data_1ACJ
# 
_entry.id   1ACJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.348 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1ACJ         pdb_00001acj 10.2210/pdb1acj/pdb 
WWPDB D_1000170654 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ACJ 
_pdbx_database_status.recvd_initial_deposition_date   1993-08-18 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sussman, J.L.' 1 
'Harel, M.'     2 
'Silman, I.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Quaternary ligand binding to aromatic residues in the active-site gorge of acetylcholinesterase.'              
Proc.Natl.Acad.Sci.USA 90  9031 9035 1993 PNASA6 US 0027-8424 0040 ? 8415649 10.1073/pnas.90.19.9031 
1       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253 872  ?    1991 SCIEAS US 0036-8075 0038 ? ?       ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Harel, M.'          1  ? 
primary 'Schalk, I.'         2  ? 
primary 'Ehret-Sabatier, L.' 3  ? 
primary 'Bouet, F.'          4  ? 
primary 'Goeldner, M.'       5  ? 
primary 'Hirth, C.'          6  ? 
primary 'Axelsen, P.H.'      7  ? 
primary 'Silman, I.'         8  ? 
primary 'Sussman, J.L.'      9  ? 
1       'Sussman, J.'        10 ? 
1       'Harel, M.'          11 ? 
1       'Frolow, F.'         12 ? 
1       'Oefner, C.'         13 ? 
1       'Goldman, A.'        14 ? 
1       'Toker, L.'          15 ? 
1       'Silman, I.'         16 ? 
# 
_cell.entry_id           1ACJ 
_cell.length_a           113.700 
_cell.length_b           113.700 
_cell.length_c           138.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ACJ 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 60792.516 1  3.1.1.7 ? ? ? 
2 non-polymer syn TACRINE              198.264   1  ?       ? ? ? 
3 water       nat water                18.015    82 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATET
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATET
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 GLU n 
1 537 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Pacific electric ray' 
_entity_src_gen.gene_src_genus                     Torpedo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Torpedo californica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7787 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ACJ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 535 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  556 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       535 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THA non-polymer         . TACRINE         ? 'C13 H14 N2'     198.264 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ACJ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.24 
_exptl_crystal.density_percent_sol   70.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1ACJ 
_refine.ls_number_reflns_obs                     23213 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.195 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.195 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THE STRUCTURE WAS REFINED STARTING FROM NATIVE COORDINATES
USING X-PLOR.  82 WATER MOLECULES ARE INCLUDED.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4095 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             82 
_refine_hist.number_atoms_total               4192 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.025 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ACJ 
_struct.title                     'QUATERNARY LIGAND BINDING TO AROMATIC RESIDUES IN THE ACTIVE-SITE GORGE OF ACETYLCHOLINESTERASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ACJ 
_struct_keywords.pdbx_keywords   'HYDROLASE(CARBOXYLIC ESTERASE)' 
_struct_keywords.text            'HYDROLASE(CARBOXYLIC ESTERASE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  H2  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  H3  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  H4  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  H5  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  H6  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  H7  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  H8  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  H9  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 H10 ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 H11 ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 H12 GLY A 384 ? TYR A 411 ? GLY A 384 TYR A 411 1 ? 28 
HELX_P HELX_P13 H13 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P14 H14 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P15 H15 VAL A 518 ? ALA A 534 ? VAL A 518 ALA A 534 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 67  SG ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.040 ? ? 
disulf2 disulf ? ? A CYS 254 SG ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3 disulf ? ? A CYS 402 SG ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.068 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 12 ? 
S2 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1  2  ? anti-parallel 
S1 2  3  ? anti-parallel 
S1 3  4  ? anti-parallel 
S1 4  5  ? anti-parallel 
S1 5  6  ? anti-parallel 
S1 6  7  ? anti-parallel 
S1 7  8  ? parallel      
S1 8  9  ? parallel      
S1 9  10 ? parallel      
S1 10 11 ? parallel      
S1 11 12 ? parallel      
S2 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
S1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
S1 3  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
S1 4  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
S1 5  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
S1 6  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
S1 7  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
S1 8  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
S1 9  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
S1 10 ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
S1 11 GLN A 318 ? TYR A 334 ? GLN A 318 TYR A 334 
S1 12 GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
S2 1  PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
S2 2  MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
THA Unknown  ? ?   ?   ? 4 ?                                    
AC1 Software A THA 999 ? 7 'BINDING SITE FOR RESIDUE THA A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  THA 4 SER A 200 ? SER A 200 . ? 1_555 ? 
2  THA 4 HIS A 440 ? HIS A 440 . ? 1_555 ? 
3  THA 4 GLU A 327 ? GLU A 327 . ? 1_555 ? 
4  THA 4 THA B .   ? THA A 999 . ? 1_555 ? 
5  AC1 7 TRP A 84  ? TRP A 84  . ? 1_555 ? 
6  AC1 7 GLY A 118 ? GLY A 118 . ? 1_555 ? 
7  AC1 7 GLU A 199 ? GLU A 199 . ? 1_555 ? 
8  AC1 7 PHE A 330 ? PHE A 330 . ? 1_555 ? 
9  AC1 7 TRP A 432 ? TRP A 432 . ? 1_555 ? 
10 AC1 7 HIS A 440 ? HIS A 440 . ? 1_555 ? 
11 AC1 7 GLY A 441 ? GLY A 441 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ACJ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ACJ 
_atom_sites.fract_transf_matrix[1][1]   0.008795 
_atom_sites.fract_transf_matrix[1][2]   0.005078 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010156 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007241 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO     104'                                   
2 'RESIDUE THA 999 IS BOUND NON-COVALENTLY IN THE ACTIVE SITE.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.503 89.084 35.130 1.00 66.28 ? 4   SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.189 87.877 35.866 1.00 63.52 ? 4   SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -11.066 88.196 36.842 1.00 59.52 ? 4   SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -11.260 89.101 37.633 1.00 57.70 ? 4   SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -12.025 86.720 34.856 1.00 67.07 ? 4   SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.195 86.792 34.018 1.00 70.02 ? 4   SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.920  87.515 36.768 1.00 54.99 ? 5   GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.763  87.673 37.662 1.00 47.42 ? 5   GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.082  86.841 38.872 1.00 43.05 ? 5   GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.332  85.956 39.236 1.00 44.40 ? 5   GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -8.315  89.106 38.012 1.00 47.14 ? 5   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -7.047  89.190 38.917 1.00 51.13 ? 5   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.714  88.670 38.353 1.00 52.76 ? 5   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.502  88.765 37.150 1.00 54.93 ? 5   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.880  88.179 39.122 1.00 56.48 ? 5   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.253 87.138 39.444 1.00 36.79 ? 6   LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.748 86.426 40.612 1.00 32.75 ? 6   LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.840 85.431 40.295 1.00 33.35 ? 6   LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.296 84.700 41.162 1.00 35.53 ? 6   LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.321 87.429 41.633 1.00 28.61 ? 6   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.276 87.885 42.667 1.00 29.95 ? 6   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -9.060  88.579 42.040 1.00 28.52 ? 6   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -10.937 88.762 43.732 1.00 28.46 ? 6   LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.302 85.444 39.053 1.00 33.35 ? 7   LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.363 84.515 38.679 1.00 33.07 ? 7   LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.689 83.488 37.822 1.00 32.11 ? 7   LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.018 83.906 36.874 1.00 36.48 ? 7   LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.409 85.233 37.811 1.00 33.65 ? 7   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.741 84.489 37.662 1.00 33.73 ? 7   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -15.669 83.103 37.017 1.00 34.68 ? 7   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.471 84.394 38.993 1.00 34.90 ? 7   LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.856 82.204 38.136 1.00 24.81 ? 8   VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -12.232 81.181 37.334 1.00 21.36 ? 8   VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -13.261 80.103 37.069 1.00 25.40 ? 8   VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -14.082 79.793 37.921 1.00 27.94 ? 8   VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -11.015 80.653 38.107 1.00 15.33 ? 8   VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.339 79.451 37.430 1.00 17.12 ? 8   VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.983  81.780 38.306 1.00 14.32 ? 8   VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -13.228 79.552 35.849 1.00 29.47 ? 9   ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -14.133 78.459 35.493 1.00 33.22 ? 9   ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -13.227 77.276 35.611 1.00 34.13 ? 9   ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -12.125 77.308 35.074 1.00 35.41 ? 9   ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.555 78.386 34.013 1.00 38.11 ? 9   ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.552 79.424 33.597 1.00 42.62 ? 9   ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.720 79.332 33.924 1.00 48.35 ? 9   ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.081 80.421 32.850 1.00 41.34 ? 9   ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.656 76.260 36.320 1.00 33.20 ? 10  THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.829 75.086 36.438 1.00 30.23 ? 10  THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.712 74.031 35.844 1.00 31.69 ? 10  THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.915 74.252 35.715 1.00 35.98 ? 10  THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.478 74.820 37.913 1.00 27.41 ? 10  THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.619 74.419 38.674 1.00 24.65 ? 10  THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.894 76.058 38.615 1.00 27.48 ? 10  THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.156 72.866 35.542 1.00 27.84 ? 11  LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -14.023 71.850 34.980 1.00 24.67 ? 11  LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -15.154 71.440 35.929 1.00 24.68 ? 11  LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -16.072 70.775 35.486 1.00 27.54 ? 11  LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -13.208 70.653 34.493 1.00 17.20 ? 11  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -12.087 71.099 33.547 1.00 14.65 ? 11  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.250 69.939 33.014 1.00 16.35 ? 11  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.911  70.312 32.358 1.00 19.73 ? 11  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.107  69.103 32.179 1.00 22.74 ? 11  LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -15.078 71.792 37.231 1.00 27.83 ? 12  SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -16.163 71.425 38.154 1.00 28.06 ? 12  SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -17.186 72.558 38.349 1.00 29.85 ? 12  SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -18.303 72.296 38.787 1.00 26.76 ? 12  SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.645 71.067 39.569 1.00 28.31 ? 12  SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.456 70.262 39.614 1.00 28.89 ? 12  SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.789 73.809 38.067 1.00 27.92 ? 13  GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.743 74.889 38.268 1.00 30.42 ? 13  GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.970 76.173 38.361 1.00 32.86 ? 13  GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.750 76.147 38.199 1.00 31.43 ? 13  GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.661 77.300 38.603 1.00 34.06 ? 14  LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.946 78.577 38.695 1.00 35.67 ? 14  LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.546 78.847 40.127 1.00 34.96 ? 14  LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.215 78.370 41.034 1.00 34.65 ? 14  LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.839 79.721 38.192 1.00 38.99 ? 14  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.873 79.759 36.661 1.00 47.77 ? 14  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.766 80.858 36.070 1.00 55.48 ? 14  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -20.267 80.650 36.336 1.00 64.81 ? 14  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.749 79.427 35.705 1.00 71.00 ? 14  LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.479 79.629 40.328 1.00 34.04 ? 15  VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -15.026 79.952 41.667 1.00 32.93 ? 15  VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.591 81.417 41.683 1.00 34.62 ? 15  VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.953 81.902 40.751 1.00 29.89 ? 15  VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.875 79.002 42.098 1.00 29.03 ? 15  VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -14.269 77.516 42.075 1.00 29.98 ? 15  VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -12.622 79.141 41.229 1.00 31.49 ? 15  VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.981 82.082 42.777 1.00 37.70 ? 16  MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.696 83.486 43.083 1.00 39.31 ? 16  MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.672 83.472 44.208 1.00 37.45 ? 16  MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.922 82.839 45.227 1.00 37.64 ? 16  MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.964 84.164 43.671 1.00 43.76 ? 16  MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -16.786 84.967 42.656 1.00 51.80 ? 16  MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.852 86.472 42.182 1.00 59.52 ? 16  MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -16.117 87.473 43.685 1.00 62.28 ? 16  MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.555 84.166 44.044 1.00 35.12 ? 17  GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.542 84.181 45.098 1.00 31.94 ? 17  GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.538 85.515 45.789 1.00 29.25 ? 17  GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.538 86.225 45.821 1.00 29.77 ? 17  GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.387 85.877 46.335 1.00 29.14 ? 18  THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.240 87.143 47.021 1.00 32.39 ? 18  THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -8.877  87.671 46.695 1.00 29.82 ? 18  THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -7.952  86.944 46.354 1.00 29.28 ? 18  THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.270 86.929 48.552 1.00 38.14 ? 18  THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -11.384 86.119 48.917 1.00 42.11 ? 18  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.355 88.216 49.399 1.00 41.82 ? 18  THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.772  88.981 46.807 1.00 28.01 ? 19  ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.503  89.605 46.570 1.00 29.07 ? 19  ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.948  89.704 47.989 1.00 30.93 ? 19  ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.634  90.258 48.842 1.00 35.56 ? 19  ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.758  90.976 45.920 1.00 28.93 ? 19  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.503  91.613 45.339 1.00 32.23 ? 19  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.762  93.028 44.816 1.00 35.26 ? 19  ARG A CD  1 
ATOM   115  N N   . VAL A 1 20  ? -5.760  89.164 48.263 1.00 30.18 ? 20  VAL A N   1 
ATOM   116  C CA  . VAL A 1 20  ? -5.210  89.235 49.617 1.00 26.81 ? 20  VAL A CA  1 
ATOM   117  C C   . VAL A 1 20  ? -3.984  90.126 49.576 1.00 28.42 ? 20  VAL A C   1 
ATOM   118  O O   . VAL A 1 20  ? -3.243  90.053 48.604 1.00 28.65 ? 20  VAL A O   1 
ATOM   119  C CB  . VAL A 1 20  ? -4.849  87.825 50.132 1.00 25.26 ? 20  VAL A CB  1 
ATOM   120  C CG1 . VAL A 1 20  ? -6.086  86.908 50.086 1.00 20.35 ? 20  VAL A CG1 1 
ATOM   121  C CG2 . VAL A 1 20  ? -3.672  87.168 49.377 1.00 25.28 ? 20  VAL A CG2 1 
ATOM   122  N N   . PRO A 1 21  ? -3.764  90.961 50.603 1.00 29.36 ? 21  PRO A N   1 
ATOM   123  C CA  . PRO A 1 21  ? -2.543  91.749 50.665 1.00 28.64 ? 21  PRO A CA  1 
ATOM   124  C C   . PRO A 1 21  ? -1.347  90.886 50.931 1.00 28.38 ? 21  PRO A C   1 
ATOM   125  O O   . PRO A 1 21  ? -1.405  89.986 51.758 1.00 29.32 ? 21  PRO A O   1 
ATOM   126  C CB  . PRO A 1 21  ? -2.741  92.681 51.869 1.00 30.26 ? 21  PRO A CB  1 
ATOM   127  C CG  . PRO A 1 21  ? -4.219  92.582 52.263 1.00 31.39 ? 21  PRO A CG  1 
ATOM   128  C CD  . PRO A 1 21  ? -4.740  91.285 51.635 1.00 31.49 ? 21  PRO A CD  1 
ATOM   129  N N   . VAL A 1 22  ? -0.249  91.183 50.261 1.00 29.82 ? 22  VAL A N   1 
ATOM   130  C CA  . VAL A 1 22  ? 0.960   90.419 50.471 1.00 31.13 ? 22  VAL A CA  1 
ATOM   131  C C   . VAL A 1 22  ? 2.012   91.460 50.498 1.00 34.00 ? 22  VAL A C   1 
ATOM   132  O O   . VAL A 1 22  ? 2.306   92.090 49.498 1.00 36.68 ? 22  VAL A O   1 
ATOM   133  C CB  . VAL A 1 22  ? 1.232   89.459 49.316 1.00 28.17 ? 22  VAL A CB  1 
ATOM   134  C CG1 . VAL A 1 22  ? 2.433   88.577 49.605 1.00 27.98 ? 22  VAL A CG1 1 
ATOM   135  C CG2 . VAL A 1 22  ? 0.011   88.599 49.042 1.00 33.00 ? 22  VAL A CG2 1 
ATOM   136  N N   . LEU A 1 23  ? 2.605   91.635 51.659 1.00 35.38 ? 23  LEU A N   1 
ATOM   137  C CA  . LEU A 1 23  ? 3.623   92.660 51.758 1.00 37.84 ? 23  LEU A CA  1 
ATOM   138  C C   . LEU A 1 23  ? 3.003   93.998 51.372 1.00 43.58 ? 23  LEU A C   1 
ATOM   139  O O   . LEU A 1 23  ? 2.056   94.464 51.991 1.00 47.15 ? 23  LEU A O   1 
ATOM   140  C CB  . LEU A 1 23  ? 4.926   92.342 51.009 1.00 34.91 ? 23  LEU A CB  1 
ATOM   141  C CG  . LEU A 1 23  ? 5.762   91.224 51.648 1.00 37.14 ? 23  LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 23  ? 5.306   89.823 51.252 1.00 37.74 ? 23  LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 23  ? 7.228   91.372 51.229 1.00 43.47 ? 23  LEU A CD2 1 
ATOM   144  N N   . SER A 1 24  ? 3.546   94.547 50.304 1.00 45.59 ? 24  SER A N   1 
ATOM   145  C CA  . SER A 1 24  ? 3.151   95.833 49.783 1.00 47.78 ? 24  SER A CA  1 
ATOM   146  C C   . SER A 1 24  ? 2.170   95.764 48.633 1.00 46.42 ? 24  SER A C   1 
ATOM   147  O O   . SER A 1 24  ? 1.802   96.789 48.070 1.00 49.47 ? 24  SER A O   1 
ATOM   148  C CB  . SER A 1 24  ? 4.454   96.470 49.252 1.00 53.04 ? 24  SER A CB  1 
ATOM   149  O OG  . SER A 1 24  ? 5.276   95.514 48.535 1.00 56.67 ? 24  SER A OG  1 
ATOM   150  N N   . SER A 1 25  ? 1.764   94.551 48.285 1.00 43.60 ? 25  SER A N   1 
ATOM   151  C CA  . SER A 1 25  ? 0.900   94.351 47.149 1.00 41.55 ? 25  SER A CA  1 
ATOM   152  C C   . SER A 1 25  ? -0.283  93.474 47.480 1.00 39.27 ? 25  SER A C   1 
ATOM   153  O O   . SER A 1 25  ? -0.777  93.456 48.602 1.00 42.44 ? 25  SER A O   1 
ATOM   154  C CB  . SER A 1 25  ? 1.780   93.725 46.060 1.00 43.12 ? 25  SER A CB  1 
ATOM   155  O OG  . SER A 1 25  ? 3.058   94.368 46.008 1.00 49.23 ? 25  SER A OG  1 
ATOM   156  N N   . HIS A 1 26  ? -0.731  92.728 46.465 1.00 35.32 ? 26  HIS A N   1 
ATOM   157  C CA  . HIS A 1 26  ? -1.858  91.841 46.579 1.00 32.06 ? 26  HIS A CA  1 
ATOM   158  C C   . HIS A 1 26  ? -1.588  90.547 45.794 1.00 29.59 ? 26  HIS A C   1 
ATOM   159  O O   . HIS A 1 26  ? -0.578  90.415 45.113 1.00 31.42 ? 26  HIS A O   1 
ATOM   160  C CB  . HIS A 1 26  ? -3.032  92.623 45.990 1.00 31.02 ? 26  HIS A CB  1 
ATOM   161  N N   . ILE A 1 27  ? -2.509  89.600 45.908 1.00 21.50 ? 27  ILE A N   1 
ATOM   162  C CA  . ILE A 1 27  ? -2.427  88.321 45.230 1.00 20.27 ? 27  ILE A CA  1 
ATOM   163  C C   . ILE A 1 27  ? -3.851  87.860 45.203 1.00 21.51 ? 27  ILE A C   1 
ATOM   164  O O   . ILE A 1 27  ? -4.717  88.495 45.793 1.00 19.80 ? 27  ILE A O   1 
ATOM   165  C CB  . ILE A 1 27  ? -1.505  87.378 46.027 1.00 19.81 ? 27  ILE A CB  1 
ATOM   166  C CG1 . ILE A 1 27  ? -0.111  87.355 45.413 1.00 25.98 ? 27  ILE A CG1 1 
ATOM   167  C CG2 . ILE A 1 27  ? -2.007  85.970 46.354 1.00 21.89 ? 27  ILE A CG2 1 
ATOM   168  C CD1 . ILE A 1 27  ? 0.663   86.040 45.648 1.00 33.64 ? 27  ILE A CD1 1 
ATOM   169  N N   . SER A 1 28  ? -4.094  86.767 44.510 1.00 21.19 ? 28  SER A N   1 
ATOM   170  C CA  . SER A 1 28  ? -5.439  86.251 44.469 1.00 25.17 ? 28  SER A CA  1 
ATOM   171  C C   . SER A 1 28  ? -5.369  85.028 45.334 1.00 25.66 ? 28  SER A C   1 
ATOM   172  O O   . SER A 1 28  ? -4.345  84.353 45.388 1.00 30.04 ? 28  SER A O   1 
ATOM   173  C CB  . SER A 1 28  ? -5.835  85.861 43.030 1.00 29.04 ? 28  SER A CB  1 
ATOM   174  O OG  . SER A 1 28  ? -5.758  86.989 42.156 1.00 36.88 ? 28  SER A OG  1 
ATOM   175  N N   . ALA A 1 29  ? -6.460  84.718 46.010 1.00 23.77 ? 29  ALA A N   1 
ATOM   176  C CA  . ALA A 1 29  ? -6.460  83.548 46.848 1.00 21.82 ? 29  ALA A CA  1 
ATOM   177  C C   . ALA A 1 29  ? -7.798  82.928 46.654 1.00 22.70 ? 29  ALA A C   1 
ATOM   178  O O   . ALA A 1 29  ? -8.797  83.637 46.615 1.00 21.72 ? 29  ALA A O   1 
ATOM   179  C CB  . ALA A 1 29  ? -6.325  83.972 48.315 1.00 24.17 ? 29  ALA A CB  1 
ATOM   180  N N   . PHE A 1 30  ? -7.788  81.613 46.502 1.00 22.31 ? 30  PHE A N   1 
ATOM   181  C CA  . PHE A 1 30  ? -9.018  80.867 46.330 1.00 23.55 ? 30  PHE A CA  1 
ATOM   182  C C   . PHE A 1 30  ? -8.917  79.880 47.469 1.00 24.51 ? 30  PHE A C   1 
ATOM   183  O O   . PHE A 1 30  ? -8.094  78.969 47.399 1.00 27.63 ? 30  PHE A O   1 
ATOM   184  C CB  . PHE A 1 30  ? -9.061  80.119 44.960 1.00 25.71 ? 30  PHE A CB  1 
ATOM   185  C CG  . PHE A 1 30  ? -9.027  81.019 43.728 1.00 21.98 ? 30  PHE A CG  1 
ATOM   186  C CD1 . PHE A 1 30  ? -7.797  81.505 43.221 1.00 18.64 ? 30  PHE A CD1 1 
ATOM   187  C CD2 . PHE A 1 30  ? -10.233 81.399 43.094 1.00 19.09 ? 30  PHE A CD2 1 
ATOM   188  C CE1 . PHE A 1 30  ? -7.779  82.375 42.119 1.00 16.13 ? 30  PHE A CE1 1 
ATOM   189  C CE2 . PHE A 1 30  ? -10.221 82.265 41.995 1.00 12.59 ? 30  PHE A CE2 1 
ATOM   190  C CZ  . PHE A 1 30  ? -8.995  82.757 41.517 1.00 19.18 ? 30  PHE A CZ  1 
ATOM   191  N N   . LEU A 1 31  ? -9.699  80.075 48.528 1.00 22.04 ? 31  LEU A N   1 
ATOM   192  C CA  . LEU A 1 31  ? -9.615  79.160 49.663 1.00 18.95 ? 31  LEU A CA  1 
ATOM   193  C C   . LEU A 1 31  ? -10.854 78.281 49.734 1.00 20.31 ? 31  LEU A C   1 
ATOM   194  O O   . LEU A 1 31  ? -11.951 78.708 49.409 1.00 22.57 ? 31  LEU A O   1 
ATOM   195  C CB  . LEU A 1 31  ? -9.615  79.944 50.992 1.00 15.90 ? 31  LEU A CB  1 
ATOM   196  C CG  . LEU A 1 31  ? -8.438  80.872 51.338 1.00 10.17 ? 31  LEU A CG  1 
ATOM   197  C CD1 . LEU A 1 31  ? -7.296  80.912 50.334 1.00 9.79  ? 31  LEU A CD1 1 
ATOM   198  C CD2 . LEU A 1 31  ? -8.958  82.277 51.614 1.00 7.92  ? 31  LEU A CD2 1 
ATOM   199  N N   . GLY A 1 32  ? -10.675 77.043 50.189 1.00 19.63 ? 32  GLY A N   1 
ATOM   200  C CA  . GLY A 1 32  ? -11.825 76.159 50.338 1.00 17.79 ? 32  GLY A CA  1 
ATOM   201  C C   . GLY A 1 32  ? -12.485 75.571 49.094 1.00 17.48 ? 32  GLY A C   1 
ATOM   202  O O   . GLY A 1 32  ? -13.682 75.307 49.118 1.00 19.31 ? 32  GLY A O   1 
ATOM   203  N N   . ILE A 1 33  ? -11.741 75.327 47.998 1.00 16.16 ? 33  ILE A N   1 
ATOM   204  C CA  . ILE A 1 33  ? -12.403 74.743 46.822 1.00 12.47 ? 33  ILE A CA  1 
ATOM   205  C C   . ILE A 1 33  ? -12.593 73.236 47.093 1.00 11.92 ? 33  ILE A C   1 
ATOM   206  O O   . ILE A 1 33  ? -11.624 72.549 47.397 1.00 15.94 ? 33  ILE A O   1 
ATOM   207  C CB  . ILE A 1 33  ? -11.539 74.952 45.567 1.00 9.82  ? 33  ILE A CB  1 
ATOM   208  C CG1 . ILE A 1 33  ? -11.207 76.435 45.302 1.00 9.70  ? 33  ILE A CG1 1 
ATOM   209  C CG2 . ILE A 1 33  ? -12.199 74.334 44.332 1.00 11.40 ? 33  ILE A CG2 1 
ATOM   210  C CD1 . ILE A 1 33  ? -10.035 76.570 44.319 1.00 10.55 ? 33  ILE A CD1 1 
ATOM   211  N N   . PRO A 1 34  ? -13.822 72.711 47.015 1.00 9.19  ? 34  PRO A N   1 
ATOM   212  C CA  . PRO A 1 34  ? -14.031 71.303 47.350 1.00 12.31 ? 34  PRO A CA  1 
ATOM   213  C C   . PRO A 1 34  ? -13.398 70.436 46.293 1.00 13.30 ? 34  PRO A C   1 
ATOM   214  O O   . PRO A 1 34  ? -13.393 70.816 45.138 1.00 18.57 ? 34  PRO A O   1 
ATOM   215  C CB  . PRO A 1 34  ? -15.562 71.124 47.334 1.00 8.07  ? 34  PRO A CB  1 
ATOM   216  C CG  . PRO A 1 34  ? -16.099 72.321 46.537 1.00 5.81  ? 34  PRO A CG  1 
ATOM   217  C CD  . PRO A 1 34  ? -15.028 73.419 46.629 1.00 7.70  ? 34  PRO A CD  1 
ATOM   218  N N   . PHE A 1 35  ? -12.895 69.263 46.671 1.00 14.36 ? 35  PHE A N   1 
ATOM   219  C CA  . PHE A 1 35  ? -12.300 68.406 45.655 1.00 9.91  ? 35  PHE A CA  1 
ATOM   220  C C   . PHE A 1 35  ? -12.831 66.998 45.693 1.00 12.79 ? 35  PHE A C   1 
ATOM   221  O O   . PHE A 1 35  ? -12.381 66.173 44.914 1.00 15.80 ? 35  PHE A O   1 
ATOM   222  C CB  . PHE A 1 35  ? -10.776 68.408 45.715 1.00 11.07 ? 35  PHE A CB  1 
ATOM   223  C CG  . PHE A 1 35  ? -10.152 67.808 46.961 1.00 17.39 ? 35  PHE A CG  1 
ATOM   224  C CD1 . PHE A 1 35  ? -10.133 66.414 47.151 1.00 16.80 ? 35  PHE A CD1 1 
ATOM   225  C CD2 . PHE A 1 35  ? -9.518  68.631 47.914 1.00 19.76 ? 35  PHE A CD2 1 
ATOM   226  C CE1 . PHE A 1 35  ? -9.469  65.840 48.245 1.00 18.35 ? 35  PHE A CE1 1 
ATOM   227  C CE2 . PHE A 1 35  ? -8.852  68.058 49.009 1.00 19.78 ? 35  PHE A CE2 1 
ATOM   228  C CZ  . PHE A 1 35  ? -8.822  66.664 49.171 1.00 20.22 ? 35  PHE A CZ  1 
ATOM   229  N N   . ALA A 1 36  ? -13.774 66.688 46.592 1.00 10.85 ? 36  ALA A N   1 
ATOM   230  C CA  . ALA A 1 36  ? -14.325 65.340 46.667 1.00 8.56  ? 36  ALA A CA  1 
ATOM   231  C C   . ALA A 1 36  ? -15.632 65.480 47.393 1.00 12.49 ? 36  ALA A C   1 
ATOM   232  O O   . ALA A 1 36  ? -15.897 66.525 47.967 1.00 18.58 ? 36  ALA A O   1 
ATOM   233  C CB  . ALA A 1 36  ? -13.386 64.415 47.425 1.00 6.98  ? 36  ALA A CB  1 
ATOM   234  N N   . GLU A 1 37  ? -16.480 64.461 47.356 1.00 17.66 ? 37  GLU A N   1 
ATOM   235  C CA  . GLU A 1 37  ? -17.760 64.582 48.069 1.00 21.71 ? 37  GLU A CA  1 
ATOM   236  C C   . GLU A 1 37  ? -17.514 64.410 49.571 1.00 22.94 ? 37  GLU A C   1 
ATOM   237  O O   . GLU A 1 37  ? -16.832 63.452 49.918 1.00 26.27 ? 37  GLU A O   1 
ATOM   238  C CB  . GLU A 1 37  ? -18.750 63.467 47.648 1.00 23.74 ? 37  GLU A CB  1 
ATOM   239  C CG  . GLU A 1 37  ? -19.328 63.616 46.228 1.00 27.33 ? 37  GLU A CG  1 
ATOM   240  C CD  . GLU A 1 37  ? -20.406 64.704 46.157 1.00 31.25 ? 37  GLU A CD  1 
ATOM   241  O OE1 . GLU A 1 37  ? -21.535 64.424 46.561 1.00 34.04 ? 37  GLU A OE1 1 
ATOM   242  O OE2 . GLU A 1 37  ? -20.126 65.817 45.704 1.00 30.36 ? 37  GLU A OE2 1 
ATOM   243  N N   . PRO A 1 38  ? -18.101 65.289 50.436 1.00 23.11 ? 38  PRO A N   1 
ATOM   244  C CA  . PRO A 1 38  ? -17.897 65.221 51.887 1.00 17.99 ? 38  PRO A CA  1 
ATOM   245  C C   . PRO A 1 38  ? -18.053 63.833 52.455 1.00 17.78 ? 38  PRO A C   1 
ATOM   246  O O   . PRO A 1 38  ? -19.148 63.295 52.367 1.00 23.08 ? 38  PRO A O   1 
ATOM   247  C CB  . PRO A 1 38  ? -18.999 66.109 52.467 1.00 15.25 ? 38  PRO A CB  1 
ATOM   248  C CG  . PRO A 1 38  ? -19.381 67.077 51.348 1.00 21.82 ? 38  PRO A CG  1 
ATOM   249  C CD  . PRO A 1 38  ? -19.040 66.343 50.042 1.00 25.22 ? 38  PRO A CD  1 
ATOM   250  N N   . PRO A 1 39  ? -16.988 63.271 53.040 1.00 14.62 ? 39  PRO A N   1 
ATOM   251  C CA  . PRO A 1 39  ? -17.013 61.878 53.449 1.00 14.68 ? 39  PRO A CA  1 
ATOM   252  C C   . PRO A 1 39  ? -17.702 61.743 54.784 1.00 18.19 ? 39  PRO A C   1 
ATOM   253  O O   . PRO A 1 39  ? -17.113 61.328 55.779 1.00 26.50 ? 39  PRO A O   1 
ATOM   254  C CB  . PRO A 1 39  ? -15.525 61.549 53.563 1.00 12.52 ? 39  PRO A CB  1 
ATOM   255  C CG  . PRO A 1 39  ? -14.860 62.880 53.931 1.00 13.31 ? 39  PRO A CG  1 
ATOM   256  C CD  . PRO A 1 39  ? -15.722 63.950 53.278 1.00 10.24 ? 39  PRO A CD  1 
ATOM   257  N N   . VAL A 1 40  ? -18.959 62.123 54.810 1.00 17.25 ? 40  VAL A N   1 
ATOM   258  C CA  . VAL A 1 40  ? -19.699 62.057 56.038 1.00 17.22 ? 40  VAL A CA  1 
ATOM   259  C C   . VAL A 1 40  ? -20.662 60.892 55.947 1.00 20.33 ? 40  VAL A C   1 
ATOM   260  O O   . VAL A 1 40  ? -20.742 60.152 54.976 1.00 25.80 ? 40  VAL A O   1 
ATOM   261  C CB  . VAL A 1 40  ? -20.370 63.440 56.216 1.00 15.36 ? 40  VAL A CB  1 
ATOM   262  C CG1 . VAL A 1 40  ? -19.347 64.601 56.138 1.00 6.48  ? 40  VAL A CG1 1 
ATOM   263  C CG2 . VAL A 1 40  ? -21.509 63.677 55.208 1.00 18.85 ? 40  VAL A CG2 1 
ATOM   264  N N   . GLY A 1 41  ? -21.420 60.721 57.009 1.00 24.29 ? 41  GLY A N   1 
ATOM   265  C CA  . GLY A 1 41  ? -22.414 59.661 57.013 1.00 25.93 ? 41  GLY A CA  1 
ATOM   266  C C   . GLY A 1 41  ? -21.868 58.298 56.733 1.00 26.15 ? 41  GLY A C   1 
ATOM   267  O O   . GLY A 1 41  ? -20.822 57.901 57.228 1.00 30.02 ? 41  GLY A O   1 
ATOM   268  N N   . ASN A 1 42  ? -22.623 57.602 55.878 1.00 28.14 ? 42  ASN A N   1 
ATOM   269  C CA  . ASN A 1 42  ? -22.273 56.252 55.477 1.00 31.52 ? 42  ASN A CA  1 
ATOM   270  C C   . ASN A 1 42  ? -20.982 56.182 54.642 1.00 32.76 ? 42  ASN A C   1 
ATOM   271  O O   . ASN A 1 42  ? -20.514 55.113 54.276 1.00 31.62 ? 42  ASN A O   1 
ATOM   272  C CB  . ASN A 1 42  ? -23.492 55.583 54.843 1.00 29.49 ? 42  ASN A CB  1 
ATOM   273  N N   . MET A 1 43  ? -20.390 57.351 54.357 1.00 33.93 ? 43  MET A N   1 
ATOM   274  C CA  . MET A 1 43  ? -19.153 57.405 53.590 1.00 34.65 ? 43  MET A CA  1 
ATOM   275  C C   . MET A 1 43  ? -17.935 57.446 54.473 1.00 33.26 ? 43  MET A C   1 
ATOM   276  O O   . MET A 1 43  ? -16.805 57.433 53.997 1.00 34.27 ? 43  MET A O   1 
ATOM   277  C CB  . MET A 1 43  ? -19.165 58.630 52.682 1.00 37.67 ? 43  MET A CB  1 
ATOM   278  C CG  . MET A 1 43  ? -20.371 58.550 51.737 1.00 40.13 ? 43  MET A CG  1 
ATOM   279  S SD  . MET A 1 43  ? -19.833 59.076 50.095 1.00 47.63 ? 43  MET A SD  1 
ATOM   280  C CE  . MET A 1 43  ? -19.690 60.877 50.378 1.00 44.23 ? 43  MET A CE  1 
ATOM   281  N N   . ARG A 1 44  ? -18.166 57.528 55.783 1.00 30.06 ? 44  ARG A N   1 
ATOM   282  C CA  . ARG A 1 44  ? -17.026 57.556 56.677 1.00 26.22 ? 44  ARG A CA  1 
ATOM   283  C C   . ARG A 1 44  ? -16.200 56.290 56.450 1.00 23.34 ? 44  ARG A C   1 
ATOM   284  O O   . ARG A 1 44  ? -16.777 55.227 56.309 1.00 17.04 ? 44  ARG A O   1 
ATOM   285  C CB  . ARG A 1 44  ? -17.503 57.608 58.154 1.00 26.73 ? 44  ARG A CB  1 
ATOM   286  C CG  . ARG A 1 44  ? -16.350 57.879 59.143 1.00 24.95 ? 44  ARG A CG  1 
ATOM   287  C CD  . ARG A 1 44  ? -16.741 57.776 60.605 1.00 19.41 ? 44  ARG A CD  1 
ATOM   288  N NE  . ARG A 1 44  ? -17.507 58.934 61.005 1.00 20.92 ? 44  ARG A NE  1 
ATOM   289  C CZ  . ARG A 1 44  ? -18.057 58.982 62.228 1.00 25.75 ? 44  ARG A CZ  1 
ATOM   290  N NH1 . ARG A 1 44  ? -17.995 57.949 63.063 1.00 20.03 ? 44  ARG A NH1 1 
ATOM   291  N NH2 . ARG A 1 44  ? -18.688 60.079 62.620 1.00 28.74 ? 44  ARG A NH2 1 
ATOM   292  N N   . PHE A 1 45  ? -14.874 56.430 56.432 1.00 22.58 ? 45  PHE A N   1 
ATOM   293  C CA  . PHE A 1 45  ? -13.973 55.303 56.241 1.00 24.60 ? 45  PHE A CA  1 
ATOM   294  C C   . PHE A 1 45  ? -13.869 54.856 54.801 1.00 26.95 ? 45  PHE A C   1 
ATOM   295  O O   . PHE A 1 45  ? -12.971 54.090 54.462 1.00 32.12 ? 45  PHE A O   1 
ATOM   296  C CB  . PHE A 1 45  ? -14.279 54.062 57.117 1.00 24.86 ? 45  PHE A CB  1 
ATOM   297  C CG  . PHE A 1 45  ? -14.422 54.432 58.584 1.00 31.63 ? 45  PHE A CG  1 
ATOM   298  C CD1 . PHE A 1 45  ? -13.381 55.119 59.260 1.00 29.49 ? 45  PHE A CD1 1 
ATOM   299  C CD2 . PHE A 1 45  ? -15.605 54.120 59.289 1.00 29.74 ? 45  PHE A CD2 1 
ATOM   300  C CE1 . PHE A 1 45  ? -13.531 55.500 60.597 1.00 26.98 ? 45  PHE A CE1 1 
ATOM   301  C CE2 . PHE A 1 45  ? -15.744 54.500 60.630 1.00 28.30 ? 45  PHE A CE2 1 
ATOM   302  C CZ  . PHE A 1 45  ? -14.716 55.196 61.278 1.00 26.58 ? 45  PHE A CZ  1 
ATOM   303  N N   . ARG A 1 46  ? -14.770 55.330 53.947 1.00 26.89 ? 46  ARG A N   1 
ATOM   304  C CA  . ARG A 1 46  ? -14.704 54.881 52.560 1.00 25.38 ? 46  ARG A CA  1 
ATOM   305  C C   . ARG A 1 46  ? -13.835 55.815 51.756 1.00 22.97 ? 46  ARG A C   1 
ATOM   306  O O   . ARG A 1 46  ? -13.538 56.937 52.136 1.00 19.69 ? 46  ARG A O   1 
ATOM   307  C CB  . ARG A 1 46  ? -16.095 54.907 51.956 1.00 30.17 ? 46  ARG A CB  1 
ATOM   308  C CG  . ARG A 1 46  ? -16.952 53.785 52.545 1.00 36.60 ? 46  ARG A CG  1 
ATOM   309  C CD  . ARG A 1 46  ? -18.289 53.639 51.817 1.00 45.15 ? 46  ARG A CD  1 
ATOM   310  N NE  . ARG A 1 46  ? -18.359 52.390 51.078 1.00 50.41 ? 46  ARG A NE  1 
ATOM   311  N N   . ARG A 1 47  ? -13.446 55.274 50.622 1.00 17.96 ? 47  ARG A N   1 
ATOM   312  C CA  . ARG A 1 47  ? -12.572 56.029 49.722 1.00 13.93 ? 47  ARG A CA  1 
ATOM   313  C C   . ARG A 1 47  ? -13.318 57.269 49.231 1.00 10.14 ? 47  ARG A C   1 
ATOM   314  O O   . ARG A 1 47  ? -14.526 57.161 49.107 1.00 14.08 ? 47  ARG A O   1 
ATOM   315  C CB  . ARG A 1 47  ? -12.068 55.222 48.516 1.00 16.88 ? 47  ARG A CB  1 
ATOM   316  C CG  . ARG A 1 47  ? -12.371 53.729 48.484 1.00 22.12 ? 47  ARG A CG  1 
ATOM   317  C CD  . ARG A 1 47  ? -11.133 52.923 47.979 1.00 23.05 ? 47  ARG A CD  1 
ATOM   318  N NE  . ARG A 1 47  ? -11.447 51.504 47.852 0.06 15.19 ? 47  ARG A NE  1 
ATOM   319  C CZ  . ARG A 1 47  ? -10.463 50.635 47.534 0.06 12.62 ? 47  ARG A CZ  1 
ATOM   320  N NH1 . ARG A 1 47  ? -9.186  50.983 47.289 0.06 11.23 ? 47  ARG A NH1 1 
ATOM   321  N NH2 . ARG A 1 47  ? -10.897 49.352 47.483 0.06 10.41 ? 47  ARG A NH2 1 
ATOM   322  N N   . PRO A 1 48  ? -12.618 58.367 48.935 1.00 6.34  ? 48  PRO A N   1 
ATOM   323  C CA  . PRO A 1 48  ? -13.323 59.597 48.534 1.00 11.93 ? 48  PRO A CA  1 
ATOM   324  C C   . PRO A 1 48  ? -13.937 59.577 47.126 1.00 16.79 ? 48  PRO A C   1 
ATOM   325  O O   . PRO A 1 48  ? -13.374 59.012 46.195 1.00 17.10 ? 48  PRO A O   1 
ATOM   326  C CB  . PRO A 1 48  ? -12.224 60.664 48.594 1.00 8.51  ? 48  PRO A CB  1 
ATOM   327  C CG  . PRO A 1 48  ? -10.920 59.881 48.407 1.00 8.25  ? 48  PRO A CG  1 
ATOM   328  C CD  . PRO A 1 48  ? -11.171 58.513 49.037 1.00 5.71  ? 48  PRO A CD  1 
ATOM   329  N N   . GLU A 1 49  ? -15.109 60.234 46.973 1.00 20.27 ? 49  GLU A N   1 
ATOM   330  C CA  . GLU A 1 49  ? -15.726 60.303 45.642 1.00 20.95 ? 49  GLU A CA  1 
ATOM   331  C C   . GLU A 1 49  ? -15.296 61.616 45.036 1.00 20.57 ? 49  GLU A C   1 
ATOM   332  O O   . GLU A 1 49  ? -15.185 62.573 45.792 1.00 21.43 ? 49  GLU A O   1 
ATOM   333  C CB  . GLU A 1 49  ? -17.264 60.383 45.663 1.00 27.74 ? 49  GLU A CB  1 
ATOM   334  C CG  . GLU A 1 49  ? -17.958 59.115 46.176 1.00 37.97 ? 49  GLU A CG  1 
ATOM   335  C CD  . GLU A 1 49  ? -19.473 59.230 46.012 1.00 42.75 ? 49  GLU A CD  1 
ATOM   336  O OE1 . GLU A 1 49  ? -20.030 60.296 46.295 1.00 47.09 ? 49  GLU A OE1 1 
ATOM   337  O OE2 . GLU A 1 49  ? -20.092 58.250 45.598 1.00 49.76 ? 49  GLU A OE2 1 
ATOM   338  N N   . PRO A 1 50  ? -15.143 61.696 43.692 1.00 19.49 ? 50  PRO A N   1 
ATOM   339  C CA  . PRO A 1 50  ? -14.871 62.976 43.054 1.00 17.83 ? 50  PRO A CA  1 
ATOM   340  C C   . PRO A 1 50  ? -16.095 63.827 43.265 1.00 22.18 ? 50  PRO A C   1 
ATOM   341  O O   . PRO A 1 50  ? -17.208 63.309 43.296 1.00 26.65 ? 50  PRO A O   1 
ATOM   342  C CB  . PRO A 1 50  ? -14.564 62.647 41.609 1.00 18.41 ? 50  PRO A CB  1 
ATOM   343  C CG  . PRO A 1 50  ? -14.684 61.118 41.449 1.00 22.20 ? 50  PRO A CG  1 
ATOM   344  C CD  . PRO A 1 50  ? -15.207 60.570 42.775 1.00 20.22 ? 50  PRO A CD  1 
ATOM   345  N N   . LYS A 1 51  ? -15.878 65.129 43.433 1.00 24.77 ? 51  LYS A N   1 
ATOM   346  C CA  . LYS A 1 51  ? -17.011 65.994 43.725 1.00 29.54 ? 51  LYS A CA  1 
ATOM   347  C C   . LYS A 1 51  ? -17.920 66.304 42.558 1.00 33.14 ? 51  LYS A C   1 
ATOM   348  O O   . LYS A 1 51  ? -17.460 66.654 41.482 1.00 36.22 ? 51  LYS A O   1 
ATOM   349  C CB  . LYS A 1 51  ? -16.494 67.315 44.305 1.00 30.84 ? 51  LYS A CB  1 
ATOM   350  C CG  . LYS A 1 51  ? -17.438 67.930 45.350 1.00 29.10 ? 51  LYS A CG  1 
ATOM   351  C CD  . LYS A 1 51  ? -17.954 69.297 44.917 1.00 32.33 ? 51  LYS A CD  1 
ATOM   352  C CE  . LYS A 1 51  ? -18.780 70.023 45.989 1.00 37.69 ? 51  LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 51  ? -19.987 69.282 46.342 1.00 44.09 ? 51  LYS A NZ  1 
ATOM   354  N N   . LYS A 1 52  ? -19.237 66.214 42.814 1.00 33.86 ? 52  LYS A N   1 
ATOM   355  C CA  . LYS A 1 52  ? -20.193 66.535 41.757 1.00 34.64 ? 52  LYS A CA  1 
ATOM   356  C C   . LYS A 1 52  ? -20.045 68.015 41.406 1.00 34.51 ? 52  LYS A C   1 
ATOM   357  O O   . LYS A 1 52  ? -19.902 68.825 42.311 1.00 32.61 ? 52  LYS A O   1 
ATOM   358  C CB  . LYS A 1 52  ? -21.631 66.295 42.230 1.00 38.77 ? 52  LYS A CB  1 
ATOM   359  C CG  . LYS A 1 52  ? -21.923 64.811 42.475 1.00 43.55 ? 52  LYS A CG  1 
ATOM   360  C CD  . LYS A 1 52  ? -23.163 64.610 43.356 1.00 47.58 ? 52  LYS A CD  1 
ATOM   361  C CE  . LYS A 1 52  ? -23.393 63.127 43.700 1.00 52.94 ? 52  LYS A CE  1 
ATOM   362  N NZ  . LYS A 1 52  ? -24.124 62.998 44.953 1.00 56.70 ? 52  LYS A NZ  1 
ATOM   363  N N   . PRO A 1 53  ? -20.056 68.371 40.105 1.00 35.14 ? 53  PRO A N   1 
ATOM   364  C CA  . PRO A 1 53  ? -19.880 69.766 39.752 1.00 35.65 ? 53  PRO A CA  1 
ATOM   365  C C   . PRO A 1 53  ? -20.983 70.593 40.350 1.00 36.92 ? 53  PRO A C   1 
ATOM   366  O O   . PRO A 1 53  ? -22.042 70.101 40.731 1.00 37.97 ? 53  PRO A O   1 
ATOM   367  C CB  . PRO A 1 53  ? -19.919 69.766 38.220 1.00 34.28 ? 53  PRO A CB  1 
ATOM   368  C CG  . PRO A 1 53  ? -19.604 68.327 37.802 1.00 32.67 ? 53  PRO A CG  1 
ATOM   369  C CD  . PRO A 1 53  ? -20.125 67.473 38.956 1.00 33.93 ? 53  PRO A CD  1 
ATOM   370  N N   . TRP A 1 54  ? -20.715 71.881 40.395 1.00 37.83 ? 54  TRP A N   1 
ATOM   371  C CA  . TRP A 1 54  ? -21.704 72.773 40.948 1.00 37.84 ? 54  TRP A CA  1 
ATOM   372  C C   . TRP A 1 54  ? -22.015 73.853 39.924 1.00 41.97 ? 54  TRP A C   1 
ATOM   373  O O   . TRP A 1 54  ? -21.310 74.126 38.951 1.00 41.63 ? 54  TRP A O   1 
ATOM   374  C CB  . TRP A 1 54  ? -21.223 73.316 42.315 1.00 30.12 ? 54  TRP A CB  1 
ATOM   375  C CG  . TRP A 1 54  ? -19.918 74.055 42.160 1.00 17.64 ? 54  TRP A CG  1 
ATOM   376  C CD1 . TRP A 1 54  ? -19.780 75.404 41.755 1.00 17.68 ? 54  TRP A CD1 1 
ATOM   377  C CD2 . TRP A 1 54  ? -18.631 73.527 42.308 1.00 15.11 ? 54  TRP A CD2 1 
ATOM   378  N NE1 . TRP A 1 54  ? -18.473 75.731 41.635 1.00 18.46 ? 54  TRP A NE1 1 
ATOM   379  C CE2 . TRP A 1 54  ? -17.707 74.634 41.955 1.00 16.29 ? 54  TRP A CE2 1 
ATOM   380  C CE3 . TRP A 1 54  ? -18.123 72.274 42.655 1.00 9.58  ? 54  TRP A CE3 1 
ATOM   381  C CZ2 . TRP A 1 54  ? -16.324 74.409 41.983 1.00 12.62 ? 54  TRP A CZ2 1 
ATOM   382  C CZ3 . TRP A 1 54  ? -16.732 72.090 42.666 1.00 8.82  ? 54  TRP A CZ3 1 
ATOM   383  C CH2 . TRP A 1 54  ? -15.847 73.138 42.342 1.00 11.55 ? 54  TRP A CH2 1 
ATOM   384  N N   . SER A 1 55  ? -23.157 74.468 40.195 1.00 46.06 ? 55  SER A N   1 
ATOM   385  C CA  . SER A 1 55  ? -23.649 75.549 39.372 1.00 48.87 ? 55  SER A CA  1 
ATOM   386  C C   . SER A 1 55  ? -23.364 76.787 40.199 1.00 47.85 ? 55  SER A C   1 
ATOM   387  O O   . SER A 1 55  ? -23.043 76.715 41.382 1.00 46.18 ? 55  SER A O   1 
ATOM   388  C CB  . SER A 1 55  ? -25.153 75.354 39.109 1.00 51.18 ? 55  SER A CB  1 
ATOM   389  O OG  . SER A 1 55  ? -25.787 74.843 40.292 1.00 58.54 ? 55  SER A OG  1 
ATOM   390  N N   . GLY A 1 56  ? -23.508 77.943 39.575 1.00 46.29 ? 56  GLY A N   1 
ATOM   391  C CA  . GLY A 1 56  ? -23.243 79.120 40.376 1.00 46.52 ? 56  GLY A CA  1 
ATOM   392  C C   . GLY A 1 56  ? -21.763 79.303 40.447 1.00 43.81 ? 56  GLY A C   1 
ATOM   393  O O   . GLY A 1 56  ? -21.016 78.780 39.623 1.00 46.74 ? 56  GLY A O   1 
ATOM   394  N N   . VAL A 1 57  ? -21.377 80.089 41.434 1.00 39.39 ? 57  VAL A N   1 
ATOM   395  C CA  . VAL A 1 57  ? -19.994 80.367 41.663 1.00 35.44 ? 57  VAL A CA  1 
ATOM   396  C C   . VAL A 1 57  ? -19.775 79.847 43.070 1.00 38.08 ? 57  VAL A C   1 
ATOM   397  O O   . VAL A 1 57  ? -20.596 80.025 43.964 1.00 37.40 ? 57  VAL A O   1 
ATOM   398  C CB  . VAL A 1 57  ? -19.733 81.891 41.571 1.00 29.31 ? 57  VAL A CB  1 
ATOM   399  C CG1 . VAL A 1 57  ? -18.822 82.249 40.414 1.00 29.88 ? 57  VAL A CG1 1 
ATOM   400  C CG2 . VAL A 1 57  ? -21.016 82.725 41.454 1.00 35.24 ? 57  VAL A CG2 1 
ATOM   401  N N   . TRP A 1 58  ? -18.641 79.180 43.258 1.00 38.80 ? 58  TRP A N   1 
ATOM   402  C CA  . TRP A 1 58  ? -18.314 78.692 44.572 1.00 34.49 ? 58  TRP A CA  1 
ATOM   403  C C   . TRP A 1 58  ? -17.604 79.887 45.168 1.00 35.37 ? 58  TRP A C   1 
ATOM   404  O O   . TRP A 1 58  ? -16.763 80.508 44.513 1.00 36.57 ? 58  TRP A O   1 
ATOM   405  C CB  . TRP A 1 58  ? -17.320 77.542 44.483 1.00 32.34 ? 58  TRP A CB  1 
ATOM   406  C CG  . TRP A 1 58  ? -17.216 76.872 45.822 1.00 33.36 ? 58  TRP A CG  1 
ATOM   407  C CD1 . TRP A 1 58  ? -16.307 77.208 46.851 1.00 30.36 ? 58  TRP A CD1 1 
ATOM   408  C CD2 . TRP A 1 58  ? -18.023 75.828 46.280 1.00 30.42 ? 58  TRP A CD2 1 
ATOM   409  N NE1 . TRP A 1 58  ? -16.530 76.417 47.920 1.00 30.04 ? 58  TRP A NE1 1 
ATOM   410  C CE2 . TRP A 1 58  ? -17.560 75.553 47.647 1.00 28.90 ? 58  TRP A CE2 1 
ATOM   411  C CE3 . TRP A 1 58  ? -19.060 75.079 45.722 1.00 32.78 ? 58  TRP A CE3 1 
ATOM   412  C CZ2 . TRP A 1 58  ? -18.195 74.553 48.389 1.00 30.89 ? 58  TRP A CZ2 1 
ATOM   413  C CZ3 . TRP A 1 58  ? -19.668 74.071 46.487 1.00 34.22 ? 58  TRP A CZ3 1 
ATOM   414  C CH2 . TRP A 1 58  ? -19.244 73.819 47.804 1.00 35.78 ? 58  TRP A CH2 1 
ATOM   415  N N   . ASN A 1 59  ? -17.961 80.227 46.395 1.00 34.61 ? 59  ASN A N   1 
ATOM   416  C CA  . ASN A 1 59  ? -17.306 81.370 47.007 1.00 32.65 ? 59  ASN A CA  1 
ATOM   417  C C   . ASN A 1 59  ? -16.065 80.811 47.645 1.00 30.32 ? 59  ASN A C   1 
ATOM   418  O O   . ASN A 1 59  ? -16.183 79.977 48.525 1.00 33.22 ? 59  ASN A O   1 
ATOM   419  C CB  . ASN A 1 59  ? -18.226 81.979 48.075 1.00 37.84 ? 59  ASN A CB  1 
ATOM   420  C CG  . ASN A 1 59  ? -17.671 83.293 48.596 1.00 42.52 ? 59  ASN A CG  1 
ATOM   421  O OD1 . ASN A 1 59  ? -17.007 83.365 49.615 1.00 47.22 ? 59  ASN A OD1 1 
ATOM   422  N ND2 . ASN A 1 59  ? -17.927 84.356 47.842 1.00 44.27 ? 59  ASN A ND2 1 
ATOM   423  N N   . ALA A 1 60  ? -14.896 81.244 47.205 1.00 24.99 ? 60  ALA A N   1 
ATOM   424  C CA  . ALA A 1 60  ? -13.669 80.730 47.765 1.00 23.98 ? 60  ALA A CA  1 
ATOM   425  C C   . ALA A 1 60  ? -12.939 81.819 48.482 1.00 27.18 ? 60  ALA A C   1 
ATOM   426  O O   . ALA A 1 60  ? -11.769 82.062 48.199 1.00 27.44 ? 60  ALA A O   1 
ATOM   427  C CB  . ALA A 1 60  ? -12.767 80.191 46.652 1.00 26.41 ? 60  ALA A CB  1 
ATOM   428  N N   . SER A 1 61  ? -13.642 82.467 49.421 1.00 31.48 ? 61  SER A N   1 
ATOM   429  C CA  . SER A 1 61  ? -13.040 83.578 50.173 1.00 32.86 ? 61  SER A CA  1 
ATOM   430  C C   . SER A 1 61  ? -12.625 83.304 51.622 1.00 34.53 ? 61  SER A C   1 
ATOM   431  O O   . SER A 1 61  ? -12.053 84.157 52.298 1.00 36.50 ? 61  SER A O   1 
ATOM   432  C CB  . SER A 1 61  ? -14.065 84.730 50.228 1.00 31.96 ? 61  SER A CB  1 
ATOM   433  O OG  . SER A 1 61  ? -14.657 84.951 48.941 1.00 38.85 ? 61  SER A OG  1 
ATOM   434  N N   . THR A 1 62  ? -12.931 82.118 52.137 1.00 33.87 ? 62  THR A N   1 
ATOM   435  C CA  . THR A 1 62  ? -12.587 81.857 53.529 1.00 30.62 ? 62  THR A CA  1 
ATOM   436  C C   . THR A 1 62  ? -11.978 80.477 53.615 1.00 28.79 ? 62  THR A C   1 
ATOM   437  O O   . THR A 1 62  ? -12.095 79.707 52.675 1.00 32.61 ? 62  THR A O   1 
ATOM   438  C CB  . THR A 1 62  ? -13.883 82.017 54.348 1.00 31.32 ? 62  THR A CB  1 
ATOM   439  O OG1 . THR A 1 62  ? -14.976 81.404 53.663 1.00 29.68 ? 62  THR A OG1 1 
ATOM   440  C CG2 . THR A 1 62  ? -14.286 83.490 54.576 1.00 31.03 ? 62  THR A CG2 1 
ATOM   441  N N   . TYR A 1 63  ? -11.300 80.174 54.729 1.00 25.93 ? 63  TYR A N   1 
ATOM   442  C CA  . TYR A 1 63  ? -10.717 78.836 54.813 1.00 19.78 ? 63  TYR A CA  1 
ATOM   443  C C   . TYR A 1 63  ? -11.796 77.818 55.072 1.00 18.69 ? 63  TYR A C   1 
ATOM   444  O O   . TYR A 1 63  ? -12.836 78.140 55.619 1.00 18.46 ? 63  TYR A O   1 
ATOM   445  C CB  . TYR A 1 63  ? -9.722  78.710 55.951 1.00 15.15 ? 63  TYR A CB  1 
ATOM   446  C CG  . TYR A 1 63  ? -8.453  79.424 55.622 1.00 15.43 ? 63  TYR A CG  1 
ATOM   447  C CD1 . TYR A 1 63  ? -7.489  78.794 54.827 1.00 15.81 ? 63  TYR A CD1 1 
ATOM   448  C CD2 . TYR A 1 63  ? -8.225  80.720 56.109 1.00 17.62 ? 63  TYR A CD2 1 
ATOM   449  C CE1 . TYR A 1 63  ? -6.285  79.443 54.537 1.00 19.43 ? 63  TYR A CE1 1 
ATOM   450  C CE2 . TYR A 1 63  ? -7.024  81.375 55.809 1.00 20.65 ? 63  TYR A CE2 1 
ATOM   451  C CZ  . TYR A 1 63  ? -6.048  80.737 55.025 1.00 19.70 ? 63  TYR A CZ  1 
ATOM   452  O OH  . TYR A 1 63  ? -4.857  81.380 54.735 1.00 24.19 ? 63  TYR A OH  1 
ATOM   453  N N   . PRO A 1 64  ? -11.522 76.573 54.693 1.00 19.06 ? 64  PRO A N   1 
ATOM   454  C CA  . PRO A 1 64  ? -12.468 75.517 55.001 1.00 20.68 ? 64  PRO A CA  1 
ATOM   455  C C   . PRO A 1 64  ? -12.327 75.036 56.444 1.00 18.38 ? 64  PRO A C   1 
ATOM   456  O O   . PRO A 1 64  ? -11.485 75.450 57.224 1.00 17.54 ? 64  PRO A O   1 
ATOM   457  C CB  . PRO A 1 64  ? -12.081 74.422 53.982 1.00 22.54 ? 64  PRO A CB  1 
ATOM   458  C CG  . PRO A 1 64  ? -10.591 74.661 53.665 1.00 21.58 ? 64  PRO A CG  1 
ATOM   459  C CD  . PRO A 1 64  ? -10.386 76.162 53.866 1.00 19.54 ? 64  PRO A CD  1 
ATOM   460  N N   . ASN A 1 65  ? -13.221 74.112 56.766 1.00 20.56 ? 65  ASN A N   1 
ATOM   461  C CA  . ASN A 1 65  ? -13.196 73.527 58.091 1.00 23.26 ? 65  ASN A CA  1 
ATOM   462  C C   . ASN A 1 65  ? -11.989 72.626 58.109 1.00 22.74 ? 65  ASN A C   1 
ATOM   463  O O   . ASN A 1 65  ? -11.470 72.232 57.067 1.00 23.75 ? 65  ASN A O   1 
ATOM   464  C CB  . ASN A 1 65  ? -14.439 72.651 58.366 1.00 27.73 ? 65  ASN A CB  1 
ATOM   465  C CG  . ASN A 1 65  ? -15.731 73.455 58.323 1.00 36.61 ? 65  ASN A CG  1 
ATOM   466  O OD1 . ASN A 1 65  ? -15.859 74.583 58.789 1.00 37.06 ? 65  ASN A OD1 1 
ATOM   467  N ND2 . ASN A 1 65  ? -16.725 72.834 57.702 1.00 40.45 ? 65  ASN A ND2 1 
ATOM   468  N N   . ASN A 1 66  ? -11.573 72.259 59.314 1.00 21.64 ? 66  ASN A N   1 
ATOM   469  C CA  . ASN A 1 66  ? -10.423 71.387 59.440 1.00 16.44 ? 66  ASN A CA  1 
ATOM   470  C C   . ASN A 1 66  ? -10.979 70.013 59.711 1.00 16.55 ? 66  ASN A C   1 
ATOM   471  O O   . ASN A 1 66  ? -12.110 69.833 60.146 1.00 14.30 ? 66  ASN A O   1 
ATOM   472  C CB  . ASN A 1 66  ? -9.482  71.882 60.547 1.00 16.96 ? 66  ASN A CB  1 
ATOM   473  C CG  . ASN A 1 66  ? -8.813  73.191 60.115 1.00 18.49 ? 66  ASN A CG  1 
ATOM   474  O OD1 . ASN A 1 66  ? -8.817  73.579 58.965 1.00 26.03 ? 66  ASN A OD1 1 
ATOM   475  N ND2 . ASN A 1 66  ? -8.183  73.894 61.037 1.00 16.89 ? 66  ASN A ND2 1 
ATOM   476  N N   . CYS A 1 67  ? -10.185 68.993 59.417 1.00 17.25 ? 67  CYS A N   1 
ATOM   477  C CA  . CYS A 1 67  ? -10.706 67.656 59.682 1.00 18.57 ? 67  CYS A CA  1 
ATOM   478  C C   . CYS A 1 67  ? -10.667 67.450 61.184 1.00 19.81 ? 67  CYS A C   1 
ATOM   479  O O   . CYS A 1 67  ? -9.984  68.203 61.875 1.00 20.61 ? 67  CYS A O   1 
ATOM   480  C CB  . CYS A 1 67  ? -9.863  66.601 58.960 1.00 17.42 ? 67  CYS A CB  1 
ATOM   481  S SG  . CYS A 1 67  ? -9.905  66.802 57.151 1.00 18.98 ? 67  CYS A SG  1 
ATOM   482  N N   . GLN A 1 68  ? -11.393 66.439 61.675 1.00 17.55 ? 68  GLN A N   1 
ATOM   483  C CA  . GLN A 1 68  ? -11.407 66.168 63.091 1.00 17.18 ? 68  GLN A CA  1 
ATOM   484  C C   . GLN A 1 68  ? -10.043 65.664 63.483 1.00 19.88 ? 68  GLN A C   1 
ATOM   485  O O   . GLN A 1 68  ? -9.417  64.953 62.712 1.00 21.99 ? 68  GLN A O   1 
ATOM   486  C CB  . GLN A 1 68  ? -12.416 65.039 63.353 1.00 15.22 ? 68  GLN A CB  1 
ATOM   487  C CG  . GLN A 1 68  ? -13.847 65.325 62.915 1.00 18.79 ? 68  GLN A CG  1 
ATOM   488  C CD  . GLN A 1 68  ? -14.639 66.144 63.915 1.00 21.79 ? 68  GLN A CD  1 
ATOM   489  O OE1 . GLN A 1 68  ? -15.813 65.936 64.118 1.00 25.17 ? 68  GLN A OE1 1 
ATOM   490  N NE2 . GLN A 1 68  ? -14.006 67.092 64.571 1.00 21.53 ? 68  GLN A NE2 1 
ATOM   491  N N   . GLN A 1 69  ? -9.585  66.025 64.673 1.00 20.12 ? 69  GLN A N   1 
ATOM   492  C CA  . GLN A 1 69  ? -8.279  65.555 65.080 1.00 18.14 ? 69  GLN A CA  1 
ATOM   493  C C   . GLN A 1 69  ? -8.147  65.827 66.551 1.00 17.20 ? 69  GLN A C   1 
ATOM   494  O O   . GLN A 1 69  ? -9.001  66.466 67.156 1.00 19.15 ? 69  GLN A O   1 
ATOM   495  C CB  . GLN A 1 69  ? -7.197  66.296 64.294 1.00 13.21 ? 69  GLN A CB  1 
ATOM   496  C CG  . GLN A 1 69  ? -7.408  67.813 64.392 1.00 13.01 ? 69  GLN A CG  1 
ATOM   497  C CD  . GLN A 1 69  ? -6.498  68.483 63.423 1.00 16.68 ? 69  GLN A CD  1 
ATOM   498  O OE1 . GLN A 1 69  ? -5.318  68.723 63.680 1.00 11.84 ? 69  GLN A OE1 1 
ATOM   499  N NE2 . GLN A 1 69  ? -7.090  68.699 62.256 1.00 13.06 ? 69  GLN A NE2 1 
ATOM   500  N N   . TYR A 1 70  ? -7.044  65.343 67.113 1.00 14.49 ? 70  TYR A N   1 
ATOM   501  C CA  . TYR A 1 70  ? -6.790  65.538 68.513 1.00 12.98 ? 70  TYR A CA  1 
ATOM   502  C C   . TYR A 1 70  ? -6.205  66.938 68.694 1.00 15.14 ? 70  TYR A C   1 
ATOM   503  O O   . TYR A 1 70  ? -5.191  67.281 68.101 1.00 14.54 ? 70  TYR A O   1 
ATOM   504  C CB  . TYR A 1 70  ? -5.840  64.438 68.969 1.00 12.17 ? 70  TYR A CB  1 
ATOM   505  C CG  . TYR A 1 70  ? -5.233  64.737 70.316 1.00 23.88 ? 70  TYR A CG  1 
ATOM   506  C CD1 . TYR A 1 70  ? -5.991  64.599 71.488 1.00 25.60 ? 70  TYR A CD1 1 
ATOM   507  C CD2 . TYR A 1 70  ? -3.895  65.176 70.399 1.00 30.10 ? 70  TYR A CD2 1 
ATOM   508  C CE1 . TYR A 1 70  ? -5.410  64.871 72.737 1.00 33.68 ? 70  TYR A CE1 1 
ATOM   509  C CE2 . TYR A 1 70  ? -3.309  65.448 71.647 1.00 34.94 ? 70  TYR A CE2 1 
ATOM   510  C CZ  . TYR A 1 70  ? -4.068  65.298 72.822 1.00 37.28 ? 70  TYR A CZ  1 
ATOM   511  O OH  . TYR A 1 70  ? -3.512  65.590 74.064 1.00 42.92 ? 70  TYR A OH  1 
ATOM   512  N N   . VAL A 1 71  ? -6.861  67.738 69.544 1.00 15.09 ? 71  VAL A N   1 
ATOM   513  C CA  . VAL A 1 71  ? -6.376  69.079 69.781 1.00 17.72 ? 71  VAL A CA  1 
ATOM   514  C C   . VAL A 1 71  ? -5.276  68.956 70.821 1.00 20.76 ? 71  VAL A C   1 
ATOM   515  O O   . VAL A 1 71  ? -5.424  68.232 71.802 1.00 23.36 ? 71  VAL A O   1 
ATOM   516  C CB  . VAL A 1 71  ? -7.523  69.971 70.266 1.00 13.32 ? 71  VAL A CB  1 
ATOM   517  C CG1 . VAL A 1 71  ? -7.165  71.450 70.135 1.00 14.34 ? 71  VAL A CG1 1 
ATOM   518  C CG2 . VAL A 1 71  ? -8.824  69.702 69.504 1.00 20.84 ? 71  VAL A CG2 1 
ATOM   519  N N   . ASP A 1 72  ? -4.183  69.698 70.626 1.00 20.45 ? 72  ASP A N   1 
ATOM   520  C CA  . ASP A 1 72  ? -3.127  69.544 71.594 1.00 21.84 ? 72  ASP A CA  1 
ATOM   521  C C   . ASP A 1 72  ? -3.302  70.556 72.658 1.00 26.30 ? 72  ASP A C   1 
ATOM   522  O O   . ASP A 1 72  ? -3.206  71.743 72.396 1.00 30.97 ? 72  ASP A O   1 
ATOM   523  C CB  . ASP A 1 72  ? -1.754  69.806 70.955 1.00 20.11 ? 72  ASP A CB  1 
ATOM   524  C CG  . ASP A 1 72  ? -0.569  69.712 71.938 1.00 16.69 ? 72  ASP A CG  1 
ATOM   525  O OD1 . ASP A 1 72  ? -0.730  69.182 73.035 1.00 14.30 ? 72  ASP A OD1 1 
ATOM   526  O OD2 . ASP A 1 72  ? 0.509   70.179 71.599 1.00 15.91 ? 72  ASP A OD2 1 
ATOM   527  N N   . GLU A 1 73  ? -3.506  70.103 73.893 1.00 26.74 ? 73  GLU A N   1 
ATOM   528  C CA  . GLU A 1 73  ? -3.640  71.101 74.945 1.00 27.99 ? 73  GLU A CA  1 
ATOM   529  C C   . GLU A 1 73  ? -2.727  70.780 76.094 1.00 27.05 ? 73  GLU A C   1 
ATOM   530  O O   . GLU A 1 73  ? -3.059  70.917 77.258 1.00 29.33 ? 73  GLU A O   1 
ATOM   531  C CB  . GLU A 1 73  ? -5.101  71.421 75.302 1.00 27.16 ? 73  GLU A CB  1 
ATOM   532  C CG  . GLU A 1 73  ? -5.977  70.214 75.663 1.00 24.07 ? 73  GLU A CG  1 
ATOM   533  C CD  . GLU A 1 73  ? -7.451  70.568 75.563 1.00 25.62 ? 73  GLU A CD  1 
ATOM   534  O OE1 . GLU A 1 73  ? -7.784  71.736 75.339 1.00 26.72 ? 73  GLU A OE1 1 
ATOM   535  O OE2 . GLU A 1 73  ? -8.264  69.660 75.686 1.00 28.37 ? 73  GLU A OE2 1 
ATOM   536  N N   . GLN A 1 74  ? -1.517  70.335 75.725 1.00 24.18 ? 74  GLN A N   1 
ATOM   537  C CA  . GLN A 1 74  ? -0.546  70.019 76.766 1.00 19.75 ? 74  GLN A CA  1 
ATOM   538  C C   . GLN A 1 74  ? 0.044   71.294 77.338 1.00 19.07 ? 74  GLN A C   1 
ATOM   539  O O   . GLN A 1 74  ? 0.621   71.275 78.414 1.00 27.55 ? 74  GLN A O   1 
ATOM   540  C CB  . GLN A 1 74  ? 0.568   69.058 76.295 1.00 17.91 ? 74  GLN A CB  1 
ATOM   541  C CG  . GLN A 1 74  ? 1.124   68.127 77.404 1.00 15.27 ? 74  GLN A CG  1 
ATOM   542  C CD  . GLN A 1 74  ? 1.981   68.819 78.458 1.00 19.09 ? 74  GLN A CD  1 
ATOM   543  N N   . PHE A 1 75  ? -0.054  72.391 76.599 1.00 16.81 ? 75  PHE A N   1 
ATOM   544  C CA  . PHE A 1 75  ? 0.473   73.652 77.110 1.00 14.63 ? 75  PHE A CA  1 
ATOM   545  C C   . PHE A 1 75  ? -0.519  74.701 76.670 1.00 15.75 ? 75  PHE A C   1 
ATOM   546  O O   . PHE A 1 75  ? -0.237  75.476 75.759 1.00 12.66 ? 75  PHE A O   1 
ATOM   547  C CB  . PHE A 1 75  ? 1.868   73.986 76.534 1.00 15.63 ? 75  PHE A CB  1 
ATOM   548  C CG  . PHE A 1 75  ? 2.928   72.957 76.865 1.00 18.37 ? 75  PHE A CG  1 
ATOM   549  C CD1 . PHE A 1 75  ? 3.598   72.994 78.100 1.00 20.71 ? 75  PHE A CD1 1 
ATOM   550  C CD2 . PHE A 1 75  ? 3.258   71.951 75.946 1.00 18.70 ? 75  PHE A CD2 1 
ATOM   551  C CE1 . PHE A 1 75  ? 4.584   72.045 78.399 1.00 19.08 ? 75  PHE A CE1 1 
ATOM   552  C CE2 . PHE A 1 75  ? 4.235   70.996 76.251 1.00 18.19 ? 75  PHE A CE2 1 
ATOM   553  C CZ  . PHE A 1 75  ? 4.903   71.041 77.477 1.00 17.69 ? 75  PHE A CZ  1 
ATOM   554  N N   . PRO A 1 76  ? -1.744  74.678 77.265 1.00 16.59 ? 76  PRO A N   1 
ATOM   555  C CA  . PRO A 1 76  ? -2.817  75.523 76.755 1.00 14.83 ? 76  PRO A CA  1 
ATOM   556  C C   . PRO A 1 76  ? -2.395  76.960 76.723 1.00 13.89 ? 76  PRO A C   1 
ATOM   557  O O   . PRO A 1 76  ? -1.759  77.441 77.645 1.00 13.58 ? 76  PRO A O   1 
ATOM   558  C CB  . PRO A 1 76  ? -3.987  75.306 77.719 1.00 8.91  ? 76  PRO A CB  1 
ATOM   559  C CG  . PRO A 1 76  ? -3.700  73.971 78.406 1.00 14.56 ? 76  PRO A CG  1 
ATOM   560  C CD  . PRO A 1 76  ? -2.166  73.842 78.392 1.00 16.53 ? 76  PRO A CD  1 
ATOM   561  N N   . GLY A 1 77  ? -2.741  77.619 75.619 1.00 15.94 ? 77  GLY A N   1 
ATOM   562  C CA  . GLY A 1 77  ? -2.389  79.024 75.478 1.00 19.13 ? 77  GLY A CA  1 
ATOM   563  C C   . GLY A 1 77  ? -0.983  79.255 74.957 1.00 20.30 ? 77  GLY A C   1 
ATOM   564  O O   . GLY A 1 77  ? -0.685  80.291 74.364 1.00 21.30 ? 77  GLY A O   1 
ATOM   565  N N   . PHE A 1 78  ? -0.109  78.252 75.139 1.00 15.84 ? 78  PHE A N   1 
ATOM   566  C CA  . PHE A 1 78  ? 1.246   78.450 74.670 1.00 12.27 ? 78  PHE A CA  1 
ATOM   567  C C   . PHE A 1 78  ? 1.308   78.493 73.158 1.00 14.11 ? 78  PHE A C   1 
ATOM   568  O O   . PHE A 1 78  ? 0.957   77.528 72.493 1.00 13.80 ? 78  PHE A O   1 
ATOM   569  C CB  . PHE A 1 78  ? 2.119   77.307 75.170 1.00 5.30  ? 78  PHE A CB  1 
ATOM   570  C CG  . PHE A 1 78  ? 3.577   77.446 74.816 1.00 2.00  ? 78  PHE A CG  1 
ATOM   571  C CD1 . PHE A 1 78  ? 4.231   78.684 74.890 1.00 2.00  ? 78  PHE A CD1 1 
ATOM   572  C CD2 . PHE A 1 78  ? 4.300   76.310 74.427 1.00 4.23  ? 78  PHE A CD2 1 
ATOM   573  C CE1 . PHE A 1 78  ? 5.597   78.780 74.589 1.00 4.27  ? 78  PHE A CE1 1 
ATOM   574  C CE2 . PHE A 1 78  ? 5.664   76.406 74.135 1.00 2.00  ? 78  PHE A CE2 1 
ATOM   575  C CZ  . PHE A 1 78  ? 6.313   77.638 74.221 1.00 3.02  ? 78  PHE A CZ  1 
ATOM   576  N N   . SER A 1 79  ? 1.815   79.598 72.611 1.00 14.75 ? 79  SER A N   1 
ATOM   577  C CA  . SER A 1 79  ? 1.897   79.700 71.151 1.00 15.44 ? 79  SER A CA  1 
ATOM   578  C C   . SER A 1 79  ? 2.697   78.584 70.502 1.00 14.29 ? 79  SER A C   1 
ATOM   579  O O   . SER A 1 79  ? 2.311   78.023 69.490 1.00 16.49 ? 79  SER A O   1 
ATOM   580  C CB  . SER A 1 79  ? 2.481   81.045 70.710 1.00 15.68 ? 79  SER A CB  1 
ATOM   581  O OG  . SER A 1 79  ? 3.691   81.268 71.437 1.00 27.82 ? 79  SER A OG  1 
ATOM   582  N N   . GLY A 1 80  ? 3.810   78.235 71.123 1.00 11.96 ? 80  GLY A N   1 
ATOM   583  C CA  . GLY A 1 80  ? 4.616   77.182 70.527 1.00 13.22 ? 80  GLY A CA  1 
ATOM   584  C C   . GLY A 1 80  ? 3.864   75.898 70.204 1.00 11.30 ? 80  GLY A C   1 
ATOM   585  O O   . GLY A 1 80  ? 4.277   75.133 69.351 1.00 10.75 ? 80  GLY A O   1 
ATOM   586  N N   . SER A 1 81  ? 2.763   75.636 70.908 1.00 13.86 ? 81  SER A N   1 
ATOM   587  C CA  . SER A 1 81  ? 2.028   74.419 70.622 1.00 18.66 ? 81  SER A CA  1 
ATOM   588  C C   . SER A 1 81  ? 0.785   74.773 69.848 1.00 19.99 ? 81  SER A C   1 
ATOM   589  O O   . SER A 1 81  ? 0.384   74.134 68.881 1.00 22.67 ? 81  SER A O   1 
ATOM   590  C CB  . SER A 1 81  ? 1.723   73.612 71.906 1.00 18.45 ? 81  SER A CB  1 
ATOM   591  O OG  . SER A 1 81  ? 0.831   74.263 72.818 1.00 22.06 ? 81  SER A OG  1 
ATOM   592  N N   . GLU A 1 82  ? 0.180   75.859 70.287 1.00 22.40 ? 82  GLU A N   1 
ATOM   593  C CA  . GLU A 1 82  ? -1.040  76.335 69.685 1.00 25.67 ? 82  GLU A CA  1 
ATOM   594  C C   . GLU A 1 82  ? -0.906  76.617 68.200 1.00 23.30 ? 82  GLU A C   1 
ATOM   595  O O   . GLU A 1 82  ? -1.831  76.370 67.440 1.00 27.14 ? 82  GLU A O   1 
ATOM   596  C CB  . GLU A 1 82  ? -1.532  77.605 70.422 1.00 32.47 ? 82  GLU A CB  1 
ATOM   597  C CG  . GLU A 1 82  ? -1.881  77.416 71.915 1.00 36.84 ? 82  GLU A CG  1 
ATOM   598  C CD  . GLU A 1 82  ? -3.270  76.830 72.117 1.00 43.72 ? 82  GLU A CD  1 
ATOM   599  O OE1 . GLU A 1 82  ? -3.543  75.763 71.555 1.00 46.39 ? 82  GLU A OE1 1 
ATOM   600  O OE2 . GLU A 1 82  ? -4.068  77.443 72.835 1.00 46.73 ? 82  GLU A OE2 1 
ATOM   601  N N   . MET A 1 83  ? 0.248   77.120 67.780 1.00 18.06 ? 83  MET A N   1 
ATOM   602  C CA  . MET A 1 83  ? 0.401   77.412 66.360 1.00 17.25 ? 83  MET A CA  1 
ATOM   603  C C   . MET A 1 83  ? 0.068   76.234 65.434 1.00 17.90 ? 83  MET A C   1 
ATOM   604  O O   . MET A 1 83  ? -0.217  76.428 64.259 1.00 21.67 ? 83  MET A O   1 
ATOM   605  C CB  . MET A 1 83  ? 1.822   77.934 66.058 1.00 15.60 ? 83  MET A CB  1 
ATOM   606  C CG  . MET A 1 83  ? 2.927   76.975 66.505 1.00 19.41 ? 83  MET A CG  1 
ATOM   607  S SD  . MET A 1 83  ? 4.383   77.143 65.446 1.00 28.06 ? 83  MET A SD  1 
ATOM   608  C CE  . MET A 1 83  ? 5.245   78.487 66.290 1.00 35.21 ? 83  MET A CE  1 
ATOM   609  N N   . TRP A 1 84  ? 0.122   75.015 65.987 1.00 13.03 ? 84  TRP A N   1 
ATOM   610  C CA  . TRP A 1 84  ? -0.154  73.823 65.211 1.00 10.68 ? 84  TRP A CA  1 
ATOM   611  C C   . TRP A 1 84  ? -1.550  73.249 65.396 1.00 11.34 ? 84  TRP A C   1 
ATOM   612  O O   . TRP A 1 84  ? -1.813  72.168 64.877 1.00 14.46 ? 84  TRP A O   1 
ATOM   613  C CB  . TRP A 1 84  ? 0.789   72.670 65.625 1.00 11.48 ? 84  TRP A CB  1 
ATOM   614  C CG  . TRP A 1 84  ? 2.245   73.044 65.576 1.00 11.73 ? 84  TRP A CG  1 
ATOM   615  C CD1 . TRP A 1 84  ? 3.028   73.442 66.672 1.00 10.38 ? 84  TRP A CD1 1 
ATOM   616  C CD2 . TRP A 1 84  ? 3.062   73.098 64.437 1.00 12.68 ? 84  TRP A CD2 1 
ATOM   617  N NE1 . TRP A 1 84  ? 4.277   73.747 66.266 1.00 9.30  ? 84  TRP A NE1 1 
ATOM   618  C CE2 . TRP A 1 84  ? 4.378   73.566 64.911 1.00 12.27 ? 84  TRP A CE2 1 
ATOM   619  C CE3 . TRP A 1 84  ? 2.858   72.867 63.071 1.00 14.19 ? 84  TRP A CE3 1 
ATOM   620  C CZ2 . TRP A 1 84  ? 5.406   73.766 63.977 1.00 13.17 ? 84  TRP A CZ2 1 
ATOM   621  C CZ3 . TRP A 1 84  ? 3.909   73.089 62.167 1.00 12.49 ? 84  TRP A CZ3 1 
ATOM   622  C CH2 . TRP A 1 84  ? 5.167   73.528 62.615 1.00 12.78 ? 84  TRP A CH2 1 
ATOM   623  N N   . ASN A 1 85  ? -2.439  73.908 66.131 1.00 11.34 ? 85  ASN A N   1 
ATOM   624  C CA  . ASN A 1 85  ? -3.767  73.296 66.338 1.00 14.49 ? 85  ASN A CA  1 
ATOM   625  C C   . ASN A 1 85  ? -4.784  73.834 65.359 1.00 15.95 ? 85  ASN A C   1 
ATOM   626  O O   . ASN A 1 85  ? -4.643  74.972 64.916 1.00 19.96 ? 85  ASN A O   1 
ATOM   627  C CB  . ASN A 1 85  ? -4.309  73.642 67.730 1.00 19.34 ? 85  ASN A CB  1 
ATOM   628  C CG  . ASN A 1 85  ? -3.765  72.718 68.778 1.00 22.60 ? 85  ASN A CG  1 
ATOM   629  O OD1 . ASN A 1 85  ? -2.968  71.846 68.502 1.00 26.16 ? 85  ASN A OD1 1 
ATOM   630  N ND2 . ASN A 1 85  ? -4.202  72.907 70.003 1.00 26.67 ? 85  ASN A ND2 1 
ATOM   631  N N   . PRO A 1 86  ? -5.850  73.044 65.055 1.00 10.84 ? 86  PRO A N   1 
ATOM   632  C CA  . PRO A 1 86  ? -6.830  73.496 64.089 1.00 12.43 ? 86  PRO A CA  1 
ATOM   633  C C   . PRO A 1 86  ? -7.317  74.875 64.470 1.00 14.14 ? 86  PRO A C   1 
ATOM   634  O O   . PRO A 1 86  ? -7.778  75.053 65.585 1.00 23.78 ? 86  PRO A O   1 
ATOM   635  C CB  . PRO A 1 86  ? -7.953  72.437 64.107 1.00 8.30  ? 86  PRO A CB  1 
ATOM   636  C CG  . PRO A 1 86  ? -7.633  71.487 65.260 1.00 7.62  ? 86  PRO A CG  1 
ATOM   637  C CD  . PRO A 1 86  ? -6.166  71.751 65.639 1.00 12.16 ? 86  PRO A CD  1 
ATOM   638  N N   . ASN A 1 87  ? -7.184  75.827 63.546 1.00 13.45 ? 87  ASN A N   1 
ATOM   639  C CA  . ASN A 1 87  ? -7.612  77.184 63.822 1.00 11.93 ? 87  ASN A CA  1 
ATOM   640  C C   . ASN A 1 87  ? -8.935  77.473 63.171 1.00 14.55 ? 87  ASN A C   1 
ATOM   641  O O   . ASN A 1 87  ? -9.237  78.627 62.907 1.00 18.89 ? 87  ASN A O   1 
ATOM   642  C CB  . ASN A 1 87  ? -6.571  78.188 63.300 1.00 14.24 ? 87  ASN A CB  1 
ATOM   643  C CG  . ASN A 1 87  ? -6.456  78.117 61.801 1.00 16.61 ? 87  ASN A CG  1 
ATOM   644  O OD1 . ASN A 1 87  ? -6.933  77.187 61.179 1.00 21.68 ? 87  ASN A OD1 1 
ATOM   645  N ND2 . ASN A 1 87  ? -5.786  79.091 61.213 1.00 23.10 ? 87  ASN A ND2 1 
ATOM   646  N N   . ARG A 1 88  ? -9.727  76.438 62.877 1.00 17.04 ? 88  ARG A N   1 
ATOM   647  C CA  . ARG A 1 88  ? -11.026 76.615 62.228 1.00 16.41 ? 88  ARG A CA  1 
ATOM   648  C C   . ARG A 1 88  ? -11.900 75.523 62.793 1.00 15.60 ? 88  ARG A C   1 
ATOM   649  O O   . ARG A 1 88  ? -11.425 74.616 63.461 1.00 19.57 ? 88  ARG A O   1 
ATOM   650  C CB  . ARG A 1 88  ? -10.897 76.429 60.692 1.00 18.43 ? 88  ARG A CB  1 
ATOM   651  C CG  . ARG A 1 88  ? -10.398 77.678 59.953 1.00 18.59 ? 88  ARG A CG  1 
ATOM   652  C CD  . ARG A 1 88  ? -11.553 78.663 59.658 1.00 25.23 ? 88  ARG A CD  1 
ATOM   653  N NE  . ARG A 1 88  ? -11.109 79.955 59.127 1.00 30.01 ? 88  ARG A NE  1 
ATOM   654  C CZ  . ARG A 1 88  ? -10.173 80.693 59.756 1.00 28.05 ? 88  ARG A CZ  1 
ATOM   655  N N   . GLU A 1 89  ? -13.204 75.606 62.516 1.00 14.40 ? 89  GLU A N   1 
ATOM   656  C CA  . GLU A 1 89  ? -14.088 74.573 63.058 1.00 14.71 ? 89  GLU A CA  1 
ATOM   657  C C   . GLU A 1 89  ? -13.716 73.272 62.445 1.00 12.51 ? 89  GLU A C   1 
ATOM   658  O O   . GLU A 1 89  ? -13.467 73.181 61.256 1.00 15.65 ? 89  GLU A O   1 
ATOM   659  C CB  . GLU A 1 89  ? -15.585 74.844 62.744 1.00 19.87 ? 89  GLU A CB  1 
ATOM   660  C CG  . GLU A 1 89  ? -16.649 73.877 63.346 1.00 26.55 ? 89  GLU A CG  1 
ATOM   661  N N   . MET A 1 90  ? -13.654 72.264 63.280 1.00 12.40 ? 90  MET A N   1 
ATOM   662  C CA  . MET A 1 90  ? -13.329 70.979 62.735 1.00 12.40 ? 90  MET A CA  1 
ATOM   663  C C   . MET A 1 90  ? -14.657 70.444 62.245 1.00 13.29 ? 90  MET A C   1 
ATOM   664  O O   . MET A 1 90  ? -15.685 70.875 62.764 1.00 11.14 ? 90  MET A O   1 
ATOM   665  C CB  . MET A 1 90  ? -12.753 70.062 63.817 1.00 13.61 ? 90  MET A CB  1 
ATOM   666  C CG  . MET A 1 90  ? -11.597 70.693 64.597 1.00 13.67 ? 90  MET A CG  1 
ATOM   667  S SD  . MET A 1 90  ? -10.606 69.351 65.317 1.00 19.43 ? 90  MET A SD  1 
ATOM   668  C CE  . MET A 1 90  ? -11.676 68.792 66.655 1.00 20.51 ? 90  MET A CE  1 
ATOM   669  N N   . SER A 1 91  ? -14.617 69.531 61.273 1.00 13.06 ? 91  SER A N   1 
ATOM   670  C CA  . SER A 1 91  ? -15.811 68.921 60.732 1.00 14.99 ? 91  SER A CA  1 
ATOM   671  C C   . SER A 1 91  ? -15.326 67.704 59.970 1.00 15.19 ? 91  SER A C   1 
ATOM   672  O O   . SER A 1 91  ? -14.161 67.604 59.592 1.00 14.69 ? 91  SER A O   1 
ATOM   673  C CB  . SER A 1 91  ? -16.520 69.899 59.763 1.00 18.90 ? 91  SER A CB  1 
ATOM   674  O OG  . SER A 1 91  ? -17.801 69.436 59.296 1.00 25.45 ? 91  SER A OG  1 
ATOM   675  N N   . GLU A 1 92  ? -16.250 66.746 59.745 1.00 13.93 ? 92  GLU A N   1 
ATOM   676  C CA  . GLU A 1 92  ? -15.851 65.579 58.959 1.00 13.90 ? 92  GLU A CA  1 
ATOM   677  C C   . GLU A 1 92  ? -15.772 66.009 57.501 1.00 18.57 ? 92  GLU A C   1 
ATOM   678  O O   . GLU A 1 92  ? -15.003 65.503 56.698 1.00 20.05 ? 92  GLU A O   1 
ATOM   679  C CB  . GLU A 1 92  ? -16.781 64.389 59.120 1.00 10.43 ? 92  GLU A CB  1 
ATOM   680  C CG  . GLU A 1 92  ? -16.496 63.628 60.415 1.00 12.39 ? 92  GLU A CG  1 
ATOM   681  C CD  . GLU A 1 92  ? -17.146 62.256 60.346 1.00 13.13 ? 92  GLU A CD  1 
ATOM   682  O OE1 . GLU A 1 92  ? -18.335 62.159 60.636 1.00 10.48 ? 92  GLU A OE1 1 
ATOM   683  O OE2 . GLU A 1 92  ? -16.460 61.294 59.986 1.00 16.23 ? 92  GLU A OE2 1 
ATOM   684  N N   . ASP A 1 93  ? -16.625 66.984 57.189 1.00 17.71 ? 93  ASP A N   1 
ATOM   685  C CA  . ASP A 1 93  ? -16.665 67.591 55.878 1.00 17.64 ? 93  ASP A CA  1 
ATOM   686  C C   . ASP A 1 93  ? -15.462 68.539 55.844 1.00 19.89 ? 93  ASP A C   1 
ATOM   687  O O   . ASP A 1 93  ? -15.565 69.715 56.197 1.00 20.41 ? 93  ASP A O   1 
ATOM   688  C CB  . ASP A 1 93  ? -17.978 68.384 55.757 1.00 17.65 ? 93  ASP A CB  1 
ATOM   689  C CG  . ASP A 1 93  ? -18.136 69.104 54.433 1.00 23.35 ? 93  ASP A CG  1 
ATOM   690  O OD1 . ASP A 1 93  ? -17.123 69.476 53.846 1.00 22.00 ? 93  ASP A OD1 1 
ATOM   691  O OD2 . ASP A 1 93  ? -19.273 69.294 53.993 1.00 26.90 ? 93  ASP A OD2 1 
ATOM   692  N N   . CYS A 1 94  ? -14.311 68.010 55.427 1.00 18.50 ? 94  CYS A N   1 
ATOM   693  C CA  . CYS A 1 94  ? -13.140 68.872 55.416 1.00 18.58 ? 94  CYS A CA  1 
ATOM   694  C C   . CYS A 1 94  ? -12.241 68.687 54.217 1.00 20.84 ? 94  CYS A C   1 
ATOM   695  O O   . CYS A 1 94  ? -11.129 69.207 54.206 1.00 24.77 ? 94  CYS A O   1 
ATOM   696  C CB  . CYS A 1 94  ? -12.313 68.570 56.663 1.00 15.68 ? 94  CYS A CB  1 
ATOM   697  S SG  . CYS A 1 94  ? -11.885 66.805 56.660 1.00 8.01  ? 94  CYS A SG  1 
ATOM   698  N N   . LEU A 1 95  ? -12.699 67.928 53.211 1.00 17.60 ? 95  LEU A N   1 
ATOM   699  C CA  . LEU A 1 95  ? -11.859 67.746 52.024 1.00 15.22 ? 95  LEU A CA  1 
ATOM   700  C C   . LEU A 1 95  ? -12.026 68.932 51.043 1.00 13.32 ? 95  LEU A C   1 
ATOM   701  O O   . LEU A 1 95  ? -12.969 68.980 50.253 1.00 14.93 ? 95  LEU A O   1 
ATOM   702  C CB  . LEU A 1 95  ? -12.223 66.423 51.337 1.00 11.27 ? 95  LEU A CB  1 
ATOM   703  C CG  . LEU A 1 95  ? -11.924 65.184 52.183 1.00 9.22  ? 95  LEU A CG  1 
ATOM   704  C CD1 . LEU A 1 95  ? -12.398 63.918 51.459 1.00 12.24 ? 95  LEU A CD1 1 
ATOM   705  C CD2 . LEU A 1 95  ? -10.420 65.086 52.473 1.00 9.44  ? 95  LEU A CD2 1 
ATOM   706  N N   . TYR A 1 96  ? -11.101 69.895 51.130 1.00 9.45  ? 96  TYR A N   1 
ATOM   707  C CA  . TYR A 1 96  ? -11.074 71.093 50.284 1.00 10.39 ? 96  TYR A CA  1 
ATOM   708  C C   . TYR A 1 96  ? -9.627  71.405 50.015 1.00 9.24  ? 96  TYR A C   1 
ATOM   709  O O   . TYR A 1 96  ? -8.755  70.757 50.572 1.00 11.56 ? 96  TYR A O   1 
ATOM   710  C CB  . TYR A 1 96  ? -11.648 72.315 51.011 1.00 6.27  ? 96  TYR A CB  1 
ATOM   711  C CG  . TYR A 1 96  ? -13.088 72.116 51.361 1.00 12.78 ? 96  TYR A CG  1 
ATOM   712  C CD1 . TYR A 1 96  ? -13.465 71.437 52.529 1.00 17.73 ? 96  TYR A CD1 1 
ATOM   713  C CD2 . TYR A 1 96  ? -14.069 72.620 50.511 1.00 17.02 ? 96  TYR A CD2 1 
ATOM   714  C CE1 . TYR A 1 96  ? -14.825 71.256 52.837 1.00 24.42 ? 96  TYR A CE1 1 
ATOM   715  C CE2 . TYR A 1 96  ? -15.421 72.460 50.809 1.00 23.71 ? 96  TYR A CE2 1 
ATOM   716  C CZ  . TYR A 1 96  ? -15.807 71.768 51.968 1.00 25.91 ? 96  TYR A CZ  1 
ATOM   717  O OH  . TYR A 1 96  ? -17.150 71.591 52.241 1.00 30.42 ? 96  TYR A OH  1 
ATOM   718  N N   . LEU A 1 97  ? -9.366  72.384 49.156 1.00 7.65  ? 97  LEU A N   1 
ATOM   719  C CA  . LEU A 1 97  ? -7.987  72.753 48.892 1.00 7.91  ? 97  LEU A CA  1 
ATOM   720  C C   . LEU A 1 97  ? -7.950  74.249 48.762 1.00 9.01  ? 97  LEU A C   1 
ATOM   721  O O   . LEU A 1 97  ? -8.992  74.870 48.596 1.00 10.81 ? 97  LEU A O   1 
ATOM   722  C CB  . LEU A 1 97  ? -7.373  71.963 47.728 1.00 9.23  ? 97  LEU A CB  1 
ATOM   723  C CG  . LEU A 1 97  ? -8.126  71.943 46.392 1.00 6.13  ? 97  LEU A CG  1 
ATOM   724  C CD1 . LEU A 1 97  ? -8.029  73.281 45.657 1.00 8.91  ? 97  LEU A CD1 1 
ATOM   725  C CD2 . LEU A 1 97  ? -7.571  70.818 45.512 1.00 3.47  ? 97  LEU A CD2 1 
ATOM   726  N N   . ASN A 1 98  ? -6.752  74.834 48.859 1.00 11.33 ? 98  ASN A N   1 
ATOM   727  C CA  . ASN A 1 98  ? -6.601  76.300 48.768 1.00 13.70 ? 98  ASN A CA  1 
ATOM   728  C C   . ASN A 1 98  ? -5.518  76.564 47.749 1.00 16.15 ? 98  ASN A C   1 
ATOM   729  O O   . ASN A 1 98  ? -4.615  75.746 47.647 1.00 20.18 ? 98  ASN A O   1 
ATOM   730  C CB  . ASN A 1 98  ? -6.149  76.913 50.122 1.00 17.58 ? 98  ASN A CB  1 
ATOM   731  C CG  . ASN A 1 98  ? -6.964  76.389 51.307 1.00 18.01 ? 98  ASN A CG  1 
ATOM   732  O OD1 . ASN A 1 98  ? -8.144  76.679 51.485 1.00 12.42 ? 98  ASN A OD1 1 
ATOM   733  N ND2 . ASN A 1 98  ? -6.307  75.544 52.103 1.00 16.23 ? 98  ASN A ND2 1 
ATOM   734  N N   . ILE A 1 99  ? -5.592  77.688 47.031 1.00 18.79 ? 99  ILE A N   1 
ATOM   735  C CA  . ILE A 1 99  ? -4.629  78.040 45.997 1.00 15.69 ? 99  ILE A CA  1 
ATOM   736  C C   . ILE A 1 99  ? -4.294  79.528 46.085 1.00 12.75 ? 99  ILE A C   1 
ATOM   737  O O   . ILE A 1 99  ? -5.196  80.364 46.115 1.00 12.25 ? 99  ILE A O   1 
ATOM   738  C CB  . ILE A 1 99  ? -5.339  77.820 44.625 1.00 21.08 ? 99  ILE A CB  1 
ATOM   739  C CG1 . ILE A 1 99  ? -6.118  76.476 44.526 1.00 22.08 ? 99  ILE A CG1 1 
ATOM   740  C CG2 . ILE A 1 99  ? -4.408  78.076 43.422 1.00 20.15 ? 99  ILE A CG2 1 
ATOM   741  C CD1 . ILE A 1 99  ? -6.870  76.280 43.201 1.00 26.01 ? 99  ILE A CD1 1 
ATOM   742  N N   . TRP A 1 100 ? -3.013  79.861 46.120 1.00 10.55 ? 100 TRP A N   1 
ATOM   743  C CA  . TRP A 1 100 ? -2.637  81.271 46.144 1.00 17.45 ? 100 TRP A CA  1 
ATOM   744  C C   . TRP A 1 100 ? -2.096  81.427 44.763 1.00 23.25 ? 100 TRP A C   1 
ATOM   745  O O   . TRP A 1 100 ? -1.264  80.608 44.366 1.00 28.28 ? 100 TRP A O   1 
ATOM   746  C CB  . TRP A 1 100 ? -1.524  81.610 47.157 1.00 18.88 ? 100 TRP A CB  1 
ATOM   747  C CG  . TRP A 1 100 ? -2.133  81.683 48.538 1.00 18.39 ? 100 TRP A CG  1 
ATOM   748  C CD1 . TRP A 1 100 ? -2.729  82.828 49.114 1.00 18.87 ? 100 TRP A CD1 1 
ATOM   749  C CD2 . TRP A 1 100 ? -2.332  80.619 49.423 1.00 16.27 ? 100 TRP A CD2 1 
ATOM   750  N NE1 . TRP A 1 100 ? -3.304  82.509 50.294 1.00 20.89 ? 100 TRP A NE1 1 
ATOM   751  C CE2 . TRP A 1 100 ? -3.111  81.179 50.541 1.00 14.55 ? 100 TRP A CE2 1 
ATOM   752  C CE3 . TRP A 1 100 ? -2.010  79.260 49.404 1.00 17.00 ? 100 TRP A CE3 1 
ATOM   753  C CZ2 . TRP A 1 100 ? -3.551  80.332 51.550 1.00 15.08 ? 100 TRP A CZ2 1 
ATOM   754  C CZ3 . TRP A 1 100 ? -2.458  78.443 50.445 1.00 16.68 ? 100 TRP A CZ3 1 
ATOM   755  C CH2 . TRP A 1 100 ? -3.225  78.966 51.500 1.00 20.05 ? 100 TRP A CH2 1 
ATOM   756  N N   . VAL A 1 101 ? -2.574  82.443 44.034 1.00 25.62 ? 101 VAL A N   1 
ATOM   757  C CA  . VAL A 1 101 ? -2.140  82.667 42.646 1.00 23.97 ? 101 VAL A CA  1 
ATOM   758  C C   . VAL A 1 101 ? -1.583  84.090 42.563 1.00 24.09 ? 101 VAL A C   1 
ATOM   759  O O   . VAL A 1 101 ? -2.116  84.979 43.228 1.00 26.95 ? 101 VAL A O   1 
ATOM   760  C CB  . VAL A 1 101 ? -3.342  82.445 41.686 1.00 21.20 ? 101 VAL A CB  1 
ATOM   761  C CG1 . VAL A 1 101 ? -2.914  82.450 40.222 1.00 22.08 ? 101 VAL A CG1 1 
ATOM   762  C CG2 . VAL A 1 101 ? -4.116  81.135 41.970 1.00 21.41 ? 101 VAL A CG2 1 
ATOM   763  N N   . PRO A 1 102 ? -0.491  84.299 41.786 1.00 21.15 ? 102 PRO A N   1 
ATOM   764  C CA  . PRO A 1 102 ? -0.021  85.659 41.549 1.00 21.79 ? 102 PRO A CA  1 
ATOM   765  C C   . PRO A 1 102 ? -1.007  86.572 40.836 1.00 27.45 ? 102 PRO A C   1 
ATOM   766  O O   . PRO A 1 102 ? -2.032  86.168 40.293 1.00 29.87 ? 102 PRO A O   1 
ATOM   767  C CB  . PRO A 1 102 ? 1.267   85.476 40.748 1.00 18.71 ? 102 PRO A CB  1 
ATOM   768  C CG  . PRO A 1 102 ? 1.739   84.039 41.042 1.00 19.23 ? 102 PRO A CG  1 
ATOM   769  C CD  . PRO A 1 102 ? 0.455   83.261 41.369 1.00 21.10 ? 102 PRO A CD  1 
ATOM   770  N N   . SER A 1 103 ? -0.639  87.853 40.861 1.00 31.89 ? 103 SER A N   1 
ATOM   771  C CA  . SER A 1 103 ? -1.418  88.895 40.214 1.00 36.65 ? 103 SER A CA  1 
ATOM   772  C C   . SER A 1 103 ? -0.335  89.673 39.495 1.00 40.27 ? 103 SER A C   1 
ATOM   773  O O   . SER A 1 103 ? 0.624   90.067 40.149 1.00 45.43 ? 103 SER A O   1 
ATOM   774  C CB  . SER A 1 103 ? -2.139  89.825 41.201 1.00 33.60 ? 103 SER A CB  1 
ATOM   775  O OG  . SER A 1 103 ? -2.995  90.716 40.485 1.00 36.95 ? 103 SER A OG  1 
ATOM   776  N N   . PRO A 1 104 ? -0.464  89.891 38.178 1.00 39.36 ? 104 PRO A N   1 
ATOM   777  C CA  . PRO A 1 104 ? -1.536  89.364 37.338 1.00 34.51 ? 104 PRO A CA  1 
ATOM   778  C C   . PRO A 1 104 ? -1.392  87.856 37.227 1.00 29.79 ? 104 PRO A C   1 
ATOM   779  O O   . PRO A 1 104 ? -0.305  87.316 37.385 1.00 27.40 ? 104 PRO A O   1 
ATOM   780  C CB  . PRO A 1 104 ? -1.295  90.051 35.988 1.00 39.40 ? 104 PRO A CB  1 
ATOM   781  C CG  . PRO A 1 104 ? 0.176   90.518 35.995 1.00 40.72 ? 104 PRO A CG  1 
ATOM   782  C CD  . PRO A 1 104 ? 0.561   90.646 37.471 1.00 40.10 ? 104 PRO A CD  1 
ATOM   783  N N   . ARG A 1 105 ? -2.532  87.204 36.976 1.00 25.21 ? 105 ARG A N   1 
ATOM   784  C CA  . ARG A 1 105 ? -2.520  85.753 36.840 1.00 25.56 ? 105 ARG A CA  1 
ATOM   785  C C   . ARG A 1 105 ? -1.487  85.352 35.791 1.00 28.23 ? 105 ARG A C   1 
ATOM   786  O O   . ARG A 1 105 ? -1.502  85.940 34.720 1.00 31.77 ? 105 ARG A O   1 
ATOM   787  C CB  . ARG A 1 105 ? -3.902  85.296 36.371 1.00 23.36 ? 105 ARG A CB  1 
ATOM   788  C CG  . ARG A 1 105 ? -4.102  83.777 36.413 1.00 25.28 ? 105 ARG A CG  1 
ATOM   789  C CD  . ARG A 1 105 ? -5.452  83.331 35.826 1.00 33.93 ? 105 ARG A CD  1 
ATOM   790  N NE  . ARG A 1 105 ? -6.571  84.129 36.333 1.00 38.86 ? 105 ARG A NE  1 
ATOM   791  C CZ  . ARG A 1 105 ? -7.844  83.856 35.996 1.00 40.85 ? 105 ARG A CZ  1 
ATOM   792  N NH1 . ARG A 1 105 ? -8.146  82.852 35.176 1.00 45.02 ? 105 ARG A NH1 1 
ATOM   793  N NH2 . ARG A 1 105 ? -8.831  84.600 36.485 1.00 41.71 ? 105 ARG A NH2 1 
ATOM   794  N N   . PRO A 1 106 ? -0.605  84.386 36.088 1.00 30.08 ? 106 PRO A N   1 
ATOM   795  C CA  . PRO A 1 106 ? 0.352   83.921 35.084 1.00 30.73 ? 106 PRO A CA  1 
ATOM   796  C C   . PRO A 1 106 ? -0.389  83.037 34.076 1.00 32.25 ? 106 PRO A C   1 
ATOM   797  O O   . PRO A 1 106 ? -1.511  82.591 34.312 1.00 32.38 ? 106 PRO A O   1 
ATOM   798  C CB  . PRO A 1 106 ? 1.400   83.140 35.902 1.00 30.25 ? 106 PRO A CB  1 
ATOM   799  C CG  . PRO A 1 106 ? 0.702   82.765 37.223 1.00 31.36 ? 106 PRO A CG  1 
ATOM   800  C CD  . PRO A 1 106 ? -0.475  83.744 37.389 1.00 29.44 ? 106 PRO A CD  1 
ATOM   801  N N   . LYS A 1 107 ? 0.301   82.769 32.946 1.00 30.72 ? 107 LYS A N   1 
ATOM   802  C CA  . LYS A 1 107 ? -0.264  81.958 31.873 1.00 27.34 ? 107 LYS A CA  1 
ATOM   803  C C   . LYS A 1 107 ? -0.089  80.476 32.151 1.00 26.12 ? 107 LYS A C   1 
ATOM   804  O O   . LYS A 1 107 ? -1.005  79.674 32.119 1.00 25.20 ? 107 LYS A O   1 
ATOM   805  C CB  . LYS A 1 107 ? 0.287   82.423 30.530 1.00 28.41 ? 107 LYS A CB  1 
ATOM   806  N N   . SER A 1 108 ? 1.144   80.134 32.430 1.00 25.79 ? 108 SER A N   1 
ATOM   807  C CA  . SER A 1 108 ? 1.465   78.762 32.780 1.00 29.14 ? 108 SER A CA  1 
ATOM   808  C C   . SER A 1 108 ? 2.701   78.929 33.610 1.00 30.57 ? 108 SER A C   1 
ATOM   809  O O   . SER A 1 108 ? 3.641   79.517 33.095 1.00 30.49 ? 108 SER A O   1 
ATOM   810  C CB  . SER A 1 108 ? 1.841   77.916 31.571 1.00 28.68 ? 108 SER A CB  1 
ATOM   811  O OG  . SER A 1 108 ? 0.699   77.249 31.060 1.00 37.53 ? 108 SER A OG  1 
ATOM   812  N N   . THR A 1 109 ? 2.696   78.444 34.861 1.00 29.70 ? 109 THR A N   1 
ATOM   813  C CA  . THR A 1 109 ? 3.864   78.570 35.721 1.00 25.60 ? 109 THR A CA  1 
ATOM   814  C C   . THR A 1 109 ? 3.887   77.365 36.631 1.00 25.96 ? 109 THR A C   1 
ATOM   815  O O   . THR A 1 109 ? 2.918   76.606 36.626 1.00 28.79 ? 109 THR A O   1 
ATOM   816  C CB  . THR A 1 109 ? 3.839   79.919 36.435 1.00 22.51 ? 109 THR A CB  1 
ATOM   817  O OG1 . THR A 1 109 ? 5.133   80.163 36.970 1.00 30.15 ? 109 THR A OG1 1 
ATOM   818  C CG2 . THR A 1 109 ? 2.746   80.107 37.496 1.00 20.47 ? 109 THR A CG2 1 
ATOM   819  N N   . THR A 1 110 ? 4.999   77.202 37.372 1.00 20.30 ? 110 THR A N   1 
ATOM   820  C CA  . THR A 1 110 ? 5.191   76.072 38.277 1.00 16.91 ? 110 THR A CA  1 
ATOM   821  C C   . THR A 1 110 ? 4.161   76.062 39.382 1.00 16.26 ? 110 THR A C   1 
ATOM   822  O O   . THR A 1 110 ? 3.648   77.099 39.804 1.00 16.76 ? 110 THR A O   1 
ATOM   823  C CB  . THR A 1 110 ? 6.597   76.167 38.862 1.00 17.56 ? 110 THR A CB  1 
ATOM   824  O OG1 . THR A 1 110 ? 7.482   76.435 37.782 1.00 19.32 ? 110 THR A OG1 1 
ATOM   825  C CG2 . THR A 1 110 ? 7.093   74.903 39.562 1.00 17.74 ? 110 THR A CG2 1 
ATOM   826  N N   . VAL A 1 111 ? 3.905   74.847 39.850 1.00 12.04 ? 111 VAL A N   1 
ATOM   827  C CA  . VAL A 1 111 ? 2.933   74.650 40.884 1.00 12.71 ? 111 VAL A CA  1 
ATOM   828  C C   . VAL A 1 111 ? 3.619   73.910 42.015 1.00 13.45 ? 111 VAL A C   1 
ATOM   829  O O   . VAL A 1 111 ? 4.440   73.036 41.749 1.00 8.98  ? 111 VAL A O   1 
ATOM   830  C CB  . VAL A 1 111 ? 1.822   73.790 40.267 1.00 10.48 ? 111 VAL A CB  1 
ATOM   831  C CG1 . VAL A 1 111 ? 0.650   73.518 41.209 1.00 17.35 ? 111 VAL A CG1 1 
ATOM   832  C CG2 . VAL A 1 111 ? 1.294   74.387 38.961 1.00 10.89 ? 111 VAL A CG2 1 
ATOM   833  N N   . MET A 1 112 ? 3.268   74.270 43.272 1.00 13.92 ? 112 MET A N   1 
ATOM   834  C CA  . MET A 1 112 ? 3.810   73.625 44.465 1.00 8.38  ? 112 MET A CA  1 
ATOM   835  C C   . MET A 1 112 ? 2.588   73.253 45.273 1.00 10.42 ? 112 MET A C   1 
ATOM   836  O O   . MET A 1 112 ? 1.780   74.125 45.580 1.00 12.73 ? 112 MET A O   1 
ATOM   837  C CB  . MET A 1 112 ? 4.730   74.574 45.226 1.00 2.88  ? 112 MET A CB  1 
ATOM   838  C CG  . MET A 1 112 ? 5.907   75.036 44.352 1.00 2.00  ? 112 MET A CG  1 
ATOM   839  S SD  . MET A 1 112 ? 7.230   75.786 45.353 1.00 8.80  ? 112 MET A SD  1 
ATOM   840  C CE  . MET A 1 112 ? 7.892   74.272 46.113 1.00 5.32  ? 112 MET A CE  1 
ATOM   841  N N   . VAL A 1 113 ? 2.431   71.954 45.563 1.00 9.72  ? 113 VAL A N   1 
ATOM   842  C CA  . VAL A 1 113 ? 1.284   71.466 46.333 1.00 9.94  ? 113 VAL A CA  1 
ATOM   843  C C   . VAL A 1 113 ? 1.840   71.047 47.683 1.00 12.79 ? 113 VAL A C   1 
ATOM   844  O O   . VAL A 1 113 ? 2.714   70.192 47.747 1.00 17.85 ? 113 VAL A O   1 
ATOM   845  C CB  . VAL A 1 113 ? 0.700   70.192 45.662 1.00 8.48  ? 113 VAL A CB  1 
ATOM   846  C CG1 . VAL A 1 113 ? -0.476  69.582 46.422 1.00 5.76  ? 113 VAL A CG1 1 
ATOM   847  C CG2 . VAL A 1 113 ? 0.339   70.337 44.185 1.00 5.88  ? 113 VAL A CG2 1 
ATOM   848  N N   . TRP A 1 114 ? 1.310   71.613 48.756 1.00 13.62 ? 114 TRP A N   1 
ATOM   849  C CA  . TRP A 1 114 ? 1.767   71.319 50.113 1.00 13.84 ? 114 TRP A CA  1 
ATOM   850  C C   . TRP A 1 114 ? 0.871   70.289 50.789 1.00 13.20 ? 114 TRP A C   1 
ATOM   851  O O   . TRP A 1 114 ? -0.340  70.506 50.888 1.00 16.95 ? 114 TRP A O   1 
ATOM   852  C CB  . TRP A 1 114 ? 1.693   72.653 50.908 1.00 15.62 ? 114 TRP A CB  1 
ATOM   853  C CG  . TRP A 1 114 ? 2.009   72.493 52.386 1.00 16.04 ? 114 TRP A CG  1 
ATOM   854  C CD1 . TRP A 1 114 ? 1.093   72.608 53.465 1.00 16.62 ? 114 TRP A CD1 1 
ATOM   855  C CD2 . TRP A 1 114 ? 3.257   72.186 52.940 1.00 12.64 ? 114 TRP A CD2 1 
ATOM   856  N NE1 . TRP A 1 114 ? 1.724   72.376 54.643 1.00 14.39 ? 114 TRP A NE1 1 
ATOM   857  C CE2 . TRP A 1 114 ? 3.044   72.106 54.395 1.00 10.99 ? 114 TRP A CE2 1 
ATOM   858  C CE3 . TRP A 1 114 ? 4.520   71.943 52.408 1.00 12.85 ? 114 TRP A CE3 1 
ATOM   859  C CZ2 . TRP A 1 114 ? 4.130   71.810 55.211 1.00 10.13 ? 114 TRP A CZ2 1 
ATOM   860  C CZ3 . TRP A 1 114 ? 5.589   71.640 53.260 1.00 9.96  ? 114 TRP A CZ3 1 
ATOM   861  C CH2 . TRP A 1 114 ? 5.392   71.573 54.643 1.00 9.36  ? 114 TRP A CH2 1 
ATOM   862  N N   . ILE A 1 115 ? 1.487   69.200 51.262 1.00 12.94 ? 115 ILE A N   1 
ATOM   863  C CA  . ILE A 1 115 ? 0.812   68.126 51.991 1.00 11.91 ? 115 ILE A CA  1 
ATOM   864  C C   . ILE A 1 115 ? 1.353   68.264 53.426 1.00 17.84 ? 115 ILE A C   1 
ATOM   865  O O   . ILE A 1 115 ? 2.548   68.034 53.654 1.00 21.48 ? 115 ILE A O   1 
ATOM   866  C CB  . ILE A 1 115 ? 1.185   66.764 51.380 1.00 8.50  ? 115 ILE A CB  1 
ATOM   867  C CG1 . ILE A 1 115 ? 1.022   66.806 49.833 1.00 6.95  ? 115 ILE A CG1 1 
ATOM   868  C CG2 . ILE A 1 115 ? 0.438   65.597 52.059 1.00 2.50  ? 115 ILE A CG2 1 
ATOM   869  C CD1 . ILE A 1 115 ? 1.134   65.447 49.121 1.00 5.12  ? 115 ILE A CD1 1 
ATOM   870  N N   . TYR A 1 116 ? 0.453   68.652 54.372 1.00 16.62 ? 116 TYR A N   1 
ATOM   871  C CA  . TYR A 1 116 ? 0.810   68.865 55.784 1.00 11.94 ? 116 TYR A CA  1 
ATOM   872  C C   . TYR A 1 116 ? 1.152   67.614 56.581 1.00 14.71 ? 116 TYR A C   1 
ATOM   873  O O   . TYR A 1 116 ? 0.761   66.489 56.293 1.00 16.59 ? 116 TYR A O   1 
ATOM   874  C CB  . TYR A 1 116 ? -0.278  69.648 56.545 1.00 9.80  ? 116 TYR A CB  1 
ATOM   875  C CG  . TYR A 1 116 ? -1.647  69.008 56.579 1.00 8.10  ? 116 TYR A CG  1 
ATOM   876  C CD1 . TYR A 1 116 ? -1.881  67.740 57.158 1.00 9.71  ? 116 TYR A CD1 1 
ATOM   877  C CD2 . TYR A 1 116 ? -2.725  69.704 56.022 1.00 7.13  ? 116 TYR A CD2 1 
ATOM   878  C CE1 . TYR A 1 116 ? -3.169  67.182 57.164 1.00 6.62  ? 116 TYR A CE1 1 
ATOM   879  C CE2 . TYR A 1 116 ? -4.006  69.153 56.019 1.00 3.94  ? 116 TYR A CE2 1 
ATOM   880  C CZ  . TYR A 1 116 ? -4.225  67.898 56.586 1.00 4.37  ? 116 TYR A CZ  1 
ATOM   881  O OH  . TYR A 1 116 ? -5.500  67.391 56.594 1.00 10.79 ? 116 TYR A OH  1 
ATOM   882  N N   . GLY A 1 117 ? 1.886   67.862 57.656 1.00 16.91 ? 117 GLY A N   1 
ATOM   883  C CA  . GLY A 1 117 ? 2.315   66.812 58.550 1.00 14.98 ? 117 GLY A CA  1 
ATOM   884  C C   . GLY A 1 117 ? 1.378   66.772 59.725 1.00 16.30 ? 117 GLY A C   1 
ATOM   885  O O   . GLY A 1 117 ? 0.361   67.469 59.779 1.00 13.80 ? 117 GLY A O   1 
ATOM   886  N N   . GLY A 1 118 ? 1.802   65.935 60.691 1.00 17.02 ? 118 GLY A N   1 
ATOM   887  C CA  . GLY A 1 118 ? 1.026   65.735 61.919 1.00 11.44 ? 118 GLY A CA  1 
ATOM   888  C C   . GLY A 1 118 ? 0.969   64.274 62.377 1.00 8.72  ? 118 GLY A C   1 
ATOM   889  O O   . GLY A 1 118 ? -0.008  63.845 62.978 1.00 5.62  ? 118 GLY A O   1 
ATOM   890  N N   . GLY A 1 119 ? 2.020   63.492 62.055 1.00 2.00  ? 119 GLY A N   1 
ATOM   891  C CA  . GLY A 1 119 ? 1.985   62.085 62.487 1.00 5.94  ? 119 GLY A CA  1 
ATOM   892  C C   . GLY A 1 119 ? 0.749   61.270 62.079 1.00 8.79  ? 119 GLY A C   1 
ATOM   893  O O   . GLY A 1 119 ? 0.359   60.285 62.688 1.00 13.50 ? 119 GLY A O   1 
ATOM   894  N N   . PHE A 1 120 ? 0.105   61.718 61.013 1.00 11.22 ? 120 PHE A N   1 
ATOM   895  C CA  . PHE A 1 120 ? -1.093  61.067 60.490 1.00 12.14 ? 120 PHE A CA  1 
ATOM   896  C C   . PHE A 1 120 ? -2.344  61.235 61.335 1.00 15.23 ? 120 PHE A C   1 
ATOM   897  O O   . PHE A 1 120 ? -3.405  60.852 60.864 1.00 15.16 ? 120 PHE A O   1 
ATOM   898  C CB  . PHE A 1 120 ? -0.898  59.592 60.086 1.00 11.92 ? 120 PHE A CB  1 
ATOM   899  C CG  . PHE A 1 120 ? -0.021  59.437 58.865 1.00 11.41 ? 120 PHE A CG  1 
ATOM   900  C CD1 . PHE A 1 120 ? -0.517  59.828 57.608 1.00 11.70 ? 120 PHE A CD1 1 
ATOM   901  C CD2 . PHE A 1 120 ? 1.272   58.896 58.957 1.00 12.73 ? 120 PHE A CD2 1 
ATOM   902  C CE1 . PHE A 1 120 ? 0.257   59.674 56.456 1.00 11.52 ? 120 PHE A CE1 1 
ATOM   903  C CE2 . PHE A 1 120 ? 2.049   58.734 57.798 1.00 14.44 ? 120 PHE A CE2 1 
ATOM   904  C CZ  . PHE A 1 120 ? 1.542   59.125 56.554 1.00 14.34 ? 120 PHE A CZ  1 
ATOM   905  N N   . TYR A 1 121 ? -2.252  61.817 62.554 1.00 19.62 ? 121 TYR A N   1 
ATOM   906  C CA  . TYR A 1 121 ? -3.430  62.023 63.438 1.00 13.61 ? 121 TYR A CA  1 
ATOM   907  C C   . TYR A 1 121 ? -3.834  63.487 63.533 1.00 12.90 ? 121 TYR A C   1 
ATOM   908  O O   . TYR A 1 121 ? -4.836  63.806 64.170 1.00 15.56 ? 121 TYR A O   1 
ATOM   909  C CB  . TYR A 1 121 ? -3.222  61.517 64.891 1.00 11.91 ? 121 TYR A CB  1 
ATOM   910  C CG  . TYR A 1 121 ? -2.162  62.299 65.637 1.00 11.99 ? 121 TYR A CG  1 
ATOM   911  C CD1 . TYR A 1 121 ? -0.821  61.913 65.545 1.00 12.64 ? 121 TYR A CD1 1 
ATOM   912  C CD2 . TYR A 1 121 ? -2.498  63.446 66.378 1.00 8.96  ? 121 TYR A CD2 1 
ATOM   913  C CE1 . TYR A 1 121 ? 0.169   62.668 66.173 1.00 16.39 ? 121 TYR A CE1 1 
ATOM   914  C CE2 . TYR A 1 121 ? -1.511  64.207 67.010 1.00 10.84 ? 121 TYR A CE2 1 
ATOM   915  C CZ  . TYR A 1 121 ? -0.169  63.811 66.912 1.00 16.22 ? 121 TYR A CZ  1 
ATOM   916  O OH  . TYR A 1 121 ? 0.852   64.505 67.542 1.00 20.04 ? 121 TYR A OH  1 
ATOM   917  N N   . SER A 1 122 ? -3.043  64.388 62.951 1.00 12.66 ? 122 SER A N   1 
ATOM   918  C CA  . SER A 1 122 ? -3.433  65.783 63.028 1.00 13.78 ? 122 SER A CA  1 
ATOM   919  C C   . SER A 1 122 ? -2.996  66.469 61.746 1.00 15.52 ? 122 SER A C   1 
ATOM   920  O O   . SER A 1 122 ? -2.343  65.840 60.917 1.00 19.00 ? 122 SER A O   1 
ATOM   921  C CB  . SER A 1 122 ? -2.833  66.390 64.309 1.00 15.76 ? 122 SER A CB  1 
ATOM   922  O OG  . SER A 1 122 ? -1.385  66.399 64.278 1.00 15.94 ? 122 SER A OG  1 
ATOM   923  N N   . GLY A 1 123 ? -3.381  67.749 61.621 1.00 14.94 ? 123 GLY A N   1 
ATOM   924  C CA  . GLY A 1 123 ? -2.982  68.541 60.481 1.00 12.91 ? 123 GLY A CA  1 
ATOM   925  C C   . GLY A 1 123 ? -4.081  69.464 59.985 1.00 14.38 ? 123 GLY A C   1 
ATOM   926  O O   . GLY A 1 123 ? -5.277  69.204 60.076 1.00 17.47 ? 123 GLY A O   1 
ATOM   927  N N   . SER A 1 124 ? -3.667  70.609 59.463 1.00 12.13 ? 124 SER A N   1 
ATOM   928  C CA  . SER A 1 124 ? -4.608  71.546 58.902 1.00 15.36 ? 124 SER A CA  1 
ATOM   929  C C   . SER A 1 124 ? -3.839  72.263 57.826 1.00 19.62 ? 124 SER A C   1 
ATOM   930  O O   . SER A 1 124 ? -2.623  72.360 57.868 1.00 21.18 ? 124 SER A O   1 
ATOM   931  C CB  . SER A 1 124 ? -5.124  72.554 59.919 1.00 16.61 ? 124 SER A CB  1 
ATOM   932  O OG  . SER A 1 124 ? -5.954  71.920 60.876 1.00 22.82 ? 124 SER A OG  1 
ATOM   933  N N   . SER A 1 125 ? -4.571  72.752 56.839 1.00 20.53 ? 125 SER A N   1 
ATOM   934  C CA  . SER A 1 125 ? -3.953  73.469 55.739 1.00 19.71 ? 125 SER A CA  1 
ATOM   935  C C   . SER A 1 125 ? -4.045  74.981 55.940 1.00 19.53 ? 125 SER A C   1 
ATOM   936  O O   . SER A 1 125 ? -3.391  75.776 55.296 1.00 23.23 ? 125 SER A O   1 
ATOM   937  C CB  . SER A 1 125 ? -4.691  73.059 54.458 1.00 16.00 ? 125 SER A CB  1 
ATOM   938  O OG  . SER A 1 125 ? -6.096  73.286 54.626 1.00 20.88 ? 125 SER A OG  1 
ATOM   939  N N   . THR A 1 126 ? -4.918  75.336 56.865 1.00 17.15 ? 126 THR A N   1 
ATOM   940  C CA  . THR A 1 126 ? -5.267  76.683 57.258 1.00 16.37 ? 126 THR A CA  1 
ATOM   941  C C   . THR A 1 126 ? -4.343  77.317 58.289 1.00 15.76 ? 126 THR A C   1 
ATOM   942  O O   . THR A 1 126 ? -4.533  78.441 58.740 1.00 19.46 ? 126 THR A O   1 
ATOM   943  C CB  . THR A 1 126 ? -6.684  76.536 57.859 1.00 18.02 ? 126 THR A CB  1 
ATOM   944  O OG1 . THR A 1 126 ? -6.568  75.606 58.952 1.00 21.85 ? 126 THR A OG1 1 
ATOM   945  C CG2 . THR A 1 126 ? -7.685  75.878 56.882 1.00 14.37 ? 126 THR A CG2 1 
ATOM   946  N N   . LEU A 1 127 ? -3.337  76.562 58.719 1.00 13.50 ? 127 LEU A N   1 
ATOM   947  C CA  . LEU A 1 127 ? -2.451  77.133 59.722 1.00 11.70 ? 127 LEU A CA  1 
ATOM   948  C C   . LEU A 1 127 ? -1.705  78.306 59.147 1.00 12.34 ? 127 LEU A C   1 
ATOM   949  O O   . LEU A 1 127 ? -1.409  78.366 57.975 1.00 17.17 ? 127 LEU A O   1 
ATOM   950  C CB  . LEU A 1 127 ? -1.422  76.104 60.212 1.00 9.96  ? 127 LEU A CB  1 
ATOM   951  C CG  . LEU A 1 127 ? -2.002  74.756 60.677 1.00 7.51  ? 127 LEU A CG  1 
ATOM   952  C CD1 . LEU A 1 127 ? -0.870  73.911 61.282 1.00 9.80  ? 127 LEU A CD1 1 
ATOM   953  C CD2 . LEU A 1 127 ? -3.143  74.925 61.696 1.00 6.16  ? 127 LEU A CD2 1 
ATOM   954  N N   . ASP A 1 128 ? -1.321  79.238 59.977 1.00 13.92 ? 128 ASP A N   1 
ATOM   955  C CA  . ASP A 1 128 ? -0.609  80.406 59.501 1.00 16.51 ? 128 ASP A CA  1 
ATOM   956  C C   . ASP A 1 128 ? 0.772   80.081 59.013 1.00 15.68 ? 128 ASP A C   1 
ATOM   957  O O   . ASP A 1 128 ? 1.313   80.837 58.228 1.00 18.82 ? 128 ASP A O   1 
ATOM   958  C CB  . ASP A 1 128 ? -0.487  81.527 60.544 1.00 23.30 ? 128 ASP A CB  1 
ATOM   959  C CG  . ASP A 1 128 ? -1.804  82.083 61.084 1.00 28.62 ? 128 ASP A CG  1 
ATOM   960  O OD1 . ASP A 1 128 ? -2.870  81.733 60.572 1.00 36.47 ? 128 ASP A OD1 1 
ATOM   961  O OD2 . ASP A 1 128 ? -1.751  82.873 62.029 1.00 35.21 ? 128 ASP A OD2 1 
ATOM   962  N N   . VAL A 1 129 ? 1.374   78.973 59.458 1.00 16.76 ? 129 VAL A N   1 
ATOM   963  C CA  . VAL A 1 129 ? 2.721   78.716 58.919 1.00 17.51 ? 129 VAL A CA  1 
ATOM   964  C C   . VAL A 1 129 ? 2.614   78.002 57.572 1.00 20.95 ? 129 VAL A C   1 
ATOM   965  O O   . VAL A 1 129 ? 3.617   77.561 57.037 1.00 24.78 ? 129 VAL A O   1 
ATOM   966  C CB  . VAL A 1 129 ? 3.617   77.937 59.912 1.00 9.97  ? 129 VAL A CB  1 
ATOM   967  C CG1 . VAL A 1 129 ? 4.157   78.846 61.020 1.00 15.67 ? 129 VAL A CG1 1 
ATOM   968  C CG2 . VAL A 1 129 ? 2.894   76.746 60.546 1.00 7.52  ? 129 VAL A CG2 1 
ATOM   969  N N   . TYR A 1 130 ? 1.381   77.844 57.063 1.00 17.72 ? 130 TYR A N   1 
ATOM   970  C CA  . TYR A 1 130 ? 1.176   77.188 55.783 1.00 15.58 ? 130 TYR A CA  1 
ATOM   971  C C   . TYR A 1 130 ? 0.429   78.157 54.867 1.00 22.21 ? 130 TYR A C   1 
ATOM   972  O O   . TYR A 1 130 ? -0.228  77.797 53.894 1.00 24.39 ? 130 TYR A O   1 
ATOM   973  C CB  . TYR A 1 130 ? 0.299   75.934 55.952 1.00 11.62 ? 130 TYR A CB  1 
ATOM   974  C CG  . TYR A 1 130 ? 0.825   74.823 56.857 1.00 9.44  ? 130 TYR A CG  1 
ATOM   975  C CD1 . TYR A 1 130 ? 2.180   74.673 57.197 1.00 5.49  ? 130 TYR A CD1 1 
ATOM   976  C CD2 . TYR A 1 130 ? -0.092  73.884 57.363 1.00 8.88  ? 130 TYR A CD2 1 
ATOM   977  C CE1 . TYR A 1 130 ? 2.591   73.611 58.022 1.00 6.11  ? 130 TYR A CE1 1 
ATOM   978  C CE2 . TYR A 1 130 ? 0.320   72.812 58.171 1.00 5.33  ? 130 TYR A CE2 1 
ATOM   979  C CZ  . TYR A 1 130 ? 1.671   72.666 58.500 1.00 7.17  ? 130 TYR A CZ  1 
ATOM   980  O OH  . TYR A 1 130 ? 2.143   71.595 59.244 1.00 4.45  ? 130 TYR A OH  1 
ATOM   981  N N   . ASN A 1 131 ? 0.493   79.452 55.222 1.00 24.81 ? 131 ASN A N   1 
ATOM   982  C CA  . ASN A 1 131 ? -0.197  80.445 54.400 1.00 23.92 ? 131 ASN A CA  1 
ATOM   983  C C   . ASN A 1 131 ? 0.734   80.708 53.237 1.00 23.49 ? 131 ASN A C   1 
ATOM   984  O O   . ASN A 1 131 ? 1.803   81.283 53.393 1.00 25.76 ? 131 ASN A O   1 
ATOM   985  C CB  . ASN A 1 131 ? -0.482  81.708 55.217 1.00 24.47 ? 131 ASN A CB  1 
ATOM   986  C CG  . ASN A 1 131 ? -1.187  82.722 54.362 1.00 22.55 ? 131 ASN A CG  1 
ATOM   987  O OD1 . ASN A 1 131 ? -0.626  83.207 53.402 1.00 22.56 ? 131 ASN A OD1 1 
ATOM   988  N ND2 . ASN A 1 131 ? -2.427  83.044 54.691 1.00 27.84 ? 131 ASN A ND2 1 
ATOM   989  N N   . GLY A 1 132 ? 0.325   80.257 52.049 1.00 25.22 ? 132 GLY A N   1 
ATOM   990  C CA  . GLY A 1 132 ? 1.201   80.415 50.887 1.00 24.01 ? 132 GLY A CA  1 
ATOM   991  C C   . GLY A 1 132 ? 1.292   81.780 50.223 1.00 24.53 ? 132 GLY A C   1 
ATOM   992  O O   . GLY A 1 132 ? 1.938   81.880 49.181 1.00 22.81 ? 132 GLY A O   1 
ATOM   993  N N   . LYS A 1 133 ? 0.691   82.840 50.796 1.00 23.16 ? 133 LYS A N   1 
ATOM   994  C CA  . LYS A 1 133 ? 0.787   84.142 50.126 1.00 20.32 ? 133 LYS A CA  1 
ATOM   995  C C   . LYS A 1 133 ? 2.206   84.627 49.859 1.00 20.65 ? 133 LYS A C   1 
ATOM   996  O O   . LYS A 1 133 ? 2.522   85.208 48.831 1.00 21.83 ? 133 LYS A O   1 
ATOM   997  C CB  . LYS A 1 133 ? 0.023   85.259 50.877 1.00 16.95 ? 133 LYS A CB  1 
ATOM   998  C CG  . LYS A 1 133 ? 0.713   85.863 52.142 1.00 22.40 ? 133 LYS A CG  1 
ATOM   999  C CD  . LYS A 1 133 ? -0.033  87.022 52.852 1.00 20.59 ? 133 LYS A CD  1 
ATOM   1000 C CE  . LYS A 1 133 ? -1.463  86.654 53.243 1.00 30.03 ? 133 LYS A CE  1 
ATOM   1001 N NZ  . LYS A 1 133 ? -2.093  87.733 53.974 1.00 36.80 ? 133 LYS A NZ  1 
ATOM   1002 N N   . TYR A 1 134 ? 3.082   84.366 50.816 1.00 21.50 ? 134 TYR A N   1 
ATOM   1003 C CA  . TYR A 1 134 ? 4.442   84.873 50.659 1.00 22.90 ? 134 TYR A CA  1 
ATOM   1004 C C   . TYR A 1 134 ? 5.211   84.124 49.615 1.00 22.76 ? 134 TYR A C   1 
ATOM   1005 O O   . TYR A 1 134 ? 5.920   84.695 48.808 1.00 22.22 ? 134 TYR A O   1 
ATOM   1006 C CB  . TYR A 1 134 ? 5.214   84.878 52.002 1.00 25.06 ? 134 TYR A CB  1 
ATOM   1007 C CG  . TYR A 1 134 ? 4.405   85.495 53.122 1.00 25.21 ? 134 TYR A CG  1 
ATOM   1008 C CD1 . TYR A 1 134 ? 4.387   86.883 53.331 1.00 26.12 ? 134 TYR A CD1 1 
ATOM   1009 C CD2 . TYR A 1 134 ? 3.620   84.668 53.938 1.00 27.87 ? 134 TYR A CD2 1 
ATOM   1010 C CE1 . TYR A 1 134 ? 3.581   87.440 54.333 1.00 29.44 ? 134 TYR A CE1 1 
ATOM   1011 C CE2 . TYR A 1 134 ? 2.807   85.215 54.935 1.00 30.74 ? 134 TYR A CE2 1 
ATOM   1012 C CZ  . TYR A 1 134 ? 2.783   86.605 55.135 1.00 32.62 ? 134 TYR A CZ  1 
ATOM   1013 O OH  . TYR A 1 134 ? 1.969   87.160 56.108 1.00 36.70 ? 134 TYR A OH  1 
ATOM   1014 N N   . LEU A 1 135 ? 5.041   82.804 49.612 1.00 25.17 ? 135 LEU A N   1 
ATOM   1015 C CA  . LEU A 1 135 ? 5.786   82.023 48.620 1.00 22.13 ? 135 LEU A CA  1 
ATOM   1016 C C   . LEU A 1 135 ? 5.305   82.336 47.200 1.00 23.51 ? 135 LEU A C   1 
ATOM   1017 O O   . LEU A 1 135 ? 6.081   82.613 46.287 1.00 23.54 ? 135 LEU A O   1 
ATOM   1018 C CB  . LEU A 1 135 ? 5.709   80.520 48.958 1.00 13.03 ? 135 LEU A CB  1 
ATOM   1019 C CG  . LEU A 1 135 ? 6.761   79.635 48.278 1.00 9.29  ? 135 LEU A CG  1 
ATOM   1020 C CD1 . LEU A 1 135 ? 8.181   80.179 48.469 1.00 6.96  ? 135 LEU A CD1 1 
ATOM   1021 C CD2 . LEU A 1 135 ? 6.710   78.203 48.836 1.00 2.00  ? 135 LEU A CD2 1 
ATOM   1022 N N   . ALA A 1 136 ? 3.969   82.313 47.054 1.00 22.76 ? 136 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 136 ? 3.352   82.583 45.765 1.00 22.99 ? 136 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 136 ? 3.797   83.909 45.190 1.00 26.43 ? 136 ALA A C   1 
ATOM   1025 O O   . ALA A 1 136 ? 4.072   84.061 44.008 1.00 31.51 ? 136 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 136 ? 1.822   82.620 45.886 1.00 24.06 ? 136 ALA A CB  1 
ATOM   1027 N N   . TYR A 1 137 ? 3.864   84.891 46.075 1.00 25.08 ? 137 TYR A N   1 
ATOM   1028 C CA  . TYR A 1 137 ? 4.259   86.228 45.667 1.00 21.07 ? 137 TYR A CA  1 
ATOM   1029 C C   . TYR A 1 137 ? 5.752   86.352 45.390 1.00 19.78 ? 137 TYR A C   1 
ATOM   1030 O O   . TYR A 1 137 ? 6.186   86.678 44.302 1.00 22.62 ? 137 TYR A O   1 
ATOM   1031 C CB  . TYR A 1 137 ? 3.776   87.176 46.780 1.00 21.86 ? 137 TYR A CB  1 
ATOM   1032 C CG  . TYR A 1 137 ? 4.207   88.596 46.587 1.00 25.22 ? 137 TYR A CG  1 
ATOM   1033 C CD1 . TYR A 1 137 ? 5.469   89.006 47.056 1.00 26.11 ? 137 TYR A CD1 1 
ATOM   1034 C CD2 . TYR A 1 137 ? 3.390   89.502 45.897 1.00 27.33 ? 137 TYR A CD2 1 
ATOM   1035 C CE1 . TYR A 1 137 ? 5.934   90.303 46.813 1.00 26.02 ? 137 TYR A CE1 1 
ATOM   1036 C CE2 . TYR A 1 137 ? 3.861   90.803 45.650 1.00 29.82 ? 137 TYR A CE2 1 
ATOM   1037 C CZ  . TYR A 1 137 ? 5.131   91.205 46.099 1.00 27.30 ? 137 TYR A CZ  1 
ATOM   1038 O OH  . TYR A 1 137 ? 5.590   92.473 45.816 1.00 30.83 ? 137 TYR A OH  1 
ATOM   1039 N N   . THR A 1 138 ? 6.561   86.075 46.389 1.00 20.97 ? 138 THR A N   1 
ATOM   1040 C CA  . THR A 1 138 ? 7.994   86.219 46.226 1.00 20.55 ? 138 THR A CA  1 
ATOM   1041 C C   . THR A 1 138 ? 8.594   85.388 45.105 1.00 19.98 ? 138 THR A C   1 
ATOM   1042 O O   . THR A 1 138 ? 9.536   85.824 44.465 1.00 22.83 ? 138 THR A O   1 
ATOM   1043 C CB  . THR A 1 138 ? 8.658   85.913 47.603 1.00 23.61 ? 138 THR A CB  1 
ATOM   1044 O OG1 . THR A 1 138 ? 8.013   86.675 48.628 1.00 26.10 ? 138 THR A OG1 1 
ATOM   1045 C CG2 . THR A 1 138 ? 10.153  86.255 47.751 1.00 24.64 ? 138 THR A CG2 1 
ATOM   1046 N N   . GLU A 1 139 ? 8.076   84.177 44.875 1.00 20.94 ? 139 GLU A N   1 
ATOM   1047 C CA  . GLU A 1 139 ? 8.660   83.342 43.822 1.00 20.56 ? 139 GLU A CA  1 
ATOM   1048 C C   . GLU A 1 139 ? 7.784   83.199 42.580 1.00 24.47 ? 139 GLU A C   1 
ATOM   1049 O O   . GLU A 1 139 ? 8.175   82.603 41.583 1.00 25.05 ? 139 GLU A O   1 
ATOM   1050 C CB  . GLU A 1 139 ? 9.037   81.968 44.390 1.00 14.12 ? 139 GLU A CB  1 
ATOM   1051 C CG  . GLU A 1 139 ? 10.209  82.052 45.386 1.00 17.03 ? 139 GLU A CG  1 
ATOM   1052 C CD  . GLU A 1 139 ? 11.524  82.428 44.705 1.00 24.78 ? 139 GLU A CD  1 
ATOM   1053 O OE1 . GLU A 1 139 ? 11.720  82.081 43.540 1.00 26.19 ? 139 GLU A OE1 1 
ATOM   1054 O OE2 . GLU A 1 139 ? 12.362  83.065 45.341 1.00 27.39 ? 139 GLU A OE2 1 
ATOM   1055 N N   . GLU A 1 140 ? 6.575   83.751 42.655 1.00 25.50 ? 140 GLU A N   1 
ATOM   1056 C CA  . GLU A 1 140 ? 5.678   83.684 41.516 1.00 25.77 ? 140 GLU A CA  1 
ATOM   1057 C C   . GLU A 1 140 ? 5.417   82.271 41.083 1.00 23.21 ? 140 GLU A C   1 
ATOM   1058 O O   . GLU A 1 140 ? 5.790   81.845 40.001 1.00 24.20 ? 140 GLU A O   1 
ATOM   1059 C CB  . GLU A 1 140 ? 6.182   84.550 40.358 1.00 31.13 ? 140 GLU A CB  1 
ATOM   1060 C CG  . GLU A 1 140 ? 6.341   86.013 40.826 1.00 42.92 ? 140 GLU A CG  1 
ATOM   1061 C CD  . GLU A 1 140 ? 7.014   86.896 39.795 1.00 46.01 ? 140 GLU A CD  1 
ATOM   1062 O OE1 . GLU A 1 140 ? 8.247   86.987 39.816 1.00 48.31 ? 140 GLU A OE1 1 
ATOM   1063 O OE2 . GLU A 1 140 ? 6.300   87.494 38.988 1.00 48.93 ? 140 GLU A OE2 1 
ATOM   1064 N N   . VAL A 1 141 ? 4.758   81.551 41.978 1.00 19.10 ? 141 VAL A N   1 
ATOM   1065 C CA  . VAL A 1 141 ? 4.408   80.193 41.681 1.00 16.20 ? 141 VAL A CA  1 
ATOM   1066 C C   . VAL A 1 141 ? 2.971   80.098 42.117 1.00 17.91 ? 141 VAL A C   1 
ATOM   1067 O O   . VAL A 1 141 ? 2.477   80.967 42.828 1.00 19.30 ? 141 VAL A O   1 
ATOM   1068 C CB  . VAL A 1 141 ? 5.310   79.223 42.464 1.00 13.59 ? 141 VAL A CB  1 
ATOM   1069 C CG1 . VAL A 1 141 ? 6.789   79.545 42.267 1.00 14.93 ? 141 VAL A CG1 1 
ATOM   1070 C CG2 . VAL A 1 141 ? 5.016   79.148 43.974 1.00 15.84 ? 141 VAL A CG2 1 
ATOM   1071 N N   . VAL A 1 142 ? 2.297   79.049 41.667 1.00 19.99 ? 142 VAL A N   1 
ATOM   1072 C CA  . VAL A 1 142 ? 0.929   78.836 42.099 1.00 21.84 ? 142 VAL A CA  1 
ATOM   1073 C C   . VAL A 1 142 ? 1.158   77.865 43.278 1.00 25.41 ? 142 VAL A C   1 
ATOM   1074 O O   . VAL A 1 142 ? 1.933   76.905 43.156 1.00 28.57 ? 142 VAL A O   1 
ATOM   1075 C CB  . VAL A 1 142 ? 0.102   78.239 40.935 1.00 16.98 ? 142 VAL A CB  1 
ATOM   1076 C CG1 . VAL A 1 142 ? -1.294  77.780 41.354 1.00 13.15 ? 142 VAL A CG1 1 
ATOM   1077 C CG2 . VAL A 1 142 ? -0.015  79.247 39.779 1.00 14.31 ? 142 VAL A CG2 1 
ATOM   1078 N N   . LEU A 1 143 ? 0.506   78.116 44.421 1.00 20.39 ? 143 LEU A N   1 
ATOM   1079 C CA  . LEU A 1 143 ? 0.739   77.203 45.521 1.00 16.77 ? 143 LEU A CA  1 
ATOM   1080 C C   . LEU A 1 143 ? -0.568  76.675 45.998 1.00 14.76 ? 143 LEU A C   1 
ATOM   1081 O O   . LEU A 1 143 ? -1.495  77.470 46.130 1.00 16.15 ? 143 LEU A O   1 
ATOM   1082 C CB  . LEU A 1 143 ? 1.421   77.980 46.647 1.00 18.86 ? 143 LEU A CB  1 
ATOM   1083 C CG  . LEU A 1 143 ? 2.033   77.054 47.721 1.00 21.71 ? 143 LEU A CG  1 
ATOM   1084 C CD1 . LEU A 1 143 ? 3.315   77.673 48.226 1.00 23.56 ? 143 LEU A CD1 1 
ATOM   1085 C CD2 . LEU A 1 143 ? 1.098   76.749 48.911 1.00 25.64 ? 143 LEU A CD2 1 
ATOM   1086 N N   . VAL A 1 144 ? -0.655  75.366 46.252 1.00 10.75 ? 144 VAL A N   1 
ATOM   1087 C CA  . VAL A 1 144 ? -1.919  74.860 46.755 1.00 14.28 ? 144 VAL A CA  1 
ATOM   1088 C C   . VAL A 1 144 ? -1.633  74.090 48.043 1.00 17.51 ? 144 VAL A C   1 
ATOM   1089 O O   . VAL A 1 144 ? -0.498  73.691 48.307 1.00 17.97 ? 144 VAL A O   1 
ATOM   1090 C CB  . VAL A 1 144 ? -2.686  74.015 45.688 1.00 13.80 ? 144 VAL A CB  1 
ATOM   1091 C CG1 . VAL A 1 144 ? -2.732  74.691 44.318 1.00 12.20 ? 144 VAL A CG1 1 
ATOM   1092 C CG2 . VAL A 1 144 ? -2.147  72.612 45.491 1.00 12.87 ? 144 VAL A CG2 1 
ATOM   1093 N N   . SER A 1 145 ? -2.688  73.863 48.838 1.00 18.01 ? 145 SER A N   1 
ATOM   1094 C CA  . SER A 1 145 ? -2.565  73.094 50.077 1.00 16.75 ? 145 SER A CA  1 
ATOM   1095 C C   . SER A 1 145 ? -3.721  72.102 50.093 1.00 18.35 ? 145 SER A C   1 
ATOM   1096 O O   . SER A 1 145 ? -4.841  72.534 49.830 1.00 21.33 ? 145 SER A O   1 
ATOM   1097 C CB  . SER A 1 145 ? -2.752  73.997 51.294 1.00 14.17 ? 145 SER A CB  1 
ATOM   1098 O OG  . SER A 1 145 ? -1.903  75.113 51.205 1.00 15.89 ? 145 SER A OG  1 
ATOM   1099 N N   . LEU A 1 146 ? -3.436  70.823 50.382 1.00 16.79 ? 146 LEU A N   1 
ATOM   1100 C CA  . LEU A 1 146 ? -4.478  69.793 50.431 1.00 18.68 ? 146 LEU A CA  1 
ATOM   1101 C C   . LEU A 1 146 ? -5.026  69.673 51.849 1.00 20.48 ? 146 LEU A C   1 
ATOM   1102 O O   . LEU A 1 146 ? -4.548  70.291 52.790 1.00 21.78 ? 146 LEU A O   1 
ATOM   1103 C CB  . LEU A 1 146 ? -3.892  68.376 50.129 1.00 16.79 ? 146 LEU A CB  1 
ATOM   1104 C CG  . LEU A 1 146 ? -2.875  68.317 48.994 1.00 14.27 ? 146 LEU A CG  1 
ATOM   1105 C CD1 . LEU A 1 146 ? -2.457  66.882 48.684 1.00 13.59 ? 146 LEU A CD1 1 
ATOM   1106 C CD2 . LEU A 1 146 ? -3.470  68.973 47.764 1.00 19.32 ? 146 LEU A CD2 1 
ATOM   1107 N N   . SER A 1 147 ? -6.012  68.801 51.976 1.00 19.32 ? 147 SER A N   1 
ATOM   1108 C CA  . SER A 1 147 ? -6.625  68.454 53.232 1.00 18.72 ? 147 SER A CA  1 
ATOM   1109 C C   . SER A 1 147 ? -6.769  66.967 53.082 1.00 19.40 ? 147 SER A C   1 
ATOM   1110 O O   . SER A 1 147 ? -6.957  66.501 51.965 1.00 22.27 ? 147 SER A O   1 
ATOM   1111 C CB  . SER A 1 147 ? -8.036  69.035 53.378 1.00 20.89 ? 147 SER A CB  1 
ATOM   1112 O OG  . SER A 1 147 ? -7.956  70.444 53.544 1.00 37.06 ? 147 SER A OG  1 
ATOM   1113 N N   . TYR A 1 148 ? -6.666  66.195 54.149 1.00 17.63 ? 148 TYR A N   1 
ATOM   1114 C CA  . TYR A 1 148 ? -6.852  64.775 54.008 1.00 13.26 ? 148 TYR A CA  1 
ATOM   1115 C C   . TYR A 1 148 ? -7.206  64.252 55.354 1.00 11.54 ? 148 TYR A C   1 
ATOM   1116 O O   . TYR A 1 148 ? -6.831  64.780 56.380 1.00 13.23 ? 148 TYR A O   1 
ATOM   1117 C CB  . TYR A 1 148 ? -5.637  64.082 53.421 1.00 14.40 ? 148 TYR A CB  1 
ATOM   1118 C CG  . TYR A 1 148 ? -4.381  64.141 54.265 1.00 9.41  ? 148 TYR A CG  1 
ATOM   1119 C CD1 . TYR A 1 148 ? -3.487  65.221 54.133 1.00 10.32 ? 148 TYR A CD1 1 
ATOM   1120 C CD2 . TYR A 1 148 ? -4.081  63.096 55.175 1.00 10.52 ? 148 TYR A CD2 1 
ATOM   1121 C CE1 . TYR A 1 148 ? -2.315  65.264 54.877 1.00 12.35 ? 148 TYR A CE1 1 
ATOM   1122 C CE2 . TYR A 1 148 ? -2.915  63.128 55.942 1.00 7.28  ? 148 TYR A CE2 1 
ATOM   1123 C CZ  . TYR A 1 148 ? -2.053  64.227 55.784 1.00 8.13  ? 148 TYR A CZ  1 
ATOM   1124 O OH  . TYR A 1 148 ? -0.947  64.277 56.571 1.00 10.17 ? 148 TYR A OH  1 
ATOM   1125 N N   . ARG A 1 149 ? -7.992  63.207 55.347 1.00 8.06  ? 149 ARG A N   1 
ATOM   1126 C CA  . ARG A 1 149 ? -8.396  62.667 56.614 1.00 7.55  ? 149 ARG A CA  1 
ATOM   1127 C C   . ARG A 1 149 ? -7.230  62.040 57.315 1.00 10.66 ? 149 ARG A C   1 
ATOM   1128 O O   . ARG A 1 149 ? -6.502  61.285 56.693 1.00 15.64 ? 149 ARG A O   1 
ATOM   1129 C CB  . ARG A 1 149 ? -9.464  61.634 56.327 1.00 2.81  ? 149 ARG A CB  1 
ATOM   1130 C CG  . ARG A 1 149 ? -10.742 62.352 55.885 1.00 4.63  ? 149 ARG A CG  1 
ATOM   1131 C CD  . ARG A 1 149 ? -11.813 61.344 55.529 1.00 7.73  ? 149 ARG A CD  1 
ATOM   1132 N NE  . ARG A 1 149 ? -11.515 60.858 54.207 1.00 6.60  ? 149 ARG A NE  1 
ATOM   1133 C CZ  . ARG A 1 149 ? -12.149 59.825 53.671 1.00 8.52  ? 149 ARG A CZ  1 
ATOM   1134 N NH1 . ARG A 1 149 ? -12.956 59.041 54.382 1.00 5.14  ? 149 ARG A NH1 1 
ATOM   1135 N NH2 . ARG A 1 149 ? -11.952 59.587 52.384 1.00 12.44 ? 149 ARG A NH2 1 
ATOM   1136 N N   . VAL A 1 150 ? -7.116  62.352 58.605 1.00 10.93 ? 150 VAL A N   1 
ATOM   1137 C CA  . VAL A 1 150 ? -6.094  61.871 59.496 1.00 9.40  ? 150 VAL A CA  1 
ATOM   1138 C C   . VAL A 1 150 ? -6.789  60.995 60.528 1.00 11.21 ? 150 VAL A C   1 
ATOM   1139 O O   . VAL A 1 150 ? -8.006  60.908 60.612 1.00 10.42 ? 150 VAL A O   1 
ATOM   1140 C CB  . VAL A 1 150 ? -5.471  63.106 60.162 1.00 5.14  ? 150 VAL A CB  1 
ATOM   1141 C CG1 . VAL A 1 150 ? -4.638  63.903 59.153 1.00 8.30  ? 150 VAL A CG1 1 
ATOM   1142 C CG2 . VAL A 1 150 ? -6.524  64.009 60.828 1.00 2.00  ? 150 VAL A CG2 1 
ATOM   1143 N N   . GLY A 1 151 ? -6.004  60.306 61.333 1.00 8.74  ? 151 GLY A N   1 
ATOM   1144 C CA  . GLY A 1 151 ? -6.612  59.499 62.367 1.00 13.27 ? 151 GLY A CA  1 
ATOM   1145 C C   . GLY A 1 151 ? -7.414  58.318 61.874 1.00 13.43 ? 151 GLY A C   1 
ATOM   1146 O O   . GLY A 1 151 ? -7.234  57.777 60.799 1.00 18.94 ? 151 GLY A O   1 
ATOM   1147 N N   . ALA A 1 152 ? -8.338  57.913 62.734 1.00 15.81 ? 152 ALA A N   1 
ATOM   1148 C CA  . ALA A 1 152 ? -9.201  56.786 62.448 1.00 15.08 ? 152 ALA A CA  1 
ATOM   1149 C C   . ALA A 1 152 ? -9.902  56.996 61.142 1.00 16.48 ? 152 ALA A C   1 
ATOM   1150 O O   . ALA A 1 152 ? -9.926  56.157 60.255 1.00 19.77 ? 152 ALA A O   1 
ATOM   1151 C CB  . ALA A 1 152 ? -10.277 56.644 63.557 1.00 16.38 ? 152 ALA A CB  1 
ATOM   1152 N N   . PHE A 1 153 ? -10.456 58.201 61.068 1.00 16.47 ? 153 PHE A N   1 
ATOM   1153 C CA  . PHE A 1 153 ? -11.234 58.661 59.929 1.00 17.52 ? 153 PHE A CA  1 
ATOM   1154 C C   . PHE A 1 153 ? -10.564 58.546 58.590 1.00 19.10 ? 153 PHE A C   1 
ATOM   1155 O O   . PHE A 1 153 ? -11.256 58.502 57.578 1.00 22.12 ? 153 PHE A O   1 
ATOM   1156 C CB  . PHE A 1 153 ? -11.598 60.141 60.079 1.00 17.58 ? 153 PHE A CB  1 
ATOM   1157 C CG  . PHE A 1 153 ? -12.250 60.434 61.396 1.00 18.29 ? 153 PHE A CG  1 
ATOM   1158 C CD1 . PHE A 1 153 ? -13.592 60.077 61.604 1.00 17.81 ? 153 PHE A CD1 1 
ATOM   1159 C CD2 . PHE A 1 153 ? -11.517 61.048 62.428 1.00 19.79 ? 153 PHE A CD2 1 
ATOM   1160 C CE1 . PHE A 1 153 ? -14.192 60.328 62.843 1.00 19.64 ? 153 PHE A CE1 1 
ATOM   1161 C CE2 . PHE A 1 153 ? -12.119 61.298 63.664 1.00 14.71 ? 153 PHE A CE2 1 
ATOM   1162 C CZ  . PHE A 1 153 ? -13.454 60.935 63.873 1.00 16.31 ? 153 PHE A CZ  1 
ATOM   1163 N N   . GLY A 1 154 ? -9.223  58.559 58.589 1.00 17.08 ? 154 GLY A N   1 
ATOM   1164 C CA  . GLY A 1 154 ? -8.510  58.461 57.335 1.00 13.20 ? 154 GLY A CA  1 
ATOM   1165 C C   . GLY A 1 154 ? -7.645  57.226 57.227 1.00 16.76 ? 154 GLY A C   1 
ATOM   1166 O O   . GLY A 1 154 ? -7.200  56.899 56.126 1.00 21.42 ? 154 GLY A O   1 
ATOM   1167 N N   . PHE A 1 155 ? -7.410  56.495 58.332 1.00 10.13 ? 155 PHE A N   1 
ATOM   1168 C CA  . PHE A 1 155 ? -6.518  55.357 58.190 1.00 4.35  ? 155 PHE A CA  1 
ATOM   1169 C C   . PHE A 1 155 ? -6.946  54.070 58.856 1.00 6.32  ? 155 PHE A C   1 
ATOM   1170 O O   . PHE A 1 155 ? -6.132  53.154 59.010 1.00 5.80  ? 155 PHE A O   1 
ATOM   1171 C CB  . PHE A 1 155 ? -5.110  55.781 58.600 1.00 2.53  ? 155 PHE A CB  1 
ATOM   1172 C CG  . PHE A 1 155 ? -4.545  56.853 57.682 1.00 7.11  ? 155 PHE A CG  1 
ATOM   1173 C CD1 . PHE A 1 155 ? -4.762  58.218 57.957 1.00 7.24  ? 155 PHE A CD1 1 
ATOM   1174 C CD2 . PHE A 1 155 ? -3.771  56.499 56.553 1.00 8.43  ? 155 PHE A CD2 1 
ATOM   1175 C CE1 . PHE A 1 155 ? -4.200  59.206 57.133 1.00 6.69  ? 155 PHE A CE1 1 
ATOM   1176 C CE2 . PHE A 1 155 ? -3.213  57.491 55.732 1.00 5.43  ? 155 PHE A CE2 1 
ATOM   1177 C CZ  . PHE A 1 155 ? -3.423  58.846 56.027 1.00 3.73  ? 155 PHE A CZ  1 
ATOM   1178 N N   . LEU A 1 156 ? -8.224  53.988 59.250 1.00 5.30  ? 156 LEU A N   1 
ATOM   1179 C CA  . LEU A 1 156 ? -8.702  52.738 59.857 1.00 8.53  ? 156 LEU A CA  1 
ATOM   1180 C C   . LEU A 1 156 ? -8.566  51.683 58.777 1.00 8.36  ? 156 LEU A C   1 
ATOM   1181 O O   . LEU A 1 156 ? -8.850  51.994 57.634 1.00 10.64 ? 156 LEU A O   1 
ATOM   1182 C CB  . LEU A 1 156 ? -10.174 52.893 60.269 1.00 11.58 ? 156 LEU A CB  1 
ATOM   1183 C CG  . LEU A 1 156 ? -10.789 51.648 60.921 1.00 9.96  ? 156 LEU A CG  1 
ATOM   1184 C CD1 . LEU A 1 156 ? -10.048 51.273 62.201 1.00 13.48 ? 156 LEU A CD1 1 
ATOM   1185 C CD2 . LEU A 1 156 ? -12.269 51.889 61.218 1.00 11.63 ? 156 LEU A CD2 1 
ATOM   1186 N N   . ALA A 1 157 ? -8.180  50.451 59.089 1.00 8.96  ? 157 ALA A N   1 
ATOM   1187 C CA  . ALA A 1 157 ? -8.007  49.543 57.969 1.00 8.75  ? 157 ALA A CA  1 
ATOM   1188 C C   . ALA A 1 157 ? -8.408  48.094 58.168 1.00 12.30 ? 157 ALA A C   1 
ATOM   1189 O O   . ALA A 1 157 ? -7.582  47.229 58.464 1.00 8.91  ? 157 ALA A O   1 
ATOM   1190 C CB  . ALA A 1 157 ? -6.513  49.552 57.612 1.00 8.11  ? 157 ALA A CB  1 
ATOM   1191 N N   . LEU A 1 158 ? -9.694  47.818 57.925 1.00 15.41 ? 158 LEU A N   1 
ATOM   1192 C CA  . LEU A 1 158 ? -10.188 46.440 58.014 1.00 18.08 ? 158 LEU A CA  1 
ATOM   1193 C C   . LEU A 1 158 ? -10.000 45.902 56.602 1.00 18.96 ? 158 LEU A C   1 
ATOM   1194 O O   . LEU A 1 158 ? -10.913 45.777 55.804 1.00 19.40 ? 158 LEU A O   1 
ATOM   1195 C CB  . LEU A 1 158 ? -11.651 46.445 58.445 1.00 16.34 ? 158 LEU A CB  1 
ATOM   1196 C CG  . LEU A 1 158 ? -11.791 46.932 59.889 1.00 16.07 ? 158 LEU A CG  1 
ATOM   1197 C CD1 . LEU A 1 158 ? -13.179 47.487 60.148 1.00 16.62 ? 158 LEU A CD1 1 
ATOM   1198 C CD2 . LEU A 1 158 ? -11.417 45.835 60.895 1.00 16.50 ? 158 LEU A CD2 1 
ATOM   1199 N N   . HIS A 1 159 ? -8.738  45.603 56.329 1.00 22.98 ? 159 HIS A N   1 
ATOM   1200 C CA  . HIS A 1 159 ? -8.257  45.148 55.040 1.00 30.84 ? 159 HIS A CA  1 
ATOM   1201 C C   . HIS A 1 159 ? -9.211  44.578 54.011 1.00 34.01 ? 159 HIS A C   1 
ATOM   1202 O O   . HIS A 1 159 ? -9.410  45.223 52.986 1.00 40.62 ? 159 HIS A O   1 
ATOM   1203 C CB  . HIS A 1 159 ? -6.949  44.348 55.106 1.00 38.70 ? 159 HIS A CB  1 
ATOM   1204 C CG  . HIS A 1 159 ? -6.384  44.161 53.698 1.00 45.22 ? 159 HIS A CG  1 
ATOM   1205 N ND1 . HIS A 1 159 ? -6.542  45.038 52.670 1.00 47.49 ? 159 HIS A ND1 1 
ATOM   1206 C CD2 . HIS A 1 159 ? -5.646  43.062 53.201 1.00 48.81 ? 159 HIS A CD2 1 
ATOM   1207 C CE1 . HIS A 1 159 ? -5.920  44.506 51.599 1.00 48.99 ? 159 HIS A CE1 1 
ATOM   1208 N NE2 . HIS A 1 159 ? -5.375  43.317 51.906 1.00 48.28 ? 159 HIS A NE2 1 
ATOM   1209 N N   . GLY A 1 160 ? -9.753  43.384 54.212 1.00 32.34 ? 160 GLY A N   1 
ATOM   1210 C CA  . GLY A 1 160 ? -10.620 42.905 53.139 1.00 30.82 ? 160 GLY A CA  1 
ATOM   1211 C C   . GLY A 1 160 ? -11.985 43.554 53.111 1.00 33.28 ? 160 GLY A C   1 
ATOM   1212 O O   . GLY A 1 160 ? -12.973 42.851 52.919 1.00 37.69 ? 160 GLY A O   1 
ATOM   1213 N N   . SER A 1 161 ? -12.084 44.860 53.310 1.00 32.25 ? 161 SER A N   1 
ATOM   1214 C CA  . SER A 1 161 ? -13.387 45.468 53.317 1.00 33.51 ? 161 SER A CA  1 
ATOM   1215 C C   . SER A 1 161 ? -13.352 46.684 52.425 1.00 34.90 ? 161 SER A C   1 
ATOM   1216 O O   . SER A 1 161 ? -12.417 47.471 52.363 1.00 39.21 ? 161 SER A O   1 
ATOM   1217 C CB  . SER A 1 161 ? -13.697 45.914 54.752 1.00 31.18 ? 161 SER A CB  1 
ATOM   1218 O OG  . SER A 1 161 ? -15.002 46.512 54.807 1.00 36.26 ? 161 SER A OG  1 
ATOM   1219 N N   . GLN A 1 162 ? -14.531 46.811 51.795 1.00 35.80 ? 162 GLN A N   1 
ATOM   1220 C CA  . GLN A 1 162 ? -14.720 47.953 50.900 1.00 36.93 ? 162 GLN A CA  1 
ATOM   1221 C C   . GLN A 1 162 ? -15.178 49.161 51.716 1.00 34.72 ? 162 GLN A C   1 
ATOM   1222 O O   . GLN A 1 162 ? -15.019 50.319 51.367 1.00 36.56 ? 162 GLN A O   1 
ATOM   1223 C CB  . GLN A 1 162 ? -15.836 47.628 49.860 1.00 39.31 ? 162 GLN A CB  1 
ATOM   1224 C CG  . GLN A 1 162 ? -15.532 46.469 48.834 1.00 41.84 ? 162 GLN A CG  1 
ATOM   1225 N N   . GLU A 1 163 ? -15.808 48.818 52.853 1.00 31.51 ? 163 GLU A N   1 
ATOM   1226 C CA  . GLU A 1 163 ? -16.312 49.886 53.716 1.00 26.96 ? 163 GLU A CA  1 
ATOM   1227 C C   . GLU A 1 163 ? -15.213 50.641 54.439 1.00 23.35 ? 163 GLU A C   1 
ATOM   1228 O O   . GLU A 1 163 ? -15.340 51.820 54.704 1.00 26.46 ? 163 GLU A O   1 
ATOM   1229 C CB  . GLU A 1 163 ? -17.382 49.341 54.675 1.00 29.38 ? 163 GLU A CB  1 
ATOM   1230 C CG  . GLU A 1 163 ? -18.573 48.666 53.964 1.00 23.59 ? 163 GLU A CG  1 
ATOM   1231 C CD  . GLU A 1 163 ? -19.228 49.607 52.977 1.00 23.58 ? 163 GLU A CD  1 
ATOM   1232 N N   . ALA A 1 164 ? -14.150 49.927 54.793 1.00 16.59 ? 164 ALA A N   1 
ATOM   1233 C CA  . ALA A 1 164 ? -13.012 50.549 55.458 1.00 15.06 ? 164 ALA A CA  1 
ATOM   1234 C C   . ALA A 1 164 ? -11.768 49.786 54.980 1.00 16.71 ? 164 ALA A C   1 
ATOM   1235 O O   . ALA A 1 164 ? -11.191 48.965 55.698 1.00 20.04 ? 164 ALA A O   1 
ATOM   1236 C CB  . ALA A 1 164 ? -13.102 50.473 56.993 1.00 9.11  ? 164 ALA A CB  1 
ATOM   1237 N N   . PRO A 1 165 ? -11.363 50.053 53.733 1.00 14.97 ? 165 PRO A N   1 
ATOM   1238 C CA  . PRO A 1 165 ? -10.059 49.592 53.279 1.00 13.44 ? 165 PRO A CA  1 
ATOM   1239 C C   . PRO A 1 165 ? -9.125  50.605 53.898 1.00 16.94 ? 165 PRO A C   1 
ATOM   1240 O O   . PRO A 1 165 ? -9.521  51.684 54.341 1.00 23.84 ? 165 PRO A O   1 
ATOM   1241 C CB  . PRO A 1 165 ? -10.132 49.788 51.767 1.00 14.41 ? 165 PRO A CB  1 
ATOM   1242 C CG  . PRO A 1 165 ? -11.148 50.929 51.544 1.00 13.25 ? 165 PRO A CG  1 
ATOM   1243 C CD  . PRO A 1 165 ? -12.055 50.921 52.779 1.00 11.35 ? 165 PRO A CD  1 
ATOM   1244 N N   . GLY A 1 166 ? -7.847  50.290 53.930 1.00 14.46 ? 166 GLY A N   1 
ATOM   1245 C CA  . GLY A 1 166 ? -7.054  51.348 54.567 1.00 15.06 ? 166 GLY A CA  1 
ATOM   1246 C C   . GLY A 1 166 ? -6.750  52.485 53.617 1.00 10.60 ? 166 GLY A C   1 
ATOM   1247 O O   . GLY A 1 166 ? -7.401  52.732 52.616 1.00 14.05 ? 166 GLY A O   1 
ATOM   1248 N N   . ASN A 1 167 ? -5.690  53.192 53.974 1.00 6.94  ? 167 ASN A N   1 
ATOM   1249 C CA  . ASN A 1 167 ? -5.128  54.278 53.193 1.00 3.98  ? 167 ASN A CA  1 
ATOM   1250 C C   . ASN A 1 167 ? -6.064  55.306 52.602 1.00 5.66  ? 167 ASN A C   1 
ATOM   1251 O O   . ASN A 1 167 ? -5.674  56.072 51.728 1.00 7.40  ? 167 ASN A O   1 
ATOM   1252 C CB  . ASN A 1 167 ? -4.268  53.663 52.087 1.00 2.00  ? 167 ASN A CB  1 
ATOM   1253 C CG  . ASN A 1 167 ? -3.276  52.695 52.707 1.00 8.15  ? 167 ASN A CG  1 
ATOM   1254 O OD1 . ASN A 1 167 ? -2.762  52.947 53.782 1.00 16.28 ? 167 ASN A OD1 1 
ATOM   1255 N ND2 . ASN A 1 167 ? -3.023  51.567 52.071 1.00 7.46  ? 167 ASN A ND2 1 
ATOM   1256 N N   . VAL A 1 168 ? -7.279  55.390 53.110 1.00 6.08  ? 168 VAL A N   1 
ATOM   1257 C CA  . VAL A 1 168 ? -8.209  56.344 52.551 1.00 8.29  ? 168 VAL A CA  1 
ATOM   1258 C C   . VAL A 1 168 ? -7.717  57.784 52.574 1.00 10.31 ? 168 VAL A C   1 
ATOM   1259 O O   . VAL A 1 168 ? -7.963  58.584 51.681 1.00 17.23 ? 168 VAL A O   1 
ATOM   1260 C CB  . VAL A 1 168 ? -9.541  56.083 53.259 1.00 9.91  ? 168 VAL A CB  1 
ATOM   1261 C CG1 . VAL A 1 168 ? -10.541 57.207 53.160 1.00 7.10  ? 168 VAL A CG1 1 
ATOM   1262 C CG2 . VAL A 1 168 ? -10.166 54.775 52.740 1.00 11.93 ? 168 VAL A CG2 1 
ATOM   1263 N N   . GLY A 1 169 ? -6.979  58.137 53.601 1.00 14.57 ? 169 GLY A N   1 
ATOM   1264 C CA  . GLY A 1 169 ? -6.485  59.514 53.652 1.00 13.64 ? 169 GLY A CA  1 
ATOM   1265 C C   . GLY A 1 169 ? -5.486  59.788 52.558 1.00 11.80 ? 169 GLY A C   1 
ATOM   1266 O O   . GLY A 1 169 ? -5.331  60.897 52.058 1.00 12.92 ? 169 GLY A O   1 
ATOM   1267 N N   . LEU A 1 170 ? -4.818  58.707 52.181 1.00 8.00  ? 170 LEU A N   1 
ATOM   1268 C CA  . LEU A 1 170 ? -3.813  58.722 51.151 1.00 8.15  ? 170 LEU A CA  1 
ATOM   1269 C C   . LEU A 1 170 ? -4.537  58.945 49.820 1.00 10.89 ? 170 LEU A C   1 
ATOM   1270 O O   . LEU A 1 170 ? -4.164  59.742 48.956 1.00 10.83 ? 170 LEU A O   1 
ATOM   1271 C CB  . LEU A 1 170 ? -3.015  57.415 51.312 1.00 5.68  ? 170 LEU A CB  1 
ATOM   1272 C CG  . LEU A 1 170 ? -1.491  57.557 51.374 1.00 3.76  ? 170 LEU A CG  1 
ATOM   1273 C CD1 . LEU A 1 170 ? -0.946  58.687 52.256 1.00 4.84  ? 170 LEU A CD1 1 
ATOM   1274 C CD2 . LEU A 1 170 ? -0.888  56.218 51.803 1.00 3.40  ? 170 LEU A CD2 1 
ATOM   1275 N N   . LEU A 1 171 ? -5.679  58.255 49.700 1.00 12.59 ? 171 LEU A N   1 
ATOM   1276 C CA  . LEU A 1 171 ? -6.450  58.469 48.466 1.00 13.94 ? 171 LEU A CA  1 
ATOM   1277 C C   . LEU A 1 171 ? -6.950  59.916 48.384 1.00 16.31 ? 171 LEU A C   1 
ATOM   1278 O O   . LEU A 1 171 ? -6.981  60.529 47.327 1.00 22.51 ? 171 LEU A O   1 
ATOM   1279 C CB  . LEU A 1 171 ? -7.633  57.509 48.325 1.00 6.31  ? 171 LEU A CB  1 
ATOM   1280 C CG  . LEU A 1 171 ? -7.182  56.046 48.320 1.00 4.35  ? 171 LEU A CG  1 
ATOM   1281 C CD1 . LEU A 1 171 ? -8.382  55.107 48.295 1.00 10.78 ? 171 LEU A CD1 1 
ATOM   1282 C CD2 . LEU A 1 171 ? -6.277  55.739 47.141 1.00 7.49  ? 171 LEU A CD2 1 
ATOM   1283 N N   . ASP A 1 172 ? -7.333  60.493 49.524 1.00 15.07 ? 172 ASP A N   1 
ATOM   1284 C CA  . ASP A 1 172 ? -7.785  61.875 49.442 1.00 14.35 ? 172 ASP A CA  1 
ATOM   1285 C C   . ASP A 1 172 ? -6.727  62.773 48.866 1.00 15.63 ? 172 ASP A C   1 
ATOM   1286 O O   . ASP A 1 172 ? -7.038  63.722 48.161 1.00 18.63 ? 172 ASP A O   1 
ATOM   1287 C CB  . ASP A 1 172 ? -8.118  62.497 50.799 1.00 18.99 ? 172 ASP A CB  1 
ATOM   1288 C CG  . ASP A 1 172 ? -9.113  61.733 51.635 1.00 24.06 ? 172 ASP A CG  1 
ATOM   1289 O OD1 . ASP A 1 172 ? -9.846  60.915 51.094 1.00 26.06 ? 172 ASP A OD1 1 
ATOM   1290 O OD2 . ASP A 1 172 ? -9.144  61.963 52.839 1.00 30.47 ? 172 ASP A OD2 1 
ATOM   1291 N N   . GLN A 1 173 ? -5.463  62.456 49.191 1.00 15.38 ? 173 GLN A N   1 
ATOM   1292 C CA  . GLN A 1 173 ? -4.376  63.289 48.687 1.00 13.29 ? 173 GLN A CA  1 
ATOM   1293 C C   . GLN A 1 173 ? -4.322  63.187 47.198 1.00 13.91 ? 173 GLN A C   1 
ATOM   1294 O O   . GLN A 1 173 ? -4.220  64.154 46.457 1.00 14.44 ? 173 GLN A O   1 
ATOM   1295 C CB  . GLN A 1 173 ? -3.008  62.871 49.249 1.00 10.88 ? 173 GLN A CB  1 
ATOM   1296 C CG  . GLN A 1 173 ? -2.957  62.897 50.779 1.00 12.69 ? 173 GLN A CG  1 
ATOM   1297 C CD  . GLN A 1 173 ? -1.554  62.665 51.307 1.00 12.03 ? 173 GLN A CD  1 
ATOM   1298 O OE1 . GLN A 1 173 ? -0.559  62.832 50.633 1.00 8.80  ? 173 GLN A OE1 1 
ATOM   1299 N NE2 . GLN A 1 173 ? -1.480  62.303 52.567 1.00 17.30 ? 173 GLN A NE2 1 
ATOM   1300 N N   . ARG A 1 174 ? -4.424  61.930 46.775 1.00 14.81 ? 174 ARG A N   1 
ATOM   1301 C CA  . ARG A 1 174 ? -4.386  61.661 45.346 1.00 13.15 ? 174 ARG A CA  1 
ATOM   1302 C C   . ARG A 1 174 ? -5.470  62.412 44.626 1.00 11.65 ? 174 ARG A C   1 
ATOM   1303 O O   . ARG A 1 174 ? -5.216  63.072 43.635 1.00 14.76 ? 174 ARG A O   1 
ATOM   1304 C CB  . ARG A 1 174 ? -4.520  60.167 45.099 1.00 10.52 ? 174 ARG A CB  1 
ATOM   1305 C CG  . ARG A 1 174 ? -4.373  59.751 43.646 1.00 7.57  ? 174 ARG A CG  1 
ATOM   1306 C CD  . ARG A 1 174 ? -4.632  58.244 43.505 1.00 15.22 ? 174 ARG A CD  1 
ATOM   1307 N NE  . ARG A 1 174 ? -3.503  57.506 44.014 1.00 12.35 ? 174 ARG A NE  1 
ATOM   1308 C CZ  . ARG A 1 174 ? -3.431  56.166 44.057 1.00 16.56 ? 174 ARG A CZ  1 
ATOM   1309 N NH1 . ARG A 1 174 ? -4.500  55.388 43.885 1.00 13.82 ? 174 ARG A NH1 1 
ATOM   1310 N NH2 . ARG A 1 174 ? -2.258  55.603 44.296 1.00 15.94 ? 174 ARG A NH2 1 
ATOM   1311 N N   . MET A 1 175 ? -6.692  62.313 45.140 1.00 9.23  ? 175 MET A N   1 
ATOM   1312 C CA  . MET A 1 175 ? -7.790  63.018 44.507 1.00 9.52  ? 175 MET A CA  1 
ATOM   1313 C C   . MET A 1 175 ? -7.516  64.506 44.372 1.00 11.08 ? 175 MET A C   1 
ATOM   1314 O O   . MET A 1 175 ? -7.845  65.149 43.384 1.00 14.83 ? 175 MET A O   1 
ATOM   1315 C CB  . MET A 1 175 ? -9.079  62.809 45.275 1.00 12.36 ? 175 MET A CB  1 
ATOM   1316 C CG  . MET A 1 175 ? -10.280 63.432 44.559 1.00 17.99 ? 175 MET A CG  1 
ATOM   1317 S SD  . MET A 1 175 ? -11.671 62.302 44.755 1.00 26.77 ? 175 MET A SD  1 
ATOM   1318 C CE  . MET A 1 175 ? -11.147 61.180 43.418 1.00 23.60 ? 175 MET A CE  1 
ATOM   1319 N N   . ALA A 1 176 ? -6.883  65.076 45.383 1.00 13.80 ? 176 ALA A N   1 
ATOM   1320 C CA  . ALA A 1 176 ? -6.607  66.488 45.224 1.00 12.57 ? 176 ALA A CA  1 
ATOM   1321 C C   . ALA A 1 176 ? -5.559  66.667 44.156 1.00 11.01 ? 176 ALA A C   1 
ATOM   1322 O O   . ALA A 1 176 ? -5.618  67.616 43.404 1.00 14.19 ? 176 ALA A O   1 
ATOM   1323 C CB  . ALA A 1 176 ? -6.152  67.113 46.519 1.00 15.81 ? 176 ALA A CB  1 
ATOM   1324 N N   . LEU A 1 177 ? -4.603  65.740 44.080 1.00 12.40 ? 177 LEU A N   1 
ATOM   1325 C CA  . LEU A 1 177 ? -3.565  65.816 43.039 1.00 15.13 ? 177 LEU A CA  1 
ATOM   1326 C C   . LEU A 1 177 ? -4.202  65.733 41.646 1.00 17.24 ? 177 LEU A C   1 
ATOM   1327 O O   . LEU A 1 177 ? -3.788  66.347 40.668 1.00 19.47 ? 177 LEU A O   1 
ATOM   1328 C CB  . LEU A 1 177 ? -2.537  64.662 43.180 1.00 13.77 ? 177 LEU A CB  1 
ATOM   1329 C CG  . LEU A 1 177 ? -1.163  64.996 43.810 1.00 9.51  ? 177 LEU A CG  1 
ATOM   1330 C CD1 . LEU A 1 177 ? -1.056  66.379 44.458 1.00 2.74  ? 177 LEU A CD1 1 
ATOM   1331 C CD2 . LEU A 1 177 ? -0.756  63.887 44.783 1.00 8.15  ? 177 LEU A CD2 1 
ATOM   1332 N N   . GLN A 1 178 ? -5.261  64.929 41.573 1.00 17.82 ? 178 GLN A N   1 
ATOM   1333 C CA  . GLN A 1 178 ? -5.959  64.804 40.312 1.00 14.51 ? 178 GLN A CA  1 
ATOM   1334 C C   . GLN A 1 178 ? -6.584  66.124 39.954 1.00 13.43 ? 178 GLN A C   1 
ATOM   1335 O O   . GLN A 1 178 ? -6.358  66.654 38.885 1.00 21.47 ? 178 GLN A O   1 
ATOM   1336 C CB  . GLN A 1 178 ? -7.046  63.733 40.379 1.00 10.61 ? 178 GLN A CB  1 
ATOM   1337 C CG  . GLN A 1 178 ? -7.709  63.438 39.027 1.00 18.80 ? 178 GLN A CG  1 
ATOM   1338 C CD  . GLN A 1 178 ? -6.842  62.486 38.228 1.00 21.16 ? 178 GLN A CD  1 
ATOM   1339 O OE1 . GLN A 1 178 ? -6.622  61.349 38.610 1.00 25.52 ? 178 GLN A OE1 1 
ATOM   1340 N NE2 . GLN A 1 178 ? -6.331  62.966 37.106 1.00 22.73 ? 178 GLN A NE2 1 
ATOM   1341 N N   . TRP A 1 179 ? -7.383  66.675 40.850 1.00 10.74 ? 179 TRP A N   1 
ATOM   1342 C CA  . TRP A 1 179 ? -8.034  67.945 40.549 1.00 10.13 ? 179 TRP A CA  1 
ATOM   1343 C C   . TRP A 1 179 ? -7.021  68.996 40.155 1.00 12.00 ? 179 TRP A C   1 
ATOM   1344 O O   . TRP A 1 179 ? -7.252  69.795 39.264 1.00 19.76 ? 179 TRP A O   1 
ATOM   1345 C CB  . TRP A 1 179 ? -8.838  68.399 41.776 1.00 10.49 ? 179 TRP A CB  1 
ATOM   1346 C CG  . TRP A 1 179 ? -9.853  69.491 41.510 1.00 6.08  ? 179 TRP A CG  1 
ATOM   1347 C CD1 . TRP A 1 179 ? -11.250 69.295 41.381 1.00 9.25  ? 179 TRP A CD1 1 
ATOM   1348 C CD2 . TRP A 1 179 ? -9.633  70.880 41.419 1.00 4.45  ? 179 TRP A CD2 1 
ATOM   1349 N NE1 . TRP A 1 179 ? -11.899 70.487 41.223 1.00 8.77  ? 179 TRP A NE1 1 
ATOM   1350 C CE2 . TRP A 1 179 ? -10.977 71.493 41.236 1.00 2.68  ? 179 TRP A CE2 1 
ATOM   1351 C CE3 . TRP A 1 179 ? -8.500  71.697 41.465 1.00 2.00  ? 179 TRP A CE3 1 
ATOM   1352 C CZ2 . TRP A 1 179 ? -11.100 72.872 41.112 1.00 2.18  ? 179 TRP A CZ2 1 
ATOM   1353 C CZ3 . TRP A 1 179 ? -8.663  73.088 41.336 1.00 2.57  ? 179 TRP A CZ3 1 
ATOM   1354 C CH2 . TRP A 1 179 ? -9.937  73.663 41.165 1.00 2.00  ? 179 TRP A CH2 1 
ATOM   1355 N N   . VAL A 1 180 ? -5.873  69.006 40.810 1.00 11.87 ? 180 VAL A N   1 
ATOM   1356 C CA  . VAL A 1 180 ? -4.876  70.004 40.443 1.00 11.64 ? 180 VAL A CA  1 
ATOM   1357 C C   . VAL A 1 180 ? -4.423  69.780 39.005 1.00 14.32 ? 180 VAL A C   1 
ATOM   1358 O O   . VAL A 1 180 ? -4.296  70.711 38.218 1.00 14.72 ? 180 VAL A O   1 
ATOM   1359 C CB  . VAL A 1 180 ? -3.729  69.940 41.459 1.00 5.95  ? 180 VAL A CB  1 
ATOM   1360 C CG1 . VAL A 1 180 ? -2.492  70.774 41.089 1.00 7.08  ? 180 VAL A CG1 1 
ATOM   1361 C CG2 . VAL A 1 180 ? -4.286  70.381 42.817 1.00 9.69  ? 180 VAL A CG2 1 
ATOM   1362 N N   . HIS A 1 181 ? -4.209  68.510 38.675 1.00 15.12 ? 181 HIS A N   1 
ATOM   1363 C CA  . HIS A 1 181 ? -3.773  68.124 37.336 1.00 17.44 ? 181 HIS A CA  1 
ATOM   1364 C C   . HIS A 1 181 ? -4.755  68.548 36.260 1.00 17.59 ? 181 HIS A C   1 
ATOM   1365 O O   . HIS A 1 181 ? -4.426  69.055 35.200 1.00 21.94 ? 181 HIS A O   1 
ATOM   1366 C CB  . HIS A 1 181 ? -3.624  66.595 37.336 1.00 19.59 ? 181 HIS A CB  1 
ATOM   1367 C CG  . HIS A 1 181 ? -3.014  66.035 36.074 1.00 25.78 ? 181 HIS A CG  1 
ATOM   1368 N ND1 . HIS A 1 181 ? -3.709  65.319 35.169 1.00 24.30 ? 181 HIS A ND1 1 
ATOM   1369 C CD2 . HIS A 1 181 ? -1.650  66.070 35.680 1.00 30.09 ? 181 HIS A CD2 1 
ATOM   1370 C CE1 . HIS A 1 181 ? -2.819  64.901 34.257 1.00 31.34 ? 181 HIS A CE1 1 
ATOM   1371 N NE2 . HIS A 1 181 ? -1.573  65.342 34.544 1.00 35.14 ? 181 HIS A NE2 1 
ATOM   1372 N N   . ASP A 1 182 ? -6.016  68.345 36.586 1.00 16.68 ? 182 ASP A N   1 
ATOM   1373 C CA  . ASP A 1 182 ? -7.076  68.676 35.656 1.00 17.41 ? 182 ASP A CA  1 
ATOM   1374 C C   . ASP A 1 182 ? -7.573  70.110 35.729 1.00 19.32 ? 182 ASP A C   1 
ATOM   1375 O O   . ASP A 1 182 ? -8.522  70.425 35.029 1.00 25.05 ? 182 ASP A O   1 
ATOM   1376 C CB  . ASP A 1 182 ? -8.311  67.791 35.923 1.00 16.95 ? 182 ASP A CB  1 
ATOM   1377 C CG  . ASP A 1 182 ? -8.047  66.296 35.756 1.00 24.00 ? 182 ASP A CG  1 
ATOM   1378 O OD1 . ASP A 1 182 ? -7.010  65.927 35.196 1.00 26.34 ? 182 ASP A OD1 1 
ATOM   1379 O OD2 . ASP A 1 182 ? -8.894  65.503 36.173 1.00 23.74 ? 182 ASP A OD2 1 
ATOM   1380 N N   . ASN A 1 183 ? -7.035  70.994 36.574 1.00 14.46 ? 183 ASN A N   1 
ATOM   1381 C CA  . ASN A 1 183 ? -7.651  72.321 36.518 1.00 9.77  ? 183 ASN A CA  1 
ATOM   1382 C C   . ASN A 1 183 ? -6.696  73.420 36.867 1.00 14.26 ? 183 ASN A C   1 
ATOM   1383 O O   . ASN A 1 183 ? -7.050  74.589 36.787 1.00 14.61 ? 183 ASN A O   1 
ATOM   1384 C CB  . ASN A 1 183 ? -8.816  72.502 37.490 1.00 7.86  ? 183 ASN A CB  1 
ATOM   1385 C CG  . ASN A 1 183 ? -9.939  71.512 37.343 1.00 13.76 ? 183 ASN A CG  1 
ATOM   1386 O OD1 . ASN A 1 183 ? -11.011 71.777 36.814 1.00 20.88 ? 183 ASN A OD1 1 
ATOM   1387 N ND2 . ASN A 1 183 ? -9.696  70.337 37.881 1.00 19.16 ? 183 ASN A ND2 1 
ATOM   1388 N N   . ILE A 1 184 ? -5.451  73.094 37.220 1.00 15.04 ? 184 ILE A N   1 
ATOM   1389 C CA  . ILE A 1 184 ? -4.580  74.188 37.591 1.00 15.27 ? 184 ILE A CA  1 
ATOM   1390 C C   . ILE A 1 184 ? -4.324  75.187 36.459 1.00 20.74 ? 184 ILE A C   1 
ATOM   1391 O O   . ILE A 1 184 ? -4.015  76.361 36.670 1.00 24.30 ? 184 ILE A O   1 
ATOM   1392 C CB  . ILE A 1 184 ? -3.371  73.644 38.359 1.00 12.84 ? 184 ILE A CB  1 
ATOM   1393 C CG1 . ILE A 1 184 ? -2.721  74.747 39.222 1.00 14.79 ? 184 ILE A CG1 1 
ATOM   1394 C CG2 . ILE A 1 184 ? -2.389  72.882 37.477 1.00 10.86 ? 184 ILE A CG2 1 
ATOM   1395 C CD1 . ILE A 1 184 ? -3.634  75.214 40.373 1.00 14.42 ? 184 ILE A CD1 1 
ATOM   1396 N N   . GLN A 1 185 ? -4.498  74.683 35.222 1.00 21.09 ? 185 GLN A N   1 
ATOM   1397 C CA  . GLN A 1 185 ? -4.327  75.498 34.020 1.00 18.39 ? 185 GLN A CA  1 
ATOM   1398 C C   . GLN A 1 185 ? -5.223  76.718 34.082 1.00 18.63 ? 185 GLN A C   1 
ATOM   1399 O O   . GLN A 1 185 ? -4.812  77.806 33.720 1.00 20.92 ? 185 GLN A O   1 
ATOM   1400 C CB  . GLN A 1 185 ? -4.637  74.678 32.746 1.00 15.12 ? 185 GLN A CB  1 
ATOM   1401 C CG  . GLN A 1 185 ? -5.989  73.945 32.830 1.00 19.60 ? 185 GLN A CG  1 
ATOM   1402 C CD  . GLN A 1 185 ? -6.305  73.169 31.586 1.00 19.46 ? 185 GLN A CD  1 
ATOM   1403 O OE1 . GLN A 1 185 ? -6.282  71.952 31.557 1.00 24.41 ? 185 GLN A OE1 1 
ATOM   1404 N NE2 . GLN A 1 185 ? -6.625  73.910 30.555 1.00 19.15 ? 185 GLN A NE2 1 
ATOM   1405 N N   . PHE A 1 186 ? -6.446  76.544 34.602 1.00 13.62 ? 186 PHE A N   1 
ATOM   1406 C CA  . PHE A 1 186 ? -7.335  77.705 34.653 1.00 15.96 ? 186 PHE A CA  1 
ATOM   1407 C C   . PHE A 1 186 ? -6.889  78.759 35.633 1.00 16.69 ? 186 PHE A C   1 
ATOM   1408 O O   . PHE A 1 186 ? -7.435  79.855 35.684 1.00 18.51 ? 186 PHE A O   1 
ATOM   1409 C CB  . PHE A 1 186 ? -8.799  77.332 34.931 1.00 18.39 ? 186 PHE A CB  1 
ATOM   1410 C CG  . PHE A 1 186 ? -9.188  76.212 34.006 1.00 23.70 ? 186 PHE A CG  1 
ATOM   1411 C CD1 . PHE A 1 186 ? -9.287  76.437 32.624 1.00 23.43 ? 186 PHE A CD1 1 
ATOM   1412 C CD2 . PHE A 1 186 ? -9.383  74.923 34.514 1.00 26.04 ? 186 PHE A CD2 1 
ATOM   1413 C CE1 . PHE A 1 186 ? -9.560  75.372 31.761 1.00 22.42 ? 186 PHE A CE1 1 
ATOM   1414 C CE2 . PHE A 1 186 ? -9.654  73.861 33.652 1.00 23.14 ? 186 PHE A CE2 1 
ATOM   1415 C CZ  . PHE A 1 186 ? -9.738  74.083 32.274 1.00 23.73 ? 186 PHE A CZ  1 
ATOM   1416 N N   . PHE A 1 187 ? -5.879  78.411 36.429 1.00 15.55 ? 187 PHE A N   1 
ATOM   1417 C CA  . PHE A 1 187 ? -5.357  79.346 37.407 1.00 14.10 ? 187 PHE A CA  1 
ATOM   1418 C C   . PHE A 1 187 ? -3.978  79.810 36.991 1.00 13.32 ? 187 PHE A C   1 
ATOM   1419 O O   . PHE A 1 187 ? -3.339  80.559 37.714 1.00 19.48 ? 187 PHE A O   1 
ATOM   1420 C CB  . PHE A 1 187 ? -5.288  78.723 38.811 1.00 9.50  ? 187 PHE A CB  1 
ATOM   1421 C CG  . PHE A 1 187 ? -6.641  78.300 39.334 1.00 4.66  ? 187 PHE A CG  1 
ATOM   1422 C CD1 . PHE A 1 187 ? -7.440  79.189 40.061 1.00 6.69  ? 187 PHE A CD1 1 
ATOM   1423 C CD2 . PHE A 1 187 ? -7.114  76.999 39.104 1.00 6.80  ? 187 PHE A CD2 1 
ATOM   1424 C CE1 . PHE A 1 187 ? -8.689  78.783 40.557 1.00 6.63  ? 187 PHE A CE1 1 
ATOM   1425 C CE2 . PHE A 1 187 ? -8.361  76.586 39.595 1.00 5.03  ? 187 PHE A CE2 1 
ATOM   1426 C CZ  . PHE A 1 187 ? -9.154  77.480 40.325 1.00 3.61  ? 187 PHE A CZ  1 
ATOM   1427 N N   . GLY A 1 188 ? -3.499  79.342 35.845 1.00 8.19  ? 188 GLY A N   1 
ATOM   1428 C CA  . GLY A 1 188 ? -2.186  79.785 35.402 1.00 4.82  ? 188 GLY A CA  1 
ATOM   1429 C C   . GLY A 1 188 ? -1.104  78.791 35.711 1.00 8.15  ? 188 GLY A C   1 
ATOM   1430 O O   . GLY A 1 188 ? 0.080   79.026 35.509 1.00 9.97  ? 188 GLY A O   1 
ATOM   1431 N N   . GLY A 1 189 ? -1.481  77.614 36.203 1.00 8.79  ? 189 GLY A N   1 
ATOM   1432 C CA  . GLY A 1 189 ? -0.411  76.673 36.528 1.00 13.76 ? 189 GLY A CA  1 
ATOM   1433 C C   . GLY A 1 189 ? -0.188  75.661 35.446 1.00 16.62 ? 189 GLY A C   1 
ATOM   1434 O O   . GLY A 1 189 ? -1.086  75.289 34.711 1.00 22.62 ? 189 GLY A O   1 
ATOM   1435 N N   . ASP A 1 190 ? 1.039   75.177 35.352 1.00 15.07 ? 190 ASP A N   1 
ATOM   1436 C CA  . ASP A 1 190 ? 1.391   74.193 34.349 1.00 13.98 ? 190 ASP A CA  1 
ATOM   1437 C C   . ASP A 1 190 ? 1.259   72.804 34.955 1.00 12.79 ? 190 ASP A C   1 
ATOM   1438 O O   . ASP A 1 190 ? 2.108   72.434 35.749 1.00 11.02 ? 190 ASP A O   1 
ATOM   1439 C CB  . ASP A 1 190 ? 2.866   74.426 33.998 1.00 15.65 ? 190 ASP A CB  1 
ATOM   1440 C CG  . ASP A 1 190 ? 3.469   73.435 33.006 1.00 23.99 ? 190 ASP A CG  1 
ATOM   1441 O OD1 . ASP A 1 190 ? 2.841   72.443 32.626 1.00 21.26 ? 190 ASP A OD1 1 
ATOM   1442 O OD2 . ASP A 1 190 ? 4.602   73.669 32.608 1.00 34.62 ? 190 ASP A OD2 1 
ATOM   1443 N N   . PRO A 1 191 ? 0.259   71.998 34.566 1.00 12.68 ? 191 PRO A N   1 
ATOM   1444 C CA  . PRO A 1 191 ? 0.122   70.660 35.150 1.00 16.22 ? 191 PRO A CA  1 
ATOM   1445 C C   . PRO A 1 191 ? 1.292   69.707 34.980 1.00 19.00 ? 191 PRO A C   1 
ATOM   1446 O O   . PRO A 1 191 ? 1.365   68.673 35.628 1.00 22.85 ? 191 PRO A O   1 
ATOM   1447 C CB  . PRO A 1 191 ? -1.149  70.073 34.529 1.00 15.20 ? 191 PRO A CB  1 
ATOM   1448 C CG  . PRO A 1 191 ? -1.519  71.005 33.364 1.00 13.76 ? 191 PRO A CG  1 
ATOM   1449 C CD  . PRO A 1 191 ? -0.786  72.335 33.612 1.00 11.62 ? 191 PRO A CD  1 
ATOM   1450 N N   . LYS A 1 192 ? 2.204   70.064 34.084 1.00 21.61 ? 192 LYS A N   1 
ATOM   1451 C CA  . LYS A 1 192 ? 3.363   69.217 33.860 1.00 28.35 ? 192 LYS A CA  1 
ATOM   1452 C C   . LYS A 1 192 ? 4.542   69.661 34.684 1.00 27.64 ? 192 LYS A C   1 
ATOM   1453 O O   . LYS A 1 192 ? 5.659   69.192 34.486 1.00 23.51 ? 192 LYS A O   1 
ATOM   1454 C CB  . LYS A 1 192 ? 3.752   69.154 32.373 1.00 35.92 ? 192 LYS A CB  1 
ATOM   1455 C CG  . LYS A 1 192 ? 2.560   68.817 31.450 1.00 47.01 ? 192 LYS A CG  1 
ATOM   1456 C CD  . LYS A 1 192 ? 1.747   67.549 31.847 1.00 52.79 ? 192 LYS A CD  1 
ATOM   1457 C CE  . LYS A 1 192 ? 0.462   67.361 31.003 1.00 57.95 ? 192 LYS A CE  1 
ATOM   1458 N NZ  . LYS A 1 192 ? -0.422  66.361 31.583 1.00 62.00 ? 192 LYS A NZ  1 
ATOM   1459 N N   . THR A 1 193 ? 4.303   70.605 35.598 1.00 29.06 ? 193 THR A N   1 
ATOM   1460 C CA  . THR A 1 193 ? 5.398   71.065 36.445 1.00 31.46 ? 193 THR A CA  1 
ATOM   1461 C C   . THR A 1 193 ? 4.927   71.348 37.860 1.00 28.81 ? 193 THR A C   1 
ATOM   1462 O O   . THR A 1 193 ? 5.159   72.434 38.382 1.00 30.32 ? 193 THR A O   1 
ATOM   1463 C CB  . THR A 1 193 ? 6.157   72.253 35.831 1.00 31.79 ? 193 THR A CB  1 
ATOM   1464 O OG1 . THR A 1 193 ? 6.252   72.054 34.417 1.00 35.69 ? 193 THR A OG1 1 
ATOM   1465 C CG2 . THR A 1 193 ? 7.596   72.396 36.364 1.00 33.07 ? 193 THR A CG2 1 
ATOM   1466 N N   . VAL A 1 194 ? 4.224   70.353 38.450 1.00 27.55 ? 194 VAL A N   1 
ATOM   1467 C CA  . VAL A 1 194 ? 3.775   70.498 39.821 1.00 23.61 ? 194 VAL A CA  1 
ATOM   1468 C C   . VAL A 1 194 ? 4.735   69.675 40.659 1.00 23.20 ? 194 VAL A C   1 
ATOM   1469 O O   . VAL A 1 194 ? 5.070   68.553 40.286 1.00 21.51 ? 194 VAL A O   1 
ATOM   1470 C CB  . VAL A 1 194 ? 2.301   70.058 40.037 1.00 18.62 ? 194 VAL A CB  1 
ATOM   1471 C CG1 . VAL A 1 194 ? 1.364   70.532 38.913 1.00 23.81 ? 194 VAL A CG1 1 
ATOM   1472 C CG2 . VAL A 1 194 ? 2.127   68.549 40.147 1.00 18.56 ? 194 VAL A CG2 1 
ATOM   1473 N N   . THR A 1 195 ? 5.167   70.242 41.773 1.00 24.74 ? 195 THR A N   1 
ATOM   1474 C CA  . THR A 1 195 ? 6.053   69.596 42.723 1.00 24.42 ? 195 THR A CA  1 
ATOM   1475 C C   . THR A 1 195 ? 5.240   69.404 44.033 1.00 21.50 ? 195 THR A C   1 
ATOM   1476 O O   . THR A 1 195 ? 4.592   70.330 44.517 1.00 23.06 ? 195 THR A O   1 
ATOM   1477 C CB  . THR A 1 195 ? 7.246   70.554 42.929 1.00 25.90 ? 195 THR A CB  1 
ATOM   1478 O OG1 . THR A 1 195 ? 7.944   70.758 41.698 1.00 26.70 ? 195 THR A OG1 1 
ATOM   1479 C CG2 . THR A 1 195 ? 8.274   70.117 43.978 1.00 23.91 ? 195 THR A CG2 1 
ATOM   1480 N N   . ILE A 1 196 ? 5.234   68.191 44.586 1.00 17.85 ? 196 ILE A N   1 
ATOM   1481 C CA  . ILE A 1 196 ? 4.520   68.008 45.837 1.00 13.44 ? 196 ILE A CA  1 
ATOM   1482 C C   . ILE A 1 196 ? 5.592   68.167 46.934 1.00 17.35 ? 196 ILE A C   1 
ATOM   1483 O O   . ILE A 1 196 ? 6.678   67.597 46.804 1.00 19.81 ? 196 ILE A O   1 
ATOM   1484 C CB  . ILE A 1 196 ? 3.856   66.618 45.882 1.00 4.26  ? 196 ILE A CB  1 
ATOM   1485 C CG1 . ILE A 1 196 ? 4.785   65.463 45.468 1.00 2.00  ? 196 ILE A CG1 1 
ATOM   1486 C CG2 . ILE A 1 196 ? 2.594   66.612 45.039 1.00 3.52  ? 196 ILE A CG2 1 
ATOM   1487 C CD1 . ILE A 1 196 ? 4.190   64.075 45.727 1.00 2.00  ? 196 ILE A CD1 1 
ATOM   1488 N N   . PHE A 1 197 ? 5.316   68.960 47.982 1.00 16.41 ? 197 PHE A N   1 
ATOM   1489 C CA  . PHE A 1 197 ? 6.277   69.120 49.077 1.00 15.70 ? 197 PHE A CA  1 
ATOM   1490 C C   . PHE A 1 197 ? 5.505   68.817 50.347 1.00 16.69 ? 197 PHE A C   1 
ATOM   1491 O O   . PHE A 1 197 ? 4.294   68.990 50.354 1.00 20.30 ? 197 PHE A O   1 
ATOM   1492 C CB  . PHE A 1 197 ? 7.093   70.444 49.051 1.00 14.78 ? 197 PHE A CB  1 
ATOM   1493 C CG  . PHE A 1 197 ? 6.459   71.814 49.265 1.00 11.75 ? 197 PHE A CG  1 
ATOM   1494 C CD1 . PHE A 1 197 ? 5.179   72.144 48.782 1.00 8.99  ? 197 PHE A CD1 1 
ATOM   1495 C CD2 . PHE A 1 197 ? 7.204   72.808 49.944 1.00 6.26  ? 197 PHE A CD2 1 
ATOM   1496 C CE1 . PHE A 1 197 ? 4.653   73.437 48.985 1.00 9.05  ? 197 PHE A CE1 1 
ATOM   1497 C CE2 . PHE A 1 197 ? 6.683   74.095 50.142 1.00 5.01  ? 197 PHE A CE2 1 
ATOM   1498 C CZ  . PHE A 1 197 ? 5.400   74.412 49.668 1.00 4.37  ? 197 PHE A CZ  1 
ATOM   1499 N N   . GLY A 1 198 ? 6.169   68.335 51.407 1.00 17.51 ? 198 GLY A N   1 
ATOM   1500 C CA  . GLY A 1 198 ? 5.440   68.026 52.652 1.00 14.35 ? 198 GLY A CA  1 
ATOM   1501 C C   . GLY A 1 198 ? 6.441   67.752 53.757 1.00 12.67 ? 198 GLY A C   1 
ATOM   1502 O O   . GLY A 1 198 ? 7.595   67.431 53.481 1.00 7.51  ? 198 GLY A O   1 
ATOM   1503 N N   . GLU A 1 199 ? 6.002   67.858 55.024 1.00 13.87 ? 199 GLU A N   1 
ATOM   1504 C CA  . GLU A 1 199 ? 6.901   67.638 56.174 1.00 11.81 ? 199 GLU A CA  1 
ATOM   1505 C C   . GLU A 1 199 ? 6.361   66.609 57.156 1.00 12.20 ? 199 GLU A C   1 
ATOM   1506 O O   . GLU A 1 199 ? 5.153   66.503 57.326 1.00 13.40 ? 199 GLU A O   1 
ATOM   1507 C CB  . GLU A 1 199 ? 7.090   68.986 56.878 1.00 11.00 ? 199 GLU A CB  1 
ATOM   1508 C CG  . GLU A 1 199 ? 8.063   69.009 58.069 1.00 16.00 ? 199 GLU A CG  1 
ATOM   1509 C CD  . GLU A 1 199 ? 7.362   68.769 59.401 1.00 15.20 ? 199 GLU A CD  1 
ATOM   1510 O OE1 . GLU A 1 199 ? 6.154   68.632 59.412 1.00 17.52 ? 199 GLU A OE1 1 
ATOM   1511 O OE2 . GLU A 1 199 ? 8.012   68.711 60.431 1.00 11.72 ? 199 GLU A OE2 1 
ATOM   1512 N N   . SER A 1 200 ? 7.242   65.857 57.833 1.00 11.87 ? 200 SER A N   1 
ATOM   1513 C CA  . SER A 1 200 ? 6.778   64.855 58.793 1.00 12.54 ? 200 SER A CA  1 
ATOM   1514 C C   . SER A 1 200 ? 5.938   63.860 58.001 1.00 12.69 ? 200 SER A C   1 
ATOM   1515 O O   . SER A 1 200 ? 6.403   63.292 57.025 1.00 15.40 ? 200 SER A O   1 
ATOM   1516 C CB  . SER A 1 200 ? 6.151   65.519 60.050 1.00 13.30 ? 200 SER A CB  1 
ATOM   1517 O OG  . SER A 1 200 ? 5.634   64.653 61.093 1.00 21.59 ? 200 SER A OG  1 
ATOM   1518 N N   . ALA A 1 201 ? 4.675   63.680 58.393 1.00 11.48 ? 201 ALA A N   1 
ATOM   1519 C CA  . ALA A 1 201 ? 3.821   62.741 57.676 1.00 10.52 ? 201 ALA A CA  1 
ATOM   1520 C C   . ALA A 1 201 ? 3.596   63.203 56.250 1.00 13.66 ? 201 ALA A C   1 
ATOM   1521 O O   . ALA A 1 201 ? 3.349   62.402 55.369 1.00 17.28 ? 201 ALA A O   1 
ATOM   1522 C CB  . ALA A 1 201 ? 2.477   62.545 58.374 1.00 10.33 ? 201 ALA A CB  1 
ATOM   1523 N N   . GLY A 1 202 ? 3.704   64.518 56.030 1.00 12.24 ? 202 GLY A N   1 
ATOM   1524 C CA  . GLY A 1 202 ? 3.539   65.025 54.675 1.00 12.84 ? 202 GLY A CA  1 
ATOM   1525 C C   . GLY A 1 202 ? 4.710   64.547 53.834 1.00 14.34 ? 202 GLY A C   1 
ATOM   1526 O O   . GLY A 1 202 ? 4.568   64.000 52.754 1.00 18.23 ? 202 GLY A O   1 
ATOM   1527 N N   . GLY A 1 203 ? 5.918   64.706 54.373 1.00 9.95  ? 203 GLY A N   1 
ATOM   1528 C CA  . GLY A 1 203 ? 7.081   64.248 53.628 1.00 6.16  ? 203 GLY A CA  1 
ATOM   1529 C C   . GLY A 1 203 ? 7.043   62.740 53.414 1.00 3.97  ? 203 GLY A C   1 
ATOM   1530 O O   . GLY A 1 203 ? 7.506   62.188 52.429 1.00 7.91  ? 203 GLY A O   1 
ATOM   1531 N N   . ALA A 1 204 ? 6.469   62.029 54.374 1.00 4.18  ? 204 ALA A N   1 
ATOM   1532 C CA  . ALA A 1 204 ? 6.396   60.587 54.173 1.00 5.94  ? 204 ALA A CA  1 
ATOM   1533 C C   . ALA A 1 204 ? 5.338   60.269 53.101 1.00 6.82  ? 204 ALA A C   1 
ATOM   1534 O O   . ALA A 1 204 ? 5.487   59.338 52.319 1.00 10.15 ? 204 ALA A O   1 
ATOM   1535 C CB  . ALA A 1 204 ? 6.106   59.837 55.485 1.00 4.71  ? 204 ALA A CB  1 
ATOM   1536 N N   . SER A 1 205 ? 4.261   61.055 53.073 1.00 5.33  ? 205 SER A N   1 
ATOM   1537 C CA  . SER A 1 205 ? 3.218   60.858 52.077 1.00 5.86  ? 205 SER A CA  1 
ATOM   1538 C C   . SER A 1 205 ? 3.780   61.076 50.653 1.00 8.20  ? 205 SER A C   1 
ATOM   1539 O O   . SER A 1 205 ? 3.547   60.320 49.715 1.00 8.05  ? 205 SER A O   1 
ATOM   1540 C CB  . SER A 1 205 ? 2.075   61.857 52.346 1.00 7.72  ? 205 SER A CB  1 
ATOM   1541 O OG  . SER A 1 205 ? 1.365   61.451 53.513 1.00 5.90  ? 205 SER A OG  1 
ATOM   1542 N N   . VAL A 1 206 ? 4.566   62.146 50.515 1.00 6.12  ? 206 VAL A N   1 
ATOM   1543 C CA  . VAL A 1 206 ? 5.196   62.469 49.256 1.00 2.00  ? 206 VAL A CA  1 
ATOM   1544 C C   . VAL A 1 206 ? 5.972   61.252 48.764 1.00 3.78  ? 206 VAL A C   1 
ATOM   1545 O O   . VAL A 1 206 ? 5.787   60.752 47.665 1.00 11.42 ? 206 VAL A O   1 
ATOM   1546 C CB  . VAL A 1 206 ? 6.055   63.713 49.507 1.00 2.00  ? 206 VAL A CB  1 
ATOM   1547 C CG1 . VAL A 1 206 ? 7.097   63.956 48.444 1.00 2.00  ? 206 VAL A CG1 1 
ATOM   1548 C CG2 . VAL A 1 206 ? 5.182   64.976 49.697 1.00 2.00  ? 206 VAL A CG2 1 
ATOM   1549 N N   . GLY A 1 207 ? 6.842   60.733 49.604 1.00 4.92  ? 207 GLY A N   1 
ATOM   1550 C CA  . GLY A 1 207 ? 7.560   59.553 49.153 1.00 5.92  ? 207 GLY A CA  1 
ATOM   1551 C C   . GLY A 1 207 ? 6.625   58.386 48.855 1.00 8.28  ? 207 GLY A C   1 
ATOM   1552 O O   . GLY A 1 207 ? 6.941   57.511 48.058 1.00 10.84 ? 207 GLY A O   1 
ATOM   1553 N N   . MET A 1 208 ? 5.454   58.370 49.497 1.00 7.20  ? 208 MET A N   1 
ATOM   1554 C CA  . MET A 1 208 ? 4.528   57.283 49.206 1.00 13.02 ? 208 MET A CA  1 
ATOM   1555 C C   . MET A 1 208 ? 3.913   57.475 47.828 1.00 14.81 ? 208 MET A C   1 
ATOM   1556 O O   . MET A 1 208 ? 3.509   56.511 47.199 1.00 18.28 ? 208 MET A O   1 
ATOM   1557 C CB  . MET A 1 208 ? 3.466   57.097 50.302 1.00 12.68 ? 208 MET A CB  1 
ATOM   1558 C CG  . MET A 1 208 ? 4.136   56.577 51.591 1.00 17.91 ? 208 MET A CG  1 
ATOM   1559 S SD  . MET A 1 208 ? 3.052   56.711 53.030 1.00 20.21 ? 208 MET A SD  1 
ATOM   1560 C CE  . MET A 1 208 ? 3.906   55.526 54.098 1.00 20.24 ? 208 MET A CE  1 
ATOM   1561 N N   . HIS A 1 209 ? 3.848   58.718 47.340 1.00 14.66 ? 209 HIS A N   1 
ATOM   1562 C CA  . HIS A 1 209 ? 3.291   58.947 45.996 1.00 11.19 ? 209 HIS A CA  1 
ATOM   1563 C C   . HIS A 1 209 ? 4.358   58.572 44.978 1.00 11.42 ? 209 HIS A C   1 
ATOM   1564 O O   . HIS A 1 209 ? 4.084   58.017 43.928 1.00 14.54 ? 209 HIS A O   1 
ATOM   1565 C CB  . HIS A 1 209 ? 2.747   60.365 45.814 1.00 5.09  ? 209 HIS A CB  1 
ATOM   1566 C CG  . HIS A 1 209 ? 1.485   60.551 46.643 1.00 10.19 ? 209 HIS A CG  1 
ATOM   1567 N ND1 . HIS A 1 209 ? 1.229   61.615 47.439 1.00 6.95  ? 209 HIS A ND1 1 
ATOM   1568 C CD2 . HIS A 1 209 ? 0.350   59.703 46.712 1.00 11.14 ? 209 HIS A CD2 1 
ATOM   1569 C CE1 . HIS A 1 209 ? -0.001  61.438 47.940 1.00 5.74  ? 209 HIS A CE1 1 
ATOM   1570 N NE2 . HIS A 1 209 ? -0.557  60.293 47.518 1.00 9.38  ? 209 HIS A NE2 1 
ATOM   1571 N N   . ILE A 1 210 ? 5.610   58.860 45.305 1.00 6.53  ? 210 ILE A N   1 
ATOM   1572 C CA  . ILE A 1 210 ? 6.673   58.440 44.411 1.00 3.94  ? 210 ILE A CA  1 
ATOM   1573 C C   . ILE A 1 210 ? 6.668   56.913 44.266 1.00 5.37  ? 210 ILE A C   1 
ATOM   1574 O O   . ILE A 1 210 ? 7.180   56.400 43.284 1.00 6.16  ? 210 ILE A O   1 
ATOM   1575 C CB  . ILE A 1 210 ? 8.032   58.884 45.019 1.00 2.00  ? 210 ILE A CB  1 
ATOM   1576 C CG1 . ILE A 1 210 ? 8.188   60.403 44.963 1.00 2.00  ? 210 ILE A CG1 1 
ATOM   1577 C CG2 . ILE A 1 210 ? 9.267   58.176 44.438 1.00 2.00  ? 210 ILE A CG2 1 
ATOM   1578 C CD1 . ILE A 1 210 ? 9.641   60.860 45.130 1.00 2.00  ? 210 ILE A CD1 1 
ATOM   1579 N N   . LEU A 1 211 ? 6.136   56.196 45.270 1.00 9.23  ? 211 LEU A N   1 
ATOM   1580 C CA  . LEU A 1 211 ? 6.130   54.723 45.227 1.00 11.06 ? 211 LEU A CA  1 
ATOM   1581 C C   . LEU A 1 211 ? 4.860   54.134 44.636 1.00 10.95 ? 211 LEU A C   1 
ATOM   1582 O O   . LEU A 1 211 ? 4.847   53.175 43.886 1.00 11.23 ? 211 LEU A O   1 
ATOM   1583 C CB  . LEU A 1 211 ? 6.248   54.128 46.660 1.00 12.80 ? 211 LEU A CB  1 
ATOM   1584 C CG  . LEU A 1 211 ? 7.587   54.369 47.402 1.00 13.52 ? 211 LEU A CG  1 
ATOM   1585 C CD1 . LEU A 1 211 ? 7.445   54.183 48.916 1.00 17.51 ? 211 LEU A CD1 1 
ATOM   1586 C CD2 . LEU A 1 211 ? 8.665   53.413 46.916 1.00 12.10 ? 211 LEU A CD2 1 
ATOM   1587 N N   . SER A 1 212 ? 3.736   54.704 45.013 1.00 14.70 ? 212 SER A N   1 
ATOM   1588 C CA  . SER A 1 212 ? 2.476   54.173 44.523 1.00 14.50 ? 212 SER A CA  1 
ATOM   1589 C C   . SER A 1 212 ? 2.337   54.386 43.025 1.00 21.75 ? 212 SER A C   1 
ATOM   1590 O O   . SER A 1 212 ? 2.259   55.534 42.568 1.00 21.93 ? 212 SER A O   1 
ATOM   1591 C CB  . SER A 1 212 ? 1.355   54.934 45.211 1.00 15.12 ? 212 SER A CB  1 
ATOM   1592 O OG  . SER A 1 212 ? 0.118   54.303 44.978 1.00 13.22 ? 212 SER A OG  1 
ATOM   1593 N N   . PRO A 1 213 ? 2.192   53.264 42.271 1.00 23.23 ? 213 PRO A N   1 
ATOM   1594 C CA  . PRO A 1 213 ? 1.945   53.349 40.829 1.00 21.02 ? 213 PRO A CA  1 
ATOM   1595 C C   . PRO A 1 213 ? 0.849   54.321 40.459 1.00 19.13 ? 213 PRO A C   1 
ATOM   1596 O O   . PRO A 1 213 ? 1.017   55.184 39.612 1.00 27.56 ? 213 PRO A O   1 
ATOM   1597 C CB  . PRO A 1 213 ? 1.602   51.919 40.393 1.00 20.29 ? 213 PRO A CB  1 
ATOM   1598 C CG  . PRO A 1 213 ? 2.090   51.014 41.535 1.00 28.00 ? 213 PRO A CG  1 
ATOM   1599 C CD  . PRO A 1 213 ? 2.252   51.897 42.783 1.00 25.05 ? 213 PRO A CD  1 
ATOM   1600 N N   . GLY A 1 214 ? -0.279  54.169 41.142 1.00 14.82 ? 214 GLY A N   1 
ATOM   1601 C CA  . GLY A 1 214 ? -1.396  55.057 40.855 1.00 11.73 ? 214 GLY A CA  1 
ATOM   1602 C C   . GLY A 1 214 ? -1.131  56.562 40.981 1.00 16.73 ? 214 GLY A C   1 
ATOM   1603 O O   . GLY A 1 214 ? -1.838  57.366 40.392 1.00 18.79 ? 214 GLY A O   1 
ATOM   1604 N N   . SER A 1 215 ? -0.120  56.979 41.746 1.00 17.16 ? 215 SER A N   1 
ATOM   1605 C CA  . SER A 1 215 ? 0.068   58.425 41.839 1.00 16.69 ? 215 SER A CA  1 
ATOM   1606 C C   . SER A 1 215 ? 1.252   58.958 41.067 1.00 16.13 ? 215 SER A C   1 
ATOM   1607 O O   . SER A 1 215 ? 1.328   60.161 40.835 1.00 15.15 ? 215 SER A O   1 
ATOM   1608 C CB  . SER A 1 215 ? 0.333   58.824 43.298 1.00 18.02 ? 215 SER A CB  1 
ATOM   1609 O OG  . SER A 1 215 ? -0.780  58.428 44.069 1.00 16.10 ? 215 SER A OG  1 
ATOM   1610 N N   . ARG A 1 216 ? 2.166   58.067 40.662 1.00 11.76 ? 216 ARG A N   1 
ATOM   1611 C CA  . ARG A 1 216 ? 3.365   58.553 39.993 1.00 7.47  ? 216 ARG A CA  1 
ATOM   1612 C C   . ARG A 1 216 ? 3.154   59.544 38.901 1.00 12.43 ? 216 ARG A C   1 
ATOM   1613 O O   . ARG A 1 216 ? 4.003   60.381 38.658 1.00 13.54 ? 216 ARG A O   1 
ATOM   1614 C CB  . ARG A 1 216 ? 4.172   57.414 39.365 1.00 3.07  ? 216 ARG A CB  1 
ATOM   1615 C CG  . ARG A 1 216 ? 4.511   56.315 40.358 1.00 4.23  ? 216 ARG A CG  1 
ATOM   1616 C CD  . ARG A 1 216 ? 5.389   55.216 39.790 1.00 3.04  ? 216 ARG A CD  1 
ATOM   1617 N NE  . ARG A 1 216 ? 5.359   54.129 40.725 1.00 5.69  ? 216 ARG A NE  1 
ATOM   1618 C CZ  . ARG A 1 216 ? 5.964   52.959 40.550 1.00 11.34 ? 216 ARG A CZ  1 
ATOM   1619 N NH1 . ARG A 1 216 ? 6.790   52.725 39.536 1.00 14.95 ? 216 ARG A NH1 1 
ATOM   1620 N NH2 . ARG A 1 216 ? 5.701   52.009 41.433 1.00 13.59 ? 216 ARG A NH2 1 
ATOM   1621 N N   . ASP A 1 217 ? 2.000   59.449 38.236 1.00 15.00 ? 217 ASP A N   1 
ATOM   1622 C CA  . ASP A 1 217 ? 1.829   60.353 37.105 1.00 19.24 ? 217 ASP A CA  1 
ATOM   1623 C C   . ASP A 1 217 ? 1.248   61.740 37.367 1.00 18.74 ? 217 ASP A C   1 
ATOM   1624 O O   . ASP A 1 217 ? 1.229   62.518 36.421 1.00 21.91 ? 217 ASP A O   1 
ATOM   1625 C CB  . ASP A 1 217 ? 0.959   59.675 36.016 1.00 23.06 ? 217 ASP A CB  1 
ATOM   1626 C CG  . ASP A 1 217 ? 1.414   58.278 35.549 1.00 25.62 ? 217 ASP A CG  1 
ATOM   1627 O OD1 . ASP A 1 217 ? 2.548   57.880 35.829 1.00 22.78 ? 217 ASP A OD1 1 
ATOM   1628 O OD2 . ASP A 1 217 ? 0.623   57.592 34.893 1.00 22.82 ? 217 ASP A OD2 1 
ATOM   1629 N N   . LEU A 1 218 ? 0.777   62.060 38.588 1.00 16.28 ? 218 LEU A N   1 
ATOM   1630 C CA  . LEU A 1 218 ? 0.167   63.379 38.791 1.00 7.33  ? 218 LEU A CA  1 
ATOM   1631 C C   . LEU A 1 218 ? 1.103   64.435 39.320 1.00 6.79  ? 218 LEU A C   1 
ATOM   1632 O O   . LEU A 1 218 ? 0.637   65.480 39.781 1.00 8.66  ? 218 LEU A O   1 
ATOM   1633 C CB  . LEU A 1 218 ? -1.065  63.315 39.710 1.00 4.41  ? 218 LEU A CB  1 
ATOM   1634 C CG  . LEU A 1 218 ? -2.056  62.222 39.286 1.00 5.15  ? 218 LEU A CG  1 
ATOM   1635 C CD1 . LEU A 1 218 ? -1.925  61.003 40.179 1.00 12.78 ? 218 LEU A CD1 1 
ATOM   1636 C CD2 . LEU A 1 218 ? -3.501  62.692 39.304 1.00 9.62  ? 218 LEU A CD2 1 
ATOM   1637 N N   . PHE A 1 219 ? 2.408   64.162 39.300 1.00 2.00  ? 219 PHE A N   1 
ATOM   1638 C CA  . PHE A 1 219 ? 3.315   65.184 39.796 1.00 3.78  ? 219 PHE A CA  1 
ATOM   1639 C C   . PHE A 1 219 ? 4.652   64.960 39.090 1.00 6.87  ? 219 PHE A C   1 
ATOM   1640 O O   . PHE A 1 219 ? 4.892   63.889 38.535 1.00 2.00  ? 219 PHE A O   1 
ATOM   1641 C CB  . PHE A 1 219 ? 3.368   65.195 41.347 1.00 3.53  ? 219 PHE A CB  1 
ATOM   1642 C CG  . PHE A 1 219 ? 3.986   63.928 41.898 1.00 2.00  ? 219 PHE A CG  1 
ATOM   1643 C CD1 . PHE A 1 219 ? 3.212   62.771 42.060 1.00 2.00  ? 219 PHE A CD1 1 
ATOM   1644 C CD2 . PHE A 1 219 ? 5.364   63.892 42.168 1.00 2.00  ? 219 PHE A CD2 1 
ATOM   1645 C CE1 . PHE A 1 219 ? 3.828   61.581 42.454 1.00 2.00  ? 219 PHE A CE1 1 
ATOM   1646 C CE2 . PHE A 1 219 ? 5.977   62.707 42.564 1.00 2.00  ? 219 PHE A CE2 1 
ATOM   1647 C CZ  . PHE A 1 219 ? 5.206   61.550 42.701 1.00 2.00  ? 219 PHE A CZ  1 
ATOM   1648 N N   . ARG A 1 220 ? 5.515   65.991 39.120 1.00 6.39  ? 220 ARG A N   1 
ATOM   1649 C CA  . ARG A 1 220 ? 6.808   65.884 38.440 1.00 9.97  ? 220 ARG A CA  1 
ATOM   1650 C C   . ARG A 1 220 ? 7.912   65.556 39.397 1.00 14.43 ? 220 ARG A C   1 
ATOM   1651 O O   . ARG A 1 220 ? 8.466   64.473 39.360 1.00 18.16 ? 220 ARG A O   1 
ATOM   1652 C CB  . ARG A 1 220 ? 7.108   67.173 37.640 1.00 12.04 ? 220 ARG A CB  1 
ATOM   1653 C CG  . ARG A 1 220 ? 8.271   67.027 36.635 1.00 15.91 ? 220 ARG A CG  1 
ATOM   1654 C CD  . ARG A 1 220 ? 8.000   67.797 35.337 1.00 19.43 ? 220 ARG A CD  1 
ATOM   1655 N NE  . ARG A 1 220 ? 9.148   67.726 34.445 1.00 22.80 ? 220 ARG A NE  1 
ATOM   1656 C CZ  . ARG A 1 220 ? 9.270   68.564 33.400 1.00 22.42 ? 220 ARG A CZ  1 
ATOM   1657 N NH1 . ARG A 1 220 ? 8.375   69.516 33.153 1.00 20.61 ? 220 ARG A NH1 1 
ATOM   1658 N NH2 . ARG A 1 220 ? 10.321  68.455 32.605 1.00 25.46 ? 220 ARG A NH2 1 
ATOM   1659 N N   . ARG A 1 221 ? 8.195   66.527 40.276 1.00 17.89 ? 221 ARG A N   1 
ATOM   1660 C CA  . ARG A 1 221 ? 9.258   66.383 41.266 1.00 17.22 ? 221 ARG A CA  1 
ATOM   1661 C C   . ARG A 1 221 ? 8.644   66.313 42.658 1.00 17.46 ? 221 ARG A C   1 
ATOM   1662 O O   . ARG A 1 221 ? 7.445   66.512 42.819 1.00 17.58 ? 221 ARG A O   1 
ATOM   1663 C CB  . ARG A 1 221 ? 10.161  67.625 41.216 1.00 19.05 ? 221 ARG A CB  1 
ATOM   1664 C CG  . ARG A 1 221 ? 10.647  68.028 39.816 1.00 16.37 ? 221 ARG A CG  1 
ATOM   1665 C CD  . ARG A 1 221 ? 11.060  69.518 39.785 1.00 28.68 ? 221 ARG A CD  1 
ATOM   1666 N NE  . ARG A 1 221 ? 10.931  70.103 38.460 1.00 33.55 ? 221 ARG A NE  1 
ATOM   1667 C CZ  . ARG A 1 221 ? 11.679  69.665 37.455 1.00 35.29 ? 221 ARG A CZ  1 
ATOM   1668 N NH1 . ARG A 1 221 ? 12.631  68.772 37.692 1.00 34.37 ? 221 ARG A NH1 1 
ATOM   1669 N NH2 . ARG A 1 221 ? 11.456  70.112 36.218 1.00 36.84 ? 221 ARG A NH2 1 
ATOM   1670 N N   . ALA A 1 222 ? 9.486   66.088 43.675 1.00 15.70 ? 222 ALA A N   1 
ATOM   1671 C CA  . ALA A 1 222 ? 8.963   66.034 45.036 1.00 13.29 ? 222 ALA A CA  1 
ATOM   1672 C C   . ALA A 1 222 ? 10.009  66.556 46.017 1.00 13.23 ? 222 ALA A C   1 
ATOM   1673 O O   . ALA A 1 222 ? 11.200  66.445 45.737 1.00 14.05 ? 222 ALA A O   1 
ATOM   1674 C CB  . ALA A 1 222 ? 8.669   64.583 45.397 1.00 9.62  ? 222 ALA A CB  1 
ATOM   1675 N N   . ILE A 1 223 ? 9.543   67.114 47.149 1.00 13.40 ? 223 ILE A N   1 
ATOM   1676 C CA  . ILE A 1 223 ? 10.397  67.622 48.233 1.00 11.20 ? 223 ILE A CA  1 
ATOM   1677 C C   . ILE A 1 223 ? 9.900   66.909 49.494 1.00 11.06 ? 223 ILE A C   1 
ATOM   1678 O O   . ILE A 1 223 ? 8.696   66.894 49.755 1.00 9.43  ? 223 ILE A O   1 
ATOM   1679 C CB  . ILE A 1 223 ? 10.267  69.139 48.446 1.00 7.01  ? 223 ILE A CB  1 
ATOM   1680 C CG1 . ILE A 1 223 ? 10.630  69.951 47.196 1.00 8.53  ? 223 ILE A CG1 1 
ATOM   1681 C CG2 . ILE A 1 223 ? 11.073  69.602 49.656 1.00 6.83  ? 223 ILE A CG2 1 
ATOM   1682 C CD1 . ILE A 1 223 ? 10.706  71.477 47.400 1.00 2.00  ? 223 ILE A CD1 1 
ATOM   1683 N N   . LEU A 1 224 ? 10.832  66.364 50.282 1.00 10.82 ? 224 LEU A N   1 
ATOM   1684 C CA  . LEU A 1 224 ? 10.454  65.636 51.504 1.00 10.14 ? 224 LEU A CA  1 
ATOM   1685 C C   . LEU A 1 224 ? 11.186  66.286 52.662 1.00 7.47  ? 224 LEU A C   1 
ATOM   1686 O O   . LEU A 1 224 ? 12.407  66.353 52.657 1.00 8.76  ? 224 LEU A O   1 
ATOM   1687 C CB  . LEU A 1 224 ? 10.856  64.138 51.432 1.00 9.75  ? 224 LEU A CB  1 
ATOM   1688 C CG  . LEU A 1 224 ? 10.162  63.329 50.311 1.00 4.79  ? 224 LEU A CG  1 
ATOM   1689 C CD1 . LEU A 1 224 ? 10.817  63.512 48.939 1.00 5.18  ? 224 LEU A CD1 1 
ATOM   1690 C CD2 . LEU A 1 224 ? 10.126  61.833 50.641 1.00 2.00  ? 224 LEU A CD2 1 
ATOM   1691 N N   . GLN A 1 225 ? 10.441  66.772 53.661 1.00 6.25  ? 225 GLN A N   1 
ATOM   1692 C CA  . GLN A 1 225 ? 11.071  67.435 54.809 1.00 5.17  ? 225 GLN A CA  1 
ATOM   1693 C C   . GLN A 1 225 ? 10.840  66.600 56.068 1.00 5.65  ? 225 GLN A C   1 
ATOM   1694 O O   . GLN A 1 225 ? 9.703   66.387 56.488 1.00 4.29  ? 225 GLN A O   1 
ATOM   1695 C CB  . GLN A 1 225 ? 10.491  68.867 54.981 1.00 6.19  ? 225 GLN A CB  1 
ATOM   1696 C CG  . GLN A 1 225 ? 10.039  69.499 53.638 1.00 9.69  ? 225 GLN A CG  1 
ATOM   1697 C CD  . GLN A 1 225 ? 9.983   71.001 53.631 1.00 7.42  ? 225 GLN A CD  1 
ATOM   1698 O OE1 . GLN A 1 225 ? 8.963   71.660 53.579 1.00 11.52 ? 225 GLN A OE1 1 
ATOM   1699 N NE2 . GLN A 1 225 ? 11.165  71.555 53.655 1.00 14.31 ? 225 GLN A NE2 1 
ATOM   1700 N N   . SER A 1 226 ? 11.935  66.119 56.667 1.00 7.22  ? 226 SER A N   1 
ATOM   1701 C CA  . SER A 1 226 ? 11.870  65.309 57.882 1.00 7.97  ? 226 SER A CA  1 
ATOM   1702 C C   . SER A 1 226 ? 10.855  64.187 57.790 1.00 9.27  ? 226 SER A C   1 
ATOM   1703 O O   . SER A 1 226 ? 10.069  63.996 58.704 1.00 14.08 ? 226 SER A O   1 
ATOM   1704 C CB  . SER A 1 226 ? 11.509  66.207 59.087 1.00 9.13  ? 226 SER A CB  1 
ATOM   1705 O OG  . SER A 1 226 ? 12.345  67.380 59.155 1.00 17.16 ? 226 SER A OG  1 
ATOM   1706 N N   . GLY A 1 227 ? 10.841  63.453 56.686 1.00 9.93  ? 227 GLY A N   1 
ATOM   1707 C CA  . GLY A 1 227 ? 9.866   62.365 56.553 1.00 10.00 ? 227 GLY A CA  1 
ATOM   1708 C C   . GLY A 1 227 ? 10.398  61.422 55.485 1.00 9.65  ? 227 GLY A C   1 
ATOM   1709 O O   . GLY A 1 227 ? 11.241  61.798 54.678 1.00 9.92  ? 227 GLY A O   1 
ATOM   1710 N N   . SER A 1 228 ? 9.934   60.186 55.475 1.00 4.61  ? 228 SER A N   1 
ATOM   1711 C CA  . SER A 1 228 ? 10.456  59.283 54.477 1.00 4.86  ? 228 SER A CA  1 
ATOM   1712 C C   . SER A 1 228 ? 9.499   58.143 54.546 1.00 8.96  ? 228 SER A C   1 
ATOM   1713 O O   . SER A 1 228 ? 9.098   57.836 55.653 1.00 14.21 ? 228 SER A O   1 
ATOM   1714 C CB  . SER A 1 228 ? 11.860  58.847 54.901 1.00 2.40  ? 228 SER A CB  1 
ATOM   1715 O OG  . SER A 1 228 ? 12.576  58.342 53.834 1.00 10.54 ? 228 SER A OG  1 
ATOM   1716 N N   . PRO A 1 229 ? 9.076   57.527 53.426 1.00 11.99 ? 229 PRO A N   1 
ATOM   1717 C CA  . PRO A 1 229 ? 7.931   56.615 53.484 1.00 9.60  ? 229 PRO A CA  1 
ATOM   1718 C C   . PRO A 1 229 ? 8.277   55.397 54.298 1.00 7.79  ? 229 PRO A C   1 
ATOM   1719 O O   . PRO A 1 229 ? 7.446   54.725 54.874 1.00 10.90 ? 229 PRO A O   1 
ATOM   1720 C CB  . PRO A 1 229 ? 7.694   56.249 52.014 1.00 10.02 ? 229 PRO A CB  1 
ATOM   1721 C CG  . PRO A 1 229 ? 9.027   56.508 51.286 1.00 11.62 ? 229 PRO A CG  1 
ATOM   1722 C CD  . PRO A 1 229 ? 9.709   57.613 52.107 1.00 11.57 ? 229 PRO A CD  1 
ATOM   1723 N N   . ASN A 1 230 ? 9.573   55.114 54.322 1.00 7.25  ? 230 ASN A N   1 
ATOM   1724 C CA  . ASN A 1 230 ? 10.101  53.963 55.035 1.00 6.94  ? 230 ASN A CA  1 
ATOM   1725 C C   . ASN A 1 230 ? 10.359  54.238 56.512 1.00 9.37  ? 230 ASN A C   1 
ATOM   1726 O O   . ASN A 1 230 ? 10.986  53.433 57.193 1.00 15.47 ? 230 ASN A O   1 
ATOM   1727 C CB  . ASN A 1 230 ? 11.407  53.456 54.369 1.00 2.00  ? 230 ASN A CB  1 
ATOM   1728 C CG  . ASN A 1 230 ? 12.516  54.501 54.448 1.00 6.77  ? 230 ASN A CG  1 
ATOM   1729 O OD1 . ASN A 1 230 ? 12.303  55.690 54.241 1.00 2.00  ? 230 ASN A OD1 1 
ATOM   1730 N ND2 . ASN A 1 230 ? 13.720  54.047 54.770 1.00 11.81 ? 230 ASN A ND2 1 
ATOM   1731 N N   . CYS A 1 231 ? 9.937   55.401 57.009 1.00 7.38  ? 231 CYS A N   1 
ATOM   1732 C CA  . CYS A 1 231 ? 10.172  55.654 58.423 1.00 5.55  ? 231 CYS A CA  1 
ATOM   1733 C C   . CYS A 1 231 ? 9.274   54.707 59.206 1.00 7.90  ? 231 CYS A C   1 
ATOM   1734 O O   . CYS A 1 231 ? 8.155   54.482 58.758 1.00 6.82  ? 231 CYS A O   1 
ATOM   1735 C CB  . CYS A 1 231 ? 9.735   57.072 58.763 1.00 2.72  ? 231 CYS A CB  1 
ATOM   1736 S SG  . CYS A 1 231 ? 10.980  58.262 58.302 1.00 16.21 ? 231 CYS A SG  1 
ATOM   1737 N N   . PRO A 1 232 ? 9.742   54.211 60.387 1.00 6.94  ? 232 PRO A N   1 
ATOM   1738 C CA  . PRO A 1 232 ? 9.078   53.113 61.078 1.00 6.07  ? 232 PRO A CA  1 
ATOM   1739 C C   . PRO A 1 232 ? 7.696   53.428 61.555 1.00 10.04 ? 232 PRO A C   1 
ATOM   1740 O O   . PRO A 1 232 ? 6.866   52.567 61.792 1.00 14.91 ? 232 PRO A O   1 
ATOM   1741 C CB  . PRO A 1 232 ? 9.964   52.840 62.296 1.00 3.63  ? 232 PRO A CB  1 
ATOM   1742 C CG  . PRO A 1 232 ? 10.918  54.028 62.451 1.00 2.00  ? 232 PRO A CG  1 
ATOM   1743 C CD  . PRO A 1 232 ? 10.904  54.738 61.101 1.00 6.31  ? 232 PRO A CD  1 
ATOM   1744 N N   . TRP A 1 233 ? 7.475   54.719 61.733 1.00 10.65 ? 233 TRP A N   1 
ATOM   1745 C CA  . TRP A 1 233 ? 6.176   55.128 62.214 1.00 10.28 ? 233 TRP A CA  1 
ATOM   1746 C C   . TRP A 1 233 ? 5.197   55.439 61.106 1.00 12.09 ? 233 TRP A C   1 
ATOM   1747 O O   . TRP A 1 233 ? 4.084   55.868 61.389 1.00 15.11 ? 233 TRP A O   1 
ATOM   1748 C CB  . TRP A 1 233 ? 6.341   56.372 63.088 1.00 7.96  ? 233 TRP A CB  1 
ATOM   1749 C CG  . TRP A 1 233 ? 7.222   57.386 62.399 1.00 7.00  ? 233 TRP A CG  1 
ATOM   1750 C CD1 . TRP A 1 233 ? 8.621   57.518 62.583 1.00 9.69  ? 233 TRP A CD1 1 
ATOM   1751 C CD2 . TRP A 1 233 ? 6.822   58.383 61.495 1.00 5.75  ? 233 TRP A CD2 1 
ATOM   1752 N NE1 . TRP A 1 233 ? 9.099   58.558 61.845 1.00 9.36  ? 233 TRP A NE1 1 
ATOM   1753 C CE2 . TRP A 1 233 ? 8.057   59.138 61.158 1.00 6.32  ? 233 TRP A CE2 1 
ATOM   1754 C CE3 . TRP A 1 233 ? 5.602   58.746 60.911 1.00 4.33  ? 233 TRP A CE3 1 
ATOM   1755 C CZ2 . TRP A 1 233 ? 7.987   60.215 60.272 1.00 2.00  ? 233 TRP A CZ2 1 
ATOM   1756 C CZ3 . TRP A 1 233 ? 5.565   59.831 60.018 1.00 4.01  ? 233 TRP A CZ3 1 
ATOM   1757 C CH2 . TRP A 1 233 ? 6.738   60.552 59.709 1.00 5.70  ? 233 TRP A CH2 1 
ATOM   1758 N N   . ALA A 1 234 ? 5.603   55.263 59.837 1.00 10.40 ? 234 ALA A N   1 
ATOM   1759 C CA  . ALA A 1 234 ? 4.664   55.613 58.762 1.00 10.23 ? 234 ALA A CA  1 
ATOM   1760 C C   . ALA A 1 234 ? 3.829   54.471 58.193 1.00 9.20  ? 234 ALA A C   1 
ATOM   1761 O O   . ALA A 1 234 ? 2.994   54.737 57.345 1.00 8.66  ? 234 ALA A O   1 
ATOM   1762 C CB  . ALA A 1 234 ? 5.389   56.299 57.601 1.00 9.92  ? 234 ALA A CB  1 
ATOM   1763 N N   . SER A 1 235 ? 4.009   53.214 58.584 1.00 9.85  ? 235 SER A N   1 
ATOM   1764 C CA  . SER A 1 235 ? 3.125   52.240 57.963 1.00 8.55  ? 235 SER A CA  1 
ATOM   1765 C C   . SER A 1 235 ? 2.925   51.041 58.838 1.00 11.23 ? 235 SER A C   1 
ATOM   1766 O O   . SER A 1 235 ? 3.702   50.831 59.755 1.00 14.24 ? 235 SER A O   1 
ATOM   1767 C CB  . SER A 1 235 ? 3.689   51.813 56.616 1.00 9.56  ? 235 SER A CB  1 
ATOM   1768 O OG  . SER A 1 235 ? 5.031   51.343 56.756 1.00 11.78 ? 235 SER A OG  1 
ATOM   1769 N N   . VAL A 1 236 ? 1.875   50.263 58.594 1.00 12.67 ? 236 VAL A N   1 
ATOM   1770 C CA  . VAL A 1 236 ? 1.665   49.054 59.377 1.00 12.89 ? 236 VAL A CA  1 
ATOM   1771 C C   . VAL A 1 236 ? 1.203   47.980 58.410 1.00 14.64 ? 236 VAL A C   1 
ATOM   1772 O O   . VAL A 1 236 ? 0.770   48.250 57.299 1.00 18.52 ? 236 VAL A O   1 
ATOM   1773 C CB  . VAL A 1 236 ? 0.694   49.230 60.562 1.00 13.36 ? 236 VAL A CB  1 
ATOM   1774 C CG1 . VAL A 1 236 ? 1.252   50.234 61.568 1.00 9.32  ? 236 VAL A CG1 1 
ATOM   1775 C CG2 . VAL A 1 236 ? -0.759  49.575 60.164 1.00 12.44 ? 236 VAL A CG2 1 
ATOM   1776 N N   . SER A 1 237 ? 1.280   46.733 58.829 1.00 11.99 ? 237 SER A N   1 
ATOM   1777 C CA  . SER A 1 237 ? 0.841   45.682 57.934 1.00 14.87 ? 237 SER A CA  1 
ATOM   1778 C C   . SER A 1 237 ? -0.664  45.589 58.008 1.00 16.44 ? 237 SER A C   1 
ATOM   1779 O O   . SER A 1 237 ? -1.283  46.134 58.916 1.00 17.84 ? 237 SER A O   1 
ATOM   1780 C CB  . SER A 1 237 ? 1.473   44.359 58.355 1.00 20.46 ? 237 SER A CB  1 
ATOM   1781 O OG  . SER A 1 237 ? 1.233   44.181 59.749 1.00 31.59 ? 237 SER A OG  1 
ATOM   1782 N N   . VAL A 1 238 ? -1.261  44.849 57.074 1.00 16.30 ? 238 VAL A N   1 
ATOM   1783 C CA  . VAL A 1 238 ? -2.705  44.760 57.161 1.00 17.07 ? 238 VAL A CA  1 
ATOM   1784 C C   . VAL A 1 238 ? -3.148  44.105 58.431 1.00 17.30 ? 238 VAL A C   1 
ATOM   1785 O O   . VAL A 1 238 ? -4.183  44.417 59.005 1.00 20.67 ? 238 VAL A O   1 
ATOM   1786 C CB  . VAL A 1 238 ? -3.267  44.082 55.922 1.00 13.86 ? 238 VAL A CB  1 
ATOM   1787 C CG1 . VAL A 1 238 ? -3.019  44.988 54.718 1.00 21.79 ? 238 VAL A CG1 1 
ATOM   1788 C CG2 . VAL A 1 238 ? -2.649  42.709 55.657 1.00 20.71 ? 238 VAL A CG2 1 
ATOM   1789 N N   . ALA A 1 239 ? -2.299  43.184 58.874 1.00 16.88 ? 239 ALA A N   1 
ATOM   1790 C CA  . ALA A 1 239 ? -2.651  42.491 60.097 1.00 19.71 ? 239 ALA A CA  1 
ATOM   1791 C C   . ALA A 1 239 ? -2.739  43.451 61.258 1.00 22.34 ? 239 ALA A C   1 
ATOM   1792 O O   . ALA A 1 239 ? -3.704  43.480 62.010 1.00 24.99 ? 239 ALA A O   1 
ATOM   1793 C CB  . ALA A 1 239 ? -1.629  41.400 60.402 1.00 20.58 ? 239 ALA A CB  1 
ATOM   1794 N N   . GLU A 1 240 ? -1.687  44.271 61.369 1.00 21.45 ? 240 GLU A N   1 
ATOM   1795 C CA  . GLU A 1 240 ? -1.680  45.231 62.462 1.00 20.50 ? 240 GLU A CA  1 
ATOM   1796 C C   . GLU A 1 240 ? -2.828  46.188 62.386 1.00 19.54 ? 240 GLU A C   1 
ATOM   1797 O O   . GLU A 1 240 ? -3.458  46.502 63.378 1.00 22.06 ? 240 GLU A O   1 
ATOM   1798 C CB  . GLU A 1 240 ? -0.360  46.019 62.554 1.00 23.57 ? 240 GLU A CB  1 
ATOM   1799 C CG  . GLU A 1 240 ? 0.418   45.679 63.843 1.00 30.30 ? 240 GLU A CG  1 
ATOM   1800 C CD  . GLU A 1 240 ? -0.134  46.401 65.072 1.00 27.07 ? 240 GLU A CD  1 
ATOM   1801 O OE1 . GLU A 1 240 ? -1.308  46.735 65.099 1.00 26.76 ? 240 GLU A OE1 1 
ATOM   1802 O OE2 . GLU A 1 240 ? 0.622   46.643 65.998 1.00 28.68 ? 240 GLU A OE2 1 
ATOM   1803 N N   . GLY A 1 241 ? -3.095  46.672 61.187 1.00 19.60 ? 241 GLY A N   1 
ATOM   1804 C CA  . GLY A 1 241 ? -4.201  47.607 61.081 1.00 17.71 ? 241 GLY A CA  1 
ATOM   1805 C C   . GLY A 1 241 ? -5.484  46.963 61.526 1.00 16.81 ? 241 GLY A C   1 
ATOM   1806 O O   . GLY A 1 241 ? -6.326  47.575 62.165 1.00 17.07 ? 241 GLY A O   1 
ATOM   1807 N N   . ARG A 1 242 ? -5.615  45.674 61.211 1.00 18.59 ? 242 ARG A N   1 
ATOM   1808 C CA  . ARG A 1 242 ? -6.839  45.009 61.630 1.00 21.59 ? 242 ARG A CA  1 
ATOM   1809 C C   . ARG A 1 242 ? -6.910  44.993 63.144 1.00 22.77 ? 242 ARG A C   1 
ATOM   1810 O O   . ARG A 1 242 ? -7.902  45.334 63.782 1.00 24.72 ? 242 ARG A O   1 
ATOM   1811 C CB  . ARG A 1 242 ? -6.885  43.591 61.054 1.00 20.14 ? 242 ARG A CB  1 
ATOM   1812 C CG  . ARG A 1 242 ? -8.240  42.915 61.291 1.00 27.41 ? 242 ARG A CG  1 
ATOM   1813 C CD  . ARG A 1 242 ? -8.448  41.677 60.402 1.00 32.04 ? 242 ARG A CD  1 
ATOM   1814 N NE  . ARG A 1 242 ? -8.830  42.067 59.050 1.00 38.93 ? 242 ARG A NE  1 
ATOM   1815 C CZ  . ARG A 1 242 ? -10.099 42.372 58.735 1.00 42.03 ? 242 ARG A CZ  1 
ATOM   1816 N NH1 . ARG A 1 242 ? -11.063 42.318 59.650 1.00 41.27 ? 242 ARG A NH1 1 
ATOM   1817 N NH2 . ARG A 1 242 ? -10.400 42.719 57.484 1.00 48.90 ? 242 ARG A NH2 1 
ATOM   1818 N N   . ARG A 1 243 ? -5.778  44.583 63.707 1.00 21.15 ? 243 ARG A N   1 
ATOM   1819 C CA  . ARG A 1 243 ? -5.649  44.508 65.137 1.00 19.68 ? 243 ARG A CA  1 
ATOM   1820 C C   . ARG A 1 243 ? -6.085  45.804 65.811 1.00 20.18 ? 243 ARG A C   1 
ATOM   1821 O O   . ARG A 1 243 ? -6.945  45.824 66.687 1.00 22.86 ? 243 ARG A O   1 
ATOM   1822 C CB  . ARG A 1 243 ? -4.203  44.175 65.490 1.00 25.56 ? 243 ARG A CB  1 
ATOM   1823 C CG  . ARG A 1 243 ? -4.106  43.158 66.634 1.00 39.24 ? 243 ARG A CG  1 
ATOM   1824 C CD  . ARG A 1 243 ? -2.964  43.359 67.672 1.00 50.63 ? 243 ARG A CD  1 
ATOM   1825 N NE  . ARG A 1 243 ? -2.293  44.668 67.651 1.00 52.71 ? 243 ARG A NE  1 
ATOM   1826 C CZ  . ARG A 1 243 ? -2.663  45.754 68.373 1.00 54.11 ? 243 ARG A CZ  1 
ATOM   1827 N NH1 . ARG A 1 243 ? -3.759  45.769 69.142 1.00 53.49 ? 243 ARG A NH1 1 
ATOM   1828 N NH2 . ARG A 1 243 ? -1.899  46.844 68.331 1.00 52.99 ? 243 ARG A NH2 1 
ATOM   1829 N N   . ARG A 1 244 ? -5.476  46.905 65.381 1.00 14.29 ? 244 ARG A N   1 
ATOM   1830 C CA  . ARG A 1 244 ? -5.837  48.182 65.980 1.00 13.22 ? 244 ARG A CA  1 
ATOM   1831 C C   . ARG A 1 244 ? -7.269  48.582 65.667 1.00 18.25 ? 244 ARG A C   1 
ATOM   1832 O O   . ARG A 1 244 ? -7.947  49.238 66.450 1.00 22.33 ? 244 ARG A O   1 
ATOM   1833 C CB  . ARG A 1 244 ? -4.915  49.321 65.515 1.00 8.69  ? 244 ARG A CB  1 
ATOM   1834 C CG  . ARG A 1 244 ? -3.440  48.987 65.728 1.00 3.14  ? 244 ARG A CG  1 
ATOM   1835 C CD  . ARG A 1 244 ? -2.461  50.102 65.352 1.00 2.00  ? 244 ARG A CD  1 
ATOM   1836 N NE  . ARG A 1 244 ? -1.132  49.595 65.636 1.00 2.00  ? 244 ARG A NE  1 
ATOM   1837 C CZ  . ARG A 1 244 ? -0.019  50.311 65.467 1.00 4.07  ? 244 ARG A CZ  1 
ATOM   1838 N NH1 . ARG A 1 244 ? -0.037  51.595 65.109 1.00 3.12  ? 244 ARG A NH1 1 
ATOM   1839 N NH2 . ARG A 1 244 ? 1.148   49.721 65.664 1.00 3.18  ? 244 ARG A NH2 1 
ATOM   1840 N N   . ALA A 1 245 ? -7.734  48.170 64.494 1.00 19.86 ? 245 ALA A N   1 
ATOM   1841 C CA  . ALA A 1 245 ? -9.075  48.541 64.107 1.00 18.78 ? 245 ALA A CA  1 
ATOM   1842 C C   . ALA A 1 245 ? -10.095 47.949 65.022 1.00 20.84 ? 245 ALA A C   1 
ATOM   1843 O O   . ALA A 1 245 ? -11.067 48.583 65.403 1.00 21.84 ? 245 ALA A O   1 
ATOM   1844 C CB  . ALA A 1 245 ? -9.343  48.070 62.679 1.00 21.74 ? 245 ALA A CB  1 
ATOM   1845 N N   . VAL A 1 246 ? -9.839  46.699 65.386 1.00 22.44 ? 246 VAL A N   1 
ATOM   1846 C CA  . VAL A 1 246 ? -10.754 45.975 66.263 1.00 25.15 ? 246 VAL A CA  1 
ATOM   1847 C C   . VAL A 1 246 ? -10.609 46.438 67.693 1.00 25.86 ? 246 VAL A C   1 
ATOM   1848 O O   . VAL A 1 246 ? -11.558 46.574 68.455 1.00 26.45 ? 246 VAL A O   1 
ATOM   1849 C CB  . VAL A 1 246 ? -10.494 44.470 66.075 1.00 23.34 ? 246 VAL A CB  1 
ATOM   1850 C CG1 . VAL A 1 246 ? -10.293 43.644 67.350 1.00 23.96 ? 246 VAL A CG1 1 
ATOM   1851 C CG2 . VAL A 1 246 ? -11.575 43.874 65.168 1.00 29.50 ? 246 VAL A CG2 1 
ATOM   1852 N N   . GLU A 1 247 ? -9.357  46.691 68.063 1.00 28.05 ? 247 GLU A N   1 
ATOM   1853 C CA  . GLU A 1 247 ? -9.075  47.151 69.409 1.00 23.29 ? 247 GLU A CA  1 
ATOM   1854 C C   . GLU A 1 247 ? -9.797  48.444 69.684 1.00 19.74 ? 247 GLU A C   1 
ATOM   1855 O O   . GLU A 1 247 ? -10.273 48.697 70.782 1.00 22.40 ? 247 GLU A O   1 
ATOM   1856 C CB  . GLU A 1 247 ? -7.564  47.278 69.601 1.00 28.40 ? 247 GLU A CB  1 
ATOM   1857 C CG  . GLU A 1 247 ? -7.144  47.345 71.067 1.00 40.09 ? 247 GLU A CG  1 
ATOM   1858 C CD  . GLU A 1 247 ? -7.638  46.115 71.815 1.00 46.37 ? 247 GLU A CD  1 
ATOM   1859 O OE1 . GLU A 1 247 ? -7.740  45.049 71.196 1.00 45.76 ? 247 GLU A OE1 1 
ATOM   1860 O OE2 . GLU A 1 247 ? -7.933  46.237 73.007 1.00 52.56 ? 247 GLU A OE2 1 
ATOM   1861 N N   . LEU A 1 248 ? -9.884  49.267 68.644 1.00 17.77 ? 248 LEU A N   1 
ATOM   1862 C CA  . LEU A 1 248 ? -10.612 50.516 68.796 1.00 16.07 ? 248 LEU A CA  1 
ATOM   1863 C C   . LEU A 1 248 ? -12.057 50.175 69.038 1.00 16.10 ? 248 LEU A C   1 
ATOM   1864 O O   . LEU A 1 248 ? -12.733 50.697 69.906 1.00 18.19 ? 248 LEU A O   1 
ATOM   1865 C CB  . LEU A 1 248 ? -10.540 51.368 67.524 1.00 13.23 ? 248 LEU A CB  1 
ATOM   1866 C CG  . LEU A 1 248 ? -11.058 52.795 67.764 1.00 12.13 ? 248 LEU A CG  1 
ATOM   1867 C CD1 . LEU A 1 248 ? -10.051 53.618 68.579 1.00 21.34 ? 248 LEU A CD1 1 
ATOM   1868 C CD2 . LEU A 1 248 ? -11.360 53.513 66.456 1.00 10.06 ? 248 LEU A CD2 1 
ATOM   1869 N N   . GLY A 1 249 ? -12.517 49.220 68.249 1.00 17.29 ? 249 GLY A N   1 
ATOM   1870 C CA  . GLY A 1 249 ? -13.888 48.784 68.363 1.00 18.58 ? 249 GLY A CA  1 
ATOM   1871 C C   . GLY A 1 249 ? -14.254 48.364 69.750 1.00 21.46 ? 249 GLY A C   1 
ATOM   1872 O O   . GLY A 1 249 ? -15.311 48.718 70.259 1.00 19.70 ? 249 GLY A O   1 
ATOM   1873 N N   . ARG A 1 250 ? -13.353 47.612 70.389 1.00 24.60 ? 250 ARG A N   1 
ATOM   1874 C CA  . ARG A 1 250 ? -13.712 47.195 71.734 1.00 29.78 ? 250 ARG A CA  1 
ATOM   1875 C C   . ARG A 1 250 ? -13.672 48.348 72.707 1.00 28.84 ? 250 ARG A C   1 
ATOM   1876 O O   . ARG A 1 250 ? -14.412 48.351 73.672 1.00 32.85 ? 250 ARG A O   1 
ATOM   1877 C CB  . ARG A 1 250 ? -13.000 45.921 72.197 1.00 31.65 ? 250 ARG A CB  1 
ATOM   1878 C CG  . ARG A 1 250 ? -11.564 46.095 72.694 1.00 38.32 ? 250 ARG A CG  1 
ATOM   1879 C CD  . ARG A 1 250 ? -10.716 44.826 72.510 1.00 42.10 ? 250 ARG A CD  1 
ATOM   1880 N NE  . ARG A 1 250 ? -11.511 43.603 72.529 1.00 47.16 ? 250 ARG A NE  1 
ATOM   1881 C CZ  . ARG A 1 250 ? -11.060 42.488 71.919 1.00 52.25 ? 250 ARG A CZ  1 
ATOM   1882 N NH1 . ARG A 1 250 ? -9.846  42.455 71.360 1.00 51.05 ? 250 ARG A NH1 1 
ATOM   1883 N NH2 . ARG A 1 250 ? -11.833 41.398 71.868 1.00 54.19 ? 250 ARG A NH2 1 
ATOM   1884 N N   . ASN A 1 251 ? -12.838 49.354 72.455 1.00 27.17 ? 251 ASN A N   1 
ATOM   1885 C CA  . ASN A 1 251 ? -12.850 50.482 73.400 1.00 27.75 ? 251 ASN A CA  1 
ATOM   1886 C C   . ASN A 1 251 ? -14.185 51.219 73.329 1.00 24.12 ? 251 ASN A C   1 
ATOM   1887 O O   . ASN A 1 251 ? -14.548 51.915 74.259 1.00 23.52 ? 251 ASN A O   1 
ATOM   1888 C CB  . ASN A 1 251 ? -11.711 51.511 73.204 1.00 32.09 ? 251 ASN A CB  1 
ATOM   1889 C CG  . ASN A 1 251 ? -10.356 51.085 73.755 1.00 34.22 ? 251 ASN A CG  1 
ATOM   1890 O OD1 . ASN A 1 251 ? -9.710  51.814 74.491 1.00 37.29 ? 251 ASN A OD1 1 
ATOM   1891 N ND2 . ASN A 1 251 ? -9.902  49.886 73.399 1.00 34.04 ? 251 ASN A ND2 1 
ATOM   1892 N N   . LEU A 1 252 ? -14.909 51.094 72.209 1.00 24.55 ? 252 LEU A N   1 
ATOM   1893 C CA  . LEU A 1 252 ? -16.217 51.752 72.133 1.00 25.74 ? 252 LEU A CA  1 
ATOM   1894 C C   . LEU A 1 252 ? -17.323 50.719 72.346 1.00 26.48 ? 252 LEU A C   1 
ATOM   1895 O O   . LEU A 1 252 ? -18.519 50.958 72.198 1.00 23.35 ? 252 LEU A O   1 
ATOM   1896 C CB  . LEU A 1 252 ? -16.488 52.490 70.818 1.00 25.90 ? 252 LEU A CB  1 
ATOM   1897 C CG  . LEU A 1 252 ? -15.578 53.685 70.503 1.00 28.99 ? 252 LEU A CG  1 
ATOM   1898 C CD1 . LEU A 1 252 ? -15.508 54.707 71.638 1.00 28.34 ? 252 LEU A CD1 1 
ATOM   1899 C CD2 . LEU A 1 252 ? -14.181 53.256 70.045 1.00 33.43 ? 252 LEU A CD2 1 
ATOM   1900 N N   . ASN A 1 253 ? -16.888 49.519 72.719 1.00 30.95 ? 253 ASN A N   1 
ATOM   1901 C CA  . ASN A 1 253 ? -17.778 48.392 72.987 1.00 36.81 ? 253 ASN A CA  1 
ATOM   1902 C C   . ASN A 1 253 ? -18.655 48.030 71.804 1.00 34.30 ? 253 ASN A C   1 
ATOM   1903 O O   . ASN A 1 253 ? -19.840 47.745 71.914 1.00 31.53 ? 253 ASN A O   1 
ATOM   1904 C CB  . ASN A 1 253 ? -18.562 48.511 74.327 1.00 41.04 ? 253 ASN A CB  1 
ATOM   1905 C CG  . ASN A 1 253 ? -19.823 49.371 74.216 1.00 46.22 ? 253 ASN A CG  1 
ATOM   1906 N N   . CYS A 1 254 ? -18.026 48.082 70.650 1.00 35.23 ? 254 CYS A N   1 
ATOM   1907 C CA  . CYS A 1 254 ? -18.746 47.740 69.444 1.00 36.37 ? 254 CYS A CA  1 
ATOM   1908 C C   . CYS A 1 254 ? -18.806 46.251 69.356 1.00 40.41 ? 254 CYS A C   1 
ATOM   1909 O O   . CYS A 1 254 ? -17.977 45.558 69.928 1.00 42.26 ? 254 CYS A O   1 
ATOM   1910 C CB  . CYS A 1 254 ? -17.968 48.234 68.238 1.00 29.99 ? 254 CYS A CB  1 
ATOM   1911 S SG  . CYS A 1 254 ? -18.232 49.996 68.077 1.00 22.76 ? 254 CYS A SG  1 
ATOM   1912 N N   . ASN A 1 255 ? -19.809 45.776 68.607 1.00 40.92 ? 255 ASN A N   1 
ATOM   1913 C CA  . ASN A 1 255 ? -19.980 44.344 68.396 1.00 40.55 ? 255 ASN A CA  1 
ATOM   1914 C C   . ASN A 1 255 ? -18.837 43.974 67.487 1.00 39.35 ? 255 ASN A C   1 
ATOM   1915 O O   . ASN A 1 255 ? -18.743 44.576 66.427 1.00 38.20 ? 255 ASN A O   1 
ATOM   1916 C CB  . ASN A 1 255 ? -21.341 44.116 67.707 1.00 42.22 ? 255 ASN A CB  1 
ATOM   1917 C CG  . ASN A 1 255 ? -21.585 42.672 67.309 1.00 42.69 ? 255 ASN A CG  1 
ATOM   1918 O OD1 . ASN A 1 255 ? -20.725 41.998 66.773 1.00 44.86 ? 255 ASN A OD1 1 
ATOM   1919 N ND2 . ASN A 1 255 ? -22.792 42.190 67.567 1.00 44.25 ? 255 ASN A ND2 1 
ATOM   1920 N N   . LEU A 1 256 ? -17.980 43.038 67.899 1.00 39.51 ? 256 LEU A N   1 
ATOM   1921 C CA  . LEU A 1 256 ? -16.841 42.692 67.051 1.00 42.33 ? 256 LEU A CA  1 
ATOM   1922 C C   . LEU A 1 256 ? -16.977 41.364 66.324 1.00 44.21 ? 256 LEU A C   1 
ATOM   1923 O O   . LEU A 1 256 ? -15.986 40.706 66.026 1.00 47.32 ? 256 LEU A O   1 
ATOM   1924 C CB  . LEU A 1 256 ? -15.527 42.636 67.853 1.00 43.59 ? 256 LEU A CB  1 
ATOM   1925 C CG  . LEU A 1 256 ? -15.167 43.899 68.662 1.00 47.10 ? 256 LEU A CG  1 
ATOM   1926 C CD1 . LEU A 1 256 ? -15.667 43.837 70.112 1.00 50.25 ? 256 LEU A CD1 1 
ATOM   1927 C CD2 . LEU A 1 256 ? -13.648 44.085 68.684 1.00 49.35 ? 256 LEU A CD2 1 
ATOM   1928 N N   . ASN A 1 257 ? -18.209 40.954 66.040 1.00 44.93 ? 257 ASN A N   1 
ATOM   1929 C CA  . ASN A 1 257 ? -18.446 39.689 65.349 1.00 45.58 ? 257 ASN A CA  1 
ATOM   1930 C C   . ASN A 1 257 ? -18.190 39.770 63.848 1.00 45.23 ? 257 ASN A C   1 
ATOM   1931 O O   . ASN A 1 257 ? -18.074 38.772 63.153 1.00 44.48 ? 257 ASN A O   1 
ATOM   1932 C CB  . ASN A 1 257 ? -19.885 39.220 65.621 1.00 47.18 ? 257 ASN A CB  1 
ATOM   1933 N N   . SER A 1 258 ? -18.108 40.983 63.317 1.00 47.53 ? 258 SER A N   1 
ATOM   1934 C CA  . SER A 1 258 ? -17.875 41.086 61.879 1.00 46.62 ? 258 SER A CA  1 
ATOM   1935 C C   . SER A 1 258 ? -17.447 42.492 61.525 1.00 45.93 ? 258 SER A C   1 
ATOM   1936 O O   . SER A 1 258 ? -17.716 43.454 62.239 1.00 45.45 ? 258 SER A O   1 
ATOM   1937 C CB  . SER A 1 258 ? -19.177 40.743 61.130 1.00 48.28 ? 258 SER A CB  1 
ATOM   1938 O OG  . SER A 1 258 ? -20.272 41.439 61.741 1.00 49.10 ? 258 SER A OG  1 
ATOM   1939 N N   . ASP A 1 259 ? -16.807 42.611 60.356 1.00 43.15 ? 259 ASP A N   1 
ATOM   1940 C CA  . ASP A 1 259 ? -16.392 43.960 59.967 1.00 39.16 ? 259 ASP A CA  1 
ATOM   1941 C C   . ASP A 1 259 ? -17.603 44.839 59.743 1.00 36.02 ? 259 ASP A C   1 
ATOM   1942 O O   . ASP A 1 259 ? -17.582 46.030 59.962 1.00 34.56 ? 259 ASP A O   1 
ATOM   1943 C CB  . ASP A 1 259 ? -15.510 44.013 58.702 1.00 37.85 ? 259 ASP A CB  1 
ATOM   1944 C CG  . ASP A 1 259 ? -14.228 43.207 58.821 1.00 39.63 ? 259 ASP A CG  1 
ATOM   1945 O OD1 . ASP A 1 259 ? -13.947 42.697 59.903 1.00 42.63 ? 259 ASP A OD1 1 
ATOM   1946 O OD2 . ASP A 1 259 ? -13.511 43.092 57.827 1.00 40.96 ? 259 ASP A OD2 1 
ATOM   1947 N N   . GLU A 1 260 ? -18.687 44.211 59.313 1.00 34.31 ? 260 GLU A N   1 
ATOM   1948 C CA  . GLU A 1 260 ? -19.893 44.978 59.060 1.00 34.44 ? 260 GLU A CA  1 
ATOM   1949 C C   . GLU A 1 260 ? -20.438 45.628 60.310 1.00 34.84 ? 260 GLU A C   1 
ATOM   1950 O O   . GLU A 1 260 ? -20.857 46.782 60.338 1.00 32.90 ? 260 GLU A O   1 
ATOM   1951 C CB  . GLU A 1 260 ? -20.997 44.034 58.553 1.00 35.01 ? 260 GLU A CB  1 
ATOM   1952 N N   . GLU A 1 261 ? -20.432 44.797 61.367 1.00 34.19 ? 261 GLU A N   1 
ATOM   1953 C CA  . GLU A 1 261 ? -20.950 45.244 62.649 1.00 32.00 ? 261 GLU A CA  1 
ATOM   1954 C C   . GLU A 1 261 ? -20.023 46.281 63.250 1.00 31.67 ? 261 GLU A C   1 
ATOM   1955 O O   . GLU A 1 261 ? -20.417 47.345 63.730 1.00 31.79 ? 261 GLU A O   1 
ATOM   1956 C CB  . GLU A 1 261 ? -21.191 44.038 63.594 1.00 35.52 ? 261 GLU A CB  1 
ATOM   1957 C CG  . GLU A 1 261 ? -22.578 43.336 63.399 1.00 32.88 ? 261 GLU A CG  1 
ATOM   1958 N N   . LEU A 1 262 ? -18.747 45.931 63.201 1.00 27.26 ? 262 LEU A N   1 
ATOM   1959 C CA  . LEU A 1 262 ? -17.738 46.803 63.731 1.00 23.27 ? 262 LEU A CA  1 
ATOM   1960 C C   . LEU A 1 262 ? -17.801 48.161 63.070 1.00 25.58 ? 262 LEU A C   1 
ATOM   1961 O O   . LEU A 1 262 ? -17.867 49.203 63.706 1.00 29.63 ? 262 LEU A O   1 
ATOM   1962 C CB  . LEU A 1 262 ? -16.390 46.126 63.490 1.00 23.67 ? 262 LEU A CB  1 
ATOM   1963 C CG  . LEU A 1 262 ? -15.172 46.989 63.827 1.00 24.34 ? 262 LEU A CG  1 
ATOM   1964 C CD1 . LEU A 1 262 ? -15.243 47.536 65.250 1.00 31.17 ? 262 LEU A CD1 1 
ATOM   1965 C CD2 . LEU A 1 262 ? -13.881 46.193 63.629 1.00 25.63 ? 262 LEU A CD2 1 
ATOM   1966 N N   . ILE A 1 263 ? -17.818 48.130 61.749 1.00 25.88 ? 263 ILE A N   1 
ATOM   1967 C CA  . ILE A 1 263 ? -17.847 49.358 60.975 1.00 28.49 ? 263 ILE A CA  1 
ATOM   1968 C C   . ILE A 1 263 ? -19.124 50.128 61.189 1.00 31.31 ? 263 ILE A C   1 
ATOM   1969 O O   . ILE A 1 263 ? -19.069 51.329 61.404 1.00 33.92 ? 263 ILE A O   1 
ATOM   1970 C CB  . ILE A 1 263 ? -17.535 49.065 59.487 1.00 24.74 ? 263 ILE A CB  1 
ATOM   1971 C CG1 . ILE A 1 263 ? -16.059 48.644 59.363 1.00 22.96 ? 263 ILE A CG1 1 
ATOM   1972 C CG2 . ILE A 1 263 ? -17.839 50.236 58.544 1.00 19.49 ? 263 ILE A CG2 1 
ATOM   1973 C CD1 . ILE A 1 263 ? -15.716 48.015 58.015 1.00 19.48 ? 263 ILE A CD1 1 
ATOM   1974 N N   . HIS A 1 264 ? -20.278 49.455 61.149 1.00 33.61 ? 264 HIS A N   1 
ATOM   1975 C CA  . HIS A 1 264 ? -21.518 50.205 61.354 1.00 38.39 ? 264 HIS A CA  1 
ATOM   1976 C C   . HIS A 1 264 ? -21.444 50.922 62.677 1.00 37.97 ? 264 HIS A C   1 
ATOM   1977 O O   . HIS A 1 264 ? -21.759 52.098 62.833 1.00 40.86 ? 264 HIS A O   1 
ATOM   1978 C CB  . HIS A 1 264 ? -22.772 49.289 61.292 1.00 48.98 ? 264 HIS A CB  1 
ATOM   1979 C CG  . HIS A 1 264 ? -23.998 49.912 61.975 1.00 61.06 ? 264 HIS A CG  1 
ATOM   1980 N ND1 . HIS A 1 264 ? -24.607 51.064 61.597 1.00 64.46 ? 264 HIS A ND1 1 
ATOM   1981 C CD2 . HIS A 1 264 ? -24.674 49.438 63.133 1.00 65.12 ? 264 HIS A CD2 1 
ATOM   1982 C CE1 . HIS A 1 264 ? -25.606 51.285 62.475 1.00 66.51 ? 264 HIS A CE1 1 
ATOM   1983 N NE2 . HIS A 1 264 ? -25.661 50.319 63.410 1.00 67.54 ? 264 HIS A NE2 1 
ATOM   1984 N N   . CYS A 1 265 ? -20.976 50.147 63.640 1.00 32.83 ? 265 CYS A N   1 
ATOM   1985 C CA  . CYS A 1 265 ? -20.856 50.683 64.969 1.00 29.03 ? 265 CYS A CA  1 
ATOM   1986 C C   . CYS A 1 265 ? -20.017 51.947 64.991 1.00 27.28 ? 265 CYS A C   1 
ATOM   1987 O O   . CYS A 1 265 ? -20.428 53.001 65.464 1.00 30.45 ? 265 CYS A O   1 
ATOM   1988 C CB  . CYS A 1 265 ? -20.271 49.584 65.840 1.00 29.44 ? 265 CYS A CB  1 
ATOM   1989 S SG  . CYS A 1 265 ? -20.203 50.034 67.584 1.00 30.11 ? 265 CYS A SG  1 
ATOM   1990 N N   . LEU A 1 266 ? -18.829 51.837 64.402 1.00 22.45 ? 266 LEU A N   1 
ATOM   1991 C CA  . LEU A 1 266 ? -17.952 52.988 64.390 1.00 20.17 ? 266 LEU A CA  1 
ATOM   1992 C C   . LEU A 1 266 ? -18.529 54.142 63.596 1.00 21.08 ? 266 LEU A C   1 
ATOM   1993 O O   . LEU A 1 266 ? -18.179 55.288 63.818 1.00 22.26 ? 266 LEU A O   1 
ATOM   1994 C CB  . LEU A 1 266 ? -16.566 52.593 63.860 1.00 13.80 ? 266 LEU A CB  1 
ATOM   1995 C CG  . LEU A 1 266 ? -15.856 51.541 64.743 1.00 9.35  ? 266 LEU A CG  1 
ATOM   1996 C CD1 . LEU A 1 266 ? -14.740 50.835 63.993 1.00 6.60  ? 266 LEU A CD1 1 
ATOM   1997 C CD2 . LEU A 1 266 ? -15.281 52.153 66.026 1.00 11.99 ? 266 LEU A CD2 1 
ATOM   1998 N N   . ARG A 1 267 ? -19.415 53.842 62.651 1.00 25.36 ? 267 ARG A N   1 
ATOM   1999 C CA  . ARG A 1 267 ? -19.995 54.917 61.850 1.00 28.09 ? 267 ARG A CA  1 
ATOM   2000 C C   . ARG A 1 267 ? -21.064 55.661 62.610 1.00 29.00 ? 267 ARG A C   1 
ATOM   2001 O O   . ARG A 1 267 ? -21.477 56.728 62.177 1.00 30.66 ? 267 ARG A O   1 
ATOM   2002 C CB  . ARG A 1 267 ? -20.549 54.436 60.474 1.00 29.47 ? 267 ARG A CB  1 
ATOM   2003 C CG  . ARG A 1 267 ? -19.486 53.801 59.531 1.00 29.74 ? 267 ARG A CG  1 
ATOM   2004 C CD  . ARG A 1 267 ? -19.493 54.271 58.048 1.00 31.57 ? 267 ARG A CD  1 
ATOM   2005 N NE  . ARG A 1 267 ? -20.047 53.252 57.148 1.00 29.99 ? 267 ARG A NE  1 
ATOM   2006 C CZ  . ARG A 1 267 ? -19.349 52.606 56.184 1.00 29.62 ? 267 ARG A CZ  1 
ATOM   2007 N NH1 . ARG A 1 267 ? -18.071 52.858 55.912 1.00 21.41 ? 267 ARG A NH1 1 
ATOM   2008 N NH2 . ARG A 1 267 ? -19.958 51.667 55.468 1.00 32.91 ? 267 ARG A NH2 1 
ATOM   2009 N N   . GLU A 1 268 ? -21.536 55.071 63.718 1.00 30.51 ? 268 GLU A N   1 
ATOM   2010 C CA  . GLU A 1 268 ? -22.578 55.737 64.515 1.00 31.71 ? 268 GLU A CA  1 
ATOM   2011 C C   . GLU A 1 268 ? -21.981 56.554 65.625 1.00 32.42 ? 268 GLU A C   1 
ATOM   2012 O O   . GLU A 1 268 ? -22.645 57.400 66.212 1.00 36.23 ? 268 GLU A O   1 
ATOM   2013 C CB  . GLU A 1 268 ? -23.553 54.751 65.201 1.00 32.99 ? 268 GLU A CB  1 
ATOM   2014 C CG  . GLU A 1 268 ? -24.478 53.994 64.216 1.00 40.92 ? 268 GLU A CG  1 
ATOM   2015 N N   . LYS A 1 269 ? -20.727 56.248 65.966 1.00 30.23 ? 269 LYS A N   1 
ATOM   2016 C CA  . LYS A 1 269 ? -20.136 57.002 67.048 1.00 28.67 ? 269 LYS A CA  1 
ATOM   2017 C C   . LYS A 1 269 ? -19.852 58.419 66.608 1.00 27.17 ? 269 LYS A C   1 
ATOM   2018 O O   . LYS A 1 269 ? -19.518 58.714 65.474 1.00 28.28 ? 269 LYS A O   1 
ATOM   2019 C CB  . LYS A 1 269 ? -18.853 56.308 67.490 1.00 31.35 ? 269 LYS A CB  1 
ATOM   2020 C CG  . LYS A 1 269 ? -19.103 54.880 67.994 1.00 35.61 ? 269 LYS A CG  1 
ATOM   2021 C CD  . LYS A 1 269 ? -19.619 54.834 69.447 1.00 42.51 ? 269 LYS A CD  1 
ATOM   2022 C CE  . LYS A 1 269 ? -19.981 53.407 69.892 1.00 46.28 ? 269 LYS A CE  1 
ATOM   2023 N NZ  . LYS A 1 269 ? -21.133 52.934 69.153 1.00 51.59 ? 269 LYS A NZ  1 
ATOM   2024 N N   . LYS A 1 270 ? -19.979 59.330 67.561 1.00 25.86 ? 270 LYS A N   1 
ATOM   2025 C CA  . LYS A 1 270 ? -19.709 60.724 67.236 1.00 25.82 ? 270 LYS A CA  1 
ATOM   2026 C C   . LYS A 1 270 ? -18.202 60.845 67.060 1.00 25.56 ? 270 LYS A C   1 
ATOM   2027 O O   . LYS A 1 270 ? -17.471 60.112 67.724 1.00 28.89 ? 270 LYS A O   1 
ATOM   2028 C CB  . LYS A 1 270 ? -20.179 61.623 68.394 1.00 29.72 ? 270 LYS A CB  1 
ATOM   2029 C CG  . LYS A 1 270 ? -21.486 61.133 69.055 1.00 34.57 ? 270 LYS A CG  1 
ATOM   2030 N N   . PRO A 1 271 ? -17.728 61.788 66.223 1.00 21.99 ? 271 PRO A N   1 
ATOM   2031 C CA  . PRO A 1 271 ? -16.312 61.825 65.882 1.00 19.77 ? 271 PRO A CA  1 
ATOM   2032 C C   . PRO A 1 271 ? -15.406 61.873 67.097 1.00 19.51 ? 271 PRO A C   1 
ATOM   2033 O O   . PRO A 1 271 ? -14.427 61.145 67.208 1.00 18.77 ? 271 PRO A O   1 
ATOM   2034 C CB  . PRO A 1 271 ? -16.150 63.032 64.951 1.00 17.86 ? 271 PRO A CB  1 
ATOM   2035 C CG  . PRO A 1 271 ? -17.502 63.772 64.960 1.00 19.70 ? 271 PRO A CG  1 
ATOM   2036 C CD  . PRO A 1 271 ? -18.527 62.824 65.588 1.00 21.39 ? 271 PRO A CD  1 
ATOM   2037 N N   . GLN A 1 272 ? -15.781 62.747 68.045 1.00 20.44 ? 272 GLN A N   1 
ATOM   2038 C CA  . GLN A 1 272 ? -14.959 62.861 69.255 1.00 20.29 ? 272 GLN A CA  1 
ATOM   2039 C C   . GLN A 1 272 ? -14.813 61.567 70.024 1.00 16.35 ? 272 GLN A C   1 
ATOM   2040 O O   . GLN A 1 272 ? -13.796 61.346 70.659 1.00 14.98 ? 272 GLN A O   1 
ATOM   2041 C CB  . GLN A 1 272 ? -15.424 63.988 70.206 1.00 25.23 ? 272 GLN A CB  1 
ATOM   2042 C CG  . GLN A 1 272 ? -14.716 65.336 69.967 1.00 35.78 ? 272 GLN A CG  1 
ATOM   2043 C CD  . GLN A 1 272 ? -13.264 65.246 70.428 1.00 40.78 ? 272 GLN A CD  1 
ATOM   2044 O OE1 . GLN A 1 272 ? -12.922 64.449 71.287 1.00 41.42 ? 272 GLN A OE1 1 
ATOM   2045 N NE2 . GLN A 1 272 ? -12.403 66.076 69.832 1.00 43.62 ? 272 GLN A NE2 1 
ATOM   2046 N N   . GLU A 1 273 ? -15.814 60.683 69.974 1.00 15.06 ? 273 GLU A N   1 
ATOM   2047 C CA  . GLU A 1 273 ? -15.616 59.448 70.732 1.00 16.59 ? 273 GLU A CA  1 
ATOM   2048 C C   . GLU A 1 273 ? -14.449 58.688 70.170 1.00 17.35 ? 273 GLU A C   1 
ATOM   2049 O O   . GLU A 1 273 ? -13.670 58.105 70.916 1.00 18.34 ? 273 GLU A O   1 
ATOM   2050 C CB  . GLU A 1 273 ? -16.839 58.526 70.737 1.00 19.35 ? 273 GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 273 ? -17.982 59.089 71.591 1.00 26.28 ? 273 GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 273 ? -19.280 58.340 71.341 1.00 32.07 ? 273 GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 273 ? -19.991 58.685 70.392 1.00 31.44 ? 273 GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 273 ? -19.578 57.420 72.102 1.00 35.54 ? 273 GLU A OE2 1 
ATOM   2055 N N   . LEU A 1 274 ? -14.342 58.737 68.832 1.00 17.24 ? 274 LEU A N   1 
ATOM   2056 C CA  . LEU A 1 274 ? -13.243 58.017 68.201 1.00 16.07 ? 274 LEU A CA  1 
ATOM   2057 C C   . LEU A 1 274 ? -11.927 58.632 68.622 1.00 12.97 ? 274 LEU A C   1 
ATOM   2058 O O   . LEU A 1 274 ? -10.984 57.957 69.004 1.00 16.28 ? 274 LEU A O   1 
ATOM   2059 C CB  . LEU A 1 274 ? -13.388 57.989 66.664 1.00 19.09 ? 274 LEU A CB  1 
ATOM   2060 C CG  . LEU A 1 274 ? -14.568 57.105 66.157 1.00 21.29 ? 274 LEU A CG  1 
ATOM   2061 C CD1 . LEU A 1 274 ? -15.439 57.817 65.127 1.00 18.90 ? 274 LEU A CD1 1 
ATOM   2062 C CD2 . LEU A 1 274 ? -14.099 55.763 65.575 1.00 19.75 ? 274 LEU A CD2 1 
ATOM   2063 N N   . ILE A 1 275 ? -11.874 59.954 68.582 1.00 9.96  ? 275 ILE A N   1 
ATOM   2064 C CA  . ILE A 1 275 ? -10.621 60.576 68.970 1.00 9.89  ? 275 ILE A CA  1 
ATOM   2065 C C   . ILE A 1 275 ? -10.229 60.260 70.403 1.00 13.55 ? 275 ILE A C   1 
ATOM   2066 O O   . ILE A 1 275 ? -9.072  59.954 70.664 1.00 17.07 ? 275 ILE A O   1 
ATOM   2067 C CB  . ILE A 1 275 ? -10.652 62.094 68.769 1.00 11.57 ? 275 ILE A CB  1 
ATOM   2068 C CG1 . ILE A 1 275 ? -11.319 62.423 67.420 1.00 2.17  ? 275 ILE A CG1 1 
ATOM   2069 C CG2 . ILE A 1 275 ? -9.236  62.708 68.908 1.00 9.05  ? 275 ILE A CG2 1 
ATOM   2070 C CD1 . ILE A 1 275 ? -11.178 63.888 67.037 1.00 6.35  ? 275 ILE A CD1 1 
ATOM   2071 N N   . ASP A 1 276 ? -11.214 60.323 71.312 1.00 13.66 ? 276 ASP A N   1 
ATOM   2072 C CA  . ASP A 1 276 ? -10.967 60.055 72.736 1.00 9.99  ? 276 ASP A CA  1 
ATOM   2073 C C   . ASP A 1 276 ? -10.209 58.755 72.987 1.00 9.78  ? 276 ASP A C   1 
ATOM   2074 O O   . ASP A 1 276 ? -9.256  58.728 73.749 1.00 15.86 ? 276 ASP A O   1 
ATOM   2075 C CB  . ASP A 1 276 ? -12.268 60.066 73.579 1.00 6.67  ? 276 ASP A CB  1 
ATOM   2076 C CG  . ASP A 1 276 ? -12.935 61.437 73.832 1.00 13.34 ? 276 ASP A CG  1 
ATOM   2077 O OD1 . ASP A 1 276 ? -12.247 62.466 73.816 1.00 11.05 ? 276 ASP A OD1 1 
ATOM   2078 O OD2 . ASP A 1 276 ? -14.149 61.465 74.080 1.00 12.50 ? 276 ASP A OD2 1 
ATOM   2079 N N   . VAL A 1 277 ? -10.607 57.654 72.345 1.00 10.57 ? 277 VAL A N   1 
ATOM   2080 C CA  . VAL A 1 277 ? -9.861  56.422 72.639 1.00 11.18 ? 277 VAL A CA  1 
ATOM   2081 C C   . VAL A 1 277 ? -8.818  56.096 71.598 1.00 9.73  ? 277 VAL A C   1 
ATOM   2082 O O   . VAL A 1 277 ? -8.168  55.065 71.658 1.00 6.66  ? 277 VAL A O   1 
ATOM   2083 C CB  . VAL A 1 277 ? -10.844 55.258 72.819 1.00 12.00 ? 277 VAL A CB  1 
ATOM   2084 C CG1 . VAL A 1 277 ? -11.716 55.499 74.059 1.00 14.32 ? 277 VAL A CG1 1 
ATOM   2085 C CG2 . VAL A 1 277 ? -11.750 55.051 71.604 1.00 14.63 ? 277 VAL A CG2 1 
ATOM   2086 N N   . GLU A 1 278 ? -8.644  56.991 70.636 1.00 13.19 ? 278 GLU A N   1 
ATOM   2087 C CA  . GLU A 1 278 ? -7.692  56.760 69.568 1.00 15.23 ? 278 GLU A CA  1 
ATOM   2088 C C   . GLU A 1 278 ? -6.290  56.328 70.024 1.00 17.91 ? 278 GLU A C   1 
ATOM   2089 O O   . GLU A 1 278 ? -5.709  55.380 69.506 1.00 17.63 ? 278 GLU A O   1 
ATOM   2090 C CB  . GLU A 1 278 ? -7.666  58.018 68.686 1.00 14.05 ? 278 GLU A CB  1 
ATOM   2091 C CG  . GLU A 1 278 ? -6.897  57.868 67.363 1.00 22.36 ? 278 GLU A CG  1 
ATOM   2092 C CD  . GLU A 1 278 ? -6.148  59.113 66.886 1.00 24.06 ? 278 GLU A CD  1 
ATOM   2093 O OE1 . GLU A 1 278 ? -6.613  60.233 67.110 1.00 17.72 ? 278 GLU A OE1 1 
ATOM   2094 O OE2 . GLU A 1 278 ? -5.080  58.936 66.290 1.00 29.64 ? 278 GLU A OE2 1 
ATOM   2095 N N   . TRP A 1 279 ? -5.748  56.995 71.039 1.00 19.53 ? 279 TRP A N   1 
ATOM   2096 C CA  . TRP A 1 279 ? -4.375  56.663 71.456 1.00 23.58 ? 279 TRP A CA  1 
ATOM   2097 C C   . TRP A 1 279 ? -4.326  55.378 72.305 1.00 21.75 ? 279 TRP A C   1 
ATOM   2098 O O   . TRP A 1 279 ? -3.270  54.887 72.685 1.00 20.15 ? 279 TRP A O   1 
ATOM   2099 C CB  . TRP A 1 279 ? -3.626  57.911 72.073 1.00 27.83 ? 279 TRP A CB  1 
ATOM   2100 C CG  . TRP A 1 279 ? -3.609  59.185 71.180 1.00 45.87 ? 279 TRP A CG  1 
ATOM   2101 C CD1 . TRP A 1 279 ? -4.600  59.611 70.245 1.00 51.14 ? 279 TRP A CD1 1 
ATOM   2102 C CD2 . TRP A 1 279 ? -2.638  60.215 71.124 1.00 51.75 ? 279 TRP A CD2 1 
ATOM   2103 N NE1 . TRP A 1 279 ? -4.320  60.787 69.652 1.00 49.73 ? 279 TRP A NE1 1 
ATOM   2104 C CE2 . TRP A 1 279 ? -3.129  61.217 70.139 1.00 49.88 ? 279 TRP A CE2 1 
ATOM   2105 C CE3 . TRP A 1 279 ? -1.396  60.443 71.739 1.00 58.48 ? 279 TRP A CE3 1 
ATOM   2106 C CZ2 . TRP A 1 279 ? -2.355  62.344 69.845 1.00 52.53 ? 279 TRP A CZ2 1 
ATOM   2107 C CZ3 . TRP A 1 279 ? -0.651  61.593 71.411 1.00 56.28 ? 279 TRP A CZ3 1 
ATOM   2108 C CH2 . TRP A 1 279 ? -1.121  62.532 70.477 1.00 54.43 ? 279 TRP A CH2 1 
ATOM   2109 N N   . ASN A 1 280 ? -5.489  54.797 72.608 1.00 20.31 ? 280 ASN A N   1 
ATOM   2110 C CA  . ASN A 1 280 ? -5.433  53.582 73.429 1.00 20.08 ? 280 ASN A CA  1 
ATOM   2111 C C   . ASN A 1 280 ? -5.039  52.341 72.694 1.00 22.62 ? 280 ASN A C   1 
ATOM   2112 O O   . ASN A 1 280 ? -4.460  51.425 73.248 1.00 26.63 ? 280 ASN A O   1 
ATOM   2113 C CB  . ASN A 1 280 ? -6.789  53.199 74.043 1.00 20.19 ? 280 ASN A CB  1 
ATOM   2114 C CG  . ASN A 1 280 ? -7.137  54.098 75.195 1.00 24.84 ? 280 ASN A CG  1 
ATOM   2115 O OD1 . ASN A 1 280 ? -6.304  54.823 75.717 1.00 25.20 ? 280 ASN A OD1 1 
ATOM   2116 N ND2 . ASN A 1 280 ? -8.397  54.069 75.590 1.00 28.34 ? 280 ASN A ND2 1 
ATOM   2117 N N   . VAL A 1 281 ? -5.380  52.275 71.420 1.00 25.56 ? 281 VAL A N   1 
ATOM   2118 C CA  . VAL A 1 281 ? -5.062  51.042 70.707 1.00 24.42 ? 281 VAL A CA  1 
ATOM   2119 C C   . VAL A 1 281 ? -3.599  50.711 70.393 1.00 22.95 ? 281 VAL A C   1 
ATOM   2120 O O   . VAL A 1 281 ? -3.372  49.647 69.821 1.00 24.23 ? 281 VAL A O   1 
ATOM   2121 C CB  . VAL A 1 281 ? -5.906  51.000 69.425 1.00 25.83 ? 281 VAL A CB  1 
ATOM   2122 C CG1 . VAL A 1 281 ? -7.411  51.111 69.722 1.00 27.99 ? 281 VAL A CG1 1 
ATOM   2123 C CG2 . VAL A 1 281 ? -5.501  52.081 68.401 1.00 30.18 ? 281 VAL A CG2 1 
ATOM   2124 N N   . LEU A 1 282 ? -2.624  51.588 70.698 1.00 20.87 ? 282 LEU A N   1 
ATOM   2125 C CA  . LEU A 1 282 ? -1.259  51.173 70.351 1.00 23.00 ? 282 LEU A CA  1 
ATOM   2126 C C   . LEU A 1 282 ? -0.893  49.880 71.054 1.00 27.86 ? 282 LEU A C   1 
ATOM   2127 O O   . LEU A 1 282 ? -1.344  49.607 72.150 1.00 32.56 ? 282 LEU A O   1 
ATOM   2128 C CB  . LEU A 1 282 ? -0.159  52.178 70.739 1.00 21.55 ? 282 LEU A CB  1 
ATOM   2129 C CG  . LEU A 1 282 ? -0.144  53.460 69.926 1.00 18.06 ? 282 LEU A CG  1 
ATOM   2130 C CD1 . LEU A 1 282 ? 0.864   54.445 70.504 1.00 16.80 ? 282 LEU A CD1 1 
ATOM   2131 C CD2 . LEU A 1 282 ? 0.197   53.174 68.463 1.00 26.92 ? 282 LEU A CD2 1 
ATOM   2132 N N   . PRO A 1 283 ? -0.024  49.098 70.427 1.00 30.70 ? 283 PRO A N   1 
ATOM   2133 C CA  . PRO A 1 283 ? 0.402   47.861 71.049 1.00 32.14 ? 283 PRO A CA  1 
ATOM   2134 C C   . PRO A 1 283 ? 1.517   48.007 72.090 1.00 33.95 ? 283 PRO A C   1 
ATOM   2135 O O   . PRO A 1 283 ? 1.919   47.011 72.680 1.00 36.67 ? 283 PRO A O   1 
ATOM   2136 C CB  . PRO A 1 283 ? 0.991   47.076 69.875 1.00 30.98 ? 283 PRO A CB  1 
ATOM   2137 C CG  . PRO A 1 283 ? 1.456   48.150 68.884 1.00 33.78 ? 283 PRO A CG  1 
ATOM   2138 C CD  . PRO A 1 283 ? 0.527   49.340 69.104 1.00 32.00 ? 283 PRO A CD  1 
ATOM   2139 N N   . PHE A 1 284 ? 2.073   49.210 72.301 1.00 33.22 ? 284 PHE A N   1 
ATOM   2140 C CA  . PHE A 1 284 ? 3.173   49.257 73.275 1.00 33.70 ? 284 PHE A CA  1 
ATOM   2141 C C   . PHE A 1 284 ? 3.401   50.664 73.784 1.00 31.26 ? 284 PHE A C   1 
ATOM   2142 O O   . PHE A 1 284 ? 2.904   51.640 73.250 1.00 35.29 ? 284 PHE A O   1 
ATOM   2143 C CB  . PHE A 1 284 ? 4.480   48.725 72.623 1.00 37.60 ? 284 PHE A CB  1 
ATOM   2144 C CG  . PHE A 1 284 ? 4.800   49.364 71.288 1.00 35.44 ? 284 PHE A CG  1 
ATOM   2145 N N   . ASP A 1 285 ? 4.190   50.780 74.844 1.00 27.46 ? 285 ASP A N   1 
ATOM   2146 C CA  . ASP A 1 285 ? 4.458   52.113 75.370 1.00 27.08 ? 285 ASP A CA  1 
ATOM   2147 C C   . ASP A 1 285 ? 5.465   52.645 74.399 1.00 24.63 ? 285 ASP A C   1 
ATOM   2148 O O   . ASP A 1 285 ? 6.459   51.963 74.202 1.00 23.44 ? 285 ASP A O   1 
ATOM   2149 C CB  . ASP A 1 285 ? 5.088   52.010 76.783 1.00 32.77 ? 285 ASP A CB  1 
ATOM   2150 C CG  . ASP A 1 285 ? 4.963   53.250 77.680 1.00 36.82 ? 285 ASP A CG  1 
ATOM   2151 O OD1 . ASP A 1 285 ? 4.601   54.334 77.200 1.00 41.07 ? 285 ASP A OD1 1 
ATOM   2152 O OD2 . ASP A 1 285 ? 5.201   53.110 78.885 1.00 39.75 ? 285 ASP A OD2 1 
ATOM   2153 N N   . SER A 1 286 ? 5.244   53.807 73.796 1.00 22.20 ? 286 SER A N   1 
ATOM   2154 C CA  . SER A 1 286 ? 6.287   54.187 72.865 1.00 20.31 ? 286 SER A CA  1 
ATOM   2155 C C   . SER A 1 286 ? 6.190   55.639 72.579 1.00 20.85 ? 286 SER A C   1 
ATOM   2156 O O   . SER A 1 286 ? 5.215   56.291 72.907 1.00 25.15 ? 286 SER A O   1 
ATOM   2157 C CB  . SER A 1 286 ? 6.124   53.397 71.571 1.00 22.04 ? 286 SER A CB  1 
ATOM   2158 N N   . ILE A 1 287 ? 7.231   56.149 71.957 1.00 20.58 ? 287 ILE A N   1 
ATOM   2159 C CA  . ILE A 1 287 ? 7.316   57.542 71.600 1.00 18.81 ? 287 ILE A CA  1 
ATOM   2160 C C   . ILE A 1 287 ? 7.566   57.539 70.101 1.00 23.59 ? 287 ILE A C   1 
ATOM   2161 O O   . ILE A 1 287 ? 8.253   56.669 69.584 1.00 23.54 ? 287 ILE A O   1 
ATOM   2162 C CB  . ILE A 1 287 ? 8.386   58.168 72.526 1.00 19.40 ? 287 ILE A CB  1 
ATOM   2163 C CG1 . ILE A 1 287 ? 7.674   58.758 73.738 1.00 26.33 ? 287 ILE A CG1 1 
ATOM   2164 C CG2 . ILE A 1 287 ? 9.381   59.180 71.969 1.00 12.50 ? 287 ILE A CG2 1 
ATOM   2165 C CD1 . ILE A 1 287 ? 6.783   59.964 73.388 1.00 37.57 ? 287 ILE A CD1 1 
ATOM   2166 N N   . PHE A 1 288 ? 6.980   58.527 69.409 1.00 22.61 ? 288 PHE A N   1 
ATOM   2167 C CA  . PHE A 1 288 ? 7.142   58.613 67.965 1.00 18.77 ? 288 PHE A CA  1 
ATOM   2168 C C   . PHE A 1 288 ? 6.488   57.438 67.263 1.00 17.49 ? 288 PHE A C   1 
ATOM   2169 O O   . PHE A 1 288 ? 7.068   56.848 66.366 1.00 18.77 ? 288 PHE A O   1 
ATOM   2170 C CB  . PHE A 1 288 ? 8.626   58.732 67.524 1.00 18.74 ? 288 PHE A CB  1 
ATOM   2171 C CG  . PHE A 1 288 ? 8.842   59.709 66.391 1.00 20.03 ? 288 PHE A CG  1 
ATOM   2172 C CD1 . PHE A 1 288 ? 7.959   59.770 65.297 1.00 18.55 ? 288 PHE A CD1 1 
ATOM   2173 C CD2 . PHE A 1 288 ? 9.937   60.591 66.439 1.00 20.66 ? 288 PHE A CD2 1 
ATOM   2174 C CE1 . PHE A 1 288 ? 8.162   60.724 64.286 1.00 21.85 ? 288 PHE A CE1 1 
ATOM   2175 C CE2 . PHE A 1 288 ? 10.152  61.527 65.417 1.00 18.68 ? 288 PHE A CE2 1 
ATOM   2176 C CZ  . PHE A 1 288 ? 9.258   61.601 64.342 1.00 18.73 ? 288 PHE A CZ  1 
ATOM   2177 N N   . ARG A 1 289 ? 5.281   57.080 67.706 1.00 13.71 ? 289 ARG A N   1 
ATOM   2178 C CA  . ARG A 1 289 ? 4.589   55.990 67.040 1.00 10.97 ? 289 ARG A CA  1 
ATOM   2179 C C   . ARG A 1 289 ? 3.133   56.446 67.008 1.00 13.17 ? 289 ARG A C   1 
ATOM   2180 O O   . ARG A 1 289 ? 2.672   57.044 67.976 1.00 15.46 ? 289 ARG A O   1 
ATOM   2181 C CB  . ARG A 1 289 ? 4.870   54.676 67.752 1.00 7.32  ? 289 ARG A CB  1 
ATOM   2182 C CG  . ARG A 1 289 ? 5.166   53.550 66.761 1.00 10.17 ? 289 ARG A CG  1 
ATOM   2183 C CD  . ARG A 1 289 ? 6.592   52.986 66.804 1.00 8.16  ? 289 ARG A CD  1 
ATOM   2184 N NE  . ARG A 1 289 ? 7.610   53.993 66.528 1.00 6.44  ? 289 ARG A NE  1 
ATOM   2185 C CZ  . ARG A 1 289 ? 8.888   53.619 66.311 1.00 7.30  ? 289 ARG A CZ  1 
ATOM   2186 N NH1 . ARG A 1 289 ? 9.265   52.332 66.314 1.00 9.32  ? 289 ARG A NH1 1 
ATOM   2187 N NH2 . ARG A 1 289 ? 9.799   54.549 66.100 1.00 2.00  ? 289 ARG A NH2 1 
ATOM   2188 N N   . PHE A 1 290 ? 2.423   56.202 65.890 1.00 13.80 ? 290 PHE A N   1 
ATOM   2189 C CA  . PHE A 1 290 ? 1.030   56.669 65.753 1.00 7.02  ? 290 PHE A CA  1 
ATOM   2190 C C   . PHE A 1 290 ? 0.166   55.475 65.563 1.00 7.77  ? 290 PHE A C   1 
ATOM   2191 O O   . PHE A 1 290 ? 0.620   54.426 65.140 1.00 8.78  ? 290 PHE A O   1 
ATOM   2192 C CB  . PHE A 1 290 ? 0.930   57.706 64.649 1.00 5.39  ? 290 PHE A CB  1 
ATOM   2193 C CG  . PHE A 1 290 ? 2.049   58.697 64.835 1.00 6.71  ? 290 PHE A CG  1 
ATOM   2194 C CD1 . PHE A 1 290 ? 2.069   59.518 65.980 1.00 9.75  ? 290 PHE A CD1 1 
ATOM   2195 C CD2 . PHE A 1 290 ? 3.094   58.785 63.908 1.00 5.00  ? 290 PHE A CD2 1 
ATOM   2196 C CE1 . PHE A 1 290 ? 3.123   60.416 66.204 1.00 12.99 ? 290 PHE A CE1 1 
ATOM   2197 C CE2 . PHE A 1 290 ? 4.152   59.683 64.134 1.00 15.40 ? 290 PHE A CE2 1 
ATOM   2198 C CZ  . PHE A 1 290 ? 4.175   60.502 65.278 1.00 13.61 ? 290 PHE A CZ  1 
ATOM   2199 N N   . SER A 1 291 ? -1.106  55.638 65.857 1.00 8.32  ? 291 SER A N   1 
ATOM   2200 C CA  . SER A 1 291 ? -1.972  54.462 65.823 1.00 16.13 ? 291 SER A CA  1 
ATOM   2201 C C   . SER A 1 291 ? -2.512  54.045 64.482 1.00 17.73 ? 291 SER A C   1 
ATOM   2202 O O   . SER A 1 291 ? -2.336  52.912 64.051 1.00 20.12 ? 291 SER A O   1 
ATOM   2203 C CB  . SER A 1 291 ? -3.099  54.609 66.872 1.00 19.54 ? 291 SER A CB  1 
ATOM   2204 O OG  . SER A 1 291 ? -3.357  56.010 67.071 1.00 33.63 ? 291 SER A OG  1 
ATOM   2205 N N   . PHE A 1 292 ? -3.239  54.985 63.879 1.00 17.03 ? 292 PHE A N   1 
ATOM   2206 C CA  . PHE A 1 292 ? -3.854  54.779 62.570 1.00 16.67 ? 292 PHE A CA  1 
ATOM   2207 C C   . PHE A 1 292 ? -2.927  55.452 61.567 1.00 16.80 ? 292 PHE A C   1 
ATOM   2208 O O   . PHE A 1 292 ? -2.770  56.670 61.518 1.00 15.50 ? 292 PHE A O   1 
ATOM   2209 C CB  . PHE A 1 292 ? -5.270  55.372 62.539 1.00 17.52 ? 292 PHE A CB  1 
ATOM   2210 C CG  . PHE A 1 292 ? -6.134  54.657 63.543 1.00 17.08 ? 292 PHE A CG  1 
ATOM   2211 C CD1 . PHE A 1 292 ? -6.500  53.322 63.309 1.00 15.40 ? 292 PHE A CD1 1 
ATOM   2212 C CD2 . PHE A 1 292 ? -6.550  55.293 64.726 1.00 18.33 ? 292 PHE A CD2 1 
ATOM   2213 C CE1 . PHE A 1 292 ? -7.267  52.620 64.249 1.00 18.53 ? 292 PHE A CE1 1 
ATOM   2214 C CE2 . PHE A 1 292 ? -7.321  54.589 65.666 1.00 17.40 ? 292 PHE A CE2 1 
ATOM   2215 C CZ  . PHE A 1 292 ? -7.677  53.255 65.429 1.00 14.64 ? 292 PHE A CZ  1 
ATOM   2216 N N   . VAL A 1 293 ? -2.289  54.601 60.776 1.00 12.34 ? 293 VAL A N   1 
ATOM   2217 C CA  . VAL A 1 293 ? -1.336  55.080 59.827 1.00 8.67  ? 293 VAL A CA  1 
ATOM   2218 C C   . VAL A 1 293 ? -1.555  54.254 58.525 1.00 12.18 ? 293 VAL A C   1 
ATOM   2219 O O   . VAL A 1 293 ? -2.342  53.305 58.560 1.00 16.80 ? 293 VAL A O   1 
ATOM   2220 C CB  . VAL A 1 293 ? -0.041  54.883 60.652 1.00 4.33  ? 293 VAL A CB  1 
ATOM   2221 C CG1 . VAL A 1 293 ? 0.600   53.521 60.414 1.00 2.00  ? 293 VAL A CG1 1 
ATOM   2222 C CG2 . VAL A 1 293 ? 0.897   56.091 60.681 1.00 2.00  ? 293 VAL A CG2 1 
ATOM   2223 N N   . PRO A 1 294 ? -0.904  54.629 57.388 1.00 9.30  ? 294 PRO A N   1 
ATOM   2224 C CA  . PRO A 1 294 ? -0.938  53.815 56.186 1.00 8.79  ? 294 PRO A CA  1 
ATOM   2225 C C   . PRO A 1 294 ? -0.599  52.352 56.371 1.00 10.50 ? 294 PRO A C   1 
ATOM   2226 O O   . PRO A 1 294 ? 0.323   51.972 57.076 1.00 9.56  ? 294 PRO A O   1 
ATOM   2227 C CB  . PRO A 1 294 ? 0.094   54.478 55.268 1.00 6.80  ? 294 PRO A CB  1 
ATOM   2228 C CG  . PRO A 1 294 ? 0.162   55.948 55.710 1.00 6.81  ? 294 PRO A CG  1 
ATOM   2229 C CD  . PRO A 1 294 ? -0.242  55.919 57.186 1.00 9.07  ? 294 PRO A CD  1 
ATOM   2230 N N   . VAL A 1 295 ? -1.359  51.520 55.684 1.00 11.41 ? 295 VAL A N   1 
ATOM   2231 C CA  . VAL A 1 295 ? -1.144  50.105 55.753 1.00 11.66 ? 295 VAL A CA  1 
ATOM   2232 C C   . VAL A 1 295 ? -0.563  49.626 54.426 1.00 11.36 ? 295 VAL A C   1 
ATOM   2233 O O   . VAL A 1 295 ? -0.921  50.100 53.345 1.00 15.72 ? 295 VAL A O   1 
ATOM   2234 C CB  . VAL A 1 295 ? -2.500  49.475 56.064 1.00 11.25 ? 295 VAL A CB  1 
ATOM   2235 C CG1 . VAL A 1 295 ? -3.536  49.665 54.957 1.00 11.82 ? 295 VAL A CG1 1 
ATOM   2236 C CG2 . VAL A 1 295 ? -2.383  48.012 56.439 1.00 13.92 ? 295 VAL A CG2 1 
ATOM   2237 N N   . ILE A 1 296 ? 0.332   48.650 54.494 1.00 7.67  ? 296 ILE A N   1 
ATOM   2238 C CA  . ILE A 1 296 ? 0.909   48.108 53.269 1.00 9.07  ? 296 ILE A CA  1 
ATOM   2239 C C   . ILE A 1 296 ? -0.113  47.067 52.819 1.00 13.22 ? 296 ILE A C   1 
ATOM   2240 O O   . ILE A 1 296 ? -0.081  45.901 53.170 1.00 16.51 ? 296 ILE A O   1 
ATOM   2241 C CB  . ILE A 1 296 ? 2.320   47.588 53.556 1.00 3.19  ? 296 ILE A CB  1 
ATOM   2242 C CG1 . ILE A 1 296 ? 3.177   48.649 54.284 1.00 7.61  ? 296 ILE A CG1 1 
ATOM   2243 C CG2 . ILE A 1 296 ? 3.046   47.123 52.298 1.00 9.21  ? 296 ILE A CG2 1 
ATOM   2244 C CD1 . ILE A 1 296 ? 3.414   49.937 53.482 1.00 2.00  ? 296 ILE A CD1 1 
ATOM   2245 N N   . ASP A 1 297 ? -1.079  47.551 52.048 1.00 17.57 ? 297 ASP A N   1 
ATOM   2246 C CA  . ASP A 1 297 ? -2.187  46.710 51.598 1.00 18.19 ? 297 ASP A CA  1 
ATOM   2247 C C   . ASP A 1 297 ? -2.087  45.968 50.305 1.00 18.63 ? 297 ASP A C   1 
ATOM   2248 O O   . ASP A 1 297 ? -3.040  45.291 49.965 1.00 20.40 ? 297 ASP A O   1 
ATOM   2249 C CB  . ASP A 1 297 ? -3.443  47.587 51.441 1.00 21.53 ? 297 ASP A CB  1 
ATOM   2250 C CG  . ASP A 1 297 ? -3.249  48.707 50.408 1.00 25.52 ? 297 ASP A CG  1 
ATOM   2251 O OD1 . ASP A 1 297 ? -2.118  48.919 49.965 1.00 25.27 ? 297 ASP A OD1 1 
ATOM   2252 O OD2 . ASP A 1 297 ? -4.229  49.360 50.045 1.00 30.02 ? 297 ASP A OD2 1 
ATOM   2253 N N   . GLY A 1 298 ? -1.035  46.149 49.527 1.00 19.76 ? 298 GLY A N   1 
ATOM   2254 C CA  . GLY A 1 298 ? -1.012  45.399 48.265 1.00 20.13 ? 298 GLY A CA  1 
ATOM   2255 C C   . GLY A 1 298 ? -1.680  46.119 47.101 1.00 21.29 ? 298 GLY A C   1 
ATOM   2256 O O   . GLY A 1 298 ? -1.650  45.683 45.964 1.00 21.74 ? 298 GLY A O   1 
ATOM   2257 N N   . GLU A 1 299 ? -2.354  47.242 47.391 1.00 24.12 ? 299 GLU A N   1 
ATOM   2258 C CA  . GLU A 1 299 ? -2.987  48.004 46.305 1.00 25.75 ? 299 GLU A CA  1 
ATOM   2259 C C   . GLU A 1 299 ? -2.149  49.253 46.134 1.00 24.40 ? 299 GLU A C   1 
ATOM   2260 O O   . GLU A 1 299 ? -1.330  49.372 45.239 1.00 26.48 ? 299 GLU A O   1 
ATOM   2261 C CB  . GLU A 1 299 ? -4.484  48.325 46.503 1.00 25.83 ? 299 GLU A CB  1 
ATOM   2262 C CG  . GLU A 1 299 ? -5.398  47.079 46.580 1.00 32.58 ? 299 GLU A CG  1 
ATOM   2263 N N   . PHE A 1 300 ? -2.350  50.184 47.083 1.00 18.19 ? 300 PHE A N   1 
ATOM   2264 C CA  . PHE A 1 300 ? -1.590  51.437 47.050 1.00 12.45 ? 300 PHE A CA  1 
ATOM   2265 C C   . PHE A 1 300 ? -0.093  51.132 46.920 1.00 11.34 ? 300 PHE A C   1 
ATOM   2266 O O   . PHE A 1 300 ? 0.658   51.681 46.131 1.00 13.48 ? 300 PHE A O   1 
ATOM   2267 C CB  . PHE A 1 300 ? -1.975  52.258 48.291 1.00 7.90  ? 300 PHE A CB  1 
ATOM   2268 C CG  . PHE A 1 300 ? -1.758  53.743 48.144 1.00 2.53  ? 300 PHE A CG  1 
ATOM   2269 C CD1 . PHE A 1 300 ? -0.450  54.264 48.217 1.00 2.00  ? 300 PHE A CD1 1 
ATOM   2270 C CD2 . PHE A 1 300 ? -2.854  54.617 47.978 1.00 2.00  ? 300 PHE A CD2 1 
ATOM   2271 C CE1 . PHE A 1 300 ? -0.238  55.646 48.138 1.00 2.00  ? 300 PHE A CE1 1 
ATOM   2272 C CE2 . PHE A 1 300 ? -2.636  56.001 47.897 1.00 2.42  ? 300 PHE A CE2 1 
ATOM   2273 C CZ  . PHE A 1 300 ? -1.329  56.516 47.975 1.00 2.00  ? 300 PHE A CZ  1 
ATOM   2274 N N   . PHE A 1 301 ? 0.338   50.182 47.740 1.00 13.91 ? 301 PHE A N   1 
ATOM   2275 C CA  . PHE A 1 301 ? 1.728   49.748 47.685 1.00 16.40 ? 301 PHE A CA  1 
ATOM   2276 C C   . PHE A 1 301 ? 1.552   48.355 47.154 1.00 17.78 ? 301 PHE A C   1 
ATOM   2277 O O   . PHE A 1 301 ? 0.813   47.606 47.779 1.00 18.74 ? 301 PHE A O   1 
ATOM   2278 C CB  . PHE A 1 301 ? 2.442   49.680 49.055 1.00 12.10 ? 301 PHE A CB  1 
ATOM   2279 C CG  . PHE A 1 301 ? 2.334   50.999 49.759 1.00 8.05  ? 301 PHE A CG  1 
ATOM   2280 C CD1 . PHE A 1 301 ? 3.190   52.053 49.410 1.00 8.60  ? 301 PHE A CD1 1 
ATOM   2281 C CD2 . PHE A 1 301 ? 1.335   51.199 50.731 1.00 7.13  ? 301 PHE A CD2 1 
ATOM   2282 C CE1 . PHE A 1 301 ? 3.033   53.309 50.021 1.00 11.99 ? 301 PHE A CE1 1 
ATOM   2283 C CE2 . PHE A 1 301 ? 1.180   52.448 51.337 1.00 7.18  ? 301 PHE A CE2 1 
ATOM   2284 C CZ  . PHE A 1 301 ? 2.027   53.509 50.983 1.00 6.39  ? 301 PHE A CZ  1 
ATOM   2285 N N   . PRO A 1 302 ? 2.178   48.011 46.027 1.00 22.94 ? 302 PRO A N   1 
ATOM   2286 C CA  . PRO A 1 302 ? 2.077   46.642 45.548 1.00 24.21 ? 302 PRO A CA  1 
ATOM   2287 C C   . PRO A 1 302 ? 2.809   45.660 46.448 1.00 26.54 ? 302 PRO A C   1 
ATOM   2288 O O   . PRO A 1 302 ? 2.337   44.569 46.749 1.00 30.30 ? 302 PRO A O   1 
ATOM   2289 C CB  . PRO A 1 302 ? 2.681   46.708 44.135 1.00 22.95 ? 302 PRO A CB  1 
ATOM   2290 C CG  . PRO A 1 302 ? 3.442   48.048 44.018 1.00 21.28 ? 302 PRO A CG  1 
ATOM   2291 C CD  . PRO A 1 302 ? 2.862   48.938 45.116 1.00 25.04 ? 302 PRO A CD  1 
ATOM   2292 N N   . THR A 1 303 ? 4.011   46.070 46.872 1.00 24.95 ? 303 THR A N   1 
ATOM   2293 C CA  . THR A 1 303 ? 4.819   45.204 47.717 1.00 23.35 ? 303 THR A CA  1 
ATOM   2294 C C   . THR A 1 303 ? 5.359   46.023 48.858 1.00 21.75 ? 303 THR A C   1 
ATOM   2295 O O   . THR A 1 303 ? 5.061   47.188 49.080 1.00 22.57 ? 303 THR A O   1 
ATOM   2296 C CB  . THR A 1 303 ? 5.960   44.619 46.857 1.00 24.02 ? 303 THR A CB  1 
ATOM   2297 O OG1 . THR A 1 303 ? 5.373   44.118 45.672 1.00 35.66 ? 303 THR A OG1 1 
ATOM   2298 C CG2 . THR A 1 303 ? 6.781   43.426 47.395 1.00 32.95 ? 303 THR A CG2 1 
ATOM   2299 N N   . SER A 1 304 ? 6.179   45.353 49.634 1.00 19.64 ? 304 SER A N   1 
ATOM   2300 C CA  . SER A 1 304 ? 6.777   46.036 50.737 1.00 22.00 ? 304 SER A CA  1 
ATOM   2301 C C   . SER A 1 304 ? 7.647   47.171 50.223 1.00 20.40 ? 304 SER A C   1 
ATOM   2302 O O   . SER A 1 304 ? 8.325   47.026 49.214 1.00 21.63 ? 304 SER A O   1 
ATOM   2303 C CB  . SER A 1 304 ? 7.617   45.022 51.523 1.00 25.76 ? 304 SER A CB  1 
ATOM   2304 O OG  . SER A 1 304 ? 8.746   44.583 50.764 1.00 28.88 ? 304 SER A OG  1 
ATOM   2305 N N   . LEU A 1 305 ? 7.668   48.268 50.974 1.00 17.53 ? 305 LEU A N   1 
ATOM   2306 C CA  . LEU A 1 305 ? 8.469   49.379 50.532 1.00 16.57 ? 305 LEU A CA  1 
ATOM   2307 C C   . LEU A 1 305 ? 9.931   49.020 50.352 1.00 19.69 ? 305 LEU A C   1 
ATOM   2308 O O   . LEU A 1 305 ? 10.656  49.623 49.579 1.00 24.75 ? 305 LEU A O   1 
ATOM   2309 C CB  . LEU A 1 305 ? 8.384   50.527 51.537 1.00 12.69 ? 305 LEU A CB  1 
ATOM   2310 C CG  . LEU A 1 305 ? 6.978   50.885 52.035 1.00 13.00 ? 305 LEU A CG  1 
ATOM   2311 C CD1 . LEU A 1 305 ? 7.040   52.244 52.743 1.00 15.70 ? 305 LEU A CD1 1 
ATOM   2312 C CD2 . LEU A 1 305 ? 5.920   50.939 50.919 1.00 16.88 ? 305 LEU A CD2 1 
ATOM   2313 N N   . GLU A 1 306 ? 10.385  48.013 51.088 1.00 21.26 ? 306 GLU A N   1 
ATOM   2314 C CA  . GLU A 1 306 ? 11.788  47.694 50.939 1.00 23.53 ? 306 GLU A CA  1 
ATOM   2315 C C   . GLU A 1 306 ? 12.068  47.065 49.589 1.00 26.40 ? 306 GLU A C   1 
ATOM   2316 O O   . GLU A 1 306 ? 13.099  47.362 48.988 1.00 26.99 ? 306 GLU A O   1 
ATOM   2317 C CB  . GLU A 1 306 ? 12.304  46.861 52.115 1.00 27.54 ? 306 GLU A CB  1 
ATOM   2318 C CG  . GLU A 1 306 ? 13.848  46.784 52.138 1.00 36.12 ? 306 GLU A CG  1 
ATOM   2319 C CD  . GLU A 1 306 ? 14.553  48.135 52.349 1.00 42.13 ? 306 GLU A CD  1 
ATOM   2320 O OE1 . GLU A 1 306 ? 13.897  49.103 52.749 1.00 48.53 ? 306 GLU A OE1 1 
ATOM   2321 O OE2 . GLU A 1 306 ? 15.763  48.207 52.113 1.00 41.09 ? 306 GLU A OE2 1 
ATOM   2322 N N   . SER A 1 307 ? 11.155  46.186 49.122 1.00 24.56 ? 307 SER A N   1 
ATOM   2323 C CA  . SER A 1 307 ? 11.386  45.608 47.794 1.00 23.34 ? 307 SER A CA  1 
ATOM   2324 C C   . SER A 1 307 ? 11.332  46.696 46.751 1.00 22.27 ? 307 SER A C   1 
ATOM   2325 O O   . SER A 1 307 ? 12.171  46.808 45.879 1.00 25.50 ? 307 SER A O   1 
ATOM   2326 C CB  . SER A 1 307 ? 10.291  44.624 47.401 1.00 25.32 ? 307 SER A CB  1 
ATOM   2327 O OG  . SER A 1 307 ? 10.486  43.433 48.131 1.00 35.53 ? 307 SER A OG  1 
ATOM   2328 N N   . MET A 1 308 ? 10.309  47.540 46.867 1.00 18.81 ? 308 MET A N   1 
ATOM   2329 C CA  . MET A 1 308 ? 10.191  48.616 45.913 1.00 14.66 ? 308 MET A CA  1 
ATOM   2330 C C   . MET A 1 308 ? 11.475  49.436 45.845 1.00 16.78 ? 308 MET A C   1 
ATOM   2331 O O   . MET A 1 308 ? 12.003  49.676 44.766 1.00 18.54 ? 308 MET A O   1 
ATOM   2332 C CB  . MET A 1 308 ? 8.931   49.437 46.194 1.00 10.18 ? 308 MET A CB  1 
ATOM   2333 C CG  . MET A 1 308 ? 7.683   48.546 46.106 1.00 9.23  ? 308 MET A CG  1 
ATOM   2334 S SD  . MET A 1 308 ? 6.168   49.530 46.289 1.00 18.45 ? 308 MET A SD  1 
ATOM   2335 C CE  . MET A 1 308 ? 6.091   50.363 44.685 1.00 12.01 ? 308 MET A CE  1 
ATOM   2336 N N   . LEU A 1 309 ? 11.991  49.825 47.011 1.00 16.99 ? 309 LEU A N   1 
ATOM   2337 C CA  . LEU A 1 309 ? 13.222  50.592 46.993 1.00 17.95 ? 309 LEU A CA  1 
ATOM   2338 C C   . LEU A 1 309 ? 14.345  49.795 46.357 1.00 17.65 ? 309 LEU A C   1 
ATOM   2339 O O   . LEU A 1 309 ? 15.151  50.301 45.592 1.00 16.10 ? 309 LEU A O   1 
ATOM   2340 C CB  . LEU A 1 309 ? 13.666  51.032 48.407 1.00 17.08 ? 309 LEU A CB  1 
ATOM   2341 C CG  . LEU A 1 309 ? 12.687  52.013 49.072 1.00 19.36 ? 309 LEU A CG  1 
ATOM   2342 C CD1 . LEU A 1 309 ? 12.952  52.089 50.571 1.00 21.60 ? 309 LEU A CD1 1 
ATOM   2343 C CD2 . LEU A 1 309 ? 12.728  53.417 48.462 1.00 21.39 ? 309 LEU A CD2 1 
ATOM   2344 N N   . ASN A 1 310 ? 14.386  48.511 46.680 1.00 21.00 ? 310 ASN A N   1 
ATOM   2345 C CA  . ASN A 1 310 ? 15.469  47.696 46.131 1.00 24.25 ? 310 ASN A CA  1 
ATOM   2346 C C   . ASN A 1 310 ? 15.341  47.420 44.651 1.00 23.67 ? 310 ASN A C   1 
ATOM   2347 O O   . ASN A 1 310 ? 16.341  47.175 43.994 1.00 28.49 ? 310 ASN A O   1 
ATOM   2348 C CB  . ASN A 1 310 ? 15.643  46.361 46.879 1.00 22.68 ? 310 ASN A CB  1 
ATOM   2349 N N   . SER A 1 311 ? 14.126  47.470 44.120 1.00 22.33 ? 311 SER A N   1 
ATOM   2350 C CA  . SER A 1 311 ? 13.956  47.185 42.700 1.00 20.64 ? 311 SER A CA  1 
ATOM   2351 C C   . SER A 1 311 ? 13.793  48.386 41.819 1.00 19.56 ? 311 SER A C   1 
ATOM   2352 O O   . SER A 1 311 ? 13.630  48.256 40.625 1.00 23.99 ? 311 SER A O   1 
ATOM   2353 C CB  . SER A 1 311 ? 12.680  46.370 42.501 1.00 17.52 ? 311 SER A CB  1 
ATOM   2354 O OG  . SER A 1 311 ? 12.759  45.201 43.314 1.00 28.32 ? 311 SER A OG  1 
ATOM   2355 N N   . GLY A 1 312 ? 13.792  49.586 42.366 1.00 22.66 ? 312 GLY A N   1 
ATOM   2356 C CA  . GLY A 1 312 ? 13.590  50.708 41.450 1.00 16.05 ? 312 GLY A CA  1 
ATOM   2357 C C   . GLY A 1 312 ? 12.176  50.853 41.018 1.00 15.93 ? 312 GLY A C   1 
ATOM   2358 O O   . GLY A 1 312 ? 11.823  51.512 40.050 1.00 16.26 ? 312 GLY A O   1 
ATOM   2359 N N   . ASN A 1 313 ? 11.317  50.212 41.788 1.00 13.55 ? 313 ASN A N   1 
ATOM   2360 C CA  . ASN A 1 313 ? 9.934   50.273 41.428 1.00 12.79 ? 313 ASN A CA  1 
ATOM   2361 C C   . ASN A 1 313 ? 9.345   51.562 41.939 1.00 14.18 ? 313 ASN A C   1 
ATOM   2362 O O   . ASN A 1 313 ? 8.511   51.543 42.827 1.00 17.05 ? 313 ASN A O   1 
ATOM   2363 C CB  . ASN A 1 313 ? 9.246   49.058 42.036 1.00 9.57  ? 313 ASN A CB  1 
ATOM   2364 C CG  . ASN A 1 313 ? 7.795   48.867 41.661 1.00 9.15  ? 313 ASN A CG  1 
ATOM   2365 O OD1 . ASN A 1 313 ? 7.154   47.935 42.126 1.00 17.83 ? 313 ASN A OD1 1 
ATOM   2366 N ND2 . ASN A 1 313 ? 7.261   49.725 40.809 1.00 7.64  ? 313 ASN A ND2 1 
ATOM   2367 N N   . PHE A 1 314 ? 9.769   52.687 41.365 1.00 12.17 ? 314 PHE A N   1 
ATOM   2368 C CA  . PHE A 1 314 ? 9.246   53.960 41.811 1.00 11.47 ? 314 PHE A CA  1 
ATOM   2369 C C   . PHE A 1 314 ? 9.491   55.002 40.742 1.00 9.09  ? 314 PHE A C   1 
ATOM   2370 O O   . PHE A 1 314 ? 10.292  54.813 39.841 1.00 11.88 ? 314 PHE A O   1 
ATOM   2371 C CB  . PHE A 1 314 ? 9.927   54.378 43.142 1.00 8.27  ? 314 PHE A CB  1 
ATOM   2372 C CG  . PHE A 1 314 ? 11.439  54.212 43.190 1.00 5.34  ? 314 PHE A CG  1 
ATOM   2373 C CD1 . PHE A 1 314 ? 12.275  55.125 42.522 1.00 5.50  ? 314 PHE A CD1 1 
ATOM   2374 C CD2 . PHE A 1 314 ? 12.032  53.161 43.921 1.00 6.88  ? 314 PHE A CD2 1 
ATOM   2375 C CE1 . PHE A 1 314 ? 13.670  55.013 42.589 1.00 5.64  ? 314 PHE A CE1 1 
ATOM   2376 C CE2 . PHE A 1 314 ? 13.434  53.046 43.990 1.00 6.23  ? 314 PHE A CE2 1 
ATOM   2377 C CZ  . PHE A 1 314 ? 14.252  53.974 43.326 1.00 8.11  ? 314 PHE A CZ  1 
ATOM   2378 N N   . LYS A 1 315 ? 8.780   56.117 40.865 1.00 6.19  ? 315 LYS A N   1 
ATOM   2379 C CA  . LYS A 1 315 ? 8.949   57.212 39.930 1.00 5.55  ? 315 LYS A CA  1 
ATOM   2380 C C   . LYS A 1 315 ? 10.401  57.689 39.991 1.00 8.59  ? 315 LYS A C   1 
ATOM   2381 O O   . LYS A 1 315 ? 10.940  57.798 41.078 1.00 11.14 ? 315 LYS A O   1 
ATOM   2382 C CB  . LYS A 1 315 ? 8.034   58.359 40.375 1.00 2.00  ? 315 LYS A CB  1 
ATOM   2383 C CG  . LYS A 1 315 ? 7.791   59.418 39.309 1.00 2.00  ? 315 LYS A CG  1 
ATOM   2384 C CD  . LYS A 1 315 ? 6.984   60.602 39.844 1.00 5.62  ? 315 LYS A CD  1 
ATOM   2385 C CE  . LYS A 1 315 ? 7.012   61.841 38.941 1.00 2.23  ? 315 LYS A CE  1 
ATOM   2386 N NZ  . LYS A 1 315 ? 6.314   61.584 37.702 1.00 7.21  ? 315 LYS A NZ  1 
ATOM   2387 N N   . LYS A 1 316 ? 11.009  57.995 38.832 1.00 11.74 ? 316 LYS A N   1 
ATOM   2388 C CA  . LYS A 1 316 ? 12.404  58.456 38.780 1.00 11.54 ? 316 LYS A CA  1 
ATOM   2389 C C   . LYS A 1 316 ? 12.451  59.858 38.240 1.00 13.56 ? 316 LYS A C   1 
ATOM   2390 O O   . LYS A 1 316 ? 12.348  60.074 37.049 1.00 20.69 ? 316 LYS A O   1 
ATOM   2391 C CB  . LYS A 1 316 ? 13.171  57.521 37.864 1.00 8.26  ? 316 LYS A CB  1 
ATOM   2392 C CG  . LYS A 1 316 ? 13.127  56.119 38.485 1.00 16.81 ? 316 LYS A CG  1 
ATOM   2393 C CD  . LYS A 1 316 ? 13.289  54.969 37.505 1.00 20.85 ? 316 LYS A CD  1 
ATOM   2394 C CE  . LYS A 1 316 ? 12.902  53.663 38.201 1.00 26.47 ? 316 LYS A CE  1 
ATOM   2395 N NZ  . LYS A 1 316 ? 13.286  52.521 37.401 1.00 38.01 ? 316 LYS A NZ  1 
ATOM   2396 N N   . THR A 1 317 ? 12.594  60.814 39.134 1.00 14.01 ? 317 THR A N   1 
ATOM   2397 C CA  . THR A 1 317 ? 12.652  62.244 38.864 1.00 9.79  ? 317 THR A CA  1 
ATOM   2398 C C   . THR A 1 317 ? 13.686  62.692 39.841 1.00 10.09 ? 317 THR A C   1 
ATOM   2399 O O   . THR A 1 317 ? 14.387  61.834 40.377 1.00 14.11 ? 317 THR A O   1 
ATOM   2400 C CB  . THR A 1 317 ? 11.268  62.826 39.158 1.00 8.40  ? 317 THR A CB  1 
ATOM   2401 O OG1 . THR A 1 317 ? 11.163  64.217 38.919 1.00 3.20  ? 317 THR A OG1 1 
ATOM   2402 C CG2 . THR A 1 317 ? 10.726  62.508 40.561 1.00 13.38 ? 317 THR A CG2 1 
ATOM   2403 N N   . GLN A 1 318 ? 13.803  63.988 40.092 1.00 6.37  ? 318 GLN A N   1 
ATOM   2404 C CA  . GLN A 1 318 ? 14.777  64.420 41.073 1.00 12.87 ? 318 GLN A CA  1 
ATOM   2405 C C   . GLN A 1 318 ? 13.988  64.827 42.278 1.00 14.14 ? 318 GLN A C   1 
ATOM   2406 O O   . GLN A 1 318 ? 12.856  65.269 42.127 1.00 16.56 ? 318 GLN A O   1 
ATOM   2407 C CB  . GLN A 1 318 ? 15.678  65.574 40.599 1.00 15.58 ? 318 GLN A CB  1 
ATOM   2408 C CG  . GLN A 1 318 ? 14.988  66.667 39.762 1.00 19.31 ? 318 GLN A CG  1 
ATOM   2409 C CD  . GLN A 1 318 ? 14.540  66.130 38.419 1.00 22.16 ? 318 GLN A CD  1 
ATOM   2410 O OE1 . GLN A 1 318 ? 13.369  66.144 38.104 1.00 23.76 ? 318 GLN A OE1 1 
ATOM   2411 N NE2 . GLN A 1 318 ? 15.466  65.585 37.653 1.00 23.65 ? 318 GLN A NE2 1 
ATOM   2412 N N   . ILE A 1 319 ? 14.601  64.668 43.460 1.00 14.51 ? 319 ILE A N   1 
ATOM   2413 C CA  . ILE A 1 319 ? 13.962  65.028 44.715 1.00 13.89 ? 319 ILE A CA  1 
ATOM   2414 C C   . ILE A 1 319 ? 14.935  65.892 45.481 1.00 13.76 ? 319 ILE A C   1 
ATOM   2415 O O   . ILE A 1 319 ? 16.143  65.848 45.224 1.00 15.41 ? 319 ILE A O   1 
ATOM   2416 C CB  . ILE A 1 319 ? 13.606  63.764 45.533 1.00 8.68  ? 319 ILE A CB  1 
ATOM   2417 C CG1 . ILE A 1 319 ? 14.810  62.833 45.701 1.00 9.47  ? 319 ILE A CG1 1 
ATOM   2418 C CG2 . ILE A 1 319 ? 12.439  63.029 44.879 1.00 8.02  ? 319 ILE A CG2 1 
ATOM   2419 C CD1 . ILE A 1 319 ? 14.535  61.645 46.616 1.00 10.02 ? 319 ILE A CD1 1 
ATOM   2420 N N   . LEU A 1 320 ? 14.374  66.653 46.433 1.00 12.95 ? 320 LEU A N   1 
ATOM   2421 C CA  . LEU A 1 320 ? 15.133  67.534 47.325 1.00 13.55 ? 320 LEU A CA  1 
ATOM   2422 C C   . LEU A 1 320 ? 14.604  67.179 48.708 1.00 16.92 ? 320 LEU A C   1 
ATOM   2423 O O   . LEU A 1 320 ? 13.402  67.300 48.938 1.00 17.93 ? 320 LEU A O   1 
ATOM   2424 C CB  . LEU A 1 320 ? 14.885  68.995 46.946 1.00 10.04 ? 320 LEU A CB  1 
ATOM   2425 C CG  . LEU A 1 320 ? 15.616  70.015 47.806 1.00 2.89  ? 320 LEU A CG  1 
ATOM   2426 C CD1 . LEU A 1 320 ? 15.902  71.283 46.999 1.00 2.00  ? 320 LEU A CD1 1 
ATOM   2427 C CD2 . LEU A 1 320 ? 14.777  70.365 49.034 1.00 2.00  ? 320 LEU A CD2 1 
ATOM   2428 N N   . LEU A 1 321 ? 15.471  66.724 49.628 1.00 19.13 ? 321 LEU A N   1 
ATOM   2429 C CA  . LEU A 1 321 ? 14.983  66.334 50.959 1.00 20.76 ? 321 LEU A CA  1 
ATOM   2430 C C   . LEU A 1 321 ? 15.948  66.716 52.073 1.00 21.85 ? 321 LEU A C   1 
ATOM   2431 O O   . LEU A 1 321 ? 17.080  67.123 51.823 1.00 21.77 ? 321 LEU A O   1 
ATOM   2432 C CB  . LEU A 1 321 ? 14.567  64.848 50.994 1.00 13.85 ? 321 LEU A CB  1 
ATOM   2433 C CG  . LEU A 1 321 ? 15.662  63.771 50.878 1.00 10.01 ? 321 LEU A CG  1 
ATOM   2434 C CD1 . LEU A 1 321 ? 14.969  62.419 50.669 1.00 14.33 ? 321 LEU A CD1 1 
ATOM   2435 C CD2 . LEU A 1 321 ? 16.697  64.033 49.786 1.00 12.34 ? 321 LEU A CD2 1 
ATOM   2436 N N   . GLY A 1 322 ? 15.474  66.606 53.323 1.00 20.68 ? 322 GLY A N   1 
ATOM   2437 C CA  . GLY A 1 322 ? 16.364  66.975 54.413 1.00 21.02 ? 322 GLY A CA  1 
ATOM   2438 C C   . GLY A 1 322 ? 15.837  66.670 55.788 1.00 20.39 ? 322 GLY A C   1 
ATOM   2439 O O   . GLY A 1 322 ? 14.748  66.148 56.012 1.00 17.65 ? 322 GLY A O   1 
ATOM   2440 N N   . VAL A 1 323 ? 16.676  67.039 56.737 1.00 19.21 ? 323 VAL A N   1 
ATOM   2441 C CA  . VAL A 1 323 ? 16.454  66.802 58.135 1.00 16.39 ? 323 VAL A CA  1 
ATOM   2442 C C   . VAL A 1 323 ? 16.833  68.060 58.918 1.00 18.43 ? 323 VAL A C   1 
ATOM   2443 O O   . VAL A 1 323 ? 17.569  68.917 58.453 1.00 21.23 ? 323 VAL A O   1 
ATOM   2444 C CB  . VAL A 1 323 ? 17.385  65.595 58.390 1.00 13.97 ? 323 VAL A CB  1 
ATOM   2445 C CG1 . VAL A 1 323 ? 18.247  65.660 59.636 1.00 22.44 ? 323 VAL A CG1 1 
ATOM   2446 C CG2 . VAL A 1 323 ? 16.668  64.246 58.256 1.00 12.08 ? 323 VAL A CG2 1 
ATOM   2447 N N   . ASN A 1 324 ? 16.312  68.130 60.140 1.00 19.64 ? 324 ASN A N   1 
ATOM   2448 C CA  . ASN A 1 324 ? 16.576  69.232 61.065 1.00 20.25 ? 324 ASN A CA  1 
ATOM   2449 C C   . ASN A 1 324 ? 17.483  68.638 62.123 1.00 18.45 ? 324 ASN A C   1 
ATOM   2450 O O   . ASN A 1 324 ? 17.417  67.451 62.429 1.00 17.84 ? 324 ASN A O   1 
ATOM   2451 C CB  . ASN A 1 324 ? 15.325  69.717 61.812 1.00 22.56 ? 324 ASN A CB  1 
ATOM   2452 C CG  . ASN A 1 324 ? 14.487  70.641 60.991 1.00 27.51 ? 324 ASN A CG  1 
ATOM   2453 O OD1 . ASN A 1 324 ? 14.739  70.895 59.826 1.00 37.47 ? 324 ASN A OD1 1 
ATOM   2454 N ND2 . ASN A 1 324 ? 13.440  71.163 61.614 1.00 29.83 ? 324 ASN A ND2 1 
ATOM   2455 N N   . LYS A 1 325 ? 18.277  69.490 62.736 1.00 16.85 ? 325 LYS A N   1 
ATOM   2456 C CA  . LYS A 1 325 ? 19.209  69.004 63.749 1.00 18.86 ? 325 LYS A CA  1 
ATOM   2457 C C   . LYS A 1 325 ? 18.633  68.269 64.972 1.00 19.76 ? 325 LYS A C   1 
ATOM   2458 O O   . LYS A 1 325 ? 19.155  67.238 65.376 1.00 22.32 ? 325 LYS A O   1 
ATOM   2459 C CB  . LYS A 1 325 ? 20.041  70.206 64.203 1.00 19.84 ? 325 LYS A CB  1 
ATOM   2460 C CG  . LYS A 1 325 ? 21.235  69.913 65.106 1.00 18.37 ? 325 LYS A CG  1 
ATOM   2461 C CD  . LYS A 1 325 ? 21.879  71.216 65.602 1.00 23.69 ? 325 LYS A CD  1 
ATOM   2462 C CE  . LYS A 1 325 ? 22.953  70.945 66.686 1.00 31.93 ? 325 LYS A CE  1 
ATOM   2463 N N   . ASP A 1 326 ? 17.564  68.800 65.589 1.00 19.00 ? 326 ASP A N   1 
ATOM   2464 C CA  . ASP A 1 326 ? 16.997  68.168 66.786 1.00 15.13 ? 326 ASP A CA  1 
ATOM   2465 C C   . ASP A 1 326 ? 15.582  67.685 66.541 1.00 15.41 ? 326 ASP A C   1 
ATOM   2466 O O   . ASP A 1 326 ? 14.554  68.246 66.915 1.00 17.38 ? 326 ASP A O   1 
ATOM   2467 C CB  . ASP A 1 326 ? 17.045  69.147 67.964 1.00 14.86 ? 326 ASP A CB  1 
ATOM   2468 C CG  . ASP A 1 326 ? 18.481  69.585 68.202 1.00 15.21 ? 326 ASP A CG  1 
ATOM   2469 O OD1 . ASP A 1 326 ? 19.246  68.787 68.744 1.00 12.30 ? 326 ASP A OD1 1 
ATOM   2470 O OD2 . ASP A 1 326 ? 18.837  70.705 67.836 1.00 17.21 ? 326 ASP A OD2 1 
ATOM   2471 N N   . GLU A 1 327 ? 15.548  66.544 65.869 1.00 15.52 ? 327 GLU A N   1 
ATOM   2472 C CA  . GLU A 1 327 ? 14.229  66.004 65.564 1.00 13.42 ? 327 GLU A CA  1 
ATOM   2473 C C   . GLU A 1 327 ? 13.532  65.379 66.751 1.00 10.57 ? 327 GLU A C   1 
ATOM   2474 O O   . GLU A 1 327 ? 12.316  65.300 66.771 1.00 9.81  ? 327 GLU A O   1 
ATOM   2475 C CB  . GLU A 1 327 ? 14.333  64.889 64.496 1.00 17.15 ? 327 GLU A CB  1 
ATOM   2476 C CG  . GLU A 1 327 ? 14.964  65.334 63.166 1.00 18.52 ? 327 GLU A CG  1 
ATOM   2477 C CD  . GLU A 1 327 ? 13.970  66.056 62.282 1.00 19.62 ? 327 GLU A CD  1 
ATOM   2478 O OE1 . GLU A 1 327 ? 12.931  66.484 62.781 1.00 21.93 ? 327 GLU A OE1 1 
ATOM   2479 O OE2 . GLU A 1 327 ? 14.237  66.179 61.090 1.00 16.45 ? 327 GLU A OE2 1 
ATOM   2480 N N   . GLY A 1 328 ? 14.326  64.899 67.718 1.00 11.45 ? 328 GLY A N   1 
ATOM   2481 C CA  . GLY A 1 328 ? 13.742  64.223 68.891 1.00 9.29  ? 328 GLY A CA  1 
ATOM   2482 C C   . GLY A 1 328 ? 13.019  65.075 69.925 1.00 5.98  ? 328 GLY A C   1 
ATOM   2483 O O   . GLY A 1 328 ? 11.947  64.733 70.402 1.00 5.07  ? 328 GLY A O   1 
ATOM   2484 N N   . SER A 1 329 ? 13.605  66.213 70.250 1.00 4.05  ? 329 SER A N   1 
ATOM   2485 C CA  . SER A 1 329 ? 13.070  67.137 71.237 1.00 6.39  ? 329 SER A CA  1 
ATOM   2486 C C   . SER A 1 329 ? 11.602  67.111 71.523 1.00 9.36  ? 329 SER A C   1 
ATOM   2487 O O   . SER A 1 329 ? 11.178  66.831 72.631 1.00 15.58 ? 329 SER A O   1 
ATOM   2488 C CB  . SER A 1 329 ? 13.402  68.587 70.876 1.00 4.71  ? 329 SER A CB  1 
ATOM   2489 O OG  . SER A 1 329 ? 14.743  68.550 70.442 1.00 15.15 ? 329 SER A OG  1 
ATOM   2490 N N   . PHE A 1 330 ? 10.831  67.435 70.503 1.00 10.03 ? 330 PHE A N   1 
ATOM   2491 C CA  . PHE A 1 330 ? 9.388   67.504 70.670 1.00 9.24  ? 330 PHE A CA  1 
ATOM   2492 C C   . PHE A 1 330 ? 8.801   66.222 71.233 1.00 11.37 ? 330 PHE A C   1 
ATOM   2493 O O   . PHE A 1 330 ? 7.995   66.250 72.151 1.00 14.67 ? 330 PHE A O   1 
ATOM   2494 C CB  . PHE A 1 330 ? 8.797   67.941 69.310 1.00 9.90  ? 330 PHE A CB  1 
ATOM   2495 C CG  . PHE A 1 330 ? 7.361   67.570 69.090 1.00 5.23  ? 330 PHE A CG  1 
ATOM   2496 C CD1 . PHE A 1 330 ? 6.355   68.074 69.932 1.00 7.49  ? 330 PHE A CD1 1 
ATOM   2497 C CD2 . PHE A 1 330 ? 7.029   66.699 68.050 1.00 2.00  ? 330 PHE A CD2 1 
ATOM   2498 C CE1 . PHE A 1 330 ? 5.016   67.694 69.746 1.00 5.45  ? 330 PHE A CE1 1 
ATOM   2499 C CE2 . PHE A 1 330 ? 5.702   66.309 67.869 1.00 6.92  ? 330 PHE A CE2 1 
ATOM   2500 C CZ  . PHE A 1 330 ? 4.692   66.803 68.719 1.00 7.06  ? 330 PHE A CZ  1 
ATOM   2501 N N   . PHE A 1 331 ? 9.253   65.093 70.703 1.00 10.22 ? 331 PHE A N   1 
ATOM   2502 C CA  . PHE A 1 331 ? 8.704   63.827 71.186 1.00 9.49  ? 331 PHE A CA  1 
ATOM   2503 C C   . PHE A 1 331 ? 9.104   63.550 72.605 1.00 10.53 ? 331 PHE A C   1 
ATOM   2504 O O   . PHE A 1 331 ? 8.302   63.082 73.401 1.00 18.03 ? 331 PHE A O   1 
ATOM   2505 C CB  . PHE A 1 331 ? 9.108   62.653 70.283 1.00 5.51  ? 331 PHE A CB  1 
ATOM   2506 C CG  . PHE A 1 331 ? 8.718   62.957 68.870 1.00 7.87  ? 331 PHE A CG  1 
ATOM   2507 C CD1 . PHE A 1 331 ? 9.586   63.696 68.044 1.00 9.94  ? 331 PHE A CD1 1 
ATOM   2508 C CD2 . PHE A 1 331 ? 7.436   62.607 68.414 1.00 7.15  ? 331 PHE A CD2 1 
ATOM   2509 C CE1 . PHE A 1 331 ? 9.155   64.126 66.787 1.00 9.44  ? 331 PHE A CE1 1 
ATOM   2510 C CE2 . PHE A 1 331 ? 7.007   63.035 67.154 1.00 9.46  ? 331 PHE A CE2 1 
ATOM   2511 C CZ  . PHE A 1 331 ? 7.863   63.800 66.344 1.00 11.59 ? 331 PHE A CZ  1 
ATOM   2512 N N   . LEU A 1 332 ? 10.375  63.847 72.918 1.00 9.05  ? 332 LEU A N   1 
ATOM   2513 C CA  . LEU A 1 332 ? 10.840  63.607 74.285 1.00 7.07  ? 332 LEU A CA  1 
ATOM   2514 C C   . LEU A 1 332 ? 10.027  64.468 75.245 1.00 7.31  ? 332 LEU A C   1 
ATOM   2515 O O   . LEU A 1 332 ? 9.320   63.979 76.117 1.00 5.40  ? 332 LEU A O   1 
ATOM   2516 C CB  . LEU A 1 332 ? 12.349  63.825 74.423 1.00 2.00  ? 332 LEU A CB  1 
ATOM   2517 C CG  . LEU A 1 332 ? 13.172  62.733 73.743 1.00 2.00  ? 332 LEU A CG  1 
ATOM   2518 C CD1 . LEU A 1 332 ? 14.622  63.164 73.595 1.00 2.00  ? 332 LEU A CD1 1 
ATOM   2519 C CD2 . LEU A 1 332 ? 13.094  61.403 74.488 1.00 2.00  ? 332 LEU A CD2 1 
ATOM   2520 N N   . LEU A 1 333 ? 10.102  65.774 75.008 1.00 4.82  ? 333 LEU A N   1 
ATOM   2521 C CA  . LEU A 1 333 ? 9.359   66.732 75.799 1.00 4.67  ? 333 LEU A CA  1 
ATOM   2522 C C   . LEU A 1 333 ? 7.899   66.344 76.002 1.00 6.42  ? 333 LEU A C   1 
ATOM   2523 O O   . LEU A 1 333 ? 7.330   66.523 77.071 1.00 13.53 ? 333 LEU A O   1 
ATOM   2524 C CB  . LEU A 1 333 ? 9.460   68.073 75.079 1.00 6.73  ? 333 LEU A CB  1 
ATOM   2525 C CG  . LEU A 1 333 ? 8.757   69.310 75.682 1.00 8.90  ? 333 LEU A CG  1 
ATOM   2526 C CD1 . LEU A 1 333 ? 7.382   69.539 75.101 1.00 9.01  ? 333 LEU A CD1 1 
ATOM   2527 C CD2 . LEU A 1 333 ? 8.713   69.365 77.212 1.00 12.87 ? 333 LEU A CD2 1 
ATOM   2528 N N   . TYR A 1 334 ? 7.280   65.785 74.975 1.00 6.07  ? 334 TYR A N   1 
ATOM   2529 C CA  . TYR A 1 334 ? 5.871   65.437 75.152 1.00 6.57  ? 334 TYR A CA  1 
ATOM   2530 C C   . TYR A 1 334 ? 5.629   64.108 75.786 1.00 6.32  ? 334 TYR A C   1 
ATOM   2531 O O   . TYR A 1 334 ? 4.517   63.901 76.249 1.00 8.62  ? 334 TYR A O   1 
ATOM   2532 C CB  . TYR A 1 334 ? 5.054   65.477 73.835 1.00 5.74  ? 334 TYR A CB  1 
ATOM   2533 C CG  . TYR A 1 334 ? 4.521   66.852 73.512 1.00 2.00  ? 334 TYR A CG  1 
ATOM   2534 C CD1 . TYR A 1 334 ? 5.409   67.907 73.254 1.00 2.00  ? 334 TYR A CD1 1 
ATOM   2535 C CD2 . TYR A 1 334 ? 3.137   67.079 73.460 1.00 2.00  ? 334 TYR A CD2 1 
ATOM   2536 C CE1 . TYR A 1 334 ? 4.912   69.181 72.946 1.00 5.08  ? 334 TYR A CE1 1 
ATOM   2537 C CE2 . TYR A 1 334 ? 2.633   68.349 73.155 1.00 2.00  ? 334 TYR A CE2 1 
ATOM   2538 C CZ  . TYR A 1 334 ? 3.521   69.399 72.890 1.00 4.53  ? 334 TYR A CZ  1 
ATOM   2539 O OH  . TYR A 1 334 ? 3.049   70.651 72.554 1.00 11.53 ? 334 TYR A OH  1 
ATOM   2540 N N   . GLY A 1 335 ? 6.595   63.194 75.819 1.00 6.87  ? 335 GLY A N   1 
ATOM   2541 C CA  . GLY A 1 335 ? 6.176   61.960 76.480 1.00 7.35  ? 335 GLY A CA  1 
ATOM   2542 C C   . GLY A 1 335 ? 7.252   61.095 77.070 1.00 9.23  ? 335 GLY A C   1 
ATOM   2543 O O   . GLY A 1 335 ? 7.053   59.912 77.296 1.00 7.96  ? 335 GLY A O   1 
ATOM   2544 N N   . ALA A 1 336 ? 8.413   61.661 77.332 1.00 10.09 ? 336 ALA A N   1 
ATOM   2545 C CA  . ALA A 1 336 ? 9.487   60.899 77.920 1.00 11.90 ? 336 ALA A CA  1 
ATOM   2546 C C   . ALA A 1 336 ? 9.673   61.485 79.315 1.00 15.96 ? 336 ALA A C   1 
ATOM   2547 O O   . ALA A 1 336 ? 9.580   62.702 79.500 1.00 18.28 ? 336 ALA A O   1 
ATOM   2548 C CB  . ALA A 1 336 ? 10.768  61.057 77.107 1.00 15.83 ? 336 ALA A CB  1 
ATOM   2549 N N   . PRO A 1 337 ? 9.904   60.610 80.308 1.00 15.53 ? 337 PRO A N   1 
ATOM   2550 C CA  . PRO A 1 337 ? 9.985   61.082 81.683 1.00 14.25 ? 337 PRO A CA  1 
ATOM   2551 C C   . PRO A 1 337 ? 11.283  61.808 82.017 1.00 15.93 ? 337 PRO A C   1 
ATOM   2552 O O   . PRO A 1 337 ? 12.366  61.243 81.891 1.00 15.63 ? 337 PRO A O   1 
ATOM   2553 C CB  . PRO A 1 337 ? 9.910   59.789 82.500 1.00 16.93 ? 337 PRO A CB  1 
ATOM   2554 C CG  . PRO A 1 337 ? 10.331  58.651 81.553 1.00 17.25 ? 337 PRO A CG  1 
ATOM   2555 C CD  . PRO A 1 337 ? 9.995   59.158 80.154 1.00 17.55 ? 337 PRO A CD  1 
ATOM   2556 N N   . GLY A 1 338 ? 11.154  63.059 82.479 1.00 14.88 ? 338 GLY A N   1 
ATOM   2557 C CA  . GLY A 1 338 ? 12.336  63.815 82.855 1.00 14.54 ? 338 GLY A CA  1 
ATOM   2558 C C   . GLY A 1 338 ? 12.454  65.113 82.127 1.00 17.81 ? 338 GLY A C   1 
ATOM   2559 O O   . GLY A 1 338 ? 13.127  66.053 82.554 1.00 22.81 ? 338 GLY A O   1 
ATOM   2560 N N   . PHE A 1 339 ? 11.757  65.184 80.999 1.00 19.32 ? 339 PHE A N   1 
ATOM   2561 C CA  . PHE A 1 339 ? 11.838  66.393 80.199 1.00 13.96 ? 339 PHE A CA  1 
ATOM   2562 C C   . PHE A 1 339 ? 10.696  67.272 80.539 1.00 13.96 ? 339 PHE A C   1 
ATOM   2563 O O   . PHE A 1 339 ? 9.606   66.770 80.776 1.00 22.31 ? 339 PHE A O   1 
ATOM   2564 C CB  . PHE A 1 339 ? 11.708  66.044 78.717 1.00 10.64 ? 339 PHE A CB  1 
ATOM   2565 C CG  . PHE A 1 339 ? 12.837  65.169 78.270 1.00 3.88  ? 339 PHE A CG  1 
ATOM   2566 C CD1 . PHE A 1 339 ? 12.760  63.776 78.437 1.00 2.63  ? 339 PHE A CD1 1 
ATOM   2567 C CD2 . PHE A 1 339 ? 13.967  65.743 77.680 1.00 2.00  ? 339 PHE A CD2 1 
ATOM   2568 C CE1 . PHE A 1 339 ? 13.811  62.968 78.001 1.00 2.88  ? 339 PHE A CE1 1 
ATOM   2569 C CE2 . PHE A 1 339 ? 15.001  64.936 77.218 1.00 2.00  ? 339 PHE A CE2 1 
ATOM   2570 C CZ  . PHE A 1 339 ? 14.928  63.553 77.384 1.00 2.00  ? 339 PHE A CZ  1 
ATOM   2571 N N   . SER A 1 340 ? 10.907  68.570 80.551 1.00 5.93  ? 340 SER A N   1 
ATOM   2572 C CA  . SER A 1 340 ? 9.788   69.412 80.861 1.00 8.24  ? 340 SER A CA  1 
ATOM   2573 C C   . SER A 1 340 ? 10.176  70.702 80.211 1.00 9.54  ? 340 SER A C   1 
ATOM   2574 O O   . SER A 1 340 ? 11.351  71.018 80.104 1.00 12.25 ? 340 SER A O   1 
ATOM   2575 C CB  . SER A 1 340 ? 9.520   69.474 82.370 1.00 13.24 ? 340 SER A CB  1 
ATOM   2576 O OG  . SER A 1 340 ? 10.769  69.483 83.055 1.00 20.34 ? 340 SER A OG  1 
ATOM   2577 N N   . LYS A 1 341 ? 9.165   71.447 79.776 1.00 8.55  ? 341 LYS A N   1 
ATOM   2578 C CA  . LYS A 1 341 ? 9.393   72.688 79.084 1.00 6.09  ? 341 LYS A CA  1 
ATOM   2579 C C   . LYS A 1 341 ? 10.149  73.771 79.809 1.00 10.80 ? 341 LYS A C   1 
ATOM   2580 O O   . LYS A 1 341 ? 10.918  74.490 79.193 1.00 16.03 ? 341 LYS A O   1 
ATOM   2581 C CB  . LYS A 1 341 ? 8.028   73.295 78.730 1.00 8.30  ? 341 LYS A CB  1 
ATOM   2582 C CG  . LYS A 1 341 ? 8.154   74.489 77.781 1.00 12.38 ? 341 LYS A CG  1 
ATOM   2583 C CD  . LYS A 1 341 ? 6.811   75.078 77.352 1.00 17.57 ? 341 LYS A CD  1 
ATOM   2584 C CE  . LYS A 1 341 ? 6.425   76.349 78.108 1.00 20.78 ? 341 LYS A CE  1 
ATOM   2585 N NZ  . LYS A 1 341 ? 5.582   75.995 79.230 1.00 27.83 ? 341 LYS A NZ  1 
ATOM   2586 N N   . ASP A 1 342 ? 9.896   73.931 81.115 1.00 11.84 ? 342 ASP A N   1 
ATOM   2587 C CA  . ASP A 1 342 ? 10.561  75.064 81.769 1.00 10.44 ? 342 ASP A CA  1 
ATOM   2588 C C   . ASP A 1 342 ? 11.803  74.749 82.550 1.00 11.23 ? 342 ASP A C   1 
ATOM   2589 O O   . ASP A 1 342 ? 12.316  75.581 83.279 1.00 11.16 ? 342 ASP A O   1 
ATOM   2590 C CB  . ASP A 1 342 ? 9.553   75.748 82.683 1.00 13.39 ? 342 ASP A CB  1 
ATOM   2591 C CG  . ASP A 1 342 ? 8.298   76.132 81.915 1.00 18.79 ? 342 ASP A CG  1 
ATOM   2592 O OD1 . ASP A 1 342 ? 8.437   76.553 80.772 1.00 19.02 ? 342 ASP A OD1 1 
ATOM   2593 O OD2 . ASP A 1 342 ? 7.189   76.011 82.446 1.00 26.74 ? 342 ASP A OD2 1 
ATOM   2594 N N   . SER A 1 343 ? 12.270  73.537 82.398 1.00 12.35 ? 343 SER A N   1 
ATOM   2595 C CA  . SER A 1 343 ? 13.432  73.038 83.083 1.00 13.10 ? 343 SER A CA  1 
ATOM   2596 C C   . SER A 1 343 ? 14.442  72.800 81.979 1.00 14.58 ? 343 SER A C   1 
ATOM   2597 O O   . SER A 1 343 ? 14.082  72.847 80.821 1.00 22.87 ? 343 SER A O   1 
ATOM   2598 C CB  . SER A 1 343 ? 12.901  71.703 83.628 1.00 9.72  ? 343 SER A CB  1 
ATOM   2599 O OG  . SER A 1 343 ? 13.862  70.896 84.288 1.00 24.12 ? 343 SER A OG  1 
ATOM   2600 N N   . GLU A 1 344 ? 15.701  72.514 82.304 1.00 12.45 ? 344 GLU A N   1 
ATOM   2601 C CA  . GLU A 1 344 ? 16.664  72.234 81.208 1.00 12.60 ? 344 GLU A CA  1 
ATOM   2602 C C   . GLU A 1 344 ? 16.839  70.723 81.029 1.00 14.76 ? 344 GLU A C   1 
ATOM   2603 O O   . GLU A 1 344 ? 17.855  70.186 80.595 1.00 12.18 ? 344 GLU A O   1 
ATOM   2604 C CB  . GLU A 1 344 ? 18.042  72.927 81.380 1.00 16.85 ? 344 GLU A CB  1 
ATOM   2605 C CG  . GLU A 1 344 ? 18.786  72.592 82.679 1.00 22.04 ? 344 GLU A CG  1 
ATOM   2606 N N   . SER A 1 345 ? 15.812  70.055 81.504 1.00 14.52 ? 345 SER A N   1 
ATOM   2607 C CA  . SER A 1 345 ? 15.761  68.621 81.409 1.00 17.55 ? 345 SER A CA  1 
ATOM   2608 C C   . SER A 1 345 ? 17.032  67.777 81.415 1.00 20.59 ? 345 SER A C   1 
ATOM   2609 O O   . SER A 1 345 ? 17.349  67.167 80.404 1.00 21.82 ? 345 SER A O   1 
ATOM   2610 C CB  . SER A 1 345 ? 14.978  68.355 80.137 1.00 16.43 ? 345 SER A CB  1 
ATOM   2611 O OG  . SER A 1 345 ? 13.731  69.049 80.314 1.00 18.13 ? 345 SER A OG  1 
ATOM   2612 N N   . LYS A 1 346 ? 17.716  67.723 82.579 1.00 21.86 ? 346 LYS A N   1 
ATOM   2613 C CA  . LYS A 1 346 ? 18.910  66.879 82.705 1.00 23.77 ? 346 LYS A CA  1 
ATOM   2614 C C   . LYS A 1 346 ? 18.369  65.497 83.043 1.00 25.00 ? 346 LYS A C   1 
ATOM   2615 O O   . LYS A 1 346 ? 17.660  65.332 84.033 1.00 29.16 ? 346 LYS A O   1 
ATOM   2616 C CB  . LYS A 1 346 ? 19.810  67.439 83.801 1.00 24.40 ? 346 LYS A CB  1 
ATOM   2617 C CG  . LYS A 1 346 ? 20.523  68.699 83.294 1.00 33.23 ? 346 LYS A CG  1 
ATOM   2618 C CD  . LYS A 1 346 ? 21.118  69.581 84.404 1.00 39.97 ? 346 LYS A CD  1 
ATOM   2619 C CE  . LYS A 1 346 ? 22.034  70.688 83.836 1.00 45.95 ? 346 LYS A CE  1 
ATOM   2620 N NZ  . LYS A 1 346 ? 21.742  71.993 84.410 1.00 51.42 ? 346 LYS A NZ  1 
ATOM   2621 N N   . ILE A 1 347 ? 18.678  64.494 82.229 1.00 25.23 ? 347 ILE A N   1 
ATOM   2622 C CA  . ILE A 1 347 ? 18.097  63.181 82.513 1.00 24.86 ? 347 ILE A CA  1 
ATOM   2623 C C   . ILE A 1 347 ? 19.087  62.314 83.248 1.00 24.84 ? 347 ILE A C   1 
ATOM   2624 O O   . ILE A 1 347 ? 20.276  62.293 82.982 1.00 25.36 ? 347 ILE A O   1 
ATOM   2625 C CB  . ILE A 1 347 ? 17.521  62.564 81.206 1.00 20.35 ? 347 ILE A CB  1 
ATOM   2626 C CG1 . ILE A 1 347 ? 16.094  63.087 80.926 1.00 19.69 ? 347 ILE A CG1 1 
ATOM   2627 C CG2 . ILE A 1 347 ? 17.475  61.029 81.185 1.00 18.16 ? 347 ILE A CG2 1 
ATOM   2628 C CD1 . ILE A 1 347 ? 15.975  64.597 80.697 1.00 12.30 ? 347 ILE A CD1 1 
ATOM   2629 N N   . SER A 1 348 ? 18.517  61.576 84.190 1.00 22.60 ? 348 SER A N   1 
ATOM   2630 C CA  . SER A 1 348 ? 19.280  60.669 85.023 1.00 22.96 ? 348 SER A CA  1 
ATOM   2631 C C   . SER A 1 348 ? 19.473  59.374 84.291 1.00 25.12 ? 348 SER A C   1 
ATOM   2632 O O   . SER A 1 348 ? 18.705  59.101 83.376 1.00 29.86 ? 348 SER A O   1 
ATOM   2633 C CB  . SER A 1 348 ? 18.412  60.381 86.270 1.00 22.94 ? 348 SER A CB  1 
ATOM   2634 O OG  . SER A 1 348 ? 17.043  60.109 85.921 1.00 21.81 ? 348 SER A OG  1 
ATOM   2635 N N   . ARG A 1 349 ? 20.421  58.520 84.727 1.00 26.78 ? 349 ARG A N   1 
ATOM   2636 C CA  . ARG A 1 349 ? 20.509  57.267 83.982 1.00 26.44 ? 349 ARG A CA  1 
ATOM   2637 C C   . ARG A 1 349 ? 19.252  56.469 84.092 1.00 23.30 ? 349 ARG A C   1 
ATOM   2638 O O   . ARG A 1 349 ? 18.958  55.655 83.241 1.00 23.92 ? 349 ARG A O   1 
ATOM   2639 C CB  . ARG A 1 349 ? 21.692  56.337 84.303 1.00 28.34 ? 349 ARG A CB  1 
ATOM   2640 C CG  . ARG A 1 349 ? 23.027  56.810 83.672 1.00 39.36 ? 349 ARG A CG  1 
ATOM   2641 C CD  . ARG A 1 349 ? 23.038  57.123 82.138 1.00 42.13 ? 349 ARG A CD  1 
ATOM   2642 N NE  . ARG A 1 349 ? 23.855  56.244 81.299 1.00 42.13 ? 349 ARG A NE  1 
ATOM   2643 C CZ  . ARG A 1 349 ? 23.557  54.954 81.069 1.00 43.18 ? 349 ARG A CZ  1 
ATOM   2644 N NH1 . ARG A 1 349 ? 22.555  54.338 81.691 1.00 44.85 ? 349 ARG A NH1 1 
ATOM   2645 N NH2 . ARG A 1 349 ? 24.288  54.268 80.201 1.00 43.64 ? 349 ARG A NH2 1 
ATOM   2646 N N   . GLU A 1 350 ? 18.488  56.699 85.144 1.00 26.90 ? 350 GLU A N   1 
ATOM   2647 C CA  . GLU A 1 350 ? 17.263  55.911 85.222 1.00 31.45 ? 350 GLU A CA  1 
ATOM   2648 C C   . GLU A 1 350 ? 16.301  56.334 84.127 1.00 30.75 ? 350 GLU A C   1 
ATOM   2649 O O   . GLU A 1 350 ? 15.825  55.539 83.332 1.00 33.01 ? 350 GLU A O   1 
ATOM   2650 C CB  . GLU A 1 350 ? 16.599  55.970 86.622 1.00 35.70 ? 350 GLU A CB  1 
ATOM   2651 C CG  . GLU A 1 350 ? 15.595  54.810 86.857 1.00 42.44 ? 350 GLU A CG  1 
ATOM   2652 N N   . ASP A 1 351 ? 16.039  57.637 84.077 1.00 29.40 ? 351 ASP A N   1 
ATOM   2653 C CA  . ASP A 1 351 ? 15.114  58.079 83.044 1.00 28.05 ? 351 ASP A CA  1 
ATOM   2654 C C   . ASP A 1 351 ? 15.675  57.927 81.642 1.00 27.22 ? 351 ASP A C   1 
ATOM   2655 O O   . ASP A 1 351 ? 14.950  57.870 80.655 1.00 30.60 ? 351 ASP A O   1 
ATOM   2656 C CB  . ASP A 1 351 ? 14.650  59.510 83.302 1.00 28.99 ? 351 ASP A CB  1 
ATOM   2657 C CG  . ASP A 1 351 ? 13.711  59.620 84.492 1.00 28.45 ? 351 ASP A CG  1 
ATOM   2658 O OD1 . ASP A 1 351 ? 12.964  58.665 84.744 1.00 26.02 ? 351 ASP A OD1 1 
ATOM   2659 O OD2 . ASP A 1 351 ? 13.732  60.665 85.149 1.00 27.93 ? 351 ASP A OD2 1 
ATOM   2660 N N   . PHE A 1 352 ? 17.001  57.870 81.560 1.00 24.01 ? 352 PHE A N   1 
ATOM   2661 C CA  . PHE A 1 352 ? 17.655  57.687 80.279 1.00 19.62 ? 352 PHE A CA  1 
ATOM   2662 C C   . PHE A 1 352 ? 17.260  56.333 79.769 1.00 19.15 ? 352 PHE A C   1 
ATOM   2663 O O   . PHE A 1 352 ? 16.744  56.171 78.675 1.00 25.45 ? 352 PHE A O   1 
ATOM   2664 C CB  . PHE A 1 352 ? 19.180  57.737 80.436 1.00 18.20 ? 352 PHE A CB  1 
ATOM   2665 C CG  . PHE A 1 352 ? 19.923  57.384 79.172 1.00 18.83 ? 352 PHE A CG  1 
ATOM   2666 C CD1 . PHE A 1 352 ? 20.242  58.377 78.231 1.00 21.32 ? 352 PHE A CD1 1 
ATOM   2667 C CD2 . PHE A 1 352 ? 20.326  56.058 78.941 1.00 15.96 ? 352 PHE A CD2 1 
ATOM   2668 C CE1 . PHE A 1 352 ? 20.986  58.048 77.086 1.00 21.96 ? 352 PHE A CE1 1 
ATOM   2669 C CE2 . PHE A 1 352 ? 21.057  55.728 77.794 1.00 14.30 ? 352 PHE A CE2 1 
ATOM   2670 C CZ  . PHE A 1 352 ? 21.399  56.724 76.869 1.00 18.25 ? 352 PHE A CZ  1 
ATOM   2671 N N   . MET A 1 353 ? 17.487  55.335 80.612 1.00 17.09 ? 353 MET A N   1 
ATOM   2672 C CA  . MET A 1 353 ? 17.134  53.996 80.193 1.00 18.52 ? 353 MET A CA  1 
ATOM   2673 C C   . MET A 1 353 ? 15.644  53.840 79.978 1.00 20.49 ? 353 MET A C   1 
ATOM   2674 O O   . MET A 1 353 ? 15.198  53.013 79.189 1.00 19.81 ? 353 MET A O   1 
ATOM   2675 C CB  . MET A 1 353 ? 17.754  52.953 81.110 1.00 19.65 ? 353 MET A CB  1 
ATOM   2676 C CG  . MET A 1 353 ? 19.295  53.119 81.050 1.00 18.12 ? 353 MET A CG  1 
ATOM   2677 N N   . SER A 1 354 ? 14.859  54.645 80.703 1.00 22.71 ? 354 SER A N   1 
ATOM   2678 C CA  . SER A 1 354 ? 13.424  54.538 80.475 1.00 25.84 ? 354 SER A CA  1 
ATOM   2679 C C   . SER A 1 354 ? 13.094  55.109 79.090 1.00 25.87 ? 354 SER A C   1 
ATOM   2680 O O   . SER A 1 354 ? 12.221  54.666 78.352 1.00 28.42 ? 354 SER A O   1 
ATOM   2681 C CB  . SER A 1 354 ? 12.633  55.339 81.526 1.00 27.61 ? 354 SER A CB  1 
ATOM   2682 O OG  . SER A 1 354 ? 13.050  55.077 82.868 1.00 35.58 ? 354 SER A OG  1 
ATOM   2683 N N   . GLY A 1 355 ? 13.847  56.145 78.754 1.00 23.04 ? 355 GLY A N   1 
ATOM   2684 C CA  . GLY A 1 355 ? 13.632  56.789 77.491 1.00 20.76 ? 355 GLY A CA  1 
ATOM   2685 C C   . GLY A 1 355 ? 13.913  55.887 76.330 1.00 20.74 ? 355 GLY A C   1 
ATOM   2686 O O   . GLY A 1 355 ? 13.065  55.716 75.465 1.00 20.96 ? 355 GLY A O   1 
ATOM   2687 N N   . VAL A 1 356 ? 15.118  55.281 76.330 1.00 16.58 ? 356 VAL A N   1 
ATOM   2688 C CA  . VAL A 1 356 ? 15.436  54.406 75.221 1.00 12.80 ? 356 VAL A CA  1 
ATOM   2689 C C   . VAL A 1 356 ? 14.445  53.285 75.072 1.00 12.89 ? 356 VAL A C   1 
ATOM   2690 O O   . VAL A 1 356 ? 14.189  52.860 73.962 1.00 20.26 ? 356 VAL A O   1 
ATOM   2691 C CB  . VAL A 1 356 ? 16.919  53.999 75.178 1.00 15.13 ? 356 VAL A CB  1 
ATOM   2692 C CG1 . VAL A 1 356 ? 17.576  53.882 76.541 1.00 11.98 ? 356 VAL A CG1 1 
ATOM   2693 C CG2 . VAL A 1 356 ? 17.220  52.742 74.320 1.00 16.47 ? 356 VAL A CG2 1 
ATOM   2694 N N   . LYS A 1 357 ? 13.868  52.798 76.158 1.00 17.12 ? 357 LYS A N   1 
ATOM   2695 C CA  . LYS A 1 357 ? 12.876  51.743 75.975 1.00 18.30 ? 357 LYS A CA  1 
ATOM   2696 C C   . LYS A 1 357 ? 11.719  52.291 75.167 1.00 16.64 ? 357 LYS A C   1 
ATOM   2697 O O   . LYS A 1 357 ? 11.169  51.615 74.316 1.00 20.77 ? 357 LYS A O   1 
ATOM   2698 C CB  . LYS A 1 357 ? 12.315  51.214 77.311 1.00 23.65 ? 357 LYS A CB  1 
ATOM   2699 C CG  . LYS A 1 357 ? 13.340  50.427 78.147 1.00 34.69 ? 357 LYS A CG  1 
ATOM   2700 C CD  . LYS A 1 357 ? 12.893  49.065 78.757 1.00 48.38 ? 357 LYS A CD  1 
ATOM   2701 C CE  . LYS A 1 357 ? 11.495  48.500 78.390 1.00 53.77 ? 357 LYS A CE  1 
ATOM   2702 N NZ  . LYS A 1 357 ? 11.366  48.161 76.970 1.00 58.39 ? 357 LYS A NZ  1 
ATOM   2703 N N   . LEU A 1 358 ? 11.354  53.539 75.448 1.00 16.56 ? 358 LEU A N   1 
ATOM   2704 C CA  . LEU A 1 358 ? 10.239  54.119 74.705 1.00 16.67 ? 358 LEU A CA  1 
ATOM   2705 C C   . LEU A 1 358 ? 10.595  54.389 73.255 1.00 19.85 ? 358 LEU A C   1 
ATOM   2706 O O   . LEU A 1 358 ? 9.729   54.354 72.389 1.00 26.58 ? 358 LEU A O   1 
ATOM   2707 C CB  . LEU A 1 358 ? 9.796   55.471 75.298 1.00 7.56  ? 358 LEU A CB  1 
ATOM   2708 C CG  . LEU A 1 358 ? 9.274   55.385 76.723 1.00 2.00  ? 358 LEU A CG  1 
ATOM   2709 C CD1 . LEU A 1 358 ? 9.116   56.780 77.314 1.00 2.00  ? 358 LEU A CD1 1 
ATOM   2710 C CD2 . LEU A 1 358 ? 7.937   54.652 76.758 1.00 2.00  ? 358 LEU A CD2 1 
ATOM   2711 N N   . SER A 1 359 ? 11.862  54.715 73.003 1.00 17.69 ? 359 SER A N   1 
ATOM   2712 C CA  . SER A 1 359 ? 12.256  54.998 71.638 1.00 15.36 ? 359 SER A CA  1 
ATOM   2713 C C   . SER A 1 359 ? 12.405  53.770 70.792 1.00 16.54 ? 359 SER A C   1 
ATOM   2714 O O   . SER A 1 359 ? 12.192  53.833 69.594 1.00 22.90 ? 359 SER A O   1 
ATOM   2715 C CB  . SER A 1 359 ? 13.594  55.739 71.579 1.00 13.60 ? 359 SER A CB  1 
ATOM   2716 O OG  . SER A 1 359 ? 13.573  56.801 72.535 1.00 20.22 ? 359 SER A OG  1 
ATOM   2717 N N   . VAL A 1 360 ? 12.759  52.645 71.391 1.00 11.65 ? 360 VAL A N   1 
ATOM   2718 C CA  . VAL A 1 360 ? 12.944  51.481 70.561 1.00 9.46  ? 360 VAL A CA  1 
ATOM   2719 C C   . VAL A 1 360 ? 11.964  50.393 70.960 1.00 12.11 ? 360 VAL A C   1 
ATOM   2720 O O   . VAL A 1 360 ? 12.368  49.333 71.408 1.00 16.36 ? 360 VAL A O   1 
ATOM   2721 C CB  . VAL A 1 360 ? 14.434  51.063 70.661 1.00 9.14  ? 360 VAL A CB  1 
ATOM   2722 C CG1 . VAL A 1 360 ? 14.841  50.178 69.466 1.00 10.89 ? 360 VAL A CG1 1 
ATOM   2723 C CG2 . VAL A 1 360 ? 15.367  52.292 70.691 1.00 10.29 ? 360 VAL A CG2 1 
ATOM   2724 N N   . PRO A 1 361 ? 10.655  50.620 70.779 1.00 15.18 ? 361 PRO A N   1 
ATOM   2725 C CA  . PRO A 1 361 ? 9.654   49.694 71.335 1.00 15.98 ? 361 PRO A CA  1 
ATOM   2726 C C   . PRO A 1 361 ? 9.757   48.242 70.921 1.00 19.48 ? 361 PRO A C   1 
ATOM   2727 O O   . PRO A 1 361 ? 9.177   47.348 71.504 1.00 23.85 ? 361 PRO A O   1 
ATOM   2728 C CB  . PRO A 1 361 ? 8.306   50.273 70.880 1.00 11.55 ? 361 PRO A CB  1 
ATOM   2729 C CG  . PRO A 1 361 ? 8.642   51.317 69.810 1.00 12.75 ? 361 PRO A CG  1 
ATOM   2730 C CD  . PRO A 1 361 ? 10.084  51.755 70.062 1.00 14.40 ? 361 PRO A CD  1 
ATOM   2731 N N   . HIS A 1 362 ? 10.477  48.020 69.845 1.00 25.44 ? 362 HIS A N   1 
ATOM   2732 C CA  . HIS A 1 362 ? 10.623  46.670 69.321 1.00 29.48 ? 362 HIS A CA  1 
ATOM   2733 C C   . HIS A 1 362 ? 11.939  46.025 69.693 1.00 30.30 ? 362 HIS A C   1 
ATOM   2734 O O   . HIS A 1 362 ? 12.196  44.881 69.334 1.00 34.95 ? 362 HIS A O   1 
ATOM   2735 C CB  . HIS A 1 362 ? 10.507  46.696 67.769 1.00 35.06 ? 362 HIS A CB  1 
ATOM   2736 C CG  . HIS A 1 362 ? 11.270  47.870 67.165 1.00 36.68 ? 362 HIS A CG  1 
ATOM   2737 N ND1 . HIS A 1 362 ? 10.727  49.092 66.938 1.00 35.63 ? 362 HIS A ND1 1 
ATOM   2738 C CD2 . HIS A 1 362 ? 12.633  47.919 66.802 1.00 35.92 ? 362 HIS A CD2 1 
ATOM   2739 C CE1 . HIS A 1 362 ? 11.710  49.868 66.466 1.00 36.94 ? 362 HIS A CE1 1 
ATOM   2740 N NE2 . HIS A 1 362 ? 12.865  49.175 66.382 1.00 39.26 ? 362 HIS A NE2 1 
ATOM   2741 N N   . ALA A 1 363 ? 12.812  46.774 70.361 1.00 25.05 ? 363 ALA A N   1 
ATOM   2742 C CA  . ALA A 1 363 ? 14.062  46.133 70.675 1.00 24.30 ? 363 ALA A CA  1 
ATOM   2743 C C   . ALA A 1 363 ? 13.848  45.186 71.823 1.00 26.94 ? 363 ALA A C   1 
ATOM   2744 O O   . ALA A 1 363 ? 12.951  45.319 72.646 1.00 27.66 ? 363 ALA A O   1 
ATOM   2745 C CB  . ALA A 1 363 ? 15.134  47.133 71.121 1.00 24.12 ? 363 ALA A CB  1 
ATOM   2746 N N   . ASN A 1 364 ? 14.749  44.213 71.849 1.00 25.62 ? 364 ASN A N   1 
ATOM   2747 C CA  . ASN A 1 364 ? 14.758  43.232 72.908 1.00 22.62 ? 364 ASN A CA  1 
ATOM   2748 C C   . ASN A 1 364 ? 15.867  43.752 73.798 1.00 24.40 ? 364 ASN A C   1 
ATOM   2749 O O   . ASN A 1 364 ? 16.571  44.705 73.484 1.00 24.24 ? 364 ASN A O   1 
ATOM   2750 C CB  . ASN A 1 364 ? 15.012  41.792 72.399 1.00 23.27 ? 364 ASN A CB  1 
ATOM   2751 C CG  . ASN A 1 364 ? 16.304  41.675 71.630 1.00 23.08 ? 364 ASN A CG  1 
ATOM   2752 O OD1 . ASN A 1 364 ? 17.141  42.556 71.718 1.00 28.93 ? 364 ASN A OD1 1 
ATOM   2753 N ND2 . ASN A 1 364 ? 16.476  40.606 70.870 1.00 23.88 ? 364 ASN A ND2 1 
ATOM   2754 N N   . ASP A 1 365 ? 16.056  43.061 74.917 1.00 27.48 ? 365 ASP A N   1 
ATOM   2755 C CA  . ASP A 1 365 ? 17.081  43.472 75.882 1.00 25.27 ? 365 ASP A CA  1 
ATOM   2756 C C   . ASP A 1 365 ? 18.430  43.730 75.275 1.00 25.82 ? 365 ASP A C   1 
ATOM   2757 O O   . ASP A 1 365 ? 19.141  44.680 75.568 1.00 28.02 ? 365 ASP A O   1 
ATOM   2758 C CB  . ASP A 1 365 ? 17.372  42.372 76.914 1.00 26.63 ? 365 ASP A CB  1 
ATOM   2759 N N   . LEU A 1 366 ? 18.782  42.827 74.380 1.00 23.27 ? 366 LEU A N   1 
ATOM   2760 C CA  . LEU A 1 366 ? 20.075  42.962 73.762 1.00 21.37 ? 366 LEU A CA  1 
ATOM   2761 C C   . LEU A 1 366 ? 20.147  44.191 72.883 1.00 21.66 ? 366 LEU A C   1 
ATOM   2762 O O   . LEU A 1 366 ? 21.144  44.898 72.806 1.00 22.93 ? 366 LEU A O   1 
ATOM   2763 C CB  . LEU A 1 366 ? 20.344  41.690 72.966 1.00 22.53 ? 366 LEU A CB  1 
ATOM   2764 C CG  . LEU A 1 366 ? 21.729  41.107 73.176 1.00 21.41 ? 366 LEU A CG  1 
ATOM   2765 C CD1 . LEU A 1 366 ? 21.853  39.905 72.247 1.00 26.47 ? 366 LEU A CD1 1 
ATOM   2766 C CD2 . LEU A 1 366 ? 22.850  42.138 72.963 1.00 22.36 ? 366 LEU A CD2 1 
ATOM   2767 N N   . GLY A 1 367 ? 19.025  44.444 72.229 1.00 18.78 ? 367 GLY A N   1 
ATOM   2768 C CA  . GLY A 1 367 ? 18.936  45.581 71.345 1.00 20.09 ? 367 GLY A CA  1 
ATOM   2769 C C   . GLY A 1 367 ? 19.094  46.861 72.104 1.00 19.16 ? 367 GLY A C   1 
ATOM   2770 O O   . GLY A 1 367 ? 19.884  47.713 71.725 1.00 17.49 ? 367 GLY A O   1 
ATOM   2771 N N   . LEU A 1 368 ? 18.342  46.960 73.218 1.00 19.69 ? 368 LEU A N   1 
ATOM   2772 C CA  . LEU A 1 368 ? 18.410  48.152 74.058 1.00 18.37 ? 368 LEU A CA  1 
ATOM   2773 C C   . LEU A 1 368 ? 19.844  48.330 74.525 1.00 18.27 ? 368 LEU A C   1 
ATOM   2774 O O   . LEU A 1 368 ? 20.426  49.409 74.485 1.00 15.58 ? 368 LEU A O   1 
ATOM   2775 C CB  . LEU A 1 368 ? 17.438  48.068 75.248 1.00 21.93 ? 368 LEU A CB  1 
ATOM   2776 C CG  . LEU A 1 368 ? 15.933  48.026 74.877 1.00 25.14 ? 368 LEU A CG  1 
ATOM   2777 C CD1 . LEU A 1 368 ? 15.070  47.567 76.053 1.00 22.66 ? 368 LEU A CD1 1 
ATOM   2778 C CD2 . LEU A 1 368 ? 15.401  49.388 74.386 1.00 26.92 ? 368 LEU A CD2 1 
ATOM   2779 N N   . ASP A 1 369 ? 20.428  47.189 74.923 1.00 18.38 ? 369 ASP A N   1 
ATOM   2780 C CA  . ASP A 1 369 ? 21.827  47.226 75.362 1.00 19.79 ? 369 ASP A CA  1 
ATOM   2781 C C   . ASP A 1 369 ? 22.745  47.793 74.289 1.00 19.98 ? 369 ASP A C   1 
ATOM   2782 O O   . ASP A 1 369 ? 23.653  48.575 74.568 1.00 20.06 ? 369 ASP A O   1 
ATOM   2783 C CB  . ASP A 1 369 ? 22.362  45.826 75.703 1.00 20.42 ? 369 ASP A CB  1 
ATOM   2784 C CG  . ASP A 1 369 ? 22.133  45.388 77.141 1.00 25.81 ? 369 ASP A CG  1 
ATOM   2785 O OD1 . ASP A 1 369 ? 21.345  46.014 77.858 1.00 28.18 ? 369 ASP A OD1 1 
ATOM   2786 O OD2 . ASP A 1 369 ? 22.771  44.415 77.545 1.00 28.77 ? 369 ASP A OD2 1 
ATOM   2787 N N   . ALA A 1 370 ? 22.475  47.355 73.042 1.00 19.57 ? 370 ALA A N   1 
ATOM   2788 C CA  . ALA A 1 370 ? 23.252  47.794 71.903 1.00 12.88 ? 370 ALA A CA  1 
ATOM   2789 C C   . ALA A 1 370 ? 23.109  49.283 71.682 1.00 13.98 ? 370 ALA A C   1 
ATOM   2790 O O   . ALA A 1 370 ? 24.088  49.947 71.360 1.00 17.14 ? 370 ALA A O   1 
ATOM   2791 C CB  . ALA A 1 370 ? 22.849  47.031 70.655 1.00 10.17 ? 370 ALA A CB  1 
ATOM   2792 N N   . VAL A 1 371 ? 21.890  49.808 71.859 1.00 13.39 ? 371 VAL A N   1 
ATOM   2793 C CA  . VAL A 1 371 ? 21.688  51.248 71.663 1.00 13.99 ? 371 VAL A CA  1 
ATOM   2794 C C   . VAL A 1 371 ? 22.480  52.053 72.704 1.00 14.95 ? 371 VAL A C   1 
ATOM   2795 O O   . VAL A 1 371 ? 23.202  52.998 72.393 1.00 18.40 ? 371 VAL A O   1 
ATOM   2796 C CB  . VAL A 1 371 ? 20.179  51.599 71.742 1.00 13.56 ? 371 VAL A CB  1 
ATOM   2797 C CG1 . VAL A 1 371 ? 19.924  53.103 71.535 1.00 9.32  ? 371 VAL A CG1 1 
ATOM   2798 C CG2 . VAL A 1 371 ? 19.330  50.764 70.762 1.00 6.60  ? 371 VAL A CG2 1 
ATOM   2799 N N   . THR A 1 372 ? 22.316  51.663 73.967 1.00 14.34 ? 372 THR A N   1 
ATOM   2800 C CA  . THR A 1 372 ? 23.003  52.331 75.058 1.00 13.68 ? 372 THR A CA  1 
ATOM   2801 C C   . THR A 1 372 ? 24.507  52.355 74.841 1.00 12.35 ? 372 THR A C   1 
ATOM   2802 O O   . THR A 1 372 ? 25.194  53.339 75.056 1.00 9.76  ? 372 THR A O   1 
ATOM   2803 C CB  . THR A 1 372 ? 22.682  51.541 76.319 1.00 18.11 ? 372 THR A CB  1 
ATOM   2804 O OG1 . THR A 1 372 ? 21.272  51.359 76.415 1.00 21.72 ? 372 THR A OG1 1 
ATOM   2805 C CG2 . THR A 1 372 ? 23.187  52.181 77.614 1.00 26.75 ? 372 THR A CG2 1 
ATOM   2806 N N   . LEU A 1 373 ? 25.014  51.219 74.372 1.00 12.03 ? 373 LEU A N   1 
ATOM   2807 C CA  . LEU A 1 373 ? 26.438  51.164 74.118 1.00 12.19 ? 373 LEU A CA  1 
ATOM   2808 C C   . LEU A 1 373 ? 26.899  52.318 73.242 1.00 15.50 ? 373 LEU A C   1 
ATOM   2809 O O   . LEU A 1 373 ? 27.837  53.027 73.567 1.00 15.29 ? 373 LEU A O   1 
ATOM   2810 C CB  . LEU A 1 373 ? 26.804  49.835 73.429 1.00 9.08  ? 373 LEU A CB  1 
ATOM   2811 C CG  . LEU A 1 373 ? 28.225  49.330 73.745 1.00 11.38 ? 373 LEU A CG  1 
ATOM   2812 C CD1 . LEU A 1 373 ? 28.554  48.051 72.978 1.00 14.39 ? 373 LEU A CD1 1 
ATOM   2813 C CD2 . LEU A 1 373 ? 29.337  50.350 73.488 1.00 17.82 ? 373 LEU A CD2 1 
ATOM   2814 N N   . GLN A 1 374 ? 26.163  52.495 72.132 1.00 20.44 ? 374 GLN A N   1 
ATOM   2815 C CA  . GLN A 1 374 ? 26.528  53.529 71.166 1.00 21.57 ? 374 GLN A CA  1 
ATOM   2816 C C   . GLN A 1 374 ? 26.289  54.941 71.597 1.00 22.18 ? 374 GLN A C   1 
ATOM   2817 O O   . GLN A 1 374 ? 27.070  55.833 71.300 1.00 23.00 ? 374 GLN A O   1 
ATOM   2818 C CB  . GLN A 1 374 ? 25.739  53.401 69.848 1.00 24.24 ? 374 GLN A CB  1 
ATOM   2819 C CG  . GLN A 1 374 ? 25.628  51.987 69.285 1.00 33.24 ? 374 GLN A CG  1 
ATOM   2820 C CD  . GLN A 1 374 ? 26.957  51.458 68.790 1.00 39.05 ? 374 GLN A CD  1 
ATOM   2821 O OE1 . GLN A 1 374 ? 27.753  52.173 68.192 1.00 42.09 ? 374 GLN A OE1 1 
ATOM   2822 N NE2 . GLN A 1 374 ? 27.159  50.156 69.011 1.00 39.02 ? 374 GLN A NE2 1 
ATOM   2823 N N   . TYR A 1 375 ? 25.159  55.138 72.272 1.00 20.75 ? 375 TYR A N   1 
ATOM   2824 C CA  . TYR A 1 375 ? 24.832  56.505 72.658 1.00 22.88 ? 375 TYR A CA  1 
ATOM   2825 C C   . TYR A 1 375 ? 25.365  56.972 74.005 1.00 25.42 ? 375 TYR A C   1 
ATOM   2826 O O   . TYR A 1 375 ? 25.221  58.143 74.345 1.00 26.36 ? 375 TYR A O   1 
ATOM   2827 C CB  . TYR A 1 375 ? 23.308  56.706 72.501 1.00 22.55 ? 375 TYR A CB  1 
ATOM   2828 C CG  . TYR A 1 375 ? 22.939  56.796 71.029 1.00 24.01 ? 375 TYR A CG  1 
ATOM   2829 C CD1 . TYR A 1 375 ? 22.995  58.053 70.382 1.00 21.13 ? 375 TYR A CD1 1 
ATOM   2830 C CD2 . TYR A 1 375 ? 22.608  55.639 70.277 1.00 20.10 ? 375 TYR A CD2 1 
ATOM   2831 C CE1 . TYR A 1 375 ? 22.734  58.162 69.013 1.00 16.38 ? 375 TYR A CE1 1 
ATOM   2832 C CE2 . TYR A 1 375 ? 22.344  55.752 68.898 1.00 13.81 ? 375 TYR A CE2 1 
ATOM   2833 C CZ  . TYR A 1 375 ? 22.400  57.021 68.275 1.00 17.25 ? 375 TYR A CZ  1 
ATOM   2834 O OH  . TYR A 1 375 ? 22.110  57.194 66.939 1.00 18.33 ? 375 TYR A OH  1 
ATOM   2835 N N   . THR A 1 376 ? 25.972  56.094 74.795 1.00 27.14 ? 376 THR A N   1 
ATOM   2836 C CA  . THR A 1 376 ? 26.466  56.558 76.079 1.00 26.81 ? 376 THR A CA  1 
ATOM   2837 C C   . THR A 1 376 ? 27.950  56.896 76.026 1.00 30.00 ? 376 THR A C   1 
ATOM   2838 O O   . THR A 1 376 ? 28.788  56.256 75.401 1.00 32.19 ? 376 THR A O   1 
ATOM   2839 C CB  . THR A 1 376 ? 26.248  55.429 77.102 1.00 24.27 ? 376 THR A CB  1 
ATOM   2840 O OG1 . THR A 1 376 ? 24.848  55.183 77.221 1.00 26.14 ? 376 THR A OG1 1 
ATOM   2841 C CG2 . THR A 1 376 ? 26.772  55.689 78.525 1.00 26.13 ? 376 THR A CG2 1 
ATOM   2842 N N   . ASP A 1 377 ? 28.267  57.974 76.756 1.00 32.90 ? 377 ASP A N   1 
ATOM   2843 C CA  . ASP A 1 377 ? 29.663  58.373 76.884 1.00 33.12 ? 377 ASP A CA  1 
ATOM   2844 C C   . ASP A 1 377 ? 30.088  57.620 78.138 1.00 33.75 ? 377 ASP A C   1 
ATOM   2845 O O   . ASP A 1 377 ? 29.853  58.093 79.246 1.00 35.52 ? 377 ASP A O   1 
ATOM   2846 C CB  . ASP A 1 377 ? 29.821  59.888 77.099 1.00 29.45 ? 377 ASP A CB  1 
ATOM   2847 C CG  . ASP A 1 377 ? 31.259  60.278 77.411 1.00 32.39 ? 377 ASP A CG  1 
ATOM   2848 O OD1 . ASP A 1 377 ? 32.052  59.407 77.779 1.00 31.09 ? 377 ASP A OD1 1 
ATOM   2849 O OD2 . ASP A 1 377 ? 31.587  61.456 77.284 1.00 36.13 ? 377 ASP A OD2 1 
ATOM   2850 N N   . TRP A 1 378 ? 30.724  56.467 77.964 1.00 33.67 ? 378 TRP A N   1 
ATOM   2851 C CA  . TRP A 1 378 ? 31.115  55.677 79.118 1.00 32.74 ? 378 TRP A CA  1 
ATOM   2852 C C   . TRP A 1 378 ? 32.033  56.368 80.072 1.00 35.40 ? 378 TRP A C   1 
ATOM   2853 O O   . TRP A 1 378 ? 32.005  56.047 81.250 1.00 38.33 ? 378 TRP A O   1 
ATOM   2854 C CB  . TRP A 1 378 ? 31.630  54.292 78.729 1.00 34.03 ? 378 TRP A CB  1 
ATOM   2855 C CG  . TRP A 1 378 ? 30.471  53.588 78.076 1.00 34.63 ? 378 TRP A CG  1 
ATOM   2856 C CD1 . TRP A 1 378 ? 30.183  53.518 76.694 1.00 35.42 ? 378 TRP A CD1 1 
ATOM   2857 C CD2 . TRP A 1 378 ? 29.417  52.973 78.756 1.00 33.28 ? 378 TRP A CD2 1 
ATOM   2858 N NE1 . TRP A 1 378 ? 29.000  52.899 76.494 1.00 35.74 ? 378 TRP A NE1 1 
ATOM   2859 C CE2 . TRP A 1 378 ? 28.471  52.533 77.709 1.00 34.52 ? 378 TRP A CE2 1 
ATOM   2860 C CE3 . TRP A 1 378 ? 29.112  52.790 80.102 1.00 32.54 ? 378 TRP A CE3 1 
ATOM   2861 C CZ2 . TRP A 1 378 ? 27.263  51.928 78.090 1.00 33.96 ? 378 TRP A CZ2 1 
ATOM   2862 C CZ3 . TRP A 1 378 ? 27.891  52.181 80.439 1.00 37.50 ? 378 TRP A CZ3 1 
ATOM   2863 C CH2 . TRP A 1 378 ? 26.978  51.757 79.451 1.00 33.89 ? 378 TRP A CH2 1 
ATOM   2864 N N   . MET A 1 379 ? 32.825  57.343 79.609 1.00 35.43 ? 379 MET A N   1 
ATOM   2865 C CA  . MET A 1 379 ? 33.697  58.015 80.583 1.00 38.11 ? 379 MET A CA  1 
ATOM   2866 C C   . MET A 1 379 ? 33.006  59.171 81.323 1.00 37.63 ? 379 MET A C   1 
ATOM   2867 O O   . MET A 1 379 ? 33.621  60.030 81.937 1.00 37.01 ? 379 MET A O   1 
ATOM   2868 C CB  . MET A 1 379 ? 34.997  58.503 79.946 1.00 39.47 ? 379 MET A CB  1 
ATOM   2869 C CG  . MET A 1 379 ? 36.089  58.677 81.013 1.00 48.58 ? 379 MET A CG  1 
ATOM   2870 S SD  . MET A 1 379 ? 37.630  59.176 80.217 1.00 60.48 ? 379 MET A SD  1 
ATOM   2871 C CE  . MET A 1 379 ? 38.186  57.574 79.529 1.00 60.32 ? 379 MET A CE  1 
ATOM   2872 N N   . ASP A 1 380 ? 31.684  59.210 81.242 1.00 37.26 ? 380 ASP A N   1 
ATOM   2873 C CA  . ASP A 1 380 ? 30.950  60.276 81.901 1.00 35.20 ? 380 ASP A CA  1 
ATOM   2874 C C   . ASP A 1 380 ? 29.496  59.852 82.031 1.00 36.78 ? 380 ASP A C   1 
ATOM   2875 O O   . ASP A 1 380 ? 28.558  60.633 82.001 1.00 36.31 ? 380 ASP A O   1 
ATOM   2876 C CB  . ASP A 1 380 ? 31.085  61.573 81.080 1.00 37.41 ? 380 ASP A CB  1 
ATOM   2877 C CG  . ASP A 1 380 ? 30.946  62.833 81.916 1.00 42.24 ? 380 ASP A CG  1 
ATOM   2878 O OD1 . ASP A 1 380 ? 30.115  62.841 82.818 1.00 44.95 ? 380 ASP A OD1 1 
ATOM   2879 O OD2 . ASP A 1 380 ? 31.680  63.796 81.681 1.00 46.59 ? 380 ASP A OD2 1 
ATOM   2880 N N   . ASP A 1 381 ? 29.362  58.537 82.159 1.00 39.63 ? 381 ASP A N   1 
ATOM   2881 C CA  . ASP A 1 381 ? 28.137  57.774 82.303 1.00 41.26 ? 381 ASP A CA  1 
ATOM   2882 C C   . ASP A 1 381 ? 26.898  58.498 82.853 1.00 40.30 ? 381 ASP A C   1 
ATOM   2883 O O   . ASP A 1 381 ? 25.862  58.482 82.204 1.00 41.14 ? 381 ASP A O   1 
ATOM   2884 C CB  . ASP A 1 381 ? 28.520  56.477 83.058 1.00 44.63 ? 381 ASP A CB  1 
ATOM   2885 C CG  . ASP A 1 381 ? 27.429  55.697 83.761 1.00 53.35 ? 381 ASP A CG  1 
ATOM   2886 O OD1 . ASP A 1 381 ? 26.283  55.738 83.316 1.00 56.74 ? 381 ASP A OD1 1 
ATOM   2887 O OD2 . ASP A 1 381 ? 27.743  55.043 84.760 1.00 59.44 ? 381 ASP A OD2 1 
ATOM   2888 N N   . ASN A 1 382 ? 27.006  59.118 84.031 1.00 42.03 ? 382 ASN A N   1 
ATOM   2889 C CA  . ASN A 1 382 ? 25.865  59.779 84.670 1.00 41.65 ? 382 ASN A CA  1 
ATOM   2890 C C   . ASN A 1 382 ? 25.642  61.248 84.350 1.00 42.00 ? 382 ASN A C   1 
ATOM   2891 O O   . ASN A 1 382 ? 24.947  61.916 85.107 1.00 45.11 ? 382 ASN A O   1 
ATOM   2892 C CB  . ASN A 1 382 ? 26.124  59.744 86.202 1.00 39.34 ? 382 ASN A CB  1 
ATOM   2893 N N   . ASN A 1 383 ? 26.225  61.785 83.267 1.00 41.46 ? 383 ASN A N   1 
ATOM   2894 C CA  . ASN A 1 383 ? 26.010  63.225 83.006 1.00 35.71 ? 383 ASN A CA  1 
ATOM   2895 C C   . ASN A 1 383 ? 24.620  63.545 82.472 1.00 33.59 ? 383 ASN A C   1 
ATOM   2896 O O   . ASN A 1 383 ? 24.279  63.254 81.336 1.00 38.41 ? 383 ASN A O   1 
ATOM   2897 C CB  . ASN A 1 383 ? 27.083  63.795 82.076 1.00 31.38 ? 383 ASN A CB  1 
ATOM   2898 C CG  . ASN A 1 383 ? 26.928  65.278 81.831 1.00 32.86 ? 383 ASN A CG  1 
ATOM   2899 O OD1 . ASN A 1 383 ? 25.842  65.826 81.848 1.00 35.62 ? 383 ASN A OD1 1 
ATOM   2900 N ND2 . ASN A 1 383 ? 28.040  65.962 81.597 1.00 33.67 ? 383 ASN A ND2 1 
ATOM   2901 N N   . GLY A 1 384 ? 23.850  64.252 83.289 1.00 30.80 ? 384 GLY A N   1 
ATOM   2902 C CA  . GLY A 1 384 ? 22.496  64.597 82.893 1.00 27.25 ? 384 GLY A CA  1 
ATOM   2903 C C   . GLY A 1 384 ? 22.328  65.341 81.593 1.00 22.82 ? 384 GLY A C   1 
ATOM   2904 O O   . GLY A 1 384 ? 21.356  65.150 80.884 1.00 24.91 ? 384 GLY A O   1 
ATOM   2905 N N   . ILE A 1 385 ? 23.257  66.223 81.275 1.00 19.50 ? 385 ILE A N   1 
ATOM   2906 C CA  . ILE A 1 385 ? 23.151  66.941 80.018 1.00 21.44 ? 385 ILE A CA  1 
ATOM   2907 C C   . ILE A 1 385 ? 23.415  65.938 78.883 1.00 21.19 ? 385 ILE A C   1 
ATOM   2908 O O   . ILE A 1 385 ? 22.682  65.776 77.911 1.00 22.17 ? 385 ILE A O   1 
ATOM   2909 C CB  . ILE A 1 385 ? 24.161  68.106 80.037 1.00 22.64 ? 385 ILE A CB  1 
ATOM   2910 C CG1 . ILE A 1 385 ? 23.678  69.272 80.907 1.00 25.55 ? 385 ILE A CG1 1 
ATOM   2911 C CG2 . ILE A 1 385 ? 24.550  68.612 78.650 1.00 26.15 ? 385 ILE A CG2 1 
ATOM   2912 C CD1 . ILE A 1 385 ? 22.582  70.084 80.198 1.00 31.32 ? 385 ILE A CD1 1 
ATOM   2913 N N   . LYS A 1 386 ? 24.507  65.208 79.051 1.00 19.41 ? 386 LYS A N   1 
ATOM   2914 C CA  . LYS A 1 386 ? 24.846  64.229 78.030 1.00 16.41 ? 386 LYS A CA  1 
ATOM   2915 C C   . LYS A 1 386 ? 23.746  63.214 77.802 1.00 15.50 ? 386 LYS A C   1 
ATOM   2916 O O   . LYS A 1 386 ? 23.520  62.748 76.696 1.00 19.02 ? 386 LYS A O   1 
ATOM   2917 C CB  . LYS A 1 386 ? 26.163  63.511 78.355 1.00 15.67 ? 386 LYS A CB  1 
ATOM   2918 C CG  . LYS A 1 386 ? 27.363  64.470 78.269 1.00 13.97 ? 386 LYS A CG  1 
ATOM   2919 C CD  . LYS A 1 386 ? 28.705  63.748 78.404 1.00 22.76 ? 386 LYS A CD  1 
ATOM   2920 C CE  . LYS A 1 386 ? 29.899  64.709 78.258 1.00 29.85 ? 386 LYS A CE  1 
ATOM   2921 N NZ  . LYS A 1 386 ? 31.167  63.988 78.174 1.00 32.24 ? 386 LYS A NZ  1 
ATOM   2922 N N   . ASN A 1 387 ? 23.045  62.872 78.863 1.00 14.39 ? 387 ASN A N   1 
ATOM   2923 C CA  . ASN A 1 387 ? 21.969  61.905 78.713 1.00 15.86 ? 387 ASN A CA  1 
ATOM   2924 C C   . ASN A 1 387 ? 20.782  62.521 78.022 1.00 15.13 ? 387 ASN A C   1 
ATOM   2925 O O   . ASN A 1 387 ? 20.085  61.866 77.261 1.00 17.02 ? 387 ASN A O   1 
ATOM   2926 C CB  . ASN A 1 387 ? 21.521  61.340 80.070 1.00 21.64 ? 387 ASN A CB  1 
ATOM   2927 C CG  . ASN A 1 387 ? 22.530  60.443 80.766 1.00 28.33 ? 387 ASN A CG  1 
ATOM   2928 O OD1 . ASN A 1 387 ? 22.410  60.183 81.952 1.00 35.96 ? 387 ASN A OD1 1 
ATOM   2929 N ND2 . ASN A 1 387 ? 23.541  59.943 80.033 1.00 29.77 ? 387 ASN A ND2 1 
ATOM   2930 N N   . ARG A 1 388 ? 20.558  63.808 78.281 1.00 11.15 ? 388 ARG A N   1 
ATOM   2931 C CA  . ARG A 1 388 ? 19.430  64.467 77.645 1.00 11.50 ? 388 ARG A CA  1 
ATOM   2932 C C   . ARG A 1 388 ? 19.648  64.479 76.139 1.00 13.43 ? 388 ARG A C   1 
ATOM   2933 O O   . ARG A 1 388 ? 18.815  64.110 75.308 1.00 10.98 ? 388 ARG A O   1 
ATOM   2934 C CB  . ARG A 1 388 ? 19.340  65.916 78.167 1.00 9.27  ? 388 ARG A CB  1 
ATOM   2935 C CG  . ARG A 1 388 ? 18.216  66.780 77.556 1.00 7.23  ? 388 ARG A CG  1 
ATOM   2936 C CD  . ARG A 1 388 ? 18.418  68.277 77.829 1.00 10.14 ? 388 ARG A CD  1 
ATOM   2937 N NE  . ARG A 1 388 ? 19.677  68.697 77.262 1.00 9.96  ? 388 ARG A NE  1 
ATOM   2938 C CZ  . ARG A 1 388 ? 20.276  69.841 77.586 1.00 14.29 ? 388 ARG A CZ  1 
ATOM   2939 N NH1 . ARG A 1 388 ? 19.710  70.708 78.412 1.00 19.41 ? 388 ARG A NH1 1 
ATOM   2940 N NH2 . ARG A 1 388 ? 21.468  70.114 77.068 1.00 21.28 ? 388 ARG A NH2 1 
ATOM   2941 N N   . ASP A 1 389 ? 20.858  64.938 75.812 1.00 10.11 ? 389 ASP A N   1 
ATOM   2942 C CA  . ASP A 1 389 ? 21.227  65.033 74.418 1.00 6.98  ? 389 ASP A CA  1 
ATOM   2943 C C   . ASP A 1 389 ? 21.295  63.682 73.756 1.00 6.78  ? 389 ASP A C   1 
ATOM   2944 O O   . ASP A 1 389 ? 20.832  63.526 72.638 1.00 11.27 ? 389 ASP A O   1 
ATOM   2945 C CB  . ASP A 1 389 ? 22.537  65.804 74.258 1.00 11.29 ? 389 ASP A CB  1 
ATOM   2946 C CG  . ASP A 1 389 ? 22.402  67.288 74.636 1.00 17.29 ? 389 ASP A CG  1 
ATOM   2947 O OD1 . ASP A 1 389 ? 21.275  67.756 74.811 1.00 17.15 ? 389 ASP A OD1 1 
ATOM   2948 O OD2 . ASP A 1 389 ? 23.423  67.979 74.735 1.00 17.35 ? 389 ASP A OD2 1 
ATOM   2949 N N   . GLY A 1 390 ? 21.829  62.673 74.429 1.00 3.73  ? 390 GLY A N   1 
ATOM   2950 C CA  . GLY A 1 390 ? 21.891  61.375 73.763 1.00 6.75  ? 390 GLY A CA  1 
ATOM   2951 C C   . GLY A 1 390 ? 20.517  60.854 73.369 1.00 11.44 ? 390 GLY A C   1 
ATOM   2952 O O   . GLY A 1 390 ? 20.280  60.300 72.303 1.00 18.60 ? 390 GLY A O   1 
ATOM   2953 N N   . LEU A 1 391 ? 19.560  61.102 74.239 1.00 12.73 ? 391 LEU A N   1 
ATOM   2954 C CA  . LEU A 1 391 ? 18.210  60.633 73.972 1.00 13.42 ? 391 LEU A CA  1 
ATOM   2955 C C   . LEU A 1 391 ? 17.604  61.378 72.800 1.00 12.34 ? 391 LEU A C   1 
ATOM   2956 O O   . LEU A 1 391 ? 16.874  60.877 71.957 1.00 11.07 ? 391 LEU A O   1 
ATOM   2957 C CB  . LEU A 1 391 ? 17.431  60.825 75.281 1.00 17.09 ? 391 LEU A CB  1 
ATOM   2958 C CG  . LEU A 1 391 ? 16.427  59.725 75.627 1.00 15.61 ? 391 LEU A CG  1 
ATOM   2959 C CD1 . LEU A 1 391 ? 17.014  58.315 75.658 1.00 20.05 ? 391 LEU A CD1 1 
ATOM   2960 C CD2 . LEU A 1 391 ? 15.854  60.061 76.993 1.00 18.22 ? 391 LEU A CD2 1 
ATOM   2961 N N   . ASP A 1 392 ? 17.964  62.645 72.739 1.00 13.63 ? 392 ASP A N   1 
ATOM   2962 C CA  . ASP A 1 392 ? 17.482  63.480 71.651 1.00 16.96 ? 392 ASP A CA  1 
ATOM   2963 C C   . ASP A 1 392 ? 18.015  62.979 70.298 1.00 21.00 ? 392 ASP A C   1 
ATOM   2964 O O   . ASP A 1 392 ? 17.426  63.204 69.238 1.00 25.56 ? 392 ASP A O   1 
ATOM   2965 C CB  . ASP A 1 392 ? 17.897  64.926 71.935 1.00 22.14 ? 392 ASP A CB  1 
ATOM   2966 C CG  . ASP A 1 392 ? 17.358  65.901 70.910 1.00 25.90 ? 392 ASP A CG  1 
ATOM   2967 O OD1 . ASP A 1 392 ? 17.973  66.037 69.857 1.00 33.47 ? 392 ASP A OD1 1 
ATOM   2968 O OD2 . ASP A 1 392 ? 16.335  66.521 71.162 1.00 26.93 ? 392 ASP A OD2 1 
ATOM   2969 N N   . ASP A 1 393 ? 19.156  62.283 70.341 1.00 19.36 ? 393 ASP A N   1 
ATOM   2970 C CA  . ASP A 1 393 ? 19.713  61.750 69.109 1.00 14.77 ? 393 ASP A CA  1 
ATOM   2971 C C   . ASP A 1 393 ? 19.246  60.355 68.865 1.00 16.13 ? 393 ASP A C   1 
ATOM   2972 O O   . ASP A 1 393 ? 19.321  59.871 67.745 1.00 15.95 ? 393 ASP A O   1 
ATOM   2973 C CB  . ASP A 1 393 ? 21.224  61.641 69.157 1.00 16.70 ? 393 ASP A CB  1 
ATOM   2974 C CG  . ASP A 1 393 ? 21.909  62.970 69.052 1.00 20.90 ? 393 ASP A CG  1 
ATOM   2975 O OD1 . ASP A 1 393 ? 21.285  63.912 68.572 1.00 28.23 ? 393 ASP A OD1 1 
ATOM   2976 O OD2 . ASP A 1 393 ? 23.076  63.058 69.438 1.00 28.40 ? 393 ASP A OD2 1 
ATOM   2977 N N   . ILE A 1 394 ? 18.806  59.670 69.917 1.00 16.81 ? 394 ILE A N   1 
ATOM   2978 C CA  . ILE A 1 394 ? 18.326  58.320 69.686 1.00 14.79 ? 394 ILE A CA  1 
ATOM   2979 C C   . ILE A 1 394 ? 17.034  58.468 68.911 1.00 14.40 ? 394 ILE A C   1 
ATOM   2980 O O   . ILE A 1 394 ? 16.827  57.899 67.848 1.00 15.07 ? 394 ILE A O   1 
ATOM   2981 C CB  . ILE A 1 394 ? 18.197  57.526 71.020 1.00 9.94  ? 394 ILE A CB  1 
ATOM   2982 C CG1 . ILE A 1 394 ? 19.600  57.171 71.545 1.00 9.43  ? 394 ILE A CG1 1 
ATOM   2983 C CG2 . ILE A 1 394 ? 17.360  56.246 70.892 1.00 3.78  ? 394 ILE A CG2 1 
ATOM   2984 C CD1 . ILE A 1 394 ? 19.620  56.444 72.895 1.00 11.88 ? 394 ILE A CD1 1 
ATOM   2985 N N   . VAL A 1 395 ? 16.159  59.314 69.440 1.00 17.14 ? 395 VAL A N   1 
ATOM   2986 C CA  . VAL A 1 395 ? 14.882  59.476 68.762 1.00 16.27 ? 395 VAL A CA  1 
ATOM   2987 C C   . VAL A 1 395 ? 15.066  59.986 67.326 1.00 18.15 ? 395 VAL A C   1 
ATOM   2988 O O   . VAL A 1 395 ? 14.518  59.477 66.360 1.00 17.08 ? 395 VAL A O   1 
ATOM   2989 C CB  . VAL A 1 395 ? 13.981  60.346 69.672 1.00 13.18 ? 395 VAL A CB  1 
ATOM   2990 C CG1 . VAL A 1 395 ? 12.546  60.519 69.153 1.00 12.93 ? 395 VAL A CG1 1 
ATOM   2991 C CG2 . VAL A 1 395 ? 13.926  59.757 71.097 1.00 6.53  ? 395 VAL A CG2 1 
ATOM   2992 N N   . GLY A 1 396 ? 15.891  61.009 67.180 1.00 21.58 ? 396 GLY A N   1 
ATOM   2993 C CA  . GLY A 1 396 ? 16.084  61.550 65.844 1.00 18.28 ? 396 GLY A CA  1 
ATOM   2994 C C   . GLY A 1 396 ? 16.695  60.588 64.847 1.00 16.40 ? 396 GLY A C   1 
ATOM   2995 O O   . GLY A 1 396 ? 16.185  60.406 63.751 1.00 23.24 ? 396 GLY A O   1 
ATOM   2996 N N   . ASP A 1 397 ? 17.805  59.961 65.219 1.00 12.43 ? 397 ASP A N   1 
ATOM   2997 C CA  . ASP A 1 397 ? 18.447  59.048 64.289 1.00 3.45  ? 397 ASP A CA  1 
ATOM   2998 C C   . ASP A 1 397 ? 17.594  57.853 63.993 1.00 5.71  ? 397 ASP A C   1 
ATOM   2999 O O   . ASP A 1 397 ? 17.481  57.433 62.852 1.00 11.98 ? 397 ASP A O   1 
ATOM   3000 C CB  . ASP A 1 397 ? 19.799  58.569 64.821 1.00 2.73  ? 397 ASP A CB  1 
ATOM   3001 C CG  . ASP A 1 397 ? 20.775  59.713 65.035 1.00 7.64  ? 397 ASP A CG  1 
ATOM   3002 O OD1 . ASP A 1 397 ? 20.479  60.845 64.650 1.00 6.63  ? 397 ASP A OD1 1 
ATOM   3003 O OD2 . ASP A 1 397 ? 21.844  59.477 65.595 1.00 10.63 ? 397 ASP A OD2 1 
ATOM   3004 N N   . HIS A 1 398 ? 16.974  57.304 65.016 1.00 5.99  ? 398 HIS A N   1 
ATOM   3005 C CA  . HIS A 1 398 ? 16.160  56.141 64.764 1.00 8.08  ? 398 HIS A CA  1 
ATOM   3006 C C   . HIS A 1 398 ? 14.946  56.444 63.901 1.00 12.21 ? 398 HIS A C   1 
ATOM   3007 O O   . HIS A 1 398 ? 14.656  55.722 62.959 1.00 17.17 ? 398 HIS A O   1 
ATOM   3008 C CB  . HIS A 1 398 ? 15.656  55.541 66.098 1.00 5.36  ? 398 HIS A CB  1 
ATOM   3009 C CG  . HIS A 1 398 ? 14.660  54.405 65.892 1.00 3.31  ? 398 HIS A CG  1 
ATOM   3010 N ND1 . HIS A 1 398 ? 14.967  53.237 65.314 1.00 2.00  ? 398 HIS A ND1 1 
ATOM   3011 C CD2 . HIS A 1 398 ? 13.281  54.365 66.230 1.00 5.16  ? 398 HIS A CD2 1 
ATOM   3012 C CE1 . HIS A 1 398 ? 13.840  52.506 65.297 1.00 2.44  ? 398 HIS A CE1 1 
ATOM   3013 N NE2 . HIS A 1 398 ? 12.802  53.160 65.843 1.00 2.00  ? 398 HIS A NE2 1 
ATOM   3014 N N   . ASN A 1 399 ? 14.251  57.533 64.234 1.00 11.60 ? 399 ASN A N   1 
ATOM   3015 C CA  . ASN A 1 399 ? 13.000  57.822 63.527 1.00 11.44 ? 399 ASN A CA  1 
ATOM   3016 C C   . ASN A 1 399 ? 12.992  58.748 62.330 1.00 10.94 ? 399 ASN A C   1 
ATOM   3017 O O   . ASN A 1 399 ? 11.989  58.763 61.629 1.00 11.39 ? 399 ASN A O   1 
ATOM   3018 C CB  . ASN A 1 399 ? 11.987  58.485 64.480 1.00 13.59 ? 399 ASN A CB  1 
ATOM   3019 C CG  . ASN A 1 399 ? 11.643  57.649 65.659 1.00 12.03 ? 399 ASN A CG  1 
ATOM   3020 O OD1 . ASN A 1 399 ? 10.740  56.841 65.605 1.00 7.86  ? 399 ASN A OD1 1 
ATOM   3021 N ND2 . ASN A 1 399 ? 12.376  57.852 66.740 1.00 16.18 ? 399 ASN A ND2 1 
ATOM   3022 N N   . VAL A 1 400 ? 14.027  59.553 62.106 1.00 8.13  ? 400 VAL A N   1 
ATOM   3023 C CA  . VAL A 1 400 ? 13.945  60.448 60.962 1.00 6.64  ? 400 VAL A CA  1 
ATOM   3024 C C   . VAL A 1 400 ? 15.215  60.433 60.133 1.00 11.94 ? 400 VAL A C   1 
ATOM   3025 O O   . VAL A 1 400 ? 15.197  60.192 58.936 1.00 19.91 ? 400 VAL A O   1 
ATOM   3026 C CB  . VAL A 1 400 ? 13.629  61.870 61.447 1.00 2.00  ? 400 VAL A CB  1 
ATOM   3027 C CG1 . VAL A 1 400 ? 13.447  62.823 60.272 1.00 9.10  ? 400 VAL A CG1 1 
ATOM   3028 C CG2 . VAL A 1 400 ? 12.362  61.916 62.321 1.00 2.00  ? 400 VAL A CG2 1 
ATOM   3029 N N   . ILE A 1 401 ? 16.354  60.678 60.767 1.00 12.04 ? 401 ILE A N   1 
ATOM   3030 C CA  . ILE A 1 401 ? 17.569  60.715 59.961 1.00 10.10 ? 401 ILE A CA  1 
ATOM   3031 C C   . ILE A 1 401 ? 17.938  59.398 59.349 1.00 11.78 ? 401 ILE A C   1 
ATOM   3032 O O   . ILE A 1 401 ? 18.093  59.291 58.145 1.00 18.25 ? 401 ILE A O   1 
ATOM   3033 C CB  . ILE A 1 401 ? 18.755  61.335 60.721 1.00 8.29  ? 401 ILE A CB  1 
ATOM   3034 C CG1 . ILE A 1 401 ? 18.295  62.654 61.372 1.00 3.74  ? 401 ILE A CG1 1 
ATOM   3035 C CG2 . ILE A 1 401 ? 19.984  61.535 59.814 1.00 8.02  ? 401 ILE A CG2 1 
ATOM   3036 C CD1 . ILE A 1 401 ? 19.433  63.514 61.913 1.00 2.00  ? 401 ILE A CD1 1 
ATOM   3037 N N   . CYS A 1 402 ? 18.088  58.365 60.152 1.00 13.62 ? 402 CYS A N   1 
ATOM   3038 C CA  . CYS A 1 402 ? 18.495  57.121 59.506 1.00 14.50 ? 402 CYS A CA  1 
ATOM   3039 C C   . CYS A 1 402 ? 17.572  56.533 58.450 1.00 13.22 ? 402 CYS A C   1 
ATOM   3040 O O   . CYS A 1 402 ? 18.124  56.120 57.438 1.00 19.78 ? 402 CYS A O   1 
ATOM   3041 C CB  . CYS A 1 402 ? 19.014  56.084 60.477 1.00 11.32 ? 402 CYS A CB  1 
ATOM   3042 S SG  . CYS A 1 402 ? 20.385  56.807 61.425 1.00 15.97 ? 402 CYS A SG  1 
ATOM   3043 N N   . PRO A 1 403 ? 16.235  56.464 58.600 1.00 8.93  ? 403 PRO A N   1 
ATOM   3044 C CA  . PRO A 1 403 ? 15.429  55.964 57.494 1.00 10.79 ? 403 PRO A CA  1 
ATOM   3045 C C   . PRO A 1 403 ? 15.525  56.854 56.245 1.00 12.36 ? 403 PRO A C   1 
ATOM   3046 O O   . PRO A 1 403 ? 15.529  56.351 55.119 1.00 14.53 ? 403 PRO A O   1 
ATOM   3047 C CB  . PRO A 1 403 ? 14.006  55.757 58.043 1.00 6.70  ? 403 PRO A CB  1 
ATOM   3048 C CG  . PRO A 1 403 ? 14.020  56.382 59.436 1.00 11.20 ? 403 PRO A CG  1 
ATOM   3049 C CD  . PRO A 1 403 ? 15.491  56.629 59.826 1.00 10.36 ? 403 PRO A CD  1 
ATOM   3050 N N   . LEU A 1 404 ? 15.628  58.175 56.465 1.00 11.19 ? 404 LEU A N   1 
ATOM   3051 C CA  . LEU A 1 404 ? 15.735  59.087 55.320 1.00 9.91  ? 404 LEU A CA  1 
ATOM   3052 C C   . LEU A 1 404 ? 17.004  58.797 54.535 1.00 13.85 ? 404 LEU A C   1 
ATOM   3053 O O   . LEU A 1 404 ? 17.003  58.677 53.314 1.00 16.68 ? 404 LEU A O   1 
ATOM   3054 C CB  . LEU A 1 404 ? 15.669  60.553 55.770 1.00 5.07  ? 404 LEU A CB  1 
ATOM   3055 C CG  . LEU A 1 404 ? 15.739  61.585 54.627 1.00 2.50  ? 404 LEU A CG  1 
ATOM   3056 C CD1 . LEU A 1 404 ? 14.649  62.656 54.746 1.00 2.00  ? 404 LEU A CD1 1 
ATOM   3057 C CD2 . LEU A 1 404 ? 17.120  62.247 54.544 1.00 6.97  ? 404 LEU A CD2 1 
ATOM   3058 N N   . MET A 1 405 ? 18.117  58.637 55.263 1.00 12.00 ? 405 MET A N   1 
ATOM   3059 C CA  . MET A 1 405 ? 19.348  58.326 54.539 1.00 10.39 ? 405 MET A CA  1 
ATOM   3060 C C   . MET A 1 405 ? 19.229  57.001 53.802 1.00 10.10 ? 405 MET A C   1 
ATOM   3061 O O   . MET A 1 405 ? 19.838  56.745 52.774 1.00 12.42 ? 405 MET A O   1 
ATOM   3062 C CB  . MET A 1 405 ? 20.552  58.236 55.476 1.00 6.38  ? 405 MET A CB  1 
ATOM   3063 C CG  . MET A 1 405 ? 20.791  59.550 56.205 1.00 8.23  ? 405 MET A CG  1 
ATOM   3064 S SD  . MET A 1 405 ? 21.080  60.867 55.011 1.00 9.64  ? 405 MET A SD  1 
ATOM   3065 C CE  . MET A 1 405 ? 22.706  60.365 54.398 1.00 6.69  ? 405 MET A CE  1 
ATOM   3066 N N   . HIS A 1 406 ? 18.421  56.121 54.352 1.00 8.78  ? 406 HIS A N   1 
ATOM   3067 C CA  . HIS A 1 406 ? 18.273  54.847 53.674 1.00 14.38 ? 406 HIS A CA  1 
ATOM   3068 C C   . HIS A 1 406 ? 17.589  55.083 52.331 1.00 17.53 ? 406 HIS A C   1 
ATOM   3069 O O   . HIS A 1 406 ? 18.028  54.641 51.274 1.00 22.81 ? 406 HIS A O   1 
ATOM   3070 C CB  . HIS A 1 406 ? 17.449  53.885 54.554 1.00 14.21 ? 406 HIS A CB  1 
ATOM   3071 C CG  . HIS A 1 406 ? 17.406  52.506 53.951 1.00 11.97 ? 406 HIS A CG  1 
ATOM   3072 N ND1 . HIS A 1 406 ? 18.492  51.722 53.819 1.00 8.45  ? 406 HIS A ND1 1 
ATOM   3073 C CD2 . HIS A 1 406 ? 16.284  51.813 53.440 1.00 10.64 ? 406 HIS A CD2 1 
ATOM   3074 C CE1 . HIS A 1 406 ? 18.058  50.585 53.250 1.00 10.91 ? 406 HIS A CE1 1 
ATOM   3075 N NE2 . HIS A 1 406 ? 16.734  50.620 53.012 1.00 7.82  ? 406 HIS A NE2 1 
ATOM   3076 N N   . PHE A 1 407 ? 16.493  55.848 52.405 1.00 17.65 ? 407 PHE A N   1 
ATOM   3077 C CA  . PHE A 1 407 ? 15.696  56.164 51.206 1.00 14.69 ? 407 PHE A CA  1 
ATOM   3078 C C   . PHE A 1 407 ? 16.547  56.830 50.161 1.00 14.22 ? 407 PHE A C   1 
ATOM   3079 O O   . PHE A 1 407 ? 16.575  56.427 49.013 1.00 17.34 ? 407 PHE A O   1 
ATOM   3080 C CB  . PHE A 1 407 ? 14.542  57.078 51.605 1.00 12.33 ? 407 PHE A CB  1 
ATOM   3081 C CG  . PHE A 1 407 ? 13.625  57.489 50.499 1.00 3.35  ? 407 PHE A CG  1 
ATOM   3082 C CD1 . PHE A 1 407 ? 12.684  56.579 50.008 1.00 5.65  ? 407 PHE A CD1 1 
ATOM   3083 C CD2 . PHE A 1 407 ? 13.668  58.801 50.002 1.00 6.05  ? 407 PHE A CD2 1 
ATOM   3084 C CE1 . PHE A 1 407 ? 11.771  56.991 49.026 1.00 8.33  ? 407 PHE A CE1 1 
ATOM   3085 C CE2 . PHE A 1 407 ? 12.757  59.209 49.016 1.00 9.10  ? 407 PHE A CE2 1 
ATOM   3086 C CZ  . PHE A 1 407 ? 11.805  58.305 48.524 1.00 4.46  ? 407 PHE A CZ  1 
ATOM   3087 N N   . VAL A 1 408 ? 17.279  57.849 50.591 1.00 12.31 ? 408 VAL A N   1 
ATOM   3088 C CA  . VAL A 1 408 ? 18.151  58.552 49.671 1.00 9.26  ? 408 VAL A CA  1 
ATOM   3089 C C   . VAL A 1 408 ? 19.090  57.619 48.972 1.00 11.77 ? 408 VAL A C   1 
ATOM   3090 O O   . VAL A 1 408 ? 19.218  57.638 47.761 1.00 17.89 ? 408 VAL A O   1 
ATOM   3091 C CB  . VAL A 1 408 ? 18.942  59.613 50.439 1.00 5.68  ? 408 VAL A CB  1 
ATOM   3092 C CG1 . VAL A 1 408 ? 20.075  60.236 49.642 1.00 4.05  ? 408 VAL A CG1 1 
ATOM   3093 C CG2 . VAL A 1 408 ? 17.982  60.718 50.857 1.00 15.34 ? 408 VAL A CG2 1 
ATOM   3094 N N   . ASN A 1 409 ? 19.735  56.759 49.738 1.00 11.92 ? 409 ASN A N   1 
ATOM   3095 C CA  . ASN A 1 409 ? 20.667  55.896 49.049 1.00 11.95 ? 409 ASN A CA  1 
ATOM   3096 C C   . ASN A 1 409 ? 20.016  54.975 48.085 1.00 13.78 ? 409 ASN A C   1 
ATOM   3097 O O   . ASN A 1 409 ? 20.558  54.718 47.022 1.00 17.57 ? 409 ASN A O   1 
ATOM   3098 C CB  . ASN A 1 409 ? 21.513  55.093 50.010 1.00 17.99 ? 409 ASN A CB  1 
ATOM   3099 C CG  . ASN A 1 409 ? 22.596  56.014 50.523 1.00 27.06 ? 409 ASN A CG  1 
ATOM   3100 O OD1 . ASN A 1 409 ? 23.575  56.287 49.842 1.00 31.47 ? 409 ASN A OD1 1 
ATOM   3101 N ND2 . ASN A 1 409 ? 22.413  56.505 51.746 1.00 30.06 ? 409 ASN A ND2 1 
ATOM   3102 N N   . LYS A 1 410 ? 18.847  54.458 48.435 1.00 14.56 ? 410 LYS A N   1 
ATOM   3103 C CA  . LYS A 1 410 ? 18.255  53.555 47.450 1.00 17.00 ? 410 LYS A CA  1 
ATOM   3104 C C   . LYS A 1 410 ? 17.628  54.304 46.266 1.00 17.50 ? 410 LYS A C   1 
ATOM   3105 O O   . LYS A 1 410 ? 17.487  53.799 45.165 1.00 19.56 ? 410 LYS A O   1 
ATOM   3106 C CB  . LYS A 1 410 ? 17.248  52.611 48.122 1.00 20.71 ? 410 LYS A CB  1 
ATOM   3107 C CG  . LYS A 1 410 ? 17.908  51.718 49.185 1.00 20.55 ? 410 LYS A CG  1 
ATOM   3108 C CD  . LYS A 1 410 ? 17.452  50.251 49.115 1.00 26.51 ? 410 LYS A CD  1 
ATOM   3109 C CE  . LYS A 1 410 ? 18.611  49.238 49.018 1.00 29.06 ? 410 LYS A CE  1 
ATOM   3110 N NZ  . LYS A 1 410 ? 18.277  48.013 49.749 1.00 39.74 ? 410 LYS A NZ  1 
ATOM   3111 N N   . TYR A 1 411 ? 17.242  55.543 46.489 1.00 16.18 ? 411 TYR A N   1 
ATOM   3112 C CA  . TYR A 1 411 ? 16.627  56.259 45.386 1.00 18.03 ? 411 TYR A CA  1 
ATOM   3113 C C   . TYR A 1 411 ? 17.659  56.751 44.412 1.00 22.49 ? 411 TYR A C   1 
ATOM   3114 O O   . TYR A 1 411 ? 17.502  56.663 43.201 1.00 22.41 ? 411 TYR A O   1 
ATOM   3115 C CB  . TYR A 1 411 ? 15.854  57.471 45.904 1.00 11.23 ? 411 TYR A CB  1 
ATOM   3116 C CG  . TYR A 1 411 ? 14.999  58.125 44.836 1.00 5.60  ? 411 TYR A CG  1 
ATOM   3117 C CD1 . TYR A 1 411 ? 13.747  57.578 44.508 1.00 2.08  ? 411 TYR A CD1 1 
ATOM   3118 C CD2 . TYR A 1 411 ? 15.428  59.307 44.207 1.00 4.34  ? 411 TYR A CD2 1 
ATOM   3119 C CE1 . TYR A 1 411 ? 12.913  58.220 43.586 1.00 4.24  ? 411 TYR A CE1 1 
ATOM   3120 C CE2 . TYR A 1 411 ? 14.598  59.950 43.287 1.00 2.00  ? 411 TYR A CE2 1 
ATOM   3121 C CZ  . TYR A 1 411 ? 13.344  59.409 42.977 1.00 8.61  ? 411 TYR A CZ  1 
ATOM   3122 O OH  . TYR A 1 411 ? 12.557  60.074 42.057 1.00 16.66 ? 411 TYR A OH  1 
ATOM   3123 N N   . THR A 1 412 ? 18.740  57.293 44.956 1.00 24.51 ? 412 THR A N   1 
ATOM   3124 C CA  . THR A 1 412 ? 19.797  57.830 44.105 1.00 25.23 ? 412 THR A CA  1 
ATOM   3125 C C   . THR A 1 412 ? 20.306  56.858 43.091 1.00 22.66 ? 412 THR A C   1 
ATOM   3126 O O   . THR A 1 412 ? 20.812  57.270 42.056 1.00 23.24 ? 412 THR A O   1 
ATOM   3127 C CB  . THR A 1 412 ? 20.895  58.461 44.978 1.00 24.60 ? 412 THR A CB  1 
ATOM   3128 O OG1 . THR A 1 412 ? 20.281  59.445 45.809 1.00 26.37 ? 412 THR A OG1 1 
ATOM   3129 C CG2 . THR A 1 412 ? 21.998  59.210 44.205 1.00 26.60 ? 412 THR A CG2 1 
ATOM   3130 N N   . LYS A 1 413 ? 20.163  55.564 43.354 1.00 23.19 ? 413 LYS A N   1 
ATOM   3131 C CA  . LYS A 1 413 ? 20.682  54.713 42.345 1.00 25.73 ? 413 LYS A CA  1 
ATOM   3132 C C   . LYS A 1 413 ? 19.917  54.864 41.029 1.00 26.73 ? 413 LYS A C   1 
ATOM   3133 O O   . LYS A 1 413 ? 20.461  54.651 40.014 1.00 28.60 ? 413 LYS A O   1 
ATOM   3134 C CB  . LYS A 1 413 ? 20.665  53.230 42.754 1.00 24.16 ? 413 LYS A CB  1 
ATOM   3135 C CG  . LYS A 1 413 ? 21.693  52.927 43.883 1.00 27.52 ? 413 LYS A CG  1 
ATOM   3136 C CD  . LYS A 1 413 ? 21.330  51.727 44.779 1.00 36.17 ? 413 LYS A CD  1 
ATOM   3137 N N   . PHE A 1 414 ? 18.623  55.180 41.183 1.00 28.42 ? 414 PHE A N   1 
ATOM   3138 C CA  . PHE A 1 414 ? 17.814  55.245 39.972 1.00 29.89 ? 414 PHE A CA  1 
ATOM   3139 C C   . PHE A 1 414 ? 17.061  56.556 39.706 1.00 28.33 ? 414 PHE A C   1 
ATOM   3140 O O   . PHE A 1 414 ? 16.297  56.674 38.736 1.00 31.27 ? 414 PHE A O   1 
ATOM   3141 C CB  . PHE A 1 414 ? 16.740  54.146 40.065 1.00 32.75 ? 414 PHE A CB  1 
ATOM   3142 C CG  . PHE A 1 414 ? 17.272  52.746 40.301 1.00 37.50 ? 414 PHE A CG  1 
ATOM   3143 C CD1 . PHE A 1 414 ? 18.572  52.276 40.169 1.00 44.88 ? 414 PHE A CD1 1 
ATOM   3144 C CD2 . PHE A 1 414 ? 16.344  51.858 40.722 1.00 43.49 ? 414 PHE A CD2 1 
ATOM   3145 C CE1 . PHE A 1 414 ? 18.984  51.007 40.512 1.00 50.06 ? 414 PHE A CE1 1 
ATOM   3146 C CE2 . PHE A 1 414 ? 16.694  50.529 41.049 1.00 45.95 ? 414 PHE A CE2 1 
ATOM   3147 C CZ  . PHE A 1 414 ? 18.030  50.125 40.954 1.00 46.66 ? 414 PHE A CZ  1 
ATOM   3148 N N   . GLY A 1 415 ? 17.218  57.553 40.575 1.00 26.12 ? 415 GLY A N   1 
ATOM   3149 C CA  . GLY A 1 415 ? 16.485  58.772 40.358 1.00 25.57 ? 415 GLY A CA  1 
ATOM   3150 C C   . GLY A 1 415 ? 17.222  59.643 39.391 1.00 25.05 ? 415 GLY A C   1 
ATOM   3151 O O   . GLY A 1 415 ? 18.299  59.318 38.929 1.00 23.29 ? 415 GLY A O   1 
ATOM   3152 N N   . ASN A 1 416 ? 16.658  60.812 39.103 1.00 28.85 ? 416 ASN A N   1 
ATOM   3153 C CA  . ASN A 1 416 ? 17.307  61.714 38.161 1.00 34.03 ? 416 ASN A CA  1 
ATOM   3154 C C   . ASN A 1 416 ? 17.867  62.946 38.848 1.00 33.90 ? 416 ASN A C   1 
ATOM   3155 O O   . ASN A 1 416 ? 17.753  64.054 38.351 1.00 35.24 ? 416 ASN A O   1 
ATOM   3156 C CB  . ASN A 1 416 ? 16.331  62.053 36.999 1.00 39.49 ? 416 ASN A CB  1 
ATOM   3157 C CG  . ASN A 1 416 ? 16.946  62.694 35.738 1.00 42.24 ? 416 ASN A CG  1 
ATOM   3158 O OD1 . ASN A 1 416 ? 16.387  63.603 35.139 1.00 46.71 ? 416 ASN A OD1 1 
ATOM   3159 N ND2 . ASN A 1 416 ? 18.100  62.178 35.308 1.00 38.36 ? 416 ASN A ND2 1 
ATOM   3160 N N   . GLY A 1 417 ? 18.467  62.755 40.028 1.00 37.53 ? 417 GLY A N   1 
ATOM   3161 C CA  . GLY A 1 417 ? 19.061  63.874 40.788 1.00 35.91 ? 417 GLY A CA  1 
ATOM   3162 C C   . GLY A 1 417 ? 18.572  63.903 42.225 1.00 30.56 ? 417 GLY A C   1 
ATOM   3163 O O   . GLY A 1 417 ? 17.407  63.631 42.488 1.00 29.49 ? 417 GLY A O   1 
ATOM   3164 N N   . THR A 1 418 ? 19.465  64.226 43.162 1.00 27.58 ? 418 THR A N   1 
ATOM   3165 C CA  . THR A 1 418 ? 19.038  64.247 44.557 1.00 27.31 ? 418 THR A CA  1 
ATOM   3166 C C   . THR A 1 418 ? 19.764  65.383 45.256 1.00 25.21 ? 418 THR A C   1 
ATOM   3167 O O   . THR A 1 418 ? 20.978  65.478 45.111 1.00 26.31 ? 418 THR A O   1 
ATOM   3168 C CB  . THR A 1 418 ? 19.424  62.879 45.187 1.00 23.65 ? 418 THR A CB  1 
ATOM   3169 O OG1 . THR A 1 418 ? 18.789  61.811 44.470 1.00 29.40 ? 418 THR A OG1 1 
ATOM   3170 C CG2 . THR A 1 418 ? 19.017  62.701 46.648 1.00 21.43 ? 418 THR A CG2 1 
ATOM   3171 N N   . TYR A 1 419 ? 19.030  66.227 45.997 1.00 22.29 ? 419 TYR A N   1 
ATOM   3172 C CA  . TYR A 1 419 ? 19.643  67.346 46.738 1.00 25.88 ? 419 TYR A CA  1 
ATOM   3173 C C   . TYR A 1 419 ? 19.254  67.124 48.199 1.00 25.80 ? 419 TYR A C   1 
ATOM   3174 O O   . TYR A 1 419 ? 18.079  66.883 48.465 1.00 27.82 ? 419 TYR A O   1 
ATOM   3175 C CB  . TYR A 1 419 ? 19.164  68.702 46.184 1.00 30.13 ? 419 TYR A CB  1 
ATOM   3176 C CG  . TYR A 1 419 ? 19.512  68.841 44.711 1.00 29.73 ? 419 TYR A CG  1 
ATOM   3177 C CD1 . TYR A 1 419 ? 18.600  68.368 43.751 1.00 31.80 ? 419 TYR A CD1 1 
ATOM   3178 C CD2 . TYR A 1 419 ? 20.734  69.407 44.287 1.00 26.44 ? 419 TYR A CD2 1 
ATOM   3179 C CE1 . TYR A 1 419 ? 18.899  68.453 42.387 1.00 32.84 ? 419 TYR A CE1 1 
ATOM   3180 C CE2 . TYR A 1 419 ? 21.036  69.489 42.917 1.00 27.55 ? 419 TYR A CE2 1 
ATOM   3181 C CZ  . TYR A 1 419 ? 20.114  69.013 41.961 1.00 31.05 ? 419 TYR A CZ  1 
ATOM   3182 O OH  . TYR A 1 419 ? 20.364  69.090 40.602 1.00 31.88 ? 419 TYR A OH  1 
ATOM   3183 N N   . LEU A 1 420 ? 20.228  67.176 49.121 1.00 19.41 ? 420 LEU A N   1 
ATOM   3184 C CA  . LEU A 1 420 ? 20.014  66.915 50.540 1.00 17.98 ? 420 LEU A CA  1 
ATOM   3185 C C   . LEU A 1 420 ? 20.492  68.074 51.392 1.00 19.04 ? 420 LEU A C   1 
ATOM   3186 O O   . LEU A 1 420 ? 21.580  68.595 51.158 1.00 16.48 ? 420 LEU A O   1 
ATOM   3187 C CB  . LEU A 1 420 ? 20.834  65.657 50.884 1.00 13.19 ? 420 LEU A CB  1 
ATOM   3188 C CG  . LEU A 1 420 ? 20.683  65.139 52.324 1.00 13.97 ? 420 LEU A CG  1 
ATOM   3189 C CD1 . LEU A 1 420 ? 19.221  64.883 52.694 1.00 13.11 ? 420 LEU A CD1 1 
ATOM   3190 C CD2 . LEU A 1 420 ? 21.501  63.860 52.553 1.00 9.68  ? 420 LEU A CD2 1 
ATOM   3191 N N   . TYR A 1 421 ? 19.674  68.470 52.388 1.00 20.00 ? 421 TYR A N   1 
ATOM   3192 C CA  . TYR A 1 421 ? 20.041  69.576 53.300 1.00 21.21 ? 421 TYR A CA  1 
ATOM   3193 C C   . TYR A 1 421 ? 19.942  69.123 54.759 1.00 22.16 ? 421 TYR A C   1 
ATOM   3194 O O   . TYR A 1 421 ? 19.268  68.147 55.083 1.00 27.68 ? 421 TYR A O   1 
ATOM   3195 C CB  . TYR A 1 421 ? 19.160  70.825 53.113 1.00 18.16 ? 421 TYR A CB  1 
ATOM   3196 C CG  . TYR A 1 421 ? 17.717  70.594 53.501 1.00 20.61 ? 421 TYR A CG  1 
ATOM   3197 C CD1 . TYR A 1 421 ? 16.780  70.057 52.595 1.00 18.30 ? 421 TYR A CD1 1 
ATOM   3198 C CD2 . TYR A 1 421 ? 17.312  70.898 54.806 1.00 17.41 ? 421 TYR A CD2 1 
ATOM   3199 C CE1 . TYR A 1 421 ? 15.451  69.838 53.002 1.00 18.02 ? 421 TYR A CE1 1 
ATOM   3200 C CE2 . TYR A 1 421 ? 15.996  70.665 55.207 1.00 18.17 ? 421 TYR A CE2 1 
ATOM   3201 C CZ  . TYR A 1 421 ? 15.057  70.145 54.313 1.00 17.49 ? 421 TYR A CZ  1 
ATOM   3202 O OH  . TYR A 1 421 ? 13.749  69.954 54.734 1.00 23.43 ? 421 TYR A OH  1 
ATOM   3203 N N   . PHE A 1 422 ? 20.608  69.887 55.631 1.00 19.35 ? 422 PHE A N   1 
ATOM   3204 C CA  . PHE A 1 422 ? 20.637  69.652 57.073 1.00 16.89 ? 422 PHE A CA  1 
ATOM   3205 C C   . PHE A 1 422 ? 20.322  71.005 57.627 1.00 15.31 ? 422 PHE A C   1 
ATOM   3206 O O   . PHE A 1 422 ? 21.156  71.895 57.543 1.00 17.01 ? 422 PHE A O   1 
ATOM   3207 C CB  . PHE A 1 422 ? 22.054  69.215 57.459 1.00 17.68 ? 422 PHE A CB  1 
ATOM   3208 C CG  . PHE A 1 422 ? 22.178  68.850 58.909 1.00 18.34 ? 422 PHE A CG  1 
ATOM   3209 C CD1 . PHE A 1 422 ? 21.524  67.705 59.394 1.00 17.93 ? 422 PHE A CD1 1 
ATOM   3210 C CD2 . PHE A 1 422 ? 22.957  69.638 59.779 1.00 20.27 ? 422 PHE A CD2 1 
ATOM   3211 C CE1 . PHE A 1 422 ? 21.650  67.347 60.742 1.00 16.41 ? 422 PHE A CE1 1 
ATOM   3212 C CE2 . PHE A 1 422 ? 23.087  69.277 61.123 1.00 16.33 ? 422 PHE A CE2 1 
ATOM   3213 C CZ  . PHE A 1 422 ? 22.431  68.132 61.601 1.00 17.51 ? 422 PHE A CZ  1 
ATOM   3214 N N   . PHE A 1 423 ? 19.102  71.191 58.111 1.00 14.66 ? 423 PHE A N   1 
ATOM   3215 C CA  . PHE A 1 423 ? 18.694  72.484 58.631 1.00 16.94 ? 423 PHE A CA  1 
ATOM   3216 C C   . PHE A 1 423 ? 19.040  72.523 60.103 1.00 20.96 ? 423 PHE A C   1 
ATOM   3217 O O   . PHE A 1 423 ? 18.555  71.738 60.923 1.00 26.49 ? 423 PHE A O   1 
ATOM   3218 C CB  . PHE A 1 423 ? 17.200  72.684 58.390 1.00 12.96 ? 423 PHE A CB  1 
ATOM   3219 C CG  . PHE A 1 423 ? 16.724  74.040 58.834 1.00 12.99 ? 423 PHE A CG  1 
ATOM   3220 C CD1 . PHE A 1 423 ? 16.886  75.165 58.004 1.00 14.02 ? 423 PHE A CD1 1 
ATOM   3221 C CD2 . PHE A 1 423 ? 16.100  74.192 60.080 1.00 17.13 ? 423 PHE A CD2 1 
ATOM   3222 C CE1 . PHE A 1 423 ? 16.416  76.428 58.401 1.00 11.33 ? 423 PHE A CE1 1 
ATOM   3223 C CE2 . PHE A 1 423 ? 15.623  75.456 60.481 1.00 20.89 ? 423 PHE A CE2 1 
ATOM   3224 C CZ  . PHE A 1 423 ? 15.778  76.573 59.637 1.00 15.84 ? 423 PHE A CZ  1 
ATOM   3225 N N   . ASN A 1 424 ? 19.894  73.481 60.441 1.00 18.24 ? 424 ASN A N   1 
ATOM   3226 C CA  . ASN A 1 424 ? 20.337  73.577 61.812 1.00 14.83 ? 424 ASN A CA  1 
ATOM   3227 C C   . ASN A 1 424 ? 20.403  74.990 62.302 1.00 12.86 ? 424 ASN A C   1 
ATOM   3228 O O   . ASN A 1 424 ? 21.415  75.403 62.828 1.00 16.41 ? 424 ASN A O   1 
ATOM   3229 C CB  . ASN A 1 424 ? 21.694  72.892 61.978 1.00 9.86  ? 424 ASN A CB  1 
ATOM   3230 C CG  . ASN A 1 424 ? 22.744  73.517 61.102 1.00 14.25 ? 424 ASN A CG  1 
ATOM   3231 O OD1 . ASN A 1 424 ? 22.489  74.376 60.268 1.00 19.01 ? 424 ASN A OD1 1 
ATOM   3232 N ND2 . ASN A 1 424 ? 23.976  73.051 61.272 1.00 17.43 ? 424 ASN A ND2 1 
ATOM   3233 N N   . HIS A 1 425 ? 19.324  75.737 62.152 1.00 14.01 ? 425 HIS A N   1 
ATOM   3234 C CA  . HIS A 1 425 ? 19.291  77.111 62.619 1.00 14.70 ? 425 HIS A CA  1 
ATOM   3235 C C   . HIS A 1 425 ? 18.127  77.227 63.581 1.00 20.28 ? 425 HIS A C   1 
ATOM   3236 O O   . HIS A 1 425 ? 17.025  76.743 63.342 1.00 22.87 ? 425 HIS A O   1 
ATOM   3237 C CB  . HIS A 1 425 ? 19.069  78.038 61.424 1.00 13.69 ? 425 HIS A CB  1 
ATOM   3238 C CG  . HIS A 1 425 ? 18.758  79.457 61.849 1.00 16.20 ? 425 HIS A CG  1 
ATOM   3239 N ND1 . HIS A 1 425 ? 19.673  80.364 62.264 1.00 14.43 ? 425 HIS A ND1 1 
ATOM   3240 C CD2 . HIS A 1 425 ? 17.483  80.067 61.888 1.00 16.15 ? 425 HIS A CD2 1 
ATOM   3241 C CE1 . HIS A 1 425 ? 18.988  81.491 62.540 1.00 13.89 ? 425 HIS A CE1 1 
ATOM   3242 N NE2 . HIS A 1 425 ? 17.667  81.335 62.316 1.00 13.71 ? 425 HIS A NE2 1 
ATOM   3243 N N   . ARG A 1 426 ? 18.386  77.897 64.696 1.00 24.28 ? 426 ARG A N   1 
ATOM   3244 C CA  . ARG A 1 426 ? 17.337  78.083 65.683 1.00 27.35 ? 426 ARG A CA  1 
ATOM   3245 C C   . ARG A 1 426 ? 16.832  79.506 65.509 1.00 27.39 ? 426 ARG A C   1 
ATOM   3246 O O   . ARG A 1 426 ? 17.588  80.471 65.630 1.00 26.12 ? 426 ARG A O   1 
ATOM   3247 C CB  . ARG A 1 426 ? 17.902  77.842 67.106 1.00 30.12 ? 426 ARG A CB  1 
ATOM   3248 C CG  . ARG A 1 426 ? 16.810  77.838 68.200 1.00 36.19 ? 426 ARG A CG  1 
ATOM   3249 C CD  . ARG A 1 426 ? 17.260  77.301 69.568 1.00 36.30 ? 426 ARG A CD  1 
ATOM   3250 N NE  . ARG A 1 426 ? 16.233  77.525 70.574 1.00 39.87 ? 426 ARG A NE  1 
ATOM   3251 C CZ  . ARG A 1 426 ? 16.103  78.735 71.150 1.00 44.86 ? 426 ARG A CZ  1 
ATOM   3252 N NH1 . ARG A 1 426 ? 16.896  79.766 70.825 1.00 45.41 ? 426 ARG A NH1 1 
ATOM   3253 N NH2 . ARG A 1 426 ? 15.158  78.908 72.068 1.00 46.68 ? 426 ARG A NH2 1 
ATOM   3254 N N   . ALA A 1 427 ? 15.526  79.628 65.219 1.00 25.42 ? 427 ALA A N   1 
ATOM   3255 C CA  . ALA A 1 427 ? 15.003  80.979 65.054 1.00 24.06 ? 427 ALA A CA  1 
ATOM   3256 C C   . ALA A 1 427 ? 15.285  81.755 66.302 1.00 24.95 ? 427 ALA A C   1 
ATOM   3257 O O   . ALA A 1 427 ? 15.147  81.236 67.399 1.00 23.58 ? 427 ALA A O   1 
ATOM   3258 C CB  . ALA A 1 427 ? 13.487  81.020 64.833 1.00 21.86 ? 427 ALA A CB  1 
ATOM   3259 N N   . SER A 1 428 ? 15.636  83.023 66.100 1.00 27.92 ? 428 SER A N   1 
ATOM   3260 C CA  . SER A 1 428 ? 15.952  83.883 67.235 1.00 27.44 ? 428 SER A CA  1 
ATOM   3261 C C   . SER A 1 428 ? 14.768  84.113 68.163 1.00 27.61 ? 428 SER A C   1 
ATOM   3262 O O   . SER A 1 428 ? 14.926  84.401 69.339 1.00 33.83 ? 428 SER A O   1 
ATOM   3263 C CB  . SER A 1 428 ? 16.575  85.213 66.778 1.00 25.08 ? 428 SER A CB  1 
ATOM   3264 O OG  . SER A 1 428 ? 15.802  85.842 65.750 1.00 27.48 ? 428 SER A OG  1 
ATOM   3265 N N   . ASN A 1 429 ? 13.572  83.993 67.608 1.00 25.58 ? 429 ASN A N   1 
ATOM   3266 C CA  . ASN A 1 429 ? 12.360  84.182 68.382 1.00 26.14 ? 429 ASN A CA  1 
ATOM   3267 C C   . ASN A 1 429 ? 11.719  82.855 68.810 1.00 29.45 ? 429 ASN A C   1 
ATOM   3268 O O   . ASN A 1 429 ? 10.538  82.806 69.149 1.00 31.59 ? 429 ASN A O   1 
ATOM   3269 C CB  . ASN A 1 429 ? 11.360  85.021 67.566 1.00 27.84 ? 429 ASN A CB  1 
ATOM   3270 C CG  . ASN A 1 429 ? 11.162  84.534 66.142 1.00 30.89 ? 429 ASN A CG  1 
ATOM   3271 O OD1 . ASN A 1 429 ? 11.689  83.507 65.720 1.00 28.88 ? 429 ASN A OD1 1 
ATOM   3272 N ND2 . ASN A 1 429 ? 10.414  85.321 65.380 1.00 31.96 ? 429 ASN A ND2 1 
ATOM   3273 N N   . LEU A 1 430 ? 12.494  81.755 68.801 1.00 27.22 ? 430 LEU A N   1 
ATOM   3274 C CA  . LEU A 1 430 ? 11.872  80.491 69.183 1.00 24.25 ? 430 LEU A CA  1 
ATOM   3275 C C   . LEU A 1 430 ? 11.330  80.608 70.604 1.00 25.62 ? 430 LEU A C   1 
ATOM   3276 O O   . LEU A 1 430 ? 12.050  81.102 71.463 1.00 28.75 ? 430 LEU A O   1 
ATOM   3277 C CB  . LEU A 1 430 ? 12.928  79.358 69.116 1.00 22.89 ? 430 LEU A CB  1 
ATOM   3278 C CG  . LEU A 1 430 ? 12.497  78.024 68.491 1.00 21.01 ? 430 LEU A CG  1 
ATOM   3279 C CD1 . LEU A 1 430 ? 11.098  77.558 68.878 1.00 25.25 ? 430 LEU A CD1 1 
ATOM   3280 C CD2 . LEU A 1 430 ? 12.610  78.064 66.978 1.00 32.12 ? 430 LEU A CD2 1 
ATOM   3281 N N   . VAL A 1 431 ? 10.083  80.155 70.846 1.00 24.53 ? 431 VAL A N   1 
ATOM   3282 C CA  . VAL A 1 431 ? 9.550   80.220 72.222 1.00 23.47 ? 431 VAL A CA  1 
ATOM   3283 C C   . VAL A 1 431 ? 9.752   78.924 73.018 1.00 20.42 ? 431 VAL A C   1 
ATOM   3284 O O   . VAL A 1 431 ? 9.338   78.790 74.157 1.00 22.54 ? 431 VAL A O   1 
ATOM   3285 C CB  . VAL A 1 431 ? 8.045   80.571 72.220 1.00 20.23 ? 431 VAL A CB  1 
ATOM   3286 C CG1 . VAL A 1 431 ? 7.851   81.943 71.578 1.00 24.35 ? 431 VAL A CG1 1 
ATOM   3287 C CG2 . VAL A 1 431 ? 7.178   79.519 71.508 1.00 17.82 ? 431 VAL A CG2 1 
ATOM   3288 N N   . TRP A 1 432 ? 10.322  77.925 72.377 1.00 16.34 ? 432 TRP A N   1 
ATOM   3289 C CA  . TRP A 1 432 ? 10.549  76.664 73.056 1.00 14.40 ? 432 TRP A CA  1 
ATOM   3290 C C   . TRP A 1 432 ? 11.928  76.825 73.709 1.00 13.99 ? 432 TRP A C   1 
ATOM   3291 O O   . TRP A 1 432 ? 12.698  77.677 73.290 1.00 13.34 ? 432 TRP A O   1 
ATOM   3292 C CB  . TRP A 1 432 ? 10.491  75.491 72.050 1.00 11.71 ? 432 TRP A CB  1 
ATOM   3293 C CG  . TRP A 1 432 ? 9.087   75.215 71.549 1.00 13.78 ? 432 TRP A CG  1 
ATOM   3294 C CD1 . TRP A 1 432 ? 8.494   75.696 70.352 1.00 14.89 ? 432 TRP A CD1 1 
ATOM   3295 C CD2 . TRP A 1 432 ? 8.113   74.417 72.184 1.00 15.44 ? 432 TRP A CD2 1 
ATOM   3296 N NE1 . TRP A 1 432 ? 7.217   75.230 70.222 1.00 13.83 ? 432 TRP A NE1 1 
ATOM   3297 C CE2 . TRP A 1 432 ? 6.919   74.434 71.305 1.00 16.22 ? 432 TRP A CE2 1 
ATOM   3298 C CE3 . TRP A 1 432 ? 8.058   73.711 73.388 1.00 16.05 ? 432 TRP A CE3 1 
ATOM   3299 C CZ2 . TRP A 1 432 ? 5.771   73.727 71.707 1.00 14.52 ? 432 TRP A CZ2 1 
ATOM   3300 C CZ3 . TRP A 1 432 ? 6.884   73.027 73.752 1.00 15.01 ? 432 TRP A CZ3 1 
ATOM   3301 C CH2 . TRP A 1 432 ? 5.757   73.028 72.921 1.00 12.98 ? 432 TRP A CH2 1 
ATOM   3302 N N   . PRO A 1 433 ? 12.245  76.018 74.743 1.00 12.67 ? 433 PRO A N   1 
ATOM   3303 C CA  . PRO A 1 433 ? 13.523  76.153 75.404 1.00 9.19  ? 433 PRO A CA  1 
ATOM   3304 C C   . PRO A 1 433 ? 14.678  75.802 74.534 1.00 12.11 ? 433 PRO A C   1 
ATOM   3305 O O   . PRO A 1 433 ? 14.623  74.982 73.635 1.00 21.23 ? 433 PRO A O   1 
ATOM   3306 C CB  . PRO A 1 433 ? 13.459  75.154 76.556 1.00 8.32  ? 433 PRO A CB  1 
ATOM   3307 C CG  . PRO A 1 433 ? 12.309  74.202 76.229 1.00 4.90  ? 433 PRO A CG  1 
ATOM   3308 C CD  . PRO A 1 433 ? 11.370  75.011 75.342 1.00 9.63  ? 433 PRO A CD  1 
ATOM   3309 N N   . GLU A 1 434 ? 15.797  76.398 74.910 1.00 15.38 ? 434 GLU A N   1 
ATOM   3310 C CA  . GLU A 1 434 ? 17.052  76.209 74.207 1.00 14.21 ? 434 GLU A CA  1 
ATOM   3311 C C   . GLU A 1 434 ? 17.471  74.746 74.132 1.00 13.83 ? 434 GLU A C   1 
ATOM   3312 O O   . GLU A 1 434 ? 18.152  74.354 73.203 1.00 17.17 ? 434 GLU A O   1 
ATOM   3313 C CB  . GLU A 1 434 ? 18.131  77.082 74.901 1.00 12.25 ? 434 GLU A CB  1 
ATOM   3314 C CG  . GLU A 1 434 ? 19.471  77.250 74.154 1.00 20.68 ? 434 GLU A CG  1 
ATOM   3315 N N   . TRP A 1 435 ? 17.062  73.930 75.109 1.00 13.60 ? 435 TRP A N   1 
ATOM   3316 C CA  . TRP A 1 435 ? 17.525  72.544 75.044 1.00 13.74 ? 435 TRP A CA  1 
ATOM   3317 C C   . TRP A 1 435 ? 16.939  71.785 73.877 1.00 16.40 ? 435 TRP A C   1 
ATOM   3318 O O   . TRP A 1 435 ? 17.517  70.819 73.400 1.00 23.41 ? 435 TRP A O   1 
ATOM   3319 C CB  . TRP A 1 435 ? 17.391  71.777 76.402 1.00 13.33 ? 435 TRP A CB  1 
ATOM   3320 C CG  . TRP A 1 435 ? 15.962  71.442 76.812 1.00 7.61  ? 435 TRP A CG  1 
ATOM   3321 C CD1 . TRP A 1 435 ? 15.117  72.204 77.650 1.00 5.44  ? 435 TRP A CD1 1 
ATOM   3322 C CD2 . TRP A 1 435 ? 15.215  70.325 76.407 1.00 5.75  ? 435 TRP A CD2 1 
ATOM   3323 N NE1 . TRP A 1 435 ? 13.895  71.623 77.769 1.00 2.00  ? 435 TRP A NE1 1 
ATOM   3324 C CE2 . TRP A 1 435 ? 13.876  70.476 77.028 1.00 4.00  ? 435 TRP A CE2 1 
ATOM   3325 C CE3 . TRP A 1 435 ? 15.492  69.206 75.613 1.00 5.40  ? 435 TRP A CE3 1 
ATOM   3326 C CZ2 . TRP A 1 435 ? 12.889  69.511 76.783 1.00 5.82  ? 435 TRP A CZ2 1 
ATOM   3327 C CZ3 . TRP A 1 435 ? 14.484  68.250 75.403 1.00 9.91  ? 435 TRP A CZ3 1 
ATOM   3328 C CH2 . TRP A 1 435 ? 13.197  68.405 75.967 1.00 8.73  ? 435 TRP A CH2 1 
ATOM   3329 N N   . MET A 1 436 ? 15.758  72.216 73.436 1.00 16.03 ? 436 MET A N   1 
ATOM   3330 C CA  . MET A 1 436 ? 15.126  71.534 72.318 1.00 17.89 ? 436 MET A CA  1 
ATOM   3331 C C   . MET A 1 436 ? 15.859  71.830 70.984 1.00 20.10 ? 436 MET A C   1 
ATOM   3332 O O   . MET A 1 436 ? 15.715  71.137 69.985 1.00 20.80 ? 436 MET A O   1 
ATOM   3333 C CB  . MET A 1 436 ? 13.632  71.873 72.286 1.00 14.73 ? 436 MET A CB  1 
ATOM   3334 C CG  . MET A 1 436 ? 12.913  71.395 73.543 1.00 10.31 ? 436 MET A CG  1 
ATOM   3335 S SD  . MET A 1 436 ? 11.190  71.974 73.524 1.00 13.56 ? 436 MET A SD  1 
ATOM   3336 C CE  . MET A 1 436 ? 10.487  70.820 72.309 1.00 13.12 ? 436 MET A CE  1 
ATOM   3337 N N   . GLY A 1 437 ? 16.660  72.895 70.964 1.00 20.64 ? 437 GLY A N   1 
ATOM   3338 C CA  . GLY A 1 437 ? 17.403  73.168 69.739 1.00 18.75 ? 437 GLY A CA  1 
ATOM   3339 C C   . GLY A 1 437 ? 16.552  73.492 68.521 1.00 17.03 ? 437 GLY A C   1 
ATOM   3340 O O   . GLY A 1 437 ? 15.594  74.256 68.593 1.00 18.08 ? 437 GLY A O   1 
ATOM   3341 N N   . VAL A 1 438 ? 16.977  72.905 67.382 1.00 12.62 ? 438 VAL A N   1 
ATOM   3342 C CA  . VAL A 1 438 ? 16.330  73.055 66.081 1.00 9.94  ? 438 VAL A CA  1 
ATOM   3343 C C   . VAL A 1 438 ? 15.270  71.965 66.028 1.00 6.84  ? 438 VAL A C   1 
ATOM   3344 O O   . VAL A 1 438 ? 15.538  70.830 65.653 1.00 2.00  ? 438 VAL A O   1 
ATOM   3345 C CB  . VAL A 1 438 ? 17.385  72.902 64.976 1.00 6.49  ? 438 VAL A CB  1 
ATOM   3346 C CG1 . VAL A 1 438 ? 16.813  73.247 63.604 1.00 12.47 ? 438 VAL A CG1 1 
ATOM   3347 C CG2 . VAL A 1 438 ? 18.622  73.766 65.262 1.00 4.15  ? 438 VAL A CG2 1 
ATOM   3348 N N   . ILE A 1 439 ? 14.062  72.371 66.379 1.00 8.21  ? 439 ILE A N   1 
ATOM   3349 C CA  . ILE A 1 439 ? 12.963  71.434 66.493 1.00 9.83  ? 439 ILE A CA  1 
ATOM   3350 C C   . ILE A 1 439 ? 12.315  70.981 65.199 1.00 12.68 ? 439 ILE A C   1 
ATOM   3351 O O   . ILE A 1 439 ? 12.240  71.645 64.166 1.00 17.50 ? 439 ILE A O   1 
ATOM   3352 C CB  . ILE A 1 439 ? 11.928  72.134 67.412 1.00 8.73  ? 439 ILE A CB  1 
ATOM   3353 C CG1 . ILE A 1 439 ? 12.536  72.553 68.764 1.00 5.52  ? 439 ILE A CG1 1 
ATOM   3354 C CG2 . ILE A 1 439 ? 10.641  71.337 67.687 1.00 9.39  ? 439 ILE A CG2 1 
ATOM   3355 C CD1 . ILE A 1 439 ? 11.738  73.672 69.435 1.00 2.00  ? 439 ILE A CD1 1 
ATOM   3356 N N   . HIS A 1 440 ? 11.787  69.767 65.315 1.00 10.68 ? 440 HIS A N   1 
ATOM   3357 C CA  . HIS A 1 440 ? 11.053  69.108 64.252 1.00 9.48  ? 440 HIS A CA  1 
ATOM   3358 C C   . HIS A 1 440 ? 9.911   70.051 63.934 1.00 9.31  ? 440 HIS A C   1 
ATOM   3359 O O   . HIS A 1 440 ? 9.208   70.462 64.829 1.00 8.12  ? 440 HIS A O   1 
ATOM   3360 C CB  . HIS A 1 440 ? 10.550  67.777 64.839 1.00 8.57  ? 440 HIS A CB  1 
ATOM   3361 C CG  . HIS A 1 440 ? 9.657   66.946 63.948 1.00 7.99  ? 440 HIS A CG  1 
ATOM   3362 N ND1 . HIS A 1 440 ? 10.086  66.014 63.073 1.00 6.63  ? 440 HIS A ND1 1 
ATOM   3363 C CD2 . HIS A 1 440 ? 8.240   66.895 63.984 1.00 9.96  ? 440 HIS A CD2 1 
ATOM   3364 C CE1 . HIS A 1 440 ? 8.975   65.395 62.600 1.00 12.43 ? 440 HIS A CE1 1 
ATOM   3365 N NE2 . HIS A 1 440 ? 7.845   65.912 63.137 1.00 10.39 ? 440 HIS A NE2 1 
ATOM   3366 N N   . GLY A 1 441 ? 9.782   70.443 62.665 1.00 12.04 ? 441 GLY A N   1 
ATOM   3367 C CA  . GLY A 1 441 ? 8.713   71.358 62.293 1.00 8.35  ? 441 GLY A CA  1 
ATOM   3368 C C   . GLY A 1 441 ? 9.180   72.772 62.174 1.00 8.92  ? 441 GLY A C   1 
ATOM   3369 O O   . GLY A 1 441 ? 8.565   73.583 61.507 1.00 9.77  ? 441 GLY A O   1 
ATOM   3370 N N   . TYR A 1 442 ? 10.356  73.065 62.706 1.00 8.66  ? 442 TYR A N   1 
ATOM   3371 C CA  . TYR A 1 442 ? 10.755  74.475 62.684 1.00 11.82 ? 442 TYR A CA  1 
ATOM   3372 C C   . TYR A 1 442 ? 11.364  75.119 61.445 1.00 13.54 ? 442 TYR A C   1 
ATOM   3373 O O   . TYR A 1 442 ? 11.672  76.305 61.457 1.00 20.09 ? 442 TYR A O   1 
ATOM   3374 C CB  . TYR A 1 442 ? 11.369  74.815 64.079 1.00 11.19 ? 442 TYR A CB  1 
ATOM   3375 C CG  . TYR A 1 442 ? 10.204  74.997 65.047 1.00 7.21  ? 442 TYR A CG  1 
ATOM   3376 C CD1 . TYR A 1 442 ? 9.504   73.889 65.567 1.00 5.33  ? 442 TYR A CD1 1 
ATOM   3377 C CD2 . TYR A 1 442 ? 9.715   76.291 65.292 1.00 2.00  ? 442 TYR A CD2 1 
ATOM   3378 C CE1 . TYR A 1 442 ? 8.320   74.070 66.286 1.00 2.00  ? 442 TYR A CE1 1 
ATOM   3379 C CE2 . TYR A 1 442 ? 8.531   76.476 66.001 1.00 2.00  ? 442 TYR A CE2 1 
ATOM   3380 C CZ  . TYR A 1 442 ? 7.836   75.369 66.490 1.00 4.13  ? 442 TYR A CZ  1 
ATOM   3381 O OH  . TYR A 1 442 ? 6.660   75.593 67.164 1.00 13.11 ? 442 TYR A OH  1 
ATOM   3382 N N   . GLU A 1 443 ? 11.519  74.358 60.342 1.00 15.74 ? 443 GLU A N   1 
ATOM   3383 C CA  . GLU A 1 443 ? 12.072  74.942 59.086 1.00 7.98  ? 443 GLU A CA  1 
ATOM   3384 C C   . GLU A 1 443 ? 10.944  75.473 58.230 1.00 5.61  ? 443 GLU A C   1 
ATOM   3385 O O   . GLU A 1 443 ? 11.091  76.316 57.364 1.00 7.19  ? 443 GLU A O   1 
ATOM   3386 C CB  . GLU A 1 443 ? 12.889  73.972 58.219 1.00 9.60  ? 443 GLU A CB  1 
ATOM   3387 C CG  . GLU A 1 443 ? 12.093  72.991 57.312 1.00 7.55  ? 443 GLU A CG  1 
ATOM   3388 C CD  . GLU A 1 443 ? 11.196  72.053 58.088 1.00 6.46  ? 443 GLU A CD  1 
ATOM   3389 O OE1 . GLU A 1 443 ? 11.514  71.797 59.235 1.00 8.12  ? 443 GLU A OE1 1 
ATOM   3390 O OE2 . GLU A 1 443 ? 10.196  71.582 57.551 1.00 6.22  ? 443 GLU A OE2 1 
ATOM   3391 N N   . ILE A 1 444 ? 9.757   74.944 58.494 1.00 3.67  ? 444 ILE A N   1 
ATOM   3392 C CA  . ILE A 1 444 ? 8.602   75.371 57.745 1.00 2.76  ? 444 ILE A CA  1 
ATOM   3393 C C   . ILE A 1 444 ? 8.391   76.890 57.829 1.00 6.05  ? 444 ILE A C   1 
ATOM   3394 O O   . ILE A 1 444 ? 7.849   77.504 56.938 1.00 9.34  ? 444 ILE A O   1 
ATOM   3395 C CB  . ILE A 1 444 ? 7.359   74.564 58.209 1.00 2.00  ? 444 ILE A CB  1 
ATOM   3396 C CG1 . ILE A 1 444 ? 7.604   73.028 58.241 1.00 5.67  ? 444 ILE A CG1 1 
ATOM   3397 C CG2 . ILE A 1 444 ? 6.150   74.919 57.348 1.00 3.61  ? 444 ILE A CG2 1 
ATOM   3398 C CD1 . ILE A 1 444 ? 6.379   72.173 58.631 1.00 2.00  ? 444 ILE A CD1 1 
ATOM   3399 N N   . GLU A 1 445 ? 8.840   77.540 58.906 1.00 16.65 ? 445 GLU A N   1 
ATOM   3400 C CA  . GLU A 1 445 ? 8.601   78.992 58.980 1.00 17.10 ? 445 GLU A CA  1 
ATOM   3401 C C   . GLU A 1 445 ? 9.356   79.694 57.924 1.00 14.25 ? 445 GLU A C   1 
ATOM   3402 O O   . GLU A 1 445 ? 8.937   80.729 57.438 1.00 8.96  ? 445 GLU A O   1 
ATOM   3403 C CB  . GLU A 1 445 ? 9.088   79.671 60.292 1.00 24.89 ? 445 GLU A CB  1 
ATOM   3404 C CG  . GLU A 1 445 ? 8.687   78.932 61.563 1.00 25.68 ? 445 GLU A CG  1 
ATOM   3405 C CD  . GLU A 1 445 ? 9.181   79.521 62.848 1.00 31.64 ? 445 GLU A CD  1 
ATOM   3406 O OE1 . GLU A 1 445 ? 10.321  79.998 62.881 1.00 28.92 ? 445 GLU A OE1 1 
ATOM   3407 O OE2 . GLU A 1 445 ? 8.421   79.476 63.819 1.00 35.91 ? 445 GLU A OE2 1 
ATOM   3408 N N   . PHE A 1 446 ? 10.512  79.084 57.639 1.00 14.43 ? 446 PHE A N   1 
ATOM   3409 C CA  . PHE A 1 446 ? 11.436  79.601 56.650 1.00 17.47 ? 446 PHE A CA  1 
ATOM   3410 C C   . PHE A 1 446 ? 10.935  79.364 55.231 1.00 17.92 ? 446 PHE A C   1 
ATOM   3411 O O   . PHE A 1 446 ? 10.854  80.285 54.429 1.00 17.24 ? 446 PHE A O   1 
ATOM   3412 C CB  . PHE A 1 446 ? 12.841  79.006 56.892 1.00 14.25 ? 446 PHE A CB  1 
ATOM   3413 C CG  . PHE A 1 446 ? 13.479  79.696 58.073 1.00 18.46 ? 446 PHE A CG  1 
ATOM   3414 C CD1 . PHE A 1 446 ? 13.109  79.356 59.382 1.00 21.45 ? 446 PHE A CD1 1 
ATOM   3415 C CD2 . PHE A 1 446 ? 14.397  80.744 57.865 1.00 17.73 ? 446 PHE A CD2 1 
ATOM   3416 C CE1 . PHE A 1 446 ? 13.632  80.089 60.462 1.00 25.35 ? 446 PHE A CE1 1 
ATOM   3417 C CE2 . PHE A 1 446 ? 14.922  81.463 58.941 1.00 16.63 ? 446 PHE A CE2 1 
ATOM   3418 C CZ  . PHE A 1 446 ? 14.533  81.146 60.246 1.00 17.92 ? 446 PHE A CZ  1 
ATOM   3419 N N   . VAL A 1 447 ? 10.587  78.103 54.953 1.00 15.23 ? 447 VAL A N   1 
ATOM   3420 C CA  . VAL A 1 447 ? 10.097  77.751 53.637 1.00 11.34 ? 447 VAL A CA  1 
ATOM   3421 C C   . VAL A 1 447 ? 8.867   78.578 53.236 1.00 13.43 ? 447 VAL A C   1 
ATOM   3422 O O   . VAL A 1 447 ? 8.675   78.844 52.058 1.00 18.88 ? 447 VAL A O   1 
ATOM   3423 C CB  . VAL A 1 447 ? 9.843   76.228 53.599 1.00 9.38  ? 447 VAL A CB  1 
ATOM   3424 C CG1 . VAL A 1 447 ? 9.027   75.750 52.392 1.00 4.32  ? 447 VAL A CG1 1 
ATOM   3425 C CG2 . VAL A 1 447 ? 11.168  75.435 53.691 1.00 3.90  ? 447 VAL A CG2 1 
ATOM   3426 N N   . PHE A 1 448 ? 8.042   78.981 54.207 1.00 4.53  ? 448 PHE A N   1 
ATOM   3427 C CA  . PHE A 1 448 ? 6.869   79.755 53.840 1.00 3.52  ? 448 PHE A CA  1 
ATOM   3428 C C   . PHE A 1 448 ? 7.071   81.254 53.952 1.00 7.21  ? 448 PHE A C   1 
ATOM   3429 O O   . PHE A 1 448 ? 6.141   82.041 53.829 1.00 10.21 ? 448 PHE A O   1 
ATOM   3430 C CB  . PHE A 1 448 ? 5.622   79.283 54.591 1.00 3.13  ? 448 PHE A CB  1 
ATOM   3431 C CG  . PHE A 1 448 ? 4.956   78.088 53.952 1.00 3.83  ? 448 PHE A CG  1 
ATOM   3432 C CD1 . PHE A 1 448 ? 5.567   76.827 53.991 1.00 2.43  ? 448 PHE A CD1 1 
ATOM   3433 C CD2 . PHE A 1 448 ? 3.705   78.237 53.307 1.00 6.22  ? 448 PHE A CD2 1 
ATOM   3434 C CE1 . PHE A 1 448 ? 4.929   75.722 53.393 1.00 9.88  ? 448 PHE A CE1 1 
ATOM   3435 C CE2 . PHE A 1 448 ? 3.070   77.138 52.709 1.00 5.13  ? 448 PHE A CE2 1 
ATOM   3436 C CZ  . PHE A 1 448 ? 3.685   75.876 52.751 1.00 8.76  ? 448 PHE A CZ  1 
ATOM   3437 N N   . GLY A 1 449 ? 8.302   81.669 54.212 1.00 12.35 ? 449 GLY A N   1 
ATOM   3438 C CA  . GLY A 1 449 ? 8.601   83.113 54.262 1.00 19.06 ? 449 GLY A CA  1 
ATOM   3439 C C   . GLY A 1 449 ? 8.035   83.979 55.378 1.00 22.16 ? 449 GLY A C   1 
ATOM   3440 O O   . GLY A 1 449 ? 7.885   85.192 55.224 1.00 23.38 ? 449 GLY A O   1 
ATOM   3441 N N   . LEU A 1 450 ? 7.735   83.363 56.538 1.00 23.86 ? 450 LEU A N   1 
ATOM   3442 C CA  . LEU A 1 450 ? 7.219   84.190 57.634 1.00 20.32 ? 450 LEU A CA  1 
ATOM   3443 C C   . LEU A 1 450 ? 8.256   85.211 58.121 1.00 17.70 ? 450 LEU A C   1 
ATOM   3444 O O   . LEU A 1 450 ? 7.883   86.310 58.488 1.00 16.68 ? 450 LEU A O   1 
ATOM   3445 C CB  . LEU A 1 450 ? 6.676   83.381 58.824 1.00 18.87 ? 450 LEU A CB  1 
ATOM   3446 C CG  . LEU A 1 450 ? 5.459   82.475 58.544 1.00 19.02 ? 450 LEU A CG  1 
ATOM   3447 C CD1 . LEU A 1 450 ? 4.479   82.480 59.723 1.00 23.46 ? 450 LEU A CD1 1 
ATOM   3448 C CD2 . LEU A 1 450 ? 4.688   82.824 57.271 1.00 23.14 ? 450 LEU A CD2 1 
ATOM   3449 N N   . PRO A 1 451 ? 9.564   84.906 58.111 1.00 16.06 ? 451 PRO A N   1 
ATOM   3450 C CA  . PRO A 1 451 ? 10.523  85.973 58.367 1.00 20.20 ? 451 PRO A CA  1 
ATOM   3451 C C   . PRO A 1 451 ? 10.389  87.265 57.568 1.00 25.32 ? 451 PRO A C   1 
ATOM   3452 O O   . PRO A 1 451 ? 10.988  88.278 57.919 1.00 30.73 ? 451 PRO A O   1 
ATOM   3453 C CB  . PRO A 1 451 ? 11.898  85.312 58.167 1.00 16.42 ? 451 PRO A CB  1 
ATOM   3454 C CG  . PRO A 1 451 ? 11.663  83.804 58.374 1.00 13.92 ? 451 PRO A CG  1 
ATOM   3455 C CD  . PRO A 1 451 ? 10.182  83.586 58.012 1.00 15.33 ? 451 PRO A CD  1 
ATOM   3456 N N   . LEU A 1 452 ? 9.636   87.218 56.456 1.00 30.14 ? 452 LEU A N   1 
ATOM   3457 C CA  . LEU A 1 452 ? 9.477   88.436 55.666 1.00 31.12 ? 452 LEU A CA  1 
ATOM   3458 C C   . LEU A 1 452 ? 8.561   89.402 56.374 1.00 32.76 ? 452 LEU A C   1 
ATOM   3459 O O   . LEU A 1 452 ? 8.601   90.608 56.162 1.00 34.65 ? 452 LEU A O   1 
ATOM   3460 C CB  . LEU A 1 452 ? 8.945   88.149 54.262 1.00 28.34 ? 452 LEU A CB  1 
ATOM   3461 C CG  . LEU A 1 452 ? 9.855   87.242 53.419 1.00 25.04 ? 452 LEU A CG  1 
ATOM   3462 C CD1 . LEU A 1 452 ? 9.640   87.572 51.947 1.00 29.84 ? 452 LEU A CD1 1 
ATOM   3463 C CD2 . LEU A 1 452 ? 11.347  87.363 53.738 1.00 21.13 ? 452 LEU A CD2 1 
ATOM   3464 N N   . VAL A 1 453 ? 7.715   88.831 57.230 1.00 33.50 ? 453 VAL A N   1 
ATOM   3465 C CA  . VAL A 1 453 ? 6.785   89.616 58.003 1.00 35.18 ? 453 VAL A CA  1 
ATOM   3466 C C   . VAL A 1 453 ? 7.585   90.214 59.143 1.00 37.58 ? 453 VAL A C   1 
ATOM   3467 O O   . VAL A 1 453 ? 7.915   89.555 60.116 1.00 41.33 ? 453 VAL A O   1 
ATOM   3468 C CB  . VAL A 1 453 ? 5.670   88.683 58.497 1.00 33.52 ? 453 VAL A CB  1 
ATOM   3469 C CG1 . VAL A 1 453 ? 4.555   89.448 59.213 1.00 36.53 ? 453 VAL A CG1 1 
ATOM   3470 C CG2 . VAL A 1 453 ? 5.056   87.869 57.338 1.00 35.81 ? 453 VAL A CG2 1 
ATOM   3471 N N   . LYS A 1 454 ? 7.877   91.503 59.035 1.00 42.92 ? 454 LYS A N   1 
ATOM   3472 C CA  . LYS A 1 454 ? 8.669   92.165 60.076 1.00 47.90 ? 454 LYS A CA  1 
ATOM   3473 C C   . LYS A 1 454 ? 8.020   92.125 61.467 1.00 47.66 ? 454 LYS A C   1 
ATOM   3474 O O   . LYS A 1 454 ? 8.691   92.052 62.489 1.00 47.79 ? 454 LYS A O   1 
ATOM   3475 C CB  . LYS A 1 454 ? 9.056   93.591 59.627 1.00 51.97 ? 454 LYS A CB  1 
ATOM   3476 C CG  . LYS A 1 454 ? 9.627   93.678 58.174 1.00 61.84 ? 454 LYS A CG  1 
ATOM   3477 C CD  . LYS A 1 454 ? 11.067  93.135 57.962 1.00 65.28 ? 454 LYS A CD  1 
ATOM   3478 C CE  . LYS A 1 454 ? 11.212  91.600 57.792 1.00 69.26 ? 454 LYS A CE  1 
ATOM   3479 N NZ  . LYS A 1 454 ? 12.612  91.209 57.883 1.00 74.01 ? 454 LYS A NZ  1 
ATOM   3480 N N   . GLU A 1 455 ? 6.675   92.124 61.481 1.00 45.37 ? 455 GLU A N   1 
ATOM   3481 C CA  . GLU A 1 455 ? 5.960   92.071 62.763 1.00 38.25 ? 455 GLU A CA  1 
ATOM   3482 C C   . GLU A 1 455 ? 6.248   90.803 63.540 1.00 35.88 ? 455 GLU A C   1 
ATOM   3483 O O   . GLU A 1 455 ? 5.957   90.725 64.719 1.00 37.11 ? 455 GLU A O   1 
ATOM   3484 C CB  . GLU A 1 455 ? 4.420   92.127 62.657 1.00 37.95 ? 455 GLU A CB  1 
ATOM   3485 N N   . LEU A 1 456 ? 6.810   89.791 62.886 1.00 31.87 ? 456 LEU A N   1 
ATOM   3486 C CA  . LEU A 1 456 ? 7.071   88.568 63.621 1.00 30.70 ? 456 LEU A CA  1 
ATOM   3487 C C   . LEU A 1 456 ? 8.401   88.558 64.368 1.00 32.17 ? 456 LEU A C   1 
ATOM   3488 O O   . LEU A 1 456 ? 8.719   87.593 65.061 1.00 30.98 ? 456 LEU A O   1 
ATOM   3489 C CB  . LEU A 1 456 ? 6.879   87.370 62.708 1.00 30.84 ? 456 LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 456 ? 5.485   87.371 62.068 1.00 31.62 ? 456 LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 456 ? 5.310   86.161 61.149 1.00 36.79 ? 456 LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 456 ? 4.328   87.460 63.076 1.00 27.13 ? 456 LEU A CD2 1 
ATOM   3493 N N   . ASN A 1 457 ? 9.185   89.624 64.218 1.00 31.39 ? 457 ASN A N   1 
ATOM   3494 C CA  . ASN A 1 457 ? 10.453  89.752 64.958 1.00 35.14 ? 457 ASN A CA  1 
ATOM   3495 C C   . ASN A 1 457 ? 11.590  88.804 64.619 1.00 32.17 ? 457 ASN A C   1 
ATOM   3496 O O   . ASN A 1 457 ? 12.171  88.197 65.517 1.00 32.00 ? 457 ASN A O   1 
ATOM   3497 C CB  . ASN A 1 457 ? 10.273  89.624 66.508 1.00 43.52 ? 457 ASN A CB  1 
ATOM   3498 C CG  . ASN A 1 457 ? 9.348   90.650 67.137 1.00 49.23 ? 457 ASN A CG  1 
ATOM   3499 O OD1 . ASN A 1 457 ? 9.710   91.802 67.325 1.00 54.33 ? 457 ASN A OD1 1 
ATOM   3500 N ND2 . ASN A 1 457 ? 8.133   90.219 67.469 1.00 51.90 ? 457 ASN A ND2 1 
ATOM   3501 N N   . TYR A 1 458 ? 11.913  88.633 63.338 1.00 28.42 ? 458 TYR A N   1 
ATOM   3502 C CA  . TYR A 1 458 ? 13.045  87.738 63.059 1.00 25.04 ? 458 TYR A CA  1 
ATOM   3503 C C   . TYR A 1 458 ? 14.182  88.661 62.723 1.00 24.07 ? 458 TYR A C   1 
ATOM   3504 O O   . TYR A 1 458 ? 13.974  89.827 62.420 1.00 25.65 ? 458 TYR A O   1 
ATOM   3505 C CB  . TYR A 1 458 ? 12.794  86.785 61.881 1.00 20.00 ? 458 TYR A CB  1 
ATOM   3506 C CG  . TYR A 1 458 ? 11.774  85.705 62.144 1.00 15.51 ? 458 TYR A CG  1 
ATOM   3507 C CD1 . TYR A 1 458 ? 10.402  85.989 61.988 1.00 15.40 ? 458 TYR A CD1 1 
ATOM   3508 C CD2 . TYR A 1 458 ? 12.175  84.390 62.453 1.00 12.32 ? 458 TYR A CD2 1 
ATOM   3509 C CE1 . TYR A 1 458 ? 9.447   84.962 62.057 1.00 11.67 ? 458 TYR A CE1 1 
ATOM   3510 C CE2 . TYR A 1 458 ? 11.221  83.364 62.531 1.00 12.05 ? 458 TYR A CE2 1 
ATOM   3511 C CZ  . TYR A 1 458 ? 9.861   83.644 62.307 1.00 12.36 ? 458 TYR A CZ  1 
ATOM   3512 O OH  . TYR A 1 458 ? 8.926   82.623 62.289 1.00 16.52 ? 458 TYR A OH  1 
ATOM   3513 N N   . THR A 1 459 ? 15.397  88.146 62.764 1.00 25.51 ? 459 THR A N   1 
ATOM   3514 C CA  . THR A 1 459 ? 16.491  89.042 62.421 1.00 30.49 ? 459 THR A CA  1 
ATOM   3515 C C   . THR A 1 459 ? 16.556  89.189 60.907 1.00 34.22 ? 459 THR A C   1 
ATOM   3516 O O   . THR A 1 459 ? 16.074  88.354 60.138 1.00 38.20 ? 459 THR A O   1 
ATOM   3517 C CB  . THR A 1 459 ? 17.828  88.505 62.978 1.00 31.63 ? 459 THR A CB  1 
ATOM   3518 O OG1 . THR A 1 459 ? 18.006  87.127 62.639 1.00 32.54 ? 459 THR A OG1 1 
ATOM   3519 C CG2 . THR A 1 459 ? 17.895  88.568 64.503 1.00 37.27 ? 459 THR A CG2 1 
ATOM   3520 N N   . ALA A 1 460 ? 17.256  90.250 60.485 1.00 35.28 ? 460 ALA A N   1 
ATOM   3521 C CA  . ALA A 1 460 ? 17.392  90.463 59.049 1.00 31.19 ? 460 ALA A CA  1 
ATOM   3522 C C   . ALA A 1 460 ? 18.147  89.318 58.423 1.00 31.00 ? 460 ALA A C   1 
ATOM   3523 O O   . ALA A 1 460 ? 17.868  88.901 57.311 1.00 36.66 ? 460 ALA A O   1 
ATOM   3524 C CB  . ALA A 1 460 ? 18.138  91.756 58.740 1.00 31.44 ? 460 ALA A CB  1 
ATOM   3525 N N   . GLU A 1 461 ? 19.120  88.794 59.182 1.00 26.39 ? 461 GLU A N   1 
ATOM   3526 C CA  . GLU A 1 461 ? 19.890  87.674 58.654 1.00 23.78 ? 461 GLU A CA  1 
ATOM   3527 C C   . GLU A 1 461 ? 18.974  86.461 58.393 1.00 23.06 ? 461 GLU A C   1 
ATOM   3528 O O   . GLU A 1 461 ? 19.246  85.601 57.572 1.00 26.98 ? 461 GLU A O   1 
ATOM   3529 C CB  . GLU A 1 461 ? 21.064  87.271 59.585 1.00 25.76 ? 461 GLU A CB  1 
ATOM   3530 C CG  . GLU A 1 461 ? 21.864  88.405 60.275 1.00 31.33 ? 461 GLU A CG  1 
ATOM   3531 N N   . GLU A 1 462 ? 17.866  86.374 59.133 1.00 22.80 ? 462 GLU A N   1 
ATOM   3532 C CA  . GLU A 1 462 ? 16.933  85.262 58.938 1.00 22.36 ? 462 GLU A CA  1 
ATOM   3533 C C   . GLU A 1 462 ? 16.067  85.557 57.749 1.00 23.82 ? 462 GLU A C   1 
ATOM   3534 O O   . GLU A 1 462 ? 15.620  84.657 57.053 1.00 26.24 ? 462 GLU A O   1 
ATOM   3535 C CB  . GLU A 1 462 ? 16.067  85.018 60.182 1.00 19.23 ? 462 GLU A CB  1 
ATOM   3536 C CG  . GLU A 1 462 ? 16.911  84.411 61.317 1.00 16.08 ? 462 GLU A CG  1 
ATOM   3537 C CD  . GLU A 1 462 ? 16.242  84.428 62.681 1.00 16.57 ? 462 GLU A CD  1 
ATOM   3538 O OE1 . GLU A 1 462 ? 15.343  85.249 62.900 1.00 10.48 ? 462 GLU A OE1 1 
ATOM   3539 O OE2 . GLU A 1 462 ? 16.636  83.613 63.518 1.00 6.73  ? 462 GLU A OE2 1 
ATOM   3540 N N   . GLU A 1 463 ? 15.804  86.853 57.519 1.00 26.21 ? 463 GLU A N   1 
ATOM   3541 C CA  . GLU A 1 463 ? 15.000  87.209 56.343 1.00 27.74 ? 463 GLU A CA  1 
ATOM   3542 C C   . GLU A 1 463 ? 15.748  86.741 55.097 1.00 24.31 ? 463 GLU A C   1 
ATOM   3543 O O   . GLU A 1 463 ? 15.214  86.181 54.152 1.00 23.26 ? 463 GLU A O   1 
ATOM   3544 C CB  . GLU A 1 463 ? 14.741  88.720 56.214 1.00 33.13 ? 463 GLU A CB  1 
ATOM   3545 C CG  . GLU A 1 463 ? 13.667  88.991 55.142 1.00 43.02 ? 463 GLU A CG  1 
ATOM   3546 C CD  . GLU A 1 463 ? 13.678  90.403 54.567 1.00 49.44 ? 463 GLU A CD  1 
ATOM   3547 O OE1 . GLU A 1 463 ? 14.724  90.820 54.065 1.00 55.82 ? 463 GLU A OE1 1 
ATOM   3548 O OE2 . GLU A 1 463 ? 12.639  91.071 54.602 1.00 52.07 ? 463 GLU A OE2 1 
ATOM   3549 N N   . ALA A 1 464 ? 17.053  86.988 55.147 1.00 21.45 ? 464 ALA A N   1 
ATOM   3550 C CA  . ALA A 1 464 ? 17.904  86.571 54.059 1.00 17.40 ? 464 ALA A CA  1 
ATOM   3551 C C   . ALA A 1 464 ? 17.806  85.072 53.872 1.00 16.84 ? 464 ALA A C   1 
ATOM   3552 O O   . ALA A 1 464 ? 17.625  84.578 52.772 1.00 23.96 ? 464 ALA A O   1 
ATOM   3553 C CB  . ALA A 1 464 ? 19.359  86.947 54.361 1.00 18.00 ? 464 ALA A CB  1 
ATOM   3554 N N   . LEU A 1 465 ? 17.917  84.353 54.990 1.00 14.92 ? 465 LEU A N   1 
ATOM   3555 C CA  . LEU A 1 465 ? 17.840  82.901 54.957 1.00 11.99 ? 465 LEU A CA  1 
ATOM   3556 C C   . LEU A 1 465 ? 16.538  82.392 54.346 1.00 13.91 ? 465 LEU A C   1 
ATOM   3557 O O   . LEU A 1 465 ? 16.581  81.508 53.502 1.00 14.21 ? 465 LEU A O   1 
ATOM   3558 C CB  . LEU A 1 465 ? 18.063  82.291 56.357 1.00 10.67 ? 465 LEU A CB  1 
ATOM   3559 C CG  . LEU A 1 465 ? 18.192  80.753 56.381 1.00 11.62 ? 465 LEU A CG  1 
ATOM   3560 C CD1 . LEU A 1 465 ? 19.344  80.255 55.509 1.00 19.35 ? 465 LEU A CD1 1 
ATOM   3561 C CD2 . LEU A 1 465 ? 18.403  80.203 57.788 1.00 11.16 ? 465 LEU A CD2 1 
ATOM   3562 N N   . SER A 1 466 ? 15.367  82.933 54.737 1.00 12.62 ? 466 SER A N   1 
ATOM   3563 C CA  . SER A 1 466 ? 14.166  82.366 54.110 1.00 17.34 ? 466 SER A CA  1 
ATOM   3564 C C   . SER A 1 466 ? 14.102  82.694 52.637 1.00 22.63 ? 466 SER A C   1 
ATOM   3565 O O   . SER A 1 466 ? 13.545  81.933 51.858 1.00 26.36 ? 466 SER A O   1 
ATOM   3566 C CB  . SER A 1 466 ? 12.832  82.685 54.780 1.00 14.63 ? 466 SER A CB  1 
ATOM   3567 O OG  . SER A 1 466 ? 12.762  84.077 55.007 1.00 25.19 ? 466 SER A OG  1 
ATOM   3568 N N   . ARG A 1 467 ? 14.675  83.836 52.233 1.00 22.38 ? 467 ARG A N   1 
ATOM   3569 C CA  . ARG A 1 467 ? 14.612  84.090 50.803 1.00 20.89 ? 467 ARG A CA  1 
ATOM   3570 C C   . ARG A 1 467 ? 15.467  83.065 50.051 1.00 20.90 ? 467 ARG A C   1 
ATOM   3571 O O   . ARG A 1 467 ? 15.126  82.650 48.949 1.00 22.37 ? 467 ARG A O   1 
ATOM   3572 C CB  . ARG A 1 467 ? 15.008  85.515 50.486 1.00 20.62 ? 467 ARG A CB  1 
ATOM   3573 C CG  . ARG A 1 467 ? 14.021  86.543 51.059 1.00 24.03 ? 467 ARG A CG  1 
ATOM   3574 C CD  . ARG A 1 467 ? 14.477  87.965 50.698 1.00 29.71 ? 467 ARG A CD  1 
ATOM   3575 N NE  . ARG A 1 467 ? 13.686  88.998 51.343 1.00 34.93 ? 467 ARG A NE  1 
ATOM   3576 C CZ  . ARG A 1 467 ? 12.560  89.506 50.812 1.00 36.36 ? 467 ARG A CZ  1 
ATOM   3577 N NH1 . ARG A 1 467 ? 12.048  89.034 49.678 1.00 36.65 ? 467 ARG A NH1 1 
ATOM   3578 N NH2 . ARG A 1 467 ? 11.944  90.507 51.441 1.00 40.08 ? 467 ARG A NH2 1 
ATOM   3579 N N   . ARG A 1 468 ? 16.576  82.636 50.669 1.00 17.65 ? 468 ARG A N   1 
ATOM   3580 C CA  . ARG A 1 468 ? 17.387  81.648 49.973 1.00 19.11 ? 468 ARG A CA  1 
ATOM   3581 C C   . ARG A 1 468 ? 16.678  80.334 49.900 1.00 20.33 ? 468 ARG A C   1 
ATOM   3582 O O   . ARG A 1 468 ? 16.709  79.626 48.903 1.00 22.41 ? 468 ARG A O   1 
ATOM   3583 C CB  . ARG A 1 468 ? 18.738  81.360 50.640 1.00 18.67 ? 468 ARG A CB  1 
ATOM   3584 C CG  . ARG A 1 468 ? 19.467  82.632 51.088 1.00 28.44 ? 468 ARG A CG  1 
ATOM   3585 C CD  . ARG A 1 468 ? 21.002  82.519 51.106 1.00 34.04 ? 468 ARG A CD  1 
ATOM   3586 N NE  . ARG A 1 468 ? 21.519  81.658 52.167 1.00 40.98 ? 468 ARG A NE  1 
ATOM   3587 C CZ  . ARG A 1 468 ? 21.745  80.345 51.975 1.00 44.67 ? 468 ARG A CZ  1 
ATOM   3588 N NH1 . ARG A 1 468 ? 21.341  79.745 50.866 1.00 46.16 ? 468 ARG A NH1 1 
ATOM   3589 N NH2 . ARG A 1 468 ? 22.383  79.621 52.895 1.00 46.32 ? 468 ARG A NH2 1 
ATOM   3590 N N   . ILE A 1 469 ? 16.030  80.025 51.022 1.00 20.68 ? 469 ILE A N   1 
ATOM   3591 C CA  . ILE A 1 469 ? 15.311  78.769 51.105 1.00 19.33 ? 469 ILE A CA  1 
ATOM   3592 C C   . ILE A 1 469 ? 14.193  78.758 50.084 1.00 19.36 ? 469 ILE A C   1 
ATOM   3593 O O   . ILE A 1 469 ? 14.060  77.842 49.284 1.00 23.77 ? 469 ILE A O   1 
ATOM   3594 C CB  . ILE A 1 469 ? 14.783  78.529 52.537 1.00 17.87 ? 469 ILE A CB  1 
ATOM   3595 C CG1 . ILE A 1 469 ? 15.877  78.713 53.626 1.00 17.95 ? 469 ILE A CG1 1 
ATOM   3596 C CG2 . ILE A 1 469 ? 14.077  77.177 52.658 1.00 17.95 ? 469 ILE A CG2 1 
ATOM   3597 C CD1 . ILE A 1 469 ? 16.398  77.436 54.273 1.00 10.76 ? 469 ILE A CD1 1 
ATOM   3598 N N   . MET A 1 470 ? 13.390  79.821 50.110 1.00 16.41 ? 470 MET A N   1 
ATOM   3599 C CA  . MET A 1 470 ? 12.270  79.928 49.189 1.00 16.31 ? 470 MET A CA  1 
ATOM   3600 C C   . MET A 1 470 ? 12.703  79.892 47.736 1.00 16.06 ? 470 MET A C   1 
ATOM   3601 O O   . MET A 1 470 ? 11.992  79.431 46.852 1.00 13.24 ? 470 MET A O   1 
ATOM   3602 C CB  . MET A 1 470 ? 11.493  81.220 49.444 1.00 14.61 ? 470 MET A CB  1 
ATOM   3603 C CG  . MET A 1 470 ? 10.687  81.174 50.737 1.00 15.84 ? 470 MET A CG  1 
ATOM   3604 S SD  . MET A 1 470 ? 9.476   82.526 50.688 1.00 15.15 ? 470 MET A SD  1 
ATOM   3605 C CE  . MET A 1 470 ? 10.636  83.920 50.863 1.00 15.78 ? 470 MET A CE  1 
ATOM   3606 N N   . HIS A 1 471 ? 13.896  80.417 47.493 1.00 17.20 ? 471 HIS A N   1 
ATOM   3607 C CA  . HIS A 1 471 ? 14.352  80.401 46.118 1.00 21.69 ? 471 HIS A CA  1 
ATOM   3608 C C   . HIS A 1 471 ? 14.757  78.995 45.748 1.00 20.45 ? 471 HIS A C   1 
ATOM   3609 O O   . HIS A 1 471 ? 14.348  78.472 44.731 1.00 20.20 ? 471 HIS A O   1 
ATOM   3610 C CB  . HIS A 1 471 ? 15.475  81.429 45.913 1.00 29.47 ? 471 HIS A CB  1 
ATOM   3611 C CG  . HIS A 1 471 ? 15.657  81.781 44.446 1.00 33.27 ? 471 HIS A CG  1 
ATOM   3612 N ND1 . HIS A 1 471 ? 14.668  82.211 43.634 1.00 33.46 ? 471 HIS A ND1 1 
ATOM   3613 C CD2 . HIS A 1 471 ? 16.854  81.743 43.693 1.00 34.65 ? 471 HIS A CD2 1 
ATOM   3614 C CE1 . HIS A 1 471 ? 15.227  82.430 42.433 1.00 37.54 ? 471 HIS A CE1 1 
ATOM   3615 N NE2 . HIS A 1 471 ? 16.548  82.159 42.446 1.00 37.05 ? 471 HIS A NE2 1 
ATOM   3616 N N   . TYR A 1 472 ? 15.524  78.353 46.625 1.00 21.14 ? 472 TYR A N   1 
ATOM   3617 C CA  . TYR A 1 472 ? 15.949  76.982 46.342 1.00 19.71 ? 472 TYR A CA  1 
ATOM   3618 C C   . TYR A 1 472 ? 14.750  76.076 46.083 1.00 20.98 ? 472 TYR A C   1 
ATOM   3619 O O   . TYR A 1 472 ? 14.714  75.220 45.206 1.00 22.37 ? 472 TYR A O   1 
ATOM   3620 C CB  . TYR A 1 472 ? 16.667  76.379 47.569 1.00 20.34 ? 472 TYR A CB  1 
ATOM   3621 C CG  . TYR A 1 472 ? 18.070  76.843 47.860 1.00 23.95 ? 472 TYR A CG  1 
ATOM   3622 C CD1 . TYR A 1 472 ? 18.992  77.017 46.826 1.00 24.90 ? 472 TYR A CD1 1 
ATOM   3623 C CD2 . TYR A 1 472 ? 18.484  77.038 49.186 1.00 26.94 ? 472 TYR A CD2 1 
ATOM   3624 C CE1 . TYR A 1 472 ? 20.319  77.345 47.103 1.00 26.10 ? 472 TYR A CE1 1 
ATOM   3625 C CE2 . TYR A 1 472 ? 19.814  77.368 49.468 1.00 30.01 ? 472 TYR A CE2 1 
ATOM   3626 C CZ  . TYR A 1 472 ? 20.740  77.515 48.424 1.00 30.84 ? 472 TYR A CZ  1 
ATOM   3627 O OH  . TYR A 1 472 ? 22.066  77.823 48.690 1.00 36.97 ? 472 TYR A OH  1 
ATOM   3628 N N   . TRP A 1 473 ? 13.744  76.283 46.923 1.00 18.72 ? 473 TRP A N   1 
ATOM   3629 C CA  . TRP A 1 473 ? 12.550  75.483 46.804 1.00 20.30 ? 473 TRP A CA  1 
ATOM   3630 C C   . TRP A 1 473 ? 11.855  75.781 45.475 1.00 20.82 ? 473 TRP A C   1 
ATOM   3631 O O   . TRP A 1 473 ? 11.469  74.865 44.757 1.00 22.52 ? 473 TRP A O   1 
ATOM   3632 C CB  . TRP A 1 473 ? 11.611  75.704 48.027 1.00 17.97 ? 473 TRP A CB  1 
ATOM   3633 C CG  . TRP A 1 473 ? 11.772  74.677 49.157 1.00 18.66 ? 473 TRP A CG  1 
ATOM   3634 C CD1 . TRP A 1 473 ? 10.715  73.896 49.684 1.00 15.00 ? 473 TRP A CD1 1 
ATOM   3635 C CD2 . TRP A 1 473 ? 12.930  74.304 49.885 1.00 16.88 ? 473 TRP A CD2 1 
ATOM   3636 N NE1 . TRP A 1 473 ? 11.154  73.078 50.675 1.00 14.33 ? 473 TRP A NE1 1 
ATOM   3637 C CE2 . TRP A 1 473 ? 12.501  73.272 50.857 1.00 13.46 ? 473 TRP A CE2 1 
ATOM   3638 C CE3 . TRP A 1 473 ? 14.272  74.684 49.864 1.00 18.34 ? 473 TRP A CE3 1 
ATOM   3639 C CZ2 . TRP A 1 473 ? 13.458  72.703 51.715 1.00 10.94 ? 473 TRP A CZ2 1 
ATOM   3640 C CZ3 . TRP A 1 473 ? 15.204  74.093 50.741 1.00 15.94 ? 473 TRP A CZ3 1 
ATOM   3641 C CH2 . TRP A 1 473 ? 14.797  73.118 51.659 1.00 13.44 ? 473 TRP A CH2 1 
ATOM   3642 N N   . ALA A 1 474 ? 11.725  77.080 45.143 1.00 18.06 ? 474 ALA A N   1 
ATOM   3643 C CA  . ALA A 1 474 ? 11.038  77.443 43.897 1.00 12.46 ? 474 ALA A CA  1 
ATOM   3644 C C   . ALA A 1 474 ? 11.815  76.997 42.682 1.00 10.86 ? 474 ALA A C   1 
ATOM   3645 O O   . ALA A 1 474 ? 11.290  76.292 41.835 1.00 13.28 ? 474 ALA A O   1 
ATOM   3646 C CB  . ALA A 1 474 ? 10.740  78.933 43.835 1.00 11.11 ? 474 ALA A CB  1 
ATOM   3647 N N   . THR A 1 475 ? 13.074  77.399 42.593 1.00 7.89  ? 475 THR A N   1 
ATOM   3648 C CA  . THR A 1 475 ? 13.950  77.014 41.495 1.00 9.64  ? 475 THR A CA  1 
ATOM   3649 C C   . THR A 1 475 ? 14.029  75.501 41.324 1.00 12.78 ? 475 THR A C   1 
ATOM   3650 O O   . THR A 1 475 ? 14.080  74.974 40.219 1.00 12.13 ? 475 THR A O   1 
ATOM   3651 C CB  . THR A 1 475 ? 15.327  77.597 41.792 1.00 7.84  ? 475 THR A CB  1 
ATOM   3652 O OG1 . THR A 1 475 ? 15.073  78.985 41.895 1.00 11.47 ? 475 THR A OG1 1 
ATOM   3653 C CG2 . THR A 1 475 ? 16.398  77.356 40.722 1.00 6.36  ? 475 THR A CG2 1 
ATOM   3654 N N   . PHE A 1 476 ? 14.034  74.766 42.439 1.00 16.53 ? 476 PHE A N   1 
ATOM   3655 C CA  . PHE A 1 476 ? 14.063  73.322 42.254 1.00 16.97 ? 476 PHE A CA  1 
ATOM   3656 C C   . PHE A 1 476 ? 12.729  72.858 41.634 1.00 19.25 ? 476 PHE A C   1 
ATOM   3657 O O   . PHE A 1 476 ? 12.684  71.957 40.806 1.00 20.45 ? 476 PHE A O   1 
ATOM   3658 C CB  . PHE A 1 476 ? 14.322  72.604 43.592 1.00 14.69 ? 476 PHE A CB  1 
ATOM   3659 C CG  . PHE A 1 476 ? 14.130  71.110 43.470 1.00 8.02  ? 476 PHE A CG  1 
ATOM   3660 C CD1 . PHE A 1 476 ? 15.191  70.290 43.041 1.00 8.40  ? 476 PHE A CD1 1 
ATOM   3661 C CD2 . PHE A 1 476 ? 12.871  70.541 43.736 1.00 2.00  ? 476 PHE A CD2 1 
ATOM   3662 C CE1 . PHE A 1 476 ? 14.993  68.913 42.870 1.00 8.04  ? 476 PHE A CE1 1 
ATOM   3663 C CE2 . PHE A 1 476 ? 12.666  69.171 43.563 1.00 2.00  ? 476 PHE A CE2 1 
ATOM   3664 C CZ  . PHE A 1 476 ? 13.726  68.359 43.132 1.00 8.31  ? 476 PHE A CZ  1 
ATOM   3665 N N   . ALA A 1 477 ? 11.641  73.498 42.056 1.00 19.29 ? 477 ALA A N   1 
ATOM   3666 C CA  . ALA A 1 477 ? 10.344  73.088 41.528 1.00 23.33 ? 477 ALA A CA  1 
ATOM   3667 C C   . ALA A 1 477 ? 10.208  73.333 40.055 1.00 25.47 ? 477 ALA A C   1 
ATOM   3668 O O   . ALA A 1 477 ? 9.512   72.608 39.359 1.00 31.09 ? 477 ALA A O   1 
ATOM   3669 C CB  . ALA A 1 477 ? 9.185   73.787 42.257 1.00 21.87 ? 477 ALA A CB  1 
ATOM   3670 N N   . LYS A 1 478 ? 10.871  74.396 39.589 1.00 25.09 ? 478 LYS A N   1 
ATOM   3671 C CA  . LYS A 1 478 ? 10.770  74.689 38.160 1.00 23.32 ? 478 LYS A CA  1 
ATOM   3672 C C   . LYS A 1 478 ? 11.755  73.867 37.357 1.00 20.81 ? 478 LYS A C   1 
ATOM   3673 O O   . LYS A 1 478 ? 11.423  73.053 36.521 1.00 26.35 ? 478 LYS A O   1 
ATOM   3674 C CB  . LYS A 1 478 ? 11.013  76.172 37.858 1.00 24.55 ? 478 LYS A CB  1 
ATOM   3675 C CG  . LYS A 1 478 ? 10.290  77.145 38.788 1.00 27.31 ? 478 LYS A CG  1 
ATOM   3676 C CD  . LYS A 1 478 ? 10.070  78.487 38.068 1.00 36.59 ? 478 LYS A CD  1 
ATOM   3677 N N   . THR A 1 479 ? 13.002  74.130 37.645 1.00 15.01 ? 479 THR A N   1 
ATOM   3678 C CA  . THR A 1 479 ? 14.102  73.509 36.995 1.00 13.07 ? 479 THR A CA  1 
ATOM   3679 C C   . THR A 1 479 ? 14.392  72.091 37.362 1.00 16.43 ? 479 THR A C   1 
ATOM   3680 O O   . THR A 1 479 ? 14.615  71.263 36.499 1.00 22.36 ? 479 THR A O   1 
ATOM   3681 C CB  . THR A 1 479 ? 15.332  74.313 37.420 1.00 13.16 ? 479 THR A CB  1 
ATOM   3682 O OG1 . THR A 1 479 ? 15.090  75.645 37.005 1.00 20.56 ? 479 THR A OG1 1 
ATOM   3683 C CG2 . THR A 1 479 ? 16.670  73.866 36.836 1.00 19.93 ? 479 THR A CG2 1 
ATOM   3684 N N   . GLY A 1 480 ? 14.472  71.805 38.653 1.00 20.24 ? 480 GLY A N   1 
ATOM   3685 C CA  . GLY A 1 480 ? 14.836  70.440 39.044 1.00 16.81 ? 480 GLY A CA  1 
ATOM   3686 C C   . GLY A 1 480 ? 16.209  70.443 39.664 1.00 15.43 ? 480 GLY A C   1 
ATOM   3687 O O   . GLY A 1 480 ? 16.827  69.429 39.964 1.00 16.07 ? 480 GLY A O   1 
ATOM   3688 N N   . ASN A 1 481 ? 16.709  71.653 39.846 1.00 13.23 ? 481 ASN A N   1 
ATOM   3689 C CA  . ASN A 1 481 ? 18.005  71.873 40.445 1.00 15.96 ? 481 ASN A CA  1 
ATOM   3690 C C   . ASN A 1 481 ? 17.730  73.119 41.247 1.00 18.94 ? 481 ASN A C   1 
ATOM   3691 O O   . ASN A 1 481 ? 17.024  73.960 40.705 1.00 22.56 ? 481 ASN A O   1 
ATOM   3692 C CB  . ASN A 1 481 ? 19.029  72.126 39.349 1.00 17.90 ? 481 ASN A CB  1 
ATOM   3693 C CG  . ASN A 1 481 ? 20.375  72.417 39.921 1.00 19.48 ? 481 ASN A CG  1 
ATOM   3694 O OD1 . ASN A 1 481 ? 20.513  73.084 40.924 1.00 25.74 ? 481 ASN A OD1 1 
ATOM   3695 N ND2 . ASN A 1 481 ? 21.399  71.899 39.278 1.00 23.51 ? 481 ASN A ND2 1 
ATOM   3696 N N   . PRO A 1 482 ? 18.168  73.197 42.528 1.00 19.54 ? 482 PRO A N   1 
ATOM   3697 C CA  . PRO A 1 482 ? 17.886  74.366 43.366 1.00 19.34 ? 482 PRO A CA  1 
ATOM   3698 C C   . PRO A 1 482 ? 18.739  75.583 43.049 1.00 21.48 ? 482 PRO A C   1 
ATOM   3699 O O   . PRO A 1 482 ? 18.451  76.700 43.465 1.00 21.62 ? 482 PRO A O   1 
ATOM   3700 C CB  . PRO A 1 482 ? 18.230  73.874 44.785 1.00 18.08 ? 482 PRO A CB  1 
ATOM   3701 C CG  . PRO A 1 482 ? 19.205  72.705 44.604 1.00 16.26 ? 482 PRO A CG  1 
ATOM   3702 C CD  . PRO A 1 482 ? 18.867  72.121 43.238 1.00 17.03 ? 482 PRO A CD  1 
ATOM   3703 N N   . ASN A 1 483 ? 19.846  75.327 42.358 1.00 23.18 ? 483 ASN A N   1 
ATOM   3704 C CA  . ASN A 1 483 ? 20.779  76.374 41.991 1.00 25.35 ? 483 ASN A CA  1 
ATOM   3705 C C   . ASN A 1 483 ? 20.437  77.083 40.708 1.00 29.38 ? 483 ASN A C   1 
ATOM   3706 O O   . ASN A 1 483 ? 20.162  76.487 39.676 1.00 31.96 ? 483 ASN A O   1 
ATOM   3707 C CB  . ASN A 1 483 ? 22.151  75.763 41.699 1.00 22.37 ? 483 ASN A CB  1 
ATOM   3708 C CG  . ASN A 1 483 ? 22.794  75.294 42.960 1.00 25.40 ? 483 ASN A CG  1 
ATOM   3709 O OD1 . ASN A 1 483 ? 22.995  74.115 43.211 1.00 18.89 ? 483 ASN A OD1 1 
ATOM   3710 N ND2 . ASN A 1 483 ? 23.130  76.288 43.791 1.00 27.50 ? 483 ASN A ND2 1 
ATOM   3711 N N   . GLU A 1 484 ? 20.466  78.424 40.773 1.00 34.07 ? 484 GLU A N   1 
ATOM   3712 C CA  . GLU A 1 484 ? 20.242  79.176 39.540 1.00 37.82 ? 484 GLU A CA  1 
ATOM   3713 C C   . GLU A 1 484 ? 21.578  78.951 38.851 1.00 44.50 ? 484 GLU A C   1 
ATOM   3714 O O   . GLU A 1 484 ? 22.560  78.711 39.559 1.00 43.46 ? 484 GLU A O   1 
ATOM   3715 C CB  . GLU A 1 484 ? 20.014  80.696 39.740 1.00 36.04 ? 484 GLU A CB  1 
ATOM   3716 C CG  . GLU A 1 484 ? 18.511  81.037 39.875 1.00 34.11 ? 484 GLU A CG  1 
ATOM   3717 N N   . PRO A 1 485 ? 21.583  79.025 37.500 1.00 50.47 ? 485 PRO A N   1 
ATOM   3718 C CA  . PRO A 1 485 ? 22.850  79.019 36.758 1.00 51.91 ? 485 PRO A CA  1 
ATOM   3719 C C   . PRO A 1 485 ? 23.766  80.205 37.072 1.00 52.65 ? 485 PRO A C   1 
ATOM   3720 O O   . PRO A 1 485 ? 24.981  80.013 37.035 1.00 52.72 ? 485 PRO A O   1 
ATOM   3721 C CB  . PRO A 1 485 ? 22.418  78.986 35.283 1.00 52.01 ? 485 PRO A CB  1 
ATOM   3722 C CG  . PRO A 1 485 ? 20.927  78.579 35.263 1.00 50.28 ? 485 PRO A CG  1 
ATOM   3723 C CD  . PRO A 1 485 ? 20.381  78.905 36.656 1.00 49.49 ? 485 PRO A CD  1 
ATOM   3724 N N   . SER A 1 490 ? 26.591  79.111 46.480 1.00 46.63 ? 490 SER A N   1 
ATOM   3725 C CA  . SER A 1 490 ? 27.530  78.335 45.692 1.00 45.59 ? 490 SER A CA  1 
ATOM   3726 C C   . SER A 1 490 ? 26.698  77.159 45.269 1.00 42.64 ? 490 SER A C   1 
ATOM   3727 O O   . SER A 1 490 ? 25.538  77.111 45.674 1.00 42.60 ? 490 SER A O   1 
ATOM   3728 C CB  . SER A 1 490 ? 28.772  78.073 46.562 1.00 47.19 ? 490 SER A CB  1 
ATOM   3729 O OG  . SER A 1 490 ? 29.102  79.384 47.073 1.00 50.73 ? 490 SER A OG  1 
ATOM   3730 N N   . LYS A 1 491 ? 27.241  76.276 44.447 1.00 38.77 ? 491 LYS A N   1 
ATOM   3731 C CA  . LYS A 1 491 ? 26.402  75.181 44.041 1.00 36.63 ? 491 LYS A CA  1 
ATOM   3732 C C   . LYS A 1 491 ? 26.177  74.297 45.234 1.00 33.13 ? 491 LYS A C   1 
ATOM   3733 O O   . LYS A 1 491 ? 27.062  74.134 46.060 1.00 35.13 ? 491 LYS A O   1 
ATOM   3734 C CB  . LYS A 1 491 ? 27.005  74.422 42.846 1.00 40.99 ? 491 LYS A CB  1 
ATOM   3735 C CG  . LYS A 1 491 ? 27.213  75.311 41.594 1.00 48.99 ? 491 LYS A CG  1 
ATOM   3736 C CD  . LYS A 1 491 ? 25.893  75.808 40.953 1.00 57.24 ? 491 LYS A CD  1 
ATOM   3737 C CE  . LYS A 1 491 ? 26.055  76.967 39.944 1.00 61.63 ? 491 LYS A CE  1 
ATOM   3738 N NZ  . LYS A 1 491 ? 26.300  78.221 40.640 1.00 62.54 ? 491 LYS A NZ  1 
ATOM   3739 N N   . TRP A 1 492 ? 24.951  73.815 45.309 1.00 26.12 ? 492 TRP A N   1 
ATOM   3740 C CA  . TRP A 1 492 ? 24.500  72.929 46.334 1.00 19.00 ? 492 TRP A CA  1 
ATOM   3741 C C   . TRP A 1 492 ? 24.755  71.623 45.588 1.00 18.58 ? 492 TRP A C   1 
ATOM   3742 O O   . TRP A 1 492 ? 24.022  71.332 44.657 1.00 20.29 ? 492 TRP A O   1 
ATOM   3743 C CB  . TRP A 1 492 ? 22.994  73.252 46.571 1.00 11.79 ? 492 TRP A CB  1 
ATOM   3744 C CG  . TRP A 1 492 ? 22.225  72.250 47.431 1.00 10.05 ? 492 TRP A CG  1 
ATOM   3745 C CD1 . TRP A 1 492 ? 22.584  70.919 47.775 1.00 7.17  ? 492 TRP A CD1 1 
ATOM   3746 C CD2 . TRP A 1 492 ? 20.962  72.476 48.003 1.00 6.08  ? 492 TRP A CD2 1 
ATOM   3747 N NE1 . TRP A 1 492 ? 21.616  70.329 48.509 1.00 9.72  ? 492 TRP A NE1 1 
ATOM   3748 C CE2 . TRP A 1 492 ? 20.594  71.219 48.686 1.00 6.70  ? 492 TRP A CE2 1 
ATOM   3749 C CE3 . TRP A 1 492 ? 20.074  73.558 48.020 1.00 9.07  ? 492 TRP A CE3 1 
ATOM   3750 C CZ2 . TRP A 1 492 ? 19.363  71.130 49.348 1.00 5.91  ? 492 TRP A CZ2 1 
ATOM   3751 C CZ3 . TRP A 1 492 ? 18.846  73.430 48.700 1.00 6.97  ? 492 TRP A CZ3 1 
ATOM   3752 C CH2 . TRP A 1 492 ? 18.498  72.235 49.355 1.00 4.77  ? 492 TRP A CH2 1 
ATOM   3753 N N   . PRO A 1 493 ? 25.819  70.870 45.921 1.00 17.27 ? 493 PRO A N   1 
ATOM   3754 C CA  . PRO A 1 493 ? 26.128  69.659 45.145 1.00 19.88 ? 493 PRO A CA  1 
ATOM   3755 C C   . PRO A 1 493 ? 25.022  68.629 45.075 1.00 20.16 ? 493 PRO A C   1 
ATOM   3756 O O   . PRO A 1 493 ? 24.136  68.597 45.921 1.00 26.93 ? 493 PRO A O   1 
ATOM   3757 C CB  . PRO A 1 493 ? 27.271  68.983 45.936 1.00 19.03 ? 493 PRO A CB  1 
ATOM   3758 C CG  . PRO A 1 493 ? 27.844  70.063 46.857 1.00 22.50 ? 493 PRO A CG  1 
ATOM   3759 C CD  . PRO A 1 493 ? 26.749  71.135 47.013 1.00 18.43 ? 493 PRO A CD  1 
ATOM   3760 N N   . LEU A 1 494 ? 25.130  67.751 44.078 1.00 18.42 ? 494 LEU A N   1 
ATOM   3761 C CA  . LEU A 1 494 ? 24.140  66.682 43.997 1.00 19.26 ? 494 LEU A CA  1 
ATOM   3762 C C   . LEU A 1 494 ? 24.604  65.687 45.037 1.00 21.65 ? 494 LEU A C   1 
ATOM   3763 O O   . LEU A 1 494 ? 25.778  65.617 45.407 1.00 26.28 ? 494 LEU A O   1 
ATOM   3764 C CB  . LEU A 1 494 ? 24.198  65.863 42.675 1.00 18.39 ? 494 LEU A CB  1 
ATOM   3765 C CG  . LEU A 1 494 ? 23.502  66.431 41.420 1.00 14.50 ? 494 LEU A CG  1 
ATOM   3766 C CD1 . LEU A 1 494 ? 24.072  65.720 40.181 1.00 14.53 ? 494 LEU A CD1 1 
ATOM   3767 C CD2 . LEU A 1 494 ? 21.976  66.245 41.464 1.00 4.23  ? 494 LEU A CD2 1 
ATOM   3768 N N   . PHE A 1 495 ? 23.658  64.893 45.485 1.00 20.58 ? 495 PHE A N   1 
ATOM   3769 C CA  . PHE A 1 495 ? 24.010  63.884 46.449 1.00 24.09 ? 495 PHE A CA  1 
ATOM   3770 C C   . PHE A 1 495 ? 24.387  62.725 45.561 1.00 25.16 ? 495 PHE A C   1 
ATOM   3771 O O   . PHE A 1 495 ? 23.678  62.448 44.600 1.00 27.40 ? 495 PHE A O   1 
ATOM   3772 C CB  . PHE A 1 495 ? 22.790  63.533 47.346 1.00 24.00 ? 495 PHE A CB  1 
ATOM   3773 C CG  . PHE A 1 495 ? 23.040  62.305 48.198 1.00 19.91 ? 495 PHE A CG  1 
ATOM   3774 C CD1 . PHE A 1 495 ? 22.816  61.023 47.681 1.00 19.53 ? 495 PHE A CD1 1 
ATOM   3775 C CD2 . PHE A 1 495 ? 23.561  62.437 49.487 1.00 19.87 ? 495 PHE A CD2 1 
ATOM   3776 C CE1 . PHE A 1 495 ? 23.152  59.888 48.429 1.00 23.95 ? 495 PHE A CE1 1 
ATOM   3777 C CE2 . PHE A 1 495 ? 23.875  61.305 50.240 1.00 20.88 ? 495 PHE A CE2 1 
ATOM   3778 C CZ  . PHE A 1 495 ? 23.690  60.024 49.713 1.00 20.47 ? 495 PHE A CZ  1 
ATOM   3779 N N   . THR A 1 496 ? 25.487  62.048 45.868 1.00 26.97 ? 496 THR A N   1 
ATOM   3780 C CA  . THR A 1 496 ? 25.872  60.907 45.060 1.00 28.29 ? 496 THR A CA  1 
ATOM   3781 C C   . THR A 1 496 ? 26.175  59.786 46.027 1.00 30.14 ? 496 THR A C   1 
ATOM   3782 O O   . THR A 1 496 ? 26.657  60.005 47.130 1.00 31.89 ? 496 THR A O   1 
ATOM   3783 C CB  . THR A 1 496 ? 27.053  61.284 44.158 1.00 30.33 ? 496 THR A CB  1 
ATOM   3784 O OG1 . THR A 1 496 ? 28.256  61.472 44.897 1.00 36.96 ? 496 THR A OG1 1 
ATOM   3785 C CG2 . THR A 1 496 ? 26.828  62.591 43.379 1.00 34.12 ? 496 THR A CG2 1 
ATOM   3786 N N   . THR A 1 497 ? 25.927  58.562 45.611 1.00 31.97 ? 497 THR A N   1 
ATOM   3787 C CA  . THR A 1 497 ? 26.216  57.468 46.527 1.00 33.76 ? 497 THR A CA  1 
ATOM   3788 C C   . THR A 1 497 ? 27.712  57.368 46.853 1.00 37.80 ? 497 THR A C   1 
ATOM   3789 O O   . THR A 1 497 ? 28.118  56.851 47.886 1.00 40.57 ? 497 THR A O   1 
ATOM   3790 C CB  . THR A 1 497 ? 25.634  56.185 45.937 1.00 32.55 ? 497 THR A CB  1 
ATOM   3791 O OG1 . THR A 1 497 ? 26.015  56.130 44.560 1.00 37.23 ? 497 THR A OG1 1 
ATOM   3792 C CG2 . THR A 1 497 ? 24.099  56.140 45.988 1.00 34.37 ? 497 THR A CG2 1 
ATOM   3793 N N   . LYS A 1 498 ? 28.511  57.888 45.908 1.00 40.37 ? 498 LYS A N   1 
ATOM   3794 C CA  . LYS A 1 498 ? 29.960  57.887 46.057 1.00 42.80 ? 498 LYS A CA  1 
ATOM   3795 C C   . LYS A 1 498 ? 30.373  58.851 47.147 1.00 42.93 ? 498 LYS A C   1 
ATOM   3796 O O   . LYS A 1 498 ? 30.764  58.517 48.254 1.00 43.73 ? 498 LYS A O   1 
ATOM   3797 C CB  . LYS A 1 498 ? 30.722  58.284 44.762 1.00 42.58 ? 498 LYS A CB  1 
ATOM   3798 N N   . GLU A 1 499 ? 30.274  60.117 46.782 1.00 43.38 ? 499 GLU A N   1 
ATOM   3799 C CA  . GLU A 1 499 ? 30.643  61.219 47.656 1.00 44.02 ? 499 GLU A CA  1 
ATOM   3800 C C   . GLU A 1 499 ? 29.337  61.877 48.026 1.00 42.03 ? 499 GLU A C   1 
ATOM   3801 O O   . GLU A 1 499 ? 28.832  62.794 47.380 1.00 45.50 ? 499 GLU A O   1 
ATOM   3802 C CB  . GLU A 1 499 ? 31.619  62.139 46.899 1.00 45.86 ? 499 GLU A CB  1 
ATOM   3803 C CG  . GLU A 1 499 ? 31.172  62.342 45.437 1.00 45.32 ? 499 GLU A CG  1 
ATOM   3804 N N   . GLN A 1 500 ? 28.787  61.317 49.089 1.00 36.62 ? 500 GLN A N   1 
ATOM   3805 C CA  . GLN A 1 500 ? 27.509  61.713 49.653 1.00 33.88 ? 500 GLN A CA  1 
ATOM   3806 C C   . GLN A 1 500 ? 27.470  63.138 50.196 1.00 31.50 ? 500 GLN A C   1 
ATOM   3807 O O   . GLN A 1 500 ? 27.473  63.311 51.409 1.00 37.01 ? 500 GLN A O   1 
ATOM   3808 C CB  . GLN A 1 500 ? 27.230  60.692 50.764 1.00 35.36 ? 500 GLN A CB  1 
ATOM   3809 C CG  . GLN A 1 500 ? 27.456  59.250 50.291 1.00 34.03 ? 500 GLN A CG  1 
ATOM   3810 C CD  . GLN A 1 500 ? 26.779  58.232 51.164 1.00 36.65 ? 500 GLN A CD  1 
ATOM   3811 O OE1 . GLN A 1 500 ? 26.191  58.493 52.215 1.00 38.59 ? 500 GLN A OE1 1 
ATOM   3812 N NE2 . GLN A 1 500 ? 26.894  57.016 50.684 1.00 39.33 ? 500 GLN A NE2 1 
ATOM   3813 N N   . LYS A 1 501 ? 27.434  64.140 49.321 1.00 26.18 ? 501 LYS A N   1 
ATOM   3814 C CA  . LYS A 1 501 ? 27.421  65.517 49.789 1.00 21.65 ? 501 LYS A CA  1 
ATOM   3815 C C   . LYS A 1 501 ? 26.041  66.019 50.134 1.00 21.55 ? 501 LYS A C   1 
ATOM   3816 O O   . LYS A 1 501 ? 25.049  65.554 49.594 1.00 21.60 ? 501 LYS A O   1 
ATOM   3817 C CB  . LYS A 1 501 ? 27.978  66.424 48.693 1.00 22.57 ? 501 LYS A CB  1 
ATOM   3818 C CG  . LYS A 1 501 ? 29.489  66.261 48.541 1.00 27.22 ? 501 LYS A CG  1 
ATOM   3819 C CD  . LYS A 1 501 ? 29.927  66.053 47.091 1.00 34.72 ? 501 LYS A CD  1 
ATOM   3820 C CE  . LYS A 1 501 ? 31.419  66.344 46.895 1.00 37.58 ? 501 LYS A CE  1 
ATOM   3821 N NZ  . LYS A 1 501 ? 31.651  67.784 46.932 1.00 41.05 ? 501 LYS A NZ  1 
ATOM   3822 N N   . PHE A 1 502 ? 26.030  67.015 51.026 1.00 19.88 ? 502 PHE A N   1 
ATOM   3823 C CA  . PHE A 1 502 ? 24.828  67.687 51.502 1.00 20.61 ? 502 PHE A CA  1 
ATOM   3824 C C   . PHE A 1 502 ? 25.297  69.030 51.998 1.00 21.35 ? 502 PHE A C   1 
ATOM   3825 O O   . PHE A 1 502 ? 26.501  69.257 52.126 1.00 20.82 ? 502 PHE A O   1 
ATOM   3826 C CB  . PHE A 1 502 ? 24.091  66.939 52.623 1.00 20.67 ? 502 PHE A CB  1 
ATOM   3827 C CG  . PHE A 1 502 ? 24.852  66.899 53.936 1.00 19.91 ? 502 PHE A CG  1 
ATOM   3828 C CD1 . PHE A 1 502 ? 24.654  67.907 54.902 1.00 19.70 ? 502 PHE A CD1 1 
ATOM   3829 C CD2 . PHE A 1 502 ? 25.717  65.828 54.225 1.00 18.02 ? 502 PHE A CD2 1 
ATOM   3830 C CE1 . PHE A 1 502 ? 25.280  67.827 56.149 1.00 16.32 ? 502 PHE A CE1 1 
ATOM   3831 C CE2 . PHE A 1 502 ? 26.338  65.743 55.477 1.00 16.24 ? 502 PHE A CE2 1 
ATOM   3832 C CZ  . PHE A 1 502 ? 26.110  66.737 56.438 1.00 16.77 ? 502 PHE A CZ  1 
ATOM   3833 N N   . ILE A 1 503 ? 24.340  69.909 52.303 1.00 19.70 ? 503 ILE A N   1 
ATOM   3834 C CA  . ILE A 1 503 ? 24.756  71.214 52.769 1.00 21.62 ? 503 ILE A CA  1 
ATOM   3835 C C   . ILE A 1 503 ? 24.054  71.584 54.048 1.00 23.19 ? 503 ILE A C   1 
ATOM   3836 O O   . ILE A 1 503 ? 23.018  71.033 54.414 1.00 26.92 ? 503 ILE A O   1 
ATOM   3837 C CB  . ILE A 1 503 ? 24.485  72.259 51.670 1.00 20.67 ? 503 ILE A CB  1 
ATOM   3838 C CG1 . ILE A 1 503 ? 23.007  72.413 51.293 1.00 18.01 ? 503 ILE A CG1 1 
ATOM   3839 C CG2 . ILE A 1 503 ? 25.304  71.926 50.425 1.00 24.07 ? 503 ILE A CG2 1 
ATOM   3840 C CD1 . ILE A 1 503 ? 22.765  73.733 50.558 1.00 17.69 ? 503 ILE A CD1 1 
ATOM   3841 N N   . ASP A 1 504 ? 24.667  72.543 54.740 1.00 23.58 ? 504 ASP A N   1 
ATOM   3842 C CA  . ASP A 1 504 ? 24.075  73.039 55.972 1.00 24.35 ? 504 ASP A CA  1 
ATOM   3843 C C   . ASP A 1 504 ? 23.161  74.165 55.530 1.00 23.37 ? 504 ASP A C   1 
ATOM   3844 O O   . ASP A 1 504 ? 23.494  74.928 54.633 1.00 26.80 ? 504 ASP A O   1 
ATOM   3845 C CB  . ASP A 1 504 ? 25.142  73.603 56.917 1.00 28.56 ? 504 ASP A CB  1 
ATOM   3846 C CG  . ASP A 1 504 ? 25.866  72.563 57.755 1.00 31.28 ? 504 ASP A CG  1 
ATOM   3847 O OD1 . ASP A 1 504 ? 25.449  71.404 57.795 1.00 30.48 ? 504 ASP A OD1 1 
ATOM   3848 O OD2 . ASP A 1 504 ? 26.854  72.935 58.387 1.00 36.62 ? 504 ASP A OD2 1 
ATOM   3849 N N   . LEU A 1 505 ? 22.027  74.291 56.181 1.00 21.29 ? 505 LEU A N   1 
ATOM   3850 C CA  . LEU A 1 505 ? 21.099  75.326 55.795 1.00 19.77 ? 505 LEU A CA  1 
ATOM   3851 C C   . LEU A 1 505 ? 20.890  76.199 57.017 1.00 22.78 ? 505 LEU A C   1 
ATOM   3852 O O   . LEU A 1 505 ? 20.004  75.992 57.834 1.00 27.15 ? 505 LEU A O   1 
ATOM   3853 C CB  . LEU A 1 505 ? 19.843  74.574 55.338 1.00 16.00 ? 505 LEU A CB  1 
ATOM   3854 C CG  . LEU A 1 505 ? 19.007  75.260 54.277 1.00 14.53 ? 505 LEU A CG  1 
ATOM   3855 C CD1 . LEU A 1 505 ? 19.803  75.551 52.994 1.00 11.95 ? 505 LEU A CD1 1 
ATOM   3856 C CD2 . LEU A 1 505 ? 17.796  74.358 53.969 1.00 13.12 ? 505 LEU A CD2 1 
ATOM   3857 N N   . ASN A 1 506 ? 21.768  77.168 57.181 1.00 22.31 ? 506 ASN A N   1 
ATOM   3858 C CA  . ASN A 1 506 ? 21.673  78.071 58.314 1.00 23.56 ? 506 ASN A CA  1 
ATOM   3859 C C   . ASN A 1 506 ? 22.193  79.378 57.791 1.00 26.60 ? 506 ASN A C   1 
ATOM   3860 O O   . ASN A 1 506 ? 22.670  79.422 56.675 1.00 31.76 ? 506 ASN A O   1 
ATOM   3861 C CB  . ASN A 1 506 ? 22.439  77.572 59.537 1.00 21.45 ? 506 ASN A CB  1 
ATOM   3862 C CG  . ASN A 1 506 ? 23.910  77.470 59.239 1.00 21.54 ? 506 ASN A CG  1 
ATOM   3863 O OD1 . ASN A 1 506 ? 24.511  78.471 58.895 1.00 15.80 ? 506 ASN A OD1 1 
ATOM   3864 N ND2 . ASN A 1 506 ? 24.483  76.272 59.376 1.00 18.47 ? 506 ASN A ND2 1 
ATOM   3865 N N   . THR A 1 507 ? 22.104  80.426 58.594 1.00 26.94 ? 507 THR A N   1 
ATOM   3866 C CA  . THR A 1 507 ? 22.532  81.752 58.159 1.00 28.80 ? 507 THR A CA  1 
ATOM   3867 C C   . THR A 1 507 ? 24.014  82.032 57.809 1.00 31.21 ? 507 THR A C   1 
ATOM   3868 O O   . THR A 1 507 ? 24.354  83.131 57.382 1.00 32.73 ? 507 THR A O   1 
ATOM   3869 C CB  . THR A 1 507 ? 22.051  82.754 59.214 1.00 29.17 ? 507 THR A CB  1 
ATOM   3870 O OG1 . THR A 1 507 ? 22.596  82.406 60.489 1.00 30.67 ? 507 THR A OG1 1 
ATOM   3871 C CG2 . THR A 1 507 ? 20.523  82.841 59.393 1.00 27.48 ? 507 THR A CG2 1 
ATOM   3872 N N   . GLU A 1 508 ? 24.918  81.088 58.022 1.00 33.28 ? 508 GLU A N   1 
ATOM   3873 C CA  . GLU A 1 508 ? 26.312  81.365 57.690 1.00 37.80 ? 508 GLU A CA  1 
ATOM   3874 C C   . GLU A 1 508 ? 26.534  81.120 56.192 1.00 43.12 ? 508 GLU A C   1 
ATOM   3875 O O   . GLU A 1 508 ? 25.679  80.610 55.477 1.00 46.45 ? 508 GLU A O   1 
ATOM   3876 C CB  . GLU A 1 508 ? 27.222  80.495 58.560 1.00 36.74 ? 508 GLU A CB  1 
ATOM   3877 C CG  . GLU A 1 508 ? 27.087  80.878 60.030 1.00 37.93 ? 508 GLU A CG  1 
ATOM   3878 N N   . PRO A 1 509 ? 27.753  81.462 55.723 1.00 45.16 ? 509 PRO A N   1 
ATOM   3879 C CA  . PRO A 1 509 ? 28.326  80.814 54.543 1.00 45.89 ? 509 PRO A CA  1 
ATOM   3880 C C   . PRO A 1 509 ? 28.195  79.279 54.480 1.00 46.40 ? 509 PRO A C   1 
ATOM   3881 O O   . PRO A 1 509 ? 28.728  78.532 55.291 1.00 47.25 ? 509 PRO A O   1 
ATOM   3882 C CB  . PRO A 1 509 ? 29.783  81.285 54.586 1.00 47.53 ? 509 PRO A CB  1 
ATOM   3883 C CG  . PRO A 1 509 ? 29.772  82.639 55.328 1.00 49.06 ? 509 PRO A CG  1 
ATOM   3884 C CD  . PRO A 1 509 ? 28.515  82.611 56.209 1.00 47.98 ? 509 PRO A CD  1 
ATOM   3885 N N   . MET A 1 510 ? 27.466  78.864 53.443 1.00 45.34 ? 510 MET A N   1 
ATOM   3886 C CA  . MET A 1 510 ? 27.173  77.470 53.140 1.00 43.84 ? 510 MET A CA  1 
ATOM   3887 C C   . MET A 1 510 ? 28.368  76.540 53.244 1.00 42.69 ? 510 MET A C   1 
ATOM   3888 O O   . MET A 1 510 ? 29.455  76.849 52.775 1.00 45.05 ? 510 MET A O   1 
ATOM   3889 C CB  . MET A 1 510 ? 26.687  77.420 51.678 1.00 44.66 ? 510 MET A CB  1 
ATOM   3890 C CG  . MET A 1 510 ? 25.631  76.352 51.383 1.00 48.03 ? 510 MET A CG  1 
ATOM   3891 S SD  . MET A 1 510 ? 25.524  76.214 49.574 1.00 48.04 ? 510 MET A SD  1 
ATOM   3892 C CE  . MET A 1 510 ? 26.976  75.147 49.315 1.00 46.50 ? 510 MET A CE  1 
ATOM   3893 N N   . LYS A 1 511 ? 28.127  75.365 53.813 1.00 38.25 ? 511 LYS A N   1 
ATOM   3894 C CA  . LYS A 1 511 ? 29.199  74.402 53.925 1.00 37.85 ? 511 LYS A CA  1 
ATOM   3895 C C   . LYS A 1 511 ? 28.612  73.139 53.386 1.00 36.58 ? 511 LYS A C   1 
ATOM   3896 O O   . LYS A 1 511 ? 27.443  72.831 53.590 1.00 41.64 ? 511 LYS A O   1 
ATOM   3897 C CB  . LYS A 1 511 ? 29.680  74.208 55.364 1.00 39.61 ? 511 LYS A CB  1 
ATOM   3898 C CG  . LYS A 1 511 ? 30.365  75.483 55.888 1.00 45.90 ? 511 LYS A CG  1 
ATOM   3899 N N   . VAL A 1 512 ? 29.451  72.433 52.668 1.00 33.40 ? 512 VAL A N   1 
ATOM   3900 C CA  . VAL A 1 512 ? 29.092  71.186 52.072 1.00 31.10 ? 512 VAL A CA  1 
ATOM   3901 C C   . VAL A 1 512 ? 29.763  70.204 52.995 1.00 31.86 ? 512 VAL A C   1 
ATOM   3902 O O   . VAL A 1 512 ? 30.877  70.441 53.458 1.00 35.08 ? 512 VAL A O   1 
ATOM   3903 C CB  . VAL A 1 512 ? 29.715  71.171 50.663 1.00 29.54 ? 512 VAL A CB  1 
ATOM   3904 C CG1 . VAL A 1 512 ? 29.595  69.803 49.976 1.00 24.94 ? 512 VAL A CG1 1 
ATOM   3905 C CG2 . VAL A 1 512 ? 29.173  72.324 49.782 1.00 24.63 ? 512 VAL A CG2 1 
ATOM   3906 N N   . HIS A 1 513 ? 29.103  69.099 53.252 1.00 30.57 ? 513 HIS A N   1 
ATOM   3907 C CA  . HIS A 1 513 ? 29.684  68.110 54.137 1.00 28.81 ? 513 HIS A CA  1 
ATOM   3908 C C   . HIS A 1 513 ? 29.496  66.808 53.442 1.00 25.76 ? 513 HIS A C   1 
ATOM   3909 O O   . HIS A 1 513 ? 29.010  66.767 52.325 1.00 25.49 ? 513 HIS A O   1 
ATOM   3910 C CB  . HIS A 1 513 ? 28.911  68.108 55.460 1.00 30.36 ? 513 HIS A CB  1 
ATOM   3911 C CG  . HIS A 1 513 ? 29.010  69.433 56.177 1.00 30.18 ? 513 HIS A CG  1 
ATOM   3912 N ND1 . HIS A 1 513 ? 29.984  69.762 57.046 1.00 27.05 ? 513 HIS A ND1 1 
ATOM   3913 C CD2 . HIS A 1 513 ? 28.120  70.531 56.077 1.00 30.29 ? 513 HIS A CD2 1 
ATOM   3914 C CE1 . HIS A 1 513 ? 29.710  71.006 57.465 1.00 29.04 ? 513 HIS A CE1 1 
ATOM   3915 N NE2 . HIS A 1 513 ? 28.595  71.488 56.893 1.00 27.19 ? 513 HIS A NE2 1 
ATOM   3916 N N   . GLN A 1 514 ? 29.878  65.729 54.107 1.00 26.12 ? 514 GLN A N   1 
ATOM   3917 C CA  . GLN A 1 514 ? 29.700  64.446 53.466 1.00 28.73 ? 514 GLN A CA  1 
ATOM   3918 C C   . GLN A 1 514 ? 29.154  63.479 54.488 1.00 26.20 ? 514 GLN A C   1 
ATOM   3919 O O   . GLN A 1 514 ? 29.258  63.668 55.688 1.00 28.26 ? 514 GLN A O   1 
ATOM   3920 C CB  . GLN A 1 514 ? 31.047  63.886 52.982 1.00 34.39 ? 514 GLN A CB  1 
ATOM   3921 C CG  . GLN A 1 514 ? 31.757  64.771 51.948 1.00 43.27 ? 514 GLN A CG  1 
ATOM   3922 C CD  . GLN A 1 514 ? 32.749  63.918 51.176 1.00 50.37 ? 514 GLN A CD  1 
ATOM   3923 O OE1 . GLN A 1 514 ? 32.742  63.829 49.961 1.00 54.52 ? 514 GLN A OE1 1 
ATOM   3924 N NE2 . GLN A 1 514 ? 33.595  63.232 51.934 1.00 54.93 ? 514 GLN A NE2 1 
ATOM   3925 N N   . ARG A 1 515 ? 28.572  62.430 53.950 1.00 22.03 ? 515 ARG A N   1 
ATOM   3926 C CA  . ARG A 1 515 ? 28.017  61.340 54.718 1.00 25.43 ? 515 ARG A CA  1 
ATOM   3927 C C   . ARG A 1 515 ? 27.241  61.698 55.989 1.00 26.46 ? 515 ARG A C   1 
ATOM   3928 O O   . ARG A 1 515 ? 27.659  61.338 57.085 1.00 28.69 ? 515 ARG A O   1 
ATOM   3929 C CB  . ARG A 1 515 ? 29.141  60.360 55.035 1.00 22.70 ? 515 ARG A CB  1 
ATOM   3930 C CG  . ARG A 1 515 ? 30.029  60.068 53.829 1.00 28.79 ? 515 ARG A CG  1 
ATOM   3931 C CD  . ARG A 1 515 ? 30.769  58.730 53.914 1.00 32.56 ? 515 ARG A CD  1 
ATOM   3932 N NE  . ARG A 1 515 ? 31.746  58.638 52.841 1.00 36.56 ? 515 ARG A NE  1 
ATOM   3933 N N   . LEU A 1 516 ? 26.088  62.384 55.818 1.00 26.31 ? 516 LEU A N   1 
ATOM   3934 C CA  . LEU A 1 516 ? 25.240  62.770 56.973 1.00 23.29 ? 516 LEU A CA  1 
ATOM   3935 C C   . LEU A 1 516 ? 25.011  61.575 57.903 1.00 23.73 ? 516 LEU A C   1 
ATOM   3936 O O   . LEU A 1 516 ? 24.396  60.585 57.519 1.00 27.68 ? 516 LEU A O   1 
ATOM   3937 C CB  . LEU A 1 516 ? 23.860  63.311 56.494 1.00 18.50 ? 516 LEU A CB  1 
ATOM   3938 C CG  . LEU A 1 516 ? 22.863  63.749 57.589 1.00 14.83 ? 516 LEU A CG  1 
ATOM   3939 C CD1 . LEU A 1 516 ? 23.390  64.914 58.426 1.00 12.67 ? 516 LEU A CD1 1 
ATOM   3940 C CD2 . LEU A 1 516 ? 21.511  64.142 56.982 1.00 13.11 ? 516 LEU A CD2 1 
ATOM   3941 N N   . ARG A 1 517 ? 25.558  61.711 59.122 1.00 20.27 ? 517 ARG A N   1 
ATOM   3942 C CA  . ARG A 1 517 ? 25.469  60.716 60.191 1.00 17.84 ? 517 ARG A CA  1 
ATOM   3943 C C   . ARG A 1 517 ? 25.761  59.285 59.806 1.00 15.26 ? 517 ARG A C   1 
ATOM   3944 O O   . ARG A 1 517 ? 24.978  58.420 60.175 1.00 16.45 ? 517 ARG A O   1 
ATOM   3945 C CB  . ARG A 1 517 ? 24.117  60.794 60.935 1.00 19.67 ? 517 ARG A CB  1 
ATOM   3946 C CG  . ARG A 1 517 ? 23.890  62.214 61.487 1.00 30.15 ? 517 ARG A CG  1 
ATOM   3947 C CD  . ARG A 1 517 ? 22.794  62.298 62.550 1.00 36.82 ? 517 ARG A CD  1 
ATOM   3948 N NE  . ARG A 1 517 ? 23.183  61.635 63.783 1.00 41.57 ? 517 ARG A NE  1 
ATOM   3949 C CZ  . ARG A 1 517 ? 23.891  62.251 64.733 1.00 43.20 ? 517 ARG A CZ  1 
ATOM   3950 N NH1 . ARG A 1 517 ? 24.358  63.482 64.526 1.00 47.32 ? 517 ARG A NH1 1 
ATOM   3951 N NH2 . ARG A 1 517 ? 24.121  61.624 65.890 1.00 42.62 ? 517 ARG A NH2 1 
ATOM   3952 N N   . VAL A 1 518 ? 26.889  59.019 59.127 1.00 13.18 ? 518 VAL A N   1 
ATOM   3953 C CA  . VAL A 1 518 ? 27.135  57.612 58.778 1.00 17.36 ? 518 VAL A CA  1 
ATOM   3954 C C   . VAL A 1 518 ? 27.213  56.664 59.963 1.00 18.52 ? 518 VAL A C   1 
ATOM   3955 O O   . VAL A 1 518 ? 26.413  55.754 60.096 1.00 14.69 ? 518 VAL A O   1 
ATOM   3956 C CB  . VAL A 1 518 ? 28.401  57.398 57.912 1.00 18.87 ? 518 VAL A CB  1 
ATOM   3957 C CG1 . VAL A 1 518 ? 27.970  57.120 56.474 1.00 28.46 ? 518 VAL A CG1 1 
ATOM   3958 C CG2 . VAL A 1 518 ? 29.428  58.554 57.996 1.00 21.55 ? 518 VAL A CG2 1 
ATOM   3959 N N   . GLN A 1 519 ? 28.214  56.902 60.832 1.00 22.65 ? 519 GLN A N   1 
ATOM   3960 C CA  . GLN A 1 519 ? 28.449  56.063 62.017 1.00 24.45 ? 519 GLN A CA  1 
ATOM   3961 C C   . GLN A 1 519 ? 27.175  55.603 62.702 1.00 22.52 ? 519 GLN A C   1 
ATOM   3962 O O   . GLN A 1 519 ? 26.929  54.421 62.883 1.00 24.00 ? 519 GLN A O   1 
ATOM   3963 C CB  . GLN A 1 519 ? 29.347  56.800 63.032 1.00 32.94 ? 519 GLN A CB  1 
ATOM   3964 C CG  . GLN A 1 519 ? 30.815  57.005 62.565 1.00 45.37 ? 519 GLN A CG  1 
ATOM   3965 C CD  . GLN A 1 519 ? 31.899  56.076 63.138 1.00 53.76 ? 519 GLN A CD  1 
ATOM   3966 O OE1 . GLN A 1 519 ? 32.995  56.074 62.600 1.00 55.27 ? 519 GLN A OE1 1 
ATOM   3967 N NE2 . GLN A 1 519 ? 31.604  55.292 64.188 1.00 57.01 ? 519 GLN A NE2 1 
ATOM   3968 N N   . MET A 1 520 ? 26.362  56.589 63.069 1.00 18.13 ? 520 MET A N   1 
ATOM   3969 C CA  . MET A 1 520 ? 25.139  56.218 63.731 1.00 17.36 ? 520 MET A CA  1 
ATOM   3970 C C   . MET A 1 520 ? 24.192  55.493 62.790 1.00 17.54 ? 520 MET A C   1 
ATOM   3971 O O   . MET A 1 520 ? 23.574  54.475 63.097 1.00 20.36 ? 520 MET A O   1 
ATOM   3972 C CB  . MET A 1 520 ? 24.492  57.463 64.356 1.00 21.26 ? 520 MET A CB  1 
ATOM   3973 C CG  . MET A 1 520 ? 25.296  58.011 65.558 1.00 29.41 ? 520 MET A CG  1 
ATOM   3974 S SD  . MET A 1 520 ? 25.354  56.747 66.907 1.00 39.85 ? 520 MET A SD  1 
ATOM   3975 C CE  . MET A 1 520 ? 27.122  56.322 67.005 1.00 34.92 ? 520 MET A CE  1 
ATOM   3976 N N   . CYS A 1 521 ? 24.081  56.023 61.579 1.00 17.21 ? 521 CYS A N   1 
ATOM   3977 C CA  . CYS A 1 521 ? 23.154  55.371 60.677 1.00 14.00 ? 521 CYS A CA  1 
ATOM   3978 C C   . CYS A 1 521 ? 23.529  53.950 60.292 1.00 16.98 ? 521 CYS A C   1 
ATOM   3979 O O   . CYS A 1 521 ? 22.612  53.181 60.031 1.00 17.51 ? 521 CYS A O   1 
ATOM   3980 C CB  . CYS A 1 521 ? 22.786  56.281 59.529 1.00 8.52  ? 521 CYS A CB  1 
ATOM   3981 S SG  . CYS A 1 521 ? 21.751  57.655 60.125 1.00 16.59 ? 521 CYS A SG  1 
ATOM   3982 N N   . VAL A 1 522 ? 24.819  53.545 60.268 1.00 17.40 ? 522 VAL A N   1 
ATOM   3983 C CA  . VAL A 1 522 ? 25.074  52.145 59.913 1.00 18.14 ? 522 VAL A CA  1 
ATOM   3984 C C   . VAL A 1 522 ? 24.569  51.258 61.053 1.00 19.65 ? 522 VAL A C   1 
ATOM   3985 O O   . VAL A 1 522 ? 24.107  50.131 60.864 1.00 20.84 ? 522 VAL A O   1 
ATOM   3986 C CB  . VAL A 1 522 ? 26.535  51.858 59.422 1.00 18.71 ? 522 VAL A CB  1 
ATOM   3987 C CG1 . VAL A 1 522 ? 27.443  53.092 59.300 1.00 18.10 ? 522 VAL A CG1 1 
ATOM   3988 C CG2 . VAL A 1 522 ? 27.275  50.710 60.133 1.00 19.79 ? 522 VAL A CG2 1 
ATOM   3989 N N   . PHE A 1 523 ? 24.641  51.823 62.273 1.00 17.39 ? 523 PHE A N   1 
ATOM   3990 C CA  . PHE A 1 523 ? 24.176  51.083 63.433 1.00 9.03  ? 523 PHE A CA  1 
ATOM   3991 C C   . PHE A 1 523 ? 22.695  50.785 63.259 1.00 8.45  ? 523 PHE A C   1 
ATOM   3992 O O   . PHE A 1 523 ? 22.258  49.643 63.346 1.00 3.41  ? 523 PHE A O   1 
ATOM   3993 C CB  . PHE A 1 523 ? 24.518  51.825 64.769 1.00 7.45  ? 523 PHE A CB  1 
ATOM   3994 C CG  . PHE A 1 523 ? 23.720  51.305 65.945 1.00 5.37  ? 523 PHE A CG  1 
ATOM   3995 C CD1 . PHE A 1 523 ? 24.035  50.067 66.541 1.00 6.23  ? 523 PHE A CD1 1 
ATOM   3996 C CD2 . PHE A 1 523 ? 22.576  52.001 66.370 1.00 3.83  ? 523 PHE A CD2 1 
ATOM   3997 C CE1 . PHE A 1 523 ? 23.190  49.508 67.508 1.00 2.00  ? 523 PHE A CE1 1 
ATOM   3998 C CE2 . PHE A 1 523 ? 21.724  51.438 67.331 1.00 7.44  ? 523 PHE A CE2 1 
ATOM   3999 C CZ  . PHE A 1 523 ? 22.026  50.187 67.892 1.00 6.72  ? 523 PHE A CZ  1 
ATOM   4000 N N   . TRP A 1 524 ? 21.937  51.834 62.952 1.00 7.86  ? 524 TRP A N   1 
ATOM   4001 C CA  . TRP A 1 524 ? 20.500  51.585 62.835 1.00 11.10 ? 524 TRP A CA  1 
ATOM   4002 C C   . TRP A 1 524 ? 20.040  50.879 61.586 1.00 15.89 ? 524 TRP A C   1 
ATOM   4003 O O   . TRP A 1 524 ? 19.126  50.063 61.596 1.00 17.80 ? 524 TRP A O   1 
ATOM   4004 C CB  . TRP A 1 524 ? 19.715  52.895 62.845 1.00 12.61 ? 524 TRP A CB  1 
ATOM   4005 C CG  . TRP A 1 524 ? 19.798  53.607 64.177 1.00 15.47 ? 524 TRP A CG  1 
ATOM   4006 C CD1 . TRP A 1 524 ? 20.569  54.758 64.435 1.00 15.71 ? 524 TRP A CD1 1 
ATOM   4007 C CD2 . TRP A 1 524 ? 19.075  53.306 65.356 1.00 18.98 ? 524 TRP A CD2 1 
ATOM   4008 N NE1 . TRP A 1 524 ? 20.342  55.184 65.697 1.00 20.24 ? 524 TRP A NE1 1 
ATOM   4009 C CE2 . TRP A 1 524 ? 19.442  54.362 66.316 1.00 19.98 ? 524 TRP A CE2 1 
ATOM   4010 C CE3 . TRP A 1 524 ? 18.150  52.319 65.742 1.00 19.46 ? 524 TRP A CE3 1 
ATOM   4011 C CZ2 . TRP A 1 524 ? 18.834  54.384 67.573 1.00 19.02 ? 524 TRP A CZ2 1 
ATOM   4012 C CZ3 . TRP A 1 524 ? 17.566  52.368 67.018 1.00 17.22 ? 524 TRP A CZ3 1 
ATOM   4013 C CH2 . TRP A 1 524 ? 17.898  53.396 67.915 1.00 18.94 ? 524 TRP A CH2 1 
ATOM   4014 N N   . ASN A 1 525 ? 20.692  51.232 60.494 1.00 17.10 ? 525 ASN A N   1 
ATOM   4015 C CA  . ASN A 1 525 ? 20.282  50.645 59.219 1.00 16.79 ? 525 ASN A CA  1 
ATOM   4016 C C   . ASN A 1 525 ? 20.845  49.277 58.944 1.00 14.42 ? 525 ASN A C   1 
ATOM   4017 O O   . ASN A 1 525 ? 20.261  48.520 58.189 1.00 16.93 ? 525 ASN A O   1 
ATOM   4018 C CB  . ASN A 1 525 ? 20.606  51.587 58.051 1.00 17.20 ? 525 ASN A CB  1 
ATOM   4019 C CG  . ASN A 1 525 ? 19.745  52.837 58.125 1.00 18.04 ? 525 ASN A CG  1 
ATOM   4020 O OD1 . ASN A 1 525 ? 18.776  52.946 58.867 1.00 21.34 ? 525 ASN A OD1 1 
ATOM   4021 N ND2 . ASN A 1 525 ? 20.136  53.832 57.342 1.00 14.58 ? 525 ASN A ND2 1 
ATOM   4022 N N   . GLN A 1 526 ? 21.976  48.930 59.546 1.00 12.51 ? 526 GLN A N   1 
ATOM   4023 C CA  . GLN A 1 526 ? 22.513  47.607 59.243 1.00 14.28 ? 526 GLN A CA  1 
ATOM   4024 C C   . GLN A 1 526 ? 22.716  46.736 60.470 1.00 16.98 ? 526 GLN A C   1 
ATOM   4025 O O   . GLN A 1 526 ? 22.320  45.578 60.494 1.00 19.08 ? 526 GLN A O   1 
ATOM   4026 C CB  . GLN A 1 526 ? 23.829  47.745 58.438 1.00 13.48 ? 526 GLN A CB  1 
ATOM   4027 C CG  . GLN A 1 526 ? 23.650  48.678 57.207 1.00 17.90 ? 526 GLN A CG  1 
ATOM   4028 N N   . PHE A 1 527 ? 23.318  47.297 61.527 1.00 16.07 ? 527 PHE A N   1 
ATOM   4029 C CA  . PHE A 1 527 ? 23.563  46.421 62.686 1.00 16.54 ? 527 PHE A CA  1 
ATOM   4030 C C   . PHE A 1 527 ? 22.332  46.007 63.488 1.00 16.59 ? 527 PHE A C   1 
ATOM   4031 O O   . PHE A 1 527 ? 22.007  44.828 63.604 1.00 13.61 ? 527 PHE A O   1 
ATOM   4032 C CB  . PHE A 1 527 ? 24.655  47.012 63.596 1.00 14.68 ? 527 PHE A CB  1 
ATOM   4033 C CG  . PHE A 1 527 ? 25.076  46.046 64.677 1.00 10.73 ? 527 PHE A CG  1 
ATOM   4034 C CD1 . PHE A 1 527 ? 25.852  44.917 64.363 1.00 11.88 ? 527 PHE A CD1 1 
ATOM   4035 C CD2 . PHE A 1 527 ? 24.671  46.263 66.008 1.00 12.72 ? 527 PHE A CD2 1 
ATOM   4036 C CE1 . PHE A 1 527 ? 26.214  44.004 65.365 1.00 13.01 ? 527 PHE A CE1 1 
ATOM   4037 C CE2 . PHE A 1 527 ? 25.025  45.356 67.012 1.00 8.78  ? 527 PHE A CE2 1 
ATOM   4038 C CZ  . PHE A 1 527 ? 25.794  44.223 66.689 1.00 12.29 ? 527 PHE A CZ  1 
ATOM   4039 N N   . LEU A 1 528 ? 21.662  47.022 64.063 1.00 16.71 ? 528 LEU A N   1 
ATOM   4040 C CA  . LEU A 1 528 ? 20.475  46.833 64.892 1.00 14.70 ? 528 LEU A CA  1 
ATOM   4041 C C   . LEU A 1 528 ? 19.553  45.799 64.305 1.00 18.13 ? 528 LEU A C   1 
ATOM   4042 O O   . LEU A 1 528 ? 19.262  44.812 64.965 1.00 20.42 ? 528 LEU A O   1 
ATOM   4043 C CB  . LEU A 1 528 ? 19.785  48.171 65.282 1.00 15.48 ? 528 LEU A CB  1 
ATOM   4044 C CG  . LEU A 1 528 ? 18.899  48.182 66.562 1.00 17.15 ? 528 LEU A CG  1 
ATOM   4045 C CD1 . LEU A 1 528 ? 17.433  47.902 66.268 1.00 17.51 ? 528 LEU A CD1 1 
ATOM   4046 C CD2 . LEU A 1 528 ? 19.384  47.234 67.680 1.00 22.24 ? 528 LEU A CD2 1 
ATOM   4047 N N   . PRO A 1 529 ? 19.117  45.982 63.041 1.00 21.47 ? 529 PRO A N   1 
ATOM   4048 C CA  . PRO A 1 529 ? 18.174  45.038 62.469 1.00 19.45 ? 529 PRO A CA  1 
ATOM   4049 C C   . PRO A 1 529 ? 18.692  43.611 62.490 1.00 19.92 ? 529 PRO A C   1 
ATOM   4050 O O   . PRO A 1 529 ? 17.931  42.702 62.791 1.00 22.84 ? 529 PRO A O   1 
ATOM   4051 C CB  . PRO A 1 529 ? 17.891  45.584 61.059 1.00 20.48 ? 529 PRO A CB  1 
ATOM   4052 C CG  . PRO A 1 529 ? 18.428  47.033 61.030 1.00 22.90 ? 529 PRO A CG  1 
ATOM   4053 C CD  . PRO A 1 529 ? 19.505  47.054 62.112 1.00 24.83 ? 529 PRO A CD  1 
ATOM   4054 N N   . LYS A 1 530 ? 19.993  43.418 62.184 1.00 20.19 ? 530 LYS A N   1 
ATOM   4055 C CA  . LYS A 1 530 ? 20.520  42.043 62.197 1.00 21.49 ? 530 LYS A CA  1 
ATOM   4056 C C   . LYS A 1 530 ? 20.456  41.436 63.567 1.00 22.31 ? 530 LYS A C   1 
ATOM   4057 O O   . LYS A 1 530 ? 20.130  40.275 63.761 1.00 21.11 ? 530 LYS A O   1 
ATOM   4058 C CB  . LYS A 1 530 ? 22.023  41.919 61.863 1.00 24.91 ? 530 LYS A CB  1 
ATOM   4059 C CG  . LYS A 1 530 ? 22.412  42.144 60.399 1.00 33.70 ? 530 LYS A CG  1 
ATOM   4060 C CD  . LYS A 1 530 ? 23.846  41.645 60.116 1.00 35.91 ? 530 LYS A CD  1 
ATOM   4061 C CE  . LYS A 1 530 ? 23.982  40.107 60.198 1.00 38.83 ? 530 LYS A CE  1 
ATOM   4062 N NZ  . LYS A 1 530 ? 25.241  39.667 59.617 1.00 41.88 ? 530 LYS A NZ  1 
ATOM   4063 N N   . LEU A 1 531 ? 20.847  42.280 64.517 1.00 22.30 ? 531 LEU A N   1 
ATOM   4064 C CA  . LEU A 1 531 ? 20.876  41.865 65.898 1.00 18.46 ? 531 LEU A CA  1 
ATOM   4065 C C   . LEU A 1 531 ? 19.522  41.358 66.294 1.00 17.79 ? 531 LEU A C   1 
ATOM   4066 O O   . LEU A 1 531 ? 19.353  40.208 66.678 1.00 16.65 ? 531 LEU A O   1 
ATOM   4067 C CB  . LEU A 1 531 ? 21.411  43.010 66.772 1.00 17.72 ? 531 LEU A CB  1 
ATOM   4068 C CG  . LEU A 1 531 ? 21.552  42.671 68.270 1.00 15.86 ? 531 LEU A CG  1 
ATOM   4069 C CD1 . LEU A 1 531 ? 22.744  43.392 68.889 1.00 16.38 ? 531 LEU A CD1 1 
ATOM   4070 C CD2 . LEU A 1 531 ? 20.288  43.038 69.055 1.00 16.82 ? 531 LEU A CD2 1 
ATOM   4071 N N   . LEU A 1 532 ? 18.546  42.244 66.105 1.00 15.97 ? 532 LEU A N   1 
ATOM   4072 C CA  . LEU A 1 532 ? 17.185  41.887 66.469 1.00 20.58 ? 532 LEU A CA  1 
ATOM   4073 C C   . LEU A 1 532 ? 16.678  40.657 65.760 1.00 24.00 ? 532 LEU A C   1 
ATOM   4074 O O   . LEU A 1 532 ? 15.829  39.963 66.296 1.00 29.22 ? 532 LEU A O   1 
ATOM   4075 C CB  . LEU A 1 532 ? 16.181  43.042 66.267 1.00 15.90 ? 532 LEU A CB  1 
ATOM   4076 C CG  . LEU A 1 532 ? 16.396  44.267 67.183 1.00 18.48 ? 532 LEU A CG  1 
ATOM   4077 C CD1 . LEU A 1 532 ? 15.331  45.338 66.923 1.00 16.50 ? 532 LEU A CD1 1 
ATOM   4078 C CD2 . LEU A 1 532 ? 16.394  43.907 68.686 1.00 17.77 ? 532 LEU A CD2 1 
ATOM   4079 N N   . ASN A 1 533 ? 17.185  40.405 64.549 1.00 27.83 ? 533 ASN A N   1 
ATOM   4080 C CA  . ASN A 1 533 ? 16.745  39.236 63.789 1.00 28.48 ? 533 ASN A CA  1 
ATOM   4081 C C   . ASN A 1 533 ? 17.405  37.945 64.224 1.00 30.57 ? 533 ASN A C   1 
ATOM   4082 O O   . ASN A 1 533 ? 16.837  36.864 64.159 1.00 29.70 ? 533 ASN A O   1 
ATOM   4083 C CB  . ASN A 1 533 ? 17.090  39.419 62.312 1.00 26.73 ? 533 ASN A CB  1 
ATOM   4084 N N   . ALA A 1 534 ? 18.662  38.069 64.651 1.00 32.89 ? 534 ALA A N   1 
ATOM   4085 C CA  . ALA A 1 534 ? 19.349  36.857 65.054 1.00 36.26 ? 534 ALA A CA  1 
ATOM   4086 C C   . ALA A 1 534 ? 18.814  36.337 66.354 1.00 42.30 ? 534 ALA A C   1 
ATOM   4087 O O   . ALA A 1 534 ? 18.765  35.133 66.595 1.00 44.56 ? 534 ALA A O   1 
ATOM   4088 C CB  . ALA A 1 534 ? 20.852  37.072 65.222 1.00 32.57 ? 534 ALA A CB  1 
ATOM   4089 N N   . THR A 1 535 ? 18.484  37.298 67.215 1.00 47.29 ? 535 THR A N   1 
ATOM   4090 C CA  . THR A 1 535 ? 17.953  36.960 68.511 1.00 51.46 ? 535 THR A CA  1 
ATOM   4091 C C   . THR A 1 535 ? 16.502  36.487 68.376 1.00 53.10 ? 535 THR A C   1 
ATOM   4092 O O   . THR A 1 535 ? 15.627  37.055 69.040 1.00 57.37 ? 535 THR A O   1 
ATOM   4093 C CB  . THR A 1 535 ? 18.060  38.196 69.422 1.00 53.08 ? 535 THR A CB  1 
ATOM   4094 O OG1 . THR A 1 535 ? 19.279  38.910 69.244 1.00 52.38 ? 535 THR A OG1 1 
ATOM   4095 C CG2 . THR A 1 535 ? 18.026  37.829 70.916 1.00 59.93 ? 535 THR A CG2 1 
HETATM 4096 C C1  . THA B 2 .   ? 6.362   71.261 69.025 1.00 22.38 ? 999 THA A C1  1 
HETATM 4097 C C2  . THA B 2 .   ? 6.697   70.955 67.712 1.00 25.41 ? 999 THA A C2  1 
HETATM 4098 C C3  . THA B 2 .   ? 5.719   70.518 66.819 1.00 24.66 ? 999 THA A C3  1 
HETATM 4099 C C4  . THA B 2 .   ? 4.351   70.381 67.260 1.00 21.70 ? 999 THA A C4  1 
HETATM 4100 C C5  . THA B 2 .   ? 4.056   70.702 68.603 1.00 20.76 ? 999 THA A C5  1 
HETATM 4101 C C6  . THA B 2 .   ? 5.053   71.136 69.468 1.00 18.93 ? 999 THA A C6  1 
HETATM 4102 N N7  . THA B 2 .   ? 6.068   70.236 65.585 1.00 21.62 ? 999 THA A N7  1 
HETATM 4103 C C8  . THA B 2 .   ? 5.207   69.821 64.683 1.00 20.49 ? 999 THA A C8  1 
HETATM 4104 C C9  . THA B 2 .   ? 3.833   69.634 64.995 1.00 19.83 ? 999 THA A C9  1 
HETATM 4105 C C10 . THA B 2 .   ? 3.396   69.933 66.309 1.00 17.75 ? 999 THA A C10 1 
HETATM 4106 C C11 . THA B 2 .   ? 5.776   69.459 63.289 1.00 18.30 ? 999 THA A C11 1 
HETATM 4107 C C12 . THA B 2 .   ? 4.736   69.363 62.145 1.00 20.27 ? 999 THA A C12 1 
HETATM 4108 C C13 . THA B 2 .   ? 3.515   68.540 62.597 1.00 19.36 ? 999 THA A C13 1 
HETATM 4109 C C14 . THA B 2 .   ? 2.860   69.177 63.848 1.00 21.42 ? 999 THA A C14 1 
HETATM 4110 N N15 . THA B 2 .   ? 2.092   69.798 66.625 1.00 20.69 ? 999 THA A N15 1 
HETATM 4111 O O   . HOH C 3 .   ? 21.436  52.967 54.670 1.00 16.26 ? 601 HOH A O   1 
HETATM 4112 O O   . HOH C 3 .   ? -9.713  62.939 60.080 1.00 9.25  ? 602 HOH A O   1 
HETATM 4113 O O   . HOH C 3 .   ? 24.198  67.851 85.549 1.00 70.20 ? 603 HOH A O   1 
HETATM 4114 O O   . HOH C 3 .   ? 3.897   69.768 58.109 1.00 2.00  ? 604 HOH A O   1 
HETATM 4115 O O   . HOH C 3 .   ? -1.728  70.694 53.271 1.00 6.67  ? 605 HOH A O   1 
HETATM 4116 O O   . HOH C 3 .   ? -14.301 59.527 57.034 1.00 6.46  ? 606 HOH A O   1 
HETATM 4117 O O   . HOH C 3 .   ? -2.078  69.350 67.406 1.00 12.08 ? 607 HOH A O   1 
HETATM 4118 O O   . HOH C 3 .   ? -6.865  62.657 65.578 1.00 12.95 ? 608 HOH A O   1 
HETATM 4119 O O   . HOH C 3 .   ? 0.027   70.297 60.632 1.00 6.46  ? 609 HOH A O   1 
HETATM 4120 O O   . HOH C 3 .   ? -3.893  52.228 41.330 1.00 39.68 ? 610 HOH A O   1 
HETATM 4121 O O   . HOH C 3 .   ? 7.233   80.005 68.092 1.00 36.26 ? 611 HOH A O   1 
HETATM 4122 O O   . HOH C 3 .   ? 24.646  60.791 40.027 1.00 18.08 ? 612 HOH A O   1 
HETATM 4123 O O   . HOH C 3 .   ? 21.313  59.198 38.314 1.00 36.84 ? 613 HOH A O   1 
HETATM 4124 O O   . HOH C 3 .   ? -0.421  64.062 59.320 1.00 12.50 ? 614 HOH A O   1 
HETATM 4125 O O   . HOH C 3 .   ? 0.001   83.914 58.002 1.00 43.23 ? 615 HOH A O   1 
HETATM 4126 O O   . HOH C 3 .   ? -0.460  66.877 69.033 1.00 36.24 ? 616 HOH A O   1 
HETATM 4127 O O   . HOH C 3 .   ? 2.101   41.668 61.980 1.00 40.25 ? 617 HOH A O   1 
HETATM 4128 O O   . HOH C 3 .   ? 10.934  56.303 68.662 1.00 12.08 ? 618 HOH A O   1 
HETATM 4129 O O   . HOH C 3 .   ? 2.682   81.870 62.939 1.00 32.61 ? 619 HOH A O   1 
HETATM 4130 O O   . HOH C 3 .   ? 3.300   53.939 63.596 1.00 18.53 ? 620 HOH A O   1 
HETATM 4131 O O   . HOH C 3 .   ? 10.421  48.537 38.102 1.00 64.57 ? 621 HOH A O   1 
HETATM 4132 O O   . HOH C 3 .   ? 18.266  72.459 85.879 1.00 58.97 ? 622 HOH A O   1 
HETATM 4133 O O   . HOH C 3 .   ? -1.187  96.318 44.308 1.00 54.71 ? 623 HOH A O   1 
HETATM 4134 O O   . HOH C 3 .   ? 10.416  69.328 59.826 1.00 5.83  ? 624 HOH A O   1 
HETATM 4135 O O   . HOH C 3 .   ? -12.114 68.571 37.502 1.00 32.99 ? 625 HOH A O   1 
HETATM 4136 O O   . HOH C 3 .   ? -6.304  61.451 71.954 1.00 42.24 ? 626 HOH A O   1 
HETATM 4137 O O   . HOH C 3 .   ? -6.447  50.296 61.416 1.00 10.24 ? 627 HOH A O   1 
HETATM 4138 O O   . HOH C 3 .   ? 2.152   63.062 72.710 1.00 61.59 ? 628 HOH A O   1 
HETATM 4139 O O   . HOH C 3 .   ? 31.963  66.709 56.534 1.00 16.65 ? 629 HOH A O   1 
HETATM 4140 O O   . HOH C 3 .   ? 9.379   58.011 85.633 1.00 44.47 ? 630 HOH A O   1 
HETATM 4141 O O   . HOH C 3 .   ? -7.920  58.968 44.298 1.00 42.11 ? 631 HOH A O   1 
HETATM 4142 O O   . HOH C 3 .   ? 9.288   57.159 35.791 1.00 36.44 ? 632 HOH A O   1 
HETATM 4143 O O   . HOH C 3 .   ? -3.902  51.644 60.543 1.00 9.44  ? 633 HOH A O   1 
HETATM 4144 O O   . HOH C 3 .   ? -0.179  69.329 64.529 1.00 24.06 ? 634 HOH A O   1 
HETATM 4145 O O   . HOH C 3 .   ? 12.302  66.886 33.785 1.00 33.25 ? 635 HOH A O   1 
HETATM 4146 O O   . HOH C 3 .   ? -0.829  58.797 69.112 1.00 22.60 ? 636 HOH A O   1 
HETATM 4147 O O   . HOH C 3 .   ? 5.229   58.019 35.824 1.00 20.86 ? 637 HOH A O   1 
HETATM 4148 O O   . HOH C 3 .   ? 6.341   81.499 64.810 1.00 23.90 ? 638 HOH A O   1 
HETATM 4149 O O   . HOH C 3 .   ? -12.258 64.448 59.540 1.00 42.34 ? 639 HOH A O   1 
HETATM 4150 O O   . HOH C 3 .   ? 7.609   52.533 56.827 1.00 30.17 ? 640 HOH A O   1 
HETATM 4151 O O   . HOH C 3 .   ? 24.358  57.909 56.015 1.00 36.95 ? 641 HOH A O   1 
HETATM 4152 O O   . HOH C 3 .   ? 5.862   63.777 80.088 1.00 61.65 ? 642 HOH A O   1 
HETATM 4153 O O   . HOH C 3 .   ? 0.529   71.248 68.951 1.00 20.34 ? 643 HOH A O   1 
HETATM 4154 O O   . HOH C 3 .   ? 11.370  63.907 35.699 1.00 19.83 ? 644 HOH A O   1 
HETATM 4155 O O   . HOH C 3 .   ? 2.328   91.164 54.939 1.00 13.04 ? 645 HOH A O   1 
HETATM 4156 O O   . HOH C 3 .   ? -15.401 67.703 52.231 1.00 24.77 ? 646 HOH A O   1 
HETATM 4157 O O   . HOH C 3 .   ? -2.176  79.106 62.623 1.00 32.03 ? 647 HOH A O   1 
HETATM 4158 O O   . HOH C 3 .   ? 25.329  55.453 53.425 1.00 40.01 ? 648 HOH A O   1 
HETATM 4159 O O   . HOH C 3 .   ? 25.021  64.798 35.997 1.00 30.72 ? 649 HOH A O   1 
HETATM 4160 O O   . HOH C 3 .   ? 13.669  47.295 59.660 1.00 45.32 ? 650 HOH A O   1 
HETATM 4161 O O   . HOH C 3 .   ? -13.244 50.312 44.199 1.00 54.67 ? 651 HOH A O   1 
HETATM 4162 O O   . HOH C 3 .   ? 3.242   83.352 32.284 1.00 34.21 ? 652 HOH A O   1 
HETATM 4163 O O   . HOH C 3 .   ? -5.381  58.887 37.832 1.00 40.03 ? 653 HOH A O   1 
HETATM 4164 O O   . HOH C 3 .   ? 12.644  49.806 33.065 1.00 51.32 ? 654 HOH A O   1 
HETATM 4165 O O   . HOH C 3 .   ? 7.810   76.268 61.395 1.00 50.53 ? 655 HOH A O   1 
HETATM 4166 O O   . HOH C 3 .   ? -0.969  59.532 33.421 1.00 25.89 ? 656 HOH A O   1 
HETATM 4167 O O   . HOH C 3 .   ? -14.849 67.281 39.525 1.00 42.11 ? 657 HOH A O   1 
HETATM 4168 O O   . HOH C 3 .   ? -18.694 86.088 50.675 1.00 47.80 ? 658 HOH A O   1 
HETATM 4169 O O   . HOH C 3 .   ? -15.520 83.163 31.580 1.00 47.06 ? 659 HOH A O   1 
HETATM 4170 O O   . HOH C 3 .   ? 21.328  50.999 53.078 1.00 17.17 ? 660 HOH A O   1 
HETATM 4171 O O   . HOH C 3 .   ? 18.419  92.769 62.731 1.00 36.34 ? 661 HOH A O   1 
HETATM 4172 O O   . HOH C 3 .   ? 29.951  58.597 85.155 1.00 72.74 ? 662 HOH A O   1 
HETATM 4173 O O   . HOH C 3 .   ? 20.915  62.497 36.857 1.00 27.46 ? 663 HOH A O   1 
HETATM 4174 O O   . HOH C 3 .   ? 23.889  59.314 35.821 1.00 40.76 ? 664 HOH A O   1 
HETATM 4175 O O   . HOH C 3 .   ? -0.387  90.815 55.611 1.00 41.40 ? 665 HOH A O   1 
HETATM 4176 O O   . HOH C 3 .   ? 4.850   58.304 76.420 1.00 53.69 ? 666 HOH A O   1 
HETATM 4177 O O   . HOH C 3 .   ? 19.660  62.741 32.748 1.00 83.14 ? 667 HOH A O   1 
HETATM 4178 O O   . HOH C 3 .   ? -19.347 84.392 54.165 1.00 37.79 ? 668 HOH A O   1 
HETATM 4179 O O   . HOH C 3 .   ? 11.705  50.605 81.909 1.00 43.68 ? 669 HOH A O   1 
HETATM 4180 O O   . HOH C 3 .   ? 13.043  77.224 85.640 1.00 50.32 ? 670 HOH A O   1 
HETATM 4181 O O   . HOH C 3 .   ? 32.987  69.879 57.554 1.00 28.33 ? 671 HOH A O   1 
HETATM 4182 O O   . HOH C 3 .   ? 22.971  53.558 52.370 1.00 84.49 ? 672 HOH A O   1 
HETATM 4183 O O   . HOH C 3 .   ? 15.230  62.617 89.723 1.00 55.09 ? 673 HOH A O   1 
HETATM 4184 O O   . HOH C 3 .   ? 8.378   94.303 47.727 1.00 56.64 ? 674 HOH A O   1 
HETATM 4185 O O   . HOH C 3 .   ? -21.202 67.831 58.722 1.00 68.40 ? 675 HOH A O   1 
HETATM 4186 O O   . HOH C 3 .   ? -11.439 84.351 57.579 1.00 46.30 ? 676 HOH A O   1 
HETATM 4187 O O   . HOH C 3 .   ? 16.299  59.930 32.317 1.00 40.67 ? 677 HOH A O   1 
HETATM 4188 O O   . HOH C 3 .   ? 3.879   46.681 60.148 1.00 67.54 ? 678 HOH A O   1 
HETATM 4189 O O   . HOH C 3 .   ? 17.253  64.097 87.165 1.00 52.19 ? 679 HOH A O   1 
HETATM 4190 O O   . HOH C 3 .   ? 19.551  31.826 68.006 1.00 39.50 ? 680 HOH A O   1 
HETATM 4191 O O   . HOH C 3 .   ? 23.095  67.354 48.330 1.00 12.96 ? 681 HOH A O   1 
HETATM 4192 O O   . HOH C 3 .   ? -13.326 47.816 47.354 1.00 46.29 ? 682 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 GLU 536 536 ?   ?   ?   A . n 
A 1 537 THR 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 THA 1  999 999 THA THA A . 
C 3 HOH 1  601 601 HOH HOH A . 
C 3 HOH 2  602 602 HOH HOH A . 
C 3 HOH 3  603 603 HOH HOH A . 
C 3 HOH 4  604 604 HOH HOH A . 
C 3 HOH 5  605 605 HOH HOH A . 
C 3 HOH 6  606 606 HOH HOH A . 
C 3 HOH 7  607 607 HOH HOH A . 
C 3 HOH 8  608 608 HOH HOH A . 
C 3 HOH 9  609 609 HOH HOH A . 
C 3 HOH 10 610 610 HOH HOH A . 
C 3 HOH 11 611 611 HOH HOH A . 
C 3 HOH 12 612 612 HOH HOH A . 
C 3 HOH 13 613 613 HOH HOH A . 
C 3 HOH 14 614 614 HOH HOH A . 
C 3 HOH 15 615 615 HOH HOH A . 
C 3 HOH 16 616 616 HOH HOH A . 
C 3 HOH 17 617 617 HOH HOH A . 
C 3 HOH 18 618 618 HOH HOH A . 
C 3 HOH 19 619 619 HOH HOH A . 
C 3 HOH 20 620 620 HOH HOH A . 
C 3 HOH 21 621 621 HOH HOH A . 
C 3 HOH 22 622 622 HOH HOH A . 
C 3 HOH 23 623 623 HOH HOH A . 
C 3 HOH 24 624 624 HOH HOH A . 
C 3 HOH 25 625 625 HOH HOH A . 
C 3 HOH 26 626 626 HOH HOH A . 
C 3 HOH 27 627 627 HOH HOH A . 
C 3 HOH 28 628 628 HOH HOH A . 
C 3 HOH 29 629 629 HOH HOH A . 
C 3 HOH 30 630 630 HOH HOH A . 
C 3 HOH 31 631 631 HOH HOH A . 
C 3 HOH 32 632 632 HOH HOH A . 
C 3 HOH 33 633 633 HOH HOH A . 
C 3 HOH 34 634 634 HOH HOH A . 
C 3 HOH 35 635 635 HOH HOH A . 
C 3 HOH 36 636 636 HOH HOH A . 
C 3 HOH 37 637 637 HOH HOH A . 
C 3 HOH 38 638 638 HOH HOH A . 
C 3 HOH 39 639 639 HOH HOH A . 
C 3 HOH 40 640 640 HOH HOH A . 
C 3 HOH 41 641 641 HOH HOH A . 
C 3 HOH 42 642 642 HOH HOH A . 
C 3 HOH 43 643 643 HOH HOH A . 
C 3 HOH 44 644 644 HOH HOH A . 
C 3 HOH 45 645 645 HOH HOH A . 
C 3 HOH 46 646 646 HOH HOH A . 
C 3 HOH 47 647 647 HOH HOH A . 
C 3 HOH 48 648 648 HOH HOH A . 
C 3 HOH 49 649 649 HOH HOH A . 
C 3 HOH 50 650 650 HOH HOH A . 
C 3 HOH 51 651 651 HOH HOH A . 
C 3 HOH 52 652 652 HOH HOH A . 
C 3 HOH 53 653 653 HOH HOH A . 
C 3 HOH 54 654 654 HOH HOH A . 
C 3 HOH 55 655 655 HOH HOH A . 
C 3 HOH 56 656 656 HOH HOH A . 
C 3 HOH 57 657 657 HOH HOH A . 
C 3 HOH 58 658 658 HOH HOH A . 
C 3 HOH 59 659 659 HOH HOH A . 
C 3 HOH 60 660 660 HOH HOH A . 
C 3 HOH 61 661 661 HOH HOH A . 
C 3 HOH 62 662 662 HOH HOH A . 
C 3 HOH 63 663 663 HOH HOH A . 
C 3 HOH 64 664 664 HOH HOH A . 
C 3 HOH 65 665 665 HOH HOH A . 
C 3 HOH 66 666 666 HOH HOH A . 
C 3 HOH 67 667 667 HOH HOH A . 
C 3 HOH 68 668 668 HOH HOH A . 
C 3 HOH 69 669 669 HOH HOH A . 
C 3 HOH 70 670 670 HOH HOH A . 
C 3 HOH 71 671 671 HOH HOH A . 
C 3 HOH 72 672 672 HOH HOH A . 
C 3 HOH 73 673 673 HOH HOH A . 
C 3 HOH 74 674 674 HOH HOH A . 
C 3 HOH 75 675 675 HOH HOH A . 
C 3 HOH 76 676 676 HOH HOH A . 
C 3 HOH 77 677 677 HOH HOH A . 
C 3 HOH 78 678 678 HOH HOH A . 
C 3 HOH 79 679 679 HOH HOH A . 
C 3 HOH 80 680 680 HOH HOH A . 
C 3 HOH 81 681 681 HOH HOH A . 
C 3 HOH 82 682 682 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2940  ? 
1 MORE         -12   ? 
1 'SSA (A^2)'  35930 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 138.1000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-08-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-06-29 
5 'Structure model' 1 4 2021-08-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' database_2           
2 5 'Structure model' pdbx_database_status 
3 5 'Structure model' struct_site          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_database_2.pdbx_DOI'                
2 5 'Structure model' '_database_2.pdbx_database_accession' 
3 5 'Structure model' '_pdbx_database_status.process_site'  
4 5 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 5 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 5 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_pdbx_entry_details.entry_id                 1ACJ 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       'RESIDUE THA 999 IS BOUND NON-COVALENTLY IN THE ACTIVE SITE.' 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1  1 CE2 A TRP 54  ? ? CD2 A TRP 54  ? ? 1.485 1.409 0.076 0.012 N 
2  1 CG  A HIS 159 ? ? CD2 A HIS 159 ? ? 1.414 1.354 0.060 0.009 N 
3  1 CE2 A TRP 179 ? ? CD2 A TRP 179 ? ? 1.488 1.409 0.079 0.012 N 
4  1 CG  A HIS 181 ? ? CD2 A HIS 181 ? ? 1.420 1.354 0.066 0.009 N 
5  1 CG  A HIS 209 ? ? CD2 A HIS 209 ? ? 1.418 1.354 0.064 0.009 N 
6  1 CE2 A TRP 233 ? ? CD2 A TRP 233 ? ? 1.486 1.409 0.077 0.012 N 
7  1 CG  A HIS 264 ? ? CD2 A HIS 264 ? ? 1.422 1.354 0.068 0.009 N 
8  1 CE2 A TRP 279 ? ? CD2 A TRP 279 ? ? 1.488 1.409 0.079 0.012 N 
9  1 CG  A HIS 362 ? ? CD2 A HIS 362 ? ? 1.411 1.354 0.057 0.009 N 
10 1 CG  A HIS 398 ? ? CD2 A HIS 398 ? ? 1.420 1.354 0.066 0.009 N 
11 1 CG  A HIS 406 ? ? CD2 A HIS 406 ? ? 1.414 1.354 0.060 0.009 N 
12 1 CG  A HIS 425 ? ? CD2 A HIS 425 ? ? 1.414 1.354 0.060 0.009 N 
13 1 CE2 A TRP 432 ? ? CD2 A TRP 432 ? ? 1.483 1.409 0.074 0.012 N 
14 1 CE2 A TRP 435 ? ? CD2 A TRP 435 ? ? 1.484 1.409 0.075 0.012 N 
15 1 CG  A HIS 440 ? ? CD2 A HIS 440 ? ? 1.418 1.354 0.064 0.009 N 
16 1 CG  A HIS 471 ? ? CD2 A HIS 471 ? ? 1.415 1.354 0.061 0.009 N 
17 1 CE2 A TRP 473 ? ? CD2 A TRP 473 ? ? 1.481 1.409 0.072 0.012 N 
18 1 CG  A HIS 513 ? ? CD2 A HIS 513 ? ? 1.417 1.354 0.063 0.009 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 47  ? ? CZ A ARG 47  ? ? NH1 A ARG 47  ? ? 124.59 120.30 4.29  0.50 N 
2 1 NE A ARG 47  ? ? CZ A ARG 47  ? ? NH2 A ARG 47  ? ? 112.62 120.30 -7.68 0.50 N 
3 1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH2 A ARG 216 ? ? 116.98 120.30 -3.32 0.50 N 
4 1 NE A ARG 267 ? ? CZ A ARG 267 ? ? NH1 A ARG 267 ? ? 123.38 120.30 3.08  0.50 N 
5 1 N  A SER 343 ? ? CA A SER 343 ? ? CB  A SER 343 ? ? 101.02 110.50 -9.48 1.50 N 
6 1 CB A PHE 414 ? ? CG A PHE 414 ? ? CD2 A PHE 414 ? ? 114.47 120.80 -6.33 0.70 N 
7 1 CB A PHE 414 ? ? CG A PHE 414 ? ? CD1 A PHE 414 ? ? 128.77 120.80 7.97  0.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 5   ? ? 82.74   -54.44  
2  1 LEU A 23  ? ? 58.24   -117.52 
3  1 SER A 25  ? ? -130.90 -148.71 
4  1 PHE A 45  ? ? 77.90   -13.00  
5  1 ALA A 60  ? ? -114.64 54.33   
6  1 CYS A 94  ? ? -140.13 10.02   
7  1 PHE A 120 ? ? 71.73   -7.55   
8  1 HIS A 159 ? ? -18.74  -71.17  
9  1 ASN A 167 ? ? 45.27   18.23   
10 1 ASN A 183 ? ? -150.41 -2.07   
11 1 THR A 193 ? ? -142.72 51.16   
12 1 SER A 200 ? ? 61.05   -122.35 
13 1 ARG A 220 ? ? -99.61  -67.37  
14 1 GLU A 299 ? ? -107.66 -76.18  
15 1 ASP A 326 ? ? -116.39 78.45   
16 1 SER A 329 ? ? -24.13  -63.42  
17 1 SER A 345 ? ? 30.02   69.41   
18 1 VAL A 360 ? ? -118.47 65.15   
19 1 ASP A 380 ? ? -162.16 30.81   
20 1 ASP A 381 ? ? -23.32  -55.24  
21 1 VAL A 400 ? ? -133.32 -54.20  
22 1 ASN A 416 ? ? -109.87 40.81   
23 1 LYS A 498 ? ? -69.78  -73.98  
24 1 GLN A 500 ? ? -63.70  73.98   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 442 ? ? 0.063 'SIDE CHAIN' 
2 1 TYR A 458 ? ? 0.070 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 19  ? NE  ? A ARG 19  NE  
2   1 Y 1 A ARG 19  ? CZ  ? A ARG 19  CZ  
3   1 Y 1 A ARG 19  ? NH1 ? A ARG 19  NH1 
4   1 Y 1 A ARG 19  ? NH2 ? A ARG 19  NH2 
5   1 Y 1 A HIS 26  ? CG  ? A HIS 26  CG  
6   1 Y 1 A HIS 26  ? ND1 ? A HIS 26  ND1 
7   1 Y 1 A HIS 26  ? CD2 ? A HIS 26  CD2 
8   1 Y 1 A HIS 26  ? CE1 ? A HIS 26  CE1 
9   1 Y 1 A HIS 26  ? NE2 ? A HIS 26  NE2 
10  1 Y 1 A ASN 42  ? CG  ? A ASN 42  CG  
11  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
12  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
13  1 Y 1 A ARG 46  ? CZ  ? A ARG 46  CZ  
14  1 Y 1 A ARG 46  ? NH1 ? A ARG 46  NH1 
15  1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
16  1 Y 1 A GLN 74  ? OE1 ? A GLN 74  OE1 
17  1 Y 1 A GLN 74  ? NE2 ? A GLN 74  NE2 
18  1 Y 1 A ARG 88  ? NH1 ? A ARG 88  NH1 
19  1 Y 1 A ARG 88  ? NH2 ? A ARG 88  NH2 
20  1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
21  1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
22  1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
23  1 Y 1 A LYS 107 ? CG  ? A LYS 107 CG  
24  1 Y 1 A LYS 107 ? CD  ? A LYS 107 CD  
25  1 Y 1 A LYS 107 ? CE  ? A LYS 107 CE  
26  1 Y 1 A LYS 107 ? NZ  ? A LYS 107 NZ  
27  1 Y 1 A GLN 162 ? CD  ? A GLN 162 CD  
28  1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 
29  1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 
30  1 Y 1 A GLU 163 ? OE1 ? A GLU 163 OE1 
31  1 Y 1 A GLU 163 ? OE2 ? A GLU 163 OE2 
32  1 Y 1 A ASN 253 ? OD1 ? A ASN 253 OD1 
33  1 Y 1 A ASN 253 ? ND2 ? A ASN 253 ND2 
34  1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
35  1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
36  1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
37  1 Y 1 A GLU 260 ? CG  ? A GLU 260 CG  
38  1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
39  1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
40  1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
41  1 Y 1 A GLU 261 ? CD  ? A GLU 261 CD  
42  1 Y 1 A GLU 261 ? OE1 ? A GLU 261 OE1 
43  1 Y 1 A GLU 261 ? OE2 ? A GLU 261 OE2 
44  1 Y 1 A GLU 268 ? CD  ? A GLU 268 CD  
45  1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
46  1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
47  1 Y 1 A LYS 270 ? CD  ? A LYS 270 CD  
48  1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
49  1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
50  1 Y 1 A PHE 284 ? CD1 ? A PHE 284 CD1 
51  1 Y 1 A PHE 284 ? CD2 ? A PHE 284 CD2 
52  1 Y 1 A PHE 284 ? CE1 ? A PHE 284 CE1 
53  1 Y 1 A PHE 284 ? CE2 ? A PHE 284 CE2 
54  1 Y 1 A PHE 284 ? CZ  ? A PHE 284 CZ  
55  1 Y 1 A SER 286 ? OG  ? A SER 286 OG  
56  1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
57  1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
58  1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
59  1 Y 1 A ASN 310 ? CG  ? A ASN 310 CG  
60  1 Y 1 A ASN 310 ? OD1 ? A ASN 310 OD1 
61  1 Y 1 A ASN 310 ? ND2 ? A ASN 310 ND2 
62  1 Y 1 A LYS 325 ? NZ  ? A LYS 325 NZ  
63  1 Y 1 A GLU 344 ? CD  ? A GLU 344 CD  
64  1 Y 1 A GLU 344 ? OE1 ? A GLU 344 OE1 
65  1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
66  1 Y 1 A GLU 350 ? CD  ? A GLU 350 CD  
67  1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
68  1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
69  1 Y 1 A MET 353 ? SD  ? A MET 353 SD  
70  1 Y 1 A MET 353 ? CE  ? A MET 353 CE  
71  1 Y 1 A ASP 365 ? CG  ? A ASP 365 CG  
72  1 Y 1 A ASP 365 ? OD1 ? A ASP 365 OD1 
73  1 Y 1 A ASP 365 ? OD2 ? A ASP 365 OD2 
74  1 Y 1 A ASN 382 ? CG  ? A ASN 382 CG  
75  1 Y 1 A ASN 382 ? OD1 ? A ASN 382 OD1 
76  1 Y 1 A ASN 382 ? ND2 ? A ASN 382 ND2 
77  1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
78  1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
79  1 Y 1 A GLU 434 ? CD  ? A GLU 434 CD  
80  1 Y 1 A GLU 434 ? OE1 ? A GLU 434 OE1 
81  1 Y 1 A GLU 434 ? OE2 ? A GLU 434 OE2 
82  1 Y 1 A GLU 455 ? CG  ? A GLU 455 CG  
83  1 Y 1 A GLU 455 ? CD  ? A GLU 455 CD  
84  1 Y 1 A GLU 455 ? OE1 ? A GLU 455 OE1 
85  1 Y 1 A GLU 455 ? OE2 ? A GLU 455 OE2 
86  1 Y 1 A GLU 461 ? CD  ? A GLU 461 CD  
87  1 Y 1 A GLU 461 ? OE1 ? A GLU 461 OE1 
88  1 Y 1 A GLU 461 ? OE2 ? A GLU 461 OE2 
89  1 Y 1 A LYS 478 ? CE  ? A LYS 478 CE  
90  1 Y 1 A LYS 478 ? NZ  ? A LYS 478 NZ  
91  1 Y 1 A GLU 484 ? CD  ? A GLU 484 CD  
92  1 Y 1 A GLU 484 ? OE1 ? A GLU 484 OE1 
93  1 Y 1 A GLU 484 ? OE2 ? A GLU 484 OE2 
94  1 Y 1 A LYS 498 ? CG  ? A LYS 498 CG  
95  1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
96  1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
97  1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
98  1 Y 1 A GLU 499 ? CD  ? A GLU 499 CD  
99  1 Y 1 A GLU 499 ? OE1 ? A GLU 499 OE1 
100 1 Y 1 A GLU 499 ? OE2 ? A GLU 499 OE2 
101 1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
102 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
103 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
104 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
105 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
106 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
107 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
108 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
109 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
110 1 Y 1 A GLN 526 ? CD  ? A GLN 526 CD  
111 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
112 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
113 1 Y 1 A ASN 533 ? CG  ? A ASN 533 CG  
114 1 Y 1 A ASN 533 ? OD1 ? A ASN 533 OD1 
115 1 Y 1 A ASN 533 ? ND2 ? A ASN 533 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ASP 1   ? A ASP 1   
2 1 Y 1 A ASP 2   ? A ASP 2   
3 1 Y 1 A HIS 3   ? A HIS 3   
4 1 Y 1 A HIS 486 ? A HIS 486 
5 1 Y 1 A SER 487 ? A SER 487 
6 1 Y 1 A GLN 488 ? A GLN 488 
7 1 Y 1 A GLU 489 ? A GLU 489 
8 1 Y 1 A GLU 536 ? A GLU 536 
9 1 Y 1 A THR 537 ? A THR 537 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 TACRINE THA 
3 water   HOH 
#