868 C  CG2   . THR A 1 374 ? 35.149  81.922 53.825  1.00 28.10 ? 374 THR A CG2   1 
ATOM   2869 N  N     . HIS A 1 375 ? 31.385  82.655 52.795  1.00 26.67 ? 375 HIS A N     1 
ATOM   2870 C  CA    . HIS A 1 375 ? 30.978  83.547 51.707  1.00 27.74 ? 375 HIS A CA    1 
ATOM   2871 C  C     . HIS A 1 375 ? 29.475  83.809 51.735  1.00 29.05 ? 375 HIS A C     1 
ATOM   2872 O  O     . HIS A 1 375 ? 28.757  83.515 50.772  1.00 28.75 ? 375 HIS A O     1 
ATOM   2873 C  CB    . HIS A 1 375 ? 31.360  82.947 50.353  1.00 27.07 ? 375 HIS A CB    1 
ATOM   2874 C  CG    . HIS A 1 375 ? 32.793  82.532 50.264  1.00 28.00 ? 375 HIS A CG    1 
ATOM   2875 N  ND1   . HIS A 1 375 ? 33.283  81.412 50.900  1.00 29.02 ? 375 HIS A ND1   1 
ATOM   2876 C  CD2   . HIS A 1 375 ? 33.849  83.103 49.641  1.00 27.78 ? 375 HIS A CD2   1 
ATOM   2877 C  CE1   . HIS A 1 375 ? 34.579  81.308 50.670  1.00 27.55 ? 375 HIS A CE1   1 
ATOM   2878 N  NE2   . HIS A 1 375 ? 34.947  82.322 49.908  1.00 27.62 ? 375 HIS A NE2   1 
ATOM   2879 N  N     . PRO A 1 376 ? 28.981  84.395 52.833  1.00 29.02 ? 376 PRO A N     1 
ATOM   2880 C  CA    . PRO A 1 376 ? 27.553  84.690 52.976  1.00 30.05 ? 376 PRO A CA    1 
ATOM   2881 C  C     . PRO A 1 376 ? 27.040  85.551 51.823  1.00 30.63 ? 376 PRO A C     1 
ATOM   2882 O  O     . PRO A 1 376 ? 26.037  85.229 51.183  1.00 29.76 ? 376 PRO A O     1 
ATOM   2883 C  CB    . PRO A 1 376 ? 27.503  85.425 54.316  1.00 30.05 ? 376 PRO A CB    1 
ATOM   2884 C  CG    . PRO A 1 376 ? 28.660  84.795 55.070  1.00 30.33 ? 376 PRO A CG    1 
ATOM   2885 C  CD    . PRO A 1 376 ? 29.716  84.891 54.007  1.00 29.93 ? 376 PRO A CD    1 
ATOM   2886 N  N     . ASP A 1 377 ? 27.755  86.643 51.567  1.00 30.84 ? 377 ASP A N     1 
ATOM   2887 C  CA    . ASP A 1 377 ? 27.413  87.587 50.509  1.00 30.71 ? 377 ASP A CA    1 
ATOM   2888 C  C     . ASP A 1 377 ? 27.306  86.947 49.138  1.00 29.45 ? 377 ASP A C     1 
ATOM   2889 O  O     . ASP A 1 377 ? 26.985  87.619 48.159  1.00 28.96 ? 377 ASP A O     1 
ATOM   2890 C  CB    . ASP A 1 377 ? 28.451  88.706 50.459  1.00 33.61 ? 377 ASP A CB    1 
ATOM   2891 C  CG    . ASP A 1 377 ? 28.435  89.573 51.710  1.00 37.27 ? 377 ASP A CG    1 
ATOM   2892 O  OD1   . ASP A 1 377 ? 28.490  89.013 52.834  1.00 38.37 ? 377 ASP A OD1   1 
ATOM   2893 O  OD2   . ASP A 1 377 ? 28.375  90.816 51.568  1.00 38.62 ? 377 ASP A OD2   1 
ATOM   2894 N  N     . LYS A 1 378 ? 27.569  85.651 49.058  1.00 28.20 ? 378 LYS A N     1 
ATOM   2895 C  CA    . LYS A 1 378 ? 27.490  84.976 47.778  1.00 27.47 ? 378 LYS A CA    1 
ATOM   2896 C  C     . LYS A 1 378 ? 26.210  84.146 47.666  1.00 26.45 ? 378 LYS A C     1 
ATOM   2897 O  O     . LYS A 1 378 ? 25.926  83.567 46.621  1.00 26.68 ? 378 LYS A O     1 
ATOM   2898 C  CB    . LYS A 1 378 ? 28.731  84.099 47.588  1.00 29.14 ? 378 LYS A CB    1 
ATOM   2899 C  CG    . LYS A 1 378 ? 28.869  83.531 46.194  1.00 32.90 ? 378 LYS A CG    1 
ATOM   2900 C  CD    . LYS A 1 378 ? 30.230  82.884 45.939  1.00 34.91 ? 378 LYS A CD    1 
ATOM   2901 C  CE    . LYS A 1 378 ? 30.475  81.660 46.805  1.00 35.07 ? 378 LYS A CE    1 
ATOM   2902 N  NZ    . LYS A 1 378 ? 31.739  80.963 46.396  1.00 35.91 ? 378 LYS A NZ    1 
ATOM   2903 N  N     . TYR A 1 379 ? 25.428  84.097 48.741  1.00 24.21 ? 379 TYR A N     1 
ATOM   2904 C  CA    . TYR A 1 379 ? 24.187  83.327 48.724  1.00 21.45 ? 379 TYR A CA    1 
ATOM   2905 C  C     . TYR A 1 379 ? 22.979  84.064 49.275  1.00 19.73 ? 379 TYR A C     1 
ATOM   2906 O  O     . TYR A 1 379 ? 22.740  84.079 50.484  1.00 17.99 ? 379 TYR A O     1 
ATOM   2907 C  CB    . TYR A 1 379 ? 24.352  82.018 49.494  1.00 20.98 ? 379 TYR A CB    1 
ATOM   2908 C  CG    . TYR A 1 379 ? 25.414  81.102 48.933  1.00 21.67 ? 379 TYR A CG    1 
ATOM   2909 C  CD1   . TYR A 1 379 ? 26.770  81.393 49.078  1.00 21.31 ? 379 TYR A CD1   1 
ATOM   2910 C  CD2   . TYR A 1 379 ? 25.065  79.941 48.248  1.00 22.82 ? 379 TYR A CD2   1 
ATOM   2911 C  CE1   . TYR A 1 379 ? 27.747  80.549 48.559  1.00 21.16 ? 379 TYR A CE1   1 
ATOM   2912 C  CE2   . TYR A 1 379 ? 26.038  79.090 47.722  1.00 22.53 ? 379 TYR A CE2   1 
ATOM   2913 C  CZ    . TYR A 1 379 ? 27.376  79.399 47.883  1.00 21.27 ? 379 TYR A CZ    1 
ATOM   2914 O  OH    . TYR A 1 379 ? 28.338  78.555 47.367  1.00 20.77 ? 379 TYR A OH    1 
ATOM   2915 N  N     . PRO A 1 380 ? 22.186  84.678 48.383  1.00 19.88 ? 380 PRO A N     1 
ATOM   2916 C  CA    . PRO A 1 380 ? 20.980  85.425 48.761  1.00 19.75 ? 380 PRO A CA    1 
ATOM   2917 C  C     . PRO A 1 380 ? 20.001  84.443 49.381  1.00 20.11 ? 380 PRO A C     1 
ATOM   2918 O  O     . PRO A 1 380 ? 20.204  83.227 49.280  1.00 20.86 ? 380 PRO A O     1 
ATOM   2919 C  CB    . PRO A 1 380 ? 20.470  85.945 47.419  1.00 18.55 ? 380 PRO A CB    1 
ATOM   2920 C  CG    . PRO A 1 380 ? 21.748  86.044 46.591  1.00 19.45 ? 380 PRO A CG    1 
ATOM   2921 C  CD    . PRO A 1 380 ? 22.347  84.700 46.921  1.00 19.19 ? 380 PRO A CD    1 
ATOM   2922 N  N     . VAL A 1 381 ? 18.954  84.947 50.029  1.00 19.70 ? 381 VAL A N     1 
ATOM   2923 C  CA    . VAL A 1 381 ? 17.981  84.039 50.613  1.00 19.06 ? 381 VAL A CA    1 
ATOM   2924 C  C     . VAL A 1 381 ? 17.434  83.253 49.439  1.00 18.88 ? 381 VAL A C     1 
ATOM   2925 O  O     . VAL A 1 381 ? 17.038  83.831 48.430  1.00 19.02 ? 381 VAL A O     1 
ATOM   2926 C  CB    . VAL A 1 381 ? 16.833  84.780 51.311  1.00 19.17 ? 381 VAL A CB    1 
ATOM   2927 C  CG1   . VAL A 1 381 ? 15.827  83.772 51.864  1.00 19.49 ? 381 VAL A CG1   1 
ATOM   2928 C  CG2   . VAL A 1 381 ? 17.383  85.628 52.451  1.00 20.11 ? 381 VAL A CG2   1 
ATOM   2929 N  N     . GLY A 1 382 ? 17.443  81.933 49.567  1.00 18.94 ? 382 GLY A N     1 
ATOM   2930 C  CA    . GLY A 1 382 ? 16.971  81.067 48.503  1.00 18.68 ? 382 GLY A CA    1 
ATOM   2931 C  C     . GLY A 1 382 ? 17.782  79.785 48.543  1.00 19.63 ? 382 GLY A C     1 
ATOM   2932 O  O     . GLY A 1 382 ? 18.652  79.621 49.411  1.00 21.43 ? 382 GLY A O     1 
ATOM   2933 N  N     . VAL A 1 383 ? 17.516  78.872 47.615  1.00 19.03 ? 383 VAL A N     1 
ATOM   2934 C  CA    . VAL A 1 383 ? 18.228  77.600 47.581  1.00 16.68 ? 383 VAL A CA    1 
ATOM   2935 C  C     . VAL A 1 383 ? 19.123  77.511 46.357  1.00 15.74 ? 383 VAL A C     1 
ATOM   2936 O  O     . VAL A 1 383 ? 18.672  77.730 45.234  1.00 14.67 ? 383 VAL A O     1 
ATOM   2937 C  CB    . VAL A 1 383 ? 17.226  76.442 47.595  1.00 16.11 ? 383 VAL A CB    1 
ATOM   2938 C  CG1   . VAL A 1 383 ? 16.150  76.715 46.600  1.00 18.39 ? 383 VAL A CG1   1 
ATOM   2939 C  CG2   . VAL A 1 383 ? 17.917  75.129 47.265  1.00 16.61 ? 383 VAL A CG2   1 
ATOM   2940 N  N     . HIS A 1 384 ? 20.395  77.181 46.584  1.00 15.17 ? 384 HIS A N     1 
ATOM   2941 C  CA    . HIS A 1 384 ? 21.364  77.091 45.498  1.00 14.74 ? 384 HIS A CA    1 
ATOM   2942 C  C     . HIS A 1 384 ? 22.050  75.723 45.415  1.00 14.97 ? 384 HIS A C     1 
ATOM   2943 O  O     . HIS A 1 384 ? 21.873  74.870 46.290  1.00 15.94 ? 384 HIS A O     1 
ATOM   2944 C  CB    . HIS A 1 384 ? 22.447  78.161 45.669  1.00 15.24 ? 384 HIS A CB    1 
ATOM   2945 C  CG    . HIS A 1 384 ? 21.933  79.496 46.120  1.00 17.58 ? 384 HIS A CG    1 
ATOM   2946 N  ND1   . HIS A 1 384 ? 21.475  79.726 47.404  1.00 17.38 ? 384 HIS A ND1   1 
ATOM   2947 C  CD2   . HIS A 1 384 ? 21.844  80.683 45.472  1.00 17.48 ? 384 HIS A CD2   1 
ATOM   2948 C  CE1   . HIS A 1 384 ? 21.132  80.997 47.526  1.00 16.86 ? 384 HIS A CE1   1 
ATOM   2949 N  NE2   . HIS A 1 384 ? 21.346  81.600 46.369  1.00 17.23 ? 384 HIS A NE2   1 
ATOM   2950 N  N     . PHE A 1 385 ? 22.841  75.533 44.356  1.00 14.77 ? 385 PHE A N     1 
ATOM   2951 C  CA    . PHE A 1 385 ? 23.590  74.296 44.136  1.00 14.71 ? 385 PHE A CA    1 
ATOM   2952 C  C     . PHE A 1 385 ? 25.058  74.629 44.269  1.00 14.64 ? 385 PHE A C     1 
ATOM   2953 O  O     . PHE A 1 385 ? 25.466  75.762 44.025  1.00 15.38 ? 385 PHE A O     1 
ATOM   2954 C  CB    . PHE A 1 385 ? 23.406  73.733 42.715  1.00 13.62 ? 385 PHE A CB    1 
ATOM   2955 C  CG    . PHE A 1 385 ? 21.985  73.511 42.313  1.00 14.64 ? 385 PHE A CG    1 
ATOM   2956 C  CD1   . PHE A 1 385 ? 21.277  72.403 42.775  1.00 14.03 ? 385 PHE A CD1   1 
ATOM   2957 C  CD2   . PHE A 1 385 ? 21.345  74.414 41.470  1.00 15.00 ? 385 PHE A CD2   1 
ATOM   2958 C  CE1   . PHE A 1 385 ? 19.945  72.196 42.396  1.00 15.12 ? 385 PHE A CE1   1 
ATOM   2959 C  CE2   . PHE A 1 385 ? 20.011  74.217 41.082  1.00 15.28 ? 385 PHE A CE2   1 
ATOM   2960 C  CZ    . PHE A 1 385 ? 19.309  73.101 41.548  1.00 14.89 ? 385 PHE A CZ    1 
ATOM   2961 N  N     . LEU A 1 386 ? 25.859  73.648 44.654  1.00 14.46 ? 386 LEU A N     1 
ATOM   2962 C  CA    . LEU A 1 386 ? 27.288  73.877 44.747  1.00 14.36 ? 386 LEU A CA    1 
ATOM   2963 C  C     . LEU A 1 386 ? 27.715  74.072 43.302  1.00 14.93 ? 386 LEU A C     1 
ATOM   2964 O  O     . LEU A 1 386 ? 26.982  73.699 42.380  1.00 16.09 ? 386 LEU A O     1 
ATOM   2965 C  CB    . LEU A 1 386 ? 27.967  72.644 45.339  1.00 14.23 ? 386 LEU A CB    1 
ATOM   2966 C  CG    . LEU A 1 386 ? 28.467  72.785 46.776  1.00 14.87 ? 386 LEU A CG    1 
ATOM   2967 C  CD1   . LEU A 1 386 ? 27.473  73.563 47.601  1.00 14.58 ? 386 LEU A CD1   1 
ATOM   2968 C  CD2   . LEU A 1 386 ? 28.732  71.405 47.358  1.00 14.28 ? 386 LEU A CD2   1 
ATOM   2969 N  N     . PRO A 1 387 ? 28.887  74.678 43.074  1.00 15.52 ? 387 PRO A N     1 
ATOM   2970 C  CA    . PRO A 1 387 ? 29.403  74.913 41.717  1.00 15.98 ? 387 PRO A CA    1 
ATOM   2971 C  C     . PRO A 1 387 ? 29.792  73.570 41.092  1.00 16.61 ? 387 PRO A C     1 
ATOM   2972 O  O     . PRO A 1 387 ? 30.330  72.700 41.776  1.00 16.86 ? 387 PRO A O     1 
ATOM   2973 C  CB    . PRO A 1 387 ? 30.623  75.798 41.972  1.00 15.38 ? 387 PRO A CB    1 
ATOM   2974 C  CG    . PRO A 1 387 ? 30.294  76.444 43.344  1.00 16.56 ? 387 PRO A CG    1 
ATOM   2975 C  CD    . PRO A 1 387 ? 29.822  75.224 44.066  1.00 15.90 ? 387 PRO A CD    1 
ATOM   2976 N  N     . LYS A 1 388 ? 29.538  73.390 39.801  1.00 17.82 ? 388 LYS A N     1 
ATOM   2977 C  CA    . LYS A 1 388 ? 29.884  72.114 39.192  1.00 19.24 ? 388 LYS A CA    1 
ATOM   2978 C  C     . LYS A 1 388 ? 31.355  71.759 39.400  1.00 21.00 ? 388 LYS A C     1 
ATOM   2979 O  O     . LYS A 1 388 ? 31.695  70.586 39.575  1.00 21.36 ? 388 LYS A O     1 
ATOM   2980 C  CB    . LYS A 1 388 ? 29.559  72.099 37.696  1.00 17.39 ? 388 LYS A CB    1 
ATOM   2981 C  CG    . LYS A 1 388 ? 29.986  70.800 37.024  1.00 16.85 ? 388 LYS A CG    1 
ATOM   2982 C  CD    . LYS A 1 388 ? 29.494  70.670 35.595  1.00 16.12 ? 388 LYS A CD    1 
ATOM   2983 C  CE    . LYS A 1 388 ? 27.964  70.622 35.541  1.00 15.55 ? 388 LYS A CE    1 
ATOM   2984 N  NZ    . LYS A 1 388 ? 27.385  69.513 36.361  1.00 14.09 ? 388 LYS A NZ    1 
ATOM   2985 N  N     . LYS A 1 389 ? 32.237  72.754 39.397  1.00 21.24 ? 389 LYS A N     1 
ATOM   2986 C  CA    . LYS A 1 389 ? 33.637  72.421 39.568  1.00 21.23 ? 389 LYS A CA    1 
ATOM   2987 C  C     . LYS A 1 389 ? 33.908  71.806 40.933  1.00 20.62 ? 389 LYS A C     1 
ATOM   2988 O  O     . LYS A 1 389 ? 34.779  70.938 41.063  1.00 20.41 ? 389 LYS A O     1 
ATOM   2989 C  CB    . LYS A 1 389 ? 34.529  73.641 39.342  1.00 23.19 ? 389 LYS A CB    1 
ATOM   2990 C  CG    . LYS A 1 389 ? 36.006  73.272 39.328  1.00 24.94 ? 389 LYS A CG    1 
ATOM   2991 C  CD    . LYS A 1 389 ? 36.800  74.259 38.506  1.00 27.39 ? 389 LYS A CD    1 
ATOM   2992 C  CE    . LYS A 1 389 ? 38.198  73.731 38.232  1.00 29.73 ? 389 LYS A CE    1 
ATOM   2993 N  NZ    . LYS A 1 389 ? 38.901  74.590 37.232  1.00 32.19 ? 389 LYS A NZ    1 
ATOM   2994 N  N     . LEU A 1 390 ? 33.172  72.243 41.953  1.00 19.25 ? 390 LEU A N     1 
ATOM   2995 C  CA    . LEU A 1 390 ? 33.364  71.666 43.281  1.00 18.74 ? 390 LEU A CA    1 
ATOM   2996 C  C     . LEU A 1 390 ? 32.771  70.258 43.304  1.00 17.96 ? 390 LEU A C     1 
ATOM   2997 O  O     . LEU A 1 390 ? 33.302  69.340 43.942  1.00 17.07 ? 390 LEU A O     1 
ATOM   2998 C  CB    . LEU A 1 390 ? 32.689  72.518 44.359  1.00 19.35 ? 390 LEU A CB    1 
ATOM   2999 C  CG    . LEU A 1 390 ? 33.289  73.886 44.693  1.00 19.25 ? 390 LEU A CG    1 
ATOM   3000 C  CD1   . LEU A 1 390 ? 32.528  74.477 45.862  1.00 18.92 ? 390 LEU A CD1   1 
ATOM   3001 C  CD2   . LEU A 1 390 ? 34.757  73.742 45.064  1.00 19.09 ? 390 LEU A CD2   1 
ATOM   3002 N  N     . ASP A 1 391 ? 31.667  70.099 42.588  1.00 16.55 ? 391 ASP A N     1 
ATOM   3003 C  CA    . ASP A 1 391 ? 30.985  68.825 42.515  1.00 15.08 ? 391 ASP A CA    1 
ATOM   3004 C  C     . ASP A 1 391 ? 31.920  67.800 41.894  1.00 14.47 ? 391 ASP A C     1 
ATOM   3005 O  O     . ASP A 1 391 ? 32.056  66.695 42.408  1.00 13.26 ? 391 ASP A O     1 
ATOM   3006 C  CB    . ASP A 1 391 ? 29.711  68.982 41.689  1.00 15.49 ? 391 ASP A CB    1 
ATOM   3007 C  CG    . ASP A 1 391 ? 28.706  67.876 41.941  1.00 16.68 ? 391 ASP A CG    1 
ATOM   3008 O  OD1   . ASP A 1 391 ? 29.081  66.810 42.488  1.00 15.59 ? 391 ASP A OD1   1 
ATOM   3009 O  OD2   . ASP A 1 391 ? 27.523  68.080 41.579  1.00 18.27 ? 391 ASP A OD2   1 
ATOM   3010 N  N     . GLU A 1 392 ? 32.587  68.177 40.806  1.00 15.42 ? 392 GLU A N     1 
ATOM   3011 C  CA    . GLU A 1 392 ? 33.512  67.267 40.141  1.00 16.93 ? 392 GLU A CA    1 
ATOM   3012 C  C     . GLU A 1 392 ? 34.629  66.927 41.104  1.00 16.69 ? 392 GLU A C     1 
ATOM   3013 O  O     . GLU A 1 392 ? 35.100  65.796 41.154  1.00 17.05 ? 392 GLU A O     1 
ATOM   3014 C  CB    . GLU A 1 392 ? 34.127  67.901 38.898  1.00 18.66 ? 392 GLU A CB    1 
ATOM   3015 C  CG    . GLU A 1 392 ? 33.138  68.523 37.943  1.00 20.23 ? 392 GLU A CG    1 
ATOM   3016 C  CD    . GLU A 1 392 ? 33.769  68.821 36.606  1.00 21.96 ? 392 GLU A CD    1 
ATOM   3017 O  OE1   . GLU A 1 392 ? 34.950  69.263 36.592  1.00 23.47 ? 392 GLU A OE1   1 
ATOM   3018 O  OE2   . GLU A 1 392 ? 33.077  68.627 35.577  1.00 22.05 ? 392 GLU A OE2   1 
ATOM   3019 N  N     . ALA A 1 393 ? 35.056  67.926 41.866  1.00 16.69 ? 393 ALA A N     1 
ATOM   3020 C  CA    . ALA A 1 393 ? 36.113  67.731 42.847  1.00 16.27 ? 393 ALA A CA    1 
ATOM   3021 C  C     . ALA A 1 393 ? 35.743  66.595 43.800  1.00 16.65 ? 393 ALA A C     1 
ATOM   3022 O  O     . ALA A 1 393 ? 36.537  65.677 44.019  1.00 18.70 ? 393 ALA A O     1 
ATOM   3023 C  CB    . ALA A 1 393 ? 36.333  69.010 43.619  1.00 15.82 ? 393 ALA A CB    1 
ATOM   3024 N  N     . VAL A 1 394 ? 34.541  66.658 44.372  1.00 16.14 ? 394 VAL A N     1 
ATOM   3025 C  CA    . VAL A 1 394 ? 34.082  65.614 45.284  1.00 15.08 ? 394 VAL A CA    1 
ATOM   3026 C  C     . VAL A 1 394 ? 34.361  64.247 44.687  1.00 14.50 ? 394 VAL A C     1 
ATOM   3027 O  O     . VAL A 1 394 ? 34.988  63.404 45.314  1.00 14.10 ? 394 VAL A O     1 
ATOM   3028 C  CB    . VAL A 1 394 ? 32.572  65.706 45.536  1.00 15.03 ? 394 VAL A CB    1 
ATOM   3029 C  CG1   . VAL A 1 394 ? 32.111  64.514 46.346  1.00 16.41 ? 394 VAL A CG1   1 
ATOM   3030 C  CG2   . VAL A 1 394 ? 32.256  66.992 46.271  1.00 13.78 ? 394 VAL A CG2   1 
ATOM   3031 N  N     . ALA A 1 395 ? 33.886  64.038 43.464  1.00 14.84 ? 395 ALA A N     1 
ATOM   3032 C  CA    . ALA A 1 395 ? 34.085  62.769 42.782  1.00 15.11 ? 395 ALA A CA    1 
ATOM   3033 C  C     . ALA A 1 395 ? 35.567  62.452 42.591  1.00 15.11 ? 395 ALA A C     1 
ATOM   3034 O  O     . ALA A 1 395 ? 36.005  61.335 42.855  1.00 14.65 ? 395 ALA A O     1 
ATOM   3035 C  CB    . ALA A 1 395 ? 33.374  62.782 41.433  1.00 14.88 ? 395 ALA A CB    1 
ATOM   3036 N  N     . GLU A 1 396 ? 36.339  63.432 42.142  1.00 15.23 ? 396 GLU A N     1 
ATOM   3037 C  CA    . GLU A 1 396 ? 37.752  63.202 41.912  1.00 16.80 ? 396 GLU A CA    1 
ATOM   3038 C  C     . GLU A 1 396 ? 38.428  62.699 43.172  1.00 17.28 ? 396 GLU A C     1 
ATOM   3039 O  O     . GLU A 1 396 ? 39.279  61.802 43.124  1.00 18.35 ? 396 GLU A O     1 
ATOM   3040 C  CB    . GLU A 1 396 ? 38.434  64.479 41.434  1.00 17.51 ? 396 GLU A CB    1 
ATOM   3041 C  CG    . GLU A 1 396 ? 39.865  64.245 40.994  1.00 21.04 ? 396 GLU A CG    1 
ATOM   3042 C  CD    . GLU A 1 396 ? 40.366  65.329 40.050  1.00 23.51 ? 396 GLU A CD    1 
ATOM   3043 O  OE1   . GLU A 1 396 ? 39.642  66.336 39.874  1.00 23.68 ? 396 GLU A OE1   1 
ATOM   3044 O  OE2   . GLU A 1 396 ? 41.478  65.172 39.484  1.00 23.49 ? 396 GLU A OE2   1 
ATOM   3045 N  N     . ALA A 1 397 ? 38.027  63.260 44.304  1.00 16.65 ? 397 ALA A N     1 
ATOM   3046 C  CA    . ALA A 1 397 ? 38.599  62.884 45.590  1.00 16.90 ? 397 ALA A CA    1 
ATOM   3047 C  C     . ALA A 1 397 ? 38.475  61.398 45.971  1.00 16.70 ? 397 ALA A C     1 
ATOM   3048 O  O     . ALA A 1 397 ? 39.202  60.915 46.843  1.00 18.13 ? 397 ALA A O     1 
ATOM   3049 C  CB    . ALA A 1 397 ? 37.991  63.757 46.687  1.00 16.65 ? 397 ALA A CB    1 
ATOM   3050 N  N     . HIS A 1 398 ? 37.568  60.667 45.334  1.00 15.54 ? 398 HIS A N     1 
ATOM   3051 C  CA    . HIS A 1 398 ? 37.408  59.256 45.672  1.00 14.49 ? 398 HIS A CA    1 
ATOM   3052 C  C     . HIS A 1 398 ? 37.937  58.322 44.594  1.00 14.27 ? 398 HIS A C     1 
ATOM   3053 O  O     . HIS A 1 398 ? 37.756  57.106 44.676  1.00 13.40 ? 398 HIS A O     1 
ATOM   3054 C  CB    . HIS A 1 398 ? 35.933  58.931 45.948  1.00 14.33 ? 398 HIS A CB    1 
ATOM   3055 C  CG    . HIS A 1 398 ? 35.332  59.749 47.050  1.00 12.94 ? 398 HIS A CG    1 
ATOM   3056 N  ND1   . HIS A 1 398 ? 35.074  61.100 46.922  1.00 11.99 ? 398 HIS A ND1   1 
ATOM   3057 C  CD2   . HIS A 1 398 ? 35.002  59.423 48.324  1.00 11.95 ? 398 HIS A CD2   1 
ATOM   3058 C  CE1   . HIS A 1 398 ? 34.616  61.569 48.070  1.00 11.43 ? 398 HIS A CE1   1 
ATOM   3059 N  NE2   . HIS A 1 398 ? 34.563  60.572 48.937  1.00 11.49 ? 398 HIS A NE2   1 
ATOM   3060 N  N     . LEU A 1 399 ? 38.590  58.886 43.584  1.00 14.37 ? 399 LEU A N     1 
ATOM   3061 C  CA    . LEU A 1 399 ? 39.135  58.071 42.513  1.00 14.47 ? 399 LEU A CA    1 
ATOM   3062 C  C     . LEU A 1 399 ? 40.375  57.311 42.963  1.00 15.45 ? 399 LEU A C     1 
ATOM   3063 O  O     . LEU A 1 399 ? 40.532  56.134 42.648  1.00 18.49 ? 399 LEU A O     1 
ATOM   3064 C  CB    . LEU A 1 399 ? 39.444  58.943 41.297  1.00 13.46 ? 399 LEU A CB    1 
ATOM   3065 C  CG    . LEU A 1 399 ? 38.334  59.076 40.239  1.00 13.57 ? 399 LEU A CG    1 
ATOM   3066 C  CD1   . LEU A 1 399 ? 36.981  59.341 40.864  1.00 12.48 ? 399 LEU A CD1   1 
ATOM   3067 C  CD2   . LEU A 1 399 ? 38.718  60.188 39.276  1.00 15.02 ? 399 LEU A CD2   1 
ATOM   3068 N  N     . GLY A 1 400 ? 41.248  57.969 43.716  1.00 15.38 ? 400 GLY A N     1 
ATOM   3069 C  CA    . GLY A 1 400 ? 42.453  57.305 44.181  1.00 14.48 ? 400 GLY A CA    1 
ATOM   3070 C  C     . GLY A 1 400 ? 42.158  56.042 44.963  1.00 15.15 ? 400 GLY A C     1 
ATOM   3071 O  O     . GLY A 1 400 ? 42.752  54.990 44.719  1.00 14.96 ? 400 GLY A O     1 
ATOM   3072 N  N     . LYS A 1 401 ? 41.230  56.141 45.910  1.00 15.40 ? 401 LYS A N     1 
ATOM   3073 C  CA    . LYS A 1 401 ? 40.846  54.997 46.739  1.00 15.36 ? 401 LYS A CA    1 
ATOM   3074 C  C     . LYS A 1 401 ? 40.376  53.784 45.918  1.00 15.81 ? 401 LYS A C     1 
ATOM   3075 O  O     . LYS A 1 401 ? 40.561  52.639 46.333  1.00 16.23 ? 401 LYS A O     1 
ATOM   3076 C  CB    . LYS A 1 401 ? 39.745  55.421 47.710  1.00 15.45 ? 401 LYS A CB    1 
ATOM   3077 C  CG    . LYS A 1 401 ? 39.158  54.306 48.559  1.00 16.91 ? 401 LYS A CG    1 
ATOM   3078 C  CD    . LYS A 1 401 ? 40.135  53.733 49.573  1.00 17.65 ? 401 LYS A CD    1 
ATOM   3079 C  CE    . LYS A 1 401 ? 39.426  52.738 50.515  1.00 18.20 ? 401 LYS A CE    1 
ATOM   3080 N  NZ    . LYS A 1 401 ? 40.306  52.204 51.602  1.00 18.18 ? 401 LYS A NZ    1 
ATOM   3081 N  N     . LEU A 1 402 ? 39.759  54.029 44.762  1.00 15.23 ? 402 LEU A N     1 
ATOM   3082 C  CA    . LEU A 1 402 ? 39.277  52.936 43.921  1.00 13.79 ? 402 LEU A CA    1 
ATOM   3083 C  C     . LEU A 1 402 ? 40.286  52.666 42.827  1.00 14.63 ? 402 LEU A C     1 
ATOM   3084 O  O     . LEU A 1 402 ? 40.061  51.863 41.925  1.00 14.23 ? 402 LEU A O     1 
ATOM   3085 C  CB    . LEU A 1 402 ? 37.925  53.297 43.319  1.00 11.81 ? 402 LEU A CB    1 
ATOM   3086 C  CG    . LEU A 1 402 ? 36.912  53.661 44.399  1.00 9.56  ? 402 LEU A CG    1 
ATOM   3087 C  CD1   . LEU A 1 402 ? 35.552  53.913 43.757  1.00 9.67  ? 402 LEU A CD1   1 
ATOM   3088 C  CD2   . LEU A 1 402 ? 36.835  52.538 45.416  1.00 7.92  ? 402 LEU A CD2   1 
ATOM   3089 N  N     . ASN A 1 403 ? 41.405  53.369 42.925  1.00 16.04 ? 403 ASN A N     1 
ATOM   3090 C  CA    . ASN A 1 403 ? 42.505  53.231 41.993  1.00 16.27 ? 403 ASN A CA    1 
ATOM   3091 C  C     . ASN A 1 403 ? 42.121  53.454 40.535  1.00 15.99 ? 403 ASN A C     1 
ATOM   3092 O  O     . ASN A 1 403 ? 42.584  52.752 39.631  1.00 15.66 ? 403 ASN A O     1 
ATOM   3093 C  CB    . ASN A 1 403 ? 43.133  51.864 42.161  1.00 17.73 ? 403 ASN A CB    1 
ATOM   3094 C  CG    . ASN A 1 403 ? 44.617  51.909 41.976  1.00 21.55 ? 403 ASN A CG    1 
ATOM   3095 O  OD1   . ASN A 1 403 ? 45.112  52.277 40.904  1.00 23.07 ? 403 ASN A OD1   1 
ATOM   3096 N  ND2   . ASN A 1 403 ? 45.354  51.563 43.033  1.00 23.81 ? 403 ASN A ND2   1 
ATOM   3097 N  N     . VAL A 1 404 ? 41.271  54.447 40.315  1.00 15.64 ? 404 VAL A N     1 
ATOM   3098 C  CA    . VAL A 1 404 ? 40.829  54.793 38.979  1.00 15.27 ? 404 VAL A CA    1 
ATOM   3099 C  C     . VAL A 1 404 ? 41.831  55.769 38.371  1.00 15.86 ? 404 VAL A C     1 
ATOM   3100 O  O     . VAL A 1 404 ? 42.170  56.786 38.990  1.00 16.31 ? 404 VAL A O     1 
ATOM   3101 C  CB    . VAL A 1 404 ? 39.449  55.468 39.032  1.00 14.09 ? 404 VAL A CB    1 
ATOM   3102 C  CG1   . VAL A 1 404 ? 38.994  55.821 37.639  1.00 13.62 ? 404 VAL A CG1   1 
ATOM   3103 C  CG2   . VAL A 1 404 ? 38.443  54.537 39.701  1.00 13.98 ? 404 VAL A CG2   1 
ATOM   3104 N  N     . LYS A 1 405 ? 42.317  55.467 37.172  1.00 15.17 ? 405 LYS A N     1 
ATOM   3105 C  CA    . LYS A 1 405 ? 43.258  56.369 36.528  1.00 15.52 ? 405 LYS A CA    1 
ATOM   3106 C  C     . LYS A 1 405 ? 42.468  57.225 35.541  1.00 15.70 ? 405 LYS A C     1 
ATOM   3107 O  O     . LYS A 1 405 ? 41.982  56.728 34.518  1.00 15.76 ? 405 LYS A O     1 
ATOM   3108 C  CB    . LYS A 1 405 ? 44.349  55.572 35.818  1.00 16.69 ? 405 LYS A CB    1 
ATOM   3109 C  CG    . LYS A 1 405 ? 45.096  54.651 36.757  1.00 19.80 ? 405 LYS A CG    1 
ATOM   3110 C  CD    . LYS A 1 405 ? 46.001  53.701 35.987  1.00 24.31 ? 405 LYS A CD    1 
ATOM   3111 C  CE    . LYS A 1 405 ? 46.570  52.596 36.879  1.00 26.00 ? 405 LYS A CE    1 
ATOM   3112 N  NZ    . LYS A 1 405 ? 47.372  51.623 36.070  1.00 27.73 ? 405 LYS A NZ    1 
ATOM   3113 N  N     . LEU A 1 406 ? 42.333  58.510 35.860  1.00 15.12 ? 406 LEU A N     1 
ATOM   3114 C  CA    . LEU A 1 406 ? 41.582  59.433 35.019  1.00 16.40 ? 406 LEU A CA    1 
ATOM   3115 C  C     . LEU A 1 406 ? 42.438  59.926 33.861  1.00 17.30 ? 406 LEU A C     1 
ATOM   3116 O  O     . LEU A 1 406 ? 43.650  60.043 33.993  1.00 19.51 ? 406 LEU A O     1 
ATOM   3117 C  CB    . LEU A 1 406 ? 41.091  60.614 35.869  1.00 16.22 ? 406 LEU A CB    1 
ATOM   3118 C  CG    . LEU A 1 406 ? 40.010  61.535 35.287  1.00 17.20 ? 406 LEU A CG    1 
ATOM   3119 C  CD1   . LEU A 1 406 ? 38.765  60.720 34.942  1.00 18.85 ? 406 LEU A CD1   1 
ATOM   3120 C  CD2   . LEU A 1 406 ? 39.649  62.609 36.294  1.00 16.82 ? 406 LEU A CD2   1 
ATOM   3121 N  N     . THR A 1 407 ? 41.814  60.195 32.720  1.00 18.22 ? 407 THR A N     1 
ATOM   3122 C  CA    . THR A 1 407 ? 42.535  60.684 31.550  1.00 18.35 ? 407 THR A CA    1 
ATOM   3123 C  C     . THR A 1 407 ? 42.558  62.212 31.558  1.00 20.63 ? 407 THR A C     1 
ATOM   3124 O  O     . THR A 1 407 ? 41.547  62.855 31.856  1.00 22.91 ? 407 THR A O     1 
ATOM   3125 C  CB    . THR A 1 407 ? 41.865  60.191 30.243  1.00 17.50 ? 407 THR A CB    1 
ATOM   3126 O  OG1   . THR A 1 407 ? 42.017  58.770 30.139  1.00 18.94 ? 407 THR A OG1   1 
ATOM   3127 C  CG2   . THR A 1 407 ? 42.485  60.850 29.028  1.00 16.73 ? 407 THR A CG2   1 
ATOM   3128 N  N     . LYS A 1 408 ? 43.711  62.796 31.250  1.00 21.12 ? 408 LYS A N     1 
ATOM   3129 C  CA    . LYS A 1 408 ? 43.832  64.248 31.212  1.00 20.75 ? 408 LYS A CA    1 
ATOM   3130 C  C     . LYS A 1 408 ? 43.684  64.769 29.801  1.00 21.25 ? 408 LYS A C     1 
ATOM   3131 O  O     . LYS A 1 408 ? 44.511  64.504 28.924  1.00 22.83 ? 408 LYS A O     1 
ATOM   3132 C  CB    . LYS A 1 408 ? 45.173  64.699 31.780  1.00 21.44 ? 408 LYS A CB    1 
ATOM   3133 C  CG    . LYS A 1 408 ? 45.077  65.312 33.164  1.00 21.89 ? 408 LYS A CG    1 
ATOM   3134 C  CD    . LYS A 1 408 ? 44.284  66.611 33.130  1.00 22.51 ? 408 LYS A CD    1 
ATOM   3135 C  CE    . LYS A 1 408 ? 44.248  67.256 34.508  1.00 23.91 ? 408 LYS A CE    1 
ATOM   3136 N  NZ    . LYS A 1 408 ? 43.579  68.585 34.482  1.00 22.71 ? 408 LYS A NZ    1 
ATOM   3137 N  N     . LEU A 1 409 ? 42.613  65.517 29.593  1.00 21.35 ? 409 LEU A N     1 
ATOM   3138 C  CA    . LEU A 1 409 ? 42.302  66.101 28.300  1.00 21.40 ? 409 LEU A CA    1 
ATOM   3139 C  C     . LEU A 1 409 ? 43.529  66.873 27.791  1.00 21.49 ? 409 LEU A C     1 
ATOM   3140 O  O     . LEU A 1 409 ? 44.034  67.740 28.488  1.00 21.45 ? 409 LEU A O     1 
ATOM   3141 C  CB    . LEU A 1 409 ? 41.111  67.021 28.505  1.00 20.50 ? 409 LEU A CB    1 
ATOM   3142 C  CG    . LEU A 1 409 ? 40.186  67.385 27.363  1.00 20.84 ? 409 LEU A CG    1 
ATOM   3143 C  CD1   . LEU A 1 409 ? 39.617  66.130 26.729  1.00 21.59 ? 409 LEU A CD1   1 
ATOM   3144 C  CD2   . LEU A 1 409 ? 39.073  68.244 27.933  1.00 20.64 ? 409 LEU A CD2   1 
ATOM   3145 N  N     . THR A 1 410 ? 44.019  66.565 26.593  1.00 22.91 ? 410 THR A N     1 
ATOM   3146 C  CA    . THR A 1 410 ? 45.197  67.273 26.074  1.00 23.86 ? 410 THR A CA    1 
ATOM   3147 C  C     . THR A 1 410 ? 44.843  68.706 25.686  1.00 24.32 ? 410 THR A C     1 
ATOM   3148 O  O     . THR A 1 410 ? 43.681  69.021 25.446  1.00 23.42 ? 410 THR A O     1 
ATOM   3149 C  CB    . THR A 1 410 ? 45.789  66.588 24.823  1.00 23.87 ? 410 THR A CB    1 
ATOM   3150 O  OG1   . THR A 1 410 ? 44.961  66.856 23.679  1.00 24.45 ? 410 THR A OG1   1 
ATOM   3151 C  CG2   . THR A 1 410 ? 45.859  65.096 25.036  1.00 24.12 ? 410 THR A CG2   1 
ATOM   3152 N  N     . GLU A 1 411 ? 45.856  69.564 25.609  1.00 25.84 ? 411 GLU A N     1 
ATOM   3153 C  CA    . GLU A 1 411 ? 45.657  70.964 25.245  1.00 26.94 ? 411 GLU A CA    1 
ATOM   3154 C  C     . GLU A 1 411 ? 44.875  71.033 23.929  1.00 26.08 ? 411 GLU A C     1 
ATOM   3155 O  O     . GLU A 1 411 ? 43.858  71.715 23.809  1.00 25.72 ? 411 GLU A O     1 
ATOM   3156 C  CB    . GLU A 1 411 ? 47.018  71.643 25.068  1.00 29.52 ? 411 GLU A CB    1 
ATOM   3157 C  CG    . GLU A 1 411 ? 47.083  73.098 25.540  1.00 33.88 ? 411 GLU A CG    1 
ATOM   3158 C  CD    . GLU A 1 411 ? 46.036  74.006 24.897  1.00 35.88 ? 411 GLU A CD    1 
ATOM   3159 O  OE1   . GLU A 1 411 ? 44.821  73.788 25.127  1.00 34.82 ? 411 GLU A OE1   1 
ATOM   3160 O  OE2   . GLU A 1 411 ? 46.434  74.945 24.165  1.00 37.72 ? 411 GLU A OE2   1 
ATOM   3161 N  N     . LYS A 1 412 ? 45.367  70.297 22.946  1.00 25.43 ? 412 LYS A N     1 
ATOM   3162 C  CA    . LYS A 1 412 ? 44.767  70.246 21.626  1.00 25.54 ? 412 LYS A CA    1 
ATOM   3163 C  C     . LYS A 1 412 ? 43.283  69.851 21.726  1.00 24.90 ? 412 LYS A C     1 
ATOM   3164 O  O     . LYS A 1 412 ? 42.420  70.453 21.071  1.00 24.94 ? 412 LYS A O     1 
ATOM   3165 C  CB    . LYS A 1 412 ? 45.562  69.236 20.788  1.00 26.76 ? 412 LYS A CB    1 
ATOM   3166 C  CG    . LYS A 1 412 ? 45.500  69.398 19.277  1.00 27.44 ? 412 LYS A CG    1 
ATOM   3167 C  CD    . LYS A 1 412 ? 44.135  69.123 18.703  1.00 29.32 ? 412 LYS A CD    1 
ATOM   3168 C  CE    . LYS A 1 412 ? 44.207  69.123 17.177  1.00 30.23 ? 412 LYS A CE    1 
ATOM   3169 N  NZ    . LYS A 1 412 ? 45.155  68.081 16.676  1.00 29.91 ? 412 LYS A NZ    1 
ATOM   3170 N  N     . GLN A 1 413 ? 42.998  68.846 22.555  1.00 23.68 ? 413 GLN A N     1 
ATOM   3171 C  CA    . GLN A 1 413 ? 41.635  68.353 22.760  1.00 22.69 ? 413 GLN A CA    1 
ATOM   3172 C  C     . GLN A 1 413 ? 40.748  69.316 23.521  1.00 21.52 ? 413 GLN A C     1 
ATOM   3173 O  O     . GLN A 1 413 ? 39.616  69.566 23.122  1.00 21.15 ? 413 GLN A O     1 
ATOM   3174 C  CB    . GLN A 1 413 ? 41.661  67.029 23.506  1.00 23.07 ? 413 GLN A CB    1 
ATOM   3175 C  CG    . GLN A 1 413 ? 41.984  65.824 22.655  1.00 22.66 ? 413 GLN A CG    1 
ATOM   3176 C  CD    . GLN A 1 413 ? 42.289  64.606 23.502  1.00 23.22 ? 413 GLN A CD    1 
ATOM   3177 O  OE1   . GLN A 1 413 ? 42.201  63.473 23.029  1.00 23.69 ? 413 GLN A OE1   1 
ATOM   3178 N  NE2   . GLN A 1 413 ? 42.679  64.835 24.761  1.00 21.89 ? 413 GLN A NE2   1 
ATOM   3179 N  N     . ALA A 1 414 ? 41.261  69.842 24.627  1.00 21.45 ? 414 ALA A N     1 
ATOM   3180 C  CA    . ALA A 1 414 ? 40.515  70.793 25.448  1.00 21.81 ? 414 ALA A CA    1 
ATOM   3181 C  C     . ALA A 1 414 ? 39.978  71.942 24.604  1.00 22.21 ? 414 ALA A C     1 
ATOM   3182 O  O     . ALA A 1 414 ? 38.884  72.449 24.849  1.00 21.73 ? 414 ALA A O     1 
ATOM   3183 C  CB    . ALA A 1 414 ? 41.401  71.338 26.557  1.00 20.24 ? 414 ALA A CB    1 
ATOM   3184 N  N     . GLN A 1 415 ? 40.747  72.360 23.609  1.00 23.26 ? 415 GLN A N     1 
ATOM   3185 C  CA    . GLN A 1 415 ? 40.294  73.445 22.756  1.00 24.33 ? 415 GLN A CA    1 
ATOM   3186 C  C     . GLN A 1 415 ? 39.190  72.980 21.819  1.00 23.45 ? 415 GLN A C     1 
ATOM   3187 O  O     . GLN A 1 415 ? 38.161  73.645 21.681  1.00 23.21 ? 415 GLN A O     1 
ATOM   3188 C  CB    . GLN A 1 415 ? 41.463  74.018 21.956  1.00 26.57 ? 415 GLN A CB    1 
ATOM   3189 C  CG    . GLN A 1 415 ? 42.570  74.540 22.853  1.00 29.80 ? 415 GLN A CG    1 
ATOM   3190 C  CD    . GLN A 1 415 ? 43.264  75.735 22.251  1.00 31.99 ? 415 GLN A CD    1 
ATOM   3191 O  OE1   . GLN A 1 415 ? 42.620  76.756 21.963  1.00 32.45 ? 415 GLN A OE1   1 
ATOM   3192 N  NE2   . GLN A 1 415 ? 44.580  75.628 22.053  1.00 32.78 ? 415 GLN A NE2   1 
ATOM   3193 N  N     . TYR A 1 416 ? 39.405  71.838 21.175  1.00 22.27 ? 416 TYR A N     1 
ATOM   3194 C  CA    . TYR A 1 416 ? 38.407  71.293 20.271  1.00 21.88 ? 416 TYR A CA    1 
ATOM   3195 C  C     . TYR A 1 416 ? 37.072  71.253 21.020  1.00 23.07 ? 416 TYR A C     1 
ATOM   3196 O  O     . TYR A 1 416 ? 36.034  71.700 20.521  1.00 23.84 ? 416 TYR A O     1 
ATOM   3197 C  CB    . TYR A 1 416 ? 38.798  69.880 19.880  1.00 21.43 ? 416 TYR A CB    1 
ATOM   3198 C  CG    . TYR A 1 416 ? 37.873  69.236 18.887  1.00 21.60 ? 416 TYR A CG    1 
ATOM   3199 C  CD1   . TYR A 1 416 ? 37.948  69.547 17.535  1.00 21.24 ? 416 TYR A CD1   1 
ATOM   3200 C  CD2   . TYR A 1 416 ? 36.947  68.277 19.293  1.00 21.77 ? 416 TYR A CD2   1 
ATOM   3201 C  CE1   . TYR A 1 416 ? 37.131  68.910 16.603  1.00 21.87 ? 416 TYR A CE1   1 
ATOM   3202 C  CE2   . TYR A 1 416 ? 36.124  67.637 18.375  1.00 23.16 ? 416 TYR A CE2   1 
ATOM   3203 C  CZ    . TYR A 1 416 ? 36.224  67.955 17.030  1.00 23.20 ? 416 TYR A CZ    1 
ATOM   3204 O  OH    . TYR A 1 416 ? 35.430  67.304 16.114  1.00 23.94 ? 416 TYR A OH    1 
ATOM   3205 N  N     . LEU A 1 417 ? 37.112  70.715 22.232  1.00 23.33 ? 417 LEU A N     1 
ATOM   3206 C  CA    . LEU A 1 417 ? 35.920  70.594 23.052  1.00 24.28 ? 417 LEU A CA    1 
ATOM   3207 C  C     . LEU A 1 417 ? 35.487  71.922 23.635  1.00 25.23 ? 417 LEU A C     1 
ATOM   3208 O  O     . LEU A 1 417 ? 34.358  72.067 24.113  1.00 26.24 ? 417 LEU A O     1 
ATOM   3209 C  CB    . LEU A 1 417 ? 36.163  69.575 24.165  1.00 24.29 ? 417 LEU A CB    1 
ATOM   3210 C  CG    . LEU A 1 417 ? 36.351  68.170 23.589  1.00 25.01 ? 417 LEU A CG    1 
ATOM   3211 C  CD1   . LEU A 1 417 ? 36.838  67.219 24.656  1.00 24.96 ? 417 LEU A CD1   1 
ATOM   3212 C  CD2   . LEU A 1 417 ? 35.037  67.695 22.977  1.00 23.68 ? 417 LEU A CD2   1 
ATOM   3213 N  N     . GLY A 1 418 ? 36.381  72.900 23.583  1.00 25.64 ? 418 GLY A N     1 
ATOM   3214 C  CA    . GLY A 1 418 ? 36.055  74.213 24.111  1.00 26.22 ? 418 GLY A CA    1 
ATOM   3215 C  C     . GLY A 1 418 ? 35.808  74.214 25.610  1.00 26.14 ? 418 GLY A C     1 
ATOM   3216 O  O     . GLY A 1 418 ? 34.796  74.749 26.079  1.00 27.46 ? 418 GLY A O     1 
HETATM 3217 N  N     . MSE A 1 419 ? 36.737  73.624 26.362  1.00 25.01 ? 419 MSE A N     1 
HETATM 3218 C  CA    . MSE A 1 419 ? 36.635  73.549 27.816  1.00 23.43 ? 419 MSE A CA    1 
HETATM 3219 C  C     . MSE A 1 419 ? 38.010  73.433 28.454  1.00 23.12 ? 419 MSE A C     1 
HETATM 3220 O  O     . MSE A 1 419 ? 38.970  72.974 27.827  1.00 22.86 ? 419 MSE A O     1 
HETATM 3221 C  CB    . MSE A 1 419 ? 35.783  72.344 28.238  1.00 22.14 ? 419 MSE A CB    1 
HETATM 3222 C  CG    . MSE A 1 419 ? 36.272  71.010 27.695  1.00 21.44 ? 419 MSE A CG    1 
HETATM 3223 SE SE    . MSE A 1 419 ? 35.225  69.615 28.340  1.00 21.07 ? 419 MSE A SE    1 
HETATM 3224 C  CE    . MSE A 1 419 ? 36.077  68.244 27.477  1.00 20.98 ? 419 MSE A CE    1 
ATOM   3225 N  N     . SER A 1 420 ? 38.100  73.856 29.709  1.00 23.28 ? 420 SER A N     1 
ATOM   3226 C  CA    . SER A 1 420 ? 39.356  73.781 30.440  1.00 22.97 ? 420 SER A CA    1 
ATOM   3227 C  C     . SER A 1 420 ? 39.706  72.344 30.733  1.00 23.80 ? 420 SER A C     1 
ATOM   3228 O  O     . SER A 1 420 ? 38.860  71.576 31.185  1.00 23.38 ? 420 SER A O     1 
ATOM   3229 C  CB    . SER A 1 420 ? 39.254  74.514 31.768  1.00 21.73 ? 420 SER A CB    1 
ATOM   3230 O  OG    . SER A 1 420 ? 40.337  74.133 32.593  1.00 19.16 ? 420 SER A OG    1 
ATOM   3231 N  N     . CYS A 1 421 ? 40.958  71.979 30.504  1.00 25.26 ? 421 CYS A N     1 
ATOM   3232 C  CA    . CYS A 1 421 ? 41.369  70.611 30.772  1.00 27.95 ? 421 CYS A CA    1 
ATOM   3233 C  C     . CYS A 1 421 ? 41.244  70.369 32.277  1.00 28.32 ? 421 CYS A C     1 
ATOM   3234 O  O     . CYS A 1 421 ? 41.508  69.268 32.768  1.00 29.46 ? 421 CYS A O     1 
ATOM   3235 C  CB    . CYS A 1 421 ? 42.811  70.388 30.314  1.00 28.77 ? 421 CYS A CB    1 
ATOM   3236 S  SG    . CYS A 1 421 ? 44.010  71.374 31.226  1.00 32.31 ? 421 CYS A SG    1 
ATOM   3237 N  N     . ASP A 1 422 ? 40.832  71.412 32.996  1.00 28.02 ? 422 ASP A N     1 
ATOM   3238 C  CA    . ASP A 1 422 ? 40.653  71.359 34.446  1.00 28.53 ? 422 ASP A CA    1 
ATOM   3239 C  C     . ASP A 1 422 ? 39.227  71.728 34.842  1.00 28.38 ? 422 ASP A C     1 
ATOM   3240 O  O     . ASP A 1 422 ? 38.537  70.972 35.533  1.00 28.07 ? 422 ASP A O     1 
ATOM   3241 C  CB    . ASP A 1 422 ? 41.597  72.349 35.132  1.00 29.71 ? 422 ASP A CB    1 
ATOM   3242 C  CG    . ASP A 1 422 ? 43.018  71.850 35.223  1.00 31.55 ? 422 ASP A CG    1 
ATOM   3243 O  OD1   . ASP A 1 422 ? 43.570  71.369 34.208  1.00 34.11 ? 422 ASP A OD1   1 
ATOM   3244 O  OD2   . ASP A 1 422 ? 43.596  71.965 36.322  1.00 32.08 ? 422 ASP A OD2   1 
ATOM   3245 N  N     . GLY A 1 423 ? 38.821  72.924 34.410  1.00 28.40 ? 423 GLY A N     1 
ATOM   3246 C  CA    . GLY A 1 423 ? 37.508  73.466 34.712  1.00 26.61 ? 423 GLY A CA    1 
ATOM   3247 C  C     . GLY A 1 423 ? 36.386  72.525 34.372  1.00 25.94 ? 423 GLY A C     1 
ATOM   3248 O  O     . GLY A 1 423 ? 36.631  71.422 33.877  1.00 27.07 ? 423 GLY A O     1 
ATOM   3249 N  N     . PRO A 1 424 ? 35.135  72.950 34.593  1.00 24.61 ? 424 PRO A N     1 
ATOM   3250 C  CA    . PRO A 1 424 ? 33.898  72.198 34.342  1.00 23.40 ? 424 PRO A CA    1 
ATOM   3251 C  C     . PRO A 1 424 ? 33.946  71.406 33.046  1.00 21.62 ? 424 PRO A C     1 
ATOM   3252 O  O     . PRO A 1 424 ? 34.349  71.926 32.008  1.00 23.07 ? 424 PRO A O     1 
ATOM   3253 C  CB    . PRO A 1 424 ? 32.844  73.298 34.321  1.00 24.24 ? 424 PRO A CB    1 
ATOM   3254 C  CG    . PRO A 1 424 ? 33.340  74.174 35.429  1.00 25.47 ? 424 PRO A CG    1 
ATOM   3255 C  CD    . PRO A 1 424 ? 34.813  74.316 35.035  1.00 24.63 ? 424 PRO A CD    1 
ATOM   3256 N  N     . PHE A 1 425 ? 33.533  70.148 33.106  1.00 19.78 ? 425 PHE A N     1 
ATOM   3257 C  CA    . PHE A 1 425 ? 33.560  69.302 31.928  1.00 17.44 ? 425 PHE A CA    1 
ATOM   3258 C  C     . PHE A 1 425 ? 32.216  69.150 31.261  1.00 16.94 ? 425 PHE A C     1 
ATOM   3259 O  O     . PHE A 1 425 ? 32.122  68.502 30.220  1.00 17.49 ? 425 PHE A O     1 
ATOM   3260 C  CB    . PHE A 1 425 ? 34.095  67.919 32.277  1.00 17.08 ? 425 PHE A CB    1 
ATOM   3261 C  CG    . PHE A 1 425 ? 35.503  67.929 32.781  1.00 16.13 ? 425 PHE A CG    1 
ATOM   3262 C  CD1   . PHE A 1 425 ? 36.548  68.260 31.927  1.00 17.24 ? 425 PHE A CD1   1 
ATOM   3263 C  CD2   . PHE A 1 425 ? 35.785  67.632 34.104  1.00 14.10 ? 425 PHE A CD2   1 
ATOM   3264 C  CE1   . PHE A 1 425 ? 37.864  68.296 32.387  1.00 16.57 ? 425 PHE A CE1   1 
ATOM   3265 C  CE2   . PHE A 1 425 ? 37.085  67.664 34.571  1.00 15.67 ? 425 PHE A CE2   1 
ATOM   3266 C  CZ    . PHE A 1 425 ? 38.133  67.999 33.707  1.00 15.88 ? 425 PHE A CZ    1 
ATOM   3267 N  N     . LYS A 1 426 ? 31.176  69.738 31.843  1.00 15.88 ? 426 LYS A N     1 
ATOM   3268 C  CA    . LYS A 1 426 ? 29.848  69.621 31.259  1.00 15.10 ? 426 LYS A CA    1 
ATOM   3269 C  C     . LYS A 1 426 ? 28.893  70.754 31.572  1.00 15.94 ? 426 LYS A C     1 
ATOM   3270 O  O     . LYS A 1 426 ? 29.049  71.459 32.562  1.00 15.90 ? 426 LYS A O     1 
ATOM   3271 C  CB    . LYS A 1 426 ? 29.230  68.281 31.658  1.00 15.25 ? 426 LYS A CB    1 
ATOM   3272 C  CG    . LYS A 1 426 ? 29.932  67.111 30.979  1.00 16.17 ? 426 LYS A CG    1 
ATOM   3273 C  CD    . LYS A 1 426 ? 29.317  65.784 31.285  1.00 14.37 ? 426 LYS A CD    1 
ATOM   3274 C  CE    . LYS A 1 426 ? 30.046  64.701 30.540  1.00 14.22 ? 426 LYS A CE    1 
ATOM   3275 N  NZ    . LYS A 1 426 ? 31.503  64.728 30.884  1.00 13.18 ? 426 LYS A NZ    1 
ATOM   3276 N  N     . PRO A 1 427 ? 27.876  70.942 30.717  1.00 16.72 ? 427 PRO A N     1 
ATOM   3277 C  CA    . PRO A 1 427 ? 26.848  71.981 30.839  1.00 17.50 ? 427 PRO A CA    1 
ATOM   3278 C  C     . PRO A 1 427 ? 26.032  71.830 32.121  1.00 17.90 ? 427 PRO A C     1 
ATOM   3279 O  O     . PRO A 1 427 ? 25.862  70.722 32.614  1.00 18.08 ? 427 PRO A O     1 
ATOM   3280 C  CB    . PRO A 1 427 ? 25.992  71.752 29.589  1.00 16.63 ? 427 PRO A CB    1 
ATOM   3281 C  CG    . PRO A 1 427 ? 26.966  71.160 28.622  1.00 16.36 ? 427 PRO A CG    1 
ATOM   3282 C  CD    . PRO A 1 427 ? 27.601  70.128 29.523  1.00 16.25 ? 427 PRO A CD    1 
ATOM   3283 N  N     . ASP A 1 428 ? 25.516  72.934 32.650  1.00 18.90 ? 428 ASP A N     1 
ATOM   3284 C  CA    . ASP A 1 428 ? 24.733  72.857 33.871  1.00 20.86 ? 428 ASP A CA    1 
ATOM   3285 C  C     . ASP A 1 428 ? 23.576  71.886 33.745  1.00 21.17 ? 428 ASP A C     1 
ATOM   3286 O  O     . ASP A 1 428 ? 23.166  71.287 34.736  1.00 22.04 ? 428 ASP A O     1 
ATOM   3287 C  CB    . ASP A 1 428 ? 24.169  74.218 34.262  1.00 24.11 ? 428 ASP A CB    1 
ATOM   3288 C  CG    . ASP A 1 428 ? 25.246  75.245 34.512  1.00 27.85 ? 428 ASP A CG    1 
ATOM   3289 O  OD1   . ASP A 1 428 ? 26.252  74.901 35.186  1.00 29.58 ? 428 ASP A OD1   1 
ATOM   3290 O  OD2   . ASP A 1 428 ? 25.070  76.401 34.054  1.00 29.11 ? 428 ASP A OD2   1 
ATOM   3291 N  N     . HIS A 1 429 ? 23.044  71.725 32.535  1.00 19.98 ? 429 HIS A N     1 
ATOM   3292 C  CA    . HIS A 1 429 ? 21.918  70.822 32.340  1.00 17.68 ? 429 HIS A CA    1 
ATOM   3293 C  C     . HIS A 1 429 ? 22.297  69.368 32.149  1.00 16.13 ? 429 HIS A C     1 
ATOM   3294 O  O     . HIS A 1 429 ? 21.414  68.521 32.046  1.00 16.00 ? 429 HIS A O     1 
ATOM   3295 C  CB    . HIS A 1 429 ? 21.077  71.247 31.141  1.00 19.67 ? 429 HIS A CB    1 
ATOM   3296 C  CG    . HIS A 1 429 ? 21.833  71.274 29.849  1.00 21.91 ? 429 HIS A CG    1 
ATOM   3297 N  ND1   . HIS A 1 429 ? 22.635  72.331 29.479  1.00 23.85 ? 429 HIS A ND1   1 
ATOM   3298 C  CD2   . HIS A 1 429 ? 21.924  70.362 28.850  1.00 22.22 ? 429 HIS A CD2   1 
ATOM   3299 C  CE1   . HIS A 1 429 ? 23.185  72.071 28.304  1.00 24.11 ? 429 HIS A CE1   1 
ATOM   3300 N  NE2   . HIS A 1 429 ? 22.771  70.882 27.901  1.00 22.15 ? 429 HIS A NE2   1 
ATOM   3301 N  N     . TYR A 1 430 ? 23.589  69.065 32.094  1.00 13.82 ? 430 TYR A N     1 
ATOM   3302 C  CA    . TYR A 1 430 ? 23.988  67.680 31.897  1.00 12.64 ? 430 TYR A CA    1 
ATOM   3303 C  C     . TYR A 1 430 ? 23.363  66.827 32.982  1.00 12.33 ? 430 TYR A C     1 
ATOM   3304 O  O     . TYR A 1 430 ? 23.405  67.192 34.154  1.00 11.51 ? 430 TYR A O     1 
ATOM   3305 C  CB    . TYR A 1 430 ? 25.503  67.504 31.951  1.00 11.31 ? 430 TYR A CB    1 
ATOM   3306 C  CG    . TYR A 1 430 ? 25.915  66.154 31.421  1.00 10.08 ? 430 TYR A CG    1 
ATOM   3307 C  CD1   . TYR A 1 430 ? 25.727  65.837 30.074  1.00 9.76  ? 430 TYR A CD1   1 
ATOM   3308 C  CD2   . TYR A 1 430 ? 26.483  65.192 32.252  1.00 9.96  ? 430 TYR A CD2   1 
ATOM   3309 C  CE1   . TYR A 1 430 ? 26.100  64.607 29.564  1.00 9.56  ? 430 TYR A CE1   1 
ATOM   3310 C  CE2   . TYR A 1 430 ? 26.864  63.945 31.742  1.00 9.94  ? 430 TYR A CE2   1 
ATOM   3311 C  CZ    . TYR A 1 430 ? 26.668  63.672 30.397  1.00 9.32  ? 430 TYR A CZ    1 
ATOM   3312 O  OH    . TYR A 1 430 ? 27.070  62.476 29.860  1.00 12.90 ? 430 TYR A OH    1 
ATOM   3313 N  N     . ARG A 1 431 ? 22.809  65.680 32.598  1.00 12.72 ? 431 ARG A N     1 
ATOM   3314 C  CA    . ARG A 1 431 ? 22.145  64.816 33.564  1.00 12.49 ? 431 ARG A CA    1 
ATOM   3315 C  C     . ARG A 1 431 ? 22.903  63.563 33.984  1.00 12.73 ? 431 ARG A C     1 
ATOM   3316 O  O     . ARG A 1 431 ? 22.346  62.726 34.697  1.00 13.84 ? 431 ARG A O     1 
ATOM   3317 C  CB    . ARG A 1 431 ? 20.777  64.391 33.029  1.00 13.11 ? 431 ARG A CB    1 
ATOM   3318 C  CG    . ARG A 1 431 ? 19.811  65.526 32.738  1.00 12.65 ? 431 ARG A CG    1 
ATOM   3319 C  CD    . ARG A 1 431 ? 18.410  64.965 32.530  1.00 12.93 ? 431 ARG A CD    1 
ATOM   3320 N  NE    . ARG A 1 431 ? 17.404  66.020 32.400  1.00 14.16 ? 431 ARG A NE    1 
ATOM   3321 C  CZ    . ARG A 1 431 ? 17.274  66.806 31.341  1.00 13.69 ? 431 ARG A CZ    1 
ATOM   3322 N  NH1   . ARG A 1 431 ? 18.091  66.653 30.306  1.00 14.39 ? 431 ARG A NH1   1 
ATOM   3323 N  NH2   . ARG A 1 431 ? 16.337  67.746 31.327  1.00 12.37 ? 431 ARG A NH2   1 
ATOM   3324 N  N     . TYR A 1 432 ? 24.156  63.424 33.552  1.00 12.39 ? 432 TYR A N     1 
ATOM   3325 C  CA    . TYR A 1 432 ? 24.968  62.251 33.893  1.00 11.55 ? 432 TYR A CA    1 
ATOM   3326 C  C     . TYR A 1 432 ? 24.190  60.935 33.836  1.00 12.65 ? 432 TYR A C     1 
ATOM   3327 O  O     . TYR A 1 432 ? 23.093  60.908 33.225  1.00 12.31 ? 432 TYR A O     1 
ATOM   3328 C  CB    . TYR A 1 432 ? 25.585  62.404 35.282  1.00 10.61 ? 432 TYR A CB    1 
ATOM   3329 C  CG    . TYR A 1 432 ? 26.410  63.659 35.440  1.00 11.59 ? 432 TYR A CG    1 
ATOM   3330 C  CD1   . TYR A 1 432 ? 25.808  64.887 35.736  1.00 12.12 ? 432 TYR A CD1   1 
ATOM   3331 C  CD2   . TYR A 1 432 ? 27.793  63.633 35.253  1.00 10.92 ? 432 TYR A CD2   1 
ATOM   3332 C  CE1   . TYR A 1 432 ? 26.568  66.056 35.841  1.00 11.69 ? 432 TYR A CE1   1 
ATOM   3333 C  CE2   . TYR A 1 432 ? 28.558  64.789 35.354  1.00 10.48 ? 432 TYR A CE2   1 
ATOM   3334 C  CZ    . TYR A 1 432 ? 27.946  65.996 35.648  1.00 11.82 ? 432 TYR A CZ    1 
ATOM   3335 O  OH    . TYR A 1 432 ? 28.713  67.144 35.752  1.00 11.82 ? 432 TYR A OH    1 
ATOM   3336 O  OXT   . TYR A 1 432 ? 24.711  59.935 34.392  1.00 13.26 ? 432 TYR A OXT   1 
ATOM   3337 N  N     . ASP B 1 3   ? 19.806  72.687 -14.507 1.00 46.92 ? 3   ASP B N     1 
ATOM   3338 C  CA    . ASP B 1 3   ? 18.488  72.241 -13.953 1.00 47.03 ? 3   ASP B CA    1 
ATOM   3339 C  C     . ASP B 1 3   ? 18.623  71.940 -12.458 1.00 47.00 ? 3   ASP B C     1 
ATOM   3340 O  O     . ASP B 1 3   ? 19.187  72.738 -11.696 1.00 47.63 ? 3   ASP B O     1 
ATOM   3341 C  CB    . ASP B 1 3   ? 18.004  70.969 -14.669 1.00 47.12 ? 3   ASP B CB    1 
ATOM   3342 C  CG    . ASP B 1 3   ? 18.063  71.085 -16.182 1.00 47.07 ? 3   ASP B CG    1 
ATOM   3343 O  OD1   . ASP B 1 3   ? 19.187  71.209 -16.720 1.00 47.19 ? 3   ASP B OD1   1 
ATOM   3344 O  OD2   . ASP B 1 3   ? 16.990  71.051 -16.829 1.00 47.52 ? 3   ASP B OD2   1 
ATOM   3345 N  N     . LYS B 1 4   ? 18.098  70.778 -12.063 1.00 45.78 ? 4   LYS B N     1 
ATOM   3346 C  CA    . LYS B 1 4   ? 18.119  70.278 -10.688 1.00 44.35 ? 4   LYS B CA    1 
ATOM   3347 C  C     . LYS B 1 4   ? 17.350  68.963 -10.636 1.00 43.55 ? 4   LYS B C     1 
ATOM   3348 O  O     . LYS B 1 4   ? 16.144  68.922 -10.907 1.00 43.55 ? 4   LYS B O     1 
ATOM   3349 C  CB    . LYS B 1 4   ? 17.478  71.277 -9.717  1.00 44.50 ? 4   LYS B CB    1 
ATOM   3350 C  CG    . LYS B 1 4   ? 17.584  70.871 -8.244  1.00 44.95 ? 4   LYS B CG    1 
ATOM   3351 C  CD    . LYS B 1 4   ? 17.091  71.974 -7.321  1.00 45.32 ? 4   LYS B CD    1 
ATOM   3352 C  CE    . LYS B 1 4   ? 17.309  71.622 -5.859  1.00 45.27 ? 4   LYS B CE    1 
ATOM   3353 N  NZ    . LYS B 1 4   ? 16.888  72.739 -4.960  1.00 45.78 ? 4   LYS B NZ    1 
ATOM   3354 N  N     . LEU B 1 5   ? 18.059  67.890 -10.296 1.00 41.93 ? 5   LEU B N     1 
ATOM   3355 C  CA    . LEU B 1 5   ? 17.458  66.562 -10.197 1.00 40.49 ? 5   LEU B CA    1 
ATOM   3356 C  C     . LEU B 1 5   ? 16.374  66.595 -9.119  1.00 39.70 ? 5   LEU B C     1 
ATOM   3357 O  O     . LEU B 1 5   ? 16.552  67.218 -8.075  1.00 40.35 ? 5   LEU B O     1 
ATOM   3358 C  CB    . LEU B 1 5   ? 18.525  65.544 -9.809  1.00 40.36 ? 5   LEU B CB    1 
ATOM   3359 C  CG    . LEU B 1 5   ? 19.835  65.625 -10.596 1.00 40.72 ? 5   LEU B CG    1 
ATOM   3360 C  CD1   . LEU B 1 5   ? 20.799  64.585 -10.064 1.00 41.26 ? 5   LEU B CD1   1 
ATOM   3361 C  CD2   . LEU B 1 5   ? 19.581  65.397 -12.073 1.00 41.46 ? 5   LEU B CD2   1 
ATOM   3362 N  N     . PRO B 1 6   ? 15.235  65.930 -9.357  1.00 38.56 ? 6   PRO B N     1 
ATOM   3363 C  CA    . PRO B 1 6   ? 14.136  65.898 -8.388  1.00 37.96 ? 6   PRO B CA    1 
ATOM   3364 C  C     . PRO B 1 6   ? 14.527  65.123 -7.133  1.00 38.20 ? 6   PRO B C     1 
ATOM   3365 O  O     . PRO B 1 6   ? 13.752  65.045 -6.176  1.00 37.08 ? 6   PRO B O     1 
ATOM   3366 C  CB    . PRO B 1 6   ? 13.030  65.194 -9.169  1.00 37.78 ? 6   PRO B CB    1 
ATOM   3367 C  CG    . PRO B 1 6   ? 13.826  64.205 -9.990  1.00 36.97 ? 6   PRO B CG    1 
ATOM   3368 C  CD    . PRO B 1 6   ? 14.867  65.158 -10.554 1.00 38.21 ? 6   PRO B CD    1 
ATOM   3369 N  N     . TYR B 1 7   ? 15.736  64.556 -7.163  1.00 38.98 ? 7   TYR B N     1 
ATOM   3370 C  CA    . TYR B 1 7   ? 16.288  63.758 -6.067  1.00 39.78 ? 7   TYR B CA    1 
ATOM   3371 C  C     . TYR B 1 7   ? 17.432  62.931 -6.630  1.00 40.55 ? 7   TYR B C     1 
ATOM   3372 O  O     . TYR B 1 7   ? 17.712  62.997 -7.824  1.00 41.67 ? 7   TYR B O     1 
ATOM   3373 C  CB    . TYR B 1 7   ? 15.232  62.805 -5.523  1.00 39.75 ? 7   TYR B CB    1 
ATOM   3374 C  CG    . TYR B 1 7   ? 14.792  61.768 -6.530  1.00 39.55 ? 7   TYR B CG    1 
ATOM   3375 C  CD1   . TYR B 1 7   ? 15.624  60.699 -6.876  1.00 38.60 ? 7   TYR B CD1   1 
ATOM   3376 C  CD2   . TYR B 1 7   ? 13.552  61.868 -7.160  1.00 39.56 ? 7   TYR B CD2   1 
ATOM   3377 C  CE1   . TYR B 1 7   ? 15.231  59.754 -7.824  1.00 38.37 ? 7   TYR B CE1   1 
ATOM   3378 C  CE2   . TYR B 1 7   ? 13.146  60.929 -8.111  1.00 39.14 ? 7   TYR B CE2   1 
ATOM   3379 C  CZ    . TYR B 1 7   ? 13.987  59.874 -8.440  1.00 38.79 ? 7   TYR B CZ    1 
ATOM   3380 O  OH    . TYR B 1 7   ? 13.568  58.943 -9.371  1.00 37.66 ? 7   TYR B OH    1 
ATOM   3381 N  N     . LYS B 1 8   ? 18.074  62.138 -5.775  1.00 41.14 ? 8   LYS B N     1 
ATOM   3382 C  CA    . LYS B 1 8   ? 19.177  61.274 -6.195  1.00 41.48 ? 8   LYS B CA    1 
ATOM   3383 C  C     . LYS B 1 8   ? 19.424  60.173 -5.168  1.00 42.30 ? 8   LYS B C     1 
ATOM   3384 O  O     . LYS B 1 8   ? 19.897  60.437 -4.061  1.00 44.00 ? 8   LYS B O     1 
ATOM   3385 C  CB    . LYS B 1 8   ? 20.460  62.085 -6.388  1.00 40.87 ? 8   LYS B CB    1 
ATOM   3386 C  CG    . LYS B 1 8   ? 21.626  61.267 -6.925  1.00 40.38 ? 8   LYS B CG    1 
ATOM   3387 C  CD    . LYS B 1 8   ? 22.824  62.154 -7.212  1.00 40.29 ? 8   LYS B CD    1 
ATOM   3388 C  CE    . LYS B 1 8   ? 23.982  61.366 -7.805  1.00 40.70 ? 8   LYS B CE    1 
ATOM   3389 N  NZ    . LYS B 1 8   ? 25.182  62.233 -8.040  1.00 40.54 ? 8   LYS B NZ    1 
ATOM   3390 N  N     . VAL B 1 9   ? 19.103  58.938 -5.536  1.00 41.87 ? 9   VAL B N     1 
ATOM   3391 C  CA    . VAL B 1 9   ? 19.296  57.815 -4.631  1.00 41.07 ? 9   VAL B CA    1 
ATOM   3392 C  C     . VAL B 1 9   ? 20.031  56.678 -5.341  1.00 40.73 ? 9   VAL B C     1 
ATOM   3393 O  O     . VAL B 1 9   ? 20.192  56.701 -6.558  1.00 41.28 ? 9   VAL B O     1 
ATOM   3394 C  CB    . VAL B 1 9   ? 17.942  57.305 -4.103  1.00 40.96 ? 9   VAL B CB    1 
ATOM   3395 C  CG1   . VAL B 1 9   ? 17.145  58.468 -3.534  1.00 40.15 ? 9   VAL B CG1   1 
ATOM   3396 C  CG2   . VAL B 1 9   ? 17.171  56.625 -5.206  1.00 40.60 ? 9   VAL B CG2   1 
ATOM   3397 N  N     . ALA B 1 10  ? 20.480  55.686 -4.579  1.00 40.08 ? 10  ALA B N     1 
ATOM   3398 C  CA    . ALA B 1 10  ? 21.206  54.559 -5.158  1.00 38.61 ? 10  ALA B CA    1 
ATOM   3399 C  C     . ALA B 1 10  ? 20.367  53.794 -6.191  1.00 37.31 ? 10  ALA B C     1 
ATOM   3400 O  O     . ALA B 1 10  ? 20.841  53.526 -7.299  1.00 37.29 ? 10  ALA B O     1 
ATOM   3401 C  CB    . ALA B 1 10  ? 21.679  53.616 -4.048  1.00 38.12 ? 10  ALA B CB    1 
ATOM   3402 N  N     . ASP B 1 11  ? 19.127  53.452 -5.835  1.00 35.21 ? 11  ASP B N     1 
ATOM   3403 C  CA    . ASP B 1 11  ? 18.248  52.716 -6.742  1.00 34.31 ? 11  ASP B CA    1 
ATOM   3404 C  C     . ASP B 1 11  ? 16.768  52.872 -6.388  1.00 33.79 ? 11  ASP B C     1 
ATOM   3405 O  O     . ASP B 1 11  ? 16.271  52.243 -5.455  1.00 34.17 ? 11  ASP B O     1 
ATOM   3406 C  CB    . ASP B 1 11  ? 18.608  51.225 -6.737  1.00 35.21 ? 11  ASP B CB    1 
ATOM   3407 C  CG    . ASP B 1 11  ? 17.724  50.401 -7.676  1.00 36.63 ? 11  ASP B CG    1 
ATOM   3408 O  OD1   . ASP B 1 11  ? 17.758  50.645 -8.903  1.00 38.46 ? 11  ASP B OD1   1 
ATOM   3409 O  OD2   . ASP B 1 11  ? 16.991  49.510 -7.194  1.00 36.07 ? 11  ASP B OD2   1 
ATOM   3410 N  N     . ILE B 1 12  ? 16.062  53.695 -7.155  1.00 32.55 ? 12  ILE B N     1 
ATOM   3411 C  CA    . ILE B 1 12  ? 14.644  53.935 -6.921  1.00 32.08 ? 12  ILE B CA    1 
ATOM   3412 C  C     . ILE B 1 12  ? 13.860  52.621 -6.879  1.00 31.24 ? 12  ILE B C     1 
ATOM   3413 O  O     . ILE B 1 12  ? 12.761  52.563 -6.323  1.00 30.31 ? 12  ILE B O     1 
ATOM   3414 C  CB    . ILE B 1 12  ? 14.053  54.829 -8.035  1.00 32.37 ? 12  ILE B CB    1 
ATOM   3415 C  CG1   . ILE B 1 12  ? 12.648  55.316 -7.662  1.00 32.62 ? 12  ILE B CG1   1 
ATOM   3416 C  CG2   . ILE B 1 12  ? 13.968  54.039 -9.326  1.00 32.52 ? 12  ILE B CG2   1 
ATOM   3417 C  CD1   . ILE B 1 12  ? 12.616  56.299 -6.514  1.00 32.35 ? 12  ILE B CD1   1 
ATOM   3418 N  N     . GLY B 1 13  ? 14.432  51.572 -7.466  1.00 31.26 ? 13  GLY B N     1 
ATOM   3419 C  CA    . GLY B 1 13  ? 13.769  50.275 -7.496  1.00 31.90 ? 13  GLY B CA    1 
ATOM   3420 C  C     . GLY B 1 13  ? 13.427  49.703 -6.127  1.00 32.50 ? 13  GLY B C     1 
ATOM   3421 O  O     . GLY B 1 13  ? 12.450  48.963 -5.970  1.00 32.43 ? 13  GLY B O     1 
ATOM   3422 N  N     . LEU B 1 14  ? 14.238  50.049 -5.131  1.00 32.59 ? 14  LEU B N     1 
ATOM   3423 C  CA    . LEU B 1 14  ? 14.043  49.579 -3.763  1.00 31.18 ? 14  LEU B CA    1 
ATOM   3424 C  C     . LEU B 1 14  ? 12.802  50.180 -3.109  1.00 31.72 ? 14  LEU B C     1 
ATOM   3425 O  O     . LEU B 1 14  ? 12.446  49.813 -1.993  1.00 31.79 ? 14  LEU B O     1 
ATOM   3426 C  CB    . LEU B 1 14  ? 15.293  49.898 -2.936  1.00 29.37 ? 14  LEU B CB    1 
ATOM   3427 C  CG    . LEU B 1 14  ? 16.522  49.004 -3.145  1.00 27.94 ? 14  LEU B CG    1 
ATOM   3428 C  CD1   . LEU B 1 14  ? 16.667  48.608 -4.588  1.00 28.13 ? 14  LEU B CD1   1 
ATOM   3429 C  CD2   . LEU B 1 14  ? 17.760  49.728 -2.659  1.00 28.10 ? 14  LEU B CD2   1 
ATOM   3430 N  N     . ALA B 1 15  ? 12.142  51.096 -3.812  1.00 32.81 ? 15  ALA B N     1 
ATOM   3431 C  CA    . ALA B 1 15  ? 10.935  51.747 -3.303  1.00 33.66 ? 15  ALA B CA    1 
ATOM   3432 C  C     . ALA B 1 15  ? 9.964   50.763 -2.671  1.00 33.19 ? 15  ALA B C     1 
ATOM   3433 O  O     . ALA B 1 15  ? 9.471   50.993 -1.571  1.00 33.09 ? 15  ALA B O     1 
ATOM   3434 C  CB    . ALA B 1 15  ? 10.225  52.507 -4.429  1.00 34.53 ? 15  ALA B CB    1 
ATOM   3435 N  N     . ALA B 1 16  ? 9.680   49.671 -3.371  1.00 33.35 ? 16  ALA B N     1 
ATOM   3436 C  CA    . ALA B 1 16  ? 8.746   48.670 -2.857  1.00 34.03 ? 16  ALA B CA    1 
ATOM   3437 C  C     . ALA B 1 16  ? 9.138   48.213 -1.447  1.00 34.05 ? 16  ALA B C     1 
ATOM   3438 O  O     . ALA B 1 16  ? 8.388   48.397 -0.479  1.00 33.96 ? 16  ALA B O     1 
ATOM   3439 C  CB    . ALA B 1 16  ? 8.695   47.474 -3.804  1.00 34.11 ? 16  ALA B CB    1 
ATOM   3440 N  N     . TRP B 1 17  ? 10.317  47.608 -1.349  1.00 33.85 ? 17  TRP B N     1 
ATOM   3441 C  CA    . TRP B 1 17  ? 10.853  47.124 -0.084  1.00 32.76 ? 17  TRP B CA    1 
ATOM   3442 C  C     . TRP B 1 17  ? 10.947  48.272 0.923   1.00 32.89 ? 17  TRP B C     1 
ATOM   3443 O  O     . TRP B 1 17  ? 10.835  48.062 2.134   1.00 33.63 ? 17  TRP B O     1 
ATOM   3444 C  CB    . TRP B 1 17  ? 12.222  46.493 -0.344  1.00 31.67 ? 17  TRP B CB    1 
ATOM   3445 C  CG    . TRP B 1 17  ? 12.975  46.070 0.868   1.00 31.11 ? 17  TRP B CG    1 
ATOM   3446 C  CD1   . TRP B 1 17  ? 12.465  45.497 1.995   1.00 30.49 ? 17  TRP B CD1   1 
ATOM   3447 C  CD2   . TRP B 1 17  ? 14.401  46.073 1.027   1.00 30.73 ? 17  TRP B CD2   1 
ATOM   3448 N  NE1   . TRP B 1 17  ? 13.485  45.139 2.845   1.00 30.96 ? 17  TRP B NE1   1 
ATOM   3449 C  CE2   . TRP B 1 17  ? 14.683  45.483 2.276   1.00 30.59 ? 17  TRP B CE2   1 
ATOM   3450 C  CE3   . TRP B 1 17  ? 15.468  46.521 0.234   1.00 30.68 ? 17  TRP B CE3   1 
ATOM   3451 C  CZ2   . TRP B 1 17  ? 15.992  45.322 2.753   1.00 31.56 ? 17  TRP B CZ2   1 
ATOM   3452 C  CZ3   . TRP B 1 17  ? 16.770  46.360 0.706   1.00 31.31 ? 17  TRP B CZ3   1 
ATOM   3453 C  CH2   . TRP B 1 17  ? 17.020  45.766 1.956   1.00 31.03 ? 17  TRP B CH2   1 
ATOM   3454 N  N     . GLY B 1 18  ? 11.154  49.483 0.409   1.00 32.08 ? 18  GLY B N     1 
ATOM   3455 C  CA    . GLY B 1 18  ? 11.220  50.650 1.263   1.00 30.69 ? 18  GLY B CA    1 
ATOM   3456 C  C     . GLY B 1 18  ? 9.930   50.707 2.059   1.00 29.81 ? 18  GLY B C     1 
ATOM   3457 O  O     . GLY B 1 18  ? 9.962   50.662 3.286   1.00 29.96 ? 18  GLY B O     1 
ATOM   3458 N  N     . ARG B 1 19  ? 8.792   50.797 1.374   1.00 28.88 ? 19  ARG B N     1 
ATOM   3459 C  CA    . ARG B 1 19  ? 7.517   50.838 2.078   1.00 29.22 ? 19  ARG B CA    1 
ATOM   3460 C  C     . ARG B 1 19  ? 7.406   49.713 3.079   1.00 29.57 ? 19  ARG B C     1 
ATOM   3461 O  O     . ARG B 1 19  ? 7.008   49.951 4.218   1.00 30.26 ? 19  ARG B O     1 
ATOM   3462 C  CB    . ARG B 1 19  ? 6.335   50.769 1.113   1.00 29.38 ? 19  ARG B CB    1 
ATOM   3463 C  CG    . ARG B 1 19  ? 6.026   52.101 0.508   1.00 30.85 ? 19  ARG B CG    1 
ATOM   3464 C  CD    . ARG B 1 19  ? 5.718   53.091 1.618   1.00 31.14 ? 19  ARG B CD    1 
ATOM   3465 N  NE    . ARG B 1 19  ? 5.834   54.468 1.158   1.00 31.43 ? 19  ARG B NE    1 
ATOM   3466 C  CZ    . ARG B 1 19  ? 5.712   55.529 1.947   1.00 31.76 ? 19  ARG B CZ    1 
ATOM   3467 N  NH1   . ARG B 1 19  ? 5.471   55.368 3.245   1.00 32.74 ? 19  ARG B NH1   1 
ATOM   3468 N  NH2   . ARG B 1 19  ? 5.845   56.748 1.439   1.00 31.40 ? 19  ARG B NH2   1 
ATOM   3469 N  N     . LYS B 1 20  ? 7.759   48.496 2.659   1.00 29.46 ? 20  LYS B N     1 
ATOM   3470 C  CA    . LYS B 1 20  ? 7.702   47.329 3.544   1.00 28.78 ? 20  LYS B CA    1 
ATOM   3471 C  C     . LYS B 1 20  ? 8.243   47.739 4.919   1.00 28.26 ? 20  LYS B C     1 
ATOM   3472 O  O     . LYS B 1 20  ? 7.538   47.679 5.935   1.00 28.55 ? 20  LYS B O     1 
ATOM   3473 C  CB    . LYS B 1 20  ? 8.561   46.186 2.976   1.00 29.37 ? 20  LYS B CB    1 
ATOM   3474 C  CG    . LYS B 1 20  ? 8.208   45.698 1.556   1.00 29.17 ? 20  LYS B CG    1 
ATOM   3475 C  CD    . LYS B 1 20  ? 6.883   44.939 1.476   1.00 28.16 ? 20  LYS B CD    1 
ATOM   3476 C  CE    . LYS B 1 20  ? 5.697   45.832 1.862   1.00 27.13 ? 20  LYS B CE    1 
ATOM   3477 N  NZ    . LYS B 1 20  ? 4.366   45.150 1.755   1.00 25.98 ? 20  LYS B NZ    1 
ATOM   3478 N  N     . ALA B 1 21  ? 9.497   48.179 4.925   1.00 26.62 ? 21  ALA B N     1 
ATOM   3479 C  CA    . ALA B 1 21  ? 10.169  48.611 6.138   1.00 25.22 ? 21  ALA B CA    1 
ATOM   3480 C  C     . ALA B 1 21  ? 9.462   49.778 6.837   1.00 24.72 ? 21  ALA B C     1 
ATOM   3481 O  O     . ALA B 1 21  ? 9.166   49.694 8.024   1.00 24.07 ? 21  ALA B O     1 
ATOM   3482 C  CB    . ALA B 1 21  ? 11.623  48.986 5.814   1.00 25.61 ? 21  ALA B CB    1 
ATOM   3483 N  N     . LEU B 1 22  ? 9.196   50.865 6.117   1.00 24.60 ? 22  LEU B N     1 
ATOM   3484 C  CA    . LEU B 1 22  ? 8.530   52.000 6.740   1.00 24.93 ? 22  LEU B CA    1 
ATOM   3485 C  C     . LEU B 1 22  ? 7.257   51.486 7.397   1.00 25.76 ? 22  LEU B C     1 
ATOM   3486 O  O     . LEU B 1 22  ? 7.028   51.695 8.582   1.00 25.64 ? 22  LEU B O     1 
ATOM   3487 C  CB    . LEU B 1 22  ? 8.162   53.077 5.712   1.00 25.03 ? 22  LEU B CB    1 
ATOM   3488 C  CG    . LEU B 1 22  ? 9.183   53.638 4.716   1.00 24.96 ? 22  LEU B CG    1 
ATOM   3489 C  CD1   . LEU B 1 22  ? 8.656   54.980 4.241   1.00 25.42 ? 22  LEU B CD1   1 
ATOM   3490 C  CD2   . LEU B 1 22  ? 10.541  53.843 5.345   1.00 25.02 ? 22  LEU B CD2   1 
ATOM   3491 N  N     . ASP B 1 23  ? 6.437   50.806 6.606   1.00 27.20 ? 23  ASP B N     1 
ATOM   3492 C  CA    . ASP B 1 23  ? 5.173   50.236 7.069   1.00 29.42 ? 23  ASP B CA    1 
ATOM   3493 C  C     . ASP B 1 23  ? 5.293   49.572 8.431   1.00 28.90 ? 23  ASP B C     1 
ATOM   3494 O  O     . ASP B 1 23  ? 4.434   49.748 9.299   1.00 28.95 ? 23  ASP B O     1 
ATOM   3495 C  CB    . ASP B 1 23  ? 4.663   49.207 6.051   1.00 32.54 ? 23  ASP B CB    1 
ATOM   3496 C  CG    . ASP B 1 23  ? 4.202   49.847 4.751   1.00 35.70 ? 23  ASP B CG    1 
ATOM   3497 O  OD1   . ASP B 1 23  ? 3.820   51.045 4.768   1.00 37.95 ? 23  ASP B OD1   1 
ATOM   3498 O  OD2   . ASP B 1 23  ? 4.204   49.145 3.715   1.00 37.08 ? 23  ASP B OD2   1 
ATOM   3499 N  N     . ILE B 1 24  ? 6.351   48.798 8.618   1.00 27.43 ? 24  ILE B N     1 
ATOM   3500 C  CA    . ILE B 1 24  ? 6.534   48.125 9.889   1.00 25.82 ? 24  ILE B CA    1 
ATOM   3501 C  C     . ILE B 1 24  ? 7.076   49.072 10.947  1.00 25.34 ? 24  ILE B C     1 
ATOM   3502 O  O     . ILE B 1 24  ? 6.656   49.020 12.100  1.00 25.75 ? 24  ILE B O     1 
ATOM   3503 C  CB    . ILE B 1 24  ? 7.459   46.914 9.739   1.00 25.13 ? 24  ILE B CB    1 
ATOM   3504 C  CG1   . ILE B 1 24  ? 6.760   45.852 8.884   1.00 24.42 ? 24  ILE B CG1   1 
ATOM   3505 C  CG2   . ILE B 1 24  ? 7.810   46.361 11.095  1.00 24.83 ? 24  ILE B CG2   1 
ATOM   3506 C  CD1   . ILE B 1 24  ? 7.602   44.652 8.586   1.00 24.65 ? 24  ILE B CD1   1 
ATOM   3507 N  N     . ALA B 1 25  ? 7.992   49.951 10.555  1.00 24.97 ? 25  ALA B N     1 
ATOM   3508 C  CA    . ALA B 1 25  ? 8.575   50.897 11.502  1.00 24.27 ? 25  ALA B CA    1 
ATOM   3509 C  C     . ALA B 1 25  ? 7.515   51.826 12.074  1.00 23.77 ? 25  ALA B C     1 
ATOM   3510 O  O     . ALA B 1 25  ? 7.610   52.241 13.224  1.00 24.93 ? 25  ALA B O     1 
ATOM   3511 C  CB    . ALA B 1 25  ? 9.676   51.716 10.828  1.00 24.19 ? 25  ALA B CB    1 
ATOM   3512 N  N     . GLU B 1 26  ? 6.500   52.147 11.283  1.00 23.13 ? 26  GLU B N     1 
ATOM   3513 C  CA    . GLU B 1 26  ? 5.464   53.047 11.761  1.00 22.86 ? 26  GLU B CA    1 
ATOM   3514 C  C     . GLU B 1 26  ? 4.728   52.425 12.924  1.00 22.54 ? 26  GLU B C     1 
ATOM   3515 O  O     . GLU B 1 26  ? 4.283   53.138 13.830  1.00 23.08 ? 26  GLU B O     1 
ATOM   3516 C  CB    . GLU B 1 26  ? 4.442   53.374 10.667  1.00 22.86 ? 26  GLU B CB    1 
ATOM   3517 C  CG    . GLU B 1 26  ? 5.037   53.840 9.348   1.00 24.86 ? 26  GLU B CG    1 
ATOM   3518 C  CD    . GLU B 1 26  ? 3.978   54.250 8.341   1.00 24.22 ? 26  GLU B CD    1 
ATOM   3519 O  OE1   . GLU B 1 26  ? 2.933   53.563 8.255   1.00 23.62 ? 26  GLU B OE1   1 
ATOM   3520 O  OE2   . GLU B 1 26  ? 4.205   55.250 7.625   1.00 25.92 ? 26  GLU B OE2   1 
ATOM   3521 N  N     . ASN B 1 27  ? 4.595   51.100 12.914  1.00 21.83 ? 27  ASN B N     1 
ATOM   3522 C  CA    . ASN B 1 27  ? 3.853   50.439 13.981  1.00 20.92 ? 27  ASN B CA    1 
ATOM   3523 C  C     . ASN B 1 27  ? 4.680   50.345 15.263  1.00 20.87 ? 27  ASN B C     1 
ATOM   3524 O  O     . ASN B 1 27  ? 4.190   49.910 16.309  1.00 21.79 ? 27  ASN B O     1 
ATOM   3525 C  CB    . ASN B 1 27  ? 3.390   49.052 13.535  1.00 19.51 ? 27  ASN B CB    1 
ATOM   3526 C  CG    . ASN B 1 27  ? 2.143   48.602 14.272  1.00 19.21 ? 27  ASN B CG    1 
ATOM   3527 O  OD1   . ASN B 1 27  ? 1.723   47.452 14.171  1.00 20.39 ? 27  ASN B OD1   1 
ATOM   3528 N  ND2   . ASN B 1 27  ? 1.535   49.518 15.009  1.00 16.74 ? 27  ASN B ND2   1 
ATOM   3529 N  N     . GLU B 1 28  ? 5.935   50.771 15.173  1.00 20.56 ? 28  GLU B N     1 
ATOM   3530 C  CA    . GLU B 1 28  ? 6.847   50.770 16.314  1.00 19.88 ? 28  GLU B CA    1 
ATOM   3531 C  C     . GLU B 1 28  ? 7.064   52.184 16.826  1.00 20.31 ? 28  GLU B C     1 
ATOM   3532 O  O     . GLU B 1 28  ? 7.697   52.384 17.865  1.00 20.36 ? 28  GLU B O     1 
ATOM   3533 C  CB    . GLU B 1 28  ? 8.202   50.178 15.915  1.00 18.66 ? 28  GLU B CB    1 
ATOM   3534 C  CG    . GLU B 1 28  ? 8.262   48.677 16.043  1.00 16.77 ? 28  GLU B CG    1 
ATOM   3535 C  CD    . GLU B 1 28  ? 8.248   48.237 17.498  1.00 14.85 ? 28  GLU B CD    1 
ATOM   3536 O  OE1   . GLU B 1 28  ? 9.265   48.444 18.200  1.00 12.96 ? 28  GLU B OE1   1 
ATOM   3537 O  OE2   . GLU B 1 28  ? 7.214   47.704 17.946  1.00 14.02 ? 28  GLU B OE2   1 
HETATM 3538 N  N     . MSE B 1 29  ? 6.526   53.159 16.098  1.00 21.48 ? 29  MSE B N     1 
HETATM 3539 C  CA    . MSE B 1 29  ? 6.691   54.564 16.446  1.00 21.70 ? 29  MSE B CA    1 
HETATM 3540 C  C     . MSE B 1 29  ? 5.387   55.260 16.785  1.00 22.47 ? 29  MSE B C     1 
HETATM 3541 O  O     . MSE B 1 29  ? 4.978   56.201 16.107  1.00 22.82 ? 29  MSE B O     1 
HETATM 3542 C  CB    . MSE B 1 29  ? 7.386   55.273 15.286  1.00 20.61 ? 29  MSE B CB    1 
HETATM 3543 C  CG    . MSE B 1 29  ? 8.670   54.580 14.911  1.00 21.41 ? 29  MSE B CG    1 
HETATM 3544 SE SE    . MSE B 1 29  ? 9.409   55.334 13.406  1.00 25.24 ? 29  MSE B SE    1 
HETATM 3545 C  CE    . MSE B 1 29  ? 10.883  54.237 13.330  1.00 24.57 ? 29  MSE B CE    1 
ATOM   3546 N  N     . PRO B 1 30  ? 4.724   54.819 17.861  1.00 23.55 ? 30  PRO B N     1 
ATOM   3547 C  CA    . PRO B 1 30  ? 3.453   55.397 18.308  1.00 24.54 ? 30  PRO B CA    1 
ATOM   3548 C  C     . PRO B 1 30  ? 3.555   56.903 18.491  1.00 25.62 ? 30  PRO B C     1 
ATOM   3549 O  O     . PRO B 1 30  ? 2.554   57.615 18.439  1.00 25.70 ? 30  PRO B O     1 
ATOM   3550 C  CB    . PRO B 1 30  ? 3.195   54.666 19.624  1.00 23.47 ? 30  PRO B CB    1 
ATOM   3551 C  CG    . PRO B 1 30  ? 4.601   54.317 20.080  1.00 24.43 ? 30  PRO B CG    1 
ATOM   3552 C  CD    . PRO B 1 30  ? 5.136   53.759 18.789  1.00 23.76 ? 30  PRO B CD    1 
ATOM   3553 N  N     . GLY B 1 31  ? 4.774   57.384 18.710  1.00 26.46 ? 31  GLY B N     1 
ATOM   3554 C  CA    . GLY B 1 31  ? 4.971   58.809 18.894  1.00 27.49 ? 31  GLY B CA    1 
ATOM   3555 C  C     . GLY B 1 31  ? 4.651   59.592 17.632  1.00 28.41 ? 31  GLY B C     1 
ATOM   3556 O  O     . GLY B 1 31  ? 3.653   60.318 17.581  1.00 28.78 ? 31  GLY B O     1 
ATOM   3557 N  N     . LEU B 1 32  ? 5.496   59.452 16.613  1.00 27.86 ? 32  LEU B N     1 
ATOM   3558 C  CA    . LEU B 1 32  ? 5.278   60.156 15.363  1.00 28.40 ? 32  LEU B CA    1 
ATOM   3559 C  C     . LEU B 1 32  ? 3.854   59.918 14.884  1.00 29.59 ? 32  LEU B C     1 
ATOM   3560 O  O     . LEU B 1 32  ? 3.173   60.842 14.440  1.00 29.98 ? 32  LEU B O     1 
ATOM   3561 C  CB    . LEU B 1 32  ? 6.252   59.662 14.299  1.00 27.30 ? 32  LEU B CB    1 
ATOM   3562 C  CG    . LEU B 1 32  ? 7.737   59.816 14.595  1.00 26.70 ? 32  LEU B CG    1 
ATOM   3563 C  CD1   . LEU B 1 32  ? 8.521   59.340 13.388  1.00 26.75 ? 32  LEU B CD1   1 
ATOM   3564 C  CD2   . LEU B 1 32  ? 8.067   61.272 14.893  1.00 26.37 ? 32  LEU B CD2   1 
HETATM 3565 N  N     . MSE B 1 33  ? 3.405   58.671 14.973  1.00 31.11 ? 33  MSE B N     1 
HETATM 3566 C  CA    . MSE B 1 33  ? 2.061   58.343 14.528  1.00 32.80 ? 33  MSE B CA    1 
HETATM 3567 C  C     . MSE B 1 33  ? 1.005   59.071 15.343  1.00 33.80 ? 33  MSE B C     1 
HETATM 3568 O  O     . MSE B 1 33  ? -0.083  59.364 14.842  1.00 34.23 ? 33  MSE B O     1 
HETATM 3569 C  CB    . MSE B 1 33  ? 1.833   56.828 14.556  1.00 33.67 ? 33  MSE B CB    1 
HETATM 3570 C  CG    . MSE B 1 33  ? 1.573   56.266 13.173  1.00 34.41 ? 33  MSE B CG    1 
HETATM 3571 SE SE    . MSE B 1 33  ? 2.989   56.678 12.052  1.00 38.76 ? 33  MSE B SE    1 
HETATM 3572 C  CE    . MSE B 1 33  ? 2.314   55.883 10.535  1.00 38.27 ? 33  MSE B CE    1 
ATOM   3573 N  N     . ARG B 1 34  ? 1.314   59.377 16.596  1.00 34.58 ? 34  ARG B N     1 
ATOM   3574 C  CA    . ARG B 1 34  ? 0.362   60.110 17.419  1.00 35.60 ? 34  ARG B CA    1 
ATOM   3575 C  C     . ARG B 1 34  ? 0.321   61.556 16.939  1.00 34.68 ? 34  ARG B C     1 
ATOM   3576 O  O     . ARG B 1 34  ? -0.744  62.179 16.866  1.00 34.52 ? 34  ARG B O     1 
ATOM   3577 C  CB    . ARG B 1 34  ? 0.764   60.064 18.897  1.00 38.01 ? 34  ARG B CB    1 
ATOM   3578 C  CG    . ARG B 1 34  ? -0.131  59.163 19.739  1.00 41.50 ? 34  ARG B CG    1 
ATOM   3579 C  CD    . ARG B 1 34  ? -1.576  59.657 19.690  1.00 44.03 ? 34  ARG B CD    1 
ATOM   3580 N  NE    . ARG B 1 34  ? -1.740  60.966 20.326  1.00 45.88 ? 34  ARG B NE    1 
ATOM   3581 C  CZ    . ARG B 1 34  ? -2.842  61.710 20.234  1.00 46.51 ? 34  ARG B CZ    1 
ATOM   3582 N  NH1   . ARG B 1 34  ? -3.882  61.275 19.528  1.00 46.10 ? 34  ARG B NH1   1 
ATOM   3583 N  NH2   . ARG B 1 34  ? -2.912  62.882 20.859  1.00 46.35 ? 34  ARG B NH2   1 
HETATM 3584 N  N     . MSE B 1 35  ? 1.495   62.076 16.599  1.00 33.25 ? 35  MSE B N     1 
HETATM 3585 C  CA    . MSE B 1 35  ? 1.624   63.440 16.124  1.00 31.57 ? 35  MSE B CA    1 
HETATM 3586 C  C     . MSE B 1 35  ? 0.818   63.603 14.829  1.00 31.29 ? 35  MSE B C     1 
HETATM 3587 O  O     . MSE B 1 35  ? 0.102   64.591 14.657  1.00 30.98 ? 35  MSE B O     1 
HETATM 3588 C  CB    . MSE B 1 35  ? 3.101   63.757 15.890  1.00 31.49 ? 35  MSE B CB    1 
HETATM 3589 C  CG    . MSE B 1 35  ? 3.525   65.139 16.374  1.00 33.12 ? 35  MSE B CG    1 
HETATM 3590 SE SE    . MSE B 1 35  ? 3.367   65.309 18.244  1.00 33.19 ? 35  MSE B SE    1 
HETATM 3591 C  CE    . MSE B 1 35  ? 3.956   67.052 18.322  1.00 32.97 ? 35  MSE B CE    1 
ATOM   3592 N  N     . ARG B 1 36  ? 0.918   62.624 13.930  1.00 30.93 ? 36  ARG B N     1 
ATOM   3593 C  CA    . ARG B 1 36  ? 0.191   62.671 12.661  1.00 30.62 ? 36  ARG B CA    1 
ATOM   3594 C  C     . ARG B 1 36  ? -1.324  62.751 12.804  1.00 32.62 ? 36  ARG B C     1 
ATOM   3595 O  O     . ARG B 1 36  ? -1.975  63.565 12.146  1.00 33.05 ? 36  ARG B O     1 
ATOM   3596 C  CB    . ARG B 1 36  ? 0.497   61.449 11.798  1.00 27.92 ? 36  ARG B CB    1 
ATOM   3597 C  CG    . ARG B 1 36  ? 1.907   61.343 11.287  1.00 26.26 ? 36  ARG B CG    1 
ATOM   3598 C  CD    . ARG B 1 36  ? 1.997   60.186 10.311  1.00 23.08 ? 36  ARG B CD    1 
ATOM   3599 N  NE    . ARG B 1 36  ? 3.351   59.993 9.818   1.00 22.29 ? 36  ARG B NE    1 
ATOM   3600 C  CZ    . ARG B 1 36  ? 3.688   59.070 8.925   1.00 22.42 ? 36  ARG B CZ    1 
ATOM   3601 N  NH1   . ARG B 1 36  ? 2.763   58.257 8.428   1.00 21.76 ? 36  ARG B NH1   1 
ATOM   3602 N  NH2   . ARG B 1 36  ? 4.950   58.957 8.530   1.00 22.88 ? 36  ARG B NH2   1 
ATOM   3603 N  N     . GLU B 1 37  ? -1.896  61.895 13.642  1.00 34.30 ? 37  GLU B N     1 
ATOM   3604 C  CA    . GLU B 1 37  ? -3.343  61.889 13.805  1.00 36.83 ? 37  GLU B CA    1 
ATOM   3605 C  C     . GLU B 1 37  ? -3.880  63.042 14.631  1.00 37.57 ? 37  GLU B C     1 
ATOM   3606 O  O     . GLU B 1 37  ? -5.090  63.174 14.824  1.00 37.53 ? 37  GLU B O     1 
ATOM   3607 C  CB    . GLU B 1 37  ? -3.811  60.558 14.399  1.00 38.50 ? 37  GLU B CB    1 
ATOM   3608 C  CG    . GLU B 1 37  ? -3.122  60.138 15.675  1.00 40.12 ? 37  GLU B CG    1 
ATOM   3609 C  CD    . GLU B 1 37  ? -3.701  58.842 16.238  1.00 41.23 ? 37  GLU B CD    1 
ATOM   3610 O  OE1   . GLU B 1 37  ? -4.900  58.843 16.594  1.00 42.30 ? 37  GLU B OE1   1 
ATOM   3611 O  OE2   . GLU B 1 37  ? -2.969  57.826 16.319  1.00 41.64 ? 37  GLU B OE2   1 
ATOM   3612 N  N     . ARG B 1 38  ? -2.977  63.889 15.105  1.00 38.58 ? 38  ARG B N     1 
ATOM   3613 C  CA    . ARG B 1 38  ? -3.366  65.037 15.907  1.00 39.21 ? 38  ARG B CA    1 
ATOM   3614 C  C     . ARG B 1 38  ? -3.156  66.341 15.135  1.00 39.31 ? 38  ARG B C     1 
ATOM   3615 O  O     . ARG B 1 38  ? -3.793  67.353 15.435  1.00 39.49 ? 38  ARG B O     1 
ATOM   3616 C  CB    . ARG B 1 38  ? -2.558  65.046 17.205  1.00 40.91 ? 38  ARG B CB    1 
ATOM   3617 C  CG    . ARG B 1 38  ? -2.756  66.263 18.091  1.00 43.03 ? 38  ARG B CG    1 
ATOM   3618 C  CD    . ARG B 1 38  ? -1.789  66.196 19.264  1.00 45.79 ? 38  ARG B CD    1 
ATOM   3619 N  NE    . ARG B 1 38  ? -1.748  67.432 20.044  1.00 49.31 ? 38  ARG B NE    1 
ATOM   3620 C  CZ    . ARG B 1 38  ? -0.896  67.654 21.046  1.00 50.85 ? 38  ARG B CZ    1 
ATOM   3621 N  NH1   . ARG B 1 38  ? -0.012  66.723 21.387  1.00 51.58 ? 38  ARG B NH1   1 
ATOM   3622 N  NH2   . ARG B 1 38  ? -0.918  68.809 21.707  1.00 51.98 ? 38  ARG B NH2   1 
ATOM   3623 N  N     . TYR B 1 39  ? -2.271  66.324 14.139  1.00 38.82 ? 39  TYR B N     1 
ATOM   3624 C  CA    . TYR B 1 39  ? -2.020  67.532 13.358  1.00 38.26 ? 39  TYR B CA    1 
ATOM   3625 C  C     . TYR B 1 39  ? -2.246  67.411 11.861  1.00 38.17 ? 39  TYR B C     1 
ATOM   3626 O  O     . TYR B 1 39  ? -2.144  68.405 11.145  1.00 39.23 ? 39  TYR B O     1 
ATOM   3627 C  CB    . TYR B 1 39  ? -0.602  68.050 13.586  1.00 37.24 ? 39  TYR B CB    1 
ATOM   3628 C  CG    . TYR B 1 39  ? -0.332  68.443 15.012  1.00 37.54 ? 39  TYR B CG    1 
ATOM   3629 C  CD1   . TYR B 1 39  ? -0.614  69.732 15.464  1.00 37.45 ? 39  TYR B CD1   1 
ATOM   3630 C  CD2   . TYR B 1 39  ? 0.173   67.521 15.926  1.00 37.64 ? 39  TYR B CD2   1 
ATOM   3631 C  CE1   . TYR B 1 39  ? -0.398  70.094 16.795  1.00 37.90 ? 39  TYR B CE1   1 
ATOM   3632 C  CE2   . TYR B 1 39  ? 0.394   67.873 17.259  1.00 37.76 ? 39  TYR B CE2   1 
ATOM   3633 C  CZ    . TYR B 1 39  ? 0.105   69.159 17.686  1.00 37.92 ? 39  TYR B CZ    1 
ATOM   3634 O  OH    . TYR B 1 39  ? 0.314   69.503 19.003  1.00 37.51 ? 39  TYR B OH    1 
ATOM   3635 N  N     . SER B 1 40  ? -2.551  66.211 11.380  1.00 37.61 ? 40  SER B N     1 
ATOM   3636 C  CA    . SER B 1 40  ? -2.780  66.024 9.950   1.00 36.63 ? 40  SER B CA    1 
ATOM   3637 C  C     . SER B 1 40  ? -3.824  67.007 9.422   1.00 36.28 ? 40  SER B C     1 
ATOM   3638 O  O     . SER B 1 40  ? -3.717  67.488 8.296   1.00 36.80 ? 40  SER B O     1 
ATOM   3639 C  CB    . SER B 1 40  ? -3.239  64.598 9.656   1.00 35.94 ? 40  SER B CB    1 
ATOM   3640 O  OG    . SER B 1 40  ? -3.476  64.438 8.270   1.00 34.84 ? 40  SER B OG    1 
ATOM   3641 N  N     . ALA B 1 41  ? -4.830  67.306 10.238  1.00 35.25 ? 41  ALA B N     1 
ATOM   3642 C  CA    . ALA B 1 41  ? -5.876  68.233 9.827   1.00 34.72 ? 41  ALA B CA    1 
ATOM   3643 C  C     . ALA B 1 41  ? -5.396  69.679 9.872   1.00 34.36 ? 41  ALA B C     1 
ATOM   3644 O  O     . ALA B 1 41  ? -5.307  70.341 8.835   1.00 34.73 ? 41  ALA B O     1 
ATOM   3645 C  CB    . ALA B 1 41  ? -7.101  68.068 10.713  1.00 34.39 ? 41  ALA B CB    1 
ATOM   3646 N  N     . SER B 1 42  ? -5.076  70.158 11.073  1.00 33.33 ? 42  SER B N     1 
ATOM   3647 C  CA    . SER B 1 42  ? -4.625  71.535 11.273  1.00 31.74 ? 42  SER B CA    1 
ATOM   3648 C  C     . SER B 1 42  ? -3.439  71.970 10.413  1.00 30.78 ? 42  SER B C     1 
ATOM   3649 O  O     . SER B 1 42  ? -3.253  73.159 10.181  1.00 30.52 ? 42  SER B O     1 
ATOM   3650 C  CB    . SER B 1 42  ? -4.280  71.765 12.745  1.00 31.19 ? 42  SER B CB    1 
ATOM   3651 O  OG    . SER B 1 42  ? -3.183  70.961 13.137  1.00 31.69 ? 42  SER B OG    1 
ATOM   3652 N  N     . LYS B 1 43  ? -2.638  71.015 9.947   1.00 30.52 ? 43  LYS B N     1 
ATOM   3653 C  CA    . LYS B 1 43  ? -1.468  71.318 9.108   1.00 29.84 ? 43  LYS B CA    1 
ATOM   3654 C  C     . LYS B 1 43  ? -0.623  72.458 9.710   1.00 29.78 ? 43  LYS B C     1 
ATOM   3655 O  O     . LYS B 1 43  ? -0.271  73.412 9.013   1.00 30.47 ? 43  LYS B O     1 
ATOM   3656 C  CB    . LYS B 1 43  ? -1.929  71.721 7.700   1.00 29.09 ? 43  LYS B CB    1 
ATOM   3657 C  CG    . LYS B 1 43  ? -2.775  70.680 6.942   1.00 28.05 ? 43  LYS B CG    1 
ATOM   3658 C  CD    . LYS B 1 43  ? -1.964  69.446 6.534   1.00 28.01 ? 43  LYS B CD    1 
ATOM   3659 C  CE    . LYS B 1 43  ? -2.794  68.471 5.689   1.00 27.36 ? 43  LYS B CE    1 
ATOM   3660 N  NZ    . LYS B 1 43  ? -2.049  67.219 5.341   1.00 25.00 ? 43  LYS B NZ    1 
ATOM   3661 N  N     . PRO B 1 44  ? -0.255  72.352 11.003  1.00 29.04 ? 44  PRO B N     1 
ATOM   3662 C  CA    . PRO B 1 44  ? 0.538   73.371 11.702  1.00 27.60 ? 44  PRO B CA    1 
ATOM   3663 C  C     . PRO B 1 44  ? 1.846   73.790 11.039  1.00 26.30 ? 44  PRO B C     1 
ATOM   3664 O  O     . PRO B 1 44  ? 2.318   74.904 11.258  1.00 25.76 ? 44  PRO B O     1 
ATOM   3665 C  CB    . PRO B 1 44  ? 0.754   72.739 13.080  1.00 27.40 ? 44  PRO B CB    1 
ATOM   3666 C  CG    . PRO B 1 44  ? 0.755   71.248 12.754  1.00 28.10 ? 44  PRO B CG    1 
ATOM   3667 C  CD    . PRO B 1 44  ? -0.507  71.224 11.915  1.00 28.39 ? 44  PRO B CD    1 
ATOM   3668 N  N     . LEU B 1 45  ? 2.435   72.908 10.237  1.00 25.75 ? 45  LEU B N     1 
ATOM   3669 C  CA    . LEU B 1 45  ? 3.691   73.236 9.561   1.00 26.82 ? 45  LEU B CA    1 
ATOM   3670 C  C     . LEU B 1 45  ? 3.491   73.803 8.159   1.00 27.51 ? 45  LEU B C     1 
ATOM   3671 O  O     . LEU B 1 45  ? 4.436   73.896 7.369   1.00 27.10 ? 45  LEU B O     1 
ATOM   3672 C  CB    . LEU B 1 45  ? 4.594   72.009 9.467   1.00 26.30 ? 45  LEU B CB    1 
ATOM   3673 C  CG    . LEU B 1 45  ? 5.065   71.401 10.777  1.00 24.91 ? 45  LEU B CG    1 
ATOM   3674 C  CD1   . LEU B 1 45  ? 5.966   70.230 10.448  1.00 25.69 ? 45  LEU B CD1   1 
ATOM   3675 C  CD2   . LEU B 1 45  ? 5.796   72.434 11.601  1.00 24.42 ? 45  LEU B CD2   1 
ATOM   3676 N  N     . LYS B 1 46  ? 2.259   74.180 7.851   1.00 28.63 ? 46  LYS B N     1 
ATOM   3677 C  CA    . LYS B 1 46  ? 1.950   74.745 6.548   1.00 30.07 ? 46  LYS B CA    1 
ATOM   3678 C  C     . LYS B 1 46  ? 2.830   75.957 6.261   1.00 29.86 ? 46  LYS B C     1 
ATOM   3679 O  O     . LYS B 1 46  ? 2.969   76.849 7.093   1.00 30.06 ? 46  LYS B O     1 
ATOM   3680 C  CB    . LYS B 1 46  ? 0.470   75.139 6.498   1.00 32.09 ? 46  LYS B CB    1 
ATOM   3681 C  CG    . LYS B 1 46  ? 0.021   75.824 5.211   1.00 34.68 ? 46  LYS B CG    1 
ATOM   3682 C  CD    . LYS B 1 46  ? -1.504  75.948 5.186   1.00 37.30 ? 46  LYS B CD    1 
ATOM   3683 C  CE    . LYS B 1 46  ? -1.974  76.844 4.054   1.00 38.51 ? 46  LYS B CE    1 
ATOM   3684 N  NZ    . LYS B 1 46  ? -1.454  78.238 4.234   1.00 39.08 ? 46  LYS B NZ    1 
ATOM   3685 N  N     . GLY B 1 47  ? 3.438   75.979 5.082   1.00 29.80 ? 47  GLY B N     1 
ATOM   3686 C  CA    . GLY B 1 47  ? 4.279   77.105 4.724   1.00 29.92 ? 47  GLY B CA    1 
ATOM   3687 C  C     . GLY B 1 47  ? 5.740   76.912 5.066   1.00 29.91 ? 47  GLY B C     1 
ATOM   3688 O  O     . GLY B 1 47  ? 6.609   77.628 4.564   1.00 29.38 ? 47  GLY B O     1 
ATOM   3689 N  N     . ALA B 1 48  ? 6.018   75.942 5.923   1.00 29.68 ? 48  ALA B N     1 
ATOM   3690 C  CA    . ALA B 1 48  ? 7.390   75.682 6.316   1.00 30.06 ? 48  ALA B CA    1 
ATOM   3691 C  C     . ALA B 1 48  ? 8.153   74.962 5.202   1.00 29.42 ? 48  ALA B C     1 
ATOM   3692 O  O     . ALA B 1 48  ? 7.617   74.075 4.541   1.00 29.80 ? 48  ALA B O     1 
ATOM   3693 C  CB    . ALA B 1 48  ? 7.413   74.852 7.607   1.00 29.73 ? 48  ALA B CB    1 
ATOM   3694 N  N     . ARG B 1 49  ? 9.399   75.369 4.980   1.00 28.87 ? 49  ARG B N     1 
ATOM   3695 C  CA    . ARG B 1 49  ? 10.248  74.741 3.975   1.00 28.53 ? 49  ARG B CA    1 
ATOM   3696 C  C     . ARG B 1 49  ? 11.434  74.209 4.755   1.00 28.09 ? 49  ARG B C     1 
ATOM   3697 O  O     . ARG B 1 49  ? 12.435  74.906 4.945   1.00 28.50 ? 49  ARG B O     1 
ATOM   3698 C  CB    . ARG B 1 49  ? 10.703  75.754 2.911   1.00 29.78 ? 49  ARG B CB    1 
ATOM   3699 C  CG    . ARG B 1 49  ? 9.599   76.174 1.927   1.00 30.25 ? 49  ARG B CG    1 
ATOM   3700 C  CD    . ARG B 1 49  ? 10.141  77.076 0.821   1.00 32.17 ? 49  ARG B CD    1 
ATOM   3701 N  NE    . ARG B 1 49  ? 10.546  78.399 1.303   1.00 33.90 ? 49  ARG B NE    1 
ATOM   3702 C  CZ    . ARG B 1 49  ? 9.697   79.332 1.724   1.00 32.79 ? 49  ARG B CZ    1 
ATOM   3703 N  NH1   . ARG B 1 49  ? 8.395   79.089 1.719   1.00 33.86 ? 49  ARG B NH1   1 
ATOM   3704 N  NH2   . ARG B 1 49  ? 10.147  80.503 2.158   1.00 32.87 ? 49  ARG B NH2   1 
ATOM   3705 N  N     . ILE B 1 50  ? 11.294  72.966 5.212   1.00 26.98 ? 50  ILE B N     1 
ATOM   3706 C  CA    . ILE B 1 50  ? 12.296  72.289 6.029   1.00 25.39 ? 50  ILE B CA    1 
ATOM   3707 C  C     . ILE B 1 50  ? 13.441  71.630 5.273   1.00 25.88 ? 50  ILE B C     1 
ATOM   3708 O  O     . ILE B 1 50  ? 13.228  70.784 4.407   1.00 25.92 ? 50  ILE B O     1 
ATOM   3709 C  CB    . ILE B 1 50  ? 11.638  71.198 6.890   1.00 23.78 ? 50  ILE B CB    1 
ATOM   3710 C  CG1   . ILE B 1 50  ? 10.516  71.799 7.731   1.00 24.24 ? 50  ILE B CG1   1 
ATOM   3711 C  CG2   . ILE B 1 50  ? 12.664  70.563 7.792   1.00 22.50 ? 50  ILE B CG2   1 
ATOM   3712 C  CD1   . ILE B 1 50  ? 9.719   70.768 8.507   1.00 24.34 ? 50  ILE B CD1   1 
ATOM   3713 N  N     . ALA B 1 51  ? 14.663  72.014 5.623   1.00 26.44 ? 51  ALA B N     1 
ATOM   3714 C  CA    . ALA B 1 51  ? 15.850  71.430 5.017   1.00 26.01 ? 51  ALA B CA    1 
ATOM   3715 C  C     . ALA B 1 51  ? 16.400  70.471 6.068   1.00 26.13 ? 51  ALA B C     1 
ATOM   3716 O  O     . ALA B 1 51  ? 16.915  70.894 7.104   1.00 25.64 ? 51  ALA B O     1 
ATOM   3717 C  CB    . ALA B 1 51  ? 16.867  72.511 4.695   1.00 26.10 ? 51  ALA B CB    1 
ATOM   3718 N  N     . GLY B 1 52  ? 16.259  69.176 5.810   1.00 27.00 ? 52  GLY B N     1 
ATOM   3719 C  CA    . GLY B 1 52  ? 16.736  68.180 6.753   1.00 27.09 ? 52  GLY B CA    1 
ATOM   3720 C  C     . GLY B 1 52  ? 18.083  67.586 6.388   1.00 27.03 ? 52  GLY B C     1 
ATOM   3721 O  O     . GLY B 1 52  ? 18.374  67.337 5.217   1.00 27.11 ? 52  GLY B O     1 
ATOM   3722 N  N     . CYS B 1 53  ? 18.915  67.371 7.397   1.00 27.16 ? 53  CYS B N     1 
ATOM   3723 C  CA    . CYS B 1 53  ? 20.233  66.794 7.195   1.00 27.24 ? 53  CYS B CA    1 
ATOM   3724 C  C     . CYS B 1 53  ? 20.455  65.819 8.330   1.00 27.84 ? 53  CYS B C     1 
ATOM   3725 O  O     . CYS B 1 53  ? 21.231  66.075 9.256   1.00 28.09 ? 53  CYS B O     1 
ATOM   3726 C  CB    . CYS B 1 53  ? 21.310  67.868 7.228   1.00 27.56 ? 53  CYS B CB    1 
ATOM   3727 S  SG    . CYS B 1 53  ? 22.918  67.167 6.960   1.00 27.54 ? 53  CYS B SG    1 
ATOM   3728 N  N     . LEU B 1 54  ? 19.752  64.695 8.248   1.00 28.39 ? 54  LEU B N     1 
ATOM   3729 C  CA    . LEU B 1 54  ? 19.816  63.658 9.267   1.00 28.98 ? 54  LEU B CA    1 
ATOM   3730 C  C     . LEU B 1 54  ? 19.793  62.279 8.616   1.00 28.36 ? 54  LEU B C     1 
ATOM   3731 O  O     . LEU B 1 54  ? 18.994  62.035 7.718   1.00 27.64 ? 54  LEU B O     1 
ATOM   3732 C  CB    . LEU B 1 54  ? 18.618  63.833 10.207  1.00 29.47 ? 54  LEU B CB    1 
ATOM   3733 C  CG    . LEU B 1 54  ? 18.372  62.918 11.406  1.00 30.23 ? 54  LEU B CG    1 
ATOM   3734 C  CD1   . LEU B 1 54  ? 17.263  63.526 12.251  1.00 29.48 ? 54  LEU B CD1   1 
ATOM   3735 C  CD2   . LEU B 1 54  ? 18.007  61.514 10.947  1.00 30.51 ? 54  LEU B CD2   1 
ATOM   3736 N  N     . HIS B 1 55  ? 20.677  61.395 9.077   1.00 28.84 ? 55  HIS B N     1 
ATOM   3737 C  CA    . HIS B 1 55  ? 20.789  60.017 8.576   1.00 29.12 ? 55  HIS B CA    1 
ATOM   3738 C  C     . HIS B 1 55  ? 19.520  59.569 7.852   1.00 29.85 ? 55  HIS B C     1 
ATOM   3739 O  O     . HIS B 1 55  ? 18.459  59.479 8.469   1.00 29.97 ? 55  HIS B O     1 
ATOM   3740 C  CB    . HIS B 1 55  ? 21.045  59.063 9.747   1.00 27.55 ? 55  HIS B CB    1 
ATOM   3741 C  CG    . HIS B 1 55  ? 22.238  59.423 10.577  1.00 26.96 ? 55  HIS B CG    1 
ATOM   3742 N  ND1   . HIS B 1 55  ? 23.530  59.378 10.093  1.00 27.27 ? 55  HIS B ND1   1 
ATOM   3743 C  CD2   . HIS B 1 55  ? 22.335  59.840 11.862  1.00 26.65 ? 55  HIS B CD2   1 
ATOM   3744 C  CE1   . HIS B 1 55  ? 24.369  59.749 11.044  1.00 26.97 ? 55  HIS B CE1   1 
ATOM   3745 N  NE2   . HIS B 1 55  ? 23.671  60.034 12.127  1.00 26.13 ? 55  HIS B NE2   1 
HETATM 3746 N  N     . MSE B 1 56  ? 19.617  59.286 6.552   1.00 30.20 ? 56  MSE B N     1 
HETATM 3747 C  CA    . MSE B 1 56  ? 18.438  58.858 5.795   1.00 29.81 ? 56  MSE B CA    1 
HETATM 3748 C  C     . MSE B 1 56  ? 18.140  57.377 6.038   1.00 30.53 ? 56  MSE B C     1 
HETATM 3749 O  O     . MSE B 1 56  ? 18.538  56.512 5.254   1.00 31.68 ? 56  MSE B O     1 
HETATM 3750 C  CB    . MSE B 1 56  ? 18.628  59.101 4.292   1.00 27.86 ? 56  MSE B CB    1 
HETATM 3751 C  CG    . MSE B 1 56  ? 17.381  58.754 3.504   1.00 26.06 ? 56  MSE B CG    1 
HETATM 3752 SE SE    . MSE B 1 56  ? 15.968  59.844 4.038   1.00 27.03 ? 56  MSE B SE    1 
HETATM 3753 C  CE    . MSE B 1 56  ? 14.696  59.141 2.941   1.00 28.99 ? 56  MSE B CE    1 
ATOM   3754 N  N     . THR B 1 57  ? 17.436  57.092 7.129   1.00 30.46 ? 57  THR B N     1 
ATOM   3755 C  CA    . THR B 1 57  ? 17.102  55.714 7.486   1.00 29.23 ? 57  THR B CA    1 
ATOM   3756 C  C     . THR B 1 57  ? 15.602  55.513 7.501   1.00 28.02 ? 57  THR B C     1 
ATOM   3757 O  O     . THR B 1 57  ? 14.834  56.477 7.432   1.00 27.94 ? 57  THR B O     1 
ATOM   3758 C  CB    . THR B 1 57  ? 17.600  55.357 8.890   1.00 28.88 ? 57  THR B CB    1 
ATOM   3759 O  OG1   . THR B 1 57  ? 16.820  56.079 9.858   1.00 28.49 ? 57  THR B OG1   1 
ATOM   3760 C  CG2   . THR B 1 57  ? 19.074  55.720 9.040   1.00 28.13 ? 57  THR B CG2   1 
ATOM   3761 N  N     . VAL B 1 58  ? 15.195  54.253 7.610   1.00 26.84 ? 58  VAL B N     1 
ATOM   3762 C  CA    . VAL B 1 58  ? 13.782  53.914 7.651   1.00 25.73 ? 58  VAL B CA    1 
ATOM   3763 C  C     . VAL B 1 58  ? 13.049  54.811 8.639   1.00 24.97 ? 58  VAL B C     1 
ATOM   3764 O  O     . VAL B 1 58  ? 12.040  55.437 8.302   1.00 24.04 ? 58  VAL B O     1 
ATOM   3765 C  CB    . VAL B 1 58  ? 13.584  52.451 8.062   1.00 25.59 ? 58  VAL B CB    1 
ATOM   3766 C  CG1   . VAL B 1 58  ? 12.105  52.178 8.311   1.00 26.50 ? 58  VAL B CG1   1 
ATOM   3767 C  CG2   . VAL B 1 58  ? 14.120  51.530 6.964   1.00 24.90 ? 58  VAL B CG2   1 
ATOM   3768 N  N     . GLU B 1 59  ? 13.566  54.881 9.860   1.00 25.47 ? 59  GLU B N     1 
ATOM   3769 C  CA    . GLU B 1 59  ? 12.952  55.710 10.889  1.00 25.94 ? 59  GLU B CA    1 
ATOM   3770 C  C     . GLU B 1 59  ? 12.790  57.129 10.361  1.00 25.90 ? 59  GLU B C     1 
ATOM   3771 O  O     . GLU B 1 59  ? 11.681  57.674 10.331  1.00 25.59 ? 59  GLU B O     1 
ATOM   3772 C  CB    . GLU B 1 59  ? 13.817  55.718 12.148  1.00 26.62 ? 59  GLU B CB    1 
ATOM   3773 C  CG    . GLU B 1 59  ? 13.975  54.355 12.841  1.00 26.95 ? 59  GLU B CG    1 
ATOM   3774 C  CD    . GLU B 1 59  ? 14.617  53.285 11.965  1.00 26.56 ? 59  GLU B CD    1 
ATOM   3775 O  OE1   . GLU B 1 59  ? 15.690  53.548 11.380  1.00 26.22 ? 59  GLU B OE1   1 
ATOM   3776 O  OE2   . GLU B 1 59  ? 14.057  52.170 11.881  1.00 26.65 ? 59  GLU B OE2   1 
ATOM   3777 N  N     . THR B 1 60  ? 13.902  57.713 9.924   1.00 26.00 ? 60  THR B N     1 
ATOM   3778 C  CA    . THR B 1 60  ? 13.899  59.073 9.387   1.00 25.59 ? 60  THR B CA    1 
ATOM   3779 C  C     . THR B 1 60  ? 12.781  59.275 8.365   1.00 25.80 ? 60  THR B C     1 
ATOM   3780 O  O     . THR B 1 60  ? 12.133  60.324 8.333   1.00 25.30 ? 60  THR B O     1 
ATOM   3781 C  CB    . THR B 1 60  ? 15.243  59.400 8.712   1.00 24.33 ? 60  THR B CB    1 
ATOM   3782 O  OG1   . THR B 1 60  ? 16.303  59.119 9.628   1.00 23.87 ? 60  THR B OG1   1 
ATOM   3783 C  CG2   . THR B 1 60  ? 15.308  60.876 8.334   1.00 24.94 ? 60  THR B CG2   1 
ATOM   3784 N  N     . ALA B 1 61  ? 12.565  58.264 7.529   1.00 26.36 ? 61  ALA B N     1 
ATOM   3785 C  CA    . ALA B 1 61  ? 11.531  58.331 6.508   1.00 27.33 ? 61  ALA B CA    1 
ATOM   3786 C  C     . ALA B 1 61  ? 10.165  58.533 7.154   1.00 28.04 ? 61  ALA B C     1 
ATOM   3787 O  O     . ALA B 1 61  ? 9.344   59.312 6.660   1.00 28.76 ? 61  ALA B O     1 
ATOM   3788 C  CB    . ALA B 1 61  ? 11.534  57.057 5.664   1.00 26.78 ? 61  ALA B CB    1 
ATOM   3789 N  N     . VAL B 1 62  ? 9.912   57.838 8.258   1.00 27.91 ? 62  VAL B N     1 
ATOM   3790 C  CA    . VAL B 1 62  ? 8.622   57.989 8.920   1.00 28.31 ? 62  VAL B CA    1 
ATOM   3791 C  C     . VAL B 1 62  ? 8.491   59.418 9.423   1.00 28.82 ? 62  VAL B C     1 
ATOM   3792 O  O     . VAL B 1 62  ? 7.403   59.992 9.427   1.00 29.17 ? 62  VAL B O     1 
ATOM   3793 C  CB    . VAL B 1 62  ? 8.472   57.017 10.098  1.00 27.54 ? 62  VAL B CB    1 
ATOM   3794 C  CG1   . VAL B 1 62  ? 7.112   57.197 10.751  1.00 25.45 ? 62  VAL B CG1   1 
ATOM   3795 C  CG2   . VAL B 1 62  ? 8.626   55.595 9.602   1.00 28.10 ? 62  VAL B CG2   1 
ATOM   3796 N  N     . LEU B 1 63  ? 9.612   59.987 9.849   1.00 28.80 ? 63  LEU B N     1 
ATOM   3797 C  CA    . LEU B 1 63  ? 9.627   61.360 10.332  1.00 28.78 ? 63  LEU B CA    1 
ATOM   3798 C  C     . LEU B 1 63  ? 9.310   62.275 9.156   1.00 29.02 ? 63  LEU B C     1 
ATOM   3799 O  O     . LEU B 1 63  ? 8.378   63.085 9.208   1.00 29.58 ? 63  LEU B O     1 
ATOM   3800 C  CB    . LEU B 1 63  ? 11.012  61.713 10.883  1.00 28.43 ? 63  LEU B CB    1 
ATOM   3801 C  CG    . LEU B 1 63  ? 11.223  63.187 11.240  1.00 27.56 ? 63  LEU B CG    1 
ATOM   3802 C  CD1   . LEU B 1 63  ? 10.228  63.585 12.320  1.00 27.89 ? 63  LEU B CD1   1 
ATOM   3803 C  CD2   . LEU B 1 63  ? 12.650  63.416 11.698  1.00 25.87 ? 63  LEU B CD2   1 
ATOM   3804 N  N     . ILE B 1 64  ? 10.098  62.130 8.096   1.00 28.88 ? 64  ILE B N     1 
ATOM   3805 C  CA    . ILE B 1 64  ? 9.935   62.933 6.896   1.00 28.94 ? 64  ILE B CA    1 
ATOM   3806 C  C     . ILE B 1 64  ? 8.477   63.000 6.457   1.00 30.03 ? 64  ILE B C     1 
ATOM   3807 O  O     . ILE B 1 64  ? 7.944   64.084 6.226   1.00 30.60 ? 64  ILE B O     1 
ATOM   3808 C  CB    . ILE B 1 64  ? 10.799  62.376 5.760   1.00 28.00 ? 64  ILE B CB    1 
ATOM   3809 C  CG1   . ILE B 1 64  ? 12.265  62.389 6.191   1.00 27.44 ? 64  ILE B CG1   1 
ATOM   3810 C  CG2   . ILE B 1 64  ? 10.615  63.208 4.511   1.00 27.83 ? 64  ILE B CG2   1 
ATOM   3811 C  CD1   . ILE B 1 64  ? 13.215  61.850 5.158   1.00 28.55 ? 64  ILE B CD1   1 
ATOM   3812 N  N     . GLU B 1 65  ? 7.822   61.850 6.352   1.00 31.10 ? 65  GLU B N     1 
ATOM   3813 C  CA    . GLU B 1 65  ? 6.425   61.846 5.942   1.00 31.98 ? 65  GLU B CA    1 
ATOM   3814 C  C     . GLU B 1 65  ? 5.543   62.487 6.992   1.00 32.32 ? 65  GLU B C     1 
ATOM   3815 O  O     . GLU B 1 65  ? 4.501   63.052 6.672   1.00 33.21 ? 65  GLU B O     1 
ATOM   3816 C  CB    . GLU B 1 65  ? 5.936   60.426 5.662   1.00 32.57 ? 65  GLU B CB    1 
ATOM   3817 C  CG    . GLU B 1 65  ? 6.442   59.845 4.359   1.00 34.34 ? 65  GLU B CG    1 
ATOM   3818 C  CD    . GLU B 1 65  ? 5.992   58.419 4.160   1.00 35.59 ? 65  GLU B CD    1 
ATOM   3819 O  OE1   . GLU B 1 65  ? 4.770   58.153 4.236   1.00 35.13 ? 65  GLU B OE1   1 
ATOM   3820 O  OE2   . GLU B 1 65  ? 6.867   57.562 3.925   1.00 36.78 ? 65  GLU B OE2   1 
ATOM   3821 N  N     . THR B 1 66  ? 5.950   62.405 8.252   1.00 32.60 ? 66  THR B N     1 
ATOM   3822 C  CA    . THR B 1 66  ? 5.149   63.011 9.309   1.00 32.82 ? 66  THR B CA    1 
ATOM   3823 C  C     . THR B 1 66  ? 5.162   64.520 9.121   1.00 31.75 ? 66  THR B C     1 
ATOM   3824 O  O     . THR B 1 66  ? 4.124   65.178 9.196   1.00 30.89 ? 66  THR B O     1 
ATOM   3825 C  CB    . THR B 1 66  ? 5.696   62.678 10.709  1.00 33.11 ? 66  THR B CB    1 
ATOM   3826 O  OG1   . THR B 1 66  ? 5.642   61.261 10.920  1.00 33.14 ? 66  THR B OG1   1 
ATOM   3827 C  CG2   . THR B 1 66  ? 4.865   63.375 11.779  1.00 33.22 ? 66  THR B CG2   1 
ATOM   3828 N  N     . LEU B 1 67  ? 6.345   65.066 8.872   1.00 31.34 ? 67  LEU B N     1 
ATOM   3829 C  CA    . LEU B 1 67  ? 6.461   66.497 8.665   1.00 31.12 ? 67  LEU B CA    1 
ATOM   3830 C  C     . LEU B 1 67  ? 5.532   66.892 7.516   1.00 31.54 ? 67  LEU B C     1 
ATOM   3831 O  O     . LEU B 1 67  ? 4.824   67.902 7.594   1.00 32.02 ? 67  LEU B O     1 
ATOM   3832 C  CB    . LEU B 1 67  ? 7.910   66.864 8.336   1.00 29.58 ? 67  LEU B CB    1 
ATOM   3833 C  CG    . LEU B 1 67  ? 8.935   66.646 9.452   1.00 27.97 ? 67  LEU B CG    1 
ATOM   3834 C  CD1   . LEU B 1 67  ? 10.339  66.984 8.953   1.00 26.72 ? 67  LEU B CD1   1 
ATOM   3835 C  CD2   . LEU B 1 67  ? 8.566   67.515 10.636  1.00 27.07 ? 67  LEU B CD2   1 
ATOM   3836 N  N     . VAL B 1 68  ? 5.535   66.081 6.458   1.00 31.01 ? 68  VAL B N     1 
ATOM   3837 C  CA    . VAL B 1 68  ? 4.701   66.329 5.287   1.00 30.69 ? 68  VAL B CA    1 
ATOM   3838 C  C     . VAL B 1 68  ? 3.213   66.290 5.636   1.00 32.09 ? 68  VAL B C     1 
ATOM   3839 O  O     . VAL B 1 68  ? 2.451   67.183 5.262   1.00 32.18 ? 68  VAL B O     1 
ATOM   3840 C  CB    . VAL B 1 68  ? 4.987   65.298 4.171   1.00 29.34 ? 68  VAL B CB    1 
ATOM   3841 C  CG1   . VAL B 1 68  ? 3.947   65.412 3.071   1.00 28.67 ? 68  VAL B CG1   1 
ATOM   3842 C  CG2   . VAL B 1 68  ? 6.376   65.533 3.595   1.00 28.89 ? 68  VAL B CG2   1 
ATOM   3843 N  N     . THR B 1 69  ? 2.795   65.252 6.348   1.00 33.11 ? 69  THR B N     1 
ATOM   3844 C  CA    . THR B 1 69  ? 1.397   65.138 6.740   1.00 34.07 ? 69  THR B CA    1 
ATOM   3845 C  C     . THR B 1 69  ? 0.965   66.389 7.499   1.00 35.10 ? 69  THR B C     1 
ATOM   3846 O  O     . THR B 1 69  ? -0.213  66.762 7.477   1.00 36.32 ? 69  THR B O     1 
ATOM   3847 C  CB    . THR B 1 69  ? 1.168   63.899 7.622   1.00 34.04 ? 69  THR B CB    1 
ATOM   3848 O  OG1   . THR B 1 69  ? 1.441   62.725 6.852   1.00 34.74 ? 69  THR B OG1   1 
ATOM   3849 C  CG2   . THR B 1 69  ? -0.263  63.847 8.123   1.00 33.61 ? 69  THR B CG2   1 
ATOM   3850 N  N     . LEU B 1 70  ? 1.915   67.034 8.172   1.00 35.35 ? 70  LEU B N     1 
ATOM   3851 C  CA    . LEU B 1 70  ? 1.612   68.256 8.905   1.00 35.88 ? 70  LEU B CA    1 
ATOM   3852 C  C     . LEU B 1 70  ? 1.644   69.470 7.972   1.00 36.27 ? 70  LEU B C     1 
ATOM   3853 O  O     . LEU B 1 70  ? 1.364   70.599 8.389   1.00 36.90 ? 70  LEU B O     1 
ATOM   3854 C  CB    . LEU B 1 70  ? 2.574   68.431 10.087  1.00 35.10 ? 70  LEU B CB    1 
ATOM   3855 C  CG    . LEU B 1 70  ? 2.168   67.648 11.347  1.00 34.26 ? 70  LEU B CG    1 
ATOM   3856 C  CD1   . LEU B 1 70  ? 1.963   66.173 11.034  1.00 33.89 ? 70  LEU B CD1   1 
ATOM   3857 C  CD2   . LEU B 1 70  ? 3.227   67.837 12.409  1.00 34.03 ? 70  LEU B CD2   1 
ATOM   3858 N  N     . GLY B 1 71  ? 1.988   69.219 6.709   1.00 35.97 ? 71  GLY B N     1 
ATOM   3859 C  CA    . GLY B 1 71  ? 2.003   70.267 5.704   1.00 35.98 ? 71  GLY B CA    1 
ATOM   3860 C  C     . GLY B 1 71  ? 3.239   71.121 5.507   1.00 36.07 ? 71  GLY B C     1 
ATOM   3861 O  O     . GLY B 1 71  ? 3.121   72.315 5.244   1.00 36.76 ? 71  GLY B O     1 
ATOM   3862 N  N     . ALA B 1 72  ? 4.423   70.535 5.613   1.00 35.85 ? 72  ALA B N     1 
ATOM   3863 C  CA    . ALA B 1 72  ? 5.638   71.312 5.424   1.00 35.94 ? 72  ALA B CA    1 
ATOM   3864 C  C     . ALA B 1 72  ? 6.381   70.793 4.208   1.00 36.36 ? 72  ALA B C     1 
ATOM   3865 O  O     . ALA B 1 72  ? 6.542   69.586 4.057   1.00 37.52 ? 72  ALA B O     1 
ATOM   3866 C  CB    . ALA B 1 72  ? 6.523   71.200 6.661   1.00 35.58 ? 72  ALA B CB    1 
ATOM   3867 N  N     . GLU B 1 73  ? 6.818   71.682 3.325   1.00 36.53 ? 73  GLU B N     1 
ATOM   3868 C  CA    . GLU B 1 73  ? 7.576   71.219 2.168   1.00 37.46 ? 73  GLU B CA    1 
ATOM   3869 C  C     . GLU B 1 73  ? 8.865   70.696 2.783   1.00 37.47 ? 73  GLU B C     1 
ATOM   3870 O  O     . GLU B 1 73  ? 9.337   71.253 3.771   1.00 38.97 ? 73  GLU B O     1 
ATOM   3871 C  CB    . GLU B 1 73  ? 7.895   72.367 1.207   1.00 37.64 ? 73  GLU B CB    1 
ATOM   3872 C  CG    . GLU B 1 73  ? 6.686   73.169 0.763   1.00 38.44 ? 73  GLU B CG    1 
ATOM   3873 C  CD    . GLU B 1 73  ? 6.960   73.977 -0.492  1.00 39.69 ? 73  GLU B CD    1 
ATOM   3874 O  OE1   . GLU B 1 73  ? 8.005   74.666 -0.542  1.00 40.59 ? 73  GLU B OE1   1 
ATOM   3875 O  OE2   . GLU B 1 73  ? 6.121   73.928 -1.425  1.00 39.28 ? 73  GLU B OE2   1 
ATOM   3876 N  N     . VAL B 1 74  ? 9.436   69.634 2.226   1.00 36.96 ? 74  VAL B N     1 
ATOM   3877 C  CA    . VAL B 1 74  ? 10.662  69.077 2.792   1.00 36.39 ? 74  VAL B CA    1 
ATOM   3878 C  C     . VAL B 1 74  ? 11.663  68.591 1.756   1.00 36.28 ? 74  VAL B C     1 
ATOM   3879 O  O     . VAL B 1 74  ? 11.297  67.998 0.746   1.00 37.39 ? 74  VAL B O     1 
ATOM   3880 C  CB    . VAL B 1 74  ? 10.350  67.886 3.736   1.00 36.72 ? 74  VAL B CB    1 
ATOM   3881 C  CG1   . VAL B 1 74  ? 11.637  67.379 4.380   1.00 36.16 ? 74  VAL B CG1   1 
ATOM   3882 C  CG2   . VAL B 1 74  ? 9.339   68.304 4.801   1.00 35.96 ? 74  VAL B CG2   1 
ATOM   3883 N  N     . GLN B 1 75  ? 12.934  68.853 2.012   1.00 36.07 ? 75  GLN B N     1 
ATOM   3884 C  CA    . GLN B 1 75  ? 14.000  68.409 1.128   1.00 35.91 ? 75  GLN B CA    1 
ATOM   3885 C  C     . GLN B 1 75  ? 15.017  67.816 2.084   1.00 34.79 ? 75  GLN B C     1 
ATOM   3886 O  O     . GLN B 1 75  ? 15.289  68.381 3.145   1.00 34.08 ? 75  GLN B O     1 
ATOM   3887 C  CB    . GLN B 1 75  ? 14.526  69.581 0.294   1.00 37.53 ? 75  GLN B CB    1 
ATOM   3888 C  CG    . GLN B 1 75  ? 13.410  70.133 -0.612  1.00 39.62 ? 75  GLN B CG    1 
ATOM   3889 C  CD    . GLN B 1 75  ? 13.900  71.050 -1.725  1.00 41.55 ? 75  GLN B CD    1 
ATOM   3890 O  OE1   . GLN B 1 75  ? 13.104  71.547 -2.529  1.00 41.42 ? 75  GLN B OE1   1 
ATOM   3891 N  NE2   . GLN B 1 75  ? 15.214  71.269 -1.785  1.00 43.04 ? 75  GLN B NE2   1 
ATOM   3892 N  N     . TRP B 1 76  ? 15.577  66.671 1.716   1.00 34.28 ? 76  TRP B N     1 
ATOM   3893 C  CA    . TRP B 1 76  ? 16.453  65.964 2.639   1.00 34.15 ? 76  TRP B CA    1 
ATOM   3894 C  C     . TRP B 1 76  ? 17.773  65.383 2.127   1.00 32.79 ? 76  TRP B C     1 
ATOM   3895 O  O     . TRP B 1 76  ? 17.935  65.094 0.943   1.00 32.43 ? 76  TRP B O     1 
ATOM   3896 C  CB    . TRP B 1 76  ? 15.599  64.854 3.248   1.00 35.29 ? 76  TRP B CB    1 
ATOM   3897 C  CG    . TRP B 1 76  ? 15.978  64.395 4.596   1.00 37.10 ? 76  TRP B CG    1 
ATOM   3898 C  CD1   . TRP B 1 76  ? 16.923  63.465 4.926   1.00 36.76 ? 76  TRP B CD1   1 
ATOM   3899 C  CD2   . TRP B 1 76  ? 15.393  64.834 5.826   1.00 37.82 ? 76  TRP B CD2   1 
ATOM   3900 N  NE1   . TRP B 1 76  ? 16.960  63.293 6.293   1.00 37.16 ? 76  TRP B NE1   1 
ATOM   3901 C  CE2   . TRP B 1 76  ? 16.031  64.122 6.870   1.00 37.85 ? 76  TRP B CE2   1 
ATOM   3902 C  CE3   . TRP B 1 76  ? 14.388  65.762 6.148   1.00 37.31 ? 76  TRP B CE3   1 
ATOM   3903 C  CZ2   . TRP B 1 76  ? 15.696  64.309 8.218   1.00 37.78 ? 76  TRP B CZ2   1 
ATOM   3904 C  CZ3   . TRP B 1 76  ? 14.056  65.949 7.482   1.00 37.43 ? 76  TRP B CZ3   1 
ATOM   3905 C  CH2   . TRP B 1 76  ? 14.710  65.224 8.503   1.00 37.63 ? 76  TRP B CH2   1 
ATOM   3906 N  N     . SER B 1 77  ? 18.704  65.209 3.057   1.00 31.55 ? 77  SER B N     1 
ATOM   3907 C  CA    . SER B 1 77  ? 20.015  64.633 2.784   1.00 31.32 ? 77  SER B CA    1 
ATOM   3908 C  C     . SER B 1 77  ? 20.469  64.009 4.105   1.00 31.45 ? 77  SER B C     1 
ATOM   3909 O  O     . SER B 1 77  ? 19.969  64.382 5.173   1.00 32.14 ? 77  SER B O     1 
ATOM   3910 C  CB    . SER B 1 77  ? 21.014  65.708 2.358   1.00 30.68 ? 77  SER B CB    1 
ATOM   3911 O  OG    . SER B 1 77  ? 21.314  66.581 3.433   1.00 31.78 ? 77  SER B OG    1 
ATOM   3912 N  N     . SER B 1 78  ? 21.403  63.065 4.043   1.00 30.43 ? 78  SER B N     1 
ATOM   3913 C  CA    . SER B 1 78  ? 21.888  62.415 5.257   1.00 29.80 ? 78  SER B CA    1 
ATOM   3914 C  C     . SER B 1 78  ? 22.971  63.257 5.902   1.00 29.53 ? 78  SER B C     1 
ATOM   3915 O  O     . SER B 1 78  ? 23.587  64.092 5.240   1.00 29.84 ? 78  SER B O     1 
ATOM   3916 C  CB    . SER B 1 78  ? 22.455  61.027 4.942   1.00 30.12 ? 78  SER B CB    1 
ATOM   3917 O  OG    . SER B 1 78  ? 22.898  60.385 6.127   1.00 28.55 ? 78  SER B OG    1 
ATOM   3918 N  N     . CYS B 1 79  ? 23.198  63.039 7.195   1.00 28.45 ? 79  CYS B N     1 
ATOM   3919 C  CA    . CYS B 1 79  ? 24.226  63.782 7.908   1.00 28.11 ? 79  CYS B CA    1 
ATOM   3920 C  C     . CYS B 1 79  ? 25.509  62.953 8.001   1.00 26.44 ? 79  CYS B C     1 
ATOM   3921 O  O     . CYS B 1 79  ? 26.418  63.273 8.778   1.00 25.21 ? 79  CYS B O     1 
ATOM   3922 C  CB    . CYS B 1 79  ? 23.738  64.163 9.311   1.00 30.14 ? 79  CYS B CB    1 
ATOM   3923 S  SG    . CYS B 1 79  ? 23.397  62.774 10.420  1.00 32.30 ? 79  CYS B SG    1 
ATOM   3924 N  N     . ASN B 1 80  ? 25.565  61.887 7.203   1.00 24.86 ? 80  ASN B N     1 
ATOM   3925 C  CA    . ASN B 1 80  ? 26.725  61.002 7.155   1.00 25.15 ? 80  ASN B CA    1 
ATOM   3926 C  C     . ASN B 1 80  ? 26.687  60.191 5.860   1.00 25.17 ? 80  ASN B C     1 
ATOM   3927 O  O     . ASN B 1 80  ? 25.627  59.734 5.429   1.00 25.92 ? 80  ASN B O     1 
ATOM   3928 C  CB    . ASN B 1 80  ? 26.755  60.073 8.379   1.00 25.81 ? 80  ASN B CB    1 
ATOM   3929 C  CG    . ASN B 1 80  ? 27.993  59.196 8.413   1.00 25.10 ? 80  ASN B CG    1 
ATOM   3930 O  OD1   . ASN B 1 80  ? 28.139  58.283 7.605   1.00 26.07 ? 80  ASN B OD1   1 
ATOM   3931 N  ND2   . ASN B 1 80  ? 28.900  59.484 9.336   1.00 23.21 ? 80  ASN B ND2   1 
ATOM   3932 N  N     . ILE B 1 81  ? 27.853  60.014 5.251   1.00 25.54 ? 81  ILE B N     1 
ATOM   3933 C  CA    . ILE B 1 81  ? 27.970  59.312 3.982   1.00 26.68 ? 81  ILE B CA    1 
ATOM   3934 C  C     . ILE B 1 81  ? 27.694  57.810 3.986   1.00 27.81 ? 81  ILE B C     1 
ATOM   3935 O  O     . ILE B 1 81  ? 27.416  57.240 2.930   1.00 29.07 ? 81  ILE B O     1 
ATOM   3936 C  CB    . ILE B 1 81  ? 29.372  59.553 3.351   1.00 27.33 ? 81  ILE B CB    1 
ATOM   3937 C  CG1   . ILE B 1 81  ? 30.472  58.957 4.232   1.00 26.85 ? 81  ILE B CG1   1 
ATOM   3938 C  CG2   . ILE B 1 81  ? 29.613  61.053 3.189   1.00 27.62 ? 81  ILE B CG2   1 
ATOM   3939 C  CD1   . ILE B 1 81  ? 31.868  59.243 3.726   1.00 26.79 ? 81  ILE B CD1   1 
ATOM   3940 N  N     . PHE B 1 82  ? 27.756  57.163 5.149   1.00 27.90 ? 82  PHE B N     1 
ATOM   3941 C  CA    . PHE B 1 82  ? 27.514  55.718 5.222   1.00 27.49 ? 82  PHE B CA    1 
ATOM   3942 C  C     . PHE B 1 82  ? 26.190  55.321 5.870   1.00 28.55 ? 82  PHE B C     1 
ATOM   3943 O  O     . PHE B 1 82  ? 25.716  54.200 5.689   1.00 29.20 ? 82  PHE B O     1 
ATOM   3944 C  CB    . PHE B 1 82  ? 28.621  55.014 6.013   1.00 26.89 ? 82  PHE B CB    1 
ATOM   3945 C  CG    . PHE B 1 82  ? 29.978  55.096 5.392   1.00 26.43 ? 82  PHE B CG    1 
ATOM   3946 C  CD1   . PHE B 1 82  ? 30.174  54.753 4.061   1.00 26.65 ? 82  PHE B CD1   1 
ATOM   3947 C  CD2   . PHE B 1 82  ? 31.083  55.443 6.163   1.00 26.71 ? 82  PHE B CD2   1 
ATOM   3948 C  CE1   . PHE B 1 82  ? 31.458  54.749 3.502   1.00 26.66 ? 82  PHE B CE1   1 
ATOM   3949 C  CE2   . PHE B 1 82  ? 32.370  55.442 5.616   1.00 26.74 ? 82  PHE B CE2   1 
ATOM   3950 C  CZ    . PHE B 1 82  ? 32.557  55.092 4.282   1.00 26.70 ? 82  PHE B CZ    1 
ATOM   3951 N  N     . SER B 1 83  ? 25.599  56.232 6.632   1.00 29.55 ? 83  SER B N     1 
ATOM   3952 C  CA    . SER B 1 83  ? 24.365  55.941 7.352   1.00 30.11 ? 83  SER B CA    1 
ATOM   3953 C  C     . SER B 1 83  ? 23.077  55.837 6.549   1.00 30.74 ? 83  SER B C     1 
ATOM   3954 O  O     . SER B 1 83  ? 22.044  55.415 7.076   1.00 31.56 ? 83  SER B O     1 
ATOM   3955 C  CB    . SER B 1 83  ? 24.182  56.974 8.460   1.00 30.17 ? 83  SER B CB    1 
ATOM   3956 O  OG    . SER B 1 83  ? 24.193  58.280 7.923   1.00 30.55 ? 83  SER B OG    1 
ATOM   3957 N  N     . THR B 1 84  ? 23.109  56.215 5.282   1.00 31.51 ? 84  THR B N     1 
ATOM   3958 C  CA    . THR B 1 84  ? 21.883  56.140 4.500   1.00 32.19 ? 84  THR B CA    1 
ATOM   3959 C  C     . THR B 1 84  ? 21.446  54.693 4.265   1.00 32.01 ? 84  THR B C     1 
ATOM   3960 O  O     . THR B 1 84  ? 22.274  53.794 4.092   1.00 32.69 ? 84  THR B O     1 
ATOM   3961 C  CB    . THR B 1 84  ? 22.050  56.838 3.134   1.00 32.35 ? 84  THR B CB    1 
ATOM   3962 O  OG1   . THR B 1 84  ? 22.412  58.212 3.337   1.00 32.41 ? 84  THR B OG1   1 
ATOM   3963 C  CG2   . THR B 1 84  ? 20.751  56.769 2.347   1.00 33.50 ? 84  THR B CG2   1 
ATOM   3964 N  N     . GLN B 1 85  ? 20.139  54.473 4.295   1.00 31.20 ? 85  GLN B N     1 
ATOM   3965 C  CA    . GLN B 1 85  ? 19.569  53.158 4.030   1.00 30.98 ? 85  GLN B CA    1 
ATOM   3966 C  C     . GLN B 1 85  ? 18.835  53.356 2.709   1.00 30.47 ? 85  GLN B C     1 
ATOM   3967 O  O     . GLN B 1 85  ? 17.795  54.012 2.656   1.00 30.10 ? 85  GLN B O     1 
ATOM   3968 C  CB    . GLN B 1 85  ? 18.618  52.756 5.160   1.00 31.96 ? 85  GLN B CB    1 
ATOM   3969 C  CG    . GLN B 1 85  ? 19.354  52.435 6.468   1.00 31.95 ? 85  GLN B CG    1 
ATOM   3970 C  CD    . GLN B 1 85  ? 18.428  52.200 7.658   1.00 32.18 ? 85  GLN B CD    1 
ATOM   3971 O  OE1   . GLN B 1 85  ? 18.896  51.867 8.744   1.00 32.11 ? 85  GLN B OE1   1 
ATOM   3972 N  NE2   . GLN B 1 85  ? 17.119  52.385 7.464   1.00 31.24 ? 85  GLN B NE2   1 
ATOM   3973 N  N     . ASN B 1 86  ? 19.395  52.797 1.641   1.00 30.09 ? 86  ASN B N     1 
ATOM   3974 C  CA    . ASN B 1 86  ? 18.853  52.980 0.298   1.00 29.57 ? 86  ASN B CA    1 
ATOM   3975 C  C     . ASN B 1 86  ? 17.365  52.735 0.049   1.00 29.58 ? 86  ASN B C     1 
ATOM   3976 O  O     . ASN B 1 86  ? 16.691  53.593 -0.517  1.00 30.44 ? 86  ASN B O     1 
ATOM   3977 C  CB    . ASN B 1 86  ? 19.695  52.190 -0.701  1.00 27.93 ? 86  ASN B CB    1 
ATOM   3978 C  CG    . ASN B 1 86  ? 21.178  52.555 -0.631  1.00 27.83 ? 86  ASN B CG    1 
ATOM   3979 O  OD1   . ASN B 1 86  ? 21.551  53.733 -0.692  1.00 27.88 ? 86  ASN B OD1   1 
ATOM   3980 N  ND2   . ASN B 1 86  ? 22.030  51.540 -0.510  1.00 26.74 ? 86  ASN B ND2   1 
ATOM   3981 N  N     . HIS B 1 87  ? 16.832  51.592 0.460   1.00 29.71 ? 87  HIS B N     1 
ATOM   3982 C  CA    . HIS B 1 87  ? 15.411  51.350 0.223   1.00 30.14 ? 87  HIS B CA    1 
ATOM   3983 C  C     . HIS B 1 87  ? 14.550  52.412 0.902   1.00 30.20 ? 87  HIS B C     1 
ATOM   3984 O  O     . HIS B 1 87  ? 13.507  52.810 0.382   1.00 30.16 ? 87  HIS B O     1 
ATOM   3985 C  CB    . HIS B 1 87  ? 15.008  49.943 0.684   1.00 30.65 ? 87  HIS B CB    1 
ATOM   3986 C  CG    . HIS B 1 87  ? 15.205  49.690 2.144   1.00 30.56 ? 87  HIS B CG    1 
ATOM   3987 N  ND1   . HIS B 1 87  ? 16.386  49.974 2.798   1.00 30.50 ? 87  HIS B ND1   1 
ATOM   3988 C  CD2   . HIS B 1 87  ? 14.399  49.102 3.062   1.00 31.05 ? 87  HIS B CD2   1 
ATOM   3989 C  CE1   . HIS B 1 87  ? 16.297  49.570 4.054   1.00 30.15 ? 87  HIS B CE1   1 
ATOM   3990 N  NE2   . HIS B 1 87  ? 15.103  49.038 4.239   1.00 30.08 ? 87  HIS B NE2   1 
ATOM   3991 N  N     . ALA B 1 88  ? 14.983  52.883 2.064   1.00 30.34 ? 88  ALA B N     1 
ATOM   3992 C  CA    . ALA B 1 88  ? 14.230  53.919 2.752   1.00 29.85 ? 88  ALA B CA    1 
ATOM   3993 C  C     . ALA B 1 88  ? 14.435  55.209 1.958   1.00 29.71 ? 88  ALA B C     1 
ATOM   3994 O  O     . ALA B 1 88  ? 13.517  56.019 1.804   1.00 29.78 ? 88  ALA B O     1 
ATOM   3995 C  CB    . ALA B 1 88  ? 14.734  54.086 4.177   1.00 29.21 ? 88  ALA B CB    1 
ATOM   3996 N  N     . ALA B 1 89  ? 15.648  55.395 1.449   1.00 28.73 ? 89  ALA B N     1 
ATOM   3997 C  CA    . ALA B 1 89  ? 15.941  56.584 0.668   1.00 28.67 ? 89  ALA B CA    1 
ATOM   3998 C  C     . ALA B 1 89  ? 14.994  56.581 -0.513  1.00 29.10 ? 89  ALA B C     1 
ATOM   3999 O  O     . ALA B 1 89  ? 14.278  57.548 -0.737  1.00 29.86 ? 89  ALA B O     1 
ATOM   4000 C  CB    . ALA B 1 89  ? 17.390  56.560 0.184   1.00 28.97 ? 89  ALA B CB    1 
ATOM   4001 N  N     . ALA B 1 90  ? 14.979  55.471 -1.249  1.00 29.48 ? 90  ALA B N     1 
ATOM   4002 C  CA    . ALA B 1 90  ? 14.129  55.328 -2.424  1.00 29.69 ? 90  ALA B CA    1 
ATOM   4003 C  C     . ALA B 1 90  ? 12.654  55.546 -2.116  1.00 29.73 ? 90  ALA B C     1 
ATOM   4004 O  O     . ALA B 1 90  ? 11.993  56.343 -2.778  1.00 30.94 ? 90  ALA B O     1 
ATOM   4005 C  CB    . ALA B 1 90  ? 14.332  53.952 -3.054  1.00 29.57 ? 90  ALA B CB    1 
ATOM   4006 N  N     . ALA B 1 91  ? 12.134  54.840 -1.120  1.00 29.60 ? 91  ALA B N     1 
ATOM   4007 C  CA    . ALA B 1 91  ? 10.730  54.986 -0.766  1.00 29.58 ? 91  ALA B CA    1 
ATOM   4008 C  C     . ALA B 1 91  ? 10.355  56.458 -0.742  1.00 29.71 ? 91  ALA B C     1 
ATOM   4009 O  O     . ALA B 1 91  ? 9.359   56.856 -1.337  1.00 30.31 ? 91  ALA B O     1 
ATOM   4010 C  CB    . ALA B 1 91  ? 10.464  54.363 0.587   1.00 30.20 ? 91  ALA B CB    1 
ATOM   4011 N  N     . ILE B 1 92  ? 11.163  57.266 -0.066  1.00 29.78 ? 92  ILE B N     1 
ATOM   4012 C  CA    . ILE B 1 92  ? 10.896  58.696 0.027   1.00 30.32 ? 92  ILE B CA    1 
ATOM   4013 C  C     . ILE B 1 92  ? 10.982  59.403 -1.326  1.00 31.01 ? 92  ILE B C     1 
ATOM   4014 O  O     . ILE B 1 92  ? 10.137  60.249 -1.639  1.00 31.13 ? 92  ILE B O     1 
ATOM   4015 C  CB    . ILE B 1 92  ? 11.854  59.384 1.032   1.00 29.43 ? 92  ILE B CB    1 
ATOM   4016 C  CG1   . ILE B 1 92  ? 11.569  58.879 2.450   1.00 29.27 ? 92  ILE B CG1   1 
ATOM   4017 C  CG2   . ILE B 1 92  ? 11.662  60.892 0.995   1.00 30.31 ? 92  ILE B CG2   1 
ATOM   4018 C  CD1   . ILE B 1 92  ? 10.195  59.242 2.984   1.00 28.96 ? 92  ILE B CD1   1 
ATOM   4019 N  N     . ALA B 1 93  ? 11.995  59.066 -2.124  1.00 31.64 ? 93  ALA B N     1 
ATOM   4020 C  CA    . ALA B 1 93  ? 12.148  59.682 -3.442  1.00 32.48 ? 93  ALA B CA    1 
ATOM   4021 C  C     . ALA B 1 93  ? 10.874  59.411 -4.213  1.00 32.43 ? 93  ALA B C     1 
ATOM   4022 O  O     . ALA B 1 93  ? 10.233  60.333 -4.709  1.00 33.81 ? 93  ALA B O     1 
ATOM   4023 C  CB    . ALA B 1 93  ? 13.341  59.092 -4.184  1.00 32.99 ? 93  ALA B CB    1 
ATOM   4024 N  N     . LYS B 1 94  ? 10.492  58.143 -4.293  1.00 32.42 ? 94  LYS B N     1 
ATOM   4025 C  CA    . LYS B 1 94  ? 9.277   57.779 -5.007  1.00 33.19 ? 94  LYS B CA    1 
ATOM   4026 C  C     . LYS B 1 94  ? 8.052   58.534 -4.482  1.00 32.63 ? 94  LYS B C     1 
ATOM   4027 O  O     . LYS B 1 94  ? 7.065   58.699 -5.196  1.00 32.07 ? 94  LYS B O     1 
ATOM   4028 C  CB    . LYS B 1 94  ? 9.008   56.276 -4.906  1.00 34.18 ? 94  LYS B CB    1 
ATOM   4029 C  CG    . LYS B 1 94  ? 7.743   55.859 -5.665  1.00 36.39 ? 94  LYS B CG    1 
ATOM   4030 C  CD    . LYS B 1 94  ? 7.312   54.433 -5.355  1.00 37.42 ? 94  LYS B CD    1 
ATOM   4031 C  CE    . LYS B 1 94  ? 5.956   54.134 -5.989  1.00 37.70 ? 94  LYS B CE    1 
ATOM   4032 N  NZ    . LYS B 1 94  ? 5.448   52.798 -5.578  1.00 37.94 ? 94  LYS B NZ    1 
ATOM   4033 N  N     . ALA B 1 95  ? 8.114   58.988 -3.237  1.00 32.69 ? 95  ALA B N     1 
ATOM   4034 C  CA    . ALA B 1 95  ? 6.995   59.711 -2.649  1.00 32.93 ? 95  ALA B CA    1 
ATOM   4035 C  C     . ALA B 1 95  ? 6.940   61.148 -3.157  1.00 33.32 ? 95  ALA B C     1 
ATOM   4036 O  O     . ALA B 1 95  ? 6.050   61.918 -2.779  1.00 33.06 ? 95  ALA B O     1 
ATOM   4037 C  CB    . ALA B 1 95  ? 7.099   59.695 -1.129  1.00 33.71 ? 95  ALA B CB    1 
ATOM   4038 N  N     . GLY B 1 96  ? 7.898   61.509 -4.008  1.00 33.04 ? 96  GLY B N     1 
ATOM   4039 C  CA    . GLY B 1 96  ? 7.922   62.850 -4.565  1.00 33.57 ? 96  GLY B CA    1 
ATOM   4040 C  C     . GLY B 1 96  ? 8.535   63.865 -3.623  1.00 34.19 ? 96  GLY B C     1 
ATOM   4041 O  O     . GLY B 1 96  ? 8.238   65.068 -3.677  1.00 35.54 ? 96  GLY B O     1 
ATOM   4042 N  N     . ILE B 1 97  ? 9.391   63.371 -2.741  1.00 32.80 ? 97  ILE B N     1 
ATOM   4043 C  CA    . ILE B 1 97  ? 10.074  64.222 -1.788  1.00 31.43 ? 97  ILE B CA    1 
ATOM   4044 C  C     . ILE B 1 97  ? 11.548  64.222 -2.178  1.00 31.01 ? 97  ILE B C     1 
ATOM   4045 O  O     . ILE B 1 97  ? 12.173  63.166 -2.281  1.00 30.86 ? 97  ILE B O     1 
ATOM   4046 C  CB    . ILE B 1 97  ? 9.910   63.670 -0.370  1.00 30.56 ? 97  ILE B CB    1 
ATOM   4047 C  CG1   . ILE B 1 97  ? 8.424   63.604 -0.028  1.00 29.27 ? 97  ILE B CG1   1 
ATOM   4048 C  CG2   . ILE B 1 97  ? 10.666  64.533 0.620   1.00 31.38 ? 97  ILE B CG2   1 
ATOM   4049 C  CD1   . ILE B 1 97  ? 8.135   63.001 1.322   1.00 28.73 ? 97  ILE B CD1   1 
ATOM   4050 N  N     . PRO B 1 98  ? 12.120  65.408 -2.417  1.00 30.73 ? 98  PRO B N     1 
ATOM   4051 C  CA    . PRO B 1 98  ? 13.530  65.506 -2.799  1.00 31.39 ? 98  PRO B CA    1 
ATOM   4052 C  C     . PRO B 1 98  ? 14.489  64.914 -1.764  1.00 31.83 ? 98  PRO B C     1 
ATOM   4053 O  O     . PRO B 1 98  ? 14.641  65.448 -0.661  1.00 32.47 ? 98  PRO B O     1 
ATOM   4054 C  CB    . PRO B 1 98  ? 13.722  67.015 -2.978  1.00 31.51 ? 98  PRO B CB    1 
ATOM   4055 C  CG    . PRO B 1 98  ? 12.327  67.469 -3.405  1.00 31.10 ? 98  PRO B CG    1 
ATOM   4056 C  CD    . PRO B 1 98  ? 11.523  66.749 -2.353  1.00 30.35 ? 98  PRO B CD    1 
ATOM   4057 N  N     . VAL B 1 99  ? 15.126  63.803 -2.120  1.00 32.11 ? 99  VAL B N     1 
ATOM   4058 C  CA    . VAL B 1 99  ? 16.085  63.165 -1.230  1.00 32.94 ? 99  VAL B CA    1 
ATOM   4059 C  C     . VAL B 1 99  ? 17.417  63.109 -1.955  1.00 33.20 ? 99  VAL B C     1 
ATOM   4060 O  O     . VAL B 1 99  ? 17.462  62.846 -3.154  1.00 33.74 ? 99  VAL B O     1 
ATOM   4061 C  CB    . VAL B 1 99  ? 15.683  61.722 -0.891  1.00 33.46 ? 99  VAL B CB    1 
ATOM   4062 C  CG1   . VAL B 1 99  ? 16.626  61.153 0.164   1.00 33.69 ? 99  VAL B CG1   1 
ATOM   4063 C  CG2   . VAL B 1 99  ? 14.262  61.681 -0.411  1.00 34.00 ? 99  VAL B CG2   1 
ATOM   4064 N  N     . TYR B 1 100 ? 18.502  63.368 -1.241  1.00 32.96 ? 100 TYR B N     1 
ATOM   4065 C  CA    . TYR B 1 100 ? 19.817  63.310 -1.858  1.00 33.19 ? 100 TYR B CA    1 
ATOM   4066 C  C     . TYR B 1 100 ? 20.735  62.585 -0.908  1.00 32.77 ? 100 TYR B C     1 
ATOM   4067 O  O     . TYR B 1 100 ? 21.440  63.210 -0.110  1.00 32.40 ? 100 TYR B O     1 
ATOM   4068 C  CB    . TYR B 1 100 ? 20.336  64.715 -2.149  1.00 34.23 ? 100 TYR B CB    1 
ATOM   4069 C  CG    . TYR B 1 100 ? 19.368  65.499 -2.997  1.00 35.38 ? 100 TYR B CG    1 
ATOM   4070 C  CD1   . TYR B 1 100 ? 18.223  66.058 -2.438  1.00 35.53 ? 100 TYR B CD1   1 
ATOM   4071 C  CD2   . TYR B 1 100 ? 19.544  65.600 -4.373  1.00 35.52 ? 100 TYR B CD2   1 
ATOM   4072 C  CE1   . TYR B 1 100 ? 17.275  66.690 -3.221  1.00 36.08 ? 100 TYR B CE1   1 
ATOM   4073 C  CE2   . TYR B 1 100 ? 18.597  66.233 -5.168  1.00 36.08 ? 100 TYR B CE2   1 
ATOM   4074 C  CZ    . TYR B 1 100 ? 17.463  66.773 -4.583  1.00 36.44 ? 100 TYR B CZ    1 
ATOM   4075 O  OH    . TYR B 1 100 ? 16.500  67.378 -5.360  1.00 37.68 ? 100 TYR B OH    1 
ATOM   4076 N  N     . ALA B 1 101 ? 20.699  61.255 -0.994  1.00 31.72 ? 101 ALA B N     1 
ATOM   4077 C  CA    . ALA B 1 101 ? 21.502  60.402 -0.135  1.00 30.66 ? 101 ALA B CA    1 
ATOM   4078 C  C     . ALA B 1 101 ? 21.538  58.971 -0.649  1.00 29.90 ? 101 ALA B C     1 
ATOM   4079 O  O     . ALA B 1 101 ? 20.618  58.514 -1.329  1.00 29.42 ? 101 ALA B O     1 
ATOM   4080 C  CB    . ALA B 1 101 ? 20.934  60.420 1.272   1.00 31.06 ? 101 ALA B CB    1 
ATOM   4081 N  N     . TRP B 1 102 ? 22.609  58.268 -0.302  1.00 28.55 ? 102 TRP B N     1 
ATOM   4082 C  CA    . TRP B 1 102 ? 22.800  56.881 -0.696  1.00 28.73 ? 102 TRP B CA    1 
ATOM   4083 C  C     . TRP B 1 102 ? 23.986  56.354 0.110   1.00 29.06 ? 102 TRP B C     1 
ATOM   4084 O  O     . TRP B 1 102 ? 24.931  57.095 0.401   1.00 28.81 ? 102 TRP B O     1 
ATOM   4085 C  CB    . TRP B 1 102 ? 23.059  56.786 -2.213  1.00 28.81 ? 102 TRP B CB    1 
ATOM   4086 C  CG    . TRP B 1 102 ? 24.289  57.520 -2.708  1.00 28.12 ? 102 TRP B CG    1 
ATOM   4087 C  CD1   . TRP B 1 102 ? 25.592  57.107 -2.616  1.00 28.39 ? 102 TRP B CD1   1 
ATOM   4088 C  CD2   . TRP B 1 102 ? 24.325  58.813 -3.330  1.00 27.93 ? 102 TRP B CD2   1 
ATOM   4089 N  NE1   . TRP B 1 102 ? 26.437  58.061 -3.142  1.00 28.88 ? 102 TRP B NE1   1 
ATOM   4090 C  CE2   . TRP B 1 102 ? 25.688  59.119 -3.586  1.00 28.16 ? 102 TRP B CE2   1 
ATOM   4091 C  CE3   . TRP B 1 102 ? 23.340  59.744 -3.693  1.00 27.52 ? 102 TRP B CE3   1 
ATOM   4092 C  CZ2   . TRP B 1 102 ? 26.091  60.317 -4.189  1.00 27.86 ? 102 TRP B CZ2   1 
ATOM   4093 C  CZ3   . TRP B 1 102 ? 23.738  60.935 -4.292  1.00 27.88 ? 102 TRP B CZ3   1 
ATOM   4094 C  CH2   . TRP B 1 102 ? 25.105  61.210 -4.534  1.00 28.53 ? 102 TRP B CH2   1 
ATOM   4095 N  N     . LYS B 1 103 ? 23.938  55.081 0.484   1.00 28.62 ? 103 LYS B N     1 
ATOM   4096 C  CA    . LYS B 1 103 ? 25.018  54.519 1.282   1.00 28.41 ? 103 LYS B CA    1 
ATOM   4097 C  C     . LYS B 1 103 ? 26.313  54.522 0.488   1.00 28.45 ? 103 LYS B C     1 
ATOM   4098 O  O     . LYS B 1 103 ? 26.371  53.972 -0.608  1.00 29.17 ? 103 LYS B O     1 
ATOM   4099 C  CB    . LYS B 1 103 ? 24.674  53.091 1.720   1.00 28.22 ? 103 LYS B CB    1 
ATOM   4100 C  CG    . LYS B 1 103 ? 25.587  52.542 2.805   1.00 27.44 ? 103 LYS B CG    1 
ATOM   4101 C  CD    . LYS B 1 103 ? 25.209  51.117 3.188   1.00 28.02 ? 103 LYS B CD    1 
ATOM   4102 C  CE    . LYS B 1 103 ? 26.031  50.607 4.378   1.00 27.35 ? 103 LYS B CE    1 
ATOM   4103 N  NZ    . LYS B 1 103 ? 25.752  51.367 5.635   1.00 28.52 ? 103 LYS B NZ    1 
ATOM   4104 N  N     . GLY B 1 104 ? 27.344  55.159 1.033   1.00 28.15 ? 104 GLY B N     1 
ATOM   4105 C  CA    . GLY B 1 104 ? 28.625  55.194 0.353   1.00 29.01 ? 104 GLY B CA    1 
ATOM   4106 C  C     . GLY B 1 104 ? 28.913  56.445 -0.457  1.00 30.06 ? 104 GLY B C     1 
ATOM   4107 O  O     . GLY B 1 104 ? 29.490  56.372 -1.541  1.00 31.63 ? 104 GLY B O     1 
ATOM   4108 N  N     . GLU B 1 105 ? 28.505  57.598 0.055   1.00 29.97 ? 105 GLU B N     1 
ATOM   4109 C  CA    . GLU B 1 105 ? 28.761  58.859 -0.622  1.00 29.70 ? 105 GLU B CA    1 
ATOM   4110 C  C     . GLU B 1 105 ? 30.241  59.204 -0.436  1.00 30.42 ? 105 GLU B C     1 
ATOM   4111 O  O     . GLU B 1 105 ? 30.947  58.543 0.328   1.00 30.46 ? 105 GLU B O     1 
ATOM   4112 C  CB    . GLU B 1 105 ? 27.891  59.961 -0.005  1.00 29.29 ? 105 GLU B CB    1 
ATOM   4113 C  CG    . GLU B 1 105 ? 26.405  59.820 -0.283  1.00 28.85 ? 105 GLU B CG    1 
ATOM   4114 C  CD    . GLU B 1 105 ? 25.552  60.800 0.521   1.00 29.11 ? 105 GLU B CD    1 
ATOM   4115 O  OE1   . GLU B 1 105 ? 26.020  61.932 0.776   1.00 29.35 ? 105 GLU B OE1   1 
ATOM   4116 O  OE2   . GLU B 1 105 ? 24.399  60.452 0.873   1.00 28.02 ? 105 GLU B OE2   1 
ATOM   4117 N  N     . THR B 1 106 ? 30.709  60.222 -1.150  1.00 31.21 ? 106 THR B N     1 
ATOM   4118 C  CA    . THR B 1 106 ? 32.091  60.675 -1.020  1.00 32.84 ? 106 THR B CA    1 
ATOM   4119 C  C     . THR B 1 106 ? 31.951  62.048 -0.377  1.00 33.90 ? 106 THR B C     1 
ATOM   4120 O  O     . THR B 1 106 ? 30.895  62.679 -0.489  1.00 33.60 ? 106 THR B O     1 
ATOM   4121 C  CB    . THR B 1 106 ? 32.800  60.840 -2.390  1.00 32.77 ? 106 THR B CB    1 
ATOM   4122 O  OG1   . THR B 1 106 ? 32.273  61.983 -3.078  1.00 32.47 ? 106 THR B OG1   1 
ATOM   4123 C  CG2   . THR B 1 106 ? 32.583  59.608 -3.252  1.00 32.51 ? 106 THR B CG2   1 
ATOM   4124 N  N     . ASP B 1 107 ? 32.999  62.512 0.296   1.00 35.50 ? 107 ASP B N     1 
ATOM   4125 C  CA    . ASP B 1 107 ? 32.948  63.816 0.955   1.00 36.62 ? 107 ASP B CA    1 
ATOM   4126 C  C     . ASP B 1 107 ? 32.340  64.903 0.063   1.00 37.31 ? 107 ASP B C     1 
ATOM   4127 O  O     . ASP B 1 107 ? 31.585  65.756 0.538   1.00 37.69 ? 107 ASP B O     1 
ATOM   4128 C  CB    . ASP B 1 107 ? 34.352  64.227 1.409   1.00 36.94 ? 107 ASP B CB    1 
ATOM   4129 C  CG    . ASP B 1 107 ? 34.939  63.258 2.423   1.00 38.25 ? 107 ASP B CG    1 
ATOM   4130 O  OD1   . ASP B 1 107 ? 34.307  63.046 3.485   1.00 39.39 ? 107 ASP B OD1   1 
ATOM   4131 O  OD2   . ASP B 1 107 ? 36.030  62.708 2.161   1.00 37.77 ? 107 ASP B OD2   1 
ATOM   4132 N  N     . GLU B 1 108 ? 32.658  64.860 -1.229  1.00 37.95 ? 108 GLU B N     1 
ATOM   4133 C  CA    . GLU B 1 108 ? 32.145  65.843 -2.170  1.00 38.25 ? 108 GLU B CA    1 
ATOM   4134 C  C     . GLU B 1 108 ? 30.654  65.605 -2.366  1.00 37.51 ? 108 GLU B C     1 
ATOM   4135 O  O     . GLU B 1 108 ? 29.848  66.520 -2.227  1.00 37.55 ? 108 GLU B O     1 
ATOM   4136 C  CB    . GLU B 1 108 ? 32.857  65.743 -3.526  1.00 40.30 ? 108 GLU B CB    1 
ATOM   4137 C  CG    . GLU B 1 108 ? 34.392  65.827 -3.497  1.00 43.25 ? 108 GLU B CG    1 
ATOM   4138 C  CD    . GLU B 1 108 ? 35.053  64.561 -2.954  1.00 45.27 ? 108 GLU B CD    1 
ATOM   4139 O  OE1   . GLU B 1 108 ? 34.848  64.228 -1.767  1.00 46.30 ? 108 GLU B OE1   1 
ATOM   4140 O  OE2   . GLU B 1 108 ? 35.780  63.889 -3.722  1.00 47.28 ? 108 GLU B OE2   1 
ATOM   4141 N  N     . GLU B 1 109 ? 30.285  64.372 -2.683  1.00 37.13 ? 109 GLU B N     1 
ATOM   4142 C  CA    . GLU B 1 109 ? 28.878  64.049 -2.893  1.00 37.11 ? 109 GLU B CA    1 
ATOM   4143 C  C     . GLU B 1 109 ? 28.067  64.402 -1.651  1.00 37.15 ? 109 GLU B C     1 
ATOM   4144 O  O     . GLU B 1 109 ? 26.933  64.884 -1.752  1.00 37.17 ? 109 GLU B O     1 
ATOM   4145 C  CB    . GLU B 1 109 ? 28.724  62.564 -3.197  1.00 37.34 ? 109 GLU B CB    1 
ATOM   4146 C  CG    . GLU B 1 109 ? 29.668  62.077 -4.270  1.00 38.84 ? 109 GLU B CG    1 
ATOM   4147 C  CD    . GLU B 1 109 ? 29.466  60.609 -4.611  1.00 40.82 ? 109 GLU B CD    1 
ATOM   4148 O  OE1   . GLU B 1 109 ? 29.553  59.753 -3.696  1.00 41.21 ? 109 GLU B OE1   1 
ATOM   4149 O  OE2   . GLU B 1 109 ? 29.226  60.315 -5.804  1.00 41.15 ? 109 GLU B OE2   1 
ATOM   4150 N  N     . TYR B 1 110 ? 28.652  64.151 -0.481  1.00 36.62 ? 110 TYR B N     1 
ATOM   4151 C  CA    . TYR B 1 110 ? 27.989  64.454 0.781   1.00 36.34 ? 110 TYR B CA    1 
ATOM   4152 C  C     . TYR B 1 110 ? 27.578  65.915 0.749   1.00 36.47 ? 110 TYR B C     1 
ATOM   4153 O  O     . TYR B 1 110 ? 26.395  66.250 0.856   1.00 35.81 ? 110 TYR B O     1 
ATOM   4154 C  CB    . TYR B 1 110 ? 28.937  64.219 1.960   1.00 35.28 ? 110 TYR B CB    1 
ATOM   4155 C  CG    . TYR B 1 110 ? 28.341  64.589 3.298   1.00 34.66 ? 110 TYR B CG    1 
ATOM   4156 C  CD1   . TYR B 1 110 ? 27.209  63.936 3.782   1.00 34.85 ? 110 TYR B CD1   1 
ATOM   4157 C  CD2   . TYR B 1 110 ? 28.889  65.618 4.069   1.00 34.43 ? 110 TYR B CD2   1 
ATOM   4158 C  CE1   . TYR B 1 110 ? 26.630  64.300 5.005   1.00 34.49 ? 110 TYR B CE1   1 
ATOM   4159 C  CE2   . TYR B 1 110 ? 28.323  65.990 5.289   1.00 34.19 ? 110 TYR B CE2   1 
ATOM   4160 C  CZ    . TYR B 1 110 ? 27.188  65.328 5.751   1.00 34.38 ? 110 TYR B CZ    1 
ATOM   4161 O  OH    . TYR B 1 110 ? 26.601  65.700 6.944   1.00 33.86 ? 110 TYR B OH    1 
ATOM   4162 N  N     . LEU B 1 111 ? 28.580  66.775 0.582   1.00 36.37 ? 111 LEU B N     1 
ATOM   4163 C  CA    . LEU B 1 111 ? 28.385  68.218 0.526   1.00 36.32 ? 111 LEU B CA    1 
ATOM   4164 C  C     . LEU B 1 111 ? 27.432  68.613 -0.592  1.00 35.73 ? 111 LEU B C     1 
ATOM   4165 O  O     . LEU B 1 111 ? 26.677  69.583 -0.467  1.00 36.10 ? 111 LEU B O     1 
ATOM   4166 C  CB    . LEU B 1 111 ? 29.743  68.909 0.337   1.00 36.40 ? 111 LEU B CB    1 
ATOM   4167 C  CG    . LEU B 1 111 ? 29.785  70.430 0.183   1.00 36.63 ? 111 LEU B CG    1 
ATOM   4168 C  CD1   . LEU B 1 111 ? 29.283  70.830 -1.189  1.00 38.41 ? 111 LEU B CD1   1 
ATOM   4169 C  CD2   . LEU B 1 111 ? 28.957  71.078 1.278   1.00 37.09 ? 111 LEU B CD2   1 
ATOM   4170 N  N     . TRP B 1 112 ? 27.481  67.856 -1.684  1.00 34.85 ? 112 TRP B N     1 
ATOM   4171 C  CA    . TRP B 1 112 ? 26.633  68.109 -2.841  1.00 34.49 ? 112 TRP B CA    1 
ATOM   4172 C  C     . TRP B 1 112 ? 25.165  67.931 -2.474  1.00 35.00 ? 112 TRP B C     1 
ATOM   4173 O  O     . TRP B 1 112 ? 24.317  68.769 -2.798  1.00 35.03 ? 112 TRP B O     1 
ATOM   4174 C  CB    . TRP B 1 112 ? 26.975  67.146 -3.975  1.00 33.98 ? 112 TRP B CB    1 
ATOM   4175 C  CG    . TRP B 1 112 ? 26.122  67.367 -5.181  1.00 33.42 ? 112 TRP B CG    1 
ATOM   4176 C  CD1   . TRP B 1 112 ? 26.242  68.371 -6.100  1.00 33.54 ? 112 TRP B CD1   1 
ATOM   4177 C  CD2   . TRP B 1 112 ? 24.936  66.643 -5.533  1.00 32.62 ? 112 TRP B CD2   1 
ATOM   4178 N  NE1   . TRP B 1 112 ? 25.202  68.320 -6.999  1.00 33.13 ? 112 TRP B NE1   1 
ATOM   4179 C  CE2   . TRP B 1 112 ? 24.385  67.270 -6.675  1.00 32.07 ? 112 TRP B CE2   1 
ATOM   4180 C  CE3   . TRP B 1 112 ? 24.283  65.529 -4.994  1.00 31.98 ? 112 TRP B CE3   1 
ATOM   4181 C  CZ2   . TRP B 1 112 ? 23.213  66.820 -7.286  1.00 30.74 ? 112 TRP B CZ2   1 
ATOM   4182 C  CZ3   . TRP B 1 112 ? 23.114  65.081 -5.602  1.00 31.01 ? 112 TRP B CZ3   1 
ATOM   4183 C  CH2   . TRP B 1 112 ? 22.593  65.727 -6.736  1.00 31.21 ? 112 TRP B CH2   1 
ATOM   4184 N  N     . CYS B 1 113 ? 24.864  66.826 -1.803  1.00 35.30 ? 113 CYS B N     1 
ATOM   4185 C  CA    . CYS B 1 113 ? 23.491  66.549 -1.398  1.00 34.96 ? 113 CYS B CA    1 
ATOM   4186 C  C     . CYS B 1 113 ? 22.882  67.656 -0.528  1.00 34.54 ? 113 CYS B C     1 
ATOM   4187 O  O     . CYS B 1 113 ? 21.811  68.171 -0.848  1.00 35.06 ? 113 CYS B O     1 
ATOM   4188 C  CB    . CYS B 1 113 ? 23.429  65.207 -0.674  1.00 35.48 ? 113 CYS B CB    1 
ATOM   4189 S  SG    . CYS B 1 113 ? 23.953  63.832 -1.722  1.00 34.33 ? 113 CYS B SG    1 
ATOM   4190 N  N     . ILE B 1 114 ? 23.552  68.022 0.564   1.00 34.21 ? 114 ILE B N     1 
ATOM   4191 C  CA    . ILE B 1 114 ? 23.037  69.076 1.441   1.00 34.15 ? 114 ILE B CA    1 
ATOM   4192 C  C     . ILE B 1 114 ? 22.596  70.263 0.597   1.00 34.08 ? 114 ILE B C     1 
ATOM   4193 O  O     . ILE B 1 114 ? 21.452  70.717 0.693   1.00 33.32 ? 114 ILE B O     1 
ATOM   4194 C  CB    . ILE B 1 114 ? 24.114  69.582 2.448   1.00 34.51 ? 114 ILE B CB    1 
ATOM   4195 C  CG1   . ILE B 1 114 ? 24.531  68.453 3.395   1.00 34.30 ? 114 ILE B CG1   1 
ATOM   4196 C  CG2   . ILE B 1 114 ? 23.576  70.771 3.243   1.00 32.37 ? 114 ILE B CG2   1 
ATOM   4197 C  CD1   . ILE B 1 114 ? 25.630  68.856 4.379   1.00 35.55 ? 114 ILE B CD1   1 
ATOM   4198 N  N     . GLU B 1 115 ? 23.510  70.746 -0.245  1.00 33.92 ? 115 GLU B N     1 
ATOM   4199 C  CA    . GLU B 1 115 ? 23.240  71.904 -1.096  1.00 33.86 ? 115 GLU B CA    1 
ATOM   4200 C  C     . GLU B 1 115 ? 21.952  71.770 -1.900  1.00 33.23 ? 115 GLU B C     1 
ATOM   4201 O  O     . GLU B 1 115 ? 21.182  72.728 -1.997  1.00 33.61 ? 115 GLU B O     1 
ATOM   4202 C  CB    . GLU B 1 115 ? 24.436  72.169 -2.020  1.00 33.44 ? 115 GLU B CB    1 
ATOM   4203 C  CG    . GLU B 1 115 ? 25.730  72.360 -1.234  1.00 35.03 ? 115 GLU B CG    1 
ATOM   4204 C  CD    . GLU B 1 115 ? 26.910  72.772 -2.090  1.00 34.62 ? 115 GLU B CD    1 
ATOM   4205 O  OE1   . GLU B 1 115 ? 27.166  72.093 -3.109  1.00 33.40 ? 115 GLU B OE1   1 
ATOM   4206 O  OE2   . GLU B 1 115 ? 27.588  73.765 -1.725  1.00 34.37 ? 115 GLU B OE2   1 
ATOM   4207 N  N     . GLN B 1 116 ? 21.701  70.586 -2.452  1.00 32.18 ? 116 GLN B N     1 
ATOM   4208 C  CA    . GLN B 1 116 ? 20.493  70.359 -3.242  1.00 31.38 ? 116 GLN B CA    1 
ATOM   4209 C  C     . GLN B 1 116 ? 19.203  70.535 -2.438  1.00 31.22 ? 116 GLN B C     1 
ATOM   4210 O  O     . GLN B 1 116 ? 18.124  70.595 -3.022  1.00 32.23 ? 116 GLN B O     1 
ATOM   4211 C  CB    . GLN B 1 116 ? 20.495  68.955 -3.852  1.00 31.34 ? 116 GLN B CB    1 
ATOM   4212 C  CG    . GLN B 1 116 ? 21.776  68.598 -4.584  1.00 33.48 ? 116 GLN B CG    1 
ATOM   4213 C  CD    . GLN B 1 116 ? 22.195  69.665 -5.569  1.00 34.20 ? 116 GLN B CD    1 
ATOM   4214 O  OE1   . GLN B 1 116 ? 21.451  70.000 -6.493  1.00 35.13 ? 116 GLN B OE1   1 
ATOM   4215 N  NE2   . GLN B 1 116 ? 23.392  70.214 -5.373  1.00 34.40 ? 116 GLN B NE2   1 
ATOM   4216 N  N     . THR B 1 117 ? 19.296  70.617 -1.112  1.00 29.93 ? 117 THR B N     1 
ATOM   4217 C  CA    . THR B 1 117 ? 18.088  70.772 -0.297  1.00 28.50 ? 117 THR B CA    1 
ATOM   4218 C  C     . THR B 1 117 ? 17.813  72.217 0.129   1.00 28.28 ? 117 THR B C     1 
ATOM   4219 O  O     . THR B 1 117 ? 16.700  72.547 0.533   1.00 27.93 ? 117 THR B O     1 
ATOM   4220 C  CB    . THR B 1 117 ? 18.162  69.913 0.977   1.00 28.38 ? 117 THR B CB    1 
ATOM   4221 O  OG1   . THR B 1 117 ? 19.179  70.430 1.838   1.00 29.74 ? 117 THR B OG1   1 
ATOM   4222 C  CG2   . THR B 1 117 ? 18.510  68.471 0.633   1.00 28.76 ? 117 THR B CG2   1 
ATOM   4223 N  N     . LEU B 1 118 ? 18.826  73.073 0.030   1.00 28.03 ? 118 LEU B N     1 
ATOM   4224 C  CA    . LEU B 1 118 ? 18.699  74.469 0.418   1.00 28.32 ? 118 LEU B CA    1 
ATOM   4225 C  C     . LEU B 1 118 ? 17.584  75.247 -0.299  1.00 28.87 ? 118 LEU B C     1 
ATOM   4226 O  O     . LEU B 1 118 ? 16.828  75.983 0.348   1.00 29.31 ? 118 LEU B O     1 
ATOM   4227 C  CB    . LEU B 1 118 ? 20.033  75.186 0.205   1.00 28.54 ? 118 LEU B CB    1 
ATOM   4228 C  CG    . LEU B 1 118 ? 21.265  74.554 0.855   1.00 28.69 ? 118 LEU B CG    1 
ATOM   4229 C  CD1   . LEU B 1 118 ? 22.492  75.387 0.529   1.00 29.89 ? 118 LEU B CD1   1 
ATOM   4230 C  CD2   . LEU B 1 118 ? 21.076  74.466 2.358   1.00 28.96 ? 118 LEU B CD2   1 
ATOM   4231 N  N     . TYR B 1 119 ? 17.471  75.101 -1.621  1.00 28.97 ? 119 TYR B N     1 
ATOM   4232 C  CA    . TYR B 1 119 ? 16.446  75.846 -2.361  1.00 28.74 ? 119 TYR B CA    1 
ATOM   4233 C  C     . TYR B 1 119 ? 15.222  75.062 -2.815  1.00 29.75 ? 119 TYR B C     1 
ATOM   4234 O  O     . TYR B 1 119 ? 15.334  74.002 -3.431  1.00 30.41 ? 119 TYR B O     1 
ATOM   4235 C  CB    . TYR B 1 119 ? 17.061  76.552 -3.574  1.00 26.03 ? 119 TYR B CB    1 
ATOM   4236 C  CG    . TYR B 1 119 ? 18.188  77.501 -3.229  1.00 24.30 ? 119 TYR B CG    1 
ATOM   4237 C  CD1   . TYR B 1 119 ? 19.492  77.029 -3.043  1.00 23.81 ? 119 TYR B CD1   1 
ATOM   4238 C  CD2   . TYR B 1 119 ? 17.948  78.872 -3.056  1.00 22.24 ? 119 TYR B CD2   1 
ATOM   4239 C  CE1   . TYR B 1 119 ? 20.535  77.903 -2.695  1.00 22.77 ? 119 TYR B CE1   1 
ATOM   4240 C  CE2   . TYR B 1 119 ? 18.978  79.749 -2.708  1.00 21.45 ? 119 TYR B CE2   1 
ATOM   4241 C  CZ    . TYR B 1 119 ? 20.267  79.255 -2.532  1.00 21.59 ? 119 TYR B CZ    1 
ATOM   4242 O  OH    . TYR B 1 119 ? 21.296  80.092 -2.198  1.00 20.38 ? 119 TYR B OH    1 
ATOM   4243 N  N     . PHE B 1 120 ? 14.050  75.609 -2.512  1.00 31.26 ? 120 PHE B N     1 
ATOM   4244 C  CA    . PHE B 1 120 ? 12.773  74.991 -2.870  1.00 33.26 ? 120 PHE B CA    1 
ATOM   4245 C  C     . PHE B 1 120 ? 12.127  75.704 -4.062  1.00 34.87 ? 120 PHE B C     1 
ATOM   4246 O  O     . PHE B 1 120 ? 12.572  76.783 -4.480  1.00 34.49 ? 120 PHE B O     1 
ATOM   4247 C  CB    . PHE B 1 120 ? 11.813  75.026 -1.672  1.00 33.47 ? 120 PHE B CB    1 
ATOM   4248 C  CG    . PHE B 1 120 ? 12.268  74.201 -0.503  1.00 34.36 ? 120 PHE B CG    1 
ATOM   4249 C  CD1   . PHE B 1 120 ? 13.504  74.432 0.097   1.00 35.34 ? 120 PHE B CD1   1 
ATOM   4250 C  CD2   . PHE B 1 120 ? 11.465  73.182 -0.007  1.00 34.51 ? 120 PHE B CD2   1 
ATOM   4251 C  CE1   . PHE B 1 120 ? 13.933  73.658 1.173   1.00 34.63 ? 120 PHE B CE1   1 
ATOM   4252 C  CE2   . PHE B 1 120 ? 11.882  72.401 1.070   1.00 34.10 ? 120 PHE B CE2   1 
ATOM   4253 C  CZ    . PHE B 1 120 ? 13.120  72.639 1.659   1.00 34.49 ? 120 PHE B CZ    1 
ATOM   4254 N  N     . LYS B 1 121 ? 11.062  75.105 -4.592  1.00 35.81 ? 121 LYS B N     1 
ATOM   4255 C  CA    . LYS B 1 121 ? 10.370  75.670 -5.744  1.00 36.89 ? 121 LYS B CA    1 
ATOM   4256 C  C     . LYS B 1 121 ? 9.793   77.049 -5.482  1.00 36.84 ? 121 LYS B C     1 
ATOM   4257 O  O     . LYS B 1 121 ? 9.468   77.786 -6.417  1.00 37.26 ? 121 LYS B O     1 
ATOM   4258 C  CB    . LYS B 1 121 ? 9.256   74.726 -6.221  1.00 38.20 ? 121 LYS B CB    1 
ATOM   4259 C  CG    . LYS B 1 121 ? 8.468   75.258 -7.434  1.00 39.37 ? 121 LYS B CG    1 
ATOM   4260 C  CD    . LYS B 1 121 ? 7.651   74.164 -8.142  1.00 40.41 ? 121 LYS B CD    1 
ATOM   4261 C  CE    . LYS B 1 121 ? 8.575   73.114 -8.785  1.00 40.83 ? 121 LYS B CE    1 
ATOM   4262 N  NZ    . LYS B 1 121 ? 7.844   72.062 -9.561  1.00 41.60 ? 121 LYS B NZ    1 
ATOM   4263 N  N     . ASP B 1 122 ? 9.674   77.407 -4.214  1.00 36.42 ? 122 ASP B N     1 
ATOM   4264 C  CA    . ASP B 1 122 ? 9.124   78.702 -3.873  1.00 36.50 ? 122 ASP B CA    1 
ATOM   4265 C  C     . ASP B 1 122 ? 10.005  79.485 -2.916  1.00 35.80 ? 122 ASP B C     1 
ATOM   4266 O  O     . ASP B 1 122 ? 9.516   80.265 -2.104  1.00 36.41 ? 122 ASP B O     1 
ATOM   4267 C  CB    . ASP B 1 122 ? 7.716   78.522 -3.312  1.00 37.71 ? 122 ASP B CB    1 
ATOM   4268 C  CG    . ASP B 1 122 ? 7.627   77.378 -2.333  1.00 39.95 ? 122 ASP B CG    1 
ATOM   4269 O  OD1   . ASP B 1 122 ? 7.977   76.239 -2.715  1.00 40.51 ? 122 ASP B OD1   1 
ATOM   4270 O  OD2   . ASP B 1 122 ? 7.201   77.611 -1.183  1.00 43.00 ? 122 ASP B OD2   1 
ATOM   4271 N  N     . GLY B 1 123 ? 11.312  79.273 -3.024  1.00 34.61 ? 123 GLY B N     1 
ATOM   4272 C  CA    . GLY B 1 123 ? 12.242  79.996 -2.179  1.00 33.94 ? 123 GLY B CA    1 
ATOM   4273 C  C     . GLY B 1 123 ? 13.109  79.145 -1.274  1.00 33.66 ? 123 GLY B C     1 
ATOM   4274 O  O     . GLY B 1 123 ? 12.997  77.921 -1.268  1.00 33.63 ? 123 GLY B O     1 
ATOM   4275 N  N     . PRO B 1 124 ? 14.015  79.780 -0.514  1.00 33.46 ? 124 PRO B N     1 
ATOM   4276 C  CA    . PRO B 1 124 ? 14.931  79.122 0.423   1.00 32.76 ? 124 PRO B CA    1 
ATOM   4277 C  C     . PRO B 1 124 ? 14.211  78.598 1.673   1.00 31.83 ? 124 PRO B C     1 
ATOM   4278 O  O     . PRO B 1 124 ? 13.101  79.019 2.006   1.00 30.58 ? 124 PRO B O     1 
ATOM   4279 C  CB    . PRO B 1 124 ? 15.923  80.239 0.768   1.00 34.03 ? 124 PRO B CB    1 
ATOM   4280 C  CG    . PRO B 1 124 ? 15.802  81.200 -0.425  1.00 33.99 ? 124 PRO B CG    1 
ATOM   4281 C  CD    . PRO B 1 124 ? 14.302  81.222 -0.541  1.00 33.49 ? 124 PRO B CD    1 
ATOM   4282 N  N     . LEU B 1 125 ? 14.881  77.683 2.359   1.00 31.18 ? 125 LEU B N     1 
ATOM   4283 C  CA    . LEU B 1 125 ? 14.381  77.052 3.571   1.00 29.47 ? 125 LEU B CA    1 
ATOM   4284 C  C     . LEU B 1 125 ? 13.888  78.019 4.648   1.00 29.81 ? 125 LEU B C     1 
ATOM   4285 O  O     . LEU B 1 125 ? 14.441  79.103 4.816   1.00 30.94 ? 125 LEU B O     1 
ATOM   4286 C  CB    . LEU B 1 125 ? 15.488  76.167 4.149   1.00 27.83 ? 125 LEU B CB    1 
ATOM   4287 C  CG    . LEU B 1 125 ? 16.866  76.807 4.392   1.00 26.60 ? 125 LEU B CG    1 
ATOM   4288 C  CD1   . LEU B 1 125 ? 17.744  75.811 5.118   1.00 26.96 ? 125 LEU B CD1   1 
ATOM   4289 C  CD2   . LEU B 1 125 ? 17.525  77.215 3.086   1.00 25.06 ? 125 LEU B CD2   1 
ATOM   4290 N  N     . ASN B 1 126 ? 12.843  77.616 5.372   1.00 29.53 ? 126 ASN B N     1 
ATOM   4291 C  CA    . ASN B 1 126 ? 12.291  78.414 6.469   1.00 29.60 ? 126 ASN B CA    1 
ATOM   4292 C  C     . ASN B 1 126 ? 12.818  77.825 7.759   1.00 29.84 ? 126 ASN B C     1 
ATOM   4293 O  O     . ASN B 1 126 ? 12.970  78.517 8.773   1.00 30.61 ? 126 ASN B O     1 
ATOM   4294 C  CB    . ASN B 1 126 ? 10.775  78.292 6.569   1.00 30.73 ? 126 ASN B CB    1 
ATOM   4295 C  CG    . ASN B 1 126 ? 10.073  78.713 5.328   1.00 32.15 ? 126 ASN B CG    1 
ATOM   4296 O  OD1   . ASN B 1 126 ? 10.327  79.792 4.792   1.00 34.71 ? 126 ASN B OD1   1 
ATOM   4297 N  ND2   . ASN B 1 126 ? 9.155   77.877 4.863   1.00 32.11 ? 126 ASN B ND2   1 
HETATM 4298 N  N     . MSE B 1 127 ? 13.070  76.522 7.704   1.00 29.49 ? 127 MSE B N     1 
HETATM 4299 C  CA    . MSE B 1 127 ? 13.519  75.771 8.858   1.00 29.81 ? 127 MSE B CA    1 
HETATM 4300 C  C     . MSE B 1 127 ? 14.708  74.854 8.601   1.00 30.48 ? 127 MSE B C     1 
HETATM 4301 O  O     . MSE B 1 127 ? 14.997  74.473 7.465   1.00 30.91 ? 127 MSE B O     1 
HETATM 4302 C  CB    . MSE B 1 127 ? 12.344  74.940 9.365   1.00 29.66 ? 127 MSE B CB    1 
HETATM 4303 C  CG    . MSE B 1 127 ? 11.173  75.789 9.800   1.00 29.08 ? 127 MSE B CG    1 
HETATM 4304 SE SE    . MSE B 1 127 ? 11.615  76.590 11.395  1.00 30.07 ? 127 MSE B SE    1 
HETATM 4305 C  CE    . MSE B 1 127 ? 10.082  77.539 11.639  1.00 28.48 ? 127 MSE B CE    1 
ATOM   4306 N  N     . ILE B 1 128 ? 15.400  74.515 9.683   1.00 30.64 ? 128 ILE B N     1 
ATOM   4307 C  CA    . ILE B 1 128 ? 16.532  73.606 9.624   1.00 30.34 ? 128 ILE B CA    1 
ATOM   4308 C  C     . ILE B 1 128 ? 16.338  72.504 10.659  1.00 31.11 ? 128 ILE B C     1 
ATOM   4309 O  O     . ILE B 1 128 ? 16.216  72.779 11.855  1.00 32.79 ? 128 ILE B O     1 
ATOM   4310 C  CB    . ILE B 1 128 ? 17.870  74.291 9.946   1.00 29.42 ? 128 ILE B CB    1 
ATOM   4311 C  CG1   . ILE B 1 128 ? 18.203  75.342 8.889   1.00 29.79 ? 128 ILE B CG1   1 
ATOM   4312 C  CG2   . ILE B 1 128 ? 18.970  73.244 10.013  1.00 28.76 ? 128 ILE B CG2   1 
ATOM   4313 C  CD1   . ILE B 1 128 ? 19.536  76.033 9.122   1.00 28.61 ? 128 ILE B CD1   1 
ATOM   4314 N  N     . LEU B 1 129 ? 16.273  71.260 10.197  1.00 30.59 ? 129 LEU B N     1 
ATOM   4315 C  CA    . LEU B 1 129 ? 16.155  70.129 11.105  1.00 30.42 ? 129 LEU B CA    1 
ATOM   4316 C  C     . LEU B 1 129 ? 17.511  69.488 10.869  1.00 30.60 ? 129 LEU B C     1 
ATOM   4317 O  O     . LEU B 1 129 ? 17.737  68.870 9.829   1.00 30.28 ? 129 LEU B O     1 
ATOM   4318 C  CB    . LEU B 1 129 ? 15.019  69.191 10.691  1.00 30.10 ? 129 LEU B CB    1 
ATOM   4319 C  CG    . LEU B 1 129 ? 14.587  68.194 11.779  1.00 29.58 ? 129 LEU B CG    1 
ATOM   4320 C  CD1   . LEU B 1 129 ? 13.300  67.510 11.373  1.00 29.83 ? 129 LEU B CD1   1 
ATOM   4321 C  CD2   . LEU B 1 129 ? 15.679  67.179 12.031  1.00 29.78 ? 129 LEU B CD2   1 
ATOM   4322 N  N     . ASP B 1 130 ? 18.411  69.658 11.836  1.00 30.47 ? 130 ASP B N     1 
ATOM   4323 C  CA    . ASP B 1 130 ? 19.778  69.168 11.712  1.00 29.68 ? 130 ASP B CA    1 
ATOM   4324 C  C     . ASP B 1 130 ? 20.160  68.087 12.736  1.00 30.01 ? 130 ASP B C     1 
ATOM   4325 O  O     . ASP B 1 130 ? 19.565  67.985 13.814  1.00 30.57 ? 130 ASP B O     1 
ATOM   4326 C  CB    . ASP B 1 130 ? 20.722  70.365 11.866  1.00 29.12 ? 130 ASP B CB    1 
ATOM   4327 C  CG    . ASP B 1 130 ? 22.044  70.171 11.165  1.00 29.10 ? 130 ASP B CG    1 
ATOM   4328 O  OD1   . ASP B 1 130 ? 22.426  69.011 10.904  1.00 30.09 ? 130 ASP B OD1   1 
ATOM   4329 O  OD2   . ASP B 1 130 ? 22.714  71.189 10.893  1.00 27.88 ? 130 ASP B OD2   1 
ATOM   4330 N  N     . ASP B 1 131 ? 21.162  67.287 12.380  1.00 29.83 ? 131 ASP B N     1 
ATOM   4331 C  CA    . ASP B 1 131 ? 21.692  66.234 13.247  1.00 29.68 ? 131 ASP B CA    1 
ATOM   4332 C  C     . ASP B 1 131 ? 23.213  66.262 13.068  1.00 29.00 ? 131 ASP B C     1 
ATOM   4333 O  O     . ASP B 1 131 ? 23.751  65.634 12.153  1.00 27.60 ? 131 ASP B O     1 
ATOM   4334 C  CB    . ASP B 1 131 ? 21.166  64.856 12.830  1.00 31.84 ? 131 ASP B CB    1 
ATOM   4335 C  CG    . ASP B 1 131 ? 21.616  63.738 13.781  1.00 33.74 ? 131 ASP B CG    1 
ATOM   4336 O  OD1   . ASP B 1 131 ? 22.804  63.729 14.186  1.00 33.67 ? 131 ASP B OD1   1 
ATOM   4337 O  OD2   . ASP B 1 131 ? 20.786  62.857 14.107  1.00 33.88 ? 131 ASP B OD2   1 
ATOM   4338 N  N     . GLY B 1 132 ? 23.903  66.997 13.933  1.00 29.30 ? 132 GLY B N     1 
ATOM   4339 C  CA    . GLY B 1 132 ? 25.349  67.089 13.828  1.00 30.34 ? 132 GLY B CA    1 
ATOM   4340 C  C     . GLY B 1 132 ? 25.821  68.514 13.604  1.00 30.85 ? 132 GLY B C     1 
ATOM   4341 O  O     . GLY B 1 132 ? 26.976  68.858 13.863  1.00 30.36 ? 132 GLY B O     1 
ATOM   4342 N  N     . GLY B 1 133 ? 24.921  69.350 13.103  1.00 32.38 ? 133 GLY B N     1 
ATOM   4343 C  CA    . GLY B 1 133 ? 25.261  70.739 12.867  1.00 33.41 ? 133 GLY B CA    1 
ATOM   4344 C  C     . GLY B 1 133 ? 25.845  71.046 11.504  1.00 33.24 ? 133 GLY B C     1 
ATOM   4345 O  O     . GLY B 1 133 ? 26.174  72.198 11.237  1.00 33.41 ? 133 GLY B O     1 
ATOM   4346 N  N     . ASP B 1 134 ? 25.976  70.045 10.633  1.00 33.43 ? 134 ASP B N     1 
ATOM   4347 C  CA    . ASP B 1 134 ? 26.545  70.308 9.315   1.00 33.47 ? 134 ASP B CA    1 
ATOM   4348 C  C     . ASP B 1 134 ? 25.713  71.282 8.499   1.00 33.33 ? 134 ASP B C     1 
ATOM   4349 O  O     . ASP B 1 134 ? 26.253  72.206 7.891   1.00 34.03 ? 134 ASP B O     1 
ATOM   4350 C  CB    . ASP B 1 134 ? 26.743  69.021 8.512   1.00 33.16 ? 134 ASP B CB    1 
ATOM   4351 C  CG    . ASP B 1 134 ? 27.923  68.203 9.002   1.00 33.99 ? 134 ASP B CG    1 
ATOM   4352 O  OD1   . ASP B 1 134 ? 28.984  68.806 9.288   1.00 33.02 ? 134 ASP B OD1   1 
ATOM   4353 O  OD2   . ASP B 1 134 ? 27.799  66.959 9.074   1.00 35.56 ? 134 ASP B OD2   1 
ATOM   4354 N  N     . LEU B 1 135 ? 24.399  71.093 8.486   1.00 32.82 ? 135 LEU B N     1 
ATOM   4355 C  CA    . LEU B 1 135 ? 23.546  71.991 7.719   1.00 32.24 ? 135 LEU B CA    1 
ATOM   4356 C  C     . LEU B 1 135 ? 23.622  73.396 8.317   1.00 32.79 ? 135 LEU B C     1 
ATOM   4357 O  O     . LEU B 1 135 ? 24.003  74.348 7.634   1.00 32.65 ? 135 LEU B O     1 
ATOM   4358 C  CB    . LEU B 1 135 ? 22.099  71.509 7.739   1.00 31.35 ? 135 LEU B CB    1 
ATOM   4359 C  CG    . LEU B 1 135 ? 21.186  72.003 6.614   1.00 30.12 ? 135 LEU B CG    1 
ATOM   4360 C  CD1   . LEU B 1 135 ? 19.750  71.673 6.983   1.00 29.07 ? 135 LEU B CD1   1 
ATOM   4361 C  CD2   . LEU B 1 135 ? 21.325  73.492 6.411   1.00 30.96 ? 135 LEU B CD2   1 
ATOM   4362 N  N     . THR B 1 136 ? 23.261  73.521 9.592   1.00 33.26 ? 136 THR B N     1 
ATOM   4363 C  CA    . THR B 1 136 ? 23.295  74.817 10.262  1.00 33.50 ? 136 THR B CA    1 
ATOM   4364 C  C     . THR B 1 136 ? 24.680  75.455 10.158  1.00 32.90 ? 136 THR B C     1 
ATOM   4365 O  O     . THR B 1 136 ? 24.802  76.674 10.063  1.00 33.62 ? 136 THR B O     1 
ATOM   4366 C  CB    . THR B 1 136 ? 22.900  74.708 11.763  1.00 34.17 ? 136 THR B CB    1 
ATOM   4367 O  OG1   . THR B 1 136 ? 23.847  73.889 12.455  1.00 36.08 ? 136 THR B OG1   1 
ATOM   4368 C  CG2   . THR B 1 136 ? 21.516  74.089 11.909  1.00 35.20 ? 136 THR B CG2   1 
ATOM   4369 N  N     . ASN B 1 137 ? 25.723  74.637 10.160  1.00 32.18 ? 137 ASN B N     1 
ATOM   4370 C  CA    . ASN B 1 137 ? 27.069  75.175 10.066  1.00 32.14 ? 137 ASN B CA    1 
ATOM   4371 C  C     . ASN B 1 137 ? 27.330  75.686 8.649   1.00 32.43 ? 137 ASN B C     1 
ATOM   4372 O  O     . ASN B 1 137 ? 27.881  76.779 8.467   1.00 33.46 ? 137 ASN B O     1 
ATOM   4373 C  CB    . ASN B 1 137 ? 28.091  74.104 10.442  1.00 32.79 ? 137 ASN B CB    1 
ATOM   4374 C  CG    . ASN B 1 137 ? 29.483  74.670 10.637  1.00 33.85 ? 137 ASN B CG    1 
ATOM   4375 O  OD1   . ASN B 1 137 ? 30.138  75.091 9.683   1.00 33.76 ? 137 ASN B OD1   1 
ATOM   4376 N  ND2   . ASN B 1 137 ? 29.937  74.699 11.891  1.00 35.58 ? 137 ASN B ND2   1 
ATOM   4377 N  N     . LEU B 1 138 ? 26.930  74.899 7.648   1.00 31.52 ? 138 LEU B N     1 
ATOM   4378 C  CA    . LEU B 1 138 ? 27.110  75.284 6.248   1.00 30.26 ? 138 LEU B CA    1 
ATOM   4379 C  C     . LEU B 1 138 ? 26.437  76.629 5.967   1.00 30.77 ? 138 LEU B C     1 
ATOM   4380 O  O     . LEU B 1 138 ? 27.059  77.543 5.427   1.00 31.47 ? 138 LEU B O     1 
ATOM   4381 C  CB    . LEU B 1 138 ? 26.540  74.202 5.312   1.00 28.44 ? 138 LEU B CB    1 
ATOM   4382 C  CG    . LEU B 1 138 ? 26.570  74.434 3.786   1.00 26.60 ? 138 LEU B CG    1 
ATOM   4383 C  CD1   . LEU B 1 138 ? 27.971  74.774 3.313   1.00 24.75 ? 138 LEU B CD1   1 
ATOM   4384 C  CD2   . LEU B 1 138 ? 26.068  73.198 3.076   1.00 24.68 ? 138 LEU B CD2   1 
ATOM   4385 N  N     . ILE B 1 139 ? 25.169  76.757 6.335   1.00 30.73 ? 139 ILE B N     1 
ATOM   4386 C  CA    . ILE B 1 139 ? 24.476  78.005 6.108   1.00 30.88 ? 139 ILE B CA    1 
ATOM   4387 C  C     . ILE B 1 139 ? 25.167  79.184 6.782   1.00 32.17 ? 139 ILE B C     1 
ATOM   4388 O  O     . ILE B 1 139 ? 25.470  80.168 6.122   1.00 34.17 ? 139 ILE B O     1 
ATOM   4389 C  CB    . ILE B 1 139 ? 23.026  77.911 6.560   1.00 29.87 ? 139 ILE B CB    1 
ATOM   4390 C  CG1   . ILE B 1 139 ? 22.274  77.024 5.573   1.00 30.19 ? 139 ILE B CG1   1 
ATOM   4391 C  CG2   . ILE B 1 139 ? 22.409  79.294 6.660   1.00 29.39 ? 139 ILE B CG2   1 
ATOM   4392 C  CD1   . ILE B 1 139 ? 20.808  76.873 5.872   1.00 33.00 ? 139 ILE B CD1   1 
ATOM   4393 N  N     . HIS B 1 140 ? 25.427  79.103 8.082   1.00 33.16 ? 140 HIS B N     1 
ATOM   4394 C  CA    . HIS B 1 140 ? 26.096  80.212 8.758   1.00 34.49 ? 140 HIS B CA    1 
ATOM   4395 C  C     . HIS B 1 140 ? 27.439  80.586 8.119   1.00 35.71 ? 140 HIS B C     1 
ATOM   4396 O  O     . HIS B 1 140 ? 27.843  81.754 8.148   1.00 36.20 ? 140 HIS B O     1 
ATOM   4397 C  CB    . HIS B 1 140 ? 26.338  79.899 10.239  1.00 34.01 ? 140 HIS B CB    1 
ATOM   4398 C  CG    . HIS B 1 140 ? 25.159  80.162 11.120  1.00 33.92 ? 140 HIS B CG    1 
ATOM   4399 N  ND1   . HIS B 1 140 ? 23.992  79.436 11.045  1.00 33.57 ? 140 HIS B ND1   1 
ATOM   4400 C  CD2   . HIS B 1 140 ? 24.968  81.083 12.094  1.00 34.45 ? 140 HIS B CD2   1 
ATOM   4401 C  CE1   . HIS B 1 140 ? 23.132  79.897 11.936  1.00 34.79 ? 140 HIS B CE1   1 
ATOM   4402 N  NE2   . HIS B 1 140 ? 23.699  80.897 12.586  1.00 35.08 ? 140 HIS B NE2   1 
ATOM   4403 N  N     . THR B 1 141 ? 28.131  79.613 7.536   1.00 35.86 ? 141 THR B N     1 
ATOM   4404 C  CA    . THR B 1 141 ? 29.428  79.908 6.942   1.00 36.49 ? 141 THR B CA    1 
ATOM   4405 C  C     . THR B 1 141 ? 29.462  80.128 5.425   1.00 36.66 ? 141 THR B C     1 
ATOM   4406 O  O     . THR B 1 141 ? 30.299  80.886 4.933   1.00 37.93 ? 141 THR B O     1 
ATOM   4407 C  CB    . THR B 1 141 ? 30.452  78.826 7.311   1.00 36.62 ? 141 THR B CB    1 
ATOM   4408 O  OG1   . THR B 1 141 ? 30.095  77.582 6.692   1.00 36.36 ? 141 THR B OG1   1 
ATOM   4409 C  CG2   . THR B 1 141 ? 30.482  78.647 8.819   1.00 36.79 ? 141 THR B CG2   1 
ATOM   4410 N  N     . LYS B 1 142 ? 28.569  79.490 4.676   1.00 36.05 ? 142 LYS B N     1 
ATOM   4411 C  CA    . LYS B 1 142 ? 28.569  79.675 3.227   1.00 35.30 ? 142 LYS B CA    1 
ATOM   4412 C  C     . LYS B 1 142 ? 27.298  80.295 2.667   1.00 34.97 ? 142 LYS B C     1 
ATOM   4413 O  O     . LYS B 1 142 ? 27.258  80.653 1.496   1.00 35.91 ? 142 LYS B O     1 
ATOM   4414 C  CB    . LYS B 1 142 ? 28.823  78.351 2.507   1.00 35.93 ? 142 LYS B CB    1 
ATOM   4415 C  CG    . LYS B 1 142 ? 30.135  77.670 2.870   1.00 37.04 ? 142 LYS B CG    1 
ATOM   4416 C  CD    . LYS B 1 142 ? 31.351  78.537 2.573   1.00 38.60 ? 142 LYS B CD    1 
ATOM   4417 C  CE    . LYS B 1 142 ? 32.639  77.789 2.927   1.00 40.35 ? 142 LYS B CE    1 
ATOM   4418 N  NZ    . LYS B 1 142 ? 33.882  78.612 2.778   1.00 41.02 ? 142 LYS B NZ    1 
ATOM   4419 N  N     . TYR B 1 143 ? 26.253  80.410 3.478   1.00 34.29 ? 143 TYR B N     1 
ATOM   4420 C  CA    . TYR B 1 143 ? 25.012  81.019 3.004   1.00 33.99 ? 143 TYR B CA    1 
ATOM   4421 C  C     . TYR B 1 143 ? 24.416  81.997 4.014   1.00 34.73 ? 143 TYR B C     1 
ATOM   4422 O  O     . TYR B 1 143 ? 23.197  82.028 4.210   1.00 35.49 ? 143 TYR B O     1 
ATOM   4423 C  CB    . TYR B 1 143 ? 23.964  79.951 2.676   1.00 32.91 ? 143 TYR B CB    1 
ATOM   4424 C  CG    . TYR B 1 143 ? 24.377  78.968 1.611   1.00 32.70 ? 143 TYR B CG    1 
ATOM   4425 C  CD1   . TYR B 1 143 ? 25.370  78.031 1.855   1.00 33.86 ? 143 TYR B CD1   1 
ATOM   4426 C  CD2   . TYR B 1 143 ? 23.771  78.972 0.355   1.00 31.92 ? 143 TYR B CD2   1 
ATOM   4427 C  CE1   . TYR B 1 143 ? 25.753  77.113 0.878   1.00 34.62 ? 143 TYR B CE1   1 
ATOM   4428 C  CE2   . TYR B 1 143 ? 24.144  78.061 -0.634  1.00 32.46 ? 143 TYR B CE2   1 
ATOM   4429 C  CZ    . TYR B 1 143 ? 25.138  77.130 -0.364  1.00 34.12 ? 143 TYR B CZ    1 
ATOM   4430 O  OH    . TYR B 1 143 ? 25.514  76.203 -1.319  1.00 34.58 ? 143 TYR B OH    1 
ATOM   4431 N  N     . PRO B 1 144 ? 25.257  82.831 4.647   1.00 34.43 ? 144 PRO B N     1 
ATOM   4432 C  CA    . PRO B 1 144 ? 24.769  83.797 5.636   1.00 35.58 ? 144 PRO B CA    1 
ATOM   4433 C  C     . PRO B 1 144 ? 23.602  84.634 5.136   1.00 36.13 ? 144 PRO B C     1 
ATOM   4434 O  O     . PRO B 1 144 ? 22.855  85.206 5.930   1.00 36.50 ? 144 PRO B O     1 
ATOM   4435 C  CB    . PRO B 1 144 ? 26.016  84.636 5.926   1.00 36.07 ? 144 PRO B CB    1 
ATOM   4436 C  CG    . PRO B 1 144 ? 26.843  84.476 4.637   1.00 36.06 ? 144 PRO B CG    1 
ATOM   4437 C  CD    . PRO B 1 144 ? 26.710  82.990 4.476   1.00 34.71 ? 144 PRO B CD    1 
ATOM   4438 N  N     . GLN B 1 145 ? 23.456  84.672 3.811   1.00 36.71 ? 145 GLN B N     1 
ATOM   4439 C  CA    . GLN B 1 145 ? 22.410  85.428 3.127   1.00 37.63 ? 145 GLN B CA    1 
ATOM   4440 C  C     . GLN B 1 145 ? 21.018  84.824 3.289   1.00 36.82 ? 145 GLN B C     1 
ATOM   4441 O  O     . GLN B 1 145 ? 20.006  85.535 3.274   1.00 36.77 ? 145 GLN B O     1 
ATOM   4442 C  CB    . GLN B 1 145 ? 22.711  85.516 1.628   1.00 39.59 ? 145 GLN B CB    1 
ATOM   4443 C  CG    . GLN B 1 145 ? 24.097  86.014 1.263   1.00 43.94 ? 145 GLN B CG    1 
ATOM   4444 C  CD    . GLN B 1 145 ? 25.136  84.929 1.341   1.00 46.30 ? 145 GLN B CD    1 
ATOM   4445 O  OE1   . GLN B 1 145 ? 26.322  85.168 1.130   1.00 47.87 ? 145 GLN B OE1   1 
ATOM   4446 N  NE2   . GLN B 1 145 ? 24.694  83.719 1.633   1.00 48.70 ? 145 GLN B NE2   1 
ATOM   4447 N  N     . LEU B 1 146 ? 20.972  83.506 3.425   1.00 35.16 ? 146 LEU B N     1 
ATOM   4448 C  CA    . LEU B 1 146 ? 19.714  82.781 3.566   1.00 33.30 ? 146 LEU B CA    1 
ATOM   4449 C  C     . LEU B 1 146 ? 19.278  82.812 5.022   1.00 32.32 ? 146 LEU B C     1 
ATOM   4450 O  O     . LEU B 1 146 ? 18.105  82.601 5.351   1.00 32.38 ? 146 LEU B O     1 
ATOM   4451 C  CB    . LEU B 1 146 ? 19.915  81.331 3.141   1.00 32.91 ? 146 LEU B CB    1 
ATOM   4452 C  CG    . LEU B 1 146 ? 20.461  81.062 1.740   1.00 32.60 ? 146 LEU B CG    1 
ATOM   4453 C  CD1   . LEU B 1 146 ? 20.727  79.583 1.586   1.00 31.54 ? 146 LEU B CD1   1 
ATOM   4454 C  CD2   . LEU B 1 146 ? 19.471  81.537 0.694   1.00 31.77 ? 146 LEU B CD2   1 
ATOM   4455 N  N     . LEU B 1 147 ? 20.253  83.086 5.878   1.00 29.94 ? 147 LEU B N     1 
ATOM   4456 C  CA    . LEU B 1 147 ? 20.065  83.130 7.312   1.00 28.69 ? 147 LEU B CA    1 
ATOM   4457 C  C     . LEU B 1 147 ? 18.841  83.936 7.739   1.00 27.75 ? 147 LEU B C     1 
ATOM   4458 O  O     . LEU B 1 147 ? 17.902  83.383 8.310   1.00 27.59 ? 147 LEU B O     1 
ATOM   4459 C  CB    . LEU B 1 147 ? 21.344  83.669 7.945   1.00 28.09 ? 147 LEU B CB    1 
ATOM   4460 C  CG    . LEU B 1 147 ? 21.807  83.019 9.241   1.00 28.62 ? 147 LEU B CG    1 
ATOM   4461 C  CD1   . LEU B 1 147 ? 21.748  81.496 9.128   1.00 27.68 ? 147 LEU B CD1   1 
ATOM   4462 C  CD2   . LEU B 1 147 ? 23.221  83.495 9.533   1.00 28.85 ? 147 LEU B CD2   1 
ATOM   4463 N  N     . PRO B 1 148 ? 18.831  85.254 7.483   1.00 28.18 ? 148 PRO B N     1 
ATOM   4464 C  CA    . PRO B 1 148 ? 17.666  86.049 7.878   1.00 28.65 ? 148 PRO B CA    1 
ATOM   4465 C  C     . PRO B 1 148 ? 16.356  85.571 7.248   1.00 28.25 ? 148 PRO B C     1 
ATOM   4466 O  O     . PRO B 1 148 ? 15.303  86.182 7.434   1.00 28.48 ? 148 PRO B O     1 
ATOM   4467 C  CB    . PRO B 1 148 ? 18.065  87.463 7.447   1.00 28.14 ? 148 PRO B CB    1 
ATOM   4468 C  CG    . PRO B 1 148 ? 18.980  87.209 6.286   1.00 27.47 ? 148 PRO B CG    1 
ATOM   4469 C  CD    . PRO B 1 148 ? 19.846  86.136 6.889   1.00 28.95 ? 148 PRO B CD    1 
ATOM   4470 N  N     . GLY B 1 149 ? 16.430  84.473 6.502   1.00 28.46 ? 149 GLY B N     1 
ATOM   4471 C  CA    . GLY B 1 149 ? 15.241  83.914 5.882   1.00 28.40 ? 149 GLY B CA    1 
ATOM   4472 C  C     . GLY B 1 149 ? 14.761  82.693 6.650   1.00 28.77 ? 149 GLY B C     1 
ATOM   4473 O  O     . GLY B 1 149 ? 13.633  82.238 6.469   1.00 28.65 ? 149 GLY B O     1 
ATOM   4474 N  N     . ILE B 1 150 ? 15.626  82.181 7.528   1.00 29.11 ? 150 ILE B N     1 
ATOM   4475 C  CA    . ILE B 1 150 ? 15.353  80.997 8.353   1.00 28.44 ? 150 ILE B CA    1 
ATOM   4476 C  C     . ILE B 1 150 ? 14.731  81.348 9.715   1.00 28.94 ? 150 ILE B C     1 
ATOM   4477 O  O     . ILE B 1 150 ? 15.242  82.212 10.438  1.00 29.76 ? 150 ILE B O     1 
ATOM   4478 C  CB    . ILE B 1 150 ? 16.654  80.215 8.572   1.00 27.13 ? 150 ILE B CB    1 
ATOM   4479 C  CG1   . ILE B 1 150 ? 17.191  79.754 7.217   1.00 25.83 ? 150 ILE B CG1   1 
ATOM   4480 C  CG2   . ILE B 1 150 ? 16.417  79.043 9.506   1.00 26.51 ? 150 ILE B CG2   1 
ATOM   4481 C  CD1   . ILE B 1 150 ? 18.561  79.132 7.287   1.00 26.57 ? 150 ILE B CD1   1 
ATOM   4482 N  N     . ARG B 1 151 ? 13.648  80.659 10.068  1.00 27.83 ? 151 ARG B N     1 
ATOM   4483 C  CA    . ARG B 1 151 ? 12.947  80.943 11.311  1.00 27.86 ? 151 ARG B CA    1 
ATOM   4484 C  C     . ARG B 1 151 ? 13.428  80.186 12.536  1.00 28.11 ? 151 ARG B C     1 
ATOM   4485 O  O     . ARG B 1 151 ? 13.264  80.670 13.659  1.00 29.42 ? 151 ARG B O     1 
ATOM   4486 C  CB    . ARG B 1 151 ? 11.446  80.721 11.113  1.00 27.77 ? 151 ARG B CB    1 
ATOM   4487 C  CG    . ARG B 1 151 ? 10.583  81.097 12.304  1.00 27.67 ? 151 ARG B CG    1 
ATOM   4488 C  CD    . ARG B 1 151 ? 9.116   81.019 11.932  1.00 27.95 ? 151 ARG B CD    1 
ATOM   4489 N  NE    . ARG B 1 151 ? 8.806   81.928 10.833  1.00 28.71 ? 151 ARG B NE    1 
ATOM   4490 C  CZ    . ARG B 1 151 ? 7.607   82.039 10.264  1.00 28.87 ? 151 ARG B CZ    1 
ATOM   4491 N  NH1   . ARG B 1 151 ? 6.591   81.296 10.688  1.00 27.85 ? 151 ARG B NH1   1 
ATOM   4492 N  NH2   . ARG B 1 151 ? 7.423   82.897 9.265   1.00 29.04 ? 151 ARG B NH2   1 
ATOM   4493 N  N     . GLY B 1 152 ? 14.018  79.009 12.341  1.00 28.07 ? 152 GLY B N     1 
ATOM   4494 C  CA    . GLY B 1 152 ? 14.505  78.249 13.484  1.00 27.31 ? 152 GLY B CA    1 
ATOM   4495 C  C     . GLY B 1 152 ? 15.329  77.008 13.170  1.00 27.26 ? 152 GLY B C     1 
ATOM   4496 O  O     . GLY B 1 152 ? 15.174  76.396 12.107  1.00 27.28 ? 152 GLY B O     1 
ATOM   4497 N  N     . ILE B 1 153 ? 16.224  76.650 14.092  1.00 26.48 ? 153 ILE B N     1 
ATOM   4498 C  CA    . ILE B 1 153 ? 17.064  75.458 13.957  1.00 25.93 ? 153 ILE B CA    1 
ATOM   4499 C  C     . ILE B 1 153 ? 16.604  74.445 14.996  1.00 26.04 ? 153 ILE B C     1 
ATOM   4500 O  O     . ILE B 1 153 ? 16.235  74.810 16.112  1.00 27.70 ? 153 ILE B O     1 
ATOM   4501 C  CB    . ILE B 1 153 ? 18.565  75.741 14.229  1.00 25.60 ? 153 ILE B CB    1 
ATOM   4502 C  CG1   . ILE B 1 153 ? 19.179  76.544 13.085  1.00 25.71 ? 153 ILE B CG1   1 
ATOM   4503 C  CG2   . ILE B 1 153 ? 19.316  74.428 14.397  1.00 24.94 ? 153 ILE B CG2   1 
ATOM   4504 C  CD1   . ILE B 1 153 ? 20.662  76.838 13.274  1.00 25.32 ? 153 ILE B CD1   1 
ATOM   4505 N  N     . SER B 1 154 ? 16.644  73.174 14.628  1.00 25.25 ? 154 SER B N     1 
ATOM   4506 C  CA    . SER B 1 154 ? 16.228  72.097 15.514  1.00 24.50 ? 154 SER B CA    1 
ATOM   4507 C  C     . SER B 1 154 ? 17.325  71.045 15.422  1.00 23.37 ? 154 SER B C     1 
ATOM   4508 O  O     . SER B 1 154 ? 17.391  70.324 14.427  1.00 22.41 ? 154 SER B O     1 
ATOM   4509 C  CB    . SER B 1 154 ? 14.902  71.536 15.011  1.00 25.02 ? 154 SER B CB    1 
ATOM   4510 O  OG    . SER B 1 154 ? 14.346  70.617 15.925  1.00 27.25 ? 154 SER B OG    1 
ATOM   4511 N  N     . GLU B 1 155 ? 18.181  70.974 16.446  1.00 23.63 ? 155 GLU B N     1 
ATOM   4512 C  CA    . GLU B 1 155 ? 19.322  70.039 16.481  1.00 24.47 ? 155 GLU B CA    1 
ATOM   4513 C  C     . GLU B 1 155 ? 19.024  68.792 17.299  1.00 25.03 ? 155 GLU B C     1 
ATOM   4514 O  O     . GLU B 1 155 ? 18.394  68.878 18.363  1.00 25.12 ? 155 GLU B O     1 
ATOM   4515 C  CB    . GLU B 1 155 ? 20.547  70.718 17.088  1.00 25.53 ? 155 GLU B CB    1 
ATOM   4516 C  CG    . GLU B 1 155 ? 21.837  70.529 16.304  1.00 29.16 ? 155 GLU B CG    1 
ATOM   4517 C  CD    . GLU B 1 155 ? 22.127  69.085 15.952  1.00 30.18 ? 155 GLU B CD    1 
ATOM   4518 O  OE1   . GLU B 1 155 ? 22.066  68.222 16.853  1.00 31.53 ? 155 GLU B OE1   1 
ATOM   4519 O  OE2   . GLU B 1 155 ? 22.435  68.821 14.770  1.00 31.49 ? 155 GLU B OE2   1 
ATOM   4520 N  N     . GLU B 1 156 ? 19.521  67.640 16.844  1.00 24.49 ? 156 GLU B N     1 
ATOM   4521 C  CA    . GLU B 1 156 ? 19.222  66.404 17.552  1.00 23.23 ? 156 GLU B CA    1 
ATOM   4522 C  C     . GLU B 1 156 ? 20.316  65.654 18.304  1.00 23.05 ? 156 GLU B C     1 
ATOM   4523 O  O     . GLU B 1 156 ? 20.012  64.984 19.287  1.00 24.29 ? 156 GLU B O     1 
ATOM   4524 C  CB    . GLU B 1 156 ? 18.563  65.413 16.606  1.00 22.28 ? 156 GLU B CB    1 
ATOM   4525 C  CG    . GLU B 1 156 ? 17.708  64.442 17.354  1.00 23.12 ? 156 GLU B CG    1 
ATOM   4526 C  CD    . GLU B 1 156 ? 17.524  63.145 16.636  1.00 24.13 ? 156 GLU B CD    1 
ATOM   4527 O  OE1   . GLU B 1 156 ? 17.222  63.179 15.427  1.00 25.91 ? 156 GLU B OE1   1 
ATOM   4528 O  OE2   . GLU B 1 156 ? 17.669  62.090 17.291  1.00 23.99 ? 156 GLU B OE2   1 
ATOM   4529 N  N     . THR B 1 157 ? 21.569  65.730 17.872  1.00 21.60 ? 157 THR B N     1 
ATOM   4530 C  CA    . THR B 1 157 ? 22.605  64.972 18.571  1.00 21.04 ? 157 THR B CA    1 
ATOM   4531 C  C     . THR B 1 157 ? 23.522  65.822 19.432  1.00 20.77 ? 157 THR B C     1 
ATOM   4532 O  O     . THR B 1 157 ? 23.628  67.032 19.237  1.00 20.96 ? 157 THR B O     1 
ATOM   4533 C  CB    . THR B 1 157 ? 23.476  64.162 17.591  1.00 21.07 ? 157 THR B CB    1 
ATOM   4534 O  OG1   . THR B 1 157 ? 24.262  63.212 18.321  1.00 21.33 ? 157 THR B OG1   1 
ATOM   4535 C  CG2   . THR B 1 157 ? 24.417  65.083 16.836  1.00 21.08 ? 157 THR B CG2   1 
ATOM   4536 N  N     . THR B 1 158 ? 24.205  65.171 20.371  1.00 20.08 ? 158 THR B N     1 
ATOM   4537 C  CA    . THR B 1 158 ? 25.106  65.852 21.298  1.00 20.08 ? 158 THR B CA    1 
ATOM   4538 C  C     . THR B 1 158 ? 26.186  66.725 20.646  1.00 19.70 ? 158 THR B C     1 
ATOM   4539 O  O     . THR B 1 158 ? 26.406  67.864 21.063  1.00 19.34 ? 158 THR B O     1 
ATOM   4540 C  CB    . THR B 1 158 ? 25.779  64.833 22.226  1.00 20.47 ? 158 THR B CB    1 
ATOM   4541 O  OG1   . THR B 1 158 ? 24.770  63.987 22.791  1.00 22.03 ? 158 THR B OG1   1 
ATOM   4542 C  CG2   . THR B 1 158 ? 26.503  65.536 23.360  1.00 19.65 ? 158 THR B CG2   1 
ATOM   4543 N  N     . THR B 1 159 ? 26.860  66.206 19.627  1.00 19.55 ? 159 THR B N     1 
ATOM   4544 C  CA    . THR B 1 159 ? 27.903  66.989 18.976  1.00 20.41 ? 159 THR B CA    1 
ATOM   4545 C  C     . THR B 1 159 ? 27.354  68.243 18.295  1.00 20.69 ? 159 THR B C     1 
ATOM   4546 O  O     . THR B 1 159 ? 28.009  69.288 18.268  1.00 19.76 ? 159 THR B O     1 
ATOM   4547 C  CB    . THR B 1 159 ? 28.662  66.146 17.943  1.00 19.85 ? 159 THR B CB    1 
ATOM   4548 O  OG1   . THR B 1 159 ? 29.301  65.057 18.617  1.00 19.87 ? 159 THR B OG1   1 
ATOM   4549 C  CG2   . THR B 1 159 ? 29.716  66.991 17.223  1.00 17.59 ? 159 THR B CG2   1 
ATOM   4550 N  N     . GLY B 1 160 ? 26.150  68.135 17.746  1.00 21.59 ? 160 GLY B N     1 
ATOM   4551 C  CA    . GLY B 1 160 ? 25.551  69.278 17.085  1.00 22.90 ? 160 GLY B CA    1 
ATOM   4552 C  C     . GLY B 1 160 ? 25.251  70.349 18.110  1.00 23.45 ? 160 GLY B C     1 
ATOM   4553 O  O     . GLY B 1 160 ? 25.686  71.496 17.992  1.00 23.98 ? 160 GLY B O     1 
ATOM   4554 N  N     . VAL B 1 161 ? 24.501  69.957 19.131  1.00 24.28 ? 161 VAL B N     1 
ATOM   4555 C  CA    . VAL B 1 161 ? 24.124  70.863 20.203  1.00 24.77 ? 161 VAL B CA    1 
ATOM   4556 C  C     . VAL B 1 161 ? 25.339  71.499 20.862  1.00 24.79 ? 161 VAL B C     1 
ATOM   4557 O  O     . VAL B 1 161 ? 25.285  72.651 21.290  1.00 24.41 ? 161 VAL B O     1 
ATOM   4558 C  CB    . VAL B 1 161 ? 23.274  70.118 21.246  1.00 24.32 ? 161 VAL B CB    1 
ATOM   4559 C  CG1   . VAL B 1 161 ? 23.069  70.967 22.466  1.00 24.72 ? 161 VAL B CG1   1 
ATOM   4560 C  CG2   . VAL B 1 161 ? 21.931  69.773 20.633  1.00 23.50 ? 161 VAL B CG2   1 
ATOM   4561 N  N     . HIS B 1 162 ? 26.440  70.760 20.928  1.00 26.01 ? 162 HIS B N     1 
ATOM   4562 C  CA    . HIS B 1 162 ? 27.644  71.298 21.534  1.00 28.12 ? 162 HIS B CA    1 
ATOM   4563 C  C     . HIS B 1 162 ? 28.079  72.527 20.744  1.00 29.33 ? 162 HIS B C     1 
ATOM   4564 O  O     . HIS B 1 162 ? 28.382  73.558 21.335  1.00 29.74 ? 162 HIS B O     1 
ATOM   4565 C  CB    . HIS B 1 162 ? 28.744  70.237 21.554  1.00 29.01 ? 162 HIS B CB    1 
ATOM   4566 C  CG    . HIS B 1 162 ? 29.994  70.665 22.264  1.00 29.76 ? 162 HIS B CG    1 
ATOM   4567 N  ND1   . HIS B 1 162 ? 30.822  71.659 21.785  1.00 30.93 ? 162 HIS B ND1   1 
ATOM   4568 C  CD2   . HIS B 1 162 ? 30.566  70.217 23.407  1.00 29.63 ? 162 HIS B CD2   1 
ATOM   4569 C  CE1   . HIS B 1 162 ? 31.852  71.803 22.603  1.00 30.52 ? 162 HIS B CE1   1 
ATOM   4570 N  NE2   . HIS B 1 162 ? 31.720  70.941 23.595  1.00 30.41 ? 162 HIS B NE2   1 
ATOM   4571 N  N     . ASN B 1 163 ? 28.091  72.434 19.413  1.00 30.73 ? 163 ASN B N     1 
ATOM   4572 C  CA    . ASN B 1 163 ? 28.476  73.587 18.594  1.00 32.00 ? 163 ASN B CA    1 
ATOM   4573 C  C     . ASN B 1 163 ? 27.477  74.742 18.675  1.00 31.48 ? 163 ASN B C     1 
ATOM   4574 O  O     . ASN B 1 163 ? 27.877  75.907 18.611  1.00 32.65 ? 163 ASN B O     1 
ATOM   4575 C  CB    . ASN B 1 163 ? 28.693  73.200 17.115  1.00 34.07 ? 163 ASN B CB    1 
ATOM   4576 C  CG    . ASN B 1 163 ? 30.109  72.648 16.840  1.00 36.64 ? 163 ASN B CG    1 
ATOM   4577 O  OD1   . ASN B 1 163 ? 30.465  71.536 17.271  1.00 37.59 ? 163 ASN B OD1   1 
ATOM   4578 N  ND2   . ASN B 1 163 ? 30.924  73.440 16.129  1.00 36.59 ? 163 ASN B ND2   1 
ATOM   4579 N  N     . LEU B 1 164 ? 26.186  74.435 18.809  1.00 29.81 ? 164 LEU B N     1 
ATOM   4580 C  CA    . LEU B 1 164 ? 25.174  75.486 18.920  1.00 27.56 ? 164 LEU B CA    1 
ATOM   4581 C  C     . LEU B 1 164 ? 25.491  76.387 20.099  1.00 27.30 ? 164 LEU B C     1 
ATOM   4582 O  O     . LEU B 1 164 ? 25.441  77.609 19.982  1.00 27.83 ? 164 LEU B O     1 
ATOM   4583 C  CB    . LEU B 1 164 ? 23.781  74.889 19.092  1.00 26.30 ? 164 LEU B CB    1 
ATOM   4584 C  CG    . LEU B 1 164 ? 23.182  74.271 17.831  1.00 24.79 ? 164 LEU B CG    1 
ATOM   4585 C  CD1   . LEU B 1 164 ? 21.842  73.640 18.145  1.00 25.08 ? 164 LEU B CD1   1 
ATOM   4586 C  CD2   . LEU B 1 164 ? 23.008  75.355 16.783  1.00 24.96 ? 164 LEU B CD2   1 
ATOM   4587 N  N     . TYR B 1 165 ? 25.822  75.779 21.235  1.00 27.07 ? 165 TYR B N     1 
ATOM   4588 C  CA    . TYR B 1 165 ? 26.176  76.547 22.425  1.00 27.12 ? 165 TYR B CA    1 
ATOM   4589 C  C     . TYR B 1 165 ? 27.466  77.332 22.184  1.00 27.24 ? 165 TYR B C     1 
ATOM   4590 O  O     . TYR B 1 165 ? 27.604  78.474 22.633  1.00 27.00 ? 165 TYR B O     1 
ATOM   4591 C  CB    . TYR B 1 165 ? 26.338  75.624 23.643  1.00 24.80 ? 165 TYR B CB    1 
ATOM   4592 C  CG    . TYR B 1 165 ? 25.029  75.048 24.156  1.00 22.55 ? 165 TYR B CG    1 
ATOM   4593 C  CD1   . TYR B 1 165 ? 24.070  75.870 24.740  1.00 21.52 ? 165 TYR B CD1   1 
ATOM   4594 C  CD2   . TYR B 1 165 ? 24.743  73.689 24.046  1.00 21.55 ? 165 TYR B CD2   1 
ATOM   4595 C  CE1   . TYR B 1 165 ? 22.861  75.355 25.203  1.00 21.54 ? 165 TYR B CE1   1 
ATOM   4596 C  CE2   . TYR B 1 165 ? 23.531  73.166 24.509  1.00 20.75 ? 165 TYR B CE2   1 
ATOM   4597 C  CZ    . TYR B 1 165 ? 22.596  74.004 25.085  1.00 21.33 ? 165 TYR B CZ    1 
ATOM   4598 O  OH    . TYR B 1 165 ? 21.392  73.503 25.541  1.00 21.13 ? 165 TYR B OH    1 
ATOM   4599 N  N     . LYS B 1 166 ? 28.401  76.720 21.463  1.00 27.39 ? 166 LYS B N     1 
ATOM   4600 C  CA    . LYS B 1 166 ? 29.668  77.373 21.152  1.00 28.63 ? 166 LYS B CA    1 
ATOM   4601 C  C     . LYS B 1 166 ? 29.393  78.600 20.269  1.00 28.74 ? 166 LYS B C     1 
ATOM   4602 O  O     . LYS B 1 166 ? 29.914  79.690 20.513  1.00 28.14 ? 166 LYS B O     1 
ATOM   4603 C  CB    . LYS B 1 166 ? 30.586  76.394 20.423  1.00 28.12 ? 166 LYS B CB    1 
ATOM   4604 C  CG    . LYS B 1 166 ? 32.001  76.886 20.193  1.00 28.44 ? 166 LYS B CG    1 
ATOM   4605 C  CD    . LYS B 1 166 ? 32.749  75.908 19.285  1.00 29.56 ? 166 LYS B CD    1 
ATOM   4606 C  CE    . LYS B 1 166 ? 34.211  76.305 19.079  1.00 29.77 ? 166 LYS B CE    1 
ATOM   4607 N  NZ    . LYS B 1 166 ? 34.968  76.276 20.368  1.00 29.14 ? 166 LYS B NZ    1 
HETATM 4608 N  N     . MSE B 1 167 ? 28.561  78.415 19.251  1.00 29.43 ? 167 MSE B N     1 
HETATM 4609 C  CA    . MSE B 1 167 ? 28.211  79.500 18.339  1.00 30.83 ? 167 MSE B CA    1 
HETATM 4610 C  C     . MSE B 1 167 ? 27.528  80.661 19.056  1.00 31.39 ? 167 MSE B C     1 
HETATM 4611 O  O     . MSE B 1 167 ? 27.949  81.813 18.917  1.00 31.48 ? 167 MSE B O     1 
HETATM 4612 C  CB    . MSE B 1 167 ? 27.301  78.991 17.217  1.00 31.06 ? 167 MSE B CB    1 
HETATM 4613 C  CG    . MSE B 1 167 ? 27.940  77.932 16.323  1.00 33.03 ? 167 MSE B CG    1 
HETATM 4614 SE SE    . MSE B 1 167 ? 26.811  77.488 14.898  1.00 35.23 ? 167 MSE B SE    1 
HETATM 4615 C  CE    . MSE B 1 167 ? 27.937  76.245 14.143  1.00 35.17 ? 167 MSE B CE    1 
HETATM 4616 N  N     . MSE B 1 168 ? 26.468  80.364 19.805  1.00 31.50 ? 168 MSE B N     1 
HETATM 4617 C  CA    . MSE B 1 168 ? 25.754  81.405 20.540  1.00 31.69 ? 168 MSE B CA    1 
HETATM 4618 C  C     . MSE B 1 168 ? 26.741  82.131 21.432  1.00 32.22 ? 168 MSE B C     1 
HETATM 4619 O  O     . MSE B 1 168 ? 26.740  83.353 21.506  1.00 33.04 ? 168 MSE B O     1 
HETATM 4620 C  CB    . MSE B 1 168 ? 24.671  80.795 21.419  1.00 32.04 ? 168 MSE B CB    1 
HETATM 4621 C  CG    . MSE B 1 168 ? 23.888  81.800 22.222  1.00 32.30 ? 168 MSE B CG    1 
HETATM 4622 SE SE    . MSE B 1 168 ? 23.002  82.962 21.081  1.00 34.91 ? 168 MSE B SE    1 
HETATM 4623 C  CE    . MSE B 1 168 ? 22.194  83.956 22.400  1.00 32.39 ? 168 MSE B CE    1 
ATOM   4624 N  N     . ALA B 1 169 ? 27.583  81.355 22.105  1.00 32.29 ? 169 ALA B N     1 
ATOM   4625 C  CA    . ALA B 1 169 ? 28.575  81.896 23.014  1.00 32.19 ? 169 ALA B CA    1 
ATOM   4626 C  C     . ALA B 1 169 ? 29.564  82.797 22.304  1.00 32.36 ? 169 ALA B C     1 
ATOM   4627 O  O     . ALA B 1 169 ? 30.260  83.580 22.947  1.00 33.59 ? 169 ALA B O     1 
ATOM   4628 C  CB    . ALA B 1 169 ? 29.310  80.766 23.709  1.00 32.31 ? 169 ALA B CB    1 
ATOM   4629 N  N     . ASN B 1 170 ? 29.642  82.687 20.983  1.00 31.90 ? 170 ASN B N     1 
ATOM   4630 C  CA    . ASN B 1 170 ? 30.569  83.531 20.230  1.00 32.45 ? 170 ASN B CA    1 
ATOM   4631 C  C     . ASN B 1 170 ? 29.827  84.450 19.267  1.00 31.73 ? 170 ASN B C     1 
ATOM   4632 O  O     . ASN B 1 170 ? 30.314  84.765 18.180  1.00 30.98 ? 170 ASN B O     1 
ATOM   4633 C  CB    . ASN B 1 170 ? 31.600  82.676 19.471  1.00 32.77 ? 170 ASN B CB    1 
ATOM   4634 C  CG    . ASN B 1 170 ? 32.467  81.836 20.411  1.00 33.25 ? 170 ASN B CG    1 
ATOM   4635 O  OD1   . ASN B 1 170 ? 32.959  82.332 21.432  1.00 32.97 ? 170 ASN B OD1   1 
ATOM   4636 N  ND2   . ASN B 1 170 ? 32.671  80.567 20.061  1.00 32.83 ? 170 ASN B ND2   1 
ATOM   4637 N  N     . GLY B 1 171 ? 28.638  84.872 19.692  1.00 31.04 ? 171 GLY B N     1 
ATOM   4638 C  CA    . GLY B 1 171 ? 27.816  85.761 18.892  1.00 30.36 ? 171 GLY B CA    1 
ATOM   4639 C  C     . GLY B 1 171 ? 27.667  85.370 17.433  1.00 30.30 ? 171 GLY B C     1 
ATOM   4640 O  O     . GLY B 1 171 ? 27.385  86.225 16.590  1.00 31.01 ? 171 GLY B O     1 
ATOM   4641 N  N     . ILE B 1 172 ? 27.842  84.088 17.121  1.00 29.17 ? 172 ILE B N     1 
ATOM   4642 C  CA    . ILE B 1 172 ? 27.724  83.634 15.738  1.00 27.37 ? 172 ILE B CA    1 
ATOM   4643 C  C     . ILE B 1 172 ? 26.353  83.014 15.424  1.00 27.07 ? 172 ILE B C     1 
ATOM   4644 O  O     . ILE B 1 172 ? 25.892  83.037 14.278  1.00 26.43 ? 172 ILE B O     1 
ATOM   4645 C  CB    . ILE B 1 172 ? 28.837  82.620 15.403  1.00 26.70 ? 172 ILE B CB    1 
ATOM   4646 C  CG1   . ILE B 1 172 ? 30.202  83.273 15.591  1.00 26.78 ? 172 ILE B CG1   1 
ATOM   4647 C  CG2   . ILE B 1 172 ? 28.706  82.144 13.971  1.00 26.30 ? 172 ILE B CG2   1 
ATOM   4648 C  CD1   . ILE B 1 172 ? 31.363  82.325 15.329  1.00 27.47 ? 172 ILE B CD1   1 
ATOM   4649 N  N     . LEU B 1 173 ? 25.694  82.461 16.435  1.00 26.96 ? 173 LEU B N     1 
ATOM   4650 C  CA    . LEU B 1 173 ? 24.386  81.859 16.210  1.00 26.24 ? 173 LEU B CA    1 
ATOM   4651 C  C     . LEU B 1 173 ? 23.431  82.994 15.818  1.00 26.17 ? 173 LEU B C     1 
ATOM   4652 O  O     . LEU B 1 173 ? 23.243  83.953 16.585  1.00 25.78 ? 173 LEU B O     1 
ATOM   4653 C  CB    . LEU B 1 173 ? 23.913  81.141 17.481  1.00 26.61 ? 173 LEU B CB    1 
ATOM   4654 C  CG    . LEU B 1 173 ? 22.693  80.222 17.356  1.00 26.12 ? 173 LEU B CG    1 
ATOM   4655 C  CD1   . LEU B 1 173 ? 21.455  81.036 17.087  1.00 27.25 ? 173 LEU B CD1   1 
ATOM   4656 C  CD2   . LEU B 1 173 ? 22.923  79.220 16.236  1.00 26.39 ? 173 LEU B CD2   1 
ATOM   4657 N  N     . LYS B 1 174 ? 22.835  82.884 14.627  1.00 25.45 ? 174 LYS B N     1 
ATOM   4658 C  CA    . LYS B 1 174 ? 21.932  83.920 14.115  1.00 25.38 ? 174 LYS B CA    1 
ATOM   4659 C  C     . LYS B 1 174 ? 20.454  83.549 14.001  1.00 24.72 ? 174 LYS B C     1 
ATOM   4660 O  O     . LYS B 1 174 ? 19.641  84.364 13.556  1.00 24.41 ? 174 LYS B O     1 
ATOM   4661 C  CB    . LYS B 1 174 ? 22.432  84.413 12.750  1.00 25.52 ? 174 LYS B CB    1 
ATOM   4662 C  CG    . LYS B 1 174 ? 23.848  84.983 12.793  1.00 27.48 ? 174 LYS B CG    1 
ATOM   4663 C  CD    . LYS B 1 174 ? 23.952  86.126 13.801  1.00 28.56 ? 174 LYS B CD    1 
ATOM   4664 C  CE    . LYS B 1 174 ? 25.376  86.658 13.917  1.00 28.69 ? 174 LYS B CE    1 
ATOM   4665 N  NZ    . LYS B 1 174 ? 25.481  87.734 14.956  1.00 29.47 ? 174 LYS B NZ    1 
ATOM   4666 N  N     . VAL B 1 175 ? 20.101  82.334 14.403  1.00 23.37 ? 175 VAL B N     1 
ATOM   4667 C  CA    . VAL B 1 175 ? 18.713  81.899 14.333  1.00 22.12 ? 175 VAL B CA    1 
ATOM   4668 C  C     . VAL B 1 175 ? 18.335  81.075 15.571  1.00 20.29 ? 175 VAL B C     1 
ATOM   4669 O  O     . VAL B 1 175 ? 19.148  80.323 16.097  1.00 20.14 ? 175 VAL B O     1 
ATOM   4670 C  CB    . VAL B 1 175 ? 18.472  81.084 13.024  1.00 22.87 ? 175 VAL B CB    1 
ATOM   4671 C  CG1   . VAL B 1 175 ? 19.442  79.934 12.957  1.00 24.51 ? 175 VAL B CG1   1 
ATOM   4672 C  CG2   . VAL B 1 175 ? 17.039  80.561 12.958  1.00 22.58 ? 175 VAL B CG2   1 
ATOM   4673 N  N     . PRO B 1 176 ? 17.091  81.216 16.059  1.00 19.01 ? 176 PRO B N     1 
ATOM   4674 C  CA    . PRO B 1 176 ? 16.667  80.461 17.238  1.00 18.07 ? 176 PRO B CA    1 
ATOM   4675 C  C     . PRO B 1 176 ? 16.759  78.965 17.001  1.00 17.06 ? 176 PRO B C     1 
ATOM   4676 O  O     . PRO B 1 176 ? 16.300  78.461 15.979  1.00 17.13 ? 176 PRO B O     1 
ATOM   4677 C  CB    . PRO B 1 176 ? 15.225  80.933 17.436  1.00 18.99 ? 176 PRO B CB    1 
ATOM   4678 C  CG    . PRO B 1 176 ? 15.277  82.353 16.909  1.00 18.69 ? 176 PRO B CG    1 
ATOM   4679 C  CD    . PRO B 1 176 ? 15.977  82.059 15.595  1.00 18.85 ? 176 PRO B CD    1 
ATOM   4680 N  N     . ALA B 1 177 ? 17.350  78.255 17.952  1.00 16.60 ? 177 ALA B N     1 
ATOM   4681 C  CA    . ALA B 1 177 ? 17.499  76.810 17.836  1.00 16.20 ? 177 ALA B CA    1 
ATOM   4682 C  C     . ALA B 1 177 ? 17.027  76.100 19.107  1.00 16.03 ? 177 ALA B C     1 
ATOM   4683 O  O     . ALA B 1 177 ? 17.139  76.642 20.215  1.00 16.18 ? 177 ALA B O     1 
ATOM   4684 C  CB    . ALA B 1 177 ? 18.975  76.457 17.547  1.00 15.66 ? 177 ALA B CB    1 
ATOM   4685 N  N     . ILE B 1 178 ? 16.495  74.889 18.939  1.00 15.69 ? 178 ILE B N     1 
ATOM   4686 C  CA    . ILE B 1 178 ? 16.027  74.097 20.068  1.00 15.11 ? 178 ILE B CA    1 
ATOM   4687 C  C     . ILE B 1 178 ? 16.922  72.883 20.249  1.00 15.69 ? 178 ILE B C     1 
ATOM   4688 O  O     . ILE B 1 178 ? 17.197  72.154 19.292  1.00 15.11 ? 178 ILE B O     1 
ATOM   4689 C  CB    . ILE B 1 178 ? 14.562  73.619 19.882  1.00 15.20 ? 178 ILE B CB    1 
ATOM   4690 C  CG1   . ILE B 1 178 ? 13.604  74.808 20.026  1.00 13.51 ? 178 ILE B CG1   1 
ATOM   4691 C  CG2   . ILE B 1 178 ? 14.249  72.503 20.889  1.00 14.90 ? 178 ILE B CG2   1 
ATOM   4692 C  CD1   . ILE B 1 178 ? 12.142  74.435 20.160  1.00 12.40 ? 178 ILE B CD1   1 
ATOM   4693 N  N     . ASN B 1 179 ? 17.377  72.672 21.482  1.00 16.39 ? 179 ASN B N     1 
ATOM   4694 C  CA    . ASN B 1 179 ? 18.251  71.550 21.796  1.00 16.00 ? 179 ASN B CA    1 
ATOM   4695 C  C     . ASN B 1 179 ? 17.441  70.289 22.062  1.00 16.87 ? 179 ASN B C     1 
ATOM   4696 O  O     . ASN B 1 179 ? 17.139  69.958 23.211  1.00 16.68 ? 179 ASN B O     1 
ATOM   4697 C  CB    . ASN B 1 179 ? 19.117  71.876 23.016  1.00 15.86 ? 179 ASN B CB    1 
ATOM   4698 C  CG    . ASN B 1 179 ? 20.067  70.740 23.377  1.00 17.17 ? 179 ASN B CG    1 
ATOM   4699 O  OD1   . ASN B 1 179 ? 20.128  69.723 22.679  1.00 18.23 ? 179 ASN B OD1   1 
ATOM   4700 N  ND2   . ASN B 1 179 ? 20.817  70.908 24.463  1.00 16.17 ? 179 ASN B ND2   1 
ATOM   4701 N  N     . VAL B 1 180 ? 17.092  69.587 20.988  1.00 17.37 ? 180 VAL B N     1 
ATOM   4702 C  CA    . VAL B 1 180 ? 16.315  68.358 21.096  1.00 17.39 ? 180 VAL B CA    1 
ATOM   4703 C  C     . VAL B 1 180 ? 17.077  67.240 21.791  1.00 17.87 ? 180 VAL B C     1 
ATOM   4704 O  O     . VAL B 1 180 ? 16.490  66.466 22.546  1.00 18.46 ? 180 VAL B O     1 
ATOM   4705 C  CB    . VAL B 1 180 ? 15.877  67.838 19.705  1.00 16.75 ? 180 VAL B CB    1 
ATOM   4706 C  CG1   . VAL B 1 180 ? 15.328  66.428 19.827  1.00 16.77 ? 180 VAL B CG1   1 
ATOM   4707 C  CG2   . VAL B 1 180 ? 14.809  68.748 19.120  1.00 14.56 ? 180 VAL B CG2   1 
ATOM   4708 N  N     . ASN B 1 181 ? 18.380  67.146 21.544  1.00 17.67 ? 181 ASN B N     1 
ATOM   4709 C  CA    . ASN B 1 181 ? 19.143  66.071 22.161  1.00 17.11 ? 181 ASN B CA    1 
ATOM   4710 C  C     . ASN B 1 181 ? 19.020  66.012 23.677  1.00 16.93 ? 181 ASN B C     1 
ATOM   4711 O  O     . ASN B 1 181 ? 18.773  64.949 24.241  1.00 15.56 ? 181 ASN B O     1 
ATOM   4712 C  CB    . ASN B 1 181 ? 20.615  66.148 21.760  1.00 15.30 ? 181 ASN B CB    1 
ATOM   4713 C  CG    . ASN B 1 181 ? 21.469  65.193 22.555  1.00 14.59 ? 181 ASN B CG    1 
ATOM   4714 O  OD1   . ASN B 1 181 ? 21.945  65.538 23.631  1.00 14.29 ? 181 ASN B OD1   1 
ATOM   4715 N  ND2   . ASN B 1 181 ? 21.632  63.971 22.054  1.00 12.77 ? 181 ASN B ND2   1 
ATOM   4716 N  N     . ASP B 1 182 ? 19.177  67.160 24.325  1.00 17.62 ? 182 ASP B N     1 
ATOM   4717 C  CA    . ASP B 1 182 ? 19.100  67.237 25.773  1.00 17.98 ? 182 ASP B CA    1 
ATOM   4718 C  C     . ASP B 1 182 ? 17.687  67.286 26.336  1.00 17.94 ? 182 ASP B C     1 
ATOM   4719 O  O     . ASP B 1 182 ? 17.456  67.678 27.486  1.00 18.83 ? 182 ASP B O     1 
ATOM   4720 C  CB    . ASP B 1 182 ? 19.939  68.413 26.236  1.00 18.40 ? 182 ASP B CB    1 
ATOM   4721 C  CG    . ASP B 1 182 ? 21.407  68.093 26.197  1.00 19.47 ? 182 ASP B CG    1 
ATOM   4722 O  OD1   . ASP B 1 182 ? 21.733  66.904 26.407  1.00 19.86 ? 182 ASP B OD1   1 
ATOM   4723 O  OD2   . ASP B 1 182 ? 22.231  69.012 25.985  1.00 20.77 ? 182 ASP B OD2   1 
ATOM   4724 N  N     . SER B 1 183 ? 16.741  66.888 25.501  1.00 15.91 ? 183 SER B N     1 
ATOM   4725 C  CA    . SER B 1 183 ? 15.351  66.796 25.895  1.00 14.89 ? 183 SER B CA    1 
ATOM   4726 C  C     . SER B 1 183 ? 15.424  65.454 26.653  1.00 14.85 ? 183 SER B C     1 
ATOM   4727 O  O     . SER B 1 183 ? 15.974  64.484 26.132  1.00 15.96 ? 183 SER B O     1 
ATOM   4728 C  CB    . SER B 1 183 ? 14.502  66.696 24.624  1.00 14.21 ? 183 SER B CB    1 
ATOM   4729 O  OG    . SER B 1 183 ? 13.129  66.625 24.903  1.00 14.97 ? 183 SER B OG    1 
ATOM   4730 N  N     . VAL B 1 184 ? 14.918  65.381 27.879  1.00 13.90 ? 184 VAL B N     1 
ATOM   4731 C  CA    . VAL B 1 184 ? 15.016  64.128 28.641  1.00 12.81 ? 184 VAL B CA    1 
ATOM   4732 C  C     . VAL B 1 184 ? 14.767  62.839 27.857  1.00 12.82 ? 184 VAL B C     1 
ATOM   4733 O  O     . VAL B 1 184 ? 15.636  61.964 27.805  1.00 13.02 ? 184 VAL B O     1 
ATOM   4734 C  CB    . VAL B 1 184 ? 14.071  64.115 29.843  1.00 11.35 ? 184 VAL B CB    1 
ATOM   4735 C  CG1   . VAL B 1 184 ? 14.253  62.814 30.616  1.00 11.26 ? 184 VAL B CG1   1 
ATOM   4736 C  CG2   . VAL B 1 184 ? 14.349  65.311 30.723  1.00 10.20 ? 184 VAL B CG2   1 
ATOM   4737 N  N     . THR B 1 185 ? 13.584  62.730 27.254  1.00 13.37 ? 185 THR B N     1 
ATOM   4738 C  CA    . THR B 1 185 ? 13.193  61.547 26.485  1.00 12.87 ? 185 THR B CA    1 
ATOM   4739 C  C     . THR B 1 185 ? 14.013  61.303 25.241  1.00 13.65 ? 185 THR B C     1 
ATOM   4740 O  O     . THR B 1 185 ? 13.608  60.511 24.394  1.00 14.62 ? 185 THR B O     1 
ATOM   4741 C  CB    . THR B 1 185 ? 11.754  61.630 26.020  1.00 11.34 ? 185 THR B CB    1 
ATOM   4742 O  OG1   . THR B 1 185 ? 11.580  62.857 25.310  1.00 12.07 ? 185 THR B OG1   1 
ATOM   4743 C  CG2   . THR B 1 185 ? 10.791  61.559 27.196  1.00 11.48 ? 185 THR B CG2   1 
ATOM   4744 N  N     . LYS B 1 186 ? 15.153  61.980 25.114  1.00 14.49 ? 186 LYS B N     1 
ATOM   4745 C  CA    . LYS B 1 186 ? 16.009  61.790 23.949  1.00 14.28 ? 186 LYS B CA    1 
ATOM   4746 C  C     . LYS B 1 186 ? 17.374  61.320 24.428  1.00 15.22 ? 186 LYS B C     1 
ATOM   4747 O  O     . LYS B 1 186 ? 17.750  60.169 24.197  1.00 16.19 ? 186 LYS B O     1 
ATOM   4748 C  CB    . LYS B 1 186 ? 16.129  63.094 23.156  1.00 14.30 ? 186 LYS B CB    1 
ATOM   4749 C  CG    . LYS B 1 186 ? 16.772  62.960 21.780  1.00 14.99 ? 186 LYS B CG    1 
ATOM   4750 C  CD    . LYS B 1 186 ? 18.242  62.645 21.867  1.00 16.29 ? 186 LYS B CD    1 
ATOM   4751 C  CE    . LYS B 1 186 ? 18.860  62.501 20.483  1.00 17.21 ? 186 LYS B CE    1 
ATOM   4752 N  NZ    . LYS B 1 186 ? 20.343  62.271 20.563  1.00 17.72 ? 186 LYS B NZ    1 
ATOM   4753 N  N     . SER B 1 187 ? 18.100  62.200 25.111  1.00 15.47 ? 187 SER B N     1 
ATOM   4754 C  CA    . SER B 1 187 ? 19.435  61.888 25.627  1.00 16.11 ? 187 SER B CA    1 
ATOM   4755 C  C     . SER B 1 187 ? 19.444  60.699 26.576  1.00 17.32 ? 187 SER B C     1 
ATOM   4756 O  O     . SER B 1 187 ? 20.381  59.888 26.569  1.00 16.13 ? 187 SER B O     1 
ATOM   4757 C  CB    . SER B 1 187 ? 19.994  63.085 26.375  1.00 16.08 ? 187 SER B CB    1 
ATOM   4758 O  OG    . SER B 1 187 ? 19.131  63.414 27.451  1.00 17.80 ? 187 SER B OG    1 
ATOM   4759 N  N     . LYS B 1 188 ? 18.406  60.607 27.407  1.00 18.64 ? 188 LYS B N     1 
ATOM   4760 C  CA    . LYS B 1 188 ? 18.315  59.516 28.366  1.00 18.61 ? 188 LYS B CA    1 
ATOM   4761 C  C     . LYS B 1 188 ? 17.643  58.255 27.858  1.00 18.19 ? 188 LYS B C     1 
ATOM   4762 O  O     . LYS B 1 188 ? 17.354  57.352 28.643  1.00 19.47 ? 188 LYS B O     1 
ATOM   4763 C  CB    . LYS B 1 188 ? 17.640  59.992 29.653  1.00 19.11 ? 188 LYS B CB    1 
ATOM   4764 C  CG    . LYS B 1 188 ? 18.651  60.441 30.711  1.00 19.86 ? 188 LYS B CG    1 
ATOM   4765 C  CD    . LYS B 1 188 ? 19.532  59.250 31.105  1.00 20.40 ? 188 LYS B CD    1 
ATOM   4766 C  CE    . LYS B 1 188 ? 20.527  59.586 32.201  1.00 21.17 ? 188 LYS B CE    1 
ATOM   4767 N  NZ    . LYS B 1 188 ? 19.875  59.958 33.501  1.00 21.59 ? 188 LYS B NZ    1 
ATOM   4768 N  N     . PHE B 1 189 ? 17.403  58.185 26.551  1.00 17.39 ? 189 PHE B N     1 
ATOM   4769 C  CA    . PHE B 1 189 ? 16.792  56.998 25.958  1.00 16.88 ? 189 PHE B CA    1 
ATOM   4770 C  C     . PHE B 1 189 ? 17.518  56.667 24.662  1.00 17.48 ? 189 PHE B C     1 
ATOM   4771 O  O     . PHE B 1 189 ? 18.217  55.656 24.582  1.00 17.60 ? 189 PHE B O     1 
ATOM   4772 C  CB    . PHE B 1 189 ? 15.288  57.216 25.706  1.00 15.59 ? 189 PHE B CB    1 
ATOM   4773 C  CG    . PHE B 1 189 ? 14.500  57.502 26.958  1.00 12.25 ? 189 PHE B CG    1 
ATOM   4774 C  CD1   . PHE B 1 189 ? 14.599  58.732 27.596  1.00 12.15 ? 189 PHE B CD1   1 
ATOM   4775 C  CD2   . PHE B 1 189 ? 13.682  56.532 27.514  1.00 11.03 ? 189 PHE B CD2   1 
ATOM   4776 C  CE1   . PHE B 1 189 ? 13.891  58.989 28.769  1.00 10.52 ? 189 PHE B CE1   1 
ATOM   4777 C  CE2   . PHE B 1 189 ? 12.972  56.781 28.687  1.00 10.36 ? 189 PHE B CE2   1 
ATOM   4778 C  CZ    . PHE B 1 189 ? 13.078  58.011 29.313  1.00 9.67  ? 189 PHE B CZ    1 
ATOM   4779 N  N     . ASP B 1 190 ? 17.353  57.525 23.660  1.00 18.14 ? 190 ASP B N     1 
ATOM   4780 C  CA    . ASP B 1 190 ? 18.007  57.358 22.364  1.00 19.07 ? 190 ASP B CA    1 
ATOM   4781 C  C     . ASP B 1 190 ? 19.497  57.087 22.554  1.00 18.92 ? 190 ASP B C     1 
ATOM   4782 O  O     . ASP B 1 190 ? 19.997  56.023 22.205  1.00 19.94 ? 190 ASP B O     1 
ATOM   4783 C  CB    . ASP B 1 190 ? 17.828  58.631 21.518  1.00 19.61 ? 190 ASP B CB    1 
ATOM   4784 C  CG    . ASP B 1 190 ? 18.714  58.650 20.272  1.00 20.01 ? 190 ASP B CG    1 
ATOM   4785 O  OD1   . ASP B 1 190 ? 19.950  58.442 20.396  1.00 18.63 ? 190 ASP B OD1   1 
ATOM   4786 O  OD2   . ASP B 1 190 ? 18.169  58.896 19.169  1.00 19.63 ? 190 ASP B OD2   1 
ATOM   4787 N  N     . ASN B 1 191 ? 20.199  58.059 23.119  1.00 18.21 ? 191 ASN B N     1 
ATOM   4788 C  CA    . ASN B 1 191 ? 21.629  57.930 23.325  1.00 18.65 ? 191 ASN B CA    1 
ATOM   4789 C  C     . ASN B 1 191 ? 22.034  56.677 24.087  1.00 18.32 ? 191 ASN B C     1 
ATOM   4790 O  O     . ASN B 1 191 ? 22.956  55.969 23.686  1.00 17.72 ? 191 ASN B O     1 
ATOM   4791 C  CB    . ASN B 1 191 ? 22.185  59.148 24.074  1.00 19.57 ? 191 ASN B CB    1 
ATOM   4792 C  CG    . ASN B 1 191 ? 21.947  60.462 23.340  1.00 20.29 ? 191 ASN B CG    1 
ATOM   4793 O  OD1   . ASN B 1 191 ? 22.625  61.461 23.607  1.00 19.62 ? 191 ASN B OD1   1 
ATOM   4794 N  ND2   . ASN B 1 191 ? 20.969  60.477 22.436  1.00 20.06 ? 191 ASN B ND2   1 
ATOM   4795 N  N     . LEU B 1 192 ? 21.347  56.421 25.195  1.00 18.16 ? 192 LEU B N     1 
ATOM   4796 C  CA    . LEU B 1 192 ? 21.644  55.287 26.064  1.00 17.26 ? 192 LEU B CA    1 
ATOM   4797 C  C     . LEU B 1 192 ? 21.110  53.965 25.535  1.00 17.23 ? 192 LEU B C     1 
ATOM   4798 O  O     . LEU B 1 192 ? 21.872  53.131 25.060  1.00 17.72 ? 192 LEU B O     1 
ATOM   4799 C  CB    . LEU B 1 192 ? 21.080  55.560 27.462  1.00 17.24 ? 192 LEU B CB    1 
ATOM   4800 C  CG    . LEU B 1 192 ? 21.195  54.479 28.545  1.00 18.44 ? 192 LEU B CG    1 
ATOM   4801 C  CD1   . LEU B 1 192 ? 22.660  54.134 28.788  1.00 16.80 ? 192 LEU B CD1   1 
ATOM   4802 C  CD2   . LEU B 1 192 ? 20.534  54.970 29.836  1.00 16.13 ? 192 LEU B CD2   1 
ATOM   4803 N  N     . TYR B 1 193 ? 19.797  53.780 25.626  1.00 16.91 ? 193 TYR B N     1 
ATOM   4804 C  CA    . TYR B 1 193 ? 19.142  52.557 25.166  1.00 16.23 ? 193 TYR B CA    1 
ATOM   4805 C  C     . TYR B 1 193 ? 19.420  52.269 23.698  1.00 16.42 ? 193 TYR B C     1 
ATOM   4806 O  O     . TYR B 1 193 ? 19.730  51.137 23.328  1.00 17.13 ? 193 TYR B O     1 
ATOM   4807 C  CB    . TYR B 1 193 ? 17.639  52.672 25.432  1.00 16.24 ? 193 TYR B CB    1 
ATOM   4808 C  CG    . TYR B 1 193 ? 17.351  52.817 26.913  1.00 16.76 ? 193 TYR B CG    1 
ATOM   4809 C  CD1   . TYR B 1 193 ? 18.204  52.247 27.858  1.00 16.35 ? 193 TYR B CD1   1 
ATOM   4810 C  CD2   . TYR B 1 193 ? 16.259  53.552 27.376  1.00 16.83 ? 193 TYR B CD2   1 
ATOM   4811 C  CE1   . TYR B 1 193 ? 17.987  52.405 29.217  1.00 15.18 ? 193 TYR B CE1   1 
ATOM   4812 C  CE2   . TYR B 1 193 ? 16.034  53.719 28.748  1.00 15.49 ? 193 TYR B CE2   1 
ATOM   4813 C  CZ    . TYR B 1 193 ? 16.908  53.140 29.656  1.00 15.08 ? 193 TYR B CZ    1 
ATOM   4814 O  OH    . TYR B 1 193 ? 16.724  53.281 31.007  1.00 14.47 ? 193 TYR B OH    1 
ATOM   4815 N  N     . GLY B 1 194 ? 19.321  53.296 22.865  1.00 16.72 ? 194 GLY B N     1 
ATOM   4816 C  CA    . GLY B 1 194 ? 19.583  53.121 21.451  1.00 17.00 ? 194 GLY B CA    1 
ATOM   4817 C  C     . GLY B 1 194 ? 20.911  52.427 21.203  1.00 17.41 ? 194 GLY B C     1 
ATOM   4818 O  O     . GLY B 1 194 ? 20.956  51.353 20.592  1.00 17.95 ? 194 GLY B O     1 
ATOM   4819 N  N     . CYS B 1 195 ? 22.001  53.023 21.676  1.00 17.73 ? 195 CYS B N     1 
ATOM   4820 C  CA    . CYS B 1 195 ? 23.321  52.428 21.471  1.00 17.32 ? 195 CYS B CA    1 
ATOM   4821 C  C     . CYS B 1 195 ? 23.422  51.036 22.075  1.00 17.08 ? 195 CYS B C     1 
ATOM   4822 O  O     . CYS B 1 195 ? 23.973  50.120 21.455  1.00 16.80 ? 195 CYS B O     1 
ATOM   4823 C  CB    . CYS B 1 195 ? 24.413  53.316 22.064  1.00 16.77 ? 195 CYS B CB    1 
ATOM   4824 S  SG    . CYS B 1 195 ? 24.600  54.899 21.212  1.00 18.96 ? 195 CYS B SG    1 
ATOM   4825 N  N     . ARG B 1 196 ? 22.880  50.875 23.279  1.00 16.97 ? 196 ARG B N     1 
ATOM   4826 C  CA    . ARG B 1 196 ? 22.937  49.588 23.951  1.00 16.40 ? 196 ARG B CA    1 
ATOM   4827 C  C     . ARG B 1 196 ? 22.543  48.459 22.985  1.00 16.53 ? 196 ARG B C     1 
ATOM   4828 O  O     . ARG B 1 196 ? 23.043  47.335 23.101  1.00 16.35 ? 196 ARG B O     1 
ATOM   4829 C  CB    . ARG B 1 196 ? 22.031  49.589 25.188  1.00 15.79 ? 196 ARG B CB    1 
ATOM   4830 C  CG    . ARG B 1 196 ? 22.257  48.390 26.113  1.00 14.68 ? 196 ARG B CG    1 
ATOM   4831 C  CD    . ARG B 1 196 ? 21.485  48.510 27.422  1.00 13.27 ? 196 ARG B CD    1 
ATOM   4832 N  NE    . ARG B 1 196 ? 20.041  48.447 27.229  1.00 14.04 ? 196 ARG B NE    1 
ATOM   4833 C  CZ    . ARG B 1 196 ? 19.149  48.598 28.206  1.00 13.19 ? 196 ARG B CZ    1 
ATOM   4834 N  NH1   . ARG B 1 196 ? 19.553  48.826 29.447  1.00 12.91 ? 196 ARG B NH1   1 
ATOM   4835 N  NH2   . ARG B 1 196 ? 17.852  48.498 27.947  1.00 11.62 ? 196 ARG B NH2   1 
ATOM   4836 N  N     . GLU B 1 197 ? 21.678  48.760 22.017  1.00 16.28 ? 197 GLU B N     1 
ATOM   4837 C  CA    . GLU B 1 197 ? 21.253  47.749 21.050  1.00 17.48 ? 197 GLU B CA    1 
ATOM   4838 C  C     . GLU B 1 197 ? 21.880  47.843 19.649  1.00 17.80 ? 197 GLU B C     1 
ATOM   4839 O  O     . GLU B 1 197 ? 22.099  46.817 18.992  1.00 17.65 ? 197 GLU B O     1 
ATOM   4840 C  CB    . GLU B 1 197 ? 19.720  47.746 20.927  1.00 17.75 ? 197 GLU B CB    1 
ATOM   4841 C  CG    . GLU B 1 197 ? 19.023  47.084 22.102  1.00 20.50 ? 197 GLU B CG    1 
ATOM   4842 C  CD    . GLU B 1 197 ? 17.511  47.087 21.987  1.00 21.41 ? 197 GLU B CD    1 
ATOM   4843 O  OE1   . GLU B 1 197 ? 16.998  46.803 20.889  1.00 22.18 ? 197 GLU B OE1   1 
ATOM   4844 O  OE2   . GLU B 1 197 ? 16.832  47.347 23.004  1.00 23.25 ? 197 GLU B OE2   1 
ATOM   4845 N  N     . SER B 1 198 ? 22.180  49.060 19.193  1.00 17.51 ? 198 SER B N     1 
ATOM   4846 C  CA    . SER B 1 198 ? 22.753  49.254 17.864  1.00 16.77 ? 198 SER B CA    1 
ATOM   4847 C  C     . SER B 1 198 ? 24.265  49.039 17.743  1.00 16.60 ? 198 SER B C     1 
ATOM   4848 O  O     . SER B 1 198 ? 24.739  48.601 16.698  1.00 17.47 ? 198 SER B O     1 
ATOM   4849 C  CB    . SER B 1 198 ? 22.397  50.650 17.342  1.00 17.20 ? 198 SER B CB    1 
ATOM   4850 O  OG    . SER B 1 198 ? 22.930  51.669 18.176  1.00 17.45 ? 198 SER B OG    1 
ATOM   4851 N  N     . LEU B 1 199 ? 25.030  49.339 18.788  1.00 16.31 ? 199 LEU B N     1 
ATOM   4852 C  CA    . LEU B 1 199 ? 26.480  49.156 18.716  1.00 16.02 ? 199 LEU B CA    1 
ATOM   4853 C  C     . LEU B 1 199 ? 26.873  47.726 18.406  1.00 17.18 ? 199 LEU B C     1 
ATOM   4854 O  O     . LEU B 1 199 ? 27.640  47.470 17.469  1.00 16.68 ? 199 LEU B O     1 
ATOM   4855 C  CB    . LEU B 1 199 ? 27.158  49.553 20.022  1.00 14.79 ? 199 LEU B CB    1 
ATOM   4856 C  CG    . LEU B 1 199 ? 28.622  49.090 20.089  1.00 14.53 ? 199 LEU B CG    1 
ATOM   4857 C  CD1   . LEU B 1 199 ? 29.430  49.778 19.015  1.00 15.77 ? 199 LEU B CD1   1 
ATOM   4858 C  CD2   . LEU B 1 199 ? 29.216  49.404 21.443  1.00 14.98 ? 199 LEU B CD2   1 
ATOM   4859 N  N     . ILE B 1 200 ? 26.371  46.795 19.213  1.00 18.25 ? 200 ILE B N     1 
ATOM   4860 C  CA    . ILE B 1 200 ? 26.692  45.383 19.010  1.00 18.83 ? 200 ILE B CA    1 
ATOM   4861 C  C     . ILE B 1 200 ? 26.249  44.975 17.616  1.00 18.50 ? 200 ILE B C     1 
ATOM   4862 O  O     . ILE B 1 200 ? 26.921  44.199 16.945  1.00 18.09 ? 200 ILE B O     1 
ATOM   4863 C  CB    . ILE B 1 200 ? 25.978  44.468 20.048  1.00 20.26 ? 200 ILE B CB    1 
ATOM   4864 C  CG1   . ILE B 1 200 ? 26.484  44.772 21.463  1.00 20.54 ? 200 ILE B CG1   1 
ATOM   4865 C  CG2   . ILE B 1 200 ? 26.240  42.993 19.722  1.00 19.31 ? 200 ILE B CG2   1 
ATOM   4866 C  CD1   . ILE B 1 200 ? 27.934  44.422 21.678  1.00 21.83 ? 200 ILE B CD1   1 
ATOM   4867 N  N     . ASP B 1 201 ? 25.115  45.526 17.191  1.00 18.78 ? 201 ASP B N     1 
ATOM   4868 C  CA    . ASP B 1 201 ? 24.536  45.228 15.886  1.00 18.07 ? 201 ASP B CA    1 
ATOM   4869 C  C     . ASP B 1 201 ? 25.585  45.504 14.815  1.00 18.45 ? 201 ASP B C     1 
ATOM   4870 O  O     . ASP B 1 201 ? 25.953  44.622 14.038  1.00 17.33 ? 201 ASP B O     1 
ATOM   4871 C  CB    . ASP B 1 201 ? 23.305  46.110 15.652  1.00 17.41 ? 201 ASP B CB    1 
ATOM   4872 C  CG    . ASP B 1 201 ? 22.317  45.489 14.687  1.00 18.51 ? 201 ASP B CG    1 
ATOM   4873 O  OD1   . ASP B 1 201 ? 22.777  44.912 13.680  1.00 17.40 ? 201 ASP B OD1   1 
ATOM   4874 O  OD2   . ASP B 1 201 ? 21.082  45.590 14.922  1.00 19.66 ? 201 ASP B OD2   1 
ATOM   4875 N  N     . GLY B 1 202 ? 26.077  46.739 14.803  1.00 19.13 ? 202 GLY B N     1 
ATOM   4876 C  CA    . GLY B 1 202 ? 27.076  47.139 13.832  1.00 18.72 ? 202 GLY B CA    1 
ATOM   4877 C  C     . GLY B 1 202 ? 28.301  46.262 13.872  1.00 19.13 ? 202 GLY B C     1 
ATOM   4878 O  O     . GLY B 1 202 ? 28.774  45.813 12.840  1.00 20.10 ? 202 GLY B O     1 
ATOM   4879 N  N     . ILE B 1 203 ? 28.820  46.008 15.062  1.00 20.45 ? 203 ILE B N     1 
ATOM   4880 C  CA    . ILE B 1 203 ? 30.004  45.174 15.179  1.00 21.18 ? 203 ILE B CA    1 
ATOM   4881 C  C     . ILE B 1 203 ? 29.741  43.782 14.616  1.00 20.97 ? 203 ILE B C     1 
ATOM   4882 O  O     . ILE B 1 203 ? 30.506  43.295 13.786  1.00 22.10 ? 203 ILE B O     1 
ATOM   4883 C  CB    . ILE B 1 203 ? 30.453  45.042 16.644  1.00 22.72 ? 203 ILE B CB    1 
ATOM   4884 C  CG1   . ILE B 1 203 ? 30.761  46.432 17.218  1.00 25.11 ? 203 ILE B CG1   1 
ATOM   4885 C  CG2   . ILE B 1 203 ? 31.677  44.133 16.732  1.00 21.09 ? 203 ILE B CG2   1 
ATOM   4886 C  CD1   . ILE B 1 203 ? 31.278  46.399 18.654  1.00 27.50 ? 203 ILE B CD1   1 
ATOM   4887 N  N     . LYS B 1 204 ? 28.658  43.150 15.068  1.00 20.89 ? 204 LYS B N     1 
ATOM   4888 C  CA    . LYS B 1 204 ? 28.287  41.802 14.617  1.00 19.94 ? 204 LYS B CA    1 
ATOM   4889 C  C     . LYS B 1 204 ? 28.166  41.680 13.102  1.00 19.22 ? 204 LYS B C     1 
ATOM   4890 O  O     . LYS B 1 204 ? 28.831  40.843 12.481  1.00 18.42 ? 204 LYS B O     1 
ATOM   4891 C  CB    . LYS B 1 204 ? 26.963  41.360 15.260  1.00 20.35 ? 204 LYS B CB    1 
ATOM   4892 C  CG    . LYS B 1 204 ? 27.065  40.884 16.707  1.00 19.59 ? 204 LYS B CG    1 
ATOM   4893 C  CD    . LYS B 1 204 ? 27.746  39.535 16.783  1.00 18.44 ? 204 LYS B CD    1 
ATOM   4894 C  CE    . LYS B 1 204 ? 27.820  39.044 18.209  1.00 17.52 ? 204 LYS B CE    1 
ATOM   4895 N  NZ    . LYS B 1 204 ? 28.400  37.681 18.278  1.00 17.07 ? 204 LYS B NZ    1 
ATOM   4896 N  N     . ARG B 1 205 ? 27.314  42.508 12.509  1.00 18.34 ? 205 ARG B N     1 
ATOM   4897 C  CA    . ARG B 1 205 ? 27.121  42.459 11.064  1.00 17.88 ? 205 ARG B CA    1 
ATOM   4898 C  C     . ARG B 1 205 ? 28.430  42.660 10.331  1.00 17.44 ? 205 ARG B C     1 
ATOM   4899 O  O     . ARG B 1 205 ? 28.653  42.068 9.278   1.00 18.33 ? 205 ARG B O     1 
ATOM   4900 C  CB    . ARG B 1 205 ? 26.103  43.511 10.608  1.00 17.01 ? 205 ARG B CB    1 
ATOM   4901 C  CG    . ARG B 1 205 ? 24.743  43.339 11.269  1.00 17.48 ? 205 ARG B CG    1 
ATOM   4902 C  CD    . ARG B 1 205 ? 23.655  44.168 10.624  1.00 16.39 ? 205 ARG B CD    1 
ATOM   4903 N  NE    . ARG B 1 205 ? 22.423  44.052 11.391  1.00 18.54 ? 205 ARG B NE    1 
ATOM   4904 C  CZ    . ARG B 1 205 ? 21.241  44.520 10.998  1.00 19.19 ? 205 ARG B CZ    1 
ATOM   4905 N  NH1   . ARG B 1 205 ? 21.135  45.132 9.832   1.00 20.08 ? 205 ARG B NH1   1 
ATOM   4906 N  NH2   . ARG B 1 205 ? 20.169  44.391 11.777  1.00 18.65 ? 205 ARG B NH2   1 
ATOM   4907 N  N     . ALA B 1 206 ? 29.305  43.478 10.896  1.00 16.71 ? 206 ALA B N     1 
ATOM   4908 C  CA    . ALA B 1 206 ? 30.581  43.746 10.264  1.00 17.43 ? 206 ALA B CA    1 
ATOM   4909 C  C     . ALA B 1 206 ? 31.648  42.689 10.533  1.00 18.97 ? 206 ALA B C     1 
ATOM   4910 O  O     . ALA B 1 206 ? 32.497  42.444 9.671   1.00 20.65 ? 206 ALA B O     1 
ATOM   4911 C  CB    . ALA B 1 206 ? 31.091  45.109 10.700  1.00 16.42 ? 206 ALA B CB    1 
ATOM   4912 N  N     . THR B 1 207 ? 31.607  42.047 11.701  1.00 19.46 ? 207 THR B N     1 
ATOM   4913 C  CA    . THR B 1 207 ? 32.642  41.064 12.045  1.00 19.52 ? 207 THR B CA    1 
ATOM   4914 C  C     . THR B 1 207 ? 32.198  39.690 12.560  1.00 19.28 ? 207 THR B C     1 
ATOM   4915 O  O     . THR B 1 207 ? 32.975  38.726 12.520  1.00 18.88 ? 207 THR B O     1 
ATOM   4916 C  CB    . THR B 1 207 ? 33.605  41.659 13.097  1.00 20.61 ? 207 THR B CB    1 
ATOM   4917 O  OG1   . THR B 1 207 ? 32.879  41.925 14.306  1.00 22.61 ? 207 THR B OG1   1 
ATOM   4918 C  CG2   . THR B 1 207 ? 34.208  42.963 12.598  1.00 20.06 ? 207 THR B CG2   1 
ATOM   4919 N  N     . ASP B 1 208 ? 30.969  39.598 13.055  1.00 18.67 ? 208 ASP B N     1 
ATOM   4920 C  CA    . ASP B 1 208 ? 30.469  38.341 13.601  1.00 18.72 ? 208 ASP B CA    1 
ATOM   4921 C  C     . ASP B 1 208 ? 31.349  37.756 14.698  1.00 17.83 ? 208 ASP B C     1 
ATOM   4922 O  O     . ASP B 1 208 ? 31.295  36.552 14.963  1.00 17.57 ? 208 ASP B O     1 
ATOM   4923 C  CB    . ASP B 1 208 ? 30.297  37.315 12.490  1.00 19.30 ? 208 ASP B CB    1 
ATOM   4924 C  CG    . ASP B 1 208 ? 29.055  37.557 11.684  1.00 21.33 ? 208 ASP B CG    1 
ATOM   4925 O  OD1   . ASP B 1 208 ? 27.962  37.624 12.304  1.00 20.39 ? 208 ASP B OD1   1 
ATOM   4926 O  OD2   . ASP B 1 208 ? 29.170  37.675 10.443  1.00 22.72 ? 208 ASP B OD2   1 
ATOM   4927 N  N     . VAL B 1 209 ? 32.145  38.608 15.340  1.00 17.30 ? 209 VAL B N     1 
ATOM   4928 C  CA    . VAL B 1 209 ? 33.040  38.163 16.402  1.00 17.47 ? 209 VAL B CA    1 
ATOM   4929 C  C     . VAL B 1 209 ? 32.268  37.941 17.692  1.00 18.00 ? 209 VAL B C     1 
ATOM   4930 O  O     . VAL B 1 209 ? 31.245  38.581 17.928  1.00 18.95 ? 209 VAL B O     1 
ATOM   4931 C  CB    . VAL B 1 209 ? 34.143  39.200 16.680  1.00 16.39 ? 209 VAL B CB    1 
ATOM   4932 C  CG1   . VAL B 1 209 ? 33.528  40.494 17.160  1.00 16.69 ? 209 VAL B CG1   1 
ATOM   4933 C  CG2   . VAL B 1 209 ? 35.091  38.676 17.716  1.00 15.84 ? 209 VAL B CG2   1 
HETATM 4934 N  N     . MSE B 1 210 ? 32.748  37.034 18.532  1.00 18.26 ? 210 MSE B N     1 
HETATM 4935 C  CA    . MSE B 1 210 ? 32.069  36.798 19.789  1.00 18.48 ? 210 MSE B CA    1 
HETATM 4936 C  C     . MSE B 1 210 ? 32.486  37.884 20.774  1.00 17.74 ? 210 MSE B C     1 
HETATM 4937 O  O     . MSE B 1 210 ? 33.672  38.222 20.882  1.00 16.75 ? 210 MSE B O     1 
HETATM 4938 C  CB    . MSE B 1 210 ? 32.430  35.431 20.341  1.00 20.87 ? 210 MSE B CB    1 
HETATM 4939 C  CG    . MSE B 1 210 ? 31.557  35.032 21.493  1.00 23.04 ? 210 MSE B CG    1 
HETATM 4940 SE SE    . MSE B 1 210 ? 31.895  33.267 21.894  1.00 25.65 ? 210 MSE B SE    1 
HETATM 4941 C  CE    . MSE B 1 210 ? 30.697  33.114 23.296  1.00 25.91 ? 210 MSE B CE    1 
ATOM   4942 N  N     . ILE B 1 211 ? 31.506  38.440 21.479  1.00 16.78 ? 211 ILE B N     1 
ATOM   4943 C  CA    . ILE B 1 211 ? 31.780  39.485 22.444  1.00 15.78 ? 211 ILE B CA    1 
ATOM   4944 C  C     . ILE B 1 211 ? 32.293  38.854 23.728  1.00 15.54 ? 211 ILE B C     1 
ATOM   4945 O  O     . ILE B 1 211 ? 33.348  39.236 24.243  1.00 14.05 ? 211 ILE B O     1 
ATOM   4946 C  CB    . ILE B 1 211 ? 30.511  40.296 22.757  1.00 15.56 ? 211 ILE B CB    1 
ATOM   4947 C  CG1   . ILE B 1 211 ? 29.936  40.888 21.468  1.00 14.64 ? 211 ILE B CG1   1 
ATOM   4948 C  CG2   . ILE B 1 211 ? 30.842  41.427 23.714  1.00 14.91 ? 211 ILE B CG2   1 
ATOM   4949 C  CD1   . ILE B 1 211 ? 30.859  41.854 20.771  1.00 13.76 ? 211 ILE B CD1   1 
ATOM   4950 N  N     . ALA B 1 212 ? 31.548  37.870 24.224  1.00 15.74 ? 212 ALA B N     1 
ATOM   4951 C  CA    . ALA B 1 212 ? 31.898  37.168 25.463  1.00 16.77 ? 212 ALA B CA    1 
ATOM   4952 C  C     . ALA B 1 212 ? 33.360  36.737 25.529  1.00 17.00 ? 212 ALA B C     1 
ATOM   4953 O  O     . ALA B 1 212 ? 33.972  36.389 24.522  1.00 18.41 ? 212 ALA B O     1 
ATOM   4954 C  CB    . ALA B 1 212 ? 30.992  35.938 25.651  1.00 16.14 ? 212 ALA B CB    1 
ATOM   4955 N  N     . GLY B 1 213 ? 33.915  36.766 26.732  1.00 16.88 ? 213 GLY B N     1 
ATOM   4956 C  CA    . GLY B 1 213 ? 35.290  36.348 26.921  1.00 15.42 ? 213 GLY B CA    1 
ATOM   4957 C  C     . GLY B 1 213 ? 36.349  37.301 26.425  1.00 14.37 ? 213 GLY B C     1 
ATOM   4958 O  O     . GLY B 1 213 ? 37.536  37.014 26.567  1.00 15.80 ? 213 GLY B O     1 
ATOM   4959 N  N     . LYS B 1 214 ? 35.944  38.422 25.843  1.00 13.20 ? 214 LYS B N     1 
ATOM   4960 C  CA    . LYS B 1 214 ? 36.922  39.388 25.362  1.00 12.38 ? 214 LYS B CA    1 
ATOM   4961 C  C     . LYS B 1 214 ? 36.977  40.641 26.214  1.00 11.75 ? 214 LYS B C     1 
ATOM   4962 O  O     . LYS B 1 214 ? 36.090  40.896 27.034  1.00 12.96 ? 214 LYS B O     1 
ATOM   4963 C  CB    . LYS B 1 214 ? 36.639  39.774 23.912  1.00 12.00 ? 214 LYS B CB    1 
ATOM   4964 C  CG    . LYS B 1 214 ? 36.821  38.622 22.961  1.00 13.71 ? 214 LYS B CG    1 
ATOM   4965 C  CD    . LYS B 1 214 ? 36.832  39.080 21.520  1.00 13.86 ? 214 LYS B CD    1 
ATOM   4966 C  CE    . LYS B 1 214 ? 37.071  37.897 20.586  1.00 13.87 ? 214 LYS B CE    1 
ATOM   4967 N  NZ    . LYS B 1 214 ? 35.976  36.875 20.681  1.00 14.39 ? 214 LYS B NZ    1 
ATOM   4968 N  N     . VAL B 1 215 ? 38.037  41.415 26.022  1.00 10.29 ? 215 VAL B N     1 
ATOM   4969 C  CA    . VAL B 1 215 ? 38.226  42.650 26.751  1.00 8.48  ? 215 VAL B CA    1 
ATOM   4970 C  C     . VAL B 1 215 ? 37.866  43.767 25.813  1.00 8.64  ? 215 VAL B C     1 
ATOM   4971 O  O     . VAL B 1 215 ? 38.512  43.938 24.778  1.00 10.32 ? 215 VAL B O     1 
ATOM   4972 C  CB    . VAL B 1 215 ? 39.681  42.834 27.164  1.00 8.37  ? 215 VAL B CB    1 
ATOM   4973 C  CG1   . VAL B 1 215 ? 39.904  44.258 27.671  1.00 9.48  ? 215 VAL B CG1   1 
ATOM   4974 C  CG2   . VAL B 1 215 ? 40.029  41.843 28.234  1.00 7.84  ? 215 VAL B CG2   1 
ATOM   4975 N  N     . ALA B 1 216 ? 36.829  44.522 26.151  1.00 7.57  ? 216 ALA B N     1 
ATOM   4976 C  CA    . ALA B 1 216 ? 36.421  45.632 25.306  1.00 6.14  ? 216 ALA B CA    1 
ATOM   4977 C  C     . ALA B 1 216 ? 36.828  46.923 26.001  1.00 7.25  ? 216 ALA B C     1 
ATOM   4978 O  O     . ALA B 1 216 ? 36.767  47.017 27.233  1.00 8.92  ? 216 ALA B O     1 
ATOM   4979 C  CB    . ALA B 1 216 ? 34.908  45.599 25.078  1.00 2.99  ? 216 ALA B CB    1 
ATOM   4980 N  N     . VAL B 1 217 ? 37.272  47.906 25.225  1.00 7.02  ? 217 VAL B N     1 
ATOM   4981 C  CA    . VAL B 1 217 ? 37.643  49.184 25.800  1.00 7.26  ? 217 VAL B CA    1 
ATOM   4982 C  C     . VAL B 1 217 ? 36.673  50.217 25.247  1.00 8.09  ? 217 VAL B C     1 
ATOM   4983 O  O     . VAL B 1 217 ? 36.474  50.306 24.027  1.00 7.74  ? 217 VAL B O     1 
ATOM   4984 C  CB    . VAL B 1 217 ? 39.083  49.587 25.439  1.00 6.42  ? 217 VAL B CB    1 
ATOM   4985 C  CG1   . VAL B 1 217 ? 39.405  50.935 26.073  1.00 5.36  ? 217 VAL B CG1   1 
ATOM   4986 C  CG2   . VAL B 1 217 ? 40.064  48.529 25.935  1.00 5.16  ? 217 VAL B CG2   1 
ATOM   4987 N  N     . VAL B 1 218 ? 36.051  50.974 26.147  1.00 7.87  ? 218 VAL B N     1 
ATOM   4988 C  CA    . VAL B 1 218 ? 35.102  51.994 25.745  1.00 8.38  ? 218 VAL B CA    1 
ATOM   4989 C  C     . VAL B 1 218 ? 35.536  53.357 26.260  1.00 10.71 ? 218 VAL B C     1 
ATOM   4990 O  O     . VAL B 1 218 ? 35.530  53.613 27.473  1.00 11.86 ? 218 VAL B O     1 
ATOM   4991 C  CB    . VAL B 1 218 ? 33.688  51.660 26.256  1.00 6.26  ? 218 VAL B CB    1 
ATOM   4992 C  CG1   . VAL B 1 218 ? 32.739  52.818 25.999  1.00 4.96  ? 218 VAL B CG1   1 
ATOM   4993 C  CG2   . VAL B 1 218 ? 33.183  50.426 25.545  1.00 4.36  ? 218 VAL B CG2   1 
ATOM   4994 N  N     . ALA B 1 219 ? 35.932  54.224 25.328  1.00 12.21 ? 219 ALA B N     1 
ATOM   4995 C  CA    . ALA B 1 219 ? 36.366  55.573 25.669  1.00 12.59 ? 219 ALA B CA    1 
ATOM   4996 C  C     . ALA B 1 219 ? 35.146  56.470 25.876  1.00 13.29 ? 219 ALA B C     1 
ATOM   4997 O  O     . ALA B 1 219 ? 34.356  56.707 24.947  1.00 11.48 ? 219 ALA B O     1 
ATOM   4998 C  CB    . ALA B 1 219 ? 37.243  56.136 24.567  1.00 11.54 ? 219 ALA B CB    1 
ATOM   4999 N  N     . GLY B 1 220 ? 35.000  56.962 27.101  1.00 13.80 ? 220 GLY B N     1 
ATOM   5000 C  CA    . GLY B 1 220 ? 33.889  57.833 27.410  1.00 15.33 ? 220 GLY B CA    1 
ATOM   5001 C  C     . GLY B 1 220 ? 32.789  57.085 28.115  1.00 16.44 ? 220 GLY B C     1 
ATOM   5002 O  O     . GLY B 1 220 ? 32.490  55.938 27.777  1.00 17.98 ? 220 GLY B O     1 
ATOM   5003 N  N     . TYR B 1 221 ? 32.183  57.722 29.108  1.00 16.74 ? 221 TYR B N     1 
ATOM   5004 C  CA    . TYR B 1 221 ? 31.110  57.070 29.831  1.00 17.67 ? 221 TYR B CA    1 
ATOM   5005 C  C     . TYR B 1 221 ? 29.914  58.014 29.959  1.00 17.50 ? 221 TYR B C     1 
ATOM   5006 O  O     . TYR B 1 221 ? 29.341  58.180 31.043  1.00 17.50 ? 221 TYR B O     1 
ATOM   5007 C  CB    . TYR B 1 221 ? 31.592  56.615 31.210  1.00 17.12 ? 221 TYR B CB    1 
ATOM   5008 C  CG    . TYR B 1 221 ? 30.656  55.623 31.863  1.00 18.05 ? 221 TYR B CG    1 
ATOM   5009 C  CD1   . TYR B 1 221 ? 30.448  54.366 31.303  1.00 16.90 ? 221 TYR B CD1   1 
ATOM   5010 C  CD2   . TYR B 1 221 ? 29.965  55.944 33.035  1.00 18.42 ? 221 TYR B CD2   1 
ATOM   5011 C  CE1   . TYR B 1 221 ? 29.576  53.449 31.896  1.00 17.18 ? 221 TYR B CE1   1 
ATOM   5012 C  CE2   . TYR B 1 221 ? 29.090  55.032 33.633  1.00 16.77 ? 221 TYR B CE2   1 
ATOM   5013 C  CZ    . TYR B 1 221 ? 28.906  53.793 33.058  1.00 16.80 ? 221 TYR B CZ    1 
ATOM   5014 O  OH    . TYR B 1 221 ? 28.058  52.895 33.648  1.00 17.80 ? 221 TYR B OH    1 
ATOM   5015 N  N     . GLY B 1 222 ? 29.556  58.644 28.840  1.00 16.66 ? 222 GLY B N     1 
ATOM   5016 C  CA    . GLY B 1 222 ? 28.414  59.538 28.824  1.00 14.96 ? 222 GLY B CA    1 
ATOM   5017 C  C     . GLY B 1 222 ? 27.216  58.679 28.484  1.00 15.02 ? 222 GLY B C     1 
ATOM   5018 O  O     . GLY B 1 222 ? 27.322  57.447 28.574  1.00 14.85 ? 222 GLY B O     1 
ATOM   5019 N  N     . ASP B 1 223 ? 26.090  59.278 28.095  1.00 14.25 ? 223 ASP B N     1 
ATOM   5020 C  CA    . ASP B 1 223 ? 24.914  58.463 27.763  1.00 13.86 ? 223 ASP B CA    1 
ATOM   5021 C  C     . ASP B 1 223 ? 25.293  57.347 26.779  1.00 13.93 ? 223 ASP B C     1 
ATOM   5022 O  O     . ASP B 1 223 ? 24.933  56.185 26.989  1.00 14.27 ? 223 ASP B O     1 
ATOM   5023 C  CB    . ASP B 1 223 ? 23.780  59.311 27.169  1.00 13.71 ? 223 ASP B CB    1 
ATOM   5024 C  CG    . ASP B 1 223 ? 23.322  60.437 28.102  1.00 14.26 ? 223 ASP B CG    1 
ATOM   5025 O  OD1   . ASP B 1 223 ? 23.011  60.165 29.279  1.00 14.19 ? 223 ASP B OD1   1 
ATOM   5026 O  OD2   . ASP B 1 223 ? 23.255  61.601 27.650  1.00 14.51 ? 223 ASP B OD2   1 
ATOM   5027 N  N     . VAL B 1 224 ? 26.031  57.692 25.720  1.00 13.26 ? 224 VAL B N     1 
ATOM   5028 C  CA    . VAL B 1 224 ? 26.459  56.710 24.718  1.00 12.11 ? 224 VAL B CA    1 
ATOM   5029 C  C     . VAL B 1 224 ? 27.467  55.695 25.276  1.00 11.24 ? 224 VAL B C     1 
ATOM   5030 O  O     . VAL B 1 224 ? 27.429  54.508 24.937  1.00 10.58 ? 224 VAL B O     1 
ATOM   5031 C  CB    . VAL B 1 224 ? 27.086  57.404 23.488  1.00 13.14 ? 224 VAL B CB    1 
ATOM   5032 C  CG1   . VAL B 1 224 ? 27.625  56.355 22.519  1.00 13.26 ? 224 VAL B CG1   1 
ATOM   5033 C  CG2   . VAL B 1 224 ? 26.046  58.266 22.791  1.00 12.34 ? 224 VAL B CG2   1 
ATOM   5034 N  N     . GLY B 1 225 ? 28.378  56.164 26.120  1.00 10.49 ? 225 GLY B N     1 
ATOM   5035 C  CA    . GLY B 1 225 ? 29.346  55.258 26.705  1.00 10.33 ? 225 GLY B CA    1 
ATOM   5036 C  C     . GLY B 1 225 ? 28.604  54.241 27.552  1.00 10.03 ? 225 GLY B C     1 
ATOM   5037 O  O     . GLY B 1 225 ? 28.751  53.028 27.376  1.00 9.80  ? 225 GLY B O     1 
ATOM   5038 N  N     . LYS B 1 226 ? 27.794  54.745 28.476  1.00 10.78 ? 226 LYS B N     1 
ATOM   5039 C  CA    . LYS B 1 226 ? 27.009  53.889 29.362  1.00 11.21 ? 226 LYS B CA    1 
ATOM   5040 C  C     . LYS B 1 226 ? 26.264  52.789 28.591  1.00 11.82 ? 226 LYS B C     1 
ATOM   5041 O  O     . LYS B 1 226 ? 26.286  51.618 28.985  1.00 12.14 ? 226 LYS B O     1 
ATOM   5042 C  CB    . LYS B 1 226 ? 26.025  54.748 30.172  1.00 9.93  ? 226 LYS B CB    1 
ATOM   5043 C  CG    . LYS B 1 226 ? 26.701  55.676 31.215  1.00 10.16 ? 226 LYS B CG    1 
ATOM   5044 C  CD    . LYS B 1 226 ? 25.677  56.559 31.937  1.00 8.22  ? 226 LYS B CD    1 
ATOM   5045 C  CE    . LYS B 1 226 ? 26.265  57.299 33.155  1.00 8.50  ? 226 LYS B CE    1 
ATOM   5046 N  NZ    . LYS B 1 226 ? 27.393  58.245 32.862  1.00 8.77  ? 226 LYS B NZ    1 
ATOM   5047 N  N     . GLY B 1 227 ? 25.626  53.157 27.483  1.00 11.92 ? 227 GLY B N     1 
ATOM   5048 C  CA    . GLY B 1 227 ? 24.903  52.174 26.693  1.00 11.25 ? 227 GLY B CA    1 
ATOM   5049 C  C     . GLY B 1 227 ? 25.813  51.115 26.091  1.00 11.03 ? 227 GLY B C     1 
ATOM   5050 O  O     . GLY B 1 227 ? 25.558  49.914 26.202  1.00 9.49  ? 227 GLY B O     1 
ATOM   5051 N  N     . CYS B 1 228 ? 26.882  51.562 25.441  1.00 11.51 ? 228 CYS B N     1 
ATOM   5052 C  CA    . CYS B 1 228 ? 27.820  50.640 24.822  1.00 12.93 ? 228 CYS B CA    1 
ATOM   5053 C  C     . CYS B 1 228 ? 28.454  49.698 25.831  1.00 14.56 ? 228 CYS B C     1 
ATOM   5054 O  O     . CYS B 1 228 ? 28.517  48.481 25.603  1.00 16.70 ? 228 CYS B O     1 
ATOM   5055 C  CB    . CYS B 1 228 ? 28.907  51.411 24.094  1.00 11.87 ? 228 CYS B CB    1 
ATOM   5056 S  SG    . CYS B 1 228 ? 28.251  52.457 22.793  1.00 11.67 ? 228 CYS B SG    1 
ATOM   5057 N  N     . ALA B 1 229 ? 28.925  50.256 26.944  1.00 15.13 ? 229 ALA B N     1 
ATOM   5058 C  CA    . ALA B 1 229 ? 29.556  49.460 27.997  1.00 15.97 ? 229 ALA B CA    1 
ATOM   5059 C  C     . ALA B 1 229 ? 28.621  48.361 28.491  1.00 16.49 ? 229 ALA B C     1 
ATOM   5060 O  O     . ALA B 1 229 ? 28.984  47.184 28.510  1.00 17.15 ? 229 ALA B O     1 
ATOM   5061 C  CB    . ALA B 1 229 ? 29.952  50.358 29.159  1.00 16.33 ? 229 ALA B CB    1 
ATOM   5062 N  N     . GLN B 1 230 ? 27.415  48.753 28.886  1.00 17.24 ? 230 GLN B N     1 
ATOM   5063 C  CA    . GLN B 1 230 ? 26.438  47.801 29.387  1.00 18.46 ? 230 GLN B CA    1 
ATOM   5064 C  C     . GLN B 1 230 ? 26.137  46.719 28.351  1.00 16.82 ? 230 GLN B C     1 
ATOM   5065 O  O     . GLN B 1 230 ? 26.059  45.530 28.677  1.00 16.14 ? 230 GLN B O     1 
ATOM   5066 C  CB    . GLN B 1 230 ? 25.162  48.543 29.781  1.00 21.39 ? 230 GLN B CB    1 
ATOM   5067 C  CG    . GLN B 1 230 ? 24.134  47.692 30.497  1.00 27.97 ? 230 GLN B CG    1 
ATOM   5068 C  CD    . GLN B 1 230 ? 22.901  48.500 30.881  1.00 31.67 ? 230 GLN B CD    1 
ATOM   5069 O  OE1   . GLN B 1 230 ? 22.267  49.130 30.023  1.00 32.67 ? 230 GLN B OE1   1 
ATOM   5070 N  NE2   . GLN B 1 230 ? 22.551  48.482 32.172  1.00 32.38 ? 230 GLN B NE2   1 
ATOM   5071 N  N     . ALA B 1 231 ? 25.985  47.137 27.099  1.00 16.30 ? 231 ALA B N     1 
ATOM   5072 C  CA    . ALA B 1 231 ? 25.701  46.212 26.003  1.00 15.96 ? 231 ALA B CA    1 
ATOM   5073 C  C     . ALA B 1 231 ? 26.802  45.156 25.884  1.00 15.25 ? 231 ALA B C     1 
ATOM   5074 O  O     . ALA B 1 231 ? 26.524  43.954 25.791  1.00 15.46 ? 231 ALA B O     1 
ATOM   5075 C  CB    . ALA B 1 231 ? 25.569  46.986 24.696  1.00 15.68 ? 231 ALA B CB    1 
ATOM   5076 N  N     . LEU B 1 232 ? 28.051  45.607 25.894  1.00 13.52 ? 232 LEU B N     1 
ATOM   5077 C  CA    . LEU B 1 232 ? 29.165  44.685 25.801  1.00 13.07 ? 232 LEU B CA    1 
ATOM   5078 C  C     . LEU B 1 232 ? 29.225  43.682 26.936  1.00 13.24 ? 232 LEU B C     1 
ATOM   5079 O  O     . LEU B 1 232 ? 29.215  42.482 26.690  1.00 13.53 ? 232 LEU B O     1 
ATOM   5080 C  CB    . LEU B 1 232 ? 30.487  45.438 25.708  1.00 12.26 ? 232 LEU B CB    1 
ATOM   5081 C  CG    . LEU B 1 232 ? 30.654  46.108 24.344  1.00 12.24 ? 232 LEU B CG    1 
ATOM   5082 C  CD1   . LEU B 1 232 ? 31.805  47.083 24.404  1.00 11.58 ? 232 LEU B CD1   1 
ATOM   5083 C  CD2   . LEU B 1 232 ? 30.855  45.042 23.249  1.00 8.83  ? 232 LEU B CD2   1 
ATOM   5084 N  N     . ARG B 1 233 ? 29.284  44.125 28.185  1.00 14.53 ? 233 ARG B N     1 
ATOM   5085 C  CA    . ARG B 1 233 ? 29.350  43.112 29.232  1.00 15.89 ? 233 ARG B CA    1 
ATOM   5086 C  C     . ARG B 1 233 ? 28.084  42.261 29.244  1.00 15.73 ? 233 ARG B C     1 
ATOM   5087 O  O     . ARG B 1 233 ? 28.122  41.089 29.627  1.00 15.53 ? 233 ARG B O     1 
ATOM   5088 C  CB    . ARG B 1 233 ? 29.595  43.724 30.613  1.00 17.97 ? 233 ARG B CB    1 
ATOM   5089 C  CG    . ARG B 1 233 ? 28.539  44.652 31.152  1.00 21.32 ? 233 ARG B CG    1 
ATOM   5090 C  CD    . ARG B 1 233 ? 28.813  44.831 32.632  1.00 23.35 ? 233 ARG B CD    1 
ATOM   5091 N  NE    . ARG B 1 233 ? 27.991  45.862 33.245  1.00 27.89 ? 233 ARG B NE    1 
ATOM   5092 C  CZ    . ARG B 1 233 ? 28.084  46.204 34.525  1.00 29.45 ? 233 ARG B CZ    1 
ATOM   5093 N  NH1   . ARG B 1 233 ? 28.962  45.583 35.310  1.00 29.83 ? 233 ARG B NH1   1 
ATOM   5094 N  NH2   . ARG B 1 233 ? 27.329  47.186 35.009  1.00 30.59 ? 233 ARG B NH2   1 
ATOM   5095 N  N     . GLY B 1 234 ? 26.968  42.837 28.803  1.00 14.47 ? 234 GLY B N     1 
ATOM   5096 C  CA    . GLY B 1 234 ? 25.742  42.071 28.770  1.00 14.05 ? 234 GLY B CA    1 
ATOM   5097 C  C     . GLY B 1 234 ? 26.005  40.737 28.097  1.00 14.43 ? 234 GLY B C     1 
ATOM   5098 O  O     . GLY B 1 234 ? 25.424  39.723 28.474  1.00 14.07 ? 234 GLY B O     1 
ATOM   5099 N  N     . PHE B 1 235 ? 26.891  40.742 27.101  1.00 14.39 ? 235 PHE B N     1 
ATOM   5100 C  CA    . PHE B 1 235 ? 27.247  39.530 26.361  1.00 13.87 ? 235 PHE B CA    1 
ATOM   5101 C  C     . PHE B 1 235 ? 28.459  38.777 26.886  1.00 12.78 ? 235 PHE B C     1 
ATOM   5102 O  O     . PHE B 1 235 ? 28.864  37.768 26.308  1.00 14.27 ? 235 PHE B O     1 
ATOM   5103 C  CB    . PHE B 1 235 ? 27.473  39.836 24.881  1.00 15.17 ? 235 PHE B CB    1 
ATOM   5104 C  CG    . PHE B 1 235 ? 26.209  40.077 24.125  1.00 17.77 ? 235 PHE B CG    1 
ATOM   5105 C  CD1   . PHE B 1 235 ? 25.241  39.083 24.048  1.00 17.63 ? 235 PHE B CD1   1 
ATOM   5106 C  CD2   . PHE B 1 235 ? 25.979  41.292 23.486  1.00 18.47 ? 235 PHE B CD2   1 
ATOM   5107 C  CE1   . PHE B 1 235 ? 24.062  39.286 23.349  1.00 19.03 ? 235 PHE B CE1   1 
ATOM   5108 C  CE2   . PHE B 1 235 ? 24.799  41.505 22.782  1.00 19.92 ? 235 PHE B CE2   1 
ATOM   5109 C  CZ    . PHE B 1 235 ? 23.835  40.495 22.713  1.00 19.18 ? 235 PHE B CZ    1 
ATOM   5110 N  N     . GLY B 1 236 ? 29.059  39.259 27.961  1.00 10.16 ? 236 GLY B N     1 
ATOM   5111 C  CA    . GLY B 1 236 ? 30.182  38.530 28.508  1.00 9.91  ? 236 GLY B CA    1 
ATOM   5112 C  C     . GLY B 1 236 ? 31.563  39.079 28.238  1.00 9.09  ? 236 GLY B C     1 
ATOM   5113 O  O     . GLY B 1 236 ? 32.540  38.351 28.343  1.00 8.45  ? 236 GLY B O     1 
ATOM   5114 N  N     . ALA B 1 237 ? 31.659  40.357 27.893  1.00 9.01  ? 237 ALA B N     1 
ATOM   5115 C  CA    . ALA B 1 237 ? 32.962  40.955 27.650  1.00 9.20  ? 237 ALA B CA    1 
ATOM   5116 C  C     . ALA B 1 237 ? 33.382  41.707 28.914  1.00 9.69  ? 237 ALA B C     1 
ATOM   5117 O  O     . ALA B 1 237 ? 32.513  42.166 29.673  1.00 9.20  ? 237 ALA B O     1 
ATOM   5118 C  CB    . ALA B 1 237 ? 32.880  41.910 26.478  1.00 7.83  ? 237 ALA B CB    1 
ATOM   5119 N  N     . ARG B 1 238 ? 34.695  41.814 29.152  1.00 9.38  ? 238 ARG B N     1 
ATOM   5120 C  CA    . ARG B 1 238 ? 35.203  42.546 30.315  1.00 8.85  ? 238 ARG B CA    1 
ATOM   5121 C  C     . ARG B 1 238 ? 35.475  43.977 29.841  1.00 8.80  ? 238 ARG B C     1 
ATOM   5122 O  O     . ARG B 1 238 ? 36.485  44.278 29.222  1.00 9.29  ? 238 ARG B O     1 
ATOM   5123 C  CB    . ARG B 1 238 ? 36.476  41.894 30.858  1.00 9.07  ? 238 ARG B CB    1 
ATOM   5124 C  CG    . ARG B 1 238 ? 37.015  42.538 32.134  1.00 10.78 ? 238 ARG B CG    1 
ATOM   5125 C  CD    . ARG B 1 238 ? 37.906  41.551 32.912  1.00 12.40 ? 238 ARG B CD    1 
ATOM   5126 N  NE    . ARG B 1 238 ? 39.128  41.194 32.192  1.00 13.11 ? 238 ARG B NE    1 
ATOM   5127 C  CZ    . ARG B 1 238 ? 40.168  42.013 32.050  1.00 14.26 ? 238 ARG B CZ    1 
ATOM   5128 N  NH1   . ARG B 1 238 ? 40.128  43.237 32.578  1.00 16.98 ? 238 ARG B NH1   1 
ATOM   5129 N  NH2   . ARG B 1 238 ? 41.245  41.613 31.388  1.00 13.01 ? 238 ARG B NH2   1 
ATOM   5130 N  N     . VAL B 1 239 ? 34.541  44.857 30.140  1.00 8.93  ? 239 VAL B N     1 
ATOM   5131 C  CA    . VAL B 1 239 ? 34.619  46.237 29.722  1.00 7.85  ? 239 VAL B CA    1 
ATOM   5132 C  C     . VAL B 1 239 ? 35.529  47.134 30.534  1.00 8.63  ? 239 VAL B C     1 
ATOM   5133 O  O     . VAL B 1 239 ? 35.348  47.281 31.739  1.00 8.97  ? 239 VAL B O     1 
ATOM   5134 C  CB    . VAL B 1 239 ? 33.215  46.854 29.731  1.00 7.01  ? 239 VAL B CB    1 
ATOM   5135 C  CG1   . VAL B 1 239 ? 33.288  48.317 29.361  1.00 7.01  ? 239 VAL B CG1   1 
ATOM   5136 C  CG2   . VAL B 1 239 ? 32.306  46.077 28.774  1.00 4.72  ? 239 VAL B CG2   1 
ATOM   5137 N  N     . ILE B 1 240 ? 36.509  47.735 29.860  1.00 9.20  ? 240 ILE B N     1 
ATOM   5138 C  CA    . ILE B 1 240 ? 37.432  48.678 30.486  1.00 9.03  ? 240 ILE B CA    1 
ATOM   5139 C  C     . ILE B 1 240 ? 37.032  50.048 29.936  1.00 10.20 ? 240 ILE B C     1 
ATOM   5140 O  O     . ILE B 1 240 ? 36.788  50.200 28.734  1.00 11.68 ? 240 ILE B O     1 
ATOM   5141 C  CB    . ILE B 1 240 ? 38.894  48.385 30.118  1.00 9.04  ? 240 ILE B CB    1 
ATOM   5142 C  CG1   . ILE B 1 240 ? 39.315  47.035 30.704  1.00 8.09  ? 240 ILE B CG1   1 
ATOM   5143 C  CG2   . ILE B 1 240 ? 39.796  49.513 30.638  1.00 8.30  ? 240 ILE B CG2   1 
ATOM   5144 C  CD1   . ILE B 1 240 ? 40.715  46.609 30.319  1.00 9.75  ? 240 ILE B CD1   1 
ATOM   5145 N  N     . ILE B 1 241 ? 36.977  51.041 30.816  1.00 10.75 ? 241 ILE B N     1 
ATOM   5146 C  CA    . ILE B 1 241 ? 36.545  52.388 30.458  1.00 10.85 ? 241 ILE B CA    1 
ATOM   5147 C  C     . ILE B 1 241 ? 37.537  53.522 30.699  1.00 12.01 ? 241 ILE B C     1 
ATOM   5148 O  O     . ILE B 1 241 ? 38.285  53.519 31.682  1.00 11.77 ? 241 ILE B O     1 
ATOM   5149 C  CB    . ILE B 1 241 ? 35.209  52.693 31.203  1.00 11.17 ? 241 ILE B CB    1 
ATOM   5150 C  CG1   . ILE B 1 241 ? 34.078  51.965 30.471  1.00 11.74 ? 241 ILE B CG1   1 
ATOM   5151 C  CG2   . ILE B 1 241 ? 34.975  54.203 31.370  1.00 9.09  ? 241 ILE B CG2   1 
ATOM   5152 C  CD1   . ILE B 1 241 ? 32.736  52.107 31.107  1.00 14.32 ? 241 ILE B CD1   1 
ATOM   5153 N  N     . THR B 1 242 ? 37.534  54.492 29.788  1.00 12.76 ? 242 THR B N     1 
ATOM   5154 C  CA    . THR B 1 242 ? 38.395  55.665 29.908  1.00 14.91 ? 242 THR B CA    1 
ATOM   5155 C  C     . THR B 1 242 ? 37.489  56.883 30.034  1.00 16.13 ? 242 THR B C     1 
ATOM   5156 O  O     . THR B 1 242 ? 36.416  56.940 29.424  1.00 15.74 ? 242 THR B O     1 
ATOM   5157 C  CB    . THR B 1 242 ? 39.288  55.869 28.665  1.00 14.57 ? 242 THR B CB    1 
ATOM   5158 O  OG1   . THR B 1 242 ? 38.462  56.084 27.509  1.00 14.23 ? 242 THR B OG1   1 
ATOM   5159 C  CG2   . THR B 1 242 ? 40.173  54.656 28.444  1.00 12.98 ? 242 THR B CG2   1 
ATOM   5160 N  N     . GLU B 1 243 ? 37.926  57.856 30.823  1.00 17.51 ? 243 GLU B N     1 
ATOM   5161 C  CA    . GLU B 1 243 ? 37.153  59.074 31.026  1.00 18.28 ? 243 GLU B CA    1 
ATOM   5162 C  C     . GLU B 1 243 ? 38.075  60.201 31.433  1.00 18.98 ? 243 GLU B C     1 
ATOM   5163 O  O     . GLU B 1 243 ? 39.184  59.966 31.913  1.00 19.31 ? 243 GLU B O     1 
ATOM   5164 C  CB    . GLU B 1 243 ? 36.109  58.876 32.127  1.00 17.79 ? 243 GLU B CB    1 
ATOM   5165 C  CG    . GLU B 1 243 ? 34.667  58.668 31.666  1.00 18.85 ? 243 GLU B CG    1 
ATOM   5166 C  CD    . GLU B 1 243 ? 34.083  59.881 30.947  1.00 19.57 ? 243 GLU B CD    1 
ATOM   5167 O  OE1   . GLU B 1 243 ? 34.338  61.028 31.371  1.00 20.07 ? 243 GLU B OE1   1 
ATOM   5168 O  OE2   . GLU B 1 243 ? 33.333  59.687 29.969  1.00 21.97 ? 243 GLU B OE2   1 
ATOM   5169 N  N     . ILE B 1 244 ? 37.605  61.427 31.244  1.00 19.33 ? 244 ILE B N     1 
ATOM   5170 C  CA    . ILE B 1 244 ? 38.377  62.595 31.615  1.00 20.35 ? 244 ILE B CA    1 
ATOM   5171 C  C     . ILE B 1 244 ? 37.625  63.291 32.738  1.00 21.04 ? 244 ILE B C     1 
ATOM   5172 O  O     . ILE B 1 244 ? 38.187  64.127 33.455  1.00 22.27 ? 244 ILE B O     1 
ATOM   5173 C  CB    . ILE B 1 244 ? 38.515  63.571 30.435  1.00 20.69 ? 244 ILE B CB    1 
ATOM   5174 C  CG1   . ILE B 1 244 ? 37.135  64.080 30.014  1.00 20.57 ? 244 ILE B CG1   1 
ATOM   5175 C  CG2   . ILE B 1 244 ? 39.194  62.875 29.263  1.00 21.51 ? 244 ILE B CG2   1 
ATOM   5176 C  CD1   . ILE B 1 244 ? 37.183  65.104 28.900  1.00 21.13 ? 244 ILE B CD1   1 
ATOM   5177 N  N     . ASP B 1 245 ? 36.352  62.924 32.888  1.00 19.82 ? 245 ASP B N     1 
ATOM   5178 C  CA    . ASP B 1 245 ? 35.478  63.512 33.895  1.00 19.12 ? 245 ASP B CA    1 
ATOM   5179 C  C     . ASP B 1 245 ? 35.384  62.635 35.148  1.00 19.42 ? 245 ASP B C     1 
ATOM   5180 O  O     . ASP B 1 245 ? 35.002  61.468 35.075  1.00 21.01 ? 245 ASP B O     1 
ATOM   5181 C  CB    . ASP B 1 245 ? 34.099  63.754 33.268  1.00 18.12 ? 245 ASP B CB    1 
ATOM   5182 C  CG    . ASP B 1 245 ? 33.147  64.477 34.201  1.00 19.09 ? 245 ASP B CG    1 
ATOM   5183 O  OD1   . ASP B 1 245 ? 33.306  64.337 35.439  1.00 18.65 ? 245 ASP B OD1   1 
ATOM   5184 O  OD2   . ASP B 1 245 ? 32.229  65.172 33.694  1.00 18.12 ? 245 ASP B OD2   1 
ATOM   5185 N  N     . PRO B 1 246 ? 35.713  63.200 36.323  1.00 18.85 ? 246 PRO B N     1 
ATOM   5186 C  CA    . PRO B 1 246 ? 35.677  62.469 37.593  1.00 17.86 ? 246 PRO B CA    1 
ATOM   5187 C  C     . PRO B 1 246 ? 34.347  61.785 37.856  1.00 16.89 ? 246 PRO B C     1 
ATOM   5188 O  O     . PRO B 1 246 ? 34.303  60.592 38.159  1.00 17.34 ? 246 PRO B O     1 
ATOM   5189 C  CB    . PRO B 1 246 ? 35.962  63.560 38.619  1.00 18.26 ? 246 PRO B CB    1 
ATOM   5190 C  CG    . PRO B 1 246 ? 36.863  64.471 37.860  1.00 19.38 ? 246 PRO B CG    1 
ATOM   5191 C  CD    . PRO B 1 246 ? 36.076  64.602 36.572  1.00 19.24 ? 246 PRO B CD    1 
ATOM   5192 N  N     . ILE B 1 247 ? 33.267  62.548 37.739  1.00 15.07 ? 247 ILE B N     1 
ATOM   5193 C  CA    . ILE B 1 247 ? 31.938  62.014 37.980  1.00 14.99 ? 247 ILE B CA    1 
ATOM   5194 C  C     . ILE B 1 247 ? 31.663  60.786 37.094  1.00 14.97 ? 247 ILE B C     1 
ATOM   5195 O  O     . ILE B 1 247 ? 31.460  59.680 37.611  1.00 15.91 ? 247 ILE B O     1 
ATOM   5196 C  CB    . ILE B 1 247 ? 30.875  63.124 37.763  1.00 15.84 ? 247 ILE B CB    1 
ATOM   5197 C  CG1   . ILE B 1 247 ? 31.202  64.324 38.671  1.00 15.10 ? 247 ILE B CG1   1 
ATOM   5198 C  CG2   . ILE B 1 247 ? 29.481  62.600 38.084  1.00 15.75 ? 247 ILE B CG2   1 
ATOM   5199 C  CD1   . ILE B 1 247 ? 30.252  65.494 38.524  1.00 13.94 ? 247 ILE B CD1   1 
ATOM   5200 N  N     . ASN B 1 248 ? 31.668  60.966 35.773  1.00 13.64 ? 248 ASN B N     1 
ATOM   5201 C  CA    . ASN B 1 248 ? 31.438  59.856 34.853  1.00 12.59 ? 248 ASN B CA    1 
ATOM   5202 C  C     . ASN B 1 248 ? 32.350  58.692 35.220  1.00 12.59 ? 248 ASN B C     1 
ATOM   5203 O  O     . ASN B 1 248 ? 31.928  57.537 35.232  1.00 12.22 ? 248 ASN B O     1 
ATOM   5204 C  CB    . ASN B 1 248 ? 31.733  60.303 33.427  1.00 14.62 ? 248 ASN B CB    1 
ATOM   5205 C  CG    . ASN B 1 248 ? 30.705  61.296 32.901  1.00 17.27 ? 248 ASN B CG    1 
ATOM   5206 O  OD1   . ASN B 1 248 ? 29.620  60.911 32.447  1.00 18.91 ? 248 ASN B OD1   1 
ATOM   5207 N  ND2   . ASN B 1 248 ? 31.030  62.580 32.979  1.00 17.22 ? 248 ASN B ND2   1 
ATOM   5208 N  N     . ALA B 1 249 ? 33.605  59.017 35.527  1.00 12.49 ? 249 ALA B N     1 
ATOM   5209 C  CA    . ALA B 1 249 ? 34.611  58.032 35.895  1.00 10.69 ? 249 ALA B CA    1 
ATOM   5210 C  C     . ALA B 1 249 ? 34.170  57.278 37.134  1.00 11.38 ? 249 ALA B C     1 
ATOM   5211 O  O     . ALA B 1 249 ? 34.170  56.038 37.154  1.00 12.18 ? 249 ALA B O     1 
ATOM   5212 C  CB    . ALA B 1 249 ? 35.933  58.726 36.154  1.00 9.61  ? 249 ALA B CB    1 
ATOM   5213 N  N     . LEU B 1 250 ? 33.785  58.024 38.169  1.00 11.06 ? 250 LEU B N     1 
ATOM   5214 C  CA    . LEU B 1 250 ? 33.358  57.407 39.422  1.00 9.88  ? 250 LEU B CA    1 
ATOM   5215 C  C     . LEU B 1 250 ? 32.164  56.509 39.175  1.00 9.76  ? 250 LEU B C     1 
ATOM   5216 O  O     . LEU B 1 250 ? 32.101  55.405 39.706  1.00 9.96  ? 250 LEU B O     1 
ATOM   5217 C  CB    . LEU B 1 250 ? 32.999  58.464 40.472  1.00 9.65  ? 250 LEU B CB    1 
ATOM   5218 C  CG    . LEU B 1 250 ? 32.707  57.892 41.869  1.00 9.17  ? 250 LEU B CG    1 
ATOM   5219 C  CD1   . LEU B 1 250 ? 33.893  57.053 42.332  1.00 8.79  ? 250 LEU B CD1   1 
ATOM   5220 C  CD2   . LEU B 1 250 ? 32.440  59.020 42.865  1.00 8.18  ? 250 LEU B CD2   1 
ATOM   5221 N  N     . GLN B 1 251 ? 31.223  56.974 38.360  1.00 9.12  ? 251 GLN B N     1 
ATOM   5222 C  CA    . GLN B 1 251 ? 30.048  56.174 38.053  1.00 9.40  ? 251 GLN B CA    1 
ATOM   5223 C  C     . GLN B 1 251 ? 30.487  54.824 37.493  1.00 10.81 ? 251 GLN B C     1 
ATOM   5224 O  O     . GLN B 1 251 ? 30.058  53.773 37.972  1.00 12.46 ? 251 GLN B O     1 
ATOM   5225 C  CB    . GLN B 1 251 ? 29.162  56.873 37.020  1.00 8.80  ? 251 GLN B CB    1 
ATOM   5226 C  CG    . GLN B 1 251 ? 28.756  58.309 37.348  1.00 5.37  ? 251 GLN B CG    1 
ATOM   5227 C  CD    . GLN B 1 251 ? 27.774  58.838 36.334  1.00 4.92  ? 251 GLN B CD    1 
ATOM   5228 O  OE1   . GLN B 1 251 ? 26.559  58.633 36.451  1.00 5.45  ? 251 GLN B OE1   1 
ATOM   5229 N  NE2   . GLN B 1 251 ? 28.292  59.487 35.302  1.00 2.70  ? 251 GLN B NE2   1 
ATOM   5230 N  N     . ALA B 1 252 ? 31.335  54.849 36.468  1.00 12.11 ? 252 ALA B N     1 
ATOM   5231 C  CA    . ALA B 1 252 ? 31.819  53.605 35.878  1.00 12.34 ? 252 ALA B CA    1 
ATOM   5232 C  C     . ALA B 1 252 ? 32.304  52.682 36.994  1.00 12.76 ? 252 ALA B C     1 
ATOM   5233 O  O     . ALA B 1 252 ? 31.771  51.591 37.181  1.00 12.60 ? 252 ALA B O     1 
ATOM   5234 C  CB    . ALA B 1 252 ? 32.949  53.884 34.898  1.00 11.59 ? 252 ALA B CB    1 
ATOM   5235 N  N     . ALA B 1 253 ? 33.302  53.126 37.749  1.00 13.35 ? 253 ALA B N     1 
ATOM   5236 C  CA    . ALA B 1 253 ? 33.831  52.303 38.833  1.00 13.88 ? 253 ALA B CA    1 
ATOM   5237 C  C     . ALA B 1 253 ? 32.724  51.769 39.757  1.00 14.99 ? 253 ALA B C     1 
ATOM   5238 O  O     . ALA B 1 253 ? 32.769  50.605 40.187  1.00 15.49 ? 253 ALA B O     1 
ATOM   5239 C  CB    . ALA B 1 253 ? 34.845  53.090 39.630  1.00 13.39 ? 253 ALA B CB    1 
HETATM 5240 N  N     . MSE B 1 254 ? 31.738  52.613 40.069  1.00 15.59 ? 254 MSE B N     1 
HETATM 5241 C  CA    . MSE B 1 254 ? 30.629  52.199 40.929  1.00 16.44 ? 254 MSE B CA    1 
HETATM 5242 C  C     . MSE B 1 254 ? 29.800  51.093 40.256  1.00 15.77 ? 254 MSE B C     1 
HETATM 5243 O  O     . MSE B 1 254 ? 29.173  50.274 40.939  1.00 16.33 ? 254 MSE B O     1 
HETATM 5244 C  CB    . MSE B 1 254 ? 29.713  53.385 41.253  1.00 18.32 ? 254 MSE B CB    1 
HETATM 5245 C  CG    . MSE B 1 254 ? 30.265  54.461 42.209  1.00 21.87 ? 254 MSE B CG    1 
HETATM 5246 SE SE    . MSE B 1 254 ? 30.574  53.818 43.954  1.00 26.35 ? 254 MSE B SE    1 
HETATM 5247 C  CE    . MSE B 1 254 ? 31.133  55.428 44.637  1.00 24.57 ? 254 MSE B CE    1 
ATOM   5248 N  N     . GLU B 1 255 ? 29.792  51.074 38.923  1.00 13.47 ? 255 GLU B N     1 
ATOM   5249 C  CA    . GLU B 1 255 ? 29.049  50.058 38.177  1.00 11.18 ? 255 GLU B CA    1 
ATOM   5250 C  C     . GLU B 1 255 ? 29.889  48.810 37.954  1.00 10.04 ? 255 GLU B C     1 
ATOM   5251 O  O     . GLU B 1 255 ? 29.448  47.874 37.310  1.00 10.50 ? 255 GLU B O     1 
ATOM   5252 C  CB    . GLU B 1 255 ? 28.587  50.612 36.828  1.00 11.82 ? 255 GLU B CB    1 
ATOM   5253 C  CG    . GLU B 1 255 ? 27.624  51.789 36.956  1.00 15.45 ? 255 GLU B CG    1 
ATOM   5254 C  CD    . GLU B 1 255 ? 26.237  51.397 37.480  1.00 17.50 ? 255 GLU B CD    1 
ATOM   5255 O  OE1   . GLU B 1 255 ? 26.097  50.312 38.103  1.00 17.49 ? 255 GLU B OE1   1 
ATOM   5256 O  OE2   . GLU B 1 255 ? 25.287  52.196 37.285  1.00 18.74 ? 255 GLU B OE2   1 
ATOM   5257 N  N     . GLY B 1 256 ? 31.110  48.805 38.473  1.00 9.88  ? 256 GLY B N     1 
ATOM   5258 C  CA    . GLY B 1 256 ? 31.961  47.641 38.331  1.00 10.88 ? 256 GLY B CA    1 
ATOM   5259 C  C     . GLY B 1 256 ? 32.980  47.609 37.200  1.00 11.20 ? 256 GLY B C     1 
ATOM   5260 O  O     . GLY B 1 256 ? 33.686  46.607 37.046  1.00 9.97  ? 256 GLY B O     1 
ATOM   5261 N  N     . TYR B 1 257 ? 33.078  48.674 36.410  1.00 12.23 ? 257 TYR B N     1 
ATOM   5262 C  CA    . TYR B 1 257 ? 34.033  48.677 35.307  1.00 12.30 ? 257 TYR B CA    1 
ATOM   5263 C  C     . TYR B 1 257 ? 35.352  49.253 35.752  1.00 13.82 ? 257 TYR B C     1 
ATOM   5264 O  O     . TYR B 1 257 ? 35.390  50.216 36.515  1.00 14.12 ? 257 TYR B O     1 
ATOM   5265 C  CB    . TYR B 1 257 ? 33.565  49.534 34.130  1.00 11.49 ? 257 TYR B CB    1 
ATOM   5266 C  CG    . TYR B 1 257 ? 32.190  49.241 33.582  1.00 11.09 ? 257 TYR B CG    1 
ATOM   5267 C  CD1   . TYR B 1 257 ? 31.992  48.204 32.686  1.00 9.89  ? 257 TYR B CD1   1 
ATOM   5268 C  CD2   . TYR B 1 257 ? 31.094  50.031 33.933  1.00 9.99  ? 257 TYR B CD2   1 
ATOM   5269 C  CE1   . TYR B 1 257 ? 30.744  47.953 32.147  1.00 10.71 ? 257 TYR B CE1   1 
ATOM   5270 C  CE2   . TYR B 1 257 ? 29.841  49.793 33.399  1.00 10.67 ? 257 TYR B CE2   1 
ATOM   5271 C  CZ    . TYR B 1 257 ? 29.668  48.748 32.505  1.00 10.96 ? 257 TYR B CZ    1 
ATOM   5272 O  OH    . TYR B 1 257 ? 28.415  48.481 31.982  1.00 9.62  ? 257 TYR B OH    1 
ATOM   5273 N  N     . GLU B 1 258 ? 36.438  48.665 35.260  1.00 15.95 ? 258 GLU B N     1 
ATOM   5274 C  CA    . GLU B 1 258 ? 37.778  49.155 35.558  1.00 16.56 ? 258 GLU B CA    1 
ATOM   5275 C  C     . GLU B 1 258 ? 37.970  50.413 34.717  1.00 16.75 ? 258 GLU B C     1 
ATOM   5276 O  O     . GLU B 1 258 ? 37.774  50.374 33.503  1.00 16.22 ? 258 GLU B O     1 
ATOM   5277 C  CB    . GLU B 1 258 ? 38.826  48.133 35.135  1.00 18.23 ? 258 GLU B CB    1 
ATOM   5278 C  CG    . GLU B 1 258 ? 40.247  48.645 35.288  1.00 19.83 ? 258 GLU B CG    1 
ATOM   5279 C  CD    . GLU B 1 258 ? 41.287  47.726 34.677  1.00 21.08 ? 258 GLU B CD    1 
ATOM   5280 O  OE1   . GLU B 1 258 ? 40.915  46.726 34.009  1.00 21.32 ? 258 GLU B OE1   1 
ATOM   5281 O  OE2   . GLU B 1 258 ? 42.489  48.024 34.866  1.00 22.48 ? 258 GLU B OE2   1 
ATOM   5282 N  N     . VAL B 1 259 ? 38.351  51.522 35.347  1.00 17.65 ? 259 VAL B N     1 
ATOM   5283 C  CA    . VAL B 1 259 ? 38.563  52.774 34.612  1.00 17.13 ? 259 VAL B CA    1 
ATOM   5284 C  C     . VAL B 1 259 ? 40.062  53.100 34.519  1.00 17.81 ? 259 VAL B C     1 
ATOM   5285 O  O     . VAL B 1 259 ? 40.757  53.170 35.544  1.00 17.14 ? 259 VAL B O     1 
ATOM   5286 C  CB    . VAL B 1 259 ? 37.820  53.958 35.299  1.00 15.87 ? 259 VAL B CB    1 
ATOM   5287 C  CG1   . VAL B 1 259 ? 38.034  55.241 34.526  1.00 14.78 ? 259 VAL B CG1   1 
ATOM   5288 C  CG2   . VAL B 1 259 ? 36.342  53.660 35.397  1.00 15.38 ? 259 VAL B CG2   1 
ATOM   5289 N  N     . THR B 1 260 ? 40.560  53.288 33.295  1.00 18.04 ? 260 THR B N     1 
ATOM   5290 C  CA    . THR B 1 260 ? 41.972  53.620 33.093  1.00 18.74 ? 260 THR B CA    1 
ATOM   5291 C  C     . THR B 1 260 ? 42.148  54.583 31.934  1.00 19.90 ? 260 THR B C     1 
ATOM   5292 O  O     . THR B 1 260 ? 41.197  55.203 31.443  1.00 20.60 ? 260 THR B O     1 
ATOM   5293 C  CB    . THR B 1 260 ? 42.843  52.406 32.720  1.00 18.25 ? 260 THR B CB    1 
ATOM   5294 O  OG1   . THR B 1 260 ? 42.270  51.207 33.243  1.00 21.03 ? 260 THR B OG1   1 
ATOM   5295 C  CG2   . THR B 1 260 ? 44.233  52.577 33.294  1.00 17.37 ? 260 THR B CG2   1 
ATOM   5296 N  N     . THR B 1 261 ? 43.395  54.667 31.490  1.00 20.51 ? 261 THR B N     1 
ATOM   5297 C  CA    . THR B 1 261 ? 43.774  55.523 30.389  1.00 21.36 ? 261 THR B CA    1 
ATOM   5298 C  C     . THR B 1 261 ? 43.911  54.658 29.143  1.00 22.65 ? 261 THR B C     1 
ATOM   5299 O  O     . THR B 1 261 ? 44.222  53.473 29.235  1.00 21.39 ? 261 THR B O     1 
ATOM   5300 C  CB    . THR B 1 261 ? 45.127  56.202 30.678  1.00 21.70 ? 261 THR B CB    1 
ATOM   5301 O  OG1   . THR B 1 261 ? 46.156  55.200 30.769  1.00 20.66 ? 261 THR B OG1   1 
ATOM   5302 C  CG2   . THR B 1 261 ? 45.052  56.999 31.990  1.00 19.96 ? 261 THR B CG2   1 
HETATM 5303 N  N     . MSE B 1 262 ? 43.676  55.249 27.977  1.00 24.86 ? 262 MSE B N     1 
HETATM 5304 C  CA    . MSE B 1 262 ? 43.792  54.503 26.732  1.00 26.67 ? 262 MSE B CA    1 
HETATM 5305 C  C     . MSE B 1 262 ? 45.197  53.916 26.588  1.00 28.56 ? 262 MSE B C     1 
HETATM 5306 O  O     . MSE B 1 262 ? 45.366  52.808 26.056  1.00 28.54 ? 262 MSE B O     1 
HETATM 5307 C  CB    . MSE B 1 262 ? 43.489  55.399 25.531  1.00 25.77 ? 262 MSE B CB    1 
HETATM 5308 C  CG    . MSE B 1 262 ? 43.574  54.683 24.188  1.00 26.19 ? 262 MSE B CG    1 
HETATM 5309 SE SE    . MSE B 1 262 ? 42.362  53.271 24.085  1.00 26.94 ? 262 MSE B SE    1 
HETATM 5310 C  CE    . MSE B 1 262 ? 42.787  52.734 22.388  1.00 29.89 ? 262 MSE B CE    1 
ATOM   5311 N  N     . ASP B 1 263 ? 46.205  54.649 27.065  1.00 29.46 ? 263 ASP B N     1 
ATOM   5312 C  CA    . ASP B 1 263 ? 47.583  54.167 26.963  1.00 31.00 ? 263 ASP B CA    1 
ATOM   5313 C  C     . ASP B 1 263 ? 47.733  52.789 27.593  1.00 31.69 ? 263 ASP B C     1 
ATOM   5314 O  O     . ASP B 1 263 ? 48.474  51.936 27.090  1.00 32.20 ? 263 ASP B O     1 
ATOM   5315 C  CB    . ASP B 1 263 ? 48.569  55.154 27.608  1.00 30.82 ? 263 ASP B CB    1 
ATOM   5316 C  CG    . ASP B 1 263 ? 48.607  56.501 26.886  1.00 31.15 ? 263 ASP B CG    1 
ATOM   5317 O  OD1   . ASP B 1 263 ? 48.427  56.514 25.647  1.00 30.60 ? 263 ASP B OD1   1 
ATOM   5318 O  OD2   . ASP B 1 263 ? 48.843  57.539 27.547  1.00 29.71 ? 263 ASP B OD2   1 
ATOM   5319 N  N     . GLU B 1 264 ? 47.015  52.575 28.690  1.00 32.09 ? 264 GLU B N     1 
ATOM   5320 C  CA    . GLU B 1 264 ? 47.040  51.301 29.395  1.00 31.78 ? 264 GLU B CA    1 
ATOM   5321 C  C     . GLU B 1 264 ? 46.168  50.275 28.676  1.00 30.95 ? 264 GLU B C     1 
ATOM   5322 O  O     . GLU B 1 264 ? 46.638  49.211 28.255  1.00 31.11 ? 264 GLU B O     1 
ATOM   5323 C  CB    . GLU B 1 264 ? 46.512  51.487 30.816  1.00 32.68 ? 264 GLU B CB    1 
ATOM   5324 C  CG    . GLU B 1 264 ? 47.373  52.370 31.677  1.00 35.28 ? 264 GLU B CG    1 
ATOM   5325 C  CD    . GLU B 1 264 ? 48.712  51.732 31.976  1.00 35.95 ? 264 GLU B CD    1 
ATOM   5326 O  OE1   . GLU B 1 264 ? 48.714  50.682 32.653  1.00 36.01 ? 264 GLU B OE1   1 
ATOM   5327 O  OE2   . GLU B 1 264 ? 49.753  52.269 31.529  1.00 36.69 ? 264 GLU B OE2   1 
ATOM   5328 N  N     . ALA B 1 265 ? 44.892  50.619 28.539  1.00 29.78 ? 265 ALA B N     1 
ATOM   5329 C  CA    . ALA B 1 265 ? 43.908  49.752 27.914  1.00 28.54 ? 265 ALA B CA    1 
ATOM   5330 C  C     . ALA B 1 265 ? 44.198  49.358 26.473  1.00 28.03 ? 265 ALA B C     1 
ATOM   5331 O  O     . ALA B 1 265 ? 43.707  48.333 26.005  1.00 28.13 ? 265 ALA B O     1 
ATOM   5332 C  CB    . ALA B 1 265 ? 42.540  50.398 28.000  1.00 28.31 ? 265 ALA B CB    1 
ATOM   5333 N  N     . CYS B 1 266 ? 44.982  50.157 25.759  1.00 27.33 ? 266 CYS B N     1 
ATOM   5334 C  CA    . CYS B 1 266 ? 45.269  49.822 24.370  1.00 26.83 ? 266 CYS B CA    1 
ATOM   5335 C  C     . CYS B 1 266 ? 46.024  48.502 24.284  1.00 26.55 ? 266 CYS B C     1 
ATOM   5336 O  O     . CYS B 1 266 ? 45.993  47.827 23.252  1.00 26.81 ? 266 CYS B O     1 
ATOM   5337 C  CB    . CYS B 1 266 ? 46.080  50.933 23.685  1.00 26.60 ? 266 CYS B CB    1 
ATOM   5338 S  SG    . CYS B 1 266 ? 47.759  51.119 24.269  1.00 24.96 ? 266 CYS B SG    1 
ATOM   5339 N  N     . GLN B 1 267 ? 46.681  48.124 25.377  1.00 25.75 ? 267 GLN B N     1 
ATOM   5340 C  CA    . GLN B 1 267 ? 47.446  46.879 25.409  1.00 26.14 ? 267 GLN B CA    1 
ATOM   5341 C  C     . GLN B 1 267 ? 46.596  45.670 25.807  1.00 25.85 ? 267 GLN B C     1 
ATOM   5342 O  O     . GLN B 1 267 ? 47.089  44.542 25.820  1.00 26.09 ? 267 GLN B O     1 
ATOM   5343 C  CB    . GLN B 1 267 ? 48.584  46.986 26.414  1.00 25.93 ? 267 GLN B CB    1 
ATOM   5344 C  CG    . GLN B 1 267 ? 49.206  48.363 26.531  1.00 26.36 ? 267 GLN B CG    1 
ATOM   5345 C  CD    . GLN B 1 267 ? 50.346  48.394 27.541  1.00 25.78 ? 267 GLN B CD    1 
ATOM   5346 O  OE1   . GLN B 1 267 ? 50.793  49.459 27.964  1.00 25.40 ? 267 GLN B OE1   1 
ATOM   5347 N  NE2   . GLN B 1 267 ? 50.829  47.221 27.916  1.00 25.37 ? 267 GLN B NE2   1 
ATOM   5348 N  N     . GLU B 1 268 ? 45.327  45.900 26.128  1.00 25.19 ? 268 GLU B N     1 
ATOM   5349 C  CA    . GLU B 1 268 ? 44.449  44.826 26.573  1.00 24.01 ? 268 GLU B CA    1 
ATOM   5350 C  C     . GLU B 1 268 ? 43.231  44.563 25.714  1.00 23.71 ? 268 GLU B C     1 
ATOM   5351 O  O     . GLU B 1 268 ? 42.803  43.422 25.554  1.00 23.69 ? 268 GLU B O     1 
ATOM   5352 C  CB    . GLU B 1 268 ? 43.967  45.130 27.986  1.00 24.84 ? 268 GLU B CB    1 
ATOM   5353 C  CG    . GLU B 1 268 ? 45.024  45.031 29.057  1.00 26.94 ? 268 GLU B CG    1 
ATOM   5354 C  CD    . GLU B 1 268 ? 44.496  45.441 30.422  1.00 28.12 ? 268 GLU B CD    1 
ATOM   5355 O  OE1   . GLU B 1 268 ? 44.320  46.662 30.650  1.00 27.48 ? 268 GLU B OE1   1 
ATOM   5356 O  OE2   . GLU B 1 268 ? 44.239  44.538 31.258  1.00 28.21 ? 268 GLU B OE2   1 
ATOM   5357 N  N     . GLY B 1 269 ? 42.662  45.633 25.182  1.00 23.52 ? 269 GLY B N     1 
ATOM   5358 C  CA    . GLY B 1 269 ? 41.463  45.512 24.381  1.00 22.20 ? 269 GLY B CA    1 
ATOM   5359 C  C     . GLY B 1 269 ? 41.521  44.626 23.158  1.00 21.58 ? 269 GLY B C     1 
ATOM   5360 O  O     . GLY B 1 269 ? 42.544  44.538 22.474  1.00 22.27 ? 269 GLY B O     1 
ATOM   5361 N  N     . ASN B 1 270 ? 40.397  43.957 22.909  1.00 20.27 ? 270 ASN B N     1 
ATOM   5362 C  CA    . ASN B 1 270 ? 40.209  43.087 21.756  1.00 18.43 ? 270 ASN B CA    1 
ATOM   5363 C  C     . ASN B 1 270 ? 39.188  43.844 20.912  1.00 17.42 ? 270 ASN B C     1 
ATOM   5364 O  O     . ASN B 1 270 ? 39.014  43.587 19.717  1.00 16.77 ? 270 ASN B O     1 
ATOM   5365 C  CB    . ASN B 1 270 ? 39.632  41.723 22.168  1.00 18.23 ? 270 ASN B CB    1 
ATOM   5366 C  CG    . ASN B 1 270 ? 40.551  40.958 23.101  1.00 18.29 ? 270 ASN B CG    1 
ATOM   5367 O  OD1   . ASN B 1 270 ? 41.741  40.817 22.822  1.00 19.30 ? 270 ASN B OD1   1 
ATOM   5368 N  ND2   . ASN B 1 270 ? 40.005  40.447 24.206  1.00 17.25 ? 270 ASN B ND2   1 
ATOM   5369 N  N     . ILE B 1 271 ? 38.504  44.779 21.561  1.00 15.06 ? 271 ILE B N     1 
ATOM   5370 C  CA    . ILE B 1 271 ? 37.515  45.599 20.883  1.00 13.60 ? 271 ILE B CA    1 
ATOM   5371 C  C     . ILE B 1 271 ? 37.632  47.012 21.445  1.00 13.17 ? 271 ILE B C     1 
ATOM   5372 O  O     . ILE B 1 271 ? 37.782  47.183 22.653  1.00 13.98 ? 271 ILE B O     1 
ATOM   5373 C  CB    . ILE B 1 271 ? 36.083  45.069 21.134  1.00 12.58 ? 271 ILE B CB    1 
ATOM   5374 C  CG1   . ILE B 1 271 ? 35.971  43.615 20.684  1.00 11.78 ? 271 ILE B CG1   1 
ATOM   5375 C  CG2   . ILE B 1 271 ? 35.059  45.908 20.368  1.00 11.05 ? 271 ILE B CG2   1 
ATOM   5376 C  CD1   . ILE B 1 271 ? 34.585  43.025 20.919  1.00 12.22 ? 271 ILE B CD1   1 
ATOM   5377 N  N     . PHE B 1 272 ? 37.597  48.020 20.581  1.00 12.56 ? 272 PHE B N     1 
ATOM   5378 C  CA    . PHE B 1 272 ? 37.666  49.398 21.051  1.00 13.08 ? 272 PHE B CA    1 
ATOM   5379 C  C     . PHE B 1 272 ? 36.500  50.201 20.470  1.00 13.79 ? 272 PHE B C     1 
ATOM   5380 O  O     . PHE B 1 272 ? 36.209  50.129 19.265  1.00 13.53 ? 272 PHE B O     1 
ATOM   5381 C  CB    . PHE B 1 272 ? 38.996  50.056 20.666  1.00 12.10 ? 272 PHE B CB    1 
ATOM   5382 C  CG    . PHE B 1 272 ? 40.210  49.365 21.237  1.00 11.03 ? 272 PHE B CG    1 
ATOM   5383 C  CD1   . PHE B 1 272 ? 40.697  48.197 20.665  1.00 9.48  ? 272 PHE B CD1   1 
ATOM   5384 C  CD2   . PHE B 1 272 ? 40.856  49.883 22.357  1.00 10.94 ? 272 PHE B CD2   1 
ATOM   5385 C  CE1   . PHE B 1 272 ? 41.815  47.551 21.196  1.00 9.60  ? 272 PHE B CE1   1 
ATOM   5386 C  CE2   . PHE B 1 272 ? 41.978  49.246 22.902  1.00 11.08 ? 272 PHE B CE2   1 
ATOM   5387 C  CZ    . PHE B 1 272 ? 42.459  48.075 22.318  1.00 10.51 ? 272 PHE B CZ    1 
ATOM   5388 N  N     . VAL B 1 273 ? 35.827  50.955 21.338  1.00 13.64 ? 273 VAL B N     1 
ATOM   5389 C  CA    . VAL B 1 273 ? 34.690  51.776 20.938  1.00 13.93 ? 273 VAL B CA    1 
ATOM   5390 C  C     . VAL B 1 273 ? 34.828  53.184 21.516  1.00 14.92 ? 273 VAL B C     1 
ATOM   5391 O  O     . VAL B 1 273 ? 34.873  53.366 22.737  1.00 15.18 ? 273 VAL B O     1 
ATOM   5392 C  CB    . VAL B 1 273 ? 33.368  51.152 21.439  1.00 12.97 ? 273 VAL B CB    1 
ATOM   5393 C  CG1   . VAL B 1 273 ? 32.176  51.982 20.971  1.00 12.44 ? 273 VAL B CG1   1 
ATOM   5394 C  CG2   . VAL B 1 273 ? 33.255  49.728 20.933  1.00 12.76 ? 273 VAL B CG2   1 
ATOM   5395 N  N     . THR B 1 274 ? 34.899  54.182 20.644  1.00 15.77 ? 274 THR B N     1 
ATOM   5396 C  CA    . THR B 1 274 ? 35.033  55.554 21.108  1.00 17.67 ? 274 THR B CA    1 
ATOM   5397 C  C     . THR B 1 274 ? 33.660  56.218 21.133  1.00 18.80 ? 274 THR B C     1 
ATOM   5398 O  O     . THR B 1 274 ? 32.985  56.283 20.102  1.00 19.82 ? 274 THR B O     1 
ATOM   5399 C  CB    . THR B 1 274 ? 35.985  56.348 20.191  1.00 17.85 ? 274 THR B CB    1 
ATOM   5400 O  OG1   . THR B 1 274 ? 35.486  56.324 18.846  1.00 20.09 ? 274 THR B OG1   1 
ATOM   5401 C  CG2   . THR B 1 274 ? 37.373  55.731 20.205  1.00 16.90 ? 274 THR B CG2   1 
ATOM   5402 N  N     . THR B 1 275 ? 33.238  56.680 22.312  1.00 19.87 ? 275 THR B N     1 
ATOM   5403 C  CA    . THR B 1 275 ? 31.942  57.339 22.462  1.00 20.74 ? 275 THR B CA    1 
ATOM   5404 C  C     . THR B 1 275 ? 32.213  58.771 22.896  1.00 21.25 ? 275 THR B C     1 
ATOM   5405 O  O     . THR B 1 275 ? 31.313  59.527 23.246  1.00 21.37 ? 275 THR B O     1 
ATOM   5406 C  CB    . THR B 1 275 ? 31.050  56.645 23.524  1.00 21.19 ? 275 THR B CB    1 
ATOM   5407 O  OG1   . THR B 1 275 ? 31.600  56.860 24.832  1.00 20.03 ? 275 THR B OG1   1 
ATOM   5408 C  CG2   . THR B 1 275 ? 30.969  55.155 23.255  1.00 21.48 ? 275 THR B CG2   1 
ATOM   5409 N  N     . THR B 1 276 ? 33.485  59.124 22.884  1.00 23.43 ? 276 THR B N     1 
ATOM   5410 C  CA    . THR B 1 276 ? 33.927  60.465 23.233  1.00 24.47 ? 276 THR B CA    1 
ATOM   5411 C  C     . THR B 1 276 ? 33.351  61.389 22.181  1.00 26.14 ? 276 THR B C     1 
ATOM   5412 O  O     . THR B 1 276 ? 32.767  60.940 21.193  1.00 27.60 ? 276 THR B O     1 
ATOM   5413 C  CB    . THR B 1 276 ? 35.460  60.558 23.161  1.00 23.56 ? 276 THR B CB    1 
ATOM   5414 O  OG1   . THR B 1 276 ? 36.029  59.811 24.238  1.00 23.70 ? 276 THR B OG1   1 
ATOM   5415 C  CG2   . THR B 1 276 ? 35.924  61.979 23.219  1.00 23.23 ? 276 THR B CG2   1 
ATOM   5416 N  N     . GLY B 1 277 ? 33.496  62.684 22.388  1.00 26.51 ? 277 GLY B N     1 
ATOM   5417 C  CA    . GLY B 1 277 ? 33.004  63.601 21.393  1.00 26.24 ? 277 GLY B CA    1 
ATOM   5418 C  C     . GLY B 1 277 ? 34.190  64.364 20.856  1.00 25.74 ? 277 GLY B C     1 
ATOM   5419 O  O     . GLY B 1 277 ? 34.009  65.378 20.186  1.00 25.90 ? 277 GLY B O     1 
ATOM   5420 N  N     . CYS B 1 278 ? 35.405  63.893 21.134  1.00 25.18 ? 278 CYS B N     1 
ATOM   5421 C  CA    . CYS B 1 278 ? 36.568  64.632 20.663  1.00 25.46 ? 278 CYS B CA    1 
ATOM   5422 C  C     . CYS B 1 278 ? 37.688  63.872 19.963  1.00 26.01 ? 278 CYS B C     1 
ATOM   5423 O  O     . CYS B 1 278 ? 37.733  62.642 19.940  1.00 26.30 ? 278 CYS B O     1 
ATOM   5424 C  CB    . CYS B 1 278 ? 37.176  65.462 21.801  1.00 25.09 ? 278 CYS B CB    1 
ATOM   5425 S  SG    . CYS B 1 278 ? 38.466  64.670 22.775  1.00 22.77 ? 278 CYS B SG    1 
ATOM   5426 N  N     . ILE B 1 279 ? 38.597  64.669 19.409  1.00 26.36 ? 279 ILE B N     1 
ATOM   5427 C  CA    . ILE B 1 279 ? 39.756  64.235 18.640  1.00 26.18 ? 279 ILE B CA    1 
ATOM   5428 C  C     . ILE B 1 279 ? 40.870  63.569 19.417  1.00 26.13 ? 279 ILE B C     1 
ATOM   5429 O  O     . ILE B 1 279 ? 41.051  63.806 20.612  1.00 25.72 ? 279 ILE B O     1 
ATOM   5430 C  CB    . ILE B 1 279 ? 40.388  65.437 17.944  1.00 25.40 ? 279 ILE B CB    1 
ATOM   5431 C  CG1   . ILE B 1 279 ? 40.781  66.456 19.013  1.00 25.73 ? 279 ILE B CG1   1 
ATOM   5432 C  CG2   . ILE B 1 279 ? 39.409  66.059 16.965  1.00 25.30 ? 279 ILE B CG2   1 
ATOM   5433 C  CD1   . ILE B 1 279 ? 41.272  67.772 18.475  1.00 27.56 ? 279 ILE B CD1   1 
ATOM   5434 N  N     . ASP B 1 280 ? 41.615  62.732 18.702  1.00 26.41 ? 280 ASP B N     1 
ATOM   5435 C  CA    . ASP B 1 280 ? 42.784  62.059 19.251  1.00 26.86 ? 280 ASP B CA    1 
ATOM   5436 C  C     . ASP B 1 280 ? 42.523  61.113 20.414  1.00 26.29 ? 280 ASP B C     1 
ATOM   5437 O  O     . ASP B 1 280 ? 43.082  61.293 21.491  1.00 26.14 ? 280 ASP B O     1 
ATOM   5438 C  CB    . ASP B 1 280 ? 43.790  63.130 19.670  1.00 27.83 ? 280 ASP B CB    1 
ATOM   5439 C  CG    . ASP B 1 280 ? 44.064  64.131 18.555  1.00 29.76 ? 280 ASP B CG    1 
ATOM   5440 O  OD1   . ASP B 1 280 ? 43.682  63.858 17.388  1.00 31.48 ? 280 ASP B OD1   1 
ATOM   5441 O  OD2   . ASP B 1 280 ? 44.671  65.185 18.841  1.00 30.85 ? 280 ASP B OD2   1 
ATOM   5442 N  N     . ILE B 1 281 ? 41.697  60.096 20.194  1.00 26.10 ? 281 ILE B N     1 
ATOM   5443 C  CA    . ILE B 1 281 ? 41.396  59.144 21.252  1.00 25.35 ? 281 ILE B CA    1 
ATOM   5444 C  C     . ILE B 1 281 ? 42.255  57.891 21.092  1.00 25.35 ? 281 ILE B C     1 
ATOM   5445 O  O     . ILE B 1 281 ? 42.840  57.394 22.062  1.00 25.03 ? 281 ILE B O     1 
ATOM   5446 C  CB    . ILE B 1 281 ? 39.904  58.753 21.234  1.00 24.40 ? 281 ILE B CB    1 
ATOM   5447 C  CG1   . ILE B 1 281 ? 39.033  60.014 21.330  1.00 23.08 ? 281 ILE B CG1   1 
ATOM   5448 C  CG2   . ILE B 1 281 ? 39.602  57.813 22.400  1.00 24.36 ? 281 ILE B CG2   1 
ATOM   5449 C  CD1   . ILE B 1 281 ? 39.263  60.839 22.581  1.00 21.28 ? 281 ILE B CD1   1 
ATOM   5450 N  N     . ILE B 1 282 ? 42.323  57.388 19.863  1.00 25.37 ? 282 ILE B N     1 
ATOM   5451 C  CA    . ILE B 1 282 ? 43.114  56.196 19.547  1.00 26.11 ? 282 ILE B CA    1 
ATOM   5452 C  C     . ILE B 1 282 ? 44.138  56.573 18.474  1.00 26.57 ? 282 ILE B C     1 
ATOM   5453 O  O     . ILE B 1 282 ? 43.780  56.804 17.311  1.00 27.83 ? 282 ILE B O     1 
ATOM   5454 C  CB    . ILE B 1 282 ? 42.215  55.058 19.020  1.00 26.06 ? 282 ILE B CB    1 
ATOM   5455 C  CG1   . ILE B 1 282 ? 41.174  54.687 20.078  1.00 25.85 ? 282 ILE B CG1   1 
ATOM   5456 C  CG2   . ILE B 1 282 ? 43.059  53.851 18.675  1.00 26.20 ? 282 ILE B CG2   1 
ATOM   5457 C  CD1   . ILE B 1 282 ? 40.257  53.550 19.681  1.00 25.92 ? 282 ILE B CD1   1 
ATOM   5458 N  N     . LEU B 1 283 ? 45.410  56.626 18.865  1.00 26.34 ? 283 LEU B N     1 
ATOM   5459 C  CA    . LEU B 1 283 ? 46.472  57.025 17.951  1.00 26.12 ? 283 LEU B CA    1 
ATOM   5460 C  C     . LEU B 1 283 ? 47.401  55.884 17.572  1.00 26.67 ? 283 LEU B C     1 
ATOM   5461 O  O     . LEU B 1 283 ? 47.202  54.738 17.988  1.00 27.14 ? 283 LEU B O     1 
ATOM   5462 C  CB    . LEU B 1 283 ? 47.318  58.129 18.585  1.00 26.95 ? 283 LEU B CB    1 
ATOM   5463 C  CG    . LEU B 1 283 ? 46.657  59.360 19.219  1.00 25.46 ? 283 LEU B CG    1 
ATOM   5464 C  CD1   . LEU B 1 283 ? 45.766  60.057 18.207  1.00 25.32 ? 283 LEU B CD1   1 
ATOM   5465 C  CD2   . LEU B 1 283 ? 45.854  58.935 20.431  1.00 26.29 ? 283 LEU B CD2   1 
ATOM   5466 N  N     . GLY B 1 284 ? 48.424  56.224 16.784  1.00 26.18 ? 284 GLY B N     1 
ATOM   5467 C  CA    . GLY B 1 284 ? 49.401  55.246 16.352  1.00 25.09 ? 284 GLY B CA    1 
ATOM   5468 C  C     . GLY B 1 284 ? 50.014  54.575 17.560  1.00 25.07 ? 284 GLY B C     1 
ATOM   5469 O  O     . GLY B 1 284 ? 50.206  53.364 17.555  1.00 25.23 ? 284 GLY B O     1 
ATOM   5470 N  N     . ARG B 1 285 ? 50.322  55.359 18.594  1.00 25.55 ? 285 ARG B N     1 
ATOM   5471 C  CA    . ARG B 1 285 ? 50.902  54.822 19.833  1.00 26.44 ? 285 ARG B CA    1 
ATOM   5472 C  C     . ARG B 1 285 ? 50.093  53.635 20.304  1.00 26.44 ? 285 ARG B C     1 
ATOM   5473 O  O     . ARG B 1 285 ? 50.628  52.621 20.747  1.00 26.63 ? 285 ARG B O     1 
ATOM   5474 C  CB    . ARG B 1 285 ? 50.841  55.855 20.949  1.00 27.22 ? 285 ARG B CB    1 
ATOM   5475 C  CG    . ARG B 1 285 ? 51.784  57.004 20.843  1.00 28.51 ? 285 ARG B CG    1 
ATOM   5476 C  CD    . ARG B 1 285 ? 51.150  58.206 21.521  1.00 30.43 ? 285 ARG B CD    1 
ATOM   5477 N  NE    . ARG B 1 285 ? 50.631  57.925 22.860  1.00 28.63 ? 285 ARG B NE    1 
ATOM   5478 C  CZ    . ARG B 1 285 ? 49.827  58.757 23.516  1.00 29.51 ? 285 ARG B CZ    1 
ATOM   5479 N  NH1   . ARG B 1 285 ? 49.459  59.904 22.953  1.00 28.56 ? 285 ARG B NH1   1 
ATOM   5480 N  NH2   . ARG B 1 285 ? 49.395  58.455 24.731  1.00 29.45 ? 285 ARG B NH2   1 
ATOM   5481 N  N     . HIS B 1 286 ? 48.784  53.809 20.224  1.00 26.90 ? 286 HIS B N     1 
ATOM   5482 C  CA    . HIS B 1 286 ? 47.822  52.813 20.644  1.00 27.89 ? 286 HIS B CA    1 
ATOM   5483 C  C     . HIS B 1 286 ? 47.735  51.653 19.654  1.00 28.23 ? 286 HIS B C     1 
ATOM   5484 O  O     . HIS B 1 286 ? 47.904  50.496 20.036  1.00 28.97 ? 286 HIS B O     1 
ATOM   5485 C  CB    . HIS B 1 286 ? 46.480  53.517 20.815  1.00 28.01 ? 286 HIS B CB    1 
ATOM   5486 C  CG    . HIS B 1 286 ? 46.535  54.655 21.789  1.00 27.00 ? 286 HIS B CG    1 
ATOM   5487 N  ND1   . HIS B 1 286 ? 45.653  55.714 21.759  1.00 27.04 ? 286 HIS B ND1   1 
ATOM   5488 C  CD2   . HIS B 1 286 ? 47.380  54.898 22.820  1.00 25.72 ? 286 HIS B CD2   1 
ATOM   5489 C  CE1   . HIS B 1 286 ? 45.954  56.563 22.727  1.00 25.92 ? 286 HIS B CE1   1 
ATOM   5490 N  NE2   . HIS B 1 286 ? 46.997  56.092 23.386  1.00 24.76 ? 286 HIS B NE2   1 
ATOM   5491 N  N     . PHE B 1 287 ? 47.484  51.961 18.388  1.00 29.02 ? 287 PHE B N     1 
ATOM   5492 C  CA    . PHE B 1 287 ? 47.400  50.921 17.365  1.00 30.32 ? 287 PHE B CA    1 
ATOM   5493 C  C     . PHE B 1 287 ? 48.544  49.920 17.463  1.00 31.26 ? 287 PHE B C     1 
ATOM   5494 O  O     . PHE B 1 287 ? 48.324  48.706 17.427  1.00 31.30 ? 287 PHE B O     1 
ATOM   5495 C  CB    . PHE B 1 287 ? 47.394  51.551 15.964  1.00 30.00 ? 287 PHE B CB    1 
ATOM   5496 C  CG    . PHE B 1 287 ? 46.069  52.142 15.569  1.00 29.11 ? 287 PHE B CG    1 
ATOM   5497 C  CD1   . PHE B 1 287 ? 44.893  51.456 15.814  1.00 28.68 ? 287 PHE B CD1   1 
ATOM   5498 C  CD2   . PHE B 1 287 ? 46.004  53.370 14.925  1.00 29.35 ? 287 PHE B CD2   1 
ATOM   5499 C  CE1   . PHE B 1 287 ? 43.669  51.981 15.428  1.00 30.43 ? 287 PHE B CE1   1 
ATOM   5500 C  CE2   . PHE B 1 287 ? 44.778  53.908 14.533  1.00 29.99 ? 287 PHE B CE2   1 
ATOM   5501 C  CZ    . PHE B 1 287 ? 43.609  53.211 14.784  1.00 29.72 ? 287 PHE B CZ    1 
ATOM   5502 N  N     . GLU B 1 288 ? 49.760  50.433 17.623  1.00 32.55 ? 288 GLU B N     1 
ATOM   5503 C  CA    . GLU B 1 288 ? 50.943  49.588 17.682  1.00 33.51 ? 288 GLU B CA    1 
ATOM   5504 C  C     . GLU B 1 288 ? 51.009  48.592 18.828  1.00 33.17 ? 288 GLU B C     1 
ATOM   5505 O  O     . GLU B 1 288 ? 51.668  47.562 18.702  1.00 34.10 ? 288 GLU B O     1 
ATOM   5506 C  CB    . GLU B 1 288 ? 52.202  50.460 17.670  1.00 35.12 ? 288 GLU B CB    1 
ATOM   5507 C  CG    . GLU B 1 288 ? 52.232  51.406 16.466  1.00 38.78 ? 288 GLU B CG    1 
ATOM   5508 C  CD    . GLU B 1 288 ? 53.584  52.070 16.235  1.00 39.83 ? 288 GLU B CD    1 
ATOM   5509 O  OE1   . GLU B 1 288 ? 54.178  52.577 17.217  1.00 37.83 ? 288 GLU B OE1   1 
ATOM   5510 O  OE2   . GLU B 1 288 ? 54.036  52.094 15.061  1.00 40.91 ? 288 GLU B OE2   1 
ATOM   5511 N  N     . GLN B 1 289 ? 50.326  48.866 19.936  1.00 32.70 ? 289 GLN B N     1 
ATOM   5512 C  CA    . GLN B 1 289 ? 50.364  47.941 21.074  1.00 31.39 ? 289 GLN B CA    1 
ATOM   5513 C  C     . GLN B 1 289 ? 49.168  46.993 21.166  1.00 30.71 ? 289 GLN B C     1 
ATOM   5514 O  O     . GLN B 1 289 ? 49.180  46.040 21.954  1.00 30.86 ? 289 GLN B O     1 
ATOM   5515 C  CB    . GLN B 1 289 ? 50.459  48.712 22.381  1.00 31.20 ? 289 GLN B CB    1 
ATOM   5516 C  CG    . GLN B 1 289 ? 51.690  49.552 22.536  1.00 30.60 ? 289 GLN B CG    1 
ATOM   5517 C  CD    . GLN B 1 289 ? 51.711  50.231 23.883  1.00 31.58 ? 289 GLN B CD    1 
ATOM   5518 O  OE1   . GLN B 1 289 ? 51.829  49.572 24.916  1.00 31.88 ? 289 GLN B OE1   1 
ATOM   5519 N  NE2   . GLN B 1 289 ? 51.567  51.555 23.886  1.00 32.10 ? 289 GLN B NE2   1 
HETATM 5520 N  N     . MSE B 1 290 ? 48.135  47.250 20.374  1.00 29.50 ? 290 MSE B N     1 
HETATM 5521 C  CA    . MSE B 1 290 ? 46.956  46.408 20.423  1.00 28.64 ? 290 MSE B CA    1 
HETATM 5522 C  C     . MSE B 1 290 ? 47.255  44.947 20.107  1.00 28.60 ? 290 MSE B C     1 
HETATM 5523 O  O     . MSE B 1 290 ? 48.246  44.625 19.450  1.00 29.16 ? 290 MSE B O     1 
HETATM 5524 C  CB    . MSE B 1 290 ? 45.895  46.943 19.466  1.00 27.53 ? 290 MSE B CB    1 
HETATM 5525 C  CG    . MSE B 1 290 ? 45.458  48.345 19.783  1.00 24.56 ? 290 MSE B CG    1 
HETATM 5526 SE SE    . MSE B 1 290 ? 44.128  48.838 18.600  1.00 24.87 ? 290 MSE B SE    1 
HETATM 5527 C  CE    . MSE B 1 290 ? 43.825  50.527 19.227  1.00 24.31 ? 290 MSE B CE    1 
ATOM   5528 N  N     . LYS B 1 291 ? 46.393  44.064 20.598  1.00 28.69 ? 291 LYS B N     1 
ATOM   5529 C  CA    . LYS B 1 291 ? 46.561  42.634 20.382  1.00 28.62 ? 291 LYS B CA    1 
ATOM   5530 C  C     . LYS B 1 291 ? 46.115  42.305 18.955  1.00 27.36 ? 291 LYS B C     1 
ATOM   5531 O  O     . LYS B 1 291 ? 45.365  43.073 18.344  1.00 28.15 ? 291 LYS B O     1 
ATOM   5532 C  CB    . LYS B 1 291 ? 45.729  41.883 21.422  1.00 29.93 ? 291 LYS B CB    1 
ATOM   5533 C  CG    . LYS B 1 291 ? 45.929  42.463 22.816  1.00 31.48 ? 291 LYS B CG    1 
ATOM   5534 C  CD    . LYS B 1 291 ? 45.148  41.733 23.884  1.00 33.59 ? 291 LYS B CD    1 
ATOM   5535 C  CE    . LYS B 1 291 ? 45.740  40.370 24.129  1.00 36.27 ? 291 LYS B CE    1 
ATOM   5536 N  NZ    . LYS B 1 291 ? 47.154  40.505 24.586  1.00 36.83 ? 291 LYS B NZ    1 
ATOM   5537 N  N     . ASP B 1 292 ? 46.583  41.180 18.420  1.00 25.71 ? 292 ASP B N     1 
ATOM   5538 C  CA    . ASP B 1 292 ? 46.245  40.784 17.054  1.00 24.89 ? 292 ASP B CA    1 
ATOM   5539 C  C     . ASP B 1 292 ? 44.739  40.838 16.807  1.00 23.66 ? 292 ASP B C     1 
ATOM   5540 O  O     . ASP B 1 292 ? 43.950  40.474 17.668  1.00 24.28 ? 292 ASP B O     1 
ATOM   5541 C  CB    . ASP B 1 292 ? 46.804  39.384 16.776  1.00 25.29 ? 292 ASP B CB    1 
ATOM   5542 C  CG    . ASP B 1 292 ? 46.752  39.010 15.306  1.00 26.49 ? 292 ASP B CG    1 
ATOM   5543 O  OD1   . ASP B 1 292 ? 47.027  39.894 14.463  1.00 27.20 ? 292 ASP B OD1   1 
ATOM   5544 O  OD2   . ASP B 1 292 ? 46.469  37.831 14.993  1.00 26.23 ? 292 ASP B OD2   1 
ATOM   5545 N  N     . ASP B 1 293 ? 44.354  41.315 15.631  1.00 22.77 ? 293 ASP B N     1 
ATOM   5546 C  CA    . ASP B 1 293 ? 42.951  41.443 15.241  1.00 22.23 ? 293 ASP B CA    1 
ATOM   5547 C  C     . ASP B 1 293 ? 42.007  42.231 16.148  1.00 21.65 ? 293 ASP B C     1 
ATOM   5548 O  O     . ASP B 1 293 ? 40.793  41.991 16.152  1.00 21.23 ? 293 ASP B O     1 
ATOM   5549 C  CB    . ASP B 1 293 ? 42.335  40.073 14.962  1.00 22.80 ? 293 ASP B CB    1 
ATOM   5550 C  CG    . ASP B 1 293 ? 42.550  39.618 13.528  1.00 22.40 ? 293 ASP B CG    1 
ATOM   5551 O  OD1   . ASP B 1 293 ? 42.277  40.417 12.604  1.00 22.02 ? 293 ASP B OD1   1 
ATOM   5552 O  OD2   . ASP B 1 293 ? 42.965  38.462 13.329  1.00 22.10 ? 293 ASP B OD2   1 
ATOM   5553 N  N     . ALA B 1 294 ? 42.552  43.176 16.902  1.00 21.29 ? 294 ALA B N     1 
ATOM   5554 C  CA    . ALA B 1 294 ? 41.725  44.004 17.766  1.00 21.24 ? 294 ALA B CA    1 
ATOM   5555 C  C     . ALA B 1 294 ? 40.742  44.722 16.850  1.00 21.13 ? 294 ALA B C     1 
ATOM   5556 O  O     . ALA B 1 294 ? 41.105  45.150 15.761  1.00 22.78 ? 294 ALA B O     1 
ATOM   5557 C  CB    . ALA B 1 294 ? 42.590  45.021 18.506  1.00 21.67 ? 294 ALA B CB    1 
ATOM   5558 N  N     . ILE B 1 295 ? 39.493  44.845 17.270  1.00 20.76 ? 295 ILE B N     1 
ATOM   5559 C  CA    . ILE B 1 295 ? 38.508  45.527 16.442  1.00 19.73 ? 295 ILE B CA    1 
ATOM   5560 C  C     . ILE B 1 295 ? 38.317  46.953 16.950  1.00 19.41 ? 295 ILE B C     1 
ATOM   5561 O  O     . ILE B 1 295 ? 37.933  47.168 18.110  1.00 19.48 ? 295 ILE B O     1 
ATOM   5562 C  CB    . ILE B 1 295 ? 37.163  44.776 16.454  1.00 20.13 ? 295 ILE B CB    1 
ATOM   5563 C  CG1   . ILE B 1 295 ? 37.337  43.407 15.800  1.00 19.20 ? 295 ILE B CG1   1 
ATOM   5564 C  CG2   . ILE B 1 295 ? 36.091  45.588 15.728  1.00 20.95 ? 295 ILE B CG2   1 
ATOM   5565 C  CD1   . ILE B 1 295 ? 36.052  42.602 15.738  1.00 19.48 ? 295 ILE B CD1   1 
ATOM   5566 N  N     . VAL B 1 296 ? 38.605  47.922 16.078  1.00 17.60 ? 296 VAL B N     1 
ATOM   5567 C  CA    . VAL B 1 296 ? 38.487  49.343 16.411  1.00 15.48 ? 296 VAL B CA    1 
ATOM   5568 C  C     . VAL B 1 296 ? 37.314  49.982 15.673  1.00 15.82 ? 296 VAL B C     1 
ATOM   5569 O  O     . VAL B 1 296 ? 37.149  49.793 14.472  1.00 16.51 ? 296 VAL B O     1 
ATOM   5570 C  CB    . VAL B 1 296 ? 39.780  50.105 16.042  1.00 13.16 ? 296 VAL B CB    1 
ATOM   5571 C  CG1   . VAL B 1 296 ? 39.647  51.562 16.405  1.00 13.02 ? 296 VAL B CG1   1 
ATOM   5572 C  CG2   . VAL B 1 296 ? 40.968  49.493 16.762  1.00 12.94 ? 296 VAL B CG2   1 
ATOM   5573 N  N     . CYS B 1 297 ? 36.483  50.722 16.394  1.00 16.20 ? 297 CYS B N     1 
ATOM   5574 C  CA    . CYS B 1 297 ? 35.353  51.384 15.767  1.00 16.87 ? 297 CYS B CA    1 
ATOM   5575 C  C     . CYS B 1 297 ? 34.977  52.599 16.598  1.00 17.03 ? 297 CYS B C     1 
ATOM   5576 O  O     . CYS B 1 297 ? 35.377  52.726 17.756  1.00 16.36 ? 297 CYS B O     1 
ATOM   5577 C  CB    . CYS B 1 297 ? 34.145  50.438 15.641  1.00 17.20 ? 297 CYS B CB    1 
ATOM   5578 S  SG    . CYS B 1 297 ? 33.309  50.001 17.200  1.00 19.91 ? 297 CYS B SG    1 
ATOM   5579 N  N     . ASN B 1 298 ? 34.214  53.493 15.992  1.00 17.63 ? 298 ASN B N     1 
ATOM   5580 C  CA    . ASN B 1 298 ? 33.779  54.705 16.649  1.00 19.13 ? 298 ASN B CA    1 
ATOM   5581 C  C     . ASN B 1 298 ? 32.269  54.822 16.544  1.00 20.57 ? 298 ASN B C     1 
ATOM   5582 O  O     . ASN B 1 298 ? 31.662  54.266 15.623  1.00 21.33 ? 298 ASN B O     1 
ATOM   5583 C  CB    . ASN B 1 298 ? 34.420  55.908 15.975  1.00 20.01 ? 298 ASN B CB    1 
ATOM   5584 C  CG    . ASN B 1 298 ? 33.668  57.177 16.252  1.00 21.77 ? 298 ASN B CG    1 
ATOM   5585 O  OD1   . ASN B 1 298 ? 33.566  57.609 17.401  1.00 24.19 ? 298 ASN B OD1   1 
ATOM   5586 N  ND2   . ASN B 1 298 ? 33.108  57.777 15.205  1.00 21.42 ? 298 ASN B ND2   1 
ATOM   5587 N  N     . ILE B 1 299 ? 31.653  55.538 17.478  1.00 21.27 ? 299 ILE B N     1 
ATOM   5588 C  CA    . ILE B 1 299 ? 30.214  55.710 17.413  1.00 23.31 ? 299 ILE B CA    1 
ATOM   5589 C  C     . ILE B 1 299 ? 29.847  57.166 17.690  1.00 24.55 ? 299 ILE B C     1 
ATOM   5590 O  O     . ILE B 1 299 ? 28.667  57.518 17.802  1.00 23.95 ? 299 ILE B O     1 
ATOM   5591 C  CB    . ILE B 1 299 ? 29.492  54.760 18.389  1.00 23.93 ? 299 ILE B CB    1 
ATOM   5592 C  CG1   . ILE B 1 299 ? 27.988  54.759 18.094  1.00 24.35 ? 299 ILE B CG1   1 
ATOM   5593 C  CG2   . ILE B 1 299 ? 29.782  55.178 19.826  1.00 26.54 ? 299 ILE B CG2   1 
ATOM   5594 C  CD1   . ILE B 1 299 ? 27.220  53.713 18.863  1.00 23.89 ? 299 ILE B CD1   1 
ATOM   5595 N  N     . GLY B 1 300 ? 30.876  58.006 17.801  1.00 25.98 ? 300 GLY B N     1 
ATOM   5596 C  CA    . GLY B 1 300 ? 30.659  59.430 18.008  1.00 27.40 ? 300 GLY B CA    1 
ATOM   5597 C  C     . GLY B 1 300 ? 30.142  59.955 16.676  1.00 27.91 ? 300 GLY B C     1 
ATOM   5598 O  O     . GLY B 1 300 ? 30.326  59.286 15.648  1.00 27.83 ? 300 GLY B O     1 
ATOM   5599 N  N     . HIS B 1 301 ? 29.511  61.127 16.666  1.00 27.23 ? 301 HIS B N     1 
ATOM   5600 C  CA    . HIS B 1 301 ? 28.971  61.649 15.417  1.00 27.44 ? 301 HIS B CA    1 
ATOM   5601 C  C     . HIS B 1 301 ? 29.990  61.832 14.295  1.00 26.99 ? 301 HIS B C     1 
ATOM   5602 O  O     . HIS B 1 301 ? 29.813  61.299 13.205  1.00 26.96 ? 301 HIS B O     1 
ATOM   5603 C  CB    . HIS B 1 301 ? 28.243  62.967 15.644  1.00 28.40 ? 301 HIS B CB    1 
ATOM   5604 C  CG    . HIS B 1 301 ? 27.657  63.533 14.392  1.00 30.05 ? 301 HIS B CG    1 
ATOM   5605 N  ND1   . HIS B 1 301 ? 26.741  62.844 13.628  1.00 30.42 ? 301 HIS B ND1   1 
ATOM   5606 C  CD2   . HIS B 1 301 ? 27.889  64.699 13.743  1.00 31.19 ? 301 HIS B CD2   1 
ATOM   5607 C  CE1   . HIS B 1 301 ? 26.435  63.562 12.560  1.00 31.94 ? 301 HIS B CE1   1 
ATOM   5608 N  NE2   . HIS B 1 301 ? 27.117  64.691 12.605  1.00 30.99 ? 301 HIS B NE2   1 
ATOM   5609 N  N     . PHE B 1 302 ? 31.047  62.591 14.556  1.00 26.96 ? 302 PHE B N     1 
ATOM   5610 C  CA    . PHE B 1 302 ? 32.078  62.832 13.551  1.00 26.85 ? 302 PHE B CA    1 
ATOM   5611 C  C     . PHE B 1 302 ? 33.185  61.809 13.653  1.00 27.07 ? 302 PHE B C     1 
ATOM   5612 O  O     . PHE B 1 302 ? 33.515  61.358 14.748  1.00 28.67 ? 302 PHE B O     1 
ATOM   5613 C  CB    . PHE B 1 302 ? 32.671  64.233 13.727  1.00 26.52 ? 302 PHE B CB    1 
ATOM   5614 C  CG    . PHE B 1 302 ? 31.756  65.341 13.284  1.00 26.44 ? 302 PHE B CG    1 
ATOM   5615 C  CD1   . PHE B 1 302 ? 30.847  65.136 12.253  1.00 25.99 ? 302 PHE B CD1   1 
ATOM   5616 C  CD2   . PHE B 1 302 ? 31.839  66.603 13.867  1.00 26.77 ? 302 PHE B CD2   1 
ATOM   5617 C  CE1   . PHE B 1 302 ? 30.031  66.164 11.807  1.00 26.76 ? 302 PHE B CE1   1 
ATOM   5618 C  CE2   . PHE B 1 302 ? 31.026  67.646 13.433  1.00 26.90 ? 302 PHE B CE2   1 
ATOM   5619 C  CZ    . PHE B 1 302 ? 30.118  67.424 12.397  1.00 27.39 ? 302 PHE B CZ    1 
ATOM   5620 N  N     . ASP B 1 303 ? 33.760  61.446 12.511  1.00 26.80 ? 303 ASP B N     1 
ATOM   5621 C  CA    . ASP B 1 303 ? 34.855  60.478 12.478  1.00 26.61 ? 303 ASP B CA    1 
ATOM   5622 C  C     . ASP B 1 303 ? 36.176  61.190 12.754  1.00 25.52 ? 303 ASP B C     1 
ATOM   5623 O  O     . ASP B 1 303 ? 36.974  61.404 11.841  1.00 24.63 ? 303 ASP B O     1 
ATOM   5624 C  CB    . ASP B 1 303 ? 34.902  59.794 11.110  1.00 28.19 ? 303 ASP B CB    1 
ATOM   5625 C  CG    . ASP B 1 303 ? 35.084  60.783 9.962   1.00 30.44 ? 303 ASP B CG    1 
ATOM   5626 O  OD1   . ASP B 1 303 ? 36.216  61.285 9.753   1.00 31.31 ? 303 ASP B OD1   1 
ATOM   5627 O  OD2   . ASP B 1 303 ? 34.079  61.069 9.273   1.00 31.70 ? 303 ASP B OD2   1 
ATOM   5628 N  N     . VAL B 1 304 ? 36.416  61.545 14.015  1.00 24.48 ? 304 VAL B N     1 
ATOM   5629 C  CA    . VAL B 1 304 ? 37.642  62.258 14.362  1.00 24.44 ? 304 VAL B CA    1 
ATOM   5630 C  C     . VAL B 1 304 ? 38.332  61.705 15.598  1.00 24.43 ? 304 VAL B C     1 
ATOM   5631 O  O     . VAL B 1 304 ? 39.379  62.205 16.014  1.00 24.18 ? 304 VAL B O     1 
ATOM   5632 C  CB    . VAL B 1 304 ? 37.344  63.745 14.627  1.00 24.51 ? 304 VAL B CB    1 
ATOM   5633 C  CG1   . VAL B 1 304 ? 36.516  64.319 13.487  1.00 25.08 ? 304 VAL B CG1   1 
ATOM   5634 C  CG2   . VAL B 1 304 ? 36.619  63.902 15.947  1.00 24.33 ? 304 VAL B CG2   1 
ATOM   5635 N  N     . GLU B 1 305 ? 37.751  60.665 16.176  1.00 25.16 ? 305 GLU B N     1 
ATOM   5636 C  CA    . GLU B 1 305 ? 38.286  60.085 17.393  1.00 25.55 ? 305 GLU B CA    1 
ATOM   5637 C  C     . GLU B 1 305 ? 39.351  59.022 17.182  1.00 26.18 ? 305 GLU B C     1 
ATOM   5638 O  O     . GLU B 1 305 ? 40.180  58.786 18.072  1.00 26.60 ? 305 GLU B O     1 
ATOM   5639 C  CB    . GLU B 1 305 ? 37.133  59.525 18.213  1.00 25.53 ? 305 GLU B CB    1 
ATOM   5640 C  CG    . GLU B 1 305 ? 36.067  60.560 18.456  1.00 26.63 ? 305 GLU B CG    1 
ATOM   5641 C  CD    . GLU B 1 305 ? 34.917  60.021 19.259  1.00 28.06 ? 305 GLU B CD    1 
ATOM   5642 O  OE1   . GLU B 1 305 ? 35.157  59.587 20.408  1.00 27.51 ? 305 GLU B OE1   1 
ATOM   5643 O  OE2   . GLU B 1 305 ? 33.777  60.033 18.737  1.00 28.71 ? 305 GLU B OE2   1 
ATOM   5644 N  N     . ILE B 1 306 ? 39.328  58.387 16.011  1.00 26.77 ? 306 ILE B N     1 
ATOM   5645 C  CA    . ILE B 1 306 ? 40.291  57.338 15.663  1.00 27.76 ? 306 ILE B CA    1 
ATOM   5646 C  C     . ILE B 1 306 ? 41.168  57.842 14.525  1.00 28.04 ? 306 ILE B C     1 
ATOM   5647 O  O     . ILE B 1 306 ? 40.649  58.157 13.457  1.00 28.29 ? 306 ILE B O     1 
ATOM   5648 C  CB    . ILE B 1 306 ? 39.581  56.084 15.140  1.00 27.27 ? 306 ILE B CB    1 
ATOM   5649 C  CG1   . ILE B 1 306 ? 38.519  55.625 16.135  1.00 28.05 ? 306 ILE B CG1   1 
ATOM   5650 C  CG2   . ILE B 1 306 ? 40.600  54.995 14.885  1.00 27.13 ? 306 ILE B CG2   1 
ATOM   5651 C  CD1   . ILE B 1 306 ? 37.664  54.476 15.632  1.00 27.81 ? 306 ILE B CD1   1 
ATOM   5652 N  N     . ASP B 1 307 ? 42.481  57.904 14.728  1.00 28.25 ? 307 ASP B N     1 
ATOM   5653 C  CA    . ASP B 1 307 ? 43.367  58.385 13.666  1.00 29.24 ? 307 ASP B CA    1 
ATOM   5654 C  C     . ASP B 1 307 ? 43.511  57.357 12.546  1.00 29.84 ? 307 ASP B C     1 
ATOM   5655 O  O     . ASP B 1 307 ? 44.556  56.717 12.395  1.00 28.48 ? 307 ASP B O     1 
ATOM   5656 C  CB    . ASP B 1 307 ? 44.748  58.755 14.235  1.00 29.94 ? 307 ASP B CB    1 
ATOM   5657 C  CG    . ASP B 1 307 ? 45.710  59.262 13.166  1.00 30.18 ? 307 ASP B CG    1 
ATOM   5658 O  OD1   . ASP B 1 307 ? 45.233  59.841 12.160  1.00 30.59 ? 307 ASP B OD1   1 
ATOM   5659 O  OD2   . ASP B 1 307 ? 46.943  59.112 13.347  1.00 28.94 ? 307 ASP B OD2   1 
ATOM   5660 N  N     . VAL B 1 308 ? 42.445  57.207 11.763  1.00 30.82 ? 308 VAL B N     1 
ATOM   5661 C  CA    . VAL B 1 308 ? 42.433  56.262 10.655  1.00 32.55 ? 308 VAL B CA    1 
ATOM   5662 C  C     . VAL B 1 308 ? 43.614  56.499 9.715   1.00 34.23 ? 308 VAL B C     1 
ATOM   5663 O  O     . VAL B 1 308 ? 44.314  55.558 9.334   1.00 34.04 ? 308 VAL B O     1 
ATOM   5664 C  CB    . VAL B 1 308 ? 41.119  56.367 9.840   1.00 32.81 ? 308 VAL B CB    1 
ATOM   5665 C  CG1   . VAL B 1 308 ? 41.162  55.403 8.664   1.00 31.61 ? 308 VAL B CG1   1 
ATOM   5666 C  CG2   . VAL B 1 308 ? 39.919  56.056 10.734  1.00 33.54 ? 308 VAL B CG2   1 
ATOM   5667 N  N     . LYS B 1 309 ? 43.838  57.757 9.346   1.00 35.50 ? 309 LYS B N     1 
ATOM   5668 C  CA    . LYS B 1 309 ? 44.930  58.091 8.446   1.00 36.03 ? 309 LYS B CA    1 
ATOM   5669 C  C     . LYS B 1 309 ? 46.253  57.446 8.833   1.00 36.09 ? 309 LYS B C     1 
ATOM   5670 O  O     . LYS B 1 309 ? 47.013  57.024 7.961   1.00 36.68 ? 309 LYS B O     1 
ATOM   5671 C  CB    . LYS B 1 309 ? 45.079  59.606 8.349   1.00 37.87 ? 309 LYS B CB    1 
ATOM   5672 C  CG    . LYS B 1 309 ? 43.887  60.255 7.658   1.00 40.15 ? 309 LYS B CG    1 
ATOM   5673 C  CD    . LYS B 1 309 ? 44.036  61.768 7.496   1.00 42.13 ? 309 LYS B CD    1 
ATOM   5674 C  CE    . LYS B 1 309 ? 42.824  62.349 6.755   1.00 42.35 ? 309 LYS B CE    1 
ATOM   5675 N  NZ    . LYS B 1 309 ? 42.874  63.831 6.573   1.00 44.42 ? 309 LYS B NZ    1 
ATOM   5676 N  N     . TRP B 1 310 ? 46.534  57.351 10.130  1.00 35.42 ? 310 TRP B N     1 
ATOM   5677 C  CA    . TRP B 1 310 ? 47.782  56.725 10.567  1.00 34.62 ? 310 TRP B CA    1 
ATOM   5678 C  C     . TRP B 1 310 ? 47.824  55.266 10.107  1.00 35.43 ? 310 TRP B C     1 
ATOM   5679 O  O     . TRP B 1 310 ? 48.899  54.712 9.848   1.00 34.88 ? 310 TRP B O     1 
ATOM   5680 C  CB    . TRP B 1 310 ? 47.899  56.737 12.081  1.00 32.81 ? 310 TRP B CB    1 
ATOM   5681 C  CG    . TRP B 1 310 ? 49.207  56.188 12.576  1.00 29.80 ? 310 TRP B CG    1 
ATOM   5682 C  CD1   . TRP B 1 310 ? 50.314  56.901 12.926  1.00 28.10 ? 310 TRP B CD1   1 
ATOM   5683 C  CD2   . TRP B 1 310 ? 49.535  54.807 12.789  1.00 28.59 ? 310 TRP B CD2   1 
ATOM   5684 N  NE1   . TRP B 1 310 ? 51.312  56.056 13.351  1.00 27.15 ? 310 TRP B NE1   1 
ATOM   5685 C  CE2   . TRP B 1 310 ? 50.862  54.764 13.278  1.00 27.72 ? 310 TRP B CE2   1 
ATOM   5686 C  CE3   . TRP B 1 310 ? 48.837  53.602 12.618  1.00 28.22 ? 310 TRP B CE3   1 
ATOM   5687 C  CZ2   . TRP B 1 310 ? 51.510  53.560 13.599  1.00 27.66 ? 310 TRP B CZ2   1 
ATOM   5688 C  CZ3   . TRP B 1 310 ? 49.484  52.401 12.939  1.00 27.93 ? 310 TRP B CZ3   1 
ATOM   5689 C  CH2   . TRP B 1 310 ? 50.808  52.395 13.425  1.00 26.67 ? 310 TRP B CH2   1 
ATOM   5690 N  N     . LEU B 1 311 ? 46.655  54.635 10.032  1.00 36.03 ? 311 LEU B N     1 
ATOM   5691 C  CA    . LEU B 1 311 ? 46.595  53.247 9.597   1.00 36.53 ? 311 LEU B CA    1 
ATOM   5692 C  C     . LEU B 1 311 ? 46.863  53.166 8.106   1.00 37.24 ? 311 LEU B C     1 
ATOM   5693 O  O     . LEU B 1 311 ? 47.663  52.345 7.658   1.00 37.99 ? 311 LEU B O     1 
ATOM   5694 C  CB    . LEU B 1 311 ? 45.236  52.614 9.927   1.00 35.93 ? 311 LEU B CB    1 
ATOM   5695 C  CG    . LEU B 1 311 ? 44.929  52.396 11.416  1.00 35.66 ? 311 LEU B CG    1 
ATOM   5696 C  CD1   . LEU B 1 311 ? 43.578  51.714 11.561  1.00 36.05 ? 311 LEU B CD1   1 
ATOM   5697 C  CD2   . LEU B 1 311 ? 46.014  51.549 12.056  1.00 34.00 ? 311 LEU B CD2   1 
ATOM   5698 N  N     . ASN B 1 312 ? 46.205  54.018 7.331   1.00 37.61 ? 312 ASN B N     1 
ATOM   5699 C  CA    . ASN B 1 312 ? 46.436  53.999 5.899   1.00 37.76 ? 312 ASN B CA    1 
ATOM   5700 C  C     . ASN B 1 312 ? 47.907  54.308 5.636   1.00 38.47 ? 312 ASN B C     1 
ATOM   5701 O  O     . ASN B 1 312 ? 48.521  53.718 4.750   1.00 38.91 ? 312 ASN B O     1 
ATOM   5702 C  CB    . ASN B 1 312 ? 45.556  55.031 5.189   1.00 37.14 ? 312 ASN B CB    1 
ATOM   5703 C  CG    . ASN B 1 312 ? 44.074  54.764 5.376   1.00 37.21 ? 312 ASN B CG    1 
ATOM   5704 O  OD1   . ASN B 1 312 ? 43.595  53.649 5.152   1.00 37.20 ? 312 ASN B OD1   1 
ATOM   5705 N  ND2   . ASN B 1 312 ? 43.333  55.794 5.767   1.00 36.95 ? 312 ASN B ND2   1 
ATOM   5706 N  N     . GLU B 1 313 ? 48.478  55.206 6.436   1.00 38.98 ? 313 GLU B N     1 
ATOM   5707 C  CA    . GLU B 1 313 ? 49.868  55.618 6.264   1.00 39.59 ? 313 GLU B CA    1 
ATOM   5708 C  C     . GLU B 1 313 ? 50.967  54.778 6.903   1.00 39.69 ? 313 GLU B C     1 
ATOM   5709 O  O     . GLU B 1 313 ? 52.147  55.029 6.662   1.00 40.64 ? 313 GLU B O     1 
ATOM   5710 C  CB    . GLU B 1 313 ? 50.041  57.071 6.724   1.00 39.80 ? 313 GLU B CB    1 
ATOM   5711 C  CG    . GLU B 1 313 ? 49.349  58.092 5.832   1.00 41.89 ? 313 GLU B CG    1 
ATOM   5712 C  CD    . GLU B 1 313 ? 49.584  59.529 6.279   1.00 43.33 ? 313 GLU B CD    1 
ATOM   5713 O  OE1   . GLU B 1 313 ? 50.765  59.918 6.452   1.00 43.31 ? 313 GLU B OE1   1 
ATOM   5714 O  OE2   . GLU B 1 313 ? 48.587  60.271 6.444   1.00 45.00 ? 313 GLU B OE2   1 
ATOM   5715 N  N     . ASN B 1 314 ? 50.617  53.780 7.701   1.00 39.54 ? 314 ASN B N     1 
ATOM   5716 C  CA    . ASN B 1 314 ? 51.667  52.988 8.342   1.00 39.81 ? 314 ASN B CA    1 
ATOM   5717 C  C     . ASN B 1 314 ? 51.444  51.483 8.285   1.00 40.37 ? 314 ASN B C     1 
ATOM   5718 O  O     . ASN B 1 314 ? 52.232  50.705 8.824   1.00 40.48 ? 314 ASN B O     1 
ATOM   5719 C  CB    . ASN B 1 314 ? 51.806  53.426 9.798   1.00 38.74 ? 314 ASN B CB    1 
ATOM   5720 C  CG    . ASN B 1 314 ? 52.139  54.884 9.923   1.00 37.96 ? 314 ASN B CG    1 
ATOM   5721 O  OD1   . ASN B 1 314 ? 53.239  55.307 9.585   1.00 38.72 ? 314 ASN B OD1   1 
ATOM   5722 N  ND2   . ASN B 1 314 ? 51.182  55.672 10.390  1.00 38.54 ? 314 ASN B ND2   1 
ATOM   5723 N  N     . ALA B 1 315 ? 50.369  51.070 7.632   1.00 41.05 ? 315 ALA B N     1 
ATOM   5724 C  CA    . ALA B 1 315 ? 50.056  49.656 7.545   1.00 41.36 ? 315 ALA B CA    1 
ATOM   5725 C  C     . ALA B 1 315 ? 50.759  49.001 6.374   1.00 41.39 ? 315 ALA B C     1 
ATOM   5726 O  O     . ALA B 1 315 ? 50.829  49.562 5.280   1.00 42.05 ? 315 ALA B O     1 
ATOM   5727 C  CB    . ALA B 1 315 ? 48.544  49.465 7.425   1.00 42.23 ? 315 ALA B CB    1 
ATOM   5728 N  N     . VAL B 1 316 ? 51.281  47.806 6.610   1.00 41.21 ? 316 VAL B N     1 
ATOM   5729 C  CA    . VAL B 1 316 ? 51.959  47.061 5.565   1.00 40.90 ? 316 VAL B CA    1 
ATOM   5730 C  C     . VAL B 1 316 ? 50.935  46.515 4.581   1.00 40.82 ? 316 VAL B C     1 
ATOM   5731 O  O     . VAL B 1 316 ? 51.275  46.171 3.454   1.00 41.88 ? 316 VAL B O     1 
ATOM   5732 C  CB    . VAL B 1 316 ? 52.765  45.904 6.161   1.00 41.32 ? 316 VAL B CB    1 
ATOM   5733 C  CG1   . VAL B 1 316 ? 53.366  45.062 5.051   1.00 42.49 ? 316 VAL B CG1   1 
ATOM   5734 C  CG2   . VAL B 1 316 ? 53.861  46.462 7.061   1.00 41.01 ? 316 VAL B CG2   1 
ATOM   5735 N  N     . GLU B 1 317 ? 49.679  46.439 5.016   1.00 40.50 ? 317 GLU B N     1 
ATOM   5736 C  CA    . GLU B 1 317 ? 48.604  45.954 4.164   1.00 40.32 ? 317 GLU B CA    1 
ATOM   5737 C  C     . GLU B 1 317 ? 47.293  46.561 4.568   1.00 39.73 ? 317 GLU B C     1 
ATOM   5738 O  O     . GLU B 1 317 ? 47.152  47.092 5.666   1.00 39.27 ? 317 GLU B O     1 
ATOM   5739 C  CB    . GLU B 1 317 ? 48.421  44.452 4.281   1.00 41.57 ? 317 GLU B CB    1 
ATOM   5740 C  CG    . GLU B 1 317 ? 49.622  43.619 3.981   1.00 45.01 ? 317 GLU B CG    1 
ATOM   5741 C  CD    . GLU B 1 317 ? 49.258  42.154 3.943   1.00 46.64 ? 317 GLU B CD    1 
ATOM   5742 O  OE1   . GLU B 1 317 ? 48.494  41.768 3.023   1.00 48.37 ? 317 GLU B OE1   1 
ATOM   5743 O  OE2   . GLU B 1 317 ? 49.716  41.402 4.837   1.00 46.58 ? 317 GLU B OE2   1 
ATOM   5744 N  N     . LYS B 1 318 ? 46.325  46.447 3.668   1.00 38.77 ? 318 LYS B N     1 
ATOM   5745 C  CA    . LYS B 1 318 ? 44.985  46.933 3.912   1.00 38.10 ? 318 LYS B CA    1 
ATOM   5746 C  C     . LYS B 1 318 ? 44.038  46.074 3.098   1.00 37.03 ? 318 LYS B C     1 
ATOM   5747 O  O     . LYS B 1 318 ? 43.622  46.461 2.012   1.00 38.23 ? 318 LYS B O     1 
ATOM   5748 C  CB    . LYS B 1 318 ? 44.829  48.400 3.495   1.00 38.60 ? 318 LYS B CB    1 
ATOM   5749 C  CG    . LYS B 1 318 ? 43.393  48.911 3.683   1.00 39.81 ? 318 LYS B CG    1 
ATOM   5750 C  CD    . LYS B 1 318 ? 43.189  50.321 3.153   1.00 39.63 ? 318 LYS B CD    1 
ATOM   5751 C  CE    . LYS B 1 318 ? 41.724  50.750 3.266   1.00 39.54 ? 318 LYS B CE    1 
ATOM   5752 N  NZ    . LYS B 1 318 ? 41.509  52.141 2.759   1.00 38.13 ? 318 LYS B NZ    1 
ATOM   5753 N  N     . VAL B 1 319 ? 43.711  44.896 3.601   1.00 34.85 ? 319 VAL B N     1 
ATOM   5754 C  CA    . VAL B 1 319 ? 42.793  44.050 2.870   1.00 33.85 ? 319 VAL B CA    1 
ATOM   5755 C  C     . VAL B 1 319 ? 41.373  44.426 3.256   1.00 32.95 ? 319 VAL B C     1 
ATOM   5756 O  O     . VAL B 1 319 ? 41.057  44.580 4.428   1.00 33.30 ? 319 VAL B O     1 
ATOM   5757 C  CB    . VAL B 1 319 ? 43.063  42.568 3.155   1.00 34.05 ? 319 VAL B CB    1 
ATOM   5758 C  CG1   . VAL B 1 319 ? 44.355  42.150 2.477   1.00 33.62 ? 319 VAL B CG1   1 
ATOM   5759 C  CG2   . VAL B 1 319 ? 43.185  42.340 4.667   1.00 35.78 ? 319 VAL B CG2   1 
ATOM   5760 N  N     . ASN B 1 320 ? 40.524  44.607 2.259   1.00 32.59 ? 320 ASN B N     1 
ATOM   5761 C  CA    . ASN B 1 320 ? 39.149  44.982 2.512   1.00 32.61 ? 320 ASN B CA    1 
ATOM   5762 C  C     . ASN B 1 320 ? 38.256  43.750 2.491   1.00 32.66 ? 320 ASN B C     1 
ATOM   5763 O  O     . ASN B 1 320 ? 37.990  43.175 1.437   1.00 34.50 ? 320 ASN B O     1 
ATOM   5764 C  CB    . ASN B 1 320 ? 38.711  46.008 1.473   1.00 33.35 ? 320 ASN B CB    1 
ATOM   5765 C  CG    . ASN B 1 320 ? 37.229  46.289 1.519   1.00 35.22 ? 320 ASN B CG    1 
ATOM   5766 O  OD1   . ASN B 1 320 ? 36.421  45.442 1.139   1.00 36.18 ? 320 ASN B OD1   1 
ATOM   5767 N  ND2   . ASN B 1 320 ? 36.858  47.479 1.995   1.00 36.09 ? 320 ASN B ND2   1 
ATOM   5768 N  N     . ILE B 1 321 ? 37.800  43.350 3.671   1.00 32.07 ? 321 ILE B N     1 
ATOM   5769 C  CA    . ILE B 1 321 ? 36.956  42.173 3.827   1.00 31.65 ? 321 ILE B CA    1 
ATOM   5770 C  C     . ILE B 1 321 ? 35.579  42.272 3.171   1.00 31.64 ? 321 ILE B C     1 
ATOM   5771 O  O     . ILE B 1 321 ? 35.120  41.325 2.532   1.00 31.61 ? 321 ILE B O     1 
ATOM   5772 C  CB    . ILE B 1 321 ? 36.792  41.836 5.332   1.00 30.70 ? 321 ILE B CB    1 
ATOM   5773 C  CG1   . ILE B 1 321 ? 38.075  41.182 5.856   1.00 29.64 ? 321 ILE B CG1   1 
ATOM   5774 C  CG2   . ILE B 1 321 ? 35.589  40.924 5.550   1.00 31.02 ? 321 ILE B CG2   1 
ATOM   5775 C  CD1   . ILE B 1 321 ? 39.322  42.023 5.733   1.00 27.08 ? 321 ILE B CD1   1 
ATOM   5776 N  N     . LYS B 1 322 ? 34.931  43.417 3.341   1.00 31.07 ? 322 LYS B N     1 
ATOM   5777 C  CA    . LYS B 1 322 ? 33.598  43.668 2.798   1.00 30.79 ? 322 LYS B CA    1 
ATOM   5778 C  C     . LYS B 1 322 ? 33.368  45.168 2.978   1.00 30.61 ? 322 LYS B C     1 
ATOM   5779 O  O     . LYS B 1 322 ? 34.169  45.845 3.634   1.00 30.00 ? 322 LYS B O     1 
ATOM   5780 C  CB    . LYS B 1 322 ? 32.533  42.858 3.577   1.00 30.73 ? 322 LYS B CB    1 
ATOM   5781 C  CG    . LYS B 1 322 ? 32.549  43.072 5.109   1.00 30.86 ? 322 LYS B CG    1 
ATOM   5782 C  CD    . LYS B 1 322 ? 31.499  42.236 5.860   1.00 29.78 ? 322 LYS B CD    1 
ATOM   5783 C  CE    . LYS B 1 322 ? 30.072  42.662 5.501   1.00 30.46 ? 322 LYS B CE    1 
ATOM   5784 N  NZ    . LYS B 1 322 ? 29.015  41.879 6.212   1.00 27.49 ? 322 LYS B NZ    1 
ATOM   5785 N  N     . PRO B 1 323 ? 32.282  45.714 2.397   1.00 32.04 ? 323 PRO B N     1 
ATOM   5786 C  CA    . PRO B 1 323 ? 32.012  47.151 2.540   1.00 31.43 ? 323 PRO B CA    1 
ATOM   5787 C  C     . PRO B 1 323 ? 32.031  47.580 4.006   1.00 30.88 ? 323 PRO B C     1 
ATOM   5788 O  O     . PRO B 1 323 ? 31.411  46.946 4.858   1.00 31.99 ? 323 PRO B O     1 
ATOM   5789 C  CB    . PRO B 1 323 ? 30.641  47.294 1.888   1.00 32.31 ? 323 PRO B CB    1 
ATOM   5790 C  CG    . PRO B 1 323 ? 30.733  46.256 0.771   1.00 32.84 ? 323 PRO B CG    1 
ATOM   5791 C  CD    . PRO B 1 323 ? 31.218  45.079 1.599   1.00 32.32 ? 323 PRO B CD    1 
ATOM   5792 N  N     . GLN B 1 324 ? 32.769  48.649 4.284   1.00 30.99 ? 324 GLN B N     1 
ATOM   5793 C  CA    . GLN B 1 324 ? 32.925  49.189 5.631   1.00 30.68 ? 324 GLN B CA    1 
ATOM   5794 C  C     . GLN B 1 324 ? 33.712  48.310 6.595   1.00 30.63 ? 324 GLN B C     1 
ATOM   5795 O  O     . GLN B 1 324 ? 33.579  48.450 7.814   1.00 31.72 ? 324 GLN B O     1 
ATOM   5796 C  CB    . GLN B 1 324 ? 31.563  49.533 6.254   1.00 30.67 ? 324 GLN B CB    1 
ATOM   5797 C  CG    . GLN B 1 324 ? 30.976  50.860 5.779   1.00 28.09 ? 324 GLN B CG    1 
ATOM   5798 C  CD    . GLN B 1 324 ? 30.730  50.881 4.291   1.00 26.29 ? 324 GLN B CD    1 
ATOM   5799 O  OE1   . GLN B 1 324 ? 29.891  50.146 3.780   1.00 23.87 ? 324 GLN B OE1   1 
ATOM   5800 N  NE2   . GLN B 1 324 ? 31.480  51.715 3.582   1.00 26.39 ? 324 GLN B NE2   1 
ATOM   5801 N  N     . VAL B 1 325 ? 34.535  47.410 6.069   1.00 29.90 ? 325 VAL B N     1 
ATOM   5802 C  CA    . VAL B 1 325 ? 35.340  46.555 6.934   1.00 29.81 ? 325 VAL B CA    1 
ATOM   5803 C  C     . VAL B 1 325 ? 36.718  46.343 6.313   1.00 30.08 ? 325 VAL B C     1 
ATOM   5804 O  O     . VAL B 1 325 ? 36.843  45.653 5.297   1.00 31.88 ? 325 VAL B O     1 
ATOM   5805 C  CB    . VAL B 1 325 ? 34.678  45.162 7.155   1.00 29.84 ? 325 VAL B CB    1 
ATOM   5806 C  CG1   . VAL B 1 325 ? 35.461  44.383 8.196   1.00 29.67 ? 325 VAL B CG1   1 
ATOM   5807 C  CG2   . VAL B 1 325 ? 33.230  45.311 7.594   1.00 29.55 ? 325 VAL B CG2   1 
ATOM   5808 N  N     . ASP B 1 326 ? 37.753  46.936 6.904   1.00 29.90 ? 326 ASP B N     1 
ATOM   5809 C  CA    . ASP B 1 326 ? 39.109  46.767 6.374   1.00 29.61 ? 326 ASP B CA    1 
ATOM   5810 C  C     . ASP B 1 326 ? 40.026  46.184 7.428   1.00 28.72 ? 326 ASP B C     1 
ATOM   5811 O  O     . ASP B 1 326 ? 40.041  46.644 8.563   1.00 29.17 ? 326 ASP B O     1 
ATOM   5812 C  CB    . ASP B 1 326 ? 39.700  48.099 5.903   1.00 30.44 ? 326 ASP B CB    1 
ATOM   5813 C  CG    . ASP B 1 326 ? 38.755  48.869 5.013   1.00 31.60 ? 326 ASP B CG    1 
ATOM   5814 O  OD1   . ASP B 1 326 ? 37.920  49.617 5.565   1.00 33.23 ? 326 ASP B OD1   1 
ATOM   5815 O  OD2   . ASP B 1 326 ? 38.826  48.708 3.770   1.00 31.52 ? 326 ASP B OD2   1 
ATOM   5816 N  N     . ARG B 1 327 ? 40.800  45.179 7.046   1.00 28.06 ? 327 ARG B N     1 
ATOM   5817 C  CA    . ARG B 1 327 ? 41.719  44.535 7.976   1.00 28.33 ? 327 ARG B CA    1 
ATOM   5818 C  C     . ARG B 1 327 ? 43.173  44.901 7.637   1.00 29.11 ? 327 ARG B C     1 
ATOM   5819 O  O     . ARG B 1 327 ? 43.714  44.500 6.596   1.00 28.83 ? 327 ARG B O     1 
ATOM   5820 C  CB    . ARG B 1 327 ? 41.526  43.021 7.917   1.00 28.30 ? 327 ARG B CB    1 
ATOM   5821 C  CG    . ARG B 1 327 ? 42.188  42.259 9.037   1.00 27.74 ? 327 ARG B CG    1 
ATOM   5822 C  CD    . ARG B 1 327 ? 42.082  40.785 8.762   1.00 28.15 ? 327 ARG B CD    1 
ATOM   5823 N  NE    . ARG B 1 327 ? 42.687  39.982 9.809   1.00 27.67 ? 327 ARG B NE    1 
ATOM   5824 C  CZ    . ARG B 1 327 ? 42.987  38.699 9.663   1.00 28.56 ? 327 ARG B CZ    1 
ATOM   5825 N  NH1   . ARG B 1 327 ? 42.736  38.089 8.511   1.00 27.97 ? 327 ARG B NH1   1 
ATOM   5826 N  NH2   . ARG B 1 327 ? 43.532  38.026 10.667  1.00 30.21 ? 327 ARG B NH2   1 
ATOM   5827 N  N     . TYR B 1 328 ? 43.796  45.668 8.527   1.00 29.32 ? 328 TYR B N     1 
ATOM   5828 C  CA    . TYR B 1 328 ? 45.171  46.114 8.341   1.00 30.12 ? 328 TYR B CA    1 
ATOM   5829 C  C     . TYR B 1 328 ? 46.167  45.158 8.964   1.00 30.25 ? 328 TYR B C     1 
ATOM   5830 O  O     . TYR B 1 328 ? 45.825  44.397 9.866   1.00 29.76 ? 328 TYR B O     1 
ATOM   5831 C  CB    . TYR B 1 328 ? 45.388  47.495 8.978   1.00 30.75 ? 328 TYR B CB    1 
ATOM   5832 C  CG    . TYR B 1 328 ? 44.544  48.599 8.403   1.00 31.81 ? 328 TYR B CG    1 
ATOM   5833 C  CD1   . TYR B 1 328 ? 43.157  48.577 8.525   1.00 32.56 ? 328 TYR B CD1   1 
ATOM   5834 C  CD2   . TYR B 1 328 ? 45.131  49.666 7.729   1.00 31.99 ? 328 TYR B CD2   1 
ATOM   5835 C  CE1   . TYR B 1 328 ? 42.369  49.592 7.989   1.00 34.28 ? 328 TYR B CE1   1 
ATOM   5836 C  CE2   . TYR B 1 328 ? 44.357  50.690 7.186   1.00 34.18 ? 328 TYR B CE2   1 
ATOM   5837 C  CZ    . TYR B 1 328 ? 42.971  50.648 7.320   1.00 34.75 ? 328 TYR B CZ    1 
ATOM   5838 O  OH    . TYR B 1 328 ? 42.186  51.654 6.785   1.00 35.38 ? 328 TYR B OH    1 
ATOM   5839 N  N     . ARG B 1 329 ? 47.401  45.204 8.466   1.00 31.35 ? 329 ARG B N     1 
ATOM   5840 C  CA    . ARG B 1 329 ? 48.486  44.393 9.000   1.00 31.85 ? 329 ARG B CA    1 
ATOM   5841 C  C     . ARG B 1 329 ? 49.630  45.368 9.222   1.00 32.12 ? 329 ARG B C     1 
ATOM   5842 O  O     . ARG B 1 329 ? 50.274  45.809 8.273   1.00 32.67 ? 329 ARG B O     1 
ATOM   5843 C  CB    . ARG B 1 329 ? 48.930  43.328 8.010   1.00 33.48 ? 329 ARG B CB    1 
ATOM   5844 C  CG    . ARG B 1 329 ? 49.843  42.289 8.647   1.00 36.53 ? 329 ARG B CG    1 
ATOM   5845 C  CD    . ARG B 1 329 ? 50.428  41.346 7.610   1.00 40.44 ? 329 ARG B CD    1 
ATOM   5846 N  NE    . ARG B 1 329 ? 51.100  40.210 8.235   1.00 44.65 ? 329 ARG B NE    1 
ATOM   5847 C  CZ    . ARG B 1 329 ? 50.465  39.214 8.855   1.00 46.93 ? 329 ARG B CZ    1 
ATOM   5848 N  NH1   . ARG B 1 329 ? 49.138  39.213 8.929   1.00 48.20 ? 329 ARG B NH1   1 
ATOM   5849 N  NH2   . ARG B 1 329 ? 51.153  38.217 9.405   1.00 48.29 ? 329 ARG B NH2   1 
ATOM   5850 N  N     . LEU B 1 330 ? 49.869  45.723 10.475  1.00 32.35 ? 330 LEU B N     1 
ATOM   5851 C  CA    . LEU B 1 330 ? 50.931  46.667 10.797  1.00 33.13 ? 330 LEU B CA    1 
ATOM   5852 C  C     . LEU B 1 330 ? 52.316  46.062 10.586  1.00 33.41 ? 330 LEU B C     1 
ATOM   5853 O  O     . LEU B 1 330 ? 52.458  44.869 10.283  1.00 33.64 ? 330 LEU B O     1 
ATOM   5854 C  CB    . LEU B 1 330 ? 50.787  47.141 12.246  1.00 32.65 ? 330 LEU B CB    1 
ATOM   5855 C  CG    . LEU B 1 330 ? 49.427  47.761 12.564  1.00 32.23 ? 330 LEU B CG    1 
ATOM   5856 C  CD1   . LEU B 1 330 ? 49.330  48.053 14.057  1.00 32.06 ? 330 LEU B CD1   1 
ATOM   5857 C  CD2   . LEU B 1 330 ? 49.239  49.026 11.729  1.00 32.03 ? 330 LEU B CD2   1 
ATOM   5858 N  N     . LYS B 1 331 ? 53.339  46.895 10.752  1.00 33.61 ? 331 LYS B N     1 
ATOM   5859 C  CA    . LYS B 1 331 ? 54.705  46.439 10.573  1.00 33.63 ? 331 LYS B CA    1 
ATOM   5860 C  C     . LYS B 1 331 ? 55.088  45.364 11.583  1.00 33.44 ? 331 LYS B C     1 
ATOM   5861 O  O     . LYS B 1 331 ? 55.897  44.492 11.284  1.00 34.28 ? 331 LYS B O     1 
ATOM   5862 C  CB    . LYS B 1 331 ? 55.674  47.619 10.663  1.00 33.40 ? 331 LYS B CB    1 
ATOM   5863 C  CG    . LYS B 1 331 ? 55.421  48.697 9.612   1.00 34.16 ? 331 LYS B CG    1 
ATOM   5864 C  CD    . LYS B 1 331 ? 56.562  49.703 9.579   1.00 34.11 ? 331 LYS B CD    1 
ATOM   5865 C  CE    . LYS B 1 331 ? 56.314  50.832 8.578   1.00 33.41 ? 331 LYS B CE    1 
ATOM   5866 N  NZ    . LYS B 1 331 ? 55.264  51.792 9.027   1.00 33.95 ? 331 LYS B NZ    1 
ATOM   5867 N  N     . ASN B 1 332 ? 54.508  45.413 12.777  1.00 33.04 ? 332 ASN B N     1 
ATOM   5868 C  CA    . ASN B 1 332 ? 54.822  44.403 13.785  1.00 32.87 ? 332 ASN B CA    1 
ATOM   5869 C  C     . ASN B 1 332 ? 54.256  43.032 13.417  1.00 32.51 ? 332 ASN B C     1 
ATOM   5870 O  O     . ASN B 1 332 ? 54.490  42.054 14.122  1.00 32.38 ? 332 ASN B O     1 
ATOM   5871 C  CB    . ASN B 1 332 ? 54.289  44.804 15.167  1.00 32.66 ? 332 ASN B CB    1 
ATOM   5872 C  CG    . ASN B 1 332 ? 52.790  45.032 15.175  1.00 33.06 ? 332 ASN B CG    1 
ATOM   5873 O  OD1   . ASN B 1 332 ? 52.023  44.280 14.566  1.00 33.48 ? 332 ASN B OD1   1 
ATOM   5874 N  ND2   . ASN B 1 332 ? 52.362  46.059 15.890  1.00 33.54 ? 332 ASN B ND2   1 
ATOM   5875 N  N     . GLY B 1 333 ? 53.501  42.962 12.327  1.00 32.80 ? 333 GLY B N     1 
ATOM   5876 C  CA    . GLY B 1 333 ? 52.938  41.687 11.919  1.00 32.81 ? 333 GLY B CA    1 
ATOM   5877 C  C     . GLY B 1 333 ? 51.501  41.462 12.348  1.00 32.83 ? 333 GLY B C     1 
ATOM   5878 O  O     . GLY B 1 333 ? 50.766  40.727 11.685  1.00 34.01 ? 333 GLY B O     1 
ATOM   5879 N  N     . ARG B 1 334 ? 51.089  42.074 13.456  1.00 32.37 ? 334 ARG B N     1 
ATOM   5880 C  CA    . ARG B 1 334 ? 49.715  41.915 13.928  1.00 32.30 ? 334 ARG B CA    1 
ATOM   5881 C  C     . ARG B 1 334 ? 48.711  42.662 13.057  1.00 31.76 ? 334 ARG B C     1 
ATOM   5882 O  O     . ARG B 1 334 ? 49.062  43.593 12.334  1.00 31.84 ? 334 ARG B O     1 
ATOM   5883 C  CB    . ARG B 1 334 ? 49.569  42.386 15.373  1.00 32.71 ? 334 ARG B CB    1 
ATOM   5884 C  CG    . ARG B 1 334 ? 50.265  41.506 16.383  1.00 33.10 ? 334 ARG B CG    1 
ATOM   5885 C  CD    . ARG B 1 334 ? 49.767  41.824 17.779  1.00 34.64 ? 334 ARG B CD    1 
ATOM   5886 N  NE    . ARG B 1 334 ? 50.110  43.178 18.200  1.00 36.07 ? 334 ARG B NE    1 
ATOM   5887 C  CZ    . ARG B 1 334 ? 51.348  43.574 18.476  1.00 36.97 ? 334 ARG B CZ    1 
ATOM   5888 N  NH1   . ARG B 1 334 ? 52.349  42.709 18.370  1.00 37.41 ? 334 ARG B NH1   1 
ATOM   5889 N  NH2   . ARG B 1 334 ? 51.586  44.824 18.861  1.00 37.26 ? 334 ARG B NH2   1 
ATOM   5890 N  N     . ARG B 1 335 ? 47.453  42.257 13.135  1.00 31.10 ? 335 ARG B N     1 
ATOM   5891 C  CA    . ARG B 1 335 ? 46.420  42.892 12.334  1.00 30.79 ? 335 ARG B CA    1 
ATOM   5892 C  C     . ARG B 1 335 ? 45.420  43.722 13.136  1.00 29.57 ? 335 ARG B C     1 
ATOM   5893 O  O     . ARG B 1 335 ? 45.320  43.592 14.355  1.00 29.84 ? 335 ARG B O     1 
ATOM   5894 C  CB    . ARG B 1 335 ? 45.705  41.820 11.508  1.00 31.89 ? 335 ARG B CB    1 
ATOM   5895 C  CG    . ARG B 1 335 ? 46.573  41.309 10.367  1.00 33.87 ? 335 ARG B CG    1 
ATOM   5896 C  CD    . ARG B 1 335 ? 46.256  39.876 9.998   1.00 35.97 ? 335 ARG B CD    1 
ATOM   5897 N  NE    . ARG B 1 335 ? 46.563  38.990 11.120  1.00 37.84 ? 335 ARG B NE    1 
ATOM   5898 C  CZ    . ARG B 1 335 ? 46.481  37.663 11.078  1.00 37.96 ? 335 ARG B CZ    1 
ATOM   5899 N  NH1   . ARG B 1 335 ? 46.099  37.052 9.960   1.00 38.84 ? 335 ARG B NH1   1 
ATOM   5900 N  NH2   . ARG B 1 335 ? 46.781  36.950 12.157  1.00 37.34 ? 335 ARG B NH2   1 
ATOM   5901 N  N     . ILE B 1 336 ? 44.705  44.597 12.439  1.00 27.89 ? 336 ILE B N     1 
ATOM   5902 C  CA    . ILE B 1 336 ? 43.707  45.447 13.062  1.00 26.75 ? 336 ILE B CA    1 
ATOM   5903 C  C     . ILE B 1 336 ? 42.512  45.609 12.138  1.00 26.73 ? 336 ILE B C     1 
ATOM   5904 O  O     . ILE B 1 336 ? 42.650  45.925 10.957  1.00 27.66 ? 336 ILE B O     1 
ATOM   5905 C  CB    . ILE B 1 336 ? 44.288  46.818 13.412  1.00 26.68 ? 336 ILE B CB    1 
ATOM   5906 C  CG1   . ILE B 1 336 ? 45.273  46.662 14.567  1.00 27.19 ? 336 ILE B CG1   1 
ATOM   5907 C  CG2   . ILE B 1 336 ? 43.174  47.791 13.761  1.00 25.88 ? 336 ILE B CG2   1 
ATOM   5908 C  CD1   . ILE B 1 336 ? 45.921  47.952 14.996  1.00 28.38 ? 336 ILE B CD1   1 
ATOM   5909 N  N     . ILE B 1 337 ? 41.330  45.376 12.688  1.00 25.81 ? 337 ILE B N     1 
ATOM   5910 C  CA    . ILE B 1 337 ? 40.106  45.465 11.925  1.00 25.01 ? 337 ILE B CA    1 
ATOM   5911 C  C     . ILE B 1 337 ? 39.437  46.804 12.223  1.00 25.76 ? 337 ILE B C     1 
ATOM   5912 O  O     . ILE B 1 337 ? 39.029  47.064 13.357  1.00 26.76 ? 337 ILE B O     1 
ATOM   5913 C  CB    . ILE B 1 337 ? 39.198  44.289 12.304  1.00 23.93 ? 337 ILE B CB    1 
ATOM   5914 C  CG1   . ILE B 1 337 ? 39.972  42.987 12.069  1.00 23.59 ? 337 ILE B CG1   1 
ATOM   5915 C  CG2   . ILE B 1 337 ? 37.912  44.319 11.487  1.00 24.02 ? 337 ILE B CG2   1 
ATOM   5916 C  CD1   . ILE B 1 337 ? 39.260  41.733 12.506  1.00 24.55 ? 337 ILE B CD1   1 
ATOM   5917 N  N     . LEU B 1 338 ? 39.345  47.653 11.200  1.00 25.59 ? 338 LEU B N     1 
ATOM   5918 C  CA    . LEU B 1 338 ? 38.743  48.981 11.322  1.00 25.68 ? 338 LEU B CA    1 
ATOM   5919 C  C     . LEU B 1 338 ? 37.372  48.971 10.644  1.00 25.96 ? 338 LEU B C     1 
ATOM   5920 O  O     . LEU B 1 338 ? 37.233  48.487 9.516   1.00 26.74 ? 338 LEU B O     1 
ATOM   5921 C  CB    . LEU B 1 338 ? 39.668  50.008 10.673  1.00 25.49 ? 338 LEU B CB    1 
ATOM   5922 C  CG    . LEU B 1 338 ? 39.368  51.497 10.800  1.00 25.97 ? 338 LEU B CG    1 
ATOM   5923 C  CD1   . LEU B 1 338 ? 38.138  51.853 10.004  1.00 26.57 ? 338 LEU B CD1   1 
ATOM   5924 C  CD2   . LEU B 1 338 ? 39.215  51.847 12.264  1.00 26.03 ? 338 LEU B CD2   1 
ATOM   5925 N  N     . LEU B 1 339 ? 36.366  49.519 11.321  1.00 25.48 ? 339 LEU B N     1 
ATOM   5926 C  CA    . LEU B 1 339 ? 35.004  49.508 10.793  1.00 25.41 ? 339 LEU B CA    1 
ATOM   5927 C  C     . LEU B 1 339 ? 34.500  50.870 10.330  1.00 26.10 ? 339 LEU B C     1 
ATOM   5928 O  O     . LEU B 1 339 ? 34.767  51.886 10.971  1.00 25.93 ? 339 LEU B O     1 
ATOM   5929 C  CB    . LEU B 1 339 ? 34.057  48.945 11.860  1.00 24.36 ? 339 LEU B CB    1 
ATOM   5930 C  CG    . LEU B 1 339 ? 34.544  47.665 12.559  1.00 22.76 ? 339 LEU B CG    1 
ATOM   5931 C  CD1   . LEU B 1 339 ? 33.474  47.184 13.518  1.00 22.38 ? 339 LEU B CD1   1 
ATOM   5932 C  CD2   . LEU B 1 339 ? 34.864  46.585 11.543  1.00 20.47 ? 339 LEU B CD2   1 
ATOM   5933 N  N     . ALA B 1 340 ? 33.766  50.874 9.216   1.00 27.62 ? 340 ALA B N     1 
ATOM   5934 C  CA    . ALA B 1 340 ? 33.191  52.092 8.629   1.00 29.43 ? 340 ALA B CA    1 
ATOM   5935 C  C     . ALA B 1 340 ? 34.175  53.266 8.551   1.00 30.53 ? 340 ALA B C     1 
ATOM   5936 O  O     . ALA B 1 340 ? 33.774  54.436 8.580   1.00 30.49 ? 340 ALA B O     1 
ATOM   5937 C  CB    . ALA B 1 340 ? 31.935  52.512 9.411   1.00 30.10 ? 340 ALA B CB    1 
ATOM   5938 N  N     . GLU B 1 341 ? 35.461  52.942 8.458   1.00 31.01 ? 341 GLU B N     1 
ATOM   5939 C  CA    . GLU B 1 341 ? 36.513  53.943 8.361   1.00 32.22 ? 341 GLU B CA    1 
ATOM   5940 C  C     . GLU B 1 341 ? 36.469  54.994 9.467   1.00 32.08 ? 341 GLU B C     1 
ATOM   5941 O  O     . GLU B 1 341 ? 36.779  56.163 9.238   1.00 32.26 ? 341 GLU B O     1 
ATOM   5942 C  CB    . GLU B 1 341 ? 36.454  54.628 6.996   1.00 34.13 ? 341 GLU B CB    1 
ATOM   5943 C  CG    . GLU B 1 341 ? 36.382  53.648 5.833   1.00 36.83 ? 341 GLU B CG    1 
ATOM   5944 C  CD    . GLU B 1 341 ? 36.616  54.308 4.484   1.00 38.44 ? 341 GLU B CD    1 
ATOM   5945 O  OE1   . GLU B 1 341 ? 37.780  54.683 4.197   1.00 37.65 ? 341 GLU B OE1   1 
ATOM   5946 O  OE2   . GLU B 1 341 ? 35.633  54.460 3.722   1.00 38.92 ? 341 GLU B OE2   1 
ATOM   5947 N  N     . GLY B 1 342 ? 36.087  54.569 10.666  1.00 32.02 ? 342 GLY B N     1 
ATOM   5948 C  CA    . GLY B 1 342 ? 36.032  55.479 11.798  1.00 30.74 ? 342 GLY B CA    1 
ATOM   5949 C  C     . GLY B 1 342 ? 34.704  56.186 11.956  1.00 29.66 ? 342 GLY B C     1 
ATOM   5950 O  O     . GLY B 1 342 ? 34.481  56.879 12.951  1.00 30.04 ? 342 GLY B O     1 
ATOM   5951 N  N     . ARG B 1 343 ? 33.818  56.011 10.982  1.00 28.37 ? 343 ARG B N     1 
ATOM   5952 C  CA    . ARG B 1 343 ? 32.514  56.661 11.030  1.00 28.24 ? 343 ARG B CA    1 
ATOM   5953 C  C     . ARG B 1 343 ? 31.531  55.840 11.863  1.00 26.78 ? 343 ARG B C     1 
ATOM   5954 O  O     . ARG B 1 343 ? 31.558  54.610 11.831  1.00 26.41 ? 343 ARG B O     1 
ATOM   5955 C  CB    . ARG B 1 343 ? 32.043  56.914 9.590   1.00 29.82 ? 343 ARG B CB    1 
ATOM   5956 C  CG    . ARG B 1 343 ? 33.055  57.828 8.877   1.00 32.08 ? 343 ARG B CG    1 
ATOM   5957 C  CD    . ARG B 1 343 ? 32.757  58.126 7.423   1.00 34.78 ? 343 ARG B CD    1 
ATOM   5958 N  NE    . ARG B 1 343 ? 33.732  59.057 6.835   1.00 37.43 ? 343 ARG B NE    1 
ATOM   5959 C  CZ    . ARG B 1 343 ? 35.046  58.832 6.745   1.00 38.65 ? 343 ARG B CZ    1 
ATOM   5960 N  NH1   . ARG B 1 343 ? 35.568  57.701 7.204   1.00 39.43 ? 343 ARG B NH1   1 
ATOM   5961 N  NH2   . ARG B 1 343 ? 35.844  59.743 6.199   1.00 38.65 ? 343 ARG B NH2   1 
ATOM   5962 N  N     . LEU B 1 344 ? 30.690  56.534 12.630  1.00 25.84 ? 344 LEU B N     1 
ATOM   5963 C  CA    . LEU B 1 344 ? 29.730  55.892 13.534  1.00 24.93 ? 344 LEU B CA    1 
ATOM   5964 C  C     . LEU B 1 344 ? 29.248  54.545 13.042  1.00 24.24 ? 344 LEU B C     1 
ATOM   5965 O  O     . LEU B 1 344 ? 28.415  54.435 12.139  1.00 24.34 ? 344 LEU B O     1 
ATOM   5966 C  CB    . LEU B 1 344 ? 28.550  56.824 13.843  1.00 24.88 ? 344 LEU B CB    1 
ATOM   5967 C  CG    . LEU B 1 344 ? 27.595  57.310 12.767  1.00 24.91 ? 344 LEU B CG    1 
ATOM   5968 C  CD1   . LEU B 1 344 ? 26.723  58.402 13.362  1.00 25.31 ? 344 LEU B CD1   1 
ATOM   5969 C  CD2   . LEU B 1 344 ? 28.372  57.862 11.594  1.00 26.43 ? 344 LEU B CD2   1 
ATOM   5970 N  N     . VAL B 1 345 ? 29.787  53.522 13.688  1.00 22.93 ? 345 VAL B N     1 
ATOM   5971 C  CA    . VAL B 1 345 ? 29.535  52.137 13.353  1.00 21.43 ? 345 VAL B CA    1 
ATOM   5972 C  C     . VAL B 1 345 ? 28.095  51.614 13.364  1.00 20.76 ? 345 VAL B C     1 
ATOM   5973 O  O     . VAL B 1 345 ? 27.720  50.839 12.483  1.00 20.77 ? 345 VAL B O     1 
ATOM   5974 C  CB    . VAL B 1 345 ? 30.423  51.238 14.237  1.00 21.05 ? 345 VAL B CB    1 
ATOM   5975 C  CG1   . VAL B 1 345 ? 29.947  51.289 15.683  1.00 19.98 ? 345 VAL B CG1   1 
ATOM   5976 C  CG2   . VAL B 1 345 ? 30.457  49.834 13.675  1.00 20.11 ? 345 VAL B CG2   1 
ATOM   5977 N  N     . ASN B 1 346 ? 27.280  52.012 14.334  1.00 20.22 ? 346 ASN B N     1 
ATOM   5978 C  CA    . ASN B 1 346 ? 25.903  51.508 14.365  1.00 20.15 ? 346 ASN B CA    1 
ATOM   5979 C  C     . ASN B 1 346 ? 25.145  51.778 13.058  1.00 19.34 ? 346 ASN B C     1 
ATOM   5980 O  O     . ASN B 1 346 ? 24.443  50.907 12.548  1.00 19.44 ? 346 ASN B O     1 
ATOM   5981 C  CB    . ASN B 1 346 ? 25.118  52.093 15.556  1.00 20.59 ? 346 ASN B CB    1 
ATOM   5982 C  CG    . ASN B 1 346 ? 25.089  53.616 15.564  1.00 20.18 ? 346 ASN B CG    1 
ATOM   5983 O  OD1   . ASN B 1 346 ? 24.312  54.222 16.303  1.00 19.86 ? 346 ASN B OD1   1 
ATOM   5984 N  ND2   . ASN B 1 346 ? 25.946  54.241 14.757  1.00 20.49 ? 346 ASN B ND2   1 
ATOM   5985 N  N     . LEU B 1 347 ? 25.295  52.982 12.513  1.00 18.52 ? 347 LEU B N     1 
ATOM   5986 C  CA    . LEU B 1 347 ? 24.629  53.344 11.262  1.00 17.71 ? 347 LEU B CA    1 
ATOM   5987 C  C     . LEU B 1 347 ? 25.433  52.872 10.059  1.00 17.76 ? 347 LEU B C     1 
ATOM   5988 O  O     . LEU B 1 347 ? 24.875  52.378 9.079   1.00 19.08 ? 347 LEU B O     1 
ATOM   5989 C  CB    . LEU B 1 347 ? 24.456  54.853 11.183  1.00 17.13 ? 347 LEU B CB    1 
ATOM   5990 C  CG    . LEU B 1 347 ? 23.478  55.426 12.203  1.00 18.65 ? 347 LEU B CG    1 
ATOM   5991 C  CD1   . LEU B 1 347 ? 23.721  56.914 12.382  1.00 18.90 ? 347 LEU B CD1   1 
ATOM   5992 C  CD2   . LEU B 1 347 ? 22.058  55.122 11.755  1.00 17.26 ? 347 LEU B CD2   1 
ATOM   5993 N  N     . GLY B 1 348 ? 26.750  53.026 10.138  1.00 17.22 ? 348 GLY B N     1 
ATOM   5994 C  CA    . GLY B 1 348 ? 27.603  52.624 9.043   1.00 16.16 ? 348 GLY B CA    1 
ATOM   5995 C  C     . GLY B 1 348 ? 27.610  51.133 8.773   1.00 17.23 ? 348 GLY B C     1 
ATOM   5996 O  O     . GLY B 1 348 ? 27.574  50.715 7.613   1.00 17.63 ? 348 GLY B O     1 
ATOM   5997 N  N     . CYS B 1 349 ? 27.646  50.322 9.831   1.00 17.96 ? 349 CYS B N     1 
ATOM   5998 C  CA    . CYS B 1 349 ? 27.694  48.878 9.664   1.00 17.19 ? 349 CYS B CA    1 
ATOM   5999 C  C     . CYS B 1 349 ? 26.418  48.143 10.003  1.00 17.93 ? 349 CYS B C     1 
ATOM   6000 O  O     . CYS B 1 349 ? 26.377  46.920 9.923   1.00 19.59 ? 349 CYS B O     1 
ATOM   6001 C  CB    . CYS B 1 349 ? 28.834  48.292 10.488  1.00 17.25 ? 349 CYS B CB    1 
ATOM   6002 S  SG    . CYS B 1 349 ? 30.458  48.890 10.009  1.00 17.48 ? 349 CYS B SG    1 
ATOM   6003 N  N     . ALA B 1 350 ? 25.373  48.862 10.388  1.00 17.79 ? 350 ALA B N     1 
ATOM   6004 C  CA    . ALA B 1 350 ? 24.121  48.189 10.704  1.00 19.27 ? 350 ALA B CA    1 
ATOM   6005 C  C     . ALA B 1 350 ? 22.938  49.033 10.240  1.00 20.45 ? 350 ALA B C     1 
ATOM   6006 O  O     . ALA B 1 350 ? 22.955  49.561 9.134   1.00 22.06 ? 350 ALA B O     1 
ATOM   6007 C  CB    . ALA B 1 350 ? 24.039  47.906 12.198  1.00 19.01 ? 350 ALA B CB    1 
HETATM 6008 N  N     . MSE B 1 351 ? 21.909  49.151 11.067  1.00 20.55 ? 351 MSE B N     1 
HETATM 6009 C  CA    . MSE B 1 351 ? 20.748  49.942 10.697  1.00 21.50 ? 351 MSE B CA    1 
HETATM 6010 C  C     . MSE B 1 351 ? 20.501  51.057 11.723  1.00 22.31 ? 351 MSE B C     1 
HETATM 6011 O  O     . MSE B 1 351 ? 19.443  51.703 11.729  1.00 22.84 ? 351 MSE B O     1 
HETATM 6012 C  CB    . MSE B 1 351 ? 19.520  49.035 10.583  1.00 22.50 ? 351 MSE B CB    1 
HETATM 6013 C  CG    . MSE B 1 351 ? 19.651  47.925 9.523   1.00 24.63 ? 351 MSE B CG    1 
HETATM 6014 SE SE    . MSE B 1 351 ? 19.706  48.628 7.797   1.00 24.96 ? 351 MSE B SE    1 
HETATM 6015 C  CE    . MSE B 1 351 ? 19.863  47.031 6.897   1.00 26.57 ? 351 MSE B CE    1 
ATOM   6016 N  N     . GLY B 1 352 ? 21.491  51.287 12.583  1.00 21.77 ? 352 GLY B N     1 
ATOM   6017 C  CA    . GLY B 1 352 ? 21.355  52.313 13.600  1.00 21.49 ? 352 GLY B CA    1 
ATOM   6018 C  C     . GLY B 1 352 ? 20.433  51.851 14.716  1.00 21.44 ? 352 GLY B C     1 
ATOM   6019 O  O     . GLY B 1 352 ? 20.297  50.656 14.953  1.00 19.98 ? 352 GLY B O     1 
ATOM   6020 N  N     . HIS B 1 353 ? 19.790  52.799 15.389  1.00 22.27 ? 353 HIS B N     1 
ATOM   6021 C  CA    . HIS B 1 353 ? 18.883  52.495 16.492  1.00 23.59 ? 353 HIS B CA    1 
ATOM   6022 C  C     . HIS B 1 353 ? 17.580  51.878 16.034  1.00 24.90 ? 353 HIS B C     1 
ATOM   6023 O  O     . HIS B 1 353 ? 17.128  52.106 14.913  1.00 25.91 ? 353 HIS B O     1 
ATOM   6024 C  CB    . HIS B 1 353 ? 18.554  53.762 17.280  1.00 23.79 ? 353 HIS B CB    1 
ATOM   6025 C  CG    . HIS B 1 353 ? 19.717  54.330 18.030  1.00 23.76 ? 353 HIS B CG    1 
ATOM   6026 N  ND1   . HIS B 1 353 ? 19.709  55.600 18.566  1.00 23.42 ? 353 HIS B ND1   1 
ATOM   6027 C  CD2   . HIS B 1 353 ? 20.918  53.793 18.345  1.00 23.86 ? 353 HIS B CD2   1 
ATOM   6028 C  CE1   . HIS B 1 353 ? 20.859  55.822 19.178  1.00 24.19 ? 353 HIS B CE1   1 
ATOM   6029 N  NE2   . HIS B 1 353 ? 21.610  54.740 19.059  1.00 24.85 ? 353 HIS B NE2   1 
ATOM   6030 N  N     . PRO B 1 354 ? 16.958  51.072 16.908  1.00 25.02 ? 354 PRO B N     1 
ATOM   6031 C  CA    . PRO B 1 354 ? 15.689  50.419 16.595  1.00 24.70 ? 354 PRO B CA    1 
ATOM   6032 C  C     . PRO B 1 354 ? 14.621  51.482 16.440  1.00 24.51 ? 354 PRO B C     1 
ATOM   6033 O  O     . PRO B 1 354 ? 14.722  52.573 17.006  1.00 23.35 ? 354 PRO B O     1 
ATOM   6034 C  CB    . PRO B 1 354 ? 15.456  49.531 17.817  1.00 24.35 ? 354 PRO B CB    1 
ATOM   6035 C  CG    . PRO B 1 354 ? 16.882  49.242 18.284  1.00 25.34 ? 354 PRO B CG    1 
ATOM   6036 C  CD    . PRO B 1 354 ? 17.413  50.658 18.240  1.00 25.24 ? 354 PRO B CD    1 
ATOM   6037 N  N     . SER B 1 355 ? 13.598  51.141 15.667  1.00 25.40 ? 355 SER B N     1 
ATOM   6038 C  CA    . SER B 1 355 ? 12.479  52.022 15.377  1.00 24.73 ? 355 SER B CA    1 
ATOM   6039 C  C     . SER B 1 355 ? 11.832  52.663 16.603  1.00 24.57 ? 355 SER B C     1 
ATOM   6040 O  O     . SER B 1 355 ? 11.625  53.875 16.643  1.00 24.85 ? 355 SER B O     1 
ATOM   6041 C  CB    . SER B 1 355 ? 11.432  51.228 14.616  1.00 25.14 ? 355 SER B CB    1 
ATOM   6042 O  OG    . SER B 1 355 ? 12.042  50.562 13.525  1.00 27.07 ? 355 SER B OG    1 
ATOM   6043 N  N     . PHE B 1 356 ? 11.518  51.845 17.602  1.00 23.80 ? 356 PHE B N     1 
ATOM   6044 C  CA    . PHE B 1 356 ? 10.849  52.334 18.803  1.00 22.54 ? 356 PHE B CA    1 
ATOM   6045 C  C     . PHE B 1 356 ? 11.508  53.515 19.488  1.00 21.53 ? 356 PHE B C     1 
ATOM   6046 O  O     . PHE B 1 356 ? 10.901  54.577 19.609  1.00 22.62 ? 356 PHE B O     1 
ATOM   6047 C  CB    . PHE B 1 356 ? 10.696  51.223 19.839  1.00 22.89 ? 356 PHE B CB    1 
ATOM   6048 C  CG    . PHE B 1 356 ? 9.803   51.601 20.995  1.00 22.43 ? 356 PHE B CG    1 
ATOM   6049 C  CD1   . PHE B 1 356 ? 8.425   51.661 20.833  1.00 22.11 ? 356 PHE B CD1   1 
ATOM   6050 C  CD2   . PHE B 1 356 ? 10.341  51.916 22.239  1.00 21.82 ? 356 PHE B CD2   1 
ATOM   6051 C  CE1   . PHE B 1 356 ? 7.592   52.024 21.895  1.00 22.65 ? 356 PHE B CE1   1 
ATOM   6052 C  CE2   . PHE B 1 356 ? 9.519   52.280 23.304  1.00 22.15 ? 356 PHE B CE2   1 
ATOM   6053 C  CZ    . PHE B 1 356 ? 8.140   52.333 23.132  1.00 22.78 ? 356 PHE B CZ    1 
ATOM   6054 N  N     . VAL B 1 357 ? 12.739  53.337 19.951  1.00 19.89 ? 357 VAL B N     1 
ATOM   6055 C  CA    . VAL B 1 357 ? 13.407  54.422 20.652  1.00 19.74 ? 357 VAL B CA    1 
ATOM   6056 C  C     . VAL B 1 357 ? 13.518  55.641 19.767  1.00 19.82 ? 357 VAL B C     1 
ATOM   6057 O  O     . VAL B 1 357 ? 13.533  56.779 20.252  1.00 20.81 ? 357 VAL B O     1 
ATOM   6058 C  CB    . VAL B 1 357 ? 14.833  54.043 21.123  1.00 19.33 ? 357 VAL B CB    1 
ATOM   6059 C  CG1   . VAL B 1 357 ? 15.750  53.865 19.934  1.00 21.64 ? 357 VAL B CG1   1 
ATOM   6060 C  CG2   . VAL B 1 357 ? 15.369  55.120 22.062  1.00 19.04 ? 357 VAL B CG2   1 
HETATM 6061 N  N     . MSE B 1 358 ? 13.583  55.427 18.462  1.00 18.65 ? 358 MSE B N     1 
HETATM 6062 C  CA    . MSE B 1 358 ? 13.710  56.586 17.619  1.00 17.44 ? 358 MSE B CA    1 
HETATM 6063 C  C     . MSE B 1 358 ? 12.444  57.437 17.564  1.00 17.13 ? 358 MSE B C     1 
HETATM 6064 O  O     . MSE B 1 358 ? 12.501  58.639 17.295  1.00 17.75 ? 358 MSE B O     1 
HETATM 6065 C  CB    . MSE B 1 358 ? 14.180  56.199 16.225  1.00 18.15 ? 358 MSE B CB    1 
HETATM 6066 C  CG    . MSE B 1 358 ? 15.202  57.200 15.861  1.00 19.31 ? 358 MSE B CG    1 
HETATM 6067 SE SE    . MSE B 1 358 ? 16.761  56.877 16.828  1.00 20.04 ? 358 MSE B SE    1 
HETATM 6068 C  CE    . MSE B 1 358 ? 17.575  58.357 16.159  1.00 19.70 ? 358 MSE B CE    1 
ATOM   6069 N  N     . SER B 1 359 ? 11.304  56.815 17.845  1.00 15.70 ? 359 SER B N     1 
ATOM   6070 C  CA    . SER B 1 359 ? 10.030  57.526 17.857  1.00 15.38 ? 359 SER B CA    1 
ATOM   6071 C  C     . SER B 1 359 ? 10.139  58.654 18.878  1.00 15.98 ? 359 SER B C     1 
ATOM   6072 O  O     . SER B 1 359 ? 9.598   59.746 18.685  1.00 15.53 ? 359 SER B O     1 
ATOM   6073 C  CB    . SER B 1 359 ? 8.895   56.579 18.260  1.00 14.64 ? 359 SER B CB    1 
ATOM   6074 O  OG    . SER B 1 359 ? 7.656   57.261 18.335  1.00 12.12 ? 359 SER B OG    1 
ATOM   6075 N  N     . ASN B 1 360 ? 10.841  58.375 19.970  1.00 16.54 ? 360 ASN B N     1 
ATOM   6076 C  CA    . ASN B 1 360 ? 11.033  59.378 20.996  1.00 17.75 ? 360 ASN B CA    1 
ATOM   6077 C  C     . ASN B 1 360 ? 11.801  60.543 20.422  1.00 18.87 ? 360 ASN B C     1 
ATOM   6078 O  O     . ASN B 1 360 ? 11.285  61.656 20.367  1.00 20.56 ? 360 ASN B O     1 
ATOM   6079 C  CB    . ASN B 1 360 ? 11.796  58.803 22.179  1.00 17.76 ? 360 ASN B CB    1 
ATOM   6080 C  CG    . ASN B 1 360 ? 10.888  58.120 23.171  1.00 17.69 ? 360 ASN B CG    1 
ATOM   6081 O  OD1   . ASN B 1 360 ? 10.129  57.218 22.818  1.00 19.84 ? 360 ASN B OD1   1 
ATOM   6082 N  ND2   . ASN B 1 360 ? 10.957  58.549 24.427  1.00 17.16 ? 360 ASN B ND2   1 
ATOM   6083 N  N     . SER B 1 361 ? 13.033  60.290 19.996  1.00 19.19 ? 361 SER B N     1 
ATOM   6084 C  CA    . SER B 1 361 ? 13.848  61.347 19.425  1.00 19.24 ? 361 SER B CA    1 
ATOM   6085 C  C     . SER B 1 361 ? 13.026  62.169 18.449  1.00 19.66 ? 361 SER B C     1 
ATOM   6086 O  O     . SER B 1 361 ? 12.794  63.365 18.667  1.00 20.40 ? 361 SER B O     1 
ATOM   6087 C  CB    . SER B 1 361 ? 15.072  60.775 18.707  1.00 19.08 ? 361 SER B CB    1 
ATOM   6088 O  OG    . SER B 1 361 ? 15.998  60.207 19.625  1.00 20.00 ? 361 SER B OG    1 
ATOM   6089 N  N     . PHE B 1 362 ? 12.552  61.525 17.390  1.00 19.25 ? 362 PHE B N     1 
ATOM   6090 C  CA    . PHE B 1 362 ? 11.781  62.240 16.388  1.00 19.51 ? 362 PHE B CA    1 
ATOM   6091 C  C     . PHE B 1 362 ? 10.513  62.954 16.832  1.00 20.20 ? 362 PHE B C     1 
ATOM   6092 O  O     . PHE B 1 362 ? 10.167  63.991 16.266  1.00 20.45 ? 362 PHE B O     1 
ATOM   6093 C  CB    . PHE B 1 362 ? 11.500  61.321 15.197  1.00 18.86 ? 362 PHE B CB    1 
ATOM   6094 C  CG    . PHE B 1 362 ? 12.741  60.932 14.450  1.00 17.31 ? 362 PHE B CG    1 
ATOM   6095 C  CD1   . PHE B 1 362 ? 13.848  61.774 14.451  1.00 16.70 ? 362 PHE B CD1   1 
ATOM   6096 C  CD2   . PHE B 1 362 ? 12.798  59.761 13.721  1.00 17.03 ? 362 PHE B CD2   1 
ATOM   6097 C  CE1   . PHE B 1 362 ? 15.000  61.456 13.736  1.00 17.64 ? 362 PHE B CE1   1 
ATOM   6098 C  CE2   . PHE B 1 362 ? 13.947  59.432 12.998  1.00 18.33 ? 362 PHE B CE2   1 
ATOM   6099 C  CZ    . PHE B 1 362 ? 15.053  60.285 13.006  1.00 17.79 ? 362 PHE B CZ    1 
ATOM   6100 N  N     . THR B 1 363 ? 9.813   62.431 17.833  1.00 21.05 ? 363 THR B N     1 
ATOM   6101 C  CA    . THR B 1 363 ? 8.609   63.119 18.299  1.00 21.59 ? 363 THR B CA    1 
ATOM   6102 C  C     . THR B 1 363 ? 9.027   64.490 18.841  1.00 23.00 ? 363 THR B C     1 
ATOM   6103 O  O     . THR B 1 363 ? 8.364   65.500 18.601  1.00 23.55 ? 363 THR B O     1 
ATOM   6104 C  CB    . THR B 1 363 ? 7.890   62.323 19.400  1.00 20.30 ? 363 THR B CB    1 
ATOM   6105 O  OG1   . THR B 1 363 ? 7.396   61.099 18.845  1.00 20.14 ? 363 THR B OG1   1 
ATOM   6106 C  CG2   . THR B 1 363 ? 6.727   63.126 19.971  1.00 18.59 ? 363 THR B CG2   1 
ATOM   6107 N  N     . ASN B 1 364 ? 10.132  64.513 19.578  1.00 23.54 ? 364 ASN B N     1 
ATOM   6108 C  CA    . ASN B 1 364 ? 10.663  65.759 20.110  1.00 24.55 ? 364 ASN B CA    1 
ATOM   6109 C  C     . ASN B 1 364 ? 11.007  66.667 18.930  1.00 25.49 ? 364 ASN B C     1 
ATOM   6110 O  O     . ASN B 1 364 ? 10.755  67.881 18.938  1.00 26.30 ? 364 ASN B O     1 
ATOM   6111 C  CB    . ASN B 1 364 ? 11.933  65.476 20.915  1.00 23.74 ? 364 ASN B CB    1 
ATOM   6112 C  CG    . ASN B 1 364 ? 11.637  64.908 22.280  1.00 23.22 ? 364 ASN B CG    1 
ATOM   6113 O  OD1   . ASN B 1 364 ? 11.213  65.629 23.181  1.00 21.59 ? 364 ASN B OD1   1 
ATOM   6114 N  ND2   . ASN B 1 364 ? 11.843  63.604 22.437  1.00 23.42 ? 364 ASN B ND2   1 
ATOM   6115 N  N     . GLN B 1 365 ? 11.583  66.049 17.910  1.00 25.20 ? 365 GLN B N     1 
ATOM   6116 C  CA    . GLN B 1 365 ? 11.998  66.749 16.716  1.00 25.03 ? 365 GLN B CA    1 
ATOM   6117 C  C     . GLN B 1 365 ? 10.810  67.445 16.050  1.00 25.87 ? 365 GLN B C     1 
ATOM   6118 O  O     . GLN B 1 365 ? 10.898  68.615 15.676  1.00 27.34 ? 365 GLN B O     1 
ATOM   6119 C  CB    . GLN B 1 365 ? 12.641  65.746 15.772  1.00 24.59 ? 365 GLN B CB    1 
ATOM   6120 C  CG    . GLN B 1 365 ? 13.503  66.374 14.723  1.00 24.57 ? 365 GLN B CG    1 
ATOM   6121 C  CD    . GLN B 1 365 ? 14.636  67.174 15.317  1.00 23.01 ? 365 GLN B CD    1 
ATOM   6122 O  OE1   . GLN B 1 365 ? 15.496  66.644 16.032  1.00 21.26 ? 365 GLN B OE1   1 
ATOM   6123 N  NE2   . GLN B 1 365 ? 14.646  68.465 15.019  1.00 22.92 ? 365 GLN B NE2   1 
ATOM   6124 N  N     . VAL B 1 366 ? 9.695   66.733 15.907  1.00 25.94 ? 366 VAL B N     1 
ATOM   6125 C  CA    . VAL B 1 366 ? 8.508   67.315 15.285  1.00 26.22 ? 366 VAL B CA    1 
ATOM   6126 C  C     . VAL B 1 366 ? 7.969   68.451 16.149  1.00 27.04 ? 366 VAL B C     1 
ATOM   6127 O  O     . VAL B 1 366 ? 7.624   69.519 15.639  1.00 28.14 ? 366 VAL B O     1 
ATOM   6128 C  CB    . VAL B 1 366 ? 7.392   66.261 15.092  1.00 25.90 ? 366 VAL B CB    1 
ATOM   6129 C  CG1   . VAL B 1 366 ? 6.167   66.899 14.467  1.00 25.10 ? 366 VAL B CG1   1 
ATOM   6130 C  CG2   . VAL B 1 366 ? 7.895   65.145 14.213  1.00 25.77 ? 366 VAL B CG2   1 
HETATM 6131 N  N     . MSE B 1 367 ? 7.905   68.221 17.459  1.00 27.10 ? 367 MSE B N     1 
HETATM 6132 C  CA    . MSE B 1 367 ? 7.409   69.232 18.393  1.00 26.86 ? 367 MSE B CA    1 
HETATM 6133 C  C     . MSE B 1 367 ? 8.263   70.491 18.273  1.00 26.50 ? 367 MSE B C     1 
HETATM 6134 O  O     . MSE B 1 367 ? 7.741   71.608 18.260  1.00 26.58 ? 367 MSE B O     1 
HETATM 6135 C  CB    . MSE B 1 367 ? 7.464   68.717 19.843  1.00 28.12 ? 367 MSE B CB    1 
HETATM 6136 C  CG    . MSE B 1 367 ? 6.548   67.534 20.171  1.00 29.40 ? 367 MSE B CG    1 
HETATM 6137 SE SE    . MSE B 1 367 ? 6.746   67.031 21.968  1.00 33.64 ? 367 MSE B SE    1 
HETATM 6138 C  CE    . MSE B 1 367 ? 5.536   65.653 21.980  1.00 30.57 ? 367 MSE B CE    1 
ATOM   6139 N  N     . ALA B 1 368 ? 9.578   70.300 18.188  1.00 25.51 ? 368 ALA B N     1 
ATOM   6140 C  CA    . ALA B 1 368 ? 10.508  71.413 18.068  1.00 24.38 ? 368 ALA B CA    1 
ATOM   6141 C  C     . ALA B 1 368 ? 10.157  72.225 16.831  1.00 24.55 ? 368 ALA B C     1 
ATOM   6142 O  O     . ALA B 1 368 ? 9.978   73.439 16.904  1.00 23.75 ? 368 ALA B O     1 
ATOM   6143 C  CB    . ALA B 1 368 ? 11.918  70.891 17.962  1.00 24.33 ? 368 ALA B CB    1 
ATOM   6144 N  N     . GLN B 1 369 ? 10.056  71.547 15.693  1.00 24.93 ? 369 GLN B N     1 
ATOM   6145 C  CA    . GLN B 1 369 ? 9.708   72.217 14.453  1.00 24.35 ? 369 GLN B CA    1 
ATOM   6146 C  C     . GLN B 1 369 ? 8.407   73.000 14.631  1.00 23.88 ? 369 GLN B C     1 
ATOM   6147 O  O     . GLN B 1 369 ? 8.347   74.171 14.272  1.00 23.83 ? 369 GLN B O     1 
ATOM   6148 C  CB    . GLN B 1 369 ? 9.557   71.201 13.326  1.00 24.88 ? 369 GLN B CB    1 
ATOM   6149 C  CG    . GLN B 1 369 ? 10.847  70.529 12.908  1.00 26.07 ? 369 GLN B CG    1 
ATOM   6150 C  CD    . GLN B 1 369 ? 11.791  71.480 12.199  1.00 27.61 ? 369 GLN B CD    1 
ATOM   6151 O  OE1   . GLN B 1 369 ? 11.406  72.146 11.233  1.00 28.00 ? 369 GLN B OE1   1 
ATOM   6152 N  NE2   . GLN B 1 369 ? 13.039  71.533 12.657  1.00 28.98 ? 369 GLN B NE2   1 
ATOM   6153 N  N     . ILE B 1 370 ? 7.371   72.374 15.190  1.00 23.79 ? 370 ILE B N     1 
ATOM   6154 C  CA    . ILE B 1 370 ? 6.099   73.084 15.382  1.00 25.09 ? 370 ILE B CA    1 
ATOM   6155 C  C     . ILE B 1 370 ? 6.292   74.335 16.253  1.00 26.38 ? 370 ILE B C     1 
ATOM   6156 O  O     . ILE B 1 370 ? 5.730   75.403 15.966  1.00 26.95 ? 370 ILE B O     1 
ATOM   6157 C  CB    . ILE B 1 370 ? 5.015   72.194 16.037  1.00 24.40 ? 370 ILE B CB    1 
ATOM   6158 C  CG1   . ILE B 1 370 ? 4.695   70.994 15.140  1.00 24.58 ? 370 ILE B CG1   1 
ATOM   6159 C  CG2   . ILE B 1 370 ? 3.753   73.012 16.256  1.00 23.65 ? 370 ILE B CG2   1 
ATOM   6160 C  CD1   . ILE B 1 370 ? 3.623   70.070 15.695  1.00 24.26 ? 370 ILE B CD1   1 
ATOM   6161 N  N     . GLU B 1 371 ? 7.086   74.204 17.316  1.00 26.72 ? 371 GLU B N     1 
ATOM   6162 C  CA    . GLU B 1 371 ? 7.362   75.333 18.202  1.00 26.66 ? 371 GLU B CA    1 
ATOM   6163 C  C     . GLU B 1 371 ? 7.994   76.507 17.468  1.00 26.74 ? 371 GLU B C     1 
ATOM   6164 O  O     . GLU B 1 371 ? 7.424   77.596 17.439  1.00 27.74 ? 371 GLU B O     1 
ATOM   6165 C  CB    . GLU B 1 371 ? 8.280   74.916 19.350  1.00 27.19 ? 371 GLU B CB    1 
ATOM   6166 C  CG    . GLU B 1 371 ? 7.581   74.173 20.480  1.00 27.15 ? 371 GLU B CG    1 
ATOM   6167 C  CD    . GLU B 1 371 ? 6.468   75.003 21.108  1.00 27.68 ? 371 GLU B CD    1 
ATOM   6168 O  OE1   . GLU B 1 371 ? 5.344   75.024 20.554  1.00 28.74 ? 371 GLU B OE1   1 
ATOM   6169 O  OE2   . GLU B 1 371 ? 6.724   75.663 22.142  1.00 26.82 ? 371 GLU B OE2   1 
ATOM   6170 N  N     . LEU B 1 372 ? 9.170   76.293 16.884  1.00 25.59 ? 372 LEU B N     1 
ATOM   6171 C  CA    . LEU B 1 372 ? 9.838   77.365 16.166  1.00 25.78 ? 372 LEU B CA    1 
ATOM   6172 C  C     . LEU B 1 372 ? 8.980   77.973 15.058  1.00 26.89 ? 372 LEU B C     1 
ATOM   6173 O  O     . LEU B 1 372 ? 8.947   79.190 14.887  1.00 27.53 ? 372 LEU B O     1 
ATOM   6174 C  CB    . LEU B 1 372 ? 11.160  76.889 15.552  1.00 24.48 ? 372 LEU B CB    1 
ATOM   6175 C  CG    . LEU B 1 372 ? 12.397  76.516 16.377  1.00 24.04 ? 372 LEU B CG    1 
ATOM   6176 C  CD1   . LEU B 1 372 ? 12.757  77.648 17.325  1.00 24.44 ? 372 LEU B CD1   1 
ATOM   6177 C  CD2   . LEU B 1 372 ? 12.145  75.268 17.138  1.00 24.06 ? 372 LEU B CD2   1 
ATOM   6178 N  N     . TRP B 1 373 ? 8.274   77.138 14.307  1.00 28.54 ? 373 TRP B N     1 
ATOM   6179 C  CA    . TRP B 1 373 ? 7.464   77.645 13.200  1.00 30.69 ? 373 TRP B CA    1 
ATOM   6180 C  C     . TRP B 1 373 ? 6.146   78.325 13.540  1.00 31.00 ? 373 TRP B C     1 
ATOM   6181 O  O     . TRP B 1 373 ? 5.758   79.289 12.878  1.00 31.38 ? 373 TRP B O     1 
ATOM   6182 C  CB    . TRP B 1 373 ? 7.205   76.529 12.179  1.00 31.39 ? 373 TRP B CB    1 
ATOM   6183 C  CG    . TRP B 1 373 ? 6.361   76.972 11.025  1.00 31.63 ? 373 TRP B CG    1 
ATOM   6184 C  CD1   . TRP B 1 373 ? 5.029   76.740 10.849  1.00 32.03 ? 373 TRP B CD1   1 
ATOM   6185 C  CD2   . TRP B 1 373 ? 6.783   77.766 9.906   1.00 32.50 ? 373 TRP B CD2   1 
ATOM   6186 N  NE1   . TRP B 1 373 ? 4.590   77.337 9.691   1.00 32.25 ? 373 TRP B NE1   1 
ATOM   6187 C  CE2   . TRP B 1 373 ? 5.644   77.973 9.091   1.00 32.44 ? 373 TRP B CE2   1 
ATOM   6188 C  CE3   . TRP B 1 373 ? 8.010   78.324 9.513   1.00 32.26 ? 373 TRP B CE3   1 
ATOM   6189 C  CZ2   . TRP B 1 373 ? 5.694   78.710 7.905   1.00 32.58 ? 373 TRP B CZ2   1 
ATOM   6190 C  CZ3   . TRP B 1 373 ? 8.063   79.059 8.331   1.00 32.92 ? 373 TRP B CZ3   1 
ATOM   6191 C  CH2   . TRP B 1 373 ? 6.909   79.244 7.540   1.00 33.29 ? 373 TRP B CH2   1 
ATOM   6192 N  N     . THR B 1 374 ? 5.462   77.832 14.565  1.00 31.36 ? 374 THR B N     1 
ATOM   6193 C  CA    . THR B 1 374 ? 4.178   78.397 14.948  1.00 32.45 ? 374 THR B CA    1 
ATOM   6194 C  C     . THR B 1 374 ? 4.268   79.463 16.038  1.00 33.69 ? 374 THR B C     1 
ATOM   6195 O  O     . THR B 1 374 ? 3.368   80.291 16.181  1.00 34.12 ? 374 THR B O     1 
ATOM   6196 C  CB    . THR B 1 374 ? 3.223   77.278 15.399  1.00 31.47 ? 374 THR B CB    1 
ATOM   6197 O  OG1   . THR B 1 374 ? 3.037   76.357 14.318  1.00 31.35 ? 374 THR B OG1   1 
ATOM   6198 C  CG2   . THR B 1 374 ? 1.876   77.845 15.786  1.00 31.88 ? 374 THR B CG2   1 
ATOM   6199 N  N     . HIS B 1 375 ? 5.354   79.449 16.805  1.00 35.06 ? 375 HIS B N     1 
ATOM   6200 C  CA    . HIS B 1 375 ? 5.531   80.423 17.877  1.00 36.09 ? 375 HIS B CA    1 
ATOM   6201 C  C     . HIS B 1 375 ? 6.934   81.018 17.843  1.00 36.71 ? 375 HIS B C     1 
ATOM   6202 O  O     . HIS B 1 375 ? 7.699   80.896 18.800  1.00 37.79 ? 375 HIS B O     1 
ATOM   6203 C  CB    . HIS B 1 375 ? 5.295   79.765 19.238  1.00 35.76 ? 375 HIS B CB    1 
ATOM   6204 C  CG    . HIS B 1 375 ? 4.001   79.024 19.328  1.00 36.21 ? 375 HIS B CG    1 
ATOM   6205 N  ND1   . HIS B 1 375 ? 3.785   77.826 18.683  1.00 36.94 ? 375 HIS B ND1   1 
ATOM   6206 C  CD2   . HIS B 1 375 ? 2.843   79.328 19.958  1.00 36.31 ? 375 HIS B CD2   1 
ATOM   6207 C  CE1   . HIS B 1 375 ? 2.549   77.421 18.914  1.00 37.71 ? 375 HIS B CE1   1 
ATOM   6208 N  NE2   . HIS B 1 375 ? 1.955   78.316 19.686  1.00 37.10 ? 375 HIS B NE2   1 
ATOM   6209 N  N     . PRO B 1 376 ? 7.284   81.696 16.747  1.00 37.07 ? 376 PRO B N     1 
ATOM   6210 C  CA    . PRO B 1 376 ? 8.611   82.305 16.611  1.00 38.39 ? 376 PRO B CA    1 
ATOM   6211 C  C     . PRO B 1 376 ? 8.917   83.281 17.754  1.00 39.24 ? 376 PRO B C     1 
ATOM   6212 O  O     . PRO B 1 376 ? 9.987   83.233 18.373  1.00 39.32 ? 376 PRO B O     1 
ATOM   6213 C  CB    . PRO B 1 376 ? 8.510   83.012 15.258  1.00 38.21 ? 376 PRO B CB    1 
ATOM   6214 C  CG    . PRO B 1 376 ? 7.521   82.129 14.506  1.00 37.63 ? 376 PRO B CG    1 
ATOM   6215 C  CD    . PRO B 1 376 ? 6.462   82.000 15.566  1.00 37.21 ? 376 PRO B CD    1 
ATOM   6216 N  N     . ASP B 1 377 ? 7.954   84.162 18.017  1.00 39.63 ? 377 ASP B N     1 
ATOM   6217 C  CA    . ASP B 1 377 ? 8.054   85.183 19.055  1.00 39.45 ? 377 ASP B CA    1 
ATOM   6218 C  C     . ASP B 1 377 ? 8.306   84.615 20.441  1.00 38.66 ? 377 ASP B C     1 
ATOM   6219 O  O     . ASP B 1 377 ? 8.459   85.365 21.408  1.00 38.58 ? 377 ASP B O     1 
ATOM   6220 C  CB    . ASP B 1 377 ? 6.769   86.013 19.078  1.00 41.05 ? 377 ASP B CB    1 
ATOM   6221 C  CG    . ASP B 1 377 ? 6.601   86.860 17.829  1.00 42.66 ? 377 ASP B CG    1 
ATOM   6222 O  OD1   . ASP B 1 377 ? 6.683   86.303 16.707  1.00 41.73 ? 377 ASP B OD1   1 
ATOM   6223 O  OD2   . ASP B 1 377 ? 6.378   88.085 17.975  1.00 44.28 ? 377 ASP B OD2   1 
ATOM   6224 N  N     . LYS B 1 378 ? 8.349   83.292 20.542  1.00 37.19 ? 378 LYS B N     1 
ATOM   6225 C  CA    . LYS B 1 378 ? 8.569   82.667 21.831  1.00 35.30 ? 378 LYS B CA    1 
ATOM   6226 C  C     . LYS B 1 378 ? 10.005  82.154 21.948  1.00 33.63 ? 378 LYS B C     1 
ATOM   6227 O  O     . LYS B 1 378 ? 10.416  81.665 22.996  1.00 34.12 ? 378 LYS B O     1 
ATOM   6228 C  CB    . LYS B 1 378 ? 7.548   81.538 22.027  1.00 35.87 ? 378 LYS B CB    1 
ATOM   6229 C  CG    . LYS B 1 378 ? 7.510   80.975 23.432  1.00 37.03 ? 378 LYS B CG    1 
ATOM   6230 C  CD    . LYS B 1 378 ? 6.335   80.007 23.663  1.00 38.05 ? 378 LYS B CD    1 
ATOM   6231 C  CE    . LYS B 1 378 ? 6.426   78.740 22.819  1.00 38.18 ? 378 LYS B CE    1 
ATOM   6232 N  NZ    . LYS B 1 378 ? 5.364   77.766 23.195  1.00 38.41 ? 378 LYS B NZ    1 
ATOM   6233 N  N     . TYR B 1 379 ? 10.780  82.287 20.877  1.00 31.17 ? 379 TYR B N     1 
ATOM   6234 C  CA    . TYR B 1 379 ? 12.159  81.822 20.907  1.00 29.48 ? 379 TYR B CA    1 
ATOM   6235 C  C     . TYR B 1 379 ? 13.156  82.824 20.345  1.00 28.73 ? 379 TYR B C     1 
ATOM   6236 O  O     . TYR B 1 379 ? 13.372  82.902 19.134  1.00 28.55 ? 379 TYR B O     1 
ATOM   6237 C  CB    . TYR B 1 379 ? 12.309  80.501 20.147  1.00 28.63 ? 379 TYR B CB    1 
ATOM   6238 C  CG    . TYR B 1 379 ? 11.493  79.362 20.703  1.00 27.18 ? 379 TYR B CG    1 
ATOM   6239 C  CD1   . TYR B 1 379 ? 10.117  79.313 20.528  1.00 27.10 ? 379 TYR B CD1   1 
ATOM   6240 C  CD2   . TYR B 1 379 ? 12.100  78.334 21.417  1.00 27.49 ? 379 TYR B CD2   1 
ATOM   6241 C  CE1   . TYR B 1 379 ? 9.359   78.262 21.051  1.00 27.97 ? 379 TYR B CE1   1 
ATOM   6242 C  CE2   . TYR B 1 379 ? 11.355  77.277 21.947  1.00 27.89 ? 379 TYR B CE2   1 
ATOM   6243 C  CZ    . TYR B 1 379 ? 9.987   77.249 21.759  1.00 28.41 ? 379 TYR B CZ    1 
ATOM   6244 O  OH    . TYR B 1 379 ? 9.255   76.212 22.280  1.00 28.41 ? 379 TYR B OH    1 
ATOM   6245 N  N     . PRO B 1 380 ? 13.790  83.601 21.230  1.00 27.95 ? 380 PRO B N     1 
ATOM   6246 C  CA    . PRO B 1 380 ? 14.782  84.606 20.838  1.00 26.78 ? 380 PRO B CA    1 
ATOM   6247 C  C     . PRO B 1 380 ? 15.973  83.871 20.241  1.00 25.52 ? 380 PRO B C     1 
ATOM   6248 O  O     . PRO B 1 380 ? 16.071  82.654 20.364  1.00 24.33 ? 380 PRO B O     1 
ATOM   6249 C  CB    . PRO B 1 380 ? 15.138  85.264 22.174  1.00 27.82 ? 380 PRO B CB    1 
ATOM   6250 C  CG    . PRO B 1 380 ? 13.868  85.051 23.010  1.00 28.72 ? 380 PRO B CG    1 
ATOM   6251 C  CD    . PRO B 1 380 ? 13.627  83.594 22.691  1.00 28.28 ? 380 PRO B CD    1 
ATOM   6252 N  N     . VAL B 1 381 ? 16.877  84.595 19.591  1.00 24.45 ? 381 VAL B N     1 
ATOM   6253 C  CA    . VAL B 1 381 ? 18.043  83.934 19.030  1.00 22.82 ? 381 VAL B CA    1 
ATOM   6254 C  C     . VAL B 1 381 ? 18.753  83.304 20.214  1.00 22.64 ? 381 VAL B C     1 
ATOM   6255 O  O     . VAL B 1 381 ? 19.020  83.961 21.215  1.00 22.32 ? 381 VAL B O     1 
ATOM   6256 C  CB    . VAL B 1 381 ? 18.985  84.919 18.331  1.00 22.67 ? 381 VAL B CB    1 
ATOM   6257 C  CG1   . VAL B 1 381 ? 20.200  84.187 17.798  1.00 22.33 ? 381 VAL B CG1   1 
ATOM   6258 C  CG2   . VAL B 1 381 ? 18.252  85.608 17.199  1.00 22.80 ? 381 VAL B CG2   1 
ATOM   6259 N  N     . GLY B 1 382 ? 19.034  82.015 20.095  1.00 22.60 ? 382 GLY B N     1 
ATOM   6260 C  CA    . GLY B 1 382 ? 19.691  81.295 21.166  1.00 22.76 ? 382 GLY B CA    1 
ATOM   6261 C  C     . GLY B 1 382 ? 19.206  79.861 21.140  1.00 22.09 ? 382 GLY B C     1 
ATOM   6262 O  O     . GLY B 1 382 ? 18.407  79.497 20.277  1.00 21.75 ? 382 GLY B O     1 
ATOM   6263 N  N     . VAL B 1 383 ? 19.679  79.044 22.077  1.00 21.46 ? 383 VAL B N     1 
ATOM   6264 C  CA    . VAL B 1 383 ? 19.291  77.641 22.127  1.00 19.75 ? 383 VAL B CA    1 
ATOM   6265 C  C     . VAL B 1 383 ? 18.436  77.336 23.350  1.00 18.87 ? 383 VAL B C     1 
ATOM   6266 O  O     . VAL B 1 383 ? 18.823  77.618 24.479  1.00 18.30 ? 383 VAL B O     1 
ATOM   6267 C  CB    . VAL B 1 383 ? 20.541  76.757 22.114  1.00 18.92 ? 383 VAL B CB    1 
ATOM   6268 C  CG1   . VAL B 1 383 ? 21.522  77.276 23.117  1.00 18.74 ? 383 VAL B CG1   1 
ATOM   6269 C  CG2   . VAL B 1 383 ? 20.170  75.314 22.424  1.00 19.59 ? 383 VAL B CG2   1 
ATOM   6270 N  N     . HIS B 1 384 ? 17.272  76.742 23.112  1.00 19.42 ? 384 HIS B N     1 
ATOM   6271 C  CA    . HIS B 1 384 ? 16.342  76.428 24.192  1.00 20.48 ? 384 HIS B CA    1 
ATOM   6272 C  C     . HIS B 1 384 ? 16.004  74.934 24.292  1.00 20.34 ? 384 HIS B C     1 
ATOM   6273 O  O     . HIS B 1 384 ? 16.390  74.135 23.436  1.00 20.78 ? 384 HIS B O     1 
ATOM   6274 C  CB    . HIS B 1 384 ? 15.036  77.208 23.995  1.00 19.79 ? 384 HIS B CB    1 
ATOM   6275 C  CG    . HIS B 1 384 ? 15.228  78.627 23.543  1.00 20.55 ? 384 HIS B CG    1 
ATOM   6276 N  ND1   . HIS B 1 384 ? 15.626  78.954 22.263  1.00 19.35 ? 384 HIS B ND1   1 
ATOM   6277 C  CD2   . HIS B 1 384 ? 15.038  79.805 24.188  1.00 20.68 ? 384 HIS B CD2   1 
ATOM   6278 C  CE1   . HIS B 1 384 ? 15.668  80.268 22.137  1.00 18.76 ? 384 HIS B CE1   1 
ATOM   6279 N  NE2   . HIS B 1 384 ? 15.316  80.809 23.290  1.00 19.12 ? 384 HIS B NE2   1 
ATOM   6280 N  N     . PHE B 1 385 ? 15.275  74.574 25.348  1.00 19.81 ? 385 PHE B N     1 
ATOM   6281 C  CA    . PHE B 1 385 ? 14.843  73.196 25.566  1.00 19.14 ? 385 PHE B CA    1 
ATOM   6282 C  C     . PHE B 1 385 ? 13.335  73.178 25.429  1.00 19.31 ? 385 PHE B C     1 
ATOM   6283 O  O     . PHE B 1 385 ? 12.676  74.187 25.658  1.00 20.17 ? 385 PHE B O     1 
ATOM   6284 C  CB    . PHE B 1 385 ? 15.153  72.704 26.986  1.00 18.00 ? 385 PHE B CB    1 
ATOM   6285 C  CG    . PHE B 1 385 ? 16.585  72.849 27.397  1.00 16.53 ? 385 PHE B CG    1 
ATOM   6286 C  CD1   . PHE B 1 385 ? 17.543  71.948 26.946  1.00 15.71 ? 385 PHE B CD1   1 
ATOM   6287 C  CD2   . PHE B 1 385 ? 16.973  73.873 28.248  1.00 14.72 ? 385 PHE B CD2   1 
ATOM   6288 C  CE1   . PHE B 1 385 ? 18.874  72.059 27.337  1.00 15.20 ? 385 PHE B CE1   1 
ATOM   6289 C  CE2   . PHE B 1 385 ? 18.298  73.995 28.649  1.00 15.91 ? 385 PHE B CE2   1 
ATOM   6290 C  CZ    . PHE B 1 385 ? 19.257  73.080 28.188  1.00 15.73 ? 385 PHE B CZ    1 
ATOM   6291 N  N     . LEU B 1 386 ? 12.782  72.033 25.062  1.00 19.84 ? 386 LEU B N     1 
ATOM   6292 C  CA    . LEU B 1 386 ? 11.336  71.929 24.964  1.00 19.25 ? 386 LEU B CA    1 
ATOM   6293 C  C     . LEU B 1 386 ? 10.874  72.025 26.402  1.00 19.26 ? 386 LEU B C     1 
ATOM   6294 O  O     . LEU B 1 386 ? 11.668  71.821 27.321  1.00 19.58 ? 386 LEU B O     1 
ATOM   6295 C  CB    . LEU B 1 386 ? 10.942  70.578 24.371  1.00 17.86 ? 386 LEU B CB    1 
ATOM   6296 C  CG    . LEU B 1 386 ? 10.444  70.582 22.929  1.00 16.58 ? 386 LEU B CG    1 
ATOM   6297 C  CD1   . LEU B 1 386 ? 11.241  71.554 22.105  1.00 16.61 ? 386 LEU B CD1   1 
ATOM   6298 C  CD2   . LEU B 1 386 ? 10.529  69.168 22.371  1.00 16.01 ? 386 LEU B CD2   1 
ATOM   6299 N  N     . PRO B 1 387 ? 9.594   72.356 26.622  1.00 19.54 ? 387 PRO B N     1 
ATOM   6300 C  CA    . PRO B 1 387 ? 9.022   72.476 27.970  1.00 18.94 ? 387 PRO B CA    1 
ATOM   6301 C  C     . PRO B 1 387 ? 8.947   71.087 28.610  1.00 18.74 ? 387 PRO B C     1 
ATOM   6302 O  O     . PRO B 1 387 ? 8.618   70.105 27.936  1.00 18.60 ? 387 PRO B O     1 
ATOM   6303 C  CB    . PRO B 1 387 ? 7.631   73.048 27.694  1.00 19.58 ? 387 PRO B CB    1 
ATOM   6304 C  CG    . PRO B 1 387 ? 7.806   73.744 26.322  1.00 20.61 ? 387 PRO B CG    1 
ATOM   6305 C  CD    . PRO B 1 387 ? 8.571   72.663 25.613  1.00 20.00 ? 387 PRO B CD    1 
ATOM   6306 N  N     . LYS B 1 388 ? 9.240   70.984 29.901  1.00 17.99 ? 388 LYS B N     1 
ATOM   6307 C  CA    . LYS B 1 388 ? 9.186   69.669 30.523  1.00 16.55 ? 388 LYS B CA    1 
ATOM   6308 C  C     . LYS B 1 388 ? 7.846   68.979 30.296  1.00 17.42 ? 388 LYS B C     1 
ATOM   6309 O  O     . LYS B 1 388 ? 7.804   67.767 30.076  1.00 19.18 ? 388 LYS B O     1 
ATOM   6310 C  CB    . LYS B 1 388 ? 9.477   69.743 32.025  1.00 13.49 ? 388 LYS B CB    1 
ATOM   6311 C  CG    . LYS B 1 388 ? 9.346   68.390 32.712  1.00 10.14 ? 388 LYS B CG    1 
ATOM   6312 C  CD    . LYS B 1 388 ? 9.882   68.402 34.137  1.00 8.48  ? 388 LYS B CD    1 
ATOM   6313 C  CE    . LYS B 1 388 ? 11.395  68.706 34.175  1.00 5.55  ? 388 LYS B CE    1 
ATOM   6314 N  NZ    . LYS B 1 388 ? 12.210  67.766 33.354  1.00 2.00  ? 388 LYS B NZ    1 
ATOM   6315 N  N     . LYS B 1 389 ? 6.749   69.727 30.320  1.00 16.98 ? 389 LYS B N     1 
ATOM   6316 C  CA    . LYS B 1 389 ? 5.471   69.069 30.130  1.00 17.75 ? 389 LYS B CA    1 
ATOM   6317 C  C     . LYS B 1 389 ? 5.362   68.414 28.762  1.00 17.78 ? 389 LYS B C     1 
ATOM   6318 O  O     . LYS B 1 389 ? 4.723   67.374 28.623  1.00 17.38 ? 389 LYS B O     1 
ATOM   6319 C  CB    . LYS B 1 389 ? 4.318   70.036 30.355  1.00 19.41 ? 389 LYS B CB    1 
ATOM   6320 C  CG    . LYS B 1 389 ? 2.981   69.336 30.390  1.00 21.33 ? 389 LYS B CG    1 
ATOM   6321 C  CD    . LYS B 1 389 ? 1.974   70.132 31.200  1.00 23.01 ? 389 LYS B CD    1 
ATOM   6322 C  CE    . LYS B 1 389 ? 0.724   69.300 31.479  1.00 24.74 ? 389 LYS B CE    1 
ATOM   6323 N  NZ    . LYS B 1 389 ? -0.181  69.973 32.456  1.00 25.09 ? 389 LYS B NZ    1 
ATOM   6324 N  N     . LEU B 1 390 ? 5.980   69.007 27.749  1.00 18.13 ? 390 LEU B N     1 
ATOM   6325 C  CA    . LEU B 1 390 ? 5.934   68.392 26.432  1.00 19.70 ? 390 LEU B CA    1 
ATOM   6326 C  C     . LEU B 1 390 ? 6.832   67.157 26.445  1.00 20.18 ? 390 LEU B C     1 
ATOM   6327 O  O     . LEU B 1 390 ? 6.518   66.121 25.842  1.00 21.43 ? 390 LEU B O     1 
ATOM   6328 C  CB    . LEU B 1 390 ? 6.411   69.363 25.338  1.00 19.89 ? 390 LEU B CB    1 
ATOM   6329 C  CG    . LEU B 1 390 ? 5.502   70.542 24.973  1.00 20.59 ? 390 LEU B CG    1 
ATOM   6330 C  CD1   . LEU B 1 390 ? 6.106   71.287 23.790  1.00 20.00 ? 390 LEU B CD1   1 
ATOM   6331 C  CD2   . LEU B 1 390 ? 4.109   70.043 24.600  1.00 19.74 ? 390 LEU B CD2   1 
ATOM   6332 N  N     . ASP B 1 391 ? 7.949   67.272 27.152  1.00 19.93 ? 391 ASP B N     1 
ATOM   6333 C  CA    . ASP B 1 391 ? 8.910   66.189 27.237  1.00 19.06 ? 391 ASP B CA    1 
ATOM   6334 C  C     . ASP B 1 391 ? 8.244   64.966 27.866  1.00 18.71 ? 391 ASP B C     1 
ATOM   6335 O  O     . ASP B 1 391 ? 8.391   63.839 27.375  1.00 16.54 ? 391 ASP B O     1 
ATOM   6336 C  CB    . ASP B 1 391 ? 10.107  66.660 28.060  1.00 19.29 ? 391 ASP B CB    1 
ATOM   6337 C  CG    . ASP B 1 391 ? 11.347  65.835 27.813  1.00 19.59 ? 391 ASP B CG    1 
ATOM   6338 O  OD1   . ASP B 1 391 ? 11.234  64.715 27.265  1.00 20.73 ? 391 ASP B OD1   1 
ATOM   6339 O  OD2   . ASP B 1 391 ? 12.442  66.313 28.177  1.00 18.82 ? 391 ASP B OD2   1 
ATOM   6340 N  N     . GLU B 1 392 ? 7.493   65.192 28.940  1.00 18.91 ? 392 GLU B N     1 
ATOM   6341 C  CA    . GLU B 1 392 ? 6.809   64.089 29.605  1.00 20.85 ? 392 GLU B CA    1 
ATOM   6342 C  C     . GLU B 1 392 ? 5.816   63.485 28.625  1.00 21.41 ? 392 GLU B C     1 
ATOM   6343 O  O     . GLU B 1 392 ? 5.644   62.270 28.569  1.00 21.99 ? 392 GLU B O     1 
ATOM   6344 C  CB    . GLU B 1 392 ? 6.045   64.565 30.844  1.00 20.50 ? 392 GLU B CB    1 
ATOM   6345 C  CG    . GLU B 1 392 ? 6.843   65.397 31.803  1.00 21.52 ? 392 GLU B CG    1 
ATOM   6346 C  CD    . GLU B 1 392 ? 6.133   65.582 33.124  1.00 22.89 ? 392 GLU B CD    1 
ATOM   6347 O  OE1   . GLU B 1 392 ? 4.894   65.761 33.113  1.00 23.10 ? 392 GLU B OE1   1 
ATOM   6348 O  OE2   . GLU B 1 392 ? 6.816   65.569 34.175  1.00 24.64 ? 392 GLU B OE2   1 
ATOM   6349 N  N     . ALA B 1 393 ? 5.152   64.349 27.866  1.00 22.17 ? 393 ALA B N     1 
ATOM   6350 C  CA    . ALA B 1 393 ? 4.182   63.897 26.883  1.00 22.98 ? 393 ALA B CA    1 
ATOM   6351 C  C     . ALA B 1 393 ? 4.829   62.869 25.948  1.00 23.18 ? 393 ALA B C     1 
ATOM   6352 O  O     . ALA B 1 393 ? 4.294   61.774 25.745  1.00 24.82 ? 393 ALA B O     1 
ATOM   6353 C  CB    . ALA B 1 393 ? 3.661   65.082 26.084  1.00 23.01 ? 393 ALA B CB    1 
ATOM   6354 N  N     . VAL B 1 394 ? 5.979   63.220 25.382  1.00 21.47 ? 394 VAL B N     1 
ATOM   6355 C  CA    . VAL B 1 394 ? 6.664   62.305 24.483  1.00 21.43 ? 394 VAL B CA    1 
ATOM   6356 C  C     . VAL B 1 394 ? 6.688   60.917 25.088  1.00 20.93 ? 394 VAL B C     1 
ATOM   6357 O  O     . VAL B 1 394 ? 6.248   59.949 24.473  1.00 21.83 ? 394 VAL B O     1 
ATOM   6358 C  CB    . VAL B 1 394 ? 8.123   62.736 24.230  1.00 21.41 ? 394 VAL B CB    1 
ATOM   6359 C  CG1   . VAL B 1 394 ? 8.844   61.676 23.423  1.00 22.64 ? 394 VAL B CG1   1 
ATOM   6360 C  CG2   . VAL B 1 394 ? 8.146   64.058 23.482  1.00 20.97 ? 394 VAL B CG2   1 
ATOM   6361 N  N     . ALA B 1 395 ? 7.208   60.828 26.305  1.00 20.55 ? 395 ALA B N     1 
ATOM   6362 C  CA    . ALA B 1 395 ? 7.310   59.555 26.993  1.00 19.49 ? 395 ALA B CA    1 
ATOM   6363 C  C     . ALA B 1 395 ? 5.948   58.921 27.194  1.00 19.37 ? 395 ALA B C     1 
ATOM   6364 O  O     . ALA B 1 395 ? 5.782   57.724 26.975  1.00 20.43 ? 395 ALA B O     1 
ATOM   6365 C  CB    . ALA B 1 395 ? 8.007   59.737 28.341  1.00 18.91 ? 395 ALA B CB    1 
ATOM   6366 N  N     . GLU B 1 396 ? 4.965   59.711 27.607  1.00 18.90 ? 396 GLU B N     1 
ATOM   6367 C  CA    . GLU B 1 396 ? 3.642   59.150 27.836  1.00 18.86 ? 396 GLU B CA    1 
ATOM   6368 C  C     . GLU B 1 396 ? 3.119   58.478 26.579  1.00 17.97 ? 396 GLU B C     1 
ATOM   6369 O  O     . GLU B 1 396 ? 2.557   57.388 26.638  1.00 17.65 ? 396 GLU B O     1 
ATOM   6370 C  CB    . GLU B 1 396 ? 2.669   60.229 28.296  1.00 19.53 ? 396 GLU B CB    1 
ATOM   6371 C  CG    . GLU B 1 396 ? 1.343   59.652 28.744  1.00 22.53 ? 396 GLU B CG    1 
ATOM   6372 C  CD    . GLU B 1 396 ? 0.589   60.580 29.677  1.00 24.86 ? 396 GLU B CD    1 
ATOM   6373 O  OE1   . GLU B 1 396 ? 1.037   61.738 29.861  1.00 26.20 ? 396 GLU B OE1   1 
ATOM   6374 O  OE2   . GLU B 1 396 ? -0.451  60.146 30.225  1.00 25.16 ? 396 GLU B OE2   1 
ATOM   6375 N  N     . ALA B 1 397 ? 3.343   59.122 25.441  1.00 16.82 ? 397 ALA B N     1 
ATOM   6376 C  CA    . ALA B 1 397 ? 2.902   58.605 24.158  1.00 17.10 ? 397 ALA B CA    1 
ATOM   6377 C  C     . ALA B 1 397 ? 3.364   57.182 23.811  1.00 18.20 ? 397 ALA B C     1 
ATOM   6378 O  O     . ALA B 1 397 ? 2.748   56.523 22.969  1.00 17.79 ? 397 ALA B O     1 
ATOM   6379 C  CB    . ALA B 1 397 ? 3.324   59.570 23.056  1.00 16.78 ? 397 ALA B CB    1 
ATOM   6380 N  N     . HIS B 1 398 ? 4.437   56.703 24.440  1.00 19.53 ? 398 HIS B N     1 
ATOM   6381 C  CA    . HIS B 1 398 ? 4.927   55.359 24.148  1.00 20.62 ? 398 HIS B CA    1 
ATOM   6382 C  C     . HIS B 1 398 ? 4.624   54.332 25.235  1.00 21.16 ? 398 HIS B C     1 
ATOM   6383 O  O     . HIS B 1 398 ? 5.095   53.196 25.178  1.00 20.36 ? 398 HIS B O     1 
ATOM   6384 C  CB    . HIS B 1 398 ? 6.427   55.383 23.886  1.00 20.74 ? 398 HIS B CB    1 
ATOM   6385 C  CG    . HIS B 1 398 ? 6.824   56.296 22.776  1.00 22.33 ? 398 HIS B CG    1 
ATOM   6386 N  ND1   . HIS B 1 398 ? 6.733   57.667 22.878  1.00 23.44 ? 398 HIS B ND1   1 
ATOM   6387 C  CD2   . HIS B 1 398 ? 7.264   56.037 21.521  1.00 23.88 ? 398 HIS B CD2   1 
ATOM   6388 C  CE1   . HIS B 1 398 ? 7.099   58.215 21.732  1.00 25.40 ? 398 HIS B CE1   1 
ATOM   6389 N  NE2   . HIS B 1 398 ? 7.426   57.247 20.891  1.00 25.77 ? 398 HIS B NE2   1 
ATOM   6390 N  N     . LEU B 1 399 ? 3.836   54.722 26.226  1.00 22.11 ? 399 LEU B N     1 
ATOM   6391 C  CA    . LEU B 1 399 ? 3.493   53.804 27.294  1.00 23.09 ? 399 LEU B CA    1 
ATOM   6392 C  C     . LEU B 1 399 ? 2.476   52.772 26.843  1.00 24.60 ? 399 LEU B C     1 
ATOM   6393 O  O     . LEU B 1 399 ? 2.623   51.592 27.148  1.00 27.16 ? 399 LEU B O     1 
ATOM   6394 C  CB    . LEU B 1 399 ? 2.977   54.576 28.507  1.00 23.70 ? 399 LEU B CB    1 
ATOM   6395 C  CG    . LEU B 1 399 ? 4.019   55.005 29.551  1.00 23.58 ? 399 LEU B CG    1 
ATOM   6396 C  CD1   . LEU B 1 399 ? 5.257   55.606 28.908  1.00 23.24 ? 399 LEU B CD1   1 
ATOM   6397 C  CD2   . LEU B 1 399 ? 3.367   55.986 30.503  1.00 24.73 ? 399 LEU B CD2   1 
ATOM   6398 N  N     . GLY B 1 400 ? 1.450   53.207 26.113  1.00 15.38 ? 400 GLY B N     1 
ATOM   6399 C  CA    . GLY B 1 400 ? 0.437   52.279 25.631  1.00 14.48 ? 400 GLY B CA    1 
ATOM   6400 C  C     . GLY B 1 400 ? 1.035   51.113 24.850  1.00 15.15 ? 400 GLY B C     1 
ATOM   6401 O  O     . GLY B 1 400 ? 0.696   49.952 25.094  1.00 14.96 ? 400 GLY B O     1 
ATOM   6402 N  N     . LYS B 1 401 ? 1.935   51.420 23.914  1.00 15.40 ? 401 LYS B N     1 
ATOM   6403 C  CA    . LYS B 1 401 ? 2.587   50.394 23.096  1.00 15.36 ? 401 LYS B CA    1 
ATOM   6404 C  C     . LYS B 1 401 ? 3.308   49.334 23.929  1.00 15.81 ? 401 LYS B C     1 
ATOM   6405 O  O     . LYS B 1 401 ? 3.394   48.179 23.526  1.00 16.23 ? 401 LYS B O     1 
ATOM   6406 C  CB    . LYS B 1 401 ? 3.584   51.056 22.134  1.00 15.45 ? 401 LYS B CB    1 
ATOM   6407 C  CG    . LYS B 1 401 ? 4.422   50.097 21.278  1.00 16.91 ? 401 LYS B CG    1 
ATOM   6408 C  CD    . LYS B 1 401 ? 3.590   49.297 20.290  1.00 17.65 ? 401 LYS B CD    1 
ATOM   6409 C  CE    . LYS B 1 401 ? 4.499   48.508 19.365  1.00 18.20 ? 401 LYS B CE    1 
ATOM   6410 N  NZ    . LYS B 1 401 ? 3.766   47.802 18.271  1.00 18.18 ? 401 LYS B NZ    1 
ATOM   6411 N  N     . LEU B 1 402 ? 3.838   49.725 25.085  1.00 19.98 ? 402 LEU B N     1 
ATOM   6412 C  CA    . LEU B 1 402 ? 4.556   48.786 25.940  1.00 19.58 ? 402 LEU B CA    1 
ATOM   6413 C  C     . LEU B 1 402 ? 3.624   48.306 27.026  1.00 20.65 ? 402 LEU B C     1 
ATOM   6414 O  O     . LEU B 1 402 ? 4.008   47.584 27.939  1.00 20.53 ? 402 LEU B O     1 
ATOM   6415 C  CB    . LEU B 1 402 ? 5.787   49.451 26.541  1.00 17.87 ? 402 LEU B CB    1 
ATOM   6416 C  CG    . LEU B 1 402 ? 6.715   50.015 25.465  1.00 17.32 ? 402 LEU B CG    1 
ATOM   6417 C  CD1   . LEU B 1 402 ? 7.967   50.583 26.114  1.00 17.73 ? 402 LEU B CD1   1 
ATOM   6418 C  CD2   . LEU B 1 402 ? 7.064   48.921 24.476  1.00 15.07 ? 402 LEU B CD2   1 
ATOM   6419 N  N     . ASN B 1 403 ? 2.378   48.730 26.908  1.00 22.51 ? 403 ASN B N     1 
ATOM   6420 C  CA    . ASN B 1 403 ? 1.337   48.344 27.832  1.00 23.16 ? 403 ASN B CA    1 
ATOM   6421 C  C     . ASN B 1 403 ? 1.652   48.656 29.281  1.00 23.13 ? 403 ASN B C     1 
ATOM   6422 O  O     . ASN B 1 403 ? 1.358   47.871 30.178  1.00 23.35 ? 403 ASN B O     1 
ATOM   6423 C  CB    . ASN B 1 403 ? 1.055   46.866 27.672  1.00 25.16 ? 403 ASN B CB    1 
ATOM   6424 C  CG    . ASN B 1 403 ? -0.403  46.553 27.849  1.00 29.51 ? 403 ASN B CG    1 
ATOM   6425 O  OD1   . ASN B 1 403 ? -0.986  46.808 28.919  1.00 31.48 ? 403 ASN B OD1   1 
ATOM   6426 N  ND2   . ASN B 1 403 ? -1.023  46.013 26.793  1.00 29.94 ? 403 ASN B ND2   1 
ATOM   6427 N  N     . VAL B 1 404 ? 2.250   49.816 29.503  1.00 22.84 ? 404 VAL B N     1 
ATOM   6428 C  CA    . VAL B 1 404 ? 2.589   50.262 30.839  1.00 23.08 ? 404 VAL B CA    1 
ATOM   6429 C  C     . VAL B 1 404 ? 1.374   50.977 31.435  1.00 24.66 ? 404 VAL B C     1 
ATOM   6430 O  O     . VAL B 1 404 ? 0.799   51.865 30.802  1.00 25.83 ? 404 VAL B O     1 
ATOM   6431 C  CB    . VAL B 1 404 ? 3.755   51.249 30.794  1.00 22.42 ? 404 VAL B CB    1 
ATOM   6432 C  CG1   . VAL B 1 404 ? 4.088   51.709 32.182  1.00 21.89 ? 404 VAL B CG1   1 
ATOM   6433 C  CG2   . VAL B 1 404 ? 4.952   50.600 30.140  1.00 22.72 ? 404 VAL B CG2   1 
ATOM   6434 N  N     . LYS B 1 405 ? 0.973   50.592 32.642  1.00 24.73 ? 405 LYS B N     1 
ATOM   6435 C  CA    . LYS B 1 405 ? -0.163  51.239 33.288  1.00 24.65 ? 405 LYS B CA    1 
ATOM   6436 C  C     . LYS B 1 405 ? 0.385   52.257 34.281  1.00 24.13 ? 405 LYS B C     1 
ATOM   6437 O  O     . LYS B 1 405 ? 0.925   51.893 35.324  1.00 24.22 ? 405 LYS B O     1 
ATOM   6438 C  CB    . LYS B 1 405 ? -1.019  50.198 33.997  1.00 26.10 ? 405 LYS B CB    1 
ATOM   6439 C  CG    . LYS B 1 405 ? -1.502  49.117 33.061  1.00 28.73 ? 405 LYS B CG    1 
ATOM   6440 C  CD    . LYS B 1 405 ? -2.160  47.996 33.834  1.00 31.84 ? 405 LYS B CD    1 
ATOM   6441 C  CE    . LYS B 1 405 ? -2.472  46.806 32.937  1.00 32.97 ? 405 LYS B CE    1 
ATOM   6442 N  NZ    . LYS B 1 405 ? -3.066  45.689 33.728  1.00 35.30 ? 405 LYS B NZ    1 
ATOM   6443 N  N     . LEU B 1 406 ? 0.250   53.536 33.943  1.00 23.38 ? 406 LEU B N     1 
ATOM   6444 C  CA    . LEU B 1 406 ? 0.758   54.619 34.781  1.00 22.03 ? 406 LEU B CA    1 
ATOM   6445 C  C     . LEU B 1 406 ? -0.198  54.902 35.942  1.00 22.66 ? 406 LEU B C     1 
ATOM   6446 O  O     . LEU B 1 406 ? -1.411  54.697 35.829  1.00 23.55 ? 406 LEU B O     1 
ATOM   6447 C  CB    . LEU B 1 406 ? 0.962   55.883 33.920  1.00 19.87 ? 406 LEU B CB    1 
ATOM   6448 C  CG    . LEU B 1 406 ? 1.790   57.040 34.491  1.00 19.80 ? 406 LEU B CG    1 
ATOM   6449 C  CD1   . LEU B 1 406 ? 3.187   56.531 34.860  1.00 20.51 ? 406 LEU B CD1   1 
ATOM   6450 C  CD2   . LEU B 1 406 ? 1.904   58.168 33.478  1.00 18.83 ? 406 LEU B CD2   1 
ATOM   6451 N  N     . THR B 1 407 ? 0.349   55.356 37.064  1.00 22.11 ? 407 THR B N     1 
ATOM   6452 C  CA    . THR B 1 407 ? -0.464  55.667 38.229  1.00 22.43 ? 407 THR B CA    1 
ATOM   6453 C  C     . THR B 1 407 ? -0.863  57.140 38.211  1.00 23.19 ? 407 THR B C     1 
ATOM   6454 O  O     . THR B 1 407 ? -0.039  58.007 37.917  1.00 23.22 ? 407 THR B O     1 
ATOM   6455 C  CB    . THR B 1 407 ? 0.304   55.366 39.537  1.00 22.24 ? 407 THR B CB    1 
ATOM   6456 O  OG1   . THR B 1 407 ? 0.525   53.956 39.648  1.00 22.98 ? 407 THR B OG1   1 
ATOM   6457 C  CG2   . THR B 1 407 ? -0.479  55.837 40.745  1.00 21.96 ? 407 THR B CG2   1 
ATOM   6458 N  N     . LYS B 1 408 ? -2.129  57.423 38.510  1.00 24.23 ? 408 LYS B N     1 
ATOM   6459 C  CA    . LYS B 1 408 ? -2.605  58.806 38.530  1.00 25.72 ? 408 LYS B CA    1 
ATOM   6460 C  C     . LYS B 1 408 ? -2.604  59.361 39.938  1.00 27.04 ? 408 LYS B C     1 
ATOM   6461 O  O     . LYS B 1 408 ? -3.369  58.936 40.808  1.00 27.63 ? 408 LYS B O     1 
ATOM   6462 C  CB    . LYS B 1 408 ? -4.013  58.929 37.933  1.00 24.88 ? 408 LYS B CB    1 
ATOM   6463 C  CG    . LYS B 1 408 ? -4.045  59.528 36.530  1.00 22.78 ? 408 LYS B CG    1 
ATOM   6464 C  CD    . LYS B 1 408 ? -3.555  60.970 36.549  1.00 22.19 ? 408 LYS B CD    1 
ATOM   6465 C  CE    . LYS B 1 408 ? -3.658  61.597 35.173  1.00 21.94 ? 408 LYS B CE    1 
ATOM   6466 N  NZ    . LYS B 1 408 ? -3.304  63.036 35.207  1.00 21.48 ? 408 LYS B NZ    1 
ATOM   6467 N  N     . LEU B 1 409 ? -1.721  60.322 40.150  1.00 28.18 ? 409 LEU B N     1 
ATOM   6468 C  CA    . LEU B 1 409 ? -1.565  60.973 41.438  1.00 28.80 ? 409 LEU B CA    1 
ATOM   6469 C  C     . LEU B 1 409 ? -2.946  61.445 41.910  1.00 29.77 ? 409 LEU B C     1 
ATOM   6470 O  O     . LEU B 1 409 ? -3.637  62.156 41.179  1.00 31.72 ? 409 LEU B O     1 
ATOM   6471 C  CB    . LEU B 1 409 ? -0.624  62.148 41.226  1.00 29.03 ? 409 LEU B CB    1 
ATOM   6472 C  CG    . LEU B 1 409 ? 0.186   62.726 42.359  1.00 27.99 ? 409 LEU B CG    1 
ATOM   6473 C  CD1   . LEU B 1 409 ? 1.032   61.643 42.978  1.00 27.80 ? 409 LEU B CD1   1 
ATOM   6474 C  CD2   . LEU B 1 409 ? 1.060   63.826 41.784  1.00 28.63 ? 409 LEU B CD2   1 
ATOM   6475 N  N     . THR B 1 410 ? -3.366  61.049 43.110  1.00 29.76 ? 410 THR B N     1 
ATOM   6476 C  CA    . THR B 1 410 ? -4.681  61.469 43.612  1.00 29.55 ? 410 THR B CA    1 
ATOM   6477 C  C     . THR B 1 410 ? -4.671  62.943 43.983  1.00 30.84 ? 410 THR B C     1 
ATOM   6478 O  O     . THR B 1 410 ? -3.608  63.520 44.210  1.00 31.99 ? 410 THR B O     1 
ATOM   6479 C  CB    . THR B 1 410 ? -5.105  60.693 44.864  1.00 29.07 ? 410 THR B CB    1 
ATOM   6480 O  OG1   . THR B 1 410 ? -4.396  61.185 46.010  1.00 27.36 ? 410 THR B OG1   1 
ATOM   6481 C  CG2   . THR B 1 410 ? -4.799  59.222 44.686  1.00 29.37 ? 410 THR B CG2   1 
ATOM   6482 N  N     . GLU B 1 411 ? -5.856  63.543 44.061  1.00 31.65 ? 411 GLU B N     1 
ATOM   6483 C  CA    . GLU B 1 411 ? -5.991  64.962 44.397  1.00 31.97 ? 411 GLU B CA    1 
ATOM   6484 C  C     . GLU B 1 411 ? -5.252  65.229 45.707  1.00 31.29 ? 411 GLU B C     1 
ATOM   6485 O  O     . GLU B 1 411 ? -4.430  66.140 45.811  1.00 31.28 ? 411 GLU B O     1 
ATOM   6486 C  CB    . GLU B 1 411 ? -7.475  65.312 44.561  1.00 33.78 ? 411 GLU B CB    1 
ATOM   6487 C  CG    . GLU B 1 411 ? -7.878  66.701 44.078  1.00 36.39 ? 411 GLU B CG    1 
ATOM   6488 C  CD    . GLU B 1 411 ? -7.096  67.817 44.744  1.00 39.04 ? 411 GLU B CD    1 
ATOM   6489 O  OE1   . GLU B 1 411 ? -5.860  67.896 44.545  1.00 40.04 ? 411 GLU B OE1   1 
ATOM   6490 O  OE2   . GLU B 1 411 ? -7.725  68.619 45.469  1.00 40.36 ? 411 GLU B OE2   1 
ATOM   6491 N  N     . LYS B 1 412 ? -5.548  64.398 46.697  1.00 30.80 ? 412 LYS B N     1 
ATOM   6492 C  CA    . LYS B 1 412 ? -4.952  64.487 48.026  1.00 30.37 ? 412 LYS B CA    1 
ATOM   6493 C  C     . LYS B 1 412 ? -3.415  64.451 47.937  1.00 29.53 ? 412 LYS B C     1 
ATOM   6494 O  O     . LYS B 1 412 ? -2.726  65.247 48.581  1.00 30.32 ? 412 LYS B O     1 
ATOM   6495 C  CB    . LYS B 1 412 ? -5.482  63.316 48.864  1.00 30.99 ? 412 LYS B CB    1 
ATOM   6496 C  CG    . LYS B 1 412 ? -5.466  63.492 50.374  1.00 30.97 ? 412 LYS B CG    1 
ATOM   6497 C  CD    . LYS B 1 412 ? -4.077  63.586 50.968  1.00 31.11 ? 412 LYS B CD    1 
ATOM   6498 C  CE    . LYS B 1 412 ? -4.159  63.575 52.498  1.00 30.66 ? 412 LYS B CE    1 
ATOM   6499 N  NZ    . LYS B 1 412 ? -4.844  62.341 53.005  1.00 29.08 ? 412 LYS B NZ    1 
ATOM   6500 N  N     . GLN B 1 413 ? -2.888  63.528 47.135  1.00 27.86 ? 413 GLN B N     1 
ATOM   6501 C  CA    . GLN B 1 413 ? -1.442  63.386 46.951  1.00 26.20 ? 413 GLN B CA    1 
ATOM   6502 C  C     . GLN B 1 413 ? -0.813  64.533 46.175  1.00 26.51 ? 413 GLN B C     1 
ATOM   6503 O  O     . GLN B 1 413 ? 0.229   65.059 46.565  1.00 27.03 ? 413 GLN B O     1 
ATOM   6504 C  CB    . GLN B 1 413 ? -1.130  62.088 46.221  1.00 24.36 ? 413 GLN B CB    1 
ATOM   6505 C  CG    . GLN B 1 413 ? -1.178  60.853 47.075  1.00 22.51 ? 413 GLN B CG    1 
ATOM   6506 C  CD    . GLN B 1 413 ? -1.193  59.590 46.231  1.00 22.16 ? 413 GLN B CD    1 
ATOM   6507 O  OE1   . GLN B 1 413 ? -0.850  58.500 46.705  1.00 21.58 ? 413 GLN B OE1   1 
ATOM   6508 N  NE2   . GLN B 1 413 ? -1.621  59.727 44.976  1.00 22.00 ? 413 GLN B NE2   1 
ATOM   6509 N  N     . ALA B 1 414 ? -1.438  64.909 45.065  1.00 26.93 ? 414 ALA B N     1 
ATOM   6510 C  CA    . ALA B 1 414 ? -0.924  65.992 44.237  1.00 26.81 ? 414 ALA B CA    1 
ATOM   6511 C  C     . ALA B 1 414 ? -0.663  67.233 45.080  1.00 27.43 ? 414 ALA B C     1 
ATOM   6512 O  O     . ALA B 1 414 ? 0.308   67.959 44.857  1.00 26.08 ? 414 ALA B O     1 
ATOM   6513 C  CB    . ALA B 1 414 ? -1.912  66.311 43.123  1.00 26.37 ? 414 ALA B CB    1 
ATOM   6514 N  N     . GLN B 1 415 ? -1.527  67.474 46.059  1.00 28.59 ? 415 GLN B N     1 
ATOM   6515 C  CA    . GLN B 1 415 ? -1.361  68.643 46.905  1.00 29.88 ? 415 GLN B CA    1 
ATOM   6516 C  C     . GLN B 1 415 ? -0.196  68.464 47.855  1.00 29.69 ? 415 GLN B C     1 
ATOM   6517 O  O     . GLN B 1 415 ? 0.636   69.363 48.015  1.00 30.65 ? 415 GLN B O     1 
ATOM   6518 C  CB    . GLN B 1 415 ? -2.640  68.923 47.686  1.00 30.83 ? 415 GLN B CB    1 
ATOM   6519 C  CG    . GLN B 1 415 ? -3.829  69.158 46.780  1.00 33.23 ? 415 GLN B CG    1 
ATOM   6520 C  CD    . GLN B 1 415 ? -4.790  70.156 47.365  1.00 34.76 ? 415 GLN B CD    1 
ATOM   6521 O  OE1   . GLN B 1 415 ? -4.413  71.305 47.626  1.00 35.63 ? 415 GLN B OE1   1 
ATOM   6522 N  NE2   . GLN B 1 415 ? -6.038  69.737 47.577  1.00 34.58 ? 415 GLN B NE2   1 
ATOM   6523 N  N     . TYR B 1 416 ? -0.136  67.302 48.492  1.00 28.40 ? 416 TYR B N     1 
ATOM   6524 C  CA    . TYR B 1 416 ? 0.958   67.011 49.406  1.00 26.76 ? 416 TYR B CA    1 
ATOM   6525 C  C     . TYR B 1 416 ? 2.275   67.279 48.678  1.00 26.05 ? 416 TYR B C     1 
ATOM   6526 O  O     . TYR B 1 416 ? 3.161   67.969 49.185  1.00 26.61 ? 416 TYR B O     1 
ATOM   6527 C  CB    . TYR B 1 416 ? 0.913   65.552 49.799  1.00 26.05 ? 416 TYR B CB    1 
ATOM   6528 C  CG    . TYR B 1 416 ? 1.964   65.162 50.799  1.00 25.74 ? 416 TYR B CG    1 
ATOM   6529 C  CD1   . TYR B 1 416 ? 1.826   65.488 52.147  1.00 24.00 ? 416 TYR B CD1   1 
ATOM   6530 C  CD2   . TYR B 1 416 ? 3.079   64.420 50.409  1.00 25.21 ? 416 TYR B CD2   1 
ATOM   6531 C  CE1   . TYR B 1 416 ? 2.765   65.073 53.085  1.00 22.97 ? 416 TYR B CE1   1 
ATOM   6532 C  CE2   . TYR B 1 416 ? 4.023   64.002 51.341  1.00 23.53 ? 416 TYR B CE2   1 
ATOM   6533 C  CZ    . TYR B 1 416 ? 3.857   64.325 52.675  1.00 23.01 ? 416 TYR B CZ    1 
ATOM   6534 O  OH    . TYR B 1 416 ? 4.762   63.863 53.605  1.00 23.37 ? 416 TYR B OH    1 
ATOM   6535 N  N     . LEU B 1 417 ? 2.388   66.723 47.477  1.00 24.62 ? 417 LEU B N     1 
ATOM   6536 C  CA    . LEU B 1 417 ? 3.580   66.884 46.663  1.00 23.83 ? 417 LEU B CA    1 
ATOM   6537 C  C     . LEU B 1 417 ? 3.702   68.281 46.073  1.00 24.21 ? 417 LEU B C     1 
ATOM   6538 O  O     . LEU B 1 417 ? 4.773   68.682 45.620  1.00 22.73 ? 417 LEU B O     1 
ATOM   6539 C  CB    . LEU B 1 417 ? 3.570   65.837 45.552  1.00 23.02 ? 417 LEU B CB    1 
ATOM   6540 C  CG    . LEU B 1 417 ? 3.696   64.433 46.143  1.00 21.94 ? 417 LEU B CG    1 
ATOM   6541 C  CD1   . LEU B 1 417 ? 3.449   63.374 45.090  1.00 20.95 ? 417 LEU B CD1   1 
ATOM   6542 C  CD2   . LEU B 1 417 ? 5.086   64.290 46.757  1.00 20.33 ? 417 LEU B CD2   1 
ATOM   6543 N  N     . GLY B 1 418 ? 2.597   69.021 46.084  1.00 25.15 ? 418 GLY B N     1 
ATOM   6544 C  CA    . GLY B 1 418 ? 2.601   70.370 45.543  1.00 25.89 ? 418 GLY B CA    1 
ATOM   6545 C  C     . GLY B 1 418 ? 2.842   70.417 44.047  1.00 26.25 ? 418 GLY B C     1 
ATOM   6546 O  O     . GLY B 1 418 ? 3.686   71.174 43.573  1.00 27.64 ? 418 GLY B O     1 
HETATM 6547 N  N     . MSE B 1 419 ? 2.102   69.605 43.299  1.00 26.19 ? 419 MSE B N     1 
HETATM 6548 C  CA    . MSE B 1 419 ? 2.240   69.561 41.846  1.00 25.93 ? 419 MSE B CA    1 
HETATM 6549 C  C     . MSE B 1 419 ? 0.931   69.135 41.186  1.00 24.92 ? 419 MSE B C     1 
HETATM 6550 O  O     . MSE B 1 419 ? 0.108   68.458 41.802  1.00 24.73 ? 419 MSE B O     1 
HETATM 6551 C  CB    . MSE B 1 419 ? 3.353   68.580 41.452  1.00 26.44 ? 419 MSE B CB    1 
HETATM 6552 C  CG    . MSE B 1 419 ? 3.154   67.155 41.991  1.00 27.56 ? 419 MSE B CG    1 
HETATM 6553 SE SE    . MSE B 1 419 ? 4.542   66.016 41.450  1.00 27.10 ? 419 MSE B SE    1 
HETATM 6554 C  CE    . MSE B 1 419 ? 3.969   64.498 42.255  1.00 27.04 ? 419 MSE B CE    1 
ATOM   6555 N  N     . SER B 1 420 ? 0.737   69.536 39.936  1.00 23.84 ? 420 SER B N     1 
ATOM   6556 C  CA    . SER B 1 420 ? -0.467  69.154 39.211  1.00 23.85 ? 420 SER B CA    1 
ATOM   6557 C  C     . SER B 1 420 ? -0.462  67.649 38.928  1.00 25.43 ? 420 SER B C     1 
ATOM   6558 O  O     . SER B 1 420 ? 0.555   67.088 38.503  1.00 26.43 ? 420 SER B O     1 
ATOM   6559 C  CB    . SER B 1 420 ? -0.558  69.900 37.885  1.00 20.82 ? 420 SER B CB    1 
ATOM   6560 O  OG    . SER B 1 420 ? -1.546  69.306 37.064  1.00 17.78 ? 420 SER B OG    1 
ATOM   6561 N  N     . CYS B 1 421 ? -1.594  66.993 39.156  1.00 25.65 ? 421 CYS B N     1 
ATOM   6562 C  CA    . CYS B 1 421 ? -1.672  65.563 38.897  1.00 26.90 ? 421 CYS B CA    1 
ATOM   6563 C  C     . CYS B 1 421 ? -1.494  65.335 37.396  1.00 26.05 ? 421 CYS B C     1 
ATOM   6564 O  O     . CYS B 1 421 ? -1.514  64.195 36.929  1.00 25.18 ? 421 CYS B O     1 
ATOM   6565 C  CB    . CYS B 1 421 ? -3.026  65.010 39.354  1.00 28.73 ? 421 CYS B CB    1 
ATOM   6566 S  SG    . CYS B 1 421 ? -4.428  65.701 38.453  1.00 33.46 ? 421 CYS B SG    1 
ATOM   6567 N  N     . ASP B 1 422 ? -1.321  66.436 36.662  1.00 26.55 ? 422 ASP B N     1 
ATOM   6568 C  CA    . ASP B 1 422 ? -1.134  66.432 35.206  1.00 27.34 ? 422 ASP B CA    1 
ATOM   6569 C  C     . ASP B 1 422 ? 0.168   67.129 34.821  1.00 27.79 ? 422 ASP B C     1 
ATOM   6570 O  O     . ASP B 1 422 ? 1.026   66.558 34.143  1.00 27.69 ? 422 ASP B O     1 
ATOM   6571 C  CB    . ASP B 1 422 ? -2.279  67.184 34.509  1.00 27.26 ? 422 ASP B CB    1 
ATOM   6572 C  CG    . ASP B 1 422 ? -3.560  66.388 34.432  1.00 27.36 ? 422 ASP B CG    1 
ATOM   6573 O  OD1   . ASP B 1 422 ? -4.009  65.826 35.452  1.00 28.29 ? 422 ASP B OD1   1 
ATOM   6574 O  OD2   . ASP B 1 422 ? -4.138  66.347 33.333  1.00 28.61 ? 422 ASP B OD2   1 
ATOM   6575 N  N     . GLY B 1 423 ? 0.273   68.388 35.242  1.00 28.93 ? 423 GLY B N     1 
ATOM   6576 C  CA    . GLY B 1 423 ? 1.428   69.220 34.946  1.00 27.77 ? 423 GLY B CA    1 
ATOM   6577 C  C     . GLY B 1 423 ? 2.739   68.569 35.310  1.00 26.99 ? 423 GLY B C     1 
ATOM   6578 O  O     . GLY B 1 423 ? 2.758   67.445 35.819  1.00 28.46 ? 423 GLY B O     1 
ATOM   6579 N  N     . PRO B 1 424 ? 3.856   69.276 35.097  1.00 25.10 ? 424 PRO B N     1 
ATOM   6580 C  CA    . PRO B 1 424 ? 5.228   68.848 35.365  1.00 23.08 ? 424 PRO B CA    1 
ATOM   6581 C  C     . PRO B 1 424 ? 5.356   68.070 36.655  1.00 21.51 ? 424 PRO B C     1 
ATOM   6582 O  O     . PRO B 1 424 ? 4.841   68.491 37.690  1.00 21.67 ? 424 PRO B O     1 
ATOM   6583 C  CB    . PRO B 1 424 ? 5.972   70.171 35.410  1.00 23.80 ? 424 PRO B CB    1 
ATOM   6584 C  CG    . PRO B 1 424 ? 5.312   70.892 34.274  1.00 25.60 ? 424 PRO B CG    1 
ATOM   6585 C  CD    . PRO B 1 424 ? 3.850   70.680 34.654  1.00 25.81 ? 424 PRO B CD    1 
ATOM   6586 N  N     . PHE B 1 425 ? 6.049   66.936 36.598  1.00 19.66 ? 425 PHE B N     1 
ATOM   6587 C  CA    . PHE B 1 425 ? 6.221   66.114 37.786  1.00 17.76 ? 425 PHE B CA    1 
ATOM   6588 C  C     . PHE B 1 425 ? 7.556   66.285 38.473  1.00 16.20 ? 425 PHE B C     1 
ATOM   6589 O  O     . PHE B 1 425 ? 7.784   65.700 39.528  1.00 14.77 ? 425 PHE B O     1 
ATOM   6590 C  CB    . PHE B 1 425 ? 6.028   64.640 37.449  1.00 18.15 ? 425 PHE B CB    1 
ATOM   6591 C  CG    . PHE B 1 425 ? 4.662   64.318 36.947  1.00 19.03 ? 425 PHE B CG    1 
ATOM   6592 C  CD1   . PHE B 1 425 ? 3.565   64.395 37.799  1.00 18.69 ? 425 PHE B CD1   1 
ATOM   6593 C  CD2   . PHE B 1 425 ? 4.458   63.970 35.617  1.00 19.15 ? 425 PHE B CD2   1 
ATOM   6594 C  CE1   . PHE B 1 425 ? 2.285   64.131 37.333  1.00 17.81 ? 425 PHE B CE1   1 
ATOM   6595 C  CE2   . PHE B 1 425 ? 3.179   63.702 35.144  1.00 19.20 ? 425 PHE B CE2   1 
ATOM   6596 C  CZ    . PHE B 1 425 ? 2.091   63.784 36.005  1.00 18.27 ? 425 PHE B CZ    1 
ATOM   6597 N  N     . LYS B 1 426 ? 8.440   67.081 37.889  1.00 15.67 ? 426 LYS B N     1 
ATOM   6598 C  CA    . LYS B 1 426 ? 9.751   67.279 38.490  1.00 15.15 ? 426 LYS B CA    1 
ATOM   6599 C  C     . LYS B 1 426 ? 10.401  68.605 38.157  1.00 15.25 ? 426 LYS B C     1 
ATOM   6600 O  O     . LYS B 1 426 ? 10.059  69.238 37.153  1.00 16.50 ? 426 LYS B O     1 
ATOM   6601 C  CB    . LYS B 1 426 ? 10.673  66.121 38.104  1.00 14.42 ? 426 LYS B CB    1 
ATOM   6602 C  CG    . LYS B 1 426 ? 10.230  64.831 38.760  1.00 13.30 ? 426 LYS B CG    1 
ATOM   6603 C  CD    . LYS B 1 426 ? 11.141  63.690 38.484  1.00 13.38 ? 426 LYS B CD    1 
ATOM   6604 C  CE    . LYS B 1 426 ? 10.712  62.465 39.257  1.00 12.22 ? 426 LYS B CE    1 
ATOM   6605 N  NZ    . LYS B 1 426 ? 9.335   62.079 38.879  1.00 14.22 ? 426 LYS B NZ    1 
ATOM   6606 N  N     . PRO B 1 427 ? 11.352  69.047 39.005  1.00 14.53 ? 427 PRO B N     1 
ATOM   6607 C  CA    . PRO B 1 427 ? 12.108  70.301 38.880  1.00 13.96 ? 427 PRO B CA    1 
ATOM   6608 C  C     . PRO B 1 427 ? 12.944  70.339 37.609  1.00 14.20 ? 427 PRO B C     1 
ATOM   6609 O  O     . PRO B 1 427 ? 13.386  69.296 37.128  1.00 13.82 ? 427 PRO B O     1 
ATOM   6610 C  CB    . PRO B 1 427 ? 12.985  70.285 40.124  1.00 13.87 ? 427 PRO B CB    1 
ATOM   6611 C  CG    . PRO B 1 427 ? 12.161  69.463 41.096  1.00 14.75 ? 427 PRO B CG    1 
ATOM   6612 C  CD    . PRO B 1 427 ? 11.807  68.321 40.199  1.00 13.50 ? 427 PRO B CD    1 
ATOM   6613 N  N     . ASP B 1 428 ? 13.178  71.532 37.068  1.00 15.34 ? 428 ASP B N     1 
ATOM   6614 C  CA    . ASP B 1 428 ? 13.974  71.624 35.851  1.00 16.95 ? 428 ASP B CA    1 
ATOM   6615 C  C     . ASP B 1 428 ? 15.324  70.944 35.996  1.00 16.49 ? 428 ASP B C     1 
ATOM   6616 O  O     . ASP B 1 428 ? 15.858  70.439 35.016  1.00 18.38 ? 428 ASP B O     1 
ATOM   6617 C  CB    . ASP B 1 428 ? 14.218  73.072 35.445  1.00 19.09 ? 428 ASP B CB    1 
ATOM   6618 C  CG    . ASP B 1 428 ? 12.941  73.818 35.165  1.00 21.83 ? 428 ASP B CG    1 
ATOM   6619 O  OD1   . ASP B 1 428 ? 12.058  73.252 34.475  1.00 22.35 ? 428 ASP B OD1   1 
ATOM   6620 O  OD2   . ASP B 1 428 ? 12.836  74.980 35.621  1.00 23.61 ? 428 ASP B OD2   1 
ATOM   6621 N  N     . HIS B 1 429 ? 15.875  70.925 37.207  1.00 14.88 ? 429 HIS B N     1 
ATOM   6622 C  CA    . HIS B 1 429 ? 17.177  70.313 37.415  1.00 13.23 ? 429 HIS B CA    1 
ATOM   6623 C  C     . HIS B 1 429 ? 17.147  68.814 37.620  1.00 12.76 ? 429 HIS B C     1 
ATOM   6624 O  O     . HIS B 1 429 ? 18.207  68.188 37.721  1.00 13.77 ? 429 HIS B O     1 
ATOM   6625 C  CB    . HIS B 1 429 ? 17.890  70.935 38.611  1.00 14.76 ? 429 HIS B CB    1 
ATOM   6626 C  CG    . HIS B 1 429 ? 17.140  70.805 39.899  1.00 16.68 ? 429 HIS B CG    1 
ATOM   6627 N  ND1   . HIS B 1 429 ? 16.126  71.664 40.262  1.00 17.57 ? 429 HIS B ND1   1 
ATOM   6628 C  CD2   . HIS B 1 429 ? 17.241  69.896 40.899  1.00 17.04 ? 429 HIS B CD2   1 
ATOM   6629 C  CE1   . HIS B 1 429 ? 15.636  71.292 41.433  1.00 18.18 ? 429 HIS B CE1   1 
ATOM   6630 N  NE2   . HIS B 1 429 ? 16.294  70.221 41.841  1.00 17.47 ? 429 HIS B NE2   1 
ATOM   6631 N  N     . TYR B 1 430 ? 15.959  68.221 37.681  1.00 11.00 ? 430 TYR B N     1 
ATOM   6632 C  CA    . TYR B 1 430 ? 15.895  66.781 37.894  1.00 10.26 ? 430 TYR B CA    1 
ATOM   6633 C  C     . TYR B 1 430 ? 16.723  66.091 36.835  1.00 9.77  ? 430 TYR B C     1 
ATOM   6634 O  O     . TYR B 1 430 ? 16.638  66.447 35.667  1.00 10.37 ? 430 TYR B O     1 
ATOM   6635 C  CB    . TYR B 1 430 ? 14.467  66.255 37.819  1.00 9.20  ? 430 TYR B CB    1 
ATOM   6636 C  CG    . TYR B 1 430 ? 14.364  64.849 38.366  1.00 8.84  ? 430 TYR B CG    1 
ATOM   6637 C  CD1   . TYR B 1 430 ? 14.594  64.597 39.716  1.00 8.27  ? 430 TYR B CD1   1 
ATOM   6638 C  CD2   . TYR B 1 430 ? 14.060  63.770 37.539  1.00 8.27  ? 430 TYR B CD2   1 
ATOM   6639 C  CE1   . TYR B 1 430 ? 14.517  63.320 40.230  1.00 7.95  ? 430 TYR B CE1   1 
ATOM   6640 C  CE2   . TYR B 1 430 ? 13.981  62.481 38.049  1.00 7.43  ? 430 TYR B CE2   1 
ATOM   6641 C  CZ    . TYR B 1 430 ? 14.208  62.268 39.392  1.00 8.01  ? 430 TYR B CZ    1 
ATOM   6642 O  OH    . TYR B 1 430 ? 14.111  61.000 39.914  1.00 10.38 ? 430 TYR B OH    1 
ATOM   6643 N  N     . ARG B 1 431 ? 17.513  65.097 37.234  1.00 10.17 ? 431 ARG B N     1 
ATOM   6644 C  CA    . ARG B 1 431 ? 18.375  64.410 36.279  1.00 10.33 ? 431 ARG B CA    1 
ATOM   6645 C  C     . ARG B 1 431 ? 17.948  63.019 35.848  1.00 10.24 ? 431 ARG B C     1 
ATOM   6646 O  O     . ARG B 1 431 ? 18.687  62.352 35.117  1.00 9.97  ? 431 ARG B O     1 
ATOM   6647 C  CB    . ARG B 1 431 ? 19.803  64.327 36.819  1.00 9.76  ? 431 ARG B CB    1 
ATOM   6648 C  CG    . ARG B 1 431 ? 20.475  65.665 37.047  1.00 9.16  ? 431 ARG B CG    1 
ATOM   6649 C  CD    . ARG B 1 431 ? 21.987  65.452 37.264  1.00 11.03 ? 431 ARG B CD    1 
ATOM   6650 N  NE    . ARG B 1 431 ? 22.715  66.716 37.397  1.00 9.32  ? 431 ARG B NE    1 
ATOM   6651 C  CZ    . ARG B 1 431 ? 22.660  67.501 38.466  1.00 8.94  ? 431 ARG B CZ    1 
ATOM   6652 N  NH1   . ARG B 1 431 ? 21.916  67.161 39.510  1.00 11.34 ? 431 ARG B NH1   1 
ATOM   6653 N  NH2   . ARG B 1 431 ? 23.332  68.640 38.484  1.00 9.00  ? 431 ARG B NH2   1 
ATOM   6654 N  N     . TYR B 1 432 ? 16.777  62.576 36.299  1.00 10.56 ? 432 TYR B N     1 
ATOM   6655 C  CA    . TYR B 1 432 ? 16.259  61.251 35.949  1.00 10.99 ? 432 TYR B CA    1 
ATOM   6656 C  C     . TYR B 1 432 ? 17.327  60.155 36.032  1.00 12.43 ? 432 TYR B C     1 
ATOM   6657 O  O     . TYR B 1 432 ? 18.363  60.396 36.692  1.00 12.27 ? 432 TYR B O     1 
ATOM   6658 C  CB    . TYR B 1 432 ? 15.630  61.259 34.545  1.00 10.17 ? 432 TYR B CB    1 
ATOM   6659 C  CG    . TYR B 1 432 ? 14.516  62.287 34.367  1.00 11.20 ? 432 TYR B CG    1 
ATOM   6660 C  CD1   . TYR B 1 432 ? 14.807  63.611 34.043  1.00 10.06 ? 432 TYR B CD1   1 
ATOM   6661 C  CD2   . TYR B 1 432 ? 13.173  61.942 34.575  1.00 11.69 ? 432 TYR B CD2   1 
ATOM   6662 C  CE1   . TYR B 1 432 ? 13.795  64.569 33.932  1.00 10.51 ? 432 TYR B CE1   1 
ATOM   6663 C  CE2   . TYR B 1 432 ? 12.157  62.890 34.468  1.00 10.64 ? 432 TYR B CE2   1 
ATOM   6664 C  CZ    . TYR B 1 432 ? 12.476  64.202 34.149  1.00 11.71 ? 432 TYR B CZ    1 
ATOM   6665 O  OH    . TYR B 1 432 ? 11.484  65.159 34.054  1.00 12.99 ? 432 TYR B OH    1 
ATOM   6666 O  OXT   . TYR B 1 432 ? 17.106  59.054 35.460  1.00 13.28 ? 432 TYR B OXT   1 
HETATM 6667 P  PA    . NAD C 2 .   ? 12.420  60.924 43.195  1.00 14.32 ? 433 NAD A PA    1 
HETATM 6668 O  O1A   . NAD C 2 .   ? 13.460  60.051 42.606  1.00 13.76 ? 433 NAD A O1A   1 
HETATM 6669 O  O2A   . NAD C 2 .   ? 12.390  62.454 43.356  1.00 13.81 ? 433 NAD A O2A   1 
HETATM 6670 O  O5B   . NAD C 2 .   ? 11.529  60.115 44.247  1.00 14.97 ? 433 NAD A O5B   1 
HETATM 6671 C  C5B   . NAD C 2 .   ? 10.152  59.517 44.052  1.00 15.47 ? 433 NAD A C5B   1 
HETATM 6672 C  C4B   . NAD C 2 .   ? 9.838   58.986 42.729  1.00 15.26 ? 433 NAD A C4B   1 
HETATM 6673 O  O4B   . NAD C 2 .   ? 8.553   58.301 42.868  1.00 16.54 ? 433 NAD A O4B   1 
HETATM 6674 C  C3B   . NAD C 2 .   ? 9.608   59.998 41.556  1.00 15.92 ? 433 NAD A C3B   1 
HETATM 6675 O  O3B   . NAD C 2 .   ? 10.358  59.511 40.390  1.00 19.70 ? 433 NAD A O3B   1 
HETATM 6676 C  C2B   . NAD C 2 .   ? 8.125   60.082 41.287  1.00 15.80 ? 433 NAD A C2B   1 
HETATM 6677 O  O2B   . NAD C 2 .   ? 7.713   60.273 39.998  1.00 13.68 ? 433 NAD A O2B   1 
HETATM 6678 C  C1B   . NAD C 2 .   ? 7.636   58.773 41.972  1.00 16.26 ? 433 NAD A C1B   1 
HETATM 6679 N  N9A   . NAD C 2 .   ? 6.410   58.935 42.717  1.00 16.35 ? 433 NAD A N9A   1 
HETATM 6680 C  C8A   . NAD C 2 .   ? 5.918   60.001 43.445  1.00 15.48 ? 433 NAD A C8A   1 
HETATM 6681 N  N7A   . NAD C 2 .   ? 4.738   59.811 44.008  1.00 15.68 ? 433 NAD A N7A   1 
HETATM 6682 C  C5A   . NAD C 2 .   ? 4.370   58.532 43.665  1.00 16.00 ? 433 NAD A C5A   1 
HETATM 6683 C  C6A   . NAD C 2 .   ? 3.122   57.714 44.006  1.00 16.03 ? 433 NAD A C6A   1 
HETATM 6684 N  N6A   . NAD C 2 .   ? 2.109   58.116 44.733  1.00 16.22 ? 433 NAD A N6A   1 
HETATM 6685 N  N1A   . NAD C 2 .   ? 3.141   56.411 43.440  1.00 16.03 ? 433 NAD A N1A   1 
HETATM 6686 C  C2A   . NAD C 2 .   ? 4.111   55.894 42.688  1.00 17.09 ? 433 NAD A C2A   1 
HETATM 6687 N  N3A   . NAD C 2 .   ? 5.292   56.637 42.354  1.00 15.85 ? 433 NAD A N3A   1 
HETATM 6688 C  C4A   . NAD C 2 .   ? 5.383   57.971 42.870  1.00 15.96 ? 433 NAD A C4A   1 
HETATM 6689 O  O3    . NAD C 2 .   ? 13.402  61.041 44.498  1.00 14.74 ? 433 NAD A O3    1 
HETATM 6690 P  PN    . NAD C 2 .   ? 14.646  60.200 45.257  1.00 13.47 ? 433 NAD A PN    1 
HETATM 6691 O  O1N   . NAD C 2 .   ? 14.995  58.956 44.667  1.00 14.37 ? 433 NAD A O1N   1 
HETATM 6692 O  O2N   . NAD C 2 .   ? 14.961  60.701 46.634  1.00 15.69 ? 433 NAD A O2N   1 
HETATM 6693 O  O5D   . NAD C 2 .   ? 13.589  59.319 46.143  1.00 13.64 ? 433 NAD A O5D   1 
HETATM 6694 C  C5D   . NAD C 2 .   ? 12.529  59.848 47.017  1.00 15.63 ? 433 NAD A C5D   1 
HETATM 6695 C  C4D   . NAD C 2 .   ? 12.591  59.590 48.498  1.00 16.85 ? 433 NAD A C4D   1 
HETATM 6696 O  O4D   . NAD C 2 .   ? 13.811  58.804 48.948  1.00 16.72 ? 433 NAD A O4D   1 
HETATM 6697 C  C3D   . NAD C 2 .   ? 12.633  60.820 49.511  1.00 18.60 ? 433 NAD A C3D   1 
HETATM 6698 O  O3D   . NAD C 2 .   ? 11.785  60.444 50.522  1.00 21.48 ? 433 NAD A O3D   1 
HETATM 6699 C  C2D   . NAD C 2 .   ? 14.103  60.933 49.941  1.00 18.77 ? 433 NAD A C2D   1 
HETATM 6700 O  O2D   . NAD C 2 .   ? 14.250  61.674 51.105  1.00 20.32 ? 433 NAD A O2D   1 
HETATM 6701 C  C1D   . NAD C 2 .   ? 14.387  59.459 50.073  1.00 17.79 ? 433 NAD A C1D   1 
HETATM 6702 N  N1N   . NAD C 2 .   ? 15.847  59.043 50.211  1.00 16.89 ? 433 NAD A N1N   1 
HETATM 6703 C  C2N   . NAD C 2 .   ? 16.175  58.008 51.138  1.00 17.04 ? 433 NAD A C2N   1 
HETATM 6704 C  C3N   . NAD C 2 .   ? 17.524  57.700 51.185  1.00 16.10 ? 433 NAD A C3N   1 
HETATM 6705 C  C7N   . NAD C 2 .   ? 17.801  56.516 52.261  1.00 16.54 ? 433 NAD A C7N   1 
HETATM 6706 O  O7N   . NAD C 2 .   ? 18.975  56.144 52.409  1.00 17.62 ? 433 NAD A O7N   1 
HETATM 6707 N  N7N   . NAD C 2 .   ? 16.705  55.984 52.964  1.00 16.95 ? 433 NAD A N7N   1 
HETATM 6708 C  C4N   . NAD C 2 .   ? 18.537  58.224 50.324  1.00 15.03 ? 433 NAD A C4N   1 
HETATM 6709 C  C5N   . NAD C 2 .   ? 18.086  59.355 49.514  1.00 15.80 ? 433 NAD A C5N   1 
HETATM 6710 C  C6N   . NAD C 2 .   ? 16.741  59.724 49.405  1.00 15.26 ? 433 NAD A C6N   1 
HETATM 6711 C  "C5'" . ADC D 3 .   ? 19.451  59.077 54.675  1.00 16.93 ? 435 ADC A "C5'" 1 
HETATM 6712 C  "C4'" . ADC D 3 .   ? 18.792  59.881 53.783  1.00 17.93 ? 435 ADC A "C4'" 1 
HETATM 6713 C  "C3'" . ADC D 3 .   ? 19.746  60.535 52.860  1.00 17.47 ? 435 ADC A "C3'" 1 
HETATM 6714 O  "O3'" . ADC D 3 .   ? 19.486  61.190 51.874  1.00 15.31 ? 435 ADC A "O3'" 1 
HETATM 6715 C  "C2'" . ADC D 3 .   ? 21.014  59.702 52.988  1.00 17.28 ? 435 ADC A "C2'" 1 
HETATM 6716 O  "O2'" . ADC D 3 .   ? 22.118  60.569 52.776  1.00 15.96 ? 435 ADC A "O2'" 1 
HETATM 6717 C  "C1'" . ADC D 3 .   ? 20.947  59.114 54.455  1.00 16.71 ? 435 ADC A "C1'" 1 
HETATM 6718 N  N9    . ADC D 3 .   ? 21.808  58.038 54.961  1.00 16.13 ? 435 ADC A N9    1 
HETATM 6719 C  C8    . ADC D 3 .   ? 21.887  56.741 54.525  1.00 16.02 ? 435 ADC A C8    1 
HETATM 6720 N  N7    . ADC D 3 .   ? 22.795  56.048 55.158  1.00 15.14 ? 435 ADC A N7    1 
HETATM 6721 C  C5    . ADC D 3 .   ? 23.371  56.905 56.083  1.00 13.97 ? 435 ADC A C5    1 
HETATM 6722 C  C6    . ADC D 3 .   ? 24.402  56.776 57.054  1.00 14.12 ? 435 ADC A C6    1 
HETATM 6723 N  N6    . ADC D 3 .   ? 25.078  55.614 57.248  1.00 13.40 ? 435 ADC A N6    1 
HETATM 6724 N  N1    . ADC D 3 .   ? 24.689  57.891 57.795  1.00 13.23 ? 435 ADC A N1    1 
HETATM 6725 C  C2    . ADC D 3 .   ? 24.025  59.040 57.603  1.00 14.74 ? 435 ADC A C2    1 
HETATM 6726 N  N3    . ADC D 3 .   ? 23.033  59.299 56.718  1.00 14.13 ? 435 ADC A N3    1 
HETATM 6727 C  C4    . ADC D 3 .   ? 22.731  58.182 55.959  1.00 14.87 ? 435 ADC A C4    1 
HETATM 6728 P  PA    . NAD E 2 .   ? 28.875  62.823 26.689  1.00 17.26 ? 434 NAD B PA    1 
HETATM 6729 O  O1A   . NAD E 2 .   ? 28.061  61.738 27.297  1.00 17.75 ? 434 NAD B O1A   1 
HETATM 6730 O  O2A   . NAD E 2 .   ? 28.570  64.310 26.505  1.00 16.43 ? 434 NAD B O2A   1 
HETATM 6731 O  O5B   . NAD E 2 .   ? 29.907  62.232 25.648  1.00 15.50 ? 434 NAD B O5B   1 
HETATM 6732 C  C5B   . NAD E 2 .   ? 31.369  61.972 25.848  1.00 17.36 ? 434 NAD B C5B   1 
HETATM 6733 C  C4B   . NAD E 2 .   ? 31.781  61.545 27.180  1.00 19.20 ? 434 NAD B C4B   1 
HETATM 6734 O  O4B   . NAD E 2 .   ? 33.200  61.186 27.057  1.00 20.25 ? 434 NAD B O4B   1 
HETATM 6735 C  C3B   . NAD E 2 .   ? 31.746  62.599 28.347  1.00 19.97 ? 434 NAD B C3B   1 
HETATM 6736 O  O3B   . NAD E 2 .   ? 31.104  61.973 29.514  1.00 22.30 ? 434 NAD B O3B   1 
HETATM 6737 C  C2B   . NAD E 2 .   ? 33.166  63.029 28.636  1.00 19.69 ? 434 NAD B C2B   1 
HETATM 6738 O  O2B   . NAD E 2 .   ? 33.497  63.305 29.940  1.00 18.01 ? 434 NAD B O2B   1 
HETATM 6739 C  C1B   . NAD E 2 .   ? 33.960  61.868 27.958  1.00 19.73 ? 434 NAD B C1B   1 
HETATM 6740 N  N9A   . NAD E 2 .   ? 35.109  62.307 27.228  1.00 21.30 ? 434 NAD B N9A   1 
HETATM 6741 C  C8A   . NAD E 2 .   ? 35.341  63.454 26.495  1.00 20.49 ? 434 NAD B C8A   1 
HETATM 6742 N  N7A   . NAD E 2 .   ? 36.532  63.536 25.946  1.00 21.03 ? 434 NAD B N7A   1 
HETATM 6743 C  C5A   . NAD E 2 .   ? 37.187  62.377 26.300  1.00 21.73 ? 434 NAD B C5A   1 
HETATM 6744 C  C6A   . NAD E 2 .   ? 38.599  61.862 25.978  1.00 22.85 ? 434 NAD B C6A   1 
HETATM 6745 N  N6A   . NAD E 2 .   ? 39.501  62.479 25.257  1.00 23.91 ? 434 NAD B N6A   1 
HETATM 6746 N  N1A   . NAD E 2 .   ? 38.879  60.590 26.560  1.00 22.01 ? 434 NAD B N1A   1 
HETATM 6747 C  C2A   . NAD E 2 .   ? 38.053  59.871 27.308  1.00 22.00 ? 434 NAD B C2A   1 
HETATM 6748 N  N3A   . NAD E 2 .   ? 36.726  60.325 27.624  1.00 21.06 ? 434 NAD B N3A   1 
HETATM 6749 C  C4A   . NAD E 2 .   ? 36.330  61.604 27.092  1.00 21.33 ? 434 NAD B C4A   1 
HETATM 6750 O  O3    . NAD E 2 .   ? 27.870  62.707 25.385  1.00 16.76 ? 434 NAD B O3    1 
HETATM 6751 P  PN    . NAD E 2 .   ? 26.823  61.614 24.645  1.00 17.05 ? 434 NAD B PN    1 
HETATM 6752 O  O1N   . NAD E 2 .   ? 26.732  60.321 25.249  1.00 18.63 ? 434 NAD B O1N   1 
HETATM 6753 O  O2N   . NAD E 2 .   ? 26.408  62.009 23.263  1.00 17.36 ? 434 NAD B O2N   1 
HETATM 6754 O  O5D   . NAD E 2 .   ? 28.077  60.972 23.782  1.00 16.92 ? 434 NAD B O5D   1 
HETATM 6755 C  C5D   . NAD E 2 .   ? 28.981  61.714 22.886  1.00 15.88 ? 434 NAD B C5D   1 
HETATM 6756 C  C4D   . NAD E 2 .   ? 28.986  61.435 21.401  1.00 15.91 ? 434 NAD B C4D   1 
HETATM 6757 O  O4D   . NAD E 2 .   ? 27.990  60.375 20.940  1.00 15.54 ? 434 NAD B O4D   1 
HETATM 6758 C  C3D   . NAD E 2 .   ? 28.652  62.615 20.380  1.00 16.17 ? 434 NAD B C3D   1 
HETATM 6759 O  O3D   . NAD E 2 .   ? 29.564  62.455 19.386  1.00 14.90 ? 434 NAD B O3D   1 
HETATM 6760 C  C2D   . NAD E 2 .   ? 27.203  62.360 19.934  1.00 17.12 ? 434 NAD B C2D   1 
HETATM 6761 O  O2D   . NAD E 2 .   ? 26.890  63.027 18.759  1.00 20.87 ? 434 NAD B O2D   1 
HETATM 6762 C  C1D   . NAD E 2 .   ? 27.285  60.865 19.812  1.00 16.68 ? 434 NAD B C1D   1 
HETATM 6763 N  N1N   . NAD E 2 .   ? 25.977  60.120 19.678  1.00 17.35 ? 434 NAD B N1N   1 
HETATM 6764 C  C2N   . NAD E 2 .   ? 25.904  59.032 18.775  1.00 17.48 ? 434 NAD B C2N   1 
HETATM 6765 C  C3N   . NAD E 2 .   ? 24.667  58.423 18.729  1.00 17.44 ? 434 NAD B C3N   1 
HETATM 6766 C  C7N   . NAD E 2 .   ? 24.679  57.205 17.658  1.00 18.49 ? 434 NAD B C7N   1 
HETATM 6767 O  O7N   . NAD E 2 .   ? 23.613  56.559 17.496  1.00 18.80 ? 434 NAD B O7N   1 
HETATM 6768 N  N7N   . NAD E 2 .   ? 25.882  56.952 16.970  1.00 17.53 ? 434 NAD B N7N   1 
HETATM 6769 C  C4N   . NAD E 2 .   ? 23.556  58.687 19.599  1.00 17.15 ? 434 NAD B C4N   1 
HETATM 6770 C  C5N   . NAD E 2 .   ? 23.713  59.911 20.382  1.00 17.68 ? 434 NAD B C5N   1 
HETATM 6771 C  C6N   . NAD E 2 .   ? 24.938  60.586 20.479  1.00 18.57 ? 434 NAD B C6N   1 
HETATM 6772 C  "C5'" . ADC F 3 .   ? 22.485  59.288 15.274  1.00 45.06 ? 436 ADC B "C5'" 1 
HETATM 6773 C  "C4'" . ADC F 3 .   ? 22.953  60.174 16.206  1.00 44.97 ? 436 ADC B "C4'" 1 
HETATM 6774 C  "C3'" . ADC F 3 .   ? 21.872  60.605 17.102  1.00 45.12 ? 436 ADC B "C3'" 1 
HETATM 6775 O  "O3'" . ADC F 3 .   ? 21.926  61.373 18.025  1.00 44.37 ? 436 ADC B "O3'" 1 
HETATM 6776 C  "C2'" . ADC F 3 .   ? 20.715  59.659 16.846  1.00 44.40 ? 436 ADC B "C2'" 1 
HETATM 6777 O  "O2'" . ADC F 3 .   ? 19.546  60.455 16.824  1.00 43.95 ? 436 ADC B "O2'" 1 
HETATM 6778 C  "C1'" . ADC F 3 .   ? 21.002  59.016 15.427  1.00 44.00 ? 436 ADC B "C1'" 1 
HETATM 6779 N  N9    . ADC F 3 .   ? 20.427  57.740 14.989  1.00 43.44 ? 436 ADC B N9    1 
HETATM 6780 C  C8    . ADC F 3 .   ? 20.714  56.492 15.466  1.00 43.77 ? 436 ADC B C8    1 
HETATM 6781 N  N7    . ADC F 3 .   ? 20.019  55.552 14.892  1.00 43.39 ? 436 ADC B N7    1 
HETATM 6782 C  C5    . ADC F 3 .   ? 19.201  56.170 13.968  1.00 42.92 ? 436 ADC B C5    1 
HETATM 6783 C  C6    . ADC F 3 .   ? 18.228  55.713 13.043  1.00 42.69 ? 436 ADC B C6    1 
HETATM 6784 N  N6    . ADC F 3 .   ? 17.911  54.404 12.914  1.00 42.95 ? 436 ADC B N6    1 
HETATM 6785 N  N1    . ADC F 3 .   ? 17.614  56.662 12.282  1.00 42.68 ? 436 ADC B N1    1 
HETATM 6786 C  C2    . ADC F 3 .   ? 17.926  57.957 12.409  1.00 43.50 ? 436 ADC B C2    1 
HETATM 6787 N  N3    . ADC F 3 .   ? 18.833  58.529 13.244  1.00 43.56 ? 436 ADC B N3    1 
HETATM 6788 C  C4    . ADC F 3 .   ? 19.464  57.580 14.026  1.00 43.20 ? 436 ADC B C4    1 
HETATM 6789 O  O     . HOH G 4 .   ? 16.352  61.014 54.888  1.00 12.18 ? 436 HOH A O     1 
HETATM 6790 O  O     . HOH G 4 .   ? 12.113  34.664 56.021  1.00 12.18 ? 437 HOH A O     1 
HETATM 6791 O  O     . HOH G 4 .   ? 19.673  48.912 62.845  1.00 12.18 ? 438 HOH A O     1 
HETATM 6792 O  O     . HOH G 4 .   ? 18.258  61.981 68.299  1.00 12.18 ? 439 HOH A O     1 
HETATM 6793 O  O     . HOH G 4 .   ? 8.547   42.928 36.068  1.00 12.18 ? 440 HOH A O     1 
HETATM 6794 O  O     . HOH G 4 .   ? 31.321  66.823 35.586  1.00 12.18 ? 441 HOH A O     1 
HETATM 6795 O  O     . HOH G 4 .   ? 7.726   47.178 62.538  1.00 12.18 ? 442 HOH A O     1 
HETATM 6796 O  O     . HOH G 4 .   ? 19.457  74.182 73.143  1.00 12.18 ? 443 HOH A O     1 
HETATM 6797 O  O     . HOH G 4 .   ? 15.470  67.001 59.772  1.00 12.18 ? 444 HOH A O     1 
HETATM 6798 O  O     . HOH G 4 .   ? 36.081  60.833 62.537  1.00 12.18 ? 445 HOH A O     1 
HETATM 6799 O  O     . HOH G 4 .   ? 32.022  51.782 53.060  1.00 12.18 ? 446 HOH A O     1 
HETATM 6800 O  O     . HOH G 4 .   ? 16.647  49.882 38.481  1.00 12.18 ? 447 HOH A O     1 
HETATM 6801 O  O     . HOH G 4 .   ? 13.888  63.542 77.881  1.00 12.18 ? 448 HOH A O     1 
HETATM 6802 O  O     . HOH G 4 .   ? 16.471  65.158 42.114  1.00 12.18 ? 449 HOH A O     1 
HETATM 6803 O  O     . HOH G 4 .   ? 20.970  51.215 31.687  1.00 12.18 ? 450 HOH A O     1 
HETATM 6804 O  O     . HOH G 4 .   ? 8.978   64.068 34.391  1.00 12.18 ? 451 HOH A O     1 
HETATM 6805 O  O     . HOH G 4 .   ? 40.932  67.436 31.246  1.00 12.48 ? 452 HOH A O     1 
HETATM 6806 O  O     . HOH G 4 .   ? 25.110  50.395 68.367  1.00 12.48 ? 453 HOH A O     1 
HETATM 6807 O  O     . HOH G 4 .   ? 24.771  69.311 35.794  1.00 12.48 ? 454 HOH A O     1 
HETATM 6808 O  O     . HOH G 4 .   ? 30.825  79.375 68.242  1.00 12.48 ? 455 HOH A O     1 
HETATM 6809 O  O     . HOH G 4 .   ? 23.177  48.769 56.262  1.00 12.48 ? 456 HOH A O     1 
HETATM 6810 O  O     . HOH G 4 .   ? 12.563  32.251 47.691  1.00 12.48 ? 457 HOH A O     1 
HETATM 6811 O  O     . HOH G 4 .   ? 1.623   53.122 43.291  1.00 12.48 ? 458 HOH A O     1 
HETATM 6812 O  O     . HOH G 4 .   ? 12.861  57.484 44.051  1.00 12.48 ? 459 HOH A O     1 
HETATM 6813 O  O     . HOH G 4 .   ? 25.536  49.655 45.215  1.00 12.48 ? 460 HOH A O     1 
HETATM 6814 O  O     . HOH G 4 .   ? 14.692  68.328 43.967  1.00 12.48 ? 461 HOH A O     1 
HETATM 6815 O  O     . HOH G 4 .   ? 15.878  71.971 54.786  1.00 12.48 ? 462 HOH A O     1 
HETATM 6816 O  O     . HOH H 4 .   ? 42.972  62.282 14.995  1.00 12.18 ? 437 HOH B O     1 
HETATM 6817 O  O     . HOH H 4 .   ? 22.849  62.402 30.504  1.00 12.18 ? 438 HOH B O     1 
HETATM 6818 O  O     . HOH H 4 .   ? 22.772  62.607 1.759   1.00 12.18 ? 439 HOH B O     1 
HETATM 6819 O  O     . HOH H 4 .   ? 29.247  58.574 25.707  1.00 12.18 ? 440 HOH B O     1 
HETATM 6820 O  O     . HOH H 4 .   ? 9.566   72.022 36.230  1.00 12.18 ? 441 HOH B O     1 
HETATM 6821 O  O     . HOH H 4 .   ? 17.953  53.861 -3.470  1.00 12.18 ? 442 HOH B O     1 
HETATM 6822 O  O     . HOH H 4 .   ? 18.410  62.224 39.069  1.00 12.18 ? 443 HOH B O     1 
HETATM 6823 O  O     . HOH H 4 .   ? 15.719  69.719 28.918  1.00 12.18 ? 444 HOH B O     1 
HETATM 6824 O  O     . HOH H 4 .   ? 45.519  57.996 27.745  1.00 12.18 ? 445 HOH B O     1 
HETATM 6825 O  O     . HOH H 4 .   ? 22.745  41.008 14.654  1.00 12.18 ? 446 HOH B O     1 
HETATM 6826 O  O     . HOH H 4 .   ? 48.577  58.874 15.612  1.00 12.18 ? 447 HOH B O     1 
HETATM 6827 O  O     . HOH H 4 .   ? 10.741  83.627 9.148   1.00 12.18 ? 448 HOH B O     1 
HETATM 6828 O  O     . HOH H 4 .   ? 11.443  48.744 17.313  1.00 12.18 ? 449 HOH B O     1 
HETATM 6829 O  O     . HOH H 4 .   ? 18.652  44.901 9.459   1.00 12.18 ? 450 HOH B O     1 
HETATM 6830 O  O     . HOH H 4 .   ? 27.356  39.430 5.148   1.00 12.48 ? 451 HOH B O     1 
HETATM 6831 O  O     . HOH H 4 .   ? 37.130  46.028 33.808  1.00 12.48 ? 452 HOH B O     1 
HETATM 6832 O  O     . HOH H 4 .   ? 15.296  67.810 34.215  1.00 12.48 ? 453 HOH B O     1 
HETATM 6833 O  O     . HOH H 4 .   ? 24.176  61.620 14.134  1.00 12.48 ? 454 HOH B O     1 
HETATM 6834 O  O     . HOH H 4 .   ? 25.581  53.949 34.938  1.00 12.48 ? 455 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MSE 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  TRP 17  17  17  TRP TRP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  MSE 29  29  29  MSE MSE A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  MSE 33  33  33  MSE MSE A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  MSE 35  35  35  MSE MSE A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  MSE 56  56  56  MSE MSE A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 CYS 113 113 113 CYS CYS A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 MSE 127 127 127 MSE MSE A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PRO 148 148 148 PRO PRO A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 MSE 167 167 167 MSE MSE A . n 
A 1 168 MSE 168 168 168 MSE MSE A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 PHE 189 189 189 PHE PHE A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 MSE 210 210 210 MSE MSE A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 CYS 228 228 228 CYS CYS A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 ILE 240 240 240 ILE ILE A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 GLN 251 251 251 GLN GLN A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 MSE 254 254 254 MSE MSE A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 THR 260 260 260 THR THR A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 MSE 262 262 262 MSE MSE A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 CYS 266 266 266 CYS CYS A . n 
A 1 267 GLN 267 267 267 GLN GLN A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 PHE 272 272 272 PHE PHE A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 GLY 277 277 277 GLY GLY A . n 
A 1 278 CYS 278 278 278 CYS CYS A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 HIS 286 286 286 HIS HIS A . n 
A 1 287 PHE 287 287 287 PHE PHE A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 GLN 289 289 289 GLN GLN A . n 
A 1 290 MSE 290 290 290 MSE MSE A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 CYS 297 297 297 CYS CYS A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 ILE 299 299 299 ILE ILE A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 HIS 301 301 301 HIS HIS A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 TRP 310 310 310 TRP TRP A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ASN 312 312 312 ASN ASN A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 LYS 318 318 318 LYS LYS A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 ASN 320 320 320 ASN ASN A . n 
A 1 321 ILE 321 321 321 ILE ILE A . n 
A 1 322 LYS 322 322 322 LYS LYS A . n 
A 1 323 PRO 323 323 323 PRO PRO A . n 
A 1 324 GLN 324 324 324 GLN GLN A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 ARG 327 327 327 ARG ARG A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 ARG 329 329 329 ARG ARG A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 ASN 332 332 332 ASN ASN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 GLU 341 341 341 GLU GLU A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ASN 346 346 346 ASN ASN A . n 
A 1 347 LEU 347 347 347 LEU LEU A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 CYS 349 349 349 CYS CYS A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 MSE 351 351 351 MSE MSE A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 HIS 353 353 353 HIS HIS A . n 
A 1 354 PRO 354 354 354 PRO PRO A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 PHE 356 356 356 PHE PHE A . n 
A 1 357 VAL 357 357 357 VAL VAL A . n 
A 1 358 MSE 358 358 358 MSE MSE A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 ASN 360 360 360 ASN ASN A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 THR 363 363 363 THR THR A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 MSE 367 367 367 MSE MSE A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 TRP 373 373 373 TRP TRP A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 HIS 375 375 375 HIS HIS A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PRO 380 380 380 PRO PRO A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 GLY 382 382 382 GLY GLY A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 HIS 384 384 384 HIS HIS A . n 
A 1 385 PHE 385 385 385 PHE PHE A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 LYS 389 389 389 LYS LYS A . n 
A 1 390 LEU 390 390 390 LEU LEU A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 GLU 392 392 392 GLU GLU A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 VAL 394 394 394 VAL VAL A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 ASN 403 403 403 ASN ASN A . n 
A 1 404 VAL 404 404 404 VAL VAL A . n 
A 1 405 LYS 405 405 405 LYS LYS A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 THR 407 407 407 THR THR A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 LEU 409 409 409 LEU LEU A . n 
A 1 410 THR 410 410 410 THR THR A . n 
A 1 411 GLU 411 411 411 GLU GLU A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 ALA 414 414 414 ALA ALA A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 GLY 418 418 418 GLY GLY A . n 
A 1 419 MSE 419 419 419 MSE MSE A . n 
A 1 420 SER 420 420 420 SER SER A . n 
A 1 421 CYS 421 421 421 CYS CYS A . n 
A 1 422 ASP 422 422 422 ASP ASP A . n 
A 1 423 GLY 423 423 423 GLY GLY A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 PHE 425 425 425 PHE PHE A . n 
A 1 426 LYS 426 426 426 LYS LYS A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 ASP 428 428 428 ASP ASP A . n 
A 1 429 HIS 429 429 429 HIS HIS A . n 
A 1 430 TYR 430 430 430 TYR TYR A . n 
A 1 431 ARG 431 431 431 ARG ARG A . n 
A 1 432 TYR 432 432 432 TYR TYR A . n 
B 1 1   MSE 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   3   ASP ASP B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   TYR 7   7   7   TYR TYR B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  ALA 15  15  15  ALA ALA B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  TRP 17  17  17  TRP TRP B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  ILE 24  24  24  ILE ILE B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  MSE 29  29  29  MSE MSE B . n 
B 1 30  PRO 30  30  30  PRO PRO B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  MSE 33  33  33  MSE MSE B . n 
B 1 34  ARG 34  34  34  ARG ARG B . n 
B 1 35  MSE 35  35  35  MSE MSE B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  ARG 38  38  38  ARG ARG B . n 
B 1 39  TYR 39  39  39  TYR TYR B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  SER 42  42  42  SER SER B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  PRO 44  44  44  PRO PRO B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  CYS 53  53  53  CYS CYS B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  HIS 55  55  55  HIS HIS B . n 
B 1 56  MSE 56  56  56  MSE MSE B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  VAL 58  58  58  VAL VAL B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  VAL 62  62  62  VAL VAL B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  GLY 71  71  71  GLY GLY B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  GLN 75  75  75  GLN GLN B . n 
B 1 76  TRP 76  76  76  TRP TRP B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  SER 78  78  78  SER SER B . n 
B 1 79  CYS 79  79  79  CYS CYS B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  ILE 81  81  81  ILE ILE B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  GLN 85  85  85  GLN GLN B . n 
B 1 86  ASN 86  86  86  ASN ASN B . n 
B 1 87  HIS 87  87  87  HIS HIS B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  PRO 98  98  98  PRO PRO B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 TRP 112 112 112 TRP TRP B . n 
B 1 113 CYS 113 113 113 CYS CYS B . n 
B 1 114 ILE 114 114 114 ILE ILE B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 THR 117 117 117 THR THR B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 LYS 121 121 121 LYS LYS B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ASN 126 126 126 ASN ASN B . n 
B 1 127 MSE 127 127 127 MSE MSE B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 HIS 140 140 140 HIS HIS B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 LYS 142 142 142 LYS LYS B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 GLN 145 145 145 GLN GLN B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 PRO 148 148 148 PRO PRO B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 GLU 156 156 156 GLU GLU B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 THR 159 159 159 THR THR B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 HIS 162 162 162 HIS HIS B . n 
B 1 163 ASN 163 163 163 ASN ASN B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 TYR 165 165 165 TYR TYR B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 MSE 167 167 167 MSE MSE B . n 
B 1 168 MSE 168 168 168 MSE MSE B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LYS 174 174 174 LYS LYS B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 PRO 176 176 176 PRO PRO B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 ILE 178 178 178 ILE ILE B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 ASN 181 181 181 ASN ASN B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 PHE 189 189 189 PHE PHE B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 ASN 191 191 191 ASN ASN B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 TYR 193 193 193 TYR TYR B . n 
B 1 194 GLY 194 194 194 GLY GLY B . n 
B 1 195 CYS 195 195 195 CYS CYS B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 ILE 200 200 200 ILE ILE B . n 
B 1 201 ASP 201 201 201 ASP ASP B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 THR 207 207 207 THR THR B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 MSE 210 210 210 MSE MSE B . n 
B 1 211 ILE 211 211 211 ILE ILE B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 LYS 214 214 214 LYS LYS B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 ALA 219 219 219 ALA ALA B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 TYR 221 221 221 TYR TYR B . n 
B 1 222 GLY 222 222 222 GLY GLY B . n 
B 1 223 ASP 223 223 223 ASP ASP B . n 
B 1 224 VAL 224 224 224 VAL VAL B . n 
B 1 225 GLY 225 225 225 GLY GLY B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 CYS 228 228 228 CYS CYS B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 GLN 230 230 230 GLN GLN B . n 
B 1 231 ALA 231 231 231 ALA ALA B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PHE 235 235 235 PHE PHE B . n 
B 1 236 GLY 236 236 236 GLY GLY B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 ARG 238 238 238 ARG ARG B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 ILE 240 240 240 ILE ILE B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 THR 242 242 242 THR THR B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ILE 244 244 244 ILE ILE B . n 
B 1 245 ASP 245 245 245 ASP ASP B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 ILE 247 247 247 ILE ILE B . n 
B 1 248 ASN 248 248 248 ASN ASN B . n 
B 1 249 ALA 249 249 249 ALA ALA B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 GLN 251 251 251 GLN GLN B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 MSE 254 254 254 MSE MSE B . n 
B 1 255 GLU 255 255 255 GLU GLU B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 TYR 257 257 257 TYR TYR B . n 
B 1 258 GLU 258 258 258 GLU GLU B . n 
B 1 259 VAL 259 259 259 VAL VAL B . n 
B 1 260 THR 260 260 260 THR THR B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 MSE 262 262 262 MSE MSE B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 ALA 265 265 265 ALA ALA B . n 
B 1 266 CYS 266 266 266 CYS CYS B . n 
B 1 267 GLN 267 267 267 GLN GLN B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 GLY 269 269 269 GLY GLY B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 PHE 272 272 272 PHE PHE B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 THR 274 274 274 THR THR B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 THR 276 276 276 THR THR B . n 
B 1 277 GLY 277 277 277 GLY GLY B . n 
B 1 278 CYS 278 278 278 CYS CYS B . n 
B 1 279 ILE 279 279 279 ILE ILE B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 ILE 281 281 281 ILE ILE B . n 
B 1 282 ILE 282 282 282 ILE ILE B . n 
B 1 283 LEU 283 283 283 LEU LEU B . n 
B 1 284 GLY 284 284 284 GLY GLY B . n 
B 1 285 ARG 285 285 285 ARG ARG B . n 
B 1 286 HIS 286 286 286 HIS HIS B . n 
B 1 287 PHE 287 287 287 PHE PHE B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 GLN 289 289 289 GLN GLN B . n 
B 1 290 MSE 290 290 290 MSE MSE B . n 
B 1 291 LYS 291 291 291 LYS LYS B . n 
B 1 292 ASP 292 292 292 ASP ASP B . n 
B 1 293 ASP 293 293 293 ASP ASP B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 ILE 295 295 295 ILE ILE B . n 
B 1 296 VAL 296 296 296 VAL VAL B . n 
B 1 297 CYS 297 297 297 CYS CYS B . n 
B 1 298 ASN 298 298 298 ASN ASN B . n 
B 1 299 ILE 299 299 299 ILE ILE B . n 
B 1 300 GLY 300 300 300 GLY GLY B . n 
B 1 301 HIS 301 301 301 HIS HIS B . n 
B 1 302 PHE 302 302 302 PHE PHE B . n 
B 1 303 ASP 303 303 303 ASP ASP B . n 
B 1 304 VAL 304 304 304 VAL VAL B . n 
B 1 305 GLU 305 305 305 GLU GLU B . n 
B 1 306 ILE 306 306 306 ILE ILE B . n 
B 1 307 ASP 307 307 307 ASP ASP B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 LYS 309 309 309 LYS LYS B . n 
B 1 310 TRP 310 310 310 TRP TRP B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 ASN 312 312 312 ASN ASN B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ASN 314 314 314 ASN ASN B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 VAL 316 316 316 VAL VAL B . n 
B 1 317 GLU 317 317 317 GLU GLU B . n 
B 1 318 LYS 318 318 318 LYS LYS B . n 
B 1 319 VAL 319 319 319 VAL VAL B . n 
B 1 320 ASN 320 320 320 ASN ASN B . n 
B 1 321 ILE 321 321 321 ILE ILE B . n 
B 1 322 LYS 322 322 322 LYS LYS B . n 
B 1 323 PRO 323 323 323 PRO PRO B . n 
B 1 324 GLN 324 324 324 GLN GLN B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 ASP 326 326 326 ASP ASP B . n 
B 1 327 ARG 327 327 327 ARG ARG B . n 
B 1 328 TYR 328 328 328 TYR TYR B . n 
B 1 329 ARG 329 329 329 ARG ARG B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 LYS 331 331 331 LYS LYS B . n 
B 1 332 ASN 332 332 332 ASN ASN B . n 
B 1 333 GLY 333 333 333 GLY GLY B . n 
B 1 334 ARG 334 334 334 ARG ARG B . n 
B 1 335 ARG 335 335 335 ARG ARG B . n 
B 1 336 ILE 336 336 336 ILE ILE B . n 
B 1 337 ILE 337 337 337 ILE ILE B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 ALA 340 340 340 ALA ALA B . n 
B 1 341 GLU 341 341 341 GLU GLU B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 ARG 343 343 343 ARG ARG B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 VAL 345 345 345 VAL VAL B . n 
B 1 346 ASN 346 346 346 ASN ASN B . n 
B 1 347 LEU 347 347 347 LEU LEU B . n 
B 1 348 GLY 348 348 348 GLY GLY B . n 
B 1 349 CYS 349 349 349 CYS CYS B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 MSE 351 351 351 MSE MSE B . n 
B 1 352 GLY 352 352 352 GLY GLY B . n 
B 1 353 HIS 353 353 353 HIS HIS B . n 
B 1 354 PRO 354 354 354 PRO PRO B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 PHE 356 356 356 PHE PHE B . n 
B 1 357 VAL 357 357 357 VAL VAL B . n 
B 1 358 MSE 358 358 358 MSE MSE B . n 
B 1 359 SER 359 359 359 SER SER B . n 
B 1 360 ASN 360 360 360 ASN ASN B . n 
B 1 361 SER 361 361 361 SER SER B . n 
B 1 362 PHE 362 362 362 PHE PHE B . n 
B 1 363 THR 363 363 363 THR THR B . n 
B 1 364 ASN 364 364 364 ASN ASN B . n 
B 1 365 GLN 365 365 365 GLN GLN B . n 
B 1 366 VAL 366 366 366 VAL VAL B . n 
B 1 367 MSE 367 367 367 MSE MSE B . n 
B 1 368 ALA 368 368 368 ALA ALA B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ILE 370 370 370 ILE ILE B . n 
B 1 371 GLU 371 371 371 GLU GLU B . n 
B 1 372 LEU 372 372 372 LEU LEU B . n 
B 1 373 TRP 373 373 373 TRP TRP B . n 
B 1 374 THR 374 374 374 THR THR B . n 
B 1 375 HIS 375 375 375 HIS HIS B . n 
B 1 376 PRO 376 376 376 PRO PRO B . n 
B 1 377 ASP 377 377 377 ASP ASP B . n 
B 1 378 LYS 378 378 378 LYS LYS B . n 
B 1 379 TYR 379 379 379 TYR TYR B . n 
B 1 380 PRO 380 380 380 PRO PRO B . n 
B 1 381 VAL 381 381 381 VAL VAL B . n 
B 1 382 GLY 382 382 382 GLY GLY B . n 
B 1 383 VAL 383 383 383 VAL VAL B . n 
B 1 384 HIS 384 384 384 HIS HIS B . n 
B 1 385 PHE 385 385 385 PHE PHE B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 PRO 387 387 387 PRO PRO B . n 
B 1 388 LYS 388 388 388 LYS LYS B . n 
B 1 389 LYS 389 389 389 LYS LYS B . n 
B 1 390 LEU 390 390 390 LEU LEU B . n 
B 1 391 ASP 391 391 391 ASP ASP B . n 
B 1 392 GLU 392 392 392 GLU GLU B . n 
B 1 393 ALA 393 393 393 ALA ALA B . n 
B 1 394 VAL 394 394 394 VAL VAL B . n 
B 1 395 ALA 395 395 395 ALA ALA B . n 
B 1 396 GLU 396 396 396 GLU GLU B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 HIS 398 398 398 HIS HIS B . n 
B 1 399 LEU 399 399 399 LEU LEU B . n 
B 1 400 GLY 400 400 400 GLY GLY B . n 
B 1 401 LYS 401 401 401 LYS LYS B . n 
B 1 402 LEU 402 402 402 LEU LEU B . n 
B 1 403 ASN 403 403 403 ASN ASN B . n 
B 1 404 VAL 404 404 404 VAL VAL B . n 
B 1 405 LYS 405 405 405 LYS LYS B . n 
B 1 406 LEU 406 406 406 LEU LEU B . n 
B 1 407 THR 407 407 407 THR THR B . n 
B 1 408 LYS 408 408 408 LYS LYS B . n 
B 1 409 LEU 409 409 409 LEU LEU B . n 
B 1 410 THR 410 410 410 THR THR B . n 
B 1 411 GLU 411 411 411 GLU GLU B . n 
B 1 412 LYS 412 412 412 LYS LYS B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 ALA 414 414 414 ALA ALA B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 TYR 416 416 416 TYR TYR B . n 
B 1 417 LEU 417 417 417 LEU LEU B . n 
B 1 418 GLY 418 418 418 GLY GLY B . n 
B 1 419 MSE 419 419 419 MSE MSE B . n 
B 1 420 SER 420 420 420 SER SER B . n 
B 1 421 CYS 421 421 421 CYS CYS B . n 
B 1 422 ASP 422 422 422 ASP ASP B . n 
B 1 423 GLY 423 423 423 GLY GLY B . n 
B 1 424 PRO 424 424 424 PRO PRO B . n 
B 1 425 PHE 425 425 425 PHE PHE B . n 
B 1 426 LYS 426 426 426 LYS LYS B . n 
B 1 427 PRO 427 427 427 PRO PRO B . n 
B 1 428 ASP 428 428 428 ASP ASP B . n 
B 1 429 HIS 429 429 429 HIS HIS B . n 
B 1 430 TYR 430 430 430 TYR TYR B . n 
B 1 431 ARG 431 431 431 ARG ARG B . n 
B 1 432 TYR 432 432 432 TYR TYR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAD 1  433 433 NAD NAH A . 
D 3 ADC 1  435 435 ADC ADC A . 
E 2 NAD 1  434 434 NAD NAH B . 
F 3 ADC 1  436 436 ADC ADC B . 
G 4 HOH 1  436 2   HOH HOH A . 
G 4 HOH 2  437 3   HOH HOH A . 
G 4 HOH 3  438 4   HOH HOH A . 
G 4 HOH 4  439 6   HOH HOH A . 
G 4 HOH 5  440 7   HOH HOH A . 
G 4 HOH 6  441 9   HOH HOH A . 
G 4 HOH 7  442 11  HOH HOH A . 
G 4 HOH 8  443 12  HOH HOH A . 
G 4 HOH 9  444 13  HOH HOH A . 
G 4 HOH 10 445 14  HOH HOH A . 
G 4 HOH 11 446 17  HOH HOH A . 
G 4 HOH 12 447 19  HOH HOH A . 
G 4 HOH 13 448 24  HOH HOH A . 
G 4 HOH 14 449 26  HOH HOH A . 
G 4 HOH 15 450 28  HOH HOH A . 
G 4 HOH 16 451 30  HOH HOH A . 
G 4 HOH 17 452 33  HOH HOH A . 
G 4 HOH 18 453 34  HOH HOH A . 
G 4 HOH 19 454 35  HOH HOH A . 
G 4 HOH 20 455 36  HOH HOH A . 
G 4 HOH 21 456 37  HOH HOH A . 
G 4 HOH 22 457 38  HOH HOH A . 
G 4 HOH 23 458 39  HOH HOH A . 
G 4 HOH 24 459 40  HOH HOH A . 
G 4 HOH 25 460 41  HOH HOH A . 
G 4 HOH 26 461 43  HOH HOH A . 
G 4 HOH 27 462 46  HOH HOH A . 
H 4 HOH 1  437 1   HOH HOH B . 
H 4 HOH 2  438 5   HOH HOH B . 
H 4 HOH 3  439 8   HOH HOH B . 
H 4 HOH 4  440 10  HOH HOH B . 
H 4 HOH 5  441 15  HOH HOH B . 
H 4 HOH 6  442 16  HOH HOH B . 
H 4 HOH 7  443 18  HOH HOH B . 
H 4 HOH 8  444 20  HOH HOH B . 
H 4 HOH 9  445 21  HOH HOH B . 
H 4 HOH 10 446 22  HOH HOH B . 
H 4 HOH 11 447 23  HOH HOH B . 
H 4 HOH 12 448 25  HOH HOH B . 
H 4 HOH 13 449 27  HOH HOH B . 
H 4 HOH 14 450 29  HOH HOH B . 
H 4 HOH 15 451 31  HOH HOH B . 
H 4 HOH 16 452 32  HOH HOH B . 
H 4 HOH 17 453 42  HOH HOH B . 
H 4 HOH 18 454 44  HOH HOH B . 
H 4 HOH 19 455 45  HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1  A MSE 29  A MSE 29  ? MET SELENOMETHIONINE 
2  A MSE 33  A MSE 33  ? MET SELENOMETHIONINE 
3  A MSE 35  A MSE 35  ? MET SELENOMETHIONINE 
4  A MSE 56  A MSE 56  ? MET SELENOMETHIONINE 
5  A MSE 127 A MSE 127 ? MET SELENOMETHIONINE 
6  A MSE 167 A MSE 167 ? MET SELENOMETHIONINE 
7  A MSE 168 A MSE 168 ? MET SELENOMETHIONINE 
8  A MSE 210 A MSE 210 ? MET SELENOMETHIONINE 
9  A MSE 254 A MSE 254 ? MET SELENOMETHIONINE 
10 A MSE 262 A MSE 262 ? MET SELENOMETHIONINE 
11 A MSE 290 A MSE 290 ? MET SELENOMETHIONINE 
12 A MSE 351 A MSE 351 ? MET SELENOMETHIONINE 
13 A MSE 358 A MSE 358 ? MET SELENOMETHIONINE 
14 A MSE 367 A MSE 367 ? MET SELENOMETHIONINE 
15 A MSE 419 A MSE 419 ? MET SELENOMETHIONINE 
16 B MSE 29  B MSE 29  ? MET SELENOMETHIONINE 
17 B MSE 33  B MSE 33  ? MET SELENOMETHIONINE 
18 B MSE 35  B MSE 35  ? MET SELENOMETHIONINE 
19 B MSE 56  B MSE 56  ? MET SELENOMETHIONINE 
20 B MSE 127 B MSE 127 ? MET SELENOMETHIONINE 
21 B MSE 167 B MSE 167 ? MET SELENOMETHIONINE 
22 B MSE 168 B MSE 168 ? MET SELENOMETHIONINE 
23 B MSE 210 B MSE 210 ? MET SELENOMETHIONINE 
24 B MSE 254 B MSE 254 ? MET SELENOMETHIONINE 
25 B MSE 262 B MSE 262 ? MET SELENOMETHIONINE 
26 B MSE 290 B MSE 290 ? MET SELENOMETHIONINE 
27 B MSE 351 B MSE 351 ? MET SELENOMETHIONINE 
28 B MSE 358 B MSE 358 ? MET SELENOMETHIONINE 
29 B MSE 367 B MSE 367 ? MET SELENOMETHIONINE 
30 B MSE 419 B MSE 419 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 28230 ? 
1 MORE         -119  ? 
1 'SSA (A^2)'  52310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z           1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 6_555 -x+1/2,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 45.9650000000 0.0000000000 
-1.0000000000 0.0000000000 84.0100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-04-20 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHAKE-N-BAKE 'model building' 2.0      ? 1 
CNS          refinement       0.1      ? 2 
DENZO        'data reduction' .        ? 3 
SCALEPACK    'data scaling'   .        ? 4 
SHAKE-N-BAKE phasing          'V. 2.0' ? 5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   B HOH 446 ? ? 1_555 O B HOH 446 ? ? 6_555 2.05 
2 1 OD1 B ASP 201 ? ? 1_555 O B HOH 446 ? ? 6_555 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 4   ? ? -30.72  114.43  
2  1 TYR A 7   ? ? 162.56  179.99  
3  1 LYS A 8   ? ? -161.85 111.46  
4  1 MSE A 29  ? ? -117.92 64.29   
5  1 HIS A 55  ? ? -21.04  116.33  
6  1 PRO A 98  ? ? -59.81  109.74  
7  1 TRP A 102 ? ? -170.53 144.89  
8  1 PRO A 148 ? ? -58.97  3.62    
9  1 THR A 185 ? ? -65.59  15.03   
10 1 LYS A 186 ? ? -121.33 -68.87  
11 1 PHE A 189 ? ? -135.92 -69.44  
12 1 LEU A 192 ? ? -78.53  -73.33  
13 1 LYS A 318 ? ? -151.70 81.24   
14 1 ALA A 340 ? ? 48.39   23.43   
15 1 LEU A 344 ? ? -29.93  105.23  
16 1 ALA A 350 ? ? -144.05 -138.68 
17 1 ASP A 377 ? ? -56.19  -1.99   
18 1 ASP A 422 ? ? -122.59 -56.47  
19 1 LYS B 4   ? ? 176.75  116.77  
20 1 TYR B 7   ? ? 161.72  179.55  
21 1 LYS B 8   ? ? -161.62 110.16  
22 1 MSE B 29  ? ? -116.78 63.62   
23 1 HIS B 55  ? ? -19.70  116.24  
24 1 PRO B 148 ? ? -58.60  3.71    
25 1 THR B 185 ? ? -65.04  13.96   
26 1 LYS B 186 ? ? -120.97 -68.05  
27 1 PHE B 189 ? ? -137.25 -68.63  
28 1 LEU B 192 ? ? -78.35  -73.88  
29 1 LYS B 318 ? ? -151.54 80.41   
30 1 ALA B 340 ? ? 45.93   27.55   
31 1 LEU B 344 ? ? -30.67  104.70  
32 1 ALA B 350 ? ? -143.07 -136.36 
33 1 ASP B 377 ? ? -57.70  -2.57   
34 1 ASP B 422 ? ? -123.40 -57.46  
35 1 PRO B 424 ? ? -39.67  132.55  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    "C3'" 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    B 
_pdbx_validate_chiral.auth_comp_id    ADC 
_pdbx_validate_chiral.auth_seq_id     436 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MSE 1 ? A MSE 1 
2 1 Y 1 B MSE 1 ? B MSE 1 
3 1 Y 1 B SER 2 ? B SER 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 NICOTINAMIDE-ADENINE-DINUCLEOTIDE                         NAD 
3 "(1'R,2'S)-9-(2-HYDROXY-3'-KETO-CYCLOPENTEN-1-YL)ADENINE" ADC 
4 water                                                     HOH 
#