data_1ACL
# 
_entry.id   1ACL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ACL         
WWPDB D_1000170656 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ACL 
_pdbx_database_status.recvd_initial_deposition_date   1993-08-18 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sussman, J.L.' 1 
'Harel, M.'     2 
'Silman, I.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Quaternary ligand binding to aromatic residues in the active-site gorge of acetylcholinesterase.'              
Proc.Natl.Acad.Sci.USA 90  9031 9035 1993 PNASA6 US 0027-8424 0040 ? 8415649 10.1073/pnas.90.19.9031 
1       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253 872  ?    1991 SCIEAS US 0036-8075 0038 ? ?       ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Harel, M.'          1  
primary 'Schalk, I.'         2  
primary 'Ehret-Sabatier, L.' 3  
primary 'Bouet, F.'          4  
primary 'Goeldner, M.'       5  
primary 'Hirth, C.'          6  
primary 'Axelsen, P.H.'      7  
primary 'Silman, I.'         8  
primary 'Sussman, J.L.'      9  
1       'Sussman, J.'        10 
1       'Harel, M.'          11 
1       'Frolow, F.'         12 
1       'Oefner, C.'         13 
1       'Goldman, A.'        14 
1       'Toker, L.'          15 
1       'Silman, I.'         16 
# 
_cell.entry_id           1ACL 
_cell.length_a           113.050 
_cell.length_b           113.050 
_cell.length_c           137.500 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ACL 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man ACETYLCHOLINESTERASE 60792.516 1  3.1.1.7 ? ? ? 
2 non-polymer syn 'DECAMETHONIUM ION'  258.486   1  ?       ? ? ? 
3 water       nat water                18.015    66 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATET
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATET
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 GLU n 
1 537 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Pacific electric ray' 
_entity_src_gen.gene_src_genus                     Torpedo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Torpedo californica' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7787 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ACL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 535 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  556 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       535 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
DME non-polymer         . 'DECAMETHONIUM ION' ? 'C16 H38 N2 2'   258.486 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ACL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.17 
_exptl_crystal.density_percent_sol   70.50 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1ACL 
_refine.ls_number_reflns_obs                     23089 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.8 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THE STRUCTURE WAS REFINED STARTING FROM NATIVE COORDINATES
USING X-PLOR.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4110 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         18 
_refine_hist.number_atoms_solvent             66 
_refine_hist.number_atoms_total               4194 
_refine_hist.d_res_high                       2.8 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ACL 
_struct.title                     'QUATERNARY LIGAND BINDING TO AROMATIC RESIDUES IN THE ACTIVE-SITE GORGE OF ACETYLCHOLINESTERASE' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE (E.C.3.1.1.7) COMPLEXED WITH DECAMETHONIUM' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ACL 
_struct_keywords.pdbx_keywords   'HYDROLASE(CARBOXYLIC ESTERASE)' 
_struct_keywords.text            'HYDROLASE(CARBOXYLIC ESTERASE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  H2  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  H3  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  H4  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  H5  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  H6  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  H7  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  H8  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  H9  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 H10 ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 H11 ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 H12 GLY A 384 ? TYR A 411 ? GLY A 384 TYR A 411 1 ? 28 
HELX_P HELX_P13 H13 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P14 H14 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P15 H15 VAL A 518 ? ALA A 534 ? VAL A 518 ALA A 534 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 67  SG ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 1.984 ? 
disulf2 disulf ? ? A CYS 254 SG ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 1.956 ? 
disulf3 disulf ? ? A CYS 402 SG ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.035 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -10.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
S1 ? 12 ? 
S2 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1  2  ? anti-parallel 
S1 2  3  ? anti-parallel 
S1 3  4  ? anti-parallel 
S1 4  5  ? anti-parallel 
S1 5  6  ? anti-parallel 
S1 6  7  ? anti-parallel 
S1 7  8  ? parallel      
S1 8  9  ? parallel      
S1 9  10 ? parallel      
S1 10 11 ? parallel      
S1 11 12 ? parallel      
S2 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
S1 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
S1 3  THR A 18  ? PRO A 21  ? THR A 18  PRO A 21  
S1 4  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
S1 5  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
S1 6  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
S1 7  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
S1 8  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
S1 9  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
S1 10 ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
S1 11 GLN A 318 ? TYR A 334 ? GLN A 318 TYR A 334 
S1 12 GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
S2 1  PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
S2 2  MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
DME Unknown  ? ? ? ? 4 ?                                    
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE DME A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  DME 4 SER A 200 ? SER A 200 . ? 1_555 ? 
2  DME 4 HIS A 440 ? HIS A 440 . ? 1_555 ? 
3  DME 4 GLU A 327 ? GLU A 327 . ? 1_555 ? 
4  DME 4 DME B .   ? DME A 999 . ? 1_555 ? 
5  AC1 6 TYR A 70  ? TYR A 70  . ? 1_555 ? 
6  AC1 6 TRP A 84  ? TRP A 84  . ? 1_555 ? 
7  AC1 6 TYR A 121 ? TYR A 121 . ? 1_555 ? 
8  AC1 6 TRP A 279 ? TRP A 279 . ? 1_555 ? 
9  AC1 6 PHE A 330 ? PHE A 330 . ? 1_555 ? 
10 AC1 6 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ACL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ACL 
_atom_sites.fract_transf_matrix[1][1]   0.008846 
_atom_sites.fract_transf_matrix[1][2]   0.005107 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010214 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007273 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO     104'                                   
2 'RESIDUE DME 999 IS BOUND NON-COVALENTLY IN THE ACTIVE SITE.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.869 86.561 35.045 1.00 53.86 ? 4   SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -12.059 87.787 35.148 1.00 49.97 ? 4   SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -10.886 87.324 36.008 1.00 45.96 ? 4   SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -10.914 86.133 36.306 1.00 46.99 ? 4   SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -12.876 88.917 35.772 1.00 51.99 ? 4   SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -13.506 88.384 36.947 1.00 62.58 ? 4   SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.950  88.188 36.456 1.00 40.37 ? 5   GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.839  87.592 37.215 1.00 37.01 ? 5   GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -9.187  86.683 38.421 1.00 34.63 ? 5   GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.515  85.708 38.715 1.00 36.80 ? 5   GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.729  88.580 37.595 1.00 35.28 ? 5   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.471  87.811 38.048 1.00 31.16 ? 5   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.241  88.670 38.202 1.00 32.07 ? 5   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.300  89.782 38.755 1.00 32.64 ? 5   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -4.204  88.199 37.752 1.00 35.69 ? 5   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.226 87.023 39.139 1.00 30.38 ? 6   LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.579 86.198 40.259 1.00 30.93 ? 6   LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.684 85.207 39.899 1.00 34.54 ? 6   LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.294 84.632 40.784 1.00 39.63 ? 6   LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.105 87.137 41.331 1.00 30.55 ? 6   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.034 87.678 42.270 1.00 35.34 ? 6   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -8.843  88.358 41.567 1.00 34.15 ? 6   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -10.746 88.615 43.245 1.00 32.08 ? 6   LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.006 84.997 38.637 1.00 34.21 ? 7   LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.101 84.040 38.384 1.00 33.58 ? 7   LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.706 83.104 37.276 1.00 30.29 ? 7   LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -12.857 83.522 36.122 1.00 35.70 ? 7   LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.359 84.826 37.940 1.00 34.48 ? 7   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.634 84.003 38.158 1.00 36.22 ? 7   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.852 84.909 38.042 1.00 38.92 ? 7   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -15.781 82.836 37.171 1.00 38.78 ? 7   LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.240 81.903 37.616 1.00 20.85 ? 8   VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.817 80.986 36.581 1.00 19.32 ? 8   VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.886 79.934 36.360 1.00 20.30 ? 8   VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.782 79.740 37.180 1.00 23.52 ? 8   VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.401 80.431 36.863 1.00 22.41 ? 8   VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -9.574  81.419 37.702 1.00 17.49 ? 8   VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -10.357 79.043 37.519 1.00 21.76 ? 8   VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.766 79.231 35.239 1.00 20.27 ? 9   ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.720 78.204 34.839 1.00 22.40 ? 9   ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.987 76.912 34.815 1.00 21.45 ? 9   ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -11.978 76.847 34.133 1.00 24.99 ? 9   ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -14.123 78.503 33.396 1.00 27.57 ? 9   ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.589 78.351 33.256 1.00 37.66 ? 9   ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.166 77.386 33.751 1.00 41.60 ? 9   ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -16.198 79.351 32.612 1.00 42.27 ? 9   ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.444 75.877 35.504 1.00 17.15 ? 10  THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.644 74.665 35.506 1.00 12.91 ? 10  THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.487 73.527 35.065 1.00 14.38 ? 10  THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.699 73.697 34.994 1.00 18.42 ? 10  THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.066 74.474 36.924 1.00 14.24 ? 10  THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.107 74.176 37.864 1.00 12.11 ? 10  THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.327 75.703 37.484 1.00 12.99 ? 10  THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -12.880 72.342 34.859 1.00 7.64  ? 11  LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.738 71.285 34.393 1.00 7.45  ? 11  LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.844 70.894 35.331 1.00 12.20 ? 11  LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.678 70.080 34.958 1.00 12.22 ? 11  LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.941 70.074 33.974 1.00 2.00  ? 11  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -12.078 70.392 32.745 1.00 2.00  ? 11  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.612 70.047 32.998 1.00 10.29 ? 11  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.722  69.860 31.770 1.00 13.81 ? 11  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -9.267  68.460 31.719 1.00 11.91 ? 11  LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.816 71.450 36.563 1.00 17.69 ? 12  SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.814 71.152 37.587 1.00 16.60 ? 12  SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.829 72.286 37.665 1.00 20.77 ? 12  SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.951 72.070 38.100 1.00 22.01 ? 12  SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.138 70.888 38.980 1.00 12.92 ? 12  SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.608 69.564 39.133 1.00 11.75 ? 12  SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.444 73.499 37.261 1.00 23.23 ? 13  GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.397 74.595 37.351 1.00 24.90 ? 13  GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.591 75.856 37.535 1.00 29.50 ? 13  GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.363 75.842 37.471 1.00 29.11 ? 13  GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.273 76.979 37.761 1.00 33.19 ? 14  LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.514 78.218 37.930 1.00 31.71 ? 14  LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.259 78.429 39.384 1.00 30.57 ? 14  LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -17.095 77.989 40.182 1.00 27.47 ? 14  LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.364 79.416 37.498 1.00 34.67 ? 14  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.580 79.484 35.989 1.00 43.23 ? 14  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -19.046 79.262 35.601 1.00 49.59 ? 14  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.884 80.530 35.823 1.00 56.99 ? 14  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -21.284 80.347 35.420 1.00 60.17 ? 14  LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.137 79.131 39.691 1.00 25.11 ? 15  VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.786 79.442 41.061 1.00 21.24 ? 15  VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.255 80.872 41.131 1.00 22.07 ? 15  VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.361 81.268 40.387 1.00 23.31 ? 15  VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.741 78.456 41.669 1.00 15.13 ? 15  VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -14.123 76.970 41.595 1.00 18.29 ? 15  VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -12.394 78.564 41.012 1.00 15.58 ? 15  VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.839 81.605 42.078 1.00 20.12 ? 16  MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.528 82.984 42.446 1.00 22.01 ? 16  MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.532 83.020 43.652 1.00 18.89 ? 16  MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.840 82.592 44.754 1.00 21.07 ? 16  MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.886 83.520 42.914 1.00 29.76 ? 16  MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.935 84.938 43.433 1.00 37.97 ? 16  MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -16.365 85.941 42.006 1.00 44.79 ? 16  MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.800 86.876 41.841 1.00 40.04 ? 16  MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.354 83.531 43.467 1.00 20.07 ? 17  GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.342 83.624 44.529 1.00 21.29 ? 17  GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.309 84.996 45.136 1.00 23.90 ? 17  GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.340 85.659 45.202 1.00 27.97 ? 17  GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.125 85.458 45.556 1.00 26.90 ? 18  THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -9.982  86.771 46.215 1.00 30.93 ? 18  THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -8.631  87.371 46.012 1.00 30.46 ? 18  THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -7.701  86.684 45.636 1.00 33.88 ? 18  THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -9.958  86.556 47.754 1.00 30.73 ? 18  THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.975 85.621 48.102 1.00 40.21 ? 18  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -10.271 87.796 48.610 1.00 39.40 ? 18  THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.503  88.663 46.267 1.00 32.72 ? 19  ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.171  89.258 46.178 1.00 36.68 ? 19  ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.634  89.186 47.597 1.00 36.23 ? 19  ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.380  89.528 48.507 1.00 35.77 ? 19  ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.220  90.770 45.875 1.00 40.77 ? 19  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -7.604  91.080 44.432 1.00 50.58 ? 19  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.358  91.118 43.534 1.00 63.96 ? 19  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.717  92.440 43.542 1.00 67.81 ? 19  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.485  92.619 43.013 1.00 72.20 ? 19  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -3.720  91.598 42.620 1.00 74.61 ? 19  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.995  93.848 42.911 1.00 76.91 ? 19  ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.404  88.753 47.803 1.00 33.51 ? 20  VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -4.908  88.735 49.169 1.00 33.23 ? 20  VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.619  89.519 49.081 1.00 32.23 ? 20  VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -2.881  89.309 48.128 1.00 36.68 ? 20  VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.815  87.310 49.762 1.00 33.11 ? 20  VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -6.129  86.551 49.470 1.00 33.27 ? 20  VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.593  86.500 49.321 1.00 29.21 ? 20  VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.382  90.460 49.999 1.00 28.72 ? 21  PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.209  91.322 49.895 1.00 26.97 ? 21  PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.057  90.475 50.268 1.00 26.02 ? 21  PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.215  89.468 50.949 1.00 27.00 ? 21  PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.332  92.379 50.982 1.00 24.85 ? 21  PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.392  91.807 51.927 1.00 31.89 ? 21  PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.195  90.728 51.156 1.00 28.50 ? 21  PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? 0.101   90.889 49.861 1.00 21.11 ? 22  VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.245   90.096 50.227 1.00 20.92 ? 22  VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.276   91.102 50.010 1.00 21.94 ? 22  VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.448   91.608 48.923 1.00 19.25 ? 22  VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.438   88.781 49.430 1.00 19.22 ? 22  VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 0.998   88.808 47.978 1.00 20.93 ? 22  VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 2.855   88.227 49.553 1.00 19.57 ? 22  VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 2.913   91.448 51.107 1.00 26.54 ? 23  LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 3.942   92.430 51.066 1.00 27.48 ? 23  LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.336   93.694 50.488 1.00 32.27 ? 23  LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 2.242   94.121 50.852 1.00 31.48 ? 23  LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.235   91.823 50.482 1.00 25.73 ? 23  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.530   90.418 51.124 1.00 27.15 ? 23  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.792   89.698 50.614 1.00 27.20 ? 23  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 5.626   90.503 52.653 1.00 32.39 ? 23  LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 4.023   94.249 49.540 1.00 38.07 ? 24  SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 3.507   95.484 48.994 1.00 43.56 ? 24  SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.556   95.286 47.833 1.00 43.69 ? 24  SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 2.365   96.208 47.042 1.00 46.69 ? 24  SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.768   96.187 48.474 1.00 47.98 ? 24  SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 5.842   95.975 49.406 1.00 56.13 ? 24  SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.967   94.095 47.738 1.00 39.51 ? 25  SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.162   93.807 46.572 1.00 35.72 ? 25  SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? -0.064  93.012 46.887 1.00 34.41 ? 25  SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.676  93.171 47.921 1.00 39.55 ? 25  SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.087   92.954 45.687 1.00 35.21 ? 25  SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 3.422   93.459 45.648 1.00 38.64 ? 25  SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.419  92.127 45.940 1.00 31.32 ? 26  HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.548  91.236 46.045 1.00 30.23 ? 26  HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.261  89.940 45.249 1.00 28.20 ? 26  HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.246  89.749 44.576 1.00 28.50 ? 26  HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.775  91.899 45.504 1.00 27.33 ? 26  HIS A CB  1 
ATOM   165  N N   . ILE A 1 27  ? -2.218  89.059 45.371 1.00 19.73 ? 27  ILE A N   1 
ATOM   166  C CA  . ILE A 1 27  ? -2.183  87.793 44.748 1.00 16.33 ? 27  ILE A CA  1 
ATOM   167  C C   . ILE A 1 27  ? -3.626  87.460 44.648 1.00 21.80 ? 27  ILE A C   1 
ATOM   168  O O   . ILE A 1 27  ? -4.464  88.156 45.211 1.00 25.55 ? 27  ILE A O   1 
ATOM   169  C CB  . ILE A 1 27  ? -1.415  86.902 45.707 1.00 12.68 ? 27  ILE A CB  1 
ATOM   170  C CG1 . ILE A 1 27  ? 0.022   86.789 45.242 1.00 13.93 ? 27  ILE A CG1 1 
ATOM   171  C CG2 . ILE A 1 27  ? -2.027  85.531 45.938 1.00 19.57 ? 27  ILE A CG2 1 
ATOM   172  C CD1 . ILE A 1 27  ? 0.731   85.557 45.839 1.00 13.34 ? 27  ILE A CD1 1 
ATOM   173  N N   . SER A 1 28  ? -3.959  86.432 43.906 1.00 25.76 ? 28  SER A N   1 
ATOM   174  C CA  . SER A 1 28  ? -5.372  86.060 43.824 1.00 27.58 ? 28  SER A CA  1 
ATOM   175  C C   . SER A 1 28  ? -5.308  84.797 44.650 1.00 26.58 ? 28  SER A C   1 
ATOM   176  O O   . SER A 1 28  ? -4.299  84.086 44.561 1.00 25.12 ? 28  SER A O   1 
ATOM   177  C CB  . SER A 1 28  ? -5.864  85.690 42.382 1.00 34.46 ? 28  SER A CB  1 
ATOM   178  O OG  . SER A 1 28  ? -5.263  86.404 41.273 1.00 41.15 ? 28  SER A OG  1 
ATOM   179  N N   . ALA A 1 29  ? -6.342  84.487 45.435 1.00 22.56 ? 29  ALA A N   1 
ATOM   180  C CA  . ALA A 1 29  ? -6.280  83.268 46.219 1.00 21.71 ? 29  ALA A CA  1 
ATOM   181  C C   . ALA A 1 29  ? -7.565  82.583 45.976 1.00 19.27 ? 29  ALA A C   1 
ATOM   182  O O   . ALA A 1 29  ? -8.577  83.258 45.872 1.00 16.03 ? 29  ALA A O   1 
ATOM   183  C CB  . ALA A 1 29  ? -6.183  83.590 47.717 1.00 23.62 ? 29  ALA A CB  1 
ATOM   184  N N   . PHE A 1 30  ? -7.526  81.272 45.857 1.00 17.68 ? 30  PHE A N   1 
ATOM   185  C CA  . PHE A 1 30  ? -8.787  80.546 45.632 1.00 20.35 ? 30  PHE A CA  1 
ATOM   186  C C   . PHE A 1 30  ? -8.801  79.609 46.821 1.00 20.17 ? 30  PHE A C   1 
ATOM   187  O O   . PHE A 1 30  ? -8.137  78.566 46.842 1.00 20.78 ? 30  PHE A O   1 
ATOM   188  C CB  . PHE A 1 30  ? -8.842  79.788 44.238 1.00 21.43 ? 30  PHE A CB  1 
ATOM   189  C CG  . PHE A 1 30  ? -8.737  80.724 43.021 1.00 17.46 ? 30  PHE A CG  1 
ATOM   190  C CD1 . PHE A 1 30  ? -7.476  81.156 42.579 1.00 12.49 ? 30  PHE A CD1 1 
ATOM   191  C CD2 . PHE A 1 30  ? -9.897  81.257 42.429 1.00 13.44 ? 30  PHE A CD2 1 
ATOM   192  C CE1 . PHE A 1 30  ? -7.396  82.163 41.625 1.00 9.08  ? 30  PHE A CE1 1 
ATOM   193  C CE2 . PHE A 1 30  ? -9.815  82.257 41.470 1.00 10.55 ? 30  PHE A CE2 1 
ATOM   194  C CZ  . PHE A 1 30  ? -8.560  82.723 41.089 1.00 10.21 ? 30  PHE A CZ  1 
ATOM   195  N N   . LEU A 1 31  ? -9.484  80.021 47.876 1.00 16.17 ? 31  LEU A N   1 
ATOM   196  C CA  . LEU A 1 31  ? -9.485  79.135 49.029 1.00 16.34 ? 31  LEU A CA  1 
ATOM   197  C C   . LEU A 1 31  ? -10.690 78.179 49.046 1.00 19.38 ? 31  LEU A C   1 
ATOM   198  O O   . LEU A 1 31  ? -11.827 78.482 48.718 1.00 23.58 ? 31  LEU A O   1 
ATOM   199  C CB  . LEU A 1 31  ? -9.500  79.961 50.332 1.00 10.74 ? 31  LEU A CB  1 
ATOM   200  C CG  . LEU A 1 31  ? -8.200  80.716 50.717 1.00 6.41  ? 31  LEU A CG  1 
ATOM   201  C CD1 . LEU A 1 31  ? -6.905  80.146 50.141 1.00 3.70  ? 31  LEU A CD1 1 
ATOM   202  C CD2 . LEU A 1 31  ? -8.248  82.188 50.369 1.00 2.00  ? 31  LEU A CD2 1 
ATOM   203  N N   . GLY A 1 32  ? -10.427 76.949 49.426 1.00 19.63 ? 32  GLY A N   1 
ATOM   204  C CA  . GLY A 1 32  ? -11.576 76.085 49.553 1.00 20.42 ? 32  GLY A CA  1 
ATOM   205  C C   . GLY A 1 32  ? -12.185 75.430 48.381 1.00 20.19 ? 32  GLY A C   1 
ATOM   206  O O   . GLY A 1 32  ? -13.352 75.075 48.482 1.00 25.33 ? 32  GLY A O   1 
ATOM   207  N N   . ILE A 1 33  ? -11.452 75.219 47.294 1.00 15.81 ? 33  ILE A N   1 
ATOM   208  C CA  . ILE A 1 33  ? -12.150 74.541 46.198 1.00 10.65 ? 33  ILE A CA  1 
ATOM   209  C C   . ILE A 1 33  ? -12.326 73.035 46.556 1.00 9.82  ? 33  ILE A C   1 
ATOM   210  O O   . ILE A 1 33  ? -11.377 72.360 46.938 1.00 10.56 ? 33  ILE A O   1 
ATOM   211  C CB  . ILE A 1 33  ? -11.307 74.669 44.932 1.00 4.64  ? 33  ILE A CB  1 
ATOM   212  C CG1 . ILE A 1 33  ? -11.134 76.118 44.500 1.00 2.66  ? 33  ILE A CG1 1 
ATOM   213  C CG2 . ILE A 1 33  ? -11.901 73.852 43.785 1.00 5.85  ? 33  ILE A CG2 1 
ATOM   214  C CD1 . ILE A 1 33  ? -9.873  76.253 43.636 1.00 11.10 ? 33  ILE A CD1 1 
ATOM   215  N N   . PRO A 1 34  ? -13.527 72.492 46.411 1.00 7.38  ? 34  PRO A N   1 
ATOM   216  C CA  . PRO A 1 34  ? -13.758 71.060 46.739 1.00 8.17  ? 34  PRO A CA  1 
ATOM   217  C C   . PRO A 1 34  ? -13.192 70.129 45.692 1.00 5.83  ? 34  PRO A C   1 
ATOM   218  O O   . PRO A 1 34  ? -13.185 70.503 44.546 1.00 15.66 ? 34  PRO A O   1 
ATOM   219  C CB  . PRO A 1 34  ? -15.303 70.912 46.697 1.00 8.04  ? 34  PRO A CB  1 
ATOM   220  C CG  . PRO A 1 34  ? -15.862 72.205 46.057 1.00 7.48  ? 34  PRO A CG  1 
ATOM   221  C CD  . PRO A 1 34  ? -14.704 73.221 45.968 1.00 7.07  ? 34  PRO A CD  1 
ATOM   222  N N   . PHE A 1 35  ? -12.782 68.920 46.012 1.00 2.27  ? 35  PHE A N   1 
ATOM   223  C CA  . PHE A 1 35  ? -12.265 68.064 44.959 1.00 2.00  ? 35  PHE A CA  1 
ATOM   224  C C   . PHE A 1 35  ? -12.747 66.681 45.066 1.00 5.05  ? 35  PHE A C   1 
ATOM   225  O O   . PHE A 1 35  ? -12.445 65.816 44.257 1.00 11.82 ? 35  PHE A O   1 
ATOM   226  C CB  . PHE A 1 35  ? -10.772 67.989 44.941 1.00 2.00  ? 35  PHE A CB  1 
ATOM   227  C CG  . PHE A 1 35  ? -10.134 67.461 46.190 1.00 12.03 ? 35  PHE A CG  1 
ATOM   228  C CD1 . PHE A 1 35  ? -10.053 66.095 46.412 1.00 15.73 ? 35  PHE A CD1 1 
ATOM   229  C CD2 . PHE A 1 35  ? -9.553  68.333 47.103 1.00 19.51 ? 35  PHE A CD2 1 
ATOM   230  C CE1 . PHE A 1 35  ? -9.385  65.611 47.524 1.00 16.08 ? 35  PHE A CE1 1 
ATOM   231  C CE2 . PHE A 1 35  ? -8.877  67.846 48.205 1.00 20.53 ? 35  PHE A CE2 1 
ATOM   232  C CZ  . PHE A 1 35  ? -8.796  66.479 48.415 1.00 16.49 ? 35  PHE A CZ  1 
ATOM   233  N N   . ALA A 1 36  ? -13.504 66.428 46.101 1.00 5.07  ? 36  ALA A N   1 
ATOM   234  C CA  . ALA A 1 36  ? -13.986 65.084 46.246 1.00 5.61  ? 36  ALA A CA  1 
ATOM   235  C C   . ALA A 1 36  ? -15.291 65.256 46.934 1.00 7.91  ? 36  ALA A C   1 
ATOM   236  O O   . ALA A 1 36  ? -15.701 66.383 47.199 1.00 8.50  ? 36  ALA A O   1 
ATOM   237  C CB  . ALA A 1 36  ? -12.974 64.233 46.951 1.00 4.59  ? 36  ALA A CB  1 
ATOM   238  N N   . GLU A 1 37  ? -15.968 64.166 47.192 1.00 9.63  ? 37  GLU A N   1 
ATOM   239  C CA  . GLU A 1 37  ? -17.252 64.386 47.823 1.00 16.38 ? 37  GLU A CA  1 
ATOM   240  C C   . GLU A 1 37  ? -17.081 64.312 49.298 1.00 18.45 ? 37  GLU A C   1 
ATOM   241  O O   . GLU A 1 37  ? -16.359 63.398 49.676 1.00 26.68 ? 37  GLU A O   1 
ATOM   242  C CB  . GLU A 1 37  ? -18.161 63.223 47.391 1.00 22.81 ? 37  GLU A CB  1 
ATOM   243  C CG  . GLU A 1 37  ? -18.635 63.357 45.936 1.00 26.38 ? 37  GLU A CG  1 
ATOM   244  C CD  . GLU A 1 37  ? -19.638 64.493 45.721 1.00 26.45 ? 37  GLU A CD  1 
ATOM   245  O OE1 . GLU A 1 37  ? -19.206 65.646 45.668 1.00 28.80 ? 37  GLU A OE1 1 
ATOM   246  O OE2 . GLU A 1 37  ? -20.841 64.213 45.605 1.00 28.48 ? 37  GLU A OE2 1 
ATOM   247  N N   . PRO A 1 38  ? -17.800 65.163 50.108 1.00 18.13 ? 38  PRO A N   1 
ATOM   248  C CA  . PRO A 1 38  ? -17.689 65.169 51.572 1.00 11.48 ? 38  PRO A CA  1 
ATOM   249  C C   . PRO A 1 38  ? -17.912 63.765 52.045 1.00 6.86  ? 38  PRO A C   1 
ATOM   250  O O   . PRO A 1 38  ? -18.952 63.214 51.757 1.00 6.63  ? 38  PRO A O   1 
ATOM   251  C CB  . PRO A 1 38  ? -18.890 65.956 52.101 1.00 11.08 ? 38  PRO A CB  1 
ATOM   252  C CG  . PRO A 1 38  ? -19.509 66.644 50.899 1.00 19.31 ? 38  PRO A CG  1 
ATOM   253  C CD  . PRO A 1 38  ? -18.988 65.897 49.663 1.00 22.38 ? 38  PRO A CD  1 
ATOM   254  N N   . PRO A 1 39  ? -16.936 63.171 52.698 1.00 7.33  ? 39  PRO A N   1 
ATOM   255  C CA  . PRO A 1 39  ? -17.044 61.766 53.038 1.00 6.95  ? 39  PRO A CA  1 
ATOM   256  C C   . PRO A 1 39  ? -17.804 61.622 54.296 1.00 9.23  ? 39  PRO A C   1 
ATOM   257  O O   . PRO A 1 39  ? -17.281 61.168 55.302 1.00 17.39 ? 39  PRO A O   1 
ATOM   258  C CB  . PRO A 1 39  ? -15.603 61.343 53.283 1.00 3.36  ? 39  PRO A CB  1 
ATOM   259  C CG  . PRO A 1 39  ? -14.849 62.624 53.512 1.00 2.91  ? 39  PRO A CG  1 
ATOM   260  C CD  . PRO A 1 39  ? -15.627 63.748 52.862 1.00 3.17  ? 39  PRO A CD  1 
ATOM   261  N N   . VAL A 1 40  ? -19.022 62.052 54.264 1.00 5.39  ? 40  VAL A N   1 
ATOM   262  C CA  . VAL A 1 40  ? -19.770 61.967 55.451 1.00 7.08  ? 40  VAL A CA  1 
ATOM   263  C C   . VAL A 1 40  ? -20.683 60.757 55.539 1.00 18.17 ? 40  VAL A C   1 
ATOM   264  O O   . VAL A 1 40  ? -21.181 60.134 54.595 1.00 18.25 ? 40  VAL A O   1 
ATOM   265  C CB  . VAL A 1 40  ? -20.468 63.271 55.516 1.00 2.73  ? 40  VAL A CB  1 
ATOM   266  C CG1 . VAL A 1 40  ? -19.381 64.349 55.641 1.00 2.00  ? 40  VAL A CG1 1 
ATOM   267  C CG2 . VAL A 1 40  ? -21.337 63.514 54.275 1.00 5.70  ? 40  VAL A CG2 1 
ATOM   268  N N   . GLY A 1 41  ? -20.871 60.430 56.826 1.00 25.38 ? 41  GLY A N   1 
ATOM   269  C CA  . GLY A 1 41  ? -21.754 59.345 57.227 1.00 29.07 ? 41  GLY A CA  1 
ATOM   270  C C   . GLY A 1 41  ? -21.444 58.022 56.648 1.00 28.84 ? 41  GLY A C   1 
ATOM   271  O O   . GLY A 1 41  ? -20.445 57.441 57.045 1.00 35.66 ? 41  GLY A O   1 
ATOM   272  N N   . ASN A 1 42  ? -22.320 57.559 55.718 1.00 28.87 ? 42  ASN A N   1 
ATOM   273  C CA  . ASN A 1 42  ? -22.166 56.253 55.044 1.00 27.27 ? 42  ASN A CA  1 
ATOM   274  C C   . ASN A 1 42  ? -20.827 56.125 54.324 1.00 28.43 ? 42  ASN A C   1 
ATOM   275  O O   . ASN A 1 42  ? -20.208 55.084 54.202 1.00 29.50 ? 42  ASN A O   1 
ATOM   276  C CB  . ASN A 1 42  ? -23.216 56.091 53.971 1.00 28.29 ? 42  ASN A CB  1 
ATOM   277  N N   . MET A 1 43  ? -20.377 57.251 53.796 1.00 28.74 ? 43  MET A N   1 
ATOM   278  C CA  . MET A 1 43  ? -19.113 57.186 53.112 1.00 27.70 ? 43  MET A CA  1 
ATOM   279  C C   . MET A 1 43  ? -17.934 57.180 54.063 1.00 24.30 ? 43  MET A C   1 
ATOM   280  O O   . MET A 1 43  ? -16.787 57.175 53.639 1.00 24.98 ? 43  MET A O   1 
ATOM   281  C CB  . MET A 1 43  ? -19.017 58.388 52.161 1.00 35.88 ? 43  MET A CB  1 
ATOM   282  C CG  . MET A 1 43  ? -19.815 58.247 50.860 1.00 37.22 ? 43  MET A CG  1 
ATOM   283  S SD  . MET A 1 43  ? -19.411 59.756 49.901 1.00 53.08 ? 43  MET A SD  1 
ATOM   284  C CE  . MET A 1 43  ? -20.674 60.910 50.563 1.00 47.35 ? 43  MET A CE  1 
ATOM   285  N N   . ARG A 1 44  ? -18.165 57.263 55.358 1.00 21.05 ? 44  ARG A N   1 
ATOM   286  C CA  . ARG A 1 44  ? -17.008 57.236 56.223 1.00 22.57 ? 44  ARG A CA  1 
ATOM   287  C C   . ARG A 1 44  ? -16.177 55.996 55.883 1.00 17.74 ? 44  ARG A C   1 
ATOM   288  O O   . ARG A 1 44  ? -16.754 54.963 55.592 1.00 12.95 ? 44  ARG A O   1 
ATOM   289  C CB  . ARG A 1 44  ? -17.426 57.231 57.735 1.00 25.81 ? 44  ARG A CB  1 
ATOM   290  C CG  . ARG A 1 44  ? -16.223 57.302 58.715 1.00 26.45 ? 44  ARG A CG  1 
ATOM   291  C CD  . ARG A 1 44  ? -16.579 57.227 60.188 1.00 25.40 ? 44  ARG A CD  1 
ATOM   292  N NE  . ARG A 1 44  ? -17.369 58.365 60.535 1.00 29.59 ? 44  ARG A NE  1 
ATOM   293  C CZ  . ARG A 1 44  ? -17.865 58.512 61.754 1.00 30.12 ? 44  ARG A CZ  1 
ATOM   294  N NH1 . ARG A 1 44  ? -17.577 57.664 62.729 1.00 30.77 ? 44  ARG A NH1 1 
ATOM   295  N NH2 . ARG A 1 44  ? -18.663 59.533 61.975 1.00 26.20 ? 44  ARG A NH2 1 
ATOM   296  N N   . PHE A 1 45  ? -14.843 56.165 55.906 1.00 17.86 ? 45  PHE A N   1 
ATOM   297  C CA  . PHE A 1 45  ? -13.870 55.112 55.644 1.00 20.96 ? 45  PHE A CA  1 
ATOM   298  C C   . PHE A 1 45  ? -13.849 54.548 54.222 1.00 23.31 ? 45  PHE A C   1 
ATOM   299  O O   . PHE A 1 45  ? -13.134 53.589 53.946 1.00 23.12 ? 45  PHE A O   1 
ATOM   300  C CB  . PHE A 1 45  ? -14.088 53.907 56.586 1.00 22.96 ? 45  PHE A CB  1 
ATOM   301  C CG  . PHE A 1 45  ? -14.301 54.266 58.034 1.00 24.50 ? 45  PHE A CG  1 
ATOM   302  C CD1 . PHE A 1 45  ? -13.313 54.930 58.747 1.00 29.81 ? 45  PHE A CD1 1 
ATOM   303  C CD2 . PHE A 1 45  ? -15.476 53.912 58.667 1.00 28.22 ? 45  PHE A CD2 1 
ATOM   304  C CE1 . PHE A 1 45  ? -13.500 55.227 60.086 1.00 32.35 ? 45  PHE A CE1 1 
ATOM   305  C CE2 . PHE A 1 45  ? -15.666 54.190 60.016 1.00 30.10 ? 45  PHE A CE2 1 
ATOM   306  C CZ  . PHE A 1 45  ? -14.675 54.848 60.722 1.00 35.09 ? 45  PHE A CZ  1 
ATOM   307  N N   . ARG A 1 46  ? -14.655 55.121 53.324 1.00 25.93 ? 46  ARG A N   1 
ATOM   308  C CA  . ARG A 1 46  ? -14.687 54.639 51.936 1.00 24.01 ? 46  ARG A CA  1 
ATOM   309  C C   . ARG A 1 46  ? -13.710 55.430 51.177 1.00 20.59 ? 46  ARG A C   1 
ATOM   310  O O   . ARG A 1 46  ? -13.229 56.441 51.664 1.00 22.02 ? 46  ARG A O   1 
ATOM   311  C CB  . ARG A 1 46  ? -16.050 54.920 51.287 1.00 28.40 ? 46  ARG A CB  1 
ATOM   312  C CG  . ARG A 1 46  ? -17.177 54.103 51.923 1.00 29.37 ? 46  ARG A CG  1 
ATOM   313  C CD  . ARG A 1 46  ? -17.044 52.640 51.554 1.00 36.01 ? 46  ARG A CD  1 
ATOM   314  N NE  . ARG A 1 46  ? -17.365 52.420 50.151 1.00 40.30 ? 46  ARG A NE  1 
ATOM   315  N N   . ARG A 1 47  ? -13.428 54.968 49.966 1.00 16.54 ? 47  ARG A N   1 
ATOM   316  C CA  . ARG A 1 47  ? -12.458 55.742 49.197 1.00 18.33 ? 47  ARG A CA  1 
ATOM   317  C C   . ARG A 1 47  ? -13.114 57.089 48.779 1.00 18.75 ? 47  ARG A C   1 
ATOM   318  O O   . ARG A 1 47  ? -14.334 57.203 48.716 1.00 18.21 ? 47  ARG A O   1 
ATOM   319  C CB  . ARG A 1 47  ? -11.992 54.944 47.966 1.00 14.90 ? 47  ARG A CB  1 
ATOM   320  C CG  . ARG A 1 47  ? -11.923 53.434 48.216 1.00 26.60 ? 47  ARG A CG  1 
ATOM   321  N N   . PRO A 1 48  ? -12.291 58.095 48.482 1.00 16.98 ? 48  PRO A N   1 
ATOM   322  C CA  . PRO A 1 48  ? -12.864 59.355 48.075 1.00 19.79 ? 48  PRO A CA  1 
ATOM   323  C C   . PRO A 1 48  ? -13.596 59.233 46.761 1.00 20.69 ? 48  PRO A C   1 
ATOM   324  O O   . PRO A 1 48  ? -13.126 58.543 45.875 1.00 20.90 ? 48  PRO A O   1 
ATOM   325  C CB  . PRO A 1 48  ? -11.672 60.315 47.947 1.00 17.47 ? 48  PRO A CB  1 
ATOM   326  C CG  . PRO A 1 48  ? -10.395 59.482 48.251 1.00 20.02 ? 48  PRO A CG  1 
ATOM   327  C CD  . PRO A 1 48  ? -10.841 58.079 48.635 1.00 17.78 ? 48  PRO A CD  1 
ATOM   328  N N   . GLU A 1 49  ? -14.767 59.868 46.657 1.00 21.17 ? 49  GLU A N   1 
ATOM   329  C CA  . GLU A 1 49  ? -15.449 59.844 45.377 1.00 21.68 ? 49  GLU A CA  1 
ATOM   330  C C   . GLU A 1 49  ? -14.981 61.167 44.835 1.00 23.18 ? 49  GLU A C   1 
ATOM   331  O O   . GLU A 1 49  ? -14.723 62.045 45.652 1.00 27.41 ? 49  GLU A O   1 
ATOM   332  C CB  . GLU A 1 49  ? -17.009 59.926 45.476 1.00 29.65 ? 49  GLU A CB  1 
ATOM   333  C CG  . GLU A 1 49  ? -17.818 58.615 45.587 1.00 30.46 ? 49  GLU A CG  1 
ATOM   334  N N   . PRO A 1 50  ? -14.956 61.339 43.504 1.00 22.33 ? 50  PRO A N   1 
ATOM   335  C CA  . PRO A 1 50  ? -14.637 62.616 42.897 1.00 19.91 ? 50  PRO A CA  1 
ATOM   336  C C   . PRO A 1 50  ? -15.800 63.518 43.037 1.00 19.46 ? 50  PRO A C   1 
ATOM   337  O O   . PRO A 1 50  ? -16.940 63.080 43.051 1.00 22.52 ? 50  PRO A O   1 
ATOM   338  C CB  . PRO A 1 50  ? -14.453 62.308 41.408 1.00 19.55 ? 50  PRO A CB  1 
ATOM   339  C CG  . PRO A 1 50  ? -15.101 60.951 41.167 1.00 25.25 ? 50  PRO A CG  1 
ATOM   340  C CD  . PRO A 1 50  ? -15.264 60.302 42.547 1.00 25.42 ? 50  PRO A CD  1 
ATOM   341  N N   . LYS A 1 51  ? -15.495 64.798 43.106 1.00 21.73 ? 51  LYS A N   1 
ATOM   342  C CA  . LYS A 1 51  ? -16.538 65.796 43.261 1.00 22.72 ? 51  LYS A CA  1 
ATOM   343  C C   . LYS A 1 51  ? -17.319 66.136 42.019 1.00 22.99 ? 51  LYS A C   1 
ATOM   344  O O   . LYS A 1 51  ? -16.766 66.794 41.142 1.00 22.47 ? 51  LYS A O   1 
ATOM   345  C CB  . LYS A 1 51  ? -15.798 67.084 43.627 1.00 24.99 ? 51  LYS A CB  1 
ATOM   346  C CG  . LYS A 1 51  ? -16.629 68.344 43.792 1.00 23.85 ? 51  LYS A CG  1 
ATOM   347  C CD  . LYS A 1 51  ? -17.752 68.202 44.815 1.00 22.96 ? 51  LYS A CD  1 
ATOM   348  C CE  . LYS A 1 51  ? -18.476 69.547 44.956 1.00 28.39 ? 51  LYS A CE  1 
ATOM   349  N NZ  . LYS A 1 51  ? -19.321 69.560 46.126 1.00 29.37 ? 51  LYS A NZ  1 
ATOM   350  N N   . LYS A 1 52  ? -18.611 65.733 41.994 1.00 26.50 ? 52  LYS A N   1 
ATOM   351  C CA  . LYS A 1 52  ? -19.500 66.052 40.863 1.00 28.61 ? 52  LYS A CA  1 
ATOM   352  C C   . LYS A 1 52  ? -19.502 67.596 40.598 1.00 28.87 ? 52  LYS A C   1 
ATOM   353  O O   . LYS A 1 52  ? -19.502 68.354 41.557 1.00 30.21 ? 52  LYS A O   1 
ATOM   354  C CB  . LYS A 1 52  ? -20.949 65.719 41.178 1.00 31.79 ? 52  LYS A CB  1 
ATOM   355  C CG  . LYS A 1 52  ? -21.203 64.302 41.725 1.00 35.82 ? 52  LYS A CG  1 
ATOM   356  C CD  . LYS A 1 52  ? -22.732 64.052 41.778 1.00 42.03 ? 52  LYS A CD  1 
ATOM   357  C CE  . LYS A 1 52  ? -23.201 62.692 42.365 1.00 48.92 ? 52  LYS A CE  1 
ATOM   358  N NZ  . LYS A 1 52  ? -23.773 62.836 43.706 1.00 48.58 ? 52  LYS A NZ  1 
ATOM   359  N N   . PRO A 1 53  ? -19.484 68.043 39.326 1.00 28.40 ? 53  PRO A N   1 
ATOM   360  C CA  . PRO A 1 53  ? -19.259 69.452 38.992 1.00 23.92 ? 53  PRO A CA  1 
ATOM   361  C C   . PRO A 1 53  ? -20.410 70.285 39.387 1.00 21.32 ? 53  PRO A C   1 
ATOM   362  O O   . PRO A 1 53  ? -21.507 69.779 39.508 1.00 23.79 ? 53  PRO A O   1 
ATOM   363  C CB  . PRO A 1 53  ? -19.201 69.461 37.467 1.00 30.21 ? 53  PRO A CB  1 
ATOM   364  C CG  . PRO A 1 53  ? -19.027 68.007 37.025 1.00 31.88 ? 53  PRO A CG  1 
ATOM   365  C CD  . PRO A 1 53  ? -19.614 67.184 38.158 1.00 32.22 ? 53  PRO A CD  1 
ATOM   366  N N   . TRP A 1 54  ? -20.169 71.564 39.521 1.00 22.23 ? 54  TRP A N   1 
ATOM   367  C CA  . TRP A 1 54  ? -21.199 72.501 39.948 1.00 29.09 ? 54  TRP A CA  1 
ATOM   368  C C   . TRP A 1 54  ? -21.593 73.519 38.841 1.00 35.85 ? 54  TRP A C   1 
ATOM   369  O O   . TRP A 1 54  ? -20.952 73.728 37.808 1.00 37.26 ? 54  TRP A O   1 
ATOM   370  C CB  . TRP A 1 54  ? -20.714 73.253 41.261 1.00 20.57 ? 54  TRP A CB  1 
ATOM   371  C CG  . TRP A 1 54  ? -19.287 73.820 41.172 1.00 11.69 ? 54  TRP A CG  1 
ATOM   372  C CD1 . TRP A 1 54  ? -18.936 75.121 40.731 1.00 9.98  ? 54  TRP A CD1 1 
ATOM   373  C CD2 . TRP A 1 54  ? -18.082 73.177 41.490 1.00 2.00  ? 54  TRP A CD2 1 
ATOM   374  N NE1 . TRP A 1 54  ? -17.598 75.290 40.716 1.00 7.71  ? 54  TRP A NE1 1 
ATOM   375  C CE2 . TRP A 1 54  ? -17.007 74.123 41.148 1.00 9.04  ? 54  TRP A CE2 1 
ATOM   376  C CE3 . TRP A 1 54  ? -17.775 71.939 42.007 1.00 2.00  ? 54  TRP A CE3 1 
ATOM   377  C CZ2 . TRP A 1 54  ? -15.684 73.816 41.484 1.00 7.15  ? 54  TRP A CZ2 1 
ATOM   378  C CZ3 . TRP A 1 54  ? -16.441 71.657 42.322 1.00 6.53  ? 54  TRP A CZ3 1 
ATOM   379  C CH2 . TRP A 1 54  ? -15.406 72.553 42.031 1.00 7.72  ? 54  TRP A CH2 1 
ATOM   380  N N   . SER A 1 55  ? -22.723 74.182 39.155 1.00 43.47 ? 55  SER A N   1 
ATOM   381  C CA  . SER A 1 55  ? -23.309 75.255 38.352 1.00 44.98 ? 55  SER A CA  1 
ATOM   382  C C   . SER A 1 55  ? -23.068 76.513 39.165 1.00 45.94 ? 55  SER A C   1 
ATOM   383  O O   . SER A 1 55  ? -22.880 76.443 40.374 1.00 48.70 ? 55  SER A O   1 
ATOM   384  C CB  . SER A 1 55  ? -24.834 75.131 38.202 1.00 41.67 ? 55  SER A CB  1 
ATOM   385  O OG  . SER A 1 55  ? -25.137 74.127 37.240 1.00 49.08 ? 55  SER A OG  1 
ATOM   386  N N   . GLY A 1 56  ? -23.128 77.675 38.487 1.00 45.82 ? 56  GLY A N   1 
ATOM   387  C CA  . GLY A 1 56  ? -22.900 78.922 39.207 1.00 42.86 ? 56  GLY A CA  1 
ATOM   388  C C   . GLY A 1 56  ? -21.445 79.010 39.615 1.00 40.52 ? 56  GLY A C   1 
ATOM   389  O O   . GLY A 1 56  ? -20.668 78.099 39.349 1.00 45.16 ? 56  GLY A O   1 
ATOM   390  N N   . VAL A 1 57  ? -21.073 80.144 40.194 1.00 34.50 ? 57  VAL A N   1 
ATOM   391  C CA  . VAL A 1 57  ? -19.709 80.207 40.582 1.00 29.78 ? 57  VAL A CA  1 
ATOM   392  C C   . VAL A 1 57  ? -19.598 79.846 42.064 1.00 32.25 ? 57  VAL A C   1 
ATOM   393  O O   . VAL A 1 57  ? -20.311 80.354 42.911 1.00 31.38 ? 57  VAL A O   1 
ATOM   394  C CB  . VAL A 1 57  ? -19.197 81.568 40.149 1.00 22.61 ? 57  VAL A CB  1 
ATOM   395  C CG1 . VAL A 1 57  ? -20.071 82.697 40.635 1.00 23.27 ? 57  VAL A CG1 1 
ATOM   396  C CG2 . VAL A 1 57  ? -17.722 81.753 40.502 1.00 24.86 ? 57  VAL A CG2 1 
ATOM   397  N N   . TRP A 1 58  ? -18.673 78.916 42.352 1.00 35.27 ? 58  TRP A N   1 
ATOM   398  C CA  . TRP A 1 58  ? -18.349 78.496 43.716 1.00 32.05 ? 58  TRP A CA  1 
ATOM   399  C C   . TRP A 1 58  ? -17.495 79.641 44.322 1.00 32.91 ? 58  TRP A C   1 
ATOM   400  O O   . TRP A 1 58  ? -16.610 80.175 43.645 1.00 31.68 ? 58  TRP A O   1 
ATOM   401  C CB  . TRP A 1 58  ? -17.449 77.281 43.589 1.00 32.24 ? 58  TRP A CB  1 
ATOM   402  C CG  . TRP A 1 58  ? -17.070 76.740 44.942 1.00 32.20 ? 58  TRP A CG  1 
ATOM   403  C CD1 . TRP A 1 58  ? -15.989 77.154 45.778 1.00 29.46 ? 58  TRP A CD1 1 
ATOM   404  C CD2 . TRP A 1 58  ? -17.795 75.761 45.611 1.00 28.22 ? 58  TRP A CD2 1 
ATOM   405  N NE1 . TRP A 1 58  ? -16.053 76.470 46.951 1.00 28.88 ? 58  TRP A NE1 1 
ATOM   406  C CE2 . TRP A 1 58  ? -17.132 75.609 46.902 1.00 29.40 ? 58  TRP A CE2 1 
ATOM   407  C CE3 . TRP A 1 58  ? -18.906 75.016 45.274 1.00 30.16 ? 58  TRP A CE3 1 
ATOM   408  C CZ2 . TRP A 1 58  ? -17.656 74.694 47.791 1.00 29.01 ? 58  TRP A CZ2 1 
ATOM   409  C CZ3 . TRP A 1 58  ? -19.394 74.104 46.187 1.00 26.79 ? 58  TRP A CZ3 1 
ATOM   410  C CH2 . TRP A 1 58  ? -18.777 73.951 47.425 1.00 28.62 ? 58  TRP A CH2 1 
ATOM   411  N N   . ASN A 1 59  ? -17.709 79.987 45.621 1.00 29.36 ? 59  ASN A N   1 
ATOM   412  C CA  . ASN A 1 59  ? -16.965 81.099 46.226 1.00 24.67 ? 59  ASN A CA  1 
ATOM   413  C C   . ASN A 1 59  ? -15.764 80.685 46.994 1.00 24.71 ? 59  ASN A C   1 
ATOM   414  O O   . ASN A 1 59  ? -15.807 80.516 48.198 1.00 28.29 ? 59  ASN A O   1 
ATOM   415  C CB  . ASN A 1 59  ? -17.842 81.853 47.243 1.00 26.24 ? 59  ASN A CB  1 
ATOM   416  C CG  . ASN A 1 59  ? -17.379 83.278 47.492 1.00 26.61 ? 59  ASN A CG  1 
ATOM   417  O OD1 . ASN A 1 59  ? -18.062 84.011 48.183 1.00 24.01 ? 59  ASN A OD1 1 
ATOM   418  N ND2 . ASN A 1 59  ? -16.221 83.689 46.900 1.00 18.65 ? 59  ASN A ND2 1 
ATOM   419  N N   . ALA A 1 60  ? -14.649 80.593 46.322 1.00 23.68 ? 60  ALA A N   1 
ATOM   420  C CA  . ALA A 1 60  ? -13.453 80.140 46.979 1.00 20.37 ? 60  ALA A CA  1 
ATOM   421  C C   . ALA A 1 60  ? -12.718 81.243 47.650 1.00 21.25 ? 60  ALA A C   1 
ATOM   422  O O   . ALA A 1 60  ? -11.561 81.498 47.357 1.00 21.25 ? 60  ALA A O   1 
ATOM   423  C CB  . ALA A 1 60  ? -12.566 79.529 45.901 1.00 21.59 ? 60  ALA A CB  1 
ATOM   424  N N   . SER A 1 61  ? -13.375 81.893 48.574 1.00 23.61 ? 61  SER A N   1 
ATOM   425  C CA  . SER A 1 61  ? -12.664 83.019 49.228 1.00 28.04 ? 61  SER A CA  1 
ATOM   426  C C   . SER A 1 61  ? -12.362 82.847 50.723 1.00 28.83 ? 61  SER A C   1 
ATOM   427  O O   . SER A 1 61  ? -11.816 83.733 51.382 1.00 26.21 ? 61  SER A O   1 
ATOM   428  C CB  . SER A 1 61  ? -13.526 84.256 49.019 1.00 29.01 ? 61  SER A CB  1 
ATOM   429  O OG  . SER A 1 61  ? -14.880 83.934 49.336 1.00 37.68 ? 61  SER A OG  1 
ATOM   430  N N   . THR A 1 62  ? -12.755 81.666 51.245 1.00 27.35 ? 62  THR A N   1 
ATOM   431  C CA  . THR A 1 62  ? -12.597 81.360 52.660 1.00 24.76 ? 62  THR A CA  1 
ATOM   432  C C   . THR A 1 62  ? -11.942 79.984 52.905 1.00 21.77 ? 62  THR A C   1 
ATOM   433  O O   . THR A 1 62  ? -12.261 78.969 52.297 1.00 20.45 ? 62  THR A O   1 
ATOM   434  C CB  . THR A 1 62  ? -14.014 81.435 53.203 1.00 23.25 ? 62  THR A CB  1 
ATOM   435  O OG1 . THR A 1 62  ? -14.864 80.589 52.439 1.00 27.86 ? 62  THR A OG1 1 
ATOM   436  C CG2 . THR A 1 62  ? -14.626 82.823 53.050 1.00 27.55 ? 62  THR A CG2 1 
ATOM   437  N N   . TYR A 1 63  ? -10.978 79.937 53.811 1.00 17.91 ? 63  TYR A N   1 
ATOM   438  C CA  . TYR A 1 63  ? -10.392 78.598 53.967 1.00 16.65 ? 63  TYR A CA  1 
ATOM   439  C C   . TYR A 1 63  ? -11.440 77.557 54.385 1.00 12.84 ? 63  TYR A C   1 
ATOM   440  O O   . TYR A 1 63  ? -12.412 77.857 55.049 1.00 17.88 ? 63  TYR A O   1 
ATOM   441  C CB  . TYR A 1 63  ? -9.377  78.571 55.069 1.00 14.20 ? 63  TYR A CB  1 
ATOM   442  C CG  . TYR A 1 63  ? -8.107  79.212 54.714 1.00 17.07 ? 63  TYR A CG  1 
ATOM   443  C CD1 . TYR A 1 63  ? -7.085  78.463 54.199 1.00 24.84 ? 63  TYR A CD1 1 
ATOM   444  C CD2 . TYR A 1 63  ? -7.879  80.539 55.034 1.00 24.33 ? 63  TYR A CD2 1 
ATOM   445  C CE1 . TYR A 1 63  ? -5.798  78.977 54.148 1.00 28.00 ? 63  TYR A CE1 1 
ATOM   446  C CE2 . TYR A 1 63  ? -6.592  81.065 54.958 1.00 29.35 ? 63  TYR A CE2 1 
ATOM   447  C CZ  . TYR A 1 63  ? -5.520  80.264 54.571 1.00 26.06 ? 63  TYR A CZ  1 
ATOM   448  O OH  . TYR A 1 63  ? -4.198  80.694 54.672 1.00 26.97 ? 63  TYR A OH  1 
ATOM   449  N N   . PRO A 1 64  ? -11.204 76.327 54.034 1.00 5.89  ? 64  PRO A N   1 
ATOM   450  C CA  . PRO A 1 64  ? -12.205 75.327 54.327 1.00 13.68 ? 64  PRO A CA  1 
ATOM   451  C C   . PRO A 1 64  ? -12.260 74.810 55.783 1.00 13.63 ? 64  PRO A C   1 
ATOM   452  O O   . PRO A 1 64  ? -11.462 75.137 56.648 1.00 13.32 ? 64  PRO A O   1 
ATOM   453  C CB  . PRO A 1 64  ? -11.825 74.198 53.333 1.00 13.56 ? 64  PRO A CB  1 
ATOM   454  C CG  . PRO A 1 64  ? -10.331 74.419 53.012 1.00 19.07 ? 64  PRO A CG  1 
ATOM   455  C CD  . PRO A 1 64  ? -10.061 75.897 53.277 1.00 11.09 ? 64  PRO A CD  1 
ATOM   456  N N   . ASN A 1 65  ? -13.240 73.938 56.052 1.00 14.96 ? 65  ASN A N   1 
ATOM   457  C CA  . ASN A 1 65  ? -13.218 73.368 57.410 1.00 19.79 ? 65  ASN A CA  1 
ATOM   458  C C   . ASN A 1 65  ? -11.950 72.497 57.506 1.00 22.37 ? 65  ASN A C   1 
ATOM   459  O O   . ASN A 1 65  ? -11.319 72.134 56.502 1.00 27.56 ? 65  ASN A O   1 
ATOM   460  C CB  . ASN A 1 65  ? -14.398 72.406 57.702 1.00 19.29 ? 65  ASN A CB  1 
ATOM   461  C CG  . ASN A 1 65  ? -15.658 73.192 57.932 1.00 21.65 ? 65  ASN A CG  1 
ATOM   462  O OD1 . ASN A 1 65  ? -15.617 74.385 58.241 1.00 14.58 ? 65  ASN A OD1 1 
ATOM   463  N ND2 . ASN A 1 65  ? -16.787 72.501 57.735 1.00 22.31 ? 65  ASN A ND2 1 
ATOM   464  N N   . ASN A 1 66  ? -11.570 72.145 58.742 1.00 19.99 ? 66  ASN A N   1 
ATOM   465  C CA  . ASN A 1 66  ? -10.386 71.300 58.896 1.00 13.81 ? 66  ASN A CA  1 
ATOM   466  C C   . ASN A 1 66  ? -10.910 69.920 59.051 1.00 13.91 ? 66  ASN A C   1 
ATOM   467  O O   . ASN A 1 66  ? -12.083 69.648 59.184 1.00 16.50 ? 66  ASN A O   1 
ATOM   468  C CB  . ASN A 1 66  ? -9.553  71.712 60.078 1.00 13.96 ? 66  ASN A CB  1 
ATOM   469  C CG  . ASN A 1 66  ? -8.745  72.949 59.775 1.00 17.34 ? 66  ASN A CG  1 
ATOM   470  O OD1 . ASN A 1 66  ? -7.570  73.025 60.048 1.00 16.82 ? 66  ASN A OD1 1 
ATOM   471  N ND2 . ASN A 1 66  ? -9.348  73.953 59.177 1.00 19.17 ? 66  ASN A ND2 1 
ATOM   472  N N   . CYS A 1 67  ? -10.047 68.988 59.040 1.00 15.13 ? 67  CYS A N   1 
ATOM   473  C CA  . CYS A 1 67  ? -10.572 67.653 59.148 1.00 18.53 ? 67  CYS A CA  1 
ATOM   474  C C   . CYS A 1 67  ? -10.747 67.327 60.611 1.00 13.29 ? 67  CYS A C   1 
ATOM   475  O O   . CYS A 1 67  ? -10.124 68.033 61.380 1.00 12.26 ? 67  CYS A O   1 
ATOM   476  C CB  . CYS A 1 67  ? -9.557  66.708 58.420 1.00 21.97 ? 67  CYS A CB  1 
ATOM   477  S SG  . CYS A 1 67  ? -9.778  66.545 56.600 1.00 20.01 ? 67  CYS A SG  1 
ATOM   478  N N   . GLN A 1 68  ? -11.564 66.292 60.958 1.00 9.45  ? 68  GLN A N   1 
ATOM   479  C CA  . GLN A 1 68  ? -11.696 65.882 62.340 1.00 10.67 ? 68  GLN A CA  1 
ATOM   480  C C   . GLN A 1 68  ? -10.345 65.346 62.767 1.00 17.96 ? 68  GLN A C   1 
ATOM   481  O O   . GLN A 1 68  ? -9.797  64.565 62.007 1.00 21.02 ? 68  GLN A O   1 
ATOM   482  C CB  . GLN A 1 68  ? -12.657 64.729 62.420 1.00 5.62  ? 68  GLN A CB  1 
ATOM   483  C CG  . GLN A 1 68  ? -14.112 65.188 62.364 1.00 14.59 ? 68  GLN A CG  1 
ATOM   484  C CD  . GLN A 1 68  ? -14.422 65.997 63.591 1.00 13.51 ? 68  GLN A CD  1 
ATOM   485  O OE1 . GLN A 1 68  ? -13.638 66.031 64.521 1.00 9.19  ? 68  GLN A OE1 1 
ATOM   486  N NE2 . GLN A 1 68  ? -15.567 66.673 63.561 1.00 9.32  ? 68  GLN A NE2 1 
ATOM   487  N N   . GLN A 1 69  ? -9.814  65.717 63.943 1.00 19.90 ? 69  GLN A N   1 
ATOM   488  C CA  . GLN A 1 69  ? -8.500  65.232 64.315 1.00 18.94 ? 69  GLN A CA  1 
ATOM   489  C C   . GLN A 1 69  ? -8.229  65.541 65.772 1.00 21.37 ? 69  GLN A C   1 
ATOM   490  O O   . GLN A 1 69  ? -8.978  66.252 66.439 1.00 21.13 ? 69  GLN A O   1 
ATOM   491  C CB  . GLN A 1 69  ? -7.432  65.991 63.491 1.00 12.63 ? 69  GLN A CB  1 
ATOM   492  C CG  . GLN A 1 69  ? -7.550  67.509 63.599 1.00 9.40  ? 69  GLN A CG  1 
ATOM   493  C CD  . GLN A 1 69  ? -6.486  68.223 62.797 1.00 11.63 ? 69  GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 69  ? -5.303  68.299 63.118 1.00 14.71 ? 69  GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 69  ? -6.954  68.718 61.678 1.00 12.47 ? 69  GLN A NE2 1 
ATOM   496  N N   . TYR A 1 70  ? -7.118  64.994 66.244 1.00 19.68 ? 70  TYR A N   1 
ATOM   497  C CA  . TYR A 1 70  ? -6.714  65.217 67.622 1.00 20.86 ? 70  TYR A CA  1 
ATOM   498  C C   . TYR A 1 70  ? -6.184  66.636 67.833 1.00 21.93 ? 70  TYR A C   1 
ATOM   499  O O   . TYR A 1 70  ? -5.241  67.016 67.163 1.00 24.51 ? 70  TYR A O   1 
ATOM   500  C CB  . TYR A 1 70  ? -5.556  64.257 67.835 1.00 25.36 ? 70  TYR A CB  1 
ATOM   501  C CG  . TYR A 1 70  ? -4.860  64.407 69.164 1.00 31.56 ? 70  TYR A CG  1 
ATOM   502  C CD1 . TYR A 1 70  ? -3.822  65.312 69.289 1.00 38.12 ? 70  TYR A CD1 1 
ATOM   503  C CD2 . TYR A 1 70  ? -5.253  63.657 70.270 1.00 31.38 ? 70  TYR A CD2 1 
ATOM   504  C CE1 . TYR A 1 70  ? -3.202  65.487 70.518 1.00 42.82 ? 70  TYR A CE1 1 
ATOM   505  C CE2 . TYR A 1 70  ? -4.645  63.840 71.494 1.00 33.74 ? 70  TYR A CE2 1 
ATOM   506  C CZ  . TYR A 1 70  ? -3.627  64.771 71.628 1.00 39.11 ? 70  TYR A CZ  1 
ATOM   507  O OH  . TYR A 1 70  ? -3.039  65.015 72.850 1.00 45.55 ? 70  TYR A OH  1 
ATOM   508  N N   . VAL A 1 71  ? -6.731  67.396 68.789 1.00 19.48 ? 71  VAL A N   1 
ATOM   509  C CA  . VAL A 1 71  ? -6.225  68.744 69.010 1.00 15.79 ? 71  VAL A CA  1 
ATOM   510  C C   . VAL A 1 71  ? -5.315  68.713 70.216 1.00 18.79 ? 71  VAL A C   1 
ATOM   511  O O   . VAL A 1 71  ? -5.701  68.162 71.238 1.00 21.54 ? 71  VAL A O   1 
ATOM   512  C CB  . VAL A 1 71  ? -7.417  69.641 69.284 1.00 9.53  ? 71  VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 71  ? -7.017  71.090 69.455 1.00 4.89  ? 71  VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 71  ? -8.391  69.499 68.122 1.00 14.50 ? 71  VAL A CG2 1 
ATOM   515  N N   . ASP A 1 72  ? -4.143  69.355 70.141 1.00 16.23 ? 72  ASP A N   1 
ATOM   516  C CA  . ASP A 1 72  ? -3.227  69.299 71.267 1.00 18.98 ? 72  ASP A CA  1 
ATOM   517  C C   . ASP A 1 72  ? -3.435  70.367 72.318 1.00 23.39 ? 72  ASP A C   1 
ATOM   518  O O   . ASP A 1 72  ? -3.308  71.569 72.094 1.00 31.60 ? 72  ASP A O   1 
ATOM   519  C CB  . ASP A 1 72  ? -1.799  69.443 70.760 1.00 23.48 ? 72  ASP A CB  1 
ATOM   520  C CG  . ASP A 1 72  ? -0.723  69.404 71.857 1.00 22.45 ? 72  ASP A CG  1 
ATOM   521  O OD1 . ASP A 1 72  ? -0.551  68.360 72.512 1.00 23.25 ? 72  ASP A OD1 1 
ATOM   522  O OD2 . ASP A 1 72  ? -0.095  70.440 72.040 1.00 20.86 ? 72  ASP A OD2 1 
ATOM   523  N N   . GLU A 1 73  ? -3.682  69.897 73.534 1.00 22.13 ? 73  GLU A N   1 
ATOM   524  C CA  . GLU A 1 73  ? -3.898  70.832 74.631 1.00 23.40 ? 73  GLU A CA  1 
ATOM   525  C C   . GLU A 1 73  ? -2.818  70.656 75.683 1.00 24.04 ? 73  GLU A C   1 
ATOM   526  O O   . GLU A 1 73  ? -2.997  70.887 76.860 1.00 27.87 ? 73  GLU A O   1 
ATOM   527  C CB  . GLU A 1 73  ? -5.264  70.530 75.244 1.00 20.58 ? 73  GLU A CB  1 
ATOM   528  C CG  . GLU A 1 73  ? -6.420  70.973 74.357 1.00 26.44 ? 73  GLU A CG  1 
ATOM   529  C CD  . GLU A 1 73  ? -7.758  70.605 74.994 1.00 29.92 ? 73  GLU A CD  1 
ATOM   530  O OE1 . GLU A 1 73  ? -7.908  69.456 75.433 1.00 27.79 ? 73  GLU A OE1 1 
ATOM   531  O OE2 . GLU A 1 73  ? -8.633  71.476 75.046 1.00 33.08 ? 73  GLU A OE2 1 
ATOM   532  N N   . GLN A 1 74  ? -1.663  70.206 75.259 1.00 20.13 ? 74  GLN A N   1 
ATOM   533  C CA  . GLN A 1 74  ? -0.670  70.016 76.282 1.00 18.02 ? 74  GLN A CA  1 
ATOM   534  C C   . GLN A 1 74  ? -0.161  71.340 76.884 1.00 18.82 ? 74  GLN A C   1 
ATOM   535  O O   . GLN A 1 74  ? 0.098   71.430 78.072 1.00 20.60 ? 74  GLN A O   1 
ATOM   536  C CB  . GLN A 1 74  ? 0.437   69.163 75.680 1.00 13.69 ? 74  GLN A CB  1 
ATOM   537  C CG  . GLN A 1 74  ? 1.640   68.959 76.599 1.00 22.51 ? 74  GLN A CG  1 
ATOM   538  C CD  . GLN A 1 74  ? 1.418   67.883 77.608 1.00 20.56 ? 74  GLN A CD  1 
ATOM   539  O OE1 . GLN A 1 74  ? 1.237   66.748 77.228 1.00 27.47 ? 74  GLN A OE1 1 
ATOM   540  N NE2 . GLN A 1 74  ? 1.407   68.261 78.871 1.00 25.68 ? 74  GLN A NE2 1 
ATOM   541  N N   . PHE A 1 75  ? 0.017   72.368 76.052 1.00 20.13 ? 75  PHE A N   1 
ATOM   542  C CA  . PHE A 1 75  ? 0.539   73.659 76.522 1.00 15.49 ? 75  PHE A CA  1 
ATOM   543  C C   . PHE A 1 75  ? -0.350  74.775 75.993 1.00 17.74 ? 75  PHE A C   1 
ATOM   544  O O   . PHE A 1 75  ? 0.037   75.530 75.102 1.00 13.13 ? 75  PHE A O   1 
ATOM   545  C CB  . PHE A 1 75  ? 1.945   73.887 75.940 1.00 15.10 ? 75  PHE A CB  1 
ATOM   546  C CG  . PHE A 1 75  ? 2.926   72.782 76.226 1.00 14.39 ? 75  PHE A CG  1 
ATOM   547  C CD1 . PHE A 1 75  ? 3.057   71.694 75.382 1.00 19.55 ? 75  PHE A CD1 1 
ATOM   548  C CD2 . PHE A 1 75  ? 3.753   72.855 77.325 1.00 20.01 ? 75  PHE A CD2 1 
ATOM   549  C CE1 . PHE A 1 75  ? 4.006   70.703 75.615 1.00 16.36 ? 75  PHE A CE1 1 
ATOM   550  C CE2 . PHE A 1 75  ? 4.685   71.863 77.566 1.00 20.68 ? 75  PHE A CE2 1 
ATOM   551  C CZ  . PHE A 1 75  ? 4.813   70.781 76.713 1.00 15.91 ? 75  PHE A CZ  1 
ATOM   552  N N   . PRO A 1 76  ? -1.599  74.830 76.505 1.00 18.12 ? 76  PRO A N   1 
ATOM   553  C CA  . PRO A 1 76  ? -2.576  75.760 75.974 1.00 19.33 ? 76  PRO A CA  1 
ATOM   554  C C   . PRO A 1 76  ? -2.084  77.189 75.828 1.00 22.39 ? 76  PRO A C   1 
ATOM   555  O O   . PRO A 1 76  ? -1.294  77.689 76.617 1.00 25.31 ? 76  PRO A O   1 
ATOM   556  C CB  . PRO A 1 76  ? -3.759  75.662 76.922 1.00 15.40 ? 76  PRO A CB  1 
ATOM   557  C CG  . PRO A 1 76  ? -3.594  74.333 77.642 1.00 14.96 ? 76  PRO A CG  1 
ATOM   558  C CD  . PRO A 1 76  ? -2.132  73.960 77.537 1.00 16.56 ? 76  PRO A CD  1 
ATOM   559  N N   . GLY A 1 77  ? -2.603  77.851 74.792 1.00 25.36 ? 77  GLY A N   1 
ATOM   560  C CA  . GLY A 1 77  ? -2.187  79.215 74.539 1.00 26.92 ? 77  GLY A CA  1 
ATOM   561  C C   . GLY A 1 77  ? -0.748  79.320 74.006 1.00 27.92 ? 77  GLY A C   1 
ATOM   562  O O   . GLY A 1 77  ? -0.449  80.158 73.158 1.00 32.38 ? 77  GLY A O   1 
ATOM   563  N N   . PHE A 1 78  ? 0.174   78.451 74.480 1.00 22.51 ? 78  PHE A N   1 
ATOM   564  C CA  . PHE A 1 78  ? 1.536   78.495 74.004 1.00 11.99 ? 78  PHE A CA  1 
ATOM   565  C C   . PHE A 1 78  ? 1.512   78.403 72.515 1.00 11.30 ? 78  PHE A C   1 
ATOM   566  O O   . PHE A 1 78  ? 1.022   77.422 71.939 1.00 7.81  ? 78  PHE A O   1 
ATOM   567  C CB  . PHE A 1 78  ? 2.277   77.249 74.474 1.00 2.15  ? 78  PHE A CB  1 
ATOM   568  C CG  . PHE A 1 78  ? 3.711   77.265 74.115 1.00 2.00  ? 78  PHE A CG  1 
ATOM   569  C CD1 . PHE A 1 78  ? 4.480   78.381 74.348 1.00 2.00  ? 78  PHE A CD1 1 
ATOM   570  C CD2 . PHE A 1 78  ? 4.342   76.133 73.665 1.00 4.12  ? 78  PHE A CD2 1 
ATOM   571  C CE1 . PHE A 1 78  ? 5.854   78.336 74.194 1.00 2.00  ? 78  PHE A CE1 1 
ATOM   572  C CE2 . PHE A 1 78  ? 5.729   76.111 73.493 1.00 2.00  ? 78  PHE A CE2 1 
ATOM   573  C CZ  . PHE A 1 78  ? 6.496   77.192 73.780 1.00 2.00  ? 78  PHE A CZ  1 
ATOM   574  N N   . SER A 1 79  ? 2.071   79.441 71.908 1.00 9.36  ? 79  SER A N   1 
ATOM   575  C CA  . SER A 1 79  ? 2.067   79.383 70.447 1.00 9.84  ? 79  SER A CA  1 
ATOM   576  C C   . SER A 1 79  ? 2.831   78.166 69.910 1.00 7.56  ? 79  SER A C   1 
ATOM   577  O O   . SER A 1 79  ? 2.449   77.571 68.928 1.00 11.69 ? 79  SER A O   1 
ATOM   578  C CB  . SER A 1 79  ? 2.668   80.631 69.811 1.00 6.51  ? 79  SER A CB  1 
ATOM   579  O OG  . SER A 1 79  ? 3.927   80.785 70.445 1.00 17.01 ? 79  SER A OG  1 
ATOM   580  N N   . GLY A 1 80  ? 3.915   77.800 70.562 1.00 4.19  ? 80  GLY A N   1 
ATOM   581  C CA  . GLY A 1 80  ? 4.683   76.676 70.068 1.00 5.87  ? 80  GLY A CA  1 
ATOM   582  C C   . GLY A 1 80  ? 3.829   75.473 69.742 1.00 8.15  ? 80  GLY A C   1 
ATOM   583  O O   . GLY A 1 80  ? 4.068   74.816 68.757 1.00 11.15 ? 80  GLY A O   1 
ATOM   584  N N   . SER A 1 81  ? 2.791   75.203 70.543 1.00 10.76 ? 81  SER A N   1 
ATOM   585  C CA  . SER A 1 81  ? 1.946   74.036 70.301 1.00 17.53 ? 81  SER A CA  1 
ATOM   586  C C   . SER A 1 81  ? 0.822   74.282 69.394 1.00 19.01 ? 81  SER A C   1 
ATOM   587  O O   . SER A 1 81  ? 0.513   73.486 68.510 1.00 24.57 ? 81  SER A O   1 
ATOM   588  C CB  . SER A 1 81  ? 1.217   73.623 71.590 1.00 21.15 ? 81  SER A CB  1 
ATOM   589  O OG  . SER A 1 81  ? 2.268   73.332 72.483 1.00 35.51 ? 81  SER A OG  1 
ATOM   590  N N   . GLU A 1 82  ? 0.195   75.417 69.713 1.00 21.29 ? 82  GLU A N   1 
ATOM   591  C CA  . GLU A 1 82  ? -0.993  75.932 69.025 1.00 23.91 ? 82  GLU A CA  1 
ATOM   592  C C   . GLU A 1 82  ? -0.792  76.157 67.512 1.00 17.87 ? 82  GLU A C   1 
ATOM   593  O O   . GLU A 1 82  ? -1.701  76.033 66.714 1.00 20.39 ? 82  GLU A O   1 
ATOM   594  C CB  . GLU A 1 82  ? -1.463  77.260 69.707 1.00 31.96 ? 82  GLU A CB  1 
ATOM   595  C CG  . GLU A 1 82  ? -1.882  77.199 71.198 1.00 34.66 ? 82  GLU A CG  1 
ATOM   596  C CD  . GLU A 1 82  ? -3.221  76.497 71.383 1.00 43.65 ? 82  GLU A CD  1 
ATOM   597  O OE1 . GLU A 1 82  ? -3.832  76.091 70.394 1.00 44.76 ? 82  GLU A OE1 1 
ATOM   598  O OE2 . GLU A 1 82  ? -3.661  76.346 72.525 1.00 51.37 ? 82  GLU A OE2 1 
ATOM   599  N N   . MET A 1 83  ? 0.432   76.481 67.147 1.00 12.41 ? 83  MET A N   1 
ATOM   600  C CA  . MET A 1 83  ? 0.861   76.712 65.791 1.00 6.96  ? 83  MET A CA  1 
ATOM   601  C C   . MET A 1 83  ? 0.297   75.785 64.793 1.00 7.45  ? 83  MET A C   1 
ATOM   602  O O   . MET A 1 83  ? -0.179  76.137 63.722 1.00 12.17 ? 83  MET A O   1 
ATOM   603  C CB  . MET A 1 83  ? 2.364   76.432 65.750 1.00 5.23  ? 83  MET A CB  1 
ATOM   604  C CG  . MET A 1 83  ? 3.076   77.511 64.984 1.00 10.05 ? 83  MET A CG  1 
ATOM   605  S SD  . MET A 1 83  ? 4.807   77.039 65.130 1.00 9.66  ? 83  MET A SD  1 
ATOM   606  C CE  . MET A 1 83  ? 5.106   77.894 66.699 1.00 25.52 ? 83  MET A CE  1 
ATOM   607  N N   . TRP A 1 84  ? 0.440   74.549 65.209 1.00 5.77  ? 84  TRP A N   1 
ATOM   608  C CA  . TRP A 1 84  ? 0.054   73.435 64.406 1.00 9.37  ? 84  TRP A CA  1 
ATOM   609  C C   . TRP A 1 84  ? -1.243  72.858 64.724 1.00 14.37 ? 84  TRP A C   1 
ATOM   610  O O   . TRP A 1 84  ? -1.487  71.772 64.201 1.00 18.65 ? 84  TRP A O   1 
ATOM   611  C CB  . TRP A 1 84  ? 0.977   72.216 64.662 1.00 15.07 ? 84  TRP A CB  1 
ATOM   612  C CG  . TRP A 1 84  ? 2.414   72.632 64.810 1.00 19.12 ? 84  TRP A CG  1 
ATOM   613  C CD1 . TRP A 1 84  ? 3.092   72.851 66.029 1.00 19.94 ? 84  TRP A CD1 1 
ATOM   614  C CD2 . TRP A 1 84  ? 3.299   72.895 63.758 1.00 16.44 ? 84  TRP A CD2 1 
ATOM   615  N NE1 . TRP A 1 84  ? 4.356   73.237 65.741 1.00 23.03 ? 84  TRP A NE1 1 
ATOM   616  C CE2 . TRP A 1 84  ? 4.548   73.285 64.384 1.00 17.54 ? 84  TRP A CE2 1 
ATOM   617  C CE3 . TRP A 1 84  ? 3.183   72.867 62.382 1.00 16.03 ? 84  TRP A CE3 1 
ATOM   618  C CZ2 . TRP A 1 84  ? 5.620   73.616 63.577 1.00 18.80 ? 84  TRP A CZ2 1 
ATOM   619  C CZ3 . TRP A 1 84  ? 4.282   73.202 61.611 1.00 20.90 ? 84  TRP A CZ3 1 
ATOM   620  C CH2 . TRP A 1 84  ? 5.487   73.570 62.201 1.00 22.45 ? 84  TRP A CH2 1 
ATOM   621  N N   . ASN A 1 85  ? -2.015  73.473 65.616 1.00 14.23 ? 85  ASN A N   1 
ATOM   622  C CA  . ASN A 1 85  ? -3.324  72.868 65.909 1.00 15.55 ? 85  ASN A CA  1 
ATOM   623  C C   . ASN A 1 85  ? -4.293  73.389 64.853 1.00 13.49 ? 85  ASN A C   1 
ATOM   624  O O   . ASN A 1 85  ? -4.066  74.492 64.359 1.00 12.42 ? 85  ASN A O   1 
ATOM   625  C CB  . ASN A 1 85  ? -3.860  73.361 67.279 1.00 23.99 ? 85  ASN A CB  1 
ATOM   626  C CG  . ASN A 1 85  ? -3.850  72.346 68.362 1.00 22.42 ? 85  ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 85  ? -3.584  71.180 68.157 1.00 33.07 ? 85  ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 85  ? -4.141  72.812 69.555 1.00 24.46 ? 85  ASN A ND2 1 
ATOM   629  N N   . PRO A 1 86  ? -5.399  72.634 64.589 1.00 10.86 ? 86  PRO A N   1 
ATOM   630  C CA  . PRO A 1 86  ? -6.381  73.031 63.599 1.00 11.19 ? 86  PRO A CA  1 
ATOM   631  C C   . PRO A 1 86  ? -6.991  74.347 63.948 1.00 12.99 ? 86  PRO A C   1 
ATOM   632  O O   . PRO A 1 86  ? -7.260  74.556 65.124 1.00 16.51 ? 86  PRO A O   1 
ATOM   633  C CB  . PRO A 1 86  ? -7.482  71.970 63.650 1.00 6.92  ? 86  PRO A CB  1 
ATOM   634  C CG  . PRO A 1 86  ? -7.304  71.295 64.973 1.00 7.74  ? 86  PRO A CG  1 
ATOM   635  C CD  . PRO A 1 86  ? -5.834  71.506 65.372 1.00 11.59 ? 86  PRO A CD  1 
ATOM   636  N N   . ASN A 1 87  ? -7.249  75.197 62.921 1.00 16.02 ? 87  ASN A N   1 
ATOM   637  C CA  . ASN A 1 87  ? -7.794  76.504 63.179 1.00 13.36 ? 87  ASN A CA  1 
ATOM   638  C C   . ASN A 1 87  ? -9.124  76.836 62.587 1.00 15.76 ? 87  ASN A C   1 
ATOM   639  O O   . ASN A 1 87  ? -9.548  77.970 62.684 1.00 22.08 ? 87  ASN A O   1 
ATOM   640  C CB  . ASN A 1 87  ? -6.764  77.589 62.946 1.00 5.99  ? 87  ASN A CB  1 
ATOM   641  C CG  . ASN A 1 87  ? -6.404  77.736 61.544 1.00 10.10 ? 87  ASN A CG  1 
ATOM   642  O OD1 . ASN A 1 87  ? -6.996  77.049 60.751 1.00 15.89 ? 87  ASN A OD1 1 
ATOM   643  N ND2 . ASN A 1 87  ? -5.440  78.618 61.228 1.00 2.00  ? 87  ASN A ND2 1 
ATOM   644  N N   . ARG A 1 88  ? -9.801  75.920 61.933 1.00 17.62 ? 88  ARG A N   1 
ATOM   645  C CA  . ARG A 1 88  ? -11.133 76.264 61.383 1.00 16.12 ? 88  ARG A CA  1 
ATOM   646  C C   . ARG A 1 88  ? -11.935 75.143 61.988 1.00 21.26 ? 88  ARG A C   1 
ATOM   647  O O   . ARG A 1 88  ? -11.341 74.166 62.444 1.00 28.65 ? 88  ARG A O   1 
ATOM   648  C CB  . ARG A 1 88  ? -11.166 76.399 59.847 1.00 15.54 ? 88  ARG A CB  1 
ATOM   649  C CG  . ARG A 1 88  ? -11.299 77.832 59.282 1.00 25.07 ? 88  ARG A CG  1 
ATOM   650  C CD  . ARG A 1 88  ? -9.971  78.620 59.292 1.00 29.19 ? 88  ARG A CD  1 
ATOM   651  N NE  . ARG A 1 88  ? -10.179 80.042 58.993 1.00 34.09 ? 88  ARG A NE  1 
ATOM   652  N N   . GLU A 1 89  ? -13.265 75.238 62.040 1.00 19.62 ? 89  GLU A N   1 
ATOM   653  C CA  . GLU A 1 89  ? -13.943 74.109 62.695 1.00 21.52 ? 89  GLU A CA  1 
ATOM   654  C C   . GLU A 1 89  ? -13.597 72.805 61.992 1.00 20.47 ? 89  GLU A C   1 
ATOM   655  O O   . GLU A 1 89  ? -13.435 72.726 60.780 1.00 22.70 ? 89  GLU A O   1 
ATOM   656  C CB  . GLU A 1 89  ? -15.485 74.295 62.813 1.00 28.77 ? 89  GLU A CB  1 
ATOM   657  C CG  . GLU A 1 89  ? -16.105 74.798 61.505 1.00 34.58 ? 89  GLU A CG  1 
ATOM   658  N N   . MET A 1 90  ? -13.435 71.784 62.798 1.00 17.93 ? 90  MET A N   1 
ATOM   659  C CA  . MET A 1 90  ? -13.105 70.511 62.214 1.00 13.53 ? 90  MET A CA  1 
ATOM   660  C C   . MET A 1 90  ? -14.389 69.991 61.642 1.00 14.36 ? 90  MET A C   1 
ATOM   661  O O   . MET A 1 90  ? -15.454 70.308 62.147 1.00 18.45 ? 90  MET A O   1 
ATOM   662  C CB  . MET A 1 90  ? -12.557 69.639 63.326 1.00 11.67 ? 90  MET A CB  1 
ATOM   663  C CG  . MET A 1 90  ? -11.376 70.329 64.021 1.00 12.81 ? 90  MET A CG  1 
ATOM   664  S SD  . MET A 1 90  ? -10.394 69.131 65.001 1.00 19.14 ? 90  MET A SD  1 
ATOM   665  C CE  . MET A 1 90  ? -11.742 68.256 65.800 1.00 20.69 ? 90  MET A CE  1 
ATOM   666  N N   . SER A 1 91  ? -14.333 69.231 60.579 1.00 13.96 ? 91  SER A N   1 
ATOM   667  C CA  . SER A 1 91  ? -15.584 68.726 60.077 1.00 16.83 ? 91  SER A CA  1 
ATOM   668  C C   . SER A 1 91  ? -15.202 67.477 59.367 1.00 15.64 ? 91  SER A C   1 
ATOM   669  O O   . SER A 1 91  ? -14.082 67.383 58.902 1.00 19.12 ? 91  SER A O   1 
ATOM   670  C CB  . SER A 1 91  ? -16.207 69.711 59.065 1.00 19.47 ? 91  SER A CB  1 
ATOM   671  O OG  . SER A 1 91  ? -17.465 69.208 58.575 1.00 21.51 ? 91  SER A OG  1 
ATOM   672  N N   . GLU A 1 92  ? -16.124 66.496 59.284 1.00 10.59 ? 92  GLU A N   1 
ATOM   673  C CA  . GLU A 1 92  ? -15.815 65.303 58.525 1.00 10.85 ? 92  GLU A CA  1 
ATOM   674  C C   . GLU A 1 92  ? -15.730 65.779 57.075 1.00 11.51 ? 92  GLU A C   1 
ATOM   675  O O   . GLU A 1 92  ? -14.889 65.377 56.297 1.00 11.63 ? 92  GLU A O   1 
ATOM   676  C CB  . GLU A 1 92  ? -16.809 64.158 58.725 1.00 11.05 ? 92  GLU A CB  1 
ATOM   677  C CG  . GLU A 1 92  ? -16.352 63.207 59.832 1.00 12.37 ? 92  GLU A CG  1 
ATOM   678  C CD  . GLU A 1 92  ? -17.218 61.964 59.877 1.00 15.25 ? 92  GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 92  ? -18.434 62.060 59.705 1.00 15.50 ? 92  GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 92  ? -16.651 60.885 60.071 1.00 21.29 ? 92  GLU A OE2 1 
ATOM   681  N N   . ASP A 1 93  ? -16.635 66.695 56.716 1.00 12.45 ? 93  ASP A N   1 
ATOM   682  C CA  . ASP A 1 93  ? -16.552 67.283 55.377 1.00 14.33 ? 93  ASP A CA  1 
ATOM   683  C C   . ASP A 1 93  ? -15.298 68.175 55.382 1.00 11.76 ? 93  ASP A C   1 
ATOM   684  O O   . ASP A 1 93  ? -15.334 69.272 55.903 1.00 11.08 ? 93  ASP A O   1 
ATOM   685  C CB  . ASP A 1 93  ? -17.810 68.133 55.094 1.00 17.06 ? 93  ASP A CB  1 
ATOM   686  C CG  . ASP A 1 93  ? -17.775 69.037 53.854 1.00 21.70 ? 93  ASP A CG  1 
ATOM   687  O OD1 . ASP A 1 93  ? -16.692 69.248 53.311 1.00 25.44 ? 93  ASP A OD1 1 
ATOM   688  O OD2 . ASP A 1 93  ? -18.838 69.519 53.441 1.00 20.45 ? 93  ASP A OD2 1 
ATOM   689  N N   . CYS A 1 94  ? -14.225 67.728 54.773 1.00 12.71 ? 94  CYS A N   1 
ATOM   690  C CA  . CYS A 1 94  ? -13.040 68.567 54.859 1.00 17.50 ? 94  CYS A CA  1 
ATOM   691  C C   . CYS A 1 94  ? -12.120 68.425 53.690 1.00 20.43 ? 94  CYS A C   1 
ATOM   692  O O   . CYS A 1 94  ? -10.995 68.885 53.786 1.00 18.99 ? 94  CYS A O   1 
ATOM   693  C CB  . CYS A 1 94  ? -12.221 68.204 56.121 1.00 16.49 ? 94  CYS A CB  1 
ATOM   694  S SG  . CYS A 1 94  ? -11.739 66.430 56.322 1.00 17.14 ? 94  CYS A SG  1 
ATOM   695  N N   . LEU A 1 95  ? -12.594 67.785 52.582 1.00 23.15 ? 95  LEU A N   1 
ATOM   696  C CA  . LEU A 1 95  ? -11.745 67.612 51.399 1.00 17.81 ? 95  LEU A CA  1 
ATOM   697  C C   . LEU A 1 95  ? -11.791 68.822 50.463 1.00 16.12 ? 95  LEU A C   1 
ATOM   698  O O   . LEU A 1 95  ? -12.748 68.933 49.716 1.00 24.49 ? 95  LEU A O   1 
ATOM   699  C CB  . LEU A 1 95  ? -12.166 66.322 50.698 1.00 8.12  ? 95  LEU A CB  1 
ATOM   700  C CG  . LEU A 1 95  ? -11.863 65.094 51.544 1.00 2.00  ? 95  LEU A CG  1 
ATOM   701  C CD1 . LEU A 1 95  ? -12.448 63.892 50.884 1.00 2.00  ? 95  LEU A CD1 1 
ATOM   702  C CD2 . LEU A 1 95  ? -10.367 64.894 51.740 1.00 2.00  ? 95  LEU A CD2 1 
ATOM   703  N N   . TYR A 1 96  ? -10.785 69.719 50.523 1.00 10.76 ? 96  TYR A N   1 
ATOM   704  C CA  . TYR A 1 96  ? -10.718 70.906 49.707 1.00 8.77  ? 96  TYR A CA  1 
ATOM   705  C C   . TYR A 1 96  ? -9.257  71.289 49.348 1.00 9.58  ? 96  TYR A C   1 
ATOM   706  O O   . TYR A 1 96  ? -8.282  70.789 49.879 1.00 12.79 ? 96  TYR A O   1 
ATOM   707  C CB  . TYR A 1 96  ? -11.304 72.035 50.522 1.00 9.15  ? 96  TYR A CB  1 
ATOM   708  C CG  . TYR A 1 96  ? -12.770 71.856 50.770 1.00 11.08 ? 96  TYR A CG  1 
ATOM   709  C CD1 . TYR A 1 96  ? -13.235 71.117 51.826 1.00 17.63 ? 96  TYR A CD1 1 
ATOM   710  C CD2 . TYR A 1 96  ? -13.695 72.438 49.946 1.00 14.51 ? 96  TYR A CD2 1 
ATOM   711  C CE1 . TYR A 1 96  ? -14.589 70.925 52.021 1.00 16.38 ? 96  TYR A CE1 1 
ATOM   712  C CE2 . TYR A 1 96  ? -15.051 72.297 50.152 1.00 12.18 ? 96  TYR A CE2 1 
ATOM   713  C CZ  . TYR A 1 96  ? -15.517 71.510 51.183 1.00 11.95 ? 96  TYR A CZ  1 
ATOM   714  O OH  . TYR A 1 96  ? -16.880 71.338 51.360 1.00 22.85 ? 96  TYR A OH  1 
ATOM   715  N N   . LEU A 1 97  ? -9.085  72.196 48.403 1.00 11.46 ? 97  LEU A N   1 
ATOM   716  C CA  . LEU A 1 97  ? -7.748  72.644 48.012 1.00 12.72 ? 97  LEU A CA  1 
ATOM   717  C C   . LEU A 1 97  ? -7.763  74.069 48.269 1.00 14.01 ? 97  LEU A C   1 
ATOM   718  O O   . LEU A 1 97  ? -8.844  74.620 48.457 1.00 15.22 ? 97  LEU A O   1 
ATOM   719  C CB  . LEU A 1 97  ? -7.590  72.561 46.483 1.00 11.96 ? 97  LEU A CB  1 
ATOM   720  C CG  . LEU A 1 97  ? -7.517  71.082 46.063 1.00 16.19 ? 97  LEU A CG  1 
ATOM   721  C CD1 . LEU A 1 97  ? -8.573  70.783 45.033 1.00 16.49 ? 97  LEU A CD1 1 
ATOM   722  C CD2 . LEU A 1 97  ? -6.129  70.732 45.518 1.00 20.98 ? 97  LEU A CD2 1 
ATOM   723  N N   . ASN A 1 98  ? -6.572  74.660 48.230 1.00 16.00 ? 98  ASN A N   1 
ATOM   724  C CA  . ASN A 1 98  ? -6.359  76.102 48.383 1.00 18.36 ? 98  ASN A CA  1 
ATOM   725  C C   . ASN A 1 98  ? -5.306  76.370 47.311 1.00 17.78 ? 98  ASN A C   1 
ATOM   726  O O   . ASN A 1 98  ? -4.388  75.563 47.230 1.00 15.59 ? 98  ASN A O   1 
ATOM   727  C CB  . ASN A 1 98  ? -5.856  76.503 49.788 1.00 23.25 ? 98  ASN A CB  1 
ATOM   728  C CG  . ASN A 1 98  ? -6.921  76.249 50.857 1.00 30.14 ? 98  ASN A CG  1 
ATOM   729  O OD1 . ASN A 1 98  ? -6.929  75.271 51.588 1.00 34.44 ? 98  ASN A OD1 1 
ATOM   730  N ND2 . ASN A 1 98  ? -7.875  77.158 50.976 1.00 33.80 ? 98  ASN A ND2 1 
ATOM   731  N N   . ILE A 1 99  ? -5.442  77.423 46.468 1.00 20.65 ? 99  ILE A N   1 
ATOM   732  C CA  . ILE A 1 99  ? -4.477  77.723 45.377 1.00 18.79 ? 99  ILE A CA  1 
ATOM   733  C C   . ILE A 1 99  ? -4.123  79.135 45.490 1.00 16.28 ? 99  ILE A C   1 
ATOM   734  O O   . ILE A 1 99  ? -5.040  79.947 45.631 1.00 23.50 ? 99  ILE A O   1 
ATOM   735  C CB  . ILE A 1 99  ? -5.104  77.592 43.933 1.00 18.04 ? 99  ILE A CB  1 
ATOM   736  C CG1 . ILE A 1 99  ? -5.910  76.274 43.787 1.00 22.45 ? 99  ILE A CG1 1 
ATOM   737  C CG2 . ILE A 1 99  ? -3.995  77.607 42.870 1.00 21.29 ? 99  ILE A CG2 1 
ATOM   738  C CD1 . ILE A 1 99  ? -6.397  75.897 42.384 1.00 16.41 ? 99  ILE A CD1 1 
ATOM   739  N N   . TRP A 1 100 ? -2.850  79.452 45.413 1.00 11.75 ? 100 TRP A N   1 
ATOM   740  C CA  . TRP A 1 100 ? -2.506  80.877 45.499 1.00 20.30 ? 100 TRP A CA  1 
ATOM   741  C C   . TRP A 1 100 ? -1.910  81.177 44.182 1.00 28.08 ? 100 TRP A C   1 
ATOM   742  O O   . TRP A 1 100 ? -0.885  80.566 43.878 1.00 34.28 ? 100 TRP A O   1 
ATOM   743  C CB  . TRP A 1 100 ? -1.383  81.177 46.525 1.00 16.95 ? 100 TRP A CB  1 
ATOM   744  C CG  . TRP A 1 100 ? -1.959  81.257 47.908 1.00 15.37 ? 100 TRP A CG  1 
ATOM   745  C CD1 . TRP A 1 100 ? -2.428  82.424 48.527 1.00 15.74 ? 100 TRP A CD1 1 
ATOM   746  C CD2 . TRP A 1 100 ? -2.199  80.194 48.796 1.00 12.89 ? 100 TRP A CD2 1 
ATOM   747  N NE1 . TRP A 1 100 ? -2.966  82.107 49.737 1.00 19.24 ? 100 TRP A NE1 1 
ATOM   748  C CE2 . TRP A 1 100 ? -2.865  80.773 49.937 1.00 8.41  ? 100 TRP A CE2 1 
ATOM   749  C CE3 . TRP A 1 100 ? -2.029  78.832 48.721 1.00 14.42 ? 100 TRP A CE3 1 
ATOM   750  C CZ2 . TRP A 1 100 ? -3.254  79.969 50.953 1.00 6.87  ? 100 TRP A CZ2 1 
ATOM   751  C CZ3 . TRP A 1 100 ? -2.450  78.049 49.761 1.00 10.81 ? 100 TRP A CZ3 1 
ATOM   752  C CH2 . TRP A 1 100 ? -3.066  78.607 50.858 1.00 14.23 ? 100 TRP A CH2 1 
ATOM   753  N N   . VAL A 1 101 ? -2.518  82.086 43.393 1.00 33.85 ? 101 VAL A N   1 
ATOM   754  C CA  . VAL A 1 101 ? -1.944  82.414 42.062 1.00 30.81 ? 101 VAL A CA  1 
ATOM   755  C C   . VAL A 1 101 ? -1.391  83.878 42.101 1.00 31.21 ? 101 VAL A C   1 
ATOM   756  O O   . VAL A 1 101 ? -1.824  84.728 42.899 1.00 28.89 ? 101 VAL A O   1 
ATOM   757  C CB  . VAL A 1 101 ? -2.988  82.168 40.953 1.00 26.67 ? 101 VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 101 ? -2.381  82.373 39.579 1.00 24.38 ? 101 VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 101 ? -3.626  80.759 41.069 1.00 28.57 ? 101 VAL A CG2 1 
ATOM   760  N N   . PRO A 1 102 ? -0.373  84.134 41.240 1.00 25.84 ? 102 PRO A N   1 
ATOM   761  C CA  . PRO A 1 102 ? -0.064  85.515 40.943 1.00 25.37 ? 102 PRO A CA  1 
ATOM   762  C C   . PRO A 1 102 ? -1.140  86.334 40.210 1.00 28.90 ? 102 PRO A C   1 
ATOM   763  O O   . PRO A 1 102 ? -2.145  85.874 39.668 1.00 26.99 ? 102 PRO A O   1 
ATOM   764  C CB  . PRO A 1 102 ? 1.260   85.454 40.202 1.00 19.54 ? 102 PRO A CB  1 
ATOM   765  C CG  . PRO A 1 102 ? 1.882   84.109 40.583 1.00 18.75 ? 102 PRO A CG  1 
ATOM   766  C CD  . PRO A 1 102 ? 0.698   83.201 40.896 1.00 23.16 ? 102 PRO A CD  1 
ATOM   767  N N   . SER A 1 103 ? -0.856  87.638 40.244 1.00 34.95 ? 103 SER A N   1 
ATOM   768  C CA  . SER A 1 103 ? -1.631  88.685 39.587 1.00 41.14 ? 103 SER A CA  1 
ATOM   769  C C   . SER A 1 103 ? -0.491  89.438 39.004 1.00 46.60 ? 103 SER A C   1 
ATOM   770  O O   . SER A 1 103 ? 0.315   89.918 39.786 1.00 47.08 ? 103 SER A O   1 
ATOM   771  C CB  . SER A 1 103 ? -2.362  89.699 40.491 1.00 40.61 ? 103 SER A CB  1 
ATOM   772  O OG  . SER A 1 103 ? -3.510  89.111 41.098 1.00 46.94 ? 103 SER A OG  1 
ATOM   773  N N   . PRO A 1 104 ? -0.369  89.534 37.673 1.00 49.31 ? 104 PRO A N   1 
ATOM   774  C CA  . PRO A 1 104 ? -1.127  88.783 36.679 1.00 47.96 ? 104 PRO A CA  1 
ATOM   775  C C   . PRO A 1 104 ? -1.015  87.270 36.735 1.00 44.03 ? 104 PRO A C   1 
ATOM   776  O O   . PRO A 1 104 ? 0.055   86.719 36.997 1.00 43.89 ? 104 PRO A O   1 
ATOM   777  C CB  . PRO A 1 104 ? -0.473  89.175 35.337 1.00 50.71 ? 104 PRO A CB  1 
ATOM   778  C CG  . PRO A 1 104 ? 0.314   90.458 35.604 1.00 52.37 ? 104 PRO A CG  1 
ATOM   779  C CD  . PRO A 1 104 ? 0.593   90.460 37.113 1.00 49.55 ? 104 PRO A CD  1 
ATOM   780  N N   . ARG A 1 105 ? -2.183  86.662 36.427 1.00 36.78 ? 105 ARG A N   1 
ATOM   781  C CA  . ARG A 1 105 ? -2.297  85.222 36.370 1.00 30.20 ? 105 ARG A CA  1 
ATOM   782  C C   . ARG A 1 105 ? -1.275  84.839 35.334 1.00 27.87 ? 105 ARG A C   1 
ATOM   783  O O   . ARG A 1 105 ? -1.270  85.485 34.296 1.00 31.62 ? 105 ARG A O   1 
ATOM   784  C CB  . ARG A 1 105 ? -3.691  84.851 35.852 1.00 25.18 ? 105 ARG A CB  1 
ATOM   785  C CG  . ARG A 1 105 ? -3.944  83.348 35.830 1.00 25.49 ? 105 ARG A CG  1 
ATOM   786  C CD  . ARG A 1 105 ? -5.323  83.016 35.281 1.00 32.03 ? 105 ARG A CD  1 
ATOM   787  N NE  . ARG A 1 105 ? -6.381  83.790 35.949 1.00 37.85 ? 105 ARG A NE  1 
ATOM   788  C CZ  . ARG A 1 105 ? -7.649  83.776 35.466 1.00 40.06 ? 105 ARG A CZ  1 
ATOM   789  N NH1 . ARG A 1 105 ? -7.946  83.108 34.361 1.00 42.58 ? 105 ARG A NH1 1 
ATOM   790  N NH2 . ARG A 1 105 ? -8.638  84.419 36.080 1.00 40.27 ? 105 ARG A NH2 1 
ATOM   791  N N   . PRO A 1 106 ? -0.404  83.873 35.603 1.00 26.21 ? 106 PRO A N   1 
ATOM   792  C CA  . PRO A 1 106 ? 0.577   83.500 34.603 1.00 27.72 ? 106 PRO A CA  1 
ATOM   793  C C   . PRO A 1 106 ? -0.107  82.651 33.530 1.00 29.02 ? 106 PRO A C   1 
ATOM   794  O O   . PRO A 1 106 ? -1.225  82.202 33.734 1.00 32.95 ? 106 PRO A O   1 
ATOM   795  C CB  . PRO A 1 106 ? 1.628   82.703 35.393 1.00 30.51 ? 106 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 106 ? 0.994   82.357 36.764 1.00 30.28 ? 106 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 106 ? -0.275  83.208 36.889 1.00 26.30 ? 106 PRO A CD  1 
ATOM   798  N N   . LYS A 1 107 ? 0.590   82.435 32.394 1.00 27.82 ? 107 LYS A N   1 
ATOM   799  C CA  . LYS A 1 107 ? 0.040   81.634 31.299 1.00 27.87 ? 107 LYS A CA  1 
ATOM   800  C C   . LYS A 1 107 ? 0.033   80.202 31.689 1.00 26.17 ? 107 LYS A C   1 
ATOM   801  O O   . LYS A 1 107 ? -0.991  79.528 31.624 1.00 23.42 ? 107 LYS A O   1 
ATOM   802  C CB  . LYS A 1 107 ? 0.836   81.758 29.979 1.00 29.47 ? 107 LYS A CB  1 
ATOM   803  C CG  . LYS A 1 107 ? 0.872   83.176 29.391 1.00 39.95 ? 107 LYS A CG  1 
ATOM   804  C CD  . LYS A 1 107 ? -0.532  83.779 29.129 1.00 46.85 ? 107 LYS A CD  1 
ATOM   805  C CE  . LYS A 1 107 ? -1.206  84.470 30.342 1.00 53.60 ? 107 LYS A CE  1 
ATOM   806  N NZ  . LYS A 1 107 ? -2.145  85.505 29.929 1.00 58.67 ? 107 LYS A NZ  1 
ATOM   807  N N   . SER A 1 108 ? 1.244   79.783 32.076 1.00 26.69 ? 108 SER A N   1 
ATOM   808  C CA  . SER A 1 108 ? 1.487   78.418 32.477 1.00 26.10 ? 108 SER A CA  1 
ATOM   809  C C   . SER A 1 108 ? 2.756   78.475 33.195 1.00 24.99 ? 108 SER A C   1 
ATOM   810  O O   . SER A 1 108 ? 3.732   78.685 32.498 1.00 26.49 ? 108 SER A O   1 
ATOM   811  C CB  . SER A 1 108 ? 1.781   77.552 31.253 1.00 27.21 ? 108 SER A CB  1 
ATOM   812  O OG  . SER A 1 108 ? 0.629   77.461 30.412 1.00 38.78 ? 108 SER A OG  1 
ATOM   813  N N   . THR A 1 109 ? 2.765   78.279 34.522 1.00 25.69 ? 109 THR A N   1 
ATOM   814  C CA  . THR A 1 109 ? 3.990   78.357 35.321 1.00 20.75 ? 109 THR A CA  1 
ATOM   815  C C   . THR A 1 109 ? 4.152   77.122 36.153 1.00 16.94 ? 109 THR A C   1 
ATOM   816  O O   . THR A 1 109 ? 3.303   76.241 36.027 1.00 16.51 ? 109 THR A O   1 
ATOM   817  C CB  . THR A 1 109 ? 3.859   79.632 36.158 1.00 20.49 ? 109 THR A CB  1 
ATOM   818  O OG1 . THR A 1 109 ? 5.155   80.039 36.552 1.00 20.29 ? 109 THR A OG1 1 
ATOM   819  C CG2 . THR A 1 109 ? 2.826   79.615 37.308 1.00 15.25 ? 109 THR A CG2 1 
ATOM   820  N N   . THR A 1 110 ? 5.224   77.066 36.975 1.00 13.40 ? 110 THR A N   1 
ATOM   821  C CA  . THR A 1 110 ? 5.470   75.896 37.829 1.00 14.31 ? 110 THR A CA  1 
ATOM   822  C C   . THR A 1 110 ? 4.429   75.844 38.906 1.00 12.28 ? 110 THR A C   1 
ATOM   823  O O   . THR A 1 110 ? 3.950   76.894 39.330 1.00 17.26 ? 110 THR A O   1 
ATOM   824  C CB  . THR A 1 110 ? 6.861   75.966 38.481 1.00 17.36 ? 110 THR A CB  1 
ATOM   825  O OG1 . THR A 1 110 ? 7.798   76.593 37.595 1.00 24.70 ? 110 THR A OG1 1 
ATOM   826  C CG2 . THR A 1 110 ? 7.461   74.587 38.761 1.00 23.90 ? 110 THR A CG2 1 
ATOM   827  N N   . VAL A 1 111 ? 4.097   74.632 39.327 1.00 8.66  ? 111 VAL A N   1 
ATOM   828  C CA  . VAL A 1 111 ? 3.106   74.429 40.356 1.00 6.76  ? 111 VAL A CA  1 
ATOM   829  C C   . VAL A 1 111 ? 3.769   73.618 41.431 1.00 11.79 ? 111 VAL A C   1 
ATOM   830  O O   . VAL A 1 111 ? 4.562   72.745 41.093 1.00 12.33 ? 111 VAL A O   1 
ATOM   831  C CB  . VAL A 1 111 ? 1.996   73.548 39.798 1.00 2.54  ? 111 VAL A CB  1 
ATOM   832  C CG1 . VAL A 1 111 ? 0.841   73.384 40.798 1.00 7.37  ? 111 VAL A CG1 1 
ATOM   833  C CG2 . VAL A 1 111 ? 1.486   74.084 38.483 1.00 2.50  ? 111 VAL A CG2 1 
ATOM   834  N N   . MET A 1 112 ? 3.427   73.899 42.704 1.00 15.39 ? 112 MET A N   1 
ATOM   835  C CA  . MET A 1 112 ? 3.941   73.160 43.868 1.00 13.99 ? 112 MET A CA  1 
ATOM   836  C C   . MET A 1 112 ? 2.721   72.837 44.720 1.00 15.27 ? 112 MET A C   1 
ATOM   837  O O   . MET A 1 112 ? 1.940   73.746 45.036 1.00 22.11 ? 112 MET A O   1 
ATOM   838  C CB  . MET A 1 112 ? 4.899   74.041 44.677 1.00 13.97 ? 112 MET A CB  1 
ATOM   839  C CG  . MET A 1 112 ? 5.937   74.741 43.820 1.00 6.80  ? 112 MET A CG  1 
ATOM   840  S SD  . MET A 1 112 ? 7.523   74.655 44.690 1.00 17.30 ? 112 MET A SD  1 
ATOM   841  C CE  . MET A 1 112 ? 7.185   75.723 46.079 1.00 19.00 ? 112 MET A CE  1 
ATOM   842  N N   . VAL A 1 113 ? 2.538   71.559 45.046 1.00 10.93 ? 113 VAL A N   1 
ATOM   843  C CA  . VAL A 1 113 ? 1.394   71.109 45.859 1.00 9.95  ? 113 VAL A CA  1 
ATOM   844  C C   . VAL A 1 113 ? 1.984   70.731 47.212 1.00 13.35 ? 113 VAL A C   1 
ATOM   845  O O   . VAL A 1 113 ? 2.869   69.892 47.220 1.00 18.53 ? 113 VAL A O   1 
ATOM   846  C CB  . VAL A 1 113 ? 0.808   69.789 45.283 1.00 7.92  ? 113 VAL A CB  1 
ATOM   847  C CG1 . VAL A 1 113 ? -0.570  69.325 45.851 1.00 2.71  ? 113 VAL A CG1 1 
ATOM   848  C CG2 . VAL A 1 113 ? 0.706   69.880 43.784 1.00 7.26  ? 113 VAL A CG2 1 
ATOM   849  N N   . TRP A 1 114 ? 1.497   71.285 48.320 1.00 13.38 ? 114 TRP A N   1 
ATOM   850  C CA  . TRP A 1 114 ? 1.971   71.025 49.678 1.00 10.26 ? 114 TRP A CA  1 
ATOM   851  C C   . TRP A 1 114 ? 1.056   70.043 50.398 1.00 11.68 ? 114 TRP A C   1 
ATOM   852  O O   . TRP A 1 114 ? -0.117  70.304 50.697 1.00 15.41 ? 114 TRP A O   1 
ATOM   853  C CB  . TRP A 1 114 ? 1.957   72.397 50.433 1.00 11.36 ? 114 TRP A CB  1 
ATOM   854  C CG  . TRP A 1 114 ? 2.152   72.287 51.919 1.00 12.48 ? 114 TRP A CG  1 
ATOM   855  C CD1 . TRP A 1 114 ? 1.141   72.393 52.907 1.00 14.97 ? 114 TRP A CD1 1 
ATOM   856  C CD2 . TRP A 1 114 ? 3.347   72.015 52.572 1.00 10.09 ? 114 TRP A CD2 1 
ATOM   857  N NE1 . TRP A 1 114 ? 1.679   72.184 54.136 1.00 10.72 ? 114 TRP A NE1 1 
ATOM   858  C CE2 . TRP A 1 114 ? 3.020   71.932 53.992 1.00 9.65  ? 114 TRP A CE2 1 
ATOM   859  C CE3 . TRP A 1 114 ? 4.630   71.820 52.135 1.00 9.36  ? 114 TRP A CE3 1 
ATOM   860  C CZ2 . TRP A 1 114 ? 4.016   71.626 54.887 1.00 2.00  ? 114 TRP A CZ2 1 
ATOM   861  C CZ3 . TRP A 1 114 ? 5.606   71.534 53.060 1.00 7.35  ? 114 TRP A CZ3 1 
ATOM   862  C CH2 . TRP A 1 114 ? 5.293   71.440 54.401 1.00 2.14  ? 114 TRP A CH2 1 
ATOM   863  N N   . ILE A 1 115 ? 1.626   68.891 50.659 1.00 13.95 ? 115 ILE A N   1 
ATOM   864  C CA  . ILE A 1 115 ? 0.922   67.901 51.423 1.00 17.04 ? 115 ILE A CA  1 
ATOM   865  C C   . ILE A 1 115 ? 1.505   68.136 52.847 1.00 23.20 ? 115 ILE A C   1 
ATOM   866  O O   . ILE A 1 115 ? 2.708   67.985 53.103 1.00 28.18 ? 115 ILE A O   1 
ATOM   867  C CB  . ILE A 1 115 ? 1.246   66.494 50.936 1.00 16.77 ? 115 ILE A CB  1 
ATOM   868  C CG1 . ILE A 1 115 ? 1.059   66.404 49.416 1.00 20.54 ? 115 ILE A CG1 1 
ATOM   869  C CG2 . ILE A 1 115 ? 0.407   65.425 51.688 1.00 21.96 ? 115 ILE A CG2 1 
ATOM   870  C CD1 . ILE A 1 115 ? 1.384   65.004 48.849 1.00 17.10 ? 115 ILE A CD1 1 
ATOM   871  N N   . TYR A 1 116 ? 0.620   68.545 53.768 1.00 24.62 ? 116 TYR A N   1 
ATOM   872  C CA  . TYR A 1 116 ? 1.016   68.804 55.140 1.00 21.98 ? 116 TYR A CA  1 
ATOM   873  C C   . TYR A 1 116 ? 1.195   67.480 55.869 1.00 24.98 ? 116 TYR A C   1 
ATOM   874  O O   . TYR A 1 116 ? 0.622   66.468 55.490 1.00 22.44 ? 116 TYR A O   1 
ATOM   875  C CB  . TYR A 1 116 ? -0.051  69.606 55.930 1.00 21.61 ? 116 TYR A CB  1 
ATOM   876  C CG  . TYR A 1 116 ? -1.409  68.934 56.005 1.00 17.51 ? 116 TYR A CG  1 
ATOM   877  C CD1 . TYR A 1 116 ? -1.659  67.848 56.842 1.00 16.40 ? 116 TYR A CD1 1 
ATOM   878  C CD2 . TYR A 1 116 ? -2.429  69.417 55.232 1.00 18.67 ? 116 TYR A CD2 1 
ATOM   879  C CE1 . TYR A 1 116 ? -2.898  67.245 56.940 1.00 11.96 ? 116 TYR A CE1 1 
ATOM   880  C CE2 . TYR A 1 116 ? -3.670  68.834 55.354 1.00 19.33 ? 116 TYR A CE2 1 
ATOM   881  C CZ  . TYR A 1 116 ? -3.930  67.768 56.200 1.00 12.12 ? 116 TYR A CZ  1 
ATOM   882  O OH  . TYR A 1 116 ? -5.224  67.301 56.319 1.00 8.33  ? 116 TYR A OH  1 
ATOM   883  N N   . GLY A 1 117 ? 1.984   67.548 56.953 1.00 24.17 ? 117 GLY A N   1 
ATOM   884  C CA  . GLY A 1 117 ? 2.187   66.363 57.722 1.00 23.92 ? 117 GLY A CA  1 
ATOM   885  C C   . GLY A 1 117 ? 1.499   66.565 59.030 1.00 23.83 ? 117 GLY A C   1 
ATOM   886  O O   . GLY A 1 117 ? 0.802   67.563 59.237 1.00 26.25 ? 117 GLY A O   1 
ATOM   887  N N   . GLY A 1 118 ? 1.790   65.584 59.917 1.00 25.33 ? 118 GLY A N   1 
ATOM   888  C CA  . GLY A 1 118 ? 1.215   65.534 61.263 1.00 25.17 ? 118 GLY A CA  1 
ATOM   889  C C   . GLY A 1 118 ? 0.962   64.100 61.716 1.00 22.69 ? 118 GLY A C   1 
ATOM   890  O O   . GLY A 1 118 ? -0.125  63.682 62.064 1.00 19.66 ? 118 GLY A O   1 
ATOM   891  N N   . GLY A 1 119 ? 1.998   63.279 61.620 1.00 21.48 ? 119 GLY A N   1 
ATOM   892  C CA  . GLY A 1 119 ? 1.854   61.878 62.051 1.00 20.45 ? 119 GLY A CA  1 
ATOM   893  C C   . GLY A 1 119 ? 0.697   61.013 61.567 1.00 17.27 ? 119 GLY A C   1 
ATOM   894  O O   . GLY A 1 119 ? 0.460   59.935 62.105 1.00 17.77 ? 119 GLY A O   1 
ATOM   895  N N   . PHE A 1 120 ? -0.018  61.508 60.552 1.00 12.46 ? 120 PHE A N   1 
ATOM   896  C CA  . PHE A 1 120 ? -1.124  60.773 59.999 1.00 12.60 ? 120 PHE A CA  1 
ATOM   897  C C   . PHE A 1 120 ? -2.335  60.791 60.911 1.00 14.70 ? 120 PHE A C   1 
ATOM   898  O O   . PHE A 1 120 ? -3.323  60.129 60.657 1.00 14.96 ? 120 PHE A O   1 
ATOM   899  C CB  . PHE A 1 120 ? -0.723  59.332 59.558 1.00 15.79 ? 120 PHE A CB  1 
ATOM   900  C CG  . PHE A 1 120 ? 0.143   59.238 58.300 1.00 14.60 ? 120 PHE A CG  1 
ATOM   901  C CD1 . PHE A 1 120 ? -0.375  59.621 57.069 1.00 19.52 ? 120 PHE A CD1 1 
ATOM   902  C CD2 . PHE A 1 120 ? 1.416   58.730 58.323 1.00 14.77 ? 120 PHE A CD2 1 
ATOM   903  C CE1 . PHE A 1 120 ? 0.357   59.476 55.909 1.00 21.68 ? 120 PHE A CE1 1 
ATOM   904  C CE2 . PHE A 1 120 ? 2.161   58.594 57.158 1.00 19.40 ? 120 PHE A CE2 1 
ATOM   905  C CZ  . PHE A 1 120 ? 1.638   58.966 55.944 1.00 21.65 ? 120 PHE A CZ  1 
ATOM   906  N N   . TYR A 1 121 ? -2.285  61.555 62.002 1.00 19.52 ? 121 TYR A N   1 
ATOM   907  C CA  . TYR A 1 121 ? -3.416  61.688 62.966 1.00 17.16 ? 121 TYR A CA  1 
ATOM   908  C C   . TYR A 1 121 ? -3.931  63.146 63.064 1.00 16.58 ? 121 TYR A C   1 
ATOM   909  O O   . TYR A 1 121 ? -4.942  63.391 63.717 1.00 22.74 ? 121 TYR A O   1 
ATOM   910  C CB  . TYR A 1 121 ? -3.077  61.204 64.434 1.00 10.61 ? 121 TYR A CB  1 
ATOM   911  C CG  . TYR A 1 121 ? -2.040  62.049 65.141 1.00 4.73  ? 121 TYR A CG  1 
ATOM   912  C CD1 . TYR A 1 121 ? -2.388  63.203 65.848 1.00 11.48 ? 121 TYR A CD1 1 
ATOM   913  C CD2 . TYR A 1 121 ? -0.716  61.703 65.057 1.00 2.00  ? 121 TYR A CD2 1 
ATOM   914  C CE1 . TYR A 1 121 ? -1.411  64.013 66.449 1.00 11.23 ? 121 TYR A CE1 1 
ATOM   915  C CE2 . TYR A 1 121 ? 0.245   62.489 65.640 1.00 4.87  ? 121 TYR A CE2 1 
ATOM   916  C CZ  . TYR A 1 121 ? -0.075  63.647 66.332 1.00 10.58 ? 121 TYR A CZ  1 
ATOM   917  O OH  . TYR A 1 121 ? 0.954   64.410 66.874 1.00 16.39 ? 121 TYR A OH  1 
ATOM   918  N N   . SER A 1 122 ? -3.204  64.093 62.477 1.00 14.16 ? 122 SER A N   1 
ATOM   919  C CA  . SER A 1 122 ? -3.561  65.493 62.543 1.00 18.73 ? 122 SER A CA  1 
ATOM   920  C C   . SER A 1 122 ? -3.041  66.224 61.324 1.00 20.99 ? 122 SER A C   1 
ATOM   921  O O   . SER A 1 122 ? -2.460  65.596 60.436 1.00 25.42 ? 122 SER A O   1 
ATOM   922  C CB  . SER A 1 122 ? -2.852  66.055 63.766 1.00 21.24 ? 122 SER A CB  1 
ATOM   923  O OG  . SER A 1 122 ? -1.476  65.639 63.725 1.00 28.09 ? 122 SER A OG  1 
ATOM   924  N N   . GLY A 1 123 ? -3.241  67.550 61.307 1.00 18.07 ? 123 GLY A N   1 
ATOM   925  C CA  . GLY A 1 123 ? -2.762  68.350 60.193 1.00 18.67 ? 123 GLY A CA  1 
ATOM   926  C C   . GLY A 1 123 ? -3.873  69.159 59.553 1.00 17.94 ? 123 GLY A C   1 
ATOM   927  O O   . GLY A 1 123 ? -5.052  68.850 59.628 1.00 18.59 ? 123 GLY A O   1 
ATOM   928  N N   . SER A 1 124 ? -3.489  70.233 58.878 1.00 18.35 ? 124 SER A N   1 
ATOM   929  C CA  . SER A 1 124 ? -4.484  71.074 58.270 1.00 14.94 ? 124 SER A CA  1 
ATOM   930  C C   . SER A 1 124 ? -3.835  71.863 57.173 1.00 19.07 ? 124 SER A C   1 
ATOM   931  O O   . SER A 1 124 ? -2.640  72.133 57.200 1.00 14.28 ? 124 SER A O   1 
ATOM   932  C CB  . SER A 1 124 ? -4.914  72.176 59.245 1.00 13.04 ? 124 SER A CB  1 
ATOM   933  O OG  . SER A 1 124 ? -4.971  71.743 60.590 1.00 12.25 ? 124 SER A OG  1 
ATOM   934  N N   . SER A 1 125 ? -4.690  72.303 56.233 1.00 20.50 ? 125 SER A N   1 
ATOM   935  C CA  . SER A 1 125 ? -4.231  73.102 55.096 1.00 19.90 ? 125 SER A CA  1 
ATOM   936  C C   . SER A 1 125 ? -4.096  74.542 55.515 1.00 18.82 ? 125 SER A C   1 
ATOM   937  O O   . SER A 1 125 ? -3.118  75.210 55.258 1.00 23.42 ? 125 SER A O   1 
ATOM   938  C CB  . SER A 1 125 ? -5.259  73.024 53.937 1.00 21.38 ? 125 SER A CB  1 
ATOM   939  O OG  . SER A 1 125 ? -5.995  71.808 54.170 1.00 31.29 ? 125 SER A OG  1 
ATOM   940  N N   . THR A 1 126 ? -5.142  74.942 56.218 1.00 10.47 ? 126 THR A N   1 
ATOM   941  C CA  . THR A 1 126 ? -5.352  76.250 56.708 1.00 7.82  ? 126 THR A CA  1 
ATOM   942  C C   . THR A 1 126 ? -4.407  76.806 57.753 1.00 9.19  ? 126 THR A C   1 
ATOM   943  O O   . THR A 1 126 ? -4.552  77.922 58.240 1.00 15.22 ? 126 THR A O   1 
ATOM   944  C CB  . THR A 1 126 ? -6.805  76.269 57.171 1.00 10.45 ? 126 THR A CB  1 
ATOM   945  O OG1 . THR A 1 126 ? -7.076  75.388 58.265 1.00 6.49  ? 126 THR A OG1 1 
ATOM   946  C CG2 . THR A 1 126 ? -7.745  75.672 56.117 1.00 11.23 ? 126 THR A CG2 1 
ATOM   947  N N   . LEU A 1 127 ? -3.442  76.030 58.202 1.00 9.18  ? 127 LEU A N   1 
ATOM   948  C CA  . LEU A 1 127 ? -2.551  76.677 59.197 1.00 10.00 ? 127 LEU A CA  1 
ATOM   949  C C   . LEU A 1 127 ? -1.879  77.913 58.663 1.00 11.67 ? 127 LEU A C   1 
ATOM   950  O O   . LEU A 1 127 ? -1.553  78.044 57.496 1.00 16.12 ? 127 LEU A O   1 
ATOM   951  C CB  . LEU A 1 127 ? -1.276  75.872 59.509 1.00 7.26  ? 127 LEU A CB  1 
ATOM   952  C CG  . LEU A 1 127 ? -1.537  74.450 59.962 1.00 5.93  ? 127 LEU A CG  1 
ATOM   953  C CD1 . LEU A 1 127 ? -0.194  73.961 60.518 1.00 8.30  ? 127 LEU A CD1 1 
ATOM   954  C CD2 . LEU A 1 127 ? -2.710  74.391 60.936 1.00 2.09  ? 127 LEU A CD2 1 
ATOM   955  N N   . ASP A 1 128 ? -1.516  78.760 59.613 1.00 17.74 ? 128 ASP A N   1 
ATOM   956  C CA  . ASP A 1 128 ? -0.863  79.991 59.199 1.00 23.64 ? 128 ASP A CA  1 
ATOM   957  C C   . ASP A 1 128 ? 0.531   79.717 58.683 1.00 21.25 ? 128 ASP A C   1 
ATOM   958  O O   . ASP A 1 128 ? 0.970   80.399 57.778 1.00 24.65 ? 128 ASP A O   1 
ATOM   959  C CB  . ASP A 1 128 ? -0.791  81.062 60.307 1.00 32.11 ? 128 ASP A CB  1 
ATOM   960  C CG  . ASP A 1 128 ? -2.135  81.517 60.881 1.00 42.17 ? 128 ASP A CG  1 
ATOM   961  O OD1 . ASP A 1 128 ? -3.138  81.511 60.139 1.00 49.94 ? 128 ASP A OD1 1 
ATOM   962  O OD2 . ASP A 1 128 ? -2.166  81.877 62.071 1.00 43.68 ? 128 ASP A OD2 1 
ATOM   963  N N   . VAL A 1 129 ? 1.239   78.730 59.273 1.00 22.10 ? 129 VAL A N   1 
ATOM   964  C CA  . VAL A 1 129 ? 2.591   78.443 58.752 1.00 20.27 ? 129 VAL A CA  1 
ATOM   965  C C   . VAL A 1 129 ? 2.540   77.765 57.404 1.00 21.21 ? 129 VAL A C   1 
ATOM   966  O O   . VAL A 1 129 ? 3.596   77.458 56.902 1.00 24.07 ? 129 VAL A O   1 
ATOM   967  C CB  . VAL A 1 129 ? 3.470   77.573 59.693 1.00 17.27 ? 129 VAL A CB  1 
ATOM   968  C CG1 . VAL A 1 129 ? 4.274   78.434 60.690 1.00 7.13  ? 129 VAL A CG1 1 
ATOM   969  C CG2 . VAL A 1 129 ? 2.579   76.501 60.386 1.00 13.27 ? 129 VAL A CG2 1 
ATOM   970  N N   . TYR A 1 130 ? 1.346   77.449 56.866 1.00 21.50 ? 130 TYR A N   1 
ATOM   971  C CA  . TYR A 1 130 ? 1.287   76.845 55.549 1.00 18.44 ? 130 TYR A CA  1 
ATOM   972  C C   . TYR A 1 130 ? 0.650   77.845 54.552 1.00 22.24 ? 130 TYR A C   1 
ATOM   973  O O   . TYR A 1 130 ? 0.051   77.432 53.568 1.00 24.07 ? 130 TYR A O   1 
ATOM   974  C CB  . TYR A 1 130 ? 0.469   75.579 55.611 1.00 8.32  ? 130 TYR A CB  1 
ATOM   975  C CG  . TYR A 1 130 ? 0.969   74.492 56.544 1.00 7.60  ? 130 TYR A CG  1 
ATOM   976  C CD1 . TYR A 1 130 ? 2.286   74.285 56.906 1.00 2.00  ? 130 TYR A CD1 1 
ATOM   977  C CD2 . TYR A 1 130 ? 0.030   73.617 57.064 1.00 6.00  ? 130 TYR A CD2 1 
ATOM   978  C CE1 . TYR A 1 130 ? 2.602   73.206 57.725 1.00 2.00  ? 130 TYR A CE1 1 
ATOM   979  C CE2 . TYR A 1 130 ? 0.339   72.545 57.878 1.00 2.27  ? 130 TYR A CE2 1 
ATOM   980  C CZ  . TYR A 1 130 ? 1.648   72.284 58.190 1.00 5.63  ? 130 TYR A CZ  1 
ATOM   981  O OH  . TYR A 1 130 ? 1.964   71.060 58.825 1.00 4.46  ? 130 TYR A OH  1 
ATOM   982  N N   . ASN A 1 131 ? 0.773   79.173 54.821 1.00 22.34 ? 131 ASN A N   1 
ATOM   983  C CA  . ASN A 1 131 ? 0.217   80.238 53.959 1.00 22.97 ? 131 ASN A CA  1 
ATOM   984  C C   . ASN A 1 131 ? 1.036   80.375 52.682 1.00 24.15 ? 131 ASN A C   1 
ATOM   985  O O   . ASN A 1 131 ? 2.171   80.857 52.633 1.00 26.09 ? 131 ASN A O   1 
ATOM   986  C CB  . ASN A 1 131 ? 0.204   81.602 54.651 1.00 24.59 ? 131 ASN A CB  1 
ATOM   987  C CG  . ASN A 1 131 ? -0.747  82.539 53.925 1.00 26.17 ? 131 ASN A CG  1 
ATOM   988  O OD1 . ASN A 1 131 ? -0.827  82.554 52.698 1.00 29.61 ? 131 ASN A OD1 1 
ATOM   989  N ND2 . ASN A 1 131 ? -1.497  83.309 54.711 1.00 20.02 ? 131 ASN A ND2 1 
ATOM   990  N N   . GLY A 1 132 ? 0.399   79.970 51.597 1.00 25.81 ? 132 GLY A N   1 
ATOM   991  C CA  . GLY A 1 132 ? 1.103   79.951 50.334 1.00 25.56 ? 132 GLY A CA  1 
ATOM   992  C C   . GLY A 1 132 ? 1.397   81.209 49.633 1.00 27.63 ? 132 GLY A C   1 
ATOM   993  O O   . GLY A 1 132 ? 2.183   81.227 48.686 1.00 27.42 ? 132 GLY A O   1 
ATOM   994  N N   . LYS A 1 133 ? 0.768   82.280 50.098 1.00 26.03 ? 133 LYS A N   1 
ATOM   995  C CA  . LYS A 1 133 ? 1.009   83.511 49.396 1.00 20.89 ? 133 LYS A CA  1 
ATOM   996  C C   . LYS A 1 133 ? 2.450   83.983 49.280 1.00 19.06 ? 133 LYS A C   1 
ATOM   997  O O   . LYS A 1 133 ? 2.838   84.573 48.287 1.00 19.49 ? 133 LYS A O   1 
ATOM   998  C CB  . LYS A 1 133 ? 0.197   84.641 50.039 1.00 18.01 ? 133 LYS A CB  1 
ATOM   999  C CG  . LYS A 1 133 ? 0.800   85.216 51.334 1.00 12.80 ? 133 LYS A CG  1 
ATOM   1000 C CD  . LYS A 1 133 ? 0.107   86.519 51.695 1.00 18.09 ? 133 LYS A CD  1 
ATOM   1001 C CE  . LYS A 1 133 ? -0.670  86.488 52.980 1.00 18.54 ? 133 LYS A CE  1 
ATOM   1002 N NZ  . LYS A 1 133 ? -1.397  87.728 53.076 1.00 24.89 ? 133 LYS A NZ  1 
ATOM   1003 N N   . TYR A 1 134 ? 3.272   83.715 50.273 1.00 19.77 ? 134 TYR A N   1 
ATOM   1004 C CA  . TYR A 1 134 ? 4.600   84.324 50.141 1.00 21.78 ? 134 TYR A CA  1 
ATOM   1005 C C   . TYR A 1 134 ? 5.454   83.668 49.109 1.00 21.63 ? 134 TYR A C   1 
ATOM   1006 O O   . TYR A 1 134 ? 6.286   84.288 48.454 1.00 23.97 ? 134 TYR A O   1 
ATOM   1007 C CB  . TYR A 1 134 ? 5.334   84.432 51.498 1.00 25.42 ? 134 TYR A CB  1 
ATOM   1008 C CG  . TYR A 1 134 ? 4.479   85.023 52.617 1.00 26.75 ? 134 TYR A CG  1 
ATOM   1009 C CD1 . TYR A 1 134 ? 3.653   84.187 53.355 1.00 30.20 ? 134 TYR A CD1 1 
ATOM   1010 C CD2 . TYR A 1 134 ? 4.502   86.377 52.921 1.00 22.77 ? 134 TYR A CD2 1 
ATOM   1011 C CE1 . TYR A 1 134 ? 2.871   84.695 54.379 1.00 29.67 ? 134 TYR A CE1 1 
ATOM   1012 C CE2 . TYR A 1 134 ? 3.718   86.886 53.935 1.00 19.54 ? 134 TYR A CE2 1 
ATOM   1013 C CZ  . TYR A 1 134 ? 2.906   86.044 54.665 1.00 23.03 ? 134 TYR A CZ  1 
ATOM   1014 O OH  . TYR A 1 134 ? 2.106   86.500 55.680 1.00 30.38 ? 134 TYR A OH  1 
ATOM   1015 N N   . LEU A 1 135 ? 5.213   82.371 48.957 1.00 16.40 ? 135 LEU A N   1 
ATOM   1016 C CA  . LEU A 1 135 ? 6.035   81.629 48.007 1.00 11.04 ? 135 LEU A CA  1 
ATOM   1017 C C   . LEU A 1 135 ? 5.601   81.921 46.600 1.00 11.91 ? 135 LEU A C   1 
ATOM   1018 O O   . LEU A 1 135 ? 6.391   82.196 45.699 1.00 10.16 ? 135 LEU A O   1 
ATOM   1019 C CB  . LEU A 1 135 ? 5.911   80.145 48.343 1.00 6.81  ? 135 LEU A CB  1 
ATOM   1020 C CG  . LEU A 1 135 ? 6.961   79.253 47.756 1.00 2.00  ? 135 LEU A CG  1 
ATOM   1021 C CD1 . LEU A 1 135 ? 8.367   79.817 47.925 1.00 2.00  ? 135 LEU A CD1 1 
ATOM   1022 C CD2 . LEU A 1 135 ? 6.905   77.902 48.474 1.00 2.00  ? 135 LEU A CD2 1 
ATOM   1023 N N   . ALA A 1 136 ? 4.276   81.867 46.432 1.00 12.31 ? 136 ALA A N   1 
ATOM   1024 C CA  . ALA A 1 136 ? 3.681   82.148 45.131 1.00 14.78 ? 136 ALA A CA  1 
ATOM   1025 C C   . ALA A 1 136 ? 4.152   83.502 44.645 1.00 22.63 ? 136 ALA A C   1 
ATOM   1026 O O   . ALA A 1 136 ? 4.654   83.713 43.549 1.00 29.12 ? 136 ALA A O   1 
ATOM   1027 C CB  . ALA A 1 136 ? 2.153   82.201 45.241 1.00 14.98 ? 136 ALA A CB  1 
ATOM   1028 N N   . TYR A 1 137 ? 3.980   84.448 45.555 1.00 22.29 ? 137 TYR A N   1 
ATOM   1029 C CA  . TYR A 1 137 ? 4.351   85.806 45.305 1.00 19.74 ? 137 TYR A CA  1 
ATOM   1030 C C   . TYR A 1 137 ? 5.815   85.912 44.965 1.00 22.22 ? 137 TYR A C   1 
ATOM   1031 O O   . TYR A 1 137 ? 6.158   86.246 43.859 1.00 26.67 ? 137 TYR A O   1 
ATOM   1032 C CB  . TYR A 1 137 ? 3.990   86.585 46.569 1.00 26.34 ? 137 TYR A CB  1 
ATOM   1033 C CG  . TYR A 1 137 ? 4.473   87.977 46.489 1.00 30.93 ? 137 TYR A CG  1 
ATOM   1034 C CD1 . TYR A 1 137 ? 5.764   88.300 46.868 1.00 27.90 ? 137 TYR A CD1 1 
ATOM   1035 C CD2 . TYR A 1 137 ? 3.646   88.921 45.948 1.00 34.79 ? 137 TYR A CD2 1 
ATOM   1036 C CE1 . TYR A 1 137 ? 6.238   89.572 46.663 1.00 34.73 ? 137 TYR A CE1 1 
ATOM   1037 C CE2 . TYR A 1 137 ? 4.136   90.196 45.745 1.00 35.67 ? 137 TYR A CE2 1 
ATOM   1038 C CZ  . TYR A 1 137 ? 5.419   90.538 46.096 1.00 34.81 ? 137 TYR A CZ  1 
ATOM   1039 O OH  . TYR A 1 137 ? 5.860   91.825 45.857 1.00 40.40 ? 137 TYR A OH  1 
ATOM   1040 N N   . THR A 1 138 ? 6.700   85.593 45.889 1.00 24.77 ? 138 THR A N   1 
ATOM   1041 C CA  . THR A 1 138 ? 8.107   85.754 45.578 1.00 27.53 ? 138 THR A CA  1 
ATOM   1042 C C   . THR A 1 138 ? 8.642   84.969 44.398 1.00 29.92 ? 138 THR A C   1 
ATOM   1043 O O   . THR A 1 138 ? 9.370   85.531 43.586 1.00 34.33 ? 138 THR A O   1 
ATOM   1044 C CB  . THR A 1 138 ? 8.914   85.445 46.841 1.00 28.64 ? 138 THR A CB  1 
ATOM   1045 O OG1 . THR A 1 138 ? 8.552   86.404 47.827 1.00 36.18 ? 138 THR A OG1 1 
ATOM   1046 C CG2 . THR A 1 138 ? 10.435  85.598 46.745 1.00 32.59 ? 138 THR A CG2 1 
ATOM   1047 N N   . GLU A 1 139 ? 8.334   83.666 44.311 1.00 27.38 ? 139 GLU A N   1 
ATOM   1048 C CA  . GLU A 1 139 ? 8.859   82.883 43.175 1.00 23.63 ? 139 GLU A CA  1 
ATOM   1049 C C   . GLU A 1 139 ? 7.893   82.753 41.970 1.00 22.15 ? 139 GLU A C   1 
ATOM   1050 O O   . GLU A 1 139 ? 8.139   82.054 41.000 1.00 16.64 ? 139 GLU A O   1 
ATOM   1051 C CB  . GLU A 1 139 ? 9.224   81.481 43.650 1.00 22.31 ? 139 GLU A CB  1 
ATOM   1052 C CG  . GLU A 1 139 ? 10.206  81.464 44.807 1.00 18.11 ? 139 GLU A CG  1 
ATOM   1053 C CD  . GLU A 1 139 ? 11.557  81.873 44.324 1.00 24.90 ? 139 GLU A CD  1 
ATOM   1054 O OE1 . GLU A 1 139 ? 12.101  81.174 43.478 1.00 23.07 ? 139 GLU A OE1 1 
ATOM   1055 O OE2 . GLU A 1 139 ? 12.063  82.896 44.777 1.00 33.08 ? 139 GLU A OE2 1 
ATOM   1056 N N   . GLU A 1 140 ? 6.743   83.405 42.025 1.00 22.43 ? 140 GLU A N   1 
ATOM   1057 C CA  . GLU A 1 140 ? 5.869   83.295 40.870 1.00 25.21 ? 140 GLU A CA  1 
ATOM   1058 C C   . GLU A 1 140 ? 5.348   81.892 40.605 1.00 21.27 ? 140 GLU A C   1 
ATOM   1059 O O   . GLU A 1 140 ? 5.130   81.555 39.469 1.00 23.56 ? 140 GLU A O   1 
ATOM   1060 C CB  . GLU A 1 140 ? 6.570   83.855 39.598 1.00 27.91 ? 140 GLU A CB  1 
ATOM   1061 C CG  . GLU A 1 140 ? 7.141   85.275 39.868 1.00 40.78 ? 140 GLU A CG  1 
ATOM   1062 C CD  . GLU A 1 140 ? 7.986   85.879 38.744 1.00 43.06 ? 140 GLU A CD  1 
ATOM   1063 O OE1 . GLU A 1 140 ? 7.394   86.505 37.865 1.00 51.75 ? 140 GLU A OE1 1 
ATOM   1064 O OE2 . GLU A 1 140 ? 9.222   85.731 38.763 1.00 40.74 ? 140 GLU A OE2 1 
ATOM   1065 N N   . VAL A 1 141 ? 5.173   81.062 41.597 1.00 15.30 ? 141 VAL A N   1 
ATOM   1066 C CA  . VAL A 1 141 ? 4.677   79.752 41.271 1.00 18.17 ? 141 VAL A CA  1 
ATOM   1067 C C   . VAL A 1 141 ? 3.232   79.689 41.701 1.00 19.95 ? 141 VAL A C   1 
ATOM   1068 O O   . VAL A 1 141 ? 2.809   80.555 42.454 1.00 24.26 ? 141 VAL A O   1 
ATOM   1069 C CB  . VAL A 1 141 ? 5.513   78.742 42.074 1.00 18.70 ? 141 VAL A CB  1 
ATOM   1070 C CG1 . VAL A 1 141 ? 6.990   78.855 41.737 1.00 21.69 ? 141 VAL A CG1 1 
ATOM   1071 C CG2 . VAL A 1 141 ? 5.396   78.847 43.598 1.00 21.37 ? 141 VAL A CG2 1 
ATOM   1072 N N   . VAL A 1 142 ? 2.454   78.727 41.198 1.00 17.38 ? 142 VAL A N   1 
ATOM   1073 C CA  . VAL A 1 142 ? 1.115   78.643 41.804 1.00 18.72 ? 142 VAL A CA  1 
ATOM   1074 C C   . VAL A 1 142 ? 1.442   77.658 42.937 1.00 21.89 ? 142 VAL A C   1 
ATOM   1075 O O   . VAL A 1 142 ? 2.360   76.827 42.817 1.00 24.46 ? 142 VAL A O   1 
ATOM   1076 C CB  . VAL A 1 142 ? -0.120  78.257 40.924 1.00 15.85 ? 142 VAL A CB  1 
ATOM   1077 C CG1 . VAL A 1 142 ? -0.155  79.075 39.636 1.00 20.44 ? 142 VAL A CG1 1 
ATOM   1078 C CG2 . VAL A 1 142 ? -0.329  76.782 40.598 1.00 12.12 ? 142 VAL A CG2 1 
ATOM   1079 N N   . LEU A 1 143 ? 0.676   77.754 44.035 1.00 20.14 ? 143 LEU A N   1 
ATOM   1080 C CA  . LEU A 1 143 ? 0.922   76.895 45.173 1.00 13.89 ? 143 LEU A CA  1 
ATOM   1081 C C   . LEU A 1 143 ? -0.382  76.365 45.557 1.00 12.95 ? 143 LEU A C   1 
ATOM   1082 O O   . LEU A 1 143 ? -1.308  77.176 45.646 1.00 14.13 ? 143 LEU A O   1 
ATOM   1083 C CB  . LEU A 1 143 ? 1.425   77.794 46.330 1.00 8.69  ? 143 LEU A CB  1 
ATOM   1084 C CG  . LEU A 1 143 ? 2.173   76.956 47.357 1.00 14.48 ? 143 LEU A CG  1 
ATOM   1085 C CD1 . LEU A 1 143 ? 3.548   77.501 47.673 1.00 9.40  ? 143 LEU A CD1 1 
ATOM   1086 C CD2 . LEU A 1 143 ? 1.327   76.760 48.626 1.00 16.02 ? 143 LEU A CD2 1 
ATOM   1087 N N   . VAL A 1 144 ? -0.505  75.055 45.718 1.00 9.85  ? 144 VAL A N   1 
ATOM   1088 C CA  . VAL A 1 144 ? -1.822  74.581 46.132 1.00 10.53 ? 144 VAL A CA  1 
ATOM   1089 C C   . VAL A 1 144 ? -1.513  73.828 47.401 1.00 14.76 ? 144 VAL A C   1 
ATOM   1090 O O   . VAL A 1 144 ? -0.426  73.255 47.502 1.00 17.96 ? 144 VAL A O   1 
ATOM   1091 C CB  . VAL A 1 144 ? -2.592  73.722 45.070 1.00 6.82  ? 144 VAL A CB  1 
ATOM   1092 C CG1 . VAL A 1 144 ? -1.948  73.679 43.680 1.00 2.00  ? 144 VAL A CG1 1 
ATOM   1093 C CG2 . VAL A 1 144 ? -2.812  72.262 45.458 1.00 2.00  ? 144 VAL A CG2 1 
ATOM   1094 N N   . SER A 1 145 ? -2.434  73.817 48.361 1.00 13.12 ? 145 SER A N   1 
ATOM   1095 C CA  . SER A 1 145 ? -2.241  73.073 49.606 1.00 12.25 ? 145 SER A CA  1 
ATOM   1096 C C   . SER A 1 145 ? -3.328  72.078 49.585 1.00 14.90 ? 145 SER A C   1 
ATOM   1097 O O   . SER A 1 145 ? -4.416  72.486 49.170 1.00 23.90 ? 145 SER A O   1 
ATOM   1098 C CB  . SER A 1 145 ? -2.732  73.918 50.811 1.00 13.74 ? 145 SER A CB  1 
ATOM   1099 O OG  . SER A 1 145 ? -2.018  75.114 50.981 1.00 14.05 ? 145 SER A OG  1 
ATOM   1100 N N   . LEU A 1 146 ? -3.152  70.845 50.029 1.00 14.97 ? 146 LEU A N   1 
ATOM   1101 C CA  . LEU A 1 146 ? -4.372  70.000 49.956 1.00 15.30 ? 146 LEU A CA  1 
ATOM   1102 C C   . LEU A 1 146 ? -4.748  69.502 51.359 1.00 16.91 ? 146 LEU A C   1 
ATOM   1103 O O   . LEU A 1 146 ? -3.939  69.558 52.292 1.00 25.53 ? 146 LEU A O   1 
ATOM   1104 C CB  . LEU A 1 146 ? -4.228  68.895 48.872 1.00 4.10  ? 146 LEU A CB  1 
ATOM   1105 C CG  . LEU A 1 146 ? -2.917  68.128 48.948 1.00 7.34  ? 146 LEU A CG  1 
ATOM   1106 C CD1 . LEU A 1 146 ? -2.920  67.291 50.227 1.00 4.91  ? 146 LEU A CD1 1 
ATOM   1107 C CD2 . LEU A 1 146 ? -2.596  67.287 47.710 1.00 2.00  ? 146 LEU A CD2 1 
ATOM   1108 N N   . SER A 1 147 ? -5.996  69.063 51.499 1.00 11.45 ? 147 SER A N   1 
ATOM   1109 C CA  . SER A 1 147 ? -6.471  68.495 52.728 1.00 9.82  ? 147 SER A CA  1 
ATOM   1110 C C   . SER A 1 147 ? -6.499  67.030 52.491 1.00 11.86 ? 147 SER A C   1 
ATOM   1111 O O   . SER A 1 147 ? -6.644  66.634 51.351 1.00 12.65 ? 147 SER A O   1 
ATOM   1112 C CB  . SER A 1 147 ? -7.985  68.726 52.883 1.00 9.98  ? 147 SER A CB  1 
ATOM   1113 O OG  . SER A 1 147 ? -8.419  70.063 53.085 1.00 18.67 ? 147 SER A OG  1 
ATOM   1114 N N   . TYR A 1 148 ? -6.426  66.191 53.515 1.00 15.11 ? 148 TYR A N   1 
ATOM   1115 C CA  . TYR A 1 148 ? -6.588  64.762 53.271 1.00 13.88 ? 148 TYR A CA  1 
ATOM   1116 C C   . TYR A 1 148 ? -7.080  64.196 54.546 1.00 10.02 ? 148 TYR A C   1 
ATOM   1117 O O   . TYR A 1 148 ? -6.751  64.738 55.580 1.00 10.74 ? 148 TYR A O   1 
ATOM   1118 C CB  . TYR A 1 148 ? -5.379  64.012 52.767 1.00 18.20 ? 148 TYR A CB  1 
ATOM   1119 C CG  . TYR A 1 148 ? -4.176  64.053 53.652 1.00 17.18 ? 148 TYR A CG  1 
ATOM   1120 C CD1 . TYR A 1 148 ? -3.376  65.172 53.725 1.00 14.77 ? 148 TYR A CD1 1 
ATOM   1121 C CD2 . TYR A 1 148 ? -3.836  62.909 54.347 1.00 17.85 ? 148 TYR A CD2 1 
ATOM   1122 C CE1 . TYR A 1 148 ? -2.240  65.101 54.522 1.00 24.11 ? 148 TYR A CE1 1 
ATOM   1123 C CE2 . TYR A 1 148 ? -2.713  62.855 55.128 1.00 14.38 ? 148 TYR A CE2 1 
ATOM   1124 C CZ  . TYR A 1 148 ? -1.915  63.957 55.251 1.00 17.50 ? 148 TYR A CZ  1 
ATOM   1125 O OH  . TYR A 1 148 ? -0.867  63.927 56.165 1.00 22.55 ? 148 TYR A OH  1 
ATOM   1126 N N   . ARG A 1 149 ? -7.885  63.148 54.497 1.00 8.82  ? 149 ARG A N   1 
ATOM   1127 C CA  . ARG A 1 149 ? -8.383  62.632 55.770 1.00 6.24  ? 149 ARG A CA  1 
ATOM   1128 C C   . ARG A 1 149 ? -7.307  61.938 56.636 1.00 10.92 ? 149 ARG A C   1 
ATOM   1129 O O   . ARG A 1 149 ? -6.640  61.004 56.189 1.00 15.79 ? 149 ARG A O   1 
ATOM   1130 C CB  . ARG A 1 149 ? -9.447  61.616 55.433 1.00 4.18  ? 149 ARG A CB  1 
ATOM   1131 C CG  . ARG A 1 149 ? -10.701 62.239 54.819 1.00 3.99  ? 149 ARG A CG  1 
ATOM   1132 C CD  . ARG A 1 149 ? -11.673 61.083 54.644 1.00 16.12 ? 149 ARG A CD  1 
ATOM   1133 N NE  . ARG A 1 149 ? -11.128 60.185 53.640 1.00 20.34 ? 149 ARG A NE  1 
ATOM   1134 C CZ  . ARG A 1 149 ? -11.866 59.234 53.088 1.00 17.09 ? 149 ARG A CZ  1 
ATOM   1135 N NH1 . ARG A 1 149 ? -12.973 58.817 53.702 1.00 15.67 ? 149 ARG A NH1 1 
ATOM   1136 N NH2 . ARG A 1 149 ? -11.484 58.733 51.914 1.00 13.06 ? 149 ARG A NH2 1 
ATOM   1137 N N   . VAL A 1 150 ? -7.185  62.358 57.899 1.00 10.75 ? 150 VAL A N   1 
ATOM   1138 C CA  . VAL A 1 150 ? -6.164  61.768 58.764 1.00 9.12  ? 150 VAL A CA  1 
ATOM   1139 C C   . VAL A 1 150 ? -6.807  60.945 59.815 1.00 9.47  ? 150 VAL A C   1 
ATOM   1140 O O   . VAL A 1 150 ? -8.010  61.046 60.016 1.00 21.04 ? 150 VAL A O   1 
ATOM   1141 C CB  . VAL A 1 150 ? -5.444  62.900 59.480 1.00 6.20  ? 150 VAL A CB  1 
ATOM   1142 C CG1 . VAL A 1 150 ? -4.516  63.645 58.525 1.00 2.00  ? 150 VAL A CG1 1 
ATOM   1143 C CG2 . VAL A 1 150 ? -6.477  63.835 60.093 1.00 2.00  ? 150 VAL A CG2 1 
ATOM   1144 N N   . GLY A 1 151 ? -6.021  60.124 60.489 1.00 3.78  ? 151 GLY A N   1 
ATOM   1145 C CA  . GLY A 1 151 ? -6.582  59.383 61.595 1.00 2.00  ? 151 GLY A CA  1 
ATOM   1146 C C   . GLY A 1 151 ? -7.371  58.205 61.302 1.00 2.52  ? 151 GLY A C   1 
ATOM   1147 O O   . GLY A 1 151 ? -7.269  57.591 60.282 1.00 9.14  ? 151 GLY A O   1 
ATOM   1148 N N   . ALA A 1 152 ? -8.226  57.819 62.233 1.00 13.12 ? 152 ALA A N   1 
ATOM   1149 C CA  . ALA A 1 152 ? -9.059  56.620 62.061 1.00 9.56  ? 152 ALA A CA  1 
ATOM   1150 C C   . ALA A 1 152 ? -9.831  56.739 60.802 1.00 13.32 ? 152 ALA A C   1 
ATOM   1151 O O   . ALA A 1 152 ? -9.934  55.803 60.025 1.00 18.22 ? 152 ALA A O   1 
ATOM   1152 C CB  . ALA A 1 152 ? -10.096 56.507 63.183 1.00 7.36  ? 152 ALA A CB  1 
ATOM   1153 N N   . PHE A 1 153 ? -10.382 57.960 60.646 1.00 11.30 ? 153 PHE A N   1 
ATOM   1154 C CA  . PHE A 1 153 ? -11.185 58.279 59.492 1.00 12.59 ? 153 PHE A CA  1 
ATOM   1155 C C   . PHE A 1 153 ? -10.377 58.205 58.224 1.00 17.14 ? 153 PHE A C   1 
ATOM   1156 O O   . PHE A 1 153 ? -10.919 57.996 57.151 1.00 26.87 ? 153 PHE A O   1 
ATOM   1157 C CB  . PHE A 1 153 ? -11.695 59.733 59.520 1.00 16.27 ? 153 PHE A CB  1 
ATOM   1158 C CG  . PHE A 1 153 ? -12.375 60.137 60.807 1.00 16.39 ? 153 PHE A CG  1 
ATOM   1159 C CD1 . PHE A 1 153 ? -13.588 59.561 61.160 1.00 13.58 ? 153 PHE A CD1 1 
ATOM   1160 C CD2 . PHE A 1 153 ? -11.758 61.028 61.667 1.00 17.76 ? 153 PHE A CD2 1 
ATOM   1161 C CE1 . PHE A 1 153 ? -14.132 59.815 62.383 1.00 16.12 ? 153 PHE A CE1 1 
ATOM   1162 C CE2 . PHE A 1 153 ? -12.306 61.309 62.888 1.00 16.01 ? 153 PHE A CE2 1 
ATOM   1163 C CZ  . PHE A 1 153 ? -13.475 60.683 63.248 1.00 22.08 ? 153 PHE A CZ  1 
ATOM   1164 N N   . GLY A 1 154 ? -9.077  58.457 58.326 1.00 11.62 ? 154 GLY A N   1 
ATOM   1165 C CA  . GLY A 1 154 ? -8.312  58.399 57.107 1.00 7.15  ? 154 GLY A CA  1 
ATOM   1166 C C   . GLY A 1 154 ? -7.561  57.097 56.900 1.00 10.90 ? 154 GLY A C   1 
ATOM   1167 O O   . GLY A 1 154 ? -7.249  56.720 55.777 1.00 16.72 ? 154 GLY A O   1 
ATOM   1168 N N   . PHE A 1 155 ? -7.271  56.339 57.950 1.00 7.12  ? 155 PHE A N   1 
ATOM   1169 C CA  . PHE A 1 155 ? -6.474  55.168 57.731 1.00 2.10  ? 155 PHE A CA  1 
ATOM   1170 C C   . PHE A 1 155 ? -6.942  53.942 58.430 1.00 2.97  ? 155 PHE A C   1 
ATOM   1171 O O   . PHE A 1 155 ? -6.069  53.119 58.723 1.00 2.00  ? 155 PHE A O   1 
ATOM   1172 C CB  . PHE A 1 155 ? -5.024  55.467 58.117 1.00 2.93  ? 155 PHE A CB  1 
ATOM   1173 C CG  . PHE A 1 155 ? -4.420  56.571 57.287 1.00 4.75  ? 155 PHE A CG  1 
ATOM   1174 C CD1 . PHE A 1 155 ? -4.699  57.903 57.554 1.00 4.52  ? 155 PHE A CD1 1 
ATOM   1175 C CD2 . PHE A 1 155 ? -3.593  56.262 56.217 1.00 7.62  ? 155 PHE A CD2 1 
ATOM   1176 C CE1 . PHE A 1 155 ? -4.182  58.896 56.748 1.00 4.72  ? 155 PHE A CE1 1 
ATOM   1177 C CE2 . PHE A 1 155 ? -3.077  57.255 55.406 1.00 2.00  ? 155 PHE A CE2 1 
ATOM   1178 C CZ  . PHE A 1 155 ? -3.382  58.571 55.678 1.00 4.31  ? 155 PHE A CZ  1 
ATOM   1179 N N   . LEU A 1 156 ? -8.273  53.816 58.709 1.00 2.00  ? 156 LEU A N   1 
ATOM   1180 C CA  . LEU A 1 156 ? -8.741  52.547 59.335 1.00 5.64  ? 156 LEU A CA  1 
ATOM   1181 C C   . LEU A 1 156 ? -8.479  51.395 58.334 1.00 7.37  ? 156 LEU A C   1 
ATOM   1182 O O   . LEU A 1 156 ? -8.265  51.644 57.168 1.00 15.00 ? 156 LEU A O   1 
ATOM   1183 C CB  . LEU A 1 156 ? -10.243 52.555 59.592 1.00 5.85  ? 156 LEU A CB  1 
ATOM   1184 C CG  . LEU A 1 156 ? -10.645 51.644 60.743 1.00 3.74  ? 156 LEU A CG  1 
ATOM   1185 C CD1 . LEU A 1 156 ? -10.327 52.370 62.046 1.00 12.98 ? 156 LEU A CD1 1 
ATOM   1186 C CD2 . LEU A 1 156 ? -12.136 51.396 60.651 1.00 6.63  ? 156 LEU A CD2 1 
ATOM   1187 N N   . ALA A 1 157 ? -8.564  50.129 58.645 1.00 7.37  ? 157 ALA A N   1 
ATOM   1188 C CA  . ALA A 1 157 ? -8.147  49.284 57.525 1.00 5.56  ? 157 ALA A CA  1 
ATOM   1189 C C   . ALA A 1 157 ? -8.505  47.856 57.651 1.00 8.89  ? 157 ALA A C   1 
ATOM   1190 O O   . ALA A 1 157 ? -7.657  46.965 57.739 1.00 8.40  ? 157 ALA A O   1 
ATOM   1191 C CB  . ALA A 1 157 ? -6.606  49.322 57.439 1.00 8.20  ? 157 ALA A CB  1 
ATOM   1192 N N   . LEU A 1 158 ? -9.797  47.640 57.623 1.00 9.39  ? 158 LEU A N   1 
ATOM   1193 C CA  . LEU A 1 158 ? -10.252 46.269 57.682 1.00 14.91 ? 158 LEU A CA  1 
ATOM   1194 C C   . LEU A 1 158 ? -10.056 45.697 56.305 1.00 17.09 ? 158 LEU A C   1 
ATOM   1195 O O   . LEU A 1 158 ? -10.953 45.651 55.493 1.00 21.18 ? 158 LEU A O   1 
ATOM   1196 C CB  . LEU A 1 158 ? -11.710 46.359 58.106 1.00 15.18 ? 158 LEU A CB  1 
ATOM   1197 C CG  . LEU A 1 158 ? -11.905 46.868 59.532 1.00 13.03 ? 158 LEU A CG  1 
ATOM   1198 C CD1 . LEU A 1 158 ? -13.285 46.382 60.006 1.00 12.27 ? 158 LEU A CD1 1 
ATOM   1199 C CD2 . LEU A 1 158 ? -10.842 46.248 60.497 1.00 10.10 ? 158 LEU A CD2 1 
ATOM   1200 N N   . HIS A 1 159 ? -8.859  45.216 56.069 1.00 24.14 ? 159 HIS A N   1 
ATOM   1201 C CA  . HIS A 1 159 ? -8.446  44.734 54.781 1.00 33.49 ? 159 HIS A CA  1 
ATOM   1202 C C   . HIS A 1 159 ? -9.419  44.223 53.692 1.00 37.15 ? 159 HIS A C   1 
ATOM   1203 O O   . HIS A 1 159 ? -9.561  44.865 52.649 1.00 42.52 ? 159 HIS A O   1 
ATOM   1204 C CB  . HIS A 1 159 ? -7.191  43.922 54.837 1.00 38.36 ? 159 HIS A CB  1 
ATOM   1205 C CG  . HIS A 1 159 ? -6.604  43.829 53.437 1.00 47.36 ? 159 HIS A CG  1 
ATOM   1206 N ND1 . HIS A 1 159 ? -6.599  44.836 52.521 1.00 48.70 ? 159 HIS A ND1 1 
ATOM   1207 C CD2 . HIS A 1 159 ? -6.004  42.687 52.852 1.00 51.97 ? 159 HIS A CD2 1 
ATOM   1208 C CE1 . HIS A 1 159 ? -5.990  44.334 51.429 1.00 53.17 ? 159 HIS A CE1 1 
ATOM   1209 N NE2 . HIS A 1 159 ? -5.624  43.049 51.607 1.00 54.19 ? 159 HIS A NE2 1 
ATOM   1210 N N   . GLY A 1 160 ? -10.058 43.068 53.874 1.00 36.72 ? 160 GLY A N   1 
ATOM   1211 C CA  . GLY A 1 160 ? -10.913 42.704 52.717 1.00 40.59 ? 160 GLY A CA  1 
ATOM   1212 C C   . GLY A 1 160 ? -12.259 43.399 52.603 1.00 42.72 ? 160 GLY A C   1 
ATOM   1213 O O   . GLY A 1 160 ? -13.082 43.063 51.759 1.00 46.42 ? 160 GLY A O   1 
ATOM   1214 N N   . SER A 1 161 ? -12.507 44.385 53.447 1.00 41.83 ? 161 SER A N   1 
ATOM   1215 C CA  . SER A 1 161 ? -13.818 45.005 53.397 1.00 42.53 ? 161 SER A CA  1 
ATOM   1216 C C   . SER A 1 161 ? -13.773 46.241 52.631 1.00 43.71 ? 161 SER A C   1 
ATOM   1217 O O   . SER A 1 161 ? -13.229 47.241 53.056 1.00 48.57 ? 161 SER A O   1 
ATOM   1218 C CB  . SER A 1 161 ? -14.238 45.464 54.780 1.00 43.02 ? 161 SER A CB  1 
ATOM   1219 N N   . GLN A 1 162 ? -14.490 46.258 51.526 1.00 43.93 ? 162 GLN A N   1 
ATOM   1220 C CA  . GLN A 1 162 ? -14.509 47.478 50.735 1.00 41.60 ? 162 GLN A CA  1 
ATOM   1221 C C   . GLN A 1 162 ? -15.110 48.655 51.477 1.00 35.99 ? 162 GLN A C   1 
ATOM   1222 O O   . GLN A 1 162 ? -15.141 49.762 50.982 1.00 37.32 ? 162 GLN A O   1 
ATOM   1223 C CB  . GLN A 1 162 ? -15.409 47.326 49.467 1.00 49.31 ? 162 GLN A CB  1 
ATOM   1224 C CG  . GLN A 1 162 ? -15.419 45.946 48.769 1.00 58.31 ? 162 GLN A CG  1 
ATOM   1225 C CD  . GLN A 1 162 ? -16.528 45.008 49.320 1.00 60.67 ? 162 GLN A CD  1 
ATOM   1226 O OE1 . GLN A 1 162 ? -17.681 45.392 49.519 1.00 60.26 ? 162 GLN A OE1 1 
ATOM   1227 N NE2 . GLN A 1 162 ? -16.112 43.763 49.611 1.00 55.78 ? 162 GLN A NE2 1 
ATOM   1228 N N   . GLU A 1 163 ? -15.671 48.409 52.648 1.00 34.09 ? 163 GLU A N   1 
ATOM   1229 C CA  . GLU A 1 163 ? -16.275 49.546 53.344 1.00 30.12 ? 163 GLU A CA  1 
ATOM   1230 C C   . GLU A 1 163 ? -15.296 50.417 54.107 1.00 23.18 ? 163 GLU A C   1 
ATOM   1231 O O   . GLU A 1 163 ? -15.606 51.562 54.397 1.00 21.94 ? 163 GLU A O   1 
ATOM   1232 C CB  . GLU A 1 163 ? -17.400 49.066 54.251 1.00 35.30 ? 163 GLU A CB  1 
ATOM   1233 C CG  . GLU A 1 163 ? -18.465 48.291 53.472 1.00 42.28 ? 163 GLU A CG  1 
ATOM   1234 C CD  . GLU A 1 163 ? -19.377 49.275 52.750 1.00 49.78 ? 163 GLU A CD  1 
ATOM   1235 O OE1 . GLU A 1 163 ? -18.893 50.199 52.075 1.00 43.09 ? 163 GLU A OE1 1 
ATOM   1236 O OE2 . GLU A 1 163 ? -20.595 49.112 52.896 1.00 55.82 ? 163 GLU A OE2 1 
ATOM   1237 N N   . ALA A 1 164 ? -14.142 49.826 54.449 1.00 17.61 ? 164 ALA A N   1 
ATOM   1238 C CA  . ALA A 1 164 ? -13.095 50.529 55.157 1.00 14.06 ? 164 ALA A CA  1 
ATOM   1239 C C   . ALA A 1 164 ? -11.826 49.829 54.812 1.00 14.83 ? 164 ALA A C   1 
ATOM   1240 O O   . ALA A 1 164 ? -11.258 49.171 55.678 1.00 18.93 ? 164 ALA A O   1 
ATOM   1241 C CB  . ALA A 1 164 ? -13.267 50.537 56.653 1.00 9.65  ? 164 ALA A CB  1 
ATOM   1242 N N   . PRO A 1 165 ? -11.399 49.955 53.540 1.00 14.97 ? 165 PRO A N   1 
ATOM   1243 C CA  . PRO A 1 165 ? -10.133 49.363 53.082 1.00 11.99 ? 165 PRO A CA  1 
ATOM   1244 C C   . PRO A 1 165 ? -9.112  50.337 53.510 1.00 14.23 ? 165 PRO A C   1 
ATOM   1245 O O   . PRO A 1 165 ? -9.403  51.499 53.768 1.00 23.12 ? 165 PRO A O   1 
ATOM   1246 C CB  . PRO A 1 165 ? -10.144 49.636 51.592 1.00 14.13 ? 165 PRO A CB  1 
ATOM   1247 C CG  . PRO A 1 165 ? -10.999 50.913 51.398 1.00 16.08 ? 165 PRO A CG  1 
ATOM   1248 C CD  . PRO A 1 165 ? -11.967 50.930 52.590 1.00 14.62 ? 165 PRO A CD  1 
ATOM   1249 N N   . GLY A 1 166 ? -7.880  49.963 53.499 1.00 15.19 ? 166 GLY A N   1 
ATOM   1250 C CA  . GLY A 1 166 ? -7.064  51.080 53.972 1.00 16.82 ? 166 GLY A CA  1 
ATOM   1251 C C   . GLY A 1 166 ? -6.791  52.209 52.987 1.00 17.29 ? 166 GLY A C   1 
ATOM   1252 O O   . GLY A 1 166 ? -7.207  52.325 51.843 1.00 24.29 ? 166 GLY A O   1 
ATOM   1253 N N   . ASN A 1 167 ? -5.970  53.069 53.537 1.00 13.59 ? 167 ASN A N   1 
ATOM   1254 C CA  . ASN A 1 167 ? -5.423  54.188 52.847 1.00 11.66 ? 167 ASN A CA  1 
ATOM   1255 C C   . ASN A 1 167 ? -6.385  55.151 52.250 1.00 9.78  ? 167 ASN A C   1 
ATOM   1256 O O   . ASN A 1 167 ? -6.008  55.948 51.403 1.00 13.35 ? 167 ASN A O   1 
ATOM   1257 C CB  . ASN A 1 167 ? -4.426  53.704 51.783 1.00 9.22  ? 167 ASN A CB  1 
ATOM   1258 C CG  . ASN A 1 167 ? -3.404  52.837 52.435 1.00 16.95 ? 167 ASN A CG  1 
ATOM   1259 O OD1 . ASN A 1 167 ? -3.140  52.975 53.627 1.00 26.43 ? 167 ASN A OD1 1 
ATOM   1260 N ND2 . ASN A 1 167 ? -2.841  51.901 51.684 1.00 13.61 ? 167 ASN A ND2 1 
ATOM   1261 N N   . VAL A 1 168 ? -7.604  55.163 52.707 1.00 10.29 ? 168 VAL A N   1 
ATOM   1262 C CA  . VAL A 1 168 ? -8.480  56.116 52.054 1.00 12.58 ? 168 VAL A CA  1 
ATOM   1263 C C   . VAL A 1 168 ? -7.958  57.532 52.103 1.00 11.66 ? 168 VAL A C   1 
ATOM   1264 O O   . VAL A 1 168 ? -8.195  58.317 51.218 1.00 21.01 ? 168 VAL A O   1 
ATOM   1265 C CB  . VAL A 1 168 ? -9.901  55.995 52.596 1.00 11.23 ? 168 VAL A CB  1 
ATOM   1266 C CG1 . VAL A 1 168 ? -10.375 54.547 52.632 1.00 5.67  ? 168 VAL A CG1 1 
ATOM   1267 C CG2 . VAL A 1 168 ? -9.976  56.559 54.006 1.00 15.82 ? 168 VAL A CG2 1 
ATOM   1268 N N   . GLY A 1 169 ? -7.194  57.862 53.108 1.00 11.57 ? 169 GLY A N   1 
ATOM   1269 C CA  . GLY A 1 169 ? -6.660  59.219 53.188 1.00 10.32 ? 169 GLY A CA  1 
ATOM   1270 C C   . GLY A 1 169 ? -5.551  59.492 52.213 1.00 11.85 ? 169 GLY A C   1 
ATOM   1271 O O   . GLY A 1 169 ? -5.287  60.627 51.813 1.00 13.83 ? 169 GLY A O   1 
ATOM   1272 N N   . LEU A 1 170 ? -4.893  58.388 51.819 1.00 12.64 ? 170 LEU A N   1 
ATOM   1273 C CA  . LEU A 1 170 ? -3.788  58.460 50.877 1.00 10.48 ? 170 LEU A CA  1 
ATOM   1274 C C   . LEU A 1 170 ? -4.337  58.751 49.520 1.00 11.28 ? 170 LEU A C   1 
ATOM   1275 O O   . LEU A 1 170 ? -3.781  59.539 48.768 1.00 8.02  ? 170 LEU A O   1 
ATOM   1276 C CB  . LEU A 1 170 ? -2.883  57.212 50.932 1.00 2.35  ? 170 LEU A CB  1 
ATOM   1277 C CG  . LEU A 1 170 ? -1.369  57.526 50.796 1.00 2.00  ? 170 LEU A CG  1 
ATOM   1278 C CD1 . LEU A 1 170 ? -0.847  58.778 51.488 1.00 2.00  ? 170 LEU A CD1 1 
ATOM   1279 C CD2 . LEU A 1 170 ? -0.568  56.362 51.353 1.00 3.04  ? 170 LEU A CD2 1 
ATOM   1280 N N   . LEU A 1 171 ? -5.495  58.108 49.247 1.00 14.08 ? 171 LEU A N   1 
ATOM   1281 C CA  . LEU A 1 171 ? -6.194  58.344 47.986 1.00 11.92 ? 171 LEU A CA  1 
ATOM   1282 C C   . LEU A 1 171 ? -6.738  59.773 47.947 1.00 14.17 ? 171 LEU A C   1 
ATOM   1283 O O   . LEU A 1 171 ? -6.757  60.420 46.911 1.00 13.93 ? 171 LEU A O   1 
ATOM   1284 C CB  . LEU A 1 171 ? -7.363  57.407 47.793 1.00 10.66 ? 171 LEU A CB  1 
ATOM   1285 C CG  . LEU A 1 171 ? -6.920  55.952 47.711 1.00 8.12  ? 171 LEU A CG  1 
ATOM   1286 C CD1 . LEU A 1 171 ? -8.148  55.046 47.760 1.00 16.56 ? 171 LEU A CD1 1 
ATOM   1287 C CD2 . LEU A 1 171 ? -6.148  55.672 46.436 1.00 6.48  ? 171 LEU A CD2 1 
ATOM   1288 N N   . ASP A 1 172 ? -7.180  60.295 49.096 1.00 15.14 ? 172 ASP A N   1 
ATOM   1289 C CA  . ASP A 1 172 ? -7.637  61.693 49.069 1.00 15.10 ? 172 ASP A CA  1 
ATOM   1290 C C   . ASP A 1 172 ? -6.553  62.562 48.495 1.00 13.36 ? 172 ASP A C   1 
ATOM   1291 O O   . ASP A 1 172 ? -6.859  63.453 47.735 1.00 16.60 ? 172 ASP A O   1 
ATOM   1292 C CB  . ASP A 1 172 ? -7.965  62.261 50.453 1.00 14.42 ? 172 ASP A CB  1 
ATOM   1293 C CG  . ASP A 1 172 ? -9.197  61.599 50.962 1.00 13.98 ? 172 ASP A CG  1 
ATOM   1294 O OD1 . ASP A 1 172 ? -9.113  60.457 51.347 1.00 14.35 ? 172 ASP A OD1 1 
ATOM   1295 O OD2 . ASP A 1 172 ? -10.250 62.213 50.956 1.00 17.03 ? 172 ASP A OD2 1 
ATOM   1296 N N   . GLN A 1 173 ? -5.284  62.273 48.862 1.00 13.77 ? 173 GLN A N   1 
ATOM   1297 C CA  . GLN A 1 173 ? -4.146  63.037 48.335 1.00 8.06  ? 173 GLN A CA  1 
ATOM   1298 C C   . GLN A 1 173 ? -4.111  62.883 46.819 1.00 9.95  ? 173 GLN A C   1 
ATOM   1299 O O   . GLN A 1 173 ? -4.104  63.889 46.121 1.00 12.38 ? 173 GLN A O   1 
ATOM   1300 C CB  . GLN A 1 173 ? -2.790  62.575 48.901 1.00 2.53  ? 173 GLN A CB  1 
ATOM   1301 C CG  . GLN A 1 173 ? -2.695  62.601 50.426 1.00 4.10  ? 173 GLN A CG  1 
ATOM   1302 C CD  . GLN A 1 173 ? -1.285  62.270 50.914 1.00 5.73  ? 173 GLN A CD  1 
ATOM   1303 O OE1 . GLN A 1 173 ? -0.288  62.299 50.232 1.00 5.40  ? 173 GLN A OE1 1 
ATOM   1304 N NE2 . GLN A 1 173 ? -1.202  61.978 52.172 1.00 10.73 ? 173 GLN A NE2 1 
ATOM   1305 N N   . ARG A 1 174 ? -4.135  61.617 46.346 1.00 6.20  ? 174 ARG A N   1 
ATOM   1306 C CA  . ARG A 1 174 ? -4.107  61.312 44.926 1.00 4.58  ? 174 ARG A CA  1 
ATOM   1307 C C   . ARG A 1 174 ? -5.228  61.990 44.158 1.00 8.54  ? 174 ARG A C   1 
ATOM   1308 O O   . ARG A 1 174 ? -5.015  62.510 43.071 1.00 10.76 ? 174 ARG A O   1 
ATOM   1309 C CB  . ARG A 1 174 ? -4.065  59.809 44.720 1.00 12.40 ? 174 ARG A CB  1 
ATOM   1310 C CG  . ARG A 1 174 ? -3.920  59.286 43.266 1.00 9.95  ? 174 ARG A CG  1 
ATOM   1311 C CD  . ARG A 1 174 ? -4.448  57.837 43.114 1.00 7.50  ? 174 ARG A CD  1 
ATOM   1312 N NE  . ARG A 1 174 ? -3.437  56.855 43.483 1.00 6.68  ? 174 ARG A NE  1 
ATOM   1313 C CZ  . ARG A 1 174 ? -3.575  55.492 43.524 1.00 9.20  ? 174 ARG A CZ  1 
ATOM   1314 N NH1 . ARG A 1 174 ? -4.782  54.915 43.549 1.00 2.00  ? 174 ARG A NH1 1 
ATOM   1315 N NH2 . ARG A 1 174 ? -2.469  54.698 43.550 1.00 11.78 ? 174 ARG A NH2 1 
ATOM   1316 N N   . MET A 1 175 ? -6.446  61.980 44.698 1.00 10.93 ? 175 MET A N   1 
ATOM   1317 C CA  . MET A 1 175 ? -7.544  62.687 44.007 1.00 10.48 ? 175 MET A CA  1 
ATOM   1318 C C   . MET A 1 175 ? -7.264  64.200 43.995 1.00 9.85  ? 175 MET A C   1 
ATOM   1319 O O   . MET A 1 175 ? -7.507  64.903 43.033 1.00 10.84 ? 175 MET A O   1 
ATOM   1320 C CB  . MET A 1 175 ? -8.900  62.392 44.626 1.00 9.91  ? 175 MET A CB  1 
ATOM   1321 C CG  . MET A 1 175 ? -10.033 62.833 43.705 1.00 14.89 ? 175 MET A CG  1 
ATOM   1322 S SD  . MET A 1 175 ? -11.624 62.081 44.155 1.00 19.84 ? 175 MET A SD  1 
ATOM   1323 C CE  . MET A 1 175 ? -11.289 60.338 43.898 1.00 8.64  ? 175 MET A CE  1 
ATOM   1324 N N   . ALA A 1 176 ? -6.708  64.746 45.056 1.00 11.85 ? 176 ALA A N   1 
ATOM   1325 C CA  . ALA A 1 176 ? -6.418  66.159 44.922 1.00 15.62 ? 176 ALA A CA  1 
ATOM   1326 C C   . ALA A 1 176 ? -5.337  66.359 43.852 1.00 16.77 ? 176 ALA A C   1 
ATOM   1327 O O   . ALA A 1 176 ? -5.274  67.405 43.235 1.00 16.51 ? 176 ALA A O   1 
ATOM   1328 C CB  . ALA A 1 176 ? -5.817  66.706 46.210 1.00 15.99 ? 176 ALA A CB  1 
ATOM   1329 N N   . LEU A 1 177 ? -4.485  65.345 43.624 1.00 14.33 ? 177 LEU A N   1 
ATOM   1330 C CA  . LEU A 1 177 ? -3.414  65.499 42.612 1.00 14.60 ? 177 LEU A CA  1 
ATOM   1331 C C   . LEU A 1 177 ? -3.976  65.468 41.201 1.00 18.78 ? 177 LEU A C   1 
ATOM   1332 O O   . LEU A 1 177 ? -3.574  66.202 40.291 1.00 23.12 ? 177 LEU A O   1 
ATOM   1333 C CB  . LEU A 1 177 ? -2.286  64.440 42.774 1.00 9.93  ? 177 LEU A CB  1 
ATOM   1334 C CG  . LEU A 1 177 ? -0.927  64.877 43.376 1.00 4.49  ? 177 LEU A CG  1 
ATOM   1335 C CD1 . LEU A 1 177 ? -0.998  66.085 44.278 1.00 2.00  ? 177 LEU A CD1 1 
ATOM   1336 C CD2 . LEU A 1 177 ? -0.316  63.688 44.140 1.00 4.62  ? 177 LEU A CD2 1 
ATOM   1337 N N   . GLN A 1 178 ? -4.955  64.590 41.034 1.00 17.50 ? 178 GLN A N   1 
ATOM   1338 C CA  . GLN A 1 178 ? -5.606  64.510 39.722 1.00 15.23 ? 178 GLN A CA  1 
ATOM   1339 C C   . GLN A 1 178 ? -6.296  65.821 39.418 1.00 10.05 ? 178 GLN A C   1 
ATOM   1340 O O   . GLN A 1 178 ? -6.077  66.417 38.380 1.00 10.73 ? 178 GLN A O   1 
ATOM   1341 C CB  . GLN A 1 178 ? -6.515  63.289 39.730 1.00 19.84 ? 178 GLN A CB  1 
ATOM   1342 C CG  . GLN A 1 178 ? -7.409  63.009 38.530 1.00 24.13 ? 178 GLN A CG  1 
ATOM   1343 C CD  . GLN A 1 178 ? -6.718  61.935 37.705 1.00 34.71 ? 178 GLN A CD  1 
ATOM   1344 O OE1 . GLN A 1 178 ? -6.345  60.851 38.155 1.00 42.34 ? 178 GLN A OE1 1 
ATOM   1345 N NE2 . GLN A 1 178 ? -6.502  62.275 36.449 1.00 42.91 ? 178 GLN A NE2 1 
ATOM   1346 N N   . TRP A 1 179 ? -7.119  66.321 40.320 1.00 5.67  ? 179 TRP A N   1 
ATOM   1347 C CA  . TRP A 1 179 ? -7.743  67.599 39.989 1.00 5.24  ? 179 TRP A CA  1 
ATOM   1348 C C   . TRP A 1 179 ? -6.737  68.666 39.741 1.00 6.39  ? 179 TRP A C   1 
ATOM   1349 O O   . TRP A 1 179 ? -6.954  69.595 38.978 1.00 12.71 ? 179 TRP A O   1 
ATOM   1350 C CB  . TRP A 1 179 ? -8.546  68.127 41.142 1.00 4.23  ? 179 TRP A CB  1 
ATOM   1351 C CG  . TRP A 1 179 ? -9.584  69.166 40.788 1.00 3.01  ? 179 TRP A CG  1 
ATOM   1352 C CD1 . TRP A 1 179 ? -10.950 68.859 40.574 1.00 2.00  ? 179 TRP A CD1 1 
ATOM   1353 C CD2 . TRP A 1 179 ? -9.452  70.584 40.822 1.00 2.00  ? 179 TRP A CD2 1 
ATOM   1354 N NE1 . TRP A 1 179 ? -11.676 70.018 40.512 1.00 13.68 ? 179 TRP A NE1 1 
ATOM   1355 C CE2 . TRP A 1 179 ? -10.815 71.107 40.665 1.00 4.06  ? 179 TRP A CE2 1 
ATOM   1356 C CE3 . TRP A 1 179 ? -8.386  71.452 40.888 1.00 2.00  ? 179 TRP A CE3 1 
ATOM   1357 C CZ2 . TRP A 1 179 ? -11.023 72.455 40.595 1.00 2.00  ? 179 TRP A CZ2 1 
ATOM   1358 C CZ3 . TRP A 1 179 ? -8.623  72.815 40.798 1.00 2.00  ? 179 TRP A CZ3 1 
ATOM   1359 C CH2 . TRP A 1 179 ? -9.917  73.290 40.662 1.00 3.24  ? 179 TRP A CH2 1 
ATOM   1360 N N   . VAL A 1 180 ? -5.611  68.580 40.409 1.00 10.23 ? 180 VAL A N   1 
ATOM   1361 C CA  . VAL A 1 180 ? -4.652  69.628 40.083 1.00 11.38 ? 180 VAL A CA  1 
ATOM   1362 C C   . VAL A 1 180 ? -4.245  69.442 38.669 1.00 7.89  ? 180 VAL A C   1 
ATOM   1363 O O   . VAL A 1 180 ? -4.209  70.428 37.996 1.00 9.35  ? 180 VAL A O   1 
ATOM   1364 C CB  . VAL A 1 180 ? -3.427  69.667 41.027 1.00 11.76 ? 180 VAL A CB  1 
ATOM   1365 C CG1 . VAL A 1 180 ? -2.308  70.618 40.571 1.00 13.22 ? 180 VAL A CG1 1 
ATOM   1366 C CG2 . VAL A 1 180 ? -3.899  70.116 42.408 1.00 14.65 ? 180 VAL A CG2 1 
ATOM   1367 N N   . HIS A 1 181 ? -3.988  68.210 38.230 1.00 11.57 ? 181 HIS A N   1 
ATOM   1368 C CA  . HIS A 1 181 ? -3.554  67.900 36.863 1.00 12.20 ? 181 HIS A CA  1 
ATOM   1369 C C   . HIS A 1 181 ? -4.446  68.454 35.764 1.00 13.68 ? 181 HIS A C   1 
ATOM   1370 O O   . HIS A 1 181 ? -4.110  69.254 34.871 1.00 13.56 ? 181 HIS A O   1 
ATOM   1371 C CB  . HIS A 1 181 ? -3.534  66.368 36.717 1.00 13.66 ? 181 HIS A CB  1 
ATOM   1372 C CG  . HIS A 1 181 ? -2.941  65.873 35.409 1.00 17.22 ? 181 HIS A CG  1 
ATOM   1373 N ND1 . HIS A 1 181 ? -3.582  65.039 34.564 1.00 14.60 ? 181 HIS A ND1 1 
ATOM   1374 C CD2 . HIS A 1 181 ? -1.611  66.040 34.927 1.00 19.54 ? 181 HIS A CD2 1 
ATOM   1375 C CE1 . HIS A 1 181 ? -2.703  64.676 33.620 1.00 11.59 ? 181 HIS A CE1 1 
ATOM   1376 N NE2 . HIS A 1 181 ? -1.526  65.266 33.826 1.00 15.88 ? 181 HIS A NE2 1 
ATOM   1377 N N   . ASP A 1 182 ? -5.669  67.945 35.911 1.00 11.04 ? 182 ASP A N   1 
ATOM   1378 C CA  . ASP A 1 182 ? -6.717  68.276 34.978 1.00 12.87 ? 182 ASP A CA  1 
ATOM   1379 C C   . ASP A 1 182 ? -7.084  69.743 34.895 1.00 14.74 ? 182 ASP A C   1 
ATOM   1380 O O   . ASP A 1 182 ? -7.393  70.174 33.802 1.00 15.77 ? 182 ASP A O   1 
ATOM   1381 C CB  . ASP A 1 182 ? -7.963  67.467 35.312 1.00 11.11 ? 182 ASP A CB  1 
ATOM   1382 C CG  . ASP A 1 182 ? -7.791  65.957 35.141 1.00 9.45  ? 182 ASP A CG  1 
ATOM   1383 O OD1 . ASP A 1 182 ? -6.711  65.516 34.763 1.00 14.07 ? 182 ASP A OD1 1 
ATOM   1384 O OD2 . ASP A 1 182 ? -8.753  65.221 35.371 1.00 7.59  ? 182 ASP A OD2 1 
ATOM   1385 N N   . ASN A 1 183 ? -7.042  70.512 36.018 1.00 18.68 ? 183 ASN A N   1 
ATOM   1386 C CA  . ASN A 1 183 ? -7.464  71.951 36.050 1.00 15.29 ? 183 ASN A CA  1 
ATOM   1387 C C   . ASN A 1 183 ? -6.521  73.049 36.408 1.00 15.99 ? 183 ASN A C   1 
ATOM   1388 O O   . ASN A 1 183 ? -6.941  74.198 36.398 1.00 19.42 ? 183 ASN A O   1 
ATOM   1389 C CB  . ASN A 1 183 ? -8.457  72.114 37.180 1.00 13.34 ? 183 ASN A CB  1 
ATOM   1390 C CG  . ASN A 1 183 ? -9.598  71.321 36.716 1.00 17.05 ? 183 ASN A CG  1 
ATOM   1391 O OD1 . ASN A 1 183 ? -10.397 71.841 35.949 1.00 23.88 ? 183 ASN A OD1 1 
ATOM   1392 N ND2 . ASN A 1 183 ? -9.654  70.060 37.151 1.00 14.63 ? 183 ASN A ND2 1 
ATOM   1393 N N   . ILE A 1 184 ? -5.263  72.756 36.699 1.00 15.09 ? 184 ILE A N   1 
ATOM   1394 C CA  . ILE A 1 184 ? -4.362  73.821 37.102 1.00 13.74 ? 184 ILE A CA  1 
ATOM   1395 C C   . ILE A 1 184 ? -4.062  74.806 36.004 1.00 15.82 ? 184 ILE A C   1 
ATOM   1396 O O   . ILE A 1 184 ? -3.718  75.968 36.212 1.00 20.34 ? 184 ILE A O   1 
ATOM   1397 C CB  . ILE A 1 184 ? -3.140  73.234 37.826 1.00 11.11 ? 184 ILE A CB  1 
ATOM   1398 C CG1 . ILE A 1 184 ? -2.480  74.257 38.760 1.00 14.63 ? 184 ILE A CG1 1 
ATOM   1399 C CG2 . ILE A 1 184 ? -2.197  72.575 36.849 1.00 7.89  ? 184 ILE A CG2 1 
ATOM   1400 C CD1 . ILE A 1 184 ? -3.395  74.585 39.970 1.00 9.15  ? 184 ILE A CD1 1 
ATOM   1401 N N   . GLN A 1 185 ? -4.230  74.277 34.789 1.00 17.41 ? 185 GLN A N   1 
ATOM   1402 C CA  . GLN A 1 185 ? -4.052  75.004 33.547 1.00 14.25 ? 185 GLN A CA  1 
ATOM   1403 C C   . GLN A 1 185 ? -4.925  76.239 33.490 1.00 13.45 ? 185 GLN A C   1 
ATOM   1404 O O   . GLN A 1 185 ? -4.497  77.257 32.983 1.00 12.47 ? 185 GLN A O   1 
ATOM   1405 C CB  . GLN A 1 185 ? -4.374  74.080 32.357 1.00 16.69 ? 185 GLN A CB  1 
ATOM   1406 C CG  . GLN A 1 185 ? -5.774  73.431 32.361 1.00 20.41 ? 185 GLN A CG  1 
ATOM   1407 C CD  . GLN A 1 185 ? -5.817  72.467 31.190 1.00 28.37 ? 185 GLN A CD  1 
ATOM   1408 O OE1 . GLN A 1 185 ? -4.915  71.680 30.962 1.00 31.66 ? 185 GLN A OE1 1 
ATOM   1409 N NE2 . GLN A 1 185 ? -6.849  72.560 30.398 1.00 31.45 ? 185 GLN A NE2 1 
ATOM   1410 N N   . PHE A 1 186 ? -6.154  76.159 34.027 1.00 12.70 ? 186 PHE A N   1 
ATOM   1411 C CA  . PHE A 1 186 ? -6.995  77.363 33.973 1.00 14.82 ? 186 PHE A CA  1 
ATOM   1412 C C   . PHE A 1 186 ? -6.596  78.429 35.007 1.00 18.34 ? 186 PHE A C   1 
ATOM   1413 O O   . PHE A 1 186 ? -7.201  79.508 35.114 1.00 18.23 ? 186 PHE A O   1 
ATOM   1414 C CB  . PHE A 1 186 ? -8.451  76.982 34.197 1.00 15.11 ? 186 PHE A CB  1 
ATOM   1415 C CG  . PHE A 1 186 ? -8.836  75.821 33.337 1.00 21.57 ? 186 PHE A CG  1 
ATOM   1416 C CD1 . PHE A 1 186 ? -8.671  75.871 31.971 1.00 21.61 ? 186 PHE A CD1 1 
ATOM   1417 C CD2 . PHE A 1 186 ? -9.384  74.686 33.900 1.00 30.29 ? 186 PHE A CD2 1 
ATOM   1418 C CE1 . PHE A 1 186 ? -9.059  74.806 31.189 1.00 21.51 ? 186 PHE A CE1 1 
ATOM   1419 C CE2 . PHE A 1 186 ? -9.791  73.617 33.113 1.00 25.65 ? 186 PHE A CE2 1 
ATOM   1420 C CZ  . PHE A 1 186 ? -9.626  73.677 31.752 1.00 24.23 ? 186 PHE A CZ  1 
ATOM   1421 N N   . PHE A 1 187 ? -5.549  78.057 35.818 1.00 15.32 ? 187 PHE A N   1 
ATOM   1422 C CA  . PHE A 1 187 ? -5.017  78.912 36.878 1.00 10.15 ? 187 PHE A CA  1 
ATOM   1423 C C   . PHE A 1 187 ? -3.663  79.361 36.524 1.00 10.92 ? 187 PHE A C   1 
ATOM   1424 O O   . PHE A 1 187 ? -2.973  80.010 37.286 1.00 15.92 ? 187 PHE A O   1 
ATOM   1425 C CB  . PHE A 1 187 ? -4.997  78.302 38.276 1.00 4.36  ? 187 PHE A CB  1 
ATOM   1426 C CG  . PHE A 1 187 ? -6.358  77.849 38.770 1.00 2.00  ? 187 PHE A CG  1 
ATOM   1427 C CD1 . PHE A 1 187 ? -6.801  76.552 38.522 1.00 2.00  ? 187 PHE A CD1 1 
ATOM   1428 C CD2 . PHE A 1 187 ? -7.146  78.681 39.525 1.00 2.00  ? 187 PHE A CD2 1 
ATOM   1429 C CE1 . PHE A 1 187 ? -7.996  76.070 39.031 1.00 2.00  ? 187 PHE A CE1 1 
ATOM   1430 C CE2 . PHE A 1 187 ? -8.346  78.218 40.046 1.00 2.00  ? 187 PHE A CE2 1 
ATOM   1431 C CZ  . PHE A 1 187 ? -8.784  76.925 39.802 1.00 2.00  ? 187 PHE A CZ  1 
ATOM   1432 N N   . GLY A 1 188 ? -3.221  79.001 35.354 1.00 12.28 ? 188 GLY A N   1 
ATOM   1433 C CA  . GLY A 1 188 ? -1.907  79.518 35.003 1.00 8.23  ? 188 GLY A CA  1 
ATOM   1434 C C   . GLY A 1 188 ? -0.874  78.548 35.297 1.00 5.28  ? 188 GLY A C   1 
ATOM   1435 O O   . GLY A 1 188 ? 0.291   78.797 35.073 1.00 9.37  ? 188 GLY A O   1 
ATOM   1436 N N   . GLY A 1 189 ? -1.249  77.401 35.787 1.00 3.83  ? 189 GLY A N   1 
ATOM   1437 C CA  . GLY A 1 189 ? -0.159  76.477 36.073 1.00 12.43 ? 189 GLY A CA  1 
ATOM   1438 C C   . GLY A 1 189 ? 0.094   75.511 34.946 1.00 15.87 ? 189 GLY A C   1 
ATOM   1439 O O   . GLY A 1 189 ? -0.730  75.258 34.080 1.00 23.41 ? 189 GLY A O   1 
ATOM   1440 N N   . ASP A 1 190 ? 1.264   74.936 34.986 1.00 9.89  ? 190 ASP A N   1 
ATOM   1441 C CA  . ASP A 1 190 ? 1.653   74.015 33.969 1.00 8.10  ? 190 ASP A CA  1 
ATOM   1442 C C   . ASP A 1 190 ? 1.574   72.577 34.454 1.00 2.65  ? 190 ASP A C   1 
ATOM   1443 O O   . ASP A 1 190 ? 2.476   72.119 35.104 1.00 5.02  ? 190 ASP A O   1 
ATOM   1444 C CB  . ASP A 1 190 ? 3.110   74.377 33.664 1.00 8.22  ? 190 ASP A CB  1 
ATOM   1445 C CG  . ASP A 1 190 ? 3.841   73.405 32.752 1.00 20.70 ? 190 ASP A CG  1 
ATOM   1446 O OD1 . ASP A 1 190 ? 3.248   72.451 32.228 1.00 24.54 ? 190 ASP A OD1 1 
ATOM   1447 O OD2 . ASP A 1 190 ? 5.037   73.606 32.576 1.00 31.33 ? 190 ASP A OD2 1 
ATOM   1448 N N   . PRO A 1 191 ? 0.601   71.792 34.087 1.00 2.00  ? 191 PRO A N   1 
ATOM   1449 C CA  . PRO A 1 191 ? 0.492   70.442 34.635 1.00 4.08  ? 191 PRO A CA  1 
ATOM   1450 C C   . PRO A 1 191 ? 1.631   69.564 34.403 1.00 8.70  ? 191 PRO A C   1 
ATOM   1451 O O   . PRO A 1 191 ? 1.748   68.514 34.995 1.00 12.58 ? 191 PRO A O   1 
ATOM   1452 C CB  . PRO A 1 191 ? -0.696  69.787 33.915 1.00 2.00  ? 191 PRO A CB  1 
ATOM   1453 C CG  . PRO A 1 191 ? -1.420  70.931 33.213 1.00 2.00  ? 191 PRO A CG  1 
ATOM   1454 C CD  . PRO A 1 191 ? -0.425  72.113 33.119 1.00 2.95  ? 191 PRO A CD  1 
ATOM   1455 N N   . LYS A 1 192 ? 2.472   69.972 33.471 1.00 18.20 ? 192 LYS A N   1 
ATOM   1456 C CA  . LYS A 1 192 ? 3.636   69.151 33.145 1.00 27.86 ? 192 LYS A CA  1 
ATOM   1457 C C   . LYS A 1 192 ? 4.802   69.414 34.075 1.00 29.82 ? 192 LYS A C   1 
ATOM   1458 O O   . LYS A 1 192 ? 5.873   68.859 33.869 1.00 26.20 ? 192 LYS A O   1 
ATOM   1459 C CB  . LYS A 1 192 ? 4.071   69.373 31.667 1.00 36.14 ? 192 LYS A CB  1 
ATOM   1460 C CG  . LYS A 1 192 ? 2.943   69.245 30.599 1.00 50.28 ? 192 LYS A CG  1 
ATOM   1461 C CD  . LYS A 1 192 ? 2.135   67.891 30.640 1.00 59.84 ? 192 LYS A CD  1 
ATOM   1462 C CE  . LYS A 1 192 ? 0.587   67.996 30.376 1.00 65.32 ? 192 LYS A CE  1 
ATOM   1463 N NZ  . LYS A 1 192 ? -0.200  66.989 31.107 1.00 63.96 ? 192 LYS A NZ  1 
ATOM   1464 N N   . THR A 1 193 ? 4.581   70.286 35.080 1.00 32.11 ? 193 THR A N   1 
ATOM   1465 C CA  . THR A 1 193 ? 5.619   70.642 36.009 1.00 32.27 ? 193 THR A CA  1 
ATOM   1466 C C   . THR A 1 193 ? 5.087   70.978 37.380 1.00 32.07 ? 193 THR A C   1 
ATOM   1467 O O   . THR A 1 193 ? 5.231   72.095 37.874 1.00 34.54 ? 193 THR A O   1 
ATOM   1468 C CB  . THR A 1 193 ? 6.443   71.821 35.483 1.00 30.34 ? 193 THR A CB  1 
ATOM   1469 O OG1 . THR A 1 193 ? 6.730   71.591 34.116 1.00 34.42 ? 193 THR A OG1 1 
ATOM   1470 C CG2 . THR A 1 193 ? 7.813   71.876 36.141 1.00 39.06 ? 193 THR A CG2 1 
ATOM   1471 N N   . VAL A 1 194 ? 4.452   69.970 37.979 1.00 30.29 ? 194 VAL A N   1 
ATOM   1472 C CA  . VAL A 1 194 ? 3.920   70.160 39.318 1.00 26.67 ? 194 VAL A CA  1 
ATOM   1473 C C   . VAL A 1 194 ? 4.846   69.352 40.225 1.00 25.43 ? 194 VAL A C   1 
ATOM   1474 O O   . VAL A 1 194 ? 5.199   68.217 39.909 1.00 21.08 ? 194 VAL A O   1 
ATOM   1475 C CB  . VAL A 1 194 ? 2.417   69.753 39.365 1.00 22.73 ? 194 VAL A CB  1 
ATOM   1476 C CG1 . VAL A 1 194 ? 2.118   68.285 39.096 1.00 21.01 ? 194 VAL A CG1 1 
ATOM   1477 C CG2 . VAL A 1 194 ? 1.772   70.078 40.688 1.00 28.54 ? 194 VAL A CG2 1 
ATOM   1478 N N   . THR A 1 195 ? 5.250   69.951 41.332 1.00 25.31 ? 195 THR A N   1 
ATOM   1479 C CA  . THR A 1 195 ? 6.096   69.266 42.305 1.00 24.91 ? 195 THR A CA  1 
ATOM   1480 C C   . THR A 1 195 ? 5.291   69.007 43.598 1.00 26.17 ? 195 THR A C   1 
ATOM   1481 O O   . THR A 1 195 ? 4.710   69.947 44.139 1.00 31.50 ? 195 THR A O   1 
ATOM   1482 C CB  . THR A 1 195 ? 7.206   70.242 42.679 1.00 20.43 ? 195 THR A CB  1 
ATOM   1483 O OG1 . THR A 1 195 ? 7.975   70.504 41.520 1.00 19.69 ? 195 THR A OG1 1 
ATOM   1484 C CG2 . THR A 1 195 ? 8.120   69.707 43.775 1.00 22.97 ? 195 THR A CG2 1 
ATOM   1485 N N   . ILE A 1 196 ? 5.226   67.764 44.096 1.00 20.62 ? 196 ILE A N   1 
ATOM   1486 C CA  . ILE A 1 196 ? 4.542   67.601 45.357 1.00 13.25 ? 196 ILE A CA  1 
ATOM   1487 C C   . ILE A 1 196 ? 5.644   67.631 46.480 1.00 18.04 ? 196 ILE A C   1 
ATOM   1488 O O   . ILE A 1 196 ? 6.665   66.932 46.444 1.00 16.08 ? 196 ILE A O   1 
ATOM   1489 C CB  . ILE A 1 196 ? 3.757   66.322 45.322 1.00 9.82  ? 196 ILE A CB  1 
ATOM   1490 C CG1 . ILE A 1 196 ? 4.628   65.102 45.051 1.00 7.40  ? 196 ILE A CG1 1 
ATOM   1491 C CG2 . ILE A 1 196 ? 2.660   66.423 44.290 1.00 9.77  ? 196 ILE A CG2 1 
ATOM   1492 C CD1 . ILE A 1 196 ? 3.880   63.837 45.398 1.00 3.67  ? 196 ILE A CD1 1 
ATOM   1493 N N   . PHE A 1 197 ? 5.441   68.528 47.459 1.00 16.91 ? 197 PHE A N   1 
ATOM   1494 C CA  . PHE A 1 197 ? 6.358   68.676 48.573 1.00 15.21 ? 197 PHE A CA  1 
ATOM   1495 C C   . PHE A 1 197 ? 5.573   68.398 49.871 1.00 20.46 ? 197 PHE A C   1 
ATOM   1496 O O   . PHE A 1 197 ? 4.335   68.405 49.861 1.00 21.77 ? 197 PHE A O   1 
ATOM   1497 C CB  . PHE A 1 197 ? 7.135   69.976 48.486 1.00 11.89 ? 197 PHE A CB  1 
ATOM   1498 C CG  . PHE A 1 197 ? 6.454   71.292 48.798 1.00 10.29 ? 197 PHE A CG  1 
ATOM   1499 C CD1 . PHE A 1 197 ? 5.224   71.594 48.287 1.00 9.55  ? 197 PHE A CD1 1 
ATOM   1500 C CD2 . PHE A 1 197 ? 7.116   72.271 49.549 1.00 9.41  ? 197 PHE A CD2 1 
ATOM   1501 C CE1 . PHE A 1 197 ? 4.665   72.837 48.514 1.00 11.79 ? 197 PHE A CE1 1 
ATOM   1502 C CE2 . PHE A 1 197 ? 6.564   73.508 49.782 1.00 2.00  ? 197 PHE A CE2 1 
ATOM   1503 C CZ  . PHE A 1 197 ? 5.329   73.796 49.262 1.00 4.23  ? 197 PHE A CZ  1 
ATOM   1504 N N   . GLY A 1 198 ? 6.288   68.111 50.985 1.00 16.31 ? 198 GLY A N   1 
ATOM   1505 C CA  . GLY A 1 198 ? 5.555   67.813 52.210 1.00 15.75 ? 198 GLY A CA  1 
ATOM   1506 C C   . GLY A 1 198 ? 6.565   67.389 53.208 1.00 20.05 ? 198 GLY A C   1 
ATOM   1507 O O   . GLY A 1 198 ? 7.597   66.822 52.862 1.00 20.39 ? 198 GLY A O   1 
ATOM   1508 N N   . GLU A 1 199 ? 6.246   67.665 54.478 1.00 21.13 ? 199 GLU A N   1 
ATOM   1509 C CA  . GLU A 1 199 ? 7.105   67.399 55.637 1.00 15.17 ? 199 GLU A CA  1 
ATOM   1510 C C   . GLU A 1 199 ? 6.588   66.344 56.591 1.00 14.49 ? 199 GLU A C   1 
ATOM   1511 O O   . GLU A 1 199 ? 5.384   66.247 56.731 1.00 14.11 ? 199 GLU A O   1 
ATOM   1512 C CB  . GLU A 1 199 ? 7.025   68.702 56.473 1.00 16.27 ? 199 GLU A CB  1 
ATOM   1513 C CG  . GLU A 1 199 ? 8.217   68.947 57.423 1.00 20.32 ? 199 GLU A CG  1 
ATOM   1514 C CD  . GLU A 1 199 ? 7.982   68.777 58.914 1.00 17.19 ? 199 GLU A CD  1 
ATOM   1515 O OE1 . GLU A 1 199 ? 6.827   68.533 59.318 1.00 2.00  ? 199 GLU A OE1 1 
ATOM   1516 O OE2 . GLU A 1 199 ? 8.999   68.902 59.627 1.00 19.68 ? 199 GLU A OE2 1 
ATOM   1517 N N   . SER A 1 200 ? 7.441   65.593 57.299 1.00 14.24 ? 200 SER A N   1 
ATOM   1518 C CA  . SER A 1 200 ? 6.980   64.612 58.271 1.00 17.33 ? 200 SER A CA  1 
ATOM   1519 C C   . SER A 1 200 ? 6.141   63.657 57.495 1.00 14.57 ? 200 SER A C   1 
ATOM   1520 O O   . SER A 1 200 ? 6.576   63.185 56.462 1.00 21.28 ? 200 SER A O   1 
ATOM   1521 C CB  . SER A 1 200 ? 6.293   65.268 59.531 1.00 22.36 ? 200 SER A CB  1 
ATOM   1522 O OG  . SER A 1 200 ? 5.865   64.380 60.590 1.00 21.95 ? 200 SER A OG  1 
ATOM   1523 N N   . ALA A 1 201 ? 4.914   63.420 57.946 1.00 8.60  ? 201 ALA A N   1 
ATOM   1524 C CA  . ALA A 1 201 ? 4.065   62.486 57.228 1.00 10.01 ? 201 ALA A CA  1 
ATOM   1525 C C   . ALA A 1 201 ? 3.703   62.973 55.793 1.00 12.02 ? 201 ALA A C   1 
ATOM   1526 O O   . ALA A 1 201 ? 3.192   62.252 54.949 1.00 12.73 ? 201 ALA A O   1 
ATOM   1527 C CB  . ALA A 1 201 ? 2.856   62.122 58.075 1.00 3.63  ? 201 ALA A CB  1 
ATOM   1528 N N   . GLY A 1 202 ? 3.963   64.243 55.535 1.00 8.32  ? 202 GLY A N   1 
ATOM   1529 C CA  . GLY A 1 202 ? 3.688   64.699 54.192 1.00 12.09 ? 202 GLY A CA  1 
ATOM   1530 C C   . GLY A 1 202 ? 4.876   64.267 53.330 1.00 13.65 ? 202 GLY A C   1 
ATOM   1531 O O   . GLY A 1 202 ? 4.777   63.770 52.221 1.00 15.08 ? 202 GLY A O   1 
ATOM   1532 N N   . GLY A 1 203 ? 6.063   64.412 53.891 1.00 9.37  ? 203 GLY A N   1 
ATOM   1533 C CA  . GLY A 1 203 ? 7.224   64.034 53.131 1.00 8.78  ? 203 GLY A CA  1 
ATOM   1534 C C   . GLY A 1 203 ? 7.307   62.555 52.996 1.00 12.44 ? 203 GLY A C   1 
ATOM   1535 O O   . GLY A 1 203 ? 7.997   61.994 52.151 1.00 14.46 ? 203 GLY A O   1 
ATOM   1536 N N   . ALA A 1 204 ? 6.596   61.896 53.902 1.00 15.23 ? 204 ALA A N   1 
ATOM   1537 C CA  . ALA A 1 204 ? 6.557   60.428 53.829 1.00 19.78 ? 204 ALA A CA  1 
ATOM   1538 C C   . ALA A 1 204 ? 5.424   60.039 52.910 1.00 18.79 ? 204 ALA A C   1 
ATOM   1539 O O   . ALA A 1 204 ? 5.472   58.989 52.307 1.00 24.37 ? 204 ALA A O   1 
ATOM   1540 C CB  . ALA A 1 204 ? 6.363   59.715 55.169 1.00 17.75 ? 204 ALA A CB  1 
ATOM   1541 N N   . SER A 1 205 ? 4.379   60.873 52.815 1.00 18.27 ? 205 SER A N   1 
ATOM   1542 C CA  . SER A 1 205 ? 3.323   60.539 51.860 1.00 13.64 ? 205 SER A CA  1 
ATOM   1543 C C   . SER A 1 205 ? 3.871   60.732 50.469 1.00 8.35  ? 205 SER A C   1 
ATOM   1544 O O   . SER A 1 205 ? 3.653   59.880 49.641 1.00 8.24  ? 205 SER A O   1 
ATOM   1545 C CB  . SER A 1 205 ? 2.052   61.407 51.992 1.00 11.85 ? 205 SER A CB  1 
ATOM   1546 O OG  . SER A 1 205 ? 1.421   61.117 53.223 1.00 3.75  ? 205 SER A OG  1 
ATOM   1547 N N   . VAL A 1 206 ? 4.601   61.831 50.231 1.00 7.40  ? 206 VAL A N   1 
ATOM   1548 C CA  . VAL A 1 206 ? 5.220   62.160 48.945 1.00 7.86  ? 206 VAL A CA  1 
ATOM   1549 C C   . VAL A 1 206 ? 5.990   60.967 48.406 1.00 8.75  ? 206 VAL A C   1 
ATOM   1550 O O   . VAL A 1 206 ? 5.749   60.469 47.311 1.00 15.30 ? 206 VAL A O   1 
ATOM   1551 C CB  . VAL A 1 206 ? 6.113   63.419 49.095 1.00 6.07  ? 206 VAL A CB  1 
ATOM   1552 C CG1 . VAL A 1 206 ? 7.139   63.582 47.990 1.00 3.28  ? 206 VAL A CG1 1 
ATOM   1553 C CG2 . VAL A 1 206 ? 5.275   64.691 49.195 1.00 2.00  ? 206 VAL A CG2 1 
ATOM   1554 N N   . GLY A 1 207 ? 6.939   60.492 49.185 1.00 7.69  ? 207 GLY A N   1 
ATOM   1555 C CA  . GLY A 1 207 ? 7.623   59.316 48.672 1.00 4.68  ? 207 GLY A CA  1 
ATOM   1556 C C   . GLY A 1 207 ? 6.656   58.167 48.401 1.00 3.89  ? 207 GLY A C   1 
ATOM   1557 O O   . GLY A 1 207 ? 6.890   57.436 47.461 1.00 5.56  ? 207 GLY A O   1 
ATOM   1558 N N   . MET A 1 208 ? 5.577   57.986 49.195 1.00 2.12  ? 208 MET A N   1 
ATOM   1559 C CA  . MET A 1 208 ? 4.642   56.865 48.897 1.00 8.67  ? 208 MET A CA  1 
ATOM   1560 C C   . MET A 1 208 ? 4.136   57.009 47.445 1.00 9.98  ? 208 MET A C   1 
ATOM   1561 O O   . MET A 1 208 ? 4.252   56.117 46.620 1.00 15.77 ? 208 MET A O   1 
ATOM   1562 C CB  . MET A 1 208 ? 3.563   56.681 49.983 1.00 8.90  ? 208 MET A CB  1 
ATOM   1563 C CG  . MET A 1 208 ? 4.221   56.325 51.337 1.00 14.86 ? 208 MET A CG  1 
ATOM   1564 S SD  . MET A 1 208 ? 3.045   56.289 52.718 1.00 16.10 ? 208 MET A SD  1 
ATOM   1565 C CE  . MET A 1 208 ? 3.684   54.806 53.508 1.00 18.57 ? 208 MET A CE  1 
ATOM   1566 N N   . HIS A 1 209 ? 3.602   58.164 47.111 1.00 7.05  ? 209 HIS A N   1 
ATOM   1567 C CA  . HIS A 1 209 ? 3.228   58.401 45.719 1.00 7.49  ? 209 HIS A CA  1 
ATOM   1568 C C   . HIS A 1 209 ? 4.450   58.163 44.759 1.00 6.36  ? 209 HIS A C   1 
ATOM   1569 O O   . HIS A 1 209 ? 4.298   57.706 43.645 1.00 4.43  ? 209 HIS A O   1 
ATOM   1570 C CB  . HIS A 1 209 ? 2.838   59.870 45.538 1.00 2.26  ? 209 HIS A CB  1 
ATOM   1571 C CG  . HIS A 1 209 ? 1.524   60.150 46.243 1.00 8.98  ? 209 HIS A CG  1 
ATOM   1572 N ND1 . HIS A 1 209 ? 1.288   61.220 47.051 1.00 2.00  ? 209 HIS A ND1 1 
ATOM   1573 C CD2 . HIS A 1 209 ? 0.318   59.403 46.165 1.00 9.94  ? 209 HIS A CD2 1 
ATOM   1574 C CE1 . HIS A 1 209 ? 0.021   61.145 47.424 1.00 2.00  ? 209 HIS A CE1 1 
ATOM   1575 N NE2 . HIS A 1 209 ? -0.600  60.072 46.904 1.00 11.36 ? 209 HIS A NE2 1 
ATOM   1576 N N   . ILE A 1 210 ? 5.678   58.527 45.109 1.00 3.15  ? 210 ILE A N   1 
ATOM   1577 C CA  . ILE A 1 210 ? 6.713   58.140 44.130 1.00 2.28  ? 210 ILE A CA  1 
ATOM   1578 C C   . ILE A 1 210 ? 6.685   56.623 43.891 1.00 6.61  ? 210 ILE A C   1 
ATOM   1579 O O   . ILE A 1 210 ? 6.982   56.213 42.785 1.00 11.76 ? 210 ILE A O   1 
ATOM   1580 C CB  . ILE A 1 210 ? 8.094   58.513 44.632 1.00 2.00  ? 210 ILE A CB  1 
ATOM   1581 C CG1 . ILE A 1 210 ? 8.276   60.011 44.565 1.00 2.00  ? 210 ILE A CG1 1 
ATOM   1582 C CG2 . ILE A 1 210 ? 9.266   57.774 43.980 1.00 2.00  ? 210 ILE A CG2 1 
ATOM   1583 C CD1 . ILE A 1 210 ? 9.654   60.403 45.136 1.00 2.00  ? 210 ILE A CD1 1 
ATOM   1584 N N   . LEU A 1 211 ? 6.361   55.804 44.903 1.00 7.15  ? 211 LEU A N   1 
ATOM   1585 C CA  . LEU A 1 211 ? 6.284   54.347 44.759 1.00 6.31  ? 211 LEU A CA  1 
ATOM   1586 C C   . LEU A 1 211 ? 4.935   53.805 44.176 1.00 11.07 ? 211 LEU A C   1 
ATOM   1587 O O   . LEU A 1 211 ? 4.918   52.814 43.441 1.00 10.77 ? 211 LEU A O   1 
ATOM   1588 C CB  . LEU A 1 211 ? 6.431   53.676 46.141 1.00 10.78 ? 211 LEU A CB  1 
ATOM   1589 C CG  . LEU A 1 211 ? 7.886   53.516 46.602 1.00 14.63 ? 211 LEU A CG  1 
ATOM   1590 C CD1 . LEU A 1 211 ? 8.573   54.865 46.790 1.00 23.89 ? 211 LEU A CD1 1 
ATOM   1591 C CD2 . LEU A 1 211 ? 7.966   52.732 47.914 1.00 12.67 ? 211 LEU A CD2 1 
ATOM   1592 N N   . SER A 1 212 ? 3.776   54.416 44.462 1.00 6.97  ? 212 SER A N   1 
ATOM   1593 C CA  . SER A 1 212 ? 2.591   53.749 43.914 1.00 11.34 ? 212 SER A CA  1 
ATOM   1594 C C   . SER A 1 212 ? 2.399   53.922 42.421 1.00 14.34 ? 212 SER A C   1 
ATOM   1595 O O   . SER A 1 212 ? 2.394   55.022 41.857 1.00 11.96 ? 212 SER A O   1 
ATOM   1596 C CB  . SER A 1 212 ? 1.266   54.136 44.555 1.00 16.37 ? 212 SER A CB  1 
ATOM   1597 O OG  . SER A 1 212 ? 1.553   53.950 45.900 1.00 29.93 ? 212 SER A OG  1 
ATOM   1598 N N   . PRO A 1 213 ? 2.141   52.761 41.761 1.00 15.45 ? 213 PRO A N   1 
ATOM   1599 C CA  . PRO A 1 213 ? 1.959   52.800 40.329 1.00 10.42 ? 213 PRO A CA  1 
ATOM   1600 C C   . PRO A 1 213 ? 1.059   53.872 39.803 1.00 11.18 ? 213 PRO A C   1 
ATOM   1601 O O   . PRO A 1 213 ? 1.396   54.633 38.888 1.00 15.33 ? 213 PRO A O   1 
ATOM   1602 C CB  . PRO A 1 213 ? 1.533   51.404 39.998 1.00 10.63 ? 213 PRO A CB  1 
ATOM   1603 C CG  . PRO A 1 213 ? 2.045   50.493 41.130 1.00 10.77 ? 213 PRO A CG  1 
ATOM   1604 C CD  . PRO A 1 213 ? 2.271   51.392 42.317 1.00 11.42 ? 213 PRO A CD  1 
ATOM   1605 N N   . GLY A 1 214 ? -0.073  53.922 40.509 1.00 8.94  ? 214 GLY A N   1 
ATOM   1606 C CA  . GLY A 1 214 ? -1.150  54.829 40.152 1.00 12.47 ? 214 GLY A CA  1 
ATOM   1607 C C   . GLY A 1 214 ? -0.940  56.284 40.388 1.00 19.14 ? 214 GLY A C   1 
ATOM   1608 O O   . GLY A 1 214 ? -1.616  57.111 39.811 1.00 24.67 ? 214 GLY A O   1 
ATOM   1609 N N   . SER A 1 215 ? -0.002  56.648 41.238 1.00 24.02 ? 215 SER A N   1 
ATOM   1610 C CA  . SER A 1 215 ? 0.160   58.087 41.435 1.00 26.44 ? 215 SER A CA  1 
ATOM   1611 C C   . SER A 1 215 ? 1.304   58.717 40.671 1.00 25.15 ? 215 SER A C   1 
ATOM   1612 O O   . SER A 1 215 ? 1.301   59.922 40.418 1.00 24.07 ? 215 SER A O   1 
ATOM   1613 C CB  . SER A 1 215 ? 0.403   58.340 42.923 1.00 30.41 ? 215 SER A CB  1 
ATOM   1614 O OG  . SER A 1 215 ? -0.694  57.769 43.590 1.00 33.95 ? 215 SER A OG  1 
ATOM   1615 N N   . ARG A 1 216 ? 2.285   57.882 40.321 1.00 20.76 ? 216 ARG A N   1 
ATOM   1616 C CA  . ARG A 1 216 ? 3.477   58.384 39.663 1.00 15.49 ? 216 ARG A CA  1 
ATOM   1617 C C   . ARG A 1 216 ? 3.218   59.303 38.555 1.00 16.86 ? 216 ARG A C   1 
ATOM   1618 O O   . ARG A 1 216 ? 3.962   60.235 38.316 1.00 16.36 ? 216 ARG A O   1 
ATOM   1619 C CB  . ARG A 1 216 ? 4.301   57.244 39.047 1.00 15.94 ? 216 ARG A CB  1 
ATOM   1620 C CG  . ARG A 1 216 ? 5.122   56.440 40.078 1.00 18.08 ? 216 ARG A CG  1 
ATOM   1621 C CD  . ARG A 1 216 ? 4.786   54.948 40.189 1.00 11.17 ? 216 ARG A CD  1 
ATOM   1622 N NE  . ARG A 1 216 ? 5.970   54.153 39.944 1.00 15.70 ? 216 ARG A NE  1 
ATOM   1623 C CZ  . ARG A 1 216 ? 6.075   52.856 40.251 1.00 10.43 ? 216 ARG A CZ  1 
ATOM   1624 N NH1 . ARG A 1 216 ? 5.116   52.166 40.849 1.00 9.51  ? 216 ARG A NH1 1 
ATOM   1625 N NH2 . ARG A 1 216 ? 7.186   52.243 39.926 1.00 11.52 ? 216 ARG A NH2 1 
ATOM   1626 N N   . ASP A 1 217 ? 2.116   59.056 37.875 1.00 17.76 ? 217 ASP A N   1 
ATOM   1627 C CA  . ASP A 1 217 ? 1.970   59.915 36.710 1.00 19.92 ? 217 ASP A CA  1 
ATOM   1628 C C   . ASP A 1 217 ? 1.455   61.319 37.004 1.00 15.53 ? 217 ASP A C   1 
ATOM   1629 O O   . ASP A 1 217 ? 1.613   62.245 36.232 1.00 12.24 ? 217 ASP A O   1 
ATOM   1630 C CB  . ASP A 1 217 ? 1.243   59.123 35.561 1.00 27.04 ? 217 ASP A CB  1 
ATOM   1631 C CG  . ASP A 1 217 ? 1.770   57.688 35.126 1.00 27.05 ? 217 ASP A CG  1 
ATOM   1632 O OD1 . ASP A 1 217 ? 2.929   57.293 35.379 1.00 26.04 ? 217 ASP A OD1 1 
ATOM   1633 O OD2 . ASP A 1 217 ? 0.976   56.982 34.501 1.00 24.29 ? 217 ASP A OD2 1 
ATOM   1634 N N   . LEU A 1 218 ? 0.835   61.479 38.151 1.00 14.72 ? 218 LEU A N   1 
ATOM   1635 C CA  . LEU A 1 218 ? 0.263   62.769 38.481 1.00 8.44  ? 218 LEU A CA  1 
ATOM   1636 C C   . LEU A 1 218 ? 1.179   63.888 38.890 1.00 6.18  ? 218 LEU A C   1 
ATOM   1637 O O   . LEU A 1 218 ? 0.683   64.977 39.123 1.00 8.23  ? 218 LEU A O   1 
ATOM   1638 C CB  . LEU A 1 218 ? -0.753  62.522 39.583 1.00 8.69  ? 218 LEU A CB  1 
ATOM   1639 C CG  . LEU A 1 218 ? -1.956  61.673 39.135 1.00 6.61  ? 218 LEU A CG  1 
ATOM   1640 C CD1 . LEU A 1 218 ? -2.836  61.234 40.309 1.00 2.00  ? 218 LEU A CD1 1 
ATOM   1641 C CD2 . LEU A 1 218 ? -2.772  62.534 38.169 1.00 8.68  ? 218 LEU A CD2 1 
ATOM   1642 N N   . PHE A 1 219 ? 2.474   63.686 38.997 1.00 6.25  ? 219 PHE A N   1 
ATOM   1643 C CA  . PHE A 1 219 ? 3.323   64.819 39.401 1.00 10.20 ? 219 PHE A CA  1 
ATOM   1644 C C   . PHE A 1 219 ? 4.687   64.737 38.679 1.00 17.96 ? 219 PHE A C   1 
ATOM   1645 O O   . PHE A 1 219 ? 5.022   63.753 38.017 1.00 22.35 ? 219 PHE A O   1 
ATOM   1646 C CB  . PHE A 1 219 ? 3.431   64.916 40.933 1.00 7.59  ? 219 PHE A CB  1 
ATOM   1647 C CG  . PHE A 1 219 ? 4.093   63.691 41.557 1.00 7.14  ? 219 PHE A CG  1 
ATOM   1648 C CD1 . PHE A 1 219 ? 3.378   62.512 41.757 1.00 2.00  ? 219 PHE A CD1 1 
ATOM   1649 C CD2 . PHE A 1 219 ? 5.439   63.739 41.860 1.00 2.00  ? 219 PHE A CD2 1 
ATOM   1650 C CE1 . PHE A 1 219 ? 4.037   61.388 42.194 1.00 6.84  ? 219 PHE A CE1 1 
ATOM   1651 C CE2 . PHE A 1 219 ? 6.077   62.605 42.308 1.00 7.41  ? 219 PHE A CE2 1 
ATOM   1652 C CZ  . PHE A 1 219 ? 5.390   61.425 42.456 1.00 2.00  ? 219 PHE A CZ  1 
ATOM   1653 N N   . ARG A 1 220 ? 5.504   65.789 38.825 1.00 18.23 ? 220 ARG A N   1 
ATOM   1654 C CA  . ARG A 1 220 ? 6.775   65.747 38.078 1.00 20.60 ? 220 ARG A CA  1 
ATOM   1655 C C   . ARG A 1 220 ? 7.906   65.222 38.885 1.00 22.71 ? 220 ARG A C   1 
ATOM   1656 O O   . ARG A 1 220 ? 8.504   64.201 38.568 1.00 22.96 ? 220 ARG A O   1 
ATOM   1657 C CB  . ARG A 1 220 ? 7.133   67.137 37.507 1.00 20.50 ? 220 ARG A CB  1 
ATOM   1658 C CG  . ARG A 1 220 ? 8.292   67.109 36.491 1.00 18.07 ? 220 ARG A CG  1 
ATOM   1659 C CD  . ARG A 1 220 ? 7.902   66.699 35.066 1.00 27.87 ? 220 ARG A CD  1 
ATOM   1660 N NE  . ARG A 1 220 ? 9.058   66.751 34.146 1.00 32.42 ? 220 ARG A NE  1 
ATOM   1661 C CZ  . ARG A 1 220 ? 9.285   67.692 33.198 1.00 29.76 ? 220 ARG A CZ  1 
ATOM   1662 N NH1 . ARG A 1 220 ? 8.477   68.725 33.015 1.00 25.56 ? 220 ARG A NH1 1 
ATOM   1663 N NH2 . ARG A 1 220 ? 10.371  67.589 32.440 1.00 29.16 ? 220 ARG A NH2 1 
ATOM   1664 N N   . ARG A 1 221 ? 8.168   66.014 39.941 1.00 23.33 ? 221 ARG A N   1 
ATOM   1665 C CA  . ARG A 1 221 ? 9.254   65.750 40.866 1.00 22.39 ? 221 ARG A CA  1 
ATOM   1666 C C   . ARG A 1 221 ? 8.758   65.881 42.312 1.00 23.26 ? 221 ARG A C   1 
ATOM   1667 O O   . ARG A 1 221 ? 7.616   66.253 42.566 1.00 27.72 ? 221 ARG A O   1 
ATOM   1668 C CB  . ARG A 1 221 ? 10.435  66.639 40.507 1.00 16.44 ? 221 ARG A CB  1 
ATOM   1669 C CG  . ARG A 1 221 ? 10.009  68.060 40.192 1.00 10.61 ? 221 ARG A CG  1 
ATOM   1670 C CD  . ARG A 1 221 ? 11.239  68.918 39.978 1.00 20.75 ? 221 ARG A CD  1 
ATOM   1671 N NE  . ARG A 1 221 ? 11.825  68.637 38.682 1.00 23.24 ? 221 ARG A NE  1 
ATOM   1672 C CZ  . ARG A 1 221 ? 11.477  69.397 37.652 1.00 30.97 ? 221 ARG A CZ  1 
ATOM   1673 N NH1 . ARG A 1 221 ? 10.578  70.367 37.782 1.00 27.98 ? 221 ARG A NH1 1 
ATOM   1674 N NH2 . ARG A 1 221 ? 12.046  69.206 36.468 1.00 40.66 ? 221 ARG A NH2 1 
ATOM   1675 N N   . ALA A 1 222 ? 9.640   65.619 43.265 1.00 19.47 ? 222 ALA A N   1 
ATOM   1676 C CA  . ALA A 1 222 ? 9.182   65.695 44.630 1.00 19.35 ? 222 ALA A CA  1 
ATOM   1677 C C   . ALA A 1 222 ? 10.259  66.251 45.520 1.00 21.83 ? 222 ALA A C   1 
ATOM   1678 O O   . ALA A 1 222 ? 11.434  66.189 45.154 1.00 20.31 ? 222 ALA A O   1 
ATOM   1679 C CB  . ALA A 1 222 ? 8.902   64.260 45.056 1.00 14.92 ? 222 ALA A CB  1 
ATOM   1680 N N   . ILE A 1 223 ? 9.799   66.793 46.675 1.00 22.39 ? 223 ILE A N   1 
ATOM   1681 C CA  . ILE A 1 223 ? 10.637  67.358 47.738 1.00 22.34 ? 223 ILE A CA  1 
ATOM   1682 C C   . ILE A 1 223 ? 10.129  66.704 49.023 1.00 22.41 ? 223 ILE A C   1 
ATOM   1683 O O   . ILE A 1 223 ? 8.964   66.911 49.354 1.00 24.61 ? 223 ILE A O   1 
ATOM   1684 C CB  . ILE A 1 223 ? 10.496  68.889 47.899 1.00 22.57 ? 223 ILE A CB  1 
ATOM   1685 C CG1 . ILE A 1 223 ? 10.739  69.678 46.597 1.00 24.71 ? 223 ILE A CG1 1 
ATOM   1686 C CG2 . ILE A 1 223 ? 11.371  69.453 49.012 1.00 15.36 ? 223 ILE A CG2 1 
ATOM   1687 C CD1 . ILE A 1 223 ? 10.329  71.151 46.707 1.00 9.50  ? 223 ILE A CD1 1 
ATOM   1688 N N   . LEU A 1 224 ? 10.970  65.950 49.741 1.00 20.10 ? 224 LEU A N   1 
ATOM   1689 C CA  . LEU A 1 224 ? 10.536  65.276 50.983 1.00 16.68 ? 224 LEU A CA  1 
ATOM   1690 C C   . LEU A 1 224 ? 11.253  65.963 52.175 1.00 16.05 ? 224 LEU A C   1 
ATOM   1691 O O   . LEU A 1 224 ? 12.476  66.091 52.172 1.00 16.00 ? 224 LEU A O   1 
ATOM   1692 C CB  . LEU A 1 224 ? 10.949  63.763 50.974 1.00 14.06 ? 224 LEU A CB  1 
ATOM   1693 C CG  . LEU A 1 224 ? 10.357  62.837 49.899 1.00 2.88  ? 224 LEU A CG  1 
ATOM   1694 C CD1 . LEU A 1 224 ? 11.041  63.103 48.571 1.00 2.00  ? 224 LEU A CD1 1 
ATOM   1695 C CD2 . LEU A 1 224 ? 10.556  61.365 50.242 1.00 2.00  ? 224 LEU A CD2 1 
ATOM   1696 N N   . GLN A 1 225 ? 10.523  66.415 53.206 1.00 14.00 ? 225 GLN A N   1 
ATOM   1697 C CA  . GLN A 1 225 ? 11.168  67.078 54.350 1.00 15.39 ? 225 GLN A CA  1 
ATOM   1698 C C   . GLN A 1 225 ? 10.959  66.268 55.653 1.00 17.01 ? 225 GLN A C   1 
ATOM   1699 O O   . GLN A 1 225 ? 9.855   66.188 56.170 1.00 22.50 ? 225 GLN A O   1 
ATOM   1700 C CB  . GLN A 1 225 ? 10.589  68.492 54.457 1.00 10.12 ? 225 GLN A CB  1 
ATOM   1701 C CG  . GLN A 1 225 ? 10.688  69.288 53.163 1.00 11.63 ? 225 GLN A CG  1 
ATOM   1702 C CD  . GLN A 1 225 ? 10.106  70.666 53.307 1.00 10.48 ? 225 GLN A CD  1 
ATOM   1703 O OE1 . GLN A 1 225 ? 9.469   71.016 54.277 1.00 20.47 ? 225 GLN A OE1 1 
ATOM   1704 N NE2 . GLN A 1 225 ? 10.355  71.482 52.327 1.00 9.85  ? 225 GLN A NE2 1 
ATOM   1705 N N   . SER A 1 226 ? 12.023  65.658 56.185 1.00 16.51 ? 226 SER A N   1 
ATOM   1706 C CA  . SER A 1 226 ? 11.932  64.837 57.383 1.00 8.06  ? 226 SER A CA  1 
ATOM   1707 C C   . SER A 1 226 ? 10.941  63.679 57.207 1.00 11.12 ? 226 SER A C   1 
ATOM   1708 O O   . SER A 1 226 ? 10.075  63.476 58.045 1.00 13.99 ? 226 SER A O   1 
ATOM   1709 C CB  . SER A 1 226 ? 11.495  65.693 58.553 1.00 5.88  ? 226 SER A CB  1 
ATOM   1710 O OG  . SER A 1 226 ? 11.979  67.031 58.529 1.00 10.99 ? 226 SER A OG  1 
ATOM   1711 N N   . GLY A 1 227 ? 11.027  62.921 56.112 1.00 10.34 ? 227 GLY A N   1 
ATOM   1712 C CA  . GLY A 1 227 ? 10.070  61.837 55.955 1.00 6.40  ? 227 GLY A CA  1 
ATOM   1713 C C   . GLY A 1 227 ? 10.504  60.968 54.790 1.00 8.31  ? 227 GLY A C   1 
ATOM   1714 O O   . GLY A 1 227 ? 11.196  61.423 53.880 1.00 6.36  ? 227 GLY A O   1 
ATOM   1715 N N   . SER A 1 228 ? 10.156  59.687 54.856 1.00 3.28  ? 228 SER A N   1 
ATOM   1716 C CA  . SER A 1 228 ? 10.485  58.765 53.769 1.00 9.13  ? 228 SER A CA  1 
ATOM   1717 C C   . SER A 1 228 ? 9.353   57.853 53.790 1.00 10.19 ? 228 SER A C   1 
ATOM   1718 O O   . SER A 1 228 ? 8.684   57.915 54.795 1.00 19.07 ? 228 SER A O   1 
ATOM   1719 C CB  . SER A 1 228 ? 11.765  57.978 53.957 1.00 11.14 ? 228 SER A CB  1 
ATOM   1720 O OG  . SER A 1 228 ? 12.775  58.938 54.162 1.00 24.37 ? 228 SER A OG  1 
ATOM   1721 N N   . PRO A 1 229 ? 9.044   57.052 52.762 1.00 11.72 ? 229 PRO A N   1 
ATOM   1722 C CA  . PRO A 1 229 ? 7.853   56.219 52.866 1.00 11.75 ? 229 PRO A CA  1 
ATOM   1723 C C   . PRO A 1 229 ? 8.094   55.086 53.805 1.00 10.29 ? 229 PRO A C   1 
ATOM   1724 O O   . PRO A 1 229 ? 7.195   54.498 54.373 1.00 12.62 ? 229 PRO A O   1 
ATOM   1725 C CB  . PRO A 1 229 ? 7.645   55.680 51.433 1.00 17.36 ? 229 PRO A CB  1 
ATOM   1726 C CG  . PRO A 1 229 ? 8.919   55.995 50.601 1.00 17.67 ? 229 PRO A CG  1 
ATOM   1727 C CD  . PRO A 1 229 ? 9.761   56.953 51.478 1.00 15.94 ? 229 PRO A CD  1 
ATOM   1728 N N   . ASN A 1 230 ? 9.384   54.804 53.935 1.00 8.40  ? 230 ASN A N   1 
ATOM   1729 C CA  . ASN A 1 230 ? 9.907   53.739 54.758 1.00 14.20 ? 230 ASN A CA  1 
ATOM   1730 C C   . ASN A 1 230 ? 10.279  54.162 56.197 1.00 17.73 ? 230 ASN A C   1 
ATOM   1731 O O   . ASN A 1 230 ? 11.189  53.582 56.784 1.00 23.04 ? 230 ASN A O   1 
ATOM   1732 C CB  . ASN A 1 230 ? 11.168  53.127 54.058 1.00 10.60 ? 230 ASN A CB  1 
ATOM   1733 C CG  . ASN A 1 230 ? 12.323  54.119 53.996 1.00 10.10 ? 230 ASN A CG  1 
ATOM   1734 O OD1 . ASN A 1 230 ? 12.155  55.268 53.640 1.00 6.24  ? 230 ASN A OD1 1 
ATOM   1735 N ND2 . ASN A 1 230 ? 13.504  53.688 54.389 1.00 14.72 ? 230 ASN A ND2 1 
ATOM   1736 N N   . CYS A 1 231 ? 9.658   55.194 56.777 1.00 16.77 ? 231 CYS A N   1 
ATOM   1737 C CA  . CYS A 1 231 ? 10.034  55.526 58.167 1.00 16.95 ? 231 CYS A CA  1 
ATOM   1738 C C   . CYS A 1 231 ? 9.142   54.654 59.055 1.00 17.22 ? 231 CYS A C   1 
ATOM   1739 O O   . CYS A 1 231 ? 7.955   54.591 58.776 1.00 15.68 ? 231 CYS A O   1 
ATOM   1740 C CB  . CYS A 1 231 ? 9.766   56.985 58.530 1.00 17.04 ? 231 CYS A CB  1 
ATOM   1741 S SG  . CYS A 1 231 ? 10.909  58.150 57.748 1.00 27.64 ? 231 CYS A SG  1 
ATOM   1742 N N   . PRO A 1 232 ? 9.692   54.010 60.126 1.00 11.88 ? 232 PRO A N   1 
ATOM   1743 C CA  . PRO A 1 232 ? 9.006   52.994 60.882 1.00 8.47  ? 232 PRO A CA  1 
ATOM   1744 C C   . PRO A 1 232 ? 7.601   53.268 61.227 1.00 10.59 ? 232 PRO A C   1 
ATOM   1745 O O   . PRO A 1 232 ? 6.755   52.405 61.294 1.00 12.04 ? 232 PRO A O   1 
ATOM   1746 C CB  . PRO A 1 232 ? 9.768   52.935 62.196 1.00 2.01  ? 232 PRO A CB  1 
ATOM   1747 C CG  . PRO A 1 232 ? 11.145  53.443 61.879 1.00 5.76  ? 232 PRO A CG  1 
ATOM   1748 C CD  . PRO A 1 232 ? 11.000  54.310 60.652 1.00 10.04 ? 232 PRO A CD  1 
ATOM   1749 N N   . TRP A 1 233 ? 7.384   54.536 61.495 1.00 17.11 ? 233 TRP A N   1 
ATOM   1750 C CA  . TRP A 1 233 ? 6.061   54.965 61.916 1.00 18.99 ? 233 TRP A CA  1 
ATOM   1751 C C   . TRP A 1 233 ? 5.030   55.147 60.829 1.00 22.30 ? 233 TRP A C   1 
ATOM   1752 O O   . TRP A 1 233 ? 3.853   55.221 61.158 1.00 29.79 ? 233 TRP A O   1 
ATOM   1753 C CB  . TRP A 1 233 ? 6.159   56.302 62.668 1.00 12.45 ? 233 TRP A CB  1 
ATOM   1754 C CG  . TRP A 1 233 ? 7.043   57.294 61.944 1.00 10.40 ? 233 TRP A CG  1 
ATOM   1755 C CD1 . TRP A 1 233 ? 8.447   57.421 62.120 1.00 9.61  ? 233 TRP A CD1 1 
ATOM   1756 C CD2 . TRP A 1 233 ? 6.634   58.259 60.999 1.00 4.74  ? 233 TRP A CD2 1 
ATOM   1757 N NE1 . TRP A 1 233 ? 8.903   58.431 61.322 1.00 8.58  ? 233 TRP A NE1 1 
ATOM   1758 C CE2 . TRP A 1 233 ? 7.851   58.979 60.623 1.00 2.00  ? 233 TRP A CE2 1 
ATOM   1759 C CE3 . TRP A 1 233 ? 5.414   58.581 60.430 1.00 2.00  ? 233 TRP A CE3 1 
ATOM   1760 C CZ2 . TRP A 1 233 ? 7.768   59.982 59.702 1.00 2.00  ? 233 TRP A CZ2 1 
ATOM   1761 C CZ3 . TRP A 1 233 ? 5.359   59.595 59.495 1.00 2.00  ? 233 TRP A CZ3 1 
ATOM   1762 C CH2 . TRP A 1 233 ? 6.523   60.277 59.153 1.00 4.80  ? 233 TRP A CH2 1 
ATOM   1763 N N   . ALA A 1 234 ? 5.455   55.244 59.562 1.00 16.32 ? 234 ALA A N   1 
ATOM   1764 C CA  . ALA A 1 234 ? 4.501   55.487 58.512 1.00 10.41 ? 234 ALA A CA  1 
ATOM   1765 C C   . ALA A 1 234 ? 3.851   54.269 57.921 1.00 8.54  ? 234 ALA A C   1 
ATOM   1766 O O   . ALA A 1 234 ? 3.136   54.428 56.954 1.00 12.83 ? 234 ALA A O   1 
ATOM   1767 C CB  . ALA A 1 234 ? 5.143   56.330 57.440 1.00 7.79  ? 234 ALA A CB  1 
ATOM   1768 N N   . SER A 1 235 ? 4.062   53.051 58.373 1.00 10.25 ? 235 SER A N   1 
ATOM   1769 C CA  . SER A 1 235 ? 3.272   52.026 57.667 1.00 13.52 ? 235 SER A CA  1 
ATOM   1770 C C   . SER A 1 235 ? 2.966   50.846 58.568 1.00 11.39 ? 235 SER A C   1 
ATOM   1771 O O   . SER A 1 235 ? 3.768   50.576 59.440 1.00 13.69 ? 235 SER A O   1 
ATOM   1772 C CB  . SER A 1 235 ? 3.959   51.605 56.334 1.00 15.57 ? 235 SER A CB  1 
ATOM   1773 O OG  . SER A 1 235 ? 5.392   51.785 56.371 1.00 23.01 ? 235 SER A OG  1 
ATOM   1774 N N   . VAL A 1 236 ? 1.809   50.204 58.434 1.00 8.86  ? 236 VAL A N   1 
ATOM   1775 C CA  . VAL A 1 236 ? 1.605   49.005 59.229 1.00 8.60  ? 236 VAL A CA  1 
ATOM   1776 C C   . VAL A 1 236 ? 1.331   47.890 58.261 1.00 14.33 ? 236 VAL A C   1 
ATOM   1777 O O   . VAL A 1 236 ? 1.013   48.052 57.102 1.00 24.04 ? 236 VAL A O   1 
ATOM   1778 C CB  . VAL A 1 236 ? 0.361   49.041 60.094 1.00 3.17  ? 236 VAL A CB  1 
ATOM   1779 C CG1 . VAL A 1 236 ? 0.440   50.170 61.098 1.00 2.72  ? 236 VAL A CG1 1 
ATOM   1780 C CG2 . VAL A 1 236 ? -0.960  49.116 59.323 1.00 5.68  ? 236 VAL A CG2 1 
ATOM   1781 N N   . SER A 1 237 ? 1.383   46.691 58.748 1.00 17.94 ? 237 SER A N   1 
ATOM   1782 C CA  . SER A 1 237 ? 1.036   45.601 57.867 1.00 18.16 ? 237 SER A CA  1 
ATOM   1783 C C   . SER A 1 237 ? -0.469  45.540 57.875 1.00 20.79 ? 237 SER A C   1 
ATOM   1784 O O   . SER A 1 237 ? -1.169  46.177 58.658 1.00 21.83 ? 237 SER A O   1 
ATOM   1785 C CB  . SER A 1 237 ? 1.549   44.295 58.453 1.00 22.13 ? 237 SER A CB  1 
ATOM   1786 O OG  . SER A 1 237 ? 1.228   44.294 59.844 1.00 28.14 ? 237 SER A OG  1 
ATOM   1787 N N   . VAL A 1 238 ? -0.940  44.649 57.027 1.00 23.48 ? 238 VAL A N   1 
ATOM   1788 C CA  . VAL A 1 238 ? -2.362  44.473 56.895 1.00 24.21 ? 238 VAL A CA  1 
ATOM   1789 C C   . VAL A 1 238 ? -3.002  43.984 58.131 1.00 26.91 ? 238 VAL A C   1 
ATOM   1790 O O   . VAL A 1 238 ? -4.086  44.362 58.557 1.00 29.46 ? 238 VAL A O   1 
ATOM   1791 C CB  . VAL A 1 238 ? -2.534  43.509 55.758 1.00 20.38 ? 238 VAL A CB  1 
ATOM   1792 C CG1 . VAL A 1 238 ? -4.001  43.235 55.521 1.00 21.06 ? 238 VAL A CG1 1 
ATOM   1793 C CG2 . VAL A 1 238 ? -1.893  44.133 54.506 1.00 26.16 ? 238 VAL A CG2 1 
ATOM   1794 N N   . ALA A 1 239 ? -2.239  43.079 58.691 1.00 27.13 ? 239 ALA A N   1 
ATOM   1795 C CA  . ALA A 1 239 ? -2.643  42.460 59.911 1.00 25.50 ? 239 ALA A CA  1 
ATOM   1796 C C   . ALA A 1 239 ? -2.830  43.492 61.011 1.00 24.86 ? 239 ALA A C   1 
ATOM   1797 O O   . ALA A 1 239 ? -3.885  43.648 61.602 1.00 24.86 ? 239 ALA A O   1 
ATOM   1798 C CB  . ALA A 1 239 ? -1.503  41.508 60.307 1.00 26.16 ? 239 ALA A CB  1 
ATOM   1799 N N   . GLU A 1 240 ? -1.728  44.217 61.253 1.00 22.64 ? 240 GLU A N   1 
ATOM   1800 C CA  . GLU A 1 240 ? -1.710  45.209 62.291 1.00 20.15 ? 240 GLU A CA  1 
ATOM   1801 C C   . GLU A 1 240 ? -2.817  46.211 62.076 1.00 18.86 ? 240 GLU A C   1 
ATOM   1802 O O   . GLU A 1 240 ? -3.375  46.728 63.028 1.00 16.44 ? 240 GLU A O   1 
ATOM   1803 C CB  . GLU A 1 240 ? -0.345  45.848 62.387 1.00 22.18 ? 240 GLU A CB  1 
ATOM   1804 C CG  . GLU A 1 240 ? -0.274  46.956 63.445 1.00 31.94 ? 240 GLU A CG  1 
ATOM   1805 C CD  . GLU A 1 240 ? -0.193  46.320 64.800 1.00 37.69 ? 240 GLU A CD  1 
ATOM   1806 O OE1 . GLU A 1 240 ? 0.727   45.545 65.037 1.00 42.07 ? 240 GLU A OE1 1 
ATOM   1807 O OE2 . GLU A 1 240 ? -1.074  46.575 65.609 1.00 45.76 ? 240 GLU A OE2 1 
ATOM   1808 N N   . GLY A 1 241 ? -3.124  46.502 60.826 1.00 17.35 ? 241 GLY A N   1 
ATOM   1809 C CA  . GLY A 1 241 ? -4.229  47.434 60.654 1.00 21.50 ? 241 GLY A CA  1 
ATOM   1810 C C   . GLY A 1 241 ? -5.621  46.867 61.061 1.00 22.93 ? 241 GLY A C   1 
ATOM   1811 O O   . GLY A 1 241 ? -6.572  47.598 61.417 1.00 18.27 ? 241 GLY A O   1 
ATOM   1812 N N   . ARG A 1 242 ? -5.698  45.519 60.966 1.00 23.48 ? 242 ARG A N   1 
ATOM   1813 C CA  . ARG A 1 242 ? -6.923  44.817 61.325 1.00 26.54 ? 242 ARG A CA  1 
ATOM   1814 C C   . ARG A 1 242 ? -7.026  44.900 62.829 1.00 24.51 ? 242 ARG A C   1 
ATOM   1815 O O   . ARG A 1 242 ? -7.985  45.373 63.435 1.00 22.54 ? 242 ARG A O   1 
ATOM   1816 C CB  . ARG A 1 242 ? -6.866  43.342 60.834 1.00 30.81 ? 242 ARG A CB  1 
ATOM   1817 C CG  . ARG A 1 242 ? -8.030  42.423 61.286 1.00 40.10 ? 242 ARG A CG  1 
ATOM   1818 C CD  . ARG A 1 242 ? -8.610  41.549 60.148 1.00 41.23 ? 242 ARG A CD  1 
ATOM   1819 N NE  . ARG A 1 242 ? -9.416  42.396 59.283 1.00 49.27 ? 242 ARG A NE  1 
ATOM   1820 C CZ  . ARG A 1 242 ? -10.264 41.931 58.356 1.00 54.86 ? 242 ARG A CZ  1 
ATOM   1821 N NH1 . ARG A 1 242 ? -10.316 40.632 58.057 1.00 63.59 ? 242 ARG A NH1 1 
ATOM   1822 N NH2 . ARG A 1 242 ? -11.069 42.782 57.717 1.00 58.21 ? 242 ARG A NH2 1 
ATOM   1823 N N   . ARG A 1 243 ? -5.904  44.433 63.391 1.00 22.12 ? 243 ARG A N   1 
ATOM   1824 C CA  . ARG A 1 243 ? -5.652  44.370 64.797 1.00 17.94 ? 243 ARG A CA  1 
ATOM   1825 C C   . ARG A 1 243 ? -6.087  45.677 65.481 1.00 13.68 ? 243 ARG A C   1 
ATOM   1826 O O   . ARG A 1 243 ? -6.879  45.723 66.416 1.00 9.72  ? 243 ARG A O   1 
ATOM   1827 C CB  . ARG A 1 243 ? -4.174  44.063 64.960 1.00 21.64 ? 243 ARG A CB  1 
ATOM   1828 C CG  . ARG A 1 243 ? -3.840  43.413 66.296 1.00 40.23 ? 243 ARG A CG  1 
ATOM   1829 C CD  . ARG A 1 243 ? -3.927  44.347 67.543 1.00 50.67 ? 243 ARG A CD  1 
ATOM   1830 N NE  . ARG A 1 243 ? -2.877  45.376 67.566 1.00 50.82 ? 243 ARG A NE  1 
ATOM   1831 C CZ  . ARG A 1 243 ? -2.948  46.466 68.375 1.00 52.30 ? 243 ARG A CZ  1 
ATOM   1832 N NH1 . ARG A 1 243 ? -3.935  46.652 69.270 1.00 49.88 ? 243 ARG A NH1 1 
ATOM   1833 N NH2 . ARG A 1 243 ? -1.998  47.390 68.263 1.00 53.33 ? 243 ARG A NH2 1 
ATOM   1834 N N   . ARG A 1 244 ? -5.547  46.768 64.967 1.00 12.23 ? 244 ARG A N   1 
ATOM   1835 C CA  . ARG A 1 244 ? -5.913  48.049 65.541 1.00 9.62  ? 244 ARG A CA  1 
ATOM   1836 C C   . ARG A 1 244 ? -7.389  48.376 65.328 1.00 11.54 ? 244 ARG A C   1 
ATOM   1837 O O   . ARG A 1 244 ? -7.928  49.075 66.168 1.00 14.12 ? 244 ARG A O   1 
ATOM   1838 C CB  . ARG A 1 244 ? -5.002  49.212 65.097 1.00 2.00  ? 244 ARG A CB  1 
ATOM   1839 C CG  . ARG A 1 244 ? -3.552  48.856 65.363 1.00 2.00  ? 244 ARG A CG  1 
ATOM   1840 C CD  . ARG A 1 244 ? -2.587  49.942 64.974 1.00 2.00  ? 244 ARG A CD  1 
ATOM   1841 N NE  . ARG A 1 244 ? -1.292  49.420 65.287 1.00 2.00  ? 244 ARG A NE  1 
ATOM   1842 C CZ  . ARG A 1 244 ? -0.189  50.145 65.139 1.00 5.80  ? 244 ARG A CZ  1 
ATOM   1843 N NH1 . ARG A 1 244 ? -0.206  51.444 64.856 1.00 2.00  ? 244 ARG A NH1 1 
ATOM   1844 N NH2 . ARG A 1 244 ? 0.977   49.530 65.268 1.00 4.07  ? 244 ARG A NH2 1 
ATOM   1845 N N   . ALA A 1 245 ? -8.051  47.907 64.255 1.00 11.59 ? 245 ALA A N   1 
ATOM   1846 C CA  . ALA A 1 245 ? -9.453  48.294 64.135 1.00 11.81 ? 245 ALA A CA  1 
ATOM   1847 C C   . ALA A 1 245 ? -10.332 47.408 64.979 1.00 16.93 ? 245 ALA A C   1 
ATOM   1848 O O   . ALA A 1 245 ? -11.471 47.779 65.194 1.00 19.78 ? 245 ALA A O   1 
ATOM   1849 C CB  . ALA A 1 245 ? -9.918  48.824 62.791 1.00 11.63 ? 245 ALA A CB  1 
ATOM   1850 N N   . VAL A 1 246 ? -9.899  46.228 65.450 1.00 20.19 ? 246 VAL A N   1 
ATOM   1851 C CA  . VAL A 1 246 ? -10.842 45.561 66.406 1.00 21.17 ? 246 VAL A CA  1 
ATOM   1852 C C   . VAL A 1 246 ? -10.588 46.204 67.762 1.00 19.95 ? 246 VAL A C   1 
ATOM   1853 O O   . VAL A 1 246 ? -11.460 46.434 68.577 1.00 21.82 ? 246 VAL A O   1 
ATOM   1854 C CB  . VAL A 1 246 ? -10.653 44.063 66.516 1.00 23.73 ? 246 VAL A CB  1 
ATOM   1855 C CG1 . VAL A 1 246 ? -11.583 43.389 65.518 1.00 32.94 ? 246 VAL A CG1 1 
ATOM   1856 C CG2 . VAL A 1 246 ? -9.198  43.645 66.290 1.00 27.27 ? 246 VAL A CG2 1 
ATOM   1857 N N   . GLU A 1 247 ? -9.335  46.550 68.008 1.00 18.30 ? 247 GLU A N   1 
ATOM   1858 C CA  . GLU A 1 247 ? -9.037  47.196 69.265 1.00 18.68 ? 247 GLU A CA  1 
ATOM   1859 C C   . GLU A 1 247 ? -9.751  48.478 69.425 1.00 15.71 ? 247 GLU A C   1 
ATOM   1860 O O   . GLU A 1 247 ? -10.239 48.816 70.489 1.00 21.31 ? 247 GLU A O   1 
ATOM   1861 C CB  . GLU A 1 247 ? -7.528  47.461 69.452 1.00 23.32 ? 247 GLU A CB  1 
ATOM   1862 C CG  . GLU A 1 247 ? -7.121  47.313 70.921 1.00 31.01 ? 247 GLU A CG  1 
ATOM   1863 C CD  . GLU A 1 247 ? -7.706  46.001 71.476 1.00 36.42 ? 247 GLU A CD  1 
ATOM   1864 O OE1 . GLU A 1 247 ? -7.631  44.993 70.763 1.00 35.93 ? 247 GLU A OE1 1 
ATOM   1865 O OE2 . GLU A 1 247 ? -8.260  46.009 72.588 1.00 38.84 ? 247 GLU A OE2 1 
ATOM   1866 N N   . LEU A 1 248 ? -9.833  49.211 68.348 1.00 11.26 ? 248 LEU A N   1 
ATOM   1867 C CA  . LEU A 1 248 ? -10.596 50.431 68.480 1.00 9.56  ? 248 LEU A CA  1 
ATOM   1868 C C   . LEU A 1 248 ? -12.053 49.986 68.576 1.00 8.24  ? 248 LEU A C   1 
ATOM   1869 O O   . LEU A 1 248 ? -12.933 50.562 69.195 1.00 10.36 ? 248 LEU A O   1 
ATOM   1870 C CB  . LEU A 1 248 ? -10.252 51.441 67.348 1.00 3.55  ? 248 LEU A CB  1 
ATOM   1871 C CG  . LEU A 1 248 ? -11.260 52.596 67.133 1.00 13.52 ? 248 LEU A CG  1 
ATOM   1872 C CD1 . LEU A 1 248 ? -10.697 54.036 67.223 1.00 8.26  ? 248 LEU A CD1 1 
ATOM   1873 C CD2 . LEU A 1 248 ? -11.975 52.389 65.779 1.00 10.57 ? 248 LEU A CD2 1 
ATOM   1874 N N   . GLY A 1 249 ? -12.324 48.850 67.997 1.00 10.93 ? 249 GLY A N   1 
ATOM   1875 C CA  . GLY A 1 249 ? -13.707 48.418 68.014 1.00 12.79 ? 249 GLY A CA  1 
ATOM   1876 C C   . GLY A 1 249 ? -14.188 48.211 69.381 1.00 15.86 ? 249 GLY A C   1 
ATOM   1877 O O   . GLY A 1 249 ? -15.342 48.489 69.711 1.00 10.77 ? 249 GLY A O   1 
ATOM   1878 N N   . ARG A 1 250 ? -13.223 47.719 70.169 1.00 19.56 ? 250 ARG A N   1 
ATOM   1879 C CA  . ARG A 1 250 ? -13.508 47.445 71.561 1.00 25.94 ? 250 ARG A CA  1 
ATOM   1880 C C   . ARG A 1 250 ? -13.589 48.727 72.352 1.00 27.88 ? 250 ARG A C   1 
ATOM   1881 O O   . ARG A 1 250 ? -14.481 48.903 73.164 1.00 30.98 ? 250 ARG A O   1 
ATOM   1882 C CB  . ARG A 1 250 ? -12.489 46.530 72.225 1.00 22.70 ? 250 ARG A CB  1 
ATOM   1883 C CG  . ARG A 1 250 ? -12.393 45.175 71.554 1.00 20.84 ? 250 ARG A CG  1 
ATOM   1884 C CD  . ARG A 1 250 ? -11.639 44.198 72.459 1.00 29.85 ? 250 ARG A CD  1 
ATOM   1885 N NE  . ARG A 1 250 ? -10.420 43.766 71.812 1.00 40.47 ? 250 ARG A NE  1 
ATOM   1886 C CZ  . ARG A 1 250 ? -10.424 42.806 70.872 1.00 46.77 ? 250 ARG A CZ  1 
ATOM   1887 N NH1 . ARG A 1 250 ? -11.548 42.114 70.617 1.00 50.29 ? 250 ARG A NH1 1 
ATOM   1888 N NH2 . ARG A 1 250 ? -9.292  42.544 70.196 1.00 45.60 ? 250 ARG A NH2 1 
ATOM   1889 N N   . ASN A 1 251 ? -12.684 49.663 72.106 1.00 28.63 ? 251 ASN A N   1 
ATOM   1890 C CA  . ASN A 1 251 ? -12.836 50.884 72.933 1.00 30.55 ? 251 ASN A CA  1 
ATOM   1891 C C   . ASN A 1 251 ? -14.191 51.586 72.670 1.00 26.76 ? 251 ASN A C   1 
ATOM   1892 O O   . ASN A 1 251 ? -14.507 52.522 73.367 1.00 30.26 ? 251 ASN A O   1 
ATOM   1893 C CB  . ASN A 1 251 ? -11.645 51.886 72.898 1.00 30.06 ? 251 ASN A CB  1 
ATOM   1894 C CG  . ASN A 1 251 ? -10.329 51.501 73.620 1.00 39.19 ? 251 ASN A CG  1 
ATOM   1895 O OD1 . ASN A 1 251 ? -9.708  52.296 74.331 1.00 42.17 ? 251 ASN A OD1 1 
ATOM   1896 N ND2 . ASN A 1 251 ? -9.848  50.271 73.396 1.00 38.14 ? 251 ASN A ND2 1 
ATOM   1897 N N   . LEU A 1 252 ? -14.979 51.188 71.671 1.00 23.61 ? 252 LEU A N   1 
ATOM   1898 C CA  . LEU A 1 252 ? -16.261 51.871 71.469 1.00 26.17 ? 252 LEU A CA  1 
ATOM   1899 C C   . LEU A 1 252 ? -17.386 50.901 71.770 1.00 28.36 ? 252 LEU A C   1 
ATOM   1900 O O   . LEU A 1 252 ? -18.582 51.150 71.760 1.00 19.81 ? 252 LEU A O   1 
ATOM   1901 C CB  . LEU A 1 252 ? -16.265 52.644 70.156 1.00 26.03 ? 252 LEU A CB  1 
ATOM   1902 C CG  . LEU A 1 252 ? -15.135 53.711 70.138 1.00 30.69 ? 252 LEU A CG  1 
ATOM   1903 C CD1 . LEU A 1 252 ? -14.780 54.204 68.731 1.00 36.83 ? 252 LEU A CD1 1 
ATOM   1904 C CD2 . LEU A 1 252 ? -15.487 54.931 70.986 1.00 33.06 ? 252 LEU A CD2 1 
ATOM   1905 N N   . ASN A 1 253 ? -16.933 49.708 72.107 1.00 34.59 ? 253 ASN A N   1 
ATOM   1906 C CA  . ASN A 1 253 ? -17.846 48.685 72.509 1.00 41.17 ? 253 ASN A CA  1 
ATOM   1907 C C   . ASN A 1 253 ? -18.714 48.254 71.413 1.00 40.26 ? 253 ASN A C   1 
ATOM   1908 O O   . ASN A 1 253 ? -19.926 48.101 71.525 1.00 40.33 ? 253 ASN A O   1 
ATOM   1909 C CB  . ASN A 1 253 ? -18.700 49.186 73.685 1.00 53.07 ? 253 ASN A CB  1 
ATOM   1910 C CG  . ASN A 1 253 ? -18.845 48.081 74.697 1.00 62.34 ? 253 ASN A CG  1 
ATOM   1911 O OD1 . ASN A 1 253 ? -17.926 47.303 74.957 1.00 64.08 ? 253 ASN A OD1 1 
ATOM   1912 N ND2 . ASN A 1 253 ? -20.048 48.038 75.279 1.00 68.49 ? 253 ASN A ND2 1 
ATOM   1913 N N   . CYS A 1 254 ? -18.014 48.080 70.302 1.00 38.36 ? 254 CYS A N   1 
ATOM   1914 C CA  . CYS A 1 254 ? -18.689 47.678 69.086 1.00 37.96 ? 254 CYS A CA  1 
ATOM   1915 C C   . CYS A 1 254 ? -18.887 46.197 68.995 1.00 41.34 ? 254 CYS A C   1 
ATOM   1916 O O   . CYS A 1 254 ? -18.319 45.376 69.704 1.00 45.20 ? 254 CYS A O   1 
ATOM   1917 C CB  . CYS A 1 254 ? -17.869 48.081 67.869 1.00 29.02 ? 254 CYS A CB  1 
ATOM   1918 S SG  . CYS A 1 254 ? -18.053 49.833 67.549 1.00 20.97 ? 254 CYS A SG  1 
ATOM   1919 N N   . ASN A 1 255 ? -19.726 45.857 68.016 1.00 43.79 ? 255 ASN A N   1 
ATOM   1920 C CA  . ASN A 1 255 ? -19.972 44.461 67.790 1.00 44.83 ? 255 ASN A CA  1 
ATOM   1921 C C   . ASN A 1 255 ? -18.820 44.014 66.953 1.00 42.87 ? 255 ASN A C   1 
ATOM   1922 O O   . ASN A 1 255 ? -18.581 44.542 65.885 1.00 42.03 ? 255 ASN A O   1 
ATOM   1923 C CB  . ASN A 1 255 ? -21.287 44.253 67.061 1.00 49.24 ? 255 ASN A CB  1 
ATOM   1924 C CG  . ASN A 1 255 ? -21.509 42.768 67.163 1.00 55.80 ? 255 ASN A CG  1 
ATOM   1925 O OD1 . ASN A 1 255 ? -20.743 41.968 66.651 1.00 58.87 ? 255 ASN A OD1 1 
ATOM   1926 N ND2 . ASN A 1 255 ? -22.547 42.402 67.903 1.00 61.52 ? 255 ASN A ND2 1 
ATOM   1927 N N   . LEU A 1 256 ? -18.105 43.056 67.471 1.00 44.42 ? 256 LEU A N   1 
ATOM   1928 C CA  . LEU A 1 256 ? -16.925 42.585 66.788 1.00 44.94 ? 256 LEU A CA  1 
ATOM   1929 C C   . LEU A 1 256 ? -17.121 41.259 66.112 1.00 45.60 ? 256 LEU A C   1 
ATOM   1930 O O   . LEU A 1 256 ? -16.158 40.573 65.834 1.00 49.17 ? 256 LEU A O   1 
ATOM   1931 C CB  . LEU A 1 256 ? -15.784 42.482 67.843 1.00 41.10 ? 256 LEU A CB  1 
ATOM   1932 C CG  . LEU A 1 256 ? -14.894 43.738 67.887 1.00 41.31 ? 256 LEU A CG  1 
ATOM   1933 C CD1 . LEU A 1 256 ? -15.559 44.857 68.678 1.00 38.97 ? 256 LEU A CD1 1 
ATOM   1934 C CD2 . LEU A 1 256 ? -13.491 43.454 68.438 1.00 41.46 ? 256 LEU A CD2 1 
ATOM   1935 N N   . ASN A 1 257 ? -18.344 40.836 65.860 1.00 46.55 ? 257 ASN A N   1 
ATOM   1936 C CA  . ASN A 1 257 ? -18.460 39.537 65.213 1.00 46.24 ? 257 ASN A CA  1 
ATOM   1937 C C   . ASN A 1 257 ? -18.337 39.777 63.740 1.00 46.56 ? 257 ASN A C   1 
ATOM   1938 O O   . ASN A 1 257 ? -17.332 39.654 63.047 1.00 46.36 ? 257 ASN A O   1 
ATOM   1939 C CB  . ASN A 1 257 ? -19.813 38.882 65.522 1.00 45.80 ? 257 ASN A CB  1 
ATOM   1940 N N   . SER A 1 258 ? -19.477 40.195 63.224 1.00 46.80 ? 258 SER A N   1 
ATOM   1941 C CA  . SER A 1 258 ? -19.528 40.438 61.816 1.00 47.85 ? 258 SER A CA  1 
ATOM   1942 C C   . SER A 1 258 ? -18.747 41.692 61.487 1.00 44.72 ? 258 SER A C   1 
ATOM   1943 O O   . SER A 1 258 ? -19.175 42.782 61.811 1.00 45.91 ? 258 SER A O   1 
ATOM   1944 C CB  . SER A 1 258 ? -21.017 40.483 61.394 1.00 52.31 ? 258 SER A CB  1 
ATOM   1945 O OG  . SER A 1 258 ? -21.816 39.530 62.128 1.00 56.38 ? 258 SER A OG  1 
ATOM   1946 N N   . ASP A 1 259 ? -17.606 41.530 60.826 1.00 40.40 ? 259 ASP A N   1 
ATOM   1947 C CA  . ASP A 1 259 ? -16.734 42.632 60.425 1.00 38.08 ? 259 ASP A CA  1 
ATOM   1948 C C   . ASP A 1 259 ? -17.468 43.888 59.868 1.00 36.80 ? 259 ASP A C   1 
ATOM   1949 O O   . ASP A 1 259 ? -17.096 45.029 60.039 1.00 32.10 ? 259 ASP A O   1 
ATOM   1950 C CB  . ASP A 1 259 ? -15.783 42.018 59.403 1.00 40.89 ? 259 ASP A CB  1 
ATOM   1951 C CG  . ASP A 1 259 ? -14.713 42.976 58.946 1.00 49.39 ? 259 ASP A CG  1 
ATOM   1952 O OD1 . ASP A 1 259 ? -15.072 44.030 58.419 1.00 52.08 ? 259 ASP A OD1 1 
ATOM   1953 O OD2 . ASP A 1 259 ? -13.526 42.666 59.114 1.00 52.38 ? 259 ASP A OD2 1 
ATOM   1954 N N   . GLU A 1 260 ? -18.575 43.648 59.150 1.00 38.12 ? 260 GLU A N   1 
ATOM   1955 C CA  . GLU A 1 260 ? -19.452 44.659 58.553 1.00 34.19 ? 260 GLU A CA  1 
ATOM   1956 C C   . GLU A 1 260 ? -20.111 45.552 59.638 1.00 34.31 ? 260 GLU A C   1 
ATOM   1957 O O   . GLU A 1 260 ? -20.421 46.734 59.433 1.00 29.96 ? 260 GLU A O   1 
ATOM   1958 C CB  . GLU A 1 260 ? -20.548 43.899 57.807 1.00 33.77 ? 260 GLU A CB  1 
ATOM   1959 N N   . GLU A 1 261 ? -20.355 44.863 60.805 1.00 30.02 ? 261 GLU A N   1 
ATOM   1960 C CA  . GLU A 1 261 ? -20.906 45.413 62.053 1.00 29.08 ? 261 GLU A CA  1 
ATOM   1961 C C   . GLU A 1 261 ? -19.846 46.263 62.777 1.00 24.36 ? 261 GLU A C   1 
ATOM   1962 O O   . GLU A 1 261 ? -20.110 47.249 63.459 1.00 21.39 ? 261 GLU A O   1 
ATOM   1963 C CB  . GLU A 1 261 ? -21.363 44.347 63.036 1.00 35.70 ? 261 GLU A CB  1 
ATOM   1964 C CG  . GLU A 1 261 ? -22.668 43.630 62.657 1.00 43.71 ? 261 GLU A CG  1 
ATOM   1965 C CD  . GLU A 1 261 ? -22.890 42.472 63.628 1.00 46.63 ? 261 GLU A CD  1 
ATOM   1966 O OE1 . GLU A 1 261 ? -21.930 41.749 63.912 1.00 47.57 ? 261 GLU A OE1 1 
ATOM   1967 O OE2 . GLU A 1 261 ? -24.014 42.317 64.112 1.00 52.34 ? 261 GLU A OE2 1 
ATOM   1968 N N   . LEU A 1 262 ? -18.595 45.858 62.628 1.00 19.39 ? 262 LEU A N   1 
ATOM   1969 C CA  . LEU A 1 262 ? -17.539 46.673 63.222 1.00 15.57 ? 262 LEU A CA  1 
ATOM   1970 C C   . LEU A 1 262 ? -17.606 48.032 62.522 1.00 16.37 ? 262 LEU A C   1 
ATOM   1971 O O   . LEU A 1 262 ? -17.725 49.122 63.100 1.00 14.52 ? 262 LEU A O   1 
ATOM   1972 C CB  . LEU A 1 262 ? -16.216 45.984 62.929 1.00 10.99 ? 262 LEU A CB  1 
ATOM   1973 C CG  . LEU A 1 262 ? -15.087 46.385 63.846 1.00 5.53  ? 262 LEU A CG  1 
ATOM   1974 C CD1 . LEU A 1 262 ? -13.846 45.489 63.589 1.00 2.00  ? 262 LEU A CD1 1 
ATOM   1975 C CD2 . LEU A 1 262 ? -14.787 47.850 63.657 1.00 9.82  ? 262 LEU A CD2 1 
ATOM   1976 N N   . ILE A 1 263 ? -17.596 47.886 61.187 1.00 16.75 ? 263 ILE A N   1 
ATOM   1977 C CA  . ILE A 1 263 ? -17.666 49.043 60.311 1.00 21.59 ? 263 ILE A CA  1 
ATOM   1978 C C   . ILE A 1 263 ? -18.921 49.854 60.555 1.00 24.33 ? 263 ILE A C   1 
ATOM   1979 O O   . ILE A 1 263 ? -18.911 51.076 60.502 1.00 19.46 ? 263 ILE A O   1 
ATOM   1980 C CB  . ILE A 1 263 ? -17.583 48.657 58.808 1.00 16.94 ? 263 ILE A CB  1 
ATOM   1981 C CG1 . ILE A 1 263 ? -16.260 47.959 58.461 1.00 12.21 ? 263 ILE A CG1 1 
ATOM   1982 C CG2 . ILE A 1 263 ? -17.786 49.882 57.913 1.00 13.65 ? 263 ILE A CG2 1 
ATOM   1983 C CD1 . ILE A 1 263 ? -15.064 48.875 58.796 1.00 18.26 ? 263 ILE A CD1 1 
ATOM   1984 N N   . HIS A 1 264 ? -20.003 49.152 60.832 1.00 27.66 ? 264 HIS A N   1 
ATOM   1985 C CA  . HIS A 1 264 ? -21.197 49.931 61.023 1.00 35.93 ? 264 HIS A CA  1 
ATOM   1986 C C   . HIS A 1 264 ? -21.158 50.684 62.342 1.00 32.57 ? 264 HIS A C   1 
ATOM   1987 O O   . HIS A 1 264 ? -21.454 51.867 62.479 1.00 33.97 ? 264 HIS A O   1 
ATOM   1988 C CB  . HIS A 1 264 ? -22.438 49.041 60.886 1.00 51.39 ? 264 HIS A CB  1 
ATOM   1989 C CG  . HIS A 1 264 ? -23.672 49.854 61.244 1.00 66.57 ? 264 HIS A CG  1 
ATOM   1990 N ND1 . HIS A 1 264 ? -24.641 49.438 62.094 1.00 72.89 ? 264 HIS A ND1 1 
ATOM   1991 C CD2 . HIS A 1 264 ? -23.992 51.167 60.808 1.00 70.48 ? 264 HIS A CD2 1 
ATOM   1992 C CE1 . HIS A 1 264 ? -25.525 50.452 62.181 1.00 78.19 ? 264 HIS A CE1 1 
ATOM   1993 N NE2 . HIS A 1 264 ? -25.150 51.496 61.414 1.00 77.49 ? 264 HIS A NE2 1 
ATOM   1994 N N   . CYS A 1 265 ? -20.774 49.937 63.348 1.00 26.53 ? 265 CYS A N   1 
ATOM   1995 C CA  . CYS A 1 265 ? -20.719 50.540 64.654 1.00 22.11 ? 265 CYS A CA  1 
ATOM   1996 C C   . CYS A 1 265 ? -19.916 51.817 64.639 1.00 17.82 ? 265 CYS A C   1 
ATOM   1997 O O   . CYS A 1 265 ? -20.398 52.863 65.032 1.00 18.38 ? 265 CYS A O   1 
ATOM   1998 C CB  . CYS A 1 265 ? -20.135 49.488 65.556 1.00 25.38 ? 265 CYS A CB  1 
ATOM   1999 S SG  . CYS A 1 265 ? -19.977 50.031 67.258 1.00 25.83 ? 265 CYS A SG  1 
ATOM   2000 N N   . LEU A 1 266 ? -18.684 51.731 64.107 1.00 15.41 ? 266 LEU A N   1 
ATOM   2001 C CA  . LEU A 1 266 ? -17.876 52.924 64.042 1.00 13.21 ? 266 LEU A CA  1 
ATOM   2002 C C   . LEU A 1 266 ? -18.507 54.006 63.174 1.00 19.28 ? 266 LEU A C   1 
ATOM   2003 O O   . LEU A 1 266 ? -18.411 55.199 63.393 1.00 20.56 ? 266 LEU A O   1 
ATOM   2004 C CB  . LEU A 1 266 ? -16.547 52.540 63.427 1.00 9.22  ? 266 LEU A CB  1 
ATOM   2005 C CG  . LEU A 1 266 ? -15.800 51.498 64.256 1.00 12.18 ? 266 LEU A CG  1 
ATOM   2006 C CD1 . LEU A 1 266 ? -14.408 51.193 63.688 1.00 2.36  ? 266 LEU A CD1 1 
ATOM   2007 C CD2 . LEU A 1 266 ? -15.663 51.940 65.714 1.00 15.19 ? 266 LEU A CD2 1 
ATOM   2008 N N   . ARG A 1 267 ? -19.200 53.577 62.137 1.00 20.60 ? 267 ARG A N   1 
ATOM   2009 C CA  . ARG A 1 267 ? -19.791 54.563 61.260 1.00 18.48 ? 267 ARG A CA  1 
ATOM   2010 C C   . ARG A 1 267 ? -20.905 55.332 61.925 1.00 19.24 ? 267 ARG A C   1 
ATOM   2011 O O   . ARG A 1 267 ? -21.383 56.329 61.365 1.00 13.43 ? 267 ARG A O   1 
ATOM   2012 C CB  . ARG A 1 267 ? -20.253 53.865 59.941 1.00 20.21 ? 267 ARG A CB  1 
ATOM   2013 C CG  . ARG A 1 267 ? -19.167 53.594 58.866 1.00 13.45 ? 267 ARG A CG  1 
ATOM   2014 C CD  . ARG A 1 267 ? -19.460 54.233 57.495 1.00 17.62 ? 267 ARG A CD  1 
ATOM   2015 N NE  . ARG A 1 267 ? -20.096 53.287 56.604 1.00 25.65 ? 267 ARG A NE  1 
ATOM   2016 C CZ  . ARG A 1 267 ? -19.384 52.494 55.769 1.00 29.26 ? 267 ARG A CZ  1 
ATOM   2017 N NH1 . ARG A 1 267 ? -18.084 52.682 55.485 1.00 25.46 ? 267 ARG A NH1 1 
ATOM   2018 N NH2 . ARG A 1 267 ? -20.025 51.459 55.240 1.00 28.46 ? 267 ARG A NH2 1 
ATOM   2019 N N   . GLU A 1 268 ? -21.336 54.792 63.096 1.00 22.12 ? 268 GLU A N   1 
ATOM   2020 C CA  . GLU A 1 268 ? -22.423 55.449 63.861 1.00 29.14 ? 268 GLU A CA  1 
ATOM   2021 C C   . GLU A 1 268 ? -21.897 56.244 65.052 1.00 30.06 ? 268 GLU A C   1 
ATOM   2022 O O   . GLU A 1 268 ? -22.670 56.996 65.635 1.00 32.42 ? 268 GLU A O   1 
ATOM   2023 C CB  . GLU A 1 268 ? -23.551 54.508 64.411 1.00 30.42 ? 268 GLU A CB  1 
ATOM   2024 C CG  . GLU A 1 268 ? -24.388 53.742 63.391 1.00 22.76 ? 268 GLU A CG  1 
ATOM   2025 N N   . LYS A 1 269 ? -20.636 56.015 65.460 1.00 29.27 ? 269 LYS A N   1 
ATOM   2026 C CA  . LYS A 1 269 ? -20.109 56.792 66.593 1.00 27.35 ? 269 LYS A CA  1 
ATOM   2027 C C   . LYS A 1 269 ? -19.810 58.187 66.098 1.00 23.83 ? 269 LYS A C   1 
ATOM   2028 O O   . LYS A 1 269 ? -19.524 58.342 64.933 1.00 29.50 ? 269 LYS A O   1 
ATOM   2029 C CB  . LYS A 1 269 ? -18.780 56.171 67.015 1.00 26.22 ? 269 LYS A CB  1 
ATOM   2030 C CG  . LYS A 1 269 ? -18.907 55.267 68.209 1.00 26.54 ? 269 LYS A CG  1 
ATOM   2031 C CD  . LYS A 1 269 ? -19.945 54.147 68.117 1.00 28.22 ? 269 LYS A CD  1 
ATOM   2032 C CE  . LYS A 1 269 ? -19.687 53.115 69.257 1.00 32.66 ? 269 LYS A CE  1 
ATOM   2033 N NZ  . LYS A 1 269 ? -20.843 52.311 69.598 1.00 35.83 ? 269 LYS A NZ  1 
ATOM   2034 N N   . LYS A 1 270 ? -19.832 59.200 66.950 1.00 21.34 ? 270 LYS A N   1 
ATOM   2035 C CA  . LYS A 1 270 ? -19.530 60.561 66.458 1.00 21.17 ? 270 LYS A CA  1 
ATOM   2036 C C   . LYS A 1 270 ? -18.019 60.759 66.390 1.00 19.91 ? 270 LYS A C   1 
ATOM   2037 O O   . LYS A 1 270 ? -17.321 59.993 67.039 1.00 29.18 ? 270 LYS A O   1 
ATOM   2038 C CB  . LYS A 1 270 ? -20.140 61.559 67.443 1.00 21.12 ? 270 LYS A CB  1 
ATOM   2039 C CG  . LYS A 1 270 ? -21.610 61.245 67.673 1.00 28.67 ? 270 LYS A CG  1 
ATOM   2040 N N   . PRO A 1 271 ? -17.477 61.791 65.708 1.00 13.77 ? 271 PRO A N   1 
ATOM   2041 C CA  . PRO A 1 271 ? -16.092 61.737 65.365 1.00 13.99 ? 271 PRO A CA  1 
ATOM   2042 C C   . PRO A 1 271 ? -15.214 61.750 66.577 1.00 17.08 ? 271 PRO A C   1 
ATOM   2043 O O   . PRO A 1 271 ? -14.286 60.968 66.717 1.00 18.05 ? 271 PRO A O   1 
ATOM   2044 C CB  . PRO A 1 271 ? -15.774 63.012 64.555 1.00 9.45  ? 271 PRO A CB  1 
ATOM   2045 C CG  . PRO A 1 271 ? -17.029 63.874 64.616 1.00 13.33 ? 271 PRO A CG  1 
ATOM   2046 C CD  . PRO A 1 271 ? -18.054 63.118 65.498 1.00 17.51 ? 271 PRO A CD  1 
ATOM   2047 N N   . GLN A 1 272 ? -15.574 62.639 67.513 1.00 20.14 ? 272 GLN A N   1 
ATOM   2048 C CA  . GLN A 1 272 ? -14.713 62.726 68.696 1.00 21.80 ? 272 GLN A CA  1 
ATOM   2049 C C   . GLN A 1 272 ? -14.595 61.447 69.484 1.00 18.95 ? 272 GLN A C   1 
ATOM   2050 O O   . GLN A 1 272 ? -13.603 61.298 70.166 1.00 19.33 ? 272 GLN A O   1 
ATOM   2051 C CB  . GLN A 1 272 ? -15.027 63.883 69.675 1.00 22.98 ? 272 GLN A CB  1 
ATOM   2052 C CG  . GLN A 1 272 ? -13.781 64.484 70.382 1.00 29.83 ? 272 GLN A CG  1 
ATOM   2053 C CD  . GLN A 1 272 ? -13.113 65.574 69.511 1.00 36.25 ? 272 GLN A CD  1 
ATOM   2054 O OE1 . GLN A 1 272 ? -13.790 66.392 68.893 1.00 38.72 ? 272 GLN A OE1 1 
ATOM   2055 N NE2 . GLN A 1 272 ? -11.769 65.573 69.449 1.00 29.46 ? 272 GLN A NE2 1 
ATOM   2056 N N   . GLU A 1 273 ? -15.565 60.519 69.409 1.00 18.15 ? 273 GLU A N   1 
ATOM   2057 C CA  . GLU A 1 273 ? -15.398 59.300 70.232 1.00 19.30 ? 273 GLU A CA  1 
ATOM   2058 C C   . GLU A 1 273 ? -14.206 58.540 69.790 1.00 17.07 ? 273 GLU A C   1 
ATOM   2059 O O   . GLU A 1 273 ? -13.410 58.070 70.597 1.00 16.79 ? 273 GLU A O   1 
ATOM   2060 C CB  . GLU A 1 273 ? -16.623 58.401 70.249 1.00 21.87 ? 273 GLU A CB  1 
ATOM   2061 C CG  . GLU A 1 273 ? -17.828 59.163 70.837 1.00 28.47 ? 273 GLU A CG  1 
ATOM   2062 C CD  . GLU A 1 273 ? -19.182 58.490 70.592 1.00 32.38 ? 273 GLU A CD  1 
ATOM   2063 O OE1 . GLU A 1 273 ? -19.424 57.436 71.181 1.00 34.09 ? 273 GLU A OE1 1 
ATOM   2064 O OE2 . GLU A 1 273 ? -19.989 59.035 69.828 1.00 32.02 ? 273 GLU A OE2 1 
ATOM   2065 N N   . LEU A 1 274 ? -14.101 58.501 68.456 1.00 13.66 ? 274 LEU A N   1 
ATOM   2066 C CA  . LEU A 1 274 ? -12.972 57.845 67.816 1.00 8.25  ? 274 LEU A CA  1 
ATOM   2067 C C   . LEU A 1 274 ? -11.703 58.616 68.088 1.00 6.32  ? 274 LEU A C   1 
ATOM   2068 O O   . LEU A 1 274 ? -10.643 58.023 68.193 1.00 6.40  ? 274 LEU A O   1 
ATOM   2069 C CB  . LEU A 1 274 ? -13.222 57.745 66.297 1.00 7.48  ? 274 LEU A CB  1 
ATOM   2070 C CG  . LEU A 1 274 ? -14.379 56.753 65.987 1.00 13.15 ? 274 LEU A CG  1 
ATOM   2071 C CD1 . LEU A 1 274 ? -15.690 57.501 65.695 1.00 12.02 ? 274 LEU A CD1 1 
ATOM   2072 C CD2 . LEU A 1 274 ? -14.005 55.752 64.884 1.00 8.98  ? 274 LEU A CD2 1 
ATOM   2073 N N   . ILE A 1 275 ? -11.811 59.949 68.226 1.00 5.72  ? 275 ILE A N   1 
ATOM   2074 C CA  . ILE A 1 275 ? -10.583 60.694 68.465 1.00 6.44  ? 275 ILE A CA  1 
ATOM   2075 C C   . ILE A 1 275 ? -10.085 60.427 69.856 1.00 9.60  ? 275 ILE A C   1 
ATOM   2076 O O   . ILE A 1 275 ? -8.904  60.263 70.132 1.00 10.64 ? 275 ILE A O   1 
ATOM   2077 C CB  . ILE A 1 275 ? -10.784 62.183 68.190 1.00 8.00  ? 275 ILE A CB  1 
ATOM   2078 C CG1 . ILE A 1 275 ? -11.275 62.400 66.753 1.00 6.50  ? 275 ILE A CG1 1 
ATOM   2079 C CG2 . ILE A 1 275 ? -9.512  63.022 68.468 1.00 4.98  ? 275 ILE A CG2 1 
ATOM   2080 C CD1 . ILE A 1 275 ? -11.320 63.891 66.359 1.00 11.02 ? 275 ILE A CD1 1 
ATOM   2081 N N   . ASP A 1 276 ? -11.056 60.373 70.744 1.00 9.03  ? 276 ASP A N   1 
ATOM   2082 C CA  . ASP A 1 276 ? -10.798 60.100 72.118 1.00 6.21  ? 276 ASP A CA  1 
ATOM   2083 C C   . ASP A 1 276 ? -10.082 58.794 72.342 1.00 7.03  ? 276 ASP A C   1 
ATOM   2084 O O   . ASP A 1 276 ? -9.002  58.850 72.906 1.00 8.19  ? 276 ASP A O   1 
ATOM   2085 C CB  . ASP A 1 276 ? -12.126 60.068 72.837 1.00 8.86  ? 276 ASP A CB  1 
ATOM   2086 C CG  . ASP A 1 276 ? -12.672 61.484 73.013 1.00 19.02 ? 276 ASP A CG  1 
ATOM   2087 O OD1 . ASP A 1 276 ? -12.090 62.464 72.463 1.00 18.45 ? 276 ASP A OD1 1 
ATOM   2088 O OD2 . ASP A 1 276 ? -13.695 61.567 73.713 1.00 19.60 ? 276 ASP A OD2 1 
ATOM   2089 N N   . VAL A 1 277 ? -10.627 57.641 71.909 1.00 3.61  ? 277 VAL A N   1 
ATOM   2090 C CA  . VAL A 1 277 ? -9.909  56.391 72.178 1.00 4.79  ? 277 VAL A CA  1 
ATOM   2091 C C   . VAL A 1 277 ? -8.817  56.044 71.133 1.00 8.77  ? 277 VAL A C   1 
ATOM   2092 O O   . VAL A 1 277 ? -8.222  54.958 71.129 1.00 5.94  ? 277 VAL A O   1 
ATOM   2093 C CB  . VAL A 1 277 ? -10.934 55.251 72.293 1.00 5.24  ? 277 VAL A CB  1 
ATOM   2094 C CG1 . VAL A 1 277 ? -12.145 55.580 73.151 1.00 6.67  ? 277 VAL A CG1 1 
ATOM   2095 C CG2 . VAL A 1 277 ? -11.520 54.880 70.938 1.00 15.82 ? 277 VAL A CG2 1 
ATOM   2096 N N   . GLU A 1 278 ? -8.568  56.995 70.222 1.00 8.69  ? 278 GLU A N   1 
ATOM   2097 C CA  . GLU A 1 278 ? -7.596  56.766 69.162 1.00 10.41 ? 278 GLU A CA  1 
ATOM   2098 C C   . GLU A 1 278 ? -6.233  56.307 69.559 1.00 11.03 ? 278 GLU A C   1 
ATOM   2099 O O   . GLU A 1 278 ? -5.477  55.864 68.723 1.00 11.07 ? 278 GLU A O   1 
ATOM   2100 C CB  . GLU A 1 278 ? -7.302  58.106 68.495 1.00 15.90 ? 278 GLU A CB  1 
ATOM   2101 C CG  . GLU A 1 278 ? -6.164  58.177 67.424 1.00 12.39 ? 278 GLU A CG  1 
ATOM   2102 C CD  . GLU A 1 278 ? -6.555  59.267 66.443 1.00 18.57 ? 278 GLU A CD  1 
ATOM   2103 O OE1 . GLU A 1 278 ? -7.463  59.003 65.645 1.00 26.19 ? 278 GLU A OE1 1 
ATOM   2104 O OE2 . GLU A 1 278 ? -6.031  60.380 66.509 1.00 23.40 ? 278 GLU A OE2 1 
ATOM   2105 N N   . TRP A 1 279 ? -5.881  56.433 70.808 1.00 11.51 ? 279 TRP A N   1 
ATOM   2106 C CA  . TRP A 1 279 ? -4.512  56.040 71.102 1.00 13.80 ? 279 TRP A CA  1 
ATOM   2107 C C   . TRP A 1 279 ? -4.431  54.848 71.964 1.00 10.12 ? 279 TRP A C   1 
ATOM   2108 O O   . TRP A 1 279 ? -3.335  54.396 72.238 1.00 4.54  ? 279 TRP A O   1 
ATOM   2109 C CB  . TRP A 1 279 ? -3.802  57.198 71.797 1.00 13.69 ? 279 TRP A CB  1 
ATOM   2110 C CG  . TRP A 1 279 ? -3.682  58.386 70.873 1.00 16.02 ? 279 TRP A CG  1 
ATOM   2111 C CD1 . TRP A 1 279 ? -4.610  59.437 70.768 1.00 22.36 ? 279 TRP A CD1 1 
ATOM   2112 C CD2 . TRP A 1 279 ? -2.623  58.704 70.026 1.00 18.50 ? 279 TRP A CD2 1 
ATOM   2113 N NE1 . TRP A 1 279 ? -4.164  60.400 69.924 1.00 23.99 ? 279 TRP A NE1 1 
ATOM   2114 C CE2 . TRP A 1 279 ? -2.935  60.021 69.461 1.00 20.63 ? 279 TRP A CE2 1 
ATOM   2115 C CE3 . TRP A 1 279 ? -1.440  58.067 69.685 1.00 25.92 ? 279 TRP A CE3 1 
ATOM   2116 C CZ2 . TRP A 1 279 ? -2.063  60.617 68.567 1.00 23.71 ? 279 TRP A CZ2 1 
ATOM   2117 C CZ3 . TRP A 1 279 ? -0.582  58.693 68.769 1.00 32.22 ? 279 TRP A CZ3 1 
ATOM   2118 C CH2 . TRP A 1 279 ? -0.884  59.960 68.251 1.00 31.99 ? 279 TRP A CH2 1 
ATOM   2119 N N   . ASN A 1 280 ? -5.570  54.316 72.389 1.00 12.56 ? 280 ASN A N   1 
ATOM   2120 C CA  . ASN A 1 280 ? -5.468  53.160 73.295 1.00 14.70 ? 280 ASN A CA  1 
ATOM   2121 C C   . ASN A 1 280 ? -5.416  51.937 72.525 1.00 16.70 ? 280 ASN A C   1 
ATOM   2122 O O   . ASN A 1 280 ? -5.851  50.917 73.015 1.00 26.24 ? 280 ASN A O   1 
ATOM   2123 C CB  . ASN A 1 280 ? -6.743  53.014 74.144 1.00 19.06 ? 280 ASN A CB  1 
ATOM   2124 C CG  . ASN A 1 280 ? -6.931  54.264 74.918 1.00 27.84 ? 280 ASN A CG  1 
ATOM   2125 O OD1 . ASN A 1 280 ? -5.951  54.878 75.322 1.00 24.26 ? 280 ASN A OD1 1 
ATOM   2126 N ND2 . ASN A 1 280 ? -8.196  54.655 75.106 1.00 35.74 ? 280 ASN A ND2 1 
ATOM   2127 N N   . VAL A 1 281 ? -4.959  52.020 71.292 1.00 20.01 ? 281 VAL A N   1 
ATOM   2128 C CA  . VAL A 1 281 ? -4.932  50.858 70.437 1.00 14.83 ? 281 VAL A CA  1 
ATOM   2129 C C   . VAL A 1 281 ? -3.605  50.525 70.012 1.00 10.54 ? 281 VAL A C   1 
ATOM   2130 O O   . VAL A 1 281 ? -3.444  49.444 69.507 1.00 13.51 ? 281 VAL A O   1 
ATOM   2131 C CB  . VAL A 1 281 ? -5.848  51.054 69.245 1.00 14.73 ? 281 VAL A CB  1 
ATOM   2132 C CG1 . VAL A 1 281 ? -7.290  51.045 69.768 1.00 12.00 ? 281 VAL A CG1 1 
ATOM   2133 C CG2 . VAL A 1 281 ? -5.504  52.334 68.470 1.00 18.02 ? 281 VAL A CG2 1 
ATOM   2134 N N   . LEU A 1 282 ? -2.654  51.435 70.159 1.00 11.54 ? 282 LEU A N   1 
ATOM   2135 C CA  . LEU A 1 282 ? -1.306  51.025 69.781 1.00 14.13 ? 282 LEU A CA  1 
ATOM   2136 C C   . LEU A 1 282 ? -0.925  49.801 70.560 1.00 18.01 ? 282 LEU A C   1 
ATOM   2137 O O   . LEU A 1 282 ? -1.492  49.550 71.609 1.00 30.43 ? 282 LEU A O   1 
ATOM   2138 C CB  . LEU A 1 282 ? -0.299  52.068 70.200 1.00 11.70 ? 282 LEU A CB  1 
ATOM   2139 C CG  . LEU A 1 282 ? -0.273  53.194 69.177 1.00 5.82  ? 282 LEU A CG  1 
ATOM   2140 C CD1 . LEU A 1 282 ? 0.355   54.457 69.686 1.00 4.69  ? 282 LEU A CD1 1 
ATOM   2141 C CD2 . LEU A 1 282 ? 0.521   52.739 67.967 1.00 17.47 ? 282 LEU A CD2 1 
ATOM   2142 N N   . PRO A 1 283 ? 0.015   49.036 70.074 1.00 18.19 ? 283 PRO A N   1 
ATOM   2143 C CA  . PRO A 1 283 ? 0.407   47.821 70.798 1.00 19.26 ? 283 PRO A CA  1 
ATOM   2144 C C   . PRO A 1 283 ? 1.590   47.891 71.763 1.00 17.99 ? 283 PRO A C   1 
ATOM   2145 O O   . PRO A 1 283 ? 2.123   46.840 72.122 1.00 18.11 ? 283 PRO A O   1 
ATOM   2146 C CB  . PRO A 1 283 ? 0.848   46.882 69.648 1.00 18.97 ? 283 PRO A CB  1 
ATOM   2147 C CG  . PRO A 1 283 ? 1.121   47.761 68.428 1.00 19.69 ? 283 PRO A CG  1 
ATOM   2148 C CD  . PRO A 1 283 ? 0.508   49.134 68.719 1.00 22.51 ? 283 PRO A CD  1 
ATOM   2149 N N   . PHE A 1 284 ? 2.051   49.078 72.182 1.00 17.63 ? 284 PHE A N   1 
ATOM   2150 C CA  . PHE A 1 284 ? 3.246   49.058 73.047 1.00 18.39 ? 284 PHE A CA  1 
ATOM   2151 C C   . PHE A 1 284 ? 3.462   50.417 73.654 1.00 16.67 ? 284 PHE A C   1 
ATOM   2152 O O   . PHE A 1 284 ? 2.709   51.349 73.389 1.00 19.06 ? 284 PHE A O   1 
ATOM   2153 C CB  . PHE A 1 284 ? 4.545   48.595 72.263 1.00 17.95 ? 284 PHE A CB  1 
ATOM   2154 C CG  . PHE A 1 284 ? 4.569   48.893 70.775 1.00 15.44 ? 284 PHE A CG  1 
ATOM   2155 N N   . ASP A 1 285 ? 4.487   50.523 74.516 1.00 12.58 ? 285 ASP A N   1 
ATOM   2156 C CA  . ASP A 1 285 ? 4.729   51.847 75.086 1.00 14.59 ? 285 ASP A CA  1 
ATOM   2157 C C   . ASP A 1 285 ? 5.765   52.361 74.114 1.00 18.94 ? 285 ASP A C   1 
ATOM   2158 O O   . ASP A 1 285 ? 6.803   51.716 73.924 1.00 17.95 ? 285 ASP A O   1 
ATOM   2159 C CB  . ASP A 1 285 ? 5.145   51.786 76.559 1.00 17.55 ? 285 ASP A CB  1 
ATOM   2160 C CG  . ASP A 1 285 ? 4.911   53.026 77.434 1.00 21.76 ? 285 ASP A CG  1 
ATOM   2161 O OD1 . ASP A 1 285 ? 4.397   54.017 76.931 1.00 30.63 ? 285 ASP A OD1 1 
ATOM   2162 O OD2 . ASP A 1 285 ? 5.240   52.990 78.627 1.00 22.52 ? 285 ASP A OD2 1 
ATOM   2163 N N   . SER A 1 286 ? 5.476   53.511 73.476 1.00 20.20 ? 286 SER A N   1 
ATOM   2164 C CA  . SER A 1 286 ? 6.413   53.988 72.490 1.00 19.40 ? 286 SER A CA  1 
ATOM   2165 C C   . SER A 1 286 ? 6.230   55.413 72.308 1.00 19.05 ? 286 SER A C   1 
ATOM   2166 O O   . SER A 1 286 ? 5.086   55.833 72.435 1.00 17.98 ? 286 SER A O   1 
ATOM   2167 C CB  . SER A 1 286 ? 5.873   53.520 71.102 1.00 18.10 ? 286 SER A CB  1 
ATOM   2168 O OG  . SER A 1 286 ? 5.571   52.121 71.033 1.00 26.41 ? 286 SER A OG  1 
ATOM   2169 N N   . ILE A 1 287 ? 7.315   56.086 71.953 1.00 16.70 ? 287 ILE A N   1 
ATOM   2170 C CA  . ILE A 1 287 ? 7.287   57.471 71.610 1.00 15.62 ? 287 ILE A CA  1 
ATOM   2171 C C   . ILE A 1 287 ? 7.405   57.358 70.038 1.00 17.74 ? 287 ILE A C   1 
ATOM   2172 O O   . ILE A 1 287 ? 7.784   56.296 69.569 1.00 17.65 ? 287 ILE A O   1 
ATOM   2173 C CB  . ILE A 1 287 ? 8.503   58.094 72.324 1.00 14.61 ? 287 ILE A CB  1 
ATOM   2174 C CG1 . ILE A 1 287 ? 8.316   59.544 72.633 1.00 18.28 ? 287 ILE A CG1 1 
ATOM   2175 C CG2 . ILE A 1 287 ? 9.860   57.891 71.617 1.00 10.50 ? 287 ILE A CG2 1 
ATOM   2176 C CD1 . ILE A 1 287 ? 9.641   60.065 73.203 1.00 32.56 ? 287 ILE A CD1 1 
ATOM   2177 N N   . PHE A 1 288 ? 7.082   58.407 69.245 1.00 19.72 ? 288 PHE A N   1 
ATOM   2178 C CA  . PHE A 1 288 ? 7.163   58.476 67.753 1.00 14.23 ? 288 PHE A CA  1 
ATOM   2179 C C   . PHE A 1 288 ? 6.626   57.266 67.039 1.00 14.34 ? 288 PHE A C   1 
ATOM   2180 O O   . PHE A 1 288 ? 7.240   56.619 66.196 1.00 17.71 ? 288 PHE A O   1 
ATOM   2181 C CB  . PHE A 1 288 ? 8.563   58.760 67.211 1.00 15.03 ? 288 PHE A CB  1 
ATOM   2182 C CG  . PHE A 1 288 ? 8.675   59.679 66.010 1.00 17.01 ? 288 PHE A CG  1 
ATOM   2183 C CD1 . PHE A 1 288 ? 7.688   59.709 65.031 1.00 10.32 ? 288 PHE A CD1 1 
ATOM   2184 C CD2 . PHE A 1 288 ? 9.813   60.492 65.888 1.00 15.40 ? 288 PHE A CD2 1 
ATOM   2185 C CE1 . PHE A 1 288 ? 7.890   60.577 63.980 1.00 17.99 ? 288 PHE A CE1 1 
ATOM   2186 C CE2 . PHE A 1 288 ? 10.029  61.332 64.815 1.00 2.00  ? 288 PHE A CE2 1 
ATOM   2187 C CZ  . PHE A 1 288 ? 9.047   61.376 63.862 1.00 12.61 ? 288 PHE A CZ  1 
ATOM   2188 N N   . ARG A 1 289 ? 5.389   56.967 67.382 1.00 9.87  ? 289 ARG A N   1 
ATOM   2189 C CA  . ARG A 1 289 ? 4.769   55.837 66.752 1.00 5.54  ? 289 ARG A CA  1 
ATOM   2190 C C   . ARG A 1 289 ? 3.325   56.230 66.820 1.00 11.58 ? 289 ARG A C   1 
ATOM   2191 O O   . ARG A 1 289 ? 2.958   56.793 67.853 1.00 10.99 ? 289 ARG A O   1 
ATOM   2192 C CB  . ARG A 1 289 ? 5.147   54.643 67.528 1.00 2.00  ? 289 ARG A CB  1 
ATOM   2193 C CG  . ARG A 1 289 ? 5.177   53.447 66.616 1.00 11.95 ? 289 ARG A CG  1 
ATOM   2194 C CD  . ARG A 1 289 ? 6.577   52.830 66.451 1.00 5.57  ? 289 ARG A CD  1 
ATOM   2195 N NE  . ARG A 1 289 ? 7.591   53.823 66.164 1.00 2.01  ? 289 ARG A NE  1 
ATOM   2196 C CZ  . ARG A 1 289 ? 8.832   53.377 65.886 1.00 10.26 ? 289 ARG A CZ  1 
ATOM   2197 N NH1 . ARG A 1 289 ? 9.100   52.063 65.903 1.00 13.21 ? 289 ARG A NH1 1 
ATOM   2198 N NH2 . ARG A 1 289 ? 9.785   54.242 65.578 1.00 6.76  ? 289 ARG A NH2 1 
ATOM   2199 N N   . PHE A 1 290 ? 2.565   56.040 65.703 1.00 9.79  ? 290 PHE A N   1 
ATOM   2200 C CA  . PHE A 1 290 ? 1.185   56.474 65.658 1.00 6.27  ? 290 PHE A CA  1 
ATOM   2201 C C   . PHE A 1 290 ? 0.237   55.307 65.385 1.00 9.41  ? 290 PHE A C   1 
ATOM   2202 O O   . PHE A 1 290 ? 0.615   54.283 64.822 1.00 11.55 ? 290 PHE A O   1 
ATOM   2203 C CB  . PHE A 1 290 ? 1.062   57.542 64.576 1.00 3.11  ? 290 PHE A CB  1 
ATOM   2204 C CG  . PHE A 1 290 ? 2.096   58.591 64.725 1.00 3.86  ? 290 PHE A CG  1 
ATOM   2205 C CD1 . PHE A 1 290 ? 2.108   59.463 65.804 1.00 8.88  ? 290 PHE A CD1 1 
ATOM   2206 C CD2 . PHE A 1 290 ? 3.128   58.668 63.810 1.00 15.77 ? 290 PHE A CD2 1 
ATOM   2207 C CE1 . PHE A 1 290 ? 3.146   60.388 66.004 1.00 2.00  ? 290 PHE A CE1 1 
ATOM   2208 C CE2 . PHE A 1 290 ? 4.177   59.580 64.003 1.00 12.94 ? 290 PHE A CE2 1 
ATOM   2209 C CZ  . PHE A 1 290 ? 4.195   60.439 65.104 1.00 3.75  ? 290 PHE A CZ  1 
ATOM   2210 N N   . SER A 1 291 ? -1.040  55.496 65.772 1.00 10.75 ? 291 SER A N   1 
ATOM   2211 C CA  . SER A 1 291 ? -1.991  54.409 65.612 1.00 13.51 ? 291 SER A CA  1 
ATOM   2212 C C   . SER A 1 291 ? -2.458  54.057 64.234 1.00 16.69 ? 291 SER A C   1 
ATOM   2213 O O   . SER A 1 291 ? -2.225  52.914 63.853 1.00 22.58 ? 291 SER A O   1 
ATOM   2214 C CB  . SER A 1 291 ? -3.291  54.532 66.434 1.00 12.33 ? 291 SER A CB  1 
ATOM   2215 O OG  . SER A 1 291 ? -2.950  54.719 67.757 1.00 11.05 ? 291 SER A OG  1 
ATOM   2216 N N   . PHE A 1 292 ? -3.183  54.970 63.540 1.00 13.30 ? 292 PHE A N   1 
ATOM   2217 C CA  . PHE A 1 292 ? -3.696  54.656 62.179 1.00 11.84 ? 292 PHE A CA  1 
ATOM   2218 C C   . PHE A 1 292 ? -2.829  55.316 61.105 1.00 16.56 ? 292 PHE A C   1 
ATOM   2219 O O   . PHE A 1 292 ? -2.678  56.538 60.941 1.00 15.85 ? 292 PHE A O   1 
ATOM   2220 C CB  . PHE A 1 292 ? -5.130  55.108 61.989 1.00 11.32 ? 292 PHE A CB  1 
ATOM   2221 C CG  . PHE A 1 292 ? -5.991  54.498 63.036 1.00 9.46  ? 292 PHE A CG  1 
ATOM   2222 C CD1 . PHE A 1 292 ? -6.347  53.180 62.909 1.00 10.16 ? 292 PHE A CD1 1 
ATOM   2223 C CD2 . PHE A 1 292 ? -6.416  55.236 64.124 1.00 11.95 ? 292 PHE A CD2 1 
ATOM   2224 C CE1 . PHE A 1 292 ? -7.165  52.618 63.857 1.00 16.38 ? 292 PHE A CE1 1 
ATOM   2225 C CE2 . PHE A 1 292 ? -7.210  54.677 65.096 1.00 7.95  ? 292 PHE A CE2 1 
ATOM   2226 C CZ  . PHE A 1 292 ? -7.598  53.368 64.942 1.00 16.98 ? 292 PHE A CZ  1 
ATOM   2227 N N   . VAL A 1 293 ? -2.265  54.402 60.322 1.00 14.87 ? 293 VAL A N   1 
ATOM   2228 C CA  . VAL A 1 293 ? -1.349  54.806 59.316 1.00 11.36 ? 293 VAL A CA  1 
ATOM   2229 C C   . VAL A 1 293 ? -1.590  53.949 58.025 1.00 14.10 ? 293 VAL A C   1 
ATOM   2230 O O   . VAL A 1 293 ? -2.358  52.982 58.026 1.00 21.46 ? 293 VAL A O   1 
ATOM   2231 C CB  . VAL A 1 293 ? -0.044  54.609 60.134 1.00 5.16  ? 293 VAL A CB  1 
ATOM   2232 C CG1 . VAL A 1 293 ? 0.812   53.487 59.584 1.00 9.70  ? 293 VAL A CG1 1 
ATOM   2233 C CG2 . VAL A 1 293 ? 0.684   55.919 60.381 1.00 6.21  ? 293 VAL A CG2 1 
ATOM   2234 N N   . PRO A 1 294 ? -0.887  54.322 56.923 1.00 9.65  ? 294 PRO A N   1 
ATOM   2235 C CA  . PRO A 1 294 ? -0.899  53.530 55.727 1.00 5.86  ? 294 PRO A CA  1 
ATOM   2236 C C   . PRO A 1 294 ? -0.546  52.042 55.862 1.00 8.47  ? 294 PRO A C   1 
ATOM   2237 O O   . PRO A 1 294 ? 0.510   51.634 56.366 1.00 5.54  ? 294 PRO A O   1 
ATOM   2238 C CB  . PRO A 1 294 ? 0.174   54.196 54.854 1.00 5.70  ? 294 PRO A CB  1 
ATOM   2239 C CG  . PRO A 1 294 ? 0.332   55.620 55.363 1.00 5.36  ? 294 PRO A CG  1 
ATOM   2240 C CD  . PRO A 1 294 ? -0.135  55.574 56.793 1.00 6.77  ? 294 PRO A CD  1 
ATOM   2241 N N   . VAL A 1 295 ? -1.457  51.224 55.351 1.00 6.85  ? 295 VAL A N   1 
ATOM   2242 C CA  . VAL A 1 295 ? -1.149  49.797 55.392 1.00 5.58  ? 295 VAL A CA  1 
ATOM   2243 C C   . VAL A 1 295 ? -0.470  49.456 54.047 1.00 8.55  ? 295 VAL A C   1 
ATOM   2244 O O   . VAL A 1 295 ? -0.765  50.015 52.987 1.00 16.07 ? 295 VAL A O   1 
ATOM   2245 C CB  . VAL A 1 295 ? -2.442  49.024 55.659 1.00 2.00  ? 295 VAL A CB  1 
ATOM   2246 C CG1 . VAL A 1 295 ? -3.650  49.578 54.900 1.00 4.66  ? 295 VAL A CG1 1 
ATOM   2247 C CG2 . VAL A 1 295 ? -2.325  47.527 55.367 1.00 6.45  ? 295 VAL A CG2 1 
ATOM   2248 N N   . ILE A 1 296 ? 0.443   48.513 54.077 1.00 2.91  ? 296 ILE A N   1 
ATOM   2249 C CA  . ILE A 1 296 ? 1.085   48.102 52.838 1.00 7.78  ? 296 ILE A CA  1 
ATOM   2250 C C   . ILE A 1 296 ? 0.187   47.019 52.318 1.00 10.02 ? 296 ILE A C   1 
ATOM   2251 O O   . ILE A 1 296 ? 0.396   45.837 52.526 1.00 14.66 ? 296 ILE A O   1 
ATOM   2252 C CB  . ILE A 1 296 ? 2.485   47.607 53.190 1.00 2.44  ? 296 ILE A CB  1 
ATOM   2253 C CG1 . ILE A 1 296 ? 3.220   48.723 53.903 1.00 7.25  ? 296 ILE A CG1 1 
ATOM   2254 C CG2 . ILE A 1 296 ? 3.283   47.201 51.978 1.00 2.00  ? 296 ILE A CG2 1 
ATOM   2255 C CD1 . ILE A 1 296 ? 3.013   50.091 53.235 1.00 19.66 ? 296 ILE A CD1 1 
ATOM   2256 N N   . ASP A 1 297 ? -0.836  47.435 51.618 1.00 10.23 ? 297 ASP A N   1 
ATOM   2257 C CA  . ASP A 1 297 ? -1.821  46.463 51.189 1.00 12.97 ? 297 ASP A CA  1 
ATOM   2258 C C   . ASP A 1 297 ? -1.676  45.800 49.908 1.00 15.90 ? 297 ASP A C   1 
ATOM   2259 O O   . ASP A 1 297 ? -2.593  45.073 49.582 1.00 19.04 ? 297 ASP A O   1 
ATOM   2260 C CB  . ASP A 1 297 ? -3.225  47.075 51.191 1.00 18.97 ? 297 ASP A CB  1 
ATOM   2261 C CG  . ASP A 1 297 ? -3.328  48.350 50.346 1.00 23.17 ? 297 ASP A CG  1 
ATOM   2262 O OD1 . ASP A 1 297 ? -2.312  48.997 50.060 1.00 16.87 ? 297 ASP A OD1 1 
ATOM   2263 O OD2 . ASP A 1 297 ? -4.460  48.696 49.999 1.00 31.59 ? 297 ASP A OD2 1 
ATOM   2264 N N   . GLY A 1 298 ? -0.650  46.015 49.117 1.00 20.98 ? 298 GLY A N   1 
ATOM   2265 C CA  . GLY A 1 298 ? -0.697  45.201 47.881 1.00 25.71 ? 298 GLY A CA  1 
ATOM   2266 C C   . GLY A 1 298 ? -1.338  45.953 46.748 1.00 26.47 ? 298 GLY A C   1 
ATOM   2267 O O   . GLY A 1 298 ? -0.917  45.935 45.605 1.00 23.16 ? 298 GLY A O   1 
ATOM   2268 N N   . GLU A 1 299 ? -2.457  46.589 47.056 1.00 28.63 ? 299 GLU A N   1 
ATOM   2269 C CA  . GLU A 1 299 ? -3.056  47.465 46.033 1.00 27.79 ? 299 GLU A CA  1 
ATOM   2270 C C   . GLU A 1 299 ? -2.435  48.786 46.491 1.00 26.93 ? 299 GLU A C   1 
ATOM   2271 O O   . GLU A 1 299 ? -2.078  48.896 47.658 1.00 32.18 ? 299 GLU A O   1 
ATOM   2272 C CB  . GLU A 1 299 ? -4.583  47.435 46.076 1.00 29.64 ? 299 GLU A CB  1 
ATOM   2273 C CG  . GLU A 1 299 ? -5.127  48.330 44.973 1.00 36.42 ? 299 GLU A CG  1 
ATOM   2274 N N   . PHE A 1 300 ? -2.291  49.799 45.677 1.00 20.86 ? 300 PHE A N   1 
ATOM   2275 C CA  . PHE A 1 300 ? -1.648  51.034 46.224 1.00 17.13 ? 300 PHE A CA  1 
ATOM   2276 C C   . PHE A 1 300 ? -0.135  50.817 46.328 1.00 15.06 ? 300 PHE A C   1 
ATOM   2277 O O   . PHE A 1 300 ? 0.635   51.461 45.619 1.00 14.51 ? 300 PHE A O   1 
ATOM   2278 C CB  . PHE A 1 300 ? -2.274  51.687 47.488 1.00 3.97  ? 300 PHE A CB  1 
ATOM   2279 C CG  . PHE A 1 300 ? -1.938  53.154 47.578 1.00 2.00  ? 300 PHE A CG  1 
ATOM   2280 C CD1 . PHE A 1 300 ? -0.647  53.579 47.878 1.00 6.22  ? 300 PHE A CD1 1 
ATOM   2281 C CD2 . PHE A 1 300 ? -2.897  54.127 47.326 1.00 2.00  ? 300 PHE A CD2 1 
ATOM   2282 C CE1 . PHE A 1 300 ? -0.261  54.926 47.908 1.00 2.00  ? 300 PHE A CE1 1 
ATOM   2283 C CE2 . PHE A 1 300 ? -2.524  55.471 47.327 1.00 5.48  ? 300 PHE A CE2 1 
ATOM   2284 C CZ  . PHE A 1 300 ? -1.205  55.878 47.602 1.00 4.57  ? 300 PHE A CZ  1 
ATOM   2285 N N   . PHE A 1 301 ? 0.300   49.917 47.225 1.00 14.57 ? 301 PHE A N   1 
ATOM   2286 C CA  . PHE A 1 301 ? 1.710   49.575 47.358 1.00 16.44 ? 301 PHE A CA  1 
ATOM   2287 C C   . PHE A 1 301 ? 1.699   48.117 46.982 1.00 18.97 ? 301 PHE A C   1 
ATOM   2288 O O   . PHE A 1 301 ? 1.300   47.310 47.818 1.00 15.36 ? 301 PHE A O   1 
ATOM   2289 C CB  . PHE A 1 301 ? 2.315   49.574 48.767 1.00 20.26 ? 301 PHE A CB  1 
ATOM   2290 C CG  . PHE A 1 301 ? 2.158   50.882 49.456 1.00 19.38 ? 301 PHE A CG  1 
ATOM   2291 C CD1 . PHE A 1 301 ? 1.015   51.131 50.198 1.00 16.64 ? 301 PHE A CD1 1 
ATOM   2292 C CD2 . PHE A 1 301 ? 3.141   51.831 49.315 1.00 17.20 ? 301 PHE A CD2 1 
ATOM   2293 C CE1 . PHE A 1 301 ? 0.861   52.369 50.778 1.00 20.02 ? 301 PHE A CE1 1 
ATOM   2294 C CE2 . PHE A 1 301 ? 2.976   53.063 49.893 1.00 17.07 ? 301 PHE A CE2 1 
ATOM   2295 C CZ  . PHE A 1 301 ? 1.839   53.339 50.615 1.00 17.77 ? 301 PHE A CZ  1 
ATOM   2296 N N   . PRO A 1 302 ? 2.156   47.804 45.742 1.00 19.98 ? 302 PRO A N   1 
ATOM   2297 C CA  . PRO A 1 302 ? 2.137   46.442 45.265 1.00 16.10 ? 302 PRO A CA  1 
ATOM   2298 C C   . PRO A 1 302 ? 2.770   45.444 46.183 1.00 18.12 ? 302 PRO A C   1 
ATOM   2299 O O   . PRO A 1 302 ? 2.380   44.290 46.309 1.00 24.70 ? 302 PRO A O   1 
ATOM   2300 C CB  . PRO A 1 302 ? 2.898   46.513 43.938 1.00 15.23 ? 302 PRO A CB  1 
ATOM   2301 C CG  . PRO A 1 302 ? 2.995   47.990 43.521 1.00 17.29 ? 302 PRO A CG  1 
ATOM   2302 C CD  . PRO A 1 302 ? 2.693   48.776 44.769 1.00 19.84 ? 302 PRO A CD  1 
ATOM   2303 N N   . THR A 1 303 ? 3.803   45.917 46.850 1.00 17.71 ? 303 THR A N   1 
ATOM   2304 C CA  . THR A 1 303 ? 4.518   44.971 47.658 1.00 16.86 ? 303 THR A CA  1 
ATOM   2305 C C   . THR A 1 303 ? 5.316   45.766 48.673 1.00 14.93 ? 303 THR A C   1 
ATOM   2306 O O   . THR A 1 303 ? 5.257   46.985 48.766 1.00 14.27 ? 303 THR A O   1 
ATOM   2307 C CB  . THR A 1 303 ? 5.349   44.105 46.652 1.00 11.04 ? 303 THR A CB  1 
ATOM   2308 O OG1 . THR A 1 303 ? 6.038   43.059 47.271 1.00 21.29 ? 303 THR A OG1 1 
ATOM   2309 C CG2 . THR A 1 303 ? 6.437   44.849 45.912 1.00 14.11 ? 303 THR A CG2 1 
ATOM   2310 N N   . SER A 1 304 ? 6.107   45.038 49.439 1.00 14.95 ? 304 SER A N   1 
ATOM   2311 C CA  . SER A 1 304 ? 6.844   45.713 50.466 1.00 17.35 ? 304 SER A CA  1 
ATOM   2312 C C   . SER A 1 304 ? 7.738   46.814 49.890 1.00 13.61 ? 304 SER A C   1 
ATOM   2313 O O   . SER A 1 304 ? 8.336   46.714 48.833 1.00 18.88 ? 304 SER A O   1 
ATOM   2314 C CB  . SER A 1 304 ? 7.452   44.680 51.444 1.00 16.49 ? 304 SER A CB  1 
ATOM   2315 O OG  . SER A 1 304 ? 8.685   44.145 50.982 1.00 19.24 ? 304 SER A OG  1 
ATOM   2316 N N   . LEU A 1 305 ? 7.856   47.871 50.656 1.00 7.18  ? 305 LEU A N   1 
ATOM   2317 C CA  . LEU A 1 305 ? 8.644   48.947 50.175 1.00 11.35 ? 305 LEU A CA  1 
ATOM   2318 C C   . LEU A 1 305 ? 10.078  48.584 50.071 1.00 12.61 ? 305 LEU A C   1 
ATOM   2319 O O   . LEU A 1 305 ? 10.855  49.237 49.399 1.00 13.75 ? 305 LEU A O   1 
ATOM   2320 C CB  . LEU A 1 305 ? 8.507   50.132 51.131 1.00 11.46 ? 305 LEU A CB  1 
ATOM   2321 C CG  . LEU A 1 305 ? 7.137   50.806 51.058 1.00 10.90 ? 305 LEU A CG  1 
ATOM   2322 C CD1 . LEU A 1 305 ? 5.995   49.923 51.528 1.00 13.58 ? 305 LEU A CD1 1 
ATOM   2323 C CD2 . LEU A 1 305 ? 7.150   52.090 51.878 1.00 12.95 ? 305 LEU A CD2 1 
ATOM   2324 N N   . GLU A 1 306 ? 10.462  47.546 50.790 1.00 16.51 ? 306 GLU A N   1 
ATOM   2325 C CA  . GLU A 1 306 ? 11.861  47.268 50.670 1.00 24.49 ? 306 GLU A CA  1 
ATOM   2326 C C   . GLU A 1 306 ? 12.059  46.668 49.308 1.00 26.64 ? 306 GLU A C   1 
ATOM   2327 O O   . GLU A 1 306 ? 13.050  46.956 48.643 1.00 27.35 ? 306 GLU A O   1 
ATOM   2328 C CB  . GLU A 1 306 ? 12.449  46.453 51.829 1.00 27.92 ? 306 GLU A CB  1 
ATOM   2329 C CG  . GLU A 1 306 ? 14.000  46.344 51.701 1.00 44.29 ? 306 GLU A CG  1 
ATOM   2330 C CD  . GLU A 1 306 ? 14.838  47.673 51.832 1.00 51.56 ? 306 GLU A CD  1 
ATOM   2331 O OE1 . GLU A 1 306 ? 14.240  48.757 51.894 1.00 53.90 ? 306 GLU A OE1 1 
ATOM   2332 O OE2 . GLU A 1 306 ? 16.091  47.606 51.874 1.00 51.81 ? 306 GLU A OE2 1 
ATOM   2333 N N   . SER A 1 307 ? 11.088  45.854 48.863 1.00 23.58 ? 307 SER A N   1 
ATOM   2334 C CA  . SER A 1 307 ? 11.326  45.309 47.541 1.00 26.86 ? 307 SER A CA  1 
ATOM   2335 C C   . SER A 1 307 ? 11.350  46.417 46.521 1.00 27.04 ? 307 SER A C   1 
ATOM   2336 O O   . SER A 1 307 ? 12.248  46.517 45.701 1.00 32.15 ? 307 SER A O   1 
ATOM   2337 C CB  . SER A 1 307 ? 10.245  44.340 47.091 1.00 31.69 ? 307 SER A CB  1 
ATOM   2338 O OG  . SER A 1 307 ? 9.919   43.489 48.168 1.00 39.67 ? 307 SER A OG  1 
ATOM   2339 N N   . MET A 1 308 ? 10.343  47.272 46.604 1.00 21.06 ? 308 MET A N   1 
ATOM   2340 C CA  . MET A 1 308 ? 10.268  48.341 45.643 1.00 19.74 ? 308 MET A CA  1 
ATOM   2341 C C   . MET A 1 308 ? 11.535  49.184 45.585 1.00 20.68 ? 308 MET A C   1 
ATOM   2342 O O   . MET A 1 308 ? 12.109  49.487 44.535 1.00 20.71 ? 308 MET A O   1 
ATOM   2343 C CB  . MET A 1 308 ? 8.999   49.155 45.884 1.00 15.77 ? 308 MET A CB  1 
ATOM   2344 C CG  . MET A 1 308 ? 7.767   48.277 45.726 1.00 18.72 ? 308 MET A CG  1 
ATOM   2345 S SD  . MET A 1 308 ? 6.215   49.212 45.823 1.00 26.26 ? 308 MET A SD  1 
ATOM   2346 C CE  . MET A 1 308 ? 6.292   50.154 44.270 1.00 27.51 ? 308 MET A CE  1 
ATOM   2347 N N   . LEU A 1 309 ? 12.001  49.517 46.775 1.00 19.88 ? 309 LEU A N   1 
ATOM   2348 C CA  . LEU A 1 309 ? 13.204  50.313 46.808 1.00 19.54 ? 309 LEU A CA  1 
ATOM   2349 C C   . LEU A 1 309 ? 14.333  49.529 46.168 1.00 21.61 ? 309 LEU A C   1 
ATOM   2350 O O   . LEU A 1 309 ? 15.106  49.998 45.349 1.00 19.95 ? 309 LEU A O   1 
ATOM   2351 C CB  . LEU A 1 309 ? 13.535  50.650 48.282 1.00 21.14 ? 309 LEU A CB  1 
ATOM   2352 C CG  . LEU A 1 309 ? 13.180  52.083 48.699 1.00 19.89 ? 309 LEU A CG  1 
ATOM   2353 C CD1 . LEU A 1 309 ? 11.689  52.369 48.594 1.00 25.10 ? 309 LEU A CD1 1 
ATOM   2354 C CD2 . LEU A 1 309 ? 13.623  52.280 50.128 1.00 26.51 ? 309 LEU A CD2 1 
ATOM   2355 N N   . ASN A 1 310 ? 14.361  48.260 46.546 1.00 22.26 ? 310 ASN A N   1 
ATOM   2356 C CA  . ASN A 1 310 ? 15.433  47.414 46.079 1.00 24.41 ? 310 ASN A CA  1 
ATOM   2357 C C   . ASN A 1 310 ? 15.487  47.170 44.592 1.00 24.69 ? 310 ASN A C   1 
ATOM   2358 O O   . ASN A 1 310 ? 16.552  46.882 44.039 1.00 25.07 ? 310 ASN A O   1 
ATOM   2359 C CB  . ASN A 1 310 ? 15.399  46.052 46.793 1.00 31.81 ? 310 ASN A CB  1 
ATOM   2360 C CG  . ASN A 1 310 ? 16.197  45.970 48.096 1.00 38.82 ? 310 ASN A CG  1 
ATOM   2361 O OD1 . ASN A 1 310 ? 16.835  46.894 48.593 1.00 42.25 ? 310 ASN A OD1 1 
ATOM   2362 N ND2 . ASN A 1 310 ? 16.150  44.760 48.667 1.00 42.69 ? 310 ASN A ND2 1 
ATOM   2363 N N   . SER A 1 311 ? 14.317  47.252 43.958 1.00 21.99 ? 311 SER A N   1 
ATOM   2364 C CA  . SER A 1 311 ? 14.264  46.967 42.525 1.00 17.99 ? 311 SER A CA  1 
ATOM   2365 C C   . SER A 1 311 ? 14.053  48.173 41.674 1.00 16.39 ? 311 SER A C   1 
ATOM   2366 O O   . SER A 1 311 ? 13.920  48.054 40.471 1.00 17.45 ? 311 SER A O   1 
ATOM   2367 C CB  . SER A 1 311 ? 13.233  45.893 42.207 1.00 13.75 ? 311 SER A CB  1 
ATOM   2368 O OG  . SER A 1 311 ? 11.951  46.305 42.652 1.00 25.72 ? 311 SER A OG  1 
ATOM   2369 N N   . GLY A 1 312 ? 13.959  49.360 42.256 1.00 18.88 ? 312 GLY A N   1 
ATOM   2370 C CA  . GLY A 1 312 ? 13.794  50.466 41.309 1.00 15.49 ? 312 GLY A CA  1 
ATOM   2371 C C   . GLY A 1 312 ? 12.384  50.611 40.872 1.00 17.23 ? 312 GLY A C   1 
ATOM   2372 O O   . GLY A 1 312 ? 12.051  51.417 40.023 1.00 21.39 ? 312 GLY A O   1 
ATOM   2373 N N   . ASN A 1 313 ? 11.523  49.813 41.473 1.00 14.33 ? 313 ASN A N   1 
ATOM   2374 C CA  . ASN A 1 313 ? 10.154  49.943 41.064 1.00 11.44 ? 313 ASN A CA  1 
ATOM   2375 C C   . ASN A 1 313 ? 9.601   51.196 41.692 1.00 13.19 ? 313 ASN A C   1 
ATOM   2376 O O   . ASN A 1 313 ? 9.074   51.172 42.798 1.00 19.37 ? 313 ASN A O   1 
ATOM   2377 C CB  . ASN A 1 313 ? 9.427   48.712 41.576 1.00 11.86 ? 313 ASN A CB  1 
ATOM   2378 C CG  . ASN A 1 313 ? 7.931   48.714 41.324 1.00 14.38 ? 313 ASN A CG  1 
ATOM   2379 O OD1 . ASN A 1 313 ? 7.245   49.702 41.118 1.00 13.69 ? 313 ASN A OD1 1 
ATOM   2380 N ND2 . ASN A 1 313 ? 7.393   47.500 41.364 1.00 15.55 ? 313 ASN A ND2 1 
ATOM   2381 N N   . PHE A 1 314 ? 9.787   52.315 41.035 1.00 11.07 ? 314 PHE A N   1 
ATOM   2382 C CA  . PHE A 1 314 ? 9.254   53.558 41.556 1.00 12.45 ? 314 PHE A CA  1 
ATOM   2383 C C   . PHE A 1 314 ? 9.479   54.625 40.496 1.00 14.49 ? 314 PHE A C   1 
ATOM   2384 O O   . PHE A 1 314 ? 10.282  54.446 39.575 1.00 16.57 ? 314 PHE A O   1 
ATOM   2385 C CB  . PHE A 1 314 ? 9.916   53.945 42.888 1.00 12.00 ? 314 PHE A CB  1 
ATOM   2386 C CG  . PHE A 1 314 ? 11.418  53.760 42.953 1.00 6.94  ? 314 PHE A CG  1 
ATOM   2387 C CD1 . PHE A 1 314 ? 12.269  54.695 42.381 1.00 2.00  ? 314 PHE A CD1 1 
ATOM   2388 C CD2 . PHE A 1 314 ? 11.943  52.665 43.606 1.00 7.54  ? 314 PHE A CD2 1 
ATOM   2389 C CE1 . PHE A 1 314 ? 13.618  54.590 42.462 1.00 2.00  ? 314 PHE A CE1 1 
ATOM   2390 C CE2 . PHE A 1 314 ? 13.313  52.549 43.691 1.00 3.25  ? 314 PHE A CE2 1 
ATOM   2391 C CZ  . PHE A 1 314 ? 14.133  53.510 43.129 1.00 2.00  ? 314 PHE A CZ  1 
ATOM   2392 N N   . LYS A 1 315 ? 8.748   55.745 40.626 1.00 11.92 ? 315 LYS A N   1 
ATOM   2393 C CA  . LYS A 1 315 ? 8.908   56.853 39.676 1.00 11.68 ? 315 LYS A CA  1 
ATOM   2394 C C   . LYS A 1 315 ? 10.359  57.225 39.639 1.00 14.42 ? 315 LYS A C   1 
ATOM   2395 O O   . LYS A 1 315 ? 10.956  57.130 40.696 1.00 17.05 ? 315 LYS A O   1 
ATOM   2396 C CB  . LYS A 1 315 ? 8.249   58.165 40.188 1.00 4.92  ? 315 LYS A CB  1 
ATOM   2397 C CG  . LYS A 1 315 ? 7.867   59.138 39.079 1.00 2.59  ? 315 LYS A CG  1 
ATOM   2398 C CD  . LYS A 1 315 ? 6.832   60.154 39.506 1.00 7.83  ? 315 LYS A CD  1 
ATOM   2399 C CE  . LYS A 1 315 ? 6.650   61.333 38.545 1.00 13.38 ? 315 LYS A CE  1 
ATOM   2400 N NZ  . LYS A 1 315 ? 6.465   60.911 37.176 1.00 17.15 ? 315 LYS A NZ  1 
ATOM   2401 N N   . LYS A 1 316 ? 10.893  57.700 38.485 1.00 15.26 ? 316 LYS A N   1 
ATOM   2402 C CA  . LYS A 1 316 ? 12.304  58.052 38.454 1.00 11.99 ? 316 LYS A CA  1 
ATOM   2403 C C   . LYS A 1 316 ? 12.532  59.447 37.987 1.00 10.70 ? 316 LYS A C   1 
ATOM   2404 O O   . LYS A 1 316 ? 12.870  59.657 36.852 1.00 15.81 ? 316 LYS A O   1 
ATOM   2405 C CB  . LYS A 1 316 ? 13.137  57.079 37.635 1.00 2.00  ? 316 LYS A CB  1 
ATOM   2406 C CG  . LYS A 1 316 ? 13.054  55.733 38.318 1.00 8.12  ? 316 LYS A CG  1 
ATOM   2407 C CD  . LYS A 1 316 ? 13.437  54.566 37.441 1.00 19.07 ? 316 LYS A CD  1 
ATOM   2408 C CE  . LYS A 1 316 ? 13.062  53.247 38.092 1.00 19.80 ? 316 LYS A CE  1 
ATOM   2409 N NZ  . LYS A 1 316 ? 13.431  52.183 37.176 1.00 28.64 ? 316 LYS A NZ  1 
ATOM   2410 N N   . THR A 1 317 ? 12.349  60.390 38.882 1.00 9.75  ? 317 THR A N   1 
ATOM   2411 C CA  . THR A 1 317 ? 12.564  61.808 38.687 1.00 4.96  ? 317 THR A CA  1 
ATOM   2412 C C   . THR A 1 317 ? 13.698  62.143 39.613 1.00 8.10  ? 317 THR A C   1 
ATOM   2413 O O   . THR A 1 317 ? 14.418  61.270 40.111 1.00 10.60 ? 317 THR A O   1 
ATOM   2414 C CB  . THR A 1 317 ? 11.295  62.465 39.160 1.00 3.46  ? 317 THR A CB  1 
ATOM   2415 O OG1 . THR A 1 317 ? 11.191  63.835 38.837 1.00 7.11  ? 317 THR A OG1 1 
ATOM   2416 C CG2 . THR A 1 317 ? 10.937  62.200 40.618 1.00 2.00  ? 317 THR A CG2 1 
ATOM   2417 N N   . GLN A 1 318 ? 13.861  63.429 39.849 1.00 5.98  ? 318 GLN A N   1 
ATOM   2418 C CA  . GLN A 1 318 ? 14.864  63.884 40.763 1.00 9.54  ? 318 GLN A CA  1 
ATOM   2419 C C   . GLN A 1 318 ? 14.075  64.379 41.916 1.00 15.67 ? 318 GLN A C   1 
ATOM   2420 O O   . GLN A 1 318 ? 12.934  64.805 41.742 1.00 19.26 ? 318 GLN A O   1 
ATOM   2421 C CB  . GLN A 1 318 ? 15.707  65.018 40.238 1.00 11.86 ? 318 GLN A CB  1 
ATOM   2422 C CG  . GLN A 1 318 ? 14.919  66.195 39.699 1.00 18.34 ? 318 GLN A CG  1 
ATOM   2423 C CD  . GLN A 1 318 ? 14.248  65.831 38.428 1.00 24.98 ? 318 GLN A CD  1 
ATOM   2424 O OE1 . GLN A 1 318 ? 13.026  65.861 38.353 1.00 24.05 ? 318 GLN A OE1 1 
ATOM   2425 N NE2 . GLN A 1 318 ? 15.076  65.408 37.464 1.00 23.68 ? 318 GLN A NE2 1 
ATOM   2426 N N   . ILE A 1 319 ? 14.708  64.328 43.097 1.00 18.35 ? 319 ILE A N   1 
ATOM   2427 C CA  . ILE A 1 319 ? 14.080  64.740 44.325 1.00 12.61 ? 319 ILE A CA  1 
ATOM   2428 C C   . ILE A 1 319 ? 15.046  65.576 45.076 1.00 13.59 ? 319 ILE A C   1 
ATOM   2429 O O   . ILE A 1 319 ? 16.262  65.539 44.861 1.00 12.14 ? 319 ILE A O   1 
ATOM   2430 C CB  . ILE A 1 319 ? 13.786  63.488 45.168 1.00 8.76  ? 319 ILE A CB  1 
ATOM   2431 C CG1 . ILE A 1 319 ? 15.076  62.654 45.306 1.00 8.48  ? 319 ILE A CG1 1 
ATOM   2432 C CG2 . ILE A 1 319 ? 12.617  62.644 44.566 1.00 9.10  ? 319 ILE A CG2 1 
ATOM   2433 C CD1 . ILE A 1 319 ? 14.873  61.428 46.206 1.00 17.48 ? 319 ILE A CD1 1 
ATOM   2434 N N   . LEU A 1 320 ? 14.445  66.293 46.002 1.00 13.17 ? 320 LEU A N   1 
ATOM   2435 C CA  . LEU A 1 320 ? 15.177  67.136 46.912 1.00 16.72 ? 320 LEU A CA  1 
ATOM   2436 C C   . LEU A 1 320 ? 14.692  66.751 48.299 1.00 21.17 ? 320 LEU A C   1 
ATOM   2437 O O   . LEU A 1 320 ? 13.485  66.813 48.535 1.00 24.34 ? 320 LEU A O   1 
ATOM   2438 C CB  . LEU A 1 320 ? 14.820  68.593 46.682 1.00 10.43 ? 320 LEU A CB  1 
ATOM   2439 C CG  . LEU A 1 320 ? 15.788  69.488 47.443 1.00 6.00  ? 320 LEU A CG  1 
ATOM   2440 C CD1 . LEU A 1 320 ? 16.327  70.551 46.481 1.00 4.58  ? 320 LEU A CD1 1 
ATOM   2441 C CD2 . LEU A 1 320 ? 15.012  70.131 48.590 1.00 4.39  ? 320 LEU A CD2 1 
ATOM   2442 N N   . LEU A 1 321 ? 15.571  66.347 49.231 1.00 20.61 ? 321 LEU A N   1 
ATOM   2443 C CA  . LEU A 1 321 ? 15.059  65.982 50.548 1.00 18.31 ? 321 LEU A CA  1 
ATOM   2444 C C   . LEU A 1 321 ? 16.054  66.326 51.626 1.00 22.75 ? 321 LEU A C   1 
ATOM   2445 O O   . LEU A 1 321 ? 17.206  66.646 51.390 1.00 24.64 ? 321 LEU A O   1 
ATOM   2446 C CB  . LEU A 1 321 ? 14.558  64.552 50.622 1.00 9.17  ? 321 LEU A CB  1 
ATOM   2447 C CG  . LEU A 1 321 ? 15.592  63.449 50.482 1.00 5.48  ? 321 LEU A CG  1 
ATOM   2448 C CD1 . LEU A 1 321 ? 14.808  62.132 50.271 1.00 4.28  ? 321 LEU A CD1 1 
ATOM   2449 C CD2 . LEU A 1 321 ? 16.625  63.725 49.384 1.00 2.00  ? 321 LEU A CD2 1 
ATOM   2450 N N   . GLY A 1 322 ? 15.607  66.305 52.862 1.00 26.38 ? 322 GLY A N   1 
ATOM   2451 C CA  . GLY A 1 322 ? 16.562  66.659 53.888 1.00 23.11 ? 322 GLY A CA  1 
ATOM   2452 C C   . GLY A 1 322 ? 15.959  66.404 55.212 1.00 25.50 ? 322 GLY A C   1 
ATOM   2453 O O   . GLY A 1 322 ? 14.796  66.027 55.394 1.00 24.70 ? 322 GLY A O   1 
ATOM   2454 N N   . VAL A 1 323 ? 16.833  66.622 56.167 1.00 22.39 ? 323 VAL A N   1 
ATOM   2455 C CA  . VAL A 1 323 ? 16.544  66.384 57.535 1.00 20.48 ? 323 VAL A CA  1 
ATOM   2456 C C   . VAL A 1 323 ? 17.004  67.571 58.328 1.00 21.64 ? 323 VAL A C   1 
ATOM   2457 O O   . VAL A 1 323 ? 17.862  68.294 57.837 1.00 28.34 ? 323 VAL A O   1 
ATOM   2458 C CB  . VAL A 1 323 ? 17.509  65.199 57.800 1.00 16.88 ? 323 VAL A CB  1 
ATOM   2459 C CG1 . VAL A 1 323 ? 17.861  64.996 59.253 1.00 24.57 ? 323 VAL A CG1 1 
ATOM   2460 C CG2 . VAL A 1 323 ? 16.926  63.886 57.250 1.00 14.06 ? 323 VAL A CG2 1 
ATOM   2461 N N   . ASN A 1 324 ? 16.466  67.782 59.541 1.00 17.44 ? 324 ASN A N   1 
ATOM   2462 C CA  . ASN A 1 324 ? 16.997  68.887 60.356 1.00 15.42 ? 324 ASN A CA  1 
ATOM   2463 C C   . ASN A 1 324 ? 17.605  68.380 61.674 1.00 16.20 ? 324 ASN A C   1 
ATOM   2464 O O   . ASN A 1 324 ? 17.255  67.316 62.157 1.00 20.40 ? 324 ASN A O   1 
ATOM   2465 C CB  . ASN A 1 324 ? 16.246  70.164 60.264 1.00 13.30 ? 324 ASN A CB  1 
ATOM   2466 C CG  . ASN A 1 324 ? 14.939  70.177 60.795 1.00 8.71  ? 324 ASN A CG  1 
ATOM   2467 O OD1 . ASN A 1 324 ? 14.114  70.944 60.338 1.00 9.56  ? 324 ASN A OD1 1 
ATOM   2468 N ND2 . ASN A 1 324 ? 14.739  69.338 61.768 1.00 19.48 ? 324 ASN A ND2 1 
ATOM   2469 N N   . LYS A 1 325 ? 18.445  69.188 62.269 1.00 13.08 ? 325 LYS A N   1 
ATOM   2470 C CA  . LYS A 1 325 ? 19.238  68.783 63.404 1.00 14.31 ? 325 LYS A CA  1 
ATOM   2471 C C   . LYS A 1 325 ? 18.654  68.005 64.519 1.00 19.62 ? 325 LYS A C   1 
ATOM   2472 O O   . LYS A 1 325 ? 19.151  66.934 64.844 1.00 23.35 ? 325 LYS A O   1 
ATOM   2473 C CB  . LYS A 1 325 ? 20.097  69.934 63.875 1.00 14.95 ? 325 LYS A CB  1 
ATOM   2474 C CG  . LYS A 1 325 ? 21.374  69.562 64.617 1.00 14.37 ? 325 LYS A CG  1 
ATOM   2475 C CD  . LYS A 1 325 ? 22.026  70.837 65.225 1.00 14.80 ? 325 LYS A CD  1 
ATOM   2476 C CE  . LYS A 1 325 ? 23.552  70.778 65.271 1.00 17.81 ? 325 LYS A CE  1 
ATOM   2477 N N   . ASP A 1 326 ? 17.589  68.535 65.141 1.00 21.54 ? 326 ASP A N   1 
ATOM   2478 C CA  . ASP A 1 326 ? 17.012  67.822 66.293 1.00 17.94 ? 326 ASP A CA  1 
ATOM   2479 C C   . ASP A 1 326 ? 15.643  67.321 65.968 1.00 17.03 ? 326 ASP A C   1 
ATOM   2480 O O   . ASP A 1 326 ? 14.574  67.889 66.223 1.00 16.30 ? 326 ASP A O   1 
ATOM   2481 C CB  . ASP A 1 326 ? 16.985  68.754 67.490 1.00 20.54 ? 326 ASP A CB  1 
ATOM   2482 C CG  . ASP A 1 326 ? 18.393  69.189 67.779 1.00 22.40 ? 326 ASP A CG  1 
ATOM   2483 O OD1 . ASP A 1 326 ? 19.151  68.264 68.079 1.00 27.99 ? 326 ASP A OD1 1 
ATOM   2484 O OD2 . ASP A 1 326 ? 18.728  70.387 67.682 1.00 17.31 ? 326 ASP A OD2 1 
ATOM   2485 N N   . GLU A 1 327 ? 15.689  66.142 65.383 1.00 13.08 ? 327 GLU A N   1 
ATOM   2486 C CA  . GLU A 1 327 ? 14.383  65.651 65.033 1.00 10.56 ? 327 GLU A CA  1 
ATOM   2487 C C   . GLU A 1 327 ? 13.602  65.204 66.212 1.00 11.94 ? 327 GLU A C   1 
ATOM   2488 O O   . GLU A 1 327 ? 12.417  65.523 66.315 1.00 12.18 ? 327 GLU A O   1 
ATOM   2489 C CB  . GLU A 1 327 ? 14.478  64.533 64.013 1.00 13.25 ? 327 GLU A CB  1 
ATOM   2490 C CG  . GLU A 1 327 ? 15.143  65.054 62.739 1.00 12.38 ? 327 GLU A CG  1 
ATOM   2491 C CD  . GLU A 1 327 ? 14.136  65.782 61.847 1.00 9.90  ? 327 GLU A CD  1 
ATOM   2492 O OE1 . GLU A 1 327 ? 13.084  66.208 62.320 1.00 13.13 ? 327 GLU A OE1 1 
ATOM   2493 O OE2 . GLU A 1 327 ? 14.389  65.891 60.658 1.00 5.00  ? 327 GLU A OE2 1 
ATOM   2494 N N   . GLY A 1 328 ? 14.346  64.458 67.067 1.00 11.61 ? 328 GLY A N   1 
ATOM   2495 C CA  . GLY A 1 328 ? 13.822  63.812 68.309 1.00 14.83 ? 328 GLY A CA  1 
ATOM   2496 C C   . GLY A 1 328 ? 12.981  64.608 69.355 1.00 13.95 ? 328 GLY A C   1 
ATOM   2497 O O   . GLY A 1 328 ? 11.889  64.241 69.792 1.00 12.76 ? 328 GLY A O   1 
ATOM   2498 N N   . SER A 1 329 ? 13.562  65.728 69.750 1.00 12.44 ? 329 SER A N   1 
ATOM   2499 C CA  . SER A 1 329 ? 13.021  66.635 70.689 1.00 11.70 ? 329 SER A CA  1 
ATOM   2500 C C   . SER A 1 329 ? 11.533  66.615 70.844 1.00 16.53 ? 329 SER A C   1 
ATOM   2501 O O   . SER A 1 329 ? 11.046  66.231 71.892 1.00 24.06 ? 329 SER A O   1 
ATOM   2502 C CB  . SER A 1 329 ? 13.497  68.050 70.304 1.00 9.64  ? 329 SER A CB  1 
ATOM   2503 O OG  . SER A 1 329 ? 14.911  67.960 70.306 1.00 10.52 ? 329 SER A OG  1 
ATOM   2504 N N   . PHE A 1 330 ? 10.788  66.967 69.816 1.00 14.20 ? 330 PHE A N   1 
ATOM   2505 C CA  . PHE A 1 330 ? 9.348   67.043 70.042 1.00 15.21 ? 330 PHE A CA  1 
ATOM   2506 C C   . PHE A 1 330 ? 8.659   65.850 70.713 1.00 13.50 ? 330 PHE A C   1 
ATOM   2507 O O   . PHE A 1 330 ? 7.713   65.967 71.472 1.00 10.51 ? 330 PHE A O   1 
ATOM   2508 C CB  . PHE A 1 330 ? 8.628   67.354 68.684 1.00 21.91 ? 330 PHE A CB  1 
ATOM   2509 C CG  . PHE A 1 330 ? 7.841   68.652 68.559 1.00 24.16 ? 330 PHE A CG  1 
ATOM   2510 C CD1 . PHE A 1 330 ? 7.323   69.331 69.649 1.00 23.60 ? 330 PHE A CD1 1 
ATOM   2511 C CD2 . PHE A 1 330 ? 7.580   69.160 67.298 1.00 27.90 ? 330 PHE A CD2 1 
ATOM   2512 C CE1 . PHE A 1 330 ? 6.559   70.462 69.465 1.00 21.11 ? 330 PHE A CE1 1 
ATOM   2513 C CE2 . PHE A 1 330 ? 6.817   70.309 67.121 1.00 30.79 ? 330 PHE A CE2 1 
ATOM   2514 C CZ  . PHE A 1 330 ? 6.297   70.960 68.213 1.00 27.19 ? 330 PHE A CZ  1 
ATOM   2515 N N   . PHE A 1 331 ? 9.140   64.670 70.380 1.00 16.64 ? 331 PHE A N   1 
ATOM   2516 C CA  . PHE A 1 331 ? 8.528   63.442 70.859 1.00 14.30 ? 331 PHE A CA  1 
ATOM   2517 C C   . PHE A 1 331 ? 8.980   63.190 72.210 1.00 12.87 ? 331 PHE A C   1 
ATOM   2518 O O   . PHE A 1 331 ? 8.196   62.762 73.020 1.00 14.49 ? 331 PHE A O   1 
ATOM   2519 C CB  . PHE A 1 331 ? 8.887   62.297 69.914 1.00 15.15 ? 331 PHE A CB  1 
ATOM   2520 C CG  . PHE A 1 331 ? 8.503   62.686 68.507 1.00 14.76 ? 331 PHE A CG  1 
ATOM   2521 C CD1 . PHE A 1 331 ? 7.204   62.456 68.056 1.00 17.31 ? 331 PHE A CD1 1 
ATOM   2522 C CD2 . PHE A 1 331 ? 9.416   63.345 67.701 1.00 8.02  ? 331 PHE A CD2 1 
ATOM   2523 C CE1 . PHE A 1 331 ? 6.807   62.909 66.804 1.00 12.74 ? 331 PHE A CE1 1 
ATOM   2524 C CE2 . PHE A 1 331 ? 9.021   63.813 66.479 1.00 7.85  ? 331 PHE A CE2 1 
ATOM   2525 C CZ  . PHE A 1 331 ? 7.728   63.591 66.035 1.00 14.96 ? 331 PHE A CZ  1 
ATOM   2526 N N   . LEU A 1 332 ? 10.280  63.456 72.440 1.00 10.54 ? 332 LEU A N   1 
ATOM   2527 C CA  . LEU A 1 332 ? 10.912  63.300 73.755 1.00 5.44  ? 332 LEU A CA  1 
ATOM   2528 C C   . LEU A 1 332 ? 10.157  64.186 74.662 1.00 7.06  ? 332 LEU A C   1 
ATOM   2529 O O   . LEU A 1 332 ? 9.592   63.653 75.579 1.00 11.47 ? 332 LEU A O   1 
ATOM   2530 C CB  . LEU A 1 332 ? 12.402  63.610 73.732 1.00 5.52  ? 332 LEU A CB  1 
ATOM   2531 C CG  . LEU A 1 332 ? 13.190  62.440 73.179 1.00 2.00  ? 332 LEU A CG  1 
ATOM   2532 C CD1 . LEU A 1 332 ? 14.631  62.872 73.010 1.00 2.00  ? 332 LEU A CD1 1 
ATOM   2533 C CD2 . LEU A 1 332 ? 13.087  61.195 74.051 1.00 2.00  ? 332 LEU A CD2 1 
ATOM   2534 N N   . LEU A 1 333 ? 10.080  65.492 74.383 1.00 9.38  ? 333 LEU A N   1 
ATOM   2535 C CA  . LEU A 1 333 ? 9.343   66.472 75.184 1.00 4.78  ? 333 LEU A CA  1 
ATOM   2536 C C   . LEU A 1 333 ? 8.041   65.946 75.530 1.00 2.00  ? 333 LEU A C   1 
ATOM   2537 O O   . LEU A 1 333 ? 7.810   65.726 76.679 1.00 6.98  ? 333 LEU A O   1 
ATOM   2538 C CB  . LEU A 1 333 ? 9.073   67.774 74.419 1.00 8.12  ? 333 LEU A CB  1 
ATOM   2539 C CG  . LEU A 1 333 ? 8.261   68.827 75.182 1.00 9.53  ? 333 LEU A CG  1 
ATOM   2540 C CD1 . LEU A 1 333 ? 9.195   69.463 76.196 1.00 9.94  ? 333 LEU A CD1 1 
ATOM   2541 C CD2 . LEU A 1 333 ? 7.684   69.947 74.296 1.00 3.10  ? 333 LEU A CD2 1 
ATOM   2542 N N   . TYR A 1 334 ? 7.179   65.760 74.549 1.00 5.30  ? 334 TYR A N   1 
ATOM   2543 C CA  . TYR A 1 334 ? 5.836   65.229 74.783 1.00 4.49  ? 334 TYR A CA  1 
ATOM   2544 C C   . TYR A 1 334 ? 5.789   63.724 75.119 1.00 7.87  ? 334 TYR A C   1 
ATOM   2545 O O   . TYR A 1 334 ? 4.742   63.131 74.909 1.00 14.48 ? 334 TYR A O   1 
ATOM   2546 C CB  . TYR A 1 334 ? 4.973   65.383 73.528 1.00 2.00  ? 334 TYR A CB  1 
ATOM   2547 C CG  . TYR A 1 334 ? 4.467   66.765 73.238 1.00 3.04  ? 334 TYR A CG  1 
ATOM   2548 C CD1 . TYR A 1 334 ? 5.320   67.746 72.754 1.00 4.90  ? 334 TYR A CD1 1 
ATOM   2549 C CD2 . TYR A 1 334 ? 3.114   67.016 73.340 1.00 2.00  ? 334 TYR A CD2 1 
ATOM   2550 C CE1 . TYR A 1 334 ? 4.781   68.930 72.295 1.00 7.90  ? 334 TYR A CE1 1 
ATOM   2551 C CE2 . TYR A 1 334 ? 2.599   68.202 72.910 1.00 2.00  ? 334 TYR A CE2 1 
ATOM   2552 C CZ  . TYR A 1 334 ? 3.409   69.154 72.341 1.00 5.47  ? 334 TYR A CZ  1 
ATOM   2553 O OH  . TYR A 1 334 ? 2.856   70.299 71.790 1.00 2.00  ? 334 TYR A OH  1 
ATOM   2554 N N   . GLY A 1 335 ? 6.822   63.035 75.607 1.00 9.10  ? 335 GLY A N   1 
ATOM   2555 C CA  . GLY A 1 335 ? 6.484   61.612 75.843 1.00 8.66  ? 335 GLY A CA  1 
ATOM   2556 C C   . GLY A 1 335 ? 7.483   60.751 76.561 1.00 10.19 ? 335 GLY A C   1 
ATOM   2557 O O   . GLY A 1 335 ? 7.240   59.573 76.813 1.00 10.02 ? 335 GLY A O   1 
ATOM   2558 N N   . ALA A 1 336 ? 8.621   61.350 76.866 1.00 10.36 ? 336 ALA A N   1 
ATOM   2559 C CA  . ALA A 1 336 ? 9.674   60.653 77.541 1.00 13.40 ? 336 ALA A CA  1 
ATOM   2560 C C   . ALA A 1 336 ? 9.902   61.316 78.912 1.00 16.03 ? 336 ALA A C   1 
ATOM   2561 O O   . ALA A 1 336 ? 9.894   62.535 79.102 1.00 13.46 ? 336 ALA A O   1 
ATOM   2562 C CB  . ALA A 1 336 ? 10.969  60.665 76.730 1.00 13.70 ? 336 ALA A CB  1 
ATOM   2563 N N   . PRO A 1 337 ? 10.089  60.432 79.893 1.00 15.81 ? 337 PRO A N   1 
ATOM   2564 C CA  . PRO A 1 337 ? 10.046  60.856 81.269 1.00 14.87 ? 337 PRO A CA  1 
ATOM   2565 C C   . PRO A 1 337 ? 11.316  61.631 81.569 1.00 17.81 ? 337 PRO A C   1 
ATOM   2566 O O   . PRO A 1 337 ? 12.378  61.147 81.197 1.00 20.80 ? 337 PRO A O   1 
ATOM   2567 C CB  . PRO A 1 337 ? 10.095  59.547 82.007 1.00 13.18 ? 337 PRO A CB  1 
ATOM   2568 C CG  . PRO A 1 337 ? 10.766  58.538 81.067 1.00 19.21 ? 337 PRO A CG  1 
ATOM   2569 C CD  . PRO A 1 337 ? 10.488  59.045 79.687 1.00 17.11 ? 337 PRO A CD  1 
ATOM   2570 N N   . GLY A 1 338 ? 11.191  62.790 82.253 1.00 12.92 ? 338 GLY A N   1 
ATOM   2571 C CA  . GLY A 1 338 ? 12.343  63.602 82.605 1.00 14.06 ? 338 GLY A CA  1 
ATOM   2572 C C   . GLY A 1 338 ? 12.398  64.933 81.880 1.00 20.44 ? 338 GLY A C   1 
ATOM   2573 O O   . GLY A 1 338 ? 12.951  65.950 82.332 1.00 23.27 ? 338 GLY A O   1 
ATOM   2574 N N   . PHE A 1 339 ? 11.731  64.915 80.714 1.00 18.54 ? 339 PHE A N   1 
ATOM   2575 C CA  . PHE A 1 339 ? 11.738  66.090 79.852 1.00 12.57 ? 339 PHE A CA  1 
ATOM   2576 C C   . PHE A 1 339 ? 10.624  67.014 80.101 1.00 11.47 ? 339 PHE A C   1 
ATOM   2577 O O   . PHE A 1 339 ? 9.485   66.600 80.263 1.00 16.74 ? 339 PHE A O   1 
ATOM   2578 C CB  . PHE A 1 339 ? 11.527  65.613 78.414 1.00 12.86 ? 339 PHE A CB  1 
ATOM   2579 C CG  . PHE A 1 339 ? 12.708  64.842 77.911 1.00 4.39  ? 339 PHE A CG  1 
ATOM   2580 C CD1 . PHE A 1 339 ? 13.806  65.532 77.434 1.00 2.74  ? 339 PHE A CD1 1 
ATOM   2581 C CD2 . PHE A 1 339 ? 12.690  63.470 77.908 1.00 2.14  ? 339 PHE A CD2 1 
ATOM   2582 C CE1 . PHE A 1 339 ? 14.838  64.846 76.828 1.00 4.11  ? 339 PHE A CE1 1 
ATOM   2583 C CE2 . PHE A 1 339 ? 13.756  62.791 77.355 1.00 8.52  ? 339 PHE A CE2 1 
ATOM   2584 C CZ  . PHE A 1 339 ? 14.808  63.475 76.770 1.00 2.00  ? 339 PHE A CZ  1 
ATOM   2585 N N   . SER A 1 340 ? 10.928  68.294 80.069 1.00 7.81  ? 340 SER A N   1 
ATOM   2586 C CA  . SER A 1 340 ? 9.859   69.213 80.310 1.00 6.90  ? 340 SER A CA  1 
ATOM   2587 C C   . SER A 1 340 ? 10.275  70.497 79.746 1.00 5.68  ? 340 SER A C   1 
ATOM   2588 O O   . SER A 1 340 ? 11.416  70.890 79.826 1.00 7.42  ? 340 SER A O   1 
ATOM   2589 C CB  . SER A 1 340 ? 9.528   69.424 81.802 1.00 5.51  ? 340 SER A CB  1 
ATOM   2590 O OG  . SER A 1 340 ? 10.586  69.004 82.630 1.00 15.97 ? 340 SER A OG  1 
ATOM   2591 N N   . LYS A 1 341 ? 9.304   71.156 79.132 1.00 8.35  ? 341 LYS A N   1 
ATOM   2592 C CA  . LYS A 1 341 ? 9.481   72.462 78.575 1.00 9.43  ? 341 LYS A CA  1 
ATOM   2593 C C   . LYS A 1 341 ? 9.763   73.220 79.852 1.00 13.83 ? 341 LYS A C   1 
ATOM   2594 O O   . LYS A 1 341 ? 9.186   72.809 80.843 1.00 21.77 ? 341 LYS A O   1 
ATOM   2595 C CB  . LYS A 1 341 ? 8.063   72.810 78.061 1.00 10.69 ? 341 LYS A CB  1 
ATOM   2596 C CG  . LYS A 1 341 ? 8.056   73.928 77.036 1.00 21.21 ? 341 LYS A CG  1 
ATOM   2597 C CD  . LYS A 1 341 ? 7.867   75.291 77.681 1.00 17.29 ? 341 LYS A CD  1 
ATOM   2598 C CE  . LYS A 1 341 ? 6.400   75.502 78.076 1.00 11.05 ? 341 LYS A CE  1 
ATOM   2599 N NZ  . LYS A 1 341 ? 6.088   76.826 77.724 1.00 20.78 ? 341 LYS A NZ  1 
ATOM   2600 N N   . ASP A 1 342 ? 10.576  74.251 79.928 1.00 13.94 ? 342 ASP A N   1 
ATOM   2601 C CA  . ASP A 1 342 ? 10.707  74.837 81.277 1.00 13.91 ? 342 ASP A CA  1 
ATOM   2602 C C   . ASP A 1 342 ? 11.832  74.230 82.117 1.00 17.30 ? 342 ASP A C   1 
ATOM   2603 O O   . ASP A 1 342 ? 12.369  74.888 83.007 1.00 17.86 ? 342 ASP A O   1 
ATOM   2604 C CB  . ASP A 1 342 ? 9.429   75.041 82.118 1.00 16.49 ? 342 ASP A CB  1 
ATOM   2605 C CG  . ASP A 1 342 ? 8.429   75.969 81.432 1.00 21.70 ? 342 ASP A CG  1 
ATOM   2606 O OD1 . ASP A 1 342 ? 8.861   76.784 80.615 1.00 25.60 ? 342 ASP A OD1 1 
ATOM   2607 O OD2 . ASP A 1 342 ? 7.232   75.910 81.739 1.00 22.19 ? 342 ASP A OD2 1 
ATOM   2608 N N   . SER A 1 343 ? 12.194  72.963 81.896 1.00 17.90 ? 343 SER A N   1 
ATOM   2609 C CA  . SER A 1 343 ? 13.350  72.415 82.627 1.00 18.49 ? 343 SER A CA  1 
ATOM   2610 C C   . SER A 1 343 ? 14.384  72.445 81.559 1.00 18.87 ? 343 SER A C   1 
ATOM   2611 O O   . SER A 1 343 ? 14.081  72.755 80.419 1.00 20.88 ? 343 SER A O   1 
ATOM   2612 C CB  . SER A 1 343 ? 13.209  70.907 82.868 1.00 20.87 ? 343 SER A CB  1 
ATOM   2613 O OG  . SER A 1 343 ? 12.850  70.606 84.196 1.00 31.10 ? 343 SER A OG  1 
ATOM   2614 N N   . GLU A 1 344 ? 15.631  72.122 81.923 1.00 18.66 ? 344 GLU A N   1 
ATOM   2615 C CA  . GLU A 1 344 ? 16.668  72.054 80.882 1.00 16.39 ? 344 GLU A CA  1 
ATOM   2616 C C   . GLU A 1 344 ? 16.985  70.599 80.861 1.00 17.75 ? 344 GLU A C   1 
ATOM   2617 O O   . GLU A 1 344 ? 18.101  70.131 80.856 1.00 23.93 ? 344 GLU A O   1 
ATOM   2618 C CB  . GLU A 1 344 ? 17.855  73.122 80.885 1.00 20.05 ? 344 GLU A CB  1 
ATOM   2619 C CG  . GLU A 1 344 ? 19.167  73.008 81.671 1.00 9.80  ? 344 GLU A CG  1 
ATOM   2620 N N   . SER A 1 345 ? 15.893  69.882 80.948 1.00 19.19 ? 345 SER A N   1 
ATOM   2621 C CA  . SER A 1 345 ? 15.801  68.449 80.964 1.00 20.55 ? 345 SER A CA  1 
ATOM   2622 C C   . SER A 1 345 ? 17.079  67.634 80.933 1.00 21.86 ? 345 SER A C   1 
ATOM   2623 O O   . SER A 1 345 ? 17.428  67.068 79.909 1.00 25.27 ? 345 SER A O   1 
ATOM   2624 C CB  . SER A 1 345 ? 14.914  68.121 79.773 1.00 22.39 ? 345 SER A CB  1 
ATOM   2625 O OG  . SER A 1 345 ? 13.742  68.956 79.892 1.00 17.28 ? 345 SER A OG  1 
ATOM   2626 N N   . LYS A 1 346 ? 17.777  67.599 82.080 1.00 22.03 ? 346 LYS A N   1 
ATOM   2627 C CA  . LYS A 1 346 ? 18.972  66.782 82.143 1.00 23.88 ? 346 LYS A CA  1 
ATOM   2628 C C   . LYS A 1 346 ? 18.394  65.434 82.508 1.00 27.63 ? 346 LYS A C   1 
ATOM   2629 O O   . LYS A 1 346 ? 17.597  65.319 83.428 1.00 35.43 ? 346 LYS A O   1 
ATOM   2630 C CB  . LYS A 1 346 ? 19.924  67.305 83.201 1.00 23.21 ? 346 LYS A CB  1 
ATOM   2631 C CG  . LYS A 1 346 ? 20.277  68.757 82.922 1.00 26.99 ? 346 LYS A CG  1 
ATOM   2632 C CD  . LYS A 1 346 ? 21.603  69.173 83.565 1.00 35.94 ? 346 LYS A CD  1 
ATOM   2633 C CE  . LYS A 1 346 ? 21.773  70.706 83.621 1.00 41.45 ? 346 LYS A CE  1 
ATOM   2634 N NZ  . LYS A 1 346 ? 22.082  71.084 84.988 1.00 49.15 ? 346 LYS A NZ  1 
ATOM   2635 N N   . ILE A 1 347 ? 18.753  64.404 81.793 1.00 29.01 ? 347 ILE A N   1 
ATOM   2636 C CA  . ILE A 1 347 ? 18.142  63.120 82.092 1.00 29.29 ? 347 ILE A CA  1 
ATOM   2637 C C   . ILE A 1 347 ? 19.076  62.319 82.988 1.00 31.23 ? 347 ILE A C   1 
ATOM   2638 O O   . ILE A 1 347 ? 20.286  62.444 83.037 1.00 31.97 ? 347 ILE A O   1 
ATOM   2639 C CB  . ILE A 1 347 ? 17.720  62.466 80.751 1.00 23.70 ? 347 ILE A CB  1 
ATOM   2640 C CG1 . ILE A 1 347 ? 16.250  62.783 80.422 1.00 28.80 ? 347 ILE A CG1 1 
ATOM   2641 C CG2 . ILE A 1 347 ? 17.936  60.977 80.646 1.00 23.00 ? 347 ILE A CG2 1 
ATOM   2642 C CD1 . ILE A 1 347 ? 15.968  64.283 80.234 1.00 22.38 ? 347 ILE A CD1 1 
ATOM   2643 N N   . SER A 1 348 ? 18.433  61.425 83.706 1.00 30.25 ? 348 SER A N   1 
ATOM   2644 C CA  . SER A 1 348 ? 19.215  60.587 84.598 1.00 29.71 ? 348 SER A CA  1 
ATOM   2645 C C   . SER A 1 348 ? 19.514  59.300 83.896 1.00 31.95 ? 348 SER A C   1 
ATOM   2646 O O   . SER A 1 348 ? 18.873  58.999 82.898 1.00 39.15 ? 348 SER A O   1 
ATOM   2647 C CB  . SER A 1 348 ? 18.292  60.250 85.762 1.00 26.41 ? 348 SER A CB  1 
ATOM   2648 O OG  . SER A 1 348 ? 17.063  59.686 85.303 1.00 24.69 ? 348 SER A OG  1 
ATOM   2649 N N   . ARG A 1 349 ? 20.419  58.482 84.427 1.00 31.14 ? 349 ARG A N   1 
ATOM   2650 C CA  . ARG A 1 349 ? 20.546  57.222 83.694 1.00 33.27 ? 349 ARG A CA  1 
ATOM   2651 C C   . ARG A 1 349 ? 19.286  56.385 83.892 1.00 27.74 ? 349 ARG A C   1 
ATOM   2652 O O   . ARG A 1 349 ? 19.024  55.456 83.155 1.00 26.60 ? 349 ARG A O   1 
ATOM   2653 C CB  . ARG A 1 349 ? 21.829  56.408 83.986 1.00 39.78 ? 349 ARG A CB  1 
ATOM   2654 C CG  . ARG A 1 349 ? 23.098  56.959 83.278 1.00 46.05 ? 349 ARG A CG  1 
ATOM   2655 C CD  . ARG A 1 349 ? 23.081  57.001 81.713 1.00 52.26 ? 349 ARG A CD  1 
ATOM   2656 N NE  . ARG A 1 349 ? 22.618  55.777 81.069 1.00 54.54 ? 349 ARG A NE  1 
ATOM   2657 C CZ  . ARG A 1 349 ? 23.376  54.689 80.892 1.00 57.23 ? 349 ARG A CZ  1 
ATOM   2658 N NH1 . ARG A 1 349 ? 24.658  54.634 81.248 1.00 61.61 ? 349 ARG A NH1 1 
ATOM   2659 N NH2 . ARG A 1 349 ? 22.829  53.613 80.343 1.00 63.01 ? 349 ARG A NH2 1 
ATOM   2660 N N   . GLU A 1 350 ? 18.480  56.755 84.865 1.00 25.57 ? 350 GLU A N   1 
ATOM   2661 C CA  . GLU A 1 350 ? 17.281  55.943 85.065 1.00 32.29 ? 350 GLU A CA  1 
ATOM   2662 C C   . GLU A 1 350 ? 16.268  56.139 83.974 1.00 32.07 ? 350 GLU A C   1 
ATOM   2663 O O   . GLU A 1 350 ? 15.750  55.207 83.386 1.00 28.70 ? 350 GLU A O   1 
ATOM   2664 C CB  . GLU A 1 350 ? 16.585  56.285 86.399 1.00 36.74 ? 350 GLU A CB  1 
ATOM   2665 C CG  . GLU A 1 350 ? 15.630  55.176 86.834 1.00 38.21 ? 350 GLU A CG  1 
ATOM   2666 N N   . ASP A 1 351 ? 16.005  57.428 83.764 1.00 33.85 ? 351 ASP A N   1 
ATOM   2667 C CA  . ASP A 1 351 ? 15.065  57.914 82.767 1.00 36.55 ? 351 ASP A CA  1 
ATOM   2668 C C   . ASP A 1 351 ? 15.636  57.745 81.361 1.00 38.40 ? 351 ASP A C   1 
ATOM   2669 O O   . ASP A 1 351 ? 14.911  57.820 80.363 1.00 44.89 ? 351 ASP A O   1 
ATOM   2670 C CB  . ASP A 1 351 ? 14.791  59.409 82.918 1.00 38.87 ? 351 ASP A CB  1 
ATOM   2671 C CG  . ASP A 1 351 ? 14.048  59.808 84.187 1.00 41.59 ? 351 ASP A CG  1 
ATOM   2672 O OD1 . ASP A 1 351 ? 13.207  59.030 84.669 1.00 40.69 ? 351 ASP A OD1 1 
ATOM   2673 O OD2 . ASP A 1 351 ? 14.320  60.919 84.670 1.00 40.17 ? 351 ASP A OD2 1 
ATOM   2674 N N   . PHE A 1 352 ? 16.972  57.572 81.287 1.00 30.38 ? 352 PHE A N   1 
ATOM   2675 C CA  . PHE A 1 352 ? 17.584  57.354 79.985 1.00 24.52 ? 352 PHE A CA  1 
ATOM   2676 C C   . PHE A 1 352 ? 17.199  55.943 79.535 1.00 21.28 ? 352 PHE A C   1 
ATOM   2677 O O   . PHE A 1 352 ? 16.690  55.687 78.462 1.00 23.82 ? 352 PHE A O   1 
ATOM   2678 C CB  . PHE A 1 352 ? 19.108  57.507 80.104 1.00 22.30 ? 352 PHE A CB  1 
ATOM   2679 C CG  . PHE A 1 352 ? 19.861  57.137 78.847 1.00 22.61 ? 352 PHE A CG  1 
ATOM   2680 C CD1 . PHE A 1 352 ? 20.126  55.810 78.580 1.00 19.24 ? 352 PHE A CD1 1 
ATOM   2681 C CD2 . PHE A 1 352 ? 20.333  58.105 77.969 1.00 25.47 ? 352 PHE A CD2 1 
ATOM   2682 C CE1 . PHE A 1 352 ? 20.873  55.445 77.470 1.00 19.49 ? 352 PHE A CE1 1 
ATOM   2683 C CE2 . PHE A 1 352 ? 21.099  57.742 76.868 1.00 26.95 ? 352 PHE A CE2 1 
ATOM   2684 C CZ  . PHE A 1 352 ? 21.374  56.405 76.624 1.00 20.16 ? 352 PHE A CZ  1 
ATOM   2685 N N   . MET A 1 353 ? 17.436  54.997 80.410 1.00 17.83 ? 353 MET A N   1 
ATOM   2686 C CA  . MET A 1 353 ? 17.103  53.650 80.022 1.00 15.33 ? 353 MET A CA  1 
ATOM   2687 C C   . MET A 1 353 ? 15.593  53.482 79.805 1.00 12.41 ? 353 MET A C   1 
ATOM   2688 O O   . MET A 1 353 ? 15.147  52.560 79.119 1.00 3.18  ? 353 MET A O   1 
ATOM   2689 C CB  . MET A 1 353 ? 17.818  52.611 80.933 1.00 21.55 ? 353 MET A CB  1 
ATOM   2690 C CG  . MET A 1 353 ? 19.335  52.476 80.617 1.00 19.24 ? 353 MET A CG  1 
ATOM   2691 N N   . SER A 1 354 ? 14.809  54.398 80.402 1.00 14.28 ? 354 SER A N   1 
ATOM   2692 C CA  . SER A 1 354 ? 13.349  54.324 80.205 1.00 18.36 ? 354 SER A CA  1 
ATOM   2693 C C   . SER A 1 354 ? 13.037  54.852 78.808 1.00 19.65 ? 354 SER A C   1 
ATOM   2694 O O   . SER A 1 354 ? 12.171  54.376 78.088 1.00 22.27 ? 354 SER A O   1 
ATOM   2695 C CB  . SER A 1 354 ? 12.556  55.231 81.178 1.00 21.82 ? 354 SER A CB  1 
ATOM   2696 O OG  . SER A 1 354 ? 12.948  55.151 82.548 1.00 32.69 ? 354 SER A OG  1 
ATOM   2697 N N   . GLY A 1 355 ? 13.791  55.929 78.511 1.00 18.87 ? 355 GLY A N   1 
ATOM   2698 C CA  . GLY A 1 355 ? 13.772  56.665 77.274 1.00 14.44 ? 355 GLY A CA  1 
ATOM   2699 C C   . GLY A 1 355 ? 14.053  55.730 76.119 1.00 16.66 ? 355 GLY A C   1 
ATOM   2700 O O   . GLY A 1 355 ? 13.181  55.507 75.291 1.00 20.29 ? 355 GLY A O   1 
ATOM   2701 N N   . VAL A 1 356 ? 15.246  55.130 76.078 1.00 8.73  ? 356 VAL A N   1 
ATOM   2702 C CA  . VAL A 1 356 ? 15.494  54.246 74.986 1.00 9.76  ? 356 VAL A CA  1 
ATOM   2703 C C   . VAL A 1 356 ? 14.442  53.159 74.803 1.00 10.73 ? 356 VAL A C   1 
ATOM   2704 O O   . VAL A 1 356 ? 14.266  52.674 73.698 1.00 14.27 ? 356 VAL A O   1 
ATOM   2705 C CB  . VAL A 1 356 ? 16.883  53.632 75.098 1.00 14.15 ? 356 VAL A CB  1 
ATOM   2706 C CG1 . VAL A 1 356 ? 17.920  54.729 75.373 1.00 24.51 ? 356 VAL A CG1 1 
ATOM   2707 C CG2 . VAL A 1 356 ? 17.006  52.580 76.183 1.00 15.79 ? 356 VAL A CG2 1 
ATOM   2708 N N   . LYS A 1 357 ? 13.769  52.715 75.856 1.00 10.14 ? 357 LYS A N   1 
ATOM   2709 C CA  . LYS A 1 357 ? 12.777  51.690 75.543 1.00 18.53 ? 357 LYS A CA  1 
ATOM   2710 C C   . LYS A 1 357 ? 11.628  52.281 74.779 1.00 20.29 ? 357 LYS A C   1 
ATOM   2711 O O   . LYS A 1 357 ? 11.075  51.680 73.881 1.00 27.06 ? 357 LYS A O   1 
ATOM   2712 C CB  . LYS A 1 357 ? 12.151  51.044 76.772 1.00 24.76 ? 357 LYS A CB  1 
ATOM   2713 C CG  . LYS A 1 357 ? 13.209  50.299 77.577 1.00 38.34 ? 357 LYS A CG  1 
ATOM   2714 C CD  . LYS A 1 357 ? 12.565  49.308 78.558 1.00 49.34 ? 357 LYS A CD  1 
ATOM   2715 C CE  . LYS A 1 357 ? 13.248  49.287 79.931 1.00 55.40 ? 357 LYS A CE  1 
ATOM   2716 N NZ  . LYS A 1 357 ? 12.900  50.503 80.660 1.00 57.78 ? 357 LYS A NZ  1 
ATOM   2717 N N   . LEU A 1 358 ? 11.232  53.481 75.152 1.00 18.78 ? 358 LEU A N   1 
ATOM   2718 C CA  . LEU A 1 358 ? 10.135  54.060 74.418 1.00 15.55 ? 358 LEU A CA  1 
ATOM   2719 C C   . LEU A 1 358 ? 10.453  54.310 72.957 1.00 17.12 ? 358 LEU A C   1 
ATOM   2720 O O   . LEU A 1 358 ? 9.545   54.330 72.128 1.00 21.01 ? 358 LEU A O   1 
ATOM   2721 C CB  . LEU A 1 358 ? 9.907   55.459 74.986 1.00 10.52 ? 358 LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 358 ? 9.253   55.459 76.341 1.00 4.87  ? 358 LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 358 ? 9.119   56.906 76.781 1.00 2.00  ? 358 LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 358 ? 7.878   54.762 76.261 1.00 2.73  ? 358 LEU A CD2 1 
ATOM   2725 N N   . SER A 1 359 ? 11.741  54.574 72.703 1.00 14.45 ? 359 SER A N   1 
ATOM   2726 C CA  . SER A 1 359 ? 12.265  54.896 71.383 1.00 14.35 ? 359 SER A CA  1 
ATOM   2727 C C   . SER A 1 359 ? 12.413  53.740 70.436 1.00 14.75 ? 359 SER A C   1 
ATOM   2728 O O   . SER A 1 359 ? 12.173  53.904 69.250 1.00 23.09 ? 359 SER A O   1 
ATOM   2729 C CB  . SER A 1 359 ? 13.643  55.579 71.483 1.00 12.31 ? 359 SER A CB  1 
ATOM   2730 O OG  . SER A 1 359 ? 13.530  56.603 72.471 1.00 16.27 ? 359 SER A OG  1 
ATOM   2731 N N   . VAL A 1 360 ? 12.810  52.591 70.925 1.00 9.10  ? 360 VAL A N   1 
ATOM   2732 C CA  . VAL A 1 360 ? 12.994  51.480 70.027 1.00 8.45  ? 360 VAL A CA  1 
ATOM   2733 C C   . VAL A 1 360 ? 12.095  50.384 70.492 1.00 12.81 ? 360 VAL A C   1 
ATOM   2734 O O   . VAL A 1 360 ? 12.546  49.337 70.958 1.00 17.60 ? 360 VAL A O   1 
ATOM   2735 C CB  . VAL A 1 360 ? 14.462  51.032 70.144 1.00 10.44 ? 360 VAL A CB  1 
ATOM   2736 C CG1 . VAL A 1 360 ? 14.838  50.097 68.999 1.00 9.07  ? 360 VAL A CG1 1 
ATOM   2737 C CG2 . VAL A 1 360 ? 15.414  52.238 70.238 1.00 13.43 ? 360 VAL A CG2 1 
ATOM   2738 N N   . PRO A 1 361 ? 10.788  50.622 70.393 1.00 13.15 ? 361 PRO A N   1 
ATOM   2739 C CA  . PRO A 1 361 ? 9.830   49.771 71.087 1.00 17.21 ? 361 PRO A CA  1 
ATOM   2740 C C   . PRO A 1 361 ? 9.813   48.371 70.695 1.00 21.59 ? 361 PRO A C   1 
ATOM   2741 O O   . PRO A 1 361 ? 9.186   47.562 71.342 1.00 27.35 ? 361 PRO A O   1 
ATOM   2742 C CB  . PRO A 1 361 ? 8.444   50.270 70.700 1.00 13.20 ? 361 PRO A CB  1 
ATOM   2743 C CG  . PRO A 1 361 ? 8.691   51.296 69.603 1.00 17.50 ? 361 PRO A CG  1 
ATOM   2744 C CD  . PRO A 1 361 ? 10.171  51.697 69.654 1.00 13.22 ? 361 PRO A CD  1 
ATOM   2745 N N   . HIS A 1 362 ? 10.443  48.085 69.580 1.00 26.07 ? 362 HIS A N   1 
ATOM   2746 C CA  . HIS A 1 362 ? 10.414  46.701 69.109 1.00 28.81 ? 362 HIS A CA  1 
ATOM   2747 C C   . HIS A 1 362 ? 11.643  45.907 69.473 1.00 26.83 ? 362 HIS A C   1 
ATOM   2748 O O   . HIS A 1 362 ? 11.725  44.693 69.302 1.00 25.62 ? 362 HIS A O   1 
ATOM   2749 C CB  . HIS A 1 362 ? 10.238  46.720 67.586 1.00 35.56 ? 362 HIS A CB  1 
ATOM   2750 C CG  . HIS A 1 362 ? 11.058  47.833 66.942 1.00 37.98 ? 362 HIS A CG  1 
ATOM   2751 N ND1 . HIS A 1 362 ? 12.276  47.651 66.401 1.00 42.01 ? 362 HIS A ND1 1 
ATOM   2752 C CD2 . HIS A 1 362 ? 10.701  49.195 66.782 1.00 36.89 ? 362 HIS A CD2 1 
ATOM   2753 C CE1 . HIS A 1 362 ? 12.668  48.845 65.926 1.00 41.15 ? 362 HIS A CE1 1 
ATOM   2754 N NE2 . HIS A 1 362 ? 11.735  49.784 66.152 1.00 38.74 ? 362 HIS A NE2 1 
ATOM   2755 N N   . ALA A 1 363 ? 12.640  46.646 69.937 1.00 21.96 ? 363 ALA A N   1 
ATOM   2756 C CA  . ALA A 1 363 ? 13.842  45.967 70.259 1.00 22.11 ? 363 ALA A CA  1 
ATOM   2757 C C   . ALA A 1 363 ? 13.713  44.964 71.409 1.00 22.44 ? 363 ALA A C   1 
ATOM   2758 O O   . ALA A 1 363 ? 12.922  45.059 72.336 1.00 21.64 ? 363 ALA A O   1 
ATOM   2759 C CB  . ALA A 1 363 ? 14.855  47.039 70.699 1.00 23.51 ? 363 ALA A CB  1 
ATOM   2760 N N   . ASN A 1 364 ? 14.576  43.954 71.324 1.00 21.00 ? 364 ASN A N   1 
ATOM   2761 C CA  . ASN A 1 364 ? 14.604  43.031 72.431 1.00 17.78 ? 364 ASN A CA  1 
ATOM   2762 C C   . ASN A 1 364 ? 15.677  43.676 73.298 1.00 20.00 ? 364 ASN A C   1 
ATOM   2763 O O   . ASN A 1 364 ? 16.349  44.644 72.925 1.00 16.71 ? 364 ASN A O   1 
ATOM   2764 C CB  . ASN A 1 364 ? 14.865  41.583 72.028 1.00 18.65 ? 364 ASN A CB  1 
ATOM   2765 C CG  . ASN A 1 364 ? 16.229  41.345 71.493 1.00 20.81 ? 364 ASN A CG  1 
ATOM   2766 O OD1 . ASN A 1 364 ? 17.110  42.139 71.751 1.00 26.55 ? 364 ASN A OD1 1 
ATOM   2767 N ND2 . ASN A 1 364 ? 16.422  40.236 70.760 1.00 22.59 ? 364 ASN A ND2 1 
ATOM   2768 N N   . ASP A 1 365 ? 15.868  43.057 74.471 1.00 21.95 ? 365 ASP A N   1 
ATOM   2769 C CA  . ASP A 1 365 ? 16.858  43.535 75.454 1.00 19.71 ? 365 ASP A CA  1 
ATOM   2770 C C   . ASP A 1 365 ? 18.262  43.642 74.887 1.00 18.62 ? 365 ASP A C   1 
ATOM   2771 O O   . ASP A 1 365 ? 19.010  44.586 75.102 1.00 15.28 ? 365 ASP A O   1 
ATOM   2772 C CB  . ASP A 1 365 ? 16.954  42.594 76.678 1.00 18.33 ? 365 ASP A CB  1 
ATOM   2773 N N   . LEU A 1 366 ? 18.650  42.609 74.125 1.00 16.54 ? 366 LEU A N   1 
ATOM   2774 C CA  . LEU A 1 366 ? 19.985  42.650 73.601 1.00 15.75 ? 366 LEU A CA  1 
ATOM   2775 C C   . LEU A 1 366 ? 20.119  43.843 72.736 1.00 17.71 ? 366 LEU A C   1 
ATOM   2776 O O   . LEU A 1 366 ? 21.094  44.583 72.707 1.00 20.69 ? 366 LEU A O   1 
ATOM   2777 C CB  . LEU A 1 366 ? 20.243  41.398 72.795 1.00 17.36 ? 366 LEU A CB  1 
ATOM   2778 C CG  . LEU A 1 366 ? 21.702  40.978 72.767 1.00 15.98 ? 366 LEU A CG  1 
ATOM   2779 C CD1 . LEU A 1 366 ? 22.680  42.156 72.843 1.00 10.98 ? 366 LEU A CD1 1 
ATOM   2780 C CD2 . LEU A 1 366 ? 21.929  39.982 73.888 1.00 20.15 ? 366 LEU A CD2 1 
ATOM   2781 N N   . GLY A 1 367 ? 19.028  44.033 72.026 1.00 18.46 ? 367 GLY A N   1 
ATOM   2782 C CA  . GLY A 1 367 ? 18.907  45.166 71.144 1.00 24.08 ? 367 GLY A CA  1 
ATOM   2783 C C   . GLY A 1 367 ? 19.001  46.466 71.901 1.00 21.30 ? 367 GLY A C   1 
ATOM   2784 O O   . GLY A 1 367 ? 19.687  47.384 71.501 1.00 21.65 ? 367 GLY A O   1 
ATOM   2785 N N   . LEU A 1 368 ? 18.320  46.559 73.030 1.00 23.27 ? 368 LEU A N   1 
ATOM   2786 C CA  . LEU A 1 368 ? 18.443  47.814 73.774 1.00 25.69 ? 368 LEU A CA  1 
ATOM   2787 C C   . LEU A 1 368 ? 19.878  47.992 74.184 1.00 26.15 ? 368 LEU A C   1 
ATOM   2788 O O   . LEU A 1 368 ? 20.402  49.093 74.210 1.00 26.04 ? 368 LEU A O   1 
ATOM   2789 C CB  . LEU A 1 368 ? 17.545  47.862 75.036 1.00 29.04 ? 368 LEU A CB  1 
ATOM   2790 C CG  . LEU A 1 368 ? 16.011  47.825 74.772 1.00 30.51 ? 368 LEU A CG  1 
ATOM   2791 C CD1 . LEU A 1 368 ? 15.216  47.473 76.037 1.00 33.19 ? 368 LEU A CD1 1 
ATOM   2792 C CD2 . LEU A 1 368 ? 15.497  49.168 74.237 1.00 34.56 ? 368 LEU A CD2 1 
ATOM   2793 N N   . ASP A 1 369 ? 20.531  46.845 74.460 1.00 27.66 ? 369 ASP A N   1 
ATOM   2794 C CA  . ASP A 1 369 ? 21.946  46.911 74.880 1.00 26.85 ? 369 ASP A CA  1 
ATOM   2795 C C   . ASP A 1 369 ? 22.774  47.478 73.815 1.00 24.49 ? 369 ASP A C   1 
ATOM   2796 O O   . ASP A 1 369 ? 23.664  48.274 74.087 1.00 25.13 ? 369 ASP A O   1 
ATOM   2797 C CB  . ASP A 1 369 ? 22.586  45.564 75.292 1.00 24.07 ? 369 ASP A CB  1 
ATOM   2798 C CG  . ASP A 1 369 ? 22.204  45.113 76.710 1.00 22.56 ? 369 ASP A CG  1 
ATOM   2799 O OD1 . ASP A 1 369 ? 21.361  45.764 77.338 1.00 20.51 ? 369 ASP A OD1 1 
ATOM   2800 O OD2 . ASP A 1 369 ? 22.782  44.122 77.180 1.00 21.17 ? 369 ASP A OD2 1 
ATOM   2801 N N   . ALA A 1 370 ? 22.452  47.045 72.593 1.00 22.62 ? 370 ALA A N   1 
ATOM   2802 C CA  . ALA A 1 370 ? 23.235  47.574 71.476 1.00 19.32 ? 370 ALA A CA  1 
ATOM   2803 C C   . ALA A 1 370 ? 23.019  49.069 71.309 1.00 12.69 ? 370 ALA A C   1 
ATOM   2804 O O   . ALA A 1 370 ? 23.931  49.833 71.035 1.00 15.64 ? 370 ALA A O   1 
ATOM   2805 C CB  . ALA A 1 370 ? 22.950  46.825 70.167 1.00 13.66 ? 370 ALA A CB  1 
ATOM   2806 N N   . VAL A 1 371 ? 21.794  49.483 71.516 1.00 8.89  ? 371 VAL A N   1 
ATOM   2807 C CA  . VAL A 1 371 ? 21.546  50.905 71.320 1.00 12.46 ? 371 VAL A CA  1 
ATOM   2808 C C   . VAL A 1 371 ? 22.295  51.788 72.296 1.00 13.82 ? 371 VAL A C   1 
ATOM   2809 O O   . VAL A 1 371 ? 22.837  52.841 71.946 1.00 11.85 ? 371 VAL A O   1 
ATOM   2810 C CB  . VAL A 1 371 ? 20.035  51.201 71.334 1.00 6.91  ? 371 VAL A CB  1 
ATOM   2811 C CG1 . VAL A 1 371 ? 19.828  52.713 71.129 1.00 4.18  ? 371 VAL A CG1 1 
ATOM   2812 C CG2 . VAL A 1 371 ? 19.260  50.338 70.311 1.00 2.00  ? 371 VAL A CG2 1 
ATOM   2813 N N   . THR A 1 372 ? 22.245  51.328 73.554 1.00 16.65 ? 372 THR A N   1 
ATOM   2814 C CA  . THR A 1 372 ? 22.899  52.048 74.642 1.00 16.27 ? 372 THR A CA  1 
ATOM   2815 C C   . THR A 1 372 ? 24.378  52.161 74.373 1.00 13.45 ? 372 THR A C   1 
ATOM   2816 O O   . THR A 1 372 ? 24.962  53.228 74.334 1.00 14.85 ? 372 THR A O   1 
ATOM   2817 C CB  . THR A 1 372 ? 22.634  51.326 75.982 1.00 16.00 ? 372 THR A CB  1 
ATOM   2818 O OG1 . THR A 1 372 ? 21.236  51.068 76.139 1.00 20.70 ? 372 THR A OG1 1 
ATOM   2819 C CG2 . THR A 1 372 ? 23.075  52.137 77.201 1.00 15.99 ? 372 THR A CG2 1 
ATOM   2820 N N   . LEU A 1 373 ? 24.971  51.007 74.138 1.00 8.94  ? 373 LEU A N   1 
ATOM   2821 C CA  . LEU A 1 373 ? 26.372  50.976 73.888 1.00 8.45  ? 373 LEU A CA  1 
ATOM   2822 C C   . LEU A 1 373 ? 26.757  51.997 72.847 1.00 13.07 ? 373 LEU A C   1 
ATOM   2823 O O   . LEU A 1 373 ? 27.834  52.587 72.905 1.00 15.05 ? 373 LEU A O   1 
ATOM   2824 C CB  . LEU A 1 373 ? 26.710  49.562 73.408 1.00 4.52  ? 373 LEU A CB  1 
ATOM   2825 C CG  . LEU A 1 373 ? 28.172  49.286 73.116 1.00 2.00  ? 373 LEU A CG  1 
ATOM   2826 C CD1 . LEU A 1 373 ? 29.085  49.766 74.229 1.00 7.24  ? 373 LEU A CD1 1 
ATOM   2827 C CD2 . LEU A 1 373 ? 28.399  47.794 72.978 1.00 2.73  ? 373 LEU A CD2 1 
ATOM   2828 N N   . GLN A 1 374 ? 25.816  52.204 71.894 1.00 16.42 ? 374 GLN A N   1 
ATOM   2829 C CA  . GLN A 1 374 ? 26.142  53.147 70.813 1.00 19.06 ? 374 GLN A CA  1 
ATOM   2830 C C   . GLN A 1 374 ? 25.921  54.558 71.182 1.00 18.67 ? 374 GLN A C   1 
ATOM   2831 O O   . GLN A 1 374 ? 26.632  55.427 70.701 1.00 19.38 ? 374 GLN A O   1 
ATOM   2832 C CB  . GLN A 1 374 ? 25.358  52.907 69.493 1.00 17.39 ? 374 GLN A CB  1 
ATOM   2833 C CG  . GLN A 1 374 ? 25.786  51.663 68.710 1.00 26.64 ? 374 GLN A CG  1 
ATOM   2834 C CD  . GLN A 1 374 ? 27.173  51.732 68.035 1.00 37.41 ? 374 GLN A CD  1 
ATOM   2835 O OE1 . GLN A 1 374 ? 27.845  50.730 67.815 1.00 36.44 ? 374 GLN A OE1 1 
ATOM   2836 N NE2 . GLN A 1 374 ? 27.613  52.960 67.725 1.00 39.35 ? 374 GLN A NE2 1 
ATOM   2837 N N   . TYR A 1 375 ? 24.929  54.789 72.017 1.00 20.29 ? 375 TYR A N   1 
ATOM   2838 C CA  . TYR A 1 375 ? 24.661  56.191 72.326 1.00 22.17 ? 375 TYR A CA  1 
ATOM   2839 C C   . TYR A 1 375 ? 25.193  56.750 73.642 1.00 24.56 ? 375 TYR A C   1 
ATOM   2840 O O   . TYR A 1 375 ? 25.069  57.945 73.883 1.00 22.37 ? 375 TYR A O   1 
ATOM   2841 C CB  . TYR A 1 375 ? 23.157  56.360 72.085 1.00 21.77 ? 375 TYR A CB  1 
ATOM   2842 C CG  . TYR A 1 375 ? 22.858  56.458 70.590 1.00 17.07 ? 375 TYR A CG  1 
ATOM   2843 C CD1 . TYR A 1 375 ? 22.882  57.705 69.992 1.00 11.82 ? 375 TYR A CD1 1 
ATOM   2844 C CD2 . TYR A 1 375 ? 22.585  55.335 69.816 1.00 10.83 ? 375 TYR A CD2 1 
ATOM   2845 C CE1 . TYR A 1 375 ? 22.627  57.855 68.657 1.00 8.23  ? 375 TYR A CE1 1 
ATOM   2846 C CE2 . TYR A 1 375 ? 22.309  55.476 68.471 1.00 9.07  ? 375 TYR A CE2 1 
ATOM   2847 C CZ  . TYR A 1 375 ? 22.315  56.751 67.917 1.00 15.99 ? 375 TYR A CZ  1 
ATOM   2848 O OH  . TYR A 1 375 ? 21.944  56.951 66.618 1.00 21.39 ? 375 TYR A OH  1 
ATOM   2849 N N   . THR A 1 376 ? 25.782  55.917 74.501 1.00 28.94 ? 376 THR A N   1 
ATOM   2850 C CA  . THR A 1 376 ? 26.300  56.397 75.785 1.00 30.31 ? 376 THR A CA  1 
ATOM   2851 C C   . THR A 1 376 ? 27.779  56.735 75.697 1.00 31.30 ? 376 THR A C   1 
ATOM   2852 O O   . THR A 1 376 ? 28.569  56.137 74.984 1.00 33.15 ? 376 THR A O   1 
ATOM   2853 C CB  . THR A 1 376 ? 26.126  55.255 76.822 1.00 28.24 ? 376 THR A CB  1 
ATOM   2854 O OG1 . THR A 1 376 ? 24.788  54.795 76.792 1.00 35.03 ? 376 THR A OG1 1 
ATOM   2855 C CG2 . THR A 1 376 ? 26.342  55.599 78.295 1.00 26.03 ? 376 THR A CG2 1 
ATOM   2856 N N   . ASP A 1 377 ? 28.164  57.736 76.492 1.00 36.72 ? 377 ASP A N   1 
ATOM   2857 C CA  . ASP A 1 377 ? 29.576  58.149 76.601 1.00 38.95 ? 377 ASP A CA  1 
ATOM   2858 C C   . ASP A 1 377 ? 30.085  57.428 77.864 1.00 39.72 ? 377 ASP A C   1 
ATOM   2859 O O   . ASP A 1 377 ? 29.975  57.910 78.976 1.00 38.19 ? 377 ASP A O   1 
ATOM   2860 C CB  . ASP A 1 377 ? 29.684  59.678 76.747 1.00 41.24 ? 377 ASP A CB  1 
ATOM   2861 C CG  . ASP A 1 377 ? 31.114  60.166 76.966 1.00 43.42 ? 377 ASP A CG  1 
ATOM   2862 O OD1 . ASP A 1 377 ? 32.044  59.362 76.863 1.00 43.27 ? 377 ASP A OD1 1 
ATOM   2863 O OD2 . ASP A 1 377 ? 31.287  61.352 77.263 1.00 44.67 ? 377 ASP A OD2 1 
ATOM   2864 N N   . TRP A 1 378 ? 30.641  56.239 77.708 1.00 43.20 ? 378 TRP A N   1 
ATOM   2865 C CA  . TRP A 1 378 ? 31.101  55.464 78.839 1.00 43.15 ? 378 TRP A CA  1 
ATOM   2866 C C   . TRP A 1 378 ? 32.083  56.172 79.686 1.00 47.28 ? 378 TRP A C   1 
ATOM   2867 O O   . TRP A 1 378 ? 32.195  55.876 80.868 1.00 51.93 ? 378 TRP A O   1 
ATOM   2868 C CB  . TRP A 1 378 ? 31.585  54.096 78.409 1.00 42.24 ? 378 TRP A CB  1 
ATOM   2869 C CG  . TRP A 1 378 ? 30.395  53.456 77.775 1.00 43.49 ? 378 TRP A CG  1 
ATOM   2870 C CD1 . TRP A 1 378 ? 30.073  53.493 76.407 1.00 48.24 ? 378 TRP A CD1 1 
ATOM   2871 C CD2 . TRP A 1 378 ? 29.347  52.806 78.425 1.00 43.40 ? 378 TRP A CD2 1 
ATOM   2872 N NE1 . TRP A 1 378 ? 28.884  52.895 76.191 1.00 48.75 ? 378 TRP A NE1 1 
ATOM   2873 C CE2 . TRP A 1 378 ? 28.388  52.441 77.388 1.00 46.45 ? 378 TRP A CE2 1 
ATOM   2874 C CE3 . TRP A 1 378 ? 29.078  52.508 79.740 1.00 45.38 ? 378 TRP A CE3 1 
ATOM   2875 C CZ2 . TRP A 1 378 ? 27.223  51.769 77.728 1.00 48.53 ? 378 TRP A CZ2 1 
ATOM   2876 C CZ3 . TRP A 1 378 ? 27.895  51.844 80.038 1.00 48.59 ? 378 TRP A CZ3 1 
ATOM   2877 C CH2 . TRP A 1 378 ? 26.984  51.469 79.049 1.00 46.71 ? 378 TRP A CH2 1 
ATOM   2878 N N   . MET A 1 379 ? 32.761  57.144 79.089 1.00 49.19 ? 379 MET A N   1 
ATOM   2879 C CA  . MET A 1 379 ? 33.743  57.940 79.828 1.00 53.98 ? 379 MET A CA  1 
ATOM   2880 C C   . MET A 1 379 ? 33.129  58.963 80.797 1.00 52.48 ? 379 MET A C   1 
ATOM   2881 O O   . MET A 1 379 ? 33.803  59.754 81.450 1.00 48.40 ? 379 MET A O   1 
ATOM   2882 C CB  . MET A 1 379 ? 34.581  58.714 78.789 1.00 62.71 ? 379 MET A CB  1 
ATOM   2883 C CG  . MET A 1 379 ? 35.909  58.027 78.534 1.00 74.86 ? 379 MET A CG  1 
ATOM   2884 S SD  . MET A 1 379 ? 36.816  58.058 80.120 1.00 83.44 ? 379 MET A SD  1 
ATOM   2885 C CE  . MET A 1 379 ? 38.371  57.306 79.499 1.00 82.61 ? 379 MET A CE  1 
ATOM   2886 N N   . ASP A 1 380 ? 31.801  58.961 80.844 1.00 51.90 ? 380 ASP A N   1 
ATOM   2887 C CA  . ASP A 1 380 ? 31.038  59.900 81.658 1.00 52.45 ? 380 ASP A CA  1 
ATOM   2888 C C   . ASP A 1 380 ? 29.584  59.514 81.479 1.00 52.28 ? 380 ASP A C   1 
ATOM   2889 O O   . ASP A 1 380 ? 28.712  60.301 81.100 1.00 45.05 ? 380 ASP A O   1 
ATOM   2890 C CB  . ASP A 1 380 ? 31.251  61.307 81.057 1.00 54.19 ? 380 ASP A CB  1 
ATOM   2891 C CG  . ASP A 1 380 ? 30.566  62.394 81.819 1.00 53.38 ? 380 ASP A CG  1 
ATOM   2892 O OD1 . ASP A 1 380 ? 29.814  62.080 82.741 1.00 57.55 ? 380 ASP A OD1 1 
ATOM   2893 O OD2 . ASP A 1 380 ? 30.799  63.553 81.487 1.00 54.23 ? 380 ASP A OD2 1 
ATOM   2894 N N   . ASP A 1 381 ? 29.388  58.224 81.797 1.00 54.80 ? 381 ASP A N   1 
ATOM   2895 C CA  . ASP A 1 381 ? 28.134  57.528 81.627 1.00 54.65 ? 381 ASP A CA  1 
ATOM   2896 C C   . ASP A 1 381 ? 26.933  58.027 82.349 1.00 53.54 ? 381 ASP A C   1 
ATOM   2897 O O   . ASP A 1 381 ? 25.947  57.316 82.298 1.00 52.57 ? 381 ASP A O   1 
ATOM   2898 C CB  . ASP A 1 381 ? 28.255  55.995 81.757 1.00 59.56 ? 381 ASP A CB  1 
ATOM   2899 C CG  . ASP A 1 381 ? 28.545  55.487 83.164 1.00 66.41 ? 381 ASP A CG  1 
ATOM   2900 O OD1 . ASP A 1 381 ? 29.688  55.627 83.626 1.00 67.08 ? 381 ASP A OD1 1 
ATOM   2901 O OD2 . ASP A 1 381 ? 27.626  54.917 83.767 1.00 68.82 ? 381 ASP A OD2 1 
ATOM   2902 N N   . ASN A 1 382 ? 26.983  59.167 83.064 1.00 53.36 ? 382 ASN A N   1 
ATOM   2903 C CA  . ASN A 1 382 ? 25.715  59.623 83.698 1.00 51.56 ? 382 ASN A CA  1 
ATOM   2904 C C   . ASN A 1 382 ? 25.590  61.104 83.590 1.00 49.35 ? 382 ASN A C   1 
ATOM   2905 O O   . ASN A 1 382 ? 24.768  61.694 84.283 1.00 53.08 ? 382 ASN A O   1 
ATOM   2906 C CB  . ASN A 1 382 ? 25.421  59.232 85.160 1.00 52.85 ? 382 ASN A CB  1 
ATOM   2907 N N   . ASN A 1 383 ? 26.409  61.727 82.714 1.00 43.60 ? 383 ASN A N   1 
ATOM   2908 C CA  . ASN A 1 383 ? 26.257  63.184 82.548 1.00 34.97 ? 383 ASN A CA  1 
ATOM   2909 C C   . ASN A 1 383 ? 24.830  63.495 82.088 1.00 26.82 ? 383 ASN A C   1 
ATOM   2910 O O   . ASN A 1 383 ? 24.478  63.364 80.933 1.00 25.39 ? 383 ASN A O   1 
ATOM   2911 C CB  . ASN A 1 383 ? 27.236  63.695 81.480 1.00 32.57 ? 383 ASN A CB  1 
ATOM   2912 C CG  . ASN A 1 383 ? 27.094  65.185 81.273 1.00 36.73 ? 383 ASN A CG  1 
ATOM   2913 O OD1 . ASN A 1 383 ? 25.997  65.743 81.158 1.00 33.43 ? 383 ASN A OD1 1 
ATOM   2914 N ND2 . ASN A 1 383 ? 28.268  65.833 81.257 1.00 36.10 ? 383 ASN A ND2 1 
ATOM   2915 N N   . GLY A 1 384 ? 24.020  63.964 83.009 1.00 21.99 ? 384 GLY A N   1 
ATOM   2916 C CA  . GLY A 1 384 ? 22.632  64.259 82.700 1.00 21.33 ? 384 GLY A CA  1 
ATOM   2917 C C   . GLY A 1 384 ? 22.321  64.906 81.368 1.00 16.91 ? 384 GLY A C   1 
ATOM   2918 O O   . GLY A 1 384 ? 21.422  64.487 80.672 1.00 15.95 ? 384 GLY A O   1 
ATOM   2919 N N   . ILE A 1 385 ? 23.075  65.925 81.000 1.00 15.44 ? 385 ILE A N   1 
ATOM   2920 C CA  . ILE A 1 385 ? 22.842  66.555 79.731 1.00 14.30 ? 385 ILE A CA  1 
ATOM   2921 C C   . ILE A 1 385 ? 23.229  65.611 78.562 1.00 22.66 ? 385 ILE A C   1 
ATOM   2922 O O   . ILE A 1 385 ? 22.545  65.469 77.550 1.00 25.93 ? 385 ILE A O   1 
ATOM   2923 C CB  . ILE A 1 385 ? 23.655  67.840 79.749 1.00 7.79  ? 385 ILE A CB  1 
ATOM   2924 C CG1 . ILE A 1 385 ? 22.681  68.959 79.685 1.00 8.74  ? 385 ILE A CG1 1 
ATOM   2925 C CG2 . ILE A 1 385 ? 24.773  67.981 78.717 1.00 2.00  ? 385 ILE A CG2 1 
ATOM   2926 C CD1 . ILE A 1 385 ? 23.391  70.284 79.818 1.00 2.00  ? 385 ILE A CD1 1 
ATOM   2927 N N   . LYS A 1 386 ? 24.368  64.940 78.688 1.00 26.33 ? 386 LYS A N   1 
ATOM   2928 C CA  . LYS A 1 386 ? 24.727  64.020 77.601 1.00 28.69 ? 386 LYS A CA  1 
ATOM   2929 C C   . LYS A 1 386 ? 23.640  62.954 77.466 1.00 28.74 ? 386 LYS A C   1 
ATOM   2930 O O   . LYS A 1 386 ? 23.326  62.484 76.388 1.00 33.37 ? 386 LYS A O   1 
ATOM   2931 C CB  . LYS A 1 386 ? 26.084  63.317 77.836 1.00 28.91 ? 386 LYS A CB  1 
ATOM   2932 C CG  . LYS A 1 386 ? 27.263  64.291 77.776 1.00 30.27 ? 386 LYS A CG  1 
ATOM   2933 C CD  . LYS A 1 386 ? 28.614  63.579 77.932 1.00 36.34 ? 386 LYS A CD  1 
ATOM   2934 C CE  . LYS A 1 386 ? 29.786  64.573 77.915 1.00 38.43 ? 386 LYS A CE  1 
ATOM   2935 N NZ  . LYS A 1 386 ? 31.048  63.914 78.234 1.00 41.47 ? 386 LYS A NZ  1 
ATOM   2936 N N   . ASN A 1 387 ? 23.032  62.581 78.575 1.00 27.67 ? 387 ASN A N   1 
ATOM   2937 C CA  . ASN A 1 387 ? 21.983  61.578 78.463 1.00 23.25 ? 387 ASN A CA  1 
ATOM   2938 C C   . ASN A 1 387 ? 20.826  62.178 77.755 1.00 21.23 ? 387 ASN A C   1 
ATOM   2939 O O   . ASN A 1 387 ? 20.113  61.505 77.031 1.00 26.44 ? 387 ASN A O   1 
ATOM   2940 C CB  . ASN A 1 387 ? 21.423  61.107 79.813 1.00 25.36 ? 387 ASN A CB  1 
ATOM   2941 C CG  . ASN A 1 387 ? 22.431  60.398 80.681 1.00 28.74 ? 387 ASN A CG  1 
ATOM   2942 O OD1 . ASN A 1 387 ? 23.405  59.783 80.235 1.00 28.60 ? 387 ASN A OD1 1 
ATOM   2943 N ND2 . ASN A 1 387 ? 22.170  60.524 81.987 1.00 27.06 ? 387 ASN A ND2 1 
ATOM   2944 N N   . ARG A 1 388 ? 20.635  63.477 77.964 1.00 15.56 ? 388 ARG A N   1 
ATOM   2945 C CA  . ARG A 1 388 ? 19.488  64.127 77.320 1.00 13.40 ? 388 ARG A CA  1 
ATOM   2946 C C   . ARG A 1 388 ? 19.713  64.120 75.844 1.00 12.77 ? 388 ARG A C   1 
ATOM   2947 O O   . ARG A 1 388 ? 18.993  63.485 75.086 1.00 14.34 ? 388 ARG A O   1 
ATOM   2948 C CB  . ARG A 1 388 ? 19.202  65.523 77.919 1.00 6.07  ? 388 ARG A CB  1 
ATOM   2949 C CG  . ARG A 1 388 ? 18.181  66.414 77.193 1.00 14.90 ? 388 ARG A CG  1 
ATOM   2950 C CD  . ARG A 1 388 ? 18.802  67.719 76.680 1.00 17.20 ? 388 ARG A CD  1 
ATOM   2951 N NE  . ARG A 1 388 ? 18.924  68.834 77.638 1.00 12.66 ? 388 ARG A NE  1 
ATOM   2952 C CZ  . ARG A 1 388 ? 19.925  69.751 77.406 1.00 17.09 ? 388 ARG A CZ  1 
ATOM   2953 N NH1 . ARG A 1 388 ? 20.821  69.555 76.440 1.00 11.82 ? 388 ARG A NH1 1 
ATOM   2954 N NH2 . ARG A 1 388 ? 20.085  70.878 78.123 1.00 16.56 ? 388 ARG A NH2 1 
ATOM   2955 N N   . ASP A 1 389 ? 20.754  64.828 75.423 1.00 12.62 ? 389 ASP A N   1 
ATOM   2956 C CA  . ASP A 1 389 ? 21.055  64.859 73.990 1.00 11.15 ? 389 ASP A CA  1 
ATOM   2957 C C   . ASP A 1 389 ? 21.243  63.493 73.372 1.00 12.24 ? 389 ASP A C   1 
ATOM   2958 O O   . ASP A 1 389 ? 20.934  63.299 72.215 1.00 18.77 ? 389 ASP A O   1 
ATOM   2959 C CB  . ASP A 1 389 ? 22.357  65.556 73.724 1.00 16.90 ? 389 ASP A CB  1 
ATOM   2960 C CG  . ASP A 1 389 ? 22.328  66.985 74.215 1.00 22.96 ? 389 ASP A CG  1 
ATOM   2961 O OD1 . ASP A 1 389 ? 21.238  67.502 74.445 1.00 30.24 ? 389 ASP A OD1 1 
ATOM   2962 O OD2 . ASP A 1 389 ? 23.400  67.578 74.365 1.00 27.67 ? 389 ASP A OD2 1 
ATOM   2963 N N   . GLY A 1 390 ? 21.741  62.520 74.094 1.00 6.81  ? 390 GLY A N   1 
ATOM   2964 C CA  . GLY A 1 390 ? 21.875  61.232 73.441 1.00 5.98  ? 390 GLY A CA  1 
ATOM   2965 C C   . GLY A 1 390 ? 20.529  60.676 73.069 1.00 11.46 ? 390 GLY A C   1 
ATOM   2966 O O   . GLY A 1 390 ? 20.374  60.076 72.025 1.00 18.78 ? 390 GLY A O   1 
ATOM   2967 N N   . LEU A 1 391 ? 19.492  60.865 73.887 1.00 15.92 ? 391 LEU A N   1 
ATOM   2968 C CA  . LEU A 1 391 ? 18.183  60.336 73.459 1.00 17.35 ? 391 LEU A CA  1 
ATOM   2969 C C   . LEU A 1 391 ? 17.664  61.148 72.283 1.00 19.54 ? 391 LEU A C   1 
ATOM   2970 O O   . LEU A 1 391 ? 17.002  60.690 71.357 1.00 20.83 ? 391 LEU A O   1 
ATOM   2971 C CB  . LEU A 1 391 ? 17.136  60.513 74.545 1.00 15.21 ? 391 LEU A CB  1 
ATOM   2972 C CG  . LEU A 1 391 ? 17.230  59.484 75.628 1.00 13.37 ? 391 LEU A CG  1 
ATOM   2973 C CD1 . LEU A 1 391 ? 16.314  59.927 76.769 1.00 24.29 ? 391 LEU A CD1 1 
ATOM   2974 C CD2 . LEU A 1 391 ? 16.758  58.132 75.122 1.00 19.04 ? 391 LEU A CD2 1 
ATOM   2975 N N   . ASP A 1 392 ? 17.960  62.424 72.353 1.00 15.42 ? 392 ASP A N   1 
ATOM   2976 C CA  . ASP A 1 392 ? 17.562  63.265 71.246 1.00 20.46 ? 392 ASP A CA  1 
ATOM   2977 C C   . ASP A 1 392 ? 18.092  62.719 69.909 1.00 23.37 ? 392 ASP A C   1 
ATOM   2978 O O   . ASP A 1 392 ? 17.475  62.854 68.860 1.00 31.68 ? 392 ASP A O   1 
ATOM   2979 C CB  . ASP A 1 392 ? 18.185  64.631 71.455 1.00 28.20 ? 392 ASP A CB  1 
ATOM   2980 C CG  . ASP A 1 392 ? 17.379  65.721 70.856 1.00 33.05 ? 392 ASP A CG  1 
ATOM   2981 O OD1 . ASP A 1 392 ? 16.889  65.528 69.755 1.00 39.53 ? 392 ASP A OD1 1 
ATOM   2982 O OD2 . ASP A 1 392 ? 17.239  66.763 71.499 1.00 42.21 ? 392 ASP A OD2 1 
ATOM   2983 N N   . ASP A 1 393 ? 19.268  62.086 69.932 1.00 20.00 ? 393 ASP A N   1 
ATOM   2984 C CA  . ASP A 1 393 ? 19.759  61.531 68.676 1.00 12.58 ? 393 ASP A CA  1 
ATOM   2985 C C   . ASP A 1 393 ? 19.189  60.164 68.433 1.00 10.81 ? 393 ASP A C   1 
ATOM   2986 O O   . ASP A 1 393 ? 19.046  59.714 67.312 1.00 13.39 ? 393 ASP A O   1 
ATOM   2987 C CB  . ASP A 1 393 ? 21.248  61.284 68.708 1.00 10.72 ? 393 ASP A CB  1 
ATOM   2988 C CG  . ASP A 1 393 ? 22.084  62.510 68.890 1.00 16.70 ? 393 ASP A CG  1 
ATOM   2989 O OD1 . ASP A 1 393 ? 21.585  63.623 68.645 1.00 12.69 ? 393 ASP A OD1 1 
ATOM   2990 O OD2 . ASP A 1 393 ? 23.255  62.323 69.272 1.00 23.22 ? 393 ASP A OD2 1 
ATOM   2991 N N   . ILE A 1 394 ? 18.896  59.438 69.496 1.00 15.67 ? 394 ILE A N   1 
ATOM   2992 C CA  . ILE A 1 394 ? 18.346  58.082 69.268 1.00 13.55 ? 394 ILE A CA  1 
ATOM   2993 C C   . ILE A 1 394 ? 16.974  58.164 68.605 1.00 10.91 ? 394 ILE A C   1 
ATOM   2994 O O   . ILE A 1 394 ? 16.619  57.389 67.753 1.00 4.56  ? 394 ILE A O   1 
ATOM   2995 C CB  . ILE A 1 394 ? 18.247  57.268 70.587 1.00 8.47  ? 394 ILE A CB  1 
ATOM   2996 C CG1 . ILE A 1 394 ? 19.627  56.933 71.173 1.00 7.87  ? 394 ILE A CG1 1 
ATOM   2997 C CG2 . ILE A 1 394 ? 17.444  55.978 70.386 1.00 12.92 ? 394 ILE A CG2 1 
ATOM   2998 C CD1 . ILE A 1 394 ? 19.554  56.001 72.395 1.00 2.00  ? 394 ILE A CD1 1 
ATOM   2999 N N   . VAL A 1 395 ? 16.176  59.126 69.018 1.00 16.54 ? 395 VAL A N   1 
ATOM   3000 C CA  . VAL A 1 395 ? 14.884  59.182 68.399 1.00 15.60 ? 395 VAL A CA  1 
ATOM   3001 C C   . VAL A 1 395 ? 15.074  59.674 66.997 1.00 18.30 ? 395 VAL A C   1 
ATOM   3002 O O   . VAL A 1 395 ? 14.610  59.050 66.067 1.00 20.25 ? 395 VAL A O   1 
ATOM   3003 C CB  . VAL A 1 395 ? 13.974  60.068 69.255 1.00 12.53 ? 395 VAL A CB  1 
ATOM   3004 C CG1 . VAL A 1 395 ? 12.574  60.119 68.661 1.00 12.48 ? 395 VAL A CG1 1 
ATOM   3005 C CG2 . VAL A 1 395 ? 13.942  59.548 70.697 1.00 11.11 ? 395 VAL A CG2 1 
ATOM   3006 N N   . GLY A 1 396 ? 15.768  60.805 66.855 1.00 20.85 ? 396 GLY A N   1 
ATOM   3007 C CA  . GLY A 1 396 ? 15.967  61.369 65.523 1.00 16.82 ? 396 GLY A CA  1 
ATOM   3008 C C   . GLY A 1 396 ? 16.476  60.353 64.490 1.00 19.44 ? 396 GLY A C   1 
ATOM   3009 O O   . GLY A 1 396 ? 15.845  60.077 63.482 1.00 25.36 ? 396 GLY A O   1 
ATOM   3010 N N   . ASP A 1 397 ? 17.649  59.789 64.740 1.00 13.97 ? 397 ASP A N   1 
ATOM   3011 C CA  . ASP A 1 397 ? 18.267  58.818 63.856 1.00 8.30  ? 397 ASP A CA  1 
ATOM   3012 C C   . ASP A 1 397 ? 17.366  57.656 63.500 1.00 8.80  ? 397 ASP A C   1 
ATOM   3013 O O   . ASP A 1 397 ? 17.142  57.321 62.356 1.00 11.21 ? 397 ASP A O   1 
ATOM   3014 C CB  . ASP A 1 397 ? 19.521  58.224 64.551 1.00 5.06  ? 397 ASP A CB  1 
ATOM   3015 C CG  . ASP A 1 397 ? 20.596  59.287 64.678 1.00 9.57  ? 397 ASP A CG  1 
ATOM   3016 O OD1 . ASP A 1 397 ? 20.310  60.423 64.340 1.00 4.38  ? 397 ASP A OD1 1 
ATOM   3017 O OD2 . ASP A 1 397 ? 21.719  58.990 65.109 1.00 10.67 ? 397 ASP A OD2 1 
ATOM   3018 N N   . HIS A 1 398 ? 16.846  57.024 64.508 1.00 8.26  ? 398 HIS A N   1 
ATOM   3019 C CA  . HIS A 1 398 ? 16.031  55.889 64.275 1.00 6.03  ? 398 HIS A CA  1 
ATOM   3020 C C   . HIS A 1 398 ? 14.767  56.236 63.582 1.00 6.96  ? 398 HIS A C   1 
ATOM   3021 O O   . HIS A 1 398 ? 14.254  55.398 62.872 1.00 16.24 ? 398 HIS A O   1 
ATOM   3022 C CB  . HIS A 1 398 ? 15.685  55.232 65.656 1.00 8.08  ? 398 HIS A CB  1 
ATOM   3023 C CG  . HIS A 1 398 ? 14.607  54.173 65.539 1.00 3.80  ? 398 HIS A CG  1 
ATOM   3024 N ND1 . HIS A 1 398 ? 14.807  52.976 64.979 1.00 2.00  ? 398 HIS A ND1 1 
ATOM   3025 C CD2 . HIS A 1 398 ? 13.241  54.284 65.859 1.00 8.80  ? 398 HIS A CD2 1 
ATOM   3026 C CE1 . HIS A 1 398 ? 13.606  52.384 64.938 1.00 7.42  ? 398 HIS A CE1 1 
ATOM   3027 N NE2 . HIS A 1 398 ? 12.636  53.146 65.460 1.00 5.75  ? 398 HIS A NE2 1 
ATOM   3028 N N   . ASN A 1 399 ? 14.255  57.432 63.755 1.00 6.37  ? 399 ASN A N   1 
ATOM   3029 C CA  . ASN A 1 399 ? 12.936  57.707 63.174 1.00 5.68  ? 399 ASN A CA  1 
ATOM   3030 C C   . ASN A 1 399 ? 12.933  58.570 61.959 1.00 8.34  ? 399 ASN A C   1 
ATOM   3031 O O   . ASN A 1 399 ? 11.917  58.599 61.272 1.00 12.64 ? 399 ASN A O   1 
ATOM   3032 C CB  . ASN A 1 399 ? 12.002  58.337 64.248 1.00 15.89 ? 399 ASN A CB  1 
ATOM   3033 C CG  . ASN A 1 399 ? 11.504  57.312 65.276 1.00 22.48 ? 399 ASN A CG  1 
ATOM   3034 O OD1 . ASN A 1 399 ? 10.720  56.453 64.924 1.00 24.83 ? 399 ASN A OD1 1 
ATOM   3035 N ND2 . ASN A 1 399 ? 11.958  57.405 66.538 1.00 22.79 ? 399 ASN A ND2 1 
ATOM   3036 N N   . VAL A 1 400 ? 13.982  59.344 61.684 1.00 7.35  ? 400 VAL A N   1 
ATOM   3037 C CA  . VAL A 1 400 ? 13.896  60.107 60.443 1.00 6.81  ? 400 VAL A CA  1 
ATOM   3038 C C   . VAL A 1 400 ? 15.192  60.087 59.691 1.00 6.02  ? 400 VAL A C   1 
ATOM   3039 O O   . VAL A 1 400 ? 15.214  59.787 58.518 1.00 10.63 ? 400 VAL A O   1 
ATOM   3040 C CB  . VAL A 1 400 ? 13.242  61.504 60.541 1.00 2.00  ? 400 VAL A CB  1 
ATOM   3041 C CG1 . VAL A 1 400 ? 12.375  61.657 61.764 1.00 2.72  ? 400 VAL A CG1 1 
ATOM   3042 C CG2 . VAL A 1 400 ? 14.237  62.630 60.612 1.00 2.00  ? 400 VAL A CG2 1 
ATOM   3043 N N   . ILE A 1 401 ? 16.302  60.337 60.358 1.00 4.56  ? 401 ILE A N   1 
ATOM   3044 C CA  . ILE A 1 401 ? 17.547  60.411 59.573 1.00 2.00  ? 401 ILE A CA  1 
ATOM   3045 C C   . ILE A 1 401 ? 17.944  59.122 59.011 1.00 6.56  ? 401 ILE A C   1 
ATOM   3046 O O   . ILE A 1 401 ? 18.193  59.000 57.830 1.00 12.70 ? 401 ILE A O   1 
ATOM   3047 C CB  . ILE A 1 401 ? 18.653  61.055 60.316 1.00 2.00  ? 401 ILE A CB  1 
ATOM   3048 C CG1 . ILE A 1 401 ? 18.055  62.213 61.110 1.00 6.79  ? 401 ILE A CG1 1 
ATOM   3049 C CG2 . ILE A 1 401 ? 19.690  61.605 59.378 1.00 2.00  ? 401 ILE A CG2 1 
ATOM   3050 C CD1 . ILE A 1 401 ? 19.095  63.053 61.830 1.00 15.06 ? 401 ILE A CD1 1 
ATOM   3051 N N   . CYS A 1 402 ? 17.984  58.108 59.825 1.00 8.10  ? 402 CYS A N   1 
ATOM   3052 C CA  . CYS A 1 402 ? 18.346  56.892 59.155 1.00 11.85 ? 402 CYS A CA  1 
ATOM   3053 C C   . CYS A 1 402 ? 17.355  56.374 58.130 1.00 9.68  ? 402 CYS A C   1 
ATOM   3054 O O   . CYS A 1 402 ? 17.822  55.968 57.079 1.00 16.47 ? 402 CYS A O   1 
ATOM   3055 C CB  . CYS A 1 402 ? 18.836  55.828 60.092 1.00 13.79 ? 402 CYS A CB  1 
ATOM   3056 S SG  . CYS A 1 402 ? 20.164  56.457 61.066 1.00 18.61 ? 402 CYS A SG  1 
ATOM   3057 N N   . PRO A 1 403 ? 16.048  56.310 58.340 1.00 6.84  ? 403 PRO A N   1 
ATOM   3058 C CA  . PRO A 1 403 ? 15.239  55.769 57.262 1.00 11.53 ? 403 PRO A CA  1 
ATOM   3059 C C   . PRO A 1 403 ? 15.360  56.588 55.965 1.00 10.57 ? 403 PRO A C   1 
ATOM   3060 O O   . PRO A 1 403 ? 15.276  56.020 54.884 1.00 16.78 ? 403 PRO A O   1 
ATOM   3061 C CB  . PRO A 1 403 ? 13.829  55.468 57.831 1.00 6.18  ? 403 PRO A CB  1 
ATOM   3062 C CG  . PRO A 1 403 ? 13.927  55.837 59.297 1.00 2.40  ? 403 PRO A CG  1 
ATOM   3063 C CD  . PRO A 1 403 ? 15.316  56.472 59.547 1.00 8.37  ? 403 PRO A CD  1 
ATOM   3064 N N   . LEU A 1 404 ? 15.598  57.909 56.096 1.00 10.35 ? 404 LEU A N   1 
ATOM   3065 C CA  . LEU A 1 404 ? 15.744  58.785 54.925 1.00 5.27  ? 404 LEU A CA  1 
ATOM   3066 C C   . LEU A 1 404 ? 17.039  58.457 54.255 1.00 8.01  ? 404 LEU A C   1 
ATOM   3067 O O   . LEU A 1 404 ? 17.045  58.126 53.080 1.00 8.87  ? 404 LEU A O   1 
ATOM   3068 C CB  . LEU A 1 404 ? 15.568  60.277 55.276 1.00 2.00  ? 404 LEU A CB  1 
ATOM   3069 C CG  . LEU A 1 404 ? 15.632  61.306 54.118 1.00 2.00  ? 404 LEU A CG  1 
ATOM   3070 C CD1 . LEU A 1 404 ? 14.836  62.599 54.406 1.00 9.15  ? 404 LEU A CD1 1 
ATOM   3071 C CD2 . LEU A 1 404 ? 17.050  61.733 53.782 1.00 4.48  ? 404 LEU A CD2 1 
ATOM   3072 N N   . MET A 1 405 ? 18.174  58.519 54.963 1.00 6.69  ? 405 MET A N   1 
ATOM   3073 C CA  . MET A 1 405 ? 19.366  58.104 54.237 1.00 7.34  ? 405 MET A CA  1 
ATOM   3074 C C   . MET A 1 405 ? 19.240  56.742 53.547 1.00 5.50  ? 405 MET A C   1 
ATOM   3075 O O   . MET A 1 405 ? 19.980  56.464 52.607 1.00 5.91  ? 405 MET A O   1 
ATOM   3076 C CB  . MET A 1 405 ? 20.591  57.977 55.149 1.00 7.47  ? 405 MET A CB  1 
ATOM   3077 C CG  . MET A 1 405 ? 20.869  59.257 55.856 1.00 7.71  ? 405 MET A CG  1 
ATOM   3078 S SD  . MET A 1 405 ? 20.687  60.516 54.600 1.00 17.61 ? 405 MET A SD  1 
ATOM   3079 C CE  . MET A 1 405 ? 22.386  60.407 53.985 1.00 5.59  ? 405 MET A CE  1 
ATOM   3080 N N   . HIS A 1 406 ? 18.350  55.874 54.030 1.00 5.19  ? 406 HIS A N   1 
ATOM   3081 C CA  . HIS A 1 406 ? 18.188  54.592 53.344 1.00 10.82 ? 406 HIS A CA  1 
ATOM   3082 C C   . HIS A 1 406 ? 17.550  54.853 51.966 1.00 13.72 ? 406 HIS A C   1 
ATOM   3083 O O   . HIS A 1 406 ? 18.072  54.512 50.912 1.00 15.12 ? 406 HIS A O   1 
ATOM   3084 C CB  . HIS A 1 406 ? 17.233  53.688 54.115 1.00 10.14 ? 406 HIS A CB  1 
ATOM   3085 C CG  . HIS A 1 406 ? 17.152  52.332 53.462 1.00 10.28 ? 406 HIS A CG  1 
ATOM   3086 N ND1 . HIS A 1 406 ? 18.198  51.498 53.337 1.00 3.06  ? 406 HIS A ND1 1 
ATOM   3087 C CD2 . HIS A 1 406 ? 15.987  51.667 53.028 1.00 10.17 ? 406 HIS A CD2 1 
ATOM   3088 C CE1 . HIS A 1 406 ? 17.701  50.349 52.864 1.00 9.89  ? 406 HIS A CE1 1 
ATOM   3089 N NE2 . HIS A 1 406 ? 16.367  50.432 52.678 1.00 7.49  ? 406 HIS A NE2 1 
ATOM   3090 N N   . PHE A 1 407 ? 16.399  55.522 52.021 1.00 12.80 ? 407 PHE A N   1 
ATOM   3091 C CA  . PHE A 1 407 ? 15.667  55.856 50.816 1.00 13.24 ? 407 PHE A CA  1 
ATOM   3092 C C   . PHE A 1 407 ? 16.535  56.665 49.888 1.00 16.36 ? 407 PHE A C   1 
ATOM   3093 O O   . PHE A 1 407 ? 16.452  56.445 48.688 1.00 19.32 ? 407 PHE A O   1 
ATOM   3094 C CB  . PHE A 1 407 ? 14.458  56.672 51.182 1.00 9.23  ? 407 PHE A CB  1 
ATOM   3095 C CG  . PHE A 1 407 ? 13.651  57.198 50.032 1.00 7.37  ? 407 PHE A CG  1 
ATOM   3096 C CD1 . PHE A 1 407 ? 12.743  56.374 49.405 1.00 9.81  ? 407 PHE A CD1 1 
ATOM   3097 C CD2 . PHE A 1 407 ? 13.708  58.550 49.714 1.00 9.30  ? 407 PHE A CD2 1 
ATOM   3098 C CE1 . PHE A 1 407 ? 11.821  56.921 48.528 1.00 11.55 ? 407 PHE A CE1 1 
ATOM   3099 C CE2 . PHE A 1 407 ? 12.779  59.088 48.840 1.00 9.49  ? 407 PHE A CE2 1 
ATOM   3100 C CZ  . PHE A 1 407 ? 11.827  58.274 48.263 1.00 4.44  ? 407 PHE A CZ  1 
ATOM   3101 N N   . VAL A 1 408 ? 17.349  57.608 50.427 1.00 11.03 ? 408 VAL A N   1 
ATOM   3102 C CA  . VAL A 1 408 ? 18.210  58.336 49.533 1.00 6.31  ? 408 VAL A CA  1 
ATOM   3103 C C   . VAL A 1 408 ? 19.089  57.364 48.803 1.00 10.89 ? 408 VAL A C   1 
ATOM   3104 O O   . VAL A 1 408 ? 19.126  57.293 47.578 1.00 11.39 ? 408 VAL A O   1 
ATOM   3105 C CB  . VAL A 1 408 ? 19.035  59.442 50.245 1.00 2.81  ? 408 VAL A CB  1 
ATOM   3106 C CG1 . VAL A 1 408 ? 20.452  59.732 49.729 1.00 2.00  ? 408 VAL A CG1 1 
ATOM   3107 C CG2 . VAL A 1 408 ? 18.274  60.769 50.129 1.00 4.09  ? 408 VAL A CG2 1 
ATOM   3108 N N   . ASN A 1 409 ? 19.755  56.554 49.635 1.00 12.00 ? 409 ASN A N   1 
ATOM   3109 C CA  . ASN A 1 409 ? 20.725  55.637 49.036 1.00 12.28 ? 409 ASN A CA  1 
ATOM   3110 C C   . ASN A 1 409 ? 20.196  54.650 48.027 1.00 13.17 ? 409 ASN A C   1 
ATOM   3111 O O   . ASN A 1 409 ? 20.874  54.314 47.077 1.00 13.72 ? 409 ASN A O   1 
ATOM   3112 C CB  . ASN A 1 409 ? 21.586  55.007 50.154 1.00 14.97 ? 409 ASN A CB  1 
ATOM   3113 C CG  . ASN A 1 409 ? 22.738  55.949 50.414 1.00 17.93 ? 409 ASN A CG  1 
ATOM   3114 O OD1 . ASN A 1 409 ? 23.785  55.845 49.809 1.00 24.52 ? 409 ASN A OD1 1 
ATOM   3115 N ND2 . ASN A 1 409 ? 22.554  56.895 51.315 1.00 15.63 ? 409 ASN A ND2 1 
ATOM   3116 N N   . LYS A 1 410 ? 18.987  54.159 48.232 1.00 17.82 ? 410 LYS A N   1 
ATOM   3117 C CA  . LYS A 1 410 ? 18.413  53.197 47.286 1.00 19.04 ? 410 LYS A CA  1 
ATOM   3118 C C   . LYS A 1 410 ? 17.914  53.903 46.037 1.00 19.00 ? 410 LYS A C   1 
ATOM   3119 O O   . LYS A 1 410 ? 18.135  53.512 44.911 1.00 23.11 ? 410 LYS A O   1 
ATOM   3120 C CB  . LYS A 1 410 ? 17.231  52.451 47.943 1.00 20.96 ? 410 LYS A CB  1 
ATOM   3121 C CG  . LYS A 1 410 ? 17.568  51.620 49.212 1.00 19.59 ? 410 LYS A CG  1 
ATOM   3122 C CD  . LYS A 1 410 ? 17.683  50.100 48.937 1.00 11.64 ? 410 LYS A CD  1 
ATOM   3123 C CE  . LYS A 1 410 ? 19.076  49.770 48.442 1.00 13.32 ? 410 LYS A CE  1 
ATOM   3124 N NZ  . LYS A 1 410 ? 19.150  48.437 47.854 1.00 23.43 ? 410 LYS A NZ  1 
ATOM   3125 N N   . TYR A 1 411 ? 17.214  54.987 46.245 1.00 18.24 ? 411 TYR A N   1 
ATOM   3126 C CA  . TYR A 1 411 ? 16.673  55.701 45.120 1.00 14.85 ? 411 TYR A CA  1 
ATOM   3127 C C   . TYR A 1 411 ? 17.760  56.380 44.336 1.00 18.27 ? 411 TYR A C   1 
ATOM   3128 O O   . TYR A 1 411 ? 17.509  56.613 43.170 1.00 22.25 ? 411 TYR A O   1 
ATOM   3129 C CB  . TYR A 1 411 ? 15.671  56.765 45.649 1.00 15.22 ? 411 TYR A CB  1 
ATOM   3130 C CG  . TYR A 1 411 ? 14.863  57.557 44.638 1.00 12.95 ? 411 TYR A CG  1 
ATOM   3131 C CD1 . TYR A 1 411 ? 15.334  58.760 44.094 1.00 14.54 ? 411 TYR A CD1 1 
ATOM   3132 C CD2 . TYR A 1 411 ? 13.643  57.052 44.222 1.00 12.46 ? 411 TYR A CD2 1 
ATOM   3133 C CE1 . TYR A 1 411 ? 14.605  59.414 43.107 1.00 14.90 ? 411 TYR A CE1 1 
ATOM   3134 C CE2 . TYR A 1 411 ? 12.919  57.691 43.234 1.00 14.16 ? 411 TYR A CE2 1 
ATOM   3135 C CZ  . TYR A 1 411 ? 13.410  58.846 42.669 1.00 16.27 ? 411 TYR A CZ  1 
ATOM   3136 O OH  . TYR A 1 411 ? 12.705  59.430 41.670 1.00 12.49 ? 411 TYR A OH  1 
ATOM   3137 N N   . THR A 1 412 ? 18.966  56.701 44.869 1.00 19.72 ? 412 THR A N   1 
ATOM   3138 C CA  . THR A 1 412 ? 19.874  57.428 43.940 1.00 19.85 ? 412 THR A CA  1 
ATOM   3139 C C   . THR A 1 412 ? 20.440  56.501 42.933 1.00 18.70 ? 412 THR A C   1 
ATOM   3140 O O   . THR A 1 412 ? 21.120  56.931 42.023 1.00 16.80 ? 412 THR A O   1 
ATOM   3141 C CB  . THR A 1 412 ? 20.748  58.634 44.453 1.00 20.24 ? 412 THR A CB  1 
ATOM   3142 O OG1 . THR A 1 412 ? 22.103  58.395 44.831 1.00 27.44 ? 412 THR A OG1 1 
ATOM   3143 C CG2 . THR A 1 412 ? 20.218  59.274 45.731 1.00 16.63 ? 412 THR A CG2 1 
ATOM   3144 N N   . LYS A 1 413 ? 20.178  55.197 43.108 1.00 22.23 ? 413 LYS A N   1 
ATOM   3145 C CA  . LYS A 1 413 ? 20.678  54.274 42.084 1.00 27.94 ? 413 LYS A CA  1 
ATOM   3146 C C   . LYS A 1 413 ? 19.731  54.215 40.881 1.00 27.68 ? 413 LYS A C   1 
ATOM   3147 O O   . LYS A 1 413 ? 20.022  53.555 39.916 1.00 32.11 ? 413 LYS A O   1 
ATOM   3148 C CB  . LYS A 1 413 ? 20.778  52.848 42.618 1.00 27.94 ? 413 LYS A CB  1 
ATOM   3149 C CG  . LYS A 1 413 ? 21.800  52.713 43.746 1.00 37.25 ? 413 LYS A CG  1 
ATOM   3150 C CD  . LYS A 1 413 ? 21.227  51.918 44.922 1.00 42.12 ? 413 LYS A CD  1 
ATOM   3151 C CE  . LYS A 1 413 ? 20.953  50.446 44.585 1.00 53.53 ? 413 LYS A CE  1 
ATOM   3152 N NZ  . LYS A 1 413 ? 22.046  49.624 45.111 1.00 63.94 ? 413 LYS A NZ  1 
ATOM   3153 N N   . PHE A 1 414 ? 18.596  54.858 40.928 1.00 27.66 ? 414 PHE A N   1 
ATOM   3154 C CA  . PHE A 1 414 ? 17.728  54.735 39.783 1.00 30.33 ? 414 PHE A CA  1 
ATOM   3155 C C   . PHE A 1 414 ? 17.012  56.020 39.483 1.00 31.94 ? 414 PHE A C   1 
ATOM   3156 O O   . PHE A 1 414 ? 16.181  56.061 38.587 1.00 34.84 ? 414 PHE A O   1 
ATOM   3157 C CB  . PHE A 1 414 ? 16.571  53.795 40.174 1.00 30.57 ? 414 PHE A CB  1 
ATOM   3158 C CG  . PHE A 1 414 ? 16.902  52.347 40.403 1.00 28.06 ? 414 PHE A CG  1 
ATOM   3159 C CD1 . PHE A 1 414 ? 17.338  51.899 41.628 1.00 30.29 ? 414 PHE A CD1 1 
ATOM   3160 C CD2 . PHE A 1 414 ? 16.676  51.429 39.393 1.00 34.70 ? 414 PHE A CD2 1 
ATOM   3161 C CE1 . PHE A 1 414 ? 17.526  50.540 41.856 1.00 38.31 ? 414 PHE A CE1 1 
ATOM   3162 C CE2 . PHE A 1 414 ? 16.869  50.072 39.603 1.00 39.85 ? 414 PHE A CE2 1 
ATOM   3163 C CZ  . PHE A 1 414 ? 17.290  49.617 40.843 1.00 41.00 ? 414 PHE A CZ  1 
ATOM   3164 N N   . GLY A 1 415 ? 17.295  57.056 40.234 1.00 28.61 ? 415 GLY A N   1 
ATOM   3165 C CA  . GLY A 1 415 ? 16.507  58.256 39.998 1.00 33.20 ? 415 GLY A CA  1 
ATOM   3166 C C   . GLY A 1 415 ? 17.228  59.235 39.174 1.00 34.35 ? 415 GLY A C   1 
ATOM   3167 O O   . GLY A 1 415 ? 18.399  59.056 38.892 1.00 34.41 ? 415 GLY A O   1 
ATOM   3168 N N   . ASN A 1 416 ? 16.544  60.325 38.833 1.00 32.42 ? 416 ASN A N   1 
ATOM   3169 C CA  . ASN A 1 416 ? 17.231  61.261 37.974 1.00 34.84 ? 416 ASN A CA  1 
ATOM   3170 C C   . ASN A 1 416 ? 17.853  62.368 38.730 1.00 33.62 ? 416 ASN A C   1 
ATOM   3171 O O   . ASN A 1 416 ? 17.686  63.488 38.273 1.00 35.72 ? 416 ASN A O   1 
ATOM   3172 C CB  . ASN A 1 416 ? 16.342  61.794 36.804 1.00 41.96 ? 416 ASN A CB  1 
ATOM   3173 C CG  . ASN A 1 416 ? 17.014  62.217 35.445 1.00 46.83 ? 416 ASN A CG  1 
ATOM   3174 O OD1 . ASN A 1 416 ? 16.334  62.404 34.437 1.00 47.66 ? 416 ASN A OD1 1 
ATOM   3175 N ND2 . ASN A 1 416 ? 18.357  62.358 35.396 1.00 47.59 ? 416 ASN A ND2 1 
ATOM   3176 N N   . GLY A 1 417 ? 18.540  62.108 39.860 1.00 33.14 ? 417 GLY A N   1 
ATOM   3177 C CA  . GLY A 1 417 ? 19.198  63.236 40.590 1.00 29.09 ? 417 GLY A CA  1 
ATOM   3178 C C   . GLY A 1 417 ? 18.699  63.425 42.011 1.00 26.05 ? 417 GLY A C   1 
ATOM   3179 O O   . GLY A 1 417 ? 17.508  63.443 42.296 1.00 22.35 ? 417 GLY A O   1 
ATOM   3180 N N   . THR A 1 418 ? 19.619  63.583 42.936 1.00 26.51 ? 418 THR A N   1 
ATOM   3181 C CA  . THR A 1 418 ? 19.144  63.718 44.302 1.00 27.96 ? 418 THR A CA  1 
ATOM   3182 C C   . THR A 1 418 ? 19.857  64.825 44.951 1.00 28.65 ? 418 THR A C   1 
ATOM   3183 O O   . THR A 1 418 ? 21.078  64.825 44.862 1.00 26.21 ? 418 THR A O   1 
ATOM   3184 C CB  . THR A 1 418 ? 19.484  62.409 45.012 1.00 26.33 ? 418 THR A CB  1 
ATOM   3185 O OG1 . THR A 1 418 ? 18.867  61.406 44.204 1.00 29.84 ? 418 THR A OG1 1 
ATOM   3186 C CG2 . THR A 1 418 ? 18.964  62.297 46.468 1.00 27.06 ? 418 THR A CG2 1 
ATOM   3187 N N   . TYR A 1 419 ? 19.092  65.749 45.583 1.00 28.67 ? 419 TYR A N   1 
ATOM   3188 C CA  . TYR A 1 419 ? 19.697  66.888 46.284 1.00 32.37 ? 419 TYR A CA  1 
ATOM   3189 C C   . TYR A 1 419 ? 19.278  66.709 47.713 1.00 31.95 ? 419 TYR A C   1 
ATOM   3190 O O   . TYR A 1 419 ? 18.087  66.626 47.971 1.00 35.38 ? 419 TYR A O   1 
ATOM   3191 C CB  . TYR A 1 419 ? 19.219  68.228 45.713 1.00 32.50 ? 419 TYR A CB  1 
ATOM   3192 C CG  . TYR A 1 419 ? 19.656  68.378 44.270 1.00 33.15 ? 419 TYR A CG  1 
ATOM   3193 C CD1 . TYR A 1 419 ? 18.855  67.891 43.234 1.00 34.60 ? 419 TYR A CD1 1 
ATOM   3194 C CD2 . TYR A 1 419 ? 20.875  68.965 43.971 1.00 30.98 ? 419 TYR A CD2 1 
ATOM   3195 C CE1 . TYR A 1 419 ? 19.285  67.972 41.921 1.00 33.05 ? 419 TYR A CE1 1 
ATOM   3196 C CE2 . TYR A 1 419 ? 21.307  69.046 42.663 1.00 27.68 ? 419 TYR A CE2 1 
ATOM   3197 C CZ  . TYR A 1 419 ? 20.524  68.536 41.654 1.00 30.87 ? 419 TYR A CZ  1 
ATOM   3198 O OH  . TYR A 1 419 ? 20.987  68.543 40.372 1.00 36.16 ? 419 TYR A OH  1 
ATOM   3199 N N   . LEU A 1 420 ? 20.253  66.623 48.631 1.00 29.69 ? 420 LEU A N   1 
ATOM   3200 C CA  . LEU A 1 420 ? 19.977  66.375 50.040 1.00 22.43 ? 420 LEU A CA  1 
ATOM   3201 C C   . LEU A 1 420 ? 20.482  67.493 50.866 1.00 18.86 ? 420 LEU A C   1 
ATOM   3202 O O   . LEU A 1 420 ? 21.642  67.845 50.677 1.00 24.46 ? 420 LEU A O   1 
ATOM   3203 C CB  . LEU A 1 420 ? 20.783  65.123 50.476 1.00 18.68 ? 420 LEU A CB  1 
ATOM   3204 C CG  . LEU A 1 420 ? 20.771  64.831 51.971 1.00 19.19 ? 420 LEU A CG  1 
ATOM   3205 C CD1 . LEU A 1 420 ? 19.348  64.512 52.433 1.00 19.59 ? 420 LEU A CD1 1 
ATOM   3206 C CD2 . LEU A 1 420 ? 21.680  63.660 52.306 1.00 20.90 ? 420 LEU A CD2 1 
ATOM   3207 N N   . TYR A 1 421 ? 19.665  68.019 51.778 1.00 16.28 ? 421 TYR A N   1 
ATOM   3208 C CA  . TYR A 1 421 ? 20.106  69.110 52.677 1.00 15.84 ? 421 TYR A CA  1 
ATOM   3209 C C   . TYR A 1 421 ? 20.020  68.656 54.137 1.00 15.91 ? 421 TYR A C   1 
ATOM   3210 O O   . TYR A 1 421 ? 19.267  67.756 54.467 1.00 25.18 ? 421 TYR A O   1 
ATOM   3211 C CB  . TYR A 1 421 ? 19.245  70.388 52.567 1.00 9.60  ? 421 TYR A CB  1 
ATOM   3212 C CG  . TYR A 1 421 ? 17.806  70.204 52.986 1.00 8.06  ? 421 TYR A CG  1 
ATOM   3213 C CD1 . TYR A 1 421 ? 16.869  69.668 52.141 1.00 5.03  ? 421 TYR A CD1 1 
ATOM   3214 C CD2 . TYR A 1 421 ? 17.396  70.538 54.255 1.00 14.77 ? 421 TYR A CD2 1 
ATOM   3215 C CE1 . TYR A 1 421 ? 15.570  69.449 52.561 1.00 5.89  ? 421 TYR A CE1 1 
ATOM   3216 C CE2 . TYR A 1 421 ? 16.088  70.307 54.677 1.00 13.71 ? 421 TYR A CE2 1 
ATOM   3217 C CZ  . TYR A 1 421 ? 15.169  69.741 53.833 1.00 4.98  ? 421 TYR A CZ  1 
ATOM   3218 O OH  . TYR A 1 421 ? 13.905  69.434 54.290 1.00 8.93  ? 421 TYR A OH  1 
ATOM   3219 N N   . PHE A 1 422 ? 20.760  69.322 55.012 1.00 14.33 ? 422 PHE A N   1 
ATOM   3220 C CA  . PHE A 1 422 ? 20.733  69.064 56.436 1.00 13.65 ? 422 PHE A CA  1 
ATOM   3221 C C   . PHE A 1 422 ? 20.440  70.404 57.025 1.00 10.71 ? 422 PHE A C   1 
ATOM   3222 O O   . PHE A 1 422 ? 21.337  71.215 56.898 1.00 7.30  ? 422 PHE A O   1 
ATOM   3223 C CB  . PHE A 1 422 ? 22.144  68.712 56.905 1.00 16.97 ? 422 PHE A CB  1 
ATOM   3224 C CG  . PHE A 1 422 ? 22.180  68.520 58.403 1.00 18.27 ? 422 PHE A CG  1 
ATOM   3225 C CD1 . PHE A 1 422 ? 21.531  67.399 58.942 1.00 10.29 ? 422 PHE A CD1 1 
ATOM   3226 C CD2 . PHE A 1 422 ? 22.904  69.422 59.191 1.00 12.53 ? 422 PHE A CD2 1 
ATOM   3227 C CE1 . PHE A 1 422 ? 21.666  67.141 60.283 1.00 10.65 ? 422 PHE A CE1 1 
ATOM   3228 C CE2 . PHE A 1 422 ? 23.033  69.154 60.534 1.00 12.50 ? 422 PHE A CE2 1 
ATOM   3229 C CZ  . PHE A 1 422 ? 22.421  68.015 61.063 1.00 14.89 ? 422 PHE A CZ  1 
ATOM   3230 N N   . PHE A 1 423 ? 19.272  70.663 57.629 1.00 11.59 ? 423 PHE A N   1 
ATOM   3231 C CA  . PHE A 1 423 ? 18.964  72.017 58.162 1.00 14.80 ? 423 PHE A CA  1 
ATOM   3232 C C   . PHE A 1 423 ? 19.344  72.025 59.607 1.00 15.44 ? 423 PHE A C   1 
ATOM   3233 O O   . PHE A 1 423 ? 19.081  71.086 60.336 1.00 17.88 ? 423 PHE A O   1 
ATOM   3234 C CB  . PHE A 1 423 ? 17.480  72.381 57.950 1.00 11.58 ? 423 PHE A CB  1 
ATOM   3235 C CG  . PHE A 1 423 ? 17.019  73.703 58.470 1.00 7.53  ? 423 PHE A CG  1 
ATOM   3236 C CD1 . PHE A 1 423 ? 17.286  74.872 57.757 1.00 10.07 ? 423 PHE A CD1 1 
ATOM   3237 C CD2 . PHE A 1 423 ? 16.262  73.782 59.618 1.00 9.14  ? 423 PHE A CD2 1 
ATOM   3238 C CE1 . PHE A 1 423 ? 16.788  76.092 58.180 1.00 4.47  ? 423 PHE A CE1 1 
ATOM   3239 C CE2 . PHE A 1 423 ? 15.767  75.009 60.047 1.00 14.12 ? 423 PHE A CE2 1 
ATOM   3240 C CZ  . PHE A 1 423 ? 16.026  76.158 59.325 1.00 10.44 ? 423 PHE A CZ  1 
ATOM   3241 N N   . ASN A 1 424 ? 19.932  73.117 60.023 1.00 17.99 ? 424 ASN A N   1 
ATOM   3242 C CA  . ASN A 1 424 ? 20.416  73.181 61.372 1.00 19.57 ? 424 ASN A CA  1 
ATOM   3243 C C   . ASN A 1 424 ? 20.530  74.608 61.834 1.00 19.48 ? 424 ASN A C   1 
ATOM   3244 O O   . ASN A 1 424 ? 21.528  75.043 62.371 1.00 21.45 ? 424 ASN A O   1 
ATOM   3245 C CB  . ASN A 1 424 ? 21.795  72.504 61.427 1.00 19.25 ? 424 ASN A CB  1 
ATOM   3246 C CG  . ASN A 1 424 ? 22.812  73.290 60.633 1.00 27.90 ? 424 ASN A CG  1 
ATOM   3247 O OD1 . ASN A 1 424 ? 22.496  74.136 59.797 1.00 31.15 ? 424 ASN A OD1 1 
ATOM   3248 N ND2 . ASN A 1 424 ? 24.079  73.034 60.940 1.00 35.68 ? 424 ASN A ND2 1 
ATOM   3249 N N   . HIS A 1 425 ? 19.494  75.362 61.611 1.00 20.96 ? 425 HIS A N   1 
ATOM   3250 C CA  . HIS A 1 425 ? 19.494  76.732 62.062 1.00 20.13 ? 425 HIS A CA  1 
ATOM   3251 C C   . HIS A 1 425 ? 18.426  76.809 63.127 1.00 22.79 ? 425 HIS A C   1 
ATOM   3252 O O   . HIS A 1 425 ? 17.329  76.286 62.969 1.00 28.22 ? 425 HIS A O   1 
ATOM   3253 C CB  . HIS A 1 425 ? 19.026  77.601 60.896 1.00 18.72 ? 425 HIS A CB  1 
ATOM   3254 C CG  . HIS A 1 425 ? 18.789  79.038 61.329 1.00 13.68 ? 425 HIS A CG  1 
ATOM   3255 N ND1 . HIS A 1 425 ? 19.755  79.893 61.742 1.00 12.23 ? 425 HIS A ND1 1 
ATOM   3256 C CD2 . HIS A 1 425 ? 17.553  79.708 61.380 1.00 9.88  ? 425 HIS A CD2 1 
ATOM   3257 C CE1 . HIS A 1 425 ? 19.137  81.052 62.027 1.00 6.12  ? 425 HIS A CE1 1 
ATOM   3258 N NE2 . HIS A 1 425 ? 17.819  80.958 61.818 1.00 11.65 ? 425 HIS A NE2 1 
ATOM   3259 N N   . ARG A 1 426 ? 18.726  77.493 64.209 1.00 21.62 ? 426 ARG A N   1 
ATOM   3260 C CA  . ARG A 1 426 ? 17.728  77.633 65.263 1.00 21.94 ? 426 ARG A CA  1 
ATOM   3261 C C   . ARG A 1 426 ? 17.039  78.953 65.054 1.00 22.29 ? 426 ARG A C   1 
ATOM   3262 O O   . ARG A 1 426 ? 17.713  79.968 65.194 1.00 24.28 ? 426 ARG A O   1 
ATOM   3263 C CB  . ARG A 1 426 ? 18.487  77.728 66.610 1.00 24.99 ? 426 ARG A CB  1 
ATOM   3264 C CG  . ARG A 1 426 ? 17.933  76.797 67.692 1.00 28.92 ? 426 ARG A CG  1 
ATOM   3265 C CD  . ARG A 1 426 ? 17.244  77.521 68.852 1.00 30.40 ? 426 ARG A CD  1 
ATOM   3266 N NE  . ARG A 1 426 ? 16.404  76.532 69.506 1.00 34.79 ? 426 ARG A NE  1 
ATOM   3267 C CZ  . ARG A 1 426 ? 15.508  76.835 70.451 1.00 34.37 ? 426 ARG A CZ  1 
ATOM   3268 N NH1 . ARG A 1 426 ? 15.385  78.110 70.894 1.00 28.88 ? 426 ARG A NH1 1 
ATOM   3269 N NH2 . ARG A 1 426 ? 14.782  75.809 70.917 1.00 31.53 ? 426 ARG A NH2 1 
ATOM   3270 N N   . ALA A 1 427 ? 15.739  79.019 64.755 1.00 20.70 ? 427 ALA A N   1 
ATOM   3271 C CA  . ALA A 1 427 ? 15.312  80.419 64.584 1.00 22.91 ? 427 ALA A CA  1 
ATOM   3272 C C   . ALA A 1 427 ? 15.487  81.223 65.891 1.00 27.76 ? 427 ALA A C   1 
ATOM   3273 O O   . ALA A 1 427 ? 15.349  80.710 67.005 1.00 26.17 ? 427 ALA A O   1 
ATOM   3274 C CB  . ALA A 1 427 ? 13.870  80.550 64.087 1.00 24.91 ? 427 ALA A CB  1 
ATOM   3275 N N   . SER A 1 428 ? 15.751  82.535 65.695 1.00 28.96 ? 428 SER A N   1 
ATOM   3276 C CA  . SER A 1 428 ? 16.016  83.442 66.816 1.00 27.25 ? 428 SER A CA  1 
ATOM   3277 C C   . SER A 1 428 ? 14.855  83.730 67.697 1.00 28.08 ? 428 SER A C   1 
ATOM   3278 O O   . SER A 1 428 ? 15.043  84.144 68.829 1.00 33.22 ? 428 SER A O   1 
ATOM   3279 C CB  . SER A 1 428 ? 16.589  84.793 66.387 1.00 26.48 ? 428 SER A CB  1 
ATOM   3280 O OG  . SER A 1 428 ? 15.824  85.285 65.279 1.00 29.57 ? 428 SER A OG  1 
ATOM   3281 N N   . ASN A 1 429 ? 13.673  83.563 67.149 1.00 24.62 ? 429 ASN A N   1 
ATOM   3282 C CA  . ASN A 1 429 ? 12.467  83.830 67.891 1.00 24.81 ? 429 ASN A CA  1 
ATOM   3283 C C   . ASN A 1 429 ? 11.711  82.572 68.219 1.00 25.77 ? 429 ASN A C   1 
ATOM   3284 O O   . ASN A 1 429 ? 10.484  82.633 68.326 1.00 31.04 ? 429 ASN A O   1 
ATOM   3285 C CB  . ASN A 1 429 ? 11.558  84.716 67.046 1.00 31.49 ? 429 ASN A CB  1 
ATOM   3286 C CG  . ASN A 1 429 ? 11.280  84.160 65.669 1.00 36.73 ? 429 ASN A CG  1 
ATOM   3287 O OD1 . ASN A 1 429 ? 11.908  83.216 65.165 1.00 40.42 ? 429 ASN A OD1 1 
ATOM   3288 N ND2 . ASN A 1 429 ? 10.328  84.835 65.042 1.00 38.82 ? 429 ASN A ND2 1 
ATOM   3289 N N   . LEU A 1 430 ? 12.418  81.421 68.366 1.00 20.98 ? 430 LEU A N   1 
ATOM   3290 C CA  . LEU A 1 430 ? 11.676  80.184 68.630 1.00 14.33 ? 430 LEU A CA  1 
ATOM   3291 C C   . LEU A 1 430 ? 11.049  80.280 70.038 1.00 14.02 ? 430 LEU A C   1 
ATOM   3292 O O   . LEU A 1 430 ? 11.646  80.910 70.888 1.00 17.13 ? 430 LEU A O   1 
ATOM   3293 C CB  . LEU A 1 430 ? 12.655  78.982 68.515 1.00 7.24  ? 430 LEU A CB  1 
ATOM   3294 C CG  . LEU A 1 430 ? 12.179  77.799 67.678 1.00 4.05  ? 430 LEU A CG  1 
ATOM   3295 C CD1 . LEU A 1 430 ? 13.115  76.600 67.803 1.00 3.29  ? 430 LEU A CD1 1 
ATOM   3296 C CD2 . LEU A 1 430 ? 10.803  77.328 68.090 1.00 5.94  ? 430 LEU A CD2 1 
ATOM   3297 N N   . VAL A 1 431 ? 9.873   79.686 70.290 1.00 7.50  ? 431 VAL A N   1 
ATOM   3298 C CA  . VAL A 1 431 ? 9.350   79.759 71.652 1.00 8.87  ? 431 VAL A CA  1 
ATOM   3299 C C   . VAL A 1 431 ? 9.694   78.549 72.483 1.00 10.36 ? 431 VAL A C   1 
ATOM   3300 O O   . VAL A 1 431 ? 9.520   78.472 73.679 1.00 14.65 ? 431 VAL A O   1 
ATOM   3301 C CB  . VAL A 1 431 ? 7.835   79.867 71.665 1.00 9.27  ? 431 VAL A CB  1 
ATOM   3302 C CG1 . VAL A 1 431 ? 7.397   81.260 71.269 1.00 15.73 ? 431 VAL A CG1 1 
ATOM   3303 C CG2 . VAL A 1 431 ? 7.140   78.824 70.793 1.00 15.09 ? 431 VAL A CG2 1 
ATOM   3304 N N   . TRP A 1 432 ? 10.107  77.510 71.809 1.00 17.08 ? 432 TRP A N   1 
ATOM   3305 C CA  . TRP A 1 432 ? 10.461  76.297 72.513 1.00 13.91 ? 432 TRP A CA  1 
ATOM   3306 C C   . TRP A 1 432 ? 11.809  76.522 73.206 1.00 17.65 ? 432 TRP A C   1 
ATOM   3307 O O   . TRP A 1 432 ? 12.555  77.420 72.826 1.00 14.88 ? 432 TRP A O   1 
ATOM   3308 C CB  . TRP A 1 432 ? 10.576  75.185 71.470 1.00 13.92 ? 432 TRP A CB  1 
ATOM   3309 C CG  . TRP A 1 432 ? 9.204   74.814 70.989 1.00 13.40 ? 432 TRP A CG  1 
ATOM   3310 C CD1 . TRP A 1 432 ? 8.629   75.228 69.779 1.00 10.18 ? 432 TRP A CD1 1 
ATOM   3311 C CD2 . TRP A 1 432 ? 8.243   74.033 71.678 1.00 15.32 ? 432 TRP A CD2 1 
ATOM   3312 N NE1 . TRP A 1 432 ? 7.369   74.744 69.694 1.00 20.50 ? 432 TRP A NE1 1 
ATOM   3313 C CE2 . TRP A 1 432 ? 7.067   74.000 70.820 1.00 17.78 ? 432 TRP A CE2 1 
ATOM   3314 C CE3 . TRP A 1 432 ? 8.145   73.473 72.935 1.00 14.29 ? 432 TRP A CE3 1 
ATOM   3315 C CZ2 . TRP A 1 432 ? 5.906   73.379 71.257 1.00 9.68  ? 432 TRP A CZ2 1 
ATOM   3316 C CZ3 . TRP A 1 432 ? 6.952   72.900 73.349 1.00 16.66 ? 432 TRP A CZ3 1 
ATOM   3317 C CH2 . TRP A 1 432 ? 5.850   72.829 72.518 1.00 10.47 ? 432 TRP A CH2 1 
ATOM   3318 N N   . PRO A 1 433 ? 12.100  75.679 74.236 1.00 19.73 ? 433 PRO A N   1 
ATOM   3319 C CA  . PRO A 1 433 ? 13.329  75.793 74.982 1.00 21.13 ? 433 PRO A CA  1 
ATOM   3320 C C   . PRO A 1 433 ? 14.464  75.324 74.137 1.00 24.34 ? 433 PRO A C   1 
ATOM   3321 O O   . PRO A 1 433 ? 14.402  74.337 73.421 1.00 32.32 ? 433 PRO A O   1 
ATOM   3322 C CB  . PRO A 1 433 ? 13.158  74.859 76.194 1.00 22.56 ? 433 PRO A CB  1 
ATOM   3323 C CG  . PRO A 1 433 ? 11.957  73.964 75.905 1.00 22.39 ? 433 PRO A CG  1 
ATOM   3324 C CD  . PRO A 1 433 ? 11.229  74.610 74.720 1.00 22.02 ? 433 PRO A CD  1 
ATOM   3325 N N   . GLU A 1 434 ? 15.556  76.031 74.327 1.00 24.15 ? 434 GLU A N   1 
ATOM   3326 C CA  . GLU A 1 434 ? 16.814  75.809 73.636 1.00 20.26 ? 434 GLU A CA  1 
ATOM   3327 C C   . GLU A 1 434 ? 17.255  74.392 73.560 1.00 20.43 ? 434 GLU A C   1 
ATOM   3328 O O   . GLU A 1 434 ? 17.901  74.003 72.593 1.00 23.48 ? 434 GLU A O   1 
ATOM   3329 C CB  . GLU A 1 434 ? 17.953  76.591 74.353 1.00 22.24 ? 434 GLU A CB  1 
ATOM   3330 C CG  . GLU A 1 434 ? 19.218  76.796 73.509 1.00 23.51 ? 434 GLU A CG  1 
ATOM   3331 N N   . TRP A 1 435 ? 16.931  73.629 74.621 1.00 17.16 ? 435 TRP A N   1 
ATOM   3332 C CA  . TRP A 1 435 ? 17.442  72.265 74.570 1.00 15.38 ? 435 TRP A CA  1 
ATOM   3333 C C   . TRP A 1 435 ? 16.930  71.488 73.383 1.00 15.49 ? 435 TRP A C   1 
ATOM   3334 O O   . TRP A 1 435 ? 17.608  70.598 72.883 1.00 20.88 ? 435 TRP A O   1 
ATOM   3335 C CB  . TRP A 1 435 ? 17.294  71.475 75.897 1.00 9.65  ? 435 TRP A CB  1 
ATOM   3336 C CG  . TRP A 1 435 ? 15.850  71.150 76.235 1.00 6.59  ? 435 TRP A CG  1 
ATOM   3337 C CD1 . TRP A 1 435 ? 14.995  71.894 77.099 1.00 8.18  ? 435 TRP A CD1 1 
ATOM   3338 C CD2 . TRP A 1 435 ? 15.103  70.048 75.787 1.00 4.53  ? 435 TRP A CD2 1 
ATOM   3339 N NE1 . TRP A 1 435 ? 13.777  71.308 77.211 1.00 2.00  ? 435 TRP A NE1 1 
ATOM   3340 C CE2 . TRP A 1 435 ? 13.786  70.174 76.432 1.00 3.46  ? 435 TRP A CE2 1 
ATOM   3341 C CE3 . TRP A 1 435 ? 15.400  68.917 75.033 1.00 2.00  ? 435 TRP A CE3 1 
ATOM   3342 C CZ2 . TRP A 1 435 ? 12.886  69.127 76.275 1.00 7.35  ? 435 TRP A CZ2 1 
ATOM   3343 C CZ3 . TRP A 1 435 ? 14.447  67.914 74.917 1.00 2.00  ? 435 TRP A CZ3 1 
ATOM   3344 C CH2 . TRP A 1 435 ? 13.208  68.002 75.523 1.00 2.00  ? 435 TRP A CH2 1 
ATOM   3345 N N   . MET A 1 436 ? 15.711  71.825 72.956 1.00 14.63 ? 436 MET A N   1 
ATOM   3346 C CA  . MET A 1 436 ? 15.128  71.099 71.843 1.00 17.22 ? 436 MET A CA  1 
ATOM   3347 C C   . MET A 1 436 ? 15.882  71.343 70.526 1.00 20.77 ? 436 MET A C   1 
ATOM   3348 O O   . MET A 1 436 ? 15.863  70.531 69.610 1.00 15.97 ? 436 MET A O   1 
ATOM   3349 C CB  . MET A 1 436 ? 13.654  71.434 71.758 1.00 13.64 ? 436 MET A CB  1 
ATOM   3350 C CG  . MET A 1 436 ? 12.847  70.870 72.906 1.00 2.00  ? 436 MET A CG  1 
ATOM   3351 S SD  . MET A 1 436 ? 11.224  71.703 72.791 1.00 13.36 ? 436 MET A SD  1 
ATOM   3352 C CE  . MET A 1 436 ? 10.273  70.402 71.934 1.00 3.34  ? 436 MET A CE  1 
ATOM   3353 N N   . GLY A 1 437 ? 16.557  72.497 70.456 1.00 21.83 ? 437 GLY A N   1 
ATOM   3354 C CA  . GLY A 1 437 ? 17.326  72.815 69.263 1.00 17.62 ? 437 GLY A CA  1 
ATOM   3355 C C   . GLY A 1 437 ? 16.464  73.082 68.024 1.00 19.52 ? 437 GLY A C   1 
ATOM   3356 O O   . GLY A 1 437 ? 15.439  73.766 68.031 1.00 21.74 ? 437 GLY A O   1 
ATOM   3357 N N   . VAL A 1 438 ? 16.978  72.539 66.912 1.00 20.56 ? 438 VAL A N   1 
ATOM   3358 C CA  . VAL A 1 438 ? 16.357  72.629 65.593 1.00 14.87 ? 438 VAL A CA  1 
ATOM   3359 C C   . VAL A 1 438 ? 15.352  71.483 65.543 1.00 10.84 ? 438 VAL A C   1 
ATOM   3360 O O   . VAL A 1 438 ? 15.591  70.331 65.209 1.00 2.00  ? 438 VAL A O   1 
ATOM   3361 C CB  . VAL A 1 438 ? 17.441  72.545 64.514 1.00 10.15 ? 438 VAL A CB  1 
ATOM   3362 C CG1 . VAL A 1 438 ? 16.806  72.725 63.170 1.00 17.07 ? 438 VAL A CG1 1 
ATOM   3363 C CG2 . VAL A 1 438 ? 18.518  73.626 64.678 1.00 2.00  ? 438 VAL A CG2 1 
ATOM   3364 N N   . ILE A 1 439 ? 14.181  71.904 65.925 1.00 15.24 ? 439 ILE A N   1 
ATOM   3365 C CA  . ILE A 1 439 ? 13.102  70.987 66.028 1.00 18.65 ? 439 ILE A CA  1 
ATOM   3366 C C   . ILE A 1 439 ? 12.545  70.511 64.712 1.00 18.20 ? 439 ILE A C   1 
ATOM   3367 O O   . ILE A 1 439 ? 12.467  71.136 63.663 1.00 19.68 ? 439 ILE A O   1 
ATOM   3368 C CB  . ILE A 1 439 ? 11.976  71.662 66.879 1.00 18.64 ? 439 ILE A CB  1 
ATOM   3369 C CG1 . ILE A 1 439 ? 12.518  72.078 68.260 1.00 15.76 ? 439 ILE A CG1 1 
ATOM   3370 C CG2 . ILE A 1 439 ? 10.672  70.807 67.026 1.00 22.10 ? 439 ILE A CG2 1 
ATOM   3371 C CD1 . ILE A 1 439 ? 11.508  72.855 69.106 1.00 6.76  ? 439 ILE A CD1 1 
ATOM   3372 N N   . HIS A 1 440 ? 12.020  69.327 64.853 1.00 16.53 ? 440 HIS A N   1 
ATOM   3373 C CA  . HIS A 1 440 ? 11.392  68.736 63.734 1.00 13.38 ? 440 HIS A CA  1 
ATOM   3374 C C   . HIS A 1 440 ? 10.227  69.620 63.366 1.00 12.56 ? 440 HIS A C   1 
ATOM   3375 O O   . HIS A 1 440 ? 9.236   69.614 64.060 1.00 13.59 ? 440 HIS A O   1 
ATOM   3376 C CB  . HIS A 1 440 ? 10.929  67.372 64.235 1.00 10.49 ? 440 HIS A CB  1 
ATOM   3377 C CG  . HIS A 1 440 ? 10.017  66.648 63.274 1.00 9.22  ? 440 HIS A CG  1 
ATOM   3378 N ND1 . HIS A 1 440 ? 10.373  65.557 62.580 1.00 2.00  ? 440 HIS A ND1 1 
ATOM   3379 C CD2 . HIS A 1 440 ? 8.627   66.847 63.113 1.00 7.71  ? 440 HIS A CD2 1 
ATOM   3380 C CE1 . HIS A 1 440 ? 9.239   65.080 62.040 1.00 8.91  ? 440 HIS A CE1 1 
ATOM   3381 N NE2 . HIS A 1 440 ? 8.160   65.836 62.352 1.00 11.31 ? 440 HIS A NE2 1 
ATOM   3382 N N   . GLY A 1 441 ? 10.338  70.408 62.315 1.00 11.66 ? 441 GLY A N   1 
ATOM   3383 C CA  . GLY A 1 441 ? 9.157   71.173 61.972 1.00 11.37 ? 441 GLY A CA  1 
ATOM   3384 C C   . GLY A 1 441 ? 9.423   72.586 61.764 1.00 14.74 ? 441 GLY A C   1 
ATOM   3385 O O   . GLY A 1 441 ? 8.664   73.289 61.081 1.00 15.13 ? 441 GLY A O   1 
ATOM   3386 N N   . TYR A 1 442 ? 10.579  72.992 62.284 1.00 8.80  ? 442 TYR A N   1 
ATOM   3387 C CA  . TYR A 1 442 ? 10.814  74.418 62.205 1.00 10.90 ? 442 TYR A CA  1 
ATOM   3388 C C   . TYR A 1 442 ? 11.437  74.968 60.889 1.00 15.46 ? 442 TYR A C   1 
ATOM   3389 O O   . TYR A 1 442 ? 11.650  76.161 60.683 1.00 17.78 ? 442 TYR A O   1 
ATOM   3390 C CB  . TYR A 1 442 ? 11.293  74.869 63.617 1.00 14.09 ? 442 TYR A CB  1 
ATOM   3391 C CG  . TYR A 1 442 ? 10.122  74.855 64.628 1.00 10.15 ? 442 TYR A CG  1 
ATOM   3392 C CD1 . TYR A 1 442 ? 9.605   73.670 65.141 1.00 8.76  ? 442 TYR A CD1 1 
ATOM   3393 C CD2 . TYR A 1 442 ? 9.475   76.036 64.945 1.00 11.63 ? 442 TYR A CD2 1 
ATOM   3394 C CE1 . TYR A 1 442 ? 8.458   73.639 65.894 1.00 7.25  ? 442 TYR A CE1 1 
ATOM   3395 C CE2 . TYR A 1 442 ? 8.297   76.029 65.667 1.00 10.96 ? 442 TYR A CE2 1 
ATOM   3396 C CZ  . TYR A 1 442 ? 7.782   74.824 66.115 1.00 14.73 ? 442 TYR A CZ  1 
ATOM   3397 O OH  . TYR A 1 442 ? 6.570   74.801 66.762 1.00 18.81 ? 442 TYR A OH  1 
ATOM   3398 N N   . GLU A 1 443 ? 11.725  74.069 59.945 1.00 16.80 ? 443 GLU A N   1 
ATOM   3399 C CA  . GLU A 1 443 ? 12.284  74.543 58.675 1.00 10.75 ? 443 GLU A CA  1 
ATOM   3400 C C   . GLU A 1 443 ? 11.163  75.083 57.803 1.00 6.62  ? 443 GLU A C   1 
ATOM   3401 O O   . GLU A 1 443 ? 11.292  76.050 57.056 1.00 5.99  ? 443 GLU A O   1 
ATOM   3402 C CB  . GLU A 1 443 ? 13.053  73.433 57.995 1.00 14.48 ? 443 GLU A CB  1 
ATOM   3403 C CG  . GLU A 1 443 ? 12.208  72.512 57.118 1.00 12.88 ? 443 GLU A CG  1 
ATOM   3404 C CD  . GLU A 1 443 ? 11.274  71.573 57.811 1.00 13.06 ? 443 GLU A CD  1 
ATOM   3405 O OE1 . GLU A 1 443 ? 11.586  70.990 58.848 1.00 16.99 ? 443 GLU A OE1 1 
ATOM   3406 O OE2 . GLU A 1 443 ? 10.215  71.390 57.248 1.00 14.39 ? 443 GLU A OE2 1 
ATOM   3407 N N   . ILE A 1 444 ? 10.028  74.412 57.940 1.00 2.31  ? 444 ILE A N   1 
ATOM   3408 C CA  . ILE A 1 444 ? 8.828   74.821 57.224 1.00 4.64  ? 444 ILE A CA  1 
ATOM   3409 C C   . ILE A 1 444 ? 8.666   76.350 57.171 1.00 10.13 ? 444 ILE A C   1 
ATOM   3410 O O   . ILE A 1 444 ? 8.543   76.931 56.109 1.00 14.75 ? 444 ILE A O   1 
ATOM   3411 C CB  . ILE A 1 444 ? 7.549   74.217 57.901 1.00 2.00  ? 444 ILE A CB  1 
ATOM   3412 C CG1 . ILE A 1 444 ? 7.602   72.691 57.967 1.00 6.70  ? 444 ILE A CG1 1 
ATOM   3413 C CG2 . ILE A 1 444 ? 6.230   74.668 57.261 1.00 2.00  ? 444 ILE A CG2 1 
ATOM   3414 C CD1 . ILE A 1 444 ? 6.318   71.984 58.432 1.00 2.00  ? 444 ILE A CD1 1 
ATOM   3415 N N   . GLU A 1 445 ? 8.727   77.030 58.331 1.00 13.33 ? 445 GLU A N   1 
ATOM   3416 C CA  . GLU A 1 445 ? 8.483   78.477 58.313 1.00 14.14 ? 445 GLU A CA  1 
ATOM   3417 C C   . GLU A 1 445 ? 9.378   79.288 57.411 1.00 14.87 ? 445 GLU A C   1 
ATOM   3418 O O   . GLU A 1 445 ? 9.058   80.422 57.034 1.00 12.25 ? 445 GLU A O   1 
ATOM   3419 C CB  . GLU A 1 445 ? 8.392   79.091 59.726 1.00 19.92 ? 445 GLU A CB  1 
ATOM   3420 C CG  . GLU A 1 445 ? 9.713   79.177 60.540 1.00 20.23 ? 445 GLU A CG  1 
ATOM   3421 C CD  . GLU A 1 445 ? 9.428   78.961 62.022 1.00 21.74 ? 445 GLU A CD  1 
ATOM   3422 O OE1 . GLU A 1 445 ? 8.679   78.009 62.329 1.00 8.56  ? 445 GLU A OE1 1 
ATOM   3423 O OE2 . GLU A 1 445 ? 9.974   79.731 62.846 1.00 22.08 ? 445 GLU A OE2 1 
ATOM   3424 N N   . PHE A 1 446 ? 10.532  78.674 57.127 1.00 15.75 ? 446 PHE A N   1 
ATOM   3425 C CA  . PHE A 1 446 ? 11.498  79.316 56.261 1.00 18.55 ? 446 PHE A CA  1 
ATOM   3426 C C   . PHE A 1 446 ? 11.112  79.039 54.858 1.00 17.49 ? 446 PHE A C   1 
ATOM   3427 O O   . PHE A 1 446 ? 11.133  79.911 54.023 1.00 17.20 ? 446 PHE A O   1 
ATOM   3428 C CB  . PHE A 1 446 ? 12.918  78.822 56.558 1.00 22.08 ? 446 PHE A CB  1 
ATOM   3429 C CG  . PHE A 1 446 ? 13.499  79.616 57.714 1.00 26.45 ? 446 PHE A CG  1 
ATOM   3430 C CD1 . PHE A 1 446 ? 13.119  79.335 59.007 1.00 26.46 ? 446 PHE A CD1 1 
ATOM   3431 C CD2 . PHE A 1 446 ? 14.432  80.625 57.504 1.00 28.40 ? 446 PHE A CD2 1 
ATOM   3432 C CE1 . PHE A 1 446 ? 13.687  80.025 60.052 1.00 28.55 ? 446 PHE A CE1 1 
ATOM   3433 C CE2 . PHE A 1 446 ? 15.002  81.317 58.561 1.00 26.70 ? 446 PHE A CE2 1 
ATOM   3434 C CZ  . PHE A 1 446 ? 14.636  81.011 59.846 1.00 25.70 ? 446 PHE A CZ  1 
ATOM   3435 N N   . VAL A 1 447 ? 10.752  77.797 54.588 1.00 18.42 ? 447 VAL A N   1 
ATOM   3436 C CA  . VAL A 1 447 ? 10.345  77.458 53.228 1.00 14.80 ? 447 VAL A CA  1 
ATOM   3437 C C   . VAL A 1 447 ? 9.148   78.262 52.803 1.00 14.09 ? 447 VAL A C   1 
ATOM   3438 O O   . VAL A 1 447 ? 9.049   78.643 51.668 1.00 22.33 ? 447 VAL A O   1 
ATOM   3439 C CB  . VAL A 1 447 ? 10.006  75.954 53.174 1.00 11.26 ? 447 VAL A CB  1 
ATOM   3440 C CG1 . VAL A 1 447 ? 9.385   75.464 51.871 1.00 7.48  ? 447 VAL A CG1 1 
ATOM   3441 C CG2 . VAL A 1 447 ? 11.281  75.183 53.467 1.00 11.04 ? 447 VAL A CG2 1 
ATOM   3442 N N   . PHE A 1 448 ? 8.226   78.531 53.687 1.00 12.33 ? 448 PHE A N   1 
ATOM   3443 C CA  . PHE A 1 448 ? 7.037   79.269 53.282 1.00 10.22 ? 448 PHE A CA  1 
ATOM   3444 C C   . PHE A 1 448 ? 7.121   80.791 53.448 1.00 12.27 ? 448 PHE A C   1 
ATOM   3445 O O   . PHE A 1 448 ? 6.111   81.468 53.539 1.00 17.76 ? 448 PHE A O   1 
ATOM   3446 C CB  . PHE A 1 448 ? 5.856   78.684 54.070 1.00 6.40  ? 448 PHE A CB  1 
ATOM   3447 C CG  . PHE A 1 448 ? 5.137   77.521 53.412 1.00 7.57  ? 448 PHE A CG  1 
ATOM   3448 C CD1 . PHE A 1 448 ? 5.755   76.298 53.267 1.00 4.84  ? 448 PHE A CD1 1 
ATOM   3449 C CD2 . PHE A 1 448 ? 3.829   77.690 52.935 1.00 8.07  ? 448 PHE A CD2 1 
ATOM   3450 C CE1 . PHE A 1 448 ? 5.100   75.249 52.645 1.00 6.30  ? 448 PHE A CE1 1 
ATOM   3451 C CE2 . PHE A 1 448 ? 3.170   76.648 52.306 1.00 11.19 ? 448 PHE A CE2 1 
ATOM   3452 C CZ  . PHE A 1 448 ? 3.815   75.428 52.157 1.00 12.95 ? 448 PHE A CZ  1 
ATOM   3453 N N   . GLY A 1 449 ? 8.308   81.350 53.533 1.00 14.09 ? 449 GLY A N   1 
ATOM   3454 C CA  . GLY A 1 449 ? 8.452   82.814 53.637 1.00 19.76 ? 449 GLY A CA  1 
ATOM   3455 C C   . GLY A 1 449 ? 7.952   83.637 54.843 1.00 23.62 ? 449 GLY A C   1 
ATOM   3456 O O   . GLY A 1 449 ? 7.620   84.828 54.726 1.00 22.21 ? 449 GLY A O   1 
ATOM   3457 N N   . LEU A 1 450 ? 7.901   83.027 56.026 1.00 23.89 ? 450 LEU A N   1 
ATOM   3458 C CA  . LEU A 1 450 ? 7.433   83.886 57.127 1.00 22.44 ? 450 LEU A CA  1 
ATOM   3459 C C   . LEU A 1 450 ? 8.481   84.860 57.586 1.00 19.34 ? 450 LEU A C   1 
ATOM   3460 O O   . LEU A 1 450 ? 8.117   85.935 58.013 1.00 15.48 ? 450 LEU A O   1 
ATOM   3461 C CB  . LEU A 1 450 ? 6.986   83.076 58.320 1.00 28.34 ? 450 LEU A CB  1 
ATOM   3462 C CG  . LEU A 1 450 ? 5.561   82.538 58.225 1.00 28.93 ? 450 LEU A CG  1 
ATOM   3463 C CD1 . LEU A 1 450 ? 5.026   82.401 56.796 1.00 30.82 ? 450 LEU A CD1 1 
ATOM   3464 C CD2 . LEU A 1 450 ? 5.538   81.161 58.899 1.00 28.05 ? 450 LEU A CD2 1 
ATOM   3465 N N   . PRO A 1 451 ? 9.784   84.535 57.503 1.00 17.48 ? 451 PRO A N   1 
ATOM   3466 C CA  . PRO A 1 451 ? 10.774  85.583 57.734 1.00 16.30 ? 451 PRO A CA  1 
ATOM   3467 C C   . PRO A 1 451 ? 10.767  86.823 56.824 1.00 18.99 ? 451 PRO A C   1 
ATOM   3468 O O   . PRO A 1 451 ? 11.723  87.597 56.858 1.00 24.60 ? 451 PRO A O   1 
ATOM   3469 C CB  . PRO A 1 451 ? 12.133  84.849 57.714 1.00 12.09 ? 451 PRO A CB  1 
ATOM   3470 C CG  . PRO A 1 451 ? 11.798  83.397 58.000 1.00 10.19 ? 451 PRO A CG  1 
ATOM   3471 C CD  . PRO A 1 451 ? 10.369  83.193 57.439 1.00 13.24 ? 451 PRO A CD  1 
ATOM   3472 N N   . LEU A 1 452 ? 9.749   86.976 55.955 1.00 21.49 ? 452 LEU A N   1 
ATOM   3473 C CA  . LEU A 1 452 ? 9.678   88.170 55.090 1.00 23.48 ? 452 LEU A CA  1 
ATOM   3474 C C   . LEU A 1 452 ? 8.789   89.156 55.793 1.00 23.41 ? 452 LEU A C   1 
ATOM   3475 O O   . LEU A 1 452 ? 8.922   90.347 55.617 1.00 24.73 ? 452 LEU A O   1 
ATOM   3476 C CB  . LEU A 1 452 ? 9.211   87.916 53.624 1.00 19.27 ? 452 LEU A CB  1 
ATOM   3477 C CG  . LEU A 1 452 ? 10.132  87.028 52.764 1.00 17.61 ? 452 LEU A CG  1 
ATOM   3478 C CD1 . LEU A 1 452 ? 11.613  87.155 53.136 1.00 11.68 ? 452 LEU A CD1 1 
ATOM   3479 C CD2 . LEU A 1 452 ? 9.728   85.546 52.829 1.00 14.92 ? 452 LEU A CD2 1 
ATOM   3480 N N   . VAL A 1 453 ? 7.866   88.642 56.579 1.00 28.41 ? 453 VAL A N   1 
ATOM   3481 C CA  . VAL A 1 453 ? 6.963   89.474 57.347 1.00 36.66 ? 453 VAL A CA  1 
ATOM   3482 C C   . VAL A 1 453 ? 7.765   90.112 58.538 1.00 43.30 ? 453 VAL A C   1 
ATOM   3483 O O   . VAL A 1 453 ? 8.234   89.451 59.465 1.00 46.58 ? 453 VAL A O   1 
ATOM   3484 C CB  . VAL A 1 453 ? 5.883   88.513 57.871 1.00 33.11 ? 453 VAL A CB  1 
ATOM   3485 C CG1 . VAL A 1 453 ? 4.722   89.268 58.490 1.00 35.04 ? 453 VAL A CG1 1 
ATOM   3486 C CG2 . VAL A 1 453 ? 5.371   87.570 56.781 1.00 33.69 ? 453 VAL A CG2 1 
ATOM   3487 N N   . LYS A 1 454 ? 7.869   91.441 58.535 1.00 45.59 ? 454 LYS A N   1 
ATOM   3488 C CA  . LYS A 1 454 ? 8.647   92.099 59.606 1.00 49.69 ? 454 LYS A CA  1 
ATOM   3489 C C   . LYS A 1 454 ? 8.011   92.039 61.011 1.00 49.24 ? 454 LYS A C   1 
ATOM   3490 O O   . LYS A 1 454 ? 8.623   91.948 62.081 1.00 46.31 ? 454 LYS A O   1 
ATOM   3491 C CB  . LYS A 1 454 ? 8.856   93.571 59.200 1.00 53.38 ? 454 LYS A CB  1 
ATOM   3492 C CG  . LYS A 1 454 ? 9.454   93.718 57.783 1.00 61.47 ? 454 LYS A CG  1 
ATOM   3493 C CD  . LYS A 1 454 ? 10.809  92.986 57.584 1.00 64.58 ? 454 LYS A CD  1 
ATOM   3494 C CE  . LYS A 1 454 ? 11.383  93.171 56.171 1.00 66.21 ? 454 LYS A CE  1 
ATOM   3495 N NZ  . LYS A 1 454 ? 12.688  92.545 56.086 1.00 71.67 ? 454 LYS A NZ  1 
ATOM   3496 N N   . GLU A 1 455 ? 6.688   92.096 60.915 1.00 45.99 ? 455 GLU A N   1 
ATOM   3497 C CA  . GLU A 1 455 ? 5.851   92.096 62.091 1.00 41.36 ? 455 GLU A CA  1 
ATOM   3498 C C   . GLU A 1 455 ? 6.138   90.936 62.991 1.00 42.88 ? 455 GLU A C   1 
ATOM   3499 O O   . GLU A 1 455 ? 6.021   91.091 64.183 1.00 47.28 ? 455 GLU A O   1 
ATOM   3500 C CB  . GLU A 1 455 ? 4.366   92.115 61.695 1.00 35.18 ? 455 GLU A CB  1 
ATOM   3501 C CG  . GLU A 1 455 ? 4.116   93.110 60.558 1.00 31.47 ? 455 GLU A CG  1 
ATOM   3502 N N   . LEU A 1 456 ? 6.510   89.790 62.434 1.00 41.75 ? 456 LEU A N   1 
ATOM   3503 C CA  . LEU A 1 456 ? 6.747   88.658 63.322 1.00 41.90 ? 456 LEU A CA  1 
ATOM   3504 C C   . LEU A 1 456 ? 8.189   88.428 63.798 1.00 42.09 ? 456 LEU A C   1 
ATOM   3505 O O   . LEU A 1 456 ? 8.625   87.325 64.115 1.00 41.04 ? 456 LEU A O   1 
ATOM   3506 C CB  . LEU A 1 456 ? 5.903   87.422 62.976 1.00 41.69 ? 456 LEU A CB  1 
ATOM   3507 C CG  . LEU A 1 456 ? 5.669   87.155 61.492 1.00 39.63 ? 456 LEU A CG  1 
ATOM   3508 C CD1 . LEU A 1 456 ? 6.732   86.211 60.986 1.00 35.03 ? 456 LEU A CD1 1 
ATOM   3509 C CD2 . LEU A 1 456 ? 4.267   86.589 61.247 1.00 41.80 ? 456 LEU A CD2 1 
ATOM   3510 N N   . ASN A 1 457 ? 8.918   89.524 63.838 1.00 41.46 ? 457 ASN A N   1 
ATOM   3511 C CA  . ASN A 1 457 ? 10.275  89.543 64.376 1.00 43.16 ? 457 ASN A CA  1 
ATOM   3512 C C   . ASN A 1 457 ? 11.268  88.446 64.066 1.00 41.67 ? 457 ASN A C   1 
ATOM   3513 O O   . ASN A 1 457 ? 11.574  87.664 64.958 1.00 45.32 ? 457 ASN A O   1 
ATOM   3514 C CB  . ASN A 1 457 ? 10.237  89.476 65.936 1.00 47.45 ? 457 ASN A CB  1 
ATOM   3515 C CG  . ASN A 1 457 ? 9.371   90.459 66.673 1.00 52.99 ? 457 ASN A CG  1 
ATOM   3516 O OD1 . ASN A 1 457 ? 8.438   90.095 67.389 1.00 54.01 ? 457 ASN A OD1 1 
ATOM   3517 N ND2 . ASN A 1 457 ? 9.717   91.745 66.494 1.00 50.76 ? 457 ASN A ND2 1 
ATOM   3518 N N   . TYR A 1 458 ? 11.790  88.359 62.845 1.00 38.01 ? 458 TYR A N   1 
ATOM   3519 C CA  . TYR A 1 458 ? 12.849  87.340 62.652 1.00 33.60 ? 458 TYR A CA  1 
ATOM   3520 C C   . TYR A 1 458 ? 14.068  88.218 62.485 1.00 35.47 ? 458 TYR A C   1 
ATOM   3521 O O   . TYR A 1 458 ? 13.924  89.425 62.538 1.00 40.60 ? 458 TYR A O   1 
ATOM   3522 C CB  . TYR A 1 458 ? 12.666  86.511 61.411 1.00 28.57 ? 458 TYR A CB  1 
ATOM   3523 C CG  . TYR A 1 458 ? 11.777  85.321 61.623 1.00 21.56 ? 458 TYR A CG  1 
ATOM   3524 C CD1 . TYR A 1 458 ? 10.408  85.492 61.450 1.00 15.50 ? 458 TYR A CD1 1 
ATOM   3525 C CD2 . TYR A 1 458 ? 12.292  84.071 61.952 1.00 13.94 ? 458 TYR A CD2 1 
ATOM   3526 C CE1 . TYR A 1 458 ? 9.549   84.437 61.594 1.00 5.84  ? 458 TYR A CE1 1 
ATOM   3527 C CE2 . TYR A 1 458 ? 11.415  83.017 62.110 1.00 14.56 ? 458 TYR A CE2 1 
ATOM   3528 C CZ  . TYR A 1 458 ? 10.046  83.211 61.932 1.00 10.41 ? 458 TYR A CZ  1 
ATOM   3529 O OH  . TYR A 1 458 ? 9.116   82.201 62.064 1.00 14.86 ? 458 TYR A OH  1 
ATOM   3530 N N   . THR A 1 459 ? 15.269  87.677 62.289 1.00 36.13 ? 459 THR A N   1 
ATOM   3531 C CA  . THR A 1 459 ? 16.408  88.592 62.132 1.00 36.83 ? 459 THR A CA  1 
ATOM   3532 C C   . THR A 1 459 ? 16.651  88.699 60.681 1.00 38.32 ? 459 THR A C   1 
ATOM   3533 O O   . THR A 1 459 ? 16.260  87.783 59.979 1.00 46.04 ? 459 THR A O   1 
ATOM   3534 C CB  . THR A 1 459 ? 17.681  88.084 62.849 1.00 38.56 ? 459 THR A CB  1 
ATOM   3535 O OG1 . THR A 1 459 ? 18.113  86.767 62.441 1.00 39.54 ? 459 THR A OG1 1 
ATOM   3536 C CG2 . THR A 1 459 ? 17.483  88.110 64.371 1.00 43.32 ? 459 THR A CG2 1 
ATOM   3537 N N   . ALA A 1 460 ? 17.350  89.734 60.231 1.00 37.19 ? 460 ALA A N   1 
ATOM   3538 C CA  . ALA A 1 460 ? 17.597  89.854 58.803 1.00 34.77 ? 460 ALA A CA  1 
ATOM   3539 C C   . ALA A 1 460 ? 18.298  88.686 58.156 1.00 35.05 ? 460 ALA A C   1 
ATOM   3540 O O   . ALA A 1 460 ? 18.001  88.334 57.020 1.00 39.77 ? 460 ALA A O   1 
ATOM   3541 C CB  . ALA A 1 460 ? 18.467  91.053 58.499 1.00 36.15 ? 460 ALA A CB  1 
ATOM   3542 N N   . GLU A 1 461 ? 19.252  88.078 58.864 1.00 30.43 ? 461 GLU A N   1 
ATOM   3543 C CA  . GLU A 1 461 ? 19.877  86.960 58.161 1.00 27.40 ? 461 GLU A CA  1 
ATOM   3544 C C   . GLU A 1 461 ? 18.867  85.818 57.955 1.00 28.61 ? 461 GLU A C   1 
ATOM   3545 O O   . GLU A 1 461 ? 19.008  85.004 57.059 1.00 31.20 ? 461 GLU A O   1 
ATOM   3546 C CB  . GLU A 1 461 ? 21.153  86.536 58.855 1.00 28.31 ? 461 GLU A CB  1 
ATOM   3547 C CG  . GLU A 1 461 ? 21.960  87.736 59.377 1.00 32.29 ? 461 GLU A CG  1 
ATOM   3548 N N   . GLU A 1 462 ? 17.851  85.730 58.822 1.00 26.38 ? 462 GLU A N   1 
ATOM   3549 C CA  . GLU A 1 462 ? 16.841  84.690 58.634 1.00 27.76 ? 462 GLU A CA  1 
ATOM   3550 C C   . GLU A 1 462 ? 15.988  85.028 57.419 1.00 34.17 ? 462 GLU A C   1 
ATOM   3551 O O   . GLU A 1 462 ? 15.575  84.148 56.666 1.00 38.60 ? 462 GLU A O   1 
ATOM   3552 C CB  . GLU A 1 462 ? 15.944  84.571 59.853 1.00 24.58 ? 462 GLU A CB  1 
ATOM   3553 C CG  . GLU A 1 462 ? 16.816  83.903 60.894 1.00 22.50 ? 462 GLU A CG  1 
ATOM   3554 C CD  . GLU A 1 462 ? 16.216  83.943 62.241 1.00 21.38 ? 462 GLU A CD  1 
ATOM   3555 O OE1 . GLU A 1 462 ? 15.356  84.789 62.531 1.00 14.53 ? 462 GLU A OE1 1 
ATOM   3556 O OE2 . GLU A 1 462 ? 16.657  83.107 63.007 1.00 25.19 ? 462 GLU A OE2 1 
ATOM   3557 N N   . GLU A 1 463 ? 15.726  86.340 57.224 1.00 34.30 ? 463 GLU A N   1 
ATOM   3558 C CA  . GLU A 1 463 ? 14.960  86.769 56.044 1.00 30.13 ? 463 GLU A CA  1 
ATOM   3559 C C   . GLU A 1 463 ? 15.731  86.226 54.854 1.00 27.34 ? 463 GLU A C   1 
ATOM   3560 O O   . GLU A 1 463 ? 15.244  85.527 53.990 1.00 30.85 ? 463 GLU A O   1 
ATOM   3561 C CB  . GLU A 1 463 ? 14.844  88.318 55.923 1.00 32.71 ? 463 GLU A CB  1 
ATOM   3562 C CG  . GLU A 1 463 ? 13.897  88.717 54.771 1.00 35.37 ? 463 GLU A CG  1 
ATOM   3563 C CD  . GLU A 1 463 ? 13.940  90.155 54.235 1.00 37.77 ? 463 GLU A CD  1 
ATOM   3564 O OE1 . GLU A 1 463 ? 15.026  90.731 54.087 1.00 36.10 ? 463 GLU A OE1 1 
ATOM   3565 O OE2 . GLU A 1 463 ? 12.862  90.677 53.926 1.00 42.22 ? 463 GLU A OE2 1 
ATOM   3566 N N   . ALA A 1 464 ? 17.003  86.528 54.854 1.00 22.84 ? 464 ALA A N   1 
ATOM   3567 C CA  . ALA A 1 464 ? 17.793  86.038 53.777 1.00 22.36 ? 464 ALA A CA  1 
ATOM   3568 C C   . ALA A 1 464 ? 17.805  84.518 53.635 1.00 23.82 ? 464 ALA A C   1 
ATOM   3569 O O   . ALA A 1 464 ? 17.723  84.009 52.531 1.00 29.03 ? 464 ALA A O   1 
ATOM   3570 C CB  . ALA A 1 464 ? 19.219  86.490 54.006 1.00 20.19 ? 464 ALA A CB  1 
ATOM   3571 N N   . LEU A 1 465 ? 17.923  83.788 54.740 1.00 22.69 ? 465 LEU A N   1 
ATOM   3572 C CA  . LEU A 1 465 ? 17.983  82.333 54.656 1.00 19.48 ? 465 LEU A CA  1 
ATOM   3573 C C   . LEU A 1 465 ? 16.709  81.796 54.055 1.00 22.24 ? 465 LEU A C   1 
ATOM   3574 O O   . LEU A 1 465 ? 16.736  80.802 53.326 1.00 17.45 ? 465 LEU A O   1 
ATOM   3575 C CB  . LEU A 1 465 ? 18.278  81.705 56.031 1.00 19.50 ? 465 LEU A CB  1 
ATOM   3576 C CG  . LEU A 1 465 ? 18.250  80.157 56.078 1.00 17.06 ? 465 LEU A CG  1 
ATOM   3577 C CD1 . LEU A 1 465 ? 19.230  79.513 55.136 1.00 18.10 ? 465 LEU A CD1 1 
ATOM   3578 C CD2 . LEU A 1 465 ? 18.566  79.635 57.476 1.00 16.25 ? 465 LEU A CD2 1 
ATOM   3579 N N   . SER A 1 466 ? 15.594  82.486 54.398 1.00 21.83 ? 466 SER A N   1 
ATOM   3580 C CA  . SER A 1 466 ? 14.279  82.139 53.893 1.00 24.04 ? 466 SER A CA  1 
ATOM   3581 C C   . SER A 1 466 ? 14.264  82.416 52.406 1.00 29.42 ? 466 SER A C   1 
ATOM   3582 O O   . SER A 1 466 ? 13.677  81.687 51.629 1.00 36.89 ? 466 SER A O   1 
ATOM   3583 C CB  . SER A 1 466 ? 13.205  82.987 54.583 1.00 24.05 ? 466 SER A CB  1 
ATOM   3584 O OG  . SER A 1 466 ? 11.863  82.858 54.094 1.00 21.43 ? 466 SER A OG  1 
ATOM   3585 N N   . ARG A 1 467 ? 14.902  83.480 51.957 1.00 30.51 ? 467 ARG A N   1 
ATOM   3586 C CA  . ARG A 1 467 ? 14.842  83.671 50.502 1.00 31.37 ? 467 ARG A CA  1 
ATOM   3587 C C   . ARG A 1 467 ? 15.678  82.621 49.758 1.00 28.65 ? 467 ARG A C   1 
ATOM   3588 O O   . ARG A 1 467 ? 15.225  82.102 48.744 1.00 25.27 ? 467 ARG A O   1 
ATOM   3589 C CB  . ARG A 1 467 ? 15.227  85.102 50.166 1.00 37.43 ? 467 ARG A CB  1 
ATOM   3590 C CG  . ARG A 1 467 ? 14.253  86.038 50.873 1.00 45.18 ? 467 ARG A CG  1 
ATOM   3591 C CD  . ARG A 1 467 ? 14.349  87.509 50.482 1.00 52.23 ? 467 ARG A CD  1 
ATOM   3592 N NE  . ARG A 1 467 ? 12.984  87.981 50.364 1.00 60.41 ? 467 ARG A NE  1 
ATOM   3593 C CZ  . ARG A 1 467 ? 12.679  89.258 50.176 1.00 65.20 ? 467 ARG A CZ  1 
ATOM   3594 N NH1 . ARG A 1 467 ? 13.604  90.195 50.393 1.00 69.97 ? 467 ARG A NH1 1 
ATOM   3595 N NH2 . ARG A 1 467 ? 11.447  89.569 49.748 1.00 68.45 ? 467 ARG A NH2 1 
ATOM   3596 N N   . ARG A 1 468 ? 16.897  82.313 50.281 1.00 25.08 ? 468 ARG A N   1 
ATOM   3597 C CA  . ARG A 1 468 ? 17.747  81.300 49.645 1.00 21.50 ? 468 ARG A CA  1 
ATOM   3598 C C   . ARG A 1 468 ? 16.969  80.016 49.550 1.00 19.38 ? 468 ARG A C   1 
ATOM   3599 O O   . ARG A 1 468 ? 16.999  79.325 48.557 1.00 22.50 ? 468 ARG A O   1 
ATOM   3600 C CB  . ARG A 1 468 ? 18.967  80.874 50.491 1.00 22.53 ? 468 ARG A CB  1 
ATOM   3601 C CG  . ARG A 1 468 ? 20.110  81.879 50.691 1.00 30.71 ? 468 ARG A CG  1 
ATOM   3602 C CD  . ARG A 1 468 ? 21.233  81.356 51.630 1.00 35.01 ? 468 ARG A CD  1 
ATOM   3603 N NE  . ARG A 1 468 ? 21.562  79.954 51.341 1.00 48.04 ? 468 ARG A NE  1 
ATOM   3604 C CZ  . ARG A 1 468 ? 22.316  79.139 52.144 1.00 52.78 ? 468 ARG A CZ  1 
ATOM   3605 N NH1 . ARG A 1 468 ? 22.985  79.631 53.183 1.00 56.05 ? 468 ARG A NH1 1 
ATOM   3606 N NH2 . ARG A 1 468 ? 22.401  77.822 51.906 1.00 49.12 ? 468 ARG A NH2 1 
ATOM   3607 N N   . ILE A 1 469 ? 16.301  79.687 50.636 1.00 17.47 ? 469 ILE A N   1 
ATOM   3608 C CA  . ILE A 1 469 ? 15.532  78.456 50.626 1.00 15.96 ? 469 ILE A CA  1 
ATOM   3609 C C   . ILE A 1 469 ? 14.431  78.503 49.580 1.00 20.58 ? 469 ILE A C   1 
ATOM   3610 O O   . ILE A 1 469 ? 14.433  77.676 48.672 1.00 24.07 ? 469 ILE A O   1 
ATOM   3611 C CB  . ILE A 1 469 ? 14.912  78.188 52.020 1.00 8.57  ? 469 ILE A CB  1 
ATOM   3612 C CG1 . ILE A 1 469 ? 15.981  77.865 53.065 1.00 4.28  ? 469 ILE A CG1 1 
ATOM   3613 C CG2 . ILE A 1 469 ? 13.729  77.188 52.037 1.00 3.76  ? 469 ILE A CG2 1 
ATOM   3614 C CD1 . ILE A 1 469 ? 16.019  76.387 53.377 1.00 2.00  ? 469 ILE A CD1 1 
ATOM   3615 N N   . MET A 1 470 ? 13.481  79.468 49.712 1.00 18.46 ? 470 MET A N   1 
ATOM   3616 C CA  . MET A 1 470 ? 12.365  79.500 48.763 1.00 17.98 ? 470 MET A CA  1 
ATOM   3617 C C   . MET A 1 470 ? 12.837  79.420 47.340 1.00 20.50 ? 470 MET A C   1 
ATOM   3618 O O   . MET A 1 470 ? 12.153  78.850 46.509 1.00 25.58 ? 470 MET A O   1 
ATOM   3619 C CB  . MET A 1 470 ? 11.482  80.737 48.890 1.00 11.44 ? 470 MET A CB  1 
ATOM   3620 C CG  . MET A 1 470 ? 10.918  80.912 50.278 1.00 14.79 ? 470 MET A CG  1 
ATOM   3621 S SD  . MET A 1 470 ? 9.684   82.260 50.317 1.00 22.18 ? 470 MET A SD  1 
ATOM   3622 C CE  . MET A 1 470 ? 10.693  83.647 49.774 1.00 26.81 ? 470 MET A CE  1 
ATOM   3623 N N   . HIS A 1 471 ? 13.991  80.027 47.062 1.00 18.87 ? 471 HIS A N   1 
ATOM   3624 C CA  . HIS A 1 471 ? 14.518  79.982 45.722 1.00 20.76 ? 471 HIS A CA  1 
ATOM   3625 C C   . HIS A 1 471 ? 14.945  78.569 45.373 1.00 21.83 ? 471 HIS A C   1 
ATOM   3626 O O   . HIS A 1 471 ? 14.476  77.968 44.428 1.00 18.32 ? 471 HIS A O   1 
ATOM   3627 C CB  . HIS A 1 471 ? 15.746  80.884 45.575 1.00 30.01 ? 471 HIS A CB  1 
ATOM   3628 C CG  . HIS A 1 471 ? 16.031  81.166 44.105 1.00 39.63 ? 471 HIS A CG  1 
ATOM   3629 N ND1 . HIS A 1 471 ? 15.188  81.862 43.293 1.00 38.41 ? 471 HIS A ND1 1 
ATOM   3630 C CD2 . HIS A 1 471 ? 17.196  80.832 43.360 1.00 42.96 ? 471 HIS A CD2 1 
ATOM   3631 C CE1 . HIS A 1 471 ? 15.817  81.960 42.101 1.00 40.76 ? 471 HIS A CE1 1 
ATOM   3632 N NE2 . HIS A 1 471 ? 17.027  81.358 42.117 1.00 41.54 ? 471 HIS A NE2 1 
ATOM   3633 N N   . TYR A 1 472 ? 15.850  78.008 46.184 1.00 24.93 ? 472 TYR A N   1 
ATOM   3634 C CA  . TYR A 1 472 ? 16.320  76.642 45.921 1.00 22.94 ? 472 TYR A CA  1 
ATOM   3635 C C   . TYR A 1 472 ? 15.156  75.694 45.643 1.00 21.48 ? 472 TYR A C   1 
ATOM   3636 O O   . TYR A 1 472 ? 15.205  74.784 44.824 1.00 25.79 ? 472 TYR A O   1 
ATOM   3637 C CB  . TYR A 1 472 ? 17.061  76.094 47.158 1.00 26.04 ? 472 TYR A CB  1 
ATOM   3638 C CG  . TYR A 1 472 ? 18.457  76.597 47.421 1.00 28.86 ? 472 TYR A CG  1 
ATOM   3639 C CD1 . TYR A 1 472 ? 19.431  76.488 46.459 1.00 37.72 ? 472 TYR A CD1 1 
ATOM   3640 C CD2 . TYR A 1 472 ? 18.814  77.075 48.656 1.00 29.77 ? 472 TYR A CD2 1 
ATOM   3641 C CE1 . TYR A 1 472 ? 20.753  76.797 46.727 1.00 41.64 ? 472 TYR A CE1 1 
ATOM   3642 C CE2 . TYR A 1 472 ? 20.118  77.392 48.930 1.00 36.53 ? 472 TYR A CE2 1 
ATOM   3643 C CZ  . TYR A 1 472 ? 21.113  77.233 47.978 1.00 41.72 ? 472 TYR A CZ  1 
ATOM   3644 O OH  . TYR A 1 472 ? 22.455  77.473 48.261 1.00 46.62 ? 472 TYR A OH  1 
ATOM   3645 N N   . TRP A 1 473 ? 14.091  75.937 46.398 1.00 16.92 ? 473 TRP A N   1 
ATOM   3646 C CA  . TRP A 1 473 ? 12.920  75.155 46.302 1.00 13.23 ? 473 TRP A CA  1 
ATOM   3647 C C   . TRP A 1 473 ? 12.232  75.369 44.979 1.00 16.32 ? 473 TRP A C   1 
ATOM   3648 O O   . TRP A 1 473 ? 12.060  74.407 44.240 1.00 18.82 ? 473 TRP A O   1 
ATOM   3649 C CB  . TRP A 1 473 ? 12.001  75.490 47.474 1.00 15.07 ? 473 TRP A CB  1 
ATOM   3650 C CG  . TRP A 1 473 ? 12.071  74.448 48.589 1.00 21.79 ? 473 TRP A CG  1 
ATOM   3651 C CD1 . TRP A 1 473 ? 10.948  73.728 49.027 1.00 22.55 ? 473 TRP A CD1 1 
ATOM   3652 C CD2 . TRP A 1 473 ? 13.148  74.016 49.415 1.00 22.50 ? 473 TRP A CD2 1 
ATOM   3653 N NE1 . TRP A 1 473 ? 11.272  72.899 50.037 1.00 20.05 ? 473 TRP A NE1 1 
ATOM   3654 C CE2 . TRP A 1 473 ? 12.595  73.015 50.335 1.00 17.44 ? 473 TRP A CE2 1 
ATOM   3655 C CE3 . TRP A 1 473 ? 14.493  74.350 49.530 1.00 22.01 ? 473 TRP A CE3 1 
ATOM   3656 C CZ2 . TRP A 1 473 ? 13.411  72.420 51.285 1.00 20.22 ? 473 TRP A CZ2 1 
ATOM   3657 C CZ3 . TRP A 1 473 ? 15.282  73.724 50.498 1.00 18.50 ? 473 TRP A CZ3 1 
ATOM   3658 C CH2 . TRP A 1 473 ? 14.754  72.779 51.360 1.00 16.42 ? 473 TRP A CH2 1 
ATOM   3659 N N   . ALA A 1 474 ? 11.841  76.627 44.667 1.00 15.99 ? 474 ALA A N   1 
ATOM   3660 C CA  . ALA A 1 474 ? 11.126  76.879 43.412 1.00 9.96  ? 474 ALA A CA  1 
ATOM   3661 C C   . ALA A 1 474 ? 12.035  76.601 42.296 1.00 10.13 ? 474 ALA A C   1 
ATOM   3662 O O   . ALA A 1 474 ? 11.658  75.911 41.378 1.00 16.20 ? 474 ALA A O   1 
ATOM   3663 C CB  . ALA A 1 474 ? 10.529  78.232 43.271 1.00 5.60  ? 474 ALA A CB  1 
ATOM   3664 N N   . THR A 1 475 ? 13.245  77.094 42.349 1.00 7.50  ? 475 THR A N   1 
ATOM   3665 C CA  . THR A 1 475 ? 14.162  76.741 41.269 1.00 10.23 ? 475 THR A CA  1 
ATOM   3666 C C   . THR A 1 475 ? 14.280  75.219 41.099 1.00 13.78 ? 475 THR A C   1 
ATOM   3667 O O   . THR A 1 475 ? 14.363  74.709 39.990 1.00 22.64 ? 475 THR A O   1 
ATOM   3668 C CB  . THR A 1 475 ? 15.499  77.461 41.459 1.00 8.38  ? 475 THR A CB  1 
ATOM   3669 O OG1 . THR A 1 475 ? 15.190  78.843 41.251 1.00 9.92  ? 475 THR A OG1 1 
ATOM   3670 C CG2 . THR A 1 475 ? 16.597  77.029 40.489 1.00 2.00  ? 475 THR A CG2 1 
ATOM   3671 N N   . PHE A 1 476 ? 14.273  74.449 42.176 1.00 16.78 ? 476 PHE A N   1 
ATOM   3672 C CA  . PHE A 1 476 ? 14.298  73.009 41.924 1.00 16.86 ? 476 PHE A CA  1 
ATOM   3673 C C   . PHE A 1 476 ? 12.967  72.519 41.273 1.00 19.61 ? 476 PHE A C   1 
ATOM   3674 O O   . PHE A 1 476 ? 12.923  71.673 40.385 1.00 19.64 ? 476 PHE A O   1 
ATOM   3675 C CB  . PHE A 1 476 ? 14.507  72.261 43.235 1.00 9.90  ? 476 PHE A CB  1 
ATOM   3676 C CG  . PHE A 1 476 ? 14.278  70.772 43.080 1.00 7.79  ? 476 PHE A CG  1 
ATOM   3677 C CD1 . PHE A 1 476 ? 15.280  69.959 42.581 1.00 3.58  ? 476 PHE A CD1 1 
ATOM   3678 C CD2 . PHE A 1 476 ? 13.068  70.214 43.447 1.00 2.20  ? 476 PHE A CD2 1 
ATOM   3679 C CE1 . PHE A 1 476 ? 15.089  68.598 42.479 1.00 3.85  ? 476 PHE A CE1 1 
ATOM   3680 C CE2 . PHE A 1 476 ? 12.870  68.852 43.348 1.00 2.00  ? 476 PHE A CE2 1 
ATOM   3681 C CZ  . PHE A 1 476 ? 13.886  68.046 42.877 1.00 3.70  ? 476 PHE A CZ  1 
ATOM   3682 N N   . ALA A 1 477 ? 11.862  73.083 41.740 1.00 19.56 ? 477 ALA A N   1 
ATOM   3683 C CA  . ALA A 1 477 ? 10.542  72.685 41.266 1.00 21.20 ? 477 ALA A CA  1 
ATOM   3684 C C   . ALA A 1 477 ? 10.314  72.771 39.755 1.00 25.07 ? 477 ALA A C   1 
ATOM   3685 O O   . ALA A 1 477 ? 9.300   72.265 39.265 1.00 26.84 ? 477 ALA A O   1 
ATOM   3686 C CB  . ALA A 1 477 ? 9.436   73.450 42.002 1.00 10.90 ? 477 ALA A CB  1 
ATOM   3687 N N   . LYS A 1 478 ? 11.227  73.455 39.027 1.00 24.87 ? 478 LYS A N   1 
ATOM   3688 C CA  . LYS A 1 478 ? 11.081  73.559 37.571 1.00 25.22 ? 478 LYS A CA  1 
ATOM   3689 C C   . LYS A 1 478 ? 12.274  72.996 36.924 1.00 27.31 ? 478 LYS A C   1 
ATOM   3690 O O   . LYS A 1 478 ? 12.266  72.073 36.140 1.00 35.14 ? 478 LYS A O   1 
ATOM   3691 C CB  . LYS A 1 478 ? 10.885  74.976 37.038 1.00 25.34 ? 478 LYS A CB  1 
ATOM   3692 C CG  . LYS A 1 478 ? 11.760  76.080 37.636 1.00 30.10 ? 478 LYS A CG  1 
ATOM   3693 C CD  . LYS A 1 478 ? 11.330  77.461 37.170 1.00 35.25 ? 478 LYS A CD  1 
ATOM   3694 N N   . THR A 1 479 ? 13.372  73.544 37.283 1.00 24.39 ? 479 THR A N   1 
ATOM   3695 C CA  . THR A 1 479 ? 14.544  73.045 36.684 1.00 25.00 ? 479 THR A CA  1 
ATOM   3696 C C   . THR A 1 479 ? 14.837  71.586 36.965 1.00 27.35 ? 479 THR A C   1 
ATOM   3697 O O   . THR A 1 479 ? 15.517  70.933 36.186 1.00 33.93 ? 479 THR A O   1 
ATOM   3698 C CB  . THR A 1 479 ? 15.634  73.879 37.341 1.00 25.77 ? 479 THR A CB  1 
ATOM   3699 O OG1 . THR A 1 479 ? 15.285  75.215 37.028 1.00 31.32 ? 479 THR A OG1 1 
ATOM   3700 C CG2 . THR A 1 479 ? 17.058  73.699 36.824 1.00 35.23 ? 479 THR A CG2 1 
ATOM   3701 N N   . GLY A 1 480 ? 14.336  71.033 38.062 1.00 25.37 ? 480 GLY A N   1 
ATOM   3702 C CA  . GLY A 1 480 ? 14.798  69.665 38.310 1.00 17.83 ? 480 GLY A CA  1 
ATOM   3703 C C   . GLY A 1 480 ? 16.104  69.807 39.108 1.00 18.25 ? 480 GLY A C   1 
ATOM   3704 O O   . GLY A 1 480 ? 16.696  68.840 39.575 1.00 11.76 ? 480 GLY A O   1 
ATOM   3705 N N   . ASN A 1 481 ? 16.540  71.085 39.314 1.00 17.79 ? 481 ASN A N   1 
ATOM   3706 C CA  . ASN A 1 481 ? 17.736  71.290 40.096 1.00 19.88 ? 481 ASN A CA  1 
ATOM   3707 C C   . ASN A 1 481 ? 17.642  72.647 40.840 1.00 22.50 ? 481 ASN A C   1 
ATOM   3708 O O   . ASN A 1 481 ? 17.049  73.574 40.294 1.00 24.60 ? 481 ASN A O   1 
ATOM   3709 C CB  . ASN A 1 481 ? 18.955  71.038 39.245 1.00 22.38 ? 481 ASN A CB  1 
ATOM   3710 C CG  . ASN A 1 481 ? 20.055  72.004 39.427 1.00 21.87 ? 481 ASN A CG  1 
ATOM   3711 O OD1 . ASN A 1 481 ? 21.158  71.720 39.849 1.00 21.33 ? 481 ASN A OD1 1 
ATOM   3712 N ND2 . ASN A 1 481 ? 19.707  73.220 39.056 1.00 28.82 ? 481 ASN A ND2 1 
ATOM   3713 N N   . PRO A 1 482 ? 18.211  72.705 42.092 1.00 20.75 ? 482 PRO A N   1 
ATOM   3714 C CA  . PRO A 1 482 ? 17.922  73.759 43.049 1.00 21.09 ? 482 PRO A CA  1 
ATOM   3715 C C   . PRO A 1 482 ? 18.729  75.014 42.866 1.00 24.54 ? 482 PRO A C   1 
ATOM   3716 O O   . PRO A 1 482 ? 18.335  76.083 43.300 1.00 28.21 ? 482 PRO A O   1 
ATOM   3717 C CB  . PRO A 1 482 ? 18.353  73.158 44.393 1.00 18.23 ? 482 PRO A CB  1 
ATOM   3718 C CG  . PRO A 1 482 ? 19.432  72.136 44.083 1.00 11.28 ? 482 PRO A CG  1 
ATOM   3719 C CD  . PRO A 1 482 ? 19.153  71.712 42.646 1.00 19.54 ? 482 PRO A CD  1 
ATOM   3720 N N   . ASN A 1 483 ? 19.930  74.911 42.319 1.00 25.41 ? 483 ASN A N   1 
ATOM   3721 C CA  . ASN A 1 483 ? 20.685  76.185 42.143 1.00 31.70 ? 483 ASN A CA  1 
ATOM   3722 C C   . ASN A 1 483 ? 20.566  76.553 40.676 1.00 34.97 ? 483 ASN A C   1 
ATOM   3723 O O   . ASN A 1 483 ? 20.593  75.659 39.845 1.00 33.38 ? 483 ASN A O   1 
ATOM   3724 C CB  . ASN A 1 483 ? 22.171  76.122 42.556 1.00 28.36 ? 483 ASN A CB  1 
ATOM   3725 C CG  . ASN A 1 483 ? 22.715  74.748 42.308 1.00 31.27 ? 483 ASN A CG  1 
ATOM   3726 O OD1 . ASN A 1 483 ? 23.160  74.092 43.227 1.00 30.91 ? 483 ASN A OD1 1 
ATOM   3727 N ND2 . ASN A 1 483 ? 22.597  74.256 41.074 1.00 31.51 ? 483 ASN A ND2 1 
ATOM   3728 N N   . GLU A 1 484 ? 20.413  77.864 40.376 1.00 39.09 ? 484 GLU A N   1 
ATOM   3729 C CA  . GLU A 1 484 ? 20.290  78.319 38.979 1.00 41.51 ? 484 GLU A CA  1 
ATOM   3730 C C   . GLU A 1 484 ? 21.677  78.493 38.356 1.00 44.88 ? 484 GLU A C   1 
ATOM   3731 O O   . GLU A 1 484 ? 22.653  78.223 39.060 1.00 48.50 ? 484 GLU A O   1 
ATOM   3732 C CB  . GLU A 1 484 ? 19.401  79.608 38.820 1.00 41.42 ? 484 GLU A CB  1 
ATOM   3733 C CG  . GLU A 1 484 ? 19.794  80.886 39.599 1.00 34.03 ? 484 GLU A CG  1 
ATOM   3734 N N   . SER A 1 490 ? 28.748  77.063 46.394 1.00 52.85 ? 490 SER A N   1 
ATOM   3735 C CA  . SER A 1 490 ? 27.618  77.667 45.668 1.00 52.15 ? 490 SER A CA  1 
ATOM   3736 C C   . SER A 1 490 ? 26.710  76.653 45.051 1.00 48.09 ? 490 SER A C   1 
ATOM   3737 O O   . SER A 1 490 ? 25.511  76.660 45.280 1.00 44.82 ? 490 SER A O   1 
ATOM   3738 C CB  . SER A 1 490 ? 28.114  78.605 44.574 1.00 54.59 ? 490 SER A CB  1 
ATOM   3739 O OG  . SER A 1 490 ? 28.475  79.713 45.360 1.00 65.43 ? 490 SER A OG  1 
ATOM   3740 N N   . LYS A 1 491 ? 27.315  75.811 44.204 1.00 43.61 ? 491 LYS A N   1 
ATOM   3741 C CA  . LYS A 1 491 ? 26.475  74.781 43.660 1.00 42.28 ? 491 LYS A CA  1 
ATOM   3742 C C   . LYS A 1 491 ? 26.362  73.792 44.807 1.00 38.08 ? 491 LYS A C   1 
ATOM   3743 O O   . LYS A 1 491 ? 27.327  73.579 45.541 1.00 40.07 ? 491 LYS A O   1 
ATOM   3744 C CB  . LYS A 1 491 ? 27.111  74.154 42.405 1.00 47.04 ? 491 LYS A CB  1 
ATOM   3745 C CG  . LYS A 1 491 ? 27.596  75.196 41.343 1.00 57.61 ? 491 LYS A CG  1 
ATOM   3746 C CD  . LYS A 1 491 ? 26.691  75.342 40.081 1.00 59.38 ? 491 LYS A CD  1 
ATOM   3747 C CE  . LYS A 1 491 ? 25.519  76.335 40.249 1.00 62.06 ? 491 LYS A CE  1 
ATOM   3748 N NZ  . LYS A 1 491 ? 25.982  77.719 40.335 1.00 63.43 ? 491 LYS A NZ  1 
ATOM   3749 N N   . TRP A 1 492 ? 25.156  73.314 44.969 1.00 29.29 ? 492 TRP A N   1 
ATOM   3750 C CA  . TRP A 1 492 ? 24.719  72.364 45.932 1.00 19.26 ? 492 TRP A CA  1 
ATOM   3751 C C   . TRP A 1 492 ? 24.899  71.050 45.157 1.00 17.17 ? 492 TRP A C   1 
ATOM   3752 O O   . TRP A 1 492 ? 24.205  70.765 44.195 1.00 18.11 ? 492 TRP A O   1 
ATOM   3753 C CB  . TRP A 1 492 ? 23.262  72.798 46.228 1.00 13.90 ? 492 TRP A CB  1 
ATOM   3754 C CG  . TRP A 1 492 ? 22.392  71.877 47.067 1.00 8.58  ? 492 TRP A CG  1 
ATOM   3755 C CD1 . TRP A 1 492 ? 22.586  70.502 47.324 1.00 14.27 ? 492 TRP A CD1 1 
ATOM   3756 C CD2 . TRP A 1 492 ? 21.153  72.209 47.647 1.00 2.40  ? 492 TRP A CD2 1 
ATOM   3757 N NE1 . TRP A 1 492 ? 21.528  69.994 48.010 1.00 16.63 ? 492 TRP A NE1 1 
ATOM   3758 C CE2 . TRP A 1 492 ? 20.604  70.985 48.229 1.00 4.08  ? 492 TRP A CE2 1 
ATOM   3759 C CE3 . TRP A 1 492 ? 20.419  73.374 47.742 1.00 2.00  ? 492 TRP A CE3 1 
ATOM   3760 C CZ2 . TRP A 1 492 ? 19.368  70.972 48.840 1.00 2.00  ? 492 TRP A CZ2 1 
ATOM   3761 C CZ3 . TRP A 1 492 ? 19.180  73.327 48.387 1.00 5.89  ? 492 TRP A CZ3 1 
ATOM   3762 C CH2 . TRP A 1 492 ? 18.658  72.145 48.921 1.00 2.00  ? 492 TRP A CH2 1 
ATOM   3763 N N   . PRO A 1 493 ? 25.879  70.245 45.511 1.00 14.27 ? 493 PRO A N   1 
ATOM   3764 C CA  . PRO A 1 493 ? 26.108  69.015 44.775 1.00 16.10 ? 493 PRO A CA  1 
ATOM   3765 C C   . PRO A 1 493 ? 24.971  68.079 44.730 1.00 18.98 ? 493 PRO A C   1 
ATOM   3766 O O   . PRO A 1 493 ? 24.050  68.158 45.537 1.00 28.06 ? 493 PRO A O   1 
ATOM   3767 C CB  . PRO A 1 493 ? 27.206  68.231 45.550 1.00 3.62  ? 493 PRO A CB  1 
ATOM   3768 C CG  . PRO A 1 493 ? 27.844  69.309 46.410 1.00 12.33 ? 493 PRO A CG  1 
ATOM   3769 C CD  . PRO A 1 493 ? 26.842  70.495 46.547 1.00 10.58 ? 493 PRO A CD  1 
ATOM   3770 N N   . LEU A 1 494 ? 25.109  67.152 43.773 1.00 19.44 ? 494 LEU A N   1 
ATOM   3771 C CA  . LEU A 1 494 ? 24.132  66.095 43.715 1.00 18.92 ? 494 LEU A CA  1 
ATOM   3772 C C   . LEU A 1 494 ? 24.698  65.100 44.686 1.00 19.90 ? 494 LEU A C   1 
ATOM   3773 O O   . LEU A 1 494 ? 25.914  64.937 44.853 1.00 19.07 ? 494 LEU A O   1 
ATOM   3774 C CB  . LEU A 1 494 ? 24.168  65.251 42.426 1.00 19.67 ? 494 LEU A CB  1 
ATOM   3775 C CG  . LEU A 1 494 ? 23.370  65.804 41.264 1.00 22.84 ? 494 LEU A CG  1 
ATOM   3776 C CD1 . LEU A 1 494 ? 23.925  65.238 39.985 1.00 23.70 ? 494 LEU A CD1 1 
ATOM   3777 C CD2 . LEU A 1 494 ? 21.892  65.414 41.387 1.00 32.01 ? 494 LEU A CD2 1 
ATOM   3778 N N   . PHE A 1 495 ? 23.732  64.423 45.268 1.00 18.30 ? 495 PHE A N   1 
ATOM   3779 C CA  . PHE A 1 495 ? 24.026  63.373 46.168 1.00 19.24 ? 495 PHE A CA  1 
ATOM   3780 C C   . PHE A 1 495 ? 24.353  62.212 45.230 1.00 24.59 ? 495 PHE A C   1 
ATOM   3781 O O   . PHE A 1 495 ? 23.729  61.993 44.196 1.00 23.93 ? 495 PHE A O   1 
ATOM   3782 C CB  . PHE A 1 495 ? 22.785  63.014 47.009 1.00 18.38 ? 495 PHE A CB  1 
ATOM   3783 C CG  . PHE A 1 495 ? 23.040  61.880 47.967 1.00 16.89 ? 495 PHE A CG  1 
ATOM   3784 C CD1 . PHE A 1 495 ? 22.928  60.570 47.544 1.00 22.72 ? 495 PHE A CD1 1 
ATOM   3785 C CD2 . PHE A 1 495 ? 23.506  62.141 49.238 1.00 19.44 ? 495 PHE A CD2 1 
ATOM   3786 C CE1 . PHE A 1 495 ? 23.290  59.528 48.376 1.00 23.56 ? 495 PHE A CE1 1 
ATOM   3787 C CE2 . PHE A 1 495 ? 23.871  61.102 50.067 1.00 20.73 ? 495 PHE A CE2 1 
ATOM   3788 C CZ  . PHE A 1 495 ? 23.760  59.798 49.636 1.00 21.93 ? 495 PHE A CZ  1 
ATOM   3789 N N   . THR A 1 496 ? 25.377  61.472 45.626 1.00 30.29 ? 496 THR A N   1 
ATOM   3790 C CA  . THR A 1 496 ? 25.827  60.338 44.896 1.00 30.22 ? 496 THR A CA  1 
ATOM   3791 C C   . THR A 1 496 ? 26.351  59.339 45.895 1.00 32.82 ? 496 THR A C   1 
ATOM   3792 O O   . THR A 1 496 ? 27.004  59.597 46.899 1.00 33.90 ? 496 THR A O   1 
ATOM   3793 C CB  . THR A 1 496 ? 26.939  60.736 43.936 1.00 29.34 ? 496 THR A CB  1 
ATOM   3794 O OG1 . THR A 1 496 ? 26.735  62.055 43.424 1.00 32.63 ? 496 THR A OG1 1 
ATOM   3795 C CG2 . THR A 1 496 ? 26.963  59.789 42.749 1.00 34.44 ? 496 THR A CG2 1 
ATOM   3796 N N   . THR A 1 497 ? 26.099  58.130 45.521 1.00 34.26 ? 497 THR A N   1 
ATOM   3797 C CA  . THR A 1 497 ? 26.465  56.983 46.309 1.00 35.72 ? 497 THR A CA  1 
ATOM   3798 C C   . THR A 1 497 ? 27.965  56.776 46.501 1.00 36.32 ? 497 THR A C   1 
ATOM   3799 O O   . THR A 1 497 ? 28.383  55.707 46.923 1.00 36.75 ? 497 THR A O   1 
ATOM   3800 C CB  . THR A 1 497 ? 25.803  55.742 45.672 1.00 34.37 ? 497 THR A CB  1 
ATOM   3801 O OG1 . THR A 1 497 ? 25.740  55.948 44.260 1.00 36.98 ? 497 THR A OG1 1 
ATOM   3802 C CG2 . THR A 1 497 ? 24.370  55.535 46.147 1.00 32.36 ? 497 THR A CG2 1 
ATOM   3803 N N   . LYS A 1 498 ? 28.775  57.764 46.156 1.00 37.10 ? 498 LYS A N   1 
ATOM   3804 C CA  . LYS A 1 498 ? 30.179  57.555 46.358 1.00 43.03 ? 498 LYS A CA  1 
ATOM   3805 C C   . LYS A 1 498 ? 30.572  58.440 47.481 1.00 45.53 ? 498 LYS A C   1 
ATOM   3806 O O   . LYS A 1 498 ? 30.656  58.035 48.631 1.00 51.28 ? 498 LYS A O   1 
ATOM   3807 C CB  . LYS A 1 498 ? 30.977  57.787 45.068 1.00 47.35 ? 498 LYS A CB  1 
ATOM   3808 C CG  . LYS A 1 498 ? 32.086  56.735 44.917 1.00 54.79 ? 498 LYS A CG  1 
ATOM   3809 C CD  . LYS A 1 498 ? 33.388  57.095 45.671 1.00 57.70 ? 498 LYS A CD  1 
ATOM   3810 C CE  . LYS A 1 498 ? 33.542  56.356 46.994 1.00 62.46 ? 498 LYS A CE  1 
ATOM   3811 N N   . GLU A 1 499 ? 30.789  59.715 47.150 1.00 46.95 ? 499 GLU A N   1 
ATOM   3812 C CA  . GLU A 1 499 ? 31.192  60.691 48.176 1.00 47.07 ? 499 GLU A CA  1 
ATOM   3813 C C   . GLU A 1 499 ? 29.972  61.505 48.535 1.00 43.25 ? 499 GLU A C   1 
ATOM   3814 O O   . GLU A 1 499 ? 29.918  62.696 48.357 1.00 45.49 ? 499 GLU A O   1 
ATOM   3815 C CB  . GLU A 1 499 ? 32.311  61.599 47.609 1.00 53.72 ? 499 GLU A CB  1 
ATOM   3816 N N   . GLN A 1 500 ? 28.972  60.822 49.026 1.00 37.84 ? 500 GLN A N   1 
ATOM   3817 C CA  . GLN A 1 500 ? 27.676  61.334 49.404 1.00 36.11 ? 500 GLN A CA  1 
ATOM   3818 C C   . GLN A 1 500 ? 27.543  62.765 50.017 1.00 36.29 ? 500 GLN A C   1 
ATOM   3819 O O   . GLN A 1 500 ? 27.328  62.965 51.212 1.00 39.07 ? 500 GLN A O   1 
ATOM   3820 C CB  . GLN A 1 500 ? 27.115  60.284 50.356 1.00 38.36 ? 500 GLN A CB  1 
ATOM   3821 C CG  . GLN A 1 500 ? 27.768  58.892 50.382 1.00 37.30 ? 500 GLN A CG  1 
ATOM   3822 C CD  . GLN A 1 500 ? 26.747  57.927 50.922 1.00 39.00 ? 500 GLN A CD  1 
ATOM   3823 O OE1 . GLN A 1 500 ? 26.035  58.168 51.896 1.00 44.07 ? 500 GLN A OE1 1 
ATOM   3824 N NE2 . GLN A 1 500 ? 26.623  56.841 50.194 1.00 39.64 ? 500 GLN A NE2 1 
ATOM   3825 N N   . LYS A 1 501 ? 27.672  63.755 49.151 1.00 32.20 ? 501 LYS A N   1 
ATOM   3826 C CA  . LYS A 1 501 ? 27.641  65.144 49.518 1.00 30.62 ? 501 LYS A CA  1 
ATOM   3827 C C   . LYS A 1 501 ? 26.265  65.672 49.838 1.00 30.51 ? 501 LYS A C   1 
ATOM   3828 O O   . LYS A 1 501 ? 25.273  65.231 49.271 1.00 33.46 ? 501 LYS A O   1 
ATOM   3829 C CB  . LYS A 1 501 ? 28.153  65.944 48.300 1.00 30.82 ? 501 LYS A CB  1 
ATOM   3830 C CG  . LYS A 1 501 ? 29.663  65.960 48.191 1.00 35.00 ? 501 LYS A CG  1 
ATOM   3831 C CD  . LYS A 1 501 ? 30.161  66.518 46.868 1.00 39.79 ? 501 LYS A CD  1 
ATOM   3832 C CE  . LYS A 1 501 ? 31.648  66.874 46.962 1.00 43.16 ? 501 LYS A CE  1 
ATOM   3833 N NZ  . LYS A 1 501 ? 32.151  67.145 45.636 1.00 51.63 ? 501 LYS A NZ  1 
ATOM   3834 N N   . PHE A 1 502 ? 26.234  66.674 50.719 1.00 24.70 ? 502 PHE A N   1 
ATOM   3835 C CA  . PHE A 1 502 ? 24.981  67.316 51.067 1.00 24.02 ? 502 PHE A CA  1 
ATOM   3836 C C   . PHE A 1 502 ? 25.419  68.674 51.555 1.00 21.94 ? 502 PHE A C   1 
ATOM   3837 O O   . PHE A 1 502 ? 26.608  68.894 51.728 1.00 21.88 ? 502 PHE A O   1 
ATOM   3838 C CB  . PHE A 1 502 ? 24.212  66.535 52.143 1.00 24.19 ? 502 PHE A CB  1 
ATOM   3839 C CG  . PHE A 1 502 ? 24.913  66.554 53.496 1.00 25.03 ? 502 PHE A CG  1 
ATOM   3840 C CD1 . PHE A 1 502 ? 24.701  67.625 54.361 1.00 23.73 ? 502 PHE A CD1 1 
ATOM   3841 C CD2 . PHE A 1 502 ? 25.754  65.522 53.874 1.00 22.63 ? 502 PHE A CD2 1 
ATOM   3842 C CE1 . PHE A 1 502 ? 25.315  67.680 55.583 1.00 19.61 ? 502 PHE A CE1 1 
ATOM   3843 C CE2 . PHE A 1 502 ? 26.356  65.569 55.108 1.00 23.81 ? 502 PHE A CE2 1 
ATOM   3844 C CZ  . PHE A 1 502 ? 26.132  66.644 55.953 1.00 24.66 ? 502 PHE A CZ  1 
ATOM   3845 N N   . ILE A 1 503 ? 24.499  69.581 51.802 1.00 19.03 ? 503 ILE A N   1 
ATOM   3846 C CA  . ILE A 1 503 ? 24.988  70.860 52.299 1.00 22.75 ? 503 ILE A CA  1 
ATOM   3847 C C   . ILE A 1 503 ? 24.285  71.228 53.578 1.00 28.00 ? 503 ILE A C   1 
ATOM   3848 O O   . ILE A 1 503 ? 23.208  70.691 53.866 1.00 31.51 ? 503 ILE A O   1 
ATOM   3849 C CB  . ILE A 1 503 ? 24.685  71.980 51.307 1.00 18.94 ? 503 ILE A CB  1 
ATOM   3850 C CG1 . ILE A 1 503 ? 23.220  72.052 50.814 1.00 14.81 ? 503 ILE A CG1 1 
ATOM   3851 C CG2 . ILE A 1 503 ? 25.616  71.928 50.136 1.00 19.52 ? 503 ILE A CG2 1 
ATOM   3852 C CD1 . ILE A 1 503 ? 22.819  73.542 50.731 1.00 11.00 ? 503 ILE A CD1 1 
ATOM   3853 N N   . ASP A 1 504 ? 24.909  72.144 54.372 1.00 25.84 ? 504 ASP A N   1 
ATOM   3854 C CA  . ASP A 1 504 ? 24.128  72.539 55.541 1.00 27.24 ? 504 ASP A CA  1 
ATOM   3855 C C   . ASP A 1 504 ? 23.395  73.726 55.000 1.00 24.74 ? 504 ASP A C   1 
ATOM   3856 O O   . ASP A 1 504 ? 23.919  74.503 54.207 1.00 26.19 ? 504 ASP A O   1 
ATOM   3857 C CB  . ASP A 1 504 ? 24.794  73.003 56.844 1.00 31.88 ? 504 ASP A CB  1 
ATOM   3858 C CG  . ASP A 1 504 ? 26.187  72.566 57.167 1.00 38.48 ? 504 ASP A CG  1 
ATOM   3859 O OD1 . ASP A 1 504 ? 26.361  71.405 57.588 1.00 36.33 ? 504 ASP A OD1 1 
ATOM   3860 O OD2 . ASP A 1 504 ? 27.078  73.433 57.031 1.00 41.33 ? 504 ASP A OD2 1 
ATOM   3861 N N   . LEU A 1 505 ? 22.192  73.871 55.477 1.00 20.55 ? 505 LEU A N   1 
ATOM   3862 C CA  . LEU A 1 505 ? 21.382  74.949 55.031 1.00 18.98 ? 505 LEU A CA  1 
ATOM   3863 C C   . LEU A 1 505 ? 21.164  75.840 56.220 1.00 21.10 ? 505 LEU A C   1 
ATOM   3864 O O   . LEU A 1 505 ? 20.334  75.552 57.065 1.00 22.60 ? 505 LEU A O   1 
ATOM   3865 C CB  . LEU A 1 505 ? 20.117  74.232 54.601 1.00 15.74 ? 505 LEU A CB  1 
ATOM   3866 C CG  . LEU A 1 505 ? 19.152  75.011 53.751 1.00 16.85 ? 505 LEU A CG  1 
ATOM   3867 C CD1 . LEU A 1 505 ? 19.828  75.854 52.660 1.00 17.95 ? 505 LEU A CD1 1 
ATOM   3868 C CD2 . LEU A 1 505 ? 18.210  73.959 53.121 1.00 15.94 ? 505 LEU A CD2 1 
ATOM   3869 N N   . ASN A 1 506 ? 21.936  76.903 56.353 1.00 22.79 ? 506 ASN A N   1 
ATOM   3870 C CA  . ASN A 1 506 ? 21.734  77.782 57.511 1.00 27.57 ? 506 ASN A CA  1 
ATOM   3871 C C   . ASN A 1 506 ? 22.185  79.138 57.063 1.00 31.29 ? 506 ASN A C   1 
ATOM   3872 O O   . ASN A 1 506 ? 22.526  79.326 55.916 1.00 34.75 ? 506 ASN A O   1 
ATOM   3873 C CB  . ASN A 1 506 ? 22.501  77.361 58.788 1.00 25.23 ? 506 ASN A CB  1 
ATOM   3874 C CG  . ASN A 1 506 ? 23.978  77.248 58.504 1.00 26.35 ? 506 ASN A CG  1 
ATOM   3875 O OD1 . ASN A 1 506 ? 24.550  77.947 57.692 1.00 20.01 ? 506 ASN A OD1 1 
ATOM   3876 N ND2 . ASN A 1 506 ? 24.619  76.313 59.172 1.00 37.06 ? 506 ASN A ND2 1 
ATOM   3877 N N   . THR A 1 507 ? 22.172  80.073 58.001 1.00 32.75 ? 507 THR A N   1 
ATOM   3878 C CA  . THR A 1 507 ? 22.563  81.466 57.783 1.00 31.84 ? 507 THR A CA  1 
ATOM   3879 C C   . THR A 1 507 ? 24.046  81.733 57.537 1.00 31.35 ? 507 THR A C   1 
ATOM   3880 O O   . THR A 1 507 ? 24.465  82.875 57.420 1.00 32.78 ? 507 THR A O   1 
ATOM   3881 C CB  . THR A 1 507 ? 22.106  82.302 58.989 1.00 32.45 ? 507 THR A CB  1 
ATOM   3882 O OG1 . THR A 1 507 ? 22.406  81.558 60.192 1.00 39.71 ? 507 THR A OG1 1 
ATOM   3883 C CG2 . THR A 1 507 ? 20.603  82.597 58.993 1.00 28.89 ? 507 THR A CG2 1 
ATOM   3884 N N   . GLU A 1 508 ? 24.864  80.706 57.529 1.00 35.18 ? 508 GLU A N   1 
ATOM   3885 C CA  . GLU A 1 508 ? 26.283  80.915 57.253 1.00 42.37 ? 508 GLU A CA  1 
ATOM   3886 C C   . GLU A 1 508 ? 26.479  80.391 55.819 1.00 48.95 ? 508 GLU A C   1 
ATOM   3887 O O   . GLU A 1 508 ? 25.697  79.557 55.382 1.00 55.10 ? 508 GLU A O   1 
ATOM   3888 C CB  . GLU A 1 508 ? 27.144  80.102 58.249 1.00 41.46 ? 508 GLU A CB  1 
ATOM   3889 C CG  . GLU A 1 508 ? 27.509  80.810 59.542 1.00 39.43 ? 508 GLU A CG  1 
ATOM   3890 N N   . PRO A 1 509 ? 27.535  80.857 55.086 1.00 52.42 ? 509 PRO A N   1 
ATOM   3891 C CA  . PRO A 1 509 ? 27.883  80.301 53.745 1.00 54.59 ? 509 PRO A CA  1 
ATOM   3892 C C   . PRO A 1 509 ? 27.868  78.749 53.600 1.00 53.20 ? 509 PRO A C   1 
ATOM   3893 O O   . PRO A 1 509 ? 28.771  78.058 54.061 1.00 53.03 ? 509 PRO A O   1 
ATOM   3894 C CB  . PRO A 1 509 ? 29.268  80.907 53.443 1.00 57.10 ? 509 PRO A CB  1 
ATOM   3895 C CG  . PRO A 1 509 ? 29.391  82.158 54.339 1.00 57.84 ? 509 PRO A CG  1 
ATOM   3896 C CD  . PRO A 1 509 ? 28.382  81.980 55.492 1.00 54.88 ? 509 PRO A CD  1 
ATOM   3897 N N   . MET A 1 510 ? 26.837  78.240 52.888 1.00 50.86 ? 510 MET A N   1 
ATOM   3898 C CA  . MET A 1 510 ? 26.676  76.812 52.765 1.00 48.64 ? 510 MET A CA  1 
ATOM   3899 C C   . MET A 1 510 ? 27.954  76.103 52.365 1.00 44.81 ? 510 MET A C   1 
ATOM   3900 O O   . MET A 1 510 ? 28.728  76.473 51.489 1.00 44.36 ? 510 MET A O   1 
ATOM   3901 C CB  . MET A 1 510 ? 25.401  76.344 52.044 1.00 52.03 ? 510 MET A CB  1 
ATOM   3902 C CG  . MET A 1 510 ? 25.276  76.711 50.559 1.00 50.91 ? 510 MET A CG  1 
ATOM   3903 S SD  . MET A 1 510 ? 26.102  75.404 49.602 1.00 46.61 ? 510 MET A SD  1 
ATOM   3904 C CE  . MET A 1 510 ? 25.212  75.692 48.049 1.00 49.81 ? 510 MET A CE  1 
ATOM   3905 N N   . LYS A 1 511 ? 28.091  75.023 53.087 1.00 43.05 ? 511 LYS A N   1 
ATOM   3906 C CA  . LYS A 1 511 ? 29.221  74.154 53.014 1.00 41.58 ? 511 LYS A CA  1 
ATOM   3907 C C   . LYS A 1 511 ? 28.757  72.776 52.657 1.00 34.61 ? 511 LYS A C   1 
ATOM   3908 O O   . LYS A 1 511 ? 27.808  72.232 53.207 1.00 34.81 ? 511 LYS A O   1 
ATOM   3909 C CB  . LYS A 1 511 ? 29.741  74.245 54.474 1.00 48.96 ? 511 LYS A CB  1 
ATOM   3910 C CG  . LYS A 1 511 ? 30.969  73.385 54.837 1.00 59.73 ? 511 LYS A CG  1 
ATOM   3911 C CD  . LYS A 1 511 ? 31.574  73.761 56.220 1.00 66.88 ? 511 LYS A CD  1 
ATOM   3912 C CE  . LYS A 1 511 ? 32.908  73.021 56.523 1.00 72.24 ? 511 LYS A CE  1 
ATOM   3913 N NZ  . LYS A 1 511 ? 33.741  73.743 57.493 1.00 73.60 ? 511 LYS A NZ  1 
ATOM   3914 N N   . VAL A 1 512 ? 29.440  72.198 51.706 1.00 29.07 ? 512 VAL A N   1 
ATOM   3915 C CA  . VAL A 1 512 ? 29.085  70.836 51.363 1.00 24.05 ? 512 VAL A CA  1 
ATOM   3916 C C   . VAL A 1 512 ? 29.854  69.963 52.339 1.00 23.00 ? 512 VAL A C   1 
ATOM   3917 O O   . VAL A 1 512 ? 31.000  70.267 52.677 1.00 25.88 ? 512 VAL A O   1 
ATOM   3918 C CB  . VAL A 1 512 ? 29.541  70.574 49.907 1.00 21.82 ? 512 VAL A CB  1 
ATOM   3919 C CG1 . VAL A 1 512 ? 29.491  69.118 49.453 1.00 20.52 ? 512 VAL A CG1 1 
ATOM   3920 C CG2 . VAL A 1 512 ? 28.767  71.429 48.913 1.00 21.93 ? 512 VAL A CG2 1 
ATOM   3921 N N   . HIS A 1 513 ? 29.225  68.878 52.776 1.00 19.62 ? 513 HIS A N   1 
ATOM   3922 C CA  . HIS A 1 513 ? 29.878  67.925 53.682 1.00 19.87 ? 513 HIS A CA  1 
ATOM   3923 C C   . HIS A 1 513 ? 29.584  66.616 53.061 1.00 17.08 ? 513 HIS A C   1 
ATOM   3924 O O   . HIS A 1 513 ? 28.902  66.613 52.056 1.00 21.33 ? 513 HIS A O   1 
ATOM   3925 C CB  . HIS A 1 513 ? 29.136  67.873 55.021 1.00 30.32 ? 513 HIS A CB  1 
ATOM   3926 C CG  . HIS A 1 513 ? 29.196  69.173 55.773 1.00 34.56 ? 513 HIS A CG  1 
ATOM   3927 N ND1 . HIS A 1 513 ? 28.562  70.308 55.395 1.00 31.56 ? 513 HIS A ND1 1 
ATOM   3928 C CD2 . HIS A 1 513 ? 29.922  69.430 56.965 1.00 37.44 ? 513 HIS A CD2 1 
ATOM   3929 C CE1 . HIS A 1 513 ? 28.926  71.213 56.312 1.00 32.66 ? 513 HIS A CE1 1 
ATOM   3930 N NE2 . HIS A 1 513 ? 29.715  70.728 57.271 1.00 35.74 ? 513 HIS A NE2 1 
ATOM   3931 N N   . GLN A 1 514 ? 30.026  65.493 53.623 1.00 17.07 ? 514 GLN A N   1 
ATOM   3932 C CA  . GLN A 1 514 ? 29.672  64.191 53.034 1.00 19.73 ? 514 GLN A CA  1 
ATOM   3933 C C   . GLN A 1 514 ? 29.106  63.250 54.080 1.00 18.89 ? 514 GLN A C   1 
ATOM   3934 O O   . GLN A 1 514 ? 29.076  63.529 55.251 1.00 23.51 ? 514 GLN A O   1 
ATOM   3935 C CB  . GLN A 1 514 ? 30.903  63.527 52.484 1.00 26.10 ? 514 GLN A CB  1 
ATOM   3936 C CG  . GLN A 1 514 ? 31.390  64.199 51.215 1.00 35.48 ? 514 GLN A CG  1 
ATOM   3937 C CD  . GLN A 1 514 ? 32.789  63.673 50.975 1.00 43.25 ? 514 GLN A CD  1 
ATOM   3938 O OE1 . GLN A 1 514 ? 33.067  62.478 50.958 1.00 46.91 ? 514 GLN A OE1 1 
ATOM   3939 N NE2 . GLN A 1 514 ? 33.698  64.632 50.867 1.00 47.80 ? 514 GLN A NE2 1 
ATOM   3940 N N   . ARG A 1 515 ? 28.647  62.120 53.638 1.00 19.59 ? 515 ARG A N   1 
ATOM   3941 C CA  . ARG A 1 515 ? 28.100  61.066 54.475 1.00 27.93 ? 515 ARG A CA  1 
ATOM   3942 C C   . ARG A 1 515 ? 27.349  61.426 55.790 1.00 29.61 ? 515 ARG A C   1 
ATOM   3943 O O   . ARG A 1 515 ? 27.861  61.189 56.886 1.00 31.16 ? 515 ARG A O   1 
ATOM   3944 C CB  . ARG A 1 515 ? 29.171  59.991 54.765 1.00 28.47 ? 515 ARG A CB  1 
ATOM   3945 C CG  . ARG A 1 515 ? 30.196  59.849 53.635 1.00 38.78 ? 515 ARG A CG  1 
ATOM   3946 C CD  . ARG A 1 515 ? 30.843  58.453 53.486 1.00 42.80 ? 515 ARG A CD  1 
ATOM   3947 N NE  . ARG A 1 515 ? 31.940  58.269 54.411 1.00 45.83 ? 515 ARG A NE  1 
ATOM   3948 N N   . LEU A 1 516 ? 26.102  61.978 55.653 1.00 28.53 ? 516 LEU A N   1 
ATOM   3949 C CA  . LEU A 1 516 ? 25.253  62.340 56.828 1.00 25.85 ? 516 LEU A CA  1 
ATOM   3950 C C   . LEU A 1 516 ? 25.032  61.118 57.789 1.00 23.53 ? 516 LEU A C   1 
ATOM   3951 O O   . LEU A 1 516 ? 24.662  60.038 57.348 1.00 23.76 ? 516 LEU A O   1 
ATOM   3952 C CB  . LEU A 1 516 ? 23.823  62.785 56.377 1.00 23.79 ? 516 LEU A CB  1 
ATOM   3953 C CG  . LEU A 1 516 ? 23.160  63.994 57.070 1.00 18.81 ? 516 LEU A CG  1 
ATOM   3954 C CD1 . LEU A 1 516 ? 21.628  63.829 57.110 1.00 12.70 ? 516 LEU A CD1 1 
ATOM   3955 C CD2 . LEU A 1 516 ? 23.721  64.267 58.448 1.00 19.94 ? 516 LEU A CD2 1 
ATOM   3956 N N   . ARG A 1 517 ? 25.244  61.310 59.111 1.00 20.54 ? 517 ARG A N   1 
ATOM   3957 C CA  . ARG A 1 517 ? 25.077  60.265 60.133 1.00 20.17 ? 517 ARG A CA  1 
ATOM   3958 C C   . ARG A 1 517 ? 25.511  58.938 59.642 1.00 20.33 ? 517 ARG A C   1 
ATOM   3959 O O   . ARG A 1 517 ? 24.788  57.969 59.830 1.00 24.00 ? 517 ARG A O   1 
ATOM   3960 C CB  . ARG A 1 517 ? 23.618  60.055 60.611 1.00 23.96 ? 517 ARG A CB  1 
ATOM   3961 C CG  . ARG A 1 517 ? 22.814  61.290 61.008 1.00 32.86 ? 517 ARG A CG  1 
ATOM   3962 C CD  . ARG A 1 517 ? 23.578  62.426 61.731 1.00 38.46 ? 517 ARG A CD  1 
ATOM   3963 N NE  . ARG A 1 517 ? 24.138  62.017 63.006 1.00 37.21 ? 517 ARG A NE  1 
ATOM   3964 C CZ  . ARG A 1 517 ? 23.369  61.905 64.078 1.00 36.25 ? 517 ARG A CZ  1 
ATOM   3965 N NH1 . ARG A 1 517 ? 22.098  62.321 64.052 1.00 34.88 ? 517 ARG A NH1 1 
ATOM   3966 N NH2 . ARG A 1 517 ? 23.911  61.372 65.173 1.00 36.56 ? 517 ARG A NH2 1 
ATOM   3967 N N   . VAL A 1 518 ? 26.684  58.864 59.049 1.00 22.54 ? 518 VAL A N   1 
ATOM   3968 C CA  . VAL A 1 518 ? 27.035  57.565 58.522 1.00 25.46 ? 518 VAL A CA  1 
ATOM   3969 C C   . VAL A 1 518 ? 27.260  56.490 59.554 1.00 29.02 ? 518 VAL A C   1 
ATOM   3970 O O   . VAL A 1 518 ? 26.773  55.380 59.428 1.00 31.45 ? 518 VAL A O   1 
ATOM   3971 C CB  . VAL A 1 518 ? 28.223  57.682 57.577 1.00 26.37 ? 518 VAL A CB  1 
ATOM   3972 C CG1 . VAL A 1 518 ? 29.466  58.281 58.265 1.00 29.02 ? 518 VAL A CG1 1 
ATOM   3973 C CG2 . VAL A 1 518 ? 28.557  56.340 56.907 1.00 31.03 ? 518 VAL A CG2 1 
ATOM   3974 N N   . GLN A 1 519 ? 27.974  56.825 60.627 1.00 32.45 ? 519 GLN A N   1 
ATOM   3975 C CA  . GLN A 1 519 ? 28.260  55.745 61.583 1.00 35.37 ? 519 GLN A CA  1 
ATOM   3976 C C   . GLN A 1 519 ? 27.069  55.195 62.284 1.00 31.85 ? 519 GLN A C   1 
ATOM   3977 O O   . GLN A 1 519 ? 26.971  54.015 62.587 1.00 36.71 ? 519 GLN A O   1 
ATOM   3978 C CB  . GLN A 1 519 ? 29.320  56.142 62.614 1.00 43.80 ? 519 GLN A CB  1 
ATOM   3979 C CG  . GLN A 1 519 ? 30.395  57.120 62.038 1.00 59.10 ? 519 GLN A CG  1 
ATOM   3980 C CD  . GLN A 1 519 ? 31.849  56.767 62.354 1.00 63.86 ? 519 GLN A CD  1 
ATOM   3981 O OE1 . GLN A 1 519 ? 32.716  56.835 61.488 1.00 68.98 ? 519 GLN A OE1 1 
ATOM   3982 N NE2 . GLN A 1 519 ? 32.073  56.349 63.591 1.00 68.63 ? 519 GLN A NE2 1 
ATOM   3983 N N   . MET A 1 520 ? 26.157  56.110 62.550 1.00 26.99 ? 520 MET A N   1 
ATOM   3984 C CA  . MET A 1 520 ? 24.963  55.690 63.246 1.00 24.28 ? 520 MET A CA  1 
ATOM   3985 C C   . MET A 1 520 ? 23.987  55.020 62.311 1.00 22.67 ? 520 MET A C   1 
ATOM   3986 O O   . MET A 1 520 ? 23.319  54.054 62.666 1.00 21.31 ? 520 MET A O   1 
ATOM   3987 C CB  . MET A 1 520 ? 24.328  56.884 63.996 1.00 23.19 ? 520 MET A CB  1 
ATOM   3988 C CG  . MET A 1 520 ? 25.318  57.702 64.856 1.00 25.60 ? 520 MET A CG  1 
ATOM   3989 S SD  . MET A 1 520 ? 25.410  57.102 66.598 1.00 31.10 ? 520 MET A SD  1 
ATOM   3990 C CE  . MET A 1 520 ? 26.076  55.423 66.402 1.00 16.86 ? 520 MET A CE  1 
ATOM   3991 N N   . CYS A 1 521 ? 23.908  55.550 61.089 1.00 20.45 ? 521 CYS A N   1 
ATOM   3992 C CA  . CYS A 1 521 ? 22.967  54.958 60.165 1.00 17.47 ? 521 CYS A CA  1 
ATOM   3993 C C   . CYS A 1 521 ? 23.349  53.549 59.720 1.00 19.19 ? 521 CYS A C   1 
ATOM   3994 O O   . CYS A 1 521 ? 22.487  52.823 59.234 1.00 11.73 ? 521 CYS A O   1 
ATOM   3995 C CB  . CYS A 1 521 ? 22.542  55.947 59.128 1.00 12.51 ? 521 CYS A CB  1 
ATOM   3996 S SG  . CYS A 1 521 ? 21.608  57.275 59.889 1.00 13.65 ? 521 CYS A SG  1 
ATOM   3997 N N   . VAL A 1 522 ? 24.646  53.175 59.910 1.00 21.37 ? 522 VAL A N   1 
ATOM   3998 C CA  . VAL A 1 522 ? 25.056  51.785 59.615 1.00 18.63 ? 522 VAL A CA  1 
ATOM   3999 C C   . VAL A 1 522 ? 24.372  50.923 60.702 1.00 19.29 ? 522 VAL A C   1 
ATOM   4000 O O   . VAL A 1 522 ? 23.683  49.934 60.494 1.00 21.91 ? 522 VAL A O   1 
ATOM   4001 C CB  . VAL A 1 522 ? 26.614  51.608 59.648 1.00 16.80 ? 522 VAL A CB  1 
ATOM   4002 C CG1 . VAL A 1 522 ? 27.083  50.153 59.606 1.00 15.88 ? 522 VAL A CG1 1 
ATOM   4003 C CG2 . VAL A 1 522 ? 27.339  52.332 58.498 1.00 14.78 ? 522 VAL A CG2 1 
ATOM   4004 N N   . PHE A 1 523 ? 24.554  51.357 61.943 1.00 20.83 ? 523 PHE A N   1 
ATOM   4005 C CA  . PHE A 1 523 ? 23.959  50.637 63.088 1.00 15.91 ? 523 PHE A CA  1 
ATOM   4006 C C   . PHE A 1 523 ? 22.452  50.398 62.948 1.00 12.65 ? 523 PHE A C   1 
ATOM   4007 O O   . PHE A 1 523 ? 21.923  49.303 63.114 1.00 9.43  ? 523 PHE A O   1 
ATOM   4008 C CB  . PHE A 1 523 ? 24.255  51.429 64.395 1.00 12.05 ? 523 PHE A CB  1 
ATOM   4009 C CG  . PHE A 1 523 ? 23.505  50.958 65.602 1.00 8.68  ? 523 PHE A CG  1 
ATOM   4010 C CD1 . PHE A 1 523 ? 23.738  49.684 66.108 1.00 15.08 ? 523 PHE A CD1 1 
ATOM   4011 C CD2 . PHE A 1 523 ? 22.550  51.759 66.197 1.00 4.42  ? 523 PHE A CD2 1 
ATOM   4012 C CE1 . PHE A 1 523 ? 23.008  49.198 67.187 1.00 8.07  ? 523 PHE A CE1 1 
ATOM   4013 C CE2 . PHE A 1 523 ? 21.813  51.277 67.275 1.00 4.98  ? 523 PHE A CE2 1 
ATOM   4014 C CZ  . PHE A 1 523 ? 22.047  49.998 67.761 1.00 6.32  ? 523 PHE A CZ  1 
ATOM   4015 N N   . TRP A 1 524 ? 21.765  51.476 62.589 1.00 12.58 ? 524 TRP A N   1 
ATOM   4016 C CA  . TRP A 1 524 ? 20.312  51.376 62.510 1.00 12.07 ? 524 TRP A CA  1 
ATOM   4017 C C   . TRP A 1 524 ? 19.733  50.709 61.296 1.00 15.25 ? 524 TRP A C   1 
ATOM   4018 O O   . TRP A 1 524 ? 18.734  49.990 61.381 1.00 14.62 ? 524 TRP A O   1 
ATOM   4019 C CB  . TRP A 1 524 ? 19.721  52.776 62.553 1.00 10.51 ? 524 TRP A CB  1 
ATOM   4020 C CG  . TRP A 1 524 ? 19.774  53.363 63.929 1.00 8.89  ? 524 TRP A CG  1 
ATOM   4021 C CD1 . TRP A 1 524 ? 20.550  54.465 64.306 1.00 12.36 ? 524 TRP A CD1 1 
ATOM   4022 C CD2 . TRP A 1 524 ? 18.998  53.011 65.053 1.00 13.37 ? 524 TRP A CD2 1 
ATOM   4023 N NE1 . TRP A 1 524 ? 20.260  54.801 65.588 1.00 19.13 ? 524 TRP A NE1 1 
ATOM   4024 C CE2 . TRP A 1 524 ? 19.346  53.955 66.095 1.00 17.10 ? 524 TRP A CE2 1 
ATOM   4025 C CE3 . TRP A 1 524 ? 18.027  52.073 65.341 1.00 20.07 ? 524 TRP A CE3 1 
ATOM   4026 C CZ2 . TRP A 1 524 ? 18.742  53.914 67.331 1.00 18.50 ? 524 TRP A CZ2 1 
ATOM   4027 C CZ3 . TRP A 1 524 ? 17.418  52.053 66.591 1.00 16.54 ? 524 TRP A CZ3 1 
ATOM   4028 C CH2 . TRP A 1 524 ? 17.775  52.959 67.568 1.00 20.19 ? 524 TRP A CH2 1 
ATOM   4029 N N   . ASN A 1 525 ? 20.384  51.031 60.160 1.00 15.02 ? 525 ASN A N   1 
ATOM   4030 C CA  . ASN A 1 525 ? 19.919  50.507 58.883 1.00 14.36 ? 525 ASN A CA  1 
ATOM   4031 C C   . ASN A 1 525 ? 20.457  49.124 58.565 1.00 17.09 ? 525 ASN A C   1 
ATOM   4032 O O   . ASN A 1 525 ? 19.925  48.436 57.706 1.00 19.46 ? 525 ASN A O   1 
ATOM   4033 C CB  . ASN A 1 525 ? 20.355  51.395 57.735 1.00 13.49 ? 525 ASN A CB  1 
ATOM   4034 C CG  . ASN A 1 525 ? 19.576  52.691 57.658 1.00 15.83 ? 525 ASN A CG  1 
ATOM   4035 O OD1 . ASN A 1 525 ? 18.490  52.852 58.190 1.00 12.63 ? 525 ASN A OD1 1 
ATOM   4036 N ND2 . ASN A 1 525 ? 20.132  53.671 56.942 1.00 16.57 ? 525 ASN A ND2 1 
ATOM   4037 N N   . GLN A 1 526 ? 21.520  48.714 59.233 1.00 15.95 ? 526 GLN A N   1 
ATOM   4038 C CA  . GLN A 1 526 ? 22.061  47.378 58.919 1.00 18.32 ? 526 GLN A CA  1 
ATOM   4039 C C   . GLN A 1 526 ? 22.310  46.504 60.172 1.00 18.61 ? 526 GLN A C   1 
ATOM   4040 O O   . GLN A 1 526 ? 21.863  45.356 60.254 1.00 16.50 ? 526 GLN A O   1 
ATOM   4041 C CB  . GLN A 1 526 ? 23.348  47.520 58.061 1.00 18.00 ? 526 GLN A CB  1 
ATOM   4042 C CG  . GLN A 1 526 ? 23.300  48.724 57.086 1.00 23.34 ? 526 GLN A CG  1 
ATOM   4043 N N   . PHE A 1 527 ? 23.009  47.094 61.175 1.00 16.04 ? 527 PHE A N   1 
ATOM   4044 C CA  . PHE A 1 527 ? 23.345  46.271 62.348 1.00 17.15 ? 527 PHE A CA  1 
ATOM   4045 C C   . PHE A 1 527 ? 22.177  45.720 63.155 1.00 16.95 ? 527 PHE A C   1 
ATOM   4046 O O   . PHE A 1 527 ? 21.961  44.516 63.260 1.00 12.17 ? 527 PHE A O   1 
ATOM   4047 C CB  . PHE A 1 527 ? 24.372  46.937 63.269 1.00 14.59 ? 527 PHE A CB  1 
ATOM   4048 C CG  . PHE A 1 527 ? 24.874  45.969 64.310 1.00 12.50 ? 527 PHE A CG  1 
ATOM   4049 C CD1 . PHE A 1 527 ? 25.620  44.868 63.929 1.00 18.65 ? 527 PHE A CD1 1 
ATOM   4050 C CD2 . PHE A 1 527 ? 24.516  46.113 65.628 1.00 14.55 ? 527 PHE A CD2 1 
ATOM   4051 C CE1 . PHE A 1 527 ? 25.986  43.892 64.839 1.00 15.62 ? 527 PHE A CE1 1 
ATOM   4052 C CE2 . PHE A 1 527 ? 24.892  45.150 66.546 1.00 19.27 ? 527 PHE A CE2 1 
ATOM   4053 C CZ  . PHE A 1 527 ? 25.610  44.040 66.151 1.00 15.97 ? 527 PHE A CZ  1 
ATOM   4054 N N   . LEU A 1 528 ? 21.441  46.682 63.732 1.00 17.12 ? 528 LEU A N   1 
ATOM   4055 C CA  . LEU A 1 528 ? 20.290  46.373 64.530 1.00 15.40 ? 528 LEU A CA  1 
ATOM   4056 C C   . LEU A 1 528 ? 19.432  45.326 63.802 1.00 15.76 ? 528 LEU A C   1 
ATOM   4057 O O   . LEU A 1 528 ? 19.275  44.215 64.273 1.00 16.98 ? 528 LEU A O   1 
ATOM   4058 C CB  . LEU A 1 528 ? 19.556  47.650 64.990 1.00 13.74 ? 528 LEU A CB  1 
ATOM   4059 C CG  . LEU A 1 528 ? 19.290  47.720 66.497 1.00 14.93 ? 528 LEU A CG  1 
ATOM   4060 C CD1 . LEU A 1 528 ? 18.422  48.922 66.869 1.00 13.01 ? 528 LEU A CD1 1 
ATOM   4061 C CD2 . LEU A 1 528 ? 18.601  46.479 67.008 1.00 16.42 ? 528 LEU A CD2 1 
ATOM   4062 N N   . PRO A 1 529 ? 18.910  45.643 62.621 1.00 18.03 ? 529 PRO A N   1 
ATOM   4063 C CA  . PRO A 1 529 ? 18.054  44.681 61.934 1.00 16.98 ? 529 PRO A CA  1 
ATOM   4064 C C   . PRO A 1 529 ? 18.577  43.235 61.935 1.00 20.05 ? 529 PRO A C   1 
ATOM   4065 O O   . PRO A 1 529 ? 17.853  42.272 62.157 1.00 16.86 ? 529 PRO A O   1 
ATOM   4066 C CB  . PRO A 1 529 ? 17.947  45.274 60.516 1.00 22.58 ? 529 PRO A CB  1 
ATOM   4067 C CG  . PRO A 1 529 ? 18.393  46.761 60.563 1.00 24.65 ? 529 PRO A CG  1 
ATOM   4068 C CD  . PRO A 1 529 ? 19.147  46.909 61.885 1.00 23.46 ? 529 PRO A CD  1 
ATOM   4069 N N   . LYS A 1 530 ? 19.883  43.112 61.690 1.00 22.00 ? 530 LYS A N   1 
ATOM   4070 C CA  . LYS A 1 530 ? 20.479  41.793 61.665 1.00 22.64 ? 530 LYS A CA  1 
ATOM   4071 C C   . LYS A 1 530 ? 20.549  41.126 63.085 1.00 23.78 ? 530 LYS A C   1 
ATOM   4072 O O   . LYS A 1 530 ? 20.487  39.911 63.292 1.00 20.74 ? 530 LYS A O   1 
ATOM   4073 C CB  . LYS A 1 530 ? 21.835  41.961 61.002 1.00 28.06 ? 530 LYS A CB  1 
ATOM   4074 C CG  . LYS A 1 530 ? 22.437  40.624 60.578 1.00 39.07 ? 530 LYS A CG  1 
ATOM   4075 C CD  . LYS A 1 530 ? 23.907  40.726 60.123 1.00 46.42 ? 530 LYS A CD  1 
ATOM   4076 C CE  . LYS A 1 530 ? 24.407  39.388 59.557 1.00 50.13 ? 530 LYS A CE  1 
ATOM   4077 N NZ  . LYS A 1 530 ? 25.855  39.369 59.415 1.00 56.42 ? 530 LYS A NZ  1 
ATOM   4078 N N   . LEU A 1 531 ? 20.679  41.981 64.087 1.00 21.29 ? 531 LEU A N   1 
ATOM   4079 C CA  . LEU A 1 531 ? 20.724  41.523 65.460 1.00 20.29 ? 531 LEU A CA  1 
ATOM   4080 C C   . LEU A 1 531 ? 19.299  41.141 65.914 1.00 20.59 ? 531 LEU A C   1 
ATOM   4081 O O   . LEU A 1 531 ? 19.037  40.131 66.551 1.00 18.61 ? 531 LEU A O   1 
ATOM   4082 C CB  . LEU A 1 531 ? 21.241  42.709 66.307 1.00 21.83 ? 531 LEU A CB  1 
ATOM   4083 C CG  . LEU A 1 531 ? 21.531  42.432 67.809 1.00 17.80 ? 531 LEU A CG  1 
ATOM   4084 C CD1 . LEU A 1 531 ? 22.813  43.146 68.197 1.00 10.85 ? 531 LEU A CD1 1 
ATOM   4085 C CD2 . LEU A 1 531 ? 20.404  42.930 68.736 1.00 16.38 ? 531 LEU A CD2 1 
ATOM   4086 N N   . LEU A 1 532 ? 18.328  41.994 65.586 1.00 19.48 ? 532 LEU A N   1 
ATOM   4087 C CA  . LEU A 1 532 ? 16.985  41.664 66.009 1.00 25.21 ? 532 LEU A CA  1 
ATOM   4088 C C   . LEU A 1 532 ? 16.499  40.485 65.205 1.00 32.87 ? 532 LEU A C   1 
ATOM   4089 O O   . LEU A 1 532 ? 15.614  39.765 65.645 1.00 34.16 ? 532 LEU A O   1 
ATOM   4090 C CB  . LEU A 1 532 ? 16.012  42.860 65.944 1.00 21.92 ? 532 LEU A CB  1 
ATOM   4091 C CG  . LEU A 1 532 ? 16.263  44.004 66.965 1.00 21.52 ? 532 LEU A CG  1 
ATOM   4092 C CD1 . LEU A 1 532 ? 15.347  45.196 66.747 1.00 20.52 ? 532 LEU A CD1 1 
ATOM   4093 C CD2 . LEU A 1 532 ? 16.134  43.625 68.451 1.00 20.61 ? 532 LEU A CD2 1 
ATOM   4094 N N   . ASN A 1 533 ? 17.094  40.297 64.001 1.00 39.91 ? 533 ASN A N   1 
ATOM   4095 C CA  . ASN A 1 533 ? 16.717  39.152 63.154 1.00 45.05 ? 533 ASN A CA  1 
ATOM   4096 C C   . ASN A 1 533 ? 17.186  37.873 63.788 1.00 48.73 ? 533 ASN A C   1 
ATOM   4097 O O   . ASN A 1 533 ? 16.439  36.915 63.815 1.00 50.13 ? 533 ASN A O   1 
ATOM   4098 C CB  . ASN A 1 533 ? 17.347  39.139 61.745 1.00 46.74 ? 533 ASN A CB  1 
ATOM   4099 N N   . ALA A 1 534 ? 18.472  37.839 64.224 1.00 52.94 ? 534 ALA A N   1 
ATOM   4100 C CA  . ALA A 1 534 ? 19.023  36.638 64.869 1.00 58.77 ? 534 ALA A CA  1 
ATOM   4101 C C   . ALA A 1 534 ? 18.248  36.463 66.173 1.00 66.61 ? 534 ALA A C   1 
ATOM   4102 O O   . ALA A 1 534 ? 17.313  35.682 66.263 1.00 70.23 ? 534 ALA A O   1 
ATOM   4103 C CB  . ALA A 1 534 ? 20.524  36.814 65.066 1.00 53.31 ? 534 ALA A CB  1 
ATOM   4104 N N   . THR A 1 535 ? 18.689  37.188 67.199 1.00 74.42 ? 535 THR A N   1 
ATOM   4105 C CA  . THR A 1 535 ? 18.004  37.252 68.482 1.00 80.60 ? 535 THR A CA  1 
ATOM   4106 C C   . THR A 1 535 ? 18.853  38.143 69.388 1.00 79.53 ? 535 THR A C   1 
ATOM   4107 O O   . THR A 1 535 ? 19.531  37.650 70.286 1.00 80.88 ? 535 THR A O   1 
ATOM   4108 C CB  . THR A 1 535 ? 17.412  35.912 69.052 1.00 85.64 ? 535 THR A CB  1 
ATOM   4109 O OG1 . THR A 1 535 ? 16.754  36.179 70.292 1.00 91.21 ? 535 THR A OG1 1 
ATOM   4110 C CG2 . THR A 1 535 ? 18.418  34.777 69.273 1.00 88.56 ? 535 THR A CG2 1 
HETATM 4111 N N1  . DME B 2 .   ? 0.354   62.248 71.567 1.00 21.86 ? 999 DME A N1  1 
HETATM 4112 C C2  . DME B 2 .   ? 1.174   62.295 70.340 1.00 20.34 ? 999 DME A C2  1 
HETATM 4113 C C3  . DME B 2 .   ? 1.939   63.625 70.294 1.00 19.23 ? 999 DME A C3  1 
HETATM 4114 C C4  . DME B 2 .   ? 3.211   63.724 69.452 1.00 19.57 ? 999 DME A C4  1 
HETATM 4115 C C5  . DME B 2 .   ? 3.767   65.143 69.695 1.00 20.97 ? 999 DME A C5  1 
HETATM 4116 C C6  . DME B 2 .   ? 5.009   65.507 68.892 1.00 14.60 ? 999 DME A C6  1 
HETATM 4117 C C7  . DME B 2 .   ? 4.749   66.485 67.771 1.00 20.98 ? 999 DME A C7  1 
HETATM 4118 C C8  . DME B 2 .   ? 4.339   67.920 68.136 1.00 12.44 ? 999 DME A C8  1 
HETATM 4119 C C9  . DME B 2 .   ? 3.711   68.650 66.914 1.00 20.29 ? 999 DME A C9  1 
HETATM 4120 C C10 . DME B 2 .   ? 4.292   68.241 65.534 1.00 22.74 ? 999 DME A C10 1 
HETATM 4121 C C11 . DME B 2 .   ? 3.840   69.056 64.293 1.00 26.94 ? 999 DME A C11 1 
HETATM 4122 N N12 . DME B 2 .   ? 4.766   68.964 63.115 1.00 25.24 ? 999 DME A N12 1 
HETATM 4123 C C13 . DME B 2 .   ? -0.382  63.521 71.796 1.00 24.30 ? 999 DME A C13 1 
HETATM 4124 C C14 . DME B 2 .   ? -0.683  61.201 71.454 1.00 24.41 ? 999 DME A C14 1 
HETATM 4125 C C15 . DME B 2 .   ? 1.203   61.900 72.734 1.00 25.02 ? 999 DME A C15 1 
HETATM 4126 C C16 . DME B 2 .   ? 5.964   69.816 63.326 1.00 18.56 ? 999 DME A C16 1 
HETATM 4127 C C17 . DME B 2 .   ? 4.072   69.378 61.885 1.00 19.07 ? 999 DME A C17 1 
HETATM 4128 C C18 . DME B 2 .   ? 5.167   67.571 62.883 1.00 28.44 ? 999 DME A C18 1 
HETATM 4129 O O   . HOH C 3 .   ? 21.067  52.257 53.248 1.00 12.47 ? 601 HOH A O   1 
HETATM 4130 O O   . HOH C 3 .   ? 1.761   90.635 54.822 1.00 19.99 ? 602 HOH A O   1 
HETATM 4131 O O   . HOH C 3 .   ? 6.476   82.274 64.815 1.00 35.12 ? 603 HOH A O   1 
HETATM 4132 O O   . HOH C 3 .   ? -21.689 71.478 47.291 1.00 44.96 ? 604 HOH A O   1 
HETATM 4133 O O   . HOH C 3 .   ? 3.432   82.455 31.812 1.00 25.78 ? 605 HOH A O   1 
HETATM 4134 O O   . HOH C 3 .   ? 16.471  62.295 88.256 1.00 44.53 ? 606 HOH A O   1 
HETATM 4135 O O   . HOH C 3 .   ? 9.512   55.568 34.834 1.00 47.27 ? 607 HOH A O   1 
HETATM 4136 O O   . HOH C 3 .   ? 12.902  45.289 58.958 1.00 42.28 ? 608 HOH A O   1 
HETATM 4137 O O   . HOH C 3 .   ? 8.262   50.449 37.133 1.00 14.74 ? 609 HOH A O   1 
HETATM 4138 O O   . HOH C 3 .   ? -13.764 63.179 57.234 1.00 13.98 ? 610 HOH A O   1 
HETATM 4139 O O   . HOH C 3 .   ? 0.704   48.575 76.054 1.00 35.75 ? 611 HOH A O   1 
HETATM 4140 O O   . HOH C 3 .   ? 4.748   60.005 69.755 1.00 38.77 ? 612 HOH A O   1 
HETATM 4141 O O   . HOH C 3 .   ? 23.071  54.841 54.102 1.00 39.41 ? 613 HOH A O   1 
HETATM 4142 O O   . HOH C 3 .   ? 6.859   79.222 64.019 1.00 27.97 ? 614 HOH A O   1 
HETATM 4143 O O   . HOH C 3 .   ? 1.377   74.593 30.111 1.00 51.37 ? 615 HOH A O   1 
HETATM 4144 O O   . HOH C 3 .   ? -6.294  52.471 40.319 1.00 56.54 ? 616 HOH A O   1 
HETATM 4145 O O   . HOH C 3 .   ? -8.203  80.437 32.600 1.00 45.67 ? 617 HOH A O   1 
HETATM 4146 O O   . HOH C 3 .   ? -9.731  51.332 46.394 1.00 44.41 ? 618 HOH A O   1 
HETATM 4147 O O   . HOH C 3 .   ? -5.971  65.792 32.287 1.00 31.66 ? 619 HOH A O   1 
HETATM 4148 O O   . HOH C 3 .   ? -13.696 81.636 32.467 1.00 30.94 ? 620 HOH A O   1 
HETATM 4149 O O   . HOH C 3 .   ? -11.073 79.591 32.264 1.00 23.71 ? 621 HOH A O   1 
HETATM 4150 O O   . HOH C 3 .   ? 0.732   70.224 67.986 1.00 47.91 ? 622 HOH A O   1 
HETATM 4151 O O   . HOH C 3 .   ? -6.881  56.410 41.061 1.00 48.89 ? 623 HOH A O   1 
HETATM 4152 O O   . HOH C 3 .   ? -14.898 60.402 57.497 1.00 36.01 ? 624 HOH A O   1 
HETATM 4153 O O   . HOH C 3 .   ? 5.147   48.676 56.957 1.00 43.77 ? 625 HOH A O   1 
HETATM 4154 O O   . HOH C 3 .   ? -3.402  94.237 47.907 1.00 17.94 ? 626 HOH A O   1 
HETATM 4155 O O   . HOH C 3 .   ? -11.827 86.427 31.832 1.00 77.45 ? 627 HOH A O   1 
HETATM 4156 O O   . HOH C 3 .   ? -1.054  51.470 42.427 1.00 32.43 ? 628 HOH A O   1 
HETATM 4157 O O   . HOH C 3 .   ? 3.670   81.475 63.602 1.00 37.34 ? 629 HOH A O   1 
HETATM 4158 O O   . HOH C 3 .   ? -3.952  86.567 54.413 1.00 35.88 ? 630 HOH A O   1 
HETATM 4159 O O   . HOH C 3 .   ? -7.607  69.273 57.659 1.00 21.24 ? 631 HOH A O   1 
HETATM 4160 O O   . HOH C 3 .   ? 9.292   47.211 62.884 1.00 36.33 ? 632 HOH A O   1 
HETATM 4161 O O   . HOH C 3 .   ? 2.202   41.184 61.466 1.00 30.87 ? 633 HOH A O   1 
HETATM 4162 O O   . HOH C 3 .   ? 0.361   68.134 64.457 1.00 56.67 ? 634 HOH A O   1 
HETATM 4163 O O   . HOH C 3 .   ? 15.704  69.529 86.298 1.00 74.25 ? 635 HOH A O   1 
HETATM 4164 O O   . HOH C 3 .   ? -5.437  57.636 38.139 1.00 55.17 ? 636 HOH A O   1 
HETATM 4165 O O   . HOH C 3 .   ? 3.014   46.517 61.090 1.00 50.97 ? 637 HOH A O   1 
HETATM 4166 O O   . HOH C 3 .   ? 20.965  49.478 53.904 1.00 28.08 ? 638 HOH A O   1 
HETATM 4167 O O   . HOH C 3 .   ? 2.763   47.105 77.579 1.00 33.43 ? 639 HOH A O   1 
HETATM 4168 O O   . HOH C 3 .   ? 0.583   69.827 61.878 1.00 26.73 ? 640 HOH A O   1 
HETATM 4169 O O   . HOH C 3 .   ? 23.306  51.805 54.667 1.00 42.55 ? 641 HOH A O   1 
HETATM 4170 O O   . HOH C 3 .   ? 0.229   66.634 69.810 1.00 46.61 ? 642 HOH A O   1 
HETATM 4171 O O   . HOH C 3 .   ? -3.812  47.374 74.299 1.00 48.68 ? 643 HOH A O   1 
HETATM 4172 O O   . HOH C 3 .   ? -15.363 83.759 31.325 1.00 71.22 ? 644 HOH A O   1 
HETATM 4173 O O   . HOH C 3 .   ? 11.146  50.613 36.567 1.00 31.18 ? 645 HOH A O   1 
HETATM 4174 O O   . HOH C 3 .   ? -16.815 68.906 49.354 1.00 33.34 ? 646 HOH A O   1 
HETATM 4175 O O   . HOH C 3 .   ? -18.023 86.360 49.864 1.00 38.72 ? 647 HOH A O   1 
HETATM 4176 O O   . HOH C 3 .   ? 11.506  48.880 60.774 1.00 34.58 ? 648 HOH A O   1 
HETATM 4177 O O   . HOH C 3 .   ? 6.894   79.505 79.119 1.00 67.46 ? 649 HOH A O   1 
HETATM 4178 O O   . HOH C 3 .   ? 9.561   72.900 32.550 1.00 49.61 ? 650 HOH A O   1 
HETATM 4179 O O   . HOH C 3 .   ? -1.977  58.040 63.312 1.00 47.41 ? 651 HOH A O   1 
HETATM 4180 O O   . HOH C 3 .   ? 24.328  68.776 85.614 1.00 61.64 ? 652 HOH A O   1 
HETATM 4181 O O   . HOH C 3 .   ? 31.360  64.899 43.594 1.00 51.08 ? 653 HOH A O   1 
HETATM 4182 O O   . HOH C 3 .   ? 13.108  49.535 54.882 1.00 44.46 ? 654 HOH A O   1 
HETATM 4183 O O   . HOH C 3 .   ? -4.246  57.621 65.309 1.00 26.07 ? 655 HOH A O   1 
HETATM 4184 O O   . HOH C 3 .   ? 7.789   47.192 54.007 1.00 29.57 ? 656 HOH A O   1 
HETATM 4185 O O   . HOH C 3 .   ? -18.505 66.902 60.807 1.00 58.05 ? 658 HOH A O   1 
HETATM 4186 O O   . HOH C 3 .   ? 5.304   44.411 74.244 1.00 43.80 ? 659 HOH A O   1 
HETATM 4187 O O   . HOH C 3 .   ? -2.635  78.754 62.421 1.00 46.95 ? 660 HOH A O   1 
HETATM 4188 O O   . HOH C 3 .   ? 8.735   95.735 46.681 1.00 61.75 ? 661 HOH A O   1 
HETATM 4189 O O   . HOH C 3 .   ? -19.975 87.744 51.650 1.00 66.53 ? 662 HOH A O   1 
HETATM 4190 O O   . HOH C 3 .   ? 23.803  65.760 85.744 1.00 36.68 ? 663 HOH A O   1 
HETATM 4191 O O   . HOH C 3 .   ? -8.425  54.161 42.309 1.00 57.16 ? 664 HOH A O   1 
HETATM 4192 O O   . HOH C 3 .   ? 20.844  55.705 34.923 1.00 44.15 ? 665 HOH A O   1 
HETATM 4193 O O   . HOH C 3 .   ? 17.487  93.337 62.310 1.00 50.48 ? 666 HOH A O   1 
HETATM 4194 O O   . HOH C 3 .   ? 24.037  59.638 34.762 1.00 48.95 ? 667 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 ?   ?   ?   A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 GLU 536 536 ?   ?   ?   A . n 
A 1 537 THR 537 537 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 DME 1  999 999 DME DME A . 
C 3 HOH 1  601 601 HOH HOH A . 
C 3 HOH 2  602 602 HOH HOH A . 
C 3 HOH 3  603 603 HOH HOH A . 
C 3 HOH 4  604 604 HOH HOH A . 
C 3 HOH 5  605 605 HOH HOH A . 
C 3 HOH 6  606 606 HOH HOH A . 
C 3 HOH 7  607 607 HOH HOH A . 
C 3 HOH 8  608 608 HOH HOH A . 
C 3 HOH 9  609 609 HOH HOH A . 
C 3 HOH 10 610 610 HOH HOH A . 
C 3 HOH 11 611 611 HOH HOH A . 
C 3 HOH 12 612 612 HOH HOH A . 
C 3 HOH 13 613 613 HOH HOH A . 
C 3 HOH 14 614 614 HOH HOH A . 
C 3 HOH 15 615 615 HOH HOH A . 
C 3 HOH 16 616 616 HOH HOH A . 
C 3 HOH 17 617 617 HOH HOH A . 
C 3 HOH 18 618 618 HOH HOH A . 
C 3 HOH 19 619 619 HOH HOH A . 
C 3 HOH 20 620 620 HOH HOH A . 
C 3 HOH 21 621 621 HOH HOH A . 
C 3 HOH 22 622 622 HOH HOH A . 
C 3 HOH 23 623 623 HOH HOH A . 
C 3 HOH 24 624 624 HOH HOH A . 
C 3 HOH 25 625 625 HOH HOH A . 
C 3 HOH 26 626 626 HOH HOH A . 
C 3 HOH 27 627 627 HOH HOH A . 
C 3 HOH 28 628 628 HOH HOH A . 
C 3 HOH 29 629 629 HOH HOH A . 
C 3 HOH 30 630 630 HOH HOH A . 
C 3 HOH 31 631 631 HOH HOH A . 
C 3 HOH 32 632 632 HOH HOH A . 
C 3 HOH 33 633 633 HOH HOH A . 
C 3 HOH 34 634 634 HOH HOH A . 
C 3 HOH 35 635 635 HOH HOH A . 
C 3 HOH 36 636 636 HOH HOH A . 
C 3 HOH 37 637 637 HOH HOH A . 
C 3 HOH 38 638 638 HOH HOH A . 
C 3 HOH 39 639 639 HOH HOH A . 
C 3 HOH 40 640 640 HOH HOH A . 
C 3 HOH 41 641 641 HOH HOH A . 
C 3 HOH 42 642 642 HOH HOH A . 
C 3 HOH 43 643 643 HOH HOH A . 
C 3 HOH 44 644 644 HOH HOH A . 
C 3 HOH 45 645 645 HOH HOH A . 
C 3 HOH 46 646 646 HOH HOH A . 
C 3 HOH 47 647 647 HOH HOH A . 
C 3 HOH 48 648 648 HOH HOH A . 
C 3 HOH 49 649 649 HOH HOH A . 
C 3 HOH 50 650 650 HOH HOH A . 
C 3 HOH 51 651 651 HOH HOH A . 
C 3 HOH 52 652 652 HOH HOH A . 
C 3 HOH 53 653 653 HOH HOH A . 
C 3 HOH 54 654 654 HOH HOH A . 
C 3 HOH 55 655 655 HOH HOH A . 
C 3 HOH 56 656 656 HOH HOH A . 
C 3 HOH 57 658 658 HOH HOH A . 
C 3 HOH 58 659 659 HOH HOH A . 
C 3 HOH 59 660 660 HOH HOH A . 
C 3 HOH 60 661 661 HOH HOH A . 
C 3 HOH 61 662 662 HOH HOH A . 
C 3 HOH 62 663 663 HOH HOH A . 
C 3 HOH 63 664 664 HOH HOH A . 
C 3 HOH 64 665 665 HOH HOH A . 
C 3 HOH 65 666 666 HOH HOH A . 
C 3 HOH 66 667 667 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 3460  ? 
1 MORE         -16   ? 
1 'SSA (A^2)'  35900 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 137.5000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-08-31 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-06-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
_pdbx_entry_details.entry_id             1ACL 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   'RESIDUE DME 999 IS BOUND NON-COVALENTLY IN THE ACTIVE SITE.' 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CG A HIS 159 ? ? CD2 A HIS 159 ? ? 1.416 1.354 0.062 0.009 N 
2 1 CG A HIS 181 ? ? CD2 A HIS 181 ? ? 1.424 1.354 0.070 0.009 N 
3 1 CG A HIS 209 ? ? CD2 A HIS 209 ? ? 1.421 1.354 0.067 0.009 N 
4 1 CG A HIS 264 ? ? CD2 A HIS 264 ? ? 1.420 1.354 0.066 0.009 N 
5 1 CG A HIS 362 ? ? CD2 A HIS 362 ? ? 1.417 1.354 0.063 0.009 N 
6 1 CG A HIS 406 ? ? CD2 A HIS 406 ? ? 1.410 1.354 0.056 0.009 N 
7 1 CG A HIS 440 ? ? CD2 A HIS 440 ? ? 1.413 1.354 0.059 0.009 N 
8 1 CG A HIS 471 ? ? CD2 A HIS 471 ? ? 1.423 1.354 0.069 0.009 N 
9 1 CG A HIS 513 ? ? CD2 A HIS 513 ? ? 1.419 1.354 0.065 0.009 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A LEU 127 ? ? CA A LEU 127 ? ? C   A LEU 127 ? ? 97.56  110.20 -12.64 1.90 N 
2  1 CB A TYR 130 ? ? CG A TYR 130 ? ? CD2 A TYR 130 ? ? 117.40 121.00 -3.60  0.60 N 
3  1 CB A TYR 130 ? ? CG A TYR 130 ? ? CD1 A TYR 130 ? ? 125.64 121.00 4.64   0.60 N 
4  1 CB A SER 145 ? ? CA A SER 145 ? ? C   A SER 145 ? ? 98.36  110.10 -11.74 1.90 N 
5  1 CB A SER 147 ? ? CA A SER 147 ? ? C   A SER 147 ? ? 98.37  110.10 -11.73 1.90 N 
6  1 C  A PRO 165 ? ? N  A GLY 166 ? ? CA  A GLY 166 ? ? 108.02 122.30 -14.28 2.10 Y 
7  1 NE A ARG 216 ? ? CZ A ARG 216 ? ? NH1 A ARG 216 ? ? 123.53 120.30 3.23   0.50 N 
8  1 CB A ALA 245 ? ? CA A ALA 245 ? ? C   A ALA 245 ? ? 121.51 110.10 11.41  1.50 N 
9  1 NE A ARG 267 ? ? CZ A ARG 267 ? ? NH1 A ARG 267 ? ? 123.86 120.30 3.56   0.50 N 
10 1 NE A ARG 267 ? ? CZ A ARG 267 ? ? NH2 A ARG 267 ? ? 116.65 120.30 -3.65  0.50 N 
11 1 CB A SER 286 ? ? CA A SER 286 ? ? C   A SER 286 ? ? 98.02  110.10 -12.08 1.90 N 
12 1 N  A VAL 293 ? ? CA A VAL 293 ? ? CB  A VAL 293 ? ? 97.64  111.50 -13.86 2.20 N 
13 1 CB A ASN 324 ? ? CA A ASN 324 ? ? C   A ASN 324 ? ? 122.47 110.40 12.07  2.00 N 
14 1 NE A ARG 388 ? ? CZ A ARG 388 ? ? NH2 A ARG 388 ? ? 123.67 120.30 3.37   0.50 N 
15 1 NE A ARG 426 ? ? CZ A ARG 426 ? ? NH2 A ARG 426 ? ? 115.80 120.30 -4.50  0.50 N 
16 1 CB A TYR 442 ? ? CA A TYR 442 ? ? C   A TYR 442 ? ? 122.75 110.40 12.35  2.00 N 
17 1 N  A ASP 504 ? ? CA A ASP 504 ? ? CB  A ASP 504 ? ? 121.95 110.60 11.35  1.80 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 22  ? ? -161.26 115.79  
2  1 LEU A 23  ? ? 57.39   -131.60 
3  1 SER A 25  ? ? -141.88 -144.76 
4  1 CYS A 94  ? ? -151.42 13.55   
5  1 SER A 108 ? ? -162.98 110.34  
6  1 ALA A 157 ? ? -166.06 66.07   
7  1 HIS A 159 ? ? -23.91  -70.08  
8  1 ALA A 164 ? ? -154.59 68.94   
9  1 SER A 200 ? ? 59.65   -127.23 
10 1 ARG A 220 ? ? -94.94  -62.92  
11 1 ASN A 257 ? ? -85.48  -80.65  
12 1 PHE A 300 ? ? 76.48   -67.33  
13 1 THR A 317 ? ? -114.89 -164.36 
14 1 SER A 329 ? ? -24.16  -64.35  
15 1 TYR A 334 ? ? -72.90  22.02   
16 1 ASP A 342 ? ? 90.27   -28.41  
17 1 SER A 345 ? ? 2.60    74.76   
18 1 ASP A 380 ? ? -177.26 55.66   
19 1 ASP A 381 ? ? -60.18  5.24    
20 1 ASN A 382 ? ? -140.27 15.05   
21 1 ASN A 383 ? ? -58.96  103.15  
22 1 VAL A 400 ? ? -137.43 -47.43  
23 1 ASN A 416 ? ? -96.83  44.49   
24 1 ASN A 424 ? ? -156.81 48.21   
25 1 PRO A 451 ? ? -59.57  8.06    
26 1 ASN A 457 ? ? 42.59   71.60   
27 1 LYS A 478 ? ? -121.42 -57.06  
28 1 THR A 497 ? ? -64.24  12.04   
29 1 LYS A 498 ? ? -109.36 -81.15  
30 1 GLU A 499 ? ? -102.08 60.66   
31 1 GLN A 500 ? ? -34.65  74.80   
32 1 THR A 507 ? ? -69.85  0.40    
33 1 PRO A 509 ? ? -44.39  107.39  
34 1 ARG A 515 ? ? 32.07   72.61   
35 1 ARG A 517 ? ? 36.88   48.44   
36 1 GLN A 526 ? ? -130.63 -49.58  
37 1 ALA A 534 ? ? -65.06  -83.29  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 63  ? ? 0.131 'SIDE CHAIN' 
2 1 TYR A 130 ? ? 0.079 'SIDE CHAIN' 
3 1 ARG A 149 ? ? 0.106 'SIDE CHAIN' 
4 1 ARG A 174 ? ? 0.081 'SIDE CHAIN' 
5 1 TYR A 334 ? ? 0.087 'SIDE CHAIN' 
6 1 TYR A 442 ? ? 0.085 'SIDE CHAIN' 
7 1 ARG A 467 ? ? 0.082 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 26  ? CG  ? A HIS 26  CG  
2  1 Y 1 A HIS 26  ? ND1 ? A HIS 26  ND1 
3  1 Y 1 A HIS 26  ? CD2 ? A HIS 26  CD2 
4  1 Y 1 A HIS 26  ? CE1 ? A HIS 26  CE1 
5  1 Y 1 A HIS 26  ? NE2 ? A HIS 26  NE2 
6  1 Y 1 A ASN 42  ? CG  ? A ASN 42  CG  
7  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
8  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
9  1 Y 1 A ARG 46  ? CZ  ? A ARG 46  CZ  
10 1 Y 1 A ARG 46  ? NH1 ? A ARG 46  NH1 
11 1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
12 1 Y 1 A ARG 47  ? CD  ? A ARG 47  CD  
13 1 Y 1 A ARG 47  ? NE  ? A ARG 47  NE  
14 1 Y 1 A ARG 47  ? CZ  ? A ARG 47  CZ  
15 1 Y 1 A ARG 47  ? NH1 ? A ARG 47  NH1 
16 1 Y 1 A ARG 47  ? NH2 ? A ARG 47  NH2 
17 1 Y 1 A GLU 49  ? CD  ? A GLU 49  CD  
18 1 Y 1 A GLU 49  ? OE1 ? A GLU 49  OE1 
19 1 Y 1 A GLU 49  ? OE2 ? A GLU 49  OE2 
20 1 Y 1 A ARG 88  ? CZ  ? A ARG 88  CZ  
21 1 Y 1 A ARG 88  ? NH1 ? A ARG 88  NH1 
22 1 Y 1 A ARG 88  ? NH2 ? A ARG 88  NH2 
23 1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
24 1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
25 1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
26 1 Y 1 A SER 161 ? OG  ? A SER 161 OG  
27 1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
28 1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
29 1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
30 1 Y 1 A GLU 260 ? CG  ? A GLU 260 CG  
31 1 Y 1 A GLU 260 ? CD  ? A GLU 260 CD  
32 1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
33 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
34 1 Y 1 A GLU 268 ? CD  ? A GLU 268 CD  
35 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
36 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
37 1 Y 1 A LYS 270 ? CD  ? A LYS 270 CD  
38 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
39 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
40 1 Y 1 A PHE 284 ? CD1 ? A PHE 284 CD1 
41 1 Y 1 A PHE 284 ? CD2 ? A PHE 284 CD2 
42 1 Y 1 A PHE 284 ? CE1 ? A PHE 284 CE1 
43 1 Y 1 A PHE 284 ? CE2 ? A PHE 284 CE2 
44 1 Y 1 A PHE 284 ? CZ  ? A PHE 284 CZ  
45 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
46 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
47 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
48 1 Y 1 A LYS 325 ? NZ  ? A LYS 325 NZ  
49 1 Y 1 A GLU 344 ? CD  ? A GLU 344 CD  
50 1 Y 1 A GLU 344 ? OE1 ? A GLU 344 OE1 
51 1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
52 1 Y 1 A GLU 350 ? CD  ? A GLU 350 CD  
53 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
54 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
55 1 Y 1 A MET 353 ? SD  ? A MET 353 SD  
56 1 Y 1 A MET 353 ? CE  ? A MET 353 CE  
57 1 Y 1 A ASP 365 ? CG  ? A ASP 365 CG  
58 1 Y 1 A ASP 365 ? OD1 ? A ASP 365 OD1 
59 1 Y 1 A ASP 365 ? OD2 ? A ASP 365 OD2 
60 1 Y 1 A ASN 382 ? CG  ? A ASN 382 CG  
61 1 Y 1 A ASN 382 ? OD1 ? A ASN 382 OD1 
62 1 Y 1 A ASN 382 ? ND2 ? A ASN 382 ND2 
63 1 Y 1 A GLU 434 ? CD  ? A GLU 434 CD  
64 1 Y 1 A GLU 434 ? OE1 ? A GLU 434 OE1 
65 1 Y 1 A GLU 434 ? OE2 ? A GLU 434 OE2 
66 1 Y 1 A GLU 455 ? CD  ? A GLU 455 CD  
67 1 Y 1 A GLU 455 ? OE1 ? A GLU 455 OE1 
68 1 Y 1 A GLU 455 ? OE2 ? A GLU 455 OE2 
69 1 Y 1 A GLU 461 ? CD  ? A GLU 461 CD  
70 1 Y 1 A GLU 461 ? OE1 ? A GLU 461 OE1 
71 1 Y 1 A GLU 461 ? OE2 ? A GLU 461 OE2 
72 1 Y 1 A LYS 478 ? CE  ? A LYS 478 CE  
73 1 Y 1 A LYS 478 ? NZ  ? A LYS 478 NZ  
74 1 Y 1 A GLU 484 ? CD  ? A GLU 484 CD  
75 1 Y 1 A GLU 484 ? OE1 ? A GLU 484 OE1 
76 1 Y 1 A GLU 484 ? OE2 ? A GLU 484 OE2 
77 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
78 1 Y 1 A GLU 499 ? CG  ? A GLU 499 CG  
79 1 Y 1 A GLU 499 ? CD  ? A GLU 499 CD  
80 1 Y 1 A GLU 499 ? OE1 ? A GLU 499 OE1 
81 1 Y 1 A GLU 499 ? OE2 ? A GLU 499 OE2 
82 1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
83 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
84 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
85 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
86 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
87 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
88 1 Y 1 A GLN 526 ? CD  ? A GLN 526 CD  
89 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
90 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
91 1 Y 1 A ASN 533 ? CG  ? A ASN 533 CG  
92 1 Y 1 A ASN 533 ? OD1 ? A ASN 533 OD1 
93 1 Y 1 A ASN 533 ? ND2 ? A ASN 533 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A PRO 485 ? A PRO 485 
5  1 Y 1 A HIS 486 ? A HIS 486 
6  1 Y 1 A SER 487 ? A SER 487 
7  1 Y 1 A GLN 488 ? A GLN 488 
8  1 Y 1 A GLU 489 ? A GLU 489 
9  1 Y 1 A GLU 536 ? A GLU 536 
10 1 Y 1 A THR 537 ? A THR 537 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'DECAMETHONIUM ION' DME 
3 water               HOH 
#