data_1A9T
# 
_entry.id   1A9T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1A9T         
WWPDB D_1000170571 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1A9T 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-10 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mao, C.'       1 
'Cook, W.J.'    2 
'Zhou, M.'      3 
'Fedorov, A.A.' 4 
'Almo, S.C.'    5 
'Ealick, S.E.'  6 
# 
_citation.id                        primary 
_citation.title                     
'Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            37 
_citation.page_first                7135 
_citation.page_last                 7146 
_citation.year                      1998 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9585525 
_citation.pdbx_database_id_DOI      10.1021/bi9723919 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mao, C.'       1 ? 
primary 'Cook, W.J.'    2 ? 
primary 'Zhou, M.'      3 ? 
primary 'Federov, A.A.' 4 ? 
primary 'Almo, S.C.'    5 ? 
primary 'Ealick, S.E.'  6 ? 
# 
_cell.entry_id           1A9T 
_cell.length_a           94.200 
_cell.length_b           94.200 
_cell.length_c           94.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1A9T 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                198 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'PURINE NUCLEOSIDE PHOSPHORYLASE'  31567.992 1  2.4.2.1 ? ? ? 
2 non-polymer man 1-O-phosphono-alpha-D-ribofuranose 230.110   1  ?       ? ? ? 
3 non-polymer syn HYPOXANTHINE                       136.111   1  ?       ? ? ? 
4 water       nat water                              18.015    56 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVM
MQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFP
AMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MANGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVM
MQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFP
AMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPV
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASN n 
1 4   GLY n 
1 5   TYR n 
1 6   THR n 
1 7   TYR n 
1 8   GLU n 
1 9   ASP n 
1 10  TYR n 
1 11  GLN n 
1 12  ASP n 
1 13  THR n 
1 14  ALA n 
1 15  LYS n 
1 16  TRP n 
1 17  LEU n 
1 18  LEU n 
1 19  SER n 
1 20  HIS n 
1 21  THR n 
1 22  GLU n 
1 23  GLN n 
1 24  ARG n 
1 25  PRO n 
1 26  GLN n 
1 27  VAL n 
1 28  ALA n 
1 29  VAL n 
1 30  ILE n 
1 31  CYS n 
1 32  GLY n 
1 33  SER n 
1 34  GLY n 
1 35  LEU n 
1 36  GLY n 
1 37  GLY n 
1 38  LEU n 
1 39  VAL n 
1 40  ASN n 
1 41  LYS n 
1 42  LEU n 
1 43  THR n 
1 44  GLN n 
1 45  ALA n 
1 46  GLN n 
1 47  THR n 
1 48  PHE n 
1 49  ASP n 
1 50  TYR n 
1 51  SER n 
1 52  GLU n 
1 53  ILE n 
1 54  PRO n 
1 55  ASN n 
1 56  PHE n 
1 57  PRO n 
1 58  GLU n 
1 59  SER n 
1 60  THR n 
1 61  VAL n 
1 62  PRO n 
1 63  GLY n 
1 64  HIS n 
1 65  ALA n 
1 66  GLY n 
1 67  ARG n 
1 68  LEU n 
1 69  VAL n 
1 70  PHE n 
1 71  GLY n 
1 72  ILE n 
1 73  LEU n 
1 74  ASN n 
1 75  GLY n 
1 76  ARG n 
1 77  ALA n 
1 78  CYS n 
1 79  VAL n 
1 80  MET n 
1 81  MET n 
1 82  GLN n 
1 83  GLY n 
1 84  ARG n 
1 85  PHE n 
1 86  HIS n 
1 87  MET n 
1 88  TYR n 
1 89  GLU n 
1 90  GLY n 
1 91  TYR n 
1 92  PRO n 
1 93  PHE n 
1 94  TRP n 
1 95  LYS n 
1 96  VAL n 
1 97  THR n 
1 98  PHE n 
1 99  PRO n 
1 100 VAL n 
1 101 ARG n 
1 102 VAL n 
1 103 PHE n 
1 104 ARG n 
1 105 LEU n 
1 106 LEU n 
1 107 GLY n 
1 108 VAL n 
1 109 GLU n 
1 110 THR n 
1 111 LEU n 
1 112 VAL n 
1 113 VAL n 
1 114 THR n 
1 115 ASN n 
1 116 ALA n 
1 117 ALA n 
1 118 GLY n 
1 119 GLY n 
1 120 LEU n 
1 121 ASN n 
1 122 PRO n 
1 123 ASN n 
1 124 PHE n 
1 125 GLU n 
1 126 VAL n 
1 127 GLY n 
1 128 ASP n 
1 129 ILE n 
1 130 MET n 
1 131 LEU n 
1 132 ILE n 
1 133 ARG n 
1 134 ASP n 
1 135 HIS n 
1 136 ILE n 
1 137 ASN n 
1 138 LEU n 
1 139 PRO n 
1 140 GLY n 
1 141 PHE n 
1 142 SER n 
1 143 GLY n 
1 144 GLU n 
1 145 ASN n 
1 146 PRO n 
1 147 LEU n 
1 148 ARG n 
1 149 GLY n 
1 150 PRO n 
1 151 ASN n 
1 152 GLU n 
1 153 GLU n 
1 154 ARG n 
1 155 PHE n 
1 156 GLY n 
1 157 VAL n 
1 158 ARG n 
1 159 PHE n 
1 160 PRO n 
1 161 ALA n 
1 162 MET n 
1 163 SER n 
1 164 ASP n 
1 165 ALA n 
1 166 TYR n 
1 167 ASP n 
1 168 ARG n 
1 169 ASP n 
1 170 MET n 
1 171 ARG n 
1 172 GLN n 
1 173 LYS n 
1 174 ALA n 
1 175 HIS n 
1 176 SER n 
1 177 THR n 
1 178 TRP n 
1 179 LYS n 
1 180 GLN n 
1 181 MET n 
1 182 GLY n 
1 183 GLU n 
1 184 GLN n 
1 185 ARG n 
1 186 GLU n 
1 187 LEU n 
1 188 GLN n 
1 189 GLU n 
1 190 GLY n 
1 191 THR n 
1 192 TYR n 
1 193 VAL n 
1 194 MET n 
1 195 LEU n 
1 196 GLY n 
1 197 GLY n 
1 198 PRO n 
1 199 ASN n 
1 200 PHE n 
1 201 GLU n 
1 202 THR n 
1 203 VAL n 
1 204 ALA n 
1 205 GLU n 
1 206 CYS n 
1 207 ARG n 
1 208 LEU n 
1 209 LEU n 
1 210 ARG n 
1 211 ASN n 
1 212 LEU n 
1 213 GLY n 
1 214 ALA n 
1 215 ASP n 
1 216 ALA n 
1 217 VAL n 
1 218 GLY n 
1 219 MET n 
1 220 SER n 
1 221 THR n 
1 222 VAL n 
1 223 PRO n 
1 224 GLU n 
1 225 VAL n 
1 226 ILE n 
1 227 VAL n 
1 228 ALA n 
1 229 ARG n 
1 230 HIS n 
1 231 CYS n 
1 232 GLY n 
1 233 LEU n 
1 234 ARG n 
1 235 VAL n 
1 236 PHE n 
1 237 GLY n 
1 238 PHE n 
1 239 SER n 
1 240 LEU n 
1 241 ILE n 
1 242 THR n 
1 243 ASN n 
1 244 LYS n 
1 245 VAL n 
1 246 ILE n 
1 247 MET n 
1 248 ASP n 
1 249 THR n 
1 250 GLU n 
1 251 SER n 
1 252 GLN n 
1 253 GLY n 
1 254 LYS n 
1 255 ALA n 
1 256 ASN n 
1 257 HIS n 
1 258 GLU n 
1 259 GLU n 
1 260 VAL n 
1 261 LEU n 
1 262 GLU n 
1 263 ALA n 
1 264 GLY n 
1 265 LYS n 
1 266 GLN n 
1 267 ALA n 
1 268 ALA n 
1 269 GLN n 
1 270 LYS n 
1 271 LEU n 
1 272 GLU n 
1 273 GLN n 
1 274 PHE n 
1 275 VAL n 
1 276 SER n 
1 277 LEU n 
1 278 LEU n 
1 279 MET n 
1 280 ALA n 
1 281 SER n 
1 282 ILE n 
1 283 PRO n 
1 284 VAL n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 SPLEEN 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PNPH_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P55859 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVM
MQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFP
AMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSL
ITNKVIMDYESQGKANHEEVLEAGKQAAQKLEQFVSLLMASIPVSGHTG
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1A9T 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 284 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P55859 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  284 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       284 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1A9T ALA A 2   ? UNP P55859 GLN 2   conflict 2   1 
1 1A9T THR A 249 ? UNP P55859 TYR 249 conflict 249 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'           y CYSTEINE                           ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                              ? 'H2 O'           18.015  
HPA non-polymer                   . HYPOXANTHINE                       ? 'C5 H4 N4 O'     136.111 
ILE 'L-peptide linking'           y ISOLEUCINE                         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE                      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                            ? 'C5 H9 N O2'     115.130 
R1P 'D-saccharide, alpha linking' n 1-O-phosphono-alpha-D-ribofuranose ? 'C5 H11 O8 P'    230.110 
SER 'L-peptide linking'           y SERINE                             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1A9T 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.21 
_exptl_crystal.density_percent_sol   44.23 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   7.8-8.2 
_exptl_crystal_grow.pdbx_details    
;PROTEIN WAS CRYSTALLIZED FROM 31-35% PEG-400 IN 100 MM HEPES OR TRIS BUFFER, PH 7.8-8.2; 100 MM MGCL2; 1% OCTYL-BETA- D-GLUCOPYRANOSIDE
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           296 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'XUONG-HAMLIN MULTIWIRE' 
_diffrn_detector.pdbx_collection_date   1996-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1A9T 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             8. 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   14891 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         80. 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1A9T 
_refine.ls_number_reflns_obs                     14891 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8. 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1900000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1900000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               15. 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1PBN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2215 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             56 
_refine_hist.number_atoms_total               2295 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        8. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.2   ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM11.DNA  TOPH11.DNA   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1A9T 
_struct.title                     'BOVINE PURINE NUCLEOSIDE PHOSPHORYLASE COMPLEXED WITH 9-DEAZAINOSINE AND PHOSPHATE' 
_struct.pdbx_descriptor           'PURINE NUCLEOSIDE PHOSPHORYLASE, HYPOXANTHINE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1A9T 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, GLYCOSYLTRANSFERASE, PENTOSYLTRANSFERASE, PURINE NUCLEOSIDE PHOSPHORYLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  TYR A 7   ? HIS A 20  ? TYR A 7   HIS A 20  1 ? 14 
HELX_P HELX_P2  2  GLY A 36  ? LYS A 41  ? GLY A 36  LYS A 41  5 ? 6  
HELX_P HELX_P3  3  TYR A 50  ? GLU A 52  ? TYR A 50  GLU A 52  5 ? 3  
HELX_P HELX_P4  4  MET A 87  ? GLU A 89  ? MET A 87  GLU A 89  5 ? 3  
HELX_P HELX_P5  5  PHE A 93  ? VAL A 96  ? PHE A 93  VAL A 96  1 ? 4  
HELX_P HELX_P6  6  PHE A 98  ? LEU A 106 ? PHE A 98  LEU A 106 1 ? 9  
HELX_P HELX_P7  7  LEU A 138 ? SER A 142 ? LEU A 138 SER A 142 1 ? 5  
HELX_P HELX_P8  8  ARG A 168 ? MET A 181 ? ARG A 168 MET A 181 1 ? 14 
HELX_P HELX_P9  9  VAL A 203 ? ASN A 211 ? VAL A 203 ASN A 211 1 ? 9  
HELX_P HELX_P10 10 VAL A 222 ? HIS A 230 ? VAL A 222 HIS A 230 1 ? 9  
HELX_P HELX_P11 11 HIS A 257 ? GLN A 266 ? HIS A 257 GLN A 266 1 ? 10 
HELX_P HELX_P12 12 ALA A 268 ? LEU A 278 ? ALA A 268 LEU A 278 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 197 A . ? GLY 197 A PRO 198 A ? PRO 198 A 1 0.51  
2 ILE 282 A . ? ILE 282 A PRO 283 A ? PRO 283 A 1 -0.47 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   9 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 216 ? GLY A 218 ? ALA A 216 GLY A 218 
A 2 GLN A 188 ? MET A 194 ? GLN A 188 MET A 194 
A 3 ILE A 129 ? ASN A 137 ? ILE A 129 ASN A 137 
A 4 ARG A 234 ? LYS A 244 ? ARG A 234 LYS A 244 
A 5 THR A 110 ? GLY A 119 ? THR A 110 GLY A 119 
A 6 VAL A 27  ? CYS A 31  ? VAL A 27  CYS A 31  
A 7 ARG A 76  ? GLN A 82  ? ARG A 76  GLN A 82  
A 8 ARG A 67  ? LEU A 73  ? ARG A 67  LEU A 73  
A 9 GLN A 46  ? ASP A 49  ? GLN A 46  ASP A 49  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 216 ? O ALA A 216 N VAL A 193 ? N VAL A 193 
A 2 3 O GLN A 188 ? O GLN A 188 N LEU A 131 ? N LEU A 131 
A 3 4 O MET A 130 ? O MET A 130 N SER A 239 ? N SER A 239 
A 4 5 O ARG A 234 ? O ARG A 234 N LEU A 111 ? N LEU A 111 
A 5 6 O THR A 110 ? O THR A 110 N ALA A 28  ? N ALA A 28  
A 6 7 O VAL A 27  ? O VAL A 27  N VAL A 79  ? N VAL A 79  
A 7 8 O ARG A 76  ? O ARG A 76  N LEU A 73  ? N LEU A 73  
A 8 9 O LEU A 68  ? O LEU A 68  N PHE A 48  ? N PHE A 48  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
9NE Unknown ? ? ? ? 2 'binding site' 
RSE Unknown ? ? ? ? 7 'binding site' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 9NE 2 GLU A 201 ? GLU A 201 . ? 1_555 ? 
2 9NE 2 ASN A 243 ? ASN A 243 . ? 1_555 ? 
3 RSE 7 SER A 33  ? SER A 33  . ? 1_555 ? 
4 RSE 7 ARG A 84  ? ARG A 84  . ? 1_555 ? 
5 RSE 7 HIS A 86  ? HIS A 86  . ? 1_555 ? 
6 RSE 7 TYR A 88  ? TYR A 88  . ? 1_555 ? 
7 RSE 7 ALA A 116 ? ALA A 116 . ? 1_555 ? 
8 RSE 7 SER A 220 ? SER A 220 . ? 1_555 ? 
9 RSE 7 HIS A 257 ? HIS A 257 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1A9T 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1A9T 
_atom_sites.fract_transf_matrix[1][1]   0.010616 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010616 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010616 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 14.163  64.880  73.555 1.00 66.57 ? 1    MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 12.834  64.648  72.928 1.00 67.12 ? 1    MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 12.529  65.859  72.050 1.00 65.11 ? 1    MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 12.807  66.994  72.444 1.00 64.63 ? 1    MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 11.760  64.508  74.015 1.00 70.19 ? 1    MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 10.428  63.926  73.544 1.00 72.79 ? 1    MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 10.505  62.143  73.213 1.00 75.68 ? 1    MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 10.339  62.114  71.423 1.00 74.10 ? 1    MET A CE  1 
ATOM   9    N N   . ALA A 1 2   ? 12.022  65.606  70.845 1.00 63.23 ? 2    ALA A N   1 
ATOM   10   C CA  . ALA A 1 2   ? 11.675  66.672  69.907 1.00 58.96 ? 2    ALA A CA  1 
ATOM   11   C C   . ALA A 1 2   ? 10.408  67.380  70.400 1.00 56.12 ? 2    ALA A C   1 
ATOM   12   O O   . ALA A 1 2   ? 10.007  67.193  71.552 1.00 56.35 ? 2    ALA A O   1 
ATOM   13   C CB  . ALA A 1 2   ? 11.471  66.098  68.505 1.00 59.06 ? 2    ALA A CB  1 
ATOM   14   N N   . ASN A 1 3   ? 9.765   68.155  69.528 1.00 52.41 ? 3    ASN A N   1 
ATOM   15   C CA  . ASN A 1 3   ? 8.564   68.901  69.906 1.00 48.64 ? 3    ASN A CA  1 
ATOM   16   C C   . ASN A 1 3   ? 7.520   68.079  70.652 1.00 45.17 ? 3    ASN A C   1 
ATOM   17   O O   . ASN A 1 3   ? 7.032   67.063  70.152 1.00 45.56 ? 3    ASN A O   1 
ATOM   18   C CB  . ASN A 1 3   ? 7.923   69.587  68.691 1.00 50.41 ? 3    ASN A CB  1 
ATOM   19   C CG  . ASN A 1 3   ? 6.785   70.534  69.082 1.00 49.88 ? 3    ASN A CG  1 
ATOM   20   O OD1 . ASN A 1 3   ? 6.742   71.047  70.201 1.00 50.37 ? 3    ASN A OD1 1 
ATOM   21   N ND2 . ASN A 1 3   ? 5.859   70.757  68.162 1.00 50.48 ? 3    ASN A ND2 1 
ATOM   22   N N   . GLY A 1 4   ? 7.200   68.529  71.860 1.00 40.26 ? 4    GLY A N   1 
ATOM   23   C CA  . GLY A 1 4   ? 6.218   67.850  72.679 1.00 34.83 ? 4    GLY A CA  1 
ATOM   24   C C   . GLY A 1 4   ? 4.820   68.403  72.496 1.00 30.75 ? 4    GLY A C   1 
ATOM   25   O O   . GLY A 1 4   ? 3.885   67.940  73.142 1.00 33.62 ? 4    GLY A O   1 
ATOM   26   N N   . TYR A 1 5   ? 4.672   69.418  71.653 1.00 26.75 ? 5    TYR A N   1 
ATOM   27   C CA  . TYR A 1 5   ? 3.361   70.005  71.412 1.00 22.02 ? 5    TYR A CA  1 
ATOM   28   C C   . TYR A 1 5   ? 2.709   69.380  70.189 1.00 21.71 ? 5    TYR A C   1 
ATOM   29   O O   . TYR A 1 5   ? 3.346   69.229  69.143 1.00 20.55 ? 5    TYR A O   1 
ATOM   30   C CB  . TYR A 1 5   ? 3.465   71.516  71.173 1.00 20.23 ? 5    TYR A CB  1 
ATOM   31   C CG  . TYR A 1 5   ? 3.824   72.351  72.379 1.00 14.88 ? 5    TYR A CG  1 
ATOM   32   C CD1 . TYR A 1 5   ? 3.003   72.378  73.505 1.00 12.37 ? 5    TYR A CD1 1 
ATOM   33   C CD2 . TYR A 1 5   ? 4.962   73.152  72.374 1.00 11.36 ? 5    TYR A CD2 1 
ATOM   34   C CE1 . TYR A 1 5   ? 3.307   73.191  74.597 1.00 15.33 ? 5    TYR A CE1 1 
ATOM   35   C CE2 . TYR A 1 5   ? 5.276   73.969  73.460 1.00 12.61 ? 5    TYR A CE2 1 
ATOM   36   C CZ  . TYR A 1 5   ? 4.445   73.986  74.567 1.00 12.48 ? 5    TYR A CZ  1 
ATOM   37   O OH  . TYR A 1 5   ? 4.748   74.807  75.632 1.00 16.31 ? 5    TYR A OH  1 
ATOM   38   N N   . THR A 1 6   ? 1.449   68.990  70.333 1.00 19.53 ? 6    THR A N   1 
ATOM   39   C CA  . THR A 1 6   ? 0.692   68.432  69.223 1.00 19.39 ? 6    THR A CA  1 
ATOM   40   C C   . THR A 1 6   ? -0.119  69.606  68.667 1.00 19.54 ? 6    THR A C   1 
ATOM   41   O O   . THR A 1 6   ? -0.308  70.615  69.355 1.00 17.72 ? 6    THR A O   1 
ATOM   42   C CB  . THR A 1 6   ? -0.265  67.307  69.683 1.00 19.75 ? 6    THR A CB  1 
ATOM   43   O OG1 . THR A 1 6   ? -1.212  67.828  70.624 1.00 24.51 ? 6    THR A OG1 1 
ATOM   44   C CG2 . THR A 1 6   ? 0.511   66.182  70.339 1.00 21.80 ? 6    THR A CG2 1 
ATOM   45   N N   . TYR A 1 7   ? -0.609  69.473  67.439 1.00 17.18 ? 7    TYR A N   1 
ATOM   46   C CA  . TYR A 1 7   ? -1.390  70.527  66.803 1.00 14.40 ? 7    TYR A CA  1 
ATOM   47   C C   . TYR A 1 7   ? -2.561  70.984  67.675 1.00 14.00 ? 7    TYR A C   1 
ATOM   48   O O   . TYR A 1 7   ? -2.865  72.175  67.748 1.00 14.93 ? 7    TYR A O   1 
ATOM   49   C CB  . TYR A 1 7   ? -1.902  70.041  65.449 1.00 12.30 ? 7    TYR A CB  1 
ATOM   50   C CG  . TYR A 1 7   ? -2.675  71.074  64.675 1.00 9.76  ? 7    TYR A CG  1 
ATOM   51   C CD1 . TYR A 1 7   ? -2.026  71.986  63.852 1.00 13.22 ? 7    TYR A CD1 1 
ATOM   52   C CD2 . TYR A 1 7   ? -4.063  71.134  64.755 1.00 13.43 ? 7    TYR A CD2 1 
ATOM   53   C CE1 . TYR A 1 7   ? -2.740  72.934  63.125 1.00 13.44 ? 7    TYR A CE1 1 
ATOM   54   C CE2 . TYR A 1 7   ? -4.784  72.079  64.034 1.00 14.12 ? 7    TYR A CE2 1 
ATOM   55   C CZ  . TYR A 1 7   ? -4.118  72.970  63.225 1.00 13.84 ? 7    TYR A CZ  1 
ATOM   56   O OH  . TYR A 1 7   ? -4.833  73.901  62.522 1.00 19.71 ? 7    TYR A OH  1 
ATOM   57   N N   . GLU A 1 8   ? -3.197  70.036  68.352 1.00 11.87 ? 8    GLU A N   1 
ATOM   58   C CA  . GLU A 1 8   ? -4.335  70.333  69.206 1.00 11.27 ? 8    GLU A CA  1 
ATOM   59   C C   . GLU A 1 8   ? -3.969  71.224  70.387 1.00 10.70 ? 8    GLU A C   1 
ATOM   60   O O   . GLU A 1 8   ? -4.785  72.028  70.834 1.00 9.00  ? 8    GLU A O   1 
ATOM   61   C CB  . GLU A 1 8   ? -4.994  69.039  69.696 1.00 16.47 ? 8    GLU A CB  1 
ATOM   62   C CG  . GLU A 1 8   ? -5.729  68.241  68.605 1.00 22.82 ? 8    GLU A CG  1 
ATOM   63   C CD  . GLU A 1 8   ? -4.797  67.649  67.543 1.00 28.70 ? 8    GLU A CD  1 
ATOM   64   O OE1 . GLU A 1 8   ? -3.693  67.171  67.899 1.00 25.17 ? 8    GLU A OE1 1 
ATOM   65   O OE2 . GLU A 1 8   ? -5.177  67.653  66.350 1.00 28.09 ? 8    GLU A OE2 1 
ATOM   66   N N   . ASP A 1 9   ? -2.741  71.094  70.885 1.00 10.00 ? 9    ASP A N   1 
ATOM   67   C CA  . ASP A 1 9   ? -2.285  71.909  72.012 1.00 10.52 ? 9    ASP A CA  1 
ATOM   68   C C   . ASP A 1 9   ? -2.253  73.381  71.631 1.00 8.89  ? 9    ASP A C   1 
ATOM   69   O O   . ASP A 1 9   ? -2.615  74.243  72.432 1.00 7.23  ? 9    ASP A O   1 
ATOM   70   C CB  . ASP A 1 9   ? -0.904  71.458  72.486 1.00 10.18 ? 9    ASP A CB  1 
ATOM   71   C CG  . ASP A 1 9   ? -0.931  70.081  73.111 1.00 13.49 ? 9    ASP A CG  1 
ATOM   72   O OD1 . ASP A 1 9   ? -1.914  69.769  73.815 1.00 10.78 ? 9    ASP A OD1 1 
ATOM   73   O OD2 . ASP A 1 9   ? 0.024   69.305  72.894 1.00 16.20 ? 9    ASP A OD2 1 
ATOM   74   N N   . TYR A 1 10  ? -1.833  73.661  70.399 1.00 8.53  ? 10   TYR A N   1 
ATOM   75   C CA  . TYR A 1 10  ? -1.775  75.033  69.908 1.00 8.69  ? 10   TYR A CA  1 
ATOM   76   C C   . TYR A 1 10  ? -3.200  75.566  69.781 1.00 8.90  ? 10   TYR A C   1 
ATOM   77   O O   . TYR A 1 10  ? -3.502  76.655  70.265 1.00 7.66  ? 10   TYR A O   1 
ATOM   78   C CB  . TYR A 1 10  ? -1.078  75.113  68.542 1.00 5.15  ? 10   TYR A CB  1 
ATOM   79   C CG  . TYR A 1 10  ? 0.372   74.681  68.537 1.00 6.51  ? 10   TYR A CG  1 
ATOM   80   C CD1 . TYR A 1 10  ? 1.380   75.544  68.961 1.00 3.68  ? 10   TYR A CD1 1 
ATOM   81   C CD2 . TYR A 1 10  ? 0.738   73.410  68.102 1.00 6.79  ? 10   TYR A CD2 1 
ATOM   82   C CE1 . TYR A 1 10  ? 2.721   75.148  68.951 1.00 5.55  ? 10   TYR A CE1 1 
ATOM   83   C CE2 . TYR A 1 10  ? 2.073   73.006  68.089 1.00 3.55  ? 10   TYR A CE2 1 
ATOM   84   C CZ  . TYR A 1 10  ? 3.053   73.877  68.514 1.00 3.36  ? 10   TYR A CZ  1 
ATOM   85   O OH  . TYR A 1 10  ? 4.368   73.475  68.495 1.00 6.86  ? 10   TYR A OH  1 
ATOM   86   N N   . GLN A 1 11  ? -4.081  74.802  69.136 1.00 10.77 ? 11   GLN A N   1 
ATOM   87   C CA  . GLN A 1 11  ? -5.455  75.260  68.979 1.00 13.36 ? 11   GLN A CA  1 
ATOM   88   C C   . GLN A 1 11  ? -6.196  75.384  70.306 1.00 12.54 ? 11   GLN A C   1 
ATOM   89   O O   . GLN A 1 11  ? -6.974  76.315  70.481 1.00 13.99 ? 11   GLN A O   1 
ATOM   90   C CB  . GLN A 1 11  ? -6.238  74.438  67.946 1.00 17.00 ? 11   GLN A CB  1 
ATOM   91   C CG  . GLN A 1 11  ? -6.530  72.995  68.287 1.00 24.96 ? 11   GLN A CG  1 
ATOM   92   C CD  . GLN A 1 11  ? -7.228  72.254  67.144 1.00 32.33 ? 11   GLN A CD  1 
ATOM   93   O OE1 . GLN A 1 11  ? -7.561  71.075  67.269 1.00 36.44 ? 11   GLN A OE1 1 
ATOM   94   N NE2 . GLN A 1 11  ? -7.451  72.942  66.027 1.00 29.67 ? 11   GLN A NE2 1 
ATOM   95   N N   . ASP A 1 12  ? -5.918  74.501  71.263 1.00 9.61  ? 12   ASP A N   1 
ATOM   96   C CA  . ASP A 1 12  ? -6.563  74.603  72.570 1.00 10.15 ? 12   ASP A CA  1 
ATOM   97   C C   . ASP A 1 12  ? -6.227  75.966  73.175 1.00 8.94  ? 12   ASP A C   1 
ATOM   98   O O   . ASP A 1 12  ? -7.113  76.671  73.658 1.00 8.30  ? 12   ASP A O   1 
ATOM   99   C CB  . ASP A 1 12  ? -6.090  73.492  73.517 1.00 13.14 ? 12   ASP A CB  1 
ATOM   100  C CG  . ASP A 1 12  ? -6.830  72.178  73.310 1.00 14.76 ? 12   ASP A CG  1 
ATOM   101  O OD1 . ASP A 1 12  ? -7.847  72.151  72.586 1.00 19.13 ? 12   ASP A OD1 1 
ATOM   102  O OD2 . ASP A 1 12  ? -6.390  71.161  73.888 1.00 16.52 ? 12   ASP A OD2 1 
ATOM   103  N N   . THR A 1 13  ? -4.946  76.333  73.142 1.00 8.71  ? 13   THR A N   1 
ATOM   104  C CA  . THR A 1 13  ? -4.493  77.617  73.668 1.00 6.48  ? 13   THR A CA  1 
ATOM   105  C C   . THR A 1 13  ? -5.118  78.773  72.870 1.00 7.25  ? 13   THR A C   1 
ATOM   106  O O   . THR A 1 13  ? -5.545  79.771  73.451 1.00 4.41  ? 13   THR A O   1 
ATOM   107  C CB  . THR A 1 13  ? -2.955  77.712  73.619 1.00 5.68  ? 13   THR A CB  1 
ATOM   108  O OG1 . THR A 1 13  ? -2.397  76.615  74.347 1.00 4.02  ? 13   THR A OG1 1 
ATOM   109  C CG2 . THR A 1 13  ? -2.463  79.025  74.236 1.00 2.12  ? 13   THR A CG2 1 
ATOM   110  N N   . ALA A 1 14  ? -5.192  78.627  71.548 1.00 4.54  ? 14   ALA A N   1 
ATOM   111  C CA  . ALA A 1 14  ? -5.785  79.663  70.704 1.00 4.02  ? 14   ALA A CA  1 
ATOM   112  C C   . ALA A 1 14  ? -7.274  79.843  71.031 1.00 5.25  ? 14   ALA A C   1 
ATOM   113  O O   . ALA A 1 14  ? -7.750  80.965  71.152 1.00 6.34  ? 14   ALA A O   1 
ATOM   114  C CB  . ALA A 1 14  ? -5.596  79.324  69.236 1.00 2.11  ? 14   ALA A CB  1 
ATOM   115  N N   . LYS A 1 15  ? -7.986  78.739  71.238 1.00 7.14  ? 15   LYS A N   1 
ATOM   116  C CA  . LYS A 1 15  ? -9.413  78.778  71.568 1.00 8.55  ? 15   LYS A CA  1 
ATOM   117  C C   . LYS A 1 15  ? -9.634  79.493  72.891 1.00 7.36  ? 15   LYS A C   1 
ATOM   118  O O   . LYS A 1 15  ? -10.579 80.272  73.031 1.00 7.67  ? 15   LYS A O   1 
ATOM   119  C CB  . LYS A 1 15  ? -9.998  77.363  71.683 1.00 12.54 ? 15   LYS A CB  1 
ATOM   120  C CG  . LYS A 1 15  ? -9.962  76.522  70.415 1.00 19.08 ? 15   LYS A CG  1 
ATOM   121  C CD  . LYS A 1 15  ? -10.833 77.086  69.310 1.00 24.49 ? 15   LYS A CD  1 
ATOM   122  C CE  . LYS A 1 15  ? -10.925 76.102  68.152 1.00 28.35 ? 15   LYS A CE  1 
ATOM   123  N NZ  . LYS A 1 15  ? -11.772 76.620  67.047 1.00 34.15 ? 15   LYS A NZ  1 
ATOM   124  N N   . TRP A 1 16  ? -8.771  79.208  73.862 1.00 4.31  ? 16   TRP A N   1 
ATOM   125  C CA  . TRP A 1 16  ? -8.862  79.821  75.182 1.00 4.42  ? 16   TRP A CA  1 
ATOM   126  C C   . TRP A 1 16  ? -8.729  81.339  75.074 1.00 4.40  ? 16   TRP A C   1 
ATOM   127  O O   . TRP A 1 16  ? -9.500  82.077  75.675 1.00 3.43  ? 16   TRP A O   1 
ATOM   128  C CB  . TRP A 1 16  ? -7.778  79.248  76.105 1.00 4.84  ? 16   TRP A CB  1 
ATOM   129  C CG  . TRP A 1 16  ? -7.913  79.639  77.563 1.00 6.88  ? 16   TRP A CG  1 
ATOM   130  C CD1 . TRP A 1 16  ? -8.561  78.938  78.550 1.00 4.63  ? 16   TRP A CD1 1 
ATOM   131  C CD2 . TRP A 1 16  ? -7.399  80.827  78.192 1.00 4.77  ? 16   TRP A CD2 1 
ATOM   132  N NE1 . TRP A 1 16  ? -8.485  79.617  79.739 1.00 2.29  ? 16   TRP A NE1 1 
ATOM   133  C CE2 . TRP A 1 16  ? -7.782  80.778  79.550 1.00 3.68  ? 16   TRP A CE2 1 
ATOM   134  C CE3 . TRP A 1 16  ? -6.657  81.927  77.736 1.00 4.40  ? 16   TRP A CE3 1 
ATOM   135  C CZ2 . TRP A 1 16  ? -7.451  81.793  80.456 1.00 4.52  ? 16   TRP A CZ2 1 
ATOM   136  C CZ3 . TRP A 1 16  ? -6.329  82.934  78.636 1.00 2.00  ? 16   TRP A CZ3 1 
ATOM   137  C CH2 . TRP A 1 16  ? -6.728  82.860  79.982 1.00 3.84  ? 16   TRP A CH2 1 
ATOM   138  N N   . LEU A 1 17  ? -7.763  81.810  74.295 1.00 5.16  ? 17   LEU A N   1 
ATOM   139  C CA  . LEU A 1 17  ? -7.567  83.245  74.136 1.00 3.50  ? 17   LEU A CA  1 
ATOM   140  C C   . LEU A 1 17  ? -8.782  83.876  73.454 1.00 5.83  ? 17   LEU A C   1 
ATOM   141  O O   . LEU A 1 17  ? -9.310  84.887  73.926 1.00 5.29  ? 17   LEU A O   1 
ATOM   142  C CB  . LEU A 1 17  ? -6.275  83.529  73.368 1.00 2.93  ? 17   LEU A CB  1 
ATOM   143  C CG  . LEU A 1 17  ? -5.005  83.207  74.171 1.00 3.50  ? 17   LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 17  ? -3.780  83.195  73.267 1.00 2.05  ? 17   LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 17  ? -4.834  84.207  75.308 1.00 2.03  ? 17   LEU A CD2 1 
ATOM   146  N N   . LEU A 1 18  ? -9.270  83.226  72.400 1.00 5.14  ? 18   LEU A N   1 
ATOM   147  C CA  . LEU A 1 18  ? -10.437 83.705  71.664 1.00 7.94  ? 18   LEU A CA  1 
ATOM   148  C C   . LEU A 1 18  ? -11.665 83.781  72.571 1.00 5.29  ? 18   LEU A C   1 
ATOM   149  O O   . LEU A 1 18  ? -12.493 84.675  72.431 1.00 8.24  ? 18   LEU A O   1 
ATOM   150  C CB  . LEU A 1 18  ? -10.727 82.808  70.449 1.00 5.57  ? 18   LEU A CB  1 
ATOM   151  C CG  . LEU A 1 18  ? -9.737  82.818  69.270 1.00 9.07  ? 18   LEU A CG  1 
ATOM   152  C CD1 . LEU A 1 18  ? -10.137 81.784  68.236 1.00 7.54  ? 18   LEU A CD1 1 
ATOM   153  C CD2 . LEU A 1 18  ? -9.670  84.189  68.621 1.00 6.12  ? 18   LEU A CD2 1 
ATOM   154  N N   . SER A 1 19  ? -11.743 82.884  73.543 1.00 7.35  ? 19   SER A N   1 
ATOM   155  C CA  . SER A 1 19  ? -12.868 82.852  74.475 1.00 8.55  ? 19   SER A CA  1 
ATOM   156  C C   . SER A 1 19  ? -12.755 83.840  75.636 1.00 7.44  ? 19   SER A C   1 
ATOM   157  O O   . SER A 1 19  ? -13.683 83.963  76.437 1.00 8.16  ? 19   SER A O   1 
ATOM   158  C CB  . SER A 1 19  ? -13.023 81.443  75.054 1.00 9.81  ? 19   SER A CB  1 
ATOM   159  O OG  . SER A 1 19  ? -13.271 80.496  74.030 1.00 23.93 ? 19   SER A OG  1 
ATOM   160  N N   . HIS A 1 20  ? -11.619 84.518  75.755 1.00 5.13  ? 20   HIS A N   1 
ATOM   161  C CA  . HIS A 1 20  ? -11.413 85.452  76.858 1.00 7.02  ? 20   HIS A CA  1 
ATOM   162  C C   . HIS A 1 20  ? -11.196 86.900  76.472 1.00 6.17  ? 20   HIS A C   1 
ATOM   163  O O   . HIS A 1 20  ? -10.928 87.737  77.337 1.00 8.76  ? 20   HIS A O   1 
ATOM   164  C CB  . HIS A 1 20  ? -10.270 84.970  77.746 1.00 4.59  ? 20   HIS A CB  1 
ATOM   165  C CG  . HIS A 1 20  ? -10.592 83.716  78.488 1.00 5.86  ? 20   HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 20  ? -10.995 83.715  79.805 1.00 7.30  ? 20   HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 20  ? -10.626 82.427  78.082 1.00 3.96  ? 20   HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 20  ? -11.268 82.478  80.177 1.00 12.88 ? 20   HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 20  ? -11.051 81.678  79.148 1.00 8.77  ? 20   HIS A NE2 1 
ATOM   170  N N   . THR A 1 21  ? -11.302 87.191  75.182 1.00 5.79  ? 21   THR A N   1 
ATOM   171  C CA  . THR A 1 21  ? -11.138 88.550  74.694 1.00 5.28  ? 21   THR A CA  1 
ATOM   172  C C   . THR A 1 21  ? -11.920 88.739  73.396 1.00 7.04  ? 21   THR A C   1 
ATOM   173  O O   . THR A 1 21  ? -12.206 87.773  72.694 1.00 7.33  ? 21   THR A O   1 
ATOM   174  C CB  . THR A 1 21  ? -9.646  88.913  74.481 1.00 4.02  ? 21   THR A CB  1 
ATOM   175  O OG1 . THR A 1 21  ? -9.545  90.318  74.211 1.00 7.29  ? 21   THR A OG1 1 
ATOM   176  C CG2 . THR A 1 21  ? -9.029  88.116  73.321 1.00 2.03  ? 21   THR A CG2 1 
ATOM   177  N N   . GLU A 1 22  ? -12.359 89.967  73.142 1.00 6.69  ? 22   GLU A N   1 
ATOM   178  C CA  . GLU A 1 22  ? -13.090 90.260  71.917 1.00 7.25  ? 22   GLU A CA  1 
ATOM   179  C C   . GLU A 1 22  ? -12.102 90.706  70.837 1.00 7.75  ? 22   GLU A C   1 
ATOM   180  O O   . GLU A 1 22  ? -12.451 90.783  69.660 1.00 10.44 ? 22   GLU A O   1 
ATOM   181  C CB  . GLU A 1 22  ? -14.141 91.351  72.153 1.00 8.90  ? 22   GLU A CB  1 
ATOM   182  C CG  . GLU A 1 22  ? -13.619 92.791  72.188 1.00 11.63 ? 22   GLU A CG  1 
ATOM   183  C CD  . GLU A 1 22  ? -12.828 93.140  73.441 1.00 14.62 ? 22   GLU A CD  1 
ATOM   184  O OE1 . GLU A 1 22  ? -12.984 92.463  74.480 1.00 12.73 ? 22   GLU A OE1 1 
ATOM   185  O OE2 . GLU A 1 22  ? -12.054 94.117  73.386 1.00 15.96 ? 22   GLU A OE2 1 
ATOM   186  N N   . GLN A 1 23  ? -10.867 90.982  71.247 1.00 5.44  ? 23   GLN A N   1 
ATOM   187  C CA  . GLN A 1 23  ? -9.821  91.431  70.334 1.00 7.20  ? 23   GLN A CA  1 
ATOM   188  C C   . GLN A 1 23  ? -9.431  90.353  69.331 1.00 5.94  ? 23   GLN A C   1 
ATOM   189  O O   . GLN A 1 23  ? -9.265  89.190  69.693 1.00 4.39  ? 23   GLN A O   1 
ATOM   190  C CB  . GLN A 1 23  ? -8.577  91.853  71.122 1.00 10.56 ? 23   GLN A CB  1 
ATOM   191  C CG  . GLN A 1 23  ? -8.748  93.089  71.987 1.00 18.62 ? 23   GLN A CG  1 
ATOM   192  C CD  . GLN A 1 23  ? -8.839  94.361  71.174 1.00 24.66 ? 23   GLN A CD  1 
ATOM   193  O OE1 . GLN A 1 23  ? -8.107  94.543  70.201 1.00 27.17 ? 23   GLN A OE1 1 
ATOM   194  N NE2 . GLN A 1 23  ? -9.733  95.255  71.571 1.00 29.27 ? 23   GLN A NE2 1 
ATOM   195  N N   . ARG A 1 24  ? -9.310  90.747  68.067 1.00 5.57  ? 24   ARG A N   1 
ATOM   196  C CA  . ARG A 1 24  ? -8.913  89.849  66.985 1.00 6.93  ? 24   ARG A CA  1 
ATOM   197  C C   . ARG A 1 24  ? -7.730  90.546  66.300 1.00 8.79  ? 24   ARG A C   1 
ATOM   198  O O   . ARG A 1 24  ? -7.908  91.329  65.359 1.00 9.00  ? 24   ARG A O   1 
ATOM   199  C CB  . ARG A 1 24  ? -10.057 89.660  65.977 1.00 9.08  ? 24   ARG A CB  1 
ATOM   200  C CG  . ARG A 1 24  ? -11.356 89.061  66.523 1.00 9.68  ? 24   ARG A CG  1 
ATOM   201  C CD  . ARG A 1 24  ? -11.248 87.573  66.860 1.00 9.99  ? 24   ARG A CD  1 
ATOM   202  N NE  . ARG A 1 24  ? -10.919 87.385  68.263 1.00 20.45 ? 24   ARG A NE  1 
ATOM   203  C CZ  . ARG A 1 24  ? -11.710 86.804  69.162 1.00 17.29 ? 24   ARG A CZ  1 
ATOM   204  N NH1 . ARG A 1 24  ? -12.895 86.320  68.821 1.00 16.60 ? 24   ARG A NH1 1 
ATOM   205  N NH2 . ARG A 1 24  ? -11.327 86.764  70.427 1.00 16.61 ? 24   ARG A NH2 1 
ATOM   206  N N   . PRO A 1 25  ? -6.508  90.307  66.795 1.00 6.28  ? 25   PRO A N   1 
ATOM   207  C CA  . PRO A 1 25  ? -5.290  90.912  66.247 1.00 7.96  ? 25   PRO A CA  1 
ATOM   208  C C   . PRO A 1 25  ? -4.843  90.362  64.898 1.00 7.85  ? 25   PRO A C   1 
ATOM   209  O O   . PRO A 1 25  ? -5.001  89.178  64.612 1.00 10.48 ? 25   PRO A O   1 
ATOM   210  C CB  . PRO A 1 25  ? -4.262  90.618  67.328 1.00 6.12  ? 25   PRO A CB  1 
ATOM   211  C CG  . PRO A 1 25  ? -4.688  89.258  67.799 1.00 9.75  ? 25   PRO A CG  1 
ATOM   212  C CD  . PRO A 1 25  ? -6.188  89.421  67.928 1.00 5.22  ? 25   PRO A CD  1 
ATOM   213  N N   . GLN A 1 26  ? -4.278  91.238  64.074 1.00 7.62  ? 26   GLN A N   1 
ATOM   214  C CA  . GLN A 1 26  ? -3.779  90.853  62.759 1.00 9.20  ? 26   GLN A CA  1 
ATOM   215  C C   . GLN A 1 26  ? -2.252  90.888  62.766 1.00 7.40  ? 26   GLN A C   1 
ATOM   216  O O   . GLN A 1 26  ? -1.599  90.251  61.934 1.00 5.95  ? 26   GLN A O   1 
ATOM   217  C CB  . GLN A 1 26  ? -4.311  91.808  61.685 1.00 19.08 ? 26   GLN A CB  1 
ATOM   218  C CG  . GLN A 1 26  ? -3.927  93.272  61.911 1.00 30.28 ? 26   GLN A CG  1 
ATOM   219  C CD  . GLN A 1 26  ? -4.348  94.184  60.766 1.00 39.14 ? 26   GLN A CD  1 
ATOM   220  O OE1 . GLN A 1 26  ? -3.549  94.504  59.883 1.00 39.08 ? 26   GLN A OE1 1 
ATOM   221  N NE2 . GLN A 1 26  ? -5.606  94.623  60.789 1.00 40.80 ? 26   GLN A NE2 1 
ATOM   222  N N   . VAL A 1 27  ? -1.698  91.638  63.716 1.00 7.46  ? 27   VAL A N   1 
ATOM   223  C CA  . VAL A 1 27  ? -0.256  91.796  63.878 1.00 7.15  ? 27   VAL A CA  1 
ATOM   224  C C   . VAL A 1 27  ? 0.150   91.300  65.266 1.00 6.39  ? 27   VAL A C   1 
ATOM   225  O O   . VAL A 1 27  ? -0.588  91.482  66.237 1.00 6.56  ? 27   VAL A O   1 
ATOM   226  C CB  . VAL A 1 27  ? 0.162   93.293  63.770 1.00 7.77  ? 27   VAL A CB  1 
ATOM   227  C CG1 . VAL A 1 27  ? 1.668   93.440  63.915 1.00 6.88  ? 27   VAL A CG1 1 
ATOM   228  C CG2 . VAL A 1 27  ? -0.302  93.885  62.457 1.00 4.29  ? 27   VAL A CG2 1 
ATOM   229  N N   . ALA A 1 28  ? 1.310   90.661  65.352 1.00 5.97  ? 28   ALA A N   1 
ATOM   230  C CA  . ALA A 1 28  ? 1.831   90.172  66.622 1.00 6.72  ? 28   ALA A CA  1 
ATOM   231  C C   . ALA A 1 28  ? 3.192   90.821  66.794 1.00 7.74  ? 28   ALA A C   1 
ATOM   232  O O   . ALA A 1 28  ? 3.947   90.935  65.828 1.00 10.22 ? 28   ALA A O   1 
ATOM   233  C CB  . ALA A 1 28  ? 1.972   88.656  66.598 1.00 6.00  ? 28   ALA A CB  1 
ATOM   234  N N   . VAL A 1 29  ? 3.494   91.285  68.002 1.00 6.84  ? 29   VAL A N   1 
ATOM   235  C CA  . VAL A 1 29  ? 4.780   91.920  68.269 1.00 5.95  ? 29   VAL A CA  1 
ATOM   236  C C   . VAL A 1 29  ? 5.449   91.224  69.443 1.00 7.72  ? 29   VAL A C   1 
ATOM   237  O O   . VAL A 1 29  ? 4.801   90.958  70.457 1.00 7.20  ? 29   VAL A O   1 
ATOM   238  C CB  . VAL A 1 29  ? 4.636   93.433  68.622 1.00 7.56  ? 29   VAL A CB  1 
ATOM   239  C CG1 . VAL A 1 29  ? 6.013   94.041  68.898 1.00 2.06  ? 29   VAL A CG1 1 
ATOM   240  C CG2 . VAL A 1 29  ? 3.950   94.191  67.492 1.00 2.08  ? 29   VAL A CG2 1 
ATOM   241  N N   . ILE A 1 30  ? 6.732   90.906  69.297 1.00 5.47  ? 30   ILE A N   1 
ATOM   242  C CA  . ILE A 1 30  ? 7.481   90.261  70.364 1.00 4.77  ? 30   ILE A CA  1 
ATOM   243  C C   . ILE A 1 30  ? 8.495   91.268  70.875 1.00 7.13  ? 30   ILE A C   1 
ATOM   244  O O   . ILE A 1 30  ? 9.364   91.717  70.121 1.00 5.19  ? 30   ILE A O   1 
ATOM   245  C CB  . ILE A 1 30  ? 8.201   88.996  69.874 1.00 5.41  ? 30   ILE A CB  1 
ATOM   246  C CG1 . ILE A 1 30  ? 7.176   87.987  69.356 1.00 3.90  ? 30   ILE A CG1 1 
ATOM   247  C CG2 . ILE A 1 30  ? 9.005   88.372  71.021 1.00 4.64  ? 30   ILE A CG2 1 
ATOM   248  C CD1 . ILE A 1 30  ? 7.789   86.720  68.802 1.00 8.10  ? 30   ILE A CD1 1 
ATOM   249  N N   . CYS A 1 31  ? 8.373   91.631  72.150 1.00 6.51  ? 31   CYS A N   1 
ATOM   250  C CA  . CYS A 1 31  ? 9.262   92.611  72.763 1.00 7.92  ? 31   CYS A CA  1 
ATOM   251  C C   . CYS A 1 31  ? 10.459  91.980  73.468 1.00 8.33  ? 31   CYS A C   1 
ATOM   252  O O   . CYS A 1 31  ? 10.311  91.074  74.295 1.00 8.12  ? 31   CYS A O   1 
ATOM   253  C CB  . CYS A 1 31  ? 8.486   93.493  73.745 1.00 8.40  ? 31   CYS A CB  1 
ATOM   254  S SG  . CYS A 1 31  ? 7.001   94.276  73.059 1.00 16.28 ? 31   CYS A SG  1 
ATOM   255  N N   . GLY A 1 32  ? 11.646  92.476  73.134 1.00 9.57  ? 32   GLY A N   1 
ATOM   256  C CA  . GLY A 1 32  ? 12.865  91.970  73.731 1.00 10.48 ? 32   GLY A CA  1 
ATOM   257  C C   . GLY A 1 32  ? 13.265  92.696  75.000 1.00 12.15 ? 32   GLY A C   1 
ATOM   258  O O   . GLY A 1 32  ? 12.470  93.438  75.585 1.00 9.81  ? 32   GLY A O   1 
ATOM   259  N N   . SER A 1 33  ? 14.515  92.489  75.414 1.00 12.39 ? 33   SER A N   1 
ATOM   260  C CA  . SER A 1 33  ? 15.056  93.101  76.625 1.00 15.31 ? 33   SER A CA  1 
ATOM   261  C C   . SER A 1 33  ? 14.979  94.618  76.598 1.00 15.60 ? 33   SER A C   1 
ATOM   262  O O   . SER A 1 33  ? 15.444  95.257  75.645 1.00 14.10 ? 33   SER A O   1 
ATOM   263  C CB  . SER A 1 33  ? 16.509  92.672  76.838 1.00 13.75 ? 33   SER A CB  1 
ATOM   264  O OG  . SER A 1 33  ? 16.602  91.297  77.171 1.00 15.62 ? 33   SER A OG  1 
ATOM   265  N N   . GLY A 1 34  ? 14.371  95.181  77.639 1.00 16.48 ? 34   GLY A N   1 
ATOM   266  C CA  . GLY A 1 34  ? 14.239  96.622  77.745 1.00 16.99 ? 34   GLY A CA  1 
ATOM   267  C C   . GLY A 1 34  ? 13.347  97.253  76.692 1.00 16.54 ? 34   GLY A C   1 
ATOM   268  O O   . GLY A 1 34  ? 13.371  98.468  76.512 1.00 16.06 ? 34   GLY A O   1 
ATOM   269  N N   . LEU A 1 35  ? 12.550  96.437  76.006 1.00 15.53 ? 35   LEU A N   1 
ATOM   270  C CA  . LEU A 1 35  ? 11.647  96.939  74.973 1.00 16.78 ? 35   LEU A CA  1 
ATOM   271  C C   . LEU A 1 35  ? 10.185  96.759  75.374 1.00 14.20 ? 35   LEU A C   1 
ATOM   272  O O   . LEU A 1 35  ? 9.272   97.047  74.597 1.00 13.40 ? 35   LEU A O   1 
ATOM   273  C CB  . LEU A 1 35  ? 11.922  96.239  73.636 1.00 19.37 ? 35   LEU A CB  1 
ATOM   274  C CG  . LEU A 1 35  ? 13.388  96.239  73.183 1.00 24.03 ? 35   LEU A CG  1 
ATOM   275  C CD1 . LEU A 1 35  ? 13.505  95.580  71.831 1.00 29.11 ? 35   LEU A CD1 1 
ATOM   276  C CD2 . LEU A 1 35  ? 13.947  97.657  73.135 1.00 25.83 ? 35   LEU A CD2 1 
ATOM   277  N N   . GLY A 1 36  ? 9.965   96.328  76.609 1.00 15.01 ? 36   GLY A N   1 
ATOM   278  C CA  . GLY A 1 36  ? 8.611   96.123  77.092 1.00 18.57 ? 36   GLY A CA  1 
ATOM   279  C C   . GLY A 1 36  ? 7.736   97.367  77.140 1.00 17.57 ? 36   GLY A C   1 
ATOM   280  O O   . GLY A 1 36  ? 6.523   97.263  77.311 1.00 19.69 ? 36   GLY A O   1 
ATOM   281  N N   . GLY A 1 37  ? 8.338   98.537  76.956 1.00 17.69 ? 37   GLY A N   1 
ATOM   282  C CA  . GLY A 1 37  ? 7.584   99.779  76.993 1.00 19.29 ? 37   GLY A CA  1 
ATOM   283  C C   . GLY A 1 37  ? 6.631   99.990  75.831 1.00 19.49 ? 37   GLY A C   1 
ATOM   284  O O   . GLY A 1 37  ? 5.701   100.791 75.934 1.00 17.82 ? 37   GLY A O   1 
ATOM   285  N N   . LEU A 1 38  ? 6.852   99.268  74.735 1.00 20.31 ? 38   LEU A N   1 
ATOM   286  C CA  . LEU A 1 38  ? 6.014   99.369  73.538 1.00 19.03 ? 38   LEU A CA  1 
ATOM   287  C C   . LEU A 1 38  ? 4.529   99.123  73.825 1.00 19.98 ? 38   LEU A C   1 
ATOM   288  O O   . LEU A 1 38  ? 3.660   99.617  73.108 1.00 19.70 ? 38   LEU A O   1 
ATOM   289  C CB  . LEU A 1 38  ? 6.512   98.387  72.474 1.00 20.73 ? 38   LEU A CB  1 
ATOM   290  C CG  . LEU A 1 38  ? 7.932   98.633  71.946 1.00 25.11 ? 38   LEU A CG  1 
ATOM   291  C CD1 . LEU A 1 38  ? 8.512   97.366  71.329 1.00 24.47 ? 38   LEU A CD1 1 
ATOM   292  C CD2 . LEU A 1 38  ? 7.922   99.769  70.937 1.00 24.93 ? 38   LEU A CD2 1 
ATOM   293  N N   . VAL A 1 39  ? 4.246   98.366  74.881 1.00 19.99 ? 39   VAL A N   1 
ATOM   294  C CA  . VAL A 1 39  ? 2.878   98.052  75.283 1.00 21.30 ? 39   VAL A CA  1 
ATOM   295  C C   . VAL A 1 39  ? 2.103   99.279  75.780 1.00 23.40 ? 39   VAL A C   1 
ATOM   296  O O   . VAL A 1 39  ? 0.881   99.344  75.646 1.00 24.37 ? 39   VAL A O   1 
ATOM   297  C CB  . VAL A 1 39  ? 2.883   96.958  76.383 1.00 23.17 ? 39   VAL A CB  1 
ATOM   298  C CG1 . VAL A 1 39  ? 1.540   96.880  77.085 1.00 26.21 ? 39   VAL A CG1 1 
ATOM   299  C CG2 . VAL A 1 39  ? 3.228   95.608  75.769 1.00 22.37 ? 39   VAL A CG2 1 
ATOM   300  N N   . ASN A 1 40  ? 2.822   100.273 76.291 1.00 25.80 ? 40   ASN A N   1 
ATOM   301  C CA  . ASN A 1 40  ? 2.209   101.488 76.830 1.00 28.43 ? 40   ASN A CA  1 
ATOM   302  C C   . ASN A 1 40  ? 1.404   102.332 75.857 1.00 27.77 ? 40   ASN A C   1 
ATOM   303  O O   . ASN A 1 40  ? 0.713   103.258 76.270 1.00 27.40 ? 40   ASN A O   1 
ATOM   304  C CB  . ASN A 1 40  ? 3.269   102.375 77.489 1.00 30.93 ? 40   ASN A CB  1 
ATOM   305  C CG  . ASN A 1 40  ? 3.827   101.773 78.763 1.00 33.63 ? 40   ASN A CG  1 
ATOM   306  O OD1 . ASN A 1 40  ? 3.157   100.993 79.444 1.00 34.32 ? 40   ASN A OD1 1 
ATOM   307  N ND2 . ASN A 1 40  ? 5.062   102.132 79.095 1.00 35.33 ? 40   ASN A ND2 1 
ATOM   308  N N   . LYS A 1 41  ? 1.517   102.041 74.567 1.00 28.16 ? 41   LYS A N   1 
ATOM   309  C CA  . LYS A 1 41  ? 0.801   102.802 73.550 1.00 28.13 ? 41   LYS A CA  1 
ATOM   310  C C   . LYS A 1 41  ? -0.509  102.139 73.119 1.00 26.75 ? 41   LYS A C   1 
ATOM   311  O O   . LYS A 1 41  ? -1.213  102.650 72.245 1.00 25.93 ? 41   LYS A O   1 
ATOM   312  C CB  . LYS A 1 41  ? 1.703   103.009 72.326 1.00 33.34 ? 41   LYS A CB  1 
ATOM   313  C CG  . LYS A 1 41  ? 3.043   103.673 72.630 1.00 38.17 ? 41   LYS A CG  1 
ATOM   314  C CD  . LYS A 1 41  ? 2.852   105.037 73.285 1.00 42.29 ? 41   LYS A CD  1 
ATOM   315  C CE  . LYS A 1 41  ? 2.066   105.983 72.385 1.00 43.53 ? 41   LYS A CE  1 
ATOM   316  N NZ  . LYS A 1 41  ? 1.685   107.241 73.088 1.00 46.92 ? 41   LYS A NZ  1 
ATOM   317  N N   . LEU A 1 42  ? -0.827  101.001 73.727 1.00 24.79 ? 42   LEU A N   1 
ATOM   318  C CA  . LEU A 1 42  ? -2.042  100.264 73.394 1.00 22.02 ? 42   LEU A CA  1 
ATOM   319  C C   . LEU A 1 42  ? -3.289  100.848 74.030 1.00 21.77 ? 42   LEU A C   1 
ATOM   320  O O   . LEU A 1 42  ? -3.283  101.261 75.193 1.00 22.67 ? 42   LEU A O   1 
ATOM   321  C CB  . LEU A 1 42  ? -1.922  98.796  73.819 1.00 18.27 ? 42   LEU A CB  1 
ATOM   322  C CG  . LEU A 1 42  ? -0.871  97.931  73.131 1.00 16.56 ? 42   LEU A CG  1 
ATOM   323  C CD1 . LEU A 1 42  ? -0.939  96.510  73.665 1.00 16.93 ? 42   LEU A CD1 1 
ATOM   324  C CD2 . LEU A 1 42  ? -1.109  97.944  71.638 1.00 14.72 ? 42   LEU A CD2 1 
ATOM   325  N N   . THR A 1 43  ? -4.361  100.885 73.255 1.00 20.24 ? 43   THR A N   1 
ATOM   326  C CA  . THR A 1 43  ? -5.638  101.366 73.752 1.00 20.24 ? 43   THR A CA  1 
ATOM   327  C C   . THR A 1 43  ? -6.522  100.119 73.838 1.00 19.77 ? 43   THR A C   1 
ATOM   328  O O   . THR A 1 43  ? -6.330  99.162  73.071 1.00 16.36 ? 43   THR A O   1 
ATOM   329  C CB  . THR A 1 43  ? -6.274  102.413 72.797 1.00 19.61 ? 43   THR A CB  1 
ATOM   330  O OG1 . THR A 1 43  ? -6.326  101.895 71.463 1.00 21.36 ? 43   THR A OG1 1 
ATOM   331  C CG2 . THR A 1 43  ? -5.463  103.693 72.793 1.00 21.89 ? 43   THR A CG2 1 
ATOM   332  N N   . GLN A 1 44  ? -7.452  100.103 74.791 1.00 18.07 ? 44   GLN A N   1 
ATOM   333  C CA  . GLN A 1 44  ? -8.354  98.959  74.959 1.00 14.78 ? 44   GLN A CA  1 
ATOM   334  C C   . GLN A 1 44  ? -7.548  97.683  75.219 1.00 12.53 ? 44   GLN A C   1 
ATOM   335  O O   . GLN A 1 44  ? -7.923  96.592  74.780 1.00 12.82 ? 44   GLN A O   1 
ATOM   336  C CB  . GLN A 1 44  ? -9.211  98.779  73.702 1.00 16.41 ? 44   GLN A CB  1 
ATOM   337  C CG  . GLN A 1 44  ? -10.019 100.002 73.311 1.00 23.30 ? 44   GLN A CG  1 
ATOM   338  C CD  . GLN A 1 44  ? -10.848 99.776  72.062 1.00 27.35 ? 44   GLN A CD  1 
ATOM   339  O OE1 . GLN A 1 44  ? -11.572 98.784  71.952 1.00 29.32 ? 44   GLN A OE1 1 
ATOM   340  N NE2 . GLN A 1 44  ? -10.743 100.696 71.108 1.00 28.23 ? 44   GLN A NE2 1 
ATOM   341  N N   . ALA A 1 45  ? -6.445  97.833  75.943 1.00 10.36 ? 45   ALA A N   1 
ATOM   342  C CA  . ALA A 1 45  ? -5.564  96.716  76.252 1.00 10.64 ? 45   ALA A CA  1 
ATOM   343  C C   . ALA A 1 45  ? -6.123  95.725  77.262 1.00 10.78 ? 45   ALA A C   1 
ATOM   344  O O   . ALA A 1 45  ? -6.779  96.110  78.230 1.00 12.81 ? 45   ALA A O   1 
ATOM   345  C CB  . ALA A 1 45  ? -4.220  97.236  76.738 1.00 12.14 ? 45   ALA A CB  1 
ATOM   346  N N   . GLN A 1 46  ? -5.873  94.445  77.016 1.00 6.28  ? 46   GLN A N   1 
ATOM   347  C CA  . GLN A 1 46  ? -6.294  93.389  77.917 1.00 4.21  ? 46   GLN A CA  1 
ATOM   348  C C   . GLN A 1 46  ? -5.029  92.581  78.110 1.00 7.53  ? 46   GLN A C   1 
ATOM   349  O O   . GLN A 1 46  ? -4.372  92.204  77.137 1.00 9.31  ? 46   GLN A O   1 
ATOM   350  C CB  . GLN A 1 46  ? -7.398  92.527  77.314 1.00 5.85  ? 46   GLN A CB  1 
ATOM   351  C CG  . GLN A 1 46  ? -7.864  91.437  78.272 1.00 3.07  ? 46   GLN A CG  1 
ATOM   352  C CD  . GLN A 1 46  ? -9.158  90.781  77.850 1.00 6.09  ? 46   GLN A CD  1 
ATOM   353  O OE1 . GLN A 1 46  ? -9.788  91.187  76.874 1.00 6.91  ? 46   GLN A OE1 1 
ATOM   354  N NE2 . GLN A 1 46  ? -9.558  89.748  78.574 1.00 6.50  ? 46   GLN A NE2 1 
ATOM   355  N N   . THR A 1 47  ? -4.683  92.326  79.362 1.00 7.92  ? 47   THR A N   1 
ATOM   356  C CA  . THR A 1 47  ? -3.459  91.622  79.680 1.00 8.83  ? 47   THR A CA  1 
ATOM   357  C C   . THR A 1 47  ? -3.701  90.229  80.230 1.00 10.43 ? 47   THR A C   1 
ATOM   358  O O   . THR A 1 47  ? -4.681  89.987  80.933 1.00 7.93  ? 47   THR A O   1 
ATOM   359  C CB  . THR A 1 47  ? -2.631  92.440  80.706 1.00 9.63  ? 47   THR A CB  1 
ATOM   360  O OG1 . THR A 1 47  ? -2.412  93.763  80.200 1.00 11.01 ? 47   THR A OG1 1 
ATOM   361  C CG2 . THR A 1 47  ? -1.283  91.798  80.958 1.00 12.39 ? 47   THR A CG2 1 
ATOM   362  N N   . PHE A 1 48  ? -2.822  89.309  79.854 1.00 7.49  ? 48   PHE A N   1 
ATOM   363  C CA  . PHE A 1 48  ? -2.879  87.940  80.335 1.00 12.21 ? 48   PHE A CA  1 
ATOM   364  C C   . PHE A 1 48  ? -1.463  87.597  80.784 1.00 13.22 ? 48   PHE A C   1 
ATOM   365  O O   . PHE A 1 48  ? -0.507  87.813  80.046 1.00 14.20 ? 48   PHE A O   1 
ATOM   366  C CB  . PHE A 1 48  ? -3.307  86.965  79.230 1.00 10.14 ? 48   PHE A CB  1 
ATOM   367  C CG  . PHE A 1 48  ? -4.759  87.056  78.859 1.00 12.27 ? 48   PHE A CG  1 
ATOM   368  C CD1 . PHE A 1 48  ? -5.736  86.500  79.679 1.00 13.61 ? 48   PHE A CD1 1 
ATOM   369  C CD2 . PHE A 1 48  ? -5.151  87.704  77.693 1.00 12.29 ? 48   PHE A CD2 1 
ATOM   370  C CE1 . PHE A 1 48  ? -7.082  86.590  79.348 1.00 11.32 ? 48   PHE A CE1 1 
ATOM   371  C CE2 . PHE A 1 48  ? -6.499  87.800  77.349 1.00 14.38 ? 48   PHE A CE2 1 
ATOM   372  C CZ  . PHE A 1 48  ? -7.464  87.243  78.178 1.00 13.10 ? 48   PHE A CZ  1 
ATOM   373  N N   . ASP A 1 49  ? -1.314  87.142  82.020 1.00 11.37 ? 49   ASP A N   1 
ATOM   374  C CA  . ASP A 1 49  ? -0.001  86.754  82.498 1.00 10.45 ? 49   ASP A CA  1 
ATOM   375  C C   . ASP A 1 49  ? 0.266   85.400  81.843 1.00 4.81  ? 49   ASP A C   1 
ATOM   376  O O   . ASP A 1 49  ? -0.649  84.592  81.722 1.00 2.32  ? 49   ASP A O   1 
ATOM   377  C CB  . ASP A 1 49  ? -0.008  86.628  84.017 1.00 15.97 ? 49   ASP A CB  1 
ATOM   378  C CG  . ASP A 1 49  ? 1.386   86.636  84.601 1.00 27.16 ? 49   ASP A CG  1 
ATOM   379  O OD1 . ASP A 1 49  ? 1.895   87.739  84.905 1.00 31.96 ? 49   ASP A OD1 1 
ATOM   380  O OD2 . ASP A 1 49  ? 1.979   85.544  84.738 1.00 29.27 ? 49   ASP A OD2 1 
ATOM   381  N N   . TYR A 1 50  ? 1.496   85.150  81.405 1.00 3.43  ? 50   TYR A N   1 
ATOM   382  C CA  . TYR A 1 50  ? 1.808   83.874  80.758 1.00 2.18  ? 50   TYR A CA  1 
ATOM   383  C C   . TYR A 1 50  ? 1.391   82.692  81.621 1.00 4.46  ? 50   TYR A C   1 
ATOM   384  O O   . TYR A 1 50  ? 0.932   81.682  81.108 1.00 5.88  ? 50   TYR A O   1 
ATOM   385  C CB  . TYR A 1 50  ? 3.301   83.752  80.436 1.00 2.49  ? 50   TYR A CB  1 
ATOM   386  C CG  . TYR A 1 50  ? 3.802   84.678  79.351 1.00 3.91  ? 50   TYR A CG  1 
ATOM   387  C CD1 . TYR A 1 50  ? 2.916   85.326  78.491 1.00 2.25  ? 50   TYR A CD1 1 
ATOM   388  C CD2 . TYR A 1 50  ? 5.168   84.940  79.214 1.00 4.84  ? 50   TYR A CD2 1 
ATOM   389  C CE1 . TYR A 1 50  ? 3.376   86.213  77.529 1.00 5.73  ? 50   TYR A CE1 1 
ATOM   390  C CE2 . TYR A 1 50  ? 5.640   85.829  78.253 1.00 3.39  ? 50   TYR A CE2 1 
ATOM   391  C CZ  . TYR A 1 50  ? 4.738   86.463  77.419 1.00 3.97  ? 50   TYR A CZ  1 
ATOM   392  O OH  . TYR A 1 50  ? 5.184   87.361  76.488 1.00 4.36  ? 50   TYR A OH  1 
ATOM   393  N N   . SER A 1 51  ? 1.489   82.846  82.937 1.00 6.15  ? 51   SER A N   1 
ATOM   394  C CA  . SER A 1 51  ? 1.138   81.765  83.858 1.00 9.23  ? 51   SER A CA  1 
ATOM   395  C C   . SER A 1 51  ? -0.337  81.364  83.869 1.00 7.36  ? 51   SER A C   1 
ATOM   396  O O   . SER A 1 51  ? -0.678  80.294  84.359 1.00 8.10  ? 51   SER A O   1 
ATOM   397  C CB  . SER A 1 51  ? 1.586   82.107  85.281 1.00 9.72  ? 51   SER A CB  1 
ATOM   398  O OG  . SER A 1 51  ? 0.915   83.257  85.770 1.00 15.95 ? 51   SER A OG  1 
ATOM   399  N N   . GLU A 1 52  ? -1.214  82.215  83.348 1.00 6.60  ? 52   GLU A N   1 
ATOM   400  C CA  . GLU A 1 52  ? -2.638  81.890  83.337 1.00 8.52  ? 52   GLU A CA  1 
ATOM   401  C C   . GLU A 1 52  ? -3.135  81.311  82.019 1.00 6.67  ? 52   GLU A C   1 
ATOM   402  O O   . GLU A 1 52  ? -4.257  80.834  81.939 1.00 6.44  ? 52   GLU A O   1 
ATOM   403  C CB  . GLU A 1 52  ? -3.476  83.114  83.713 1.00 12.64 ? 52   GLU A CB  1 
ATOM   404  C CG  . GLU A 1 52  ? -3.524  84.203  82.666 1.00 16.52 ? 52   GLU A CG  1 
ATOM   405  C CD  . GLU A 1 52  ? -4.336  85.400  83.119 1.00 20.18 ? 52   GLU A CD  1 
ATOM   406  O OE1 . GLU A 1 52  ? -5.576  85.365  82.981 1.00 25.42 ? 52   GLU A OE1 1 
ATOM   407  O OE2 . GLU A 1 52  ? -3.736  86.375  83.612 1.00 19.13 ? 52   GLU A OE2 1 
ATOM   408  N N   . ILE A 1 53  ? -2.300  81.351  80.986 1.00 8.17  ? 53   ILE A N   1 
ATOM   409  C CA  . ILE A 1 53  ? -2.679  80.843  79.672 1.00 5.15  ? 53   ILE A CA  1 
ATOM   410  C C   . ILE A 1 53  ? -2.218  79.401  79.534 1.00 4.90  ? 53   ILE A C   1 
ATOM   411  O O   . ILE A 1 53  ? -1.026  79.124  79.570 1.00 5.55  ? 53   ILE A O   1 
ATOM   412  C CB  . ILE A 1 53  ? -2.018  81.663  78.545 1.00 2.04  ? 53   ILE A CB  1 
ATOM   413  C CG1 . ILE A 1 53  ? -2.339  83.150  78.703 1.00 3.12  ? 53   ILE A CG1 1 
ATOM   414  C CG2 . ILE A 1 53  ? -2.505  81.167  77.191 1.00 2.14  ? 53   ILE A CG2 1 
ATOM   415  C CD1 . ILE A 1 53  ? -1.446  84.047  77.880 1.00 3.78  ? 53   ILE A CD1 1 
ATOM   416  N N   . PRO A 1 54  ? -3.155  78.469  79.313 1.00 7.83  ? 54   PRO A N   1 
ATOM   417  C CA  . PRO A 1 54  ? -2.800  77.052  79.168 1.00 6.82  ? 54   PRO A CA  1 
ATOM   418  C C   . PRO A 1 54  ? -1.670  76.826  78.150 1.00 9.16  ? 54   PRO A C   1 
ATOM   419  O O   . PRO A 1 54  ? -1.610  77.498  77.118 1.00 10.03 ? 54   PRO A O   1 
ATOM   420  C CB  . PRO A 1 54  ? -4.116  76.425  78.690 1.00 5.65  ? 54   PRO A CB  1 
ATOM   421  C CG  . PRO A 1 54  ? -5.151  77.284  79.335 1.00 2.83  ? 54   PRO A CG  1 
ATOM   422  C CD  . PRO A 1 54  ? -4.599  78.672  79.116 1.00 5.36  ? 54   PRO A CD  1 
ATOM   423  N N   . ASN A 1 55  ? -0.737  75.942  78.500 1.00 8.35  ? 55   ASN A N   1 
ATOM   424  C CA  . ASN A 1 55  ? 0.397   75.562  77.645 1.00 10.22 ? 55   ASN A CA  1 
ATOM   425  C C   . ASN A 1 55  ? 1.516   76.584  77.406 1.00 11.24 ? 55   ASN A C   1 
ATOM   426  O O   . ASN A 1 55  ? 2.545   76.240  76.820 1.00 12.94 ? 55   ASN A O   1 
ATOM   427  C CB  . ASN A 1 55  ? -0.102  75.032  76.290 1.00 11.35 ? 55   ASN A CB  1 
ATOM   428  C CG  . ASN A 1 55  ? -1.041  73.840  76.429 1.00 15.50 ? 55   ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 55  ? -2.038  73.734  75.712 1.00 15.86 ? 55   ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 55  ? -0.725  72.935  77.350 1.00 14.12 ? 55   ASN A ND2 1 
ATOM   431  N N   . PHE A 1 56  ? 1.335   77.817  77.869 1.00 11.66 ? 56   PHE A N   1 
ATOM   432  C CA  . PHE A 1 56  ? 2.330   78.880  77.693 1.00 12.21 ? 56   PHE A CA  1 
ATOM   433  C C   . PHE A 1 56  ? 3.510   78.762  78.661 1.00 12.99 ? 56   PHE A C   1 
ATOM   434  O O   . PHE A 1 56  ? 3.322   78.413  79.825 1.00 13.75 ? 56   PHE A O   1 
ATOM   435  C CB  . PHE A 1 56  ? 1.664   80.243  77.919 1.00 8.17  ? 56   PHE A CB  1 
ATOM   436  C CG  . PHE A 1 56  ? 1.744   81.170  76.742 1.00 7.65  ? 56   PHE A CG  1 
ATOM   437  C CD1 . PHE A 1 56  ? 0.800   81.111  75.729 1.00 6.36  ? 56   PHE A CD1 1 
ATOM   438  C CD2 . PHE A 1 56  ? 2.743   82.132  76.665 1.00 10.36 ? 56   PHE A CD2 1 
ATOM   439  C CE1 . PHE A 1 56  ? 0.845   82.000  74.657 1.00 7.97  ? 56   PHE A CE1 1 
ATOM   440  C CE2 . PHE A 1 56  ? 2.797   83.025  75.597 1.00 8.28  ? 56   PHE A CE2 1 
ATOM   441  C CZ  . PHE A 1 56  ? 1.844   82.957  74.594 1.00 6.72  ? 56   PHE A CZ  1 
ATOM   442  N N   . PRO A 1 57  ? 4.749   78.971  78.173 1.00 11.71 ? 57   PRO A N   1 
ATOM   443  C CA  . PRO A 1 57  ? 5.935   78.897  79.038 1.00 10.93 ? 57   PRO A CA  1 
ATOM   444  C C   . PRO A 1 57  ? 6.003   80.212  79.832 1.00 12.95 ? 57   PRO A C   1 
ATOM   445  O O   . PRO A 1 57  ? 5.125   81.059  79.686 1.00 14.75 ? 57   PRO A O   1 
ATOM   446  C CB  . PRO A 1 57  ? 7.085   78.824  78.029 1.00 9.07  ? 57   PRO A CB  1 
ATOM   447  C CG  . PRO A 1 57  ? 6.450   78.253  76.805 1.00 10.54 ? 57   PRO A CG  1 
ATOM   448  C CD  . PRO A 1 57  ? 5.150   78.995  76.758 1.00 8.36  ? 57   PRO A CD  1 
ATOM   449  N N   . GLU A 1 58  ? 7.054   80.412  80.625 1.00 17.87 ? 58   GLU A N   1 
ATOM   450  C CA  . GLU A 1 58  ? 7.195   81.649  81.403 1.00 21.56 ? 58   GLU A CA  1 
ATOM   451  C C   . GLU A 1 58  ? 8.565   82.309  81.257 1.00 22.67 ? 58   GLU A C   1 
ATOM   452  O O   . GLU A 1 58  ? 9.596   81.637  81.243 1.00 22.42 ? 58   GLU A O   1 
ATOM   453  C CB  . GLU A 1 58  ? 6.907   81.398  82.886 1.00 24.61 ? 58   GLU A CB  1 
ATOM   454  C CG  . GLU A 1 58  ? 5.550   81.926  83.372 1.00 33.66 ? 58   GLU A CG  1 
ATOM   455  C CD  . GLU A 1 58  ? 5.465   83.457  83.453 1.00 37.52 ? 58   GLU A CD  1 
ATOM   456  O OE1 . GLU A 1 58  ? 6.482   84.156  83.226 1.00 36.42 ? 58   GLU A OE1 1 
ATOM   457  O OE2 . GLU A 1 58  ? 4.363   83.965  83.761 1.00 39.77 ? 58   GLU A OE2 1 
ATOM   458  N N   . SER A 1 59  ? 8.581   83.630  81.136 1.00 23.41 ? 59   SER A N   1 
ATOM   459  C CA  . SER A 1 59  ? 9.843   84.343  81.003 1.00 23.92 ? 59   SER A CA  1 
ATOM   460  C C   . SER A 1 59  ? 10.427  84.541  82.401 1.00 23.88 ? 59   SER A C   1 
ATOM   461  O O   . SER A 1 59  ? 9.732   85.002  83.309 1.00 22.35 ? 59   SER A O   1 
ATOM   462  C CB  . SER A 1 59  ? 9.626   85.681  80.296 1.00 22.82 ? 59   SER A CB  1 
ATOM   463  O OG  . SER A 1 59  ? 8.577   86.407  80.899 1.00 28.64 ? 59   SER A OG  1 
ATOM   464  N N   . THR A 1 60  ? 11.688  84.156  82.574 1.00 21.66 ? 60   THR A N   1 
ATOM   465  C CA  . THR A 1 60  ? 12.367  84.265  83.865 1.00 20.65 ? 60   THR A CA  1 
ATOM   466  C C   . THR A 1 60  ? 13.502  85.297  83.868 1.00 20.15 ? 60   THR A C   1 
ATOM   467  O O   . THR A 1 60  ? 14.191  85.474  84.874 1.00 17.91 ? 60   THR A O   1 
ATOM   468  C CB  . THR A 1 60  ? 12.955  82.896  84.279 1.00 20.26 ? 60   THR A CB  1 
ATOM   469  O OG1 . THR A 1 60  ? 13.911  82.472  83.298 1.00 22.76 ? 60   THR A OG1 1 
ATOM   470  C CG2 . THR A 1 60  ? 11.862  81.850  84.373 1.00 19.61 ? 60   THR A CG2 1 
ATOM   471  N N   . VAL A 1 61  ? 13.677  85.993  82.751 1.00 18.71 ? 61   VAL A N   1 
ATOM   472  C CA  . VAL A 1 61  ? 14.743  86.975  82.613 1.00 19.58 ? 61   VAL A CA  1 
ATOM   473  C C   . VAL A 1 61  ? 14.329  88.409  82.928 1.00 23.96 ? 61   VAL A C   1 
ATOM   474  O O   . VAL A 1 61  ? 13.337  88.917  82.392 1.00 24.97 ? 61   VAL A O   1 
ATOM   475  C CB  . VAL A 1 61  ? 15.343  86.926  81.182 1.00 18.75 ? 61   VAL A CB  1 
ATOM   476  C CG1 . VAL A 1 61  ? 16.387  88.031  80.982 1.00 15.41 ? 61   VAL A CG1 1 
ATOM   477  C CG2 . VAL A 1 61  ? 15.945  85.553  80.922 1.00 17.21 ? 61   VAL A CG2 1 
ATOM   478  N N   . PRO A 1 62  ? 15.115  89.098  83.773 1.00 24.50 ? 62   PRO A N   1 
ATOM   479  C CA  . PRO A 1 62  ? 14.830  90.483  84.145 1.00 24.96 ? 62   PRO A CA  1 
ATOM   480  C C   . PRO A 1 62  ? 14.752  91.311  82.870 1.00 23.70 ? 62   PRO A C   1 
ATOM   481  O O   . PRO A 1 62  ? 15.652  91.259  82.030 1.00 22.80 ? 62   PRO A O   1 
ATOM   482  C CB  . PRO A 1 62  ? 16.051  90.864  84.979 1.00 27.09 ? 62   PRO A CB  1 
ATOM   483  C CG  . PRO A 1 62  ? 16.413  89.572  85.638 1.00 30.23 ? 62   PRO A CG  1 
ATOM   484  C CD  . PRO A 1 62  ? 16.300  88.595  84.492 1.00 27.95 ? 62   PRO A CD  1 
ATOM   485  N N   . GLY A 1 63  ? 13.664  92.054  82.724 1.00 23.12 ? 63   GLY A N   1 
ATOM   486  C CA  . GLY A 1 63  ? 13.466  92.864  81.536 1.00 22.36 ? 63   GLY A CA  1 
ATOM   487  C C   . GLY A 1 63  ? 12.407  92.216  80.663 1.00 22.48 ? 63   GLY A C   1 
ATOM   488  O O   . GLY A 1 63  ? 12.138  92.666  79.542 1.00 20.17 ? 63   GLY A O   1 
ATOM   489  N N   . HIS A 1 64  ? 11.854  91.113  81.164 1.00 18.84 ? 64   HIS A N   1 
ATOM   490  C CA  . HIS A 1 64  ? 10.810  90.373  80.472 1.00 17.54 ? 64   HIS A CA  1 
ATOM   491  C C   . HIS A 1 64  ? 9.691   90.110  81.477 1.00 17.58 ? 64   HIS A C   1 
ATOM   492  O O   . HIS A 1 64  ? 9.781   89.209  82.302 1.00 18.58 ? 64   HIS A O   1 
ATOM   493  C CB  . HIS A 1 64  ? 11.363  89.058  79.910 1.00 14.31 ? 64   HIS A CB  1 
ATOM   494  C CG  . HIS A 1 64  ? 12.415  89.246  78.859 1.00 10.76 ? 64   HIS A CG  1 
ATOM   495  N ND1 . HIS A 1 64  ? 13.719  89.575  79.160 1.00 13.59 ? 64   HIS A ND1 1 
ATOM   496  C CD2 . HIS A 1 64  ? 12.349  89.183  77.509 1.00 7.28  ? 64   HIS A CD2 1 
ATOM   497  C CE1 . HIS A 1 64  ? 14.409  89.710  78.041 1.00 9.21  ? 64   HIS A CE1 1 
ATOM   498  N NE2 . HIS A 1 64  ? 13.599  89.479  77.025 1.00 8.78  ? 64   HIS A NE2 1 
ATOM   499  N N   . ALA A 1 65  ? 8.657   90.941  81.412 1.00 17.23 ? 65   ALA A N   1 
ATOM   500  C CA  . ALA A 1 65  ? 7.503   90.863  82.302 1.00 15.79 ? 65   ALA A CA  1 
ATOM   501  C C   . ALA A 1 65  ? 6.733   89.542  82.287 1.00 14.87 ? 65   ALA A C   1 
ATOM   502  O O   . ALA A 1 65  ? 6.260   89.093  83.328 1.00 17.57 ? 65   ALA A O   1 
ATOM   503  C CB  . ALA A 1 65  ? 6.551   92.018  82.005 1.00 12.38 ? 65   ALA A CB  1 
ATOM   504  N N   . GLY A 1 66  ? 6.572   88.944  81.112 1.00 11.38 ? 66   GLY A N   1 
ATOM   505  C CA  . GLY A 1 66  ? 5.836   87.698  81.024 1.00 10.45 ? 66   GLY A CA  1 
ATOM   506  C C   . GLY A 1 66  ? 4.340   87.940  80.946 1.00 10.41 ? 66   GLY A C   1 
ATOM   507  O O   . GLY A 1 66  ? 3.562   87.371  81.713 1.00 11.49 ? 66   GLY A O   1 
ATOM   508  N N   . ARG A 1 67  ? 3.932   88.760  79.985 1.00 11.54 ? 67   ARG A N   1 
ATOM   509  C CA  . ARG A 1 67  ? 2.527   89.099  79.797 1.00 10.22 ? 67   ARG A CA  1 
ATOM   510  C C   . ARG A 1 67  ? 2.197   89.242  78.318 1.00 9.54  ? 67   ARG A C   1 
ATOM   511  O O   . ARG A 1 67  ? 3.016   89.744  77.541 1.00 4.10  ? 67   ARG A O   1 
ATOM   512  C CB  . ARG A 1 67  ? 2.205   90.406  80.521 1.00 12.01 ? 67   ARG A CB  1 
ATOM   513  C CG  . ARG A 1 67  ? 2.083   90.253  82.021 1.00 17.89 ? 67   ARG A CG  1 
ATOM   514  C CD  . ARG A 1 67  ? 2.549   91.492  82.754 1.00 23.65 ? 67   ARG A CD  1 
ATOM   515  N NE  . ARG A 1 67  ? 1.860   92.696  82.301 1.00 33.00 ? 67   ARG A NE  1 
ATOM   516  C CZ  . ARG A 1 67  ? 2.053   93.909  82.814 1.00 37.79 ? 67   ARG A CZ  1 
ATOM   517  N NH1 . ARG A 1 67  ? 2.919   94.088  83.809 1.00 37.66 ? 67   ARG A NH1 1 
ATOM   518  N NH2 . ARG A 1 67  ? 1.391   94.950  82.316 1.00 37.19 ? 67   ARG A NH2 1 
ATOM   519  N N   . LEU A 1 68  ? 1.015   88.749  77.944 1.00 8.22  ? 68   LEU A N   1 
ATOM   520  C CA  . LEU A 1 68  ? 0.500   88.810  76.577 1.00 6.80  ? 68   LEU A CA  1 
ATOM   521  C C   . LEU A 1 68  ? -0.524  89.930  76.641 1.00 6.56  ? 68   LEU A C   1 
ATOM   522  O O   . LEU A 1 68  ? -1.462  89.868  77.435 1.00 6.86  ? 68   LEU A O   1 
ATOM   523  C CB  . LEU A 1 68  ? -0.217  87.507  76.218 1.00 7.98  ? 68   LEU A CB  1 
ATOM   524  C CG  . LEU A 1 68  ? 0.039   86.768  74.899 1.00 11.58 ? 68   LEU A CG  1 
ATOM   525  C CD1 . LEU A 1 68  ? -1.283  86.246  74.386 1.00 13.02 ? 68   LEU A CD1 1 
ATOM   526  C CD2 . LEU A 1 68  ? 0.694   87.644  73.859 1.00 7.23  ? 68   LEU A CD2 1 
ATOM   527  N N   . VAL A 1 69  ? -0.337  90.961  75.827 1.00 7.68  ? 69   VAL A N   1 
ATOM   528  C CA  . VAL A 1 69  ? -1.243  92.100  75.838 1.00 6.46  ? 69   VAL A CA  1 
ATOM   529  C C   . VAL A 1 69  ? -1.916  92.332  74.487 1.00 7.62  ? 69   VAL A C   1 
ATOM   530  O O   . VAL A 1 69  ? -1.249  92.416  73.455 1.00 6.62  ? 69   VAL A O   1 
ATOM   531  C CB  . VAL A 1 69  ? -0.495  93.399  76.239 1.00 6.89  ? 69   VAL A CB  1 
ATOM   532  C CG1 . VAL A 1 69  ? -1.483  94.476  76.647 1.00 6.16  ? 69   VAL A CG1 1 
ATOM   533  C CG2 . VAL A 1 69  ? 0.498   93.125  77.357 1.00 5.41  ? 69   VAL A CG2 1 
ATOM   534  N N   . PHE A 1 70  ? -3.240  92.402  74.500 1.00 5.28  ? 70   PHE A N   1 
ATOM   535  C CA  . PHE A 1 70  ? -4.014  92.665  73.293 1.00 7.24  ? 70   PHE A CA  1 
ATOM   536  C C   . PHE A 1 70  ? -4.399  94.131  73.361 1.00 8.67  ? 70   PHE A C   1 
ATOM   537  O O   . PHE A 1 70  ? -4.640  94.665  74.451 1.00 9.41  ? 70   PHE A O   1 
ATOM   538  C CB  . PHE A 1 70  ? -5.294  91.823  73.252 1.00 5.67  ? 70   PHE A CB  1 
ATOM   539  C CG  . PHE A 1 70  ? -5.052  90.363  73.053 1.00 5.04  ? 70   PHE A CG  1 
ATOM   540  C CD1 . PHE A 1 70  ? -4.682  89.557  74.120 1.00 5.44  ? 70   PHE A CD1 1 
ATOM   541  C CD2 . PHE A 1 70  ? -5.212  89.787  71.801 1.00 5.63  ? 70   PHE A CD2 1 
ATOM   542  C CE1 . PHE A 1 70  ? -4.474  88.190  73.947 1.00 4.27  ? 70   PHE A CE1 1 
ATOM   543  C CE2 . PHE A 1 70  ? -5.008  88.425  71.618 1.00 7.66  ? 70   PHE A CE2 1 
ATOM   544  C CZ  . PHE A 1 70  ? -4.638  87.626  72.693 1.00 6.88  ? 70   PHE A CZ  1 
ATOM   545  N N   . GLY A 1 71  ? -4.451  94.783  72.210 1.00 8.63  ? 71   GLY A N   1 
ATOM   546  C CA  . GLY A 1 71  ? -4.812  96.181  72.191 1.00 8.85  ? 71   GLY A CA  1 
ATOM   547  C C   . GLY A 1 71  ? -4.770  96.759  70.800 1.00 7.72  ? 71   GLY A C   1 
ATOM   548  O O   . GLY A 1 71  ? -4.418  96.082  69.829 1.00 7.46  ? 71   GLY A O   1 
ATOM   549  N N   . ILE A 1 72  ? -5.164  98.019  70.708 1.00 9.46  ? 72   ILE A N   1 
ATOM   550  C CA  . ILE A 1 72  ? -5.170  98.733  69.448 1.00 11.44 ? 72   ILE A CA  1 
ATOM   551  C C   . ILE A 1 72  ? -3.960  99.663  69.460 1.00 11.43 ? 72   ILE A C   1 
ATOM   552  O O   . ILE A 1 72  ? -3.762  100.427 70.411 1.00 10.60 ? 72   ILE A O   1 
ATOM   553  C CB  . ILE A 1 72  ? -6.467  99.573  69.281 1.00 12.52 ? 72   ILE A CB  1 
ATOM   554  C CG1 . ILE A 1 72  ? -7.707  98.700  69.496 1.00 14.65 ? 72   ILE A CG1 1 
ATOM   555  C CG2 . ILE A 1 72  ? -6.506  100.214 67.911 1.00 12.03 ? 72   ILE A CG2 1 
ATOM   556  C CD1 . ILE A 1 72  ? -7.832  97.538  68.529 1.00 13.66 ? 72   ILE A CD1 1 
ATOM   557  N N   . LEU A 1 73  ? -3.126  99.555  68.433 1.00 12.38 ? 73   LEU A N   1 
ATOM   558  C CA  . LEU A 1 73  ? -1.944  100.394 68.312 1.00 15.92 ? 73   LEU A CA  1 
ATOM   559  C C   . LEU A 1 73  ? -2.039  101.179 67.004 1.00 16.83 ? 73   LEU A C   1 
ATOM   560  O O   . LEU A 1 73  ? -1.992  100.600 65.917 1.00 14.88 ? 73   LEU A O   1 
ATOM   561  C CB  . LEU A 1 73  ? -0.670  99.537  68.337 1.00 16.81 ? 73   LEU A CB  1 
ATOM   562  C CG  . LEU A 1 73  ? 0.668   100.274 68.220 1.00 17.98 ? 73   LEU A CG  1 
ATOM   563  C CD1 . LEU A 1 73  ? 0.791   101.359 69.280 1.00 18.48 ? 73   LEU A CD1 1 
ATOM   564  C CD2 . LEU A 1 73  ? 1.806   99.284  68.337 1.00 21.07 ? 73   LEU A CD2 1 
ATOM   565  N N   . ASN A 1 74  ? -2.250  102.487 67.126 1.00 19.78 ? 74   ASN A N   1 
ATOM   566  C CA  . ASN A 1 74  ? -2.366  103.379 65.975 1.00 21.10 ? 74   ASN A CA  1 
ATOM   567  C C   . ASN A 1 74  ? -3.344  102.845 64.925 1.00 22.55 ? 74   ASN A C   1 
ATOM   568  O O   . ASN A 1 74  ? -3.031  102.781 63.735 1.00 24.41 ? 74   ASN A O   1 
ATOM   569  C CB  . ASN A 1 74  ? -0.987  103.614 65.352 1.00 24.73 ? 74   ASN A CB  1 
ATOM   570  C CG  . ASN A 1 74  ? -0.949  104.845 64.467 1.00 28.53 ? 74   ASN A CG  1 
ATOM   571  O OD1 . ASN A 1 74  ? -1.704  105.796 64.677 1.00 33.30 ? 74   ASN A OD1 1 
ATOM   572  N ND2 . ASN A 1 74  ? -0.056  104.844 63.485 1.00 27.47 ? 74   ASN A ND2 1 
ATOM   573  N N   . GLY A 1 75  ? -4.512  102.404 65.384 1.00 23.74 ? 75   GLY A N   1 
ATOM   574  C CA  . GLY A 1 75  ? -5.527  101.883 64.481 1.00 22.88 ? 75   GLY A CA  1 
ATOM   575  C C   . GLY A 1 75  ? -5.491  100.394 64.174 1.00 19.85 ? 75   GLY A C   1 
ATOM   576  O O   . GLY A 1 75  ? -6.512  99.824  63.789 1.00 22.62 ? 75   GLY A O   1 
ATOM   577  N N   . ARG A 1 76  ? -4.333  99.762  64.326 1.00 19.05 ? 76   ARG A N   1 
ATOM   578  C CA  . ARG A 1 76  ? -4.201  98.333  64.053 1.00 17.96 ? 76   ARG A CA  1 
ATOM   579  C C   . ARG A 1 76  ? -4.358  97.482  65.309 1.00 18.07 ? 76   ARG A C   1 
ATOM   580  O O   . ARG A 1 76  ? -3.787  97.793  66.362 1.00 14.49 ? 76   ARG A O   1 
ATOM   581  C CB  . ARG A 1 76  ? -2.847  98.030  63.417 1.00 23.27 ? 76   ARG A CB  1 
ATOM   582  C CG  . ARG A 1 76  ? -2.717  98.422  61.961 1.00 32.31 ? 76   ARG A CG  1 
ATOM   583  C CD  . ARG A 1 76  ? -3.559  97.528  61.071 1.00 37.72 ? 76   ARG A CD  1 
ATOM   584  N NE  . ARG A 1 76  ? -3.014  97.440  59.718 1.00 44.42 ? 76   ARG A NE  1 
ATOM   585  C CZ  . ARG A 1 76  ? -2.994  98.443  58.845 1.00 49.55 ? 76   ARG A CZ  1 
ATOM   586  N NH1 . ARG A 1 76  ? -3.493  99.631  59.168 1.00 51.54 ? 76   ARG A NH1 1 
ATOM   587  N NH2 . ARG A 1 76  ? -2.460  98.261  57.645 1.00 52.73 ? 76   ARG A NH2 1 
ATOM   588  N N   . ALA A 1 77  ? -5.129  96.406  65.190 1.00 14.37 ? 77   ALA A N   1 
ATOM   589  C CA  . ALA A 1 77  ? -5.345  95.498  66.306 1.00 13.60 ? 77   ALA A CA  1 
ATOM   590  C C   . ALA A 1 77  ? -4.146  94.568  66.386 1.00 15.06 ? 77   ALA A C   1 
ATOM   591  O O   . ALA A 1 77  ? -3.804  93.897  65.401 1.00 13.56 ? 77   ALA A O   1 
ATOM   592  C CB  . ALA A 1 77  ? -6.617  94.696  66.095 1.00 12.23 ? 77   ALA A CB  1 
ATOM   593  N N   . CYS A 1 78  ? -3.505  94.519  67.547 1.00 14.42 ? 78   CYS A N   1 
ATOM   594  C CA  . CYS A 1 78  ? -2.352  93.654  67.699 1.00 17.21 ? 78   CYS A CA  1 
ATOM   595  C C   . CYS A 1 78  ? -2.219  93.005  69.076 1.00 13.31 ? 78   CYS A C   1 
ATOM   596  O O   . CYS A 1 78  ? -2.933  93.349  70.018 1.00 13.33 ? 78   CYS A O   1 
ATOM   597  C CB  . CYS A 1 78  ? -1.073  94.414  67.336 1.00 21.63 ? 78   CYS A CB  1 
ATOM   598  S SG  . CYS A 1 78  ? -0.593  95.679  68.493 1.00 33.44 ? 78   CYS A SG  1 
ATOM   599  N N   . VAL A 1 79  ? -1.349  92.005  69.149 1.00 9.39  ? 79   VAL A N   1 
ATOM   600  C CA  . VAL A 1 79  ? -1.079  91.294  70.386 1.00 5.49  ? 79   VAL A CA  1 
ATOM   601  C C   . VAL A 1 79  ? 0.430   91.352  70.564 1.00 5.10  ? 79   VAL A C   1 
ATOM   602  O O   . VAL A 1 79  ? 1.190   91.197  69.599 1.00 5.91  ? 79   VAL A O   1 
ATOM   603  C CB  . VAL A 1 79  ? -1.609  89.825  70.347 1.00 5.87  ? 79   VAL A CB  1 
ATOM   604  C CG1 . VAL A 1 79  ? -1.025  89.051  69.175 1.00 6.93  ? 79   VAL A CG1 1 
ATOM   605  C CG2 . VAL A 1 79  ? -1.323  89.118  71.658 1.00 2.08  ? 79   VAL A CG2 1 
ATOM   606  N N   . MET A 1 80  ? 0.859   91.667  71.779 1.00 5.32  ? 80   MET A N   1 
ATOM   607  C CA  . MET A 1 80  ? 2.276   91.785  72.079 1.00 7.01  ? 80   MET A CA  1 
ATOM   608  C C   . MET A 1 80  ? 2.730   90.852  73.182 1.00 6.44  ? 80   MET A C   1 
ATOM   609  O O   . MET A 1 80  ? 2.018   90.617  74.163 1.00 6.38  ? 80   MET A O   1 
ATOM   610  C CB  . MET A 1 80  ? 2.623   93.208  72.531 1.00 10.05 ? 80   MET A CB  1 
ATOM   611  C CG  . MET A 1 80  ? 2.033   94.323  71.703 1.00 19.08 ? 80   MET A CG  1 
ATOM   612  S SD  . MET A 1 80  ? 2.830   95.885  72.104 1.00 24.14 ? 80   MET A SD  1 
ATOM   613  C CE  . MET A 1 80  ? 2.977   96.583  70.464 1.00 24.31 ? 80   MET A CE  1 
ATOM   614  N N   . MET A 1 81  ? 3.936   90.334  73.015 1.00 5.43  ? 81   MET A N   1 
ATOM   615  C CA  . MET A 1 81  ? 4.544   89.490  74.013 1.00 4.80  ? 81   MET A CA  1 
ATOM   616  C C   . MET A 1 81  ? 5.485   90.417  74.767 1.00 3.82  ? 81   MET A C   1 
ATOM   617  O O   . MET A 1 81  ? 6.504   90.863  74.234 1.00 3.40  ? 81   MET A O   1 
ATOM   618  C CB  . MET A 1 81  ? 5.331   88.357  73.366 1.00 2.71  ? 81   MET A CB  1 
ATOM   619  C CG  . MET A 1 81  ? 4.542   87.084  73.201 1.00 4.79  ? 81   MET A CG  1 
ATOM   620  S SD  . MET A 1 81  ? 5.487   85.875  72.313 1.00 9.70  ? 81   MET A SD  1 
ATOM   621  C CE  . MET A 1 81  ? 6.712   85.402  73.559 1.00 8.54  ? 81   MET A CE  1 
ATOM   622  N N   . GLN A 1 82  ? 5.084   90.809  75.964 1.00 5.35  ? 82   GLN A N   1 
ATOM   623  C CA  . GLN A 1 82  ? 5.924   91.674  76.771 1.00 6.45  ? 82   GLN A CA  1 
ATOM   624  C C   . GLN A 1 82  ? 6.879   90.726  77.479 1.00 7.84  ? 82   GLN A C   1 
ATOM   625  O O   . GLN A 1 82  ? 6.625   90.289  78.608 1.00 8.62  ? 82   GLN A O   1 
ATOM   626  C CB  . GLN A 1 82  ? 5.084   92.446  77.781 1.00 6.75  ? 82   GLN A CB  1 
ATOM   627  C CG  . GLN A 1 82  ? 5.801   93.641  78.371 1.00 9.22  ? 82   GLN A CG  1 
ATOM   628  C CD  . GLN A 1 82  ? 4.966   94.387  79.393 1.00 13.34 ? 82   GLN A CD  1 
ATOM   629  O OE1 . GLN A 1 82  ? 5.227   95.550  79.689 1.00 14.47 ? 82   GLN A OE1 1 
ATOM   630  N NE2 . GLN A 1 82  ? 3.974   93.715  79.958 1.00 16.87 ? 82   GLN A NE2 1 
ATOM   631  N N   . GLY A 1 83  ? 7.960   90.388  76.787 1.00 6.96  ? 83   GLY A N   1 
ATOM   632  C CA  . GLY A 1 83  ? 8.942   89.469  77.324 1.00 5.51  ? 83   GLY A CA  1 
ATOM   633  C C   . GLY A 1 83  ? 8.878   88.203  76.499 1.00 5.94  ? 83   GLY A C   1 
ATOM   634  O O   . GLY A 1 83  ? 7.800   87.790  76.085 1.00 5.35  ? 83   GLY A O   1 
ATOM   635  N N   . ARG A 1 84  ? 10.023  87.588  76.244 1.00 5.04  ? 84   ARG A N   1 
ATOM   636  C CA  . ARG A 1 84  ? 10.064  86.372  75.447 1.00 5.37  ? 84   ARG A CA  1 
ATOM   637  C C   . ARG A 1 84  ? 10.838  85.278  76.161 1.00 4.58  ? 84   ARG A C   1 
ATOM   638  O O   . ARG A 1 84  ? 11.242  85.451  77.311 1.00 6.09  ? 84   ARG A O   1 
ATOM   639  C CB  . ARG A 1 84  ? 10.690  86.653  74.075 1.00 4.26  ? 84   ARG A CB  1 
ATOM   640  C CG  . ARG A 1 84  ? 12.103  87.204  74.128 1.00 5.31  ? 84   ARG A CG  1 
ATOM   641  C CD  . ARG A 1 84  ? 12.973  86.615  73.035 1.00 4.56  ? 84   ARG A CD  1 
ATOM   642  N NE  . ARG A 1 84  ? 12.522  86.961  71.688 1.00 2.83  ? 84   ARG A NE  1 
ATOM   643  C CZ  . ARG A 1 84  ? 12.759  88.124  71.091 1.00 6.48  ? 84   ARG A CZ  1 
ATOM   644  N NH1 . ARG A 1 84  ? 13.436  89.082  71.721 1.00 2.00  ? 84   ARG A NH1 1 
ATOM   645  N NH2 . ARG A 1 84  ? 12.364  88.310  69.834 1.00 6.34  ? 84   ARG A NH2 1 
ATOM   646  N N   . PHE A 1 85  ? 11.051  84.164  75.466 1.00 4.77  ? 85   PHE A N   1 
ATOM   647  C CA  . PHE A 1 85  ? 11.774  83.026  76.005 1.00 2.19  ? 85   PHE A CA  1 
ATOM   648  C C   . PHE A 1 85  ? 13.091  82.855  75.259 1.00 5.30  ? 85   PHE A C   1 
ATOM   649  O O   . PHE A 1 85  ? 13.220  83.257  74.103 1.00 6.36  ? 85   PHE A O   1 
ATOM   650  C CB  . PHE A 1 85  ? 10.922  81.768  75.873 1.00 4.36  ? 85   PHE A CB  1 
ATOM   651  C CG  . PHE A 1 85  ? 9.504   81.978  76.273 1.00 7.79  ? 85   PHE A CG  1 
ATOM   652  C CD1 . PHE A 1 85  ? 9.195   82.404  77.560 1.00 11.99 ? 85   PHE A CD1 1 
ATOM   653  C CD2 . PHE A 1 85  ? 8.481   81.843  75.347 1.00 9.70  ? 85   PHE A CD2 1 
ATOM   654  C CE1 . PHE A 1 85  ? 7.885   82.701  77.916 1.00 10.56 ? 85   PHE A CE1 1 
ATOM   655  C CE2 . PHE A 1 85  ? 7.171   82.136  75.694 1.00 9.50  ? 85   PHE A CE2 1 
ATOM   656  C CZ  . PHE A 1 85  ? 6.872   82.568  76.980 1.00 10.77 ? 85   PHE A CZ  1 
ATOM   657  N N   . HIS A 1 86  ? 14.080  82.277  75.931 1.00 5.80  ? 86   HIS A N   1 
ATOM   658  C CA  . HIS A 1 86  ? 15.390  82.065  75.326 1.00 4.58  ? 86   HIS A CA  1 
ATOM   659  C C   . HIS A 1 86  ? 15.832  80.643  75.645 1.00 6.05  ? 86   HIS A C   1 
ATOM   660  O O   . HIS A 1 86  ? 15.426  80.079  76.664 1.00 7.99  ? 86   HIS A O   1 
ATOM   661  C CB  . HIS A 1 86  ? 16.413  83.037  75.913 1.00 2.68  ? 86   HIS A CB  1 
ATOM   662  C CG  . HIS A 1 86  ? 15.963  84.465  75.932 1.00 2.14  ? 86   HIS A CG  1 
ATOM   663  N ND1 . HIS A 1 86  ? 15.083  84.961  76.872 1.00 7.16  ? 86   HIS A ND1 1 
ATOM   664  C CD2 . HIS A 1 86  ? 16.313  85.516  75.155 1.00 2.00  ? 86   HIS A CD2 1 
ATOM   665  C CE1 . HIS A 1 86  ? 14.912  86.255  76.676 1.00 2.36  ? 86   HIS A CE1 1 
ATOM   666  N NE2 . HIS A 1 86  ? 15.649  86.616  75.640 1.00 2.76  ? 86   HIS A NE2 1 
ATOM   667  N N   . MET A 1 87  ? 16.701  80.083  74.813 1.00 4.41  ? 87   MET A N   1 
ATOM   668  C CA  . MET A 1 87  ? 17.180  78.732  75.051 1.00 6.90  ? 87   MET A CA  1 
ATOM   669  C C   . MET A 1 87  ? 18.082  78.654  76.286 1.00 5.58  ? 87   MET A C   1 
ATOM   670  O O   . MET A 1 87  ? 18.109  77.630  76.958 1.00 4.89  ? 87   MET A O   1 
ATOM   671  C CB  . MET A 1 87  ? 17.893  78.176  73.810 1.00 9.36  ? 87   MET A CB  1 
ATOM   672  C CG  . MET A 1 87  ? 19.421  78.193  73.865 1.00 14.90 ? 87   MET A CG  1 
ATOM   673  S SD  . MET A 1 87  ? 20.150  77.517  72.361 1.00 20.87 ? 87   MET A SD  1 
ATOM   674  C CE  . MET A 1 87  ? 19.671  75.815  72.515 1.00 15.14 ? 87   MET A CE  1 
ATOM   675  N N   . TYR A 1 88  ? 18.783  79.740  76.620 1.00 5.41  ? 88   TYR A N   1 
ATOM   676  C CA  . TYR A 1 88  ? 19.667  79.718  77.792 1.00 4.99  ? 88   TYR A CA  1 
ATOM   677  C C   . TYR A 1 88  ? 18.934  79.583  79.133 1.00 5.48  ? 88   TYR A C   1 
ATOM   678  O O   . TYR A 1 88  ? 19.565  79.376  80.163 1.00 6.48  ? 88   TYR A O   1 
ATOM   679  C CB  . TYR A 1 88  ? 20.612  80.934  77.820 1.00 6.31  ? 88   TYR A CB  1 
ATOM   680  C CG  . TYR A 1 88  ? 19.943  82.283  78.007 1.00 4.48  ? 88   TYR A CG  1 
ATOM   681  C CD1 . TYR A 1 88  ? 19.336  82.629  79.220 1.00 2.02  ? 88   TYR A CD1 1 
ATOM   682  C CD2 . TYR A 1 88  ? 19.900  83.203  76.963 1.00 2.01  ? 88   TYR A CD2 1 
ATOM   683  C CE1 . TYR A 1 88  ? 18.699  83.850  79.383 1.00 2.05  ? 88   TYR A CE1 1 
ATOM   684  C CE2 . TYR A 1 88  ? 19.268  84.422  77.113 1.00 3.36  ? 88   TYR A CE2 1 
ATOM   685  C CZ  . TYR A 1 88  ? 18.667  84.740  78.319 1.00 3.76  ? 88   TYR A CZ  1 
ATOM   686  O OH  . TYR A 1 88  ? 17.993  85.928  78.434 1.00 8.75  ? 88   TYR A OH  1 
ATOM   687  N N   . GLU A 1 89  ? 17.609  79.717  79.113 1.00 6.58  ? 89   GLU A N   1 
ATOM   688  C CA  . GLU A 1 89  ? 16.794  79.597  80.323 1.00 6.56  ? 89   GLU A CA  1 
ATOM   689  C C   . GLU A 1 89  ? 16.509  78.125  80.601 1.00 8.87  ? 89   GLU A C   1 
ATOM   690  O O   . GLU A 1 89  ? 16.014  77.774  81.670 1.00 9.51  ? 89   GLU A O   1 
ATOM   691  C CB  . GLU A 1 89  ? 15.455  80.329  80.154 1.00 6.44  ? 89   GLU A CB  1 
ATOM   692  C CG  . GLU A 1 89  ? 15.550  81.840  80.013 1.00 8.12  ? 89   GLU A CG  1 
ATOM   693  C CD  . GLU A 1 89  ? 14.197  82.501  79.793 1.00 12.33 ? 89   GLU A CD  1 
ATOM   694  O OE1 . GLU A 1 89  ? 13.366  82.514  80.717 1.00 14.79 ? 89   GLU A OE1 1 
ATOM   695  O OE2 . GLU A 1 89  ? 13.961  83.021  78.691 1.00 15.39 ? 89   GLU A OE2 1 
ATOM   696  N N   . GLY A 1 90  ? 16.808  77.273  79.623 1.00 9.85  ? 90   GLY A N   1 
ATOM   697  C CA  . GLY A 1 90  ? 16.567  75.847  79.764 1.00 11.72 ? 90   GLY A CA  1 
ATOM   698  C C   . GLY A 1 90  ? 15.457  75.368  78.843 1.00 12.50 ? 90   GLY A C   1 
ATOM   699  O O   . GLY A 1 90  ? 15.090  74.196  78.851 1.00 14.74 ? 90   GLY A O   1 
ATOM   700  N N   . TYR A 1 91  ? 14.947  76.271  78.015 1.00 10.33 ? 91   TYR A N   1 
ATOM   701  C CA  . TYR A 1 91  ? 13.867  75.949  77.089 1.00 8.61  ? 91   TYR A CA  1 
ATOM   702  C C   . TYR A 1 91  ? 14.316  75.407  75.747 1.00 8.74  ? 91   TYR A C   1 
ATOM   703  O O   . TYR A 1 91  ? 15.216  75.954  75.113 1.00 8.12  ? 91   TYR A O   1 
ATOM   704  C CB  . TYR A 1 91  ? 13.021  77.194  76.800 1.00 10.45 ? 91   TYR A CB  1 
ATOM   705  C CG  . TYR A 1 91  ? 12.215  77.710  77.964 1.00 8.14  ? 91   TYR A CG  1 
ATOM   706  C CD1 . TYR A 1 91  ? 11.252  76.909  78.572 1.00 13.50 ? 91   TYR A CD1 1 
ATOM   707  C CD2 . TYR A 1 91  ? 12.399  79.006  78.442 1.00 10.36 ? 91   TYR A CD2 1 
ATOM   708  C CE1 . TYR A 1 91  ? 10.488  77.383  79.632 1.00 12.64 ? 91   TYR A CE1 1 
ATOM   709  C CE2 . TYR A 1 91  ? 11.640  79.494  79.501 1.00 12.58 ? 91   TYR A CE2 1 
ATOM   710  C CZ  . TYR A 1 91  ? 10.689  78.674  80.091 1.00 13.04 ? 91   TYR A CZ  1 
ATOM   711  O OH  . TYR A 1 91  ? 9.946   79.127  81.151 1.00 18.46 ? 91   TYR A OH  1 
ATOM   712  N N   . PRO A 1 92  ? 13.691  74.316  75.293 1.00 9.78  ? 92   PRO A N   1 
ATOM   713  C CA  . PRO A 1 92  ? 14.042  73.738  73.996 1.00 9.23  ? 92   PRO A CA  1 
ATOM   714  C C   . PRO A 1 92  ? 13.415  74.715  73.001 1.00 9.78  ? 92   PRO A C   1 
ATOM   715  O O   . PRO A 1 92  ? 12.449  75.408  73.347 1.00 8.75  ? 92   PRO A O   1 
ATOM   716  C CB  . PRO A 1 92  ? 13.266  72.418  73.985 1.00 11.83 ? 92   PRO A CB  1 
ATOM   717  C CG  . PRO A 1 92  ? 12.981  72.138  75.429 1.00 12.75 ? 92   PRO A CG  1 
ATOM   718  C CD  . PRO A 1 92  ? 12.694  73.489  75.990 1.00 11.10 ? 92   PRO A CD  1 
ATOM   719  N N   . PHE A 1 93  ? 13.906  74.753  71.768 1.00 8.73  ? 93   PHE A N   1 
ATOM   720  C CA  . PHE A 1 93  ? 13.339  75.674  70.789 1.00 8.50  ? 93   PHE A CA  1 
ATOM   721  C C   . PHE A 1 93  ? 11.858  75.478  70.516 1.00 7.74  ? 93   PHE A C   1 
ATOM   722  O O   . PHE A 1 93  ? 11.190  76.423  70.119 1.00 9.80  ? 93   PHE A O   1 
ATOM   723  C CB  . PHE A 1 93  ? 14.132  75.664  69.485 1.00 8.59  ? 93   PHE A CB  1 
ATOM   724  C CG  . PHE A 1 93  ? 15.382  76.474  69.544 1.00 9.70  ? 93   PHE A CG  1 
ATOM   725  C CD1 . PHE A 1 93  ? 15.386  77.717  70.167 1.00 9.28  ? 93   PHE A CD1 1 
ATOM   726  C CD2 . PHE A 1 93  ? 16.563  75.996  69.004 1.00 12.49 ? 93   PHE A CD2 1 
ATOM   727  C CE1 . PHE A 1 93  ? 16.549  78.465  70.252 1.00 8.11  ? 93   PHE A CE1 1 
ATOM   728  C CE2 . PHE A 1 93  ? 17.734  76.744  69.086 1.00 9.43  ? 93   PHE A CE2 1 
ATOM   729  C CZ  . PHE A 1 93  ? 17.724  77.977  69.711 1.00 9.51  ? 93   PHE A CZ  1 
ATOM   730  N N   . TRP A 1 94  ? 11.334  74.270  70.732 1.00 8.70  ? 94   TRP A N   1 
ATOM   731  C CA  . TRP A 1 94  ? 9.909   74.039  70.505 1.00 8.69  ? 94   TRP A CA  1 
ATOM   732  C C   . TRP A 1 94  ? 9.045   74.700  71.578 1.00 10.23 ? 94   TRP A C   1 
ATOM   733  O O   . TRP A 1 94  ? 7.858   74.931  71.367 1.00 14.18 ? 94   TRP A O   1 
ATOM   734  C CB  . TRP A 1 94  ? 9.573   72.552  70.337 1.00 8.99  ? 94   TRP A CB  1 
ATOM   735  C CG  . TRP A 1 94  ? 10.015  71.653  71.438 1.00 10.00 ? 94   TRP A CG  1 
ATOM   736  C CD1 . TRP A 1 94  ? 11.180  70.950  71.499 1.00 9.77  ? 94   TRP A CD1 1 
ATOM   737  C CD2 . TRP A 1 94  ? 9.269   71.299  72.610 1.00 11.41 ? 94   TRP A CD2 1 
ATOM   738  N NE1 . TRP A 1 94  ? 11.204  70.171  72.634 1.00 12.89 ? 94   TRP A NE1 1 
ATOM   739  C CE2 . TRP A 1 94  ? 10.043  70.368  73.333 1.00 11.15 ? 94   TRP A CE2 1 
ATOM   740  C CE3 . TRP A 1 94  ? 8.017   71.673  73.113 1.00 12.31 ? 94   TRP A CE3 1 
ATOM   741  C CZ2 . TRP A 1 94  ? 9.607   69.804  74.530 1.00 11.13 ? 94   TRP A CZ2 1 
ATOM   742  C CZ3 . TRP A 1 94  ? 7.582   71.111  74.303 1.00 10.61 ? 94   TRP A CZ3 1 
ATOM   743  C CH2 . TRP A 1 94  ? 8.376   70.186  74.998 1.00 12.68 ? 94   TRP A CH2 1 
ATOM   744  N N   . LYS A 1 95  ? 9.642   75.002  72.729 1.00 8.23  ? 95   LYS A N   1 
ATOM   745  C CA  . LYS A 1 95  ? 8.920   75.696  73.788 1.00 7.59  ? 95   LYS A CA  1 
ATOM   746  C C   . LYS A 1 95  ? 9.072   77.186  73.523 1.00 6.60  ? 95   LYS A C   1 
ATOM   747  O O   . LYS A 1 95  ? 8.113   77.943  73.630 1.00 8.85  ? 95   LYS A O   1 
ATOM   748  C CB  . LYS A 1 95  ? 9.479   75.363  75.168 1.00 9.82  ? 95   LYS A CB  1 
ATOM   749  C CG  . LYS A 1 95  ? 8.656   74.329  75.910 1.00 18.91 ? 95   LYS A CG  1 
ATOM   750  C CD  . LYS A 1 95  ? 9.083   74.234  77.357 1.00 23.01 ? 95   LYS A CD  1 
ATOM   751  C CE  . LYS A 1 95  ? 8.163   73.320  78.152 1.00 28.58 ? 95   LYS A CE  1 
ATOM   752  N NZ  . LYS A 1 95  ? 8.497   73.352  79.605 1.00 30.76 ? 95   LYS A NZ  1 
ATOM   753  N N   . VAL A 1 96  ? 10.283  77.596  73.153 1.00 4.94  ? 96   VAL A N   1 
ATOM   754  C CA  . VAL A 1 96  ? 10.573  78.998  72.852 1.00 4.53  ? 96   VAL A CA  1 
ATOM   755  C C   . VAL A 1 96  ? 9.646   79.556  71.769 1.00 2.84  ? 96   VAL A C   1 
ATOM   756  O O   . VAL A 1 96  ? 9.220   80.707  71.839 1.00 7.12  ? 96   VAL A O   1 
ATOM   757  C CB  . VAL A 1 96  ? 12.053  79.170  72.370 1.00 2.09  ? 96   VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 96  ? 12.280  80.561  71.808 1.00 4.12  ? 96   VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 96  ? 13.017  78.906  73.513 1.00 2.02  ? 96   VAL A CG2 1 
ATOM   760  N N   . THR A 1 97  ? 9.333   78.740  70.771 1.00 2.09  ? 97   THR A N   1 
ATOM   761  C CA  . THR A 1 97  ? 8.496   79.188  69.667 1.00 2.54  ? 97   THR A CA  1 
ATOM   762  C C   . THR A 1 97  ? 7.012   78.875  69.744 1.00 2.77  ? 97   THR A C   1 
ATOM   763  O O   . THR A 1 97  ? 6.291   79.114  68.778 1.00 5.64  ? 97   THR A O   1 
ATOM   764  C CB  . THR A 1 97  ? 9.015   78.653  68.329 1.00 2.00  ? 97   THR A CB  1 
ATOM   765  O OG1 . THR A 1 97  ? 9.049   77.221  68.367 1.00 2.87  ? 97   THR A OG1 1 
ATOM   766  C CG2 . THR A 1 97  ? 10.406  79.192  68.047 1.00 2.00  ? 97   THR A CG2 1 
ATOM   767  N N   . PHE A 1 98  ? 6.543   78.392  70.889 1.00 5.06  ? 98   PHE A N   1 
ATOM   768  C CA  . PHE A 1 98  ? 5.128   78.046  71.060 1.00 6.27  ? 98   PHE A CA  1 
ATOM   769  C C   . PHE A 1 98  ? 4.149   79.169  70.690 1.00 6.79  ? 98   PHE A C   1 
ATOM   770  O O   . PHE A 1 98  ? 3.208   78.945  69.922 1.00 7.61  ? 98   PHE A O   1 
ATOM   771  C CB  . PHE A 1 98  ? 4.864   77.569  72.501 1.00 7.01  ? 98   PHE A CB  1 
ATOM   772  C CG  . PHE A 1 98  ? 3.427   77.216  72.781 1.00 5.12  ? 98   PHE A CG  1 
ATOM   773  C CD1 . PHE A 1 98  ? 2.851   76.085  72.209 1.00 5.71  ? 98   PHE A CD1 1 
ATOM   774  C CD2 . PHE A 1 98  ? 2.650   78.007  73.621 1.00 5.88  ? 98   PHE A CD2 1 
ATOM   775  C CE1 . PHE A 1 98  ? 1.521   75.750  72.471 1.00 4.47  ? 98   PHE A CE1 1 
ATOM   776  C CE2 . PHE A 1 98  ? 1.320   77.678  73.890 1.00 2.07  ? 98   PHE A CE2 1 
ATOM   777  C CZ  . PHE A 1 98  ? 0.758   76.551  73.315 1.00 4.77  ? 98   PHE A CZ  1 
ATOM   778  N N   . PRO A 1 99  ? 4.373   80.397  71.198 1.00 5.07  ? 99   PRO A N   1 
ATOM   779  C CA  . PRO A 1 99  ? 3.469   81.508  70.888 1.00 5.34  ? 99   PRO A CA  1 
ATOM   780  C C   . PRO A 1 99  ? 3.300   81.828  69.413 1.00 5.90  ? 99   PRO A C   1 
ATOM   781  O O   . PRO A 1 99  ? 2.210   82.217  68.990 1.00 9.57  ? 99   PRO A O   1 
ATOM   782  C CB  . PRO A 1 99  ? 4.107   82.679  71.632 1.00 5.78  ? 99   PRO A CB  1 
ATOM   783  C CG  . PRO A 1 99  ? 4.756   82.016  72.792 1.00 6.90  ? 99   PRO A CG  1 
ATOM   784  C CD  . PRO A 1 99  ? 5.412   80.838  72.141 1.00 3.07  ? 99   PRO A CD  1 
ATOM   785  N N   . VAL A 1 100 ? 4.362   81.674  68.626 1.00 7.58  ? 100  VAL A N   1 
ATOM   786  C CA  . VAL A 1 100 ? 4.279   81.987  67.197 1.00 4.30  ? 100  VAL A CA  1 
ATOM   787  C C   . VAL A 1 100 ? 3.198   81.176  66.482 1.00 4.33  ? 100  VAL A C   1 
ATOM   788  O O   . VAL A 1 100 ? 2.418   81.728  65.699 1.00 4.24  ? 100  VAL A O   1 
ATOM   789  C CB  . VAL A 1 100 ? 5.644   81.824  66.473 1.00 4.17  ? 100  VAL A CB  1 
ATOM   790  C CG1 . VAL A 1 100 ? 5.528   82.276  65.010 1.00 5.71  ? 100  VAL A CG1 1 
ATOM   791  C CG2 . VAL A 1 100 ? 6.726   82.641  67.179 1.00 2.34  ? 100  VAL A CG2 1 
ATOM   792  N N   . ARG A 1 101 ? 3.124   79.881  66.773 1.00 2.00  ? 101  ARG A N   1 
ATOM   793  C CA  . ARG A 1 101 ? 2.118   79.032  66.142 1.00 3.43  ? 101  ARG A CA  1 
ATOM   794  C C   . ARG A 1 101 ? 0.715   79.322  66.631 1.00 3.40  ? 101  ARG A C   1 
ATOM   795  O O   . ARG A 1 101 ? -0.250  79.200  65.876 1.00 5.46  ? 101  ARG A O   1 
ATOM   796  C CB  . ARG A 1 101 ? 2.466   77.557  66.301 1.00 2.00  ? 101  ARG A CB  1 
ATOM   797  C CG  . ARG A 1 101 ? 3.527   77.130  65.316 1.00 6.03  ? 101  ARG A CG  1 
ATOM   798  C CD  . ARG A 1 101 ? 4.027   75.726  65.549 1.00 3.95  ? 101  ARG A CD  1 
ATOM   799  N NE  . ARG A 1 101 ? 4.891   75.321  64.447 1.00 5.56  ? 101  ARG A NE  1 
ATOM   800  C CZ  . ARG A 1 101 ? 5.411   74.110  64.300 1.00 7.78  ? 101  ARG A CZ  1 
ATOM   801  N NH1 . ARG A 1 101 ? 5.165   73.164  65.194 1.00 6.17  ? 101  ARG A NH1 1 
ATOM   802  N NH2 . ARG A 1 101 ? 6.156   73.845  63.240 1.00 11.41 ? 101  ARG A NH2 1 
ATOM   803  N N   . VAL A 1 102 ? 0.598   79.692  67.900 1.00 2.03  ? 102  VAL A N   1 
ATOM   804  C CA  . VAL A 1 102 ? -0.697  80.047  68.471 1.00 3.20  ? 102  VAL A CA  1 
ATOM   805  C C   . VAL A 1 102 ? -1.197  81.312  67.751 1.00 3.57  ? 102  VAL A C   1 
ATOM   806  O O   . VAL A 1 102 ? -2.376  81.407  67.393 1.00 5.27  ? 102  VAL A O   1 
ATOM   807  C CB  . VAL A 1 102 ? -0.575  80.308  70.002 1.00 2.00  ? 102  VAL A CB  1 
ATOM   808  C CG1 . VAL A 1 102 ? -1.885  80.841  70.579 1.00 2.01  ? 102  VAL A CG1 1 
ATOM   809  C CG2 . VAL A 1 102 ? -0.180  79.029  70.705 1.00 2.00  ? 102  VAL A CG2 1 
ATOM   810  N N   . PHE A 1 103 ? -0.289  82.259  67.504 1.00 4.47  ? 103  PHE A N   1 
ATOM   811  C CA  . PHE A 1 103 ? -0.626  83.512  66.818 1.00 4.23  ? 103  PHE A CA  1 
ATOM   812  C C   . PHE A 1 103 ? -1.198  83.220  65.438 1.00 6.05  ? 103  PHE A C   1 
ATOM   813  O O   . PHE A 1 103 ? -2.166  83.852  65.010 1.00 6.68  ? 103  PHE A O   1 
ATOM   814  C CB  . PHE A 1 103 ? 0.605   84.410  66.673 1.00 3.34  ? 103  PHE A CB  1 
ATOM   815  C CG  . PHE A 1 103 ? 1.108   84.976  67.973 1.00 4.66  ? 103  PHE A CG  1 
ATOM   816  C CD1 . PHE A 1 103 ? 0.253   85.137  69.061 1.00 6.42  ? 103  PHE A CD1 1 
ATOM   817  C CD2 . PHE A 1 103 ? 2.443   85.354  68.106 1.00 6.02  ? 103  PHE A CD2 1 
ATOM   818  C CE1 . PHE A 1 103 ? 0.722   85.667  70.270 1.00 11.11 ? 103  PHE A CE1 1 
ATOM   819  C CE2 . PHE A 1 103 ? 2.928   85.884  69.304 1.00 6.51  ? 103  PHE A CE2 1 
ATOM   820  C CZ  . PHE A 1 103 ? 2.065   86.042  70.392 1.00 9.42  ? 103  PHE A CZ  1 
ATOM   821  N N   . ARG A 1 104 ? -0.568  82.285  64.732 1.00 4.38  ? 104  ARG A N   1 
ATOM   822  C CA  . ARG A 1 104 ? -1.016  81.874  63.409 1.00 5.68  ? 104  ARG A CA  1 
ATOM   823  C C   . ARG A 1 104 ? -2.464  81.371  63.496 1.00 6.81  ? 104  ARG A C   1 
ATOM   824  O O   . ARG A 1 104 ? -3.302  81.712  62.663 1.00 9.43  ? 104  ARG A O   1 
ATOM   825  C CB  . ARG A 1 104 ? -0.094  80.768  62.886 1.00 10.10 ? 104  ARG A CB  1 
ATOM   826  C CG  . ARG A 1 104 ? -0.561  80.037  61.631 1.00 15.79 ? 104  ARG A CG  1 
ATOM   827  C CD  . ARG A 1 104 ? -0.430  80.889  60.385 1.00 22.63 ? 104  ARG A CD  1 
ATOM   828  N NE  . ARG A 1 104 ? -1.594  81.742  60.193 1.00 33.28 ? 104  ARG A NE  1 
ATOM   829  C CZ  . ARG A 1 104 ? -1.892  82.366  59.059 1.00 37.82 ? 104  ARG A CZ  1 
ATOM   830  N NH1 . ARG A 1 104 ? -1.105  82.245  57.992 1.00 37.59 ? 104  ARG A NH1 1 
ATOM   831  N NH2 . ARG A 1 104 ? -2.998  83.093  58.989 1.00 37.74 ? 104  ARG A NH2 1 
ATOM   832  N N   . LEU A 1 105 ? -2.768  80.600  64.536 1.00 4.90  ? 105  LEU A N   1 
ATOM   833  C CA  . LEU A 1 105 ? -4.115  80.064  64.716 1.00 4.16  ? 105  LEU A CA  1 
ATOM   834  C C   . LEU A 1 105 ? -5.129  81.098  65.203 1.00 5.55  ? 105  LEU A C   1 
ATOM   835  O O   . LEU A 1 105 ? -6.321  80.821  65.239 1.00 6.73  ? 105  LEU A O   1 
ATOM   836  C CB  . LEU A 1 105 ? -4.088  78.854  65.647 1.00 3.30  ? 105  LEU A CB  1 
ATOM   837  C CG  . LEU A 1 105 ? -3.395  77.624  65.051 1.00 6.66  ? 105  LEU A CG  1 
ATOM   838  C CD1 . LEU A 1 105 ? -3.278  76.541  66.099 1.00 7.25  ? 105  LEU A CD1 1 
ATOM   839  C CD2 . LEU A 1 105 ? -4.166  77.114  63.836 1.00 9.97  ? 105  LEU A CD2 1 
ATOM   840  N N   . LEU A 1 106 ? -4.652  82.268  65.618 1.00 5.71  ? 106  LEU A N   1 
ATOM   841  C CA  . LEU A 1 106 ? -5.535  83.345  66.061 1.00 6.16  ? 106  LEU A CA  1 
ATOM   842  C C   . LEU A 1 106 ? -5.948  84.180  64.852 1.00 8.04  ? 106  LEU A C   1 
ATOM   843  O O   . LEU A 1 106 ? -6.809  85.057  64.953 1.00 11.12 ? 106  LEU A O   1 
ATOM   844  C CB  . LEU A 1 106 ? -4.835  84.264  67.072 1.00 5.46  ? 106  LEU A CB  1 
ATOM   845  C CG  . LEU A 1 106 ? -4.575  83.799  68.508 1.00 7.29  ? 106  LEU A CG  1 
ATOM   846  C CD1 . LEU A 1 106 ? -3.968  84.938  69.309 1.00 6.29  ? 106  LEU A CD1 1 
ATOM   847  C CD2 . LEU A 1 106 ? -5.873  83.337  69.155 1.00 8.49  ? 106  LEU A CD2 1 
ATOM   848  N N   . GLY A 1 107 ? -5.306  83.935  63.714 1.00 7.49  ? 107  GLY A N   1 
ATOM   849  C CA  . GLY A 1 107 ? -5.622  84.692  62.517 1.00 8.77  ? 107  GLY A CA  1 
ATOM   850  C C   . GLY A 1 107 ? -4.596  85.769  62.195 1.00 7.23  ? 107  GLY A C   1 
ATOM   851  O O   . GLY A 1 107 ? -4.785  86.541  61.255 1.00 10.77 ? 107  GLY A O   1 
ATOM   852  N N   . VAL A 1 108 ? -3.514  85.819  62.968 1.00 4.17  ? 108  VAL A N   1 
ATOM   853  C CA  . VAL A 1 108 ? -2.454  86.793  62.760 1.00 3.36  ? 108  VAL A CA  1 
ATOM   854  C C   . VAL A 1 108 ? -1.755  86.538  61.422 1.00 5.38  ? 108  VAL A C   1 
ATOM   855  O O   . VAL A 1 108 ? -1.552  85.393  61.031 1.00 3.14  ? 108  VAL A O   1 
ATOM   856  C CB  . VAL A 1 108 ? -1.438  86.744  63.929 1.00 6.93  ? 108  VAL A CB  1 
ATOM   857  C CG1 . VAL A 1 108 ? -0.223  87.617  63.640 1.00 5.95  ? 108  VAL A CG1 1 
ATOM   858  C CG2 . VAL A 1 108 ? -2.115  87.198  65.231 1.00 6.45  ? 108  VAL A CG2 1 
ATOM   859  N N   . GLU A 1 109 ? -1.383  87.610  60.727 1.00 6.73  ? 109  GLU A N   1 
ATOM   860  C CA  . GLU A 1 109 ? -0.721  87.487  59.432 1.00 6.47  ? 109  GLU A CA  1 
ATOM   861  C C   . GLU A 1 109 ? 0.687   88.060  59.418 1.00 5.10  ? 109  GLU A C   1 
ATOM   862  O O   . GLU A 1 109 ? 1.512   87.676  58.588 1.00 3.42  ? 109  GLU A O   1 
ATOM   863  C CB  . GLU A 1 109 ? -1.550  88.173  58.353 1.00 8.56  ? 109  GLU A CB  1 
ATOM   864  C CG  . GLU A 1 109 ? -2.935  87.599  58.209 1.00 17.15 ? 109  GLU A CG  1 
ATOM   865  C CD  . GLU A 1 109 ? -3.733  88.286  57.124 1.00 24.32 ? 109  GLU A CD  1 
ATOM   866  O OE1 . GLU A 1 109 ? -4.141  89.451  57.325 1.00 28.56 ? 109  GLU A OE1 1 
ATOM   867  O OE2 . GLU A 1 109 ? -3.954  87.654  56.072 1.00 31.16 ? 109  GLU A OE2 1 
ATOM   868  N N   . THR A 1 110 ? 0.964   88.964  60.348 1.00 4.17  ? 110  THR A N   1 
ATOM   869  C CA  . THR A 1 110 ? 2.272   89.591  60.419 1.00 5.49  ? 110  THR A CA  1 
ATOM   870  C C   . THR A 1 110 ? 2.882   89.506  61.804 1.00 5.61  ? 110  THR A C   1 
ATOM   871  O O   . THR A 1 110 ? 2.198   89.712  62.811 1.00 6.43  ? 110  THR A O   1 
ATOM   872  C CB  . THR A 1 110 ? 2.190   91.057  59.991 1.00 5.02  ? 110  THR A CB  1 
ATOM   873  O OG1 . THR A 1 110 ? 1.709   91.117  58.641 1.00 10.52 ? 110  THR A OG1 1 
ATOM   874  C CG2 . THR A 1 110 ? 3.556   91.725  60.075 1.00 8.33  ? 110  THR A CG2 1 
ATOM   875  N N   . LEU A 1 111 ? 4.174   89.197  61.834 1.00 2.67  ? 111  LEU A N   1 
ATOM   876  C CA  . LEU A 1 111 ? 4.932   89.078  63.067 1.00 5.31  ? 111  LEU A CA  1 
ATOM   877  C C   . LEU A 1 111 ? 6.075   90.090  63.054 1.00 3.62  ? 111  LEU A C   1 
ATOM   878  O O   . LEU A 1 111 ? 6.861   90.148  62.104 1.00 6.30  ? 111  LEU A O   1 
ATOM   879  C CB  . LEU A 1 111 ? 5.509   87.664  63.205 1.00 3.32  ? 111  LEU A CB  1 
ATOM   880  C CG  . LEU A 1 111 ? 6.412   87.470  64.428 1.00 6.11  ? 111  LEU A CG  1 
ATOM   881  C CD1 . LEU A 1 111 ? 5.551   87.363  65.674 1.00 4.09  ? 111  LEU A CD1 1 
ATOM   882  C CD2 . LEU A 1 111 ? 7.288   86.233  64.264 1.00 2.02  ? 111  LEU A CD2 1 
ATOM   883  N N   . VAL A 1 112 ? 6.161   90.884  64.112 1.00 4.84  ? 112  VAL A N   1 
ATOM   884  C CA  . VAL A 1 112 ? 7.208   91.883  64.255 1.00 3.51  ? 112  VAL A CA  1 
ATOM   885  C C   . VAL A 1 112 ? 8.065   91.408  65.424 1.00 4.40  ? 112  VAL A C   1 
ATOM   886  O O   . VAL A 1 112 ? 7.556   91.200  66.523 1.00 7.34  ? 112  VAL A O   1 
ATOM   887  C CB  . VAL A 1 112 ? 6.606   93.289  64.556 1.00 3.74  ? 112  VAL A CB  1 
ATOM   888  C CG1 . VAL A 1 112 ? 7.719   94.320  64.817 1.00 4.50  ? 112  VAL A CG1 1 
ATOM   889  C CG2 . VAL A 1 112 ? 5.720   93.743  63.391 1.00 3.33  ? 112  VAL A CG2 1 
ATOM   890  N N   . VAL A 1 113 ? 9.347   91.173  65.176 1.00 4.79  ? 113  VAL A N   1 
ATOM   891  C CA  . VAL A 1 113 ? 10.254  90.711  66.219 1.00 3.93  ? 113  VAL A CA  1 
ATOM   892  C C   . VAL A 1 113 ? 11.280  91.786  66.541 1.00 5.35  ? 113  VAL A C   1 
ATOM   893  O O   . VAL A 1 113 ? 11.806  92.442  65.638 1.00 5.99  ? 113  VAL A O   1 
ATOM   894  C CB  . VAL A 1 113 ? 10.979  89.395  65.813 1.00 8.41  ? 113  VAL A CB  1 
ATOM   895  C CG1 . VAL A 1 113 ? 9.994   88.241  65.783 1.00 5.95  ? 113  VAL A CG1 1 
ATOM   896  C CG2 . VAL A 1 113 ? 11.670  89.542  64.451 1.00 4.31  ? 113  VAL A CG2 1 
ATOM   897  N N   . THR A 1 114 ? 11.532  92.005  67.828 1.00 3.65  ? 114  THR A N   1 
ATOM   898  C CA  . THR A 1 114 ? 12.506  93.007  68.243 1.00 2.54  ? 114  THR A CA  1 
ATOM   899  C C   . THR A 1 114 ? 13.447  92.381  69.254 1.00 2.08  ? 114  THR A C   1 
ATOM   900  O O   . THR A 1 114 ? 13.130  91.364  69.859 1.00 2.11  ? 114  THR A O   1 
ATOM   901  C CB  . THR A 1 114 ? 11.838  94.223  68.919 1.00 4.59  ? 114  THR A CB  1 
ATOM   902  O OG1 . THR A 1 114 ? 11.265  93.821  70.171 1.00 5.33  ? 114  THR A OG1 1 
ATOM   903  C CG2 . THR A 1 114 ? 10.742  94.819  68.025 1.00 4.65  ? 114  THR A CG2 1 
ATOM   904  N N   . ASN A 1 115 ? 14.605  92.990  69.439 1.00 2.18  ? 115  ASN A N   1 
ATOM   905  C CA  . ASN A 1 115 ? 15.559  92.480  70.406 1.00 2.69  ? 115  ASN A CA  1 
ATOM   906  C C   . ASN A 1 115 ? 16.616  93.526  70.680 1.00 2.06  ? 115  ASN A C   1 
ATOM   907  O O   . ASN A 1 115 ? 16.671  94.555  70.013 1.00 3.81  ? 115  ASN A O   1 
ATOM   908  C CB  . ASN A 1 115 ? 16.207  91.180  69.906 1.00 4.04  ? 115  ASN A CB  1 
ATOM   909  C CG  . ASN A 1 115 ? 16.998  91.366  68.616 1.00 5.63  ? 115  ASN A CG  1 
ATOM   910  O OD1 . ASN A 1 115 ? 17.919  92.175  68.552 1.00 7.94  ? 115  ASN A OD1 1 
ATOM   911  N ND2 . ASN A 1 115 ? 16.648  90.601  67.588 1.00 6.47  ? 115  ASN A ND2 1 
ATOM   912  N N   . ALA A 1 116 ? 17.395  93.286  71.720 1.00 2.00  ? 116  ALA A N   1 
ATOM   913  C CA  . ALA A 1 116 ? 18.491  94.153  72.106 1.00 6.29  ? 116  ALA A CA  1 
ATOM   914  C C   . ALA A 1 116 ? 19.676  93.332  71.611 1.00 5.87  ? 116  ALA A C   1 
ATOM   915  O O   . ALA A 1 116 ? 19.703  92.118  71.823 1.00 5.76  ? 116  ALA A O   1 
ATOM   916  C CB  . ALA A 1 116 ? 18.536  94.287  73.627 1.00 2.04  ? 116  ALA A CB  1 
ATOM   917  N N   . ALA A 1 117 ? 20.615  93.955  70.909 1.00 6.43  ? 117  ALA A N   1 
ATOM   918  C CA  . ALA A 1 117 ? 21.765  93.221  70.391 1.00 4.39  ? 117  ALA A CA  1 
ATOM   919  C C   . ALA A 1 117 ? 23.063  93.977  70.578 1.00 5.22  ? 117  ALA A C   1 
ATOM   920  O O   . ALA A 1 117 ? 23.070  95.204  70.709 1.00 5.13  ? 117  ALA A O   1 
ATOM   921  C CB  . ALA A 1 117 ? 21.568  92.903  68.914 1.00 4.02  ? 117  ALA A CB  1 
ATOM   922  N N   . GLY A 1 118 ? 24.161  93.228  70.598 1.00 8.26  ? 118  GLY A N   1 
ATOM   923  C CA  . GLY A 1 118 ? 25.472  93.826  70.738 1.00 5.53  ? 118  GLY A CA  1 
ATOM   924  C C   . GLY A 1 118 ? 25.914  94.198  69.342 1.00 5.34  ? 118  GLY A C   1 
ATOM   925  O O   . GLY A 1 118 ? 25.671  93.450  68.391 1.00 6.80  ? 118  GLY A O   1 
ATOM   926  N N   . GLY A 1 119 ? 26.542  95.358  69.207 1.00 5.90  ? 119  GLY A N   1 
ATOM   927  C CA  . GLY A 1 119 ? 26.984  95.806  67.906 1.00 2.94  ? 119  GLY A CA  1 
ATOM   928  C C   . GLY A 1 119 ? 28.329  95.263  67.484 1.00 5.83  ? 119  GLY A C   1 
ATOM   929  O O   . GLY A 1 119 ? 29.303  95.329  68.237 1.00 7.05  ? 119  GLY A O   1 
ATOM   930  N N   . LEU A 1 120 ? 28.372  94.702  66.281 1.00 5.80  ? 120  LEU A N   1 
ATOM   931  C CA  . LEU A 1 120 ? 29.598  94.158  65.721 1.00 4.97  ? 120  LEU A CA  1 
ATOM   932  C C   . LEU A 1 120 ? 30.091  95.111  64.644 1.00 7.66  ? 120  LEU A C   1 
ATOM   933  O O   . LEU A 1 120 ? 31.286  95.334  64.509 1.00 9.42  ? 120  LEU A O   1 
ATOM   934  C CB  . LEU A 1 120 ? 29.358  92.767  65.124 1.00 4.31  ? 120  LEU A CB  1 
ATOM   935  C CG  . LEU A 1 120 ? 29.036  91.599  66.066 1.00 5.41  ? 120  LEU A CG  1 
ATOM   936  C CD1 . LEU A 1 120 ? 28.690  90.361  65.251 1.00 2.70  ? 120  LEU A CD1 1 
ATOM   937  C CD2 . LEU A 1 120 ? 30.213  91.301  66.971 1.00 4.67  ? 120  LEU A CD2 1 
ATOM   938  N N   . ASN A 1 121 ? 29.169  95.672  63.873 1.00 9.75  ? 121  ASN A N   1 
ATOM   939  C CA  . ASN A 1 121 ? 29.540  96.606  62.817 1.00 12.12 ? 121  ASN A CA  1 
ATOM   940  C C   . ASN A 1 121 ? 30.120  97.872  63.453 1.00 15.40 ? 121  ASN A C   1 
ATOM   941  O O   . ASN A 1 121 ? 29.444  98.551  64.222 1.00 14.42 ? 121  ASN A O   1 
ATOM   942  C CB  . ASN A 1 121 ? 28.325  96.947  61.959 1.00 10.39 ? 121  ASN A CB  1 
ATOM   943  C CG  . ASN A 1 121 ? 28.689  97.745  60.728 1.00 13.82 ? 121  ASN A CG  1 
ATOM   944  O OD1 . ASN A 1 121 ? 29.452  98.711  60.802 1.00 13.10 ? 121  ASN A OD1 1 
ATOM   945  N ND2 . ASN A 1 121 ? 28.143  97.350  59.585 1.00 11.44 ? 121  ASN A ND2 1 
ATOM   946  N N   . PRO A 1 122 ? 31.369  98.224  63.103 1.00 17.38 ? 122  PRO A N   1 
ATOM   947  C CA  . PRO A 1 122 ? 32.080  99.400  63.623 1.00 21.38 ? 122  PRO A CA  1 
ATOM   948  C C   . PRO A 1 122 ? 31.339  100.721 63.470 1.00 22.69 ? 122  PRO A C   1 
ATOM   949  O O   . PRO A 1 122 ? 31.496  101.624 64.293 1.00 25.09 ? 122  PRO A O   1 
ATOM   950  C CB  . PRO A 1 122 ? 33.371  99.403  62.806 1.00 20.42 ? 122  PRO A CB  1 
ATOM   951  C CG  . PRO A 1 122 ? 33.578  97.965  62.500 1.00 22.00 ? 122  PRO A CG  1 
ATOM   952  C CD  . PRO A 1 122 ? 32.199  97.518  62.114 1.00 18.37 ? 122  PRO A CD  1 
ATOM   953  N N   . ASN A 1 123 ? 30.538  100.828 62.414 1.00 22.89 ? 123  ASN A N   1 
ATOM   954  C CA  . ASN A 1 123 ? 29.781  102.043 62.138 1.00 20.48 ? 123  ASN A CA  1 
ATOM   955  C C   . ASN A 1 123 ? 28.539  102.209 62.998 1.00 21.12 ? 123  ASN A C   1 
ATOM   956  O O   . ASN A 1 123 ? 27.839  103.220 62.883 1.00 21.60 ? 123  ASN A O   1 
ATOM   957  C CB  . ASN A 1 123 ? 29.392  102.092 60.664 1.00 21.00 ? 123  ASN A CB  1 
ATOM   958  C CG  . ASN A 1 123 ? 30.594  102.069 59.754 1.00 23.48 ? 123  ASN A CG  1 
ATOM   959  O OD1 . ASN A 1 123 ? 31.618  102.681 60.050 1.00 26.79 ? 123  ASN A OD1 1 
ATOM   960  N ND2 . ASN A 1 123 ? 30.488  101.345 58.652 1.00 23.42 ? 123  ASN A ND2 1 
ATOM   961  N N   . PHE A 1 124 ? 28.241  101.215 63.831 1.00 17.93 ? 124  PHE A N   1 
ATOM   962  C CA  . PHE A 1 124 ? 27.072  101.286 64.702 1.00 16.81 ? 124  PHE A CA  1 
ATOM   963  C C   . PHE A 1 124 ? 27.426  102.025 65.977 1.00 17.54 ? 124  PHE A C   1 
ATOM   964  O O   . PHE A 1 124 ? 28.563  101.963 66.448 1.00 21.79 ? 124  PHE A O   1 
ATOM   965  C CB  . PHE A 1 124 ? 26.562  99.886  65.066 1.00 14.45 ? 124  PHE A CB  1 
ATOM   966  C CG  . PHE A 1 124 ? 25.887  99.158  63.935 1.00 10.58 ? 124  PHE A CG  1 
ATOM   967  C CD1 . PHE A 1 124 ? 25.783  99.727  62.671 1.00 10.87 ? 124  PHE A CD1 1 
ATOM   968  C CD2 . PHE A 1 124 ? 25.358  97.890  64.140 1.00 9.17  ? 124  PHE A CD2 1 
ATOM   969  C CE1 . PHE A 1 124 ? 25.162  99.039  61.628 1.00 11.57 ? 124  PHE A CE1 1 
ATOM   970  C CE2 . PHE A 1 124 ? 24.740  97.199  63.113 1.00 6.31  ? 124  PHE A CE2 1 
ATOM   971  C CZ  . PHE A 1 124 ? 24.640  97.772  61.851 1.00 10.50 ? 124  PHE A CZ  1 
ATOM   972  N N   . GLU A 1 125 ? 26.451  102.736 66.525 1.00 16.75 ? 125  GLU A N   1 
ATOM   973  C CA  . GLU A 1 125 ? 26.636  103.472 67.764 1.00 16.70 ? 125  GLU A CA  1 
ATOM   974  C C   . GLU A 1 125 ? 25.548  103.020 68.716 1.00 15.04 ? 125  GLU A C   1 
ATOM   975  O O   . GLU A 1 125 ? 24.480  102.582 68.280 1.00 14.05 ? 125  GLU A O   1 
ATOM   976  C CB  . GLU A 1 125 ? 26.519  104.981 67.526 1.00 20.90 ? 125  GLU A CB  1 
ATOM   977  C CG  . GLU A 1 125 ? 27.679  105.599 66.743 1.00 27.94 ? 125  GLU A CG  1 
ATOM   978  C CD  . GLU A 1 125 ? 29.030  105.409 67.424 1.00 33.11 ? 125  GLU A CD  1 
ATOM   979  O OE1 . GLU A 1 125 ? 29.090  105.479 68.673 1.00 37.39 ? 125  GLU A OE1 1 
ATOM   980  O OE2 . GLU A 1 125 ? 30.033  105.185 66.708 1.00 35.20 ? 125  GLU A OE2 1 
ATOM   981  N N   . VAL A 1 126 ? 25.823  103.100 70.010 1.00 12.70 ? 126  VAL A N   1 
ATOM   982  C CA  . VAL A 1 126 ? 24.846  102.709 71.013 1.00 13.69 ? 126  VAL A CA  1 
ATOM   983  C C   . VAL A 1 126 ? 23.602  103.566 70.801 1.00 11.47 ? 126  VAL A C   1 
ATOM   984  O O   . VAL A 1 126 ? 23.705  104.782 70.638 1.00 12.81 ? 126  VAL A O   1 
ATOM   985  C CB  . VAL A 1 126 ? 25.391  102.925 72.451 1.00 14.40 ? 126  VAL A CB  1 
ATOM   986  C CG1 . VAL A 1 126 ? 24.339  102.528 73.486 1.00 16.49 ? 126  VAL A CG1 1 
ATOM   987  C CG2 . VAL A 1 126 ? 26.655  102.116 72.658 1.00 15.60 ? 126  VAL A CG2 1 
ATOM   988  N N   . GLY A 1 127 ? 22.442  102.913 70.759 1.00 12.24 ? 127  GLY A N   1 
ATOM   989  C CA  . GLY A 1 127 ? 21.184  103.607 70.555 1.00 10.39 ? 127  GLY A CA  1 
ATOM   990  C C   . GLY A 1 127 ? 20.653  103.436 69.142 1.00 12.29 ? 127  GLY A C   1 
ATOM   991  O O   . GLY A 1 127 ? 19.504  103.784 68.860 1.00 11.53 ? 127  GLY A O   1 
ATOM   992  N N   . ASP A 1 128 ? 21.487  102.910 68.249 1.00 10.38 ? 128  ASP A N   1 
ATOM   993  C CA  . ASP A 1 128 ? 21.086  102.691 66.862 1.00 10.02 ? 128  ASP A CA  1 
ATOM   994  C C   . ASP A 1 128 ? 20.012  101.628 66.736 1.00 11.19 ? 128  ASP A C   1 
ATOM   995  O O   . ASP A 1 128 ? 19.930  100.708 67.552 1.00 11.69 ? 128  ASP A O   1 
ATOM   996  C CB  . ASP A 1 128 ? 22.280  102.251 66.007 1.00 12.91 ? 128  ASP A CB  1 
ATOM   997  C CG  . ASP A 1 128 ? 22.968  103.406 65.316 1.00 10.94 ? 128  ASP A CG  1 
ATOM   998  O OD1 . ASP A 1 128 ? 22.378  104.499 65.258 1.00 16.40 ? 128  ASP A OD1 1 
ATOM   999  O OD2 . ASP A 1 128 ? 24.100  103.215 64.824 1.00 8.71  ? 128  ASP A OD2 1 
ATOM   1000 N N   . ILE A 1 129 ? 19.202  101.760 65.694 1.00 8.86  ? 129  ILE A N   1 
ATOM   1001 C CA  . ILE A 1 129 ? 18.153  100.804 65.399 1.00 10.12 ? 129  ILE A CA  1 
ATOM   1002 C C   . ILE A 1 129 ? 18.581  100.154 64.089 1.00 8.97  ? 129  ILE A C   1 
ATOM   1003 O O   . ILE A 1 129 ? 18.835  100.844 63.105 1.00 8.43  ? 129  ILE A O   1 
ATOM   1004 C CB  . ILE A 1 129 ? 16.782  101.495 65.222 1.00 11.56 ? 129  ILE A CB  1 
ATOM   1005 C CG1 . ILE A 1 129 ? 16.346  102.136 66.544 1.00 11.10 ? 129  ILE A CG1 1 
ATOM   1006 C CG2 . ILE A 1 129 ? 15.740  100.488 64.733 1.00 9.96  ? 129  ILE A CG2 1 
ATOM   1007 C CD1 . ILE A 1 129 ? 14.945  102.726 66.514 1.00 15.97 ? 129  ILE A CD1 1 
ATOM   1008 N N   . MET A 1 130 ? 18.721  98.836  64.093 1.00 7.13  ? 130  MET A N   1 
ATOM   1009 C CA  . MET A 1 130 ? 19.136  98.123  62.900 1.00 4.22  ? 130  MET A CA  1 
ATOM   1010 C C   . MET A 1 130 ? 18.031  97.224  62.375 1.00 6.30  ? 130  MET A C   1 
ATOM   1011 O O   . MET A 1 130 ? 17.567  96.331  63.089 1.00 5.45  ? 130  MET A O   1 
ATOM   1012 C CB  . MET A 1 130 ? 20.373  97.259  63.195 1.00 6.45  ? 130  MET A CB  1 
ATOM   1013 C CG  . MET A 1 130 ? 20.897  96.481  61.978 1.00 3.85  ? 130  MET A CG  1 
ATOM   1014 S SD  . MET A 1 130 ? 21.996  95.106  62.333 1.00 6.16  ? 130  MET A SD  1 
ATOM   1015 C CE  . MET A 1 130 ? 20.826  93.829  62.637 1.00 2.06  ? 130  MET A CE  1 
ATOM   1016 N N   . LEU A 1 131 ? 17.585  97.472  61.147 1.00 5.09  ? 131  LEU A N   1 
ATOM   1017 C CA  . LEU A 1 131 ? 16.577  96.613  60.531 1.00 7.45  ? 131  LEU A CA  1 
ATOM   1018 C C   . LEU A 1 131 ? 17.303  95.316  60.215 1.00 6.78  ? 131  LEU A C   1 
ATOM   1019 O O   . LEU A 1 131 ? 18.414  95.341  59.678 1.00 8.15  ? 131  LEU A O   1 
ATOM   1020 C CB  . LEU A 1 131 ? 16.061  97.189  59.218 1.00 5.32  ? 131  LEU A CB  1 
ATOM   1021 C CG  . LEU A 1 131 ? 15.272  98.488  59.199 1.00 14.52 ? 131  LEU A CG  1 
ATOM   1022 C CD1 . LEU A 1 131 ? 14.531  98.530  57.872 1.00 16.05 ? 131  LEU A CD1 1 
ATOM   1023 C CD2 . LEU A 1 131 ? 14.283  98.553  60.356 1.00 17.05 ? 131  LEU A CD2 1 
ATOM   1024 N N   . ILE A 1 132 ? 16.695  94.191  60.565 1.00 5.37  ? 132  ILE A N   1 
ATOM   1025 C CA  . ILE A 1 132 ? 17.302  92.895  60.305 1.00 5.69  ? 132  ILE A CA  1 
ATOM   1026 C C   . ILE A 1 132 ? 16.947  92.476  58.886 1.00 5.27  ? 132  ILE A C   1 
ATOM   1027 O O   . ILE A 1 132 ? 15.793  92.173  58.604 1.00 8.38  ? 132  ILE A O   1 
ATOM   1028 C CB  . ILE A 1 132 ? 16.774  91.817  61.271 1.00 2.03  ? 132  ILE A CB  1 
ATOM   1029 C CG1 . ILE A 1 132 ? 17.030  92.229  62.717 1.00 2.30  ? 132  ILE A CG1 1 
ATOM   1030 C CG2 . ILE A 1 132 ? 17.421  90.474  60.957 1.00 2.06  ? 132  ILE A CG2 1 
ATOM   1031 C CD1 . ILE A 1 132 ? 16.258  91.410  63.720 1.00 8.25  ? 132  ILE A CD1 1 
ATOM   1032 N N   . ARG A 1 133 ? 17.922  92.477  57.988 1.00 3.26  ? 133  ARG A N   1 
ATOM   1033 C CA  . ARG A 1 133 ? 17.645  92.070  56.617 1.00 5.79  ? 133  ARG A CA  1 
ATOM   1034 C C   . ARG A 1 133 ? 17.951  90.595  56.420 1.00 3.32  ? 133  ARG A C   1 
ATOM   1035 O O   . ARG A 1 133 ? 17.533  89.996  55.428 1.00 5.90  ? 133  ARG A O   1 
ATOM   1036 C CB  . ARG A 1 133 ? 18.451  92.895  55.611 1.00 11.77 ? 133  ARG A CB  1 
ATOM   1037 C CG  . ARG A 1 133 ? 19.955  92.701  55.703 1.00 19.04 ? 133  ARG A CG  1 
ATOM   1038 C CD  . ARG A 1 133 ? 20.644  92.949  54.367 1.00 25.19 ? 133  ARG A CD  1 
ATOM   1039 N NE  . ARG A 1 133 ? 20.666  94.358  53.984 1.00 31.10 ? 133  ARG A NE  1 
ATOM   1040 C CZ  . ARG A 1 133 ? 21.712  95.167  54.145 1.00 32.18 ? 133  ARG A CZ  1 
ATOM   1041 N NH1 . ARG A 1 133 ? 22.838  94.716  54.690 1.00 32.32 ? 133  ARG A NH1 1 
ATOM   1042 N NH2 . ARG A 1 133 ? 21.642  96.428  53.736 1.00 31.27 ? 133  ARG A NH2 1 
ATOM   1043 N N   . ASP A 1 134 ? 18.667  89.999  57.370 1.00 4.51  ? 134  ASP A N   1 
ATOM   1044 C CA  . ASP A 1 134 ? 19.041  88.593  57.259 1.00 3.45  ? 134  ASP A CA  1 
ATOM   1045 C C   . ASP A 1 134 ? 19.598  88.113  58.592 1.00 3.47  ? 134  ASP A C   1 
ATOM   1046 O O   . ASP A 1 134 ? 19.865  88.926  59.477 1.00 3.45  ? 134  ASP A O   1 
ATOM   1047 C CB  . ASP A 1 134 ? 20.123  88.449  56.177 1.00 5.64  ? 134  ASP A CB  1 
ATOM   1048 C CG  . ASP A 1 134 ? 20.174  87.059  55.564 1.00 10.13 ? 134  ASP A CG  1 
ATOM   1049 O OD1 . ASP A 1 134 ? 19.381  86.175  55.956 1.00 10.72 ? 134  ASP A OD1 1 
ATOM   1050 O OD2 . ASP A 1 134 ? 21.010  86.858  54.667 1.00 8.37  ? 134  ASP A OD2 1 
ATOM   1051 N N   . HIS A 1 135 ? 19.784  86.800  58.725 1.00 2.09  ? 135  HIS A N   1 
ATOM   1052 C CA  . HIS A 1 135 ? 20.339  86.222  59.943 1.00 3.47  ? 135  HIS A CA  1 
ATOM   1053 C C   . HIS A 1 135 ? 21.254  85.034  59.670 1.00 3.20  ? 135  HIS A C   1 
ATOM   1054 O O   . HIS A 1 135 ? 21.279  84.487  58.557 1.00 4.83  ? 135  HIS A O   1 
ATOM   1055 C CB  . HIS A 1 135 ? 19.228  85.807  60.933 1.00 2.09  ? 135  HIS A CB  1 
ATOM   1056 C CG  . HIS A 1 135 ? 18.452  84.588  60.523 1.00 2.01  ? 135  HIS A CG  1 
ATOM   1057 N ND1 . HIS A 1 135 ? 17.081  84.595  60.381 1.00 2.15  ? 135  HIS A ND1 1 
ATOM   1058 C CD2 . HIS A 1 135 ? 18.850  83.323  60.248 1.00 3.50  ? 135  HIS A CD2 1 
ATOM   1059 C CE1 . HIS A 1 135 ? 16.669  83.388  60.034 1.00 5.39  ? 135  HIS A CE1 1 
ATOM   1060 N NE2 . HIS A 1 135 ? 17.725  82.599  59.946 1.00 2.78  ? 135  HIS A NE2 1 
ATOM   1061 N N   . ILE A 1 136 ? 22.013  84.660  60.693 1.00 2.06  ? 136  ILE A N   1 
ATOM   1062 C CA  . ILE A 1 136 ? 22.904  83.509  60.642 1.00 2.13  ? 136  ILE A CA  1 
ATOM   1063 C C   . ILE A 1 136 ? 22.505  82.718  61.884 1.00 2.22  ? 136  ILE A C   1 
ATOM   1064 O O   . ILE A 1 136 ? 22.552  83.232  62.998 1.00 2.72  ? 136  ILE A O   1 
ATOM   1065 C CB  . ILE A 1 136 ? 24.388  83.921  60.714 1.00 2.05  ? 136  ILE A CB  1 
ATOM   1066 C CG1 . ILE A 1 136 ? 24.751  84.798  59.508 1.00 2.92  ? 136  ILE A CG1 1 
ATOM   1067 C CG2 . ILE A 1 136 ? 25.273  82.680  60.745 1.00 4.06  ? 136  ILE A CG2 1 
ATOM   1068 C CD1 . ILE A 1 136 ? 26.129  85.404  59.587 1.00 3.36  ? 136  ILE A CD1 1 
ATOM   1069 N N   . ASN A 1 137 ? 22.065  81.486  61.678 1.00 2.07  ? 137  ASN A N   1 
ATOM   1070 C CA  . ASN A 1 137 ? 21.606  80.636  62.770 1.00 2.06  ? 137  ASN A CA  1 
ATOM   1071 C C   . ASN A 1 137 ? 22.676  79.640  63.195 1.00 2.79  ? 137  ASN A C   1 
ATOM   1072 O O   . ASN A 1 137 ? 22.735  78.532  62.669 1.00 3.67  ? 137  ASN A O   1 
ATOM   1073 C CB  . ASN A 1 137 ? 20.345  79.899  62.312 1.00 2.12  ? 137  ASN A CB  1 
ATOM   1074 C CG  . ASN A 1 137 ? 19.677  79.106  63.419 1.00 3.19  ? 137  ASN A CG  1 
ATOM   1075 O OD1 . ASN A 1 137 ? 20.017  79.220  64.592 1.00 6.03  ? 137  ASN A OD1 1 
ATOM   1076 N ND2 . ASN A 1 137 ? 18.708  78.300  63.037 1.00 2.02  ? 137  ASN A ND2 1 
ATOM   1077 N N   . LEU A 1 138 ? 23.517  80.037  64.146 1.00 2.37  ? 138  LEU A N   1 
ATOM   1078 C CA  . LEU A 1 138 ? 24.583  79.167  64.643 1.00 4.18  ? 138  LEU A CA  1 
ATOM   1079 C C   . LEU A 1 138 ? 24.052  77.883  65.274 1.00 2.34  ? 138  LEU A C   1 
ATOM   1080 O O   . LEU A 1 138 ? 24.552  76.797  64.976 1.00 3.60  ? 138  LEU A O   1 
ATOM   1081 C CB  . LEU A 1 138 ? 25.504  79.918  65.619 1.00 4.09  ? 138  LEU A CB  1 
ATOM   1082 C CG  . LEU A 1 138 ? 26.342  81.024  64.969 1.00 7.34  ? 138  LEU A CG  1 
ATOM   1083 C CD1 . LEU A 1 138 ? 27.149  81.745  66.015 1.00 11.08 ? 138  LEU A CD1 1 
ATOM   1084 C CD2 . LEU A 1 138 ? 27.263  80.429  63.912 1.00 9.03  ? 138  LEU A CD2 1 
ATOM   1085 N N   . PRO A 1 139 ? 23.040  77.980  66.164 1.00 6.01  ? 139  PRO A N   1 
ATOM   1086 C CA  . PRO A 1 139 ? 22.529  76.740  66.760 1.00 5.10  ? 139  PRO A CA  1 
ATOM   1087 C C   . PRO A 1 139 ? 21.979  75.788  65.689 1.00 5.78  ? 139  PRO A C   1 
ATOM   1088 O O   . PRO A 1 139 ? 22.116  74.565  65.802 1.00 7.34  ? 139  PRO A O   1 
ATOM   1089 C CB  . PRO A 1 139 ? 21.427  77.246  67.696 1.00 7.39  ? 139  PRO A CB  1 
ATOM   1090 C CG  . PRO A 1 139 ? 21.956  78.578  68.140 1.00 2.00  ? 139  PRO A CG  1 
ATOM   1091 C CD  . PRO A 1 139 ? 22.445  79.158  66.830 1.00 2.05  ? 139  PRO A CD  1 
ATOM   1092 N N   . GLY A 1 140 ? 21.388  76.357  64.636 1.00 7.06  ? 140  GLY A N   1 
ATOM   1093 C CA  . GLY A 1 140 ? 20.834  75.555  63.552 1.00 5.62  ? 140  GLY A CA  1 
ATOM   1094 C C   . GLY A 1 140 ? 21.889  74.747  62.810 1.00 10.21 ? 140  GLY A C   1 
ATOM   1095 O O   . GLY A 1 140 ? 21.617  73.647  62.318 1.00 9.46  ? 140  GLY A O   1 
ATOM   1096 N N   . PHE A 1 141 ? 23.105  75.278  62.731 1.00 8.27  ? 141  PHE A N   1 
ATOM   1097 C CA  . PHE A 1 141 ? 24.186  74.576  62.059 1.00 8.57  ? 141  PHE A CA  1 
ATOM   1098 C C   . PHE A 1 141 ? 24.427  73.207  62.699 1.00 8.61  ? 141  PHE A C   1 
ATOM   1099 O O   . PHE A 1 141 ? 24.818  72.257  62.014 1.00 10.91 ? 141  PHE A O   1 
ATOM   1100 C CB  . PHE A 1 141 ? 25.478  75.403  62.099 1.00 8.95  ? 141  PHE A CB  1 
ATOM   1101 C CG  . PHE A 1 141 ? 25.512  76.541  61.112 1.00 9.14  ? 141  PHE A CG  1 
ATOM   1102 C CD1 . PHE A 1 141 ? 24.547  76.653  60.110 1.00 9.57  ? 141  PHE A CD1 1 
ATOM   1103 C CD2 . PHE A 1 141 ? 26.533  77.481  61.162 1.00 6.40  ? 141  PHE A CD2 1 
ATOM   1104 C CE1 . PHE A 1 141 ? 24.607  77.683  59.175 1.00 9.26  ? 141  PHE A CE1 1 
ATOM   1105 C CE2 . PHE A 1 141 ? 26.600  78.513  60.234 1.00 9.62  ? 141  PHE A CE2 1 
ATOM   1106 C CZ  . PHE A 1 141 ? 25.638  78.614  59.238 1.00 3.89  ? 141  PHE A CZ  1 
ATOM   1107 N N   . SER A 1 142 ? 24.146  73.096  63.994 1.00 7.31  ? 142  SER A N   1 
ATOM   1108 C CA  . SER A 1 142 ? 24.360  71.845  64.720 1.00 10.35 ? 142  SER A CA  1 
ATOM   1109 C C   . SER A 1 142 ? 23.117  70.969  64.903 1.00 8.61  ? 142  SER A C   1 
ATOM   1110 O O   . SER A 1 142 ? 23.184  69.917  65.539 1.00 11.00 ? 142  SER A O   1 
ATOM   1111 C CB  . SER A 1 142 ? 24.998  72.126  66.081 1.00 10.31 ? 142  SER A CB  1 
ATOM   1112 O OG  . SER A 1 142 ? 24.102  72.828  66.926 1.00 21.31 ? 142  SER A OG  1 
ATOM   1113 N N   . GLY A 1 143 ? 21.980  71.401  64.377 1.00 6.54  ? 143  GLY A N   1 
ATOM   1114 C CA  . GLY A 1 143 ? 20.793  70.584  64.512 1.00 4.85  ? 143  GLY A CA  1 
ATOM   1115 C C   . GLY A 1 143 ? 19.786  71.084  65.519 1.00 5.21  ? 143  GLY A C   1 
ATOM   1116 O O   . GLY A 1 143 ? 18.671  70.575  65.564 1.00 7.10  ? 143  GLY A O   1 
ATOM   1117 N N   . GLU A 1 144 ? 20.173  72.059  66.333 1.00 8.37  ? 144  GLU A N   1 
ATOM   1118 C CA  . GLU A 1 144 ? 19.271  72.644  67.327 1.00 10.15 ? 144  GLU A CA  1 
ATOM   1119 C C   . GLU A 1 144 ? 18.348  73.568  66.519 1.00 10.11 ? 144  GLU A C   1 
ATOM   1120 O O   . GLU A 1 144 ? 18.715  74.693  66.148 1.00 8.39  ? 144  GLU A O   1 
ATOM   1121 C CB  . GLU A 1 144 ? 20.072  73.429  68.372 1.00 11.67 ? 144  GLU A CB  1 
ATOM   1122 C CG  . GLU A 1 144 ? 19.276  73.859  69.594 1.00 22.98 ? 144  GLU A CG  1 
ATOM   1123 C CD  . GLU A 1 144 ? 18.720  72.695  70.403 1.00 28.25 ? 144  GLU A CD  1 
ATOM   1124 O OE1 . GLU A 1 144 ? 19.460  71.705  70.609 1.00 29.51 ? 144  GLU A OE1 1 
ATOM   1125 O OE2 . GLU A 1 144 ? 17.547  72.782  70.843 1.00 32.64 ? 144  GLU A OE2 1 
ATOM   1126 N N   . ASN A 1 145 ? 17.142  73.084  66.256 1.00 8.19  ? 145  ASN A N   1 
ATOM   1127 C CA  . ASN A 1 145 ? 16.201  73.813  65.424 1.00 5.80  ? 145  ASN A CA  1 
ATOM   1128 C C   . ASN A 1 145 ? 14.785  73.509  65.897 1.00 6.72  ? 145  ASN A C   1 
ATOM   1129 O O   . ASN A 1 145 ? 14.465  72.358  66.200 1.00 5.46  ? 145  ASN A O   1 
ATOM   1130 C CB  . ASN A 1 145 ? 16.405  73.308  63.991 1.00 5.05  ? 145  ASN A CB  1 
ATOM   1131 C CG  . ASN A 1 145 ? 15.684  74.124  62.969 1.00 5.50  ? 145  ASN A CG  1 
ATOM   1132 O OD1 . ASN A 1 145 ? 14.458  74.163  62.952 1.00 3.33  ? 145  ASN A OD1 1 
ATOM   1133 N ND2 . ASN A 1 145 ? 16.437  74.745  62.072 1.00 3.34  ? 145  ASN A ND2 1 
ATOM   1134 N N   . PRO A 1 146 ? 13.907  74.529  65.949 1.00 6.64  ? 146  PRO A N   1 
ATOM   1135 C CA  . PRO A 1 146 ? 12.525  74.315  66.394 1.00 9.05  ? 146  PRO A CA  1 
ATOM   1136 C C   . PRO A 1 146 ? 11.674  73.399  65.502 1.00 9.83  ? 146  PRO A C   1 
ATOM   1137 O O   . PRO A 1 146 ? 10.590  72.959  65.907 1.00 11.28 ? 146  PRO A O   1 
ATOM   1138 C CB  . PRO A 1 146 ? 11.964  75.738  66.439 1.00 7.36  ? 146  PRO A CB  1 
ATOM   1139 C CG  . PRO A 1 146 ? 12.748  76.446  65.386 1.00 2.16  ? 146  PRO A CG  1 
ATOM   1140 C CD  . PRO A 1 146 ? 14.138  75.953  65.654 1.00 3.77  ? 146  PRO A CD  1 
ATOM   1141 N N   . LEU A 1 147 ? 12.162  73.127  64.295 1.00 8.60  ? 147  LEU A N   1 
ATOM   1142 C CA  . LEU A 1 147 ? 11.458  72.275  63.345 1.00 7.32  ? 147  LEU A CA  1 
ATOM   1143 C C   . LEU A 1 147 ? 11.957  70.835  63.339 1.00 10.57 ? 147  LEU A C   1 
ATOM   1144 O O   . LEU A 1 147 ? 11.465  70.008  62.566 1.00 9.91  ? 147  LEU A O   1 
ATOM   1145 C CB  . LEU A 1 147 ? 11.575  72.852  61.934 1.00 6.31  ? 147  LEU A CB  1 
ATOM   1146 C CG  . LEU A 1 147 ? 10.875  74.187  61.673 1.00 7.40  ? 147  LEU A CG  1 
ATOM   1147 C CD1 . LEU A 1 147 ? 11.124  74.610  60.239 1.00 5.62  ? 147  LEU A CD1 1 
ATOM   1148 C CD2 . LEU A 1 147 ? 9.382   74.044  61.941 1.00 7.42  ? 147  LEU A CD2 1 
ATOM   1149 N N   . ARG A 1 148 ? 12.958  70.541  64.165 1.00 10.08 ? 148  ARG A N   1 
ATOM   1150 C CA  . ARG A 1 148 ? 13.495  69.187  64.223 1.00 10.55 ? 148  ARG A CA  1 
ATOM   1151 C C   . ARG A 1 148 ? 12.438  68.202  64.728 1.00 10.41 ? 148  ARG A C   1 
ATOM   1152 O O   . ARG A 1 148 ? 11.765  68.448  65.734 1.00 11.34 ? 148  ARG A O   1 
ATOM   1153 C CB  . ARG A 1 148 ? 14.732  69.121  65.118 1.00 7.10  ? 148  ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 148 ? 15.363  67.739  65.116 1.00 11.90 ? 148  ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 148 ? 16.461  67.579  66.140 1.00 11.71 ? 148  ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 148 ? 16.931  66.197  66.143 1.00 21.68 ? 148  ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 148 ? 18.008  65.756  66.787 1.00 24.87 ? 148  ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 148 ? 18.757  66.589  67.501 1.00 28.28 ? 148  ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 148 ? 18.338  64.474  66.710 1.00 22.48 ? 148  ARG A NH2 1 
ATOM   1160 N N   . GLY A 1 149 ? 12.336  67.064  64.054 1.00 9.86  ? 149  GLY A N   1 
ATOM   1161 C CA  . GLY A 1 149 ? 11.359  66.063  64.432 1.00 4.48  ? 149  GLY A CA  1 
ATOM   1162 C C   . GLY A 1 149 ? 10.302  66.012  63.350 1.00 8.24  ? 149  GLY A C   1 
ATOM   1163 O O   . GLY A 1 149 ? 10.405  66.737  62.359 1.00 8.37  ? 149  GLY A O   1 
ATOM   1164 N N   . PRO A 1 150 ? 9.278   65.155  63.497 1.00 8.39  ? 150  PRO A N   1 
ATOM   1165 C CA  . PRO A 1 150 ? 8.194   65.016  62.519 1.00 9.68  ? 150  PRO A CA  1 
ATOM   1166 C C   . PRO A 1 150 ? 7.607   66.369  62.144 1.00 8.07  ? 150  PRO A C   1 
ATOM   1167 O O   . PRO A 1 150 ? 7.354   67.196  63.013 1.00 4.22  ? 150  PRO A O   1 
ATOM   1168 C CB  . PRO A 1 150 ? 7.168   64.178  63.275 1.00 9.67  ? 150  PRO A CB  1 
ATOM   1169 C CG  . PRO A 1 150 ? 8.019   63.306  64.118 1.00 13.71 ? 150  PRO A CG  1 
ATOM   1170 C CD  . PRO A 1 150 ? 9.046   64.275  64.655 1.00 10.07 ? 150  PRO A CD  1 
ATOM   1171 N N   . ASN A 1 151 ? 7.398   66.587  60.851 1.00 6.92  ? 151  ASN A N   1 
ATOM   1172 C CA  . ASN A 1 151 ? 6.824   67.841  60.384 1.00 10.21 ? 151  ASN A CA  1 
ATOM   1173 C C   . ASN A 1 151 ? 5.303   67.808  60.485 1.00 10.72 ? 151  ASN A C   1 
ATOM   1174 O O   . ASN A 1 151 ? 4.669   66.805  60.160 1.00 8.27  ? 151  ASN A O   1 
ATOM   1175 C CB  . ASN A 1 151 ? 7.212   68.113  58.931 1.00 8.73  ? 151  ASN A CB  1 
ATOM   1176 C CG  . ASN A 1 151 ? 6.625   69.406  58.414 1.00 7.71  ? 151  ASN A CG  1 
ATOM   1177 O OD1 . ASN A 1 151 ? 6.907   70.484  58.939 1.00 9.33  ? 151  ASN A OD1 1 
ATOM   1178 N ND2 . ASN A 1 151 ? 5.795   69.307  57.392 1.00 2.63  ? 151  ASN A ND2 1 
ATOM   1179 N N   . GLU A 1 152 ? 4.720   68.911  60.936 1.00 10.88 ? 152  GLU A N   1 
ATOM   1180 C CA  . GLU A 1 152 ? 3.279   69.008  61.051 1.00 9.39  ? 152  GLU A CA  1 
ATOM   1181 C C   . GLU A 1 152 ? 2.817   69.706  59.783 1.00 10.27 ? 152  GLU A C   1 
ATOM   1182 O O   . GLU A 1 152 ? 2.956   70.925  59.655 1.00 7.83  ? 152  GLU A O   1 
ATOM   1183 C CB  . GLU A 1 152 ? 2.896   69.811  62.295 1.00 12.63 ? 152  GLU A CB  1 
ATOM   1184 C CG  . GLU A 1 152 ? 1.405   70.070  62.449 1.00 15.85 ? 152  GLU A CG  1 
ATOM   1185 C CD  . GLU A 1 152 ? 0.562   68.819  62.306 1.00 11.97 ? 152  GLU A CD  1 
ATOM   1186 O OE1 . GLU A 1 152 ? 0.489   68.016  63.262 1.00 15.68 ? 152  GLU A OE1 1 
ATOM   1187 O OE2 . GLU A 1 152 ? -0.045  68.656  61.235 1.00 13.98 ? 152  GLU A OE2 1 
ATOM   1188 N N   . GLU A 1 153 ? 2.307   68.918  58.838 1.00 9.72  ? 153  GLU A N   1 
ATOM   1189 C CA  . GLU A 1 153 ? 1.839   69.436  57.556 1.00 11.12 ? 153  GLU A CA  1 
ATOM   1190 C C   . GLU A 1 153 ? 0.772   70.515  57.664 1.00 11.75 ? 153  GLU A C   1 
ATOM   1191 O O   . GLU A 1 153 ? 0.561   71.273  56.719 1.00 12.52 ? 153  GLU A O   1 
ATOM   1192 C CB  . GLU A 1 153 ? 1.312   68.305  56.668 1.00 17.47 ? 153  GLU A CB  1 
ATOM   1193 C CG  . GLU A 1 153 ? 2.347   67.236  56.290 1.00 28.44 ? 153  GLU A CG  1 
ATOM   1194 C CD  . GLU A 1 153 ? 3.489   67.749  55.412 1.00 32.38 ? 153  GLU A CD  1 
ATOM   1195 O OE1 . GLU A 1 153 ? 3.244   68.558  54.485 1.00 33.29 ? 153  GLU A OE1 1 
ATOM   1196 O OE2 . GLU A 1 153 ? 4.639   67.313  55.642 1.00 36.25 ? 153  GLU A OE2 1 
ATOM   1197 N N   . ARG A 1 154 ? 0.074   70.567  58.794 1.00 10.35 ? 154  ARG A N   1 
ATOM   1198 C CA  . ARG A 1 154 ? -0.965  71.570  58.977 1.00 10.75 ? 154  ARG A CA  1 
ATOM   1199 C C   . ARG A 1 154 ? -0.402  72.972  59.191 1.00 12.28 ? 154  ARG A C   1 
ATOM   1200 O O   . ARG A 1 154 ? -1.137  73.958  59.137 1.00 15.38 ? 154  ARG A O   1 
ATOM   1201 C CB  . ARG A 1 154 ? -1.917  71.164  60.105 1.00 10.78 ? 154  ARG A CB  1 
ATOM   1202 C CG  . ARG A 1 154 ? -2.961  70.153  59.654 1.00 9.35  ? 154  ARG A CG  1 
ATOM   1203 C CD  . ARG A 1 154 ? -3.779  69.606  60.798 1.00 11.65 ? 154  ARG A CD  1 
ATOM   1204 N NE  . ARG A 1 154 ? -2.971  68.789  61.697 1.00 16.87 ? 154  ARG A NE  1 
ATOM   1205 C CZ  . ARG A 1 154 ? -3.459  68.043  62.685 1.00 18.87 ? 154  ARG A CZ  1 
ATOM   1206 N NH1 . ARG A 1 154 ? -4.767  67.997  62.915 1.00 20.93 ? 154  ARG A NH1 1 
ATOM   1207 N NH2 . ARG A 1 154 ? -2.630  67.352  63.457 1.00 18.15 ? 154  ARG A NH2 1 
ATOM   1208 N N   . PHE A 1 155 ? 0.901   73.061  59.428 1.00 12.73 ? 155  PHE A N   1 
ATOM   1209 C CA  . PHE A 1 155 ? 1.544   74.355  59.627 1.00 12.94 ? 155  PHE A CA  1 
ATOM   1210 C C   . PHE A 1 155 ? 2.363   74.754  58.413 1.00 12.65 ? 155  PHE A C   1 
ATOM   1211 O O   . PHE A 1 155 ? 2.303   75.901  57.966 1.00 12.71 ? 155  PHE A O   1 
ATOM   1212 C CB  . PHE A 1 155 ? 2.430   74.357  60.878 1.00 11.56 ? 155  PHE A CB  1 
ATOM   1213 C CG  . PHE A 1 155 ? 1.673   74.568  62.147 1.00 9.21  ? 155  PHE A CG  1 
ATOM   1214 C CD1 . PHE A 1 155 ? 0.794   75.636  62.270 1.00 7.69  ? 155  PHE A CD1 1 
ATOM   1215 C CD2 . PHE A 1 155 ? 1.817   73.690  63.210 1.00 9.72  ? 155  PHE A CD2 1 
ATOM   1216 C CE1 . PHE A 1 155 ? 0.064   75.829  63.434 1.00 9.60  ? 155  PHE A CE1 1 
ATOM   1217 C CE2 . PHE A 1 155 ? 1.089   73.873  64.384 1.00 11.14 ? 155  PHE A CE2 1 
ATOM   1218 C CZ  . PHE A 1 155 ? 0.211   74.945  64.495 1.00 9.21  ? 155  PHE A CZ  1 
ATOM   1219 N N   . GLY A 1 156 ? 3.137   73.814  57.880 1.00 10.01 ? 156  GLY A N   1 
ATOM   1220 C CA  . GLY A 1 156 ? 3.955   74.135  56.728 1.00 6.21  ? 156  GLY A CA  1 
ATOM   1221 C C   . GLY A 1 156 ? 4.672   72.930  56.171 1.00 6.61  ? 156  GLY A C   1 
ATOM   1222 O O   . GLY A 1 156 ? 4.473   71.809  56.642 1.00 3.92  ? 156  GLY A O   1 
ATOM   1223 N N   . VAL A 1 157 ? 5.563   73.181  55.217 1.00 6.25  ? 157  VAL A N   1 
ATOM   1224 C CA  . VAL A 1 157 ? 6.315   72.131  54.548 1.00 7.47  ? 157  VAL A CA  1 
ATOM   1225 C C   . VAL A 1 157 ? 7.510   71.607  55.332 1.00 9.77  ? 157  VAL A C   1 
ATOM   1226 O O   . VAL A 1 157 ? 7.968   72.247  56.278 1.00 9.93  ? 157  VAL A O   1 
ATOM   1227 C CB  . VAL A 1 157 ? 6.762   72.600  53.151 1.00 9.67  ? 157  VAL A CB  1 
ATOM   1228 C CG1 . VAL A 1 157 ? 5.540   73.043  52.357 1.00 8.94  ? 157  VAL A CG1 1 
ATOM   1229 C CG2 . VAL A 1 157 ? 7.772   73.738  53.253 1.00 6.06  ? 157  VAL A CG2 1 
ATOM   1230 N N   . ARG A 1 158 ? 8.010   70.443  54.926 1.00 6.17  ? 158  ARG A N   1 
ATOM   1231 C CA  . ARG A 1 158 ? 9.149   69.810  55.582 1.00 7.34  ? 158  ARG A CA  1 
ATOM   1232 C C   . ARG A 1 158 ? 10.451  70.606  55.448 1.00 7.47  ? 158  ARG A C   1 
ATOM   1233 O O   . ARG A 1 158 ? 11.218  70.700  56.408 1.00 8.30  ? 158  ARG A O   1 
ATOM   1234 C CB  . ARG A 1 158 ? 9.353   68.398  55.024 1.00 8.02  ? 158  ARG A CB  1 
ATOM   1235 C CG  . ARG A 1 158 ? 10.647  67.700  55.465 1.00 9.58  ? 158  ARG A CG  1 
ATOM   1236 C CD  . ARG A 1 158 ? 10.586  67.114  56.870 1.00 7.15  ? 158  ARG A CD  1 
ATOM   1237 N NE  . ARG A 1 158 ? 10.727  68.106  57.937 1.00 7.81  ? 158  ARG A NE  1 
ATOM   1238 C CZ  . ARG A 1 158 ? 10.919  67.799  59.220 1.00 5.59  ? 158  ARG A CZ  1 
ATOM   1239 N NH1 . ARG A 1 158 ? 10.996  66.525  59.600 1.00 2.20  ? 158  ARG A NH1 1 
ATOM   1240 N NH2 . ARG A 1 158 ? 11.037  68.767  60.123 1.00 3.36  ? 158  ARG A NH2 1 
ATOM   1241 N N   . PHE A 1 159 ? 10.687  71.178  54.266 1.00 5.10  ? 159  PHE A N   1 
ATOM   1242 C CA  . PHE A 1 159 ? 11.904  71.945  53.999 1.00 5.22  ? 159  PHE A CA  1 
ATOM   1243 C C   . PHE A 1 159 ? 11.597  73.389  53.608 1.00 3.99  ? 159  PHE A C   1 
ATOM   1244 O O   . PHE A 1 159 ? 11.639  73.740  52.429 1.00 9.39  ? 159  PHE A O   1 
ATOM   1245 C CB  . PHE A 1 159 ? 12.714  71.296  52.866 1.00 2.99  ? 159  PHE A CB  1 
ATOM   1246 C CG  . PHE A 1 159 ? 13.127  69.880  53.137 1.00 2.06  ? 159  PHE A CG  1 
ATOM   1247 C CD1 . PHE A 1 159 ? 14.208  69.604  53.961 1.00 4.53  ? 159  PHE A CD1 1 
ATOM   1248 C CD2 . PHE A 1 159 ? 12.445  68.826  52.553 1.00 3.99  ? 159  PHE A CD2 1 
ATOM   1249 C CE1 . PHE A 1 159 ? 14.608  68.293  54.200 1.00 8.79  ? 159  PHE A CE1 1 
ATOM   1250 C CE2 . PHE A 1 159 ? 12.833  67.515  52.783 1.00 4.78  ? 159  PHE A CE2 1 
ATOM   1251 C CZ  . PHE A 1 159 ? 13.917  67.246  53.608 1.00 7.74  ? 159  PHE A CZ  1 
ATOM   1252 N N   . PRO A 1 160 ? 11.285  74.252  54.587 1.00 4.28  ? 160  PRO A N   1 
ATOM   1253 C CA  . PRO A 1 160 ? 10.988  75.642  54.241 1.00 4.26  ? 160  PRO A CA  1 
ATOM   1254 C C   . PRO A 1 160 ? 12.239  76.438  53.863 1.00 6.82  ? 160  PRO A C   1 
ATOM   1255 O O   . PRO A 1 160 ? 13.326  76.203  54.402 1.00 8.04  ? 160  PRO A O   1 
ATOM   1256 C CB  . PRO A 1 160 ? 10.355  76.175  55.523 1.00 5.25  ? 160  PRO A CB  1 
ATOM   1257 C CG  . PRO A 1 160 ? 11.093  75.429  56.582 1.00 3.52  ? 160  PRO A CG  1 
ATOM   1258 C CD  . PRO A 1 160 ? 11.108  74.021  56.032 1.00 5.44  ? 160  PRO A CD  1 
ATOM   1259 N N   . ALA A 1 161 ? 12.087  77.359  52.918 1.00 6.40  ? 161  ALA A N   1 
ATOM   1260 C CA  . ALA A 1 161 ? 13.190  78.206  52.485 1.00 7.01  ? 161  ALA A CA  1 
ATOM   1261 C C   . ALA A 1 161 ? 13.285  79.371  53.462 1.00 4.86  ? 161  ALA A C   1 
ATOM   1262 O O   . ALA A 1 161 ? 12.288  79.750  54.079 1.00 6.49  ? 161  ALA A O   1 
ATOM   1263 C CB  . ALA A 1 161 ? 12.940  78.718  51.068 1.00 7.44  ? 161  ALA A CB  1 
ATOM   1264 N N   . MET A 1 162 ? 14.480  79.921  53.621 1.00 4.14  ? 162  MET A N   1 
ATOM   1265 C CA  . MET A 1 162 ? 14.685  81.041  54.534 1.00 5.64  ? 162  MET A CA  1 
ATOM   1266 C C   . MET A 1 162 ? 15.328  82.253  53.868 1.00 5.00  ? 162  MET A C   1 
ATOM   1267 O O   . MET A 1 162 ? 15.481  83.289  54.500 1.00 5.47  ? 162  MET A O   1 
ATOM   1268 C CB  . MET A 1 162 ? 15.541  80.607  55.728 1.00 4.03  ? 162  MET A CB  1 
ATOM   1269 C CG  . MET A 1 162 ? 14.842  79.703  56.712 1.00 6.52  ? 162  MET A CG  1 
ATOM   1270 S SD  . MET A 1 162 ? 13.439  80.500  57.517 1.00 10.67 ? 162  MET A SD  1 
ATOM   1271 C CE  . MET A 1 162 ? 12.218  79.196  57.405 1.00 6.26  ? 162  MET A CE  1 
ATOM   1272 N N   . SER A 1 163 ? 15.704  82.123  52.596 1.00 7.51  ? 163  SER A N   1 
ATOM   1273 C CA  . SER A 1 163 ? 16.349  83.213  51.865 1.00 10.61 ? 163  SER A CA  1 
ATOM   1274 C C   . SER A 1 163 ? 15.524  84.506  51.782 1.00 12.31 ? 163  SER A C   1 
ATOM   1275 O O   . SER A 1 163 ? 16.079  85.593  51.608 1.00 13.00 ? 163  SER A O   1 
ATOM   1276 C CB  . SER A 1 163 ? 16.752  82.742  50.461 1.00 13.12 ? 163  SER A CB  1 
ATOM   1277 O OG  . SER A 1 163 ? 15.679  82.075  49.812 1.00 13.92 ? 163  SER A OG  1 
ATOM   1278 N N   . ASP A 1 164 ? 14.202  84.383  51.897 1.00 12.80 ? 164  ASP A N   1 
ATOM   1279 C CA  . ASP A 1 164 ? 13.308  85.544  51.841 1.00 12.25 ? 164  ASP A CA  1 
ATOM   1280 C C   . ASP A 1 164 ? 12.540  85.726  53.155 1.00 12.93 ? 164  ASP A C   1 
ATOM   1281 O O   . ASP A 1 164 ? 11.395  86.178  53.153 1.00 12.45 ? 164  ASP A O   1 
ATOM   1282 C CB  . ASP A 1 164 ? 12.323  85.410  50.662 1.00 11.23 ? 164  ASP A CB  1 
ATOM   1283 C CG  . ASP A 1 164 ? 11.418  84.175  50.765 1.00 16.90 ? 164  ASP A CG  1 
ATOM   1284 O OD1 . ASP A 1 164 ? 11.776  83.199  51.448 1.00 13.90 ? 164  ASP A OD1 1 
ATOM   1285 O OD2 . ASP A 1 164 ? 10.338  84.172  50.138 1.00 21.31 ? 164  ASP A OD2 1 
ATOM   1286 N N   . ALA A 1 165 ? 13.192  85.409  54.272 1.00 9.83  ? 165  ALA A N   1 
ATOM   1287 C CA  . ALA A 1 165 ? 12.567  85.490  55.588 1.00 6.09  ? 165  ALA A CA  1 
ATOM   1288 C C   . ALA A 1 165 ? 12.111  86.872  56.003 1.00 5.79  ? 165  ALA A C   1 
ATOM   1289 O O   . ALA A 1 165 ? 11.031  87.020  56.559 1.00 3.94  ? 165  ALA A O   1 
ATOM   1290 C CB  . ALA A 1 165 ? 13.488  84.904  56.653 1.00 5.85  ? 165  ALA A CB  1 
ATOM   1291 N N   . TYR A 1 166 ? 12.941  87.881  55.767 1.00 4.31  ? 166  TYR A N   1 
ATOM   1292 C CA  . TYR A 1 166 ? 12.584  89.239  56.156 1.00 3.92  ? 166  TYR A CA  1 
ATOM   1293 C C   . TYR A 1 166 ? 11.962  90.014  55.000 1.00 7.15  ? 166  TYR A C   1 
ATOM   1294 O O   . TYR A 1 166 ? 12.649  90.401  54.049 1.00 8.68  ? 166  TYR A O   1 
ATOM   1295 C CB  . TYR A 1 166 ? 13.799  89.958  56.756 1.00 5.87  ? 166  TYR A CB  1 
ATOM   1296 C CG  . TYR A 1 166 ? 14.362  89.223  57.956 1.00 5.33  ? 166  TYR A CG  1 
ATOM   1297 C CD1 . TYR A 1 166 ? 15.313  88.216  57.790 1.00 6.76  ? 166  TYR A CD1 1 
ATOM   1298 C CD2 . TYR A 1 166 ? 13.874  89.457  59.239 1.00 2.64  ? 166  TYR A CD2 1 
ATOM   1299 C CE1 . TYR A 1 166 ? 15.755  87.454  58.864 1.00 2.06  ? 166  TYR A CE1 1 
ATOM   1300 C CE2 . TYR A 1 166 ? 14.314  88.695  60.325 1.00 2.77  ? 166  TYR A CE2 1 
ATOM   1301 C CZ  . TYR A 1 166 ? 15.253  87.694  60.123 1.00 2.57  ? 166  TYR A CZ  1 
ATOM   1302 O OH  . TYR A 1 166 ? 15.685  86.905  61.168 1.00 3.20  ? 166  TYR A OH  1 
ATOM   1303 N N   . ASP A 1 167 ? 10.652  90.225  55.093 1.00 6.93  ? 167  ASP A N   1 
ATOM   1304 C CA  . ASP A 1 167 ? 9.874   90.919  54.067 1.00 8.66  ? 167  ASP A CA  1 
ATOM   1305 C C   . ASP A 1 167 ? 10.527  92.193  53.511 1.00 11.71 ? 167  ASP A C   1 
ATOM   1306 O O   . ASP A 1 167 ? 10.741  93.174  54.239 1.00 9.31  ? 167  ASP A O   1 
ATOM   1307 C CB  . ASP A 1 167 ? 8.479   91.236  54.616 1.00 9.12  ? 167  ASP A CB  1 
ATOM   1308 C CG  . ASP A 1 167 ? 7.487   91.571  53.526 1.00 10.03 ? 167  ASP A CG  1 
ATOM   1309 O OD1 . ASP A 1 167 ? 7.170   90.683  52.717 1.00 12.86 ? 167  ASP A OD1 1 
ATOM   1310 O OD2 . ASP A 1 167 ? 7.023   92.720  53.471 1.00 13.48 ? 167  ASP A OD2 1 
ATOM   1311 N N   . ARG A 1 168 ? 10.770  92.199  52.200 1.00 14.51 ? 168  ARG A N   1 
ATOM   1312 C CA  . ARG A 1 168 ? 11.401  93.340  51.536 1.00 17.20 ? 168  ARG A CA  1 
ATOM   1313 C C   . ARG A 1 168 ? 10.521  94.583  51.544 1.00 15.70 ? 168  ARG A C   1 
ATOM   1314 O O   . ARG A 1 168 ? 11.005  95.689  51.777 1.00 16.43 ? 168  ARG A O   1 
ATOM   1315 C CB  . ARG A 1 168 ? 11.799  92.992  50.093 1.00 21.64 ? 168  ARG A CB  1 
ATOM   1316 C CG  . ARG A 1 168 ? 10.642  93.020  49.107 1.00 34.93 ? 168  ARG A CG  1 
ATOM   1317 C CD  . ARG A 1 168 ? 11.091  92.886  47.653 1.00 40.31 ? 168  ARG A CD  1 
ATOM   1318 N NE  . ARG A 1 168 ? 10.007  93.217  46.724 1.00 44.05 ? 168  ARG A NE  1 
ATOM   1319 C CZ  . ARG A 1 168 ? 8.882   92.517  46.585 1.00 45.62 ? 168  ARG A CZ  1 
ATOM   1320 N NH1 . ARG A 1 168 ? 8.666   91.425  47.310 1.00 46.09 ? 168  ARG A NH1 1 
ATOM   1321 N NH2 . ARG A 1 168 ? 7.956   92.922  45.725 1.00 47.92 ? 168  ARG A NH2 1 
ATOM   1322 N N   . ASP A 1 169 ? 9.227   94.401  51.302 1.00 16.52 ? 169  ASP A N   1 
ATOM   1323 C CA  . ASP A 1 169 ? 8.298   95.525  51.283 1.00 15.50 ? 169  ASP A CA  1 
ATOM   1324 C C   . ASP A 1 169 ? 8.221   96.227  52.642 1.00 15.26 ? 169  ASP A C   1 
ATOM   1325 O O   . ASP A 1 169 ? 8.220   97.454  52.707 1.00 14.90 ? 169  ASP A O   1 
ATOM   1326 C CB  . ASP A 1 169 ? 6.909   95.077  50.804 1.00 20.00 ? 169  ASP A CB  1 
ATOM   1327 C CG  . ASP A 1 169 ? 6.904   94.630  49.339 1.00 26.19 ? 169  ASP A CG  1 
ATOM   1328 O OD1 . ASP A 1 169 ? 7.559   95.289  48.503 1.00 29.96 ? 169  ASP A OD1 1 
ATOM   1329 O OD2 . ASP A 1 169 ? 6.243   93.617  49.016 1.00 31.43 ? 169  ASP A OD2 1 
ATOM   1330 N N   . MET A 1 170 ? 8.217   95.457  53.728 1.00 13.03 ? 170  MET A N   1 
ATOM   1331 C CA  . MET A 1 170 ? 8.159   96.047  55.061 1.00 13.78 ? 170  MET A CA  1 
ATOM   1332 C C   . MET A 1 170 ? 9.413   96.846  55.363 1.00 12.82 ? 170  MET A C   1 
ATOM   1333 O O   . MET A 1 170 ? 9.355   97.879  56.027 1.00 11.33 ? 170  MET A O   1 
ATOM   1334 C CB  . MET A 1 170 ? 7.953   94.982  56.141 1.00 19.08 ? 170  MET A CB  1 
ATOM   1335 C CG  . MET A 1 170 ? 6.528   94.461  56.230 1.00 28.24 ? 170  MET A CG  1 
ATOM   1336 S SD  . MET A 1 170 ? 5.351   95.814  56.089 1.00 38.36 ? 170  MET A SD  1 
ATOM   1337 C CE  . MET A 1 170 ? 5.424   96.529  57.754 1.00 39.20 ? 170  MET A CE  1 
ATOM   1338 N N   . ARG A 1 171 ? 10.552  96.376  54.871 1.00 15.45 ? 171  ARG A N   1 
ATOM   1339 C CA  . ARG A 1 171 ? 11.805  97.082  55.105 1.00 17.84 ? 171  ARG A CA  1 
ATOM   1340 C C   . ARG A 1 171 ? 11.851  98.428  54.383 1.00 16.35 ? 171  ARG A C   1 
ATOM   1341 O O   . ARG A 1 171 ? 12.437  99.386  54.884 1.00 16.36 ? 171  ARG A O   1 
ATOM   1342 C CB  . ARG A 1 171 ? 13.004  96.200  54.745 1.00 20.74 ? 171  ARG A CB  1 
ATOM   1343 C CG  . ARG A 1 171 ? 13.301  95.150  55.816 1.00 22.89 ? 171  ARG A CG  1 
ATOM   1344 C CD  . ARG A 1 171 ? 14.547  94.346  55.503 1.00 23.13 ? 171  ARG A CD  1 
ATOM   1345 N NE  . ARG A 1 171 ? 14.284  93.246  54.580 1.00 29.16 ? 171  ARG A NE  1 
ATOM   1346 C CZ  . ARG A 1 171 ? 14.961  93.026  53.457 1.00 30.63 ? 171  ARG A CZ  1 
ATOM   1347 N NH1 . ARG A 1 171 ? 15.946  93.836  53.099 1.00 33.71 ? 171  ARG A NH1 1 
ATOM   1348 N NH2 . ARG A 1 171 ? 14.677  91.971  52.704 1.00 34.71 ? 171  ARG A NH2 1 
ATOM   1349 N N   . GLN A 1 172 ? 11.238  98.502  53.208 1.00 18.36 ? 172  GLN A N   1 
ATOM   1350 C CA  . GLN A 1 172 ? 11.186  99.751  52.455 1.00 19.33 ? 172  GLN A CA  1 
ATOM   1351 C C   . GLN A 1 172 ? 10.304  100.728 53.235 1.00 15.58 ? 172  GLN A C   1 
ATOM   1352 O O   . GLN A 1 172 ? 10.657  101.890 53.418 1.00 14.32 ? 172  GLN A O   1 
ATOM   1353 C CB  . GLN A 1 172 ? 10.593  99.513  51.069 1.00 24.87 ? 172  GLN A CB  1 
ATOM   1354 C CG  . GLN A 1 172 ? 10.443  100.780 50.245 1.00 35.32 ? 172  GLN A CG  1 
ATOM   1355 C CD  . GLN A 1 172 ? 9.539   100.592 49.040 1.00 41.84 ? 172  GLN A CD  1 
ATOM   1356 O OE1 . GLN A 1 172 ? 9.059   99.486  48.772 1.00 45.68 ? 172  GLN A OE1 1 
ATOM   1357 N NE2 . GLN A 1 172 ? 9.293   101.677 48.309 1.00 41.85 ? 172  GLN A NE2 1 
ATOM   1358 N N   . LYS A 1 173 ? 9.161   100.236 53.707 1.00 14.09 ? 173  LYS A N   1 
ATOM   1359 C CA  . LYS A 1 173 ? 8.227   101.039 54.487 1.00 13.43 ? 173  LYS A CA  1 
ATOM   1360 C C   . LYS A 1 173 ? 8.925   101.595 55.713 1.00 12.28 ? 173  LYS A C   1 
ATOM   1361 O O   . LYS A 1 173 ? 8.748   102.765 56.052 1.00 12.45 ? 173  LYS A O   1 
ATOM   1362 C CB  . LYS A 1 173 ? 7.016   100.203 54.925 1.00 14.47 ? 173  LYS A CB  1 
ATOM   1363 C CG  . LYS A 1 173 ? 5.817   100.270 53.985 1.00 22.18 ? 173  LYS A CG  1 
ATOM   1364 C CD  . LYS A 1 173 ? 6.220   99.998  52.547 1.00 27.36 ? 173  LYS A CD  1 
ATOM   1365 C CE  . LYS A 1 173 ? 5.022   99.936  51.617 1.00 29.14 ? 173  LYS A CE  1 
ATOM   1366 N NZ  . LYS A 1 173 ? 5.478   99.630  50.228 1.00 32.78 ? 173  LYS A NZ  1 
ATOM   1367 N N   . ALA A 1 174 ? 9.733   100.758 56.361 1.00 10.02 ? 174  ALA A N   1 
ATOM   1368 C CA  . ALA A 1 174 ? 10.468  101.161 57.555 1.00 10.05 ? 174  ALA A CA  1 
ATOM   1369 C C   . ALA A 1 174 ? 11.377  102.350 57.269 1.00 9.79  ? 174  ALA A C   1 
ATOM   1370 O O   . ALA A 1 174 ? 11.489  103.270 58.083 1.00 8.42  ? 174  ALA A O   1 
ATOM   1371 C CB  . ALA A 1 174 ? 11.272  99.996  58.094 1.00 8.09  ? 174  ALA A CB  1 
ATOM   1372 N N   . HIS A 1 175 ? 12.010  102.344 56.101 1.00 10.50 ? 175  HIS A N   1 
ATOM   1373 C CA  . HIS A 1 175 ? 12.897  103.438 55.727 1.00 10.91 ? 175  HIS A CA  1 
ATOM   1374 C C   . HIS A 1 175 ? 12.135  104.724 55.441 1.00 10.48 ? 175  HIS A C   1 
ATOM   1375 O O   . HIS A 1 175 ? 12.550  105.795 55.877 1.00 12.11 ? 175  HIS A O   1 
ATOM   1376 C CB  . HIS A 1 175 ? 13.760  103.058 54.532 1.00 10.35 ? 175  HIS A CB  1 
ATOM   1377 C CG  . HIS A 1 175 ? 14.969  102.257 54.895 1.00 11.99 ? 175  HIS A CG  1 
ATOM   1378 N ND1 . HIS A 1 175 ? 15.054  100.899 54.686 1.00 15.48 ? 175  HIS A ND1 1 
ATOM   1379 C CD2 . HIS A 1 175 ? 16.142  102.625 55.461 1.00 9.53  ? 175  HIS A CD2 1 
ATOM   1380 C CE1 . HIS A 1 175 ? 16.226  100.463 55.109 1.00 12.35 ? 175  HIS A CE1 1 
ATOM   1381 N NE2 . HIS A 1 175 ? 16.905  101.490 55.584 1.00 13.48 ? 175  HIS A NE2 1 
ATOM   1382 N N   . SER A 1 176 ? 11.020  104.624 54.721 1.00 10.73 ? 176  SER A N   1 
ATOM   1383 C CA  . SER A 1 176 ? 10.211  105.802 54.414 1.00 10.92 ? 176  SER A CA  1 
ATOM   1384 C C   . SER A 1 176 ? 9.667   106.407 55.706 1.00 11.30 ? 176  SER A C   1 
ATOM   1385 O O   . SER A 1 176 ? 9.674   107.628 55.885 1.00 13.26 ? 176  SER A O   1 
ATOM   1386 C CB  . SER A 1 176 ? 9.061   105.438 53.474 1.00 9.84  ? 176  SER A CB  1 
ATOM   1387 O OG  . SER A 1 176 ? 9.559   105.014 52.219 1.00 9.99  ? 176  SER A OG  1 
ATOM   1388 N N   . THR A 1 177 ? 9.233   105.546 56.621 1.00 12.13 ? 177  THR A N   1 
ATOM   1389 C CA  . THR A 1 177 ? 8.702   105.990 57.908 1.00 10.87 ? 177  THR A CA  1 
ATOM   1390 C C   . THR A 1 177 ? 9.771   106.707 58.733 1.00 8.13  ? 177  THR A C   1 
ATOM   1391 O O   . THR A 1 177 ? 9.504   107.741 59.341 1.00 8.87  ? 177  THR A O   1 
ATOM   1392 C CB  . THR A 1 177 ? 8.146   104.800 58.712 1.00 9.68  ? 177  THR A CB  1 
ATOM   1393 O OG1 . THR A 1 177 ? 7.028   104.244 58.013 1.00 10.80 ? 177  THR A OG1 1 
ATOM   1394 C CG2 . THR A 1 177 ? 7.713   105.232 60.106 1.00 8.30  ? 177  THR A CG2 1 
ATOM   1395 N N   . TRP A 1 178 ? 10.989  106.176 58.716 1.00 8.37  ? 178  TRP A N   1 
ATOM   1396 C CA  . TRP A 1 178 ? 12.085  106.763 59.473 1.00 8.30  ? 178  TRP A CA  1 
ATOM   1397 C C   . TRP A 1 178 ? 12.381  108.174 58.992 1.00 8.65  ? 178  TRP A C   1 
ATOM   1398 O O   . TRP A 1 178 ? 12.585  109.084 59.798 1.00 11.91 ? 178  TRP A O   1 
ATOM   1399 C CB  . TRP A 1 178 ? 13.335  105.892 59.363 1.00 10.11 ? 178  TRP A CB  1 
ATOM   1400 C CG  . TRP A 1 178 ? 14.460  106.320 60.272 1.00 9.82  ? 178  TRP A CG  1 
ATOM   1401 C CD1 . TRP A 1 178 ? 15.571  107.036 59.923 1.00 11.63 ? 178  TRP A CD1 1 
ATOM   1402 C CD2 . TRP A 1 178 ? 14.600  106.017 61.666 1.00 13.16 ? 178  TRP A CD2 1 
ATOM   1403 N NE1 . TRP A 1 178 ? 16.397  107.191 61.011 1.00 11.69 ? 178  TRP A NE1 1 
ATOM   1404 C CE2 . TRP A 1 178 ? 15.828  106.575 62.094 1.00 14.77 ? 178  TRP A CE2 1 
ATOM   1405 C CE3 . TRP A 1 178 ? 13.813  105.322 62.595 1.00 13.42 ? 178  TRP A CE3 1 
ATOM   1406 C CZ2 . TRP A 1 178 ? 16.287  106.458 63.410 1.00 13.13 ? 178  TRP A CZ2 1 
ATOM   1407 C CZ3 . TRP A 1 178 ? 14.267  105.205 63.903 1.00 14.54 ? 178  TRP A CZ3 1 
ATOM   1408 C CH2 . TRP A 1 178 ? 15.495  105.773 64.297 1.00 17.50 ? 178  TRP A CH2 1 
ATOM   1409 N N   . LYS A 1 179 ? 12.377  108.365 57.680 1.00 7.15  ? 179  LYS A N   1 
ATOM   1410 C CA  . LYS A 1 179 ? 12.639  109.683 57.112 1.00 10.15 ? 179  LYS A CA  1 
ATOM   1411 C C   . LYS A 1 179 ? 11.578  110.688 57.550 1.00 9.38  ? 179  LYS A C   1 
ATOM   1412 O O   . LYS A 1 179 ? 11.878  111.854 57.789 1.00 11.91 ? 179  LYS A O   1 
ATOM   1413 C CB  . LYS A 1 179 ? 12.689  109.609 55.584 1.00 6.73  ? 179  LYS A CB  1 
ATOM   1414 C CG  . LYS A 1 179 ? 13.851  108.805 55.036 1.00 10.48 ? 179  LYS A CG  1 
ATOM   1415 C CD  . LYS A 1 179 ? 13.556  108.410 53.611 1.00 16.44 ? 179  LYS A CD  1 
ATOM   1416 C CE  . LYS A 1 179 ? 14.526  107.369 53.102 1.00 24.48 ? 179  LYS A CE  1 
ATOM   1417 N NZ  . LYS A 1 179 ? 14.000  106.752 51.847 1.00 28.49 ? 179  LYS A NZ  1 
ATOM   1418 N N   . GLN A 1 180 ? 10.344  110.222 57.687 1.00 11.72 ? 180  GLN A N   1 
ATOM   1419 C CA  . GLN A 1 180 ? 9.246   111.087 58.095 1.00 14.38 ? 180  GLN A CA  1 
ATOM   1420 C C   . GLN A 1 180 ? 9.353   111.514 59.554 1.00 13.96 ? 180  GLN A C   1 
ATOM   1421 O O   . GLN A 1 180 ? 8.759   112.514 59.963 1.00 13.64 ? 180  GLN A O   1 
ATOM   1422 C CB  . GLN A 1 180 ? 7.908   110.388 57.843 1.00 15.63 ? 180  GLN A CB  1 
ATOM   1423 C CG  . GLN A 1 180 ? 7.688   110.033 56.386 1.00 16.49 ? 180  GLN A CG  1 
ATOM   1424 C CD  . GLN A 1 180 ? 6.296   109.535 56.120 1.00 18.82 ? 180  GLN A CD  1 
ATOM   1425 O OE1 . GLN A 1 180 ? 5.734   108.784 56.914 1.00 19.76 ? 180  GLN A OE1 1 
ATOM   1426 N NE2 . GLN A 1 180 ? 5.717   109.964 55.008 1.00 19.88 ? 180  GLN A NE2 1 
ATOM   1427 N N   . MET A 1 181 ? 10.115  110.761 60.337 1.00 13.72 ? 181  MET A N   1 
ATOM   1428 C CA  . MET A 1 181 ? 10.284  111.074 61.750 1.00 16.73 ? 181  MET A CA  1 
ATOM   1429 C C   . MET A 1 181 ? 11.259  112.224 61.981 1.00 18.61 ? 181  MET A C   1 
ATOM   1430 O O   . MET A 1 181 ? 11.297  112.802 63.064 1.00 19.75 ? 181  MET A O   1 
ATOM   1431 C CB  . MET A 1 181 ? 10.725  109.826 62.517 1.00 15.45 ? 181  MET A CB  1 
ATOM   1432 C CG  . MET A 1 181 ? 9.628   108.778 62.642 1.00 15.99 ? 181  MET A CG  1 
ATOM   1433 S SD  . MET A 1 181 ? 10.196  107.223 63.361 1.00 21.09 ? 181  MET A SD  1 
ATOM   1434 C CE  . MET A 1 181 ? 10.599  107.724 65.037 1.00 13.15 ? 181  MET A CE  1 
ATOM   1435 N N   . GLY A 1 182 ? 12.032  112.562 60.954 1.00 21.47 ? 182  GLY A N   1 
ATOM   1436 C CA  . GLY A 1 182 ? 12.997  113.642 61.068 1.00 22.66 ? 182  GLY A CA  1 
ATOM   1437 C C   . GLY A 1 182 ? 14.187  113.278 61.934 1.00 26.04 ? 182  GLY A C   1 
ATOM   1438 O O   . GLY A 1 182 ? 14.748  114.132 62.618 1.00 27.87 ? 182  GLY A O   1 
ATOM   1439 N N   . GLU A 1 183 ? 14.568  112.005 61.920 1.00 28.53 ? 183  GLU A N   1 
ATOM   1440 C CA  . GLU A 1 183 ? 15.699  111.533 62.713 1.00 28.77 ? 183  GLU A CA  1 
ATOM   1441 C C   . GLU A 1 183 ? 17.030  111.927 62.090 1.00 28.39 ? 183  GLU A C   1 
ATOM   1442 O O   . GLU A 1 183 ? 17.210  111.843 60.879 1.00 27.31 ? 183  GLU A O   1 
ATOM   1443 C CB  . GLU A 1 183 ? 15.633  110.013 62.882 1.00 27.89 ? 183  GLU A CB  1 
ATOM   1444 C CG  . GLU A 1 183 ? 14.574  109.538 63.866 1.00 31.35 ? 183  GLU A CG  1 
ATOM   1445 C CD  . GLU A 1 183 ? 14.883  109.941 65.298 1.00 33.73 ? 183  GLU A CD  1 
ATOM   1446 O OE1 . GLU A 1 183 ? 15.928  109.504 65.826 1.00 36.73 ? 183  GLU A OE1 1 
ATOM   1447 O OE2 . GLU A 1 183 ? 14.084  110.692 65.897 1.00 34.71 ? 183  GLU A OE2 1 
ATOM   1448 N N   . GLN A 1 184 ? 17.957  112.365 62.930 1.00 30.68 ? 184  GLN A N   1 
ATOM   1449 C CA  . GLN A 1 184 ? 19.287  112.770 62.477 1.00 34.72 ? 184  GLN A CA  1 
ATOM   1450 C C   . GLN A 1 184 ? 20.176  111.561 62.154 1.00 33.46 ? 184  GLN A C   1 
ATOM   1451 O O   . GLN A 1 184 ? 20.951  111.578 61.197 1.00 34.46 ? 184  GLN A O   1 
ATOM   1452 C CB  . GLN A 1 184 ? 19.965  113.680 63.513 1.00 39.49 ? 184  GLN A CB  1 
ATOM   1453 C CG  . GLN A 1 184 ? 20.088  113.103 64.922 1.00 48.31 ? 184  GLN A CG  1 
ATOM   1454 C CD  . GLN A 1 184 ? 18.750  112.986 65.640 1.00 53.99 ? 184  GLN A CD  1 
ATOM   1455 O OE1 . GLN A 1 184 ? 18.132  111.918 65.656 1.00 55.51 ? 184  GLN A OE1 1 
ATOM   1456 N NE2 . GLN A 1 184 ? 18.288  114.088 66.220 1.00 55.29 ? 184  GLN A NE2 1 
ATOM   1457 N N   . ARG A 1 185 ? 20.063  110.514 62.961 1.00 30.27 ? 185  ARG A N   1 
ATOM   1458 C CA  . ARG A 1 185 ? 20.842  109.304 62.749 1.00 28.53 ? 185  ARG A CA  1 
ATOM   1459 C C   . ARG A 1 185 ? 20.114  108.445 61.712 1.00 26.50 ? 185  ARG A C   1 
ATOM   1460 O O   . ARG A 1 185 ? 18.882  108.395 61.691 1.00 24.97 ? 185  ARG A O   1 
ATOM   1461 C CB  . ARG A 1 185 ? 20.985  108.546 64.068 1.00 29.14 ? 185  ARG A CB  1 
ATOM   1462 C CG  . ARG A 1 185 ? 21.806  107.283 63.983 1.00 31.75 ? 185  ARG A CG  1 
ATOM   1463 C CD  . ARG A 1 185 ? 23.284  107.563 63.760 1.00 33.64 ? 185  ARG A CD  1 
ATOM   1464 N NE  . ARG A 1 185 ? 24.047  106.319 63.690 1.00 33.15 ? 185  ARG A NE  1 
ATOM   1465 C CZ  . ARG A 1 185 ? 25.353  106.246 63.466 1.00 33.04 ? 185  ARG A CZ  1 
ATOM   1466 N NH1 . ARG A 1 185 ? 26.064  107.351 63.286 1.00 35.77 ? 185  ARG A NH1 1 
ATOM   1467 N NH2 . ARG A 1 185 ? 25.949  105.064 63.419 1.00 27.34 ? 185  ARG A NH2 1 
ATOM   1468 N N   . GLU A 1 186 ? 20.875  107.784 60.849 1.00 22.12 ? 186  GLU A N   1 
ATOM   1469 C CA  . GLU A 1 186 ? 20.298  106.935 59.807 1.00 24.90 ? 186  GLU A CA  1 
ATOM   1470 C C   . GLU A 1 186 ? 19.788  105.606 60.369 1.00 21.31 ? 186  GLU A C   1 
ATOM   1471 O O   . GLU A 1 186 ? 20.262  105.139 61.412 1.00 19.28 ? 186  GLU A O   1 
ATOM   1472 C CB  . GLU A 1 186 ? 21.334  106.635 58.712 1.00 28.68 ? 186  GLU A CB  1 
ATOM   1473 C CG  . GLU A 1 186 ? 21.972  107.856 58.050 1.00 36.92 ? 186  GLU A CG  1 
ATOM   1474 C CD  . GLU A 1 186 ? 22.903  108.624 58.978 1.00 42.09 ? 186  GLU A CD  1 
ATOM   1475 O OE1 . GLU A 1 186 ? 23.646  107.980 59.758 1.00 42.64 ? 186  GLU A OE1 1 
ATOM   1476 O OE2 . GLU A 1 186 ? 22.885  109.874 58.932 1.00 46.40 ? 186  GLU A OE2 1 
ATOM   1477 N N   . LEU A 1 187 ? 18.815  105.012 59.680 1.00 16.51 ? 187  LEU A N   1 
ATOM   1478 C CA  . LEU A 1 187 ? 18.271  103.720 60.077 1.00 12.64 ? 187  LEU A CA  1 
ATOM   1479 C C   . LEU A 1 187 ? 19.248  102.685 59.518 1.00 13.94 ? 187  LEU A C   1 
ATOM   1480 O O   . LEU A 1 187 ? 19.482  102.641 58.310 1.00 12.40 ? 187  LEU A O   1 
ATOM   1481 C CB  . LEU A 1 187 ? 16.885  103.512 59.468 1.00 10.02 ? 187  LEU A CB  1 
ATOM   1482 C CG  . LEU A 1 187 ? 16.179  102.181 59.765 1.00 9.26  ? 187  LEU A CG  1 
ATOM   1483 C CD1 . LEU A 1 187 ? 15.988  102.003 61.259 1.00 10.02 ? 187  LEU A CD1 1 
ATOM   1484 C CD2 . LEU A 1 187 ? 14.838  102.140 59.065 1.00 9.36  ? 187  LEU A CD2 1 
ATOM   1485 N N   . GLN A 1 188 ? 19.847  101.889 60.396 1.00 13.75 ? 188  GLN A N   1 
ATOM   1486 C CA  . GLN A 1 188 ? 20.808  100.873 59.976 1.00 10.21 ? 188  GLN A CA  1 
ATOM   1487 C C   . GLN A 1 188 ? 20.075  99.639  59.461 1.00 11.08 ? 188  GLN A C   1 
ATOM   1488 O O   . GLN A 1 188 ? 18.863  99.501  59.641 1.00 6.11  ? 188  GLN A O   1 
ATOM   1489 C CB  . GLN A 1 188 ? 21.718  100.484 61.149 1.00 12.79 ? 188  GLN A CB  1 
ATOM   1490 C CG  . GLN A 1 188 ? 22.365  101.656 61.881 1.00 13.42 ? 188  GLN A CG  1 
ATOM   1491 C CD  . GLN A 1 188 ? 23.313  102.452 61.010 1.00 17.28 ? 188  GLN A CD  1 
ATOM   1492 O OE1 . GLN A 1 188 ? 24.084  101.889 60.243 1.00 19.02 ? 188  GLN A OE1 1 
ATOM   1493 N NE2 . GLN A 1 188 ? 23.255  103.771 61.121 1.00 21.76 ? 188  GLN A NE2 1 
ATOM   1494 N N   . GLU A 1 189 ? 20.810  98.742  58.817 1.00 10.59 ? 189  GLU A N   1 
ATOM   1495 C CA  . GLU A 1 189 ? 20.234  97.509  58.285 1.00 13.41 ? 189  GLU A CA  1 
ATOM   1496 C C   . GLU A 1 189 ? 21.351  96.483  58.192 1.00 12.97 ? 189  GLU A C   1 
ATOM   1497 O O   . GLU A 1 189 ? 22.463  96.808  57.770 1.00 14.64 ? 189  GLU A O   1 
ATOM   1498 C CB  . GLU A 1 189 ? 19.623  97.752  56.907 1.00 14.30 ? 189  GLU A CB  1 
ATOM   1499 C CG  . GLU A 1 189 ? 18.818  96.580  56.371 1.00 19.44 ? 189  GLU A CG  1 
ATOM   1500 C CD  . GLU A 1 189 ? 18.077  96.904  55.079 1.00 22.91 ? 189  GLU A CD  1 
ATOM   1501 O OE1 . GLU A 1 189 ? 18.000  98.089  54.697 1.00 21.52 ? 189  GLU A OE1 1 
ATOM   1502 O OE2 . GLU A 1 189 ? 17.564  95.966  54.440 1.00 25.71 ? 189  GLU A OE2 1 
ATOM   1503 N N   . GLY A 1 190 ? 21.081  95.254  58.616 1.00 9.87  ? 190  GLY A N   1 
ATOM   1504 C CA  . GLY A 1 190 ? 22.125  94.253  58.560 1.00 6.82  ? 190  GLY A CA  1 
ATOM   1505 C C   . GLY A 1 190 ? 21.734  92.853  58.975 1.00 4.74  ? 190  GLY A C   1 
ATOM   1506 O O   . GLY A 1 190 ? 20.552  92.523  59.119 1.00 6.69  ? 190  GLY A O   1 
ATOM   1507 N N   . THR A 1 191 ? 22.756  92.026  59.134 1.00 4.78  ? 191  THR A N   1 
ATOM   1508 C CA  . THR A 1 191 ? 22.609  90.635  59.510 1.00 4.90  ? 191  THR A CA  1 
ATOM   1509 C C   . THR A 1 191 ? 22.750  90.444  61.008 1.00 5.09  ? 191  THR A C   1 
ATOM   1510 O O   . THR A 1 191 ? 23.697  90.936  61.625 1.00 5.21  ? 191  THR A O   1 
ATOM   1511 C CB  . THR A 1 191 ? 23.674  89.783  58.815 1.00 2.93  ? 191  THR A CB  1 
ATOM   1512 O OG1 . THR A 1 191 ? 23.578  89.983  57.403 1.00 9.36  ? 191  THR A OG1 1 
ATOM   1513 C CG2 . THR A 1 191 ? 23.502  88.301  59.143 1.00 3.18  ? 191  THR A CG2 1 
ATOM   1514 N N   . TYR A 1 192 ? 21.817  89.687  61.568 1.00 3.19  ? 192  TYR A N   1 
ATOM   1515 C CA  . TYR A 1 192 ? 21.799  89.379  62.984 1.00 4.11  ? 192  TYR A CA  1 
ATOM   1516 C C   . TYR A 1 192 ? 22.315  87.948  63.161 1.00 4.26  ? 192  TYR A C   1 
ATOM   1517 O O   . TYR A 1 192 ? 21.931  87.051  62.408 1.00 3.82  ? 192  TYR A O   1 
ATOM   1518 C CB  . TYR A 1 192 ? 20.361  89.504  63.497 1.00 2.53  ? 192  TYR A CB  1 
ATOM   1519 C CG  . TYR A 1 192 ? 20.143  89.078  64.924 1.00 4.49  ? 192  TYR A CG  1 
ATOM   1520 C CD1 . TYR A 1 192 ? 19.814  87.755  65.235 1.00 4.56  ? 192  TYR A CD1 1 
ATOM   1521 C CD2 . TYR A 1 192 ? 20.227  90.000  65.964 1.00 6.21  ? 192  TYR A CD2 1 
ATOM   1522 C CE1 . TYR A 1 192 ? 19.571  87.369  66.542 1.00 4.86  ? 192  TYR A CE1 1 
ATOM   1523 C CE2 . TYR A 1 192 ? 19.985  89.619  67.279 1.00 3.59  ? 192  TYR A CE2 1 
ATOM   1524 C CZ  . TYR A 1 192 ? 19.654  88.308  67.556 1.00 4.35  ? 192  TYR A CZ  1 
ATOM   1525 O OH  . TYR A 1 192 ? 19.377  87.938  68.842 1.00 2.00  ? 192  TYR A OH  1 
ATOM   1526 N N   . VAL A 1 193 ? 23.223  87.744  64.109 1.00 5.58  ? 193  VAL A N   1 
ATOM   1527 C CA  . VAL A 1 193 ? 23.742  86.408  64.373 1.00 2.82  ? 193  VAL A CA  1 
ATOM   1528 C C   . VAL A 1 193 ? 23.300  85.962  65.764 1.00 6.09  ? 193  VAL A C   1 
ATOM   1529 O O   . VAL A 1 193 ? 23.428  86.705  66.748 1.00 6.78  ? 193  VAL A O   1 
ATOM   1530 C CB  . VAL A 1 193 ? 25.301  86.324  64.231 1.00 6.21  ? 193  VAL A CB  1 
ATOM   1531 C CG1 . VAL A 1 193 ? 26.005  87.179  65.266 1.00 2.00  ? 193  VAL A CG1 1 
ATOM   1532 C CG2 . VAL A 1 193 ? 25.765  84.872  64.336 1.00 3.59  ? 193  VAL A CG2 1 
ATOM   1533 N N   . MET A 1 194 ? 22.733  84.766  65.840 1.00 2.13  ? 194  MET A N   1 
ATOM   1534 C CA  . MET A 1 194 ? 22.288  84.247  67.121 1.00 3.83  ? 194  MET A CA  1 
ATOM   1535 C C   . MET A 1 194 ? 23.213  83.164  67.642 1.00 2.04  ? 194  MET A C   1 
ATOM   1536 O O   . MET A 1 194 ? 23.651  82.298  66.888 1.00 2.00  ? 194  MET A O   1 
ATOM   1537 C CB  . MET A 1 194 ? 20.882  83.655  67.021 1.00 3.70  ? 194  MET A CB  1 
ATOM   1538 C CG  . MET A 1 194 ? 20.277  83.354  68.388 1.00 10.66 ? 194  MET A CG  1 
ATOM   1539 S SD  . MET A 1 194 ? 19.148  81.963  68.431 1.00 13.34 ? 194  MET A SD  1 
ATOM   1540 C CE  . MET A 1 194 ? 19.313  81.463  70.126 1.00 8.78  ? 194  MET A CE  1 
ATOM   1541 N N   . LEU A 1 195 ? 23.502  83.231  68.937 1.00 2.65  ? 195  LEU A N   1 
ATOM   1542 C CA  . LEU A 1 195 ? 24.305  82.230  69.625 1.00 4.15  ? 195  LEU A CA  1 
ATOM   1543 C C   . LEU A 1 195 ? 23.550  81.887  70.916 1.00 4.51  ? 195  LEU A C   1 
ATOM   1544 O O   . LEU A 1 195 ? 22.630  82.609  71.303 1.00 5.17  ? 195  LEU A O   1 
ATOM   1545 C CB  . LEU A 1 195 ? 25.746  82.704  69.877 1.00 4.28  ? 195  LEU A CB  1 
ATOM   1546 C CG  . LEU A 1 195 ? 26.124  84.132  70.274 1.00 10.10 ? 195  LEU A CG  1 
ATOM   1547 C CD1 . LEU A 1 195 ? 25.474  84.536  71.604 1.00 7.30  ? 195  LEU A CD1 1 
ATOM   1548 C CD2 . LEU A 1 195 ? 27.656  84.210  70.362 1.00 2.75  ? 195  LEU A CD2 1 
ATOM   1549 N N   . GLY A 1 196 ? 23.921  80.788  71.563 1.00 5.14  ? 196  GLY A N   1 
ATOM   1550 C CA  . GLY A 1 196 ? 23.233  80.348  72.771 1.00 3.79  ? 196  GLY A CA  1 
ATOM   1551 C C   . GLY A 1 196 ? 23.216  81.168  74.056 1.00 6.44  ? 196  GLY A C   1 
ATOM   1552 O O   . GLY A 1 196 ? 22.166  81.293  74.702 1.00 4.23  ? 196  GLY A O   1 
ATOM   1553 N N   . GLY A 1 197 ? 24.363  81.709  74.454 1.00 4.02  ? 197  GLY A N   1 
ATOM   1554 C CA  . GLY A 1 197 ? 24.412  82.468  75.689 1.00 5.18  ? 197  GLY A CA  1 
ATOM   1555 C C   . GLY A 1 197 ? 24.422  81.483  76.849 1.00 6.03  ? 197  GLY A C   1 
ATOM   1556 O O   . GLY A 1 197 ? 24.566  80.281  76.614 1.00 3.01  ? 197  GLY A O   1 
ATOM   1557 N N   . PRO A 1 198 ? 24.188  81.931  78.098 1.00 4.82  ? 198  PRO A N   1 
ATOM   1558 C CA  . PRO A 1 198 ? 23.898  83.297  78.547 1.00 3.78  ? 198  PRO A CA  1 
ATOM   1559 C C   . PRO A 1 198 ? 25.108  84.207  78.776 1.00 3.45  ? 198  PRO A C   1 
ATOM   1560 O O   . PRO A 1 198 ? 24.948  85.391  79.052 1.00 7.74  ? 198  PRO A O   1 
ATOM   1561 C CB  . PRO A 1 198 ? 23.149  83.059  79.847 1.00 4.24  ? 198  PRO A CB  1 
ATOM   1562 C CG  . PRO A 1 198 ? 23.895  81.905  80.425 1.00 5.69  ? 198  PRO A CG  1 
ATOM   1563 C CD  . PRO A 1 198 ? 24.104  80.986  79.228 1.00 4.99  ? 198  PRO A CD  1 
ATOM   1564 N N   . ASN A 1 199 ? 26.314  83.663  78.703 1.00 2.05  ? 199  ASN A N   1 
ATOM   1565 C CA  . ASN A 1 199 ? 27.501  84.490  78.907 1.00 4.47  ? 199  ASN A CA  1 
ATOM   1566 C C   . ASN A 1 199 ? 27.723  85.410  77.718 1.00 3.88  ? 199  ASN A C   1 
ATOM   1567 O O   . ASN A 1 199 ? 27.227  85.153  76.619 1.00 2.60  ? 199  ASN A O   1 
ATOM   1568 C CB  . ASN A 1 199 ? 28.757  83.627  79.120 1.00 4.63  ? 199  ASN A CB  1 
ATOM   1569 C CG  . ASN A 1 199 ? 29.093  82.776  77.911 1.00 7.00  ? 199  ASN A CG  1 
ATOM   1570 O OD1 . ASN A 1 199 ? 28.553  81.681  77.743 1.00 9.89  ? 199  ASN A OD1 1 
ATOM   1571 N ND2 . ASN A 1 199 ? 29.985  83.271  77.058 1.00 4.40  ? 199  ASN A ND2 1 
ATOM   1572 N N   . PHE A 1 200 ? 28.466  86.485  77.944 1.00 4.84  ? 200  PHE A N   1 
ATOM   1573 C CA  . PHE A 1 200 ? 28.782  87.410  76.877 1.00 4.66  ? 200  PHE A CA  1 
ATOM   1574 C C   . PHE A 1 200 ? 30.057  86.909  76.193 1.00 4.84  ? 200  PHE A C   1 
ATOM   1575 O O   . PHE A 1 200 ? 30.812  86.132  76.767 1.00 4.81  ? 200  PHE A O   1 
ATOM   1576 C CB  . PHE A 1 200 ? 28.909  88.838  77.404 1.00 3.75  ? 200  PHE A CB  1 
ATOM   1577 C CG  . PHE A 1 200 ? 27.583  89.483  77.727 1.00 4.52  ? 200  PHE A CG  1 
ATOM   1578 C CD1 . PHE A 1 200 ? 26.622  89.655  76.739 1.00 4.39  ? 200  PHE A CD1 1 
ATOM   1579 C CD2 . PHE A 1 200 ? 27.303  89.931  79.008 1.00 6.31  ? 200  PHE A CD2 1 
ATOM   1580 C CE1 . PHE A 1 200 ? 25.402  90.265  77.021 1.00 7.48  ? 200  PHE A CE1 1 
ATOM   1581 C CE2 . PHE A 1 200 ? 26.086  90.543  79.302 1.00 11.38 ? 200  PHE A CE2 1 
ATOM   1582 C CZ  . PHE A 1 200 ? 25.133  90.712  78.306 1.00 7.63  ? 200  PHE A CZ  1 
ATOM   1583 N N   . GLU A 1 201 ? 30.291  87.374  74.974 1.00 3.72  ? 201  GLU A N   1 
ATOM   1584 C CA  . GLU A 1 201 ? 31.403  86.932  74.145 1.00 3.15  ? 201  GLU A CA  1 
ATOM   1585 C C   . GLU A 1 201 ? 32.828  87.354  74.520 1.00 5.41  ? 201  GLU A C   1 
ATOM   1586 O O   . GLU A 1 201 ? 33.051  88.326  75.245 1.00 5.47  ? 201  GLU A O   1 
ATOM   1587 C CB  . GLU A 1 201 ? 31.124  87.320  72.683 1.00 2.00  ? 201  GLU A CB  1 
ATOM   1588 C CG  . GLU A 1 201 ? 29.788  86.812  72.085 1.00 3.69  ? 201  GLU A CG  1 
ATOM   1589 C CD  . GLU A 1 201 ? 28.545  87.523  72.639 1.00 6.30  ? 201  GLU A CD  1 
ATOM   1590 O OE1 . GLU A 1 201 ? 28.596  88.751  72.836 1.00 9.20  ? 201  GLU A OE1 1 
ATOM   1591 O OE2 . GLU A 1 201 ? 27.513  86.860  72.870 1.00 8.95  ? 201  GLU A OE2 1 
ATOM   1592 N N   . THR A 1 202 ? 33.794  86.575  74.048 1.00 5.20  ? 202  THR A N   1 
ATOM   1593 C CA  . THR A 1 202 ? 35.197  86.881  74.264 1.00 4.63  ? 202  THR A CA  1 
ATOM   1594 C C   . THR A 1 202 ? 35.588  87.749  73.066 1.00 5.87  ? 202  THR A C   1 
ATOM   1595 O O   . THR A 1 202 ? 34.857  87.821  72.071 1.00 5.95  ? 202  THR A O   1 
ATOM   1596 C CB  . THR A 1 202 ? 36.079  85.606  74.257 1.00 3.47  ? 202  THR A CB  1 
ATOM   1597 O OG1 . THR A 1 202 ? 35.995  84.959  72.977 1.00 2.23  ? 202  THR A OG1 1 
ATOM   1598 C CG2 . THR A 1 202 ? 35.650  84.639  75.363 1.00 2.00  ? 202  THR A CG2 1 
ATOM   1599 N N   . VAL A 1 203 ? 36.738  88.401  73.157 1.00 5.30  ? 203  VAL A N   1 
ATOM   1600 C CA  . VAL A 1 203 ? 37.217  89.235  72.073 1.00 5.94  ? 203  VAL A CA  1 
ATOM   1601 C C   . VAL A 1 203 ? 37.388  88.373  70.822 1.00 6.10  ? 203  VAL A C   1 
ATOM   1602 O O   . VAL A 1 203 ? 36.919  88.729  69.744 1.00 8.04  ? 203  VAL A O   1 
ATOM   1603 C CB  . VAL A 1 203 ? 38.552  89.911  72.465 1.00 3.51  ? 203  VAL A CB  1 
ATOM   1604 C CG1 . VAL A 1 203 ? 39.188  90.597  71.276 1.00 3.32  ? 203  VAL A CG1 1 
ATOM   1605 C CG2 . VAL A 1 203 ? 38.296  90.918  73.565 1.00 5.77  ? 203  VAL A CG2 1 
ATOM   1606 N N   . ALA A 1 204 ? 37.975  87.191  70.992 1.00 7.59  ? 204  ALA A N   1 
ATOM   1607 C CA  . ALA A 1 204 ? 38.210  86.288  69.871 1.00 4.53  ? 204  ALA A CA  1 
ATOM   1608 C C   . ALA A 1 204 ? 36.918  85.894  69.180 1.00 4.81  ? 204  ALA A C   1 
ATOM   1609 O O   . ALA A 1 204 ? 36.848  85.867  67.957 1.00 4.09  ? 204  ALA A O   1 
ATOM   1610 C CB  . ALA A 1 204 ? 38.959  85.055  70.330 1.00 4.48  ? 204  ALA A CB  1 
ATOM   1611 N N   . GLU A 1 205 ? 35.877  85.639  69.962 1.00 6.24  ? 205  GLU A N   1 
ATOM   1612 C CA  . GLU A 1 205 ? 34.590  85.244  69.399 1.00 5.26  ? 205  GLU A CA  1 
ATOM   1613 C C   . GLU A 1 205 ? 33.955  86.383  68.604 1.00 5.71  ? 205  GLU A C   1 
ATOM   1614 O O   . GLU A 1 205 ? 33.361  86.163  67.546 1.00 3.42  ? 205  GLU A O   1 
ATOM   1615 C CB  . GLU A 1 205 ? 33.654  84.768  70.516 1.00 6.64  ? 205  GLU A CB  1 
ATOM   1616 C CG  . GLU A 1 205 ? 34.086  83.442  71.136 1.00 3.69  ? 205  GLU A CG  1 
ATOM   1617 C CD  . GLU A 1 205 ? 33.397  83.122  72.448 1.00 6.19  ? 205  GLU A CD  1 
ATOM   1618 O OE1 . GLU A 1 205 ? 32.684  83.990  72.994 1.00 4.92  ? 205  GLU A OE1 1 
ATOM   1619 O OE2 . GLU A 1 205 ? 33.585  81.990  72.944 1.00 4.18  ? 205  GLU A OE2 1 
ATOM   1620 N N   . CYS A 1 206 ? 34.091  87.601  69.116 1.00 6.65  ? 206  CYS A N   1 
ATOM   1621 C CA  . CYS A 1 206 ? 33.538  88.780  68.462 1.00 8.06  ? 206  CYS A CA  1 
ATOM   1622 C C   . CYS A 1 206 ? 34.200  89.072  67.120 1.00 6.15  ? 206  CYS A C   1 
ATOM   1623 O O   . CYS A 1 206 ? 33.519  89.394  66.146 1.00 9.13  ? 206  CYS A O   1 
ATOM   1624 C CB  . CYS A 1 206 ? 33.645  89.993  69.385 1.00 9.83  ? 206  CYS A CB  1 
ATOM   1625 S SG  . CYS A 1 206 ? 32.446  89.975  70.742 1.00 15.35 ? 206  CYS A SG  1 
ATOM   1626 N N   . ARG A 1 207 ? 35.521  88.944  67.060 1.00 4.71  ? 207  ARG A N   1 
ATOM   1627 C CA  . ARG A 1 207 ? 36.246  89.187  65.816 1.00 6.34  ? 207  ARG A CA  1 
ATOM   1628 C C   . ARG A 1 207 ? 35.827  88.164  64.771 1.00 5.84  ? 207  ARG A C   1 
ATOM   1629 O O   . ARG A 1 207 ? 35.677  88.482  63.593 1.00 9.12  ? 207  ARG A O   1 
ATOM   1630 C CB  . ARG A 1 207 ? 37.755  89.115  66.055 1.00 9.10  ? 207  ARG A CB  1 
ATOM   1631 C CG  . ARG A 1 207 ? 38.265  90.204  66.982 1.00 12.76 ? 207  ARG A CG  1 
ATOM   1632 C CD  . ARG A 1 207 ? 39.769  90.135  67.164 1.00 18.12 ? 207  ARG A CD  1 
ATOM   1633 N NE  . ARG A 1 207 ? 40.276  91.339  67.816 1.00 26.70 ? 207  ARG A NE  1 
ATOM   1634 C CZ  . ARG A 1 207 ? 41.534  91.512  68.210 1.00 30.84 ? 207  ARG A CZ  1 
ATOM   1635 N NH1 . ARG A 1 207 ? 42.437  90.555  68.026 1.00 31.26 ? 207  ARG A NH1 1 
ATOM   1636 N NH2 . ARG A 1 207 ? 41.892  92.653  68.783 1.00 32.75 ? 207  ARG A NH2 1 
ATOM   1637 N N   . LEU A 1 208 ? 35.602  86.940  65.227 1.00 3.78  ? 208  LEU A N   1 
ATOM   1638 C CA  . LEU A 1 208 ? 35.184  85.848  64.367 1.00 5.93  ? 208  LEU A CA  1 
ATOM   1639 C C   . LEU A 1 208 ? 33.784  86.106  63.807 1.00 6.56  ? 208  LEU A C   1 
ATOM   1640 O O   . LEU A 1 208 ? 33.537  85.925  62.612 1.00 8.44  ? 208  LEU A O   1 
ATOM   1641 C CB  . LEU A 1 208 ? 35.216  84.547  65.179 1.00 6.88  ? 208  LEU A CB  1 
ATOM   1642 C CG  . LEU A 1 208 ? 34.792  83.196  64.618 1.00 9.95  ? 208  LEU A CG  1 
ATOM   1643 C CD1 . LEU A 1 208 ? 35.284  82.115  65.570 1.00 11.51 ? 208  LEU A CD1 1 
ATOM   1644 C CD2 . LEU A 1 208 ? 33.287  83.103  64.486 1.00 11.01 ? 208  LEU A CD2 1 
ATOM   1645 N N   . LEU A 1 209 ? 32.866  86.517  64.677 1.00 7.77  ? 209  LEU A N   1 
ATOM   1646 C CA  . LEU A 1 209 ? 31.486  86.788  64.280 1.00 7.77  ? 209  LEU A CA  1 
ATOM   1647 C C   . LEU A 1 209 ? 31.423  87.915  63.262 1.00 8.59  ? 209  LEU A C   1 
ATOM   1648 O O   . LEU A 1 209 ? 30.667  87.846  62.291 1.00 7.66  ? 209  LEU A O   1 
ATOM   1649 C CB  . LEU A 1 209 ? 30.630  87.125  65.504 1.00 8.83  ? 209  LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 209 ? 30.424  85.977  66.499 1.00 11.20 ? 209  LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 209 ? 29.659  86.462  67.720 1.00 9.01  ? 209  LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 209 ? 29.684  84.836  65.815 1.00 10.52 ? 209  LEU A CD2 1 
ATOM   1653 N N   . ARG A 1 210 ? 32.238  88.941  63.474 1.00 9.09  ? 210  ARG A N   1 
ATOM   1654 C CA  . ARG A 1 210 ? 32.278  90.067  62.557 1.00 11.24 ? 210  ARG A CA  1 
ATOM   1655 C C   . ARG A 1 210 ? 32.829  89.600  61.222 1.00 10.83 ? 210  ARG A C   1 
ATOM   1656 O O   . ARG A 1 210 ? 32.290  89.944  60.175 1.00 13.77 ? 210  ARG A O   1 
ATOM   1657 C CB  . ARG A 1 210 ? 33.132  91.199  63.128 1.00 12.50 ? 210  ARG A CB  1 
ATOM   1658 C CG  . ARG A 1 210 ? 33.215  92.409  62.221 1.00 13.08 ? 210  ARG A CG  1 
ATOM   1659 C CD  . ARG A 1 210 ? 31.834  92.869  61.784 1.00 15.84 ? 210  ARG A CD  1 
ATOM   1660 N NE  . ARG A 1 210 ? 31.910  93.888  60.740 1.00 21.57 ? 210  ARG A NE  1 
ATOM   1661 C CZ  . ARG A 1 210 ? 30.856  94.499  60.208 1.00 22.71 ? 210  ARG A CZ  1 
ATOM   1662 N NH1 . ARG A 1 210 ? 29.631  94.200  60.616 1.00 21.58 ? 210  ARG A NH1 1 
ATOM   1663 N NH2 . ARG A 1 210 ? 31.030  95.424  59.273 1.00 24.97 ? 210  ARG A NH2 1 
ATOM   1664 N N   . ASN A 1 211 ? 33.870  88.771  61.260 1.00 12.72 ? 211  ASN A N   1 
ATOM   1665 C CA  . ASN A 1 211 ? 34.471  88.245  60.036 1.00 13.72 ? 211  ASN A CA  1 
ATOM   1666 C C   . ASN A 1 211 ? 33.574  87.260  59.290 1.00 14.87 ? 211  ASN A C   1 
ATOM   1667 O O   . ASN A 1 211 ? 33.829  86.957  58.131 1.00 16.54 ? 211  ASN A O   1 
ATOM   1668 C CB  . ASN A 1 211 ? 35.827  87.605  60.319 1.00 17.22 ? 211  ASN A CB  1 
ATOM   1669 C CG  . ASN A 1 211 ? 36.884  88.624  60.663 1.00 20.51 ? 211  ASN A CG  1 
ATOM   1670 O OD1 . ASN A 1 211 ? 37.754  88.370  61.489 1.00 27.12 ? 211  ASN A OD1 1 
ATOM   1671 N ND2 . ASN A 1 211 ? 36.812  89.792  60.039 1.00 23.29 ? 211  ASN A ND2 1 
ATOM   1672 N N   . LEU A 1 212 ? 32.564  86.719  59.971 1.00 14.47 ? 212  LEU A N   1 
ATOM   1673 C CA  . LEU A 1 212 ? 31.608  85.806  59.338 1.00 14.47 ? 212  LEU A CA  1 
ATOM   1674 C C   . LEU A 1 212 ? 30.576  86.651  58.577 1.00 13.82 ? 212  LEU A C   1 
ATOM   1675 O O   . LEU A 1 212 ? 29.702  86.112  57.898 1.00 11.81 ? 212  LEU A O   1 
ATOM   1676 C CB  . LEU A 1 212 ? 30.858  84.964  60.381 1.00 15.14 ? 212  LEU A CB  1 
ATOM   1677 C CG  . LEU A 1 212 ? 31.573  83.891  61.205 1.00 19.66 ? 212  LEU A CG  1 
ATOM   1678 C CD1 . LEU A 1 212 ? 30.557  83.206  62.100 1.00 19.14 ? 212  LEU A CD1 1 
ATOM   1679 C CD2 . LEU A 1 212 ? 32.252  82.874  60.296 1.00 20.45 ? 212  LEU A CD2 1 
ATOM   1680 N N   . GLY A 1 213 ? 30.638  87.967  58.766 1.00 10.71 ? 213  GLY A N   1 
ATOM   1681 C CA  . GLY A 1 213 ? 29.723  88.875  58.099 1.00 10.76 ? 213  GLY A CA  1 
ATOM   1682 C C   . GLY A 1 213 ? 28.530  89.330  58.924 1.00 10.28 ? 213  GLY A C   1 
ATOM   1683 O O   . GLY A 1 213 ? 27.546  89.805  58.362 1.00 11.32 ? 213  GLY A O   1 
ATOM   1684 N N   . ALA A 1 214 ? 28.602  89.215  60.246 1.00 8.83  ? 214  ALA A N   1 
ATOM   1685 C CA  . ALA A 1 214 ? 27.482  89.625  61.092 1.00 5.93  ? 214  ALA A CA  1 
ATOM   1686 C C   . ALA A 1 214 ? 27.608  91.073  61.563 1.00 5.04  ? 214  ALA A C   1 
ATOM   1687 O O   . ALA A 1 214 ? 28.706  91.569  61.785 1.00 3.30  ? 214  ALA A O   1 
ATOM   1688 C CB  . ALA A 1 214 ? 27.348  88.685  62.271 1.00 6.20  ? 214  ALA A CB  1 
ATOM   1689 N N   . ASP A 1 215 ? 26.476  91.751  61.717 1.00 6.43  ? 215  ASP A N   1 
ATOM   1690 C CA  . ASP A 1 215 ? 26.485  93.142  62.150 1.00 5.05  ? 215  ASP A CA  1 
ATOM   1691 C C   . ASP A 1 215 ? 26.097  93.324  63.612 1.00 5.59  ? 215  ASP A C   1 
ATOM   1692 O O   . ASP A 1 215 ? 26.531  94.277  64.262 1.00 3.66  ? 215  ASP A O   1 
ATOM   1693 C CB  . ASP A 1 215 ? 25.577  93.984  61.252 1.00 8.40  ? 215  ASP A CB  1 
ATOM   1694 C CG  . ASP A 1 215 ? 26.042  94.003  59.800 1.00 6.48  ? 215  ASP A CG  1 
ATOM   1695 O OD1 . ASP A 1 215 ? 27.092  94.612  59.509 1.00 8.69  ? 215  ASP A OD1 1 
ATOM   1696 O OD2 . ASP A 1 215 ? 25.351  93.420  58.945 1.00 8.22  ? 215  ASP A OD2 1 
ATOM   1697 N N   . ALA A 1 216 ? 25.297  92.400  64.130 1.00 2.96  ? 216  ALA A N   1 
ATOM   1698 C CA  . ALA A 1 216 ? 24.846  92.455  65.513 1.00 4.05  ? 216  ALA A CA  1 
ATOM   1699 C C   . ALA A 1 216 ? 24.717  91.029  66.032 1.00 4.65  ? 216  ALA A C   1 
ATOM   1700 O O   . ALA A 1 216 ? 24.399  90.115  65.276 1.00 3.07  ? 216  ALA A O   1 
ATOM   1701 C CB  . ALA A 1 216 ? 23.504  93.167  65.597 1.00 2.22  ? 216  ALA A CB  1 
ATOM   1702 N N   . VAL A 1 217 ? 24.961  90.841  67.321 1.00 5.77  ? 217  VAL A N   1 
ATOM   1703 C CA  . VAL A 1 217 ? 24.882  89.515  67.926 1.00 3.87  ? 217  VAL A CA  1 
ATOM   1704 C C   . VAL A 1 217 ? 23.832  89.512  69.044 1.00 7.11  ? 217  VAL A C   1 
ATOM   1705 O O   . VAL A 1 217 ? 23.666  90.517  69.749 1.00 5.82  ? 217  VAL A O   1 
ATOM   1706 C CB  . VAL A 1 217 ? 26.266  89.075  68.472 1.00 3.89  ? 217  VAL A CB  1 
ATOM   1707 C CG1 . VAL A 1 217 ? 26.806  90.087  69.488 1.00 4.41  ? 217  VAL A CG1 1 
ATOM   1708 C CG2 . VAL A 1 217 ? 26.181  87.686  69.081 1.00 5.16  ? 217  VAL A CG2 1 
ATOM   1709 N N   . GLY A 1 218 ? 23.124  88.394  69.188 1.00 3.73  ? 218  GLY A N   1 
ATOM   1710 C CA  . GLY A 1 218 ? 22.097  88.279  70.211 1.00 2.92  ? 218  GLY A CA  1 
ATOM   1711 C C   . GLY A 1 218 ? 21.813  86.825  70.540 1.00 3.81  ? 218  GLY A C   1 
ATOM   1712 O O   . GLY A 1 218 ? 22.360  85.930  69.888 1.00 2.23  ? 218  GLY A O   1 
ATOM   1713 N N   . MET A 1 219 ? 20.920  86.586  71.500 1.00 3.66  ? 219  MET A N   1 
ATOM   1714 C CA  . MET A 1 219 ? 20.590  85.230  71.952 1.00 4.39  ? 219  MET A CA  1 
ATOM   1715 C C   . MET A 1 219 ? 19.120  84.827  71.759 1.00 5.56  ? 219  MET A C   1 
ATOM   1716 O O   . MET A 1 219 ? 18.562  84.067  72.567 1.00 5.99  ? 219  MET A O   1 
ATOM   1717 C CB  . MET A 1 219 ? 20.949  85.091  73.439 1.00 5.01  ? 219  MET A CB  1 
ATOM   1718 C CG  . MET A 1 219 ? 22.357  85.537  73.799 1.00 8.26  ? 219  MET A CG  1 
ATOM   1719 S SD  . MET A 1 219 ? 22.608  85.739  75.586 1.00 6.21  ? 219  MET A SD  1 
ATOM   1720 C CE  . MET A 1 219 ? 24.294  86.353  75.647 1.00 4.47  ? 219  MET A CE  1 
ATOM   1721 N N   . SER A 1 220 ? 18.485  85.308  70.697 1.00 4.84  ? 220  SER A N   1 
ATOM   1722 C CA  . SER A 1 220 ? 17.084  84.975  70.462 1.00 3.75  ? 220  SER A CA  1 
ATOM   1723 C C   . SER A 1 220 ? 16.672  85.289  69.029 1.00 3.12  ? 220  SER A C   1 
ATOM   1724 O O   . SER A 1 220 ? 17.500  85.284  68.121 1.00 2.08  ? 220  SER A O   1 
ATOM   1725 C CB  . SER A 1 220 ? 16.209  85.800  71.396 1.00 3.99  ? 220  SER A CB  1 
ATOM   1726 O OG  . SER A 1 220 ? 16.190  87.150  70.958 1.00 2.24  ? 220  SER A OG  1 
ATOM   1727 N N   . THR A 1 221 ? 15.369  85.490  68.838 1.00 2.46  ? 221  THR A N   1 
ATOM   1728 C CA  . THR A 1 221 ? 14.788  85.881  67.558 1.00 2.72  ? 221  THR A CA  1 
ATOM   1729 C C   . THR A 1 221 ? 14.765  84.897  66.390 1.00 2.44  ? 221  THR A C   1 
ATOM   1730 O O   . THR A 1 221 ? 13.693  84.589  65.868 1.00 4.34  ? 221  THR A O   1 
ATOM   1731 C CB  . THR A 1 221 ? 15.388  87.234  67.108 1.00 4.79  ? 221  THR A CB  1 
ATOM   1732 O OG1 . THR A 1 221 ? 15.158  88.200  68.143 1.00 3.15  ? 221  THR A OG1 1 
ATOM   1733 C CG2 . THR A 1 221 ? 14.742  87.729  65.817 1.00 2.37  ? 221  THR A CG2 1 
ATOM   1734 N N   . VAL A 1 222 ? 15.930  84.391  65.996 1.00 3.73  ? 222  VAL A N   1 
ATOM   1735 C CA  . VAL A 1 222 ? 16.035  83.465  64.871 1.00 3.56  ? 222  VAL A CA  1 
ATOM   1736 C C   . VAL A 1 222 ? 15.086  82.258  64.927 1.00 3.34  ? 222  VAL A C   1 
ATOM   1737 O O   . VAL A 1 222 ? 14.438  81.940  63.928 1.00 2.12  ? 222  VAL A O   1 
ATOM   1738 C CB  . VAL A 1 222 ? 17.500  83.005  64.658 1.00 5.21  ? 222  VAL A CB  1 
ATOM   1739 C CG1 . VAL A 1 222 ? 17.588  82.037  63.493 1.00 2.02  ? 222  VAL A CG1 1 
ATOM   1740 C CG2 . VAL A 1 222 ? 18.389  84.217  64.399 1.00 3.50  ? 222  VAL A CG2 1 
ATOM   1741 N N   . PRO A 1 223 ? 14.986  81.572  66.088 1.00 3.07  ? 223  PRO A N   1 
ATOM   1742 C CA  . PRO A 1 223 ? 14.072  80.421  66.130 1.00 2.05  ? 223  PRO A CA  1 
ATOM   1743 C C   . PRO A 1 223 ? 12.608  80.810  65.893 1.00 2.18  ? 223  PRO A C   1 
ATOM   1744 O O   . PRO A 1 223 ? 11.834  80.042  65.314 1.00 5.30  ? 223  PRO A O   1 
ATOM   1745 C CB  . PRO A 1 223 ? 14.308  79.833  67.523 1.00 2.10  ? 223  PRO A CB  1 
ATOM   1746 C CG  . PRO A 1 223 ? 14.879  80.966  68.316 1.00 4.92  ? 223  PRO A CG  1 
ATOM   1747 C CD  . PRO A 1 223 ? 15.768  81.667  67.332 1.00 2.02  ? 223  PRO A CD  1 
ATOM   1748 N N   . GLU A 1 224 ? 12.240  82.020  66.299 1.00 2.65  ? 224  GLU A N   1 
ATOM   1749 C CA  . GLU A 1 224 ? 10.876  82.508  66.116 1.00 3.27  ? 224  GLU A CA  1 
ATOM   1750 C C   . GLU A 1 224 ? 10.629  82.835  64.645 1.00 3.71  ? 224  GLU A C   1 
ATOM   1751 O O   . GLU A 1 224 ? 9.558   82.551  64.117 1.00 5.94  ? 224  GLU A O   1 
ATOM   1752 C CB  . GLU A 1 224 ? 10.637  83.741  66.982 1.00 2.10  ? 224  GLU A CB  1 
ATOM   1753 C CG  . GLU A 1 224 ? 10.836  83.461  68.449 1.00 5.76  ? 224  GLU A CG  1 
ATOM   1754 C CD  . GLU A 1 224 ? 11.288  84.665  69.241 1.00 9.62  ? 224  GLU A CD  1 
ATOM   1755 O OE1 . GLU A 1 224 ? 11.456  85.761  68.663 1.00 14.32 ? 224  GLU A OE1 1 
ATOM   1756 O OE2 . GLU A 1 224 ? 11.479  84.507  70.459 1.00 14.36 ? 224  GLU A OE2 1 
ATOM   1757 N N   . VAL A 1 225 ? 11.629  83.409  63.985 1.00 2.15  ? 225  VAL A N   1 
ATOM   1758 C CA  . VAL A 1 225 ? 11.515  83.752  62.576 1.00 3.60  ? 225  VAL A CA  1 
ATOM   1759 C C   . VAL A 1 225 ? 11.355  82.474  61.743 1.00 3.44  ? 225  VAL A C   1 
ATOM   1760 O O   . VAL A 1 225 ? 10.506  82.396  60.843 1.00 2.24  ? 225  VAL A O   1 
ATOM   1761 C CB  . VAL A 1 225 ? 12.737  84.581  62.103 1.00 2.12  ? 225  VAL A CB  1 
ATOM   1762 C CG1 . VAL A 1 225 ? 12.715  84.770  60.588 1.00 2.07  ? 225  VAL A CG1 1 
ATOM   1763 C CG2 . VAL A 1 225 ? 12.739  85.928  62.798 1.00 2.03  ? 225  VAL A CG2 1 
ATOM   1764 N N   . ILE A 1 226 ? 12.123  81.450  62.096 1.00 4.24  ? 226  ILE A N   1 
ATOM   1765 C CA  . ILE A 1 226 ? 12.060  80.170  61.395 1.00 4.28  ? 226  ILE A CA  1 
ATOM   1766 C C   . ILE A 1 226 ? 10.659  79.563  61.473 1.00 2.90  ? 226  ILE A C   1 
ATOM   1767 O O   . ILE A 1 226 ? 10.078  79.216  60.451 1.00 2.78  ? 226  ILE A O   1 
ATOM   1768 C CB  . ILE A 1 226 ? 13.143  79.199  61.924 1.00 2.92  ? 226  ILE A CB  1 
ATOM   1769 C CG1 . ILE A 1 226 ? 14.515  79.719  61.488 1.00 2.05  ? 226  ILE A CG1 1 
ATOM   1770 C CG2 . ILE A 1 226 ? 12.892  77.778  61.428 1.00 2.10  ? 226  ILE A CG2 1 
ATOM   1771 C CD1 . ILE A 1 226 ? 15.673  79.018  62.129 1.00 10.59 ? 226  ILE A CD1 1 
ATOM   1772 N N   . VAL A 1 227 ? 10.105  79.478  62.678 1.00 2.31  ? 227  VAL A N   1 
ATOM   1773 C CA  . VAL A 1 227 ? 8.763   78.934  62.861 1.00 2.17  ? 227  VAL A CA  1 
ATOM   1774 C C   . VAL A 1 227 ? 7.716   79.824  62.186 1.00 2.02  ? 227  VAL A C   1 
ATOM   1775 O O   . VAL A 1 227 ? 6.763   79.331  61.572 1.00 2.14  ? 227  VAL A O   1 
ATOM   1776 C CB  . VAL A 1 227 ? 8.432   78.771  64.365 1.00 2.00  ? 227  VAL A CB  1 
ATOM   1777 C CG1 . VAL A 1 227 ? 6.970   78.400  64.571 1.00 2.14  ? 227  VAL A CG1 1 
ATOM   1778 C CG2 . VAL A 1 227 ? 9.320   77.708  64.970 1.00 2.18  ? 227  VAL A CG2 1 
ATOM   1779 N N   . ALA A 1 228 ? 7.900   81.136  62.289 1.00 2.08  ? 228  ALA A N   1 
ATOM   1780 C CA  . ALA A 1 228 ? 6.977   82.086  61.686 1.00 2.06  ? 228  ALA A CA  1 
ATOM   1781 C C   . ALA A 1 228 ? 6.925   81.919  60.174 1.00 3.24  ? 228  ALA A C   1 
ATOM   1782 O O   . ALA A 1 228 ? 5.848   81.917  59.584 1.00 4.45  ? 228  ALA A O   1 
ATOM   1783 C CB  . ALA A 1 228 ? 7.369   83.508  62.046 1.00 2.52  ? 228  ALA A CB  1 
ATOM   1784 N N   . ARG A 1 229 ? 8.079   81.756  59.545 1.00 2.99  ? 229  ARG A N   1 
ATOM   1785 C CA  . ARG A 1 229 ? 8.103   81.586  58.098 1.00 5.19  ? 229  ARG A CA  1 
ATOM   1786 C C   . ARG A 1 229 ? 7.547   80.222  57.694 1.00 6.19  ? 229  ARG A C   1 
ATOM   1787 O O   . ARG A 1 229 ? 6.841   80.112  56.692 1.00 5.87  ? 229  ARG A O   1 
ATOM   1788 C CB  . ARG A 1 229 ? 9.518   81.794  57.544 1.00 4.61  ? 229  ARG A CB  1 
ATOM   1789 C CG  . ARG A 1 229 ? 10.022  83.240  57.623 1.00 3.06  ? 229  ARG A CG  1 
ATOM   1790 C CD  . ARG A 1 229 ? 9.115   84.220  56.853 1.00 5.17  ? 229  ARG A CD  1 
ATOM   1791 N NE  . ARG A 1 229 ? 9.072   83.932  55.422 1.00 6.69  ? 229  ARG A NE  1 
ATOM   1792 C CZ  . ARG A 1 229 ? 8.054   84.230  54.616 1.00 9.16  ? 229  ARG A CZ  1 
ATOM   1793 N NH1 . ARG A 1 229 ? 6.976   84.840  55.083 1.00 7.41  ? 229  ARG A NH1 1 
ATOM   1794 N NH2 . ARG A 1 229 ? 8.091   83.861  53.347 1.00 8.06  ? 229  ARG A NH2 1 
ATOM   1795 N N   . HIS A 1 230 ? 7.810   79.198  58.510 1.00 4.97  ? 230  HIS A N   1 
ATOM   1796 C CA  . HIS A 1 230 ? 7.321   77.846  58.232 1.00 3.47  ? 230  HIS A CA  1 
ATOM   1797 C C   . HIS A 1 230 ? 5.800   77.850  58.116 1.00 6.64  ? 230  HIS A C   1 
ATOM   1798 O O   . HIS A 1 230 ? 5.246   77.170  57.251 1.00 4.52  ? 230  HIS A O   1 
ATOM   1799 C CB  . HIS A 1 230 ? 7.770   76.869  59.331 1.00 4.38  ? 230  HIS A CB  1 
ATOM   1800 C CG  . HIS A 1 230 ? 7.294   75.457  59.136 1.00 3.42  ? 230  HIS A CG  1 
ATOM   1801 N ND1 . HIS A 1 230 ? 6.341   74.875  59.944 1.00 4.00  ? 230  HIS A ND1 1 
ATOM   1802 C CD2 . HIS A 1 230 ? 7.687   74.492  58.269 1.00 5.65  ? 230  HIS A CD2 1 
ATOM   1803 C CE1 . HIS A 1 230 ? 6.170   73.614  59.591 1.00 5.16  ? 230  HIS A CE1 1 
ATOM   1804 N NE2 . HIS A 1 230 ? 6.976   73.354  58.577 1.00 4.66  ? 230  HIS A NE2 1 
ATOM   1805 N N   . CYS A 1 231 ? 5.127   78.616  58.976 1.00 6.83  ? 231  CYS A N   1 
ATOM   1806 C CA  . CYS A 1 231 ? 3.672   78.671  58.926 1.00 5.51  ? 231  CYS A CA  1 
ATOM   1807 C C   . CYS A 1 231 ? 3.110   79.806  58.071 1.00 6.61  ? 231  CYS A C   1 
ATOM   1808 O O   . CYS A 1 231 ? 1.918   80.114  58.118 1.00 4.61  ? 231  CYS A O   1 
ATOM   1809 C CB  . CYS A 1 231 ? 3.047   78.620  60.329 1.00 7.29  ? 231  CYS A CB  1 
ATOM   1810 S SG  . CYS A 1 231 ? 3.349   80.007  61.439 1.00 12.40 ? 231  CYS A SG  1 
ATOM   1811 N N   . GLY A 1 232 ? 3.980   80.429  57.284 1.00 8.65  ? 232  GLY A N   1 
ATOM   1812 C CA  . GLY A 1 232 ? 3.536   81.464  56.371 1.00 9.34  ? 232  GLY A CA  1 
ATOM   1813 C C   . GLY A 1 232 ? 3.275   82.868  56.864 1.00 12.66 ? 232  GLY A C   1 
ATOM   1814 O O   . GLY A 1 232 ? 2.535   83.616  56.217 1.00 14.87 ? 232  GLY A O   1 
ATOM   1815 N N   . LEU A 1 233 ? 3.873   83.246  57.984 1.00 11.09 ? 233  LEU A N   1 
ATOM   1816 C CA  . LEU A 1 233 ? 3.690   84.594  58.488 1.00 9.40  ? 233  LEU A CA  1 
ATOM   1817 C C   . LEU A 1 233 ? 4.710   85.513  57.834 1.00 9.56  ? 233  LEU A C   1 
ATOM   1818 O O   . LEU A 1 233 ? 5.837   85.102  57.549 1.00 9.30  ? 233  LEU A O   1 
ATOM   1819 C CB  . LEU A 1 233 ? 3.895   84.652  60.002 1.00 7.59  ? 233  LEU A CB  1 
ATOM   1820 C CG  . LEU A 1 233 ? 2.936   83.906  60.922 1.00 10.86 ? 233  LEU A CG  1 
ATOM   1821 C CD1 . LEU A 1 233 ? 3.450   83.996  62.366 1.00 8.05  ? 233  LEU A CD1 1 
ATOM   1822 C CD2 . LEU A 1 233 ? 1.541   84.497  60.799 1.00 9.39  ? 233  LEU A CD2 1 
ATOM   1823 N N   . ARG A 1 234 ? 4.289   86.747  57.581 1.00 8.07  ? 234  ARG A N   1 
ATOM   1824 C CA  . ARG A 1 234 ? 5.142   87.786  57.021 1.00 7.73  ? 234  ARG A CA  1 
ATOM   1825 C C   . ARG A 1 234 ? 5.967   88.217  58.234 1.00 6.49  ? 234  ARG A C   1 
ATOM   1826 O O   . ARG A 1 234 ? 5.410   88.441  59.304 1.00 11.66 ? 234  ARG A O   1 
ATOM   1827 C CB  . ARG A 1 234 ? 4.268   88.945  56.543 1.00 5.43  ? 234  ARG A CB  1 
ATOM   1828 C CG  . ARG A 1 234 ? 5.024   90.171  56.079 1.00 15.88 ? 234  ARG A CG  1 
ATOM   1829 C CD  . ARG A 1 234 ? 4.062   91.284  55.694 1.00 17.35 ? 234  ARG A CD  1 
ATOM   1830 N NE  . ARG A 1 234 ? 3.180   90.875  54.603 1.00 22.56 ? 234  ARG A NE  1 
ATOM   1831 C CZ  . ARG A 1 234 ? 1.861   90.735  54.712 1.00 29.35 ? 234  ARG A CZ  1 
ATOM   1832 N NH1 . ARG A 1 234 ? 1.251   90.976  55.867 1.00 32.22 ? 234  ARG A NH1 1 
ATOM   1833 N NH2 . ARG A 1 234 ? 1.151   90.328  53.668 1.00 30.65 ? 234  ARG A NH2 1 
ATOM   1834 N N   . VAL A 1 235 ? 7.281   88.305  58.092 1.00 7.65  ? 235  VAL A N   1 
ATOM   1835 C CA  . VAL A 1 235 ? 8.129   88.676  59.217 1.00 5.20  ? 235  VAL A CA  1 
ATOM   1836 C C   . VAL A 1 235 ? 8.912   89.965  58.991 1.00 6.39  ? 235  VAL A C   1 
ATOM   1837 O O   . VAL A 1 235 ? 9.444   90.209  57.906 1.00 4.73  ? 235  VAL A O   1 
ATOM   1838 C CB  . VAL A 1 235 ? 9.135   87.531  59.556 1.00 4.81  ? 235  VAL A CB  1 
ATOM   1839 C CG1 . VAL A 1 235 ? 10.001  87.910  60.751 1.00 3.47  ? 235  VAL A CG1 1 
ATOM   1840 C CG2 . VAL A 1 235 ? 8.390   86.236  59.850 1.00 4.00  ? 235  VAL A CG2 1 
ATOM   1841 N N   . PHE A 1 236 ? 8.983   90.778  60.036 1.00 5.33  ? 236  PHE A N   1 
ATOM   1842 C CA  . PHE A 1 236 ? 9.725   92.027  60.017 1.00 5.00  ? 236  PHE A CA  1 
ATOM   1843 C C   . PHE A 1 236 ? 10.359  92.163  61.403 1.00 6.03  ? 236  PHE A C   1 
ATOM   1844 O O   . PHE A 1 236 ? 9.733   91.824  62.407 1.00 6.76  ? 236  PHE A O   1 
ATOM   1845 C CB  . PHE A 1 236 ? 8.778   93.206  59.747 1.00 8.21  ? 236  PHE A CB  1 
ATOM   1846 C CG  . PHE A 1 236 ? 9.380   94.539  60.052 1.00 11.29 ? 236  PHE A CG  1 
ATOM   1847 C CD1 . PHE A 1 236 ? 10.267  95.134  59.163 1.00 15.17 ? 236  PHE A CD1 1 
ATOM   1848 C CD2 . PHE A 1 236 ? 9.096   95.182  61.251 1.00 13.11 ? 236  PHE A CD2 1 
ATOM   1849 C CE1 . PHE A 1 236 ? 10.867  96.352  59.465 1.00 19.50 ? 236  PHE A CE1 1 
ATOM   1850 C CE2 . PHE A 1 236 ? 9.689   96.399  61.568 1.00 18.16 ? 236  PHE A CE2 1 
ATOM   1851 C CZ  . PHE A 1 236 ? 10.577  96.988  60.675 1.00 20.73 ? 236  PHE A CZ  1 
ATOM   1852 N N   . GLY A 1 237 ? 11.594  92.643  61.476 1.00 5.30  ? 237  GLY A N   1 
ATOM   1853 C CA  . GLY A 1 237 ? 12.211  92.791  62.779 1.00 5.90  ? 237  GLY A CA  1 
ATOM   1854 C C   . GLY A 1 237 ? 13.368  93.760  62.850 1.00 7.31  ? 237  GLY A C   1 
ATOM   1855 O O   . GLY A 1 237 ? 13.938  94.136  61.820 1.00 8.02  ? 237  GLY A O   1 
ATOM   1856 N N   . PHE A 1 238 ? 13.717  94.170  64.065 1.00 4.09  ? 238  PHE A N   1 
ATOM   1857 C CA  . PHE A 1 238 ? 14.831  95.084  64.261 1.00 7.39  ? 238  PHE A CA  1 
ATOM   1858 C C   . PHE A 1 238 ? 15.515  94.892  65.607 1.00 7.07  ? 238  PHE A C   1 
ATOM   1859 O O   . PHE A 1 238 ? 14.916  94.391  66.563 1.00 5.58  ? 238  PHE A O   1 
ATOM   1860 C CB  . PHE A 1 238 ? 14.396  96.544  64.095 1.00 12.18 ? 238  PHE A CB  1 
ATOM   1861 C CG  . PHE A 1 238 ? 13.331  96.970  65.051 1.00 15.54 ? 238  PHE A CG  1 
ATOM   1862 C CD1 . PHE A 1 238 ? 13.658  97.372  66.342 1.00 16.59 ? 238  PHE A CD1 1 
ATOM   1863 C CD2 . PHE A 1 238 ? 11.993  96.966  64.661 1.00 17.68 ? 238  PHE A CD2 1 
ATOM   1864 C CE1 . PHE A 1 238 ? 12.668  97.767  67.237 1.00 21.31 ? 238  PHE A CE1 1 
ATOM   1865 C CE2 . PHE A 1 238 ? 10.996  97.356  65.543 1.00 22.67 ? 238  PHE A CE2 1 
ATOM   1866 C CZ  . PHE A 1 238 ? 11.333  97.760  66.838 1.00 22.00 ? 238  PHE A CZ  1 
ATOM   1867 N N   . SER A 1 239 ? 16.783  95.280  65.648 1.00 5.85  ? 239  SER A N   1 
ATOM   1868 C CA  . SER A 1 239 ? 17.600  95.187  66.837 1.00 7.90  ? 239  SER A CA  1 
ATOM   1869 C C   . SER A 1 239 ? 17.902  96.589  67.339 1.00 8.46  ? 239  SER A C   1 
ATOM   1870 O O   . SER A 1 239 ? 18.040  97.525  66.547 1.00 9.03  ? 239  SER A O   1 
ATOM   1871 C CB  . SER A 1 239 ? 18.936  94.491  66.517 1.00 5.99  ? 239  SER A CB  1 
ATOM   1872 O OG  . SER A 1 239 ? 18.739  93.195  65.973 1.00 11.87 ? 239  SER A OG  1 
ATOM   1873 N N   . LEU A 1 240 ? 17.901  96.749  68.655 1.00 6.70  ? 240  LEU A N   1 
ATOM   1874 C CA  . LEU A 1 240 ? 18.266  98.016  69.262 1.00 5.76  ? 240  LEU A CA  1 
ATOM   1875 C C   . LEU A 1 240 ? 19.707  97.719  69.663 1.00 5.96  ? 240  LEU A C   1 
ATOM   1876 O O   . LEU A 1 240 ? 19.958  96.738  70.375 1.00 5.20  ? 240  LEU A O   1 
ATOM   1877 C CB  . LEU A 1 240 ? 17.433  98.296  70.516 1.00 4.73  ? 240  LEU A CB  1 
ATOM   1878 C CG  . LEU A 1 240 ? 17.969  99.436  71.388 1.00 7.46  ? 240  LEU A CG  1 
ATOM   1879 C CD1 . LEU A 1 240 ? 17.834  100.763 70.667 1.00 6.41  ? 240  LEU A CD1 1 
ATOM   1880 C CD2 . LEU A 1 240 ? 17.236  99.477  72.717 1.00 9.88  ? 240  LEU A CD2 1 
ATOM   1881 N N   . ILE A 1 241 ? 20.655  98.491  69.143 1.00 4.80  ? 241  ILE A N   1 
ATOM   1882 C CA  . ILE A 1 241 ? 22.064  98.285  69.468 1.00 6.05  ? 241  ILE A CA  1 
ATOM   1883 C C   . ILE A 1 241 ? 22.291  98.877  70.861 1.00 8.55  ? 241  ILE A C   1 
ATOM   1884 O O   . ILE A 1 241 ? 22.377  100.096 71.015 1.00 10.17 ? 241  ILE A O   1 
ATOM   1885 C CB  . ILE A 1 241 ? 22.986  98.949  68.398 1.00 7.13  ? 241  ILE A CB  1 
ATOM   1886 C CG1 . ILE A 1 241 ? 22.646  98.389  67.006 1.00 2.01  ? 241  ILE A CG1 1 
ATOM   1887 C CG2 . ILE A 1 241 ? 24.478  98.731  68.734 1.00 2.12  ? 241  ILE A CG2 1 
ATOM   1888 C CD1 . ILE A 1 241 ? 22.681  96.864  66.907 1.00 2.13  ? 241  ILE A CD1 1 
ATOM   1889 N N   . THR A 1 242 ? 22.350  98.012  71.874 1.00 7.24  ? 242  THR A N   1 
ATOM   1890 C CA  . THR A 1 242 ? 22.520  98.449  73.257 1.00 8.15  ? 242  THR A CA  1 
ATOM   1891 C C   . THR A 1 242 ? 23.952  98.678  73.718 1.00 6.35  ? 242  THR A C   1 
ATOM   1892 O O   . THR A 1 242 ? 24.190  99.368  74.712 1.00 11.82 ? 242  THR A O   1 
ATOM   1893 C CB  . THR A 1 242 ? 21.857  97.467  74.246 1.00 10.49 ? 242  THR A CB  1 
ATOM   1894 O OG1 . THR A 1 242 ? 22.374  96.140  74.047 1.00 5.64  ? 242  THR A OG1 1 
ATOM   1895 C CG2 . THR A 1 242 ? 20.347  97.472  74.061 1.00 9.31  ? 242  THR A CG2 1 
ATOM   1896 N N   . ASN A 1 243 ? 24.905  98.113  73.002 1.00 4.12  ? 243  ASN A N   1 
ATOM   1897 C CA  . ASN A 1 243 ? 26.295  98.259  73.386 1.00 7.15  ? 243  ASN A CA  1 
ATOM   1898 C C   . ASN A 1 243 ? 27.205  97.873  72.245 1.00 7.48  ? 243  ASN A C   1 
ATOM   1899 O O   . ASN A 1 243 ? 26.810  97.152  71.333 1.00 7.76  ? 243  ASN A O   1 
ATOM   1900 C CB  . ASN A 1 243 ? 26.601  97.360  74.589 1.00 5.38  ? 243  ASN A CB  1 
ATOM   1901 C CG  . ASN A 1 243 ? 26.358  95.885  74.294 1.00 7.48  ? 243  ASN A CG  1 
ATOM   1902 O OD1 . ASN A 1 243 ? 25.219  95.465  74.115 1.00 8.43  ? 243  ASN A OD1 1 
ATOM   1903 N ND2 . ASN A 1 243 ? 27.428  95.100  74.222 1.00 7.84  ? 243  ASN A ND2 1 
ATOM   1904 N N   . LYS A 1 244 ? 28.427  98.375  72.299 1.00 10.56 ? 244  LYS A N   1 
ATOM   1905 C CA  . LYS A 1 244 ? 29.428  98.059  71.300 1.00 14.03 ? 244  LYS A CA  1 
ATOM   1906 C C   . LYS A 1 244 ? 30.253  96.916  71.870 1.00 13.90 ? 244  LYS A C   1 
ATOM   1907 O O   . LYS A 1 244 ? 30.704  96.961  73.015 1.00 10.72 ? 244  LYS A O   1 
ATOM   1908 C CB  . LYS A 1 244 ? 30.325  99.268  71.012 1.00 19.27 ? 244  LYS A CB  1 
ATOM   1909 C CG  . LYS A 1 244 ? 29.640  100.390 70.230 1.00 22.50 ? 244  LYS A CG  1 
ATOM   1910 C CD  . LYS A 1 244 ? 29.180  99.895  68.864 1.00 30.25 ? 244  LYS A CD  1 
ATOM   1911 C CE  . LYS A 1 244 ? 30.361  99.448  67.999 1.00 30.83 ? 244  LYS A CE  1 
ATOM   1912 N NZ  . LYS A 1 244 ? 29.915  98.764  66.757 1.00 28.37 ? 244  LYS A NZ  1 
ATOM   1913 N N   . VAL A 1 245 ? 30.372  95.858  71.083 1.00 16.13 ? 245  VAL A N   1 
ATOM   1914 C CA  . VAL A 1 245 ? 31.123  94.672  71.463 1.00 16.96 ? 245  VAL A CA  1 
ATOM   1915 C C   . VAL A 1 245 ? 32.623  94.977  71.643 1.00 15.53 ? 245  VAL A C   1 
ATOM   1916 O O   . VAL A 1 245 ? 33.207  95.739  70.875 1.00 18.19 ? 245  VAL A O   1 
ATOM   1917 C CB  . VAL A 1 245 ? 30.894  93.579  70.396 1.00 16.29 ? 245  VAL A CB  1 
ATOM   1918 C CG1 . VAL A 1 245 ? 32.115  92.744  70.209 1.00 17.98 ? 245  VAL A CG1 1 
ATOM   1919 C CG2 . VAL A 1 245 ? 29.698  92.727  70.779 1.00 11.89 ? 245  VAL A CG2 1 
ATOM   1920 N N   . ILE A 1 246 ? 33.232  94.388  72.668 1.00 15.63 ? 246  ILE A N   1 
ATOM   1921 C CA  . ILE A 1 246 ? 34.661  94.585  72.951 1.00 15.09 ? 246  ILE A CA  1 
ATOM   1922 C C   . ILE A 1 246 ? 35.473  93.787  71.919 1.00 15.81 ? 246  ILE A C   1 
ATOM   1923 O O   . ILE A 1 246 ? 35.379  92.564  71.860 1.00 12.58 ? 246  ILE A O   1 
ATOM   1924 C CB  . ILE A 1 246 ? 35.043  94.095  74.387 1.00 15.26 ? 246  ILE A CB  1 
ATOM   1925 C CG1 . ILE A 1 246 ? 34.133  94.721  75.450 1.00 11.92 ? 246  ILE A CG1 1 
ATOM   1926 C CG2 . ILE A 1 246 ? 36.510  94.422  74.692 1.00 16.57 ? 246  ILE A CG2 1 
ATOM   1927 C CD1 . ILE A 1 246 ? 34.313  96.207  75.652 1.00 14.36 ? 246  ILE A CD1 1 
ATOM   1928 N N   . MET A 1 247 ? 36.271  94.482  71.114 1.00 19.22 ? 247  MET A N   1 
ATOM   1929 C CA  . MET A 1 247 ? 37.074  93.830  70.079 1.00 20.06 ? 247  MET A CA  1 
ATOM   1930 C C   . MET A 1 247 ? 38.574  93.837  70.346 1.00 22.81 ? 247  MET A C   1 
ATOM   1931 O O   . MET A 1 247 ? 39.343  93.299  69.557 1.00 20.65 ? 247  MET A O   1 
ATOM   1932 C CB  . MET A 1 247 ? 36.811  94.492  68.725 1.00 23.07 ? 247  MET A CB  1 
ATOM   1933 C CG  . MET A 1 247 ? 35.368  94.403  68.249 1.00 27.45 ? 247  MET A CG  1 
ATOM   1934 S SD  . MET A 1 247 ? 34.967  92.836  67.453 1.00 33.21 ? 247  MET A SD  1 
ATOM   1935 C CE  . MET A 1 247 ? 34.370  93.412  65.866 1.00 26.58 ? 247  MET A CE  1 
ATOM   1936 N N   . ASP A 1 248 ? 38.999  94.446  71.448 1.00 26.27 ? 248  ASP A N   1 
ATOM   1937 C CA  . ASP A 1 248 ? 40.422  94.508  71.766 1.00 30.13 ? 248  ASP A CA  1 
ATOM   1938 C C   . ASP A 1 248 ? 40.695  94.010  73.175 1.00 30.66 ? 248  ASP A C   1 
ATOM   1939 O O   . ASP A 1 248 ? 39.905  94.241  74.090 1.00 28.34 ? 248  ASP A O   1 
ATOM   1940 C CB  . ASP A 1 248 ? 40.955  95.936  71.592 1.00 36.25 ? 248  ASP A CB  1 
ATOM   1941 C CG  . ASP A 1 248 ? 42.472  96.022  71.743 1.00 43.56 ? 248  ASP A CG  1 
ATOM   1942 O OD1 . ASP A 1 248 ? 43.187  95.091  71.298 1.00 46.20 ? 248  ASP A OD1 1 
ATOM   1943 O OD2 . ASP A 1 248 ? 42.951  97.030  72.310 1.00 47.49 ? 248  ASP A OD2 1 
ATOM   1944 N N   . THR A 1 249 ? 41.840  93.353  73.341 1.00 33.48 ? 249  THR A N   1 
ATOM   1945 C CA  . THR A 1 249 ? 42.244  92.790  74.623 1.00 36.98 ? 249  THR A CA  1 
ATOM   1946 C C   . THR A 1 249 ? 42.464  93.848  75.711 1.00 39.48 ? 249  THR A C   1 
ATOM   1947 O O   . THR A 1 249 ? 42.595  93.522  76.893 1.00 39.15 ? 249  THR A O   1 
ATOM   1948 C CB  . THR A 1 249 ? 43.476  91.868  74.450 1.00 36.92 ? 249  THR A CB  1 
ATOM   1949 O OG1 . THR A 1 249 ? 43.253  90.986  73.338 1.00 32.65 ? 249  THR A OG1 1 
ATOM   1950 C CG2 . THR A 1 249 ? 43.690  91.015  75.695 1.00 39.88 ? 249  THR A CG2 1 
ATOM   1951 N N   . GLU A 1 250 ? 42.524  95.115  75.313 1.00 43.18 ? 250  GLU A N   1 
ATOM   1952 C CA  . GLU A 1 250 ? 42.662  96.197  76.283 1.00 48.46 ? 250  GLU A CA  1 
ATOM   1953 C C   . GLU A 1 250 ? 41.221  96.549  76.655 1.00 51.73 ? 250  GLU A C   1 
ATOM   1954 O O   . GLU A 1 250 ? 40.697  97.608  76.291 1.00 51.67 ? 250  GLU A O   1 
ATOM   1955 C CB  . GLU A 1 250 ? 43.380  97.405  75.673 1.00 47.73 ? 250  GLU A CB  1 
ATOM   1956 C CG  . GLU A 1 250 ? 44.816  97.597  76.162 1.00 48.01 ? 250  GLU A CG  1 
ATOM   1957 C CD  . GLU A 1 250 ? 45.779  96.552  75.627 1.00 48.22 ? 250  GLU A CD  1 
ATOM   1958 O OE1 . GLU A 1 250 ? 46.268  96.727  74.490 1.00 50.64 ? 250  GLU A OE1 1 
ATOM   1959 O OE2 . GLU A 1 250 ? 46.059  95.566  76.346 1.00 43.96 ? 250  GLU A OE2 1 
ATOM   1960 N N   . SER A 1 251 ? 40.568  95.602  77.321 1.00 54.01 ? 251  SER A N   1 
ATOM   1961 C CA  . SER A 1 251 ? 39.182  95.745  77.733 1.00 55.03 ? 251  SER A CA  1 
ATOM   1962 C C   . SER A 1 251 ? 38.938  96.936  78.655 1.00 54.71 ? 251  SER A C   1 
ATOM   1963 O O   . SER A 1 251 ? 39.171  96.871  79.863 1.00 55.50 ? 251  SER A O   1 
ATOM   1964 C CB  . SER A 1 251 ? 38.697  94.445  78.386 1.00 55.81 ? 251  SER A CB  1 
ATOM   1965 O OG  . SER A 1 251 ? 38.926  93.337  77.527 1.00 55.53 ? 251  SER A OG  1 
ATOM   1966 N N   . GLN A 1 252 ? 38.465  98.028  78.066 1.00 54.10 ? 252  GLN A N   1 
ATOM   1967 C CA  . GLN A 1 252 ? 38.157  99.242  78.814 1.00 55.19 ? 252  GLN A CA  1 
ATOM   1968 C C   . GLN A 1 252 ? 36.770  99.115  79.451 1.00 53.83 ? 252  GLN A C   1 
ATOM   1969 O O   . GLN A 1 252 ? 36.114  100.118 79.740 1.00 55.42 ? 252  GLN A O   1 
ATOM   1970 C CB  . GLN A 1 252 ? 38.190  100.458 77.879 1.00 57.93 ? 252  GLN A CB  1 
ATOM   1971 C CG  . GLN A 1 252 ? 37.260  100.336 76.669 1.00 60.90 ? 252  GLN A CG  1 
ATOM   1972 C CD  . GLN A 1 252 ? 37.130  101.628 75.882 1.00 62.38 ? 252  GLN A CD  1 
ATOM   1973 O OE1 . GLN A 1 252 ? 37.582  101.721 74.742 1.00 62.08 ? 252  GLN A OE1 1 
ATOM   1974 N NE2 . GLN A 1 252 ? 36.488  102.626 76.480 1.00 63.13 ? 252  GLN A NE2 1 
ATOM   1975 N N   . GLY A 1 253 ? 36.324  97.877  79.640 1.00 51.31 ? 253  GLY A N   1 
ATOM   1976 C CA  . GLY A 1 253 ? 35.021  97.618  80.222 1.00 49.03 ? 253  GLY A CA  1 
ATOM   1977 C C   . GLY A 1 253 ? 34.520  96.267  79.751 1.00 46.76 ? 253  GLY A C   1 
ATOM   1978 O O   . GLY A 1 253 ? 35.281  95.494  79.163 1.00 46.52 ? 253  GLY A O   1 
ATOM   1979 N N   . LYS A 1 254 ? 33.249  95.972  80.008 1.00 43.68 ? 254  LYS A N   1 
ATOM   1980 C CA  . LYS A 1 254 ? 32.662  94.704  79.594 1.00 40.31 ? 254  LYS A CA  1 
ATOM   1981 C C   . LYS A 1 254 ? 31.137  94.725  79.636 1.00 36.88 ? 254  LYS A C   1 
ATOM   1982 O O   . LYS A 1 254 ? 30.536  95.453  80.429 1.00 35.77 ? 254  LYS A O   1 
ATOM   1983 C CB  . LYS A 1 254 ? 33.228  93.546  80.426 1.00 42.74 ? 254  LYS A CB  1 
ATOM   1984 C CG  . LYS A 1 254 ? 33.221  93.762  81.927 1.00 46.09 ? 254  LYS A CG  1 
ATOM   1985 C CD  . LYS A 1 254 ? 34.202  92.812  82.600 1.00 51.45 ? 254  LYS A CD  1 
ATOM   1986 C CE  . LYS A 1 254 ? 34.215  92.972  84.118 1.00 55.19 ? 254  LYS A CE  1 
ATOM   1987 N NZ  . LYS A 1 254 ? 32.950  92.504  84.763 1.00 57.44 ? 254  LYS A NZ  1 
ATOM   1988 N N   . ALA A 1 255 ? 30.524  93.976  78.721 1.00 33.21 ? 255  ALA A N   1 
ATOM   1989 C CA  . ALA A 1 255 ? 29.071  93.890  78.613 1.00 30.75 ? 255  ALA A CA  1 
ATOM   1990 C C   . ALA A 1 255 ? 28.397  93.424  79.897 1.00 29.14 ? 255  ALA A C   1 
ATOM   1991 O O   . ALA A 1 255 ? 28.917  92.559  80.606 1.00 25.21 ? 255  ALA A O   1 
ATOM   1992 C CB  . ALA A 1 255 ? 28.681  92.978  77.449 1.00 27.15 ? 255  ALA A CB  1 
ATOM   1993 N N   . ASN A 1 256 ? 27.233  94.005  80.176 1.00 29.06 ? 256  ASN A N   1 
ATOM   1994 C CA  . ASN A 1 256 ? 26.447  93.679  81.362 1.00 28.32 ? 256  ASN A CA  1 
ATOM   1995 C C   . ASN A 1 256 ? 24.971  93.893  81.036 1.00 25.99 ? 256  ASN A C   1 
ATOM   1996 O O   . ASN A 1 256 ? 24.627  94.770  80.246 1.00 27.77 ? 256  ASN A O   1 
ATOM   1997 C CB  . ASN A 1 256 ? 26.868  94.552  82.551 1.00 29.45 ? 256  ASN A CB  1 
ATOM   1998 C CG  . ASN A 1 256 ? 26.586  96.022  82.325 1.00 32.50 ? 256  ASN A CG  1 
ATOM   1999 O OD1 . ASN A 1 256 ? 25.561  96.542  82.767 1.00 30.07 ? 256  ASN A OD1 1 
ATOM   2000 N ND2 . ASN A 1 256 ? 27.489  96.698  81.626 1.00 33.15 ? 256  ASN A ND2 1 
ATOM   2001 N N   . HIS A 1 257 ? 24.108  93.090  81.648 1.00 24.78 ? 257  HIS A N   1 
ATOM   2002 C CA  . HIS A 1 257 ? 22.666  93.148  81.416 1.00 24.77 ? 257  HIS A CA  1 
ATOM   2003 C C   . HIS A 1 257 ? 21.972  94.468  81.751 1.00 25.56 ? 257  HIS A C   1 
ATOM   2004 O O   . HIS A 1 257 ? 21.048  94.871  81.043 1.00 23.54 ? 257  HIS A O   1 
ATOM   2005 C CB  . HIS A 1 257 ? 21.973  91.998  82.159 1.00 26.52 ? 257  HIS A CB  1 
ATOM   2006 C CG  . HIS A 1 257 ? 20.548  91.774  81.750 1.00 27.80 ? 257  HIS A CG  1 
ATOM   2007 N ND1 . HIS A 1 257 ? 20.155  91.687  80.431 1.00 28.65 ? 257  HIS A ND1 1 
ATOM   2008 C CD2 . HIS A 1 257 ? 19.425  91.597  82.487 1.00 28.26 ? 257  HIS A CD2 1 
ATOM   2009 C CE1 . HIS A 1 257 ? 18.853  91.463  80.372 1.00 28.83 ? 257  HIS A CE1 1 
ATOM   2010 N NE2 . HIS A 1 257 ? 18.387  91.405  81.607 1.00 29.35 ? 257  HIS A NE2 1 
ATOM   2011 N N   . GLU A 1 258 ? 22.377  95.127  82.831 1.00 26.36 ? 258  GLU A N   1 
ATOM   2012 C CA  . GLU A 1 258 ? 21.734  96.383  83.200 1.00 31.83 ? 258  GLU A CA  1 
ATOM   2013 C C   . GLU A 1 258 ? 21.989  97.487  82.177 1.00 30.05 ? 258  GLU A C   1 
ATOM   2014 O O   . GLU A 1 258 ? 21.116  98.316  81.930 1.00 30.38 ? 258  GLU A O   1 
ATOM   2015 C CB  . GLU A 1 258 ? 22.146  96.837  84.604 1.00 37.51 ? 258  GLU A CB  1 
ATOM   2016 C CG  . GLU A 1 258 ? 21.452  98.134  85.074 1.00 50.27 ? 258  GLU A CG  1 
ATOM   2017 C CD  . GLU A 1 258 ? 19.921  98.038  85.118 1.00 55.37 ? 258  GLU A CD  1 
ATOM   2018 O OE1 . GLU A 1 258 ? 19.271  98.235  84.065 1.00 56.48 ? 258  GLU A OE1 1 
ATOM   2019 O OE2 . GLU A 1 258 ? 19.367  97.786  86.212 1.00 58.59 ? 258  GLU A OE2 1 
ATOM   2020 N N   . GLU A 1 259 ? 23.169  97.479  81.560 1.00 28.90 ? 259  GLU A N   1 
ATOM   2021 C CA  . GLU A 1 259 ? 23.504  98.483  80.553 1.00 26.46 ? 259  GLU A CA  1 
ATOM   2022 C C   . GLU A 1 259 ? 22.559  98.333  79.356 1.00 24.03 ? 259  GLU A C   1 
ATOM   2023 O O   . GLU A 1 259 ? 22.137  99.330  78.765 1.00 23.08 ? 259  GLU A O   1 
ATOM   2024 C CB  . GLU A 1 259 ? 24.972  98.349  80.110 1.00 26.29 ? 259  GLU A CB  1 
ATOM   2025 C CG  . GLU A 1 259 ? 25.163  97.714  78.722 1.00 32.25 ? 259  GLU A CG  1 
ATOM   2026 C CD  . GLU A 1 259 ? 26.604  97.331  78.413 1.00 32.55 ? 259  GLU A CD  1 
ATOM   2027 O OE1 . GLU A 1 259 ? 27.496  98.208  78.493 1.00 32.66 ? 259  GLU A OE1 1 
ATOM   2028 O OE2 . GLU A 1 259 ? 26.835  96.148  78.071 1.00 30.99 ? 259  GLU A OE2 1 
ATOM   2029 N N   . VAL A 1 260 ? 22.215  97.095  79.003 1.00 20.99 ? 260  VAL A N   1 
ATOM   2030 C CA  . VAL A 1 260 ? 21.312  96.885  77.874 1.00 20.00 ? 260  VAL A CA  1 
ATOM   2031 C C   . VAL A 1 260 ? 19.900  97.347  78.234 1.00 19.97 ? 260  VAL A C   1 
ATOM   2032 O O   . VAL A 1 260 ? 19.222  97.977  77.416 1.00 19.12 ? 260  VAL A O   1 
ATOM   2033 C CB  . VAL A 1 260 ? 21.302  95.410  77.355 1.00 19.07 ? 260  VAL A CB  1 
ATOM   2034 C CG1 . VAL A 1 260 ? 22.686  94.789  77.477 1.00 17.49 ? 260  VAL A CG1 1 
ATOM   2035 C CG2 . VAL A 1 260 ? 20.229  94.586  78.032 1.00 16.96 ? 260  VAL A CG2 1 
ATOM   2036 N N   . LEU A 1 261 ? 19.474  97.066  79.467 1.00 19.35 ? 261  LEU A N   1 
ATOM   2037 C CA  . LEU A 1 261 ? 18.148  97.472  79.932 1.00 20.06 ? 261  LEU A CA  1 
ATOM   2038 C C   . LEU A 1 261 ? 18.100  98.989  80.007 1.00 20.50 ? 261  LEU A C   1 
ATOM   2039 O O   . LEU A 1 261 ? 17.112  99.616  79.624 1.00 22.46 ? 261  LEU A O   1 
ATOM   2040 C CB  . LEU A 1 261 ? 17.852  96.889  81.314 1.00 18.97 ? 261  LEU A CB  1 
ATOM   2041 C CG  . LEU A 1 261 ? 17.719  95.371  81.394 1.00 18.61 ? 261  LEU A CG  1 
ATOM   2042 C CD1 . LEU A 1 261 ? 17.403  94.962  82.816 1.00 18.95 ? 261  LEU A CD1 1 
ATOM   2043 C CD2 . LEU A 1 261 ? 16.621  94.905  80.453 1.00 21.45 ? 261  LEU A CD2 1 
ATOM   2044 N N   . GLU A 1 262 ? 19.193  99.571  80.480 1.00 20.78 ? 262  GLU A N   1 
ATOM   2045 C CA  . GLU A 1 262 ? 19.309  101.010 80.614 1.00 22.13 ? 262  GLU A CA  1 
ATOM   2046 C C   . GLU A 1 262 ? 19.172  101.646 79.241 1.00 23.74 ? 262  GLU A C   1 
ATOM   2047 O O   . GLU A 1 262 ? 18.481  102.662 79.082 1.00 21.41 ? 262  GLU A O   1 
ATOM   2048 C CB  . GLU A 1 262 ? 20.666  101.362 81.225 1.00 23.89 ? 262  GLU A CB  1 
ATOM   2049 C CG  . GLU A 1 262 ? 20.762  102.771 81.753 1.00 29.34 ? 262  GLU A CG  1 
ATOM   2050 C CD  . GLU A 1 262 ? 19.666  103.086 82.759 1.00 33.80 ? 262  GLU A CD  1 
ATOM   2051 O OE1 . GLU A 1 262 ? 19.330  102.204 83.587 1.00 36.23 ? 262  GLU A OE1 1 
ATOM   2052 O OE2 . GLU A 1 262 ? 19.132  104.218 82.716 1.00 35.98 ? 262  GLU A OE2 1 
ATOM   2053 N N   . ALA A 1 263 ? 19.810  101.026 78.247 1.00 24.53 ? 263  ALA A N   1 
ATOM   2054 C CA  . ALA A 1 263 ? 19.766  101.520 76.873 1.00 25.39 ? 263  ALA A CA  1 
ATOM   2055 C C   . ALA A 1 263 ? 18.345  101.446 76.316 1.00 25.61 ? 263  ALA A C   1 
ATOM   2056 O O   . ALA A 1 263 ? 17.911  102.345 75.591 1.00 22.71 ? 263  ALA A O   1 
ATOM   2057 C CB  . ALA A 1 263 ? 20.738  100.736 75.989 1.00 25.16 ? 263  ALA A CB  1 
ATOM   2058 N N   . GLY A 1 264 ? 17.617  100.395 76.686 1.00 28.33 ? 264  GLY A N   1 
ATOM   2059 C CA  . GLY A 1 264 ? 16.245  100.235 76.234 1.00 33.27 ? 264  GLY A CA  1 
ATOM   2060 C C   . GLY A 1 264 ? 15.367  101.393 76.676 1.00 36.05 ? 264  GLY A C   1 
ATOM   2061 O O   . GLY A 1 264 ? 14.601  101.938 75.878 1.00 36.65 ? 264  GLY A O   1 
ATOM   2062 N N   . LYS A 1 265 ? 15.477  101.769 77.950 1.00 39.18 ? 265  LYS A N   1 
ATOM   2063 C CA  . LYS A 1 265 ? 14.712  102.890 78.503 1.00 40.61 ? 265  LYS A CA  1 
ATOM   2064 C C   . LYS A 1 265 ? 15.132  104.177 77.798 1.00 40.01 ? 265  LYS A C   1 
ATOM   2065 O O   . LYS A 1 265 ? 14.304  105.032 77.491 1.00 37.97 ? 265  LYS A O   1 
ATOM   2066 C CB  . LYS A 1 265 ? 14.968  103.034 80.006 1.00 42.91 ? 265  LYS A CB  1 
ATOM   2067 C CG  . LYS A 1 265 ? 14.474  101.868 80.842 1.00 47.87 ? 265  LYS A CG  1 
ATOM   2068 C CD  . LYS A 1 265 ? 14.454  102.222 82.330 1.00 52.03 ? 265  LYS A CD  1 
ATOM   2069 C CE  . LYS A 1 265 ? 15.853  102.377 82.919 1.00 51.19 ? 265  LYS A CE  1 
ATOM   2070 N NZ  . LYS A 1 265 ? 16.561  101.069 83.030 1.00 51.70 ? 265  LYS A NZ  1 
ATOM   2071 N N   . GLN A 1 266 ? 16.436  104.297 77.561 1.00 40.09 ? 266  GLN A N   1 
ATOM   2072 C CA  . GLN A 1 266 ? 17.031  105.443 76.883 1.00 40.01 ? 266  GLN A CA  1 
ATOM   2073 C C   . GLN A 1 266 ? 16.391  105.673 75.512 1.00 39.95 ? 266  GLN A C   1 
ATOM   2074 O O   . GLN A 1 266 ? 16.086  106.807 75.148 1.00 39.65 ? 266  GLN A O   1 
ATOM   2075 C CB  . GLN A 1 266 ? 18.542  105.206 76.741 1.00 42.17 ? 266  GLN A CB  1 
ATOM   2076 C CG  . GLN A 1 266 ? 19.214  105.830 75.518 1.00 45.25 ? 266  GLN A CG  1 
ATOM   2077 C CD  . GLN A 1 266 ? 20.359  104.971 74.969 1.00 46.78 ? 266  GLN A CD  1 
ATOM   2078 O OE1 . GLN A 1 266 ? 20.149  104.096 74.124 1.00 45.42 ? 266  GLN A OE1 1 
ATOM   2079 N NE2 . GLN A 1 266 ? 21.572  105.222 75.449 1.00 41.21 ? 266  GLN A NE2 1 
ATOM   2080 N N   . ALA A 1 267 ? 16.181  104.592 74.762 1.00 39.97 ? 267  ALA A N   1 
ATOM   2081 C CA  . ALA A 1 267 ? 15.593  104.678 73.426 1.00 38.95 ? 267  ALA A CA  1 
ATOM   2082 C C   . ALA A 1 267 ? 14.095  104.377 73.387 1.00 37.71 ? 267  ALA A C   1 
ATOM   2083 O O   . ALA A 1 267 ? 13.528  104.167 72.315 1.00 36.07 ? 267  ALA A O   1 
ATOM   2084 C CB  . ALA A 1 267 ? 16.343  103.756 72.472 1.00 38.59 ? 267  ALA A CB  1 
ATOM   2085 N N   . ALA A 1 268 ? 13.446  104.436 74.544 1.00 37.71 ? 268  ALA A N   1 
ATOM   2086 C CA  . ALA A 1 268 ? 12.016  104.154 74.656 1.00 38.56 ? 268  ALA A CA  1 
ATOM   2087 C C   . ALA A 1 268 ? 11.118  104.990 73.742 1.00 38.17 ? 268  ALA A C   1 
ATOM   2088 O O   . ALA A 1 268 ? 10.402  104.446 72.901 1.00 37.65 ? 268  ALA A O   1 
ATOM   2089 C CB  . ALA A 1 268 ? 11.565  104.301 76.109 1.00 37.82 ? 268  ALA A CB  1 
ATOM   2090 N N   . GLN A 1 269 ? 11.154  106.309 73.908 1.00 38.01 ? 269  GLN A N   1 
ATOM   2091 C CA  . GLN A 1 269 ? 10.323  107.203 73.107 1.00 39.54 ? 269  GLN A CA  1 
ATOM   2092 C C   . GLN A 1 269 ? 10.524  107.080 71.597 1.00 39.19 ? 269  GLN A C   1 
ATOM   2093 O O   . GLN A 1 269 ? 9.584   107.277 70.824 1.00 42.11 ? 269  GLN A O   1 
ATOM   2094 C CB  . GLN A 1 269 ? 10.494  108.666 73.548 1.00 42.26 ? 269  GLN A CB  1 
ATOM   2095 C CG  . GLN A 1 269 ? 11.929  109.193 73.556 1.00 49.12 ? 269  GLN A CG  1 
ATOM   2096 C CD  . GLN A 1 269 ? 12.621  109.031 74.907 1.00 53.76 ? 269  GLN A CD  1 
ATOM   2097 O OE1 . GLN A 1 269 ? 12.536  107.979 75.544 1.00 55.32 ? 269  GLN A OE1 1 
ATOM   2098 N NE2 . GLN A 1 269 ? 13.307  110.079 75.348 1.00 53.31 ? 269  GLN A NE2 1 
ATOM   2099 N N   . LYS A 1 270 ? 11.733  106.720 71.180 1.00 36.93 ? 270  LYS A N   1 
ATOM   2100 C CA  . LYS A 1 270 ? 12.047  106.586 69.760 1.00 33.52 ? 270  LYS A CA  1 
ATOM   2101 C C   . LYS A 1 270 ? 11.459  105.318 69.136 1.00 32.38 ? 270  LYS A C   1 
ATOM   2102 O O   . LYS A 1 270 ? 10.757  105.391 68.126 1.00 31.47 ? 270  LYS A O   1 
ATOM   2103 C CB  . LYS A 1 270 ? 13.557  106.607 69.556 1.00 33.55 ? 270  LYS A CB  1 
ATOM   2104 C CG  . LYS A 1 270 ? 13.991  106.868 68.133 1.00 34.72 ? 270  LYS A CG  1 
ATOM   2105 C CD  . LYS A 1 270 ? 15.379  106.298 67.880 1.00 39.24 ? 270  LYS A CD  1 
ATOM   2106 C CE  . LYS A 1 270 ? 16.382  106.731 68.941 1.00 40.98 ? 270  LYS A CE  1 
ATOM   2107 N NZ  . LYS A 1 270 ? 17.709  106.083 68.739 1.00 40.57 ? 270  LYS A NZ  1 
ATOM   2108 N N   . LEU A 1 271 ? 11.747  104.162 69.732 1.00 31.52 ? 271  LEU A N   1 
ATOM   2109 C CA  . LEU A 1 271 ? 11.244  102.883 69.223 1.00 32.54 ? 271  LEU A CA  1 
ATOM   2110 C C   . LEU A 1 271 ? 9.724   102.796 69.228 1.00 31.79 ? 271  LEU A C   1 
ATOM   2111 O O   . LEU A 1 271 ? 9.121   102.361 68.249 1.00 31.31 ? 271  LEU A O   1 
ATOM   2112 C CB  . LEU A 1 271 ? 11.819  101.708 70.015 1.00 34.94 ? 271  LEU A CB  1 
ATOM   2113 C CG  . LEU A 1 271 ? 13.220  101.233 69.632 1.00 37.95 ? 271  LEU A CG  1 
ATOM   2114 C CD1 . LEU A 1 271 ? 14.249  102.304 69.940 1.00 41.07 ? 271  LEU A CD1 1 
ATOM   2115 C CD2 . LEU A 1 271 ? 13.545  99.956  70.384 1.00 40.32 ? 271  LEU A CD2 1 
ATOM   2116 N N   . GLU A 1 272 ? 9.109   103.205 70.333 1.00 33.19 ? 272  GLU A N   1 
ATOM   2117 C CA  . GLU A 1 272 ? 7.657   103.178 70.459 1.00 32.93 ? 272  GLU A CA  1 
ATOM   2118 C C   . GLU A 1 272 ? 7.018   103.999 69.350 1.00 32.29 ? 272  GLU A C   1 
ATOM   2119 O O   . GLU A 1 272 ? 6.074   103.547 68.700 1.00 33.63 ? 272  GLU A O   1 
ATOM   2120 C CB  . GLU A 1 272 ? 7.237   103.705 71.832 1.00 35.51 ? 272  GLU A CB  1 
ATOM   2121 C CG  . GLU A 1 272 ? 7.630   102.777 72.973 1.00 38.57 ? 272  GLU A CG  1 
ATOM   2122 C CD  . GLU A 1 272 ? 7.619   103.452 74.331 1.00 40.63 ? 272  GLU A CD  1 
ATOM   2123 O OE1 . GLU A 1 272 ? 6.799   104.372 74.550 1.00 42.94 ? 272  GLU A OE1 1 
ATOM   2124 O OE2 . GLU A 1 272 ? 8.441   103.052 75.184 1.00 40.20 ? 272  GLU A OE2 1 
ATOM   2125 N N   . GLN A 1 273 ? 7.570   105.187 69.115 1.00 28.67 ? 273  GLN A N   1 
ATOM   2126 C CA  . GLN A 1 273 ? 7.088   106.091 68.078 1.00 26.74 ? 273  GLN A CA  1 
ATOM   2127 C C   . GLN A 1 273 ? 7.209   105.426 66.710 1.00 22.49 ? 273  GLN A C   1 
ATOM   2128 O O   . GLN A 1 273 ? 6.275   105.460 65.904 1.00 21.60 ? 273  GLN A O   1 
ATOM   2129 C CB  . GLN A 1 273 ? 7.910   107.379 68.094 1.00 30.12 ? 273  GLN A CB  1 
ATOM   2130 C CG  . GLN A 1 273 ? 7.424   108.445 67.129 1.00 38.55 ? 273  GLN A CG  1 
ATOM   2131 C CD  . GLN A 1 273 ? 8.390   109.617 66.991 1.00 44.12 ? 273  GLN A CD  1 
ATOM   2132 O OE1 . GLN A 1 273 ? 8.292   110.399 66.044 1.00 47.03 ? 273  GLN A OE1 1 
ATOM   2133 N NE2 . GLN A 1 273 ? 9.327   109.741 67.928 1.00 44.83 ? 273  GLN A NE2 1 
ATOM   2134 N N   . PHE A 1 274 ? 8.361   104.810 66.467 1.00 19.21 ? 274  PHE A N   1 
ATOM   2135 C CA  . PHE A 1 274 ? 8.636   104.124 65.211 1.00 18.18 ? 274  PHE A CA  1 
ATOM   2136 C C   . PHE A 1 274 ? 7.694   102.942 64.969 1.00 17.57 ? 274  PHE A C   1 
ATOM   2137 O O   . PHE A 1 274 ? 7.176   102.771 63.864 1.00 15.97 ? 274  PHE A O   1 
ATOM   2138 C CB  . PHE A 1 274 ? 10.088  103.648 65.186 1.00 16.82 ? 274  PHE A CB  1 
ATOM   2139 C CG  . PHE A 1 274 ? 10.499  103.002 63.894 1.00 18.56 ? 274  PHE A CG  1 
ATOM   2140 C CD1 . PHE A 1 274 ? 10.255  103.628 62.677 1.00 17.62 ? 274  PHE A CD1 1 
ATOM   2141 C CD2 . PHE A 1 274 ? 11.154  101.772 63.896 1.00 19.73 ? 274  PHE A CD2 1 
ATOM   2142 C CE1 . PHE A 1 274 ? 10.657  103.045 61.479 1.00 19.01 ? 274  PHE A CE1 1 
ATOM   2143 C CE2 . PHE A 1 274 ? 11.560  101.180 62.705 1.00 20.02 ? 274  PHE A CE2 1 
ATOM   2144 C CZ  . PHE A 1 274 ? 11.311  101.819 61.494 1.00 20.54 ? 274  PHE A CZ  1 
ATOM   2145 N N   . VAL A 1 275 ? 7.474   102.124 65.993 1.00 17.38 ? 275  VAL A N   1 
ATOM   2146 C CA  . VAL A 1 275 ? 6.590   100.966 65.861 1.00 16.94 ? 275  VAL A CA  1 
ATOM   2147 C C   . VAL A 1 275 ? 5.147   101.405 65.662 1.00 16.01 ? 275  VAL A C   1 
ATOM   2148 O O   . VAL A 1 275 ? 4.416   100.813 64.866 1.00 16.41 ? 275  VAL A O   1 
ATOM   2149 C CB  . VAL A 1 275 ? 6.707   100.013 67.082 1.00 16.99 ? 275  VAL A CB  1 
ATOM   2150 C CG1 . VAL A 1 275 ? 5.615   98.950  67.040 1.00 16.87 ? 275  VAL A CG1 1 
ATOM   2151 C CG2 . VAL A 1 275 ? 8.074   99.336  67.074 1.00 14.73 ? 275  VAL A CG2 1 
ATOM   2152 N N   . SER A 1 276 ? 4.753   102.460 66.369 1.00 17.95 ? 276  SER A N   1 
ATOM   2153 C CA  . SER A 1 276 ? 3.405   103.002 66.266 1.00 20.60 ? 276  SER A CA  1 
ATOM   2154 C C   . SER A 1 276 ? 3.132   103.466 64.838 1.00 20.41 ? 276  SER A C   1 
ATOM   2155 O O   . SER A 1 276 ? 2.086   103.155 64.267 1.00 21.18 ? 276  SER A O   1 
ATOM   2156 C CB  . SER A 1 276 ? 3.230   104.170 67.238 1.00 22.26 ? 276  SER A CB  1 
ATOM   2157 O OG  . SER A 1 276 ? 1.925   104.715 67.152 1.00 33.10 ? 276  SER A OG  1 
ATOM   2158 N N   . LEU A 1 277 ? 4.076   104.204 64.258 1.00 21.96 ? 277  LEU A N   1 
ATOM   2159 C CA  . LEU A 1 277 ? 3.928   104.687 62.884 1.00 21.26 ? 277  LEU A CA  1 
ATOM   2160 C C   . LEU A 1 277 ? 3.907   103.541 61.873 1.00 21.27 ? 277  LEU A C   1 
ATOM   2161 O O   . LEU A 1 277 ? 3.123   103.570 60.923 1.00 21.05 ? 277  LEU A O   1 
ATOM   2162 C CB  . LEU A 1 277 ? 5.030   105.685 62.525 1.00 21.64 ? 277  LEU A CB  1 
ATOM   2163 C CG  . LEU A 1 277 ? 4.936   107.064 63.179 1.00 24.84 ? 277  LEU A CG  1 
ATOM   2164 C CD1 . LEU A 1 277 ? 6.073   107.937 62.690 1.00 25.10 ? 277  LEU A CD1 1 
ATOM   2165 C CD2 . LEU A 1 277 ? 3.600   107.704 62.842 1.00 25.76 ? 277  LEU A CD2 1 
ATOM   2166 N N   . LEU A 1 278 ? 4.744   102.529 62.097 1.00 20.89 ? 278  LEU A N   1 
ATOM   2167 C CA  . LEU A 1 278 ? 4.815   101.368 61.209 1.00 25.09 ? 278  LEU A CA  1 
ATOM   2168 C C   . LEU A 1 278 ? 3.492   100.623 61.067 1.00 25.80 ? 278  LEU A C   1 
ATOM   2169 O O   . LEU A 1 278 ? 3.245   99.999  60.035 1.00 22.80 ? 278  LEU A O   1 
ATOM   2170 C CB  . LEU A 1 278 ? 5.893   100.385 61.671 1.00 24.52 ? 278  LEU A CB  1 
ATOM   2171 C CG  . LEU A 1 278 ? 7.329   100.668 61.239 1.00 27.65 ? 278  LEU A CG  1 
ATOM   2172 C CD1 . LEU A 1 278 ? 8.233   99.586  61.789 1.00 27.14 ? 278  LEU A CD1 1 
ATOM   2173 C CD2 . LEU A 1 278 ? 7.421   100.707 59.724 1.00 26.15 ? 278  LEU A CD2 1 
ATOM   2174 N N   . MET A 1 279 ? 2.661   100.666 62.107 1.00 27.90 ? 279  MET A N   1 
ATOM   2175 C CA  . MET A 1 279 ? 1.364   99.993  62.081 1.00 32.12 ? 279  MET A CA  1 
ATOM   2176 C C   . MET A 1 279 ? 0.543   100.370 60.851 1.00 36.71 ? 279  MET A C   1 
ATOM   2177 O O   . MET A 1 279 ? -0.210  99.547  60.326 1.00 37.37 ? 279  MET A O   1 
ATOM   2178 C CB  . MET A 1 279 ? 0.573   100.274 63.359 1.00 29.72 ? 279  MET A CB  1 
ATOM   2179 C CG  . MET A 1 279 ? 1.060   99.490  64.567 1.00 30.44 ? 279  MET A CG  1 
ATOM   2180 S SD  . MET A 1 279 ? 1.045   97.691  64.315 1.00 28.79 ? 279  MET A SD  1 
ATOM   2181 C CE  . MET A 1 279 ? 2.784   97.349  64.235 1.00 29.58 ? 279  MET A CE  1 
ATOM   2182 N N   . ALA A 1 280 ? 0.690   101.611 60.392 1.00 41.62 ? 280  ALA A N   1 
ATOM   2183 C CA  . ALA A 1 280 ? -0.017  102.072 59.203 1.00 45.77 ? 280  ALA A CA  1 
ATOM   2184 C C   . ALA A 1 280 ? 0.561   101.327 57.994 1.00 49.27 ? 280  ALA A C   1 
ATOM   2185 O O   . ALA A 1 280 ? 1.721   101.518 57.630 1.00 49.01 ? 280  ALA A O   1 
ATOM   2186 C CB  . ALA A 1 280 ? 0.151   103.573 59.040 1.00 45.62 ? 280  ALA A CB  1 
ATOM   2187 N N   . SER A 1 281 ? -0.265  100.475 57.392 1.00 54.94 ? 281  SER A N   1 
ATOM   2188 C CA  . SER A 1 281 ? 0.108   99.651  56.240 1.00 58.54 ? 281  SER A CA  1 
ATOM   2189 C C   . SER A 1 281 ? 1.045   98.532  56.673 1.00 58.88 ? 281  SER A C   1 
ATOM   2190 O O   . SER A 1 281 ? 2.265   98.678  56.648 1.00 58.43 ? 281  SER A O   1 
ATOM   2191 C CB  . SER A 1 281 ? 0.754   100.476 55.120 1.00 60.84 ? 281  SER A CB  1 
ATOM   2192 O OG  . SER A 1 281 ? 0.922   99.683  53.953 1.00 61.65 ? 281  SER A OG  1 
ATOM   2193 N N   . ILE A 1 282 ? 0.453   97.421  57.095 1.00 60.45 ? 282  ILE A N   1 
ATOM   2194 C CA  . ILE A 1 282 ? 1.217   96.264  57.535 1.00 63.51 ? 282  ILE A CA  1 
ATOM   2195 C C   . ILE A 1 282 ? 1.518   95.208  56.456 1.00 65.88 ? 282  ILE A C   1 
ATOM   2196 O O   . ILE A 1 282 ? 2.560   94.553  56.516 1.00 69.16 ? 282  ILE A O   1 
ATOM   2197 C CB  . ILE A 1 282 ? 0.579   95.629  58.806 1.00 62.36 ? 282  ILE A CB  1 
ATOM   2198 C CG1 . ILE A 1 282 ? 1.034   96.399  60.048 1.00 61.62 ? 282  ILE A CG1 1 
ATOM   2199 C CG2 . ILE A 1 282 ? 0.928   94.156  58.934 1.00 62.05 ? 282  ILE A CG2 1 
ATOM   2200 C CD1 . ILE A 1 282 ? 2.538   96.394  60.258 1.00 56.73 ? 282  ILE A CD1 1 
ATOM   2201 N N   . PRO A 1 283 ? 0.632   95.024  55.455 1.00 65.72 ? 283  PRO A N   1 
ATOM   2202 C CA  . PRO A 1 283 ? -0.657  95.654  55.154 1.00 66.36 ? 283  PRO A CA  1 
ATOM   2203 C C   . PRO A 1 283 ? -1.826  95.051  55.940 1.00 66.68 ? 283  PRO A C   1 
ATOM   2204 O O   . PRO A 1 283 ? -1.987  95.340  57.124 1.00 66.82 ? 283  PRO A O   1 
ATOM   2205 C CB  . PRO A 1 283 ? -0.792  95.425  53.650 1.00 66.38 ? 283  PRO A CB  1 
ATOM   2206 C CG  . PRO A 1 283 ? -0.158  94.096  53.472 1.00 65.45 ? 283  PRO A CG  1 
ATOM   2207 C CD  . PRO A 1 283 ? 1.088   94.223  54.304 1.00 64.76 ? 283  PRO A CD  1 
ATOM   2208 N N   . VAL A 1 284 ? -2.641  94.238  55.271 1.00 67.28 ? 284  VAL A N   1 
ATOM   2209 C CA  . VAL A 1 284 ? -3.796  93.589  55.883 1.00 67.90 ? 284  VAL A CA  1 
ATOM   2210 C C   . VAL A 1 284 ? -4.360  92.556  54.897 1.00 68.02 ? 284  VAL A C   1 
ATOM   2211 O O   . VAL A 1 284 ? -4.125  92.720  53.679 1.00 69.06 ? 284  VAL A O   1 
ATOM   2212 C CB  . VAL A 1 284 ? -4.889  94.633  56.275 1.00 67.66 ? 284  VAL A CB  1 
ATOM   2213 C CG1 . VAL A 1 284 ? -5.387  95.386  55.049 1.00 66.83 ? 284  VAL A CG1 1 
ATOM   2214 C CG2 . VAL A 1 284 ? -6.041  93.959  57.015 1.00 68.16 ? 284  VAL A CG2 1 
ATOM   2215 O OXT . VAL A 1 284 ? -4.996  91.576  55.341 1.00 67.69 ? 284  VAL A OXT 1 
HETATM 2216 C C5  . R1P B 2 .   ? 21.670  90.619  77.110 1.00 3.84  ? 291  R1P A C5  1 
HETATM 2217 O O5  . R1P B 2 .   ? 21.652  91.899  77.885 1.00 7.67  ? 291  R1P A O5  1 
HETATM 2218 C C4  . R1P B 2 .   ? 20.431  89.888  76.752 1.00 2.43  ? 291  R1P A C4  1 
HETATM 2219 O O4  . R1P B 2 .   ? 19.665  90.863  75.884 1.00 8.52  ? 291  R1P A O4  1 
HETATM 2220 C C1  . R1P B 2 .   ? 19.166  90.354  74.642 1.00 4.90  ? 291  R1P A C1  1 
HETATM 2221 C C2  . R1P B 2 .   ? 20.099  89.019  74.517 1.00 4.15  ? 291  R1P A C2  1 
HETATM 2222 O O2  . R1P B 2 .   ? 19.488  88.008  73.702 1.00 4.13  ? 291  R1P A O2  1 
HETATM 2223 C C3  . R1P B 2 .   ? 20.417  88.545  75.975 1.00 4.27  ? 291  R1P A C3  1 
HETATM 2224 O O3  . R1P B 2 .   ? 19.366  87.658  76.395 1.00 5.03  ? 291  R1P A O3  1 
HETATM 2225 O O1  . R1P B 2 .   ? 17.671  89.663  74.959 1.00 -2.41 ? 291  R1P A O1  1 
HETATM 2226 P P   . R1P B 2 .   ? 16.464  89.647  73.721 1.00 -2.18 ? 291  R1P A P   1 
HETATM 2227 O O1P . R1P B 2 .   ? 15.150  89.010  74.146 1.00 0.82  ? 291  R1P A O1P 1 
HETATM 2228 O O2P . R1P B 2 .   ? 16.505  91.144  73.508 1.00 1.61  ? 291  R1P A O2P 1 
HETATM 2229 O O3P . R1P B 2 .   ? 17.158  89.048  72.525 1.00 1.01  ? 291  R1P A O3P 1 
HETATM 2230 N N1  . HPA C 3 .   ? 26.078  89.932  73.254 1.00 2.02  ? 290  HPA A N1  1 
HETATM 2231 C C2  . HPA C 3 .   ? 25.067  89.042  73.005 1.00 2.07  ? 290  HPA A C2  1 
HETATM 2232 N N3  . HPA C 3 .   ? 23.780  89.402  73.068 1.00 7.39  ? 290  HPA A N3  1 
HETATM 2233 C C4  . HPA C 3 .   ? 23.609  90.739  73.400 1.00 6.34  ? 290  HPA A C4  1 
HETATM 2234 C C5  . HPA C 3 .   ? 24.582  91.671  73.657 1.00 3.04  ? 290  HPA A C5  1 
HETATM 2235 C C6  . HPA C 3 .   ? 25.936  91.296  73.593 1.00 5.62  ? 290  HPA A C6  1 
HETATM 2236 O O6  . HPA C 3 .   ? 26.919  92.035  73.788 1.00 7.06  ? 290  HPA A O6  1 
HETATM 2237 N N7  . HPA C 3 .   ? 24.023  92.876  73.957 1.00 2.84  ? 290  HPA A N7  1 
HETATM 2238 C C8  . HPA C 3 .   ? 22.672  92.685  73.878 1.00 5.21  ? 290  HPA A C8  1 
HETATM 2239 N N9  . HPA C 3 .   ? 22.380  91.387  73.534 1.00 6.23  ? 290  HPA A N9  1 
HETATM 2240 O O   . HOH D 4 .   ? 8.985   93.226  79.188 1.00 16.16 ? 3301 HOH A O   1 
HETATM 2241 O O   . HOH D 4 .   ? 14.186  83.378  71.292 1.00 15.67 ? 3302 HOH A O   1 
HETATM 2242 O O   . HOH D 4 .   ? 9.772   83.412  72.408 1.00 11.42 ? 3303 HOH A O   1 
HETATM 2243 O O   . HOH D 4 .   ? 16.635  81.876  72.234 1.00 18.06 ? 3304 HOH A O   1 
HETATM 2244 O O   . HOH D 4 .   ? 19.396  81.595  74.026 1.00 16.30 ? 3305 HOH A O   1 
HETATM 2245 O O   . HOH D 4 .   ? 30.330  82.964  73.898 1.00 18.63 ? 3306 HOH A O   1 
HETATM 2246 O O   . HOH D 4 .   ? 27.933  84.404  74.132 1.00 17.21 ? 3307 HOH A O   1 
HETATM 2247 O O   . HOH D 4 .   ? 27.126  81.785  73.327 1.00 17.61 ? 3308 HOH A O   1 
HETATM 2248 O O   . HOH D 4 .   ? 32.873  81.696  75.631 1.00 11.98 ? 3309 HOH A O   1 
HETATM 2249 O O   . HOH D 4 .   ? 29.730  80.475  72.691 1.00 17.52 ? 3310 HOH A O   1 
HETATM 2250 O O   . HOH D 4 .   ? 17.291  82.296  86.397 1.00 16.09 ? 3311 HOH A O   1 
HETATM 2251 O O   . HOH D 4 .   ? 6.340   75.376  68.939 1.00 19.33 ? 3312 HOH A O   1 
HETATM 2252 O O   . HOH D 4 .   ? 5.203   76.729  62.010 1.00 13.69 ? 3313 HOH A O   1 
HETATM 2253 O O   . HOH D 4 .   ? -10.555 79.459  65.816 1.00 17.77 ? 3315 HOH A O   1 
HETATM 2254 O O   . HOH D 4 .   ? 17.728  69.517  63.187 1.00 15.11 ? 3316 HOH A O   1 
HETATM 2255 O O   . HOH D 4 .   ? -6.698  92.718  81.660 1.00 16.21 ? 3317 HOH A O   1 
HETATM 2256 O O   . HOH D 4 .   ? -7.484  89.763  81.108 1.00 13.19 ? 3318 HOH A O   1 
HETATM 2257 O O   . HOH D 4 .   ? -14.953 87.123  73.233 1.00 19.89 ? 3319 HOH A O   1 
HETATM 2258 O O   . HOH D 4 .   ? 13.388  93.056  58.895 1.00 16.10 ? 3320 HOH A O   1 
HETATM 2259 O O   . HOH D 4 .   ? 9.190   87.191  51.780 1.00 15.58 ? 3321 HOH A O   1 
HETATM 2260 O O   . HOH D 4 .   ? 11.523  82.573  54.097 1.00 23.53 ? 3322 HOH A O   1 
HETATM 2261 O O   . HOH D 4 .   ? 15.733  88.146  54.209 1.00 20.57 ? 3323 HOH A O   1 
HETATM 2262 O O   . HOH D 4 .   ? 19.049  72.951  62.362 1.00 14.70 ? 3324 HOH A O   1 
HETATM 2263 O O   . HOH D 4 .   ? 18.245  77.280  60.501 1.00 13.85 ? 3325 HOH A O   1 
HETATM 2264 O O   . HOH D 4 .   ? 21.805  89.167  53.041 1.00 16.79 ? 3326 HOH A O   1 
HETATM 2265 O O   . HOH D 4 .   ? 19.208  89.445  70.846 1.00 14.43 ? 3401 HOH A O   1 
HETATM 2266 O O   . HOH D 4 .   ? 29.625  90.834  74.153 1.00 15.21 ? 3402 HOH A O   1 
HETATM 2267 O O   . HOH D 4 .   ? 32.069  89.195  77.534 1.00 14.07 ? 3403 HOH A O   1 
HETATM 2268 O O   . HOH D 4 .   ? 31.953  92.309  74.719 1.00 17.02 ? 3404 HOH A O   1 
HETATM 2269 O O   . HOH D 4 .   ? 32.363  92.058  77.656 1.00 13.74 ? 3405 HOH A O   1 
HETATM 2270 O O   . HOH D 4 .   ? 12.814  85.267  79.711 1.00 14.95 ? 3406 HOH A O   1 
HETATM 2271 O O   . HOH D 4 .   ? 16.994  83.135  83.385 1.00 13.88 ? 3407 HOH A O   1 
HETATM 2272 O O   . HOH D 4 .   ? 11.343  72.487  79.919 1.00 15.13 ? 3408 HOH A O   1 
HETATM 2273 O O   . HOH D 4 .   ? 15.863  79.803  83.769 1.00 20.60 ? 3409 HOH A O   1 
HETATM 2274 O O   . HOH D 4 .   ? 13.210  75.688  82.857 1.00 17.89 ? 3410 HOH A O   1 
HETATM 2275 O O   . HOH D 4 .   ? 6.377   70.888  62.215 1.00 14.33 ? 3411 HOH A O   1 
HETATM 2276 O O   . HOH D 4 .   ? 9.716   71.216  58.757 1.00 13.92 ? 3412 HOH A O   1 
HETATM 2277 O O   . HOH D 4 .   ? 8.831   69.623  62.840 1.00 16.50 ? 3413 HOH A O   1 
HETATM 2278 O O   . HOH D 4 .   ? 10.401  72.288  49.715 1.00 17.44 ? 3414 HOH A O   1 
HETATM 2279 O O   . HOH D 4 .   ? 6.258   68.800  53.194 1.00 11.65 ? 3415 HOH A O   1 
HETATM 2280 O O   . HOH D 4 .   ? 9.443   70.522  51.658 1.00 12.85 ? 3416 HOH A O   1 
HETATM 2281 O O   . HOH D 4 .   ? 29.080  99.936  74.544 1.00 11.94 ? 3417 HOH A O   1 
HETATM 2282 O O   . HOH D 4 .   ? 19.747  104.307 64.078 1.00 14.80 ? 3418 HOH A O   1 
HETATM 2283 O O   . HOH D 4 .   ? 8.541   87.711  55.659 1.00 15.02 ? 3419 HOH A O   1 
HETATM 2284 O O   . HOH D 4 .   ? 13.581  72.082  69.244 1.00 18.20 ? 3420 HOH A O   1 
HETATM 2285 O O   . HOH D 4 .   ? 18.173  79.237  66.762 1.00 15.41 ? 3421 HOH A O   1 
HETATM 2286 O O   . HOH D 4 .   ? 27.661  86.001  55.867 1.00 16.82 ? 3422 HOH A O   1 
HETATM 2287 O O   . HOH D 4 .   ? 38.688  85.886  77.377 1.00 17.16 ? 3423 HOH A O   1 
HETATM 2288 O O   . HOH D 4 .   ? 38.494  88.049  75.465 1.00 15.80 ? 3424 HOH A O   1 
HETATM 2289 O O   . HOH D 4 .   ? -7.185  87.824  65.487 1.00 13.32 ? 3425 HOH A O   1 
HETATM 2290 O O   . HOH D 4 .   ? -7.852  78.501  65.710 1.00 16.98 ? 3426 HOH A O   1 
HETATM 2291 O O   . HOH D 4 .   ? 17.380  76.983  65.292 1.00 17.23 ? 3427 HOH A O   1 
HETATM 2292 O O   . HOH D 4 .   ? -5.858  93.172  69.357 1.00 17.04 ? 3428 HOH A O   1 
HETATM 2293 O O   . HOH D 4 .   ? 19.474  88.210  86.223 1.00 12.23 ? 3429 HOH A O   1 
HETATM 2294 O O   . HOH D 4 .   ? -6.581  80.115  83.220 1.00 17.75 ? 3430 HOH A O   1 
HETATM 2295 O O   . HOH D 4 .   ? -12.887 93.292  67.962 1.00 15.01 ? 3431 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   GLY 4   4   4   GLY GLY A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   THR 6   6   6   THR THR A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   GLU 8   8   8   GLU GLU A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  TYR 10  10  10  TYR TYR A . n 
A 1 11  GLN 11  11  11  GLN GLN A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  TRP 16  16  16  TRP TRP A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  GLN 23  23  23  GLN GLN A . n 
A 1 24  ARG 24  24  24  ARG ARG A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLN 26  26  26  GLN GLN A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  ILE 30  30  30  ILE ILE A . n 
A 1 31  CYS 31  31  31  CYS CYS A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ASN 40  40  40  ASN ASN A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  GLN 44  44  44  GLN GLN A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  THR 47  47  47  THR THR A . n 
A 1 48  PHE 48  48  48  PHE PHE A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  GLU 52  52  52  GLU GLU A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ILE 72  72  72  ILE ILE A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ASN 74  74  74  ASN ASN A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  CYS 78  78  78  CYS CYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  MET 81  81  81  MET MET A . n 
A 1 82  GLN 82  82  82  GLN GLN A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  ARG 84  84  84  ARG ARG A . n 
A 1 85  PHE 85  85  85  PHE PHE A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  TYR 91  91  91  TYR TYR A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  TRP 94  94  94  TRP TRP A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  PHE 98  98  98  PHE PHE A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 THR 114 114 114 THR THR A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 PRO 122 122 122 PRO PRO A . n 
A 1 123 ASN 123 123 123 ASN ASN A . n 
A 1 124 PHE 124 124 124 PHE PHE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 SER 142 142 142 SER SER A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 ASN 151 151 151 ASN ASN A . n 
A 1 152 GLU 152 152 152 GLU GLU A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ARG 154 154 154 ARG ARG A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 ARG 158 158 158 ARG ARG A . n 
A 1 159 PHE 159 159 159 PHE PHE A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 MET 162 162 162 MET MET A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 ASP 164 164 164 ASP ASP A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 MET 170 170 170 MET MET A . n 
A 1 171 ARG 171 171 171 ARG ARG A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 HIS 175 175 175 HIS HIS A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 THR 177 177 177 THR THR A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 LYS 179 179 179 LYS LYS A . n 
A 1 180 GLN 180 180 180 GLN GLN A . n 
A 1 181 MET 181 181 181 MET MET A . n 
A 1 182 GLY 182 182 182 GLY GLY A . n 
A 1 183 GLU 183 183 183 GLU GLU A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 ARG 185 185 185 ARG ARG A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 GLN 188 188 188 GLN GLN A . n 
A 1 189 GLU 189 189 189 GLU GLU A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 THR 191 191 191 THR THR A . n 
A 1 192 TYR 192 192 192 TYR TYR A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 MET 194 194 194 MET MET A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 PRO 198 198 198 PRO PRO A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLU 205 205 205 GLU GLU A . n 
A 1 206 CYS 206 206 206 CYS CYS A . n 
A 1 207 ARG 207 207 207 ARG ARG A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ARG 210 210 210 ARG ARG A . n 
A 1 211 ASN 211 211 211 ASN ASN A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 THR 221 221 221 THR THR A . n 
A 1 222 VAL 222 222 222 VAL VAL A . n 
A 1 223 PRO 223 223 223 PRO PRO A . n 
A 1 224 GLU 224 224 224 GLU GLU A . n 
A 1 225 VAL 225 225 225 VAL VAL A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 ARG 229 229 229 ARG ARG A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 GLY 232 232 232 GLY GLY A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ARG 234 234 234 ARG ARG A . n 
A 1 235 VAL 235 235 235 VAL VAL A . n 
A 1 236 PHE 236 236 236 PHE PHE A . n 
A 1 237 GLY 237 237 237 GLY GLY A . n 
A 1 238 PHE 238 238 238 PHE PHE A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 LEU 240 240 240 LEU LEU A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 ASN 243 243 243 ASN ASN A . n 
A 1 244 LYS 244 244 244 LYS LYS A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 MET 247 247 247 MET MET A . n 
A 1 248 ASP 248 248 248 ASP ASP A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 GLU 250 250 250 GLU GLU A . n 
A 1 251 SER 251 251 251 SER SER A . n 
A 1 252 GLN 252 252 252 GLN GLN A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LYS 254 254 254 LYS LYS A . n 
A 1 255 ALA 255 255 255 ALA ALA A . n 
A 1 256 ASN 256 256 256 ASN ASN A . n 
A 1 257 HIS 257 257 257 HIS HIS A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 LYS 265 265 265 LYS LYS A . n 
A 1 266 GLN 266 266 266 GLN GLN A . n 
A 1 267 ALA 267 267 267 ALA ALA A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 GLN 269 269 269 GLN GLN A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 GLU 272 272 272 GLU GLU A . n 
A 1 273 GLN 273 273 273 GLN GLN A . n 
A 1 274 PHE 274 274 274 PHE PHE A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 SER 276 276 276 SER SER A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 LEU 278 278 278 LEU LEU A . n 
A 1 279 MET 279 279 279 MET MET A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 R1P 1  291  291  R1P R1P A . 
C 3 HPA 1  290  290  HPA HPA A . 
D 4 HOH 1  3301 3301 HOH HOH A . 
D 4 HOH 2  3302 3302 HOH HOH A . 
D 4 HOH 3  3303 3303 HOH HOH A . 
D 4 HOH 4  3304 3304 HOH HOH A . 
D 4 HOH 5  3305 3305 HOH HOH A . 
D 4 HOH 6  3306 3306 HOH HOH A . 
D 4 HOH 7  3307 3307 HOH HOH A . 
D 4 HOH 8  3308 3308 HOH HOH A . 
D 4 HOH 9  3309 3309 HOH HOH A . 
D 4 HOH 10 3310 3310 HOH HOH A . 
D 4 HOH 11 3311 3311 HOH HOH A . 
D 4 HOH 12 3312 3312 HOH HOH A . 
D 4 HOH 13 3313 3313 HOH HOH A . 
D 4 HOH 14 3315 3315 HOH HOH A . 
D 4 HOH 15 3316 3316 HOH HOH A . 
D 4 HOH 16 3317 3317 HOH HOH A . 
D 4 HOH 17 3318 3318 HOH HOH A . 
D 4 HOH 18 3319 3319 HOH HOH A . 
D 4 HOH 19 3320 3320 HOH HOH A . 
D 4 HOH 20 3321 3321 HOH HOH A . 
D 4 HOH 21 3322 3322 HOH HOH A . 
D 4 HOH 22 3323 3323 HOH HOH A . 
D 4 HOH 23 3324 3324 HOH HOH A . 
D 4 HOH 24 3325 3325 HOH HOH A . 
D 4 HOH 25 3326 3326 HOH HOH A . 
D 4 HOH 26 3401 3401 HOH HOH A . 
D 4 HOH 27 3402 3402 HOH HOH A . 
D 4 HOH 28 3403 3403 HOH HOH A . 
D 4 HOH 29 3404 3404 HOH HOH A . 
D 4 HOH 30 3405 3405 HOH HOH A . 
D 4 HOH 31 3406 3406 HOH HOH A . 
D 4 HOH 32 3407 3407 HOH HOH A . 
D 4 HOH 33 3408 3408 HOH HOH A . 
D 4 HOH 34 3409 3409 HOH HOH A . 
D 4 HOH 35 3410 3410 HOH HOH A . 
D 4 HOH 36 3411 3411 HOH HOH A . 
D 4 HOH 37 3412 3412 HOH HOH A . 
D 4 HOH 38 3413 3413 HOH HOH A . 
D 4 HOH 39 3414 3414 HOH HOH A . 
D 4 HOH 40 3415 3415 HOH HOH A . 
D 4 HOH 41 3416 3416 HOH HOH A . 
D 4 HOH 42 3417 3417 HOH HOH A . 
D 4 HOH 43 3418 3418 HOH HOH A . 
D 4 HOH 44 3419 3419 HOH HOH A . 
D 4 HOH 45 3420 3420 HOH HOH A . 
D 4 HOH 46 3421 3421 HOH HOH A . 
D 4 HOH 47 3422 3422 HOH HOH A . 
D 4 HOH 48 3423 3423 HOH HOH A . 
D 4 HOH 49 3424 3424 HOH HOH A . 
D 4 HOH 50 3425 3425 HOH HOH A . 
D 4 HOH 51 3426 3426 HOH HOH A . 
D 4 HOH 52 3427 3427 HOH HOH A . 
D 4 HOH 53 3428 3428 HOH HOH A . 
D 4 HOH 54 3429 3429 HOH HOH A . 
D 4 HOH 55 3430 3430 HOH HOH A . 
D 4 HOH 56 3431 3431 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9570  ? 
1 MORE         -44   ? 
1 'SSA (A^2)'  29260 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z             1.0000000000 0.0000000000 0.0000000000  0.0000000000   0.0000000000 
1.0000000000 0.0000000000  0.0000000000   0.0000000000  0.0000000000  1.0000000000 0.0000000000   
2 'crystal symmetry operation' 8_656  -z+1,x+1/2,-y+3/2 0.0000000000 0.0000000000 -1.0000000000 94.2000000000  1.0000000000 
0.0000000000 0.0000000000  47.1000000000  0.0000000000  -1.0000000000 0.0000000000 141.3000000000 
3 'crystal symmetry operation' 11_466 y-1/2,-z+3/2,-x+1 0.0000000000 1.0000000000 0.0000000000  -47.1000000000 0.0000000000 
0.0000000000 -1.0000000000 141.3000000000 -1.0000000000 0.0000000000  0.0000000000 94.2000000000  
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-06-17 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 4 'Structure model' 'Data collection'           
6 4 'Structure model' 'Database references'       
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' Other                       
9 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' atom_site                 
2 4 'Structure model' chem_comp                 
3 4 'Structure model' entity                    
4 4 'Structure model' pdbx_chem_comp_identifier 
5 4 'Structure model' pdbx_database_status      
6 4 'Structure model' pdbx_entity_nonpoly       
7 4 'Structure model' struct_ref_seq_dif        
8 4 'Structure model' struct_site               
9 4 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_atom_site.auth_atom_id'            
2 4 'Structure model' '_atom_site.label_atom_id'           
3 4 'Structure model' '_chem_comp.mon_nstd_flag'           
4 4 'Structure model' '_chem_comp.name'                    
5 4 'Structure model' '_chem_comp.type'                    
6 4 'Structure model' '_entity.pdbx_description'           
7 4 'Structure model' '_pdbx_database_status.process_site' 
8 4 'Structure model' '_pdbx_entity_nonpoly.name'          
9 4 'Structure model' '_struct_ref_seq_dif.details'        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.8 ? 1 
X-PLOR refinement       3.8 ? 2 
SDMS   'data reduction' .   ? 3 
SDMS   'data scaling'   .   ? 4 
X-PLOR phasing          3.8 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 2   ? ? -72.69  -164.40 
2 1 ASN A 55  ? ? 70.64   -7.07   
3 1 SER A 220 ? ? -163.94 -156.53 
4 1 THR A 221 ? ? 69.37   -56.64  
5 1 SER A 251 ? ? -59.48  98.51   
6 1 SER A 281 ? ? 72.55   87.15   
7 1 PRO A 283 ? ? -82.24  -104.17 
# 
_pdbx_chem_comp_identifier.comp_id           R1P 
_pdbx_chem_comp_identifier.type              'IUPAC CARBOHYDRATE SYMBOL' 
_pdbx_chem_comp_identifier.program           PDB-CARE 
_pdbx_chem_comp_identifier.program_version   1.0 
_pdbx_chem_comp_identifier.identifier        a-D-Ribf1PO3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1-O-phosphono-alpha-D-ribofuranose R1P 
3 HYPOXANTHINE                       HPA 
4 water                              HOH 
#