data_1ADI
# 
_entry.id   1ADI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ADI         
WWPDB D_1000170684 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ADI 
_pdbx_database_status.recvd_initial_deposition_date   1995-09-14 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Silva, M.M.'    1 
'Poland, B.W.'   2 
'Hoffman, C.M.'  3 
'Fromm, H.J.'    4 
'Honzatko, R.B.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Refined crystal structures of unligated adenylosuccinate synthetase from Escherichia coli.' J.Mol.Biol.  254 431   446 
1995 JMOBAK UK 0022-2836 0070 ? 7490761 10.1006/jmbi.1995.0629 
1       
'Crystal Structure of Adenylosuccinate Synthetase from Escherichia Coli. Evidence for Convergent Evolution of GTP-Binding Domains' 
J.Biol.Chem. 268 25334 ?   1993 JBCHA3 US 0021-9258 0071 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Silva, M.M.'    1  
primary 'Poland, B.W.'   2  
primary 'Hoffman, C.R.'  3  
primary 'Fromm, H.J.'    4  
primary 'Honzatko, R.B.' 5  
1       'Poland, B.W.'   6  
1       'Silva, M.M.'    7  
1       'Serra, M.A.'    8  
1       'Cho, Y.'        9  
1       'Kim, K.H.'      10 
1       'Harris, E.M.'   11 
1       'Honzatko, R.B.' 12 
# 
_cell.entry_id           1ADI 
_cell.length_a           73.420 
_cell.length_b           93.630 
_cell.length_c           119.470 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ADI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'ADENYLOSUCCINATE SYNTHETASE' 47269.598 2   6.3.4.4 ? ? ? 
2 water   nat water                         18.015    439 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   ASN n 
1 4   VAL n 
1 5   VAL n 
1 6   VAL n 
1 7   LEU n 
1 8   GLY n 
1 9   THR n 
1 10  GLN n 
1 11  TRP n 
1 12  GLY n 
1 13  ASP n 
1 14  GLU n 
1 15  GLY n 
1 16  LYS n 
1 17  GLY n 
1 18  LYS n 
1 19  ILE n 
1 20  VAL n 
1 21  ASP n 
1 22  LEU n 
1 23  LEU n 
1 24  THR n 
1 25  GLU n 
1 26  ARG n 
1 27  ALA n 
1 28  LYS n 
1 29  TYR n 
1 30  VAL n 
1 31  VAL n 
1 32  ARG n 
1 33  TYR n 
1 34  GLN n 
1 35  GLY n 
1 36  GLY n 
1 37  HIS n 
1 38  ASN n 
1 39  ALA n 
1 40  GLY n 
1 41  HIS n 
1 42  THR n 
1 43  LEU n 
1 44  VAL n 
1 45  ILE n 
1 46  ASN n 
1 47  GLY n 
1 48  GLU n 
1 49  LYS n 
1 50  THR n 
1 51  VAL n 
1 52  LEU n 
1 53  HIS n 
1 54  LEU n 
1 55  ILE n 
1 56  PRO n 
1 57  SER n 
1 58  GLY n 
1 59  ILE n 
1 60  LEU n 
1 61  ARG n 
1 62  GLU n 
1 63  ASN n 
1 64  VAL n 
1 65  THR n 
1 66  SER n 
1 67  ILE n 
1 68  ILE n 
1 69  GLY n 
1 70  ASN n 
1 71  GLY n 
1 72  VAL n 
1 73  VAL n 
1 74  LEU n 
1 75  SER n 
1 76  PRO n 
1 77  ALA n 
1 78  ALA n 
1 79  LEU n 
1 80  MET n 
1 81  LYS n 
1 82  GLU n 
1 83  MET n 
1 84  LYS n 
1 85  GLU n 
1 86  LEU n 
1 87  GLU n 
1 88  ASP n 
1 89  ARG n 
1 90  GLY n 
1 91  ILE n 
1 92  PRO n 
1 93  VAL n 
1 94  ARG n 
1 95  GLU n 
1 96  ARG n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 SER n 
1 101 GLU n 
1 102 ALA n 
1 103 CYS n 
1 104 PRO n 
1 105 LEU n 
1 106 ILE n 
1 107 LEU n 
1 108 ASP n 
1 109 TYR n 
1 110 HIS n 
1 111 VAL n 
1 112 ALA n 
1 113 LEU n 
1 114 ASP n 
1 115 ASN n 
1 116 ALA n 
1 117 ARG n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 ARG n 
1 122 GLY n 
1 123 ALA n 
1 124 LYS n 
1 125 ALA n 
1 126 ILE n 
1 127 GLY n 
1 128 THR n 
1 129 THR n 
1 130 GLY n 
1 131 ARG n 
1 132 GLY n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 ALA n 
1 137 TYR n 
1 138 GLU n 
1 139 ASP n 
1 140 LYS n 
1 141 VAL n 
1 142 ALA n 
1 143 ARG n 
1 144 ARG n 
1 145 GLY n 
1 146 LEU n 
1 147 ARG n 
1 148 VAL n 
1 149 GLY n 
1 150 ASP n 
1 151 LEU n 
1 152 PHE n 
1 153 ASP n 
1 154 LYS n 
1 155 GLU n 
1 156 THR n 
1 157 PHE n 
1 158 ALA n 
1 159 GLU n 
1 160 LYS n 
1 161 LEU n 
1 162 LYS n 
1 163 GLU n 
1 164 VAL n 
1 165 MET n 
1 166 GLU n 
1 167 TYR n 
1 168 HIS n 
1 169 ASN n 
1 170 PHE n 
1 171 GLN n 
1 172 LEU n 
1 173 VAL n 
1 174 ASN n 
1 175 TYR n 
1 176 TYR n 
1 177 LYS n 
1 178 ALA n 
1 179 GLU n 
1 180 ALA n 
1 181 VAL n 
1 182 ASP n 
1 183 TYR n 
1 184 GLN n 
1 185 LYS n 
1 186 VAL n 
1 187 LEU n 
1 188 ASP n 
1 189 ASP n 
1 190 THR n 
1 191 MET n 
1 192 ALA n 
1 193 VAL n 
1 194 ALA n 
1 195 ASP n 
1 196 ILE n 
1 197 LEU n 
1 198 THR n 
1 199 SER n 
1 200 MET n 
1 201 VAL n 
1 202 VAL n 
1 203 ASP n 
1 204 VAL n 
1 205 SER n 
1 206 ASP n 
1 207 LEU n 
1 208 LEU n 
1 209 ASP n 
1 210 GLN n 
1 211 ALA n 
1 212 ARG n 
1 213 GLN n 
1 214 ARG n 
1 215 GLY n 
1 216 ASP n 
1 217 PHE n 
1 218 VAL n 
1 219 MET n 
1 220 PHE n 
1 221 GLU n 
1 222 GLY n 
1 223 ALA n 
1 224 GLN n 
1 225 GLY n 
1 226 THR n 
1 227 LEU n 
1 228 LEU n 
1 229 ASP n 
1 230 ILE n 
1 231 ASP n 
1 232 HIS n 
1 233 GLY n 
1 234 THR n 
1 235 TYR n 
1 236 PRO n 
1 237 TYR n 
1 238 VAL n 
1 239 THR n 
1 240 SER n 
1 241 SER n 
1 242 ASN n 
1 243 THR n 
1 244 THR n 
1 245 ALA n 
1 246 GLY n 
1 247 GLY n 
1 248 VAL n 
1 249 ALA n 
1 250 THR n 
1 251 GLY n 
1 252 SER n 
1 253 GLY n 
1 254 LEU n 
1 255 GLY n 
1 256 PRO n 
1 257 ARG n 
1 258 TYR n 
1 259 VAL n 
1 260 ASP n 
1 261 TYR n 
1 262 VAL n 
1 263 LEU n 
1 264 GLY n 
1 265 ILE n 
1 266 LEU n 
1 267 LYS n 
1 268 ALA n 
1 269 TYR n 
1 270 SER n 
1 271 THR n 
1 272 ARG n 
1 273 VAL n 
1 274 GLY n 
1 275 ALA n 
1 276 GLY n 
1 277 PRO n 
1 278 PHE n 
1 279 PRO n 
1 280 THR n 
1 281 GLU n 
1 282 LEU n 
1 283 PHE n 
1 284 ASP n 
1 285 GLU n 
1 286 THR n 
1 287 GLY n 
1 288 GLU n 
1 289 PHE n 
1 290 LEU n 
1 291 CYS n 
1 292 LYS n 
1 293 GLN n 
1 294 GLY n 
1 295 ASN n 
1 296 GLU n 
1 297 PHE n 
1 298 GLY n 
1 299 ALA n 
1 300 THR n 
1 301 THR n 
1 302 GLY n 
1 303 ARG n 
1 304 ARG n 
1 305 ARG n 
1 306 ARG n 
1 307 THR n 
1 308 GLY n 
1 309 TRP n 
1 310 LEU n 
1 311 ASP n 
1 312 THR n 
1 313 VAL n 
1 314 ALA n 
1 315 VAL n 
1 316 ARG n 
1 317 ARG n 
1 318 ALA n 
1 319 VAL n 
1 320 GLN n 
1 321 LEU n 
1 322 ASN n 
1 323 SER n 
1 324 LEU n 
1 325 SER n 
1 326 GLY n 
1 327 PHE n 
1 328 CYS n 
1 329 LEU n 
1 330 THR n 
1 331 LYS n 
1 332 LEU n 
1 333 ASP n 
1 334 VAL n 
1 335 LEU n 
1 336 ASP n 
1 337 GLY n 
1 338 LEU n 
1 339 LYS n 
1 340 GLU n 
1 341 VAL n 
1 342 LYS n 
1 343 LEU n 
1 344 CYS n 
1 345 VAL n 
1 346 ALA n 
1 347 TYR n 
1 348 ARG n 
1 349 MET n 
1 350 PRO n 
1 351 ASP n 
1 352 GLY n 
1 353 ARG n 
1 354 GLU n 
1 355 VAL n 
1 356 THR n 
1 357 THR n 
1 358 THR n 
1 359 PRO n 
1 360 LEU n 
1 361 ALA n 
1 362 ALA n 
1 363 ASP n 
1 364 ASP n 
1 365 TRP n 
1 366 LYS n 
1 367 GLY n 
1 368 VAL n 
1 369 GLU n 
1 370 PRO n 
1 371 ILE n 
1 372 TYR n 
1 373 GLU n 
1 374 THR n 
1 375 MET n 
1 376 PRO n 
1 377 GLY n 
1 378 TRP n 
1 379 SER n 
1 380 GLU n 
1 381 SER n 
1 382 THR n 
1 383 PHE n 
1 384 GLY n 
1 385 VAL n 
1 386 LYS n 
1 387 ASP n 
1 388 ARG n 
1 389 SER n 
1 390 GLY n 
1 391 LEU n 
1 392 PRO n 
1 393 GLN n 
1 394 ALA n 
1 395 ALA n 
1 396 LEU n 
1 397 ASN n 
1 398 TYR n 
1 399 ILE n 
1 400 LYS n 
1 401 ARG n 
1 402 ILE n 
1 403 GLU n 
1 404 GLU n 
1 405 LEU n 
1 406 THR n 
1 407 GLY n 
1 408 VAL n 
1 409 PRO n 
1 410 ILE n 
1 411 ASP n 
1 412 ILE n 
1 413 ILE n 
1 414 SER n 
1 415 THR n 
1 416 GLY n 
1 417 PRO n 
1 418 ASP n 
1 419 ARG n 
1 420 THR n 
1 421 GLU n 
1 422 THR n 
1 423 MET n 
1 424 ILE n 
1 425 LEU n 
1 426 ARG n 
1 427 ASP n 
1 428 PRO n 
1 429 PHE n 
1 430 ASP n 
1 431 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      562 
_entity_src_nat.genus                      Escherichia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'PUR A STRAIN H1238 (A GIFT FROM DR. B. BACHMAN (GENETIC CENTER, YALE UNIVERSITY))' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  'COLI GENETIC STOCK CENTER, STRAIN NUMBER 5408' 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PURA_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P0A7D4 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALM
KEMKELEDRGIPVRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEK
LKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTS
SNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQ
LNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGREVTTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIK
RIEELTGVPIDIISTGPDRTETMILRDPFDA
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ADI A 1 ? 431 ? P0A7D4 1 ? 431 ? 1 431 
2 1 1ADI B 1 ? 431 ? P0A7D4 1 ? 431 ? 1 431 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ADI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.17 
_exptl_crystal.density_percent_sol   43.34 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'SIEMENS-NICOLET X100' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ADI 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15. 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   104085 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99. 
_reflns.pdbx_Rmerge_I_obs            0.0600000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.24 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1ADI 
_refine.ls_number_reflns_obs                     27502 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             5. 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2060000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2060000 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;THERE ARE TWO REGIONS THAT ARE DISORDERED CONSISTING OF
RESIDUES 121 - 130 AND 298 - 303.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ADI 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9584 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1317 
_refine_hist.number_atoms_total               10901 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        5. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.70  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.8  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.64  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.989020 
_struct_ncs_oper.matrix[1][2]   0.013480 
_struct_ncs_oper.matrix[1][3]   -0.147170 
_struct_ncs_oper.matrix[2][1]   -0.038600 
_struct_ncs_oper.matrix[2][2]   -0.984820 
_struct_ncs_oper.matrix[2][3]   0.169230 
_struct_ncs_oper.matrix[3][1]   -0.142660 
_struct_ncs_oper.matrix[3][2]   0.173050 
_struct_ncs_oper.matrix[3][3]   0.974530 
_struct_ncs_oper.vector[1]      31.84475 
_struct_ncs_oper.vector[2]      89.01199 
_struct_ncs_oper.vector[3]      -5.32704 
# 
_struct.entry_id                  1ADI 
_struct.title                     'STRUCTURE OF ADENYLOSUCCINATE SYNTHETASE AT PH 6.5 AND 25 DEGREES CELSIUS' 
_struct.pdbx_descriptor           'ADENYLOSUCCINATE SYNTHETASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ADI 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'PURINE NUCLEOTIDE BIOSYNTHESIS, LIGASE, GTP-HYDROLYZING ENZYME' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  A1    LYS A 16  ? ARG A 26  ? LYS A 16  ARG A 26  1 ? 11 
HELX_P HELX_P2  "A1'" SER A 57  ? LEU A 60  ? SER A 57  LEU A 60  5 ? 4  
HELX_P HELX_P3  A2    PRO A 76  ? ASP A 88  ? PRO A 76  ASP A 88  1 ? 13 
HELX_P HELX_P4  "A2'" PRO A 92  ? ARG A 96  ? PRO A 92  ARG A 96  5 ? 5  
HELX_P HELX_P5  A3    ASP A 108 ? ALA A 120 ? ASP A 108 ALA A 120 1 ? 13 
HELX_P HELX_P6  A4    ILE A 133 ? ALA A 142 ? ILE A 133 ALA A 142 1 ? 10 
HELX_P HELX_P7  "A5'" VAL A 148 ? PHE A 152 ? VAL A 148 PHE A 152 5 ? 5  
HELX_P HELX_P8  A5    LYS A 154 ? TYR A 176 ? LYS A 154 TYR A 176 1 ? 23 
HELX_P HELX_P9  A6    TYR A 183 ? SER A 199 ? TYR A 183 SER A 199 1 ? 17 
HELX_P HELX_P10 A7    VAL A 204 ? GLN A 213 ? VAL A 204 GLN A 213 1 ? 10 
HELX_P HELX_P11 A8    ALA A 245 ? SER A 252 ? ALA A 245 SER A 252 1 ? 8  
HELX_P HELX_P12 A9    GLU A 285 ? GLN A 293 ? GLU A 285 GLN A 293 1 ? 9  
HELX_P HELX_P13 A10   THR A 312 ? ASN A 322 ? THR A 312 ASN A 322 1 ? 11 
HELX_P HELX_P14 "AT'" LEU A 332 ? LEU A 335 ? LEU A 332 LEU A 335 5 ? 4  
HELX_P HELX_P15 A11   GLN A 393 ? THR A 406 ? GLN A 393 THR A 406 1 ? 14 
HELX_P HELX_P16 B1    LYS B 16  ? ARG B 26  ? LYS B 16  ARG B 26  1 ? 11 
HELX_P HELX_P17 "B1'" SER B 57  ? LEU B 60  ? SER B 57  LEU B 60  5 ? 4  
HELX_P HELX_P18 B2    PRO B 76  ? ASP B 88  ? PRO B 76  ASP B 88  1 ? 13 
HELX_P HELX_P19 "B2'" PRO B 92  ? ARG B 96  ? PRO B 92  ARG B 96  5 ? 5  
HELX_P HELX_P20 B3    ASP B 108 ? ALA B 120 ? ASP B 108 ALA B 120 1 ? 13 
HELX_P HELX_P21 B4    ILE B 133 ? ALA B 142 ? ILE B 133 ALA B 142 1 ? 10 
HELX_P HELX_P22 "B5'" VAL B 148 ? PHE B 152 ? VAL B 148 PHE B 152 5 ? 5  
HELX_P HELX_P23 B5    LYS B 154 ? TYR B 176 ? LYS B 154 TYR B 176 1 ? 23 
HELX_P HELX_P24 B6    TYR B 183 ? SER B 199 ? TYR B 183 SER B 199 1 ? 17 
HELX_P HELX_P25 B7    VAL B 204 ? GLN B 213 ? VAL B 204 GLN B 213 1 ? 10 
HELX_P HELX_P26 B8    ALA B 245 ? SER B 252 ? ALA B 245 SER B 252 1 ? 8  
HELX_P HELX_P27 B9    GLU B 285 ? GLN B 293 ? GLU B 285 GLN B 293 1 ? 9  
HELX_P HELX_P28 B10   THR B 312 ? ASN B 322 ? THR B 312 ASN B 322 1 ? 11 
HELX_P HELX_P29 "BT'" LEU B 332 ? LEU B 335 ? LEU B 332 LEU B 335 5 ? 4  
HELX_P HELX_P30 B11   GLN B 393 ? THR B 406 ? GLN B 393 THR B 406 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 235 A . ? TYR 235 A PRO 236 A ? PRO 236 A 1 -1.38 
2 TYR 235 B . ? TYR 235 B PRO 236 B ? PRO 236 B 1 -1.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A1 ? 10 ? 
A2 ? 2  ? 
A3 ? 2  ? 
A4 ? 3  ? 
B1 ? 10 ? 
B2 ? 2  ? 
B3 ? 2  ? 
B4 ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A1 1 2  ? parallel      
A1 2 3  ? parallel      
A1 3 4  ? parallel      
A1 4 5  ? parallel      
A1 5 6  ? parallel      
A1 6 7  ? parallel      
A1 7 8  ? parallel      
A1 8 9  ? parallel      
A1 9 10 ? anti-parallel 
A2 1 2  ? anti-parallel 
A3 1 2  ? anti-parallel 
A4 1 2  ? anti-parallel 
A4 2 3  ? anti-parallel 
B1 1 2  ? parallel      
B1 2 3  ? parallel      
B1 3 4  ? parallel      
B1 4 5  ? parallel      
B1 5 6  ? parallel      
B1 6 7  ? parallel      
B1 7 8  ? parallel      
B1 8 9  ? parallel      
B1 9 10 ? anti-parallel 
B2 1 2  ? anti-parallel 
B3 1 2  ? anti-parallel 
B4 1 2  ? anti-parallel 
B4 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A1 1  MET A 200 ? VAL A 202 ? MET A 200 VAL A 202 
A1 2  LEU A 97  ? LEU A 99  ? LEU A 97  LEU A 99  
A1 3  THR A 65  ? GLY A 69  ? THR A 65  GLY A 69  
A1 4  LYS A 28  ? ARG A 32  ? LYS A 28  ARG A 32  
A1 5  PHE A 217 ? GLY A 222 ? PHE A 217 GLY A 222 
A1 6  ASN A 2   ? LEU A 7   ? ASN A 2   LEU A 7   
A1 7  TYR A 261 ? ALA A 268 ? TYR A 261 ALA A 268 
A1 8  SER A 325 ? THR A 330 ? SER A 325 THR A 330 
A1 9  ASP A 411 ? ILE A 413 ? ASP A 411 ILE A 413 
A1 10 MET A 423 ? LEU A 425 ? MET A 423 LEU A 425 
A2 1  ALA A 39  ? ILE A 45  ? ALA A 39  ILE A 45  
A2 2  GLU A 48  ? HIS A 53  ? GLU A 48  HIS A 53  
A3 1  ARG A 306 ? GLY A 308 ? ARG A 306 GLY A 308 
A3 2  SER A 270 ? ARG A 272 ? SER A 270 ARG A 272 
A4 1  GLU A 369 ? TRP A 378 ? GLU A 369 TRP A 378 
A4 2  GLY A 337 ? MET A 349 ? GLY A 337 MET A 349 
A4 3  GLU A 354 ? VAL A 355 ? GLU A 354 VAL A 355 
B1 1  MET B 200 ? VAL B 202 ? MET B 200 VAL B 202 
B1 2  LEU B 97  ? LEU B 99  ? LEU B 97  LEU B 99  
B1 3  THR B 65  ? GLY B 69  ? THR B 65  GLY B 69  
B1 4  LYS B 28  ? ARG B 32  ? LYS B 28  ARG B 32  
B1 5  PHE B 217 ? GLY B 222 ? PHE B 217 GLY B 222 
B1 6  ASN B 2   ? LEU B 7   ? ASN B 2   LEU B 7   
B1 7  TYR B 261 ? ALA B 268 ? TYR B 261 ALA B 268 
B1 8  SER B 325 ? THR B 330 ? SER B 325 THR B 330 
B1 9  ASP B 411 ? ILE B 413 ? ASP B 411 ILE B 413 
B1 10 MET B 423 ? LEU B 425 ? MET B 423 LEU B 425 
B2 1  ALA B 39  ? ILE B 45  ? ALA B 39  ILE B 45  
B2 2  GLU B 48  ? HIS B 53  ? GLU B 48  HIS B 53  
B3 1  ARG B 306 ? GLY B 308 ? ARG B 306 GLY B 308 
B3 2  SER B 270 ? ARG B 272 ? SER B 270 ARG B 272 
B4 1  GLU B 369 ? TRP B 378 ? GLU B 369 TRP B 378 
B4 2  GLY B 337 ? MET B 349 ? GLY B 337 MET B 349 
B4 3  GLU B 354 ? VAL B 355 ? GLU B 354 VAL B 355 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A1 1 2  N VAL A 202 ? N VAL A 202 O LEU A 99  ? O LEU A 99  
A1 2 3  N LEU A 98  ? N LEU A 98  O SER A 66  ? O SER A 66  
A1 3 4  N ILE A 67  ? N ILE A 67  O VAL A 30  ? O VAL A 30  
A1 4 5  N VAL A 31  ? N VAL A 31  O MET A 219 ? O MET A 219 
A1 5 6  O VAL A 218 ? O VAL A 218 N VAL A 4   ? N VAL A 4   
A1 6 7  O VAL A 5   ? O VAL A 5   N LEU A 263 ? N LEU A 263 
A1 7 8  O GLY A 264 ? O GLY A 264 N CYS A 328 ? N CYS A 328 
A1 8 9  N LEU A 329 ? N LEU A 329 O ILE A 412 ? O ILE A 412 
A1 9 10 N ILE A 413 ? N ILE A 413 O MET A 423 ? O MET A 423 
A2 1 2  O HIS A 41  ? O HIS A 41  N LEU A 52  ? N LEU A 52  
A3 1 2  N GLY A 308 ? N GLY A 308 O SER A 270 ? O SER A 270 
A4 1 2  N ILE A 371 ? N ILE A 371 O ALA A 346 ? O ALA A 346 
A4 2 3  O TYR A 347 ? O TYR A 347 N VAL A 355 ? N VAL A 355 
B1 1 2  N VAL B 202 ? N VAL B 202 O LEU B 99  ? O LEU B 99  
B1 2 3  N LEU B 98  ? N LEU B 98  O SER B 66  ? O SER B 66  
B1 3 4  N ILE B 67  ? N ILE B 67  O VAL B 30  ? O VAL B 30  
B1 4 5  N VAL B 31  ? N VAL B 31  O MET B 219 ? O MET B 219 
B1 5 6  O VAL B 218 ? O VAL B 218 N VAL B 4   ? N VAL B 4   
B1 6 7  O VAL B 5   ? O VAL B 5   N LEU B 263 ? N LEU B 263 
B1 7 8  O GLY B 264 ? O GLY B 264 N CYS B 328 ? N CYS B 328 
B1 8 9  N LEU B 329 ? N LEU B 329 O ILE B 412 ? O ILE B 412 
B1 9 10 N ILE B 413 ? N ILE B 413 O MET B 423 ? O MET B 423 
B2 1 2  O HIS B 41  ? O HIS B 41  N LEU B 52  ? N LEU B 52  
B3 1 2  N GLY B 308 ? N GLY B 308 O SER B 270 ? O SER B 270 
B4 1 2  N ILE B 371 ? N ILE B 371 O ALA B 346 ? O ALA B 346 
B4 2 3  O TYR B 347 ? O TYR B 347 N VAL B 355 ? N VAL B 355 
# 
_database_PDB_matrix.entry_id          1ADI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ADI 
_atom_sites.fract_transf_matrix[1][1]   0.013620 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010680 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008370 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLY A 1 1   ? 25.282  51.459 2.068   1.00 14.45 ? 1   GLY A N    1 
ATOM   2    C CA   . GLY A 1 1   ? 25.121  50.219 1.355   1.00 17.17 ? 1   GLY A CA   1 
ATOM   3    C C    . GLY A 1 1   ? 26.464  49.969 0.719   1.00 18.79 ? 1   GLY A C    1 
ATOM   4    O O    . GLY A 1 1   ? 27.153  50.948 0.309   1.00 18.40 ? 1   GLY A O    1 
ATOM   5    H H1   . GLY A 1 1   ? 26.109  51.402 2.701   1.00 0.00  ? 1   GLY A H1   1 
ATOM   6    H H2   . GLY A 1 1   ? 25.421  52.250 1.412   1.00 0.00  ? 1   GLY A H2   1 
ATOM   7    H H3   . GLY A 1 1   ? 24.429  51.722 2.666   1.00 0.00  ? 1   GLY A H3   1 
ATOM   8    N N    . ASN A 1 2   ? 26.896  48.697 0.740   1.00 19.75 ? 2   ASN A N    1 
ATOM   9    C CA   . ASN A 1 2   ? 28.178  48.333 0.142   1.00 17.82 ? 2   ASN A CA   1 
ATOM   10   C C    . ASN A 1 2   ? 28.033  48.319 -1.367  1.00 16.97 ? 2   ASN A C    1 
ATOM   11   O O    . ASN A 1 2   ? 29.007  48.554 -2.055  1.00 15.66 ? 2   ASN A O    1 
ATOM   12   C CB   . ASN A 1 2   ? 28.688  46.961 0.590   1.00 17.10 ? 2   ASN A CB   1 
ATOM   13   C CG   . ASN A 1 2   ? 28.624  46.764 2.073   1.00 20.97 ? 2   ASN A CG   1 
ATOM   14   O OD1  . ASN A 1 2   ? 27.576  46.403 2.598   1.00 24.96 ? 2   ASN A OD1  1 
ATOM   15   N ND2  . ASN A 1 2   ? 29.756  46.909 2.759   1.00 21.41 ? 2   ASN A ND2  1 
ATOM   16   H H    . ASN A 1 2   ? 26.341  48.001 1.156   1.00 0.00  ? 2   ASN A H    1 
ATOM   17   H HD21 . ASN A 1 2   ? 29.752  46.834 3.737   1.00 0.00  ? 2   ASN A HD21 1 
ATOM   18   H HD22 . ASN A 1 2   ? 30.574  47.096 2.260   1.00 0.00  ? 2   ASN A HD22 1 
ATOM   19   N N    . ASN A 1 3   ? 26.849  47.958 -1.875  1.00 14.94 ? 3   ASN A N    1 
ATOM   20   C CA   . ASN A 1 3   ? 26.624  47.923 -3.315  1.00 10.95 ? 3   ASN A CA   1 
ATOM   21   C C    . ASN A 1 3   ? 25.865  49.163 -3.755  1.00 11.97 ? 3   ASN A C    1 
ATOM   22   O O    . ASN A 1 3   ? 24.652  49.298 -3.534  1.00 14.71 ? 3   ASN A O    1 
ATOM   23   C CB   . ASN A 1 3   ? 25.833  46.706 -3.723  1.00 9.29  ? 3   ASN A CB   1 
ATOM   24   C CG   . ASN A 1 3   ? 26.531  45.407 -3.378  1.00 13.70 ? 3   ASN A CG   1 
ATOM   25   O OD1  . ASN A 1 3   ? 27.682  45.201 -3.737  1.00 18.94 ? 3   ASN A OD1  1 
ATOM   26   N ND2  . ASN A 1 3   ? 25.804  44.491 -2.729  1.00 18.50 ? 3   ASN A ND2  1 
ATOM   27   H H    . ASN A 1 3   ? 26.107  47.638 -1.317  1.00 0.00  ? 3   ASN A H    1 
ATOM   28   H HD21 . ASN A 1 3   ? 26.236  43.664 -2.453  1.00 0.00  ? 3   ASN A HD21 1 
ATOM   29   H HD22 . ASN A 1 3   ? 24.852  44.714 -2.564  1.00 0.00  ? 3   ASN A HD22 1 
ATOM   30   N N    . VAL A 1 4   ? 26.561  50.028 -4.465  1.00 12.05 ? 4   VAL A N    1 
ATOM   31   C CA   . VAL A 1 4   ? 25.973  51.262 -4.907  1.00 12.38 ? 4   VAL A CA   1 
ATOM   32   C C    . VAL A 1 4   ? 25.894  51.319 -6.428  1.00 10.57 ? 4   VAL A C    1 
ATOM   33   O O    . VAL A 1 4   ? 26.801  50.834 -7.123  1.00 9.70  ? 4   VAL A O    1 
ATOM   34   C CB   . VAL A 1 4   ? 26.806  52.457 -4.313  1.00 13.51 ? 4   VAL A CB   1 
ATOM   35   C CG1  . VAL A 1 4   ? 26.306  53.788 -4.815  1.00 16.22 ? 4   VAL A CG1  1 
ATOM   36   C CG2  . VAL A 1 4   ? 26.731  52.438 -2.807  1.00 13.60 ? 4   VAL A CG2  1 
ATOM   37   H H    . VAL A 1 4   ? 27.495  49.811 -4.702  1.00 0.00  ? 4   VAL A H    1 
ATOM   38   N N    . VAL A 1 5   ? 24.753  51.788 -6.929  1.00 10.43 ? 5   VAL A N    1 
ATOM   39   C CA   . VAL A 1 5   ? 24.526  51.974 -8.367  1.00 8.25  ? 5   VAL A CA   1 
ATOM   40   C C    . VAL A 1 5   ? 24.400  53.482 -8.602  1.00 9.34  ? 5   VAL A C    1 
ATOM   41   O O    . VAL A 1 5   ? 23.481  54.132 -8.055  1.00 9.85  ? 5   VAL A O    1 
ATOM   42   C CB   . VAL A 1 5   ? 23.203  51.344 -8.901  1.00 5.20  ? 5   VAL A CB   1 
ATOM   43   C CG1  . VAL A 1 5   ? 22.888  51.874 -10.310 1.00 5.01  ? 5   VAL A CG1  1 
ATOM   44   C CG2  . VAL A 1 5   ? 23.332  49.857 -8.989  1.00 5.01  ? 5   VAL A CG2  1 
ATOM   45   H H    . VAL A 1 5   ? 24.043  52.001 -6.279  1.00 0.00  ? 5   VAL A H    1 
ATOM   46   N N    . VAL A 1 6   ? 25.293  54.006 -9.441  1.00 9.27  ? 6   VAL A N    1 
ATOM   47   C CA   . VAL A 1 6   ? 25.289  55.414 -9.800  1.00 12.56 ? 6   VAL A CA   1 
ATOM   48   C C    . VAL A 1 6   ? 24.684  55.624 -11.195 1.00 15.49 ? 6   VAL A C    1 
ATOM   49   O O    . VAL A 1 6   ? 25.113  55.004 -12.191 1.00 18.61 ? 6   VAL A O    1 
ATOM   50   C CB   . VAL A 1 6   ? 26.736  55.984 -9.768  1.00 13.18 ? 6   VAL A CB   1 
ATOM   51   C CG1  . VAL A 1 6   ? 26.734  57.523 -9.948  1.00 12.02 ? 6   VAL A CG1  1 
ATOM   52   C CG2  . VAL A 1 6   ? 27.370  55.629 -8.455  1.00 16.66 ? 6   VAL A CG2  1 
ATOM   53   H H    . VAL A 1 6   ? 25.960  53.414 -9.872  1.00 0.00  ? 6   VAL A H    1 
ATOM   54   N N    . LEU A 1 7   ? 23.645  56.437 -11.275 1.00 14.41 ? 7   LEU A N    1 
ATOM   55   C CA   . LEU A 1 7   ? 23.075  56.705 -12.582 1.00 14.85 ? 7   LEU A CA   1 
ATOM   56   C C    . LEU A 1 7   ? 22.257  57.972 -12.620 1.00 15.19 ? 7   LEU A C    1 
ATOM   57   O O    . LEU A 1 7   ? 21.802  58.439 -11.586 1.00 15.75 ? 7   LEU A O    1 
ATOM   58   C CB   . LEU A 1 7   ? 22.252  55.526 -13.105 1.00 17.52 ? 7   LEU A CB   1 
ATOM   59   C CG   . LEU A 1 7   ? 20.819  55.312 -12.636 1.00 17.71 ? 7   LEU A CG   1 
ATOM   60   C CD1  . LEU A 1 7   ? 20.387  54.029 -13.302 1.00 15.98 ? 7   LEU A CD1  1 
ATOM   61   C CD2  . LEU A 1 7   ? 20.705  55.229 -11.095 1.00 18.48 ? 7   LEU A CD2  1 
ATOM   62   H H    . LEU A 1 7   ? 23.228  56.837 -10.477 1.00 0.00  ? 7   LEU A H    1 
ATOM   63   N N    . GLY A 1 8   ? 22.070  58.480 -13.842 1.00 15.48 ? 8   GLY A N    1 
ATOM   64   C CA   . GLY A 1 8   ? 21.345  59.700 -14.117 1.00 12.16 ? 8   GLY A CA   1 
ATOM   65   C C    . GLY A 1 8   ? 19.865  59.471 -14.293 1.00 14.99 ? 8   GLY A C    1 
ATOM   66   O O    . GLY A 1 8   ? 19.422  58.545 -14.974 1.00 16.22 ? 8   GLY A O    1 
ATOM   67   H H    . GLY A 1 8   ? 22.409  57.969 -14.605 1.00 0.00  ? 8   GLY A H    1 
ATOM   68   N N    . THR A 1 9   ? 19.087  60.401 -13.786 1.00 15.96 ? 9   THR A N    1 
ATOM   69   C CA   . THR A 1 9   ? 17.648  60.273 -13.827 1.00 16.46 ? 9   THR A CA   1 
ATOM   70   C C    . THR A 1 9   ? 16.883  61.037 -14.878 1.00 14.95 ? 9   THR A C    1 
ATOM   71   O O    . THR A 1 9   ? 15.688  60.982 -14.863 1.00 12.05 ? 9   THR A O    1 
ATOM   72   C CB   . THR A 1 9   ? 17.098  60.674 -12.492 1.00 18.04 ? 9   THR A CB   1 
ATOM   73   O OG1  . THR A 1 9   ? 17.518  62.019 -12.219 1.00 17.05 ? 9   THR A OG1  1 
ATOM   74   C CG2  . THR A 1 9   ? 17.642  59.710 -11.378 1.00 18.89 ? 9   THR A CG2  1 
ATOM   75   H H    . THR A 1 9   ? 19.467  61.202 -13.347 1.00 0.00  ? 9   THR A H    1 
ATOM   76   H HG1  . THR A 1 9   ? 16.954  62.637 -12.693 1.00 0.00  ? 9   THR A HG1  1 
ATOM   77   N N    . GLN A 1 10  ? 17.548  61.706 -15.814 1.00 17.97 ? 10  GLN A N    1 
ATOM   78   C CA   . GLN A 1 10  ? 16.861  62.478 -16.852 1.00 15.42 ? 10  GLN A CA   1 
ATOM   79   C C    . GLN A 1 10  ? 17.132  61.977 -18.267 1.00 15.99 ? 10  GLN A C    1 
ATOM   80   O O    . GLN A 1 10  ? 16.746  60.852 -18.589 1.00 15.06 ? 10  GLN A O    1 
ATOM   81   C CB   . GLN A 1 10  ? 17.220  63.974 -16.687 1.00 18.52 ? 10  GLN A CB   1 
ATOM   82   C CG   . GLN A 1 10  ? 16.492  64.651 -15.502 1.00 19.65 ? 10  GLN A CG   1 
ATOM   83   C CD   . GLN A 1 10  ? 17.229  65.827 -14.898 1.00 20.80 ? 10  GLN A CD   1 
ATOM   84   O OE1  . GLN A 1 10  ? 18.350  65.684 -14.397 1.00 21.76 ? 10  GLN A OE1  1 
ATOM   85   N NE2  . GLN A 1 10  ? 16.574  66.994 -14.875 1.00 23.04 ? 10  GLN A NE2  1 
ATOM   86   H H    . GLN A 1 10  ? 18.529  61.679 -15.828 1.00 0.00  ? 10  GLN A H    1 
ATOM   87   H HE21 . GLN A 1 10  ? 17.023  67.746 -14.433 1.00 0.00  ? 10  GLN A HE21 1 
ATOM   88   H HE22 . GLN A 1 10  ? 15.673  67.033 -15.267 1.00 0.00  ? 10  GLN A HE22 1 
ATOM   89   N N    . TRP A 1 11  ? 17.780  62.798 -19.108 1.00 17.65 ? 11  TRP A N    1 
ATOM   90   C CA   . TRP A 1 11  ? 18.109  62.458 -20.503 1.00 19.16 ? 11  TRP A CA   1 
ATOM   91   C C    . TRP A 1 11  ? 19.623  62.614 -20.734 1.00 22.31 ? 11  TRP A C    1 
ATOM   92   O O    . TRP A 1 11  ? 20.056  62.901 -21.841 1.00 26.54 ? 11  TRP A O    1 
ATOM   93   C CB   . TRP A 1 11  ? 17.408  63.406 -21.496 1.00 18.89 ? 11  TRP A CB   1 
ATOM   94   C CG   . TRP A 1 11  ? 15.889  63.378 -21.584 1.00 14.92 ? 11  TRP A CG   1 
ATOM   95   C CD1  . TRP A 1 11  ? 15.141  62.527 -22.340 1.00 16.06 ? 11  TRP A CD1  1 
ATOM   96   C CD2  . TRP A 1 11  ? 14.950  64.250 -20.922 1.00 13.53 ? 11  TRP A CD2  1 
ATOM   97   N NE1  . TRP A 1 11  ? 13.794  62.802 -22.186 1.00 17.95 ? 11  TRP A NE1  1 
ATOM   98   C CE2  . TRP A 1 11  ? 13.653  63.856 -21.322 1.00 16.84 ? 11  TRP A CE2  1 
ATOM   99   C CE3  . TRP A 1 11  ? 15.076  65.313 -20.036 1.00 14.07 ? 11  TRP A CE3  1 
ATOM   100  C CZ2  . TRP A 1 11  ? 12.490  64.499 -20.869 1.00 16.84 ? 11  TRP A CZ2  1 
ATOM   101  C CZ3  . TRP A 1 11  ? 13.905  65.954 -19.577 1.00 18.81 ? 11  TRP A CZ3  1 
ATOM   102  C CH2  . TRP A 1 11  ? 12.635  65.540 -20.001 1.00 15.30 ? 11  TRP A CH2  1 
ATOM   103  H H    . TRP A 1 11  ? 18.101  63.685 -18.835 1.00 0.00  ? 11  TRP A H    1 
ATOM   104  H HE1  . TRP A 1 11  ? 13.078  62.265 -22.584 1.00 0.00  ? 11  TRP A HE1  1 
ATOM   105  N N    . GLY A 1 12  ? 20.440  62.412 -19.708 1.00 21.84 ? 12  GLY A N    1 
ATOM   106  C CA   . GLY A 1 12  ? 21.878  62.581 -19.869 1.00 17.67 ? 12  GLY A CA   1 
ATOM   107  C C    . GLY A 1 12  ? 22.299  63.949 -19.394 1.00 17.28 ? 12  GLY A C    1 
ATOM   108  O O    . GLY A 1 12  ? 21.464  64.703 -18.859 1.00 18.34 ? 12  GLY A O    1 
ATOM   109  H H    . GLY A 1 12  ? 20.113  62.183 -18.812 1.00 0.00  ? 12  GLY A H    1 
ATOM   110  N N    . ASP A 1 13  ? 23.588  64.257 -19.484 1.00 16.16 ? 13  ASP A N    1 
ATOM   111  C CA   . ASP A 1 13  ? 24.076  65.593 -19.102 1.00 19.20 ? 13  ASP A CA   1 
ATOM   112  C C    . ASP A 1 13  ? 23.832  65.990 -17.668 1.00 18.29 ? 13  ASP A C    1 
ATOM   113  O O    . ASP A 1 13  ? 23.980  67.161 -17.325 1.00 20.74 ? 13  ASP A O    1 
ATOM   114  C CB   . ASP A 1 13  ? 23.396  66.689 -19.941 1.00 24.42 ? 13  ASP A CB   1 
ATOM   115  C CG   . ASP A 1 13  ? 23.763  66.642 -21.415 1.00 30.34 ? 13  ASP A CG   1 
ATOM   116  O OD1  . ASP A 1 13  ? 24.911  66.235 -21.764 1.00 30.11 ? 13  ASP A OD1  1 
ATOM   117  O OD2  . ASP A 1 13  ? 22.874  67.042 -22.225 1.00 35.15 ? 13  ASP A OD2  1 
ATOM   118  H H    . ASP A 1 13  ? 24.210  63.597 -19.824 1.00 0.00  ? 13  ASP A H    1 
ATOM   119  N N    . GLU A 1 14  ? 23.389  65.068 -16.829 1.00 17.78 ? 14  GLU A N    1 
ATOM   120  C CA   . GLU A 1 14  ? 23.144  65.411 -15.440 1.00 16.81 ? 14  GLU A CA   1 
ATOM   121  C C    . GLU A 1 14  ? 24.483  65.777 -14.756 1.00 18.00 ? 14  GLU A C    1 
ATOM   122  O O    . GLU A 1 14  ? 24.528  66.475 -13.753 1.00 16.95 ? 14  GLU A O    1 
ATOM   123  C CB   . GLU A 1 14  ? 22.431  64.238 -14.744 1.00 14.23 ? 14  GLU A CB   1 
ATOM   124  C CG   . GLU A 1 14  ? 21.165  63.672 -15.467 1.00 10.29 ? 14  GLU A CG   1 
ATOM   125  C CD   . GLU A 1 14  ? 21.474  62.524 -16.471 1.00 13.60 ? 14  GLU A CD   1 
ATOM   126  O OE1  . GLU A 1 14  ? 22.649  62.414 -16.841 1.00 9.61  ? 14  GLU A OE1  1 
ATOM   127  O OE2  . GLU A 1 14  ? 20.559  61.737 -16.910 1.00 11.03 ? 14  GLU A OE2  1 
ATOM   128  H H    . GLU A 1 14  ? 23.170  64.170 -17.154 1.00 0.00  ? 14  GLU A H    1 
ATOM   129  N N    . GLY A 1 15  ? 25.583  65.343 -15.361 1.00 22.65 ? 15  GLY A N    1 
ATOM   130  C CA   . GLY A 1 15  ? 26.898  65.597 -14.811 1.00 21.67 ? 15  GLY A CA   1 
ATOM   131  C C    . GLY A 1 15  ? 27.149  64.593 -13.706 1.00 22.61 ? 15  GLY A C    1 
ATOM   132  O O    . GLY A 1 15  ? 27.089  64.922 -12.516 1.00 23.80 ? 15  GLY A O    1 
ATOM   133  H H    . GLY A 1 15  ? 25.507  64.819 -16.176 1.00 0.00  ? 15  GLY A H    1 
ATOM   134  N N    A LYS A 1 16  ? 27.356  63.342 -14.098 0.50 22.68 ? 16  LYS A N    1 
ATOM   135  N N    B LYS A 1 16  ? 27.359  63.337 -14.080 0.50 23.28 ? 16  LYS A N    1 
ATOM   136  C CA   A LYS A 1 16  ? 27.616  62.275 -13.136 0.50 23.20 ? 16  LYS A CA   1 
ATOM   137  C CA   B LYS A 1 16  ? 27.626  62.309 -13.078 0.50 24.32 ? 16  LYS A CA   1 
ATOM   138  C C    A LYS A 1 16  ? 29.112  62.109 -12.832 0.50 23.11 ? 16  LYS A C    1 
ATOM   139  C C    B LYS A 1 16  ? 29.123  62.169 -12.786 0.50 23.95 ? 16  LYS A C    1 
ATOM   140  O O    A LYS A 1 16  ? 29.482  61.546 -11.794 0.50 22.30 ? 16  LYS A O    1 
ATOM   141  O O    B LYS A 1 16  ? 29.506  61.663 -11.725 0.50 23.34 ? 16  LYS A O    1 
ATOM   142  C CB   A LYS A 1 16  ? 26.985  60.946 -13.621 0.50 22.60 ? 16  LYS A CB   1 
ATOM   143  C CB   B LYS A 1 16  ? 27.023  60.949 -13.495 0.50 24.79 ? 16  LYS A CB   1 
ATOM   144  C CG   A LYS A 1 16  ? 27.143  60.674 -15.129 0.50 21.42 ? 16  LYS A CG   1 
ATOM   145  C CG   B LYS A 1 16  ? 27.457  60.452 -14.877 0.50 25.40 ? 16  LYS A CG   1 
ATOM   146  C CD   A LYS A 1 16  ? 26.257  59.529 -15.593 0.50 20.26 ? 16  LYS A CD   1 
ATOM   147  C CD   B LYS A 1 16  ? 26.959  59.048 -15.136 0.50 24.47 ? 16  LYS A CD   1 
ATOM   148  C CE   A LYS A 1 16  ? 25.964  59.597 -17.095 0.50 20.23 ? 16  LYS A CE   1 
ATOM   149  C CE   B LYS A 1 16  ? 26.979  58.712 -16.623 0.50 25.35 ? 16  LYS A CE   1 
ATOM   150  N NZ   A LYS A 1 16  ? 24.999  60.676 -17.504 0.50 16.01 ? 16  LYS A NZ   1 
ATOM   151  N NZ   B LYS A 1 16  ? 28.290  58.249 -17.155 0.50 24.09 ? 16  LYS A NZ   1 
ATOM   152  H H    A LYS A 1 16  ? 27.301  63.143 -15.053 0.50 0.00  ? 16  LYS A H    1 
ATOM   153  H H    B LYS A 1 16  ? 27.270  63.098 -15.028 0.50 0.00  ? 16  LYS A H    1 
ATOM   154  H HZ1  A LYS A 1 16  ? 25.354  61.574 -17.115 0.50 0.00  ? 16  LYS A HZ1  1 
ATOM   155  H HZ1  B LYS A 1 16  ? 28.970  59.021 -16.989 0.50 0.00  ? 16  LYS A HZ1  1 
ATOM   156  H HZ2  A LYS A 1 16  ? 24.919  60.741 -18.535 0.50 0.00  ? 16  LYS A HZ2  1 
ATOM   157  H HZ2  B LYS A 1 16  ? 28.560  57.386 -16.639 0.50 0.00  ? 16  LYS A HZ2  1 
ATOM   158  H HZ3  A LYS A 1 16  ? 24.068  60.522 -17.075 0.50 0.00  ? 16  LYS A HZ3  1 
ATOM   159  H HZ3  B LYS A 1 16  ? 28.200  58.064 -18.173 0.50 0.00  ? 16  LYS A HZ3  1 
ATOM   160  N N    . GLY A 1 17  ? 29.949  62.672 -13.706 1.00 23.99 ? 17  GLY A N    1 
ATOM   161  C CA   . GLY A 1 17  ? 31.408  62.578 -13.591 1.00 22.67 ? 17  GLY A CA   1 
ATOM   162  C C    . GLY A 1 17  ? 32.110  62.900 -12.288 1.00 20.22 ? 17  GLY A C    1 
ATOM   163  O O    . GLY A 1 17  ? 32.845  62.072 -11.727 1.00 17.45 ? 17  GLY A O    1 
ATOM   164  H H    . GLY A 1 17  ? 29.567  63.153 -14.459 1.00 0.00  ? 17  GLY A H    1 
ATOM   165  N N    . LYS A 1 18  ? 31.890  64.110 -11.797 1.00 20.30 ? 18  LYS A N    1 
ATOM   166  C CA   . LYS A 1 18  ? 32.514  64.523 -10.566 1.00 19.75 ? 18  LYS A CA   1 
ATOM   167  C C    . LYS A 1 18  ? 32.077  63.565 -9.458  1.00 23.03 ? 18  LYS A C    1 
ATOM   168  O O    . LYS A 1 18  ? 32.923  63.029 -8.714  1.00 22.64 ? 18  LYS A O    1 
ATOM   169  C CB   . LYS A 1 18  ? 32.122  65.969 -10.231 1.00 16.40 ? 18  LYS A CB   1 
ATOM   170  C CG   . LYS A 1 18  ? 32.687  66.475 -8.879  1.00 16.16 ? 18  LYS A CG   1 
ATOM   171  C CD   . LYS A 1 18  ? 32.033  67.771 -8.449  1.00 13.40 ? 18  LYS A CD   1 
ATOM   172  C CE   . LYS A 1 18  ? 32.104  67.872 -6.949  1.00 14.28 ? 18  LYS A CE   1 
ATOM   173  N NZ   . LYS A 1 18  ? 31.055  68.732 -6.366  1.00 14.32 ? 18  LYS A NZ   1 
ATOM   174  H H    . LYS A 1 18  ? 31.301  64.741 -12.269 1.00 0.00  ? 18  LYS A H    1 
ATOM   175  H HZ1  . LYS A 1 18  ? 30.115  68.598 -6.811  1.00 0.00  ? 18  LYS A HZ1  1 
ATOM   176  H HZ2  . LYS A 1 18  ? 31.073  68.519 -5.342  1.00 0.00  ? 18  LYS A HZ2  1 
ATOM   177  H HZ3  . LYS A 1 18  ? 31.403  69.693 -6.546  1.00 0.00  ? 18  LYS A HZ3  1 
ATOM   178  N N    . ILE A 1 19  ? 30.757  63.354 -9.338  1.00 23.00 ? 19  ILE A N    1 
ATOM   179  C CA   . ILE A 1 19  ? 30.254  62.446 -8.306  1.00 22.20 ? 19  ILE A CA   1 
ATOM   180  C C    . ILE A 1 19  ? 30.873  61.028 -8.412  1.00 22.18 ? 19  ILE A C    1 
ATOM   181  O O    . ILE A 1 19  ? 31.317  60.487 -7.408  1.00 23.28 ? 19  ILE A O    1 
ATOM   182  C CB   . ILE A 1 19  ? 28.690  62.312 -8.273  1.00 20.06 ? 19  ILE A CB   1 
ATOM   183  C CG1  . ILE A 1 19  ? 28.001  63.584 -7.708  1.00 18.50 ? 19  ILE A CG1  1 
ATOM   184  C CG2  . ILE A 1 19  ? 28.343  61.190 -7.341  1.00 11.17 ? 19  ILE A CG2  1 
ATOM   185  C CD1  . ILE A 1 19  ? 27.376  64.511 -8.750  1.00 11.78 ? 19  ILE A CD1  1 
ATOM   186  H H    . ILE A 1 19  ? 30.129  63.793 -9.943  1.00 0.00  ? 19  ILE A H    1 
ATOM   187  N N    . VAL A 1 20  ? 30.859  60.438 -9.614  1.00 22.61 ? 20  VAL A N    1 
ATOM   188  C CA   . VAL A 1 20  ? 31.426  59.092 -9.846  1.00 21.34 ? 20  VAL A CA   1 
ATOM   189  C C    . VAL A 1 20  ? 32.876  59.061 -9.420  1.00 22.17 ? 20  VAL A C    1 
ATOM   190  O O    . VAL A 1 20  ? 33.310  58.076 -8.849  1.00 24.96 ? 20  VAL A O    1 
ATOM   191  C CB   . VAL A 1 20  ? 31.267  58.617 -11.335 1.00 18.95 ? 20  VAL A CB   1 
ATOM   192  C CG1  . VAL A 1 20  ? 32.254  57.574 -11.662 1.00 17.93 ? 20  VAL A CG1  1 
ATOM   193  C CG2  . VAL A 1 20  ? 29.861  58.092 -11.589 1.00 15.80 ? 20  VAL A CG2  1 
ATOM   194  H H    . VAL A 1 20  ? 30.400  60.895 -10.373 1.00 0.00  ? 20  VAL A H    1 
ATOM   195  N N    . ASP A 1 21  ? 33.633  60.126 -9.708  1.00 22.91 ? 21  ASP A N    1 
ATOM   196  C CA   . ASP A 1 21  ? 35.038  60.222 -9.285  1.00 21.67 ? 21  ASP A CA   1 
ATOM   197  C C    . ASP A 1 21  ? 35.178  60.249 -7.759  1.00 20.26 ? 21  ASP A C    1 
ATOM   198  O O    . ASP A 1 21  ? 36.100  59.676 -7.195  1.00 17.06 ? 21  ASP A O    1 
ATOM   199  C CB   . ASP A 1 21  ? 35.677  61.481 -9.853  1.00 23.43 ? 21  ASP A CB   1 
ATOM   200  C CG   . ASP A 1 21  ? 36.496  61.214 -11.097 1.00 27.63 ? 21  ASP A CG   1 
ATOM   201  O OD1  . ASP A 1 21  ? 36.235  60.201 -11.788 1.00 29.22 ? 21  ASP A OD1  1 
ATOM   202  O OD2  . ASP A 1 21  ? 37.405  62.022 -11.401 1.00 33.23 ? 21  ASP A OD2  1 
ATOM   203  H H    . ASP A 1 21  ? 33.265  60.850 -10.269 1.00 0.00  ? 21  ASP A H    1 
ATOM   204  N N    . LEU A 1 22  ? 34.257  60.914 -7.088  1.00 19.99 ? 22  LEU A N    1 
ATOM   205  C CA   . LEU A 1 22  ? 34.285  61.013 -5.634  1.00 21.22 ? 22  LEU A CA   1 
ATOM   206  C C    . LEU A 1 22  ? 34.030  59.698 -4.902  1.00 22.92 ? 22  LEU A C    1 
ATOM   207  O O    . LEU A 1 22  ? 34.810  59.319 -4.003  1.00 22.68 ? 22  LEU A O    1 
ATOM   208  C CB   . LEU A 1 22  ? 33.276  62.065 -5.182  1.00 24.64 ? 22  LEU A CB   1 
ATOM   209  C CG   . LEU A 1 22  ? 33.011  62.200 -3.696  1.00 29.28 ? 22  LEU A CG   1 
ATOM   210  C CD1  . LEU A 1 22  ? 34.233  62.860 -3.054  1.00 33.00 ? 22  LEU A CD1  1 
ATOM   211  C CD2  . LEU A 1 22  ? 31.715  62.996 -3.462  1.00 31.07 ? 22  LEU A CD2  1 
ATOM   212  H H    . LEU A 1 22  ? 33.591  61.419 -7.605  1.00 0.00  ? 22  LEU A H    1 
ATOM   213  N N    . LEU A 1 23  ? 32.928  59.023 -5.272  1.00 24.10 ? 23  LEU A N    1 
ATOM   214  C CA   . LEU A 1 23  ? 32.512  57.736 -4.683  1.00 25.26 ? 23  LEU A CA   1 
ATOM   215  C C    . LEU A 1 23  ? 33.606  56.662 -4.902  1.00 24.70 ? 23  LEU A C    1 
ATOM   216  O O    . LEU A 1 23  ? 33.890  55.845 -4.002  1.00 23.20 ? 23  LEU A O    1 
ATOM   217  C CB   . LEU A 1 23  ? 31.157  57.264 -5.274  1.00 24.71 ? 23  LEU A CB   1 
ATOM   218  C CG   . LEU A 1 23  ? 29.877  58.112 -5.105  1.00 24.12 ? 23  LEU A CG   1 
ATOM   219  C CD1  . LEU A 1 23  ? 28.791  57.609 -6.036  1.00 25.67 ? 23  LEU A CD1  1 
ATOM   220  C CD2  . LEU A 1 23  ? 29.340  58.149 -3.691  1.00 24.08 ? 23  LEU A CD2  1 
ATOM   221  H H    . LEU A 1 23  ? 32.375  59.443 -5.973  1.00 0.00  ? 23  LEU A H    1 
ATOM   222  N N    . THR A 1 24  ? 34.288  56.767 -6.045  1.00 27.22 ? 24  THR A N    1 
ATOM   223  C CA   . THR A 1 24  ? 35.376  55.869 -6.463  1.00 27.58 ? 24  THR A CA   1 
ATOM   224  C C    . THR A 1 24  ? 36.644  56.033 -5.577  1.00 28.78 ? 24  THR A C    1 
ATOM   225  O O    . THR A 1 24  ? 37.760  55.684 -5.951  1.00 29.97 ? 24  THR A O    1 
ATOM   226  C CB   . THR A 1 24  ? 35.658  56.144 -7.962  1.00 26.34 ? 24  THR A CB   1 
ATOM   227  O OG1  . THR A 1 24  ? 34.424  56.038 -8.676  1.00 26.21 ? 24  THR A OG1  1 
ATOM   228  C CG2  . THR A 1 24  ? 36.616  55.151 -8.586  1.00 28.53 ? 24  THR A CG2  1 
ATOM   229  H H    . THR A 1 24  ? 34.026  57.455 -6.691  1.00 0.00  ? 24  THR A H    1 
ATOM   230  H HG1  . THR A 1 24  ? 33.934  56.899 -8.698  1.00 0.00  ? 24  THR A HG1  1 
ATOM   231  N N    . GLU A 1 25  ? 36.455  56.590 -4.390  1.00 29.68 ? 25  GLU A N    1 
ATOM   232  C CA   . GLU A 1 25  ? 37.537  56.803 -3.455  1.00 28.47 ? 25  GLU A CA   1 
ATOM   233  C C    . GLU A 1 25  ? 37.376  55.710 -2.438  1.00 27.76 ? 25  GLU A C    1 
ATOM   234  O O    . GLU A 1 25  ? 38.358  55.178 -1.917  1.00 29.94 ? 25  GLU A O    1 
ATOM   235  C CB   . GLU A 1 25  ? 37.386  58.171 -2.764  1.00 29.05 ? 25  GLU A CB   1 
ATOM   236  C CG   . GLU A 1 25  ? 38.441  59.189 -3.145  1.00 27.08 ? 25  GLU A CG   1 
ATOM   237  C CD   . GLU A 1 25  ? 38.047  60.639 -2.793  1.00 29.92 ? 25  GLU A CD   1 
ATOM   238  O OE1  . GLU A 1 25  ? 37.831  60.935 -1.596  1.00 30.60 ? 25  GLU A OE1  1 
ATOM   239  O OE2  . GLU A 1 25  ? 37.999  61.501 -3.716  1.00 30.08 ? 25  GLU A OE2  1 
ATOM   240  H H    . GLU A 1 25  ? 35.598  56.923 -4.087  1.00 0.00  ? 25  GLU A H    1 
ATOM   241  N N    . ARG A 1 26  ? 36.129  55.357 -2.156  1.00 26.38 ? 26  ARG A N    1 
ATOM   242  C CA   . ARG A 1 26  ? 35.875  54.331 -1.165  1.00 22.77 ? 26  ARG A CA   1 
ATOM   243  C C    . ARG A 1 26  ? 35.574  53.011 -1.818  1.00 21.72 ? 26  ARG A C    1 
ATOM   244  O O    . ARG A 1 26  ? 35.821  51.972 -1.224  1.00 20.70 ? 26  ARG A O    1 
ATOM   245  C CB   . ARG A 1 26  ? 34.780  54.755 -0.186  1.00 22.41 ? 26  ARG A CB   1 
ATOM   246  C CG   . ARG A 1 26  ? 35.191  55.896 0.751   1.00 20.08 ? 26  ARG A CG   1 
ATOM   247  C CD   . ARG A 1 26  ? 33.989  56.434 1.580   1.00 19.98 ? 26  ARG A CD   1 
ATOM   248  N NE   . ARG A 1 26  ? 33.573  55.572 2.696   1.00 18.24 ? 26  ARG A NE   1 
ATOM   249  C CZ   . ARG A 1 26  ? 32.407  55.684 3.326   1.00 18.56 ? 26  ARG A CZ   1 
ATOM   250  N NH1  . ARG A 1 26  ? 31.551  56.610 2.943   1.00 22.21 ? 26  ARG A NH1  1 
ATOM   251  N NH2  . ARG A 1 26  ? 32.078  54.877 4.334   1.00 17.56 ? 26  ARG A NH2  1 
ATOM   252  H H    . ARG A 1 26  ? 35.370  55.756 -2.631  1.00 0.00  ? 26  ARG A H    1 
ATOM   253  H HE   . ARG A 1 26  ? 34.209  54.888 2.989   1.00 0.00  ? 26  ARG A HE   1 
ATOM   254  H HH11 . ARG A 1 26  ? 31.731  57.254 2.200   1.00 0.00  ? 26  ARG A HH11 1 
ATOM   255  H HH12 . ARG A 1 26  ? 30.672  56.739 3.416   1.00 0.00  ? 26  ARG A HH12 1 
ATOM   256  H HH21 . ARG A 1 26  ? 32.684  54.168 4.675   1.00 0.00  ? 26  ARG A HH21 1 
ATOM   257  H HH22 . ARG A 1 26  ? 31.193  55.000 4.803   1.00 0.00  ? 26  ARG A HH22 1 
ATOM   258  N N    . ALA A 1 27  ? 35.086  53.054 -3.054  1.00 21.47 ? 27  ALA A N    1 
ATOM   259  C CA   . ALA A 1 27  ? 34.784  51.821 -3.799  1.00 20.98 ? 27  ALA A CA   1 
ATOM   260  C C    . ALA A 1 27  ? 35.997  50.909 -3.831  1.00 19.89 ? 27  ALA A C    1 
ATOM   261  O O    . ALA A 1 27  ? 37.138  51.384 -3.855  1.00 20.71 ? 27  ALA A O    1 
ATOM   262  C CB   . ALA A 1 27  ? 34.369  52.136 -5.242  1.00 20.85 ? 27  ALA A CB   1 
ATOM   263  H H    . ALA A 1 27  ? 34.898  53.926 -3.456  1.00 0.00  ? 27  ALA A H    1 
ATOM   264  N N    . LYS A 1 28  ? 35.753  49.604 -3.744  1.00 19.46 ? 28  LYS A N    1 
ATOM   265  C CA   . LYS A 1 28  ? 36.831  48.624 -3.817  1.00 19.02 ? 28  LYS A CA   1 
ATOM   266  C C    . LYS A 1 28  ? 36.823  48.197 -5.272  1.00 18.03 ? 28  LYS A C    1 
ATOM   267  O O    . LYS A 1 28  ? 37.880  48.091 -5.879  1.00 15.06 ? 28  LYS A O    1 
ATOM   268  C CB   . LYS A 1 28  ? 36.579  47.454 -2.834  1.00 20.93 ? 28  LYS A CB   1 
ATOM   269  C CG   . LYS A 1 28  ? 37.567  46.260 -2.877  1.00 22.54 ? 28  LYS A CG   1 
ATOM   270  C CD   . LYS A 1 28  ? 38.984  46.607 -3.319  1.00 24.76 ? 28  LYS A CD   1 
ATOM   271  C CE   . LYS A 1 28  ? 39.753  45.297 -3.713  1.00 29.28 ? 28  LYS A CE   1 
ATOM   272  N NZ   . LYS A 1 28  ? 40.778  45.423 -4.849  1.00 29.21 ? 28  LYS A NZ   1 
ATOM   273  H H    . LYS A 1 28  ? 34.841  49.249 -3.642  1.00 0.00  ? 28  LYS A H    1 
ATOM   274  H HZ1  . LYS A 1 28  ? 41.503  46.130 -4.623  1.00 0.00  ? 28  LYS A HZ1  1 
ATOM   275  H HZ2  . LYS A 1 28  ? 41.283  44.510 -4.972  1.00 0.00  ? 28  LYS A HZ2  1 
ATOM   276  H HZ3  . LYS A 1 28  ? 40.368  45.636 -5.780  1.00 0.00  ? 28  LYS A HZ3  1 
ATOM   277  N N    . TYR A 1 29  ? 35.622  48.045 -5.835  1.00 18.11 ? 29  TYR A N    1 
ATOM   278  C CA   . TYR A 1 29  ? 35.412  47.669 -7.249  1.00 16.64 ? 29  TYR A CA   1 
ATOM   279  C C    . TYR A 1 29  ? 34.457  48.650 -7.937  1.00 16.54 ? 29  TYR A C    1 
ATOM   280  O O    . TYR A 1 29  ? 33.437  49.047 -7.359  1.00 13.89 ? 29  TYR A O    1 
ATOM   281  C CB   . TYR A 1 29  ? 34.709  46.286 -7.381  1.00 17.04 ? 29  TYR A CB   1 
ATOM   282  C CG   . TYR A 1 29  ? 35.424  45.068 -6.782  1.00 14.69 ? 29  TYR A CG   1 
ATOM   283  C CD1  . TYR A 1 29  ? 35.266  44.748 -5.454  1.00 12.14 ? 29  TYR A CD1  1 
ATOM   284  C CD2  . TYR A 1 29  ? 36.307  44.300 -7.555  1.00 11.78 ? 29  TYR A CD2  1 
ATOM   285  C CE1  . TYR A 1 29  ? 35.975  43.706 -4.893  1.00 13.10 ? 29  TYR A CE1  1 
ATOM   286  C CE2  . TYR A 1 29  ? 37.026  43.270 -7.006  1.00 14.02 ? 29  TYR A CE2  1 
ATOM   287  C CZ   . TYR A 1 29  ? 36.864  42.969 -5.668  1.00 13.74 ? 29  TYR A CZ   1 
ATOM   288  O OH   . TYR A 1 29  ? 37.605  41.964 -5.083  1.00 8.83  ? 29  TYR A OH   1 
ATOM   289  H H    . TYR A 1 29  ? 34.837  48.178 -5.262  1.00 0.00  ? 29  TYR A H    1 
ATOM   290  H HH   . TYR A 1 29  ? 37.264  41.880 -4.191  1.00 0.00  ? 29  TYR A HH   1 
ATOM   291  N N    . VAL A 1 30  ? 34.746  49.000 -9.184  1.00 16.28 ? 30  VAL A N    1 
ATOM   292  C CA   . VAL A 1 30  ? 33.849  49.869 -9.969  1.00 14.68 ? 30  VAL A CA   1 
ATOM   293  C C    . VAL A 1 30  ? 33.359  49.057 -11.186 1.00 12.83 ? 30  VAL A C    1 
ATOM   294  O O    . VAL A 1 30  ? 34.165  48.520 -11.953 1.00 12.62 ? 30  VAL A O    1 
ATOM   295  C CB   . VAL A 1 30  ? 34.555  51.131 -10.455 1.00 12.25 ? 30  VAL A CB   1 
ATOM   296  C CG1  . VAL A 1 30  ? 33.594  51.981 -11.278 1.00 19.83 ? 30  VAL A CG1  1 
ATOM   297  C CG2  . VAL A 1 30  ? 35.099  51.886 -9.280  1.00 15.47 ? 30  VAL A CG2  1 
ATOM   298  H H    . VAL A 1 30  ? 35.560  48.635 -9.597  1.00 0.00  ? 30  VAL A H    1 
ATOM   299  N N    . VAL A 1 31  ? 32.057  48.987 -11.399 1.00 12.09 ? 31  VAL A N    1 
ATOM   300  C CA   . VAL A 1 31  ? 31.568  48.159 -12.510 1.00 12.46 ? 31  VAL A CA   1 
ATOM   301  C C    . VAL A 1 31  ? 30.678  48.775 -13.601 1.00 12.65 ? 31  VAL A C    1 
ATOM   302  O O    . VAL A 1 31  ? 29.833  49.649 -13.326 1.00 9.47  ? 31  VAL A O    1 
ATOM   303  C CB   . VAL A 1 31  ? 30.818  46.885 -11.958 1.00 10.88 ? 31  VAL A CB   1 
ATOM   304  C CG1  . VAL A 1 31  ? 30.214  46.095 -13.069 1.00 11.13 ? 31  VAL A CG1  1 
ATOM   305  C CG2  . VAL A 1 31  ? 31.778  45.997 -11.140 1.00 8.72  ? 31  VAL A CG2  1 
ATOM   306  H H    . VAL A 1 31  ? 31.449  49.465 -10.784 1.00 0.00  ? 31  VAL A H    1 
ATOM   307  N N    . ARG A 1 32  ? 30.945  48.366 -14.841 1.00 12.56 ? 32  ARG A N    1 
ATOM   308  C CA   . ARG A 1 32  ? 30.135  48.764 -15.986 1.00 11.01 ? 32  ARG A CA   1 
ATOM   309  C C    . ARG A 1 32  ? 29.183  47.576 -16.252 1.00 8.33  ? 32  ARG A C    1 
ATOM   310  O O    . ARG A 1 32  ? 29.631  46.420 -16.407 1.00 5.01  ? 32  ARG A O    1 
ATOM   311  C CB   . ARG A 1 32  ? 31.002  49.036 -17.243 1.00 11.09 ? 32  ARG A CB   1 
ATOM   312  C CG   . ARG A 1 32  ? 31.630  50.440 -17.336 1.00 12.16 ? 32  ARG A CG   1 
ATOM   313  C CD   . ARG A 1 32  ? 30.625  51.505 -17.745 1.00 11.40 ? 32  ARG A CD   1 
ATOM   314  N NE   . ARG A 1 32  ? 30.046  51.233 -19.045 1.00 18.98 ? 32  ARG A NE   1 
ATOM   315  C CZ   . ARG A 1 32  ? 30.537  51.705 -20.185 1.00 22.99 ? 32  ARG A CZ   1 
ATOM   316  N NH1  . ARG A 1 32  ? 31.624  52.469 -20.162 1.00 28.34 ? 32  ARG A NH1  1 
ATOM   317  N NH2  . ARG A 1 32  ? 29.917  51.470 -21.335 1.00 20.41 ? 32  ARG A NH2  1 
ATOM   318  H H    . ARG A 1 32  ? 31.721  47.776 -14.969 1.00 0.00  ? 32  ARG A H    1 
ATOM   319  H HE   . ARG A 1 32  ? 29.230  50.690 -19.113 1.00 0.00  ? 32  ARG A HE   1 
ATOM   320  H HH11 . ARG A 1 32  ? 32.083  52.691 -19.299 1.00 0.00  ? 32  ARG A HH11 1 
ATOM   321  H HH12 . ARG A 1 32  ? 32.005  52.830 -21.017 1.00 0.00  ? 32  ARG A HH12 1 
ATOM   322  H HH21 . ARG A 1 32  ? 29.064  50.947 -21.331 1.00 0.00  ? 32  ARG A HH21 1 
ATOM   323  H HH22 . ARG A 1 32  ? 30.312  51.769 -22.221 1.00 0.00  ? 32  ARG A HH22 1 
ATOM   324  N N    . TYR A 1 33  ? 27.894  47.867 -16.361 1.00 9.81  ? 33  TYR A N    1 
ATOM   325  C CA   . TYR A 1 33  ? 26.904  46.829 -16.612 1.00 13.10 ? 33  TYR A CA   1 
ATOM   326  C C    . TYR A 1 33  ? 26.079  46.969 -17.895 1.00 14.83 ? 33  TYR A C    1 
ATOM   327  O O    . TYR A 1 33  ? 25.248  46.126 -18.171 1.00 13.73 ? 33  TYR A O    1 
ATOM   328  C CB   . TYR A 1 33  ? 25.973  46.730 -15.423 1.00 11.56 ? 33  TYR A CB   1 
ATOM   329  C CG   . TYR A 1 33  ? 25.265  48.023 -15.119 1.00 9.76  ? 33  TYR A CG   1 
ATOM   330  C CD1  . TYR A 1 33  ? 24.053  48.334 -15.748 1.00 10.07 ? 33  TYR A CD1  1 
ATOM   331  C CD2  . TYR A 1 33  ? 25.752  48.903 -14.162 1.00 6.95  ? 33  TYR A CD2  1 
ATOM   332  C CE1  . TYR A 1 33  ? 23.341  49.476 -15.427 1.00 7.94  ? 33  TYR A CE1  1 
ATOM   333  C CE2  . TYR A 1 33  ? 25.034  50.071 -13.823 1.00 7.91  ? 33  TYR A CE2  1 
ATOM   334  C CZ   . TYR A 1 33  ? 23.838  50.342 -14.464 1.00 7.53  ? 33  TYR A CZ   1 
ATOM   335  O OH   . TYR A 1 33  ? 23.133  51.492 -14.201 1.00 9.57  ? 33  TYR A OH   1 
ATOM   336  H H    . TYR A 1 33  ? 27.618  48.798 -16.252 1.00 0.00  ? 33  TYR A H    1 
ATOM   337  H HH   . TYR A 1 33  ? 22.326  51.528 -14.734 1.00 0.00  ? 33  TYR A HH   1 
ATOM   338  N N    . GLN A 1 34  ? 26.284  48.036 -18.671 1.00 16.98 ? 34  GLN A N    1 
ATOM   339  C CA   . GLN A 1 34  ? 25.527  48.223 -19.918 1.00 16.05 ? 34  GLN A CA   1 
ATOM   340  C C    . GLN A 1 34  ? 26.177  49.268 -20.837 1.00 16.11 ? 34  GLN A C    1 
ATOM   341  O O    . GLN A 1 34  ? 27.175  49.888 -20.463 1.00 16.09 ? 34  GLN A O    1 
ATOM   342  C CB   . GLN A 1 34  ? 24.050  48.565 -19.634 1.00 16.27 ? 34  GLN A CB   1 
ATOM   343  C CG   . GLN A 1 34  ? 23.752  49.846 -18.828 1.00 13.01 ? 34  GLN A CG   1 
ATOM   344  C CD   . GLN A 1 34  ? 24.130  51.166 -19.550 1.00 15.90 ? 34  GLN A CD   1 
ATOM   345  O OE1  . GLN A 1 34  ? 24.868  51.958 -18.988 1.00 14.87 ? 34  GLN A OE1  1 
ATOM   346  N NE2  . GLN A 1 34  ? 23.609  51.399 -20.784 1.00 13.88 ? 34  GLN A NE2  1 
ATOM   347  H H    . GLN A 1 34  ? 26.950  48.719 -18.438 1.00 0.00  ? 34  GLN A H    1 
ATOM   348  H HE21 . GLN A 1 34  ? 23.896  52.210 -21.250 1.00 0.00  ? 34  GLN A HE21 1 
ATOM   349  H HE22 . GLN A 1 34  ? 22.969  50.760 -21.168 1.00 0.00  ? 34  GLN A HE22 1 
ATOM   350  N N    . GLY A 1 35  ? 25.673  49.360 -22.069 1.00 17.10 ? 35  GLY A N    1 
ATOM   351  C CA   . GLY A 1 35  ? 26.181  50.318 -23.037 1.00 14.31 ? 35  GLY A CA   1 
ATOM   352  C C    . GLY A 1 35  ? 27.458  49.819 -23.630 1.00 13.26 ? 35  GLY A C    1 
ATOM   353  O O    . GLY A 1 35  ? 27.764  48.645 -23.436 1.00 12.93 ? 35  GLY A O    1 
ATOM   354  H H    . GLY A 1 35  ? 24.998  48.725 -22.383 1.00 0.00  ? 35  GLY A H    1 
ATOM   355  N N    . GLY A 1 36  ? 28.208  50.689 -24.324 1.00 14.99 ? 36  GLY A N    1 
ATOM   356  C CA   . GLY A 1 36  ? 29.485  50.275 -24.913 1.00 16.17 ? 36  GLY A CA   1 
ATOM   357  C C    . GLY A 1 36  ? 30.573  51.326 -24.778 1.00 16.75 ? 36  GLY A C    1 
ATOM   358  O O    . GLY A 1 36  ? 30.993  51.573 -23.652 1.00 17.87 ? 36  GLY A O    1 
ATOM   359  H H    . GLY A 1 36  ? 27.915  51.622 -24.409 1.00 0.00  ? 36  GLY A H    1 
ATOM   360  N N    . HIS A 1 37  ? 31.082  51.860 -25.906 1.00 18.62 ? 37  HIS A N    1 
ATOM   361  C CA   . HIS A 1 37  ? 32.106  52.938 -25.918 1.00 21.01 ? 37  HIS A CA   1 
ATOM   362  C C    . HIS A 1 37  ? 31.447  54.307 -26.175 1.00 24.88 ? 37  HIS A C    1 
ATOM   363  O O    . HIS A 1 37  ? 31.655  54.967 -27.199 1.00 25.94 ? 37  HIS A O    1 
ATOM   364  C CB   . HIS A 1 37  ? 33.260  52.710 -26.930 1.00 20.28 ? 37  HIS A CB   1 
ATOM   365  C CG   . HIS A 1 37  ? 32.814  52.304 -28.310 1.00 18.03 ? 37  HIS A CG   1 
ATOM   366  N ND1  . HIS A 1 37  ? 31.743  51.465 -28.512 1.00 14.00 ? 37  HIS A ND1  1 
ATOM   367  C CD2  . HIS A 1 37  ? 33.397  52.572 -29.506 1.00 15.15 ? 37  HIS A CD2  1 
ATOM   368  C CE1  . HIS A 1 37  ? 31.706  51.243 -29.808 1.00 8.41  ? 37  HIS A CE1  1 
ATOM   369  N NE2  . HIS A 1 37  ? 32.681  51.890 -30.445 1.00 12.15 ? 37  HIS A NE2  1 
ATOM   370  H H    . HIS A 1 37  ? 30.833  51.551 -26.805 1.00 0.00  ? 37  HIS A H    1 
ATOM   371  H HE2  . HIS A 1 37  ? 32.809  51.927 -31.413 1.00 0.00  ? 37  HIS A HE2  1 
ATOM   372  N N    . ASN A 1 38  ? 30.643  54.733 -25.212 1.00 27.26 ? 38  ASN A N    1 
ATOM   373  C CA   . ASN A 1 38  ? 29.973  56.006 -25.317 1.00 29.77 ? 38  ASN A CA   1 
ATOM   374  C C    . ASN A 1 38  ? 29.564  56.434 -23.918 1.00 29.80 ? 38  ASN A C    1 
ATOM   375  O O    . ASN A 1 38  ? 28.385  56.640 -23.626 1.00 28.10 ? 38  ASN A O    1 
ATOM   376  C CB   . ASN A 1 38  ? 28.799  55.947 -26.322 1.00 30.61 ? 38  ASN A CB   1 
ATOM   377  C CG   . ASN A 1 38  ? 27.635  55.091 -25.852 1.00 31.39 ? 38  ASN A CG   1 
ATOM   378  O OD1  . ASN A 1 38  ? 27.703  54.396 -24.834 1.00 33.38 ? 38  ASN A OD1  1 
ATOM   379  N ND2  . ASN A 1 38  ? 26.561  55.121 -26.620 1.00 32.44 ? 38  ASN A ND2  1 
ATOM   380  H H    . ASN A 1 38  ? 30.482  54.182 -24.414 1.00 0.00  ? 38  ASN A H    1 
ATOM   381  H HD21 . ASN A 1 38  ? 25.789  54.601 -26.320 1.00 0.00  ? 38  ASN A HD21 1 
ATOM   382  H HD22 . ASN A 1 38  ? 26.582  55.664 -27.429 1.00 0.00  ? 38  ASN A HD22 1 
ATOM   383  N N    . ALA A 1 39  ? 30.574  56.552 -23.055 1.00 30.63 ? 39  ALA A N    1 
ATOM   384  C CA   . ALA A 1 39  ? 30.357  56.965 -21.674 1.00 32.90 ? 39  ALA A CA   1 
ATOM   385  C C    . ALA A 1 39  ? 30.888  58.377 -21.406 1.00 34.40 ? 39  ALA A C    1 
ATOM   386  O O    . ALA A 1 39  ? 30.527  58.996 -20.390 1.00 37.96 ? 39  ALA A O    1 
ATOM   387  C CB   . ALA A 1 39  ? 30.974  55.976 -20.708 1.00 30.81 ? 39  ALA A CB   1 
ATOM   388  H H    . ALA A 1 39  ? 31.481  56.365 -23.358 1.00 0.00  ? 39  ALA A H    1 
ATOM   389  N N    . GLY A 1 40  ? 31.746  58.871 -22.301 1.00 34.74 ? 40  GLY A N    1 
ATOM   390  C CA   . GLY A 1 40  ? 32.316  60.199 -22.156 1.00 34.71 ? 40  GLY A CA   1 
ATOM   391  C C    . GLY A 1 40  ? 32.754  60.697 -20.783 1.00 35.39 ? 40  GLY A C    1 
ATOM   392  O O    . GLY A 1 40  ? 32.438  61.835 -20.430 1.00 36.30 ? 40  GLY A O    1 
ATOM   393  H H    . GLY A 1 40  ? 32.065  58.398 -23.085 1.00 0.00  ? 40  GLY A H    1 
ATOM   394  N N    . HIS A 1 41  ? 33.443  59.885 -19.982 1.00 34.92 ? 41  HIS A N    1 
ATOM   395  C CA   . HIS A 1 41  ? 33.893  60.394 -18.688 1.00 34.87 ? 41  HIS A CA   1 
ATOM   396  C C    . HIS A 1 41  ? 35.171  61.158 -19.051 1.00 36.37 ? 41  HIS A C    1 
ATOM   397  O O    . HIS A 1 41  ? 36.070  60.642 -19.756 1.00 31.61 ? 41  HIS A O    1 
ATOM   398  C CB   . HIS A 1 41  ? 34.151  59.258 -17.678 1.00 34.40 ? 41  HIS A CB   1 
ATOM   399  C CG   . HIS A 1 41  ? 34.261  59.714 -16.247 1.00 32.15 ? 41  HIS A CG   1 
ATOM   400  N ND1  . HIS A 1 41  ? 35.369  60.387 -15.794 1.00 32.34 ? 41  HIS A ND1  1 
ATOM   401  C CD2  . HIS A 1 41  ? 33.461  59.417 -15.190 1.00 31.90 ? 41  HIS A CD2  1 
ATOM   402  C CE1  . HIS A 1 41  ? 35.231  60.473 -14.481 1.00 29.58 ? 41  HIS A CE1  1 
ATOM   403  N NE2  . HIS A 1 41  ? 34.098  59.905 -14.064 1.00 29.17 ? 41  HIS A NE2  1 
ATOM   404  H H    . HIS A 1 41  ? 33.740  58.996 -20.283 1.00 0.00  ? 41  HIS A H    1 
ATOM   405  H HE2  . HIS A 1 41  ? 33.792  59.866 -13.132 1.00 0.00  ? 41  HIS A HE2  1 
ATOM   406  N N    . THR A 1 42  ? 35.196  62.430 -18.663 1.00 38.87 ? 42  THR A N    1 
ATOM   407  C CA   . THR A 1 42  ? 36.332  63.308 -18.982 1.00 40.53 ? 42  THR A CA   1 
ATOM   408  C C    . THR A 1 42  ? 37.344  63.324 -17.839 1.00 42.50 ? 42  THR A C    1 
ATOM   409  O O    . THR A 1 42  ? 36.975  63.253 -16.672 1.00 42.80 ? 42  THR A O    1 
ATOM   410  C CB   . THR A 1 42  ? 35.838  64.735 -19.298 1.00 40.35 ? 42  THR A CB   1 
ATOM   411  O OG1  . THR A 1 42  ? 34.542  64.662 -19.928 1.00 40.80 ? 42  THR A OG1  1 
ATOM   412  C CG2  . THR A 1 42  ? 36.819  65.456 -20.248 1.00 41.16 ? 42  THR A CG2  1 
ATOM   413  H H    . THR A 1 42  ? 34.464  62.769 -18.106 1.00 0.00  ? 42  THR A H    1 
ATOM   414  H HG1  . THR A 1 42  ? 34.035  63.887 -19.654 1.00 0.00  ? 42  THR A HG1  1 
ATOM   415  N N    . LEU A 1 43  ? 38.623  63.356 -18.181 1.00 43.80 ? 43  LEU A N    1 
ATOM   416  C CA   . LEU A 1 43  ? 39.671  63.344 -17.174 1.00 45.45 ? 43  LEU A CA   1 
ATOM   417  C C    . LEU A 1 43  ? 40.832  64.283 -17.481 1.00 46.43 ? 43  LEU A C    1 
ATOM   418  O O    . LEU A 1 43  ? 41.056  64.674 -18.631 1.00 46.77 ? 43  LEU A O    1 
ATOM   419  C CB   . LEU A 1 43  ? 40.267  61.932 -17.051 1.00 45.88 ? 43  LEU A CB   1 
ATOM   420  C CG   . LEU A 1 43  ? 39.462  60.730 -16.553 1.00 47.78 ? 43  LEU A CG   1 
ATOM   421  C CD1  . LEU A 1 43  ? 38.457  60.266 -17.593 1.00 49.41 ? 43  LEU A CD1  1 
ATOM   422  C CD2  . LEU A 1 43  ? 40.423  59.607 -16.236 1.00 46.41 ? 43  LEU A CD2  1 
ATOM   423  H H    . LEU A 1 43  ? 38.908  63.327 -19.133 1.00 0.00  ? 43  LEU A H    1 
ATOM   424  N N    . VAL A 1 44  ? 41.584  64.603 -16.435 1.00 45.82 ? 44  VAL A N    1 
ATOM   425  C CA   . VAL A 1 44  ? 42.775  65.413 -16.533 1.00 45.81 ? 44  VAL A CA   1 
ATOM   426  C C    . VAL A 1 44  ? 43.824  64.516 -15.874 1.00 46.12 ? 44  VAL A C    1 
ATOM   427  O O    . VAL A 1 44  ? 43.690  64.126 -14.708 1.00 46.29 ? 44  VAL A O    1 
ATOM   428  C CB   . VAL A 1 44  ? 42.630  66.731 -15.777 1.00 45.66 ? 44  VAL A CB   1 
ATOM   429  C CG1  . VAL A 1 44  ? 43.980  67.390 -15.618 1.00 48.10 ? 44  VAL A CG1  1 
ATOM   430  C CG2  . VAL A 1 44  ? 41.707  67.660 -16.533 1.00 47.50 ? 44  VAL A CG2  1 
ATOM   431  H H    . VAL A 1 44  ? 41.344  64.260 -15.547 1.00 0.00  ? 44  VAL A H    1 
ATOM   432  N N    . ILE A 1 45  ? 44.801  64.096 -16.667 1.00 46.93 ? 45  ILE A N    1 
ATOM   433  C CA   . ILE A 1 45  ? 45.884  63.218 -16.211 1.00 46.79 ? 45  ILE A CA   1 
ATOM   434  C C    . ILE A 1 45  ? 47.203  63.861 -16.630 1.00 46.94 ? 45  ILE A C    1 
ATOM   435  O O    . ILE A 1 45  ? 47.376  64.219 -17.780 1.00 45.63 ? 45  ILE A O    1 
ATOM   436  C CB   . ILE A 1 45  ? 45.804  61.806 -16.883 1.00 44.79 ? 45  ILE A CB   1 
ATOM   437  C CG1  . ILE A 1 45  ? 44.422  61.180 -16.706 1.00 46.95 ? 45  ILE A CG1  1 
ATOM   438  C CG2  . ILE A 1 45  ? 46.782  60.879 -16.270 1.00 43.95 ? 45  ILE A CG2  1 
ATOM   439  C CD1  . ILE A 1 45  ? 44.223  59.942 -17.568 1.00 48.10 ? 45  ILE A CD1  1 
ATOM   440  H H    . ILE A 1 45  ? 44.796  64.396 -17.618 1.00 0.00  ? 45  ILE A H    1 
ATOM   441  N N    . ASN A 1 46  ? 48.078  64.098 -15.666 1.00 48.74 ? 46  ASN A N    1 
ATOM   442  C CA   . ASN A 1 46  ? 49.385  64.679 -15.932 1.00 50.87 ? 46  ASN A CA   1 
ATOM   443  C C    . ASN A 1 46  ? 49.356  65.877 -16.898 1.00 52.59 ? 46  ASN A C    1 
ATOM   444  O O    . ASN A 1 46  ? 50.116  65.926 -17.875 1.00 53.54 ? 46  ASN A O    1 
ATOM   445  C CB   . ASN A 1 46  ? 50.311  63.586 -16.467 1.00 51.18 ? 46  ASN A CB   1 
ATOM   446  C CG   . ASN A 1 46  ? 51.682  63.622 -15.820 1.00 52.96 ? 46  ASN A CG   1 
ATOM   447  O OD1  . ASN A 1 46  ? 52.481  64.529 -16.069 1.00 54.65 ? 46  ASN A OD1  1 
ATOM   448  N ND2  . ASN A 1 46  ? 51.967  62.629 -14.981 1.00 52.55 ? 46  ASN A ND2  1 
ATOM   449  H H    . ASN A 1 46  ? 47.828  63.898 -14.736 1.00 0.00  ? 46  ASN A H    1 
ATOM   450  H HD21 . ASN A 1 46  ? 52.855  62.646 -14.572 1.00 0.00  ? 46  ASN A HD21 1 
ATOM   451  H HD22 . ASN A 1 46  ? 51.297  61.935 -14.819 1.00 0.00  ? 46  ASN A HD22 1 
ATOM   452  N N    . GLY A 1 47  ? 48.471  66.838 -16.642 1.00 53.66 ? 47  GLY A N    1 
ATOM   453  C CA   . GLY A 1 47  ? 48.384  68.000 -17.514 1.00 53.39 ? 47  GLY A CA   1 
ATOM   454  C C    . GLY A 1 47  ? 47.716  67.711 -18.850 1.00 53.75 ? 47  GLY A C    1 
ATOM   455  O O    . GLY A 1 47  ? 47.761  68.533 -19.757 1.00 52.80 ? 47  GLY A O    1 
ATOM   456  H H    . GLY A 1 47  ? 47.891  66.752 -15.863 1.00 0.00  ? 47  GLY A H    1 
ATOM   457  N N    . GLU A 1 48  ? 47.098  66.543 -18.971 1.00 54.23 ? 48  GLU A N    1 
ATOM   458  C CA   . GLU A 1 48  ? 46.406  66.152 -20.189 1.00 54.91 ? 48  GLU A CA   1 
ATOM   459  C C    . GLU A 1 48  ? 44.939  65.825 -19.893 1.00 54.72 ? 48  GLU A C    1 
ATOM   460  O O    . GLU A 1 48  ? 44.630  65.050 -18.984 1.00 55.13 ? 48  GLU A O    1 
ATOM   461  C CB   . GLU A 1 48  ? 47.086  64.934 -20.820 1.00 55.84 ? 48  GLU A CB   1 
ATOM   462  C CG   . GLU A 1 48  ? 46.302  64.327 -21.994 1.00 58.15 ? 48  GLU A CG   1 
ATOM   463  C CD   . GLU A 1 48  ? 46.594  62.841 -22.225 1.00 58.39 ? 48  GLU A CD   1 
ATOM   464  O OE1  . GLU A 1 48  ? 46.640  62.071 -21.239 1.00 57.80 ? 48  GLU A OE1  1 
ATOM   465  O OE2  . GLU A 1 48  ? 46.757  62.444 -23.404 1.00 58.54 ? 48  GLU A OE2  1 
ATOM   466  H H    . GLU A 1 48  ? 47.128  65.840 -18.278 1.00 0.00  ? 48  GLU A H    1 
ATOM   467  N N    . LYS A 1 49  ? 44.035  66.460 -20.627 1.00 53.71 ? 49  LYS A N    1 
ATOM   468  C CA   . LYS A 1 49  ? 42.605  66.219 -20.462 1.00 51.58 ? 49  LYS A CA   1 
ATOM   469  C C    . LYS A 1 49  ? 42.241  65.154 -21.498 1.00 49.92 ? 49  LYS A C    1 
ATOM   470  O O    . LYS A 1 49  ? 42.342  65.372 -22.707 1.00 50.00 ? 49  LYS A O    1 
ATOM   471  C CB   . LYS A 1 49  ? 41.834  67.534 -20.655 1.00 51.57 ? 49  LYS A CB   1 
ATOM   472  C CG   . LYS A 1 49  ? 40.397  67.456 -21.145 1.00 50.11 ? 49  LYS A CG   1 
ATOM   473  C CD   . LYS A 1 49  ? 40.106  68.743 -21.911 1.00 50.97 ? 49  LYS A CD   1 
ATOM   474  C CE   . LYS A 1 49  ? 38.782  68.729 -22.654 1.00 52.77 ? 49  LYS A CE   1 
ATOM   475  N NZ   . LYS A 1 49  ? 37.623  69.120 -21.808 1.00 56.67 ? 49  LYS A NZ   1 
ATOM   476  H H    . LYS A 1 49  ? 44.306  67.091 -21.317 1.00 0.00  ? 49  LYS A H    1 
ATOM   477  H HZ1  . LYS A 1 49  ? 37.571  68.555 -20.942 1.00 0.00  ? 49  LYS A HZ1  1 
ATOM   478  H HZ2  . LYS A 1 49  ? 37.791  70.112 -21.526 1.00 0.00  ? 49  LYS A HZ2  1 
ATOM   479  H HZ3  . LYS A 1 49  ? 36.737  69.103 -22.346 1.00 0.00  ? 49  LYS A HZ3  1 
ATOM   480  N N    . THR A 1 50  ? 41.930  63.965 -21.005 1.00 48.68 ? 50  THR A N    1 
ATOM   481  C CA   . THR A 1 50  ? 41.580  62.836 -21.857 1.00 45.66 ? 50  THR A CA   1 
ATOM   482  C C    . THR A 1 50  ? 40.123  62.470 -21.612 1.00 41.91 ? 50  THR A C    1 
ATOM   483  O O    . THR A 1 50  ? 39.525  62.886 -20.616 1.00 44.12 ? 50  THR A O    1 
ATOM   484  C CB   . THR A 1 50  ? 42.466  61.605 -21.520 1.00 47.21 ? 50  THR A CB   1 
ATOM   485  O OG1  . THR A 1 50  ? 42.271  60.574 -22.511 1.00 49.39 ? 50  THR A OG1  1 
ATOM   486  C CG2  . THR A 1 50  ? 42.113  61.058 -20.122 1.00 45.52 ? 50  THR A CG2  1 
ATOM   487  H H    . THR A 1 50  ? 41.863  63.896 -20.027 1.00 0.00  ? 50  THR A H    1 
ATOM   488  H HG1  . THR A 1 50  ? 43.048  59.995 -22.565 1.00 0.00  ? 50  THR A HG1  1 
ATOM   489  N N    . VAL A 1 51  ? 39.541  61.705 -22.521 1.00 36.56 ? 51  VAL A N    1 
ATOM   490  C CA   . VAL A 1 51  ? 38.162  61.274 -22.349 1.00 31.82 ? 51  VAL A CA   1 
ATOM   491  C C    . VAL A 1 51  ? 38.135  59.749 -22.492 1.00 29.27 ? 51  VAL A C    1 
ATOM   492  O O    . VAL A 1 51  ? 38.768  59.202 -23.392 1.00 27.41 ? 51  VAL A O    1 
ATOM   493  C CB   . VAL A 1 51  ? 37.236  61.968 -23.360 1.00 31.66 ? 51  VAL A CB   1 
ATOM   494  C CG1  . VAL A 1 51  ? 35.764  61.743 -23.000 1.00 30.04 ? 51  VAL A CG1  1 
ATOM   495  C CG2  . VAL A 1 51  ? 37.540  63.453 -23.373 1.00 30.91 ? 51  VAL A CG2  1 
ATOM   496  H H    . VAL A 1 51  ? 40.064  61.379 -23.284 1.00 0.00  ? 51  VAL A H    1 
ATOM   497  N N    . LEU A 1 52  ? 37.488  59.083 -21.531 1.00 27.60 ? 52  LEU A N    1 
ATOM   498  C CA   . LEU A 1 52  ? 37.354  57.625 -21.493 1.00 24.78 ? 52  LEU A CA   1 
ATOM   499  C C    . LEU A 1 52  ? 35.927  57.201 -21.772 1.00 22.67 ? 52  LEU A C    1 
ATOM   500  O O    . LEU A 1 52  ? 34.982  57.655 -21.093 1.00 25.53 ? 52  LEU A O    1 
ATOM   501  C CB   . LEU A 1 52  ? 37.797  57.092 -20.134 1.00 25.46 ? 52  LEU A CB   1 
ATOM   502  C CG   . LEU A 1 52  ? 39.296  57.246 -19.808 1.00 27.53 ? 52  LEU A CG   1 
ATOM   503  C CD1  . LEU A 1 52  ? 39.617  56.698 -18.411 1.00 28.35 ? 52  LEU A CD1  1 
ATOM   504  C CD2  . LEU A 1 52  ? 40.114  56.522 -20.852 1.00 23.63 ? 52  LEU A CD2  1 
ATOM   505  H H    . LEU A 1 52  ? 37.034  59.612 -20.825 1.00 0.00  ? 52  LEU A H    1 
ATOM   506  N N    . HIS A 1 53  ? 35.747  56.367 -22.791 1.00 20.95 ? 53  HIS A N    1 
ATOM   507  C CA   . HIS A 1 53  ? 34.415  55.911 -23.158 1.00 17.14 ? 53  HIS A CA   1 
ATOM   508  C C    . HIS A 1 53  ? 34.110  54.471 -22.731 1.00 17.13 ? 53  HIS A C    1 
ATOM   509  O O    . HIS A 1 53  ? 32.929  54.085 -22.642 1.00 17.53 ? 53  HIS A O    1 
ATOM   510  C CB   . HIS A 1 53  ? 34.220  56.000 -24.666 1.00 17.47 ? 53  HIS A CB   1 
ATOM   511  C CG   . HIS A 1 53  ? 34.326  57.383 -25.225 1.00 19.22 ? 53  HIS A CG   1 
ATOM   512  N ND1  . HIS A 1 53  ? 33.487  58.398 -24.803 1.00 21.59 ? 53  HIS A ND1  1 
ATOM   513  C CD2  . HIS A 1 53  ? 35.226  57.877 -26.119 1.00 20.70 ? 53  HIS A CD2  1 
ATOM   514  C CE1  . HIS A 1 53  ? 33.898  59.482 -25.439 1.00 25.85 ? 53  HIS A CE1  1 
ATOM   515  N NE2  . HIS A 1 53  ? 34.952  59.219 -26.251 1.00 23.38 ? 53  HIS A NE2  1 
ATOM   516  H H    . HIS A 1 53  ? 36.520  56.022 -23.306 1.00 0.00  ? 53  HIS A H    1 
ATOM   517  H HE2  . HIS A 1 53  ? 35.442  59.860 -26.807 1.00 0.00  ? 53  HIS A HE2  1 
ATOM   518  N N    . LEU A 1 54  ? 35.159  53.713 -22.411 1.00 16.05 ? 54  LEU A N    1 
ATOM   519  C CA   . LEU A 1 54  ? 35.030  52.312 -22.067 1.00 19.31 ? 54  LEU A CA   1 
ATOM   520  C C    . LEU A 1 54  ? 35.618  51.921 -20.733 1.00 22.33 ? 54  LEU A C    1 
ATOM   521  O O    . LEU A 1 54  ? 34.923  51.318 -19.907 1.00 24.08 ? 54  LEU A O    1 
ATOM   522  C CB   . LEU A 1 54  ? 35.673  51.472 -23.191 1.00 21.63 ? 54  LEU A CB   1 
ATOM   523  C CG   . LEU A 1 54  ? 35.285  50.011 -23.452 1.00 23.41 ? 54  LEU A CG   1 
ATOM   524  C CD1  . LEU A 1 54  ? 33.795  49.797 -23.230 1.00 23.90 ? 54  LEU A CD1  1 
ATOM   525  C CD2  . LEU A 1 54  ? 35.701  49.598 -24.866 1.00 21.48 ? 54  LEU A CD2  1 
ATOM   526  H H    . LEU A 1 54  ? 36.062  54.107 -22.423 1.00 0.00  ? 54  LEU A H    1 
ATOM   527  N N    . ILE A 1 55  ? 36.889  52.227 -20.512 1.00 21.78 ? 55  ILE A N    1 
ATOM   528  C CA   . ILE A 1 55  ? 37.533  51.861 -19.249 1.00 25.25 ? 55  ILE A CA   1 
ATOM   529  C C    . ILE A 1 55  ? 36.997  52.667 -18.055 1.00 24.34 ? 55  ILE A C    1 
ATOM   530  O O    . ILE A 1 55  ? 36.871  53.898 -18.124 1.00 25.99 ? 55  ILE A O    1 
ATOM   531  C CB   . ILE A 1 55  ? 39.070  52.060 -19.305 1.00 27.62 ? 55  ILE A CB   1 
ATOM   532  C CG1  . ILE A 1 55  ? 39.690  51.232 -20.423 1.00 28.07 ? 55  ILE A CG1  1 
ATOM   533  C CG2  . ILE A 1 55  ? 39.683  51.652 -18.006 1.00 25.66 ? 55  ILE A CG2  1 
ATOM   534  C CD1  . ILE A 1 55  ? 41.168  51.422 -20.533 1.00 30.17 ? 55  ILE A CD1  1 
ATOM   535  H H    . ILE A 1 55  ? 37.400  52.728 -21.192 1.00 0.00  ? 55  ILE A H    1 
ATOM   536  N N    . PRO A 1 56  ? 36.594  51.986 -16.978 1.00 22.40 ? 56  PRO A N    1 
ATOM   537  C CA   . PRO A 1 56  ? 36.103  52.802 -15.867 1.00 22.28 ? 56  PRO A CA   1 
ATOM   538  C C    . PRO A 1 56  ? 37.177  53.787 -15.332 1.00 23.38 ? 56  PRO A C    1 
ATOM   539  O O    . PRO A 1 56  ? 38.384  53.497 -15.352 1.00 20.47 ? 56  PRO A O    1 
ATOM   540  C CB   . PRO A 1 56  ? 35.704  51.753 -14.828 1.00 21.91 ? 56  PRO A CB   1 
ATOM   541  C CG   . PRO A 1 56  ? 35.187  50.615 -15.681 1.00 18.86 ? 56  PRO A CG   1 
ATOM   542  C CD   . PRO A 1 56  ? 36.244  50.562 -16.794 1.00 22.42 ? 56  PRO A CD   1 
ATOM   543  N N    . SER A 1 57  ? 36.699  54.962 -14.896 1.00 27.11 ? 57  SER A N    1 
ATOM   544  C CA   . SER A 1 57  ? 37.488  56.078 -14.341 1.00 25.15 ? 57  SER A CA   1 
ATOM   545  C C    . SER A 1 57  ? 38.251  55.635 -13.127 1.00 26.02 ? 57  SER A C    1 
ATOM   546  O O    . SER A 1 57  ? 39.269  56.221 -12.772 1.00 30.11 ? 57  SER A O    1 
ATOM   547  C CB   . SER A 1 57  ? 36.532  57.211 -13.933 1.00 29.72 ? 57  SER A CB   1 
ATOM   548  O OG   . SER A 1 57  ? 37.149  58.189 -13.105 1.00 33.08 ? 57  SER A OG   1 
ATOM   549  H H    . SER A 1 57  ? 35.728  55.099 -14.971 1.00 0.00  ? 57  SER A H    1 
ATOM   550  H HG   . SER A 1 57  ? 36.591  58.904 -12.715 1.00 0.00  ? 57  SER A HG   1 
ATOM   551  N N    . GLY A 1 58  ? 37.706  54.643 -12.435 1.00 26.13 ? 58  GLY A N    1 
ATOM   552  C CA   . GLY A 1 58  ? 38.349  54.115 -11.244 1.00 24.40 ? 58  GLY A CA   1 
ATOM   553  C C    . GLY A 1 58  ? 39.721  53.565 -11.560 1.00 22.55 ? 58  GLY A C    1 
ATOM   554  O O    . GLY A 1 58  ? 40.515  53.328 -10.661 1.00 22.35 ? 58  GLY A O    1 
ATOM   555  H H    . GLY A 1 58  ? 36.843  54.275 -12.710 1.00 0.00  ? 58  GLY A H    1 
ATOM   556  N N    . ILE A 1 59  ? 40.023  53.409 -12.846 1.00 21.02 ? 59  ILE A N    1 
ATOM   557  C CA   . ILE A 1 59  ? 41.315  52.882 -13.243 1.00 19.55 ? 59  ILE A CA   1 
ATOM   558  C C    . ILE A 1 59  ? 42.475  53.783 -12.760 1.00 20.54 ? 59  ILE A C    1 
ATOM   559  O O    . ILE A 1 59  ? 43.643  53.349 -12.759 1.00 16.76 ? 59  ILE A O    1 
ATOM   560  C CB   . ILE A 1 59  ? 41.345  52.584 -14.767 1.00 14.72 ? 59  ILE A CB   1 
ATOM   561  C CG1  . ILE A 1 59  ? 42.298  51.449 -15.075 1.00 9.97  ? 59  ILE A CG1  1 
ATOM   562  C CG2  . ILE A 1 59  ? 41.736  53.775 -15.570 1.00 12.05 ? 59  ILE A CG2  1 
ATOM   563  C CD1  . ILE A 1 59  ? 41.633  50.090 -15.024 1.00 12.72 ? 59  ILE A CD1  1 
ATOM   564  H H    . ILE A 1 59  ? 39.391  53.584 -13.572 1.00 0.00  ? 59  ILE A H    1 
ATOM   565  N N    . LEU A 1 60  ? 42.156  55.023 -12.351 1.00 22.04 ? 60  LEU A N    1 
ATOM   566  C CA   . LEU A 1 60  ? 43.183  55.938 -11.840 1.00 23.93 ? 60  LEU A CA   1 
ATOM   567  C C    . LEU A 1 60  ? 43.556  55.600 -10.398 1.00 24.07 ? 60  LEU A C    1 
ATOM   568  O O    . LEU A 1 60  ? 44.730  55.553 -10.062 1.00 25.49 ? 60  LEU A O    1 
ATOM   569  C CB   . LEU A 1 60  ? 42.758  57.419 -11.961 1.00 23.14 ? 60  LEU A CB   1 
ATOM   570  C CG   . LEU A 1 60  ? 42.462  58.055 -13.340 1.00 24.20 ? 60  LEU A CG   1 
ATOM   571  C CD1  . LEU A 1 60  ? 42.066  59.509 -13.151 1.00 23.37 ? 60  LEU A CD1  1 
ATOM   572  C CD2  . LEU A 1 60  ? 43.654  57.971 -14.303 1.00 23.22 ? 60  LEU A CD2  1 
ATOM   573  H H    . LEU A 1 60  ? 41.230  55.344 -12.412 1.00 0.00  ? 60  LEU A H    1 
ATOM   574  N N    . ARG A 1 61  ? 42.568  55.345 -9.547  1.00 25.34 ? 61  ARG A N    1 
ATOM   575  C CA   . ARG A 1 61  ? 42.841  54.996 -8.149  1.00 23.66 ? 61  ARG A CA   1 
ATOM   576  C C    . ARG A 1 61  ? 43.726  53.733 -8.007  1.00 23.22 ? 61  ARG A C    1 
ATOM   577  O O    . ARG A 1 61  ? 43.482  52.697 -8.636  1.00 19.42 ? 61  ARG A O    1 
ATOM   578  C CB   . ARG A 1 61  ? 41.531  54.803 -7.388  1.00 25.39 ? 61  ARG A CB   1 
ATOM   579  C CG   . ARG A 1 61  ? 41.140  55.961 -6.459  1.00 27.06 ? 61  ARG A CG   1 
ATOM   580  C CD   . ARG A 1 61  ? 40.285  57.032 -7.144  1.00 28.04 ? 61  ARG A CD   1 
ATOM   581  N NE   . ARG A 1 61  ? 40.339  58.278 -6.384  1.00 32.44 ? 61  ARG A NE   1 
ATOM   582  C CZ   . ARG A 1 61  ? 39.381  59.198 -6.355  1.00 34.68 ? 61  ARG A CZ   1 
ATOM   583  N NH1  . ARG A 1 61  ? 38.265  59.011 -7.039  1.00 36.58 ? 61  ARG A NH1  1 
ATOM   584  N NH2  . ARG A 1 61  ? 39.579  60.340 -5.715  1.00 34.68 ? 61  ARG A NH2  1 
ATOM   585  H H    . ARG A 1 61  ? 41.646  55.325 -9.869  1.00 0.00  ? 61  ARG A H    1 
ATOM   586  H HE   . ARG A 1 61  ? 41.145  58.428 -5.845  1.00 0.00  ? 61  ARG A HE   1 
ATOM   587  H HH11 . ARG A 1 61  ? 38.146  58.178 -7.578  1.00 0.00  ? 61  ARG A HH11 1 
ATOM   588  H HH12 . ARG A 1 61  ? 37.478  59.660 -7.037  1.00 0.00  ? 61  ARG A HH12 1 
ATOM   589  H HH21 . ARG A 1 61  ? 40.439  60.530 -5.236  1.00 0.00  ? 61  ARG A HH21 1 
ATOM   590  H HH22 . ARG A 1 61  ? 38.841  61.016 -5.649  1.00 0.00  ? 61  ARG A HH22 1 
ATOM   591  N N    . GLU A 1 62  ? 44.751  53.809 -7.169  1.00 25.48 ? 62  GLU A N    1 
ATOM   592  C CA   . GLU A 1 62  ? 45.635  52.664 -6.979  1.00 25.88 ? 62  GLU A CA   1 
ATOM   593  C C    . GLU A 1 62  ? 44.941  51.387 -6.466  1.00 25.72 ? 62  GLU A C    1 
ATOM   594  O O    . GLU A 1 62  ? 44.976  50.357 -7.124  1.00 28.61 ? 62  GLU A O    1 
ATOM   595  C CB   . GLU A 1 62  ? 46.811  53.007 -6.047  1.00 31.60 ? 62  GLU A CB   1 
ATOM   596  C CG   . GLU A 1 62  ? 47.996  53.709 -6.715  1.00 36.96 ? 62  GLU A CG   1 
ATOM   597  C CD   . GLU A 1 62  ? 47.652  55.105 -7.235  1.00 41.82 ? 62  GLU A CD   1 
ATOM   598  O OE1  . GLU A 1 62  ? 46.962  55.858 -6.501  1.00 42.44 ? 62  GLU A OE1  1 
ATOM   599  O OE2  . GLU A 1 62  ? 48.068  55.439 -8.379  1.00 44.12 ? 62  GLU A OE2  1 
ATOM   600  H H    . GLU A 1 62  ? 44.922  54.645 -6.683  1.00 0.00  ? 62  GLU A H    1 
ATOM   601  N N    . ASN A 1 63  ? 44.274  51.449 -5.329  1.00 23.49 ? 63  ASN A N    1 
ATOM   602  C CA   . ASN A 1 63  ? 43.680  50.253 -4.811  1.00 23.24 ? 63  ASN A CA   1 
ATOM   603  C C    . ASN A 1 63  ? 42.275  49.854 -5.259  1.00 20.26 ? 63  ASN A C    1 
ATOM   604  O O    . ASN A 1 63  ? 41.573  49.169 -4.542  1.00 18.79 ? 63  ASN A O    1 
ATOM   605  C CB   . ASN A 1 63  ? 43.809  50.236 -3.293  1.00 26.60 ? 63  ASN A CB   1 
ATOM   606  C CG   . ASN A 1 63  ? 44.577  49.018 -2.808  1.00 30.91 ? 63  ASN A CG   1 
ATOM   607  O OD1  . ASN A 1 63  ? 43.997  47.948 -2.572  1.00 32.23 ? 63  ASN A OD1  1 
ATOM   608  N ND2  . ASN A 1 63  ? 45.907  49.157 -2.709  1.00 37.22 ? 63  ASN A ND2  1 
ATOM   609  H H    . ASN A 1 63  ? 44.157  52.312 -4.882  1.00 0.00  ? 63  ASN A H    1 
ATOM   610  H HD21 . ASN A 1 63  ? 46.400  48.368 -2.413  1.00 0.00  ? 63  ASN A HD21 1 
ATOM   611  H HD22 . ASN A 1 63  ? 46.310  50.018 -2.938  1.00 0.00  ? 63  ASN A HD22 1 
ATOM   612  N N    . VAL A 1 64  ? 41.927  50.160 -6.493  1.00 20.85 ? 64  VAL A N    1 
ATOM   613  C CA   . VAL A 1 64  ? 40.611  49.848 -7.015  1.00 20.57 ? 64  VAL A CA   1 
ATOM   614  C C    . VAL A 1 64  ? 40.728  48.923 -8.232  1.00 23.11 ? 64  VAL A C    1 
ATOM   615  O O    . VAL A 1 64  ? 41.729  48.971 -8.959  1.00 22.18 ? 64  VAL A O    1 
ATOM   616  C CB   . VAL A 1 64  ? 39.892  51.158 -7.417  1.00 17.05 ? 64  VAL A CB   1 
ATOM   617  C CG1  . VAL A 1 64  ? 38.550  50.875 -8.127  1.00 19.64 ? 64  VAL A CG1  1 
ATOM   618  C CG2  . VAL A 1 64  ? 39.665  51.997 -6.173  1.00 20.45 ? 64  VAL A CG2  1 
ATOM   619  H H    . VAL A 1 64  ? 42.567  50.572 -7.111  1.00 0.00  ? 64  VAL A H    1 
ATOM   620  N N    . THR A 1 65  ? 39.718  48.074 -8.440  1.00 23.23 ? 65  THR A N    1 
ATOM   621  C CA   . THR A 1 65  ? 39.699  47.166 -9.590  1.00 22.07 ? 65  THR A CA   1 
ATOM   622  C C    . THR A 1 65  ? 38.526  47.532 -10.477 1.00 20.87 ? 65  THR A C    1 
ATOM   623  O O    . THR A 1 65  ? 37.377  47.571 -10.016 1.00 19.74 ? 65  THR A O    1 
ATOM   624  C CB   . THR A 1 65  ? 39.538  45.696 -9.152  1.00 23.93 ? 65  THR A CB   1 
ATOM   625  O OG1  . THR A 1 65  ? 40.576  45.355 -8.227  1.00 28.05 ? 65  THR A OG1  1 
ATOM   626  C CG2  . THR A 1 65  ? 39.633  44.786 -10.337 1.00 22.29 ? 65  THR A CG2  1 
ATOM   627  H H    . THR A 1 65  ? 38.992  48.057 -7.775  1.00 0.00  ? 65  THR A H    1 
ATOM   628  H HG1  . THR A 1 65  ? 41.414  45.535 -8.679  1.00 0.00  ? 65  THR A HG1  1 
ATOM   629  N N    . SER A 1 66  ? 38.815  47.789 -11.754 1.00 20.49 ? 66  SER A N    1 
ATOM   630  C CA   . SER A 1 66  ? 37.787  48.174 -12.737 1.00 16.97 ? 66  SER A CA   1 
ATOM   631  C C    . SER A 1 66  ? 37.381  46.930 -13.508 1.00 16.83 ? 66  SER A C    1 
ATOM   632  O O    . SER A 1 66  ? 38.237  46.207 -14.059 1.00 17.41 ? 66  SER A O    1 
ATOM   633  C CB   . SER A 1 66  ? 38.325  49.256 -13.684 1.00 15.06 ? 66  SER A CB   1 
ATOM   634  O OG   . SER A 1 66  ? 38.651  50.469 -12.979 1.00 13.03 ? 66  SER A OG   1 
ATOM   635  H H    . SER A 1 66  ? 39.731  47.654 -12.090 1.00 0.00  ? 66  SER A H    1 
ATOM   636  H HG   . SER A 1 66  ? 39.388  50.280 -12.387 1.00 0.00  ? 66  SER A HG   1 
ATOM   637  N N    . ILE A 1 67  ? 36.075  46.683 -13.543 1.00 15.28 ? 67  ILE A N    1 
ATOM   638  C CA   . ILE A 1 67  ? 35.523  45.486 -14.182 1.00 14.78 ? 67  ILE A CA   1 
ATOM   639  C C    . ILE A 1 67  ? 34.508  45.801 -15.286 1.00 14.82 ? 67  ILE A C    1 
ATOM   640  O O    . ILE A 1 67  ? 33.542  46.545 -15.068 1.00 14.03 ? 67  ILE A O    1 
ATOM   641  C CB   . ILE A 1 67  ? 34.743  44.570 -13.081 1.00 12.60 ? 67  ILE A CB   1 
ATOM   642  C CG1  . ILE A 1 67  ? 35.635  44.259 -11.885 1.00 9.21  ? 67  ILE A CG1  1 
ATOM   643  C CG2  . ILE A 1 67  ? 34.169  43.284 -13.688 1.00 5.01  ? 67  ILE A CG2  1 
ATOM   644  C CD1  . ILE A 1 67  ? 34.958  43.397 -10.868 1.00 9.53  ? 67  ILE A CD1  1 
ATOM   645  H H    . ILE A 1 67  ? 35.447  47.314 -13.118 1.00 0.00  ? 67  ILE A H    1 
ATOM   646  N N    . ILE A 1 68  ? 34.658  45.184 -16.445 1.00 13.30 ? 68  ILE A N    1 
ATOM   647  C CA   . ILE A 1 68  ? 33.633  45.426 -17.450 1.00 16.81 ? 68  ILE A CA   1 
ATOM   648  C C    . ILE A 1 68  ? 32.673  44.206 -17.507 1.00 14.34 ? 68  ILE A C    1 
ATOM   649  O O    . ILE A 1 68  ? 33.097  43.087 -17.888 1.00 12.88 ? 68  ILE A O    1 
ATOM   650  C CB   . ILE A 1 68  ? 34.239  45.807 -18.821 1.00 21.15 ? 68  ILE A CB   1 
ATOM   651  C CG1  . ILE A 1 68  ? 34.853  47.207 -18.765 1.00 20.37 ? 68  ILE A CG1  1 
ATOM   652  C CG2  . ILE A 1 68  ? 33.179  45.739 -19.912 1.00 19.04 ? 68  ILE A CG2  1 
ATOM   653  C CD1  . ILE A 1 68  ? 35.416  47.607 -20.089 1.00 22.94 ? 68  ILE A CD1  1 
ATOM   654  H H    . ILE A 1 68  ? 35.445  44.604 -16.573 1.00 0.00  ? 68  ILE A H    1 
ATOM   655  N N    . GLY A 1 69  ? 31.449  44.414 -17.000 1.00 12.96 ? 69  GLY A N    1 
ATOM   656  C CA   . GLY A 1 69  ? 30.428  43.356 -16.954 1.00 13.84 ? 69  GLY A CA   1 
ATOM   657  C C    . GLY A 1 69  ? 29.853  42.849 -18.275 1.00 12.07 ? 69  GLY A C    1 
ATOM   658  O O    . GLY A 1 69  ? 29.872  43.568 -19.289 1.00 12.68 ? 69  GLY A O    1 
ATOM   659  H H    . GLY A 1 69  ? 31.148  45.294 -16.686 1.00 0.00  ? 69  GLY A H    1 
ATOM   660  N N    . ASN A 1 70  ? 29.301  41.633 -18.271 1.00 12.23 ? 70  ASN A N    1 
ATOM   661  C CA   . ASN A 1 70  ? 28.700  41.022 -19.492 1.00 12.96 ? 70  ASN A CA   1 
ATOM   662  C C    . ASN A 1 70  ? 27.652  41.867 -20.254 1.00 12.02 ? 70  ASN A C    1 
ATOM   663  O O    . ASN A 1 70  ? 27.380  41.620 -21.438 1.00 10.17 ? 70  ASN A O    1 
ATOM   664  C CB   . ASN A 1 70  ? 28.136  39.629 -19.196 1.00 16.42 ? 70  ASN A CB   1 
ATOM   665  C CG   . ASN A 1 70  ? 27.112  39.642 -18.094 1.00 20.67 ? 70  ASN A CG   1 
ATOM   666  O OD1  . ASN A 1 70  ? 27.467  39.740 -16.923 1.00 25.96 ? 70  ASN A OD1  1 
ATOM   667  N ND2  . ASN A 1 70  ? 25.839  39.557 -18.454 1.00 22.28 ? 70  ASN A ND2  1 
ATOM   668  H H    . ASN A 1 70  ? 29.263  41.137 -17.423 1.00 0.00  ? 70  ASN A H    1 
ATOM   669  H HD21 . ASN A 1 70  ? 25.120  39.682 -17.797 1.00 0.00  ? 70  ASN A HD21 1 
ATOM   670  H HD22 . ASN A 1 70  ? 25.634  39.400 -19.412 1.00 0.00  ? 70  ASN A HD22 1 
ATOM   671  N N    . GLY A 1 71  ? 27.029  42.825 -19.560 1.00 10.07 ? 71  GLY A N    1 
ATOM   672  C CA   . GLY A 1 71  ? 26.081  43.718 -20.217 1.00 7.78  ? 71  GLY A CA   1 
ATOM   673  C C    . GLY A 1 71  ? 26.756  44.697 -21.194 1.00 9.16  ? 71  GLY A C    1 
ATOM   674  O O    . GLY A 1 71  ? 26.117  45.177 -22.138 1.00 8.93  ? 71  GLY A O    1 
ATOM   675  H H    . GLY A 1 71  ? 27.195  42.904 -18.596 1.00 0.00  ? 71  GLY A H    1 
ATOM   676  N N    . VAL A 1 72  ? 28.066  44.899 -21.064 1.00 8.80  ? 72  VAL A N    1 
ATOM   677  C CA   . VAL A 1 72  ? 28.760  45.824 -21.934 1.00 8.47  ? 72  VAL A CA   1 
ATOM   678  C C    . VAL A 1 72  ? 29.097  45.134 -23.260 1.00 9.00  ? 72  VAL A C    1 
ATOM   679  O O    . VAL A 1 72  ? 29.447  43.957 -23.271 1.00 8.06  ? 72  VAL A O    1 
ATOM   680  C CB   . VAL A 1 72  ? 30.105  46.345 -21.274 1.00 10.93 ? 72  VAL A CB   1 
ATOM   681  C CG1  . VAL A 1 72  ? 30.833  47.286 -22.200 1.00 5.01  ? 72  VAL A CG1  1 
ATOM   682  C CG2  . VAL A 1 72  ? 29.856  47.029 -19.927 1.00 5.01  ? 72  VAL A CG2  1 
ATOM   683  H H    . VAL A 1 72  ? 28.619  44.398 -20.423 1.00 0.00  ? 72  VAL A H    1 
ATOM   684  N N    . VAL A 1 73  ? 28.992  45.865 -24.373 1.00 9.40  ? 73  VAL A N    1 
ATOM   685  C CA   . VAL A 1 73  ? 29.342  45.345 -25.695 1.00 10.92 ? 73  VAL A CA   1 
ATOM   686  C C    . VAL A 1 73  ? 30.790  45.799 -25.901 1.00 8.79  ? 73  VAL A C    1 
ATOM   687  O O    . VAL A 1 73  ? 31.095  46.975 -25.697 1.00 6.99  ? 73  VAL A O    1 
ATOM   688  C CB   . VAL A 1 73  ? 28.401  45.867 -26.769 1.00 9.41  ? 73  VAL A CB   1 
ATOM   689  C CG1  . VAL A 1 73  ? 27.290  44.849 -27.000 1.00 7.54  ? 73  VAL A CG1  1 
ATOM   690  C CG2  . VAL A 1 73  ? 27.785  47.159 -26.341 1.00 6.21  ? 73  VAL A CG2  1 
ATOM   691  H H    . VAL A 1 73  ? 28.691  46.784 -24.218 1.00 0.00  ? 73  VAL A H    1 
ATOM   692  N N    . LEU A 1 74  ? 31.673  44.915 -26.339 1.00 7.89  ? 74  LEU A N    1 
ATOM   693  C CA   . LEU A 1 74  ? 33.079  45.287 -26.391 1.00 12.79 ? 74  LEU A CA   1 
ATOM   694  C C    . LEU A 1 74  ? 33.758  45.406 -27.743 1.00 13.72 ? 74  LEU A C    1 
ATOM   695  O O    . LEU A 1 74  ? 33.506  44.594 -28.644 1.00 16.88 ? 74  LEU A O    1 
ATOM   696  C CB   . LEU A 1 74  ? 33.891  44.334 -25.503 1.00 10.76 ? 74  LEU A CB   1 
ATOM   697  C CG   . LEU A 1 74  ? 35.312  44.755 -25.140 1.00 13.76 ? 74  LEU A CG   1 
ATOM   698  C CD1  . LEU A 1 74  ? 35.188  45.821 -24.050 1.00 13.51 ? 74  LEU A CD1  1 
ATOM   699  C CD2  . LEU A 1 74  ? 36.191  43.557 -24.674 1.00 10.82 ? 74  LEU A CD2  1 
ATOM   700  H H    . LEU A 1 74  ? 31.405  44.003 -26.621 1.00 0.00  ? 74  LEU A H    1 
ATOM   701  N N    . SER A 1 75  ? 34.609  46.432 -27.863 1.00 12.36 ? 75  SER A N    1 
ATOM   702  C CA   . SER A 1 75  ? 35.387  46.708 -29.049 1.00 11.60 ? 75  SER A CA   1 
ATOM   703  C C    . SER A 1 75  ? 36.863  46.591 -28.726 1.00 10.23 ? 75  SER A C    1 
ATOM   704  O O    . SER A 1 75  ? 37.396  47.367 -27.947 1.00 8.56  ? 75  SER A O    1 
ATOM   705  C CB   . SER A 1 75  ? 35.116  48.124 -29.583 1.00 13.39 ? 75  SER A CB   1 
ATOM   706  O OG   . SER A 1 75  ? 36.061  48.462 -30.613 1.00 17.51 ? 75  SER A OG   1 
ATOM   707  H H    . SER A 1 75  ? 34.725  47.031 -27.098 1.00 0.00  ? 75  SER A H    1 
ATOM   708  H HG   . SER A 1 75  ? 35.582  49.051 -31.229 1.00 0.00  ? 75  SER A HG   1 
ATOM   709  N N    . PRO A 1 76  ? 37.537  45.562 -29.271 1.00 12.38 ? 76  PRO A N    1 
ATOM   710  C CA   . PRO A 1 76  ? 38.976  45.427 -28.982 1.00 10.43 ? 76  PRO A CA   1 
ATOM   711  C C    . PRO A 1 76  ? 39.666  46.704 -29.417 1.00 12.36 ? 76  PRO A C    1 
ATOM   712  O O    . PRO A 1 76  ? 40.555  47.195 -28.725 1.00 16.21 ? 76  PRO A O    1 
ATOM   713  C CB   . PRO A 1 76  ? 39.388  44.259 -29.856 1.00 11.76 ? 76  PRO A CB   1 
ATOM   714  C CG   . PRO A 1 76  ? 38.145  43.407 -29.862 1.00 9.57  ? 76  PRO A CG   1 
ATOM   715  C CD   . PRO A 1 76  ? 37.038  44.409 -30.053 1.00 10.00 ? 76  PRO A CD   1 
ATOM   716  N N    . ALA A 1 77  ? 39.190  47.280 -30.516 1.00 13.54 ? 77  ALA A N    1 
ATOM   717  C CA   . ALA A 1 77  ? 39.736  48.516 -31.053 1.00 12.42 ? 77  ALA A CA   1 
ATOM   718  C C    . ALA A 1 77  ? 39.606  49.599 -30.014 1.00 12.04 ? 77  ALA A C    1 
ATOM   719  O O    . ALA A 1 77  ? 40.616  50.040 -29.450 1.00 14.36 ? 77  ALA A O    1 
ATOM   720  C CB   . ALA A 1 77  ? 39.004  48.893 -32.281 1.00 13.00 ? 77  ALA A CB   1 
ATOM   721  H H    . ALA A 1 77  ? 38.438  46.867 -30.983 1.00 0.00  ? 77  ALA A H    1 
ATOM   722  N N    . ALA A 1 78  ? 38.368  49.972 -29.692 1.00 15.93 ? 78  ALA A N    1 
ATOM   723  C CA   . ALA A 1 78  ? 38.092  50.994 -28.686 1.00 16.92 ? 78  ALA A CA   1 
ATOM   724  C C    . ALA A 1 78  ? 38.923  50.750 -27.431 1.00 20.88 ? 78  ALA A C    1 
ATOM   725  O O    . ALA A 1 78  ? 39.665  51.637 -26.979 1.00 23.08 ? 78  ALA A O    1 
ATOM   726  C CB   . ALA A 1 78  ? 36.643  50.984 -28.327 1.00 21.24 ? 78  ALA A CB   1 
ATOM   727  H H    . ALA A 1 78  ? 37.610  49.502 -30.104 1.00 0.00  ? 78  ALA A H    1 
ATOM   728  N N    . LEU A 1 79  ? 38.832  49.526 -26.912 1.00 20.91 ? 79  LEU A N    1 
ATOM   729  C CA   . LEU A 1 79  ? 39.558  49.099 -25.720 1.00 22.87 ? 79  LEU A CA   1 
ATOM   730  C C    . LEU A 1 79  ? 41.062  49.369 -25.906 1.00 22.85 ? 79  LEU A C    1 
ATOM   731  O O    . LEU A 1 79  ? 41.635  50.269 -25.273 1.00 20.09 ? 79  LEU A O    1 
ATOM   732  C CB   . LEU A 1 79  ? 39.279  47.608 -25.494 1.00 22.87 ? 79  LEU A CB   1 
ATOM   733  C CG   . LEU A 1 79  ? 39.654  46.800 -24.247 1.00 23.73 ? 79  LEU A CG   1 
ATOM   734  C CD1  . LEU A 1 79  ? 41.154  46.607 -24.170 1.00 24.33 ? 79  LEU A CD1  1 
ATOM   735  C CD2  . LEU A 1 79  ? 39.120  47.475 -23.018 1.00 23.68 ? 79  LEU A CD2  1 
ATOM   736  H H    . LEU A 1 79  ? 38.264  48.851 -27.342 1.00 0.00  ? 79  LEU A H    1 
ATOM   737  N N    . MET A 1 80  ? 41.666  48.649 -26.847 1.00 24.88 ? 80  MET A N    1 
ATOM   738  C CA   . MET A 1 80  ? 43.084  48.799 -27.140 1.00 27.40 ? 80  MET A CA   1 
ATOM   739  C C    . MET A 1 80  ? 43.464  50.265 -27.263 1.00 27.28 ? 80  MET A C    1 
ATOM   740  O O    . MET A 1 80  ? 44.578  50.645 -26.908 1.00 31.73 ? 80  MET A O    1 
ATOM   741  C CB   . MET A 1 80  ? 43.460  48.048 -28.425 1.00 28.55 ? 80  MET A CB   1 
ATOM   742  C CG   . MET A 1 80  ? 43.288  46.564 -28.320 1.00 29.81 ? 80  MET A CG   1 
ATOM   743  S SD   . MET A 1 80  ? 44.186  45.910 -26.916 1.00 40.90 ? 80  MET A SD   1 
ATOM   744  C CE   . MET A 1 80  ? 45.865  45.787 -27.600 1.00 33.62 ? 80  MET A CE   1 
ATOM   745  H H    . MET A 1 80  ? 41.155  48.034 -27.425 1.00 0.00  ? 80  MET A H    1 
ATOM   746  N N    . LYS A 1 81  ? 42.565  51.095 -27.781 1.00 27.86 ? 81  LYS A N    1 
ATOM   747  C CA   . LYS A 1 81  ? 42.885  52.515 -27.880 1.00 29.54 ? 81  LYS A CA   1 
ATOM   748  C C    . LYS A 1 81  ? 43.104  53.164 -26.479 1.00 30.10 ? 81  LYS A C    1 
ATOM   749  O O    . LYS A 1 81  ? 44.200  53.689 -26.178 1.00 31.12 ? 81  LYS A O    1 
ATOM   750  C CB   . LYS A 1 81  ? 41.789  53.249 -28.653 1.00 29.66 ? 81  LYS A CB   1 
ATOM   751  C CG   . LYS A 1 81  ? 42.003  54.774 -28.768 1.00 31.83 ? 81  LYS A CG   1 
ATOM   752  C CD   . LYS A 1 81  ? 40.874  55.434 -29.557 1.00 30.59 ? 81  LYS A CD   1 
ATOM   753  C CE   . LYS A 1 81  ? 41.171  56.918 -29.841 1.00 30.98 ? 81  LYS A CE   1 
ATOM   754  N NZ   . LYS A 1 81  ? 41.275  57.744 -28.610 1.00 29.72 ? 81  LYS A NZ   1 
ATOM   755  H H    . LYS A 1 81  ? 41.728  50.742 -28.159 1.00 0.00  ? 81  LYS A H    1 
ATOM   756  H HZ1  . LYS A 1 81  ? 40.381  57.628 -28.085 1.00 0.00  ? 81  LYS A HZ1  1 
ATOM   757  H HZ2  . LYS A 1 81  ? 42.072  57.502 -27.977 1.00 0.00  ? 81  LYS A HZ2  1 
ATOM   758  H HZ3  . LYS A 1 81  ? 41.365  58.761 -28.820 1.00 0.00  ? 81  LYS A HZ3  1 
ATOM   759  N N    . GLU A 1 82  ? 42.101  53.053 -25.602 1.00 28.48 ? 82  GLU A N    1 
ATOM   760  C CA   . GLU A 1 82  ? 42.188  53.666 -24.275 1.00 27.93 ? 82  GLU A CA   1 
ATOM   761  C C    . GLU A 1 82  ? 43.275  53.013 -23.428 1.00 25.36 ? 82  GLU A C    1 
ATOM   762  O O    . GLU A 1 82  ? 43.952  53.671 -22.634 1.00 24.22 ? 82  GLU A O    1 
ATOM   763  C CB   . GLU A 1 82  ? 40.819  53.651 -23.569 1.00 27.91 ? 82  GLU A CB   1 
ATOM   764  C CG   . GLU A 1 82  ? 39.638  54.109 -24.477 1.00 27.87 ? 82  GLU A CG   1 
ATOM   765  C CD   . GLU A 1 82  ? 38.348  54.357 -23.706 1.00 24.89 ? 82  GLU A CD   1 
ATOM   766  O OE1  . GLU A 1 82  ? 38.237  53.923 -22.561 1.00 27.74 ? 82  GLU A OE1  1 
ATOM   767  O OE2  . GLU A 1 82  ? 37.433  54.999 -24.230 1.00 22.48 ? 82  GLU A OE2  1 
ATOM   768  H H    . GLU A 1 82  ? 41.296  52.558 -25.885 1.00 0.00  ? 82  GLU A H    1 
ATOM   769  N N    . MET A 1 83  ? 43.460  51.718 -23.611 1.00 25.47 ? 83  MET A N    1 
ATOM   770  C CA   . MET A 1 83  ? 44.494  51.012 -22.877 1.00 26.83 ? 83  MET A CA   1 
ATOM   771  C C    . MET A 1 83  ? 45.805  51.747 -23.146 1.00 28.16 ? 83  MET A C    1 
ATOM   772  O O    . MET A 1 83  ? 46.461  52.193 -22.204 1.00 27.39 ? 83  MET A O    1 
ATOM   773  C CB   . MET A 1 83  ? 44.576  49.546 -23.321 1.00 26.80 ? 83  MET A CB   1 
ATOM   774  C CG   . MET A 1 83  ? 45.530  48.671 -22.487 1.00 28.87 ? 83  MET A CG   1 
ATOM   775  S SD   . MET A 1 83  ? 45.050  46.909 -22.636 1.00 30.49 ? 83  MET A SD   1 
ATOM   776  C CE   . MET A 1 83  ? 43.456  47.010 -21.754 1.00 29.75 ? 83  MET A CE   1 
ATOM   777  H H    . MET A 1 83  ? 42.864  51.248 -24.242 1.00 0.00  ? 83  MET A H    1 
ATOM   778  N N    . LYS A 1 84  ? 46.083  52.002 -24.430 1.00 29.82 ? 84  LYS A N    1 
ATOM   779  C CA   . LYS A 1 84  ? 47.301  52.699 -24.857 1.00 30.75 ? 84  LYS A CA   1 
ATOM   780  C C    . LYS A 1 84  ? 47.522  54.088 -24.227 1.00 29.40 ? 84  LYS A C    1 
ATOM   781  O O    . LYS A 1 84  ? 48.605  54.383 -23.699 1.00 28.24 ? 84  LYS A O    1 
ATOM   782  C CB   . LYS A 1 84  ? 47.317  52.820 -26.371 1.00 33.55 ? 84  LYS A CB   1 
ATOM   783  C CG   . LYS A 1 84  ? 48.730  53.023 -26.969 1.00 40.11 ? 84  LYS A CG   1 
ATOM   784  C CD   . LYS A 1 84  ? 49.496  51.692 -27.255 1.00 43.26 ? 84  LYS A CD   1 
ATOM   785  C CE   . LYS A 1 84  ? 50.131  51.023 -26.010 1.00 43.39 ? 84  LYS A CE   1 
ATOM   786  N NZ   . LYS A 1 84  ? 51.367  51.706 -25.486 1.00 44.43 ? 84  LYS A NZ   1 
ATOM   787  H H    . LYS A 1 84  ? 45.472  51.693 -25.134 1.00 0.00  ? 84  LYS A H    1 
ATOM   788  H HZ1  . LYS A 1 84  ? 52.102  51.754 -26.217 1.00 0.00  ? 84  LYS A HZ1  1 
ATOM   789  H HZ2  . LYS A 1 84  ? 51.181  52.684 -25.159 1.00 0.00  ? 84  LYS A HZ2  1 
ATOM   790  H HZ3  . LYS A 1 84  ? 51.725  51.182 -24.663 1.00 0.00  ? 84  LYS A HZ3  1 
ATOM   791  N N    . GLU A 1 85  ? 46.514  54.952 -24.328 1.00 29.83 ? 85  GLU A N    1 
ATOM   792  C CA   . GLU A 1 85  ? 46.597  56.301 -23.761 1.00 30.81 ? 85  GLU A CA   1 
ATOM   793  C C    . GLU A 1 85  ? 46.942  56.246 -22.268 1.00 29.93 ? 85  GLU A C    1 
ATOM   794  O O    . GLU A 1 85  ? 47.924  56.843 -21.851 1.00 30.12 ? 85  GLU A O    1 
ATOM   795  C CB   . GLU A 1 85  ? 45.290  57.084 -23.997 1.00 30.21 ? 85  GLU A CB   1 
ATOM   796  C CG   . GLU A 1 85  ? 45.068  57.481 -25.442 1.00 31.78 ? 85  GLU A CG   1 
ATOM   797  C CD   . GLU A 1 85  ? 43.577  57.543 -25.852 1.00 36.33 ? 85  GLU A CD   1 
ATOM   798  O OE1  . GLU A 1 85  ? 42.693  57.117 -25.074 1.00 36.68 ? 85  GLU A OE1  1 
ATOM   799  O OE2  . GLU A 1 85  ? 43.287  58.012 -26.980 1.00 34.07 ? 85  GLU A OE2  1 
ATOM   800  H H    . GLU A 1 85  ? 45.711  54.656 -24.813 1.00 0.00  ? 85  GLU A H    1 
ATOM   801  N N    . LEU A 1 86  ? 46.188  55.481 -21.477 1.00 27.80 ? 86  LEU A N    1 
ATOM   802  C CA   . LEU A 1 86  ? 46.475  55.368 -20.043 1.00 25.30 ? 86  LEU A CA   1 
ATOM   803  C C    . LEU A 1 86  ? 47.849  54.778 -19.720 1.00 23.33 ? 86  LEU A C    1 
ATOM   804  O O    . LEU A 1 86  ? 48.545  55.290 -18.854 1.00 25.39 ? 86  LEU A O    1 
ATOM   805  C CB   . LEU A 1 86  ? 45.390  54.564 -19.309 1.00 23.55 ? 86  LEU A CB   1 
ATOM   806  C CG   . LEU A 1 86  ? 43.986  55.146 -19.299 1.00 21.23 ? 86  LEU A CG   1 
ATOM   807  C CD1  . LEU A 1 86  ? 43.036  54.262 -18.575 1.00 21.34 ? 86  LEU A CD1  1 
ATOM   808  C CD2  . LEU A 1 86  ? 44.011  56.523 -18.675 1.00 19.82 ? 86  LEU A CD2  1 
ATOM   809  H H    . LEU A 1 86  ? 45.441  54.962 -21.860 1.00 0.00  ? 86  LEU A H    1 
ATOM   810  N N    . GLU A 1 87  ? 48.225  53.685 -20.367 1.00 22.42 ? 87  GLU A N    1 
ATOM   811  C CA   . GLU A 1 87  ? 49.517  53.076 -20.091 1.00 24.08 ? 87  GLU A CA   1 
ATOM   812  C C    . GLU A 1 87  ? 50.655  54.054 -20.394 1.00 27.20 ? 87  GLU A C    1 
ATOM   813  O O    . GLU A 1 87  ? 51.659  54.122 -19.674 1.00 28.71 ? 87  GLU A O    1 
ATOM   814  C CB   . GLU A 1 87  ? 49.688  51.743 -20.866 1.00 23.16 ? 87  GLU A CB   1 
ATOM   815  C CG   . GLU A 1 87  ? 48.579  50.722 -20.535 1.00 19.72 ? 87  GLU A CG   1 
ATOM   816  C CD   . GLU A 1 87  ? 49.047  49.283 -20.455 1.00 19.35 ? 87  GLU A CD   1 
ATOM   817  O OE1  . GLU A 1 87  ? 49.421  48.679 -21.486 1.00 21.53 ? 87  GLU A OE1  1 
ATOM   818  O OE2  . GLU A 1 87  ? 48.983  48.726 -19.342 1.00 24.09 ? 87  GLU A OE2  1 
ATOM   819  H H    . GLU A 1 87  ? 47.622  53.250 -21.010 1.00 0.00  ? 87  GLU A H    1 
ATOM   820  N N    . ASP A 1 88  ? 50.494  54.816 -21.467 1.00 29.53 ? 88  ASP A N    1 
ATOM   821  C CA   . ASP A 1 88  ? 51.492  55.804 -21.849 1.00 29.36 ? 88  ASP A CA   1 
ATOM   822  C C    . ASP A 1 88  ? 51.630  56.860 -20.777 1.00 29.99 ? 88  ASP A C    1 
ATOM   823  O O    . ASP A 1 88  ? 52.715  57.347 -20.542 1.00 31.14 ? 88  ASP A O    1 
ATOM   824  C CB   . ASP A 1 88  ? 51.117  56.461 -23.176 1.00 28.82 ? 88  ASP A CB   1 
ATOM   825  C CG   . ASP A 1 88  ? 51.700  55.743 -24.368 1.00 26.11 ? 88  ASP A CG   1 
ATOM   826  O OD1  . ASP A 1 88  ? 51.841  54.513 -24.284 1.00 22.43 ? 88  ASP A OD1  1 
ATOM   827  O OD2  . ASP A 1 88  ? 52.024  56.415 -25.384 1.00 27.16 ? 88  ASP A OD2  1 
ATOM   828  H H    . ASP A 1 88  ? 49.717  54.698 -22.058 1.00 0.00  ? 88  ASP A H    1 
ATOM   829  N N    . ARG A 1 89  ? 50.522  57.214 -20.134 1.00 31.49 ? 89  ARG A N    1 
ATOM   830  C CA   . ARG A 1 89  ? 50.537  58.218 -19.080 1.00 33.75 ? 89  ARG A CA   1 
ATOM   831  C C    . ARG A 1 89  ? 50.935  57.639 -17.708 1.00 34.93 ? 89  ARG A C    1 
ATOM   832  O O    . ARG A 1 89  ? 50.495  58.142 -16.666 1.00 35.75 ? 89  ARG A O    1 
ATOM   833  C CB   . ARG A 1 89  ? 49.167  58.921 -18.989 1.00 34.94 ? 89  ARG A CB   1 
ATOM   834  C CG   . ARG A 1 89  ? 48.889  60.020 -20.053 1.00 36.41 ? 89  ARG A CG   1 
ATOM   835  C CD   . ARG A 1 89  ? 48.909  59.448 -21.453 1.00 41.37 ? 89  ARG A CD   1 
ATOM   836  N NE   . ARG A 1 89  ? 48.625  60.408 -22.520 1.00 43.60 ? 89  ARG A NE   1 
ATOM   837  C CZ   . ARG A 1 89  ? 48.724  60.125 -23.820 1.00 43.00 ? 89  ARG A CZ   1 
ATOM   838  N NH1  . ARG A 1 89  ? 49.085  58.909 -24.208 1.00 41.94 ? 89  ARG A NH1  1 
ATOM   839  N NH2  . ARG A 1 89  ? 48.521  61.069 -24.731 1.00 42.05 ? 89  ARG A NH2  1 
ATOM   840  H H    . ARG A 1 89  ? 49.669  56.824 -20.421 1.00 0.00  ? 89  ARG A H    1 
ATOM   841  H HE   . ARG A 1 89  ? 48.319  61.298 -22.226 1.00 0.00  ? 89  ARG A HE   1 
ATOM   842  H HH11 . ARG A 1 89  ? 49.273  58.215 -23.507 1.00 0.00  ? 89  ARG A HH11 1 
ATOM   843  H HH12 . ARG A 1 89  ? 49.184  58.640 -25.164 1.00 0.00  ? 89  ARG A HH12 1 
ATOM   844  H HH21 . ARG A 1 89  ? 48.235  61.973 -24.388 1.00 0.00  ? 89  ARG A HH21 1 
ATOM   845  H HH22 . ARG A 1 89  ? 48.582  60.906 -25.714 1.00 0.00  ? 89  ARG A HH22 1 
ATOM   846  N N    . GLY A 1 90  ? 51.773  56.595 -17.707 1.00 36.05 ? 90  GLY A N    1 
ATOM   847  C CA   . GLY A 1 90  ? 52.216  55.956 -16.463 1.00 34.25 ? 90  GLY A CA   1 
ATOM   848  C C    . GLY A 1 90  ? 51.236  55.049 -15.693 1.00 32.93 ? 90  GLY A C    1 
ATOM   849  O O    . GLY A 1 90  ? 51.584  54.510 -14.639 1.00 33.46 ? 90  GLY A O    1 
ATOM   850  H H    . GLY A 1 90  ? 52.097  56.231 -18.551 1.00 0.00  ? 90  GLY A H    1 
ATOM   851  N N    . ILE A 1 91  ? 50.024  54.860 -16.203 1.00 29.84 ? 91  ILE A N    1 
ATOM   852  C CA   . ILE A 1 91  ? 49.032  54.022 -15.543 1.00 25.46 ? 91  ILE A CA   1 
ATOM   853  C C    . ILE A 1 91  ? 49.040  52.591 -16.108 1.00 26.30 ? 91  ILE A C    1 
ATOM   854  O O    . ILE A 1 91  ? 48.904  52.411 -17.306 1.00 28.53 ? 91  ILE A O    1 
ATOM   855  C CB   . ILE A 1 91  ? 47.637  54.633 -15.786 1.00 23.56 ? 91  ILE A CB   1 
ATOM   856  C CG1  . ILE A 1 91  ? 47.637  56.082 -15.283 1.00 20.23 ? 91  ILE A CG1  1 
ATOM   857  C CG2  . ILE A 1 91  ? 46.515  53.751 -15.171 1.00 16.91 ? 91  ILE A CG2  1 
ATOM   858  C CD1  . ILE A 1 91  ? 46.421  56.868 -15.661 1.00 16.24 ? 91  ILE A CD1  1 
ATOM   859  H H    . ILE A 1 91  ? 49.759  55.247 -17.065 1.00 0.00  ? 91  ILE A H    1 
ATOM   860  N N    . PRO A 1 92  ? 49.175  51.557 -15.255 1.00 26.25 ? 92  PRO A N    1 
ATOM   861  C CA   . PRO A 1 92  ? 49.190  50.155 -15.710 1.00 27.43 ? 92  PRO A CA   1 
ATOM   862  C C    . PRO A 1 92  ? 47.766  49.557 -15.724 1.00 29.30 ? 92  PRO A C    1 
ATOM   863  O O    . PRO A 1 92  ? 47.334  48.901 -14.772 1.00 29.88 ? 92  PRO A O    1 
ATOM   864  C CB   . PRO A 1 92  ? 50.065  49.482 -14.666 1.00 26.49 ? 92  PRO A CB   1 
ATOM   865  C CG   . PRO A 1 92  ? 49.609  50.188 -13.390 1.00 27.56 ? 92  PRO A CG   1 
ATOM   866  C CD   . PRO A 1 92  ? 49.465  51.649 -13.811 1.00 27.01 ? 92  PRO A CD   1 
ATOM   867  N N    . VAL A 1 93  ? 47.065  49.740 -16.836 1.00 29.05 ? 93  VAL A N    1 
ATOM   868  C CA   . VAL A 1 93  ? 45.701  49.269 -16.955 1.00 28.82 ? 93  VAL A CA   1 
ATOM   869  C C    . VAL A 1 93  ? 45.520  47.766 -16.931 1.00 29.36 ? 93  VAL A C    1 
ATOM   870  O O    . VAL A 1 93  ? 44.638  47.246 -16.241 1.00 29.62 ? 93  VAL A O    1 
ATOM   871  C CB   . VAL A 1 93  ? 45.025  49.890 -18.173 1.00 28.39 ? 93  VAL A CB   1 
ATOM   872  C CG1  . VAL A 1 93  ? 43.579  49.444 -18.265 1.00 30.96 ? 93  VAL A CG1  1 
ATOM   873  C CG2  . VAL A 1 93  ? 45.081  51.425 -18.040 1.00 28.28 ? 93  VAL A CG2  1 
ATOM   874  H H    . VAL A 1 93  ? 47.500  50.183 -17.603 1.00 0.00  ? 93  VAL A H    1 
ATOM   875  N N    . ARG A 1 94  ? 46.398  47.064 -17.627 1.00 30.48 ? 94  ARG A N    1 
ATOM   876  C CA   . ARG A 1 94  ? 46.331  45.623 -17.689 1.00 30.10 ? 94  ARG A CA   1 
ATOM   877  C C    . ARG A 1 94  ? 46.467  44.924 -16.348 1.00 29.94 ? 94  ARG A C    1 
ATOM   878  O O    . ARG A 1 94  ? 46.239  43.709 -16.267 1.00 29.38 ? 94  ARG A O    1 
ATOM   879  C CB   . ARG A 1 94  ? 47.381  45.069 -18.644 1.00 31.91 ? 94  ARG A CB   1 
ATOM   880  C CG   . ARG A 1 94  ? 47.052  45.261 -20.093 1.00 30.60 ? 94  ARG A CG   1 
ATOM   881  C CD   . ARG A 1 94  ? 47.943  44.380 -20.881 1.00 29.95 ? 94  ARG A CD   1 
ATOM   882  N NE   . ARG A 1 94  ? 47.589  42.984 -20.676 1.00 31.29 ? 94  ARG A NE   1 
ATOM   883  C CZ   . ARG A 1 94  ? 48.289  41.955 -21.150 1.00 34.93 ? 94  ARG A CZ   1 
ATOM   884  N NH1  . ARG A 1 94  ? 49.413  42.162 -21.850 1.00 33.87 ? 94  ARG A NH1  1 
ATOM   885  N NH2  . ARG A 1 94  ? 47.808  40.717 -21.020 1.00 32.01 ? 94  ARG A NH2  1 
ATOM   886  H H    . ARG A 1 94  ? 47.116  47.537 -18.113 1.00 0.00  ? 94  ARG A H    1 
ATOM   887  H HE   . ARG A 1 94  ? 46.777  42.796 -20.156 1.00 0.00  ? 94  ARG A HE   1 
ATOM   888  H HH11 . ARG A 1 94  ? 49.733  43.096 -22.022 1.00 0.00  ? 94  ARG A HH11 1 
ATOM   889  H HH12 . ARG A 1 94  ? 49.953  41.398 -22.209 1.00 0.00  ? 94  ARG A HH12 1 
ATOM   890  H HH21 . ARG A 1 94  ? 46.938  40.477 -20.567 1.00 0.00  ? 94  ARG A HH21 1 
ATOM   891  H HH22 . ARG A 1 94  ? 48.324  39.931 -21.361 1.00 0.00  ? 94  ARG A HH22 1 
ATOM   892  N N    . GLU A 1 95  ? 46.902  45.631 -15.312 1.00 30.88 ? 95  GLU A N    1 
ATOM   893  C CA   . GLU A 1 95  ? 46.984  44.946 -14.045 1.00 30.49 ? 95  GLU A CA   1 
ATOM   894  C C    . GLU A 1 95  ? 45.811  45.279 -13.151 1.00 29.02 ? 95  GLU A C    1 
ATOM   895  O O    . GLU A 1 95  ? 45.507  44.536 -12.226 1.00 31.08 ? 95  GLU A O    1 
ATOM   896  C CB   . GLU A 1 95  ? 48.327  45.144 -13.354 1.00 32.92 ? 95  GLU A CB   1 
ATOM   897  C CG   . GLU A 1 95  ? 48.529  46.463 -12.619 1.00 36.76 ? 95  GLU A CG   1 
ATOM   898  C CD   . GLU A 1 95  ? 49.731  46.404 -11.696 1.00 36.33 ? 95  GLU A CD   1 
ATOM   899  O OE1  . GLU A 1 95  ? 50.788  45.908 -12.146 1.00 36.60 ? 95  GLU A OE1  1 
ATOM   900  O OE2  . GLU A 1 95  ? 49.601  46.819 -10.520 1.00 40.56 ? 95  GLU A OE2  1 
ATOM   901  H H    . GLU A 1 95  ? 47.162  46.573 -15.361 1.00 0.00  ? 95  GLU A H    1 
ATOM   902  N N    . ARG A 1 96  ? 45.100  46.352 -13.464 1.00 27.24 ? 96  ARG A N    1 
ATOM   903  C CA   . ARG A 1 96  ? 43.924  46.742 -12.677 1.00 25.78 ? 96  ARG A CA   1 
ATOM   904  C C    . ARG A 1 96  ? 42.590  46.621 -13.446 1.00 23.04 ? 96  ARG A C    1 
ATOM   905  O O    . ARG A 1 96  ? 41.569  47.054 -12.948 1.00 20.65 ? 96  ARG A O    1 
ATOM   906  C CB   . ARG A 1 96  ? 44.085  48.165 -12.156 1.00 26.44 ? 96  ARG A CB   1 
ATOM   907  C CG   . ARG A 1 96  ? 45.388  48.388 -11.340 1.00 33.02 ? 96  ARG A CG   1 
ATOM   908  C CD   . ARG A 1 96  ? 45.421  49.720 -10.545 1.00 32.72 ? 96  ARG A CD   1 
ATOM   909  N NE   . ARG A 1 96  ? 45.550  50.899 -11.411 1.00 35.07 ? 96  ARG A NE   1 
ATOM   910  C CZ   . ARG A 1 96  ? 46.305  51.960 -11.125 1.00 35.03 ? 96  ARG A CZ   1 
ATOM   911  N NH1  . ARG A 1 96  ? 47.014  52.005 -9.995  1.00 35.61 ? 96  ARG A NH1  1 
ATOM   912  N NH2  . ARG A 1 96  ? 46.305  53.002 -11.939 1.00 33.44 ? 96  ARG A NH2  1 
ATOM   913  H H    . ARG A 1 96  ? 45.348  46.896 -14.237 1.00 0.00  ? 96  ARG A H    1 
ATOM   914  H HE   . ARG A 1 96  ? 45.026  50.907 -12.239 1.00 0.00  ? 96  ARG A HE   1 
ATOM   915  H HH11 . ARG A 1 96  ? 46.980  51.245 -9.348  1.00 0.00  ? 96  ARG A HH11 1 
ATOM   916  H HH12 . ARG A 1 96  ? 47.593  52.800 -9.795  1.00 0.00  ? 96  ARG A HH12 1 
ATOM   917  H HH21 . ARG A 1 96  ? 45.675  53.025 -12.717 1.00 0.00  ? 96  ARG A HH21 1 
ATOM   918  H HH22 . ARG A 1 96  ? 46.863  53.810 -11.722 1.00 0.00  ? 96  ARG A HH22 1 
ATOM   919  N N    . LEU A 1 97  ? 42.586  45.999 -14.628 1.00 21.74 ? 97  LEU A N    1 
ATOM   920  C CA   . LEU A 1 97  ? 41.345  45.882 -15.417 1.00 19.78 ? 97  LEU A CA   1 
ATOM   921  C C    . LEU A 1 97  ? 40.879  44.449 -15.637 1.00 14.86 ? 97  LEU A C    1 
ATOM   922  O O    . LEU A 1 97  ? 41.643  43.588 -16.044 1.00 11.35 ? 97  LEU A O    1 
ATOM   923  C CB   . LEU A 1 97  ? 41.466  46.580 -16.789 1.00 21.92 ? 97  LEU A CB   1 
ATOM   924  C CG   . LEU A 1 97  ? 40.100  46.648 -17.489 1.00 23.66 ? 97  LEU A CG   1 
ATOM   925  C CD1  . LEU A 1 97  ? 39.261  47.720 -16.794 1.00 22.28 ? 97  LEU A CD1  1 
ATOM   926  C CD2  . LEU A 1 97  ? 40.235  46.933 -18.989 1.00 25.54 ? 97  LEU A CD2  1 
ATOM   927  H H    . LEU A 1 97  ? 43.410  45.603 -14.978 1.00 0.00  ? 97  LEU A H    1 
ATOM   928  N N    . LEU A 1 98  ? 39.611  44.203 -15.370 1.00 13.79 ? 98  LEU A N    1 
ATOM   929  C CA   . LEU A 1 98  ? 39.087  42.865 -15.543 1.00 13.69 ? 98  LEU A CA   1 
ATOM   930  C C    . LEU A 1 98  ? 37.831  42.859 -16.390 1.00 12.11 ? 98  LEU A C    1 
ATOM   931  O O    . LEU A 1 98  ? 37.038  43.794 -16.328 1.00 9.47  ? 98  LEU A O    1 
ATOM   932  C CB   . LEU A 1 98  ? 38.794  42.217 -14.177 1.00 13.84 ? 98  LEU A CB   1 
ATOM   933  C CG   . LEU A 1 98  ? 39.931  41.763 -13.245 1.00 9.65  ? 98  LEU A CG   1 
ATOM   934  C CD1  . LEU A 1 98  ? 39.378  41.425 -11.899 1.00 10.88 ? 98  LEU A CD1  1 
ATOM   935  C CD2  . LEU A 1 98  ? 40.645  40.561 -13.849 1.00 6.07  ? 98  LEU A CD2  1 
ATOM   936  H H    . LEU A 1 98  ? 39.034  44.923 -15.021 1.00 0.00  ? 98  LEU A H    1 
ATOM   937  N N    . LEU A 1 99  ? 37.667  41.804 -17.181 1.00 12.43 ? 99  LEU A N    1 
ATOM   938  C CA   . LEU A 1 99  ? 36.483  41.639 -17.989 1.00 15.38 ? 99  LEU A CA   1 
ATOM   939  C C    . LEU A 1 99  ? 35.843  40.241 -17.968 1.00 13.61 ? 99  LEU A C    1 
ATOM   940  O O    . LEU A 1 99  ? 36.489  39.201 -17.670 1.00 12.66 ? 99  LEU A O    1 
ATOM   941  C CB   . LEU A 1 99  ? 36.710  42.120 -19.440 1.00 19.18 ? 99  LEU A CB   1 
ATOM   942  C CG   . LEU A 1 99  ? 38.092  42.094 -20.105 1.00 23.54 ? 99  LEU A CG   1 
ATOM   943  C CD1  . LEU A 1 99  ? 38.407  40.746 -20.764 1.00 20.22 ? 99  LEU A CD1  1 
ATOM   944  C CD2  . LEU A 1 99  ? 38.120  43.205 -21.157 1.00 25.99 ? 99  LEU A CD2  1 
ATOM   945  H H    . LEU A 1 99  ? 38.364  41.104 -17.169 1.00 0.00  ? 99  LEU A H    1 
ATOM   946  N N    . SER A 1 100 ? 34.550  40.260 -18.295 1.00 14.18 ? 100 SER A N    1 
ATOM   947  C CA   . SER A 1 100 ? 33.708  39.091 -18.397 1.00 13.83 ? 100 SER A CA   1 
ATOM   948  C C    . SER A 1 100 ? 33.943  38.392 -19.724 1.00 15.56 ? 100 SER A C    1 
ATOM   949  O O    . SER A 1 100 ? 34.056  39.054 -20.751 1.00 17.92 ? 100 SER A O    1 
ATOM   950  C CB   . SER A 1 100 ? 32.267  39.518 -18.400 1.00 5.67  ? 100 SER A CB   1 
ATOM   951  O OG   . SER A 1 100 ? 31.449  38.375 -18.594 1.00 5.01  ? 100 SER A OG   1 
ATOM   952  H H    . SER A 1 100 ? 34.129  41.131 -18.457 1.00 0.00  ? 100 SER A H    1 
ATOM   953  H HG   . SER A 1 100 ? 31.546  37.833 -17.788 1.00 0.00  ? 100 SER A HG   1 
ATOM   954  N N    . GLU A 1 101 ? 33.903  37.057 -19.718 1.00 17.58 ? 101 GLU A N    1 
ATOM   955  C CA   . GLU A 1 101 ? 34.085  36.268 -20.928 1.00 19.05 ? 101 GLU A CA   1 
ATOM   956  C C    . GLU A 1 101 ? 32.789  36.295 -21.750 1.00 19.87 ? 101 GLU A C    1 
ATOM   957  O O    . GLU A 1 101 ? 32.812  36.029 -22.967 1.00 20.70 ? 101 GLU A O    1 
ATOM   958  C CB   . GLU A 1 101 ? 34.505  34.818 -20.589 1.00 19.69 ? 101 GLU A CB   1 
ATOM   959  C CG   . GLU A 1 101 ? 33.462  33.972 -19.869 1.00 25.13 ? 101 GLU A CG   1 
ATOM   960  C CD   . GLU A 1 101 ? 32.817  32.919 -20.782 1.00 31.48 ? 101 GLU A CD   1 
ATOM   961  O OE1  . GLU A 1 101 ? 33.551  32.083 -21.359 1.00 31.78 ? 101 GLU A OE1  1 
ATOM   962  O OE2  . GLU A 1 101 ? 31.562  32.921 -20.930 1.00 38.81 ? 101 GLU A OE2  1 
ATOM   963  H H    . GLU A 1 101 ? 33.744  36.598 -18.871 1.00 0.00  ? 101 GLU A H    1 
ATOM   964  N N    . ALA A 1 102 ? 31.682  36.676 -21.109 1.00 17.63 ? 102 ALA A N    1 
ATOM   965  C CA   . ALA A 1 102 ? 30.404  36.747 -21.794 1.00 18.04 ? 102 ALA A CA   1 
ATOM   966  C C    . ALA A 1 102 ? 30.181  38.061 -22.563 1.00 16.44 ? 102 ALA A C    1 
ATOM   967  O O    . ALA A 1 102 ? 29.107  38.253 -23.165 1.00 13.76 ? 102 ALA A O    1 
ATOM   968  C CB   . ALA A 1 102 ? 29.241  36.522 -20.816 1.00 19.59 ? 102 ALA A CB   1 
ATOM   969  H H    . ALA A 1 102 ? 31.713  36.963 -20.175 1.00 0.00  ? 102 ALA A H    1 
ATOM   970  N N    . CYS A 1 103 ? 31.140  38.985 -22.522 1.00 14.30 ? 103 CYS A N    1 
ATOM   971  C CA   . CYS A 1 103 ? 30.939  40.255 -23.250 1.00 16.67 ? 103 CYS A CA   1 
ATOM   972  C C    . CYS A 1 103 ? 30.965  39.995 -24.744 1.00 18.80 ? 103 CYS A C    1 
ATOM   973  O O    . CYS A 1 103 ? 31.853  39.276 -25.213 1.00 16.93 ? 103 CYS A O    1 
ATOM   974  C CB   . CYS A 1 103 ? 32.054  41.253 -22.978 1.00 17.63 ? 103 CYS A CB   1 
ATOM   975  S SG   . CYS A 1 103 ? 32.217  41.974 -21.377 1.00 19.83 ? 103 CYS A SG   1 
ATOM   976  H H    . CYS A 1 103 ? 31.967  38.854 -22.023 1.00 0.00  ? 103 CYS A H    1 
ATOM   977  N N    . PRO A 1 104 ? 29.937  40.477 -25.485 1.00 19.40 ? 104 PRO A N    1 
ATOM   978  C CA   . PRO A 1 104 ? 29.769  40.362 -26.949 1.00 19.50 ? 104 PRO A CA   1 
ATOM   979  C C    . PRO A 1 104 ? 30.754  41.316 -27.595 1.00 19.78 ? 104 PRO A C    1 
ATOM   980  O O    . PRO A 1 104 ? 31.045  42.368 -27.032 1.00 20.62 ? 104 PRO A O    1 
ATOM   981  C CB   . PRO A 1 104 ? 28.356  40.891 -27.190 1.00 20.73 ? 104 PRO A CB   1 
ATOM   982  C CG   . PRO A 1 104 ? 27.639  40.560 -25.950 1.00 20.29 ? 104 PRO A CG   1 
ATOM   983  C CD   . PRO A 1 104 ? 28.651  40.808 -24.839 1.00 20.61 ? 104 PRO A CD   1 
ATOM   984  N N    . LEU A 1 105 ? 31.264  40.947 -28.770 1.00 20.25 ? 105 LEU A N    1 
ATOM   985  C CA   . LEU A 1 105 ? 32.233  41.749 -29.527 1.00 18.31 ? 105 LEU A CA   1 
ATOM   986  C C    . LEU A 1 105 ? 31.678  42.667 -30.626 1.00 17.80 ? 105 LEU A C    1 
ATOM   987  O O    . LEU A 1 105 ? 30.667  42.376 -31.264 1.00 15.62 ? 105 LEU A O    1 
ATOM   988  C CB   . LEU A 1 105 ? 33.296  40.836 -30.140 1.00 16.76 ? 105 LEU A CB   1 
ATOM   989  C CG   . LEU A 1 105 ? 34.388  40.236 -29.229 1.00 16.23 ? 105 LEU A CG   1 
ATOM   990  C CD1  . LEU A 1 105 ? 34.997  38.979 -29.826 1.00 14.31 ? 105 LEU A CD1  1 
ATOM   991  C CD2  . LEU A 1 105 ? 35.472  41.234 -29.008 1.00 16.41 ? 105 LEU A CD2  1 
ATOM   992  H H    . LEU A 1 105 ? 31.040  40.055 -29.118 1.00 0.00  ? 105 LEU A H    1 
ATOM   993  N N    . ILE A 1 106 ? 32.329  43.817 -30.807 1.00 17.28 ? 106 ILE A N    1 
ATOM   994  C CA   . ILE A 1 106 ? 31.954  44.721 -31.881 1.00 14.71 ? 106 ILE A CA   1 
ATOM   995  C C    . ILE A 1 106 ? 33.139  44.718 -32.840 1.00 17.64 ? 106 ILE A C    1 
ATOM   996  O O    . ILE A 1 106 ? 34.274  45.080 -32.476 1.00 19.12 ? 106 ILE A O    1 
ATOM   997  C CB   . ILE A 1 106 ? 31.750  46.168 -31.423 1.00 14.02 ? 106 ILE A CB   1 
ATOM   998  C CG1  . ILE A 1 106 ? 30.748  46.260 -30.301 1.00 13.36 ? 106 ILE A CG1  1 
ATOM   999  C CG2  . ILE A 1 106 ? 31.215  46.985 -32.568 1.00 15.00 ? 106 ILE A CG2  1 
ATOM   1000 C CD1  . ILE A 1 106 ? 30.451  47.700 -29.940 1.00 12.93 ? 106 ILE A CD1  1 
ATOM   1001 H H    . ILE A 1 106 ? 33.029  44.074 -30.155 1.00 0.00  ? 106 ILE A H    1 
ATOM   1002 N N    . LEU A 1 107 ? 32.905  44.267 -34.056 1.00 17.88 ? 107 LEU A N    1 
ATOM   1003 C CA   . LEU A 1 107 ? 33.976  44.269 -35.039 1.00 16.72 ? 107 LEU A CA   1 
ATOM   1004 C C    . LEU A 1 107 ? 33.458  45.128 -36.204 1.00 18.85 ? 107 LEU A C    1 
ATOM   1005 O O    . LEU A 1 107 ? 32.291  45.605 -36.176 1.00 16.16 ? 107 LEU A O    1 
ATOM   1006 C CB   . LEU A 1 107 ? 34.387  42.830 -35.421 1.00 13.59 ? 107 LEU A CB   1 
ATOM   1007 C CG   . LEU A 1 107 ? 34.633  41.903 -34.196 1.00 9.72  ? 107 LEU A CG   1 
ATOM   1008 C CD1  . LEU A 1 107 ? 34.362  40.487 -34.524 1.00 5.01  ? 107 LEU A CD1  1 
ATOM   1009 C CD2  . LEU A 1 107 ? 36.026  42.047 -33.577 1.00 9.94  ? 107 LEU A CD2  1 
ATOM   1010 H H    . LEU A 1 107 ? 31.997  43.947 -34.238 1.00 0.00  ? 107 LEU A H    1 
ATOM   1011 N N    . ASP A 1 108 ? 34.337  45.410 -37.163 1.00 21.13 ? 108 ASP A N    1 
ATOM   1012 C CA   . ASP A 1 108 ? 33.994  46.271 -38.301 1.00 19.67 ? 108 ASP A CA   1 
ATOM   1013 C C    . ASP A 1 108 ? 32.665  45.937 -38.991 1.00 17.55 ? 108 ASP A C    1 
ATOM   1014 O O    . ASP A 1 108 ? 31.878  46.852 -39.284 1.00 17.13 ? 108 ASP A O    1 
ATOM   1015 C CB   . ASP A 1 108 ? 35.153  46.335 -39.313 1.00 22.34 ? 108 ASP A CB   1 
ATOM   1016 C CG   . ASP A 1 108 ? 36.465  46.787 -38.674 1.00 26.68 ? 108 ASP A CG   1 
ATOM   1017 O OD1  . ASP A 1 108 ? 36.465  47.731 -37.864 1.00 32.49 ? 108 ASP A OD1  1 
ATOM   1018 O OD2  . ASP A 1 108 ? 37.518  46.197 -38.973 1.00 28.19 ? 108 ASP A OD2  1 
ATOM   1019 H H    . ASP A 1 108 ? 35.250  45.045 -37.102 1.00 0.00  ? 108 ASP A H    1 
ATOM   1020 N N    . TYR A 1 109 ? 32.392  44.653 -39.232 1.00 14.21 ? 109 TYR A N    1 
ATOM   1021 C CA   . TYR A 1 109 ? 31.144  44.277 -39.868 1.00 11.52 ? 109 TYR A CA   1 
ATOM   1022 C C    . TYR A 1 109 ? 29.949  44.886 -39.155 1.00 16.03 ? 109 TYR A C    1 
ATOM   1023 O O    . TYR A 1 109 ? 29.038  45.428 -39.797 1.00 17.88 ? 109 TYR A O    1 
ATOM   1024 C CB   . TYR A 1 109 ? 31.015  42.759 -40.056 1.00 10.40 ? 109 TYR A CB   1 
ATOM   1025 C CG   . TYR A 1 109 ? 31.192  41.824 -38.856 1.00 13.09 ? 109 TYR A CG   1 
ATOM   1026 C CD1  . TYR A 1 109 ? 32.469  41.347 -38.476 1.00 14.73 ? 109 TYR A CD1  1 
ATOM   1027 C CD2  . TYR A 1 109 ? 30.066  41.350 -38.146 1.00 12.07 ? 109 TYR A CD2  1 
ATOM   1028 C CE1  . TYR A 1 109 ? 32.617  40.422 -37.415 1.00 12.14 ? 109 TYR A CE1  1 
ATOM   1029 C CE2  . TYR A 1 109 ? 30.199  40.435 -37.099 1.00 12.97 ? 109 TYR A CE2  1 
ATOM   1030 C CZ   . TYR A 1 109 ? 31.463  39.979 -36.738 1.00 13.91 ? 109 TYR A CZ   1 
ATOM   1031 O OH   . TYR A 1 109 ? 31.555  39.128 -35.677 1.00 9.92  ? 109 TYR A OH   1 
ATOM   1032 H H    . TYR A 1 109 ? 33.068  43.988 -38.995 1.00 0.00  ? 109 TYR A H    1 
ATOM   1033 H HH   . TYR A 1 109 ? 30.663  38.902 -35.365 1.00 0.00  ? 109 TYR A HH   1 
ATOM   1034 N N    . HIS A 1 110 ? 30.037  44.953 -37.833 1.00 15.86 ? 110 HIS A N    1 
ATOM   1035 C CA   . HIS A 1 110 ? 28.978  45.554 -37.024 1.00 15.99 ? 110 HIS A CA   1 
ATOM   1036 C C    . HIS A 1 110 ? 28.856  47.064 -37.271 1.00 13.99 ? 110 HIS A C    1 
ATOM   1037 O O    . HIS A 1 110 ? 27.752  47.588 -37.519 1.00 10.40 ? 110 HIS A O    1 
ATOM   1038 C CB   . HIS A 1 110 ? 29.233  45.271 -35.550 1.00 19.01 ? 110 HIS A CB   1 
ATOM   1039 C CG   . HIS A 1 110 ? 28.986  43.841 -35.157 1.00 19.19 ? 110 HIS A CG   1 
ATOM   1040 N ND1  . HIS A 1 110 ? 29.707  43.232 -34.139 1.00 16.84 ? 110 HIS A ND1  1 
ATOM   1041 C CD2  . HIS A 1 110 ? 28.019  42.993 -35.589 1.00 18.56 ? 110 HIS A CD2  1 
ATOM   1042 C CE1  . HIS A 1 110 ? 29.160  42.045 -33.976 1.00 17.20 ? 110 HIS A CE1  1 
ATOM   1043 N NE2  . HIS A 1 110 ? 28.134  41.851 -34.830 1.00 16.62 ? 110 HIS A NE2  1 
ATOM   1044 H H    . HIS A 1 110 ? 30.839  44.639 -37.376 1.00 0.00  ? 110 HIS A H    1 
ATOM   1045 H HE2  . HIS A 1 110 ? 27.599  41.020 -34.910 1.00 0.00  ? 110 HIS A HE2  1 
ATOM   1046 N N    . VAL A 1 111 ? 30.007  47.737 -37.281 1.00 16.63 ? 111 VAL A N    1 
ATOM   1047 C CA   . VAL A 1 111 ? 30.090  49.176 -37.515 1.00 17.40 ? 111 VAL A CA   1 
ATOM   1048 C C    . VAL A 1 111 ? 29.471  49.524 -38.827 1.00 17.58 ? 111 VAL A C    1 
ATOM   1049 O O    . VAL A 1 111 ? 28.564  50.358 -38.890 1.00 19.01 ? 111 VAL A O    1 
ATOM   1050 C CB   . VAL A 1 111 ? 31.512  49.667 -37.434 1.00 17.63 ? 111 VAL A CB   1 
ATOM   1051 C CG1  . VAL A 1 111 ? 31.699  50.858 -38.288 1.00 22.90 ? 111 VAL A CG1  1 
ATOM   1052 C CG2  . VAL A 1 111 ? 31.799  50.052 -36.015 1.00 18.75 ? 111 VAL A CG2  1 
ATOM   1053 H H    . VAL A 1 111 ? 30.818  47.214 -37.115 1.00 0.00  ? 111 VAL A H    1 
ATOM   1054 N N    . ALA A 1 112 ? 29.903  48.813 -39.858 1.00 19.09 ? 112 ALA A N    1 
ATOM   1055 C CA   . ALA A 1 112 ? 29.375  48.995 -41.202 1.00 19.90 ? 112 ALA A CA   1 
ATOM   1056 C C    . ALA A 1 112 ? 27.838  48.948 -41.163 1.00 19.07 ? 112 ALA A C    1 
ATOM   1057 O O    . ALA A 1 112 ? 27.191  49.920 -41.553 1.00 22.51 ? 112 ALA A O    1 
ATOM   1058 C CB   . ALA A 1 112 ? 29.914  47.925 -42.115 1.00 22.08 ? 112 ALA A CB   1 
ATOM   1059 H H    . ALA A 1 112 ? 30.595  48.130 -39.693 1.00 0.00  ? 112 ALA A H    1 
ATOM   1060 N N    . LEU A 1 113 ? 27.244  47.874 -40.633 1.00 17.67 ? 113 LEU A N    1 
ATOM   1061 C CA   . LEU A 1 113 ? 25.774  47.813 -40.575 1.00 17.04 ? 113 LEU A CA   1 
ATOM   1062 C C    . LEU A 1 113 ? 25.167  49.099 -39.981 1.00 17.70 ? 113 LEU A C    1 
ATOM   1063 O O    . LEU A 1 113 ? 24.145  49.562 -40.460 1.00 17.47 ? 113 LEU A O    1 
ATOM   1064 C CB   . LEU A 1 113 ? 25.258  46.581 -39.806 1.00 11.44 ? 113 LEU A CB   1 
ATOM   1065 C CG   . LEU A 1 113 ? 25.138  45.186 -40.450 1.00 11.92 ? 113 LEU A CG   1 
ATOM   1066 C CD1  . LEU A 1 113 ? 24.800  45.320 -41.914 1.00 14.89 ? 113 LEU A CD1  1 
ATOM   1067 C CD2  . LEU A 1 113 ? 26.402  44.310 -40.296 1.00 11.61 ? 113 LEU A CD2  1 
ATOM   1068 H H    . LEU A 1 113 ? 27.789  47.127 -40.298 1.00 0.00  ? 113 LEU A H    1 
ATOM   1069 N N    . ASP A 1 114 ? 25.821  49.709 -38.995 1.00 18.40 ? 114 ASP A N    1 
ATOM   1070 C CA   . ASP A 1 114 ? 25.272  50.936 -38.401 1.00 21.72 ? 114 ASP A CA   1 
ATOM   1071 C C    . ASP A 1 114 ? 25.263  52.090 -39.408 1.00 22.76 ? 114 ASP A C    1 
ATOM   1072 O O    . ASP A 1 114 ? 24.255  52.800 -39.549 1.00 22.84 ? 114 ASP A O    1 
ATOM   1073 C CB   . ASP A 1 114 ? 26.054  51.371 -37.146 1.00 21.46 ? 114 ASP A CB   1 
ATOM   1074 C CG   . ASP A 1 114 ? 25.205  51.332 -35.879 1.00 24.04 ? 114 ASP A CG   1 
ATOM   1075 O OD1  . ASP A 1 114 ? 23.956  51.178 -35.946 1.00 21.27 ? 114 ASP A OD1  1 
ATOM   1076 O OD2  . ASP A 1 114 ? 25.805  51.466 -34.799 1.00 22.50 ? 114 ASP A OD2  1 
ATOM   1077 H H    . ASP A 1 114 ? 26.647  49.315 -38.644 1.00 0.00  ? 114 ASP A H    1 
ATOM   1078 N N    . ASN A 1 115 ? 26.388  52.257 -40.109 1.00 23.63 ? 115 ASN A N    1 
ATOM   1079 C CA   . ASN A 1 115 ? 26.542  53.309 -41.109 1.00 23.07 ? 115 ASN A CA   1 
ATOM   1080 C C    . ASN A 1 115 ? 25.570  53.195 -42.270 1.00 24.94 ? 115 ASN A C    1 
ATOM   1081 O O    . ASN A 1 115 ? 24.903  54.182 -42.634 1.00 24.99 ? 115 ASN A O    1 
ATOM   1082 C CB   . ASN A 1 115 ? 27.945  53.299 -41.637 1.00 19.43 ? 115 ASN A CB   1 
ATOM   1083 C CG   . ASN A 1 115 ? 28.854  54.053 -40.763 1.00 19.22 ? 115 ASN A CG   1 
ATOM   1084 O OD1  . ASN A 1 115 ? 28.415  55.033 -40.144 1.00 12.38 ? 115 ASN A OD1  1 
ATOM   1085 N ND2  . ASN A 1 115 ? 30.119  53.612 -40.658 1.00 14.92 ? 115 ASN A ND2  1 
ATOM   1086 H H    . ASN A 1 115 ? 27.106  51.619 -39.888 1.00 0.00  ? 115 ASN A H    1 
ATOM   1087 H HD21 . ASN A 1 115 ? 30.744  54.103 -40.084 1.00 0.00  ? 115 ASN A HD21 1 
ATOM   1088 H HD22 . ASN A 1 115 ? 30.412  52.814 -41.144 1.00 0.00  ? 115 ASN A HD22 1 
ATOM   1089 N N    . ALA A 1 116 ? 25.497  51.988 -42.839 1.00 25.64 ? 116 ALA A N    1 
ATOM   1090 C CA   . ALA A 1 116 ? 24.598  51.689 -43.930 1.00 27.37 ? 116 ALA A CA   1 
ATOM   1091 C C    . ALA A 1 116 ? 23.168  51.899 -43.415 1.00 29.75 ? 116 ALA A C    1 
ATOM   1092 O O    . ALA A 1 116 ? 22.439  52.738 -43.969 1.00 32.18 ? 116 ALA A O    1 
ATOM   1093 C CB   . ALA A 1 116 ? 24.805  50.255 -44.385 1.00 26.16 ? 116 ALA A CB   1 
ATOM   1094 H H    . ALA A 1 116 ? 26.068  51.279 -42.456 1.00 0.00  ? 116 ALA A H    1 
ATOM   1095 N N    . ARG A 1 117 ? 22.810  51.226 -42.304 1.00 29.08 ? 117 ARG A N    1 
ATOM   1096 C CA   . ARG A 1 117 ? 21.471  51.337 -41.693 1.00 28.84 ? 117 ARG A CA   1 
ATOM   1097 C C    . ARG A 1 117 ? 21.188  52.792 -41.414 1.00 33.57 ? 117 ARG A C    1 
ATOM   1098 O O    . ARG A 1 117 ? 20.051  53.165 -41.150 1.00 35.97 ? 117 ARG A O    1 
ATOM   1099 C CB   . ARG A 1 117 ? 21.359  50.581 -40.362 1.00 22.33 ? 117 ARG A CB   1 
ATOM   1100 C CG   . ARG A 1 117 ? 20.996  49.112 -40.461 1.00 19.37 ? 117 ARG A CG   1 
ATOM   1101 C CD   . ARG A 1 117 ? 21.460  48.350 -39.199 1.00 18.67 ? 117 ARG A CD   1 
ATOM   1102 N NE   . ARG A 1 117 ? 21.871  46.971 -39.510 1.00 19.24 ? 117 ARG A NE   1 
ATOM   1103 C CZ   . ARG A 1 117 ? 21.541  45.889 -38.787 1.00 23.78 ? 117 ARG A CZ   1 
ATOM   1104 N NH1  . ARG A 1 117 ? 20.779  46.005 -37.694 1.00 24.32 ? 117 ARG A NH1  1 
ATOM   1105 N NH2  . ARG A 1 117 ? 22.020  44.689 -39.133 1.00 21.99 ? 117 ARG A NH2  1 
ATOM   1106 H H    . ARG A 1 117 ? 23.436  50.640 -41.816 1.00 0.00  ? 117 ARG A H    1 
ATOM   1107 H HE   . ARG A 1 117 ? 22.417  46.872 -40.317 1.00 0.00  ? 117 ARG A HE   1 
ATOM   1108 H HH11 . ARG A 1 117 ? 20.494  46.920 -37.371 1.00 0.00  ? 117 ARG A HH11 1 
ATOM   1109 H HH12 . ARG A 1 117 ? 20.513  45.225 -37.116 1.00 0.00  ? 117 ARG A HH12 1 
ATOM   1110 H HH21 . ARG A 1 117 ? 22.618  44.572 -39.925 1.00 0.00  ? 117 ARG A HH21 1 
ATOM   1111 H HH22 . ARG A 1 117 ? 21.775  43.871 -38.599 1.00 0.00  ? 117 ARG A HH22 1 
ATOM   1112 N N    . GLU A 1 118 ? 22.241  53.596 -41.371 1.00 37.09 ? 118 GLU A N    1 
ATOM   1113 C CA   . GLU A 1 118 ? 22.068  55.008 -41.130 1.00 42.50 ? 118 GLU A CA   1 
ATOM   1114 C C    . GLU A 1 118 ? 22.081  55.899 -42.379 1.00 44.10 ? 118 GLU A C    1 
ATOM   1115 O O    . GLU A 1 118 ? 21.031  56.391 -42.792 1.00 45.89 ? 118 GLU A O    1 
ATOM   1116 C CB   . GLU A 1 118 ? 23.078  55.494 -40.086 1.00 45.09 ? 118 GLU A CB   1 
ATOM   1117 C CG   . GLU A 1 118 ? 22.458  55.813 -38.725 1.00 49.01 ? 118 GLU A CG   1 
ATOM   1118 C CD   . GLU A 1 118 ? 23.497  56.109 -37.654 1.00 50.80 ? 118 GLU A CD   1 
ATOM   1119 O OE1  . GLU A 1 118 ? 24.382  56.953 -37.886 1.00 54.26 ? 118 GLU A OE1  1 
ATOM   1120 O OE2  . GLU A 1 118 ? 23.465  55.483 -36.579 1.00 52.62 ? 118 GLU A OE2  1 
ATOM   1121 H H    . GLU A 1 118 ? 23.139  53.222 -41.414 1.00 0.00  ? 118 GLU A H    1 
ATOM   1122 N N    . LYS A 1 119 ? 23.241  56.059 -43.008 1.00 45.17 ? 119 LYS A N    1 
ATOM   1123 C CA   . LYS A 1 119 ? 23.377  56.946 -44.169 1.00 48.13 ? 119 LYS A CA   1 
ATOM   1124 C C    . LYS A 1 119 ? 22.376  56.628 -45.269 1.00 48.89 ? 119 LYS A C    1 
ATOM   1125 O O    . LYS A 1 119 ? 21.683  57.525 -45.779 1.00 46.54 ? 119 LYS A O    1 
ATOM   1126 C CB   . LYS A 1 119 ? 24.810  56.915 -44.747 1.00 49.31 ? 119 LYS A CB   1 
ATOM   1127 C CG   . LYS A 1 119 ? 25.903  57.649 -43.933 1.00 50.74 ? 119 LYS A CG   1 
ATOM   1128 C CD   . LYS A 1 119 ? 26.335  56.929 -42.641 1.00 49.56 ? 119 LYS A CD   1 
ATOM   1129 C CE   . LYS A 1 119 ? 25.479  57.366 -41.455 1.00 52.39 ? 119 LYS A CE   1 
ATOM   1130 N NZ   . LYS A 1 119 ? 25.692  56.596 -40.193 1.00 50.89 ? 119 LYS A NZ   1 
ATOM   1131 H H    . LYS A 1 119 ? 23.982  55.456 -42.761 1.00 0.00  ? 119 LYS A H    1 
ATOM   1132 H HZ1  . LYS A 1 119 ? 25.501  55.584 -40.338 1.00 0.00  ? 119 LYS A HZ1  1 
ATOM   1133 H HZ2  . LYS A 1 119 ? 26.687  56.696 -39.924 1.00 0.00  ? 119 LYS A HZ2  1 
ATOM   1134 H HZ3  . LYS A 1 119 ? 25.060  56.937 -39.420 1.00 0.00  ? 119 LYS A HZ3  1 
ATOM   1135 N N    . ALA A 1 120 ? 22.282  55.337 -45.590 1.00 49.99 ? 120 ALA A N    1 
ATOM   1136 C CA   . ALA A 1 120 ? 21.378  54.852 -46.629 1.00 51.34 ? 120 ALA A CA   1 
ATOM   1137 C C    . ALA A 1 120 ? 19.932  55.003 -46.183 1.00 51.88 ? 120 ALA A C    1 
ATOM   1138 O O    . ALA A 1 120 ? 19.253  55.951 -46.589 1.00 52.31 ? 120 ALA A O    1 
ATOM   1139 C CB   . ALA A 1 120 ? 21.692  53.398 -46.970 1.00 60.99 ? 120 ALA A CB   1 
ATOM   1140 H H    . ALA A 1 120 ? 22.777  54.679 -45.063 1.00 0.00  ? 120 ALA A H    1 
ATOM   1141 N N    . ARG A 1 121 ? 19.471  54.126 -45.291 1.00 53.41 ? 121 ARG A N    1 
ATOM   1142 C CA   . ARG A 1 121 ? 18.075  54.204 -44.829 1.00 54.68 ? 121 ARG A CA   1 
ATOM   1143 C C    . ARG A 1 121 ? 17.843  55.418 -43.909 1.00 65.18 ? 121 ARG A C    1 
ATOM   1144 O O    . ARG A 1 121 ? 17.173  55.342 -42.876 1.00 63.96 ? 121 ARG A O    1 
ATOM   1145 C CB   . ARG A 1 121 ? 17.630  52.894 -44.167 1.00 73.02 ? 121 ARG A CB   1 
ATOM   1146 C CG   . ARG A 1 121 ? 16.172  52.516 -44.470 1.00 81.52 ? 121 ARG A CG   1 
ATOM   1147 C CD   . ARG A 1 121 ? 16.002  51.962 -45.890 1.00 80.04 ? 121 ARG A CD   1 
ATOM   1148 N NE   . ARG A 1 121 ? 14.664  52.204 -46.435 1.00 88.85 ? 121 ARG A NE   1 
ATOM   1149 C CZ   . ARG A 1 121 ? 13.785  51.255 -46.757 1.00 98.21 ? 121 ARG A CZ   1 
ATOM   1150 N NH1  . ARG A 1 121 ? 14.079  49.971 -46.585 1.00 97.75 ? 121 ARG A NH1  1 
ATOM   1151 N NH2  . ARG A 1 121 ? 12.614  51.593 -47.282 1.00 97.75 ? 121 ARG A NH2  1 
ATOM   1152 H H    . ARG A 1 121 ? 20.088  53.486 -44.886 1.00 0.00  ? 121 ARG A H    1 
ATOM   1153 H HE   . ARG A 1 121 ? 14.417  53.150 -46.546 1.00 0.00  ? 121 ARG A HE   1 
ATOM   1154 H HH11 . ARG A 1 121 ? 14.953  49.643 -46.220 1.00 0.00  ? 121 ARG A HH11 1 
ATOM   1155 H HH12 . ARG A 1 121 ? 13.419  49.257 -46.851 1.00 0.00  ? 121 ARG A HH12 1 
ATOM   1156 H HH21 . ARG A 1 121 ? 12.374  52.551 -47.437 1.00 0.00  ? 121 ARG A HH21 1 
ATOM   1157 H HH22 . ARG A 1 121 ? 11.954  50.879 -47.547 1.00 0.00  ? 121 ARG A HH22 1 
ATOM   1158 N N    . GLY A 1 122 ? 18.361  56.550 -44.363 1.00 66.62 ? 122 GLY A N    1 
ATOM   1159 C CA   . GLY A 1 122 ? 18.260  57.801 -43.652 1.00 69.87 ? 122 GLY A CA   1 
ATOM   1160 C C    . GLY A 1 122 ? 18.767  58.785 -44.671 1.00 72.36 ? 122 GLY A C    1 
ATOM   1161 O O    . GLY A 1 122 ? 18.256  58.809 -45.784 1.00 73.71 ? 122 GLY A O    1 
ATOM   1162 H H    . GLY A 1 122 ? 18.777  56.602 -45.260 1.00 0.00  ? 122 GLY A H    1 
ATOM   1163 N N    . ALA A 1 123 ? 19.825  59.517 -44.338 1.00 74.27 ? 123 ALA A N    1 
ATOM   1164 C CA   . ALA A 1 123 ? 20.397  60.500 -45.254 1.00 75.93 ? 123 ALA A CA   1 
ATOM   1165 C C    . ALA A 1 123 ? 21.577  61.210 -44.626 1.00 76.79 ? 123 ALA A C    1 
ATOM   1166 O O    . ALA A 1 123 ? 22.581  61.460 -45.284 1.00 77.47 ? 123 ALA A O    1 
ATOM   1167 C CB   . ALA A 1 123 ? 19.341  61.519 -45.682 1.00 75.58 ? 123 ALA A CB   1 
ATOM   1168 H H    . ALA A 1 123 ? 20.257  59.337 -43.480 1.00 0.00  ? 123 ALA A H    1 
ATOM   1169 N N    . LYS A 1 124 ? 21.444  61.576 -43.358 1.00 78.13 ? 124 LYS A N    1 
ATOM   1170 C CA   . LYS A 1 124 ? 22.525  62.266 -42.668 1.00 80.27 ? 124 LYS A CA   1 
ATOM   1171 C C    . LYS A 1 124 ? 22.736  61.620 -41.311 1.00 91.24 ? 124 LYS A C    1 
ATOM   1172 O O    . LYS A 1 124 ? 21.797  61.066 -40.734 1.00 91.15 ? 124 LYS A O    1 
ATOM   1173 C CB   . LYS A 1 124 ? 22.188  63.752 -42.482 1.00 89.47 ? 124 LYS A CB   1 
ATOM   1174 C CG   . LYS A 1 124 ? 21.708  64.486 -43.738 1.00 89.09 ? 124 LYS A CG   1 
ATOM   1175 C CD   . LYS A 1 124 ? 22.811  65.259 -44.466 1.00 88.69 ? 124 LYS A CD   1 
ATOM   1176 C CE   . LYS A 1 124 ? 23.651  64.377 -45.379 1.00 88.51 ? 124 LYS A CE   1 
ATOM   1177 N NZ   . LYS A 1 124 ? 24.478  65.182 -46.323 1.00 88.28 ? 124 LYS A NZ   1 
ATOM   1178 H H    . LYS A 1 124 ? 20.624  61.381 -42.853 1.00 0.00  ? 124 LYS A H    1 
ATOM   1179 H HZ1  . LYS A 1 124 ? 25.130  65.799 -45.802 1.00 0.00  ? 124 LYS A HZ1  1 
ATOM   1180 H HZ2  . LYS A 1 124 ? 25.036  64.532 -46.916 1.00 0.00  ? 124 LYS A HZ2  1 
ATOM   1181 H HZ3  . LYS A 1 124 ? 23.852  65.749 -46.926 1.00 0.00  ? 124 LYS A HZ3  1 
ATOM   1182 N N    . ALA A 1 125 ? 23.977  61.658 -40.832 1.00 92.07 ? 125 ALA A N    1 
ATOM   1183 C CA   . ALA A 1 125 ? 24.330  61.097 -39.533 1.00 92.78 ? 125 ALA A CA   1 
ATOM   1184 C C    . ALA A 1 125 ? 25.786  61.377 -39.203 1.00 93.27 ? 125 ALA A C    1 
ATOM   1185 O O    . ALA A 1 125 ? 26.594  61.646 -40.090 1.00 93.65 ? 125 ALA A O    1 
ATOM   1186 C CB   . ALA A 1 125 ? 24.063  59.605 -39.503 1.00 92.61 ? 125 ALA A CB   1 
ATOM   1187 H H    . ALA A 1 125 ? 24.706  62.065 -41.355 1.00 0.00  ? 125 ALA A H    1 
ATOM   1188 N N    . ILE A 1 126 ? 26.095  61.333 -37.911 1.00 94.01 ? 126 ILE A N    1 
ATOM   1189 C CA   . ILE A 1 126 ? 27.447  61.567 -37.406 1.00 93.34 ? 126 ILE A CA   1 
ATOM   1190 C C    . ILE A 1 126 ? 27.787  60.540 -36.334 1.00 93.17 ? 126 ILE A C    1 
ATOM   1191 O O    . ILE A 1 126 ? 28.838  59.875 -36.382 1.00 93.43 ? 126 ILE A O    1 
ATOM   1192 C CB   . ILE A 1 126 ? 27.568  62.972 -36.729 1.00 92.49 ? 126 ILE A CB   1 
ATOM   1193 C CG1  . ILE A 1 126 ? 27.132  64.093 -37.677 1.00 91.92 ? 126 ILE A CG1  1 
ATOM   1194 C CG2  . ILE A 1 126 ? 28.996  63.209 -36.242 1.00 92.05 ? 126 ILE A CG2  1 
ATOM   1195 C CD1  . ILE A 1 126 ? 26.987  65.444 -36.993 1.00 91.36 ? 126 ILE A CD1  1 
ATOM   1196 H H    . ILE A 1 126 ? 25.383  61.144 -37.280 1.00 0.00  ? 126 ILE A H    1 
ATOM   1197 N N    . GLY A 1 127 ? 26.855  60.356 -35.400 1.00 80.09 ? 127 GLY A N    1 
ATOM   1198 C CA   . GLY A 1 127 ? 27.099  59.471 -34.290 1.00 75.45 ? 127 GLY A CA   1 
ATOM   1199 C C    . GLY A 1 127 ? 28.102  60.236 -33.448 1.00 71.46 ? 127 GLY A C    1 
ATOM   1200 O O    . GLY A 1 127 ? 28.045  61.460 -33.373 1.00 79.94 ? 127 GLY A O    1 
ATOM   1201 H H    . GLY A 1 127 ? 26.040  60.873 -35.423 1.00 0.00  ? 127 GLY A H    1 
ATOM   1202 N N    . THR A 1 128 ? 29.078  59.520 -32.924 1.00 78.23 ? 128 THR A N    1 
ATOM   1203 C CA   . THR A 1 128 ? 30.143  60.074 -32.107 1.00 75.12 ? 128 THR A CA   1 
ATOM   1204 C C    . THR A 1 128 ? 31.047  58.862 -32.011 1.00 72.57 ? 128 THR A C    1 
ATOM   1205 O O    . THR A 1 128 ? 31.885  58.628 -32.881 1.00 73.18 ? 128 THR A O    1 
ATOM   1206 C CB   . THR A 1 128 ? 29.645  60.474 -30.675 1.00 75.67 ? 128 THR A CB   1 
ATOM   1207 O OG1  . THR A 1 128 ? 28.551  61.393 -30.782 1.00 84.78 ? 128 THR A OG1  1 
ATOM   1208 C CG2  . THR A 1 128 ? 30.774  61.104 -29.828 1.00 86.09 ? 128 THR A CG2  1 
ATOM   1209 H H    . THR A 1 128 ? 29.128  58.581 -33.146 1.00 0.00  ? 128 THR A H    1 
ATOM   1210 H HG1  . THR A 1 128 ? 28.666  62.226 -30.300 1.00 0.00  ? 128 THR A HG1  1 
ATOM   1211 N N    . THR A 1 129 ? 30.713  57.983 -31.078 1.00 78.52 ? 129 THR A N    1 
ATOM   1212 C CA   . THR A 1 129 ? 31.495  56.798 -30.852 1.00 76.18 ? 129 THR A CA   1 
ATOM   1213 C C    . THR A 1 129 ? 30.635  55.573 -30.572 1.00 54.53 ? 129 THR A C    1 
ATOM   1214 O O    . THR A 1 129 ? 31.177  54.505 -30.337 1.00 51.15 ? 129 THR A O    1 
ATOM   1215 C CB   . THR A 1 129 ? 32.460  57.039 -29.693 1.00 76.40 ? 129 THR A CB   1 
ATOM   1216 O OG1  . THR A 1 129 ? 32.531  58.453 -29.447 1.00 76.78 ? 129 THR A OG1  1 
ATOM   1217 C CG2  . THR A 1 129 ? 33.847  56.520 -30.020 1.00 73.56 ? 129 THR A CG2  1 
ATOM   1218 H H    . THR A 1 129 ? 29.981  58.105 -30.461 1.00 0.00  ? 129 THR A H    1 
ATOM   1219 H HG1  . THR A 1 129 ? 33.103  58.597 -28.723 1.00 0.00  ? 129 THR A HG1  1 
ATOM   1220 N N    . GLY A 1 130 ? 29.309  55.742 -30.523 1.00 48.10 ? 130 GLY A N    1 
ATOM   1221 C CA   . GLY A 1 130 ? 28.419  54.607 -30.324 1.00 41.87 ? 130 GLY A CA   1 
ATOM   1222 C C    . GLY A 1 130 ? 28.957  53.583 -31.298 1.00 36.15 ? 130 GLY A C    1 
ATOM   1223 O O    . GLY A 1 130 ? 29.736  52.739 -30.960 1.00 37.66 ? 130 GLY A O    1 
ATOM   1224 H H    . GLY A 1 130 ? 28.943  56.635 -30.561 1.00 0.00  ? 130 GLY A H    1 
ATOM   1225 N N    . ARG A 1 131 ? 28.545  53.715 -32.568 1.00 34.40 ? 131 ARG A N    1 
ATOM   1226 C CA   . ARG A 1 131 ? 29.046  52.869 -33.629 1.00 29.24 ? 131 ARG A CA   1 
ATOM   1227 C C    . ARG A 1 131 ? 29.071  51.339 -33.544 1.00 23.87 ? 131 ARG A C    1 
ATOM   1228 O O    . ARG A 1 131 ? 30.089  50.729 -33.163 1.00 23.54 ? 131 ARG A O    1 
ATOM   1229 C CB   . ARG A 1 131 ? 30.435  53.376 -34.051 1.00 34.70 ? 131 ARG A CB   1 
ATOM   1230 C CG   . ARG A 1 131 ? 30.448  54.741 -34.749 1.00 37.78 ? 131 ARG A CG   1 
ATOM   1231 C CD   . ARG A 1 131 ? 29.702  54.767 -36.099 1.00 41.22 ? 131 ARG A CD   1 
ATOM   1232 N NE   . ARG A 1 131 ? 28.247  54.668 -35.943 1.00 44.20 ? 131 ARG A NE   1 
ATOM   1233 C CZ   . ARG A 1 131 ? 27.352  55.395 -36.611 1.00 44.21 ? 131 ARG A CZ   1 
ATOM   1234 N NH1  . ARG A 1 131 ? 27.741  56.293 -37.498 1.00 47.55 ? 131 ARG A NH1  1 
ATOM   1235 N NH2  . ARG A 1 131 ? 26.059  55.192 -36.421 1.00 44.79 ? 131 ARG A NH2  1 
ATOM   1236 H H    . ARG A 1 131 ? 27.848  54.371 -32.773 1.00 0.00  ? 131 ARG A H    1 
ATOM   1237 H HE   . ARG A 1 131 ? 27.862  54.008 -35.337 1.00 0.00  ? 131 ARG A HE   1 
ATOM   1238 H HH11 . ARG A 1 131 ? 28.712  56.436 -37.708 1.00 0.00  ? 131 ARG A HH11 1 
ATOM   1239 H HH12 . ARG A 1 131 ? 27.053  56.834 -37.975 1.00 0.00  ? 131 ARG A HH12 1 
ATOM   1240 H HH21 . ARG A 1 131 ? 25.681  54.496 -35.804 1.00 0.00  ? 131 ARG A HH21 1 
ATOM   1241 H HH22 . ARG A 1 131 ? 25.360  55.735 -36.893 1.00 0.00  ? 131 ARG A HH22 1 
ATOM   1242 N N    . GLY A 1 132 ? 27.983  50.722 -33.980 1.00 18.09 ? 132 GLY A N    1 
ATOM   1243 C CA   . GLY A 1 132 ? 27.897  49.268 -34.016 1.00 14.89 ? 132 GLY A CA   1 
ATOM   1244 C C    . GLY A 1 132 ? 27.345  48.602 -32.774 1.00 17.57 ? 132 GLY A C    1 
ATOM   1245 O O    . GLY A 1 132 ? 27.099  47.369 -32.742 1.00 18.34 ? 132 GLY A O    1 
ATOM   1246 H H    . GLY A 1 132 ? 27.177  51.208 -34.298 1.00 0.00  ? 132 GLY A H    1 
ATOM   1247 N N    . ILE A 1 133 ? 27.151  49.397 -31.733 1.00 17.06 ? 133 ILE A N    1 
ATOM   1248 C CA   . ILE A 1 133 ? 26.605  48.865 -30.515 1.00 18.81 ? 133 ILE A CA   1 
ATOM   1249 C C    . ILE A 1 133 ? 25.285  48.118 -30.825 1.00 16.11 ? 133 ILE A C    1 
ATOM   1250 O O    . ILE A 1 133 ? 25.196  46.899 -30.619 1.00 13.12 ? 133 ILE A O    1 
ATOM   1251 C CB   . ILE A 1 133 ? 26.498  49.996 -29.468 1.00 19.85 ? 133 ILE A CB   1 
ATOM   1252 C CG1  . ILE A 1 133 ? 27.907  50.217 -28.850 1.00 19.32 ? 133 ILE A CG1  1 
ATOM   1253 C CG2  . ILE A 1 133 ? 25.333  49.731 -28.457 1.00 20.31 ? 133 ILE A CG2  1 
ATOM   1254 C CD1  . ILE A 1 133 ? 28.076  51.476 -27.975 1.00 13.40 ? 133 ILE A CD1  1 
ATOM   1255 H H    . ILE A 1 133 ? 27.387  50.344 -31.790 1.00 0.00  ? 133 ILE A H    1 
ATOM   1256 N N    . GLY A 1 134 ? 24.310  48.821 -31.401 1.00 16.31 ? 134 GLY A N    1 
ATOM   1257 C CA   . GLY A 1 134 ? 23.037  48.186 -31.759 1.00 14.05 ? 134 GLY A CA   1 
ATOM   1258 C C    . GLY A 1 134 ? 23.224  46.846 -32.468 1.00 13.32 ? 134 GLY A C    1 
ATOM   1259 O O    . GLY A 1 134 ? 22.542  45.883 -32.136 1.00 12.62 ? 134 GLY A O    1 
ATOM   1260 H H    . GLY A 1 134 ? 24.457  49.762 -31.577 1.00 0.00  ? 134 GLY A H    1 
ATOM   1261 N N    . PRO A 1 135 ? 24.074  46.772 -33.517 1.00 16.09 ? 135 PRO A N    1 
ATOM   1262 C CA   . PRO A 1 135 ? 24.250  45.471 -34.178 1.00 14.23 ? 135 PRO A CA   1 
ATOM   1263 C C    . PRO A 1 135 ? 24.805  44.365 -33.238 1.00 17.02 ? 135 PRO A C    1 
ATOM   1264 O O    . PRO A 1 135 ? 24.099  43.363 -33.009 1.00 18.90 ? 135 PRO A O    1 
ATOM   1265 C CB   . PRO A 1 135 ? 25.155  45.817 -35.357 1.00 15.49 ? 135 PRO A CB   1 
ATOM   1266 C CG   . PRO A 1 135 ? 24.607  47.171 -35.783 1.00 12.18 ? 135 PRO A CG   1 
ATOM   1267 C CD   . PRO A 1 135 ? 24.479  47.873 -34.430 1.00 14.05 ? 135 PRO A CD   1 
ATOM   1268 N N    . ALA A 1 136 ? 25.970  44.587 -32.598 1.00 15.10 ? 136 ALA A N    1 
ATOM   1269 C CA   . ALA A 1 136 ? 26.558  43.590 -31.698 1.00 13.54 ? 136 ALA A CA   1 
ATOM   1270 C C    . ALA A 1 136 ? 25.514  42.985 -30.722 1.00 15.64 ? 136 ALA A C    1 
ATOM   1271 O O    . ALA A 1 136 ? 25.577  41.788 -30.341 1.00 13.54 ? 136 ALA A O    1 
ATOM   1272 C CB   . ALA A 1 136 ? 27.721  44.177 -30.945 1.00 10.67 ? 136 ALA A CB   1 
ATOM   1273 H H    . ALA A 1 136 ? 26.409  45.464 -32.700 1.00 0.00  ? 136 ALA A H    1 
ATOM   1274 N N    . TYR A 1 137 ? 24.535  43.806 -30.361 1.00 15.13 ? 137 TYR A N    1 
ATOM   1275 C CA   . TYR A 1 137 ? 23.457  43.399 -29.484 1.00 18.37 ? 137 TYR A CA   1 
ATOM   1276 C C    . TYR A 1 137 ? 22.500  42.487 -30.249 1.00 20.40 ? 137 TYR A C    1 
ATOM   1277 O O    . TYR A 1 137 ? 22.073  41.483 -29.702 1.00 21.56 ? 137 TYR A O    1 
ATOM   1278 C CB   . TYR A 1 137 ? 22.677  44.611 -29.004 1.00 21.76 ? 137 TYR A CB   1 
ATOM   1279 C CG   . TYR A 1 137 ? 23.144  45.216 -27.718 1.00 22.64 ? 137 TYR A CG   1 
ATOM   1280 C CD1  . TYR A 1 137 ? 23.283  44.442 -26.567 1.00 25.08 ? 137 TYR A CD1  1 
ATOM   1281 C CD2  . TYR A 1 137 ? 23.435  46.567 -27.639 1.00 23.07 ? 137 TYR A CD2  1 
ATOM   1282 C CE1  . TYR A 1 137 ? 23.703  45.011 -25.369 1.00 25.84 ? 137 TYR A CE1  1 
ATOM   1283 C CE2  . TYR A 1 137 ? 23.852  47.138 -26.447 1.00 25.32 ? 137 TYR A CE2  1 
ATOM   1284 C CZ   . TYR A 1 137 ? 23.985  46.358 -25.319 1.00 25.38 ? 137 TYR A CZ   1 
ATOM   1285 O OH   . TYR A 1 137 ? 24.405  46.933 -24.137 1.00 30.99 ? 137 TYR A OH   1 
ATOM   1286 H H    . TYR A 1 137 ? 24.584  44.741 -30.655 1.00 0.00  ? 137 TYR A H    1 
ATOM   1287 H HH   . TYR A 1 137 ? 24.778  46.267 -23.539 1.00 0.00  ? 137 TYR A HH   1 
ATOM   1288 N N    . GLU A 1 138 ? 22.086  42.867 -31.462 1.00 21.58 ? 138 GLU A N    1 
ATOM   1289 C CA   . GLU A 1 138 ? 21.189  42.006 -32.237 1.00 21.01 ? 138 GLU A CA   1 
ATOM   1290 C C    . GLU A 1 138 ? 21.804  40.588 -32.499 1.00 21.27 ? 138 GLU A C    1 
ATOM   1291 O O    . GLU A 1 138 ? 21.080  39.565 -32.466 1.00 17.58 ? 138 GLU A O    1 
ATOM   1292 C CB   . GLU A 1 138 ? 20.786  42.670 -33.568 1.00 23.62 ? 138 GLU A CB   1 
ATOM   1293 C CG   . GLU A 1 138 ? 20.016  41.704 -34.498 1.00 25.51 ? 138 GLU A CG   1 
ATOM   1294 C CD   . GLU A 1 138 ? 19.439  42.342 -35.762 1.00 24.79 ? 138 GLU A CD   1 
ATOM   1295 O OE1  . GLU A 1 138 ? 19.449  43.578 -35.890 1.00 30.22 ? 138 GLU A OE1  1 
ATOM   1296 O OE2  . GLU A 1 138 ? 18.970  41.604 -36.661 1.00 21.70 ? 138 GLU A OE2  1 
ATOM   1297 H H    . GLU A 1 138 ? 22.361  43.741 -31.819 1.00 0.00  ? 138 GLU A H    1 
ATOM   1298 N N    . ASP A 1 139 ? 23.138  40.534 -32.685 1.00 21.41 ? 139 ASP A N    1 
ATOM   1299 C CA   . ASP A 1 139 ? 23.861  39.282 -32.938 1.00 20.42 ? 139 ASP A CA   1 
ATOM   1300 C C    . ASP A 1 139 ? 23.828  38.367 -31.751 1.00 20.42 ? 139 ASP A C    1 
ATOM   1301 O O    . ASP A 1 139 ? 23.964  37.147 -31.881 1.00 20.11 ? 139 ASP A O    1 
ATOM   1302 C CB   . ASP A 1 139 ? 25.334  39.533 -33.220 1.00 19.86 ? 139 ASP A CB   1 
ATOM   1303 C CG   . ASP A 1 139 ? 25.687  39.458 -34.687 1.00 18.95 ? 139 ASP A CG   1 
ATOM   1304 O OD1  . ASP A 1 139 ? 24.798  39.387 -35.567 1.00 15.96 ? 139 ASP A OD1  1 
ATOM   1305 O OD2  . ASP A 1 139 ? 26.891  39.522 -34.953 1.00 18.67 ? 139 ASP A OD2  1 
ATOM   1306 H H    . ASP A 1 139 ? 23.592  41.407 -32.702 1.00 0.00  ? 139 ASP A H    1 
ATOM   1307 N N    . LYS A 1 140 ? 23.814  39.000 -30.592 1.00 21.89 ? 140 LYS A N    1 
ATOM   1308 C CA   . LYS A 1 140 ? 23.798  38.323 -29.303 1.00 22.23 ? 140 LYS A CA   1 
ATOM   1309 C C    . LYS A 1 140 ? 22.454  37.640 -29.123 1.00 21.10 ? 140 LYS A C    1 
ATOM   1310 O O    . LYS A 1 140 ? 22.402  36.432 -28.814 1.00 21.39 ? 140 LYS A O    1 
ATOM   1311 C CB   . LYS A 1 140 ? 24.067  39.343 -28.180 1.00 21.21 ? 140 LYS A CB   1 
ATOM   1312 C CG   . LYS A 1 140 ? 23.561  38.943 -26.803 1.00 24.54 ? 140 LYS A CG   1 
ATOM   1313 C CD   . LYS A 1 140 ? 23.787  40.071 -25.817 1.00 23.69 ? 140 LYS A CD   1 
ATOM   1314 C CE   . LYS A 1 140 ? 23.477  39.643 -24.407 1.00 24.47 ? 140 LYS A CE   1 
ATOM   1315 N NZ   . LYS A 1 140 ? 23.856  40.696 -23.421 1.00 22.59 ? 140 LYS A NZ   1 
ATOM   1316 H H    . LYS A 1 140 ? 23.835  39.975 -30.604 1.00 0.00  ? 140 LYS A H    1 
ATOM   1317 H HZ1  . LYS A 1 140 ? 23.338  41.576 -23.594 1.00 0.00  ? 140 LYS A HZ1  1 
ATOM   1318 H HZ2  . LYS A 1 140 ? 23.581  40.300 -22.488 1.00 0.00  ? 140 LYS A HZ2  1 
ATOM   1319 H HZ3  . LYS A 1 140 ? 24.883  40.837 -23.421 1.00 0.00  ? 140 LYS A HZ3  1 
ATOM   1320 N N    . VAL A 1 141 ? 21.391  38.394 -29.397 1.00 19.72 ? 141 VAL A N    1 
ATOM   1321 C CA   . VAL A 1 141 ? 20.022  37.908 -29.274 1.00 20.74 ? 141 VAL A CA   1 
ATOM   1322 C C    . VAL A 1 141 ? 19.644  36.782 -30.250 1.00 22.02 ? 141 VAL A C    1 
ATOM   1323 O O    . VAL A 1 141 ? 18.892  35.859 -29.876 1.00 22.83 ? 141 VAL A O    1 
ATOM   1324 C CB   . VAL A 1 141 ? 19.009  39.075 -29.329 1.00 22.57 ? 141 VAL A CB   1 
ATOM   1325 C CG1  . VAL A 1 141 ? 17.614  38.546 -29.389 1.00 22.12 ? 141 VAL A CG1  1 
ATOM   1326 C CG2  . VAL A 1 141 ? 19.157  39.978 -28.079 1.00 16.50 ? 141 VAL A CG2  1 
ATOM   1327 H H    . VAL A 1 141 ? 21.554  39.332 -29.643 1.00 0.00  ? 141 VAL A H    1 
ATOM   1328 N N    . ALA A 1 142 ? 20.142  36.862 -31.491 1.00 22.09 ? 142 ALA A N    1 
ATOM   1329 C CA   . ALA A 1 142 ? 19.903  35.825 -32.516 1.00 19.36 ? 142 ALA A CA   1 
ATOM   1330 C C    . ALA A 1 142 ? 20.822  34.601 -32.248 1.00 19.70 ? 142 ALA A C    1 
ATOM   1331 O O    . ALA A 1 142 ? 20.578  33.466 -32.690 1.00 20.98 ? 142 ALA A O    1 
ATOM   1332 C CB   . ALA A 1 142 ? 20.199  36.380 -33.861 1.00 18.08 ? 142 ALA A CB   1 
ATOM   1333 H H    . ALA A 1 142 ? 20.599  37.692 -31.754 1.00 0.00  ? 142 ALA A H    1 
ATOM   1334 N N    . ARG A 1 143 ? 21.850  34.869 -31.464 1.00 18.90 ? 143 ARG A N    1 
ATOM   1335 C CA   . ARG A 1 143 ? 22.877  33.913 -31.077 1.00 17.76 ? 143 ARG A CA   1 
ATOM   1336 C C    . ARG A 1 143 ? 23.891  33.555 -32.143 1.00 16.96 ? 143 ARG A C    1 
ATOM   1337 O O    . ARG A 1 143 ? 24.278  32.401 -32.228 1.00 16.54 ? 143 ARG A O    1 
ATOM   1338 C CB   . ARG A 1 143 ? 22.289  32.676 -30.412 1.00 16.50 ? 143 ARG A CB   1 
ATOM   1339 C CG   . ARG A 1 143 ? 22.488  32.656 -28.878 1.00 19.16 ? 143 ARG A CG   1 
ATOM   1340 C CD   . ARG A 1 143 ? 21.237  32.113 -28.141 1.00 16.78 ? 143 ARG A CD   1 
ATOM   1341 N NE   . ARG A 1 143 ? 20.019  32.624 -28.773 1.00 15.04 ? 143 ARG A NE   1 
ATOM   1342 C CZ   . ARG A 1 143 ? 18.846  31.993 -28.788 1.00 15.12 ? 143 ARG A CZ   1 
ATOM   1343 N NH1  . ARG A 1 143 ? 18.703  30.838 -28.175 1.00 16.89 ? 143 ARG A NH1  1 
ATOM   1344 N NH2  . ARG A 1 143 ? 17.845  32.461 -29.532 1.00 19.58 ? 143 ARG A NH2  1 
ATOM   1345 H H    . ARG A 1 143 ? 21.951  35.771 -31.102 1.00 0.00  ? 143 ARG A H    1 
ATOM   1346 H HE   . ARG A 1 143 ? 20.081  33.515 -29.180 1.00 0.00  ? 143 ARG A HE   1 
ATOM   1347 H HH11 . ARG A 1 143 ? 19.465  30.397 -27.695 1.00 0.00  ? 143 ARG A HH11 1 
ATOM   1348 H HH12 . ARG A 1 143 ? 17.836  30.346 -28.201 1.00 0.00  ? 143 ARG A HH12 1 
ATOM   1349 H HH21 . ARG A 1 143 ? 17.983  33.305 -30.056 1.00 0.00  ? 143 ARG A HH21 1 
ATOM   1350 H HH22 . ARG A 1 143 ? 16.963  31.989 -29.596 1.00 0.00  ? 143 ARG A HH22 1 
ATOM   1351 N N    . ARG A 1 144 ? 24.369  34.546 -32.901 1.00 17.88 ? 144 ARG A N    1 
ATOM   1352 C CA   . ARG A 1 144 ? 25.406  34.311 -33.947 1.00 17.29 ? 144 ARG A CA   1 
ATOM   1353 C C    . ARG A 1 144 ? 26.696  34.874 -33.383 1.00 14.68 ? 144 ARG A C    1 
ATOM   1354 O O    . ARG A 1 144 ? 27.776  34.376 -33.624 1.00 18.68 ? 144 ARG A O    1 
ATOM   1355 C CB   . ARG A 1 144 ? 25.167  35.114 -35.239 1.00 13.75 ? 144 ARG A CB   1 
ATOM   1356 C CG   . ARG A 1 144 ? 23.791  35.037 -35.851 1.00 13.51 ? 144 ARG A CG   1 
ATOM   1357 C CD   . ARG A 1 144 ? 23.674  36.025 -36.988 1.00 15.16 ? 144 ARG A CD   1 
ATOM   1358 N NE   . ARG A 1 144 ? 22.900  37.212 -36.621 1.00 19.04 ? 144 ARG A NE   1 
ATOM   1359 C CZ   . ARG A 1 144 ? 21.635  37.403 -37.004 1.00 21.86 ? 144 ARG A CZ   1 
ATOM   1360 N NH1  . ARG A 1 144 ? 21.059  36.473 -37.766 1.00 14.90 ? 144 ARG A NH1  1 
ATOM   1361 N NH2  . ARG A 1 144 ? 20.946  38.493 -36.615 1.00 19.84 ? 144 ARG A NH2  1 
ATOM   1362 H H    . ARG A 1 144 ? 24.073  35.463 -32.690 1.00 0.00  ? 144 ARG A H    1 
ATOM   1363 H HE   . ARG A 1 144 ? 23.372  37.924 -36.118 1.00 0.00  ? 144 ARG A HE   1 
ATOM   1364 H HH11 . ARG A 1 144 ? 21.556  35.644 -38.036 1.00 0.00  ? 144 ARG A HH11 1 
ATOM   1365 H HH12 . ARG A 1 144 ? 20.124  36.611 -38.082 1.00 0.00  ? 144 ARG A HH12 1 
ATOM   1366 H HH21 . ARG A 1 144 ? 21.384  39.187 -36.035 1.00 0.00  ? 144 ARG A HH21 1 
ATOM   1367 H HH22 . ARG A 1 144 ? 19.990  38.677 -36.864 1.00 0.00  ? 144 ARG A HH22 1 
ATOM   1368 N N    . GLY A 1 145 ? 26.545  35.962 -32.650 1.00 16.24 ? 145 GLY A N    1 
ATOM   1369 C CA   . GLY A 1 145 ? 27.662  36.696 -32.096 1.00 12.04 ? 145 GLY A CA   1 
ATOM   1370 C C    . GLY A 1 145 ? 28.805  35.919 -31.516 1.00 9.74  ? 145 GLY A C    1 
ATOM   1371 O O    . GLY A 1 145 ? 28.723  34.701 -31.341 1.00 8.42  ? 145 GLY A O    1 
ATOM   1372 H H    . GLY A 1 145 ? 25.646  36.295 -32.452 1.00 0.00  ? 145 GLY A H    1 
ATOM   1373 N N    . LEU A 1 146 ? 29.851  36.668 -31.184 1.00 12.73 ? 146 LEU A N    1 
ATOM   1374 C CA   . LEU A 1 146 ? 31.092  36.161 -30.614 1.00 12.45 ? 146 LEU A CA   1 
ATOM   1375 C C    . LEU A 1 146 ? 31.314  36.929 -29.355 1.00 9.69  ? 146 LEU A C    1 
ATOM   1376 O O    . LEU A 1 146 ? 31.224  38.138 -29.351 1.00 5.61  ? 146 LEU A O    1 
ATOM   1377 C CB   . LEU A 1 146 ? 32.273  36.470 -31.528 1.00 13.57 ? 146 LEU A CB   1 
ATOM   1378 C CG   . LEU A 1 146 ? 32.240  35.727 -32.848 1.00 14.95 ? 146 LEU A CG   1 
ATOM   1379 C CD1  . LEU A 1 146 ? 32.332  36.749 -33.977 1.00 16.24 ? 146 LEU A CD1  1 
ATOM   1380 C CD2  . LEU A 1 146 ? 33.403  34.684 -32.900 1.00 16.23 ? 146 LEU A CD2  1 
ATOM   1381 H H    . LEU A 1 146 ? 29.783  37.637 -31.327 1.00 0.00  ? 146 LEU A H    1 
ATOM   1382 N N    . ARG A 1 147 ? 31.698  36.211 -28.319 1.00 12.14 ? 147 ARG A N    1 
ATOM   1383 C CA   . ARG A 1 147 ? 31.951  36.756 -27.017 1.00 15.49 ? 147 ARG A CA   1 
ATOM   1384 C C    . ARG A 1 147 ? 33.451  36.739 -26.815 1.00 16.01 ? 147 ARG A C    1 
ATOM   1385 O O    . ARG A 1 147 ? 34.194  36.314 -27.706 1.00 15.73 ? 147 ARG A O    1 
ATOM   1386 C CB   . ARG A 1 147 ? 31.269  35.874 -25.974 1.00 15.81 ? 147 ARG A CB   1 
ATOM   1387 C CG   . ARG A 1 147 ? 30.050  35.109 -26.517 1.00 15.92 ? 147 ARG A CG   1 
ATOM   1388 C CD   . ARG A 1 147 ? 28.979  34.979 -25.473 1.00 14.92 ? 147 ARG A CD   1 
ATOM   1389 N NE   . ARG A 1 147 ? 29.369  34.139 -24.351 1.00 13.50 ? 147 ARG A NE   1 
ATOM   1390 C CZ   . ARG A 1 147 ? 28.562  33.889 -23.331 1.00 13.08 ? 147 ARG A CZ   1 
ATOM   1391 N NH1  . ARG A 1 147 ? 27.362  34.437 -23.342 1.00 10.82 ? 147 ARG A NH1  1 
ATOM   1392 N NH2  . ARG A 1 147 ? 28.948  33.118 -22.303 1.00 20.51 ? 147 ARG A NH2  1 
ATOM   1393 H H    . ARG A 1 147 ? 31.902  35.254 -28.492 1.00 0.00  ? 147 ARG A H    1 
ATOM   1394 H HE   . ARG A 1 147 ? 30.272  33.746 -24.352 1.00 0.00  ? 147 ARG A HE   1 
ATOM   1395 H HH11 . ARG A 1 147 ? 27.059  35.039 -24.083 1.00 0.00  ? 147 ARG A HH11 1 
ATOM   1396 H HH12 . ARG A 1 147 ? 26.710  34.291 -22.588 1.00 0.00  ? 147 ARG A HH12 1 
ATOM   1397 H HH21 . ARG A 1 147 ? 29.876  32.736 -22.214 1.00 0.00  ? 147 ARG A HH21 1 
ATOM   1398 H HH22 . ARG A 1 147 ? 28.332  32.937 -21.529 1.00 0.00  ? 147 ARG A HH22 1 
ATOM   1399 N N    . VAL A 1 148 ? 33.885  37.181 -25.634 1.00 18.20 ? 148 VAL A N    1 
ATOM   1400 C CA   . VAL A 1 148 ? 35.303  37.233 -25.269 1.00 16.58 ? 148 VAL A CA   1 
ATOM   1401 C C    . VAL A 1 148 ? 35.894  35.807 -25.112 1.00 17.22 ? 148 VAL A C    1 
ATOM   1402 O O    . VAL A 1 148 ? 36.987  35.511 -25.613 1.00 19.20 ? 148 VAL A O    1 
ATOM   1403 C CB   . VAL A 1 148 ? 35.486  38.121 -24.002 1.00 16.77 ? 148 VAL A CB   1 
ATOM   1404 C CG1  . VAL A 1 148 ? 36.926  38.180 -23.560 1.00 16.62 ? 148 VAL A CG1  1 
ATOM   1405 C CG2  . VAL A 1 148 ? 35.022  39.518 -24.306 1.00 15.41 ? 148 VAL A CG2  1 
ATOM   1406 H H    . VAL A 1 148 ? 33.210  37.528 -25.014 1.00 0.00  ? 148 VAL A H    1 
ATOM   1407 N N    . GLY A 1 149 ? 35.121  34.916 -24.497 1.00 19.43 ? 149 GLY A N    1 
ATOM   1408 C CA   . GLY A 1 149 ? 35.542  33.536 -24.302 1.00 22.21 ? 149 GLY A CA   1 
ATOM   1409 C C    . GLY A 1 149 ? 35.816  32.738 -25.582 1.00 24.36 ? 149 GLY A C    1 
ATOM   1410 O O    . GLY A 1 149 ? 36.525  31.721 -25.538 1.00 23.29 ? 149 GLY A O    1 
ATOM   1411 H H    . GLY A 1 149 ? 34.250  35.209 -24.145 1.00 0.00  ? 149 GLY A H    1 
ATOM   1412 N N    . ASP A 1 150 ? 35.249  33.164 -26.713 1.00 25.65 ? 150 ASP A N    1 
ATOM   1413 C CA   . ASP A 1 150 ? 35.481  32.468 -27.979 1.00 26.94 ? 150 ASP A CA   1 
ATOM   1414 C C    . ASP A 1 150 ? 36.965  32.543 -28.325 1.00 27.71 ? 150 ASP A C    1 
ATOM   1415 O O    . ASP A 1 150 ? 37.474  31.752 -29.120 1.00 29.54 ? 150 ASP A O    1 
ATOM   1416 C CB   . ASP A 1 150 ? 34.715  33.134 -29.126 1.00 27.11 ? 150 ASP A CB   1 
ATOM   1417 C CG   . ASP A 1 150 ? 33.255  32.843 -29.094 1.00 23.59 ? 150 ASP A CG   1 
ATOM   1418 O OD1  . ASP A 1 150 ? 32.887  31.659 -29.200 1.00 24.30 ? 150 ASP A OD1  1 
ATOM   1419 O OD2  . ASP A 1 150 ? 32.459  33.785 -28.974 1.00 23.75 ? 150 ASP A OD2  1 
ATOM   1420 H H    . ASP A 1 150 ? 34.666  33.952 -26.723 1.00 0.00  ? 150 ASP A H    1 
ATOM   1421 N N    . LEU A 1 151 ? 37.644  33.522 -27.741 1.00 27.01 ? 151 LEU A N    1 
ATOM   1422 C CA   . LEU A 1 151 ? 39.058  33.743 -27.988 1.00 28.42 ? 151 LEU A CA   1 
ATOM   1423 C C    . LEU A 1 151 ? 40.026  32.835 -27.237 1.00 30.27 ? 151 LEU A C    1 
ATOM   1424 O O    . LEU A 1 151 ? 41.249  33.054 -27.272 1.00 32.06 ? 151 LEU A O    1 
ATOM   1425 C CB   . LEU A 1 151 ? 39.400  35.228 -27.758 1.00 26.03 ? 151 LEU A CB   1 
ATOM   1426 C CG   . LEU A 1 151 ? 39.009  36.110 -28.941 1.00 21.19 ? 151 LEU A CG   1 
ATOM   1427 C CD1  . LEU A 1 151 ? 38.815  37.571 -28.534 1.00 18.68 ? 151 LEU A CD1  1 
ATOM   1428 C CD2  . LEU A 1 151 ? 40.046  35.920 -29.992 1.00 18.81 ? 151 LEU A CD2  1 
ATOM   1429 H H    . LEU A 1 151 ? 37.200  34.151 -27.132 1.00 0.00  ? 151 LEU A H    1 
ATOM   1430 N N    . PHE A 1 152 ? 39.494  31.844 -26.535 1.00 30.28 ? 152 PHE A N    1 
ATOM   1431 C CA   . PHE A 1 152 ? 40.335  30.903 -25.816 1.00 32.32 ? 152 PHE A CA   1 
ATOM   1432 C C    . PHE A 1 152 ? 40.698  29.792 -26.815 1.00 34.07 ? 152 PHE A C    1 
ATOM   1433 O O    . PHE A 1 152 ? 41.813  29.264 -26.840 1.00 34.08 ? 152 PHE A O    1 
ATOM   1434 C CB   . PHE A 1 152 ? 39.585  30.361 -24.607 1.00 31.94 ? 152 PHE A CB   1 
ATOM   1435 C CG   . PHE A 1 152 ? 39.683  31.241 -23.382 1.00 33.21 ? 152 PHE A CG   1 
ATOM   1436 C CD1  . PHE A 1 152 ? 40.920  31.503 -22.792 1.00 33.78 ? 152 PHE A CD1  1 
ATOM   1437 C CD2  . PHE A 1 152 ? 38.544  31.734 -22.764 1.00 34.08 ? 152 PHE A CD2  1 
ATOM   1438 C CE1  . PHE A 1 152 ? 41.015  32.227 -21.610 1.00 31.03 ? 152 PHE A CE1  1 
ATOM   1439 C CE2  . PHE A 1 152 ? 38.637  32.463 -21.570 1.00 33.81 ? 152 PHE A CE2  1 
ATOM   1440 C CZ   . PHE A 1 152 ? 39.873  32.703 -21.000 1.00 33.09 ? 152 PHE A CZ   1 
ATOM   1441 H H    . PHE A 1 152 ? 38.518  31.747 -26.480 1.00 0.00  ? 152 PHE A H    1 
ATOM   1442 N N    . ASP A 1 153 ? 39.761  29.532 -27.714 1.00 36.77 ? 153 ASP A N    1 
ATOM   1443 C CA   . ASP A 1 153 ? 39.910  28.539 -28.765 1.00 35.86 ? 153 ASP A CA   1 
ATOM   1444 C C    . ASP A 1 153 ? 40.044  29.357 -30.071 1.00 35.52 ? 153 ASP A C    1 
ATOM   1445 O O    . ASP A 1 153 ? 39.059  29.650 -30.777 1.00 34.04 ? 153 ASP A O    1 
ATOM   1446 C CB   . ASP A 1 153 ? 38.650  27.664 -28.757 1.00 36.18 ? 153 ASP A CB   1 
ATOM   1447 C CG   . ASP A 1 153 ? 38.683  26.526 -29.755 1.00 35.33 ? 153 ASP A CG   1 
ATOM   1448 O OD1  . ASP A 1 153 ? 39.466  26.525 -30.732 1.00 32.74 ? 153 ASP A OD1  1 
ATOM   1449 O OD2  . ASP A 1 153 ? 37.847  25.621 -29.560 1.00 37.85 ? 153 ASP A OD2  1 
ATOM   1450 H H    . ASP A 1 153 ? 38.923  30.036 -27.712 1.00 0.00  ? 153 ASP A H    1 
ATOM   1451 N N    . LYS A 1 154 ? 41.272  29.767 -30.359 1.00 35.62 ? 154 LYS A N    1 
ATOM   1452 C CA   . LYS A 1 154 ? 41.550  30.542 -31.552 1.00 37.01 ? 154 LYS A CA   1 
ATOM   1453 C C    . LYS A 1 154 ? 40.966  29.927 -32.824 1.00 38.73 ? 154 LYS A C    1 
ATOM   1454 O O    . LYS A 1 154 ? 40.362  30.653 -33.616 1.00 40.00 ? 154 LYS A O    1 
ATOM   1455 C CB   . LYS A 1 154 ? 43.052  30.737 -31.724 1.00 37.16 ? 154 LYS A CB   1 
ATOM   1456 C CG   . LYS A 1 154 ? 43.790  31.073 -30.440 1.00 37.82 ? 154 LYS A CG   1 
ATOM   1457 C CD   . LYS A 1 154 ? 44.486  32.431 -30.517 1.00 37.14 ? 154 LYS A CD   1 
ATOM   1458 C CE   . LYS A 1 154 ? 45.332  32.695 -29.266 1.00 33.19 ? 154 LYS A CE   1 
ATOM   1459 N NZ   . LYS A 1 154 ? 46.155  33.928 -29.351 1.00 29.54 ? 154 LYS A NZ   1 
ATOM   1460 H H    . LYS A 1 154 ? 41.985  29.524 -29.727 1.00 0.00  ? 154 LYS A H    1 
ATOM   1461 H HZ1  . LYS A 1 154 ? 46.831  33.893 -30.131 1.00 0.00  ? 154 LYS A HZ1  1 
ATOM   1462 H HZ2  . LYS A 1 154 ? 45.603  34.803 -29.421 1.00 0.00  ? 154 LYS A HZ2  1 
ATOM   1463 H HZ3  . LYS A 1 154 ? 46.724  34.012 -28.469 1.00 0.00  ? 154 LYS A HZ3  1 
ATOM   1464 N N    . GLU A 1 155 ? 41.100  28.605 -33.024 1.00 39.70 ? 155 GLU A N    1 
ATOM   1465 C CA   . GLU A 1 155 ? 40.577  27.990 -34.260 1.00 38.90 ? 155 GLU A CA   1 
ATOM   1466 C C    . GLU A 1 155 ? 39.095  28.195 -34.457 1.00 38.02 ? 155 GLU A C    1 
ATOM   1467 O O    . GLU A 1 155 ? 38.667  28.749 -35.469 1.00 37.68 ? 155 GLU A O    1 
ATOM   1468 C CB   . GLU A 1 155 ? 40.872  26.493 -34.378 1.00 40.10 ? 155 GLU A CB   1 
ATOM   1469 C CG   . GLU A 1 155 ? 39.875  25.806 -35.355 1.00 42.21 ? 155 GLU A CG   1 
ATOM   1470 C CD   . GLU A 1 155 ? 40.370  24.515 -35.981 1.00 45.66 ? 155 GLU A CD   1 
ATOM   1471 O OE1  . GLU A 1 155 ? 40.433  23.475 -35.278 1.00 43.90 ? 155 GLU A OE1  1 
ATOM   1472 O OE2  . GLU A 1 155 ? 40.712  24.530 -37.195 1.00 47.01 ? 155 GLU A OE2  1 
ATOM   1473 H H    . GLU A 1 155 ? 41.494  28.036 -32.332 1.00 0.00  ? 155 GLU A H    1 
ATOM   1474 N N    . THR A 1 156 ? 38.318  27.710 -33.497 1.00 37.05 ? 156 THR A N    1 
ATOM   1475 C CA   . THR A 1 156 ? 36.877  27.825 -33.552 1.00 35.07 ? 156 THR A CA   1 
ATOM   1476 C C    . THR A 1 156 ? 36.448  29.290 -33.784 1.00 34.72 ? 156 THR A C    1 
ATOM   1477 O O    . THR A 1 156 ? 35.568  29.552 -34.600 1.00 33.40 ? 156 THR A O    1 
ATOM   1478 C CB   . THR A 1 156 ? 36.245  27.224 -32.290 1.00 33.63 ? 156 THR A CB   1 
ATOM   1479 O OG1  . THR A 1 156 ? 36.944  26.020 -31.961 1.00 31.80 ? 156 THR A OG1  1 
ATOM   1480 C CG2  . THR A 1 156 ? 34.780  26.864 -32.558 1.00 35.77 ? 156 THR A CG2  1 
ATOM   1481 H H    . THR A 1 156 ? 38.699  27.232 -32.720 1.00 0.00  ? 156 THR A H    1 
ATOM   1482 H HG1  . THR A 1 156 ? 36.925  25.802 -31.008 1.00 0.00  ? 156 THR A HG1  1 
ATOM   1483 N N    . PHE A 1 157 ? 37.105  30.243 -33.129 1.00 34.97 ? 157 PHE A N    1 
ATOM   1484 C CA   . PHE A 1 157 ? 36.772  31.644 -33.347 1.00 36.07 ? 157 PHE A CA   1 
ATOM   1485 C C    . PHE A 1 157 ? 36.792  31.845 -34.856 1.00 36.73 ? 157 PHE A C    1 
ATOM   1486 O O    . PHE A 1 157 ? 35.773  32.239 -35.460 1.00 36.10 ? 157 PHE A O    1 
ATOM   1487 C CB   . PHE A 1 157 ? 37.815  32.576 -32.696 1.00 36.10 ? 157 PHE A CB   1 
ATOM   1488 C CG   . PHE A 1 157 ? 37.586  34.046 -32.971 1.00 36.63 ? 157 PHE A CG   1 
ATOM   1489 C CD1  . PHE A 1 157 ? 36.640  34.773 -32.238 1.00 38.22 ? 157 PHE A CD1  1 
ATOM   1490 C CD2  . PHE A 1 157 ? 38.338  34.713 -33.942 1.00 37.10 ? 157 PHE A CD2  1 
ATOM   1491 C CE1  . PHE A 1 157 ? 36.441  36.160 -32.465 1.00 39.45 ? 157 PHE A CE1  1 
ATOM   1492 C CE2  . PHE A 1 157 ? 38.152  36.095 -34.179 1.00 37.85 ? 157 PHE A CE2  1 
ATOM   1493 C CZ   . PHE A 1 157 ? 37.203  36.820 -33.437 1.00 38.93 ? 157 PHE A CZ   1 
ATOM   1494 H H    . PHE A 1 157 ? 37.785  30.011 -32.453 1.00 0.00  ? 157 PHE A H    1 
ATOM   1495 N N    . ALA A 1 158 ? 37.904  31.434 -35.465 1.00 34.65 ? 158 ALA A N    1 
ATOM   1496 C CA   . ALA A 1 158 ? 38.084  31.584 -36.892 1.00 34.60 ? 158 ALA A CA   1 
ATOM   1497 C C    . ALA A 1 158 ? 36.917  31.126 -37.769 1.00 34.96 ? 158 ALA A C    1 
ATOM   1498 O O    . ALA A 1 158 ? 36.441  31.929 -38.586 1.00 35.87 ? 158 ALA A O    1 
ATOM   1499 C CB   . ALA A 1 158 ? 39.351  30.946 -37.315 1.00 36.72 ? 158 ALA A CB   1 
ATOM   1500 H H    . ALA A 1 158 ? 38.627  31.044 -34.922 1.00 0.00  ? 158 ALA A H    1 
ATOM   1501 N N    . GLU A 1 159 ? 36.461  29.870 -37.624 1.00 33.83 ? 159 GLU A N    1 
ATOM   1502 C CA   . GLU A 1 159 ? 35.312  29.355 -38.409 1.00 33.79 ? 159 GLU A CA   1 
ATOM   1503 C C    . GLU A 1 159 ? 34.019  30.072 -37.994 1.00 33.25 ? 159 GLU A C    1 
ATOM   1504 O O    . GLU A 1 159 ? 33.212  30.470 -38.851 1.00 35.06 ? 159 GLU A O    1 
ATOM   1505 C CB   . GLU A 1 159 ? 35.124  27.833 -38.245 1.00 35.24 ? 159 GLU A CB   1 
ATOM   1506 C CG   . GLU A 1 159 ? 34.910  27.353 -36.794 1.00 39.52 ? 159 GLU A CG   1 
ATOM   1507 C CD   . GLU A 1 159 ? 34.664  25.841 -36.671 1.00 44.02 ? 159 GLU A CD   1 
ATOM   1508 O OE1  . GLU A 1 159 ? 35.574  25.037 -37.024 1.00 43.00 ? 159 GLU A OE1  1 
ATOM   1509 O OE2  . GLU A 1 159 ? 33.555  25.456 -36.213 1.00 45.07 ? 159 GLU A OE2  1 
ATOM   1510 H H    . GLU A 1 159 ? 36.933  29.310 -36.967 1.00 0.00  ? 159 GLU A H    1 
ATOM   1511 N N    . LYS A 1 160 ? 33.863  30.260 -36.680 1.00 32.42 ? 160 LYS A N    1 
ATOM   1512 C CA   . LYS A 1 160 ? 32.717  30.941 -36.099 1.00 30.20 ? 160 LYS A CA   1 
ATOM   1513 C C    . LYS A 1 160 ? 32.594  32.283 -36.796 1.00 29.22 ? 160 LYS A C    1 
ATOM   1514 O O    . LYS A 1 160 ? 31.497  32.658 -37.261 1.00 30.51 ? 160 LYS A O    1 
ATOM   1515 C CB   . LYS A 1 160 ? 32.920  31.200 -34.592 1.00 29.63 ? 160 LYS A CB   1 
ATOM   1516 C CG   . LYS A 1 160 ? 32.995  29.972 -33.720 1.00 29.19 ? 160 LYS A CG   1 
ATOM   1517 C CD   . LYS A 1 160 ? 33.091  30.293 -32.232 1.00 29.93 ? 160 LYS A CD   1 
ATOM   1518 C CE   . LYS A 1 160 ? 31.715  30.443 -31.598 1.00 29.06 ? 160 LYS A CE   1 
ATOM   1519 N NZ   . LYS A 1 160 ? 30.926  29.181 -31.506 1.00 28.96 ? 160 LYS A NZ   1 
ATOM   1520 H H    . LYS A 1 160 ? 34.550  29.935 -36.047 1.00 0.00  ? 160 LYS A H    1 
ATOM   1521 H HZ1  . LYS A 1 160 ? 30.783  28.748 -32.442 1.00 0.00  ? 160 LYS A HZ1  1 
ATOM   1522 H HZ2  . LYS A 1 160 ? 31.387  28.505 -30.870 1.00 0.00  ? 160 LYS A HZ2  1 
ATOM   1523 H HZ3  . LYS A 1 160 ? 29.980  29.417 -31.116 1.00 0.00  ? 160 LYS A HZ3  1 
ATOM   1524 N N    . LEU A 1 161 ? 33.725  32.991 -36.854 1.00 27.40 ? 161 LEU A N    1 
ATOM   1525 C CA   . LEU A 1 161 ? 33.818  34.311 -37.464 1.00 27.85 ? 161 LEU A CA   1 
ATOM   1526 C C    . LEU A 1 161 ? 33.387  34.249 -38.896 1.00 29.14 ? 161 LEU A C    1 
ATOM   1527 O O    . LEU A 1 161 ? 32.448  34.935 -39.281 1.00 31.95 ? 161 LEU A O    1 
ATOM   1528 C CB   . LEU A 1 161 ? 35.248  34.866 -37.396 1.00 26.80 ? 161 LEU A CB   1 
ATOM   1529 C CG   . LEU A 1 161 ? 35.498  36.190 -38.147 1.00 25.23 ? 161 LEU A CG   1 
ATOM   1530 C CD1  . LEU A 1 161 ? 34.814  37.379 -37.436 1.00 21.53 ? 161 LEU A CD1  1 
ATOM   1531 C CD2  . LEU A 1 161 ? 36.989  36.438 -38.259 1.00 23.06 ? 161 LEU A CD2  1 
ATOM   1532 H H    . LEU A 1 161 ? 34.531  32.617 -36.416 1.00 0.00  ? 161 LEU A H    1 
ATOM   1533 N N    . LYS A 1 162 ? 34.053  33.404 -39.672 1.00 29.92 ? 162 LYS A N    1 
ATOM   1534 C CA   . LYS A 1 162 ? 33.749  33.236 -41.094 1.00 30.74 ? 162 LYS A CA   1 
ATOM   1535 C C    . LYS A 1 162 ? 32.249  33.080 -41.410 1.00 31.14 ? 162 LYS A C    1 
ATOM   1536 O O    . LYS A 1 162 ? 31.779  33.579 -42.430 1.00 30.98 ? 162 LYS A O    1 
ATOM   1537 C CB   . LYS A 1 162 ? 34.596  32.083 -41.672 1.00 28.53 ? 162 LYS A CB   1 
ATOM   1538 C CG   . LYS A 1 162 ? 34.496  31.912 -43.168 1.00 28.97 ? 162 LYS A CG   1 
ATOM   1539 C CD   . LYS A 1 162 ? 35.669  31.137 -43.715 1.00 26.66 ? 162 LYS A CD   1 
ATOM   1540 C CE   . LYS A 1 162 ? 35.446  29.661 -43.656 1.00 23.35 ? 162 LYS A CE   1 
ATOM   1541 N NZ   . LYS A 1 162 ? 34.337  29.299 -44.540 1.00 21.79 ? 162 LYS A NZ   1 
ATOM   1542 H H    . LYS A 1 162 ? 34.791  32.887 -39.276 1.00 0.00  ? 162 LYS A H    1 
ATOM   1543 H HZ1  . LYS A 1 162 ? 34.406  29.719 -45.486 1.00 0.00  ? 162 LYS A HZ1  1 
ATOM   1544 H HZ2  . LYS A 1 162 ? 34.213  28.271 -44.607 1.00 0.00  ? 162 LYS A HZ2  1 
ATOM   1545 H HZ3  . LYS A 1 162 ? 33.500  29.677 -44.070 1.00 0.00  ? 162 LYS A HZ3  1 
ATOM   1546 N N    . GLU A 1 163 ? 31.504  32.411 -40.535 1.00 31.94 ? 163 GLU A N    1 
ATOM   1547 C CA   . GLU A 1 163 ? 30.050  32.244 -40.709 1.00 33.85 ? 163 GLU A CA   1 
ATOM   1548 C C    . GLU A 1 163 ? 29.297  33.544 -40.527 1.00 33.64 ? 163 GLU A C    1 
ATOM   1549 O O    . GLU A 1 163 ? 28.515  33.934 -41.402 1.00 35.91 ? 163 GLU A O    1 
ATOM   1550 C CB   . GLU A 1 163 ? 29.471  31.249 -39.697 1.00 35.85 ? 163 GLU A CB   1 
ATOM   1551 C CG   . GLU A 1 163 ? 29.235  29.865 -40.266 1.00 38.66 ? 163 GLU A CG   1 
ATOM   1552 C CD   . GLU A 1 163 ? 29.073  28.826 -39.192 1.00 41.37 ? 163 GLU A CD   1 
ATOM   1553 O OE1  . GLU A 1 163 ? 30.097  28.428 -38.594 1.00 41.03 ? 163 GLU A OE1  1 
ATOM   1554 O OE2  . GLU A 1 163 ? 27.925  28.389 -38.952 1.00 43.97 ? 163 GLU A OE2  1 
ATOM   1555 H H    . GLU A 1 163 ? 31.947  31.964 -39.780 1.00 0.00  ? 163 GLU A H    1 
ATOM   1556 N N    . VAL A 1 164 ? 29.512  34.210 -39.389 1.00 31.87 ? 164 VAL A N    1 
ATOM   1557 C CA   . VAL A 1 164 ? 28.820  35.471 -39.128 1.00 29.92 ? 164 VAL A CA   1 
ATOM   1558 C C    . VAL A 1 164 ? 29.110  36.488 -40.245 1.00 29.93 ? 164 VAL A C    1 
ATOM   1559 O O    . VAL A 1 164 ? 28.183  37.134 -40.813 1.00 26.92 ? 164 VAL A O    1 
ATOM   1560 C CB   . VAL A 1 164 ? 29.216  36.143 -37.788 1.00 30.75 ? 164 VAL A CB   1 
ATOM   1561 C CG1  . VAL A 1 164 ? 28.071  37.056 -37.350 1.00 32.09 ? 164 VAL A CG1  1 
ATOM   1562 C CG2  . VAL A 1 164 ? 29.543  35.124 -36.674 1.00 30.60 ? 164 VAL A CG2  1 
ATOM   1563 H H    . VAL A 1 164 ? 30.138  33.816 -38.743 1.00 0.00  ? 164 VAL A H    1 
ATOM   1564 N N    . MET A 1 165 ? 30.388  36.585 -40.605 1.00 27.80 ? 165 MET A N    1 
ATOM   1565 C CA   . MET A 1 165 ? 30.781  37.537 -41.626 1.00 27.07 ? 165 MET A CA   1 
ATOM   1566 C C    . MET A 1 165 ? 30.119  37.329 -42.994 1.00 27.81 ? 165 MET A C    1 
ATOM   1567 O O    . MET A 1 165 ? 29.834  38.323 -43.686 1.00 26.30 ? 165 MET A O    1 
ATOM   1568 C CB   . MET A 1 165 ? 32.300  37.666 -41.728 1.00 23.47 ? 165 MET A CB   1 
ATOM   1569 C CG   . MET A 1 165 ? 32.904  38.347 -40.520 1.00 20.63 ? 165 MET A CG   1 
ATOM   1570 S SD   . MET A 1 165 ? 34.454  39.197 -40.892 1.00 19.50 ? 165 MET A SD   1 
ATOM   1571 C CE   . MET A 1 165 ? 33.865  40.375 -42.127 1.00 17.30 ? 165 MET A CE   1 
ATOM   1572 H H    . MET A 1 165 ? 31.060  36.010 -40.166 1.00 0.00  ? 165 MET A H    1 
ATOM   1573 N N    . GLU A 1 166 ? 29.863  36.072 -43.383 1.00 26.62 ? 166 GLU A N    1 
ATOM   1574 C CA   . GLU A 1 166 ? 29.205  35.806 -44.661 1.00 27.29 ? 166 GLU A CA   1 
ATOM   1575 C C    . GLU A 1 166 ? 27.771  36.321 -44.666 1.00 26.14 ? 166 GLU A C    1 
ATOM   1576 O O    . GLU A 1 166 ? 27.315  36.915 -45.651 1.00 24.71 ? 166 GLU A O    1 
ATOM   1577 C CB   . GLU A 1 166 ? 29.191  34.325 -44.971 1.00 30.61 ? 166 GLU A CB   1 
ATOM   1578 C CG   . GLU A 1 166 ? 30.509  33.803 -45.523 1.00 37.14 ? 166 GLU A CG   1 
ATOM   1579 C CD   . GLU A 1 166 ? 30.397  32.394 -46.071 1.00 37.99 ? 166 GLU A CD   1 
ATOM   1580 O OE1  . GLU A 1 166 ? 29.300  31.802 -45.994 1.00 38.63 ? 166 GLU A OE1  1 
ATOM   1581 O OE2  . GLU A 1 166 ? 31.416  31.882 -46.580 1.00 40.68 ? 166 GLU A OE2  1 
ATOM   1582 H H    . GLU A 1 166 ? 30.144  35.312 -42.828 1.00 0.00  ? 166 GLU A H    1 
ATOM   1583 N N    . TYR A 1 167 ? 27.065  36.097 -43.557 1.00 24.27 ? 167 TYR A N    1 
ATOM   1584 C CA   . TYR A 1 167 ? 25.677  36.555 -43.428 1.00 21.31 ? 167 TYR A CA   1 
ATOM   1585 C C    . TYR A 1 167 ? 25.641  38.070 -43.533 1.00 17.93 ? 167 TYR A C    1 
ATOM   1586 O O    . TYR A 1 167 ? 24.954  38.603 -44.358 1.00 21.06 ? 167 TYR A O    1 
ATOM   1587 C CB   . TYR A 1 167 ? 25.045  36.061 -42.109 1.00 20.23 ? 167 TYR A CB   1 
ATOM   1588 C CG   . TYR A 1 167 ? 23.643  36.608 -41.788 1.00 19.84 ? 167 TYR A CG   1 
ATOM   1589 C CD1  . TYR A 1 167 ? 22.500  35.970 -42.265 1.00 18.55 ? 167 TYR A CD1  1 
ATOM   1590 C CD2  . TYR A 1 167 ? 23.477  37.738 -40.945 1.00 16.42 ? 167 TYR A CD2  1 
ATOM   1591 C CE1  . TYR A 1 167 ? 21.213  36.416 -41.912 1.00 18.22 ? 167 TYR A CE1  1 
ATOM   1592 C CE2  . TYR A 1 167 ? 22.202  38.210 -40.586 1.00 19.37 ? 167 TYR A CE2  1 
ATOM   1593 C CZ   . TYR A 1 167 ? 21.065  37.534 -41.065 1.00 21.32 ? 167 TYR A CZ   1 
ATOM   1594 O OH   . TYR A 1 167 ? 19.808  37.909 -40.632 1.00 15.18 ? 167 TYR A OH   1 
ATOM   1595 H H    . TYR A 1 167 ? 27.479  35.577 -42.834 1.00 0.00  ? 167 TYR A H    1 
ATOM   1596 H HH   . TYR A 1 167 ? 19.171  37.354 -41.053 1.00 0.00  ? 167 TYR A HH   1 
ATOM   1597 N N    . HIS A 1 168 ? 26.428  38.760 -42.737 1.00 19.12 ? 168 HIS A N    1 
ATOM   1598 C CA   . HIS A 1 168 ? 26.436  40.218 -42.778 1.00 21.07 ? 168 HIS A CA   1 
ATOM   1599 C C    . HIS A 1 168 ? 26.840  40.802 -44.112 1.00 22.01 ? 168 HIS A C    1 
ATOM   1600 O O    . HIS A 1 168 ? 26.264  41.801 -44.570 1.00 23.61 ? 168 HIS A O    1 
ATOM   1601 C CB   . HIS A 1 168 ? 27.272  40.762 -41.644 1.00 26.90 ? 168 HIS A CB   1 
ATOM   1602 C CG   . HIS A 1 168 ? 26.672  40.489 -40.298 1.00 28.13 ? 168 HIS A CG   1 
ATOM   1603 N ND1  . HIS A 1 168 ? 25.340  40.717 -40.051 1.00 22.51 ? 168 HIS A ND1  1 
ATOM   1604 C CD2  . HIS A 1 168 ? 27.253  39.955 -39.193 1.00 28.82 ? 168 HIS A CD2  1 
ATOM   1605 C CE1  . HIS A 1 168 ? 25.138  40.315 -38.812 1.00 24.10 ? 168 HIS A CE1  1 
ATOM   1606 N NE2  . HIS A 1 168 ? 26.265  39.848 -38.247 1.00 25.45 ? 168 HIS A NE2  1 
ATOM   1607 H H    . HIS A 1 168 ? 27.001  38.268 -42.104 1.00 0.00  ? 168 HIS A H    1 
ATOM   1608 H HE2  . HIS A 1 168 ? 26.346  39.519 -37.321 1.00 0.00  ? 168 HIS A HE2  1 
ATOM   1609 N N    . ASN A 1 169 ? 27.783  40.152 -44.775 1.00 23.75 ? 169 ASN A N    1 
ATOM   1610 C CA   . ASN A 1 169 ? 28.203  40.596 -46.091 1.00 24.91 ? 169 ASN A CA   1 
ATOM   1611 C C    . ASN A 1 169 ? 27.079  40.437 -47.104 1.00 23.56 ? 169 ASN A C    1 
ATOM   1612 O O    . ASN A 1 169 ? 26.873  41.312 -47.957 1.00 22.90 ? 169 ASN A O    1 
ATOM   1613 C CB   . ASN A 1 169 ? 29.446  39.862 -46.541 1.00 26.20 ? 169 ASN A CB   1 
ATOM   1614 C CG   . ASN A 1 169 ? 30.676  40.538 -46.065 1.00 28.39 ? 169 ASN A CG   1 
ATOM   1615 O OD1  . ASN A 1 169 ? 30.861  41.715 -46.337 1.00 29.68 ? 169 ASN A OD1  1 
ATOM   1616 N ND2  . ASN A 1 169 ? 31.505  39.834 -45.305 1.00 30.02 ? 169 ASN A ND2  1 
ATOM   1617 H H    . ASN A 1 169 ? 28.245  39.385 -44.370 1.00 0.00  ? 169 ASN A H    1 
ATOM   1618 H HD21 . ASN A 1 169 ? 32.350  40.236 -45.014 1.00 0.00  ? 169 ASN A HD21 1 
ATOM   1619 H HD22 . ASN A 1 169 ? 31.248  38.908 -45.082 1.00 0.00  ? 169 ASN A HD22 1 
ATOM   1620 N N    . PHE A 1 170 ? 26.325  39.355 -47.002 1.00 21.26 ? 170 PHE A N    1 
ATOM   1621 C CA   . PHE A 1 170 ? 25.236  39.188 -47.920 1.00 21.59 ? 170 PHE A CA   1 
ATOM   1622 C C    . PHE A 1 170 ? 24.273  40.362 -47.684 1.00 22.77 ? 170 PHE A C    1 
ATOM   1623 O O    . PHE A 1 170 ? 23.678  40.897 -48.620 1.00 23.14 ? 170 PHE A O    1 
ATOM   1624 C CB   . PHE A 1 170 ? 24.527  37.854 -47.684 1.00 23.33 ? 170 PHE A CB   1 
ATOM   1625 C CG   . PHE A 1 170 ? 23.370  37.631 -48.585 1.00 20.98 ? 170 PHE A CG   1 
ATOM   1626 C CD1  . PHE A 1 170 ? 22.198  38.355 -48.418 1.00 22.56 ? 170 PHE A CD1  1 
ATOM   1627 C CD2  . PHE A 1 170 ? 23.468  36.749 -49.648 1.00 22.49 ? 170 PHE A CD2  1 
ATOM   1628 C CE1  . PHE A 1 170 ? 21.132  38.215 -49.304 1.00 25.04 ? 170 PHE A CE1  1 
ATOM   1629 C CE2  . PHE A 1 170 ? 22.397  36.594 -50.551 1.00 24.86 ? 170 PHE A CE2  1 
ATOM   1630 C CZ   . PHE A 1 170 ? 21.228  37.336 -50.375 1.00 24.53 ? 170 PHE A CZ   1 
ATOM   1631 H H    . PHE A 1 170 ? 26.536  38.645 -46.352 1.00 0.00  ? 170 PHE A H    1 
ATOM   1632 N N    . GLN A 1 171 ? 24.137  40.783 -46.435 1.00 23.93 ? 171 GLN A N    1 
ATOM   1633 C CA   . GLN A 1 171 ? 23.226  41.877 -46.163 1.00 26.12 ? 171 GLN A CA   1 
ATOM   1634 C C    . GLN A 1 171 ? 23.753  43.159 -46.781 1.00 25.48 ? 171 GLN A C    1 
ATOM   1635 O O    . GLN A 1 171 ? 23.060  43.811 -47.563 1.00 24.30 ? 171 GLN A O    1 
ATOM   1636 C CB   . GLN A 1 171 ? 22.987  42.055 -44.669 1.00 26.66 ? 171 GLN A CB   1 
ATOM   1637 C CG   . GLN A 1 171 ? 21.601  42.579 -44.400 1.00 34.50 ? 171 GLN A CG   1 
ATOM   1638 C CD   . GLN A 1 171 ? 21.284  42.695 -42.927 1.00 37.17 ? 171 GLN A CD   1 
ATOM   1639 O OE1  . GLN A 1 171 ? 20.728  43.713 -42.470 1.00 38.15 ? 171 GLN A OE1  1 
ATOM   1640 N NE2  . GLN A 1 171 ? 21.636  41.664 -42.164 1.00 37.96 ? 171 GLN A NE2  1 
ATOM   1641 H H    . GLN A 1 171 ? 24.602  40.302 -45.720 1.00 0.00  ? 171 GLN A H    1 
ATOM   1642 H HE21 . GLN A 1 171 ? 21.415  41.678 -41.211 1.00 0.00  ? 171 GLN A HE21 1 
ATOM   1643 H HE22 . GLN A 1 171 ? 22.087  40.893 -42.571 1.00 0.00  ? 171 GLN A HE22 1 
ATOM   1644 N N    . LEU A 1 172 ? 25.017  43.455 -46.502 1.00 27.32 ? 172 LEU A N    1 
ATOM   1645 C CA   . LEU A 1 172 ? 25.668  44.660 -47.000 1.00 27.01 ? 172 LEU A CA   1 
ATOM   1646 C C    . LEU A 1 172 ? 25.615  44.929 -48.508 1.00 26.79 ? 172 LEU A C    1 
ATOM   1647 O O    . LEU A 1 172 ? 25.042  45.927 -48.966 1.00 25.21 ? 172 LEU A O    1 
ATOM   1648 C CB   . LEU A 1 172 ? 27.125  44.661 -46.559 1.00 26.22 ? 172 LEU A CB   1 
ATOM   1649 C CG   . LEU A 1 172 ? 27.376  44.938 -45.104 1.00 24.29 ? 172 LEU A CG   1 
ATOM   1650 C CD1  . LEU A 1 172 ? 28.868  45.000 -44.868 1.00 21.86 ? 172 LEU A CD1  1 
ATOM   1651 C CD2  . LEU A 1 172 ? 26.723  46.246 -44.798 1.00 25.62 ? 172 LEU A CD2  1 
ATOM   1652 H H    . LEU A 1 172 ? 25.507  42.847 -45.903 1.00 0.00  ? 172 LEU A H    1 
ATOM   1653 N N    . VAL A 1 173 ? 26.301  44.078 -49.256 1.00 27.63 ? 173 VAL A N    1 
ATOM   1654 C CA   . VAL A 1 173 ? 26.380  44.197 -50.689 1.00 26.89 ? 173 VAL A CA   1 
ATOM   1655 C C    . VAL A 1 173 ? 24.981  44.134 -51.350 1.00 27.78 ? 173 VAL A C    1 
ATOM   1656 O O    . VAL A 1 173 ? 24.558  45.075 -52.052 1.00 29.21 ? 173 VAL A O    1 
ATOM   1657 C CB   . VAL A 1 173 ? 27.247  43.066 -51.234 1.00 25.46 ? 173 VAL A CB   1 
ATOM   1658 C CG1  . VAL A 1 173 ? 27.519  43.264 -52.714 1.00 27.18 ? 173 VAL A CG1  1 
ATOM   1659 C CG2  . VAL A 1 173 ? 28.530  42.951 -50.435 1.00 26.02 ? 173 VAL A CG2  1 
ATOM   1660 H H    . VAL A 1 173 ? 26.703  43.301 -48.808 1.00 0.00  ? 173 VAL A H    1 
ATOM   1661 N N    . ASN A 1 174 ? 24.228  43.073 -51.074 1.00 25.61 ? 174 ASN A N    1 
ATOM   1662 C CA   . ASN A 1 174 ? 22.932  42.913 -51.713 1.00 26.04 ? 174 ASN A CA   1 
ATOM   1663 C C    . ASN A 1 174 ? 21.760  43.823 -51.312 1.00 24.61 ? 174 ASN A C    1 
ATOM   1664 O O    . ASN A 1 174 ? 20.963  44.200 -52.155 1.00 25.22 ? 174 ASN A O    1 
ATOM   1665 C CB   . ASN A 1 174 ? 22.527  41.430 -51.721 1.00 27.90 ? 174 ASN A CB   1 
ATOM   1666 C CG   . ASN A 1 174 ? 23.347  40.608 -52.705 1.00 24.99 ? 174 ASN A CG   1 
ATOM   1667 O OD1  . ASN A 1 174 ? 24.045  41.153 -53.551 1.00 27.30 ? 174 ASN A OD1  1 
ATOM   1668 N ND2  . ASN A 1 174 ? 23.259  39.305 -52.601 1.00 25.28 ? 174 ASN A ND2  1 
ATOM   1669 H H    . ASN A 1 174 ? 24.525  42.420 -50.410 1.00 0.00  ? 174 ASN A H    1 
ATOM   1670 H HD21 . ASN A 1 174 ? 23.777  38.723 -53.206 1.00 0.00  ? 174 ASN A HD21 1 
ATOM   1671 H HD22 . ASN A 1 174 ? 22.673  38.950 -51.899 1.00 0.00  ? 174 ASN A HD22 1 
ATOM   1672 N N    . TYR A 1 175 ? 21.636  44.179 -50.045 1.00 23.38 ? 175 TYR A N    1 
ATOM   1673 C CA   . TYR A 1 175 ? 20.548  45.053 -49.625 1.00 21.86 ? 175 TYR A CA   1 
ATOM   1674 C C    . TYR A 1 175 ? 20.949  46.540 -49.620 1.00 23.52 ? 175 TYR A C    1 
ATOM   1675 O O    . TYR A 1 175 ? 20.278  47.384 -50.217 1.00 20.56 ? 175 TYR A O    1 
ATOM   1676 C CB   . TYR A 1 175 ? 20.098  44.660 -48.217 1.00 23.67 ? 175 TYR A CB   1 
ATOM   1677 C CG   . TYR A 1 175 ? 18.850  45.353 -47.718 1.00 21.15 ? 175 TYR A CG   1 
ATOM   1678 C CD1  . TYR A 1 175 ? 17.637  45.175 -48.362 1.00 21.06 ? 175 TYR A CD1  1 
ATOM   1679 C CD2  . TYR A 1 175 ? 18.897  46.219 -46.636 1.00 20.74 ? 175 TYR A CD2  1 
ATOM   1680 C CE1  . TYR A 1 175 ? 16.504  45.844 -47.959 1.00 22.13 ? 175 TYR A CE1  1 
ATOM   1681 C CE2  . TYR A 1 175 ? 17.761  46.896 -46.222 1.00 22.69 ? 175 TYR A CE2  1 
ATOM   1682 C CZ   . TYR A 1 175 ? 16.570  46.702 -46.902 1.00 23.24 ? 175 TYR A CZ   1 
ATOM   1683 O OH   . TYR A 1 175 ? 15.451  47.418 -46.568 1.00 25.93 ? 175 TYR A OH   1 
ATOM   1684 H H    . TYR A 1 175 ? 22.261  43.874 -49.346 1.00 0.00  ? 175 TYR A H    1 
ATOM   1685 H HH   . TYR A 1 175 ? 14.763  47.301 -47.247 1.00 0.00  ? 175 TYR A HH   1 
ATOM   1686 N N    . TYR A 1 176 ? 22.058  46.845 -48.955 1.00 24.88 ? 176 TYR A N    1 
ATOM   1687 C CA   . TYR A 1 176 ? 22.517  48.218 -48.804 1.00 28.33 ? 176 TYR A CA   1 
ATOM   1688 C C    . TYR A 1 176 ? 23.424  48.736 -49.922 1.00 29.79 ? 176 TYR A C    1 
ATOM   1689 O O    . TYR A 1 176 ? 23.567  49.952 -50.123 1.00 27.91 ? 176 TYR A O    1 
ATOM   1690 C CB   . TYR A 1 176 ? 23.247  48.335 -47.466 1.00 27.89 ? 176 TYR A CB   1 
ATOM   1691 C CG   . TYR A 1 176 ? 22.400  47.930 -46.282 1.00 29.19 ? 176 TYR A CG   1 
ATOM   1692 C CD1  . TYR A 1 176 ? 21.322  48.732 -45.886 1.00 28.81 ? 176 TYR A CD1  1 
ATOM   1693 C CD2  . TYR A 1 176 ? 22.681  46.768 -45.549 1.00 25.95 ? 176 TYR A CD2  1 
ATOM   1694 C CE1  . TYR A 1 176 ? 20.557  48.411 -44.808 1.00 30.80 ? 176 TYR A CE1  1 
ATOM   1695 C CE2  . TYR A 1 176 ? 21.904  46.424 -44.447 1.00 29.42 ? 176 TYR A CE2  1 
ATOM   1696 C CZ   . TYR A 1 176 ? 20.837  47.262 -44.075 1.00 32.17 ? 176 TYR A CZ   1 
ATOM   1697 O OH   . TYR A 1 176 ? 20.063  47.020 -42.943 1.00 34.58 ? 176 TYR A OH   1 
ATOM   1698 H H    . TYR A 1 176 ? 22.575  46.108 -48.572 1.00 0.00  ? 176 TYR A H    1 
ATOM   1699 H HH   . TYR A 1 176 ? 20.230  46.110 -42.670 1.00 0.00  ? 176 TYR A HH   1 
ATOM   1700 N N    . LYS A 1 177 ? 24.028  47.817 -50.657 1.00 30.26 ? 177 LYS A N    1 
ATOM   1701 C CA   . LYS A 1 177 ? 24.924  48.218 -51.726 1.00 31.36 ? 177 LYS A CA   1 
ATOM   1702 C C    . LYS A 1 177 ? 26.067  48.988 -51.043 1.00 30.78 ? 177 LYS A C    1 
ATOM   1703 O O    . LYS A 1 177 ? 26.193  50.215 -51.132 1.00 28.84 ? 177 LYS A O    1 
ATOM   1704 C CB   . LYS A 1 177 ? 24.174  49.072 -52.763 1.00 31.34 ? 177 LYS A CB   1 
ATOM   1705 C CG   . LYS A 1 177 ? 23.284  48.296 -53.725 1.00 29.54 ? 177 LYS A CG   1 
ATOM   1706 C CD   . LYS A 1 177 ? 22.150  47.533 -53.076 1.00 27.81 ? 177 LYS A CD   1 
ATOM   1707 C CE   . LYS A 1 177 ? 21.450  46.694 -54.126 1.00 31.38 ? 177 LYS A CE   1 
ATOM   1708 N NZ   . LYS A 1 177 ? 20.175  46.004 -53.718 1.00 30.16 ? 177 LYS A NZ   1 
ATOM   1709 H H    . LYS A 1 177 ? 23.932  46.869 -50.435 1.00 0.00  ? 177 LYS A H    1 
ATOM   1710 H HZ1  . LYS A 1 177 ? 19.466  46.656 -53.336 1.00 0.00  ? 177 LYS A HZ1  1 
ATOM   1711 H HZ2  . LYS A 1 177 ? 19.774  45.468 -54.515 1.00 0.00  ? 177 LYS A HZ2  1 
ATOM   1712 H HZ3  . LYS A 1 177 ? 20.421  45.275 -52.994 1.00 0.00  ? 177 LYS A HZ3  1 
ATOM   1713 N N    . ALA A 1 178 ? 26.867  48.241 -50.300 1.00 30.99 ? 178 ALA A N    1 
ATOM   1714 C CA   . ALA A 1 178 ? 27.989  48.829 -49.608 1.00 32.01 ? 178 ALA A CA   1 
ATOM   1715 C C    . ALA A 1 178 ? 29.148  47.839 -49.609 1.00 32.05 ? 178 ALA A C    1 
ATOM   1716 O O    . ALA A 1 178 ? 28.974  46.683 -49.966 1.00 32.90 ? 178 ALA A O    1 
ATOM   1717 C CB   . ALA A 1 178 ? 27.587  49.206 -48.196 1.00 32.65 ? 178 ALA A CB   1 
ATOM   1718 H H    . ALA A 1 178 ? 26.722  47.276 -50.222 1.00 0.00  ? 178 ALA A H    1 
ATOM   1719 N N    . GLU A 1 179 ? 30.323  48.314 -49.231 1.00 32.09 ? 179 GLU A N    1 
ATOM   1720 C CA   . GLU A 1 179 ? 31.530  47.512 -49.190 1.00 32.89 ? 179 GLU A CA   1 
ATOM   1721 C C    . GLU A 1 179 ? 31.470  46.251 -48.330 1.00 32.47 ? 179 GLU A C    1 
ATOM   1722 O O    . GLU A 1 179 ? 31.085  46.303 -47.153 1.00 33.50 ? 179 GLU A O    1 
ATOM   1723 C CB   . GLU A 1 179 ? 32.694  48.388 -48.711 1.00 36.16 ? 179 GLU A CB   1 
ATOM   1724 C CG   . GLU A 1 179 ? 32.347  49.381 -47.558 1.00 36.66 ? 179 GLU A CG   1 
ATOM   1725 C CD   . GLU A 1 179 ? 32.241  48.738 -46.167 1.00 37.21 ? 179 GLU A CD   1 
ATOM   1726 O OE1  . GLU A 1 179 ? 33.186  47.990 -45.760 1.00 40.95 ? 179 GLU A OE1  1 
ATOM   1727 O OE2  . GLU A 1 179 ? 31.225  49.019 -45.480 1.00 33.81 ? 179 GLU A OE2  1 
ATOM   1728 H H    . GLU A 1 179 ? 30.364  49.237 -48.923 1.00 0.00  ? 179 GLU A H    1 
ATOM   1729 N N    . ALA A 1 180 ? 31.808  45.106 -48.918 1.00 30.67 ? 180 ALA A N    1 
ATOM   1730 C CA   . ALA A 1 180 ? 31.830  43.877 -48.124 1.00 31.12 ? 180 ALA A CA   1 
ATOM   1731 C C    . ALA A 1 180 ? 33.001  44.091 -47.165 1.00 30.28 ? 180 ALA A C    1 
ATOM   1732 O O    . ALA A 1 180 ? 33.869  44.922 -47.434 1.00 32.69 ? 180 ALA A O    1 
ATOM   1733 C CB   . ALA A 1 180 ? 32.069  42.649 -49.006 1.00 30.65 ? 180 ALA A CB   1 
ATOM   1734 H H    . ALA A 1 180 ? 32.035  45.114 -49.868 1.00 0.00  ? 180 ALA A H    1 
ATOM   1735 N N    . VAL A 1 181 ? 33.033  43.393 -46.042 1.00 28.57 ? 181 VAL A N    1 
ATOM   1736 C CA   . VAL A 1 181 ? 34.139  43.590 -45.098 1.00 27.17 ? 181 VAL A CA   1 
ATOM   1737 C C    . VAL A 1 181 ? 35.161  42.457 -45.256 1.00 25.93 ? 181 VAL A C    1 
ATOM   1738 O O    . VAL A 1 181 ? 34.806  41.289 -45.202 1.00 24.84 ? 181 VAL A O    1 
ATOM   1739 C CB   . VAL A 1 181 ? 33.623  43.676 -43.617 1.00 30.54 ? 181 VAL A CB   1 
ATOM   1740 C CG1  . VAL A 1 181 ? 34.705  44.264 -42.712 1.00 30.28 ? 181 VAL A CG1  1 
ATOM   1741 C CG2  . VAL A 1 181 ? 32.352  44.547 -43.529 1.00 27.66 ? 181 VAL A CG2  1 
ATOM   1742 H H    . VAL A 1 181 ? 32.297  42.752 -45.893 1.00 0.00  ? 181 VAL A H    1 
ATOM   1743 N N    . ASP A 1 182 ? 36.416  42.784 -45.532 1.00 27.10 ? 182 ASP A N    1 
ATOM   1744 C CA   . ASP A 1 182 ? 37.390  41.712 -45.684 1.00 27.71 ? 182 ASP A CA   1 
ATOM   1745 C C    . ASP A 1 182 ? 37.508  40.932 -44.395 1.00 25.75 ? 182 ASP A C    1 
ATOM   1746 O O    . ASP A 1 182 ? 37.867  41.452 -43.331 1.00 26.84 ? 182 ASP A O    1 
ATOM   1747 C CB   . ASP A 1 182 ? 38.765  42.212 -46.146 1.00 29.86 ? 182 ASP A CB   1 
ATOM   1748 C CG   . ASP A 1 182 ? 39.792  41.097 -46.211 1.00 32.31 ? 182 ASP A CG   1 
ATOM   1749 O OD1  . ASP A 1 182 ? 39.718  40.271 -47.154 1.00 32.04 ? 182 ASP A OD1  1 
ATOM   1750 O OD2  . ASP A 1 182 ? 40.647  41.024 -45.285 1.00 35.05 ? 182 ASP A OD2  1 
ATOM   1751 H H    . ASP A 1 182 ? 36.676  43.723 -45.622 1.00 0.00  ? 182 ASP A H    1 
ATOM   1752 N N    . TYR A 1 183 ? 37.210  39.657 -44.509 1.00 25.33 ? 183 TYR A N    1 
ATOM   1753 C CA   . TYR A 1 183 ? 37.240  38.754 -43.386 1.00 24.40 ? 183 TYR A CA   1 
ATOM   1754 C C    . TYR A 1 183 ? 38.617  38.580 -42.776 1.00 27.44 ? 183 TYR A C    1 
ATOM   1755 O O    . TYR A 1 183 ? 38.733  38.355 -41.558 1.00 29.21 ? 183 TYR A O    1 
ATOM   1756 C CB   . TYR A 1 183 ? 36.669  37.422 -43.823 1.00 18.97 ? 183 TYR A CB   1 
ATOM   1757 C CG   . TYR A 1 183 ? 37.170  36.259 -43.043 1.00 21.18 ? 183 TYR A CG   1 
ATOM   1758 C CD1  . TYR A 1 183 ? 38.320  35.573 -43.445 1.00 19.15 ? 183 TYR A CD1  1 
ATOM   1759 C CD2  . TYR A 1 183 ? 36.453  35.773 -41.967 1.00 20.74 ? 183 TYR A CD2  1 
ATOM   1760 C CE1  . TYR A 1 183 ? 38.732  34.426 -42.801 1.00 20.72 ? 183 TYR A CE1  1 
ATOM   1761 C CE2  . TYR A 1 183 ? 36.854  34.608 -41.309 1.00 21.46 ? 183 TYR A CE2  1 
ATOM   1762 C CZ   . TYR A 1 183 ? 37.992  33.938 -41.734 1.00 23.35 ? 183 TYR A CZ   1 
ATOM   1763 O OH   . TYR A 1 183 ? 38.374  32.779 -41.090 1.00 25.57 ? 183 TYR A OH   1 
ATOM   1764 H H    . TYR A 1 183 ? 36.948  39.341 -45.405 1.00 0.00  ? 183 TYR A H    1 
ATOM   1765 H HH   . TYR A 1 183 ? 37.767  32.613 -40.359 1.00 0.00  ? 183 TYR A HH   1 
ATOM   1766 N N    . GLN A 1 184 ? 39.649  38.690 -43.617 1.00 28.93 ? 184 GLN A N    1 
ATOM   1767 C CA   . GLN A 1 184 ? 41.046  38.524 -43.200 1.00 28.70 ? 184 GLN A CA   1 
ATOM   1768 C C    . GLN A 1 184 ? 41.560  39.654 -42.326 1.00 27.43 ? 184 GLN A C    1 
ATOM   1769 O O    . GLN A 1 184 ? 42.256  39.403 -41.351 1.00 25.22 ? 184 GLN A O    1 
ATOM   1770 C CB   . GLN A 1 184 ? 41.963  38.393 -44.415 1.00 31.67 ? 184 GLN A CB   1 
ATOM   1771 C CG   . GLN A 1 184 ? 43.337  37.836 -44.061 1.00 33.26 ? 184 GLN A CG   1 
ATOM   1772 C CD   . GLN A 1 184 ? 43.220  36.461 -43.447 1.00 35.78 ? 184 GLN A CD   1 
ATOM   1773 O OE1  . GLN A 1 184 ? 42.362  35.662 -43.860 1.00 36.62 ? 184 GLN A OE1  1 
ATOM   1774 N NE2  . GLN A 1 184 ? 44.043  36.181 -42.429 1.00 36.40 ? 184 GLN A NE2  1 
ATOM   1775 H H    . GLN A 1 184 ? 39.471  38.918 -44.555 1.00 0.00  ? 184 GLN A H    1 
ATOM   1776 H HE21 . GLN A 1 184 ? 44.050  35.297 -42.014 1.00 0.00  ? 184 GLN A HE21 1 
ATOM   1777 H HE22 . GLN A 1 184 ? 44.634  36.912 -42.122 1.00 0.00  ? 184 GLN A HE22 1 
ATOM   1778 N N    . LYS A 1 185 ? 41.246  40.893 -42.704 1.00 26.46 ? 185 LYS A N    1 
ATOM   1779 C CA   . LYS A 1 185 ? 41.665  42.060 -41.934 1.00 26.52 ? 185 LYS A CA   1 
ATOM   1780 C C    . LYS A 1 185 ? 41.192  41.962 -40.476 1.00 26.54 ? 185 LYS A C    1 
ATOM   1781 O O    . LYS A 1 185 ? 41.932  42.295 -39.547 1.00 22.97 ? 185 LYS A O    1 
ATOM   1782 C CB   . LYS A 1 185 ? 41.122  43.350 -42.584 1.00 30.20 ? 185 LYS A CB   1 
ATOM   1783 C CG   . LYS A 1 185 ? 41.532  44.661 -41.879 1.00 34.51 ? 185 LYS A CG   1 
ATOM   1784 C CD   . LYS A 1 185 ? 43.069  44.789 -41.771 1.00 35.08 ? 185 LYS A CD   1 
ATOM   1785 C CE   . LYS A 1 185 ? 43.472  46.065 -41.048 1.00 38.06 ? 185 LYS A CE   1 
ATOM   1786 N NZ   . LYS A 1 185 ? 44.701  45.887 -40.221 1.00 38.48 ? 185 LYS A NZ   1 
ATOM   1787 H H    . LYS A 1 185 ? 40.796  41.008 -43.575 1.00 0.00  ? 185 LYS A H    1 
ATOM   1788 H HZ1  . LYS A 1 185 ? 45.504  45.543 -40.779 1.00 0.00  ? 185 LYS A HZ1  1 
ATOM   1789 H HZ2  . LYS A 1 185 ? 44.958  46.749 -39.710 1.00 0.00  ? 185 LYS A HZ2  1 
ATOM   1790 H HZ3  . LYS A 1 185 ? 44.497  45.141 -39.503 1.00 0.00  ? 185 LYS A HZ3  1 
ATOM   1791 N N    . VAL A 1 186 ? 39.977  41.450 -40.297 1.00 26.63 ? 186 VAL A N    1 
ATOM   1792 C CA   . VAL A 1 186 ? 39.342  41.287 -38.983 1.00 28.50 ? 186 VAL A CA   1 
ATOM   1793 C C    . VAL A 1 186 ? 39.928  40.146 -38.163 1.00 30.46 ? 186 VAL A C    1 
ATOM   1794 O O    . VAL A 1 186 ? 40.167  40.271 -36.951 1.00 30.55 ? 186 VAL A O    1 
ATOM   1795 C CB   . VAL A 1 186 ? 37.865  41.041 -39.150 1.00 28.94 ? 186 VAL A CB   1 
ATOM   1796 C CG1  . VAL A 1 186 ? 37.175  40.974 -37.782 1.00 29.04 ? 186 VAL A CG1  1 
ATOM   1797 C CG2  . VAL A 1 186 ? 37.279  42.128 -40.047 1.00 30.84 ? 186 VAL A CG2  1 
ATOM   1798 H H    . VAL A 1 186 ? 39.472  41.215 -41.104 1.00 0.00  ? 186 VAL A H    1 
ATOM   1799 N N    . LEU A 1 187 ? 40.104  39.006 -38.816 1.00 32.08 ? 187 LEU A N    1 
ATOM   1800 C CA   . LEU A 1 187 ? 40.704  37.860 -38.156 1.00 33.04 ? 187 LEU A CA   1 
ATOM   1801 C C    . LEU A 1 187 ? 42.069  38.334 -37.634 1.00 32.61 ? 187 LEU A C    1 
ATOM   1802 O O    . LEU A 1 187 ? 42.381  38.230 -36.452 1.00 34.08 ? 187 LEU A O    1 
ATOM   1803 C CB   . LEU A 1 187 ? 40.887  36.716 -39.153 1.00 32.64 ? 187 LEU A CB   1 
ATOM   1804 C CG   . LEU A 1 187 ? 41.574  35.491 -38.545 1.00 36.00 ? 187 LEU A CG   1 
ATOM   1805 C CD1  . LEU A 1 187 ? 40.738  34.982 -37.346 1.00 35.22 ? 187 LEU A CD1  1 
ATOM   1806 C CD2  . LEU A 1 187 ? 41.770  34.391 -39.601 1.00 36.47 ? 187 LEU A CD2  1 
ATOM   1807 H H    . LEU A 1 187 ? 39.785  38.905 -39.742 1.00 0.00  ? 187 LEU A H    1 
ATOM   1808 N N    . ASP A 1 188 ? 42.841  38.953 -38.507 1.00 34.27 ? 188 ASP A N    1 
ATOM   1809 C CA   . ASP A 1 188 ? 44.144  39.427 -38.115 1.00 36.06 ? 188 ASP A CA   1 
ATOM   1810 C C    . ASP A 1 188 ? 44.053  40.493 -37.046 1.00 35.38 ? 188 ASP A C    1 
ATOM   1811 O O    . ASP A 1 188 ? 44.729  40.410 -36.038 1.00 36.76 ? 188 ASP A O    1 
ATOM   1812 C CB   . ASP A 1 188 ? 44.908  39.873 -39.346 1.00 38.44 ? 188 ASP A CB   1 
ATOM   1813 C CG   . ASP A 1 188 ? 45.187  38.708 -40.296 1.00 40.46 ? 188 ASP A CG   1 
ATOM   1814 O OD1  . ASP A 1 188 ? 45.867  37.736 -39.891 1.00 41.47 ? 188 ASP A OD1  1 
ATOM   1815 O OD2  . ASP A 1 188 ? 44.717  38.750 -41.444 1.00 42.03 ? 188 ASP A OD2  1 
ATOM   1816 H H    . ASP A 1 188 ? 42.579  39.076 -39.448 1.00 0.00  ? 188 ASP A H    1 
ATOM   1817 N N    . ASP A 1 189 ? 43.154  41.446 -37.204 1.00 35.07 ? 189 ASP A N    1 
ATOM   1818 C CA   . ASP A 1 189 ? 43.014  42.474 -36.184 1.00 34.81 ? 189 ASP A CA   1 
ATOM   1819 C C    . ASP A 1 189 ? 42.637  41.914 -34.802 1.00 33.45 ? 189 ASP A C    1 
ATOM   1820 O O    . ASP A 1 189 ? 43.213  42.332 -33.797 1.00 33.30 ? 189 ASP A O    1 
ATOM   1821 C CB   . ASP A 1 189 ? 42.058  43.583 -36.661 1.00 36.28 ? 189 ASP A CB   1 
ATOM   1822 C CG   . ASP A 1 189 ? 42.680  44.454 -37.761 1.00 36.75 ? 189 ASP A CG   1 
ATOM   1823 O OD1  . ASP A 1 189 ? 43.916  44.446 -37.889 1.00 42.22 ? 189 ASP A OD1  1 
ATOM   1824 O OD2  . ASP A 1 189 ? 41.956  45.146 -38.504 1.00 38.45 ? 189 ASP A OD2  1 
ATOM   1825 H H    . ASP A 1 189 ? 42.642  41.538 -38.039 1.00 0.00  ? 189 ASP A H    1 
ATOM   1826 N N    . THR A 1 190 ? 41.694  40.969 -34.738 1.00 30.80 ? 190 THR A N    1 
ATOM   1827 C CA   . THR A 1 190 ? 41.308  40.359 -33.454 1.00 28.50 ? 190 THR A CA   1 
ATOM   1828 C C    . THR A 1 190 ? 42.404  39.415 -32.944 1.00 27.28 ? 190 THR A C    1 
ATOM   1829 O O    . THR A 1 190 ? 42.778  39.443 -31.769 1.00 26.52 ? 190 THR A O    1 
ATOM   1830 C CB   . THR A 1 190 ? 40.043  39.542 -33.595 1.00 27.90 ? 190 THR A CB   1 
ATOM   1831 O OG1  . THR A 1 190 ? 39.160  40.211 -34.490 1.00 30.14 ? 190 THR A OG1  1 
ATOM   1832 C CG2  . THR A 1 190 ? 39.360  39.364 -32.256 1.00 25.52 ? 190 THR A CG2  1 
ATOM   1833 H H    . THR A 1 190 ? 41.243  40.688 -35.564 1.00 0.00  ? 190 THR A H    1 
ATOM   1834 H HG1  . THR A 1 190 ? 39.528  40.155 -35.393 1.00 0.00  ? 190 THR A HG1  1 
ATOM   1835 N N    . MET A 1 191 ? 42.904  38.554 -33.821 1.00 26.33 ? 191 MET A N    1 
ATOM   1836 C CA   . MET A 1 191 ? 43.978  37.650 -33.424 1.00 27.74 ? 191 MET A CA   1 
ATOM   1837 C C    . MET A 1 191 ? 45.168  38.376 -32.810 1.00 25.85 ? 191 MET A C    1 
ATOM   1838 O O    . MET A 1 191 ? 45.782  37.880 -31.878 1.00 28.45 ? 191 MET A O    1 
ATOM   1839 C CB   . MET A 1 191 ? 44.460  36.799 -34.597 1.00 27.30 ? 191 MET A CB   1 
ATOM   1840 C CG   . MET A 1 191 ? 44.331  35.344 -34.292 1.00 30.98 ? 191 MET A CG   1 
ATOM   1841 S SD   . MET A 1 191 ? 42.678  34.989 -33.640 1.00 28.43 ? 191 MET A SD   1 
ATOM   1842 C CE   . MET A 1 191 ? 43.016  34.991 -31.903 1.00 32.05 ? 191 MET A CE   1 
ATOM   1843 H H    . MET A 1 191 ? 42.594  38.502 -34.758 1.00 0.00  ? 191 MET A H    1 
ATOM   1844 N N    . ALA A 1 192 ? 45.473  39.554 -33.333 1.00 24.14 ? 192 ALA A N    1 
ATOM   1845 C CA   . ALA A 1 192 ? 46.575  40.358 -32.864 1.00 24.38 ? 192 ALA A CA   1 
ATOM   1846 C C    . ALA A 1 192 ? 46.531  40.631 -31.376 1.00 26.07 ? 192 ALA A C    1 
ATOM   1847 O O    . ALA A 1 192 ? 47.590  40.759 -30.746 1.00 22.31 ? 192 ALA A O    1 
ATOM   1848 C CB   . ALA A 1 192 ? 46.601  41.684 -33.617 1.00 24.22 ? 192 ALA A CB   1 
ATOM   1849 H H    . ALA A 1 192 ? 44.947  39.901 -34.092 1.00 0.00  ? 192 ALA A H    1 
ATOM   1850 N N    . VAL A 1 193 ? 45.314  40.739 -30.820 1.00 24.55 ? 193 VAL A N    1 
ATOM   1851 C CA   . VAL A 1 193 ? 45.138  41.045 -29.393 1.00 21.58 ? 193 VAL A CA   1 
ATOM   1852 C C    . VAL A 1 193 ? 44.411  40.042 -28.455 1.00 19.92 ? 193 VAL A C    1 
ATOM   1853 O O    . VAL A 1 193 ? 44.236  40.328 -27.253 1.00 21.05 ? 193 VAL A O    1 
ATOM   1854 C CB   . VAL A 1 193 ? 44.444  42.404 -29.240 1.00 21.41 ? 193 VAL A CB   1 
ATOM   1855 C CG1  . VAL A 1 193 ? 44.947  43.355 -30.277 1.00 20.71 ? 193 VAL A CG1  1 
ATOM   1856 C CG2  . VAL A 1 193 ? 42.946  42.239 -29.342 1.00 22.91 ? 193 VAL A CG2  1 
ATOM   1857 H H    . VAL A 1 193 ? 44.511  40.608 -31.373 1.00 0.00  ? 193 VAL A H    1 
ATOM   1858 N N    . ALA A 1 194 ? 44.033  38.878 -28.965 1.00 16.12 ? 194 ALA A N    1 
ATOM   1859 C CA   . ALA A 1 194 ? 43.311  37.890 -28.164 1.00 15.51 ? 194 ALA A CA   1 
ATOM   1860 C C    . ALA A 1 194 ? 43.884  37.653 -26.796 1.00 19.48 ? 194 ALA A C    1 
ATOM   1861 O O    . ALA A 1 194 ? 43.220  37.888 -25.759 1.00 22.32 ? 194 ALA A O    1 
ATOM   1862 C CB   . ALA A 1 194 ? 43.237  36.586 -28.889 1.00 12.95 ? 194 ALA A CB   1 
ATOM   1863 H H    . ALA A 1 194 ? 44.230  38.710 -29.912 1.00 0.00  ? 194 ALA A H    1 
ATOM   1864 N N    . ASP A 1 195 ? 45.149  37.248 -26.798 1.00 22.15 ? 195 ASP A N    1 
ATOM   1865 C CA   . ASP A 1 195 ? 45.888  36.898 -25.596 1.00 20.56 ? 195 ASP A CA   1 
ATOM   1866 C C    . ASP A 1 195 ? 45.853  37.947 -24.511 1.00 21.80 ? 195 ASP A C    1 
ATOM   1867 O O    . ASP A 1 195 ? 45.856  37.612 -23.328 1.00 25.72 ? 195 ASP A O    1 
ATOM   1868 C CB   . ASP A 1 195 ? 47.315  36.551 -25.978 1.00 21.43 ? 195 ASP A CB   1 
ATOM   1869 C CG   . ASP A 1 195 ? 47.383  35.639 -27.224 1.00 21.07 ? 195 ASP A CG   1 
ATOM   1870 O OD1  . ASP A 1 195 ? 47.096  36.127 -28.355 1.00 22.08 ? 195 ASP A OD1  1 
ATOM   1871 O OD2  . ASP A 1 195 ? 47.684  34.439 -27.080 1.00 18.53 ? 195 ASP A OD2  1 
ATOM   1872 H H    . ASP A 1 195 ? 45.620  37.191 -27.659 1.00 0.00  ? 195 ASP A H    1 
ATOM   1873 N N    . ILE A 1 196 ? 45.787  39.218 -24.894 1.00 22.37 ? 196 ILE A N    1 
ATOM   1874 C CA   . ILE A 1 196 ? 45.732  40.313 -23.921 1.00 20.64 ? 196 ILE A CA   1 
ATOM   1875 C C    . ILE A 1 196 ? 44.335  40.251 -23.323 1.00 21.03 ? 196 ILE A C    1 
ATOM   1876 O O    . ILE A 1 196 ? 44.167  40.011 -22.122 1.00 21.88 ? 196 ILE A O    1 
ATOM   1877 C CB   . ILE A 1 196 ? 45.949  41.699 -24.611 1.00 18.72 ? 196 ILE A CB   1 
ATOM   1878 C CG1  . ILE A 1 196 ? 47.330  41.778 -25.237 1.00 16.09 ? 196 ILE A CG1  1 
ATOM   1879 C CG2  . ILE A 1 196 ? 45.802  42.840 -23.627 1.00 17.99 ? 196 ILE A CG2  1 
ATOM   1880 C CD1  . ILE A 1 196 ? 47.580  43.136 -25.876 1.00 12.97 ? 196 ILE A CD1  1 
ATOM   1881 H H    . ILE A 1 196 ? 45.734  39.419 -25.851 1.00 0.00  ? 196 ILE A H    1 
ATOM   1882 N N    . LEU A 1 197 ? 43.337  40.357 -24.193 1.00 21.78 ? 197 LEU A N    1 
ATOM   1883 C CA   . LEU A 1 197 ? 41.942  40.318 -23.774 1.00 20.35 ? 197 LEU A CA   1 
ATOM   1884 C C    . LEU A 1 197 ? 41.619  39.099 -22.907 1.00 21.93 ? 197 LEU A C    1 
ATOM   1885 O O    . LEU A 1 197 ? 40.835  39.204 -21.960 1.00 23.35 ? 197 LEU A O    1 
ATOM   1886 C CB   . LEU A 1 197 ? 41.015  40.325 -24.997 1.00 19.99 ? 197 LEU A CB   1 
ATOM   1887 C CG   . LEU A 1 197 ? 40.760  41.555 -25.870 1.00 16.32 ? 197 LEU A CG   1 
ATOM   1888 C CD1  . LEU A 1 197 ? 40.079  41.104 -27.121 1.00 18.48 ? 197 LEU A CD1  1 
ATOM   1889 C CD2  . LEU A 1 197 ? 39.911  42.541 -25.161 1.00 13.54 ? 197 LEU A CD2  1 
ATOM   1890 H H    . LEU A 1 197 ? 43.555  40.427 -25.152 1.00 0.00  ? 197 LEU A H    1 
ATOM   1891 N N    . THR A 1 198 ? 42.180  37.937 -23.237 1.00 22.63 ? 198 THR A N    1 
ATOM   1892 C CA   . THR A 1 198 ? 41.884  36.741 -22.447 1.00 24.51 ? 198 THR A CA   1 
ATOM   1893 C C    . THR A 1 198 ? 42.553  36.720 -21.082 1.00 25.73 ? 198 THR A C    1 
ATOM   1894 O O    . THR A 1 198 ? 42.002  36.150 -20.128 1.00 31.23 ? 198 THR A O    1 
ATOM   1895 C CB   . THR A 1 198 ? 42.154  35.436 -23.197 1.00 23.24 ? 198 THR A CB   1 
ATOM   1896 O OG1  . THR A 1 198 ? 43.556  35.281 -23.398 1.00 25.47 ? 198 THR A OG1  1 
ATOM   1897 C CG2  . THR A 1 198 ? 41.462  35.428 -24.530 1.00 21.79 ? 198 THR A CG2  1 
ATOM   1898 H H    . THR A 1 198 ? 42.718  37.875 -24.064 1.00 0.00  ? 198 THR A H    1 
ATOM   1899 H HG1  . THR A 1 198 ? 43.964  35.060 -22.555 1.00 0.00  ? 198 THR A HG1  1 
ATOM   1900 N N    . SER A 1 199 ? 43.703  37.373 -20.932 1.00 23.32 ? 199 SER A N    1 
ATOM   1901 C CA   . SER A 1 199 ? 44.344  37.397 -19.588 1.00 19.88 ? 199 SER A CA   1 
ATOM   1902 C C    . SER A 1 199 ? 43.712  38.382 -18.572 1.00 19.63 ? 199 SER A C    1 
ATOM   1903 O O    . SER A 1 199 ? 44.143  38.469 -17.442 1.00 21.36 ? 199 SER A O    1 
ATOM   1904 C CB   . SER A 1 199 ? 45.806  37.707 -19.709 1.00 11.03 ? 199 SER A CB   1 
ATOM   1905 O OG   . SER A 1 199 ? 45.946  38.978 -20.310 1.00 13.47 ? 199 SER A OG   1 
ATOM   1906 H H    . SER A 1 199 ? 44.136  37.783 -21.706 1.00 0.00  ? 199 SER A H    1 
ATOM   1907 H HG   . SER A 1 199 ? 45.293  39.084 -21.029 1.00 0.00  ? 199 SER A HG   1 
ATOM   1908 N N    . MET A 1 200 ? 42.704  39.135 -18.967 1.00 17.97 ? 200 MET A N    1 
ATOM   1909 C CA   . MET A 1 200 ? 42.097  40.057 -18.032 1.00 18.60 ? 200 MET A CA   1 
ATOM   1910 C C    . MET A 1 200 ? 40.740  39.442 -17.696 1.00 21.92 ? 200 MET A C    1 
ATOM   1911 O O    . MET A 1 200 ? 39.947  40.016 -16.912 1.00 21.13 ? 200 MET A O    1 
ATOM   1912 C CB   . MET A 1 200 ? 41.946  41.443 -18.701 1.00 20.56 ? 200 MET A CB   1 
ATOM   1913 C CG   . MET A 1 200 ? 43.294  42.000 -19.249 1.00 21.79 ? 200 MET A CG   1 
ATOM   1914 S SD   . MET A 1 200 ? 43.281  43.628 -20.020 1.00 21.68 ? 200 MET A SD   1 
ATOM   1915 C CE   . MET A 1 200 ? 43.097  44.553 -18.559 1.00 21.19 ? 200 MET A CE   1 
ATOM   1916 H H    . MET A 1 200 ? 42.371  39.091 -19.887 1.00 0.00  ? 200 MET A H    1 
ATOM   1917 N N    . VAL A 1 201 ? 40.506  38.257 -18.286 1.00 20.87 ? 201 VAL A N    1 
ATOM   1918 C CA   . VAL A 1 201 ? 39.253  37.516 -18.150 1.00 22.10 ? 201 VAL A CA   1 
ATOM   1919 C C    . VAL A 1 201 ? 39.025  36.986 -16.720 1.00 21.77 ? 201 VAL A C    1 
ATOM   1920 O O    . VAL A 1 201 ? 39.995  36.781 -15.975 1.00 26.47 ? 201 VAL A O    1 
ATOM   1921 C CB   . VAL A 1 201 ? 39.203  36.392 -19.225 1.00 22.74 ? 201 VAL A CB   1 
ATOM   1922 C CG1  . VAL A 1 201 ? 39.394  35.004 -18.619 1.00 22.46 ? 201 VAL A CG1  1 
ATOM   1923 C CG2  . VAL A 1 201 ? 37.963  36.508 -20.073 1.00 23.79 ? 201 VAL A CG2  1 
ATOM   1924 H H    . VAL A 1 201 ? 41.197  37.811 -18.810 1.00 0.00  ? 201 VAL A H    1 
ATOM   1925 N N    . VAL A 1 202 ? 37.772  36.934 -16.293 1.00 15.51 ? 202 VAL A N    1 
ATOM   1926 C CA   . VAL A 1 202 ? 37.429  36.427 -14.976 1.00 13.92 ? 202 VAL A CA   1 
ATOM   1927 C C    . VAL A 1 202 ? 35.927  36.151 -14.898 1.00 11.93 ? 202 VAL A C    1 
ATOM   1928 O O    . VAL A 1 202 ? 35.117  36.630 -15.730 1.00 11.14 ? 202 VAL A O    1 
ATOM   1929 C CB   . VAL A 1 202 ? 37.820  37.409 -13.817 1.00 14.91 ? 202 VAL A CB   1 
ATOM   1930 C CG1  . VAL A 1 202 ? 36.687  38.478 -13.517 1.00 12.12 ? 202 VAL A CG1  1 
ATOM   1931 C CG2  . VAL A 1 202 ? 38.141  36.631 -12.559 1.00 11.69 ? 202 VAL A CG2  1 
ATOM   1932 H H    . VAL A 1 202 ? 37.070  37.325 -16.860 1.00 0.00  ? 202 VAL A H    1 
ATOM   1933 N N    . ASP A 1 203 ? 35.579  35.315 -13.934 1.00 9.59  ? 203 ASP A N    1 
ATOM   1934 C CA   . ASP A 1 203 ? 34.191  34.966 -13.660 1.00 11.43 ? 203 ASP A CA   1 
ATOM   1935 C C    . ASP A 1 203 ? 33.630  36.124 -12.789 1.00 10.76 ? 203 ASP A C    1 
ATOM   1936 O O    . ASP A 1 203 ? 33.749  36.129 -11.576 1.00 12.73 ? 203 ASP A O    1 
ATOM   1937 C CB   . ASP A 1 203 ? 34.169  33.597 -12.966 1.00 9.52  ? 203 ASP A CB   1 
ATOM   1938 C CG   . ASP A 1 203 ? 32.811  33.212 -12.415 1.00 9.51  ? 203 ASP A CG   1 
ATOM   1939 O OD1  . ASP A 1 203 ? 31.896  34.059 -12.351 1.00 11.19 ? 203 ASP A OD1  1 
ATOM   1940 O OD2  . ASP A 1 203 ? 32.687  32.032 -11.991 1.00 6.51  ? 203 ASP A OD2  1 
ATOM   1941 H H    . ASP A 1 203 ? 36.272  34.901 -13.372 1.00 0.00  ? 203 ASP A H    1 
ATOM   1942 N N    . VAL A 1 204 ? 33.050  37.120 -13.461 1.00 11.43 ? 204 VAL A N    1 
ATOM   1943 C CA   . VAL A 1 204 ? 32.493  38.310 -12.837 1.00 8.83  ? 204 VAL A CA   1 
ATOM   1944 C C    . VAL A 1 204 ? 31.402  38.068 -11.782 1.00 11.07 ? 204 VAL A C    1 
ATOM   1945 O O    . VAL A 1 204 ? 31.564  38.541 -10.679 1.00 13.10 ? 204 VAL A O    1 
ATOM   1946 C CB   . VAL A 1 204 ? 32.061  39.323 -13.940 1.00 7.19  ? 204 VAL A CB   1 
ATOM   1947 C CG1  . VAL A 1 204 ? 31.369  40.576 -13.341 1.00 11.50 ? 204 VAL A CG1  1 
ATOM   1948 C CG2  . VAL A 1 204 ? 33.282  39.769 -14.703 1.00 6.90  ? 204 VAL A CG2  1 
ATOM   1949 H H    . VAL A 1 204 ? 33.004  37.044 -14.434 1.00 0.00  ? 204 VAL A H    1 
ATOM   1950 N N    . SER A 1 205 ? 30.362  37.270 -12.056 1.00 11.14 ? 205 SER A N    1 
ATOM   1951 C CA   . SER A 1 205 ? 29.313  37.045 -11.057 1.00 14.68 ? 205 SER A CA   1 
ATOM   1952 C C    . SER A 1 205 ? 29.785  36.308 -9.822  1.00 15.23 ? 205 SER A C    1 
ATOM   1953 O O    . SER A 1 205 ? 29.291  36.547 -8.705  1.00 16.24 ? 205 SER A O    1 
ATOM   1954 C CB   . SER A 1 205 ? 28.023  36.431 -11.652 1.00 16.09 ? 205 SER A CB   1 
ATOM   1955 O OG   . SER A 1 205 ? 27.933  35.017 -11.552 1.00 19.88 ? 205 SER A OG   1 
ATOM   1956 H H    . SER A 1 205 ? 30.295  36.842 -12.931 1.00 0.00  ? 205 SER A H    1 
ATOM   1957 H HG   . SER A 1 205 ? 27.788  34.756 -10.626 1.00 0.00  ? 205 SER A HG   1 
ATOM   1958 N N    . ASP A 1 206 ? 30.799  35.472 -9.979  1.00 16.14 ? 206 ASP A N    1 
ATOM   1959 C CA   . ASP A 1 206 ? 31.316  34.781 -8.813  1.00 16.63 ? 206 ASP A CA   1 
ATOM   1960 C C    . ASP A 1 206 ? 32.104  35.754 -7.929  1.00 17.46 ? 206 ASP A C    1 
ATOM   1961 O O    . ASP A 1 206 ? 32.005  35.702 -6.697  1.00 18.97 ? 206 ASP A O    1 
ATOM   1962 C CB   . ASP A 1 206 ? 32.173  33.579 -9.217  1.00 16.64 ? 206 ASP A CB   1 
ATOM   1963 C CG   . ASP A 1 206 ? 32.586  32.755 -8.035  1.00 17.86 ? 206 ASP A CG   1 
ATOM   1964 O OD1  . ASP A 1 206 ? 31.786  31.903 -7.598  1.00 19.64 ? 206 ASP A OD1  1 
ATOM   1965 O OD2  . ASP A 1 206 ? 33.682  33.000 -7.499  1.00 14.91 ? 206 ASP A OD2  1 
ATOM   1966 H H    . ASP A 1 206 ? 31.203  35.273 -10.852 1.00 0.00  ? 206 ASP A H    1 
ATOM   1967 N N    . LEU A 1 207 ? 32.870  36.658 -8.553  1.00 16.91 ? 207 LEU A N    1 
ATOM   1968 C CA   . LEU A 1 207 ? 33.643  37.672 -7.810  1.00 17.47 ? 207 LEU A CA   1 
ATOM   1969 C C    . LEU A 1 207 ? 32.730  38.662 -7.056  1.00 18.04 ? 207 LEU A C    1 
ATOM   1970 O O    . LEU A 1 207 ? 32.979  38.988 -5.898  1.00 19.90 ? 207 LEU A O    1 
ATOM   1971 C CB   . LEU A 1 207 ? 34.538  38.455 -8.764  1.00 21.59 ? 207 LEU A CB   1 
ATOM   1972 C CG   . LEU A 1 207 ? 35.809  39.149 -8.272  1.00 26.31 ? 207 LEU A CG   1 
ATOM   1973 C CD1  . LEU A 1 207 ? 36.346  40.043 -9.376  1.00 26.26 ? 207 LEU A CD1  1 
ATOM   1974 C CD2  . LEU A 1 207 ? 35.522  40.000 -7.067  1.00 29.82 ? 207 LEU A CD2  1 
ATOM   1975 H H    . LEU A 1 207 ? 32.963  36.593 -9.527  1.00 0.00  ? 207 LEU A H    1 
ATOM   1976 N N    . LEU A 1 208 ? 31.641  39.089 -7.677  1.00 14.81 ? 208 LEU A N    1 
ATOM   1977 C CA   . LEU A 1 208 ? 30.754  40.032 -7.025  1.00 14.20 ? 208 LEU A CA   1 
ATOM   1978 C C    . LEU A 1 208 ? 30.126  39.435 -5.788  1.00 14.52 ? 208 LEU A C    1 
ATOM   1979 O O    . LEU A 1 208 ? 29.818  40.139 -4.810  1.00 14.73 ? 208 LEU A O    1 
ATOM   1980 C CB   . LEU A 1 208 ? 29.682  40.543 -8.019  1.00 13.15 ? 208 LEU A CB   1 
ATOM   1981 C CG   . LEU A 1 208 ? 30.362  41.427 -9.081  1.00 13.07 ? 208 LEU A CG   1 
ATOM   1982 C CD1  . LEU A 1 208 ? 29.353  42.031 -10.030 1.00 7.51  ? 208 LEU A CD1  1 
ATOM   1983 C CD2  . LEU A 1 208 ? 31.216  42.482 -8.381  1.00 7.64  ? 208 LEU A CD2  1 
ATOM   1984 H H    . LEU A 1 208 ? 31.492  38.808 -8.605  1.00 0.00  ? 208 LEU A H    1 
ATOM   1985 N N    . ASP A 1 209 ? 29.911  38.120 -5.853  1.00 16.79 ? 209 ASP A N    1 
ATOM   1986 C CA   . ASP A 1 209 ? 29.329  37.342 -4.754  1.00 13.67 ? 209 ASP A CA   1 
ATOM   1987 C C    . ASP A 1 209 ? 30.387  37.136 -3.681  1.00 13.23 ? 209 ASP A C    1 
ATOM   1988 O O    . ASP A 1 209 ? 30.074  37.172 -2.532  1.00 10.81 ? 209 ASP A O    1 
ATOM   1989 C CB   . ASP A 1 209 ? 28.767  36.012 -5.285  1.00 10.99 ? 209 ASP A CB   1 
ATOM   1990 C CG   . ASP A 1 209 ? 28.130  35.188 -4.211  1.00 12.92 ? 209 ASP A CG   1 
ATOM   1991 O OD1  . ASP A 1 209 ? 26.992  35.488 -3.834  1.00 20.22 ? 209 ASP A OD1  1 
ATOM   1992 O OD2  . ASP A 1 209 ? 28.777  34.246 -3.715  1.00 13.01 ? 209 ASP A OD2  1 
ATOM   1993 H H    . ASP A 1 209 ? 30.103  37.629 -6.680  1.00 0.00  ? 209 ASP A H    1 
ATOM   1994 N N    . GLN A 1 210 ? 31.645  36.920 -4.056  1.00 16.54 ? 210 GLN A N    1 
ATOM   1995 C CA   . GLN A 1 210 ? 32.703  36.769 -3.048  1.00 17.39 ? 210 GLN A CA   1 
ATOM   1996 C C    . GLN A 1 210 ? 32.772  38.116 -2.357  1.00 18.10 ? 210 GLN A C    1 
ATOM   1997 O O    . GLN A 1 210 ? 32.825  38.184 -1.136  1.00 18.97 ? 210 GLN A O    1 
ATOM   1998 C CB   . GLN A 1 210 ? 34.094  36.482 -3.652  1.00 17.59 ? 210 GLN A CB   1 
ATOM   1999 C CG   . GLN A 1 210 ? 34.262  35.257 -4.621  1.00 22.72 ? 210 GLN A CG   1 
ATOM   2000 C CD   . GLN A 1 210 ? 35.724  34.835 -4.752  1.00 26.36 ? 210 GLN A CD   1 
ATOM   2001 O OE1  . GLN A 1 210 ? 36.320  34.850 -5.828  1.00 23.59 ? 210 GLN A OE1  1 
ATOM   2002 N NE2  . GLN A 1 210 ? 36.318  34.483 -3.620  1.00 29.96 ? 210 GLN A NE2  1 
ATOM   2003 H H    . GLN A 1 210 ? 31.823  36.745 -5.003  1.00 0.00  ? 210 GLN A H    1 
ATOM   2004 H HE21 . GLN A 1 210 ? 37.249  34.231 -3.682  1.00 0.00  ? 210 GLN A HE21 1 
ATOM   2005 H HE22 . GLN A 1 210 ? 35.817  34.481 -2.775  1.00 0.00  ? 210 GLN A HE22 1 
ATOM   2006 N N    . ALA A 1 211 ? 32.765  39.198 -3.148  1.00 20.56 ? 211 ALA A N    1 
ATOM   2007 C CA   . ALA A 1 211 ? 32.829  40.581 -2.612  1.00 19.74 ? 211 ALA A CA   1 
ATOM   2008 C C    . ALA A 1 211 ? 31.660  40.882 -1.669  1.00 17.77 ? 211 ALA A C    1 
ATOM   2009 O O    . ALA A 1 211 ? 31.831  41.492 -0.605  1.00 15.21 ? 211 ALA A O    1 
ATOM   2010 C CB   . ALA A 1 211 ? 32.841  41.609 -3.756  1.00 18.30 ? 211 ALA A CB   1 
ATOM   2011 H H    . ALA A 1 211 ? 32.759  39.087 -4.127  1.00 0.00  ? 211 ALA A H    1 
ATOM   2012 N N    . ARG A 1 212 ? 30.481  40.394 -2.036  1.00 17.54 ? 212 ARG A N    1 
ATOM   2013 C CA   . ARG A 1 212 ? 29.326  40.652 -1.202  1.00 18.53 ? 212 ARG A CA   1 
ATOM   2014 C C    . ARG A 1 212 ? 29.463  40.023 0.165   1.00 19.85 ? 212 ARG A C    1 
ATOM   2015 O O    . ARG A 1 212 ? 29.039  40.613 1.169   1.00 20.52 ? 212 ARG A O    1 
ATOM   2016 C CB   . ARG A 1 212 ? 28.054  40.208 -1.857  1.00 14.70 ? 212 ARG A CB   1 
ATOM   2017 C CG   . ARG A 1 212 ? 26.863  40.650 -1.086  1.00 18.55 ? 212 ARG A CG   1 
ATOM   2018 C CD   . ARG A 1 212 ? 25.605  39.998 -1.631  1.00 22.68 ? 212 ARG A CD   1 
ATOM   2019 N NE   . ARG A 1 212 ? 25.768  38.538 -1.623  1.00 22.68 ? 212 ARG A NE   1 
ATOM   2020 C CZ   . ARG A 1 212 ? 25.304  37.739 -0.667  1.00 18.45 ? 212 ARG A CZ   1 
ATOM   2021 N NH1  . ARG A 1 212 ? 24.631  38.254 0.370   1.00 17.12 ? 212 ARG A NH1  1 
ATOM   2022 N NH2  . ARG A 1 212 ? 25.508  36.435 -0.762  1.00 15.53 ? 212 ARG A NH2  1 
ATOM   2023 H H    . ARG A 1 212 ? 30.375  39.937 -2.901  1.00 0.00  ? 212 ARG A H    1 
ATOM   2024 H HE   . ARG A 1 212 ? 26.245  38.127 -2.384  1.00 0.00  ? 212 ARG A HE   1 
ATOM   2025 H HH11 . ARG A 1 212 ? 24.486  39.242 0.439   1.00 0.00  ? 212 ARG A HH11 1 
ATOM   2026 H HH12 . ARG A 1 212 ? 24.275  37.669 1.100   1.00 0.00  ? 212 ARG A HH12 1 
ATOM   2027 H HH21 . ARG A 1 212 ? 25.990  36.068 -1.575  1.00 0.00  ? 212 ARG A HH21 1 
ATOM   2028 H HH22 . ARG A 1 212 ? 25.174  35.774 -0.092  1.00 0.00  ? 212 ARG A HH22 1 
ATOM   2029 N N    . GLN A 1 213 ? 30.125  38.868 0.223   1.00 19.20 ? 213 GLN A N    1 
ATOM   2030 C CA   . GLN A 1 213 ? 30.285  38.180 1.483   1.00 23.15 ? 213 GLN A CA   1 
ATOM   2031 C C    . GLN A 1 213 ? 31.443  38.695 2.296   1.00 24.09 ? 213 GLN A C    1 
ATOM   2032 O O    . GLN A 1 213 ? 31.426  38.610 3.509   1.00 26.62 ? 213 GLN A O    1 
ATOM   2033 C CB   . GLN A 1 213 ? 30.420  36.685 1.257   1.00 26.25 ? 213 GLN A CB   1 
ATOM   2034 C CG   . GLN A 1 213 ? 29.123  35.957 0.887   1.00 32.07 ? 213 GLN A CG   1 
ATOM   2035 C CD   . GLN A 1 213 ? 29.398  34.484 0.601   1.00 35.35 ? 213 GLN A CD   1 
ATOM   2036 O OE1  . GLN A 1 213 ? 30.246  34.156 -0.228  1.00 40.82 ? 213 GLN A OE1  1 
ATOM   2037 N NE2  . GLN A 1 213 ? 28.745  33.603 1.328   1.00 35.66 ? 213 GLN A NE2  1 
ATOM   2038 H H    . GLN A 1 213 ? 30.465  38.448 -0.598  1.00 0.00  ? 213 GLN A H    1 
ATOM   2039 H HE21 . GLN A 1 213 ? 28.940  32.662 1.129   1.00 0.00  ? 213 GLN A HE21 1 
ATOM   2040 H HE22 . GLN A 1 213 ? 28.123  33.898 2.017   1.00 0.00  ? 213 GLN A HE22 1 
ATOM   2041 N N    . ARG A 1 214 ? 32.454  39.229 1.626   1.00 23.72 ? 214 ARG A N    1 
ATOM   2042 C CA   . ARG A 1 214 ? 33.643  39.763 2.293   1.00 19.92 ? 214 ARG A CA   1 
ATOM   2043 C C    . ARG A 1 214 ? 33.458  41.205 2.754   1.00 18.73 ? 214 ARG A C    1 
ATOM   2044 O O    . ARG A 1 214 ? 34.356  41.771 3.392   1.00 19.29 ? 214 ARG A O    1 
ATOM   2045 C CB   . ARG A 1 214 ? 34.821  39.683 1.329   1.00 22.25 ? 214 ARG A CB   1 
ATOM   2046 C CG   . ARG A 1 214 ? 36.183  39.994 1.924   1.00 27.24 ? 214 ARG A CG   1 
ATOM   2047 C CD   . ARG A 1 214 ? 37.221  40.226 0.846   1.00 28.25 ? 214 ARG A CD   1 
ATOM   2048 N NE   . ARG A 1 214 ? 37.169  39.201 -0.191  1.00 30.32 ? 214 ARG A NE   1 
ATOM   2049 C CZ   . ARG A 1 214 ? 37.594  39.370 -1.442  1.00 31.98 ? 214 ARG A CZ   1 
ATOM   2050 N NH1  . ARG A 1 214 ? 38.112  40.534 -1.830  1.00 32.97 ? 214 ARG A NH1  1 
ATOM   2051 N NH2  . ARG A 1 214 ? 37.471  38.380 -2.322  1.00 31.09 ? 214 ARG A NH2  1 
ATOM   2052 H H    . ARG A 1 214 ? 32.427  39.204 0.644   1.00 0.00  ? 214 ARG A H    1 
ATOM   2053 H HE   . ARG A 1 214 ? 36.827  38.323 0.086   1.00 0.00  ? 214 ARG A HE   1 
ATOM   2054 H HH11 . ARG A 1 214 ? 38.141  41.290 -1.169  1.00 0.00  ? 214 ARG A HH11 1 
ATOM   2055 H HH12 . ARG A 1 214 ? 38.422  40.695 -2.765  1.00 0.00  ? 214 ARG A HH12 1 
ATOM   2056 H HH21 . ARG A 1 214 ? 37.073  37.502 -2.062  1.00 0.00  ? 214 ARG A HH21 1 
ATOM   2057 H HH22 . ARG A 1 214 ? 37.785  38.490 -3.266  1.00 0.00  ? 214 ARG A HH22 1 
ATOM   2058 N N    . GLY A 1 215 ? 32.315  41.819 2.415   1.00 17.05 ? 215 GLY A N    1 
ATOM   2059 C CA   . GLY A 1 215 ? 32.081  43.200 2.800   1.00 13.32 ? 215 GLY A CA   1 
ATOM   2060 C C    . GLY A 1 215 ? 32.601  44.286 1.833   1.00 14.36 ? 215 GLY A C    1 
ATOM   2061 O O    . GLY A 1 215 ? 32.244  45.468 1.991   1.00 15.27 ? 215 GLY A O    1 
ATOM   2062 H H    . GLY A 1 215 ? 31.651  41.357 1.866   1.00 0.00  ? 215 GLY A H    1 
ATOM   2063 N N    . ASP A 1 216 ? 33.394  43.934 0.824   1.00 13.32 ? 216 ASP A N    1 
ATOM   2064 C CA   . ASP A 1 216 ? 33.917  44.947 -0.088  1.00 13.22 ? 216 ASP A CA   1 
ATOM   2065 C C    . ASP A 1 216 ? 32.843  45.945 -0.592  1.00 12.02 ? 216 ASP A C    1 
ATOM   2066 O O    . ASP A 1 216 ? 31.652  45.598 -0.683  1.00 5.01  ? 216 ASP A O    1 
ATOM   2067 C CB   . ASP A 1 216 ? 34.622  44.303 -1.302  1.00 11.61 ? 216 ASP A CB   1 
ATOM   2068 C CG   . ASP A 1 216 ? 35.790  43.384 -0.893  1.00 15.07 ? 216 ASP A CG   1 
ATOM   2069 O OD1  . ASP A 1 216 ? 36.764  43.876 -0.243  1.00 14.53 ? 216 ASP A OD1  1 
ATOM   2070 O OD2  . ASP A 1 216 ? 35.717  42.167 -1.245  1.00 15.27 ? 216 ASP A OD2  1 
ATOM   2071 H H    . ASP A 1 216 ? 33.609  42.994 0.661   1.00 0.00  ? 216 ASP A H    1 
ATOM   2072 N N    . PHE A 1 217 ? 33.293  47.165 -0.938  1.00 11.82 ? 217 PHE A N    1 
ATOM   2073 C CA   . PHE A 1 217 ? 32.416  48.221 -1.459  1.00 13.67 ? 217 PHE A CA   1 
ATOM   2074 C C    . PHE A 1 217 ? 32.426  48.170 -2.967  1.00 15.38 ? 217 PHE A C    1 
ATOM   2075 O O    . PHE A 1 217 ? 33.498  48.178 -3.588  1.00 17.01 ? 217 PHE A O    1 
ATOM   2076 C CB   . PHE A 1 217 ? 32.877  49.624 -1.011  1.00 14.10 ? 217 PHE A CB   1 
ATOM   2077 C CG   . PHE A 1 217 ? 32.530  49.981 0.444   1.00 13.53 ? 217 PHE A CG   1 
ATOM   2078 C CD1  . PHE A 1 217 ? 31.602  49.253 1.166   1.00 11.19 ? 217 PHE A CD1  1 
ATOM   2079 C CD2  . PHE A 1 217 ? 33.130  51.077 1.051   1.00 14.53 ? 217 PHE A CD2  1 
ATOM   2080 C CE1  . PHE A 1 217 ? 31.275  49.619 2.460   1.00 15.11 ? 217 PHE A CE1  1 
ATOM   2081 C CE2  . PHE A 1 217 ? 32.817  51.464 2.354   1.00 15.87 ? 217 PHE A CE2  1 
ATOM   2082 C CZ   . PHE A 1 217 ? 31.889  50.743 3.065   1.00 16.08 ? 217 PHE A CZ   1 
ATOM   2083 H H    . PHE A 1 217 ? 34.249  47.347 -0.815  1.00 0.00  ? 217 PHE A H    1 
ATOM   2084 N N    . VAL A 1 218 ? 31.257  48.183 -3.588  1.00 14.26 ? 218 VAL A N    1 
ATOM   2085 C CA   . VAL A 1 218 ? 31.236  48.143 -5.028  1.00 13.15 ? 218 VAL A CA   1 
ATOM   2086 C C    . VAL A 1 218 ? 30.327  49.214 -5.556  1.00 13.36 ? 218 VAL A C    1 
ATOM   2087 O O    . VAL A 1 218 ? 29.189  49.367 -5.099  1.00 15.40 ? 218 VAL A O    1 
ATOM   2088 C CB   . VAL A 1 218 ? 30.736  46.794 -5.623  1.00 12.95 ? 218 VAL A CB   1 
ATOM   2089 C CG1  . VAL A 1 218 ? 30.730  46.924 -7.141  1.00 11.90 ? 218 VAL A CG1  1 
ATOM   2090 C CG2  . VAL A 1 218 ? 31.601  45.589 -5.190  1.00 16.04 ? 218 VAL A CG2  1 
ATOM   2091 H H    . VAL A 1 218 ? 30.406  48.256 -3.086  1.00 0.00  ? 218 VAL A H    1 
ATOM   2092 N N    . MET A 1 219 ? 30.799  49.894 -6.590  1.00 14.12 ? 219 MET A N    1 
ATOM   2093 C CA   . MET A 1 219 ? 30.042  50.944 -7.251  1.00 13.82 ? 219 MET A CA   1 
ATOM   2094 C C    . MET A 1 219 ? 29.721  50.469 -8.649  1.00 14.69 ? 219 MET A C    1 
ATOM   2095 O O    . MET A 1 219 ? 30.649  50.072 -9.385  1.00 15.18 ? 219 MET A O    1 
ATOM   2096 C CB   . MET A 1 219 ? 30.871  52.212 -7.382  1.00 13.98 ? 219 MET A CB   1 
ATOM   2097 C CG   . MET A 1 219 ? 30.087  53.431 -7.852  1.00 19.78 ? 219 MET A CG   1 
ATOM   2098 S SD   . MET A 1 219 ? 31.241  54.779 -8.185  1.00 27.79 ? 219 MET A SD   1 
ATOM   2099 C CE   . MET A 1 219 ? 30.955  54.937 -9.932  1.00 29.59 ? 219 MET A CE   1 
ATOM   2100 H H    . MET A 1 219 ? 31.694  49.655 -6.928  1.00 0.00  ? 219 MET A H    1 
ATOM   2101 N N    . PHE A 1 220 ? 28.424  50.400 -8.960  1.00 10.79 ? 220 PHE A N    1 
ATOM   2102 C CA   . PHE A 1 220 ? 27.936  50.048 -10.302 1.00 11.13 ? 220 PHE A CA   1 
ATOM   2103 C C    . PHE A 1 220 ? 27.779  51.405 -11.047 1.00 11.48 ? 220 PHE A C    1 
ATOM   2104 O O    . PHE A 1 220 ? 27.087  52.322 -10.598 1.00 13.08 ? 220 PHE A O    1 
ATOM   2105 C CB   . PHE A 1 220 ? 26.601  49.289 -10.209 1.00 9.98  ? 220 PHE A CB   1 
ATOM   2106 C CG   . PHE A 1 220 ? 26.737  47.914 -9.571  1.00 9.09  ? 220 PHE A CG   1 
ATOM   2107 C CD1  . PHE A 1 220 ? 26.727  47.768 -8.182  1.00 5.26  ? 220 PHE A CD1  1 
ATOM   2108 C CD2  . PHE A 1 220 ? 27.023  46.787 -10.361 1.00 5.15  ? 220 PHE A CD2  1 
ATOM   2109 C CE1  . PHE A 1 220 ? 27.010  46.565 -7.611  1.00 5.01  ? 220 PHE A CE1  1 
ATOM   2110 C CE2  . PHE A 1 220 ? 27.300  45.591 -9.787  1.00 5.31  ? 220 PHE A CE2  1 
ATOM   2111 C CZ   . PHE A 1 220 ? 27.298  45.474 -8.416  1.00 5.01  ? 220 PHE A CZ   1 
ATOM   2112 H H    . PHE A 1 220 ? 27.760  50.592 -8.243  1.00 0.00  ? 220 PHE A H    1 
ATOM   2113 N N    . GLU A 1 221 ? 28.441  51.535 -12.169 1.00 14.29 ? 221 GLU A N    1 
ATOM   2114 C CA   . GLU A 1 221 ? 28.414  52.777 -12.897 1.00 18.54 ? 221 GLU A CA   1 
ATOM   2115 C C    . GLU A 1 221 ? 27.480  52.781 -14.149 1.00 22.48 ? 221 GLU A C    1 
ATOM   2116 O O    . GLU A 1 221 ? 27.661  51.986 -15.102 1.00 22.05 ? 221 GLU A O    1 
ATOM   2117 C CB   . GLU A 1 221 ? 29.872  53.113 -13.262 1.00 18.35 ? 221 GLU A CB   1 
ATOM   2118 C CG   . GLU A 1 221 ? 30.108  54.532 -13.628 1.00 20.86 ? 221 GLU A CG   1 
ATOM   2119 C CD   . GLU A 1 221 ? 31.525  54.791 -14.053 1.00 19.75 ? 221 GLU A CD   1 
ATOM   2120 O OE1  . GLU A 1 221 ? 32.476  54.281 -13.422 1.00 26.97 ? 221 GLU A OE1  1 
ATOM   2121 O OE2  . GLU A 1 221 ? 31.704  55.558 -15.004 1.00 21.56 ? 221 GLU A OE2  1 
ATOM   2122 H H    . GLU A 1 221 ? 28.957  50.787 -12.567 1.00 0.00  ? 221 GLU A H    1 
ATOM   2123 N N    . GLY A 1 222 ? 26.435  53.613 -14.094 1.00 23.51 ? 222 GLY A N    1 
ATOM   2124 C CA   . GLY A 1 222 ? 25.514  53.752 -15.212 1.00 24.61 ? 222 GLY A CA   1 
ATOM   2125 C C    . GLY A 1 222 ? 26.091  54.754 -16.214 1.00 25.42 ? 222 GLY A C    1 
ATOM   2126 O O    . GLY A 1 222 ? 26.553  55.849 -15.818 1.00 25.01 ? 222 GLY A O    1 
ATOM   2127 H H    . GLY A 1 222 ? 26.217  54.148 -13.294 1.00 0.00  ? 222 GLY A H    1 
ATOM   2128 N N    . ALA A 1 223 ? 26.063  54.418 -17.499 1.00 26.34 ? 223 ALA A N    1 
ATOM   2129 C CA   . ALA A 1 223 ? 26.595  55.303 -18.526 1.00 27.93 ? 223 ALA A CA   1 
ATOM   2130 C C    . ALA A 1 223 ? 25.617  56.252 -19.257 1.00 27.64 ? 223 ALA A C    1 
ATOM   2131 O O    . ALA A 1 223 ? 26.036  57.292 -19.768 1.00 29.45 ? 223 ALA A O    1 
ATOM   2132 C CB   . ALA A 1 223 ? 27.422  54.506 -19.540 1.00 26.70 ? 223 ALA A CB   1 
ATOM   2133 H H    . ALA A 1 223 ? 25.674  53.563 -17.796 1.00 0.00  ? 223 ALA A H    1 
ATOM   2134 N N    . GLN A 1 224 ? 24.333  55.940 -19.329 1.00 27.87 ? 224 GLN A N    1 
ATOM   2135 C CA   . GLN A 1 224 ? 23.435  56.869 -20.030 1.00 29.63 ? 224 GLN A CA   1 
ATOM   2136 C C    . GLN A 1 224 ? 22.227  57.223 -19.201 1.00 28.15 ? 224 GLN A C    1 
ATOM   2137 O O    . GLN A 1 224 ? 22.068  56.689 -18.111 1.00 32.82 ? 224 GLN A O    1 
ATOM   2138 C CB   . GLN A 1 224 ? 23.023  56.333 -21.401 1.00 32.01 ? 224 GLN A CB   1 
ATOM   2139 C CG   . GLN A 1 224 ? 24.160  56.368 -22.415 1.00 34.13 ? 224 GLN A CG   1 
ATOM   2140 C CD   . GLN A 1 224 ? 24.244  55.082 -23.203 1.00 35.55 ? 224 GLN A CD   1 
ATOM   2141 O OE1  . GLN A 1 224 ? 25.065  54.179 -22.884 1.00 34.87 ? 224 GLN A OE1  1 
ATOM   2142 N NE2  . GLN A 1 224 ? 23.361  54.949 -24.206 1.00 36.98 ? 224 GLN A NE2  1 
ATOM   2143 H H    . GLN A 1 224 ? 23.976  55.131 -18.905 1.00 0.00  ? 224 GLN A H    1 
ATOM   2144 H HE21 . GLN A 1 224 ? 23.452  54.099 -24.674 1.00 0.00  ? 224 GLN A HE21 1 
ATOM   2145 H HE22 . GLN A 1 224 ? 22.691  55.614 -24.452 1.00 0.00  ? 224 GLN A HE22 1 
ATOM   2146 N N    . GLY A 1 225 ? 21.378  58.103 -19.717 1.00 25.68 ? 225 GLY A N    1 
ATOM   2147 C CA   . GLY A 1 225 ? 20.216  58.542 -18.973 1.00 24.06 ? 225 GLY A CA   1 
ATOM   2148 C C    . GLY A 1 225 ? 18.985  57.670 -18.958 1.00 22.10 ? 225 GLY A C    1 
ATOM   2149 O O    . GLY A 1 225 ? 18.570  57.141 -19.984 1.00 24.92 ? 225 GLY A O    1 
ATOM   2150 H H    . GLY A 1 225 ? 21.527  58.471 -20.610 1.00 0.00  ? 225 GLY A H    1 
ATOM   2151 N N    . THR A 1 226 ? 18.365  57.597 -17.781 1.00 20.14 ? 226 THR A N    1 
ATOM   2152 C CA   . THR A 1 226 ? 17.164  56.817 -17.519 1.00 13.81 ? 226 THR A CA   1 
ATOM   2153 C C    . THR A 1 226 ? 16.049  56.870 -18.563 1.00 14.30 ? 226 THR A C    1 
ATOM   2154 O O    . THR A 1 226 ? 15.492  55.829 -18.919 1.00 13.19 ? 226 THR A O    1 
ATOM   2155 C CB   . THR A 1 226 ? 16.569  57.228 -16.122 1.00 12.60 ? 226 THR A CB   1 
ATOM   2156 O OG1  . THR A 1 226 ? 17.509  56.942 -15.081 1.00 6.74  ? 226 THR A OG1  1 
ATOM   2157 C CG2  . THR A 1 226 ? 15.263  56.512 -15.812 1.00 5.01  ? 226 THR A CG2  1 
ATOM   2158 H H    . THR A 1 226 ? 18.757  58.055 -17.009 1.00 0.00  ? 226 THR A H    1 
ATOM   2159 H HG1  . THR A 1 226 ? 18.320  57.492 -15.147 1.00 0.00  ? 226 THR A HG1  1 
ATOM   2160 N N    . LEU A 1 227 ? 15.730  58.062 -19.080 1.00 17.08 ? 227 LEU A N    1 
ATOM   2161 C CA   . LEU A 1 227 ? 14.607  58.225 -20.025 1.00 17.37 ? 227 LEU A CA   1 
ATOM   2162 C C    . LEU A 1 227 ? 14.938  57.844 -21.444 1.00 18.70 ? 227 LEU A C    1 
ATOM   2163 O O    . LEU A 1 227 ? 14.096  57.980 -22.370 1.00 14.73 ? 227 LEU A O    1 
ATOM   2164 C CB   . LEU A 1 227 ? 14.019  59.639 -19.936 1.00 14.99 ? 227 LEU A CB   1 
ATOM   2165 C CG   . LEU A 1 227 ? 13.612  59.887 -18.477 1.00 13.59 ? 227 LEU A CG   1 
ATOM   2166 C CD1  . LEU A 1 227 ? 13.025  61.262 -18.231 1.00 5.01  ? 227 LEU A CD1  1 
ATOM   2167 C CD2  . LEU A 1 227 ? 12.619  58.750 -18.052 1.00 15.76 ? 227 LEU A CD2  1 
ATOM   2168 H H    . LEU A 1 227 ? 16.214  58.886 -18.845 1.00 0.00  ? 227 LEU A H    1 
ATOM   2169 N N    . LEU A 1 228 ? 16.186  57.389 -21.591 1.00 19.83 ? 228 LEU A N    1 
ATOM   2170 C CA   . LEU A 1 228 ? 16.730  56.915 -22.863 1.00 21.61 ? 228 LEU A CA   1 
ATOM   2171 C C    . LEU A 1 228 ? 16.578  55.393 -22.946 1.00 21.59 ? 228 LEU A C    1 
ATOM   2172 O O    . LEU A 1 228 ? 16.925  54.800 -23.950 1.00 21.92 ? 228 LEU A O    1 
ATOM   2173 C CB   . LEU A 1 228 ? 18.213  57.272 -22.991 1.00 18.61 ? 228 LEU A CB   1 
ATOM   2174 C CG   . LEU A 1 228 ? 18.509  58.742 -23.290 1.00 18.64 ? 228 LEU A CG   1 
ATOM   2175 C CD1  . LEU A 1 228 ? 20.010  58.990 -23.356 1.00 16.56 ? 228 LEU A CD1  1 
ATOM   2176 C CD2  . LEU A 1 228 ? 17.851  59.083 -24.603 1.00 22.79 ? 228 LEU A CD2  1 
ATOM   2177 H H    . LEU A 1 228 ? 16.810  57.347 -20.837 1.00 0.00  ? 228 LEU A H    1 
ATOM   2178 N N    . ASP A 1 229 ? 16.166  54.782 -21.840 1.00 21.11 ? 229 ASP A N    1 
ATOM   2179 C CA   . ASP A 1 229 ? 15.960  53.337 -21.741 1.00 21.56 ? 229 ASP A CA   1 
ATOM   2180 C C    . ASP A 1 229 ? 15.155  52.789 -22.945 1.00 22.00 ? 229 ASP A C    1 
ATOM   2181 O O    . ASP A 1 229 ? 14.004  53.195 -23.191 1.00 20.13 ? 229 ASP A O    1 
ATOM   2182 C CB   . ASP A 1 229 ? 15.236  53.043 -20.434 1.00 18.84 ? 229 ASP A CB   1 
ATOM   2183 C CG   . ASP A 1 229 ? 15.056  51.595 -20.196 1.00 21.06 ? 229 ASP A CG   1 
ATOM   2184 O OD1  . ASP A 1 229 ? 14.030  51.060 -20.671 1.00 26.56 ? 229 ASP A OD1  1 
ATOM   2185 O OD2  . ASP A 1 229 ? 15.932  50.973 -19.532 1.00 27.19 ? 229 ASP A OD2  1 
ATOM   2186 H H    . ASP A 1 229 ? 15.968  55.289 -21.029 1.00 0.00  ? 229 ASP A H    1 
ATOM   2187 N N    . ILE A 1 230 ? 15.791  51.887 -23.694 1.00 18.82 ? 230 ILE A N    1 
ATOM   2188 C CA   . ILE A 1 230 ? 15.211  51.274 -24.892 1.00 19.99 ? 230 ILE A CA   1 
ATOM   2189 C C    . ILE A 1 230 ? 13.754  50.837 -24.734 1.00 19.08 ? 230 ILE A C    1 
ATOM   2190 O O    . ILE A 1 230 ? 12.965  50.911 -25.669 1.00 19.14 ? 230 ILE A O    1 
ATOM   2191 C CB   . ILE A 1 230 ? 16.057  50.017 -25.311 1.00 22.07 ? 230 ILE A CB   1 
ATOM   2192 C CG1  . ILE A 1 230 ? 15.831  49.662 -26.766 1.00 24.12 ? 230 ILE A CG1  1 
ATOM   2193 C CG2  . ILE A 1 230 ? 15.616  48.767 -24.563 1.00 18.76 ? 230 ILE A CG2  1 
ATOM   2194 C CD1  . ILE A 1 230 ? 16.687  48.474 -27.181 1.00 23.20 ? 230 ILE A CD1  1 
ATOM   2195 H H    . ILE A 1 230 ? 16.697  51.651 -23.418 1.00 0.00  ? 230 ILE A H    1 
ATOM   2196 N N    . ASP A 1 231 ? 13.447  50.369 -23.533 1.00 18.83 ? 231 ASP A N    1 
ATOM   2197 C CA   . ASP A 1 231 ? 12.163  49.836 -23.165 1.00 18.83 ? 231 ASP A CA   1 
ATOM   2198 C C    . ASP A 1 231 ? 11.186  50.744 -22.524 1.00 19.63 ? 231 ASP A C    1 
ATOM   2199 O O    . ASP A 1 231 ? 10.018  50.720 -22.873 1.00 22.22 ? 231 ASP A O    1 
ATOM   2200 C CB   . ASP A 1 231 ? 12.355  48.725 -22.139 1.00 19.61 ? 231 ASP A CB   1 
ATOM   2201 C CG   . ASP A 1 231 ? 12.380  47.363 -22.739 1.00 21.19 ? 231 ASP A CG   1 
ATOM   2202 O OD1  . ASP A 1 231 ? 11.600  47.095 -23.674 1.00 23.95 ? 231 ASP A OD1  1 
ATOM   2203 O OD2  . ASP A 1 231 ? 13.184  46.551 -22.240 1.00 24.30 ? 231 ASP A OD2  1 
ATOM   2204 H H    . ASP A 1 231 ? 14.108  50.410 -22.817 1.00 0.00  ? 231 ASP A H    1 
ATOM   2205 N N    . HIS A 1 232 ? 11.639  51.419 -21.471 1.00 18.14 ? 232 HIS A N    1 
ATOM   2206 C CA   . HIS A 1 232 ? 10.785  52.269 -20.647 1.00 17.57 ? 232 HIS A CA   1 
ATOM   2207 C C    . HIS A 1 232 ? 10.904  53.779 -20.833 1.00 15.71 ? 232 HIS A C    1 
ATOM   2208 O O    . HIS A 1 232 ? 10.214  54.565 -20.163 1.00 16.45 ? 232 HIS A O    1 
ATOM   2209 C CB   . HIS A 1 232 ? 11.017  51.907 -19.178 1.00 19.50 ? 232 HIS A CB   1 
ATOM   2210 C CG   . HIS A 1 232 ? 10.889  50.438 -18.882 1.00 19.11 ? 232 HIS A CG   1 
ATOM   2211 N ND1  . HIS A 1 232 ? 9.722   49.902 -18.381 1.00 18.06 ? 232 HIS A ND1  1 
ATOM   2212 C CD2  . HIS A 1 232 ? 11.869  49.501 -18.824 1.00 21.54 ? 232 HIS A CD2  1 
ATOM   2213 C CE1  . HIS A 1 232 ? 10.023  48.677 -18.017 1.00 18.62 ? 232 HIS A CE1  1 
ATOM   2214 N NE2  . HIS A 1 232 ? 11.308  48.390 -18.264 1.00 20.52 ? 232 HIS A NE2  1 
ATOM   2215 H H    . HIS A 1 232 ? 12.589  51.306 -21.221 1.00 0.00  ? 232 HIS A H    1 
ATOM   2216 H HE2  . HIS A 1 232 ? 11.738  47.513 -18.162 1.00 0.00  ? 232 HIS A HE2  1 
ATOM   2217 N N    . GLY A 1 233 ? 11.808  54.165 -21.719 1.00 14.71 ? 233 GLY A N    1 
ATOM   2218 C CA   . GLY A 1 233 ? 12.022  55.548 -22.009 1.00 8.36  ? 233 GLY A CA   1 
ATOM   2219 C C    . GLY A 1 233 ? 10.952  56.035 -22.958 1.00 11.92 ? 233 GLY A C    1 
ATOM   2220 O O    . GLY A 1 233 ? 9.956   55.362 -23.265 1.00 5.01  ? 233 GLY A O    1 
ATOM   2221 H H    . GLY A 1 233 ? 12.363  53.527 -22.220 1.00 0.00  ? 233 GLY A H    1 
ATOM   2222 N N    . THR A 1 234 ? 11.182  57.251 -23.427 1.00 15.04 ? 234 THR A N    1 
ATOM   2223 C CA   . THR A 1 234 ? 10.274  57.918 -24.337 1.00 15.99 ? 234 THR A CA   1 
ATOM   2224 C C    . THR A 1 234 ? 10.561  57.389 -25.719 1.00 18.19 ? 234 THR A C    1 
ATOM   2225 O O    . THR A 1 234 ? 11.401  57.935 -26.427 1.00 21.68 ? 234 THR A O    1 
ATOM   2226 C CB   . THR A 1 234 ? 10.472  59.460 -24.247 1.00 16.75 ? 234 THR A CB   1 
ATOM   2227 O OG1  . THR A 1 234 ? 11.829  59.845 -24.611 1.00 11.33 ? 234 THR A OG1  1 
ATOM   2228 C CG2  . THR A 1 234 ? 10.170  59.893 -22.822 1.00 11.48 ? 234 THR A CG2  1 
ATOM   2229 H H    . THR A 1 234 ? 12.017  57.703 -23.172 1.00 0.00  ? 234 THR A H    1 
ATOM   2230 H HG1  . THR A 1 234 ? 12.112  59.309 -25.385 1.00 0.00  ? 234 THR A HG1  1 
ATOM   2231 N N    . TYR A 1 235 ? 9.985   56.231 -26.024 1.00 18.58 ? 235 TYR A N    1 
ATOM   2232 C CA   . TYR A 1 235 ? 10.138  55.600 -27.329 1.00 19.33 ? 235 TYR A CA   1 
ATOM   2233 C C    . TYR A 1 235 ? 9.310   56.491 -28.260 1.00 21.00 ? 235 TYR A C    1 
ATOM   2234 O O    . TYR A 1 235 ? 8.292   57.054 -27.827 1.00 22.85 ? 235 TYR A O    1 
ATOM   2235 C CB   . TYR A 1 235 ? 9.487   54.217 -27.273 1.00 18.62 ? 235 TYR A CB   1 
ATOM   2236 C CG   . TYR A 1 235 ? 9.661   53.373 -28.514 1.00 17.64 ? 235 TYR A CG   1 
ATOM   2237 C CD1  . TYR A 1 235 ? 10.889  52.746 -28.783 1.00 19.01 ? 235 TYR A CD1  1 
ATOM   2238 C CD2  . TYR A 1 235 ? 8.586   53.084 -29.343 1.00 18.58 ? 235 TYR A CD2  1 
ATOM   2239 C CE1  . TYR A 1 235 ? 11.036  51.858 -29.815 1.00 17.08 ? 235 TYR A CE1  1 
ATOM   2240 C CE2  . TYR A 1 235 ? 8.731   52.171 -30.386 1.00 19.77 ? 235 TYR A CE2  1 
ATOM   2241 C CZ   . TYR A 1 235 ? 9.953   51.567 -30.598 1.00 19.24 ? 235 TYR A CZ   1 
ATOM   2242 O OH   . TYR A 1 235 ? 10.082  50.582 -31.540 1.00 24.66 ? 235 TYR A OH   1 
ATOM   2243 H H    . TYR A 1 235 ? 9.457   55.794 -25.319 1.00 0.00  ? 235 TYR A H    1 
ATOM   2244 H HH   . TYR A 1 235 ? 9.234   50.441 -31.976 1.00 0.00  ? 235 TYR A HH   1 
ATOM   2245 N N    . PRO A 1 236 ? 9.674   56.583 -29.555 1.00 22.00 ? 236 PRO A N    1 
ATOM   2246 C CA   . PRO A 1 236 ? 10.782  55.995 -30.320 1.00 22.36 ? 236 PRO A CA   1 
ATOM   2247 C C    . PRO A 1 236 ? 12.144  56.608 -30.085 1.00 24.06 ? 236 PRO A C    1 
ATOM   2248 O O    . PRO A 1 236 ? 13.148  55.948 -30.327 1.00 24.73 ? 236 PRO A O    1 
ATOM   2249 C CB   . PRO A 1 236 ? 10.366  56.269 -31.758 1.00 20.67 ? 236 PRO A CB   1 
ATOM   2250 C CG   . PRO A 1 236 ? 9.630   57.578 -31.650 1.00 18.99 ? 236 PRO A CG   1 
ATOM   2251 C CD   . PRO A 1 236 ? 8.753   57.291 -30.465 1.00 23.68 ? 236 PRO A CD   1 
ATOM   2252 N N    . TYR A 1 237 ? 12.164  57.878 -29.666 1.00 25.22 ? 237 TYR A N    1 
ATOM   2253 C CA   . TYR A 1 237 ? 13.401  58.642 -29.436 1.00 29.18 ? 237 TYR A CA   1 
ATOM   2254 C C    . TYR A 1 237 ? 14.013  58.084 -28.193 1.00 29.75 ? 237 TYR A C    1 
ATOM   2255 O O    . TYR A 1 237 ? 13.787  58.616 -27.105 1.00 32.98 ? 237 TYR A O    1 
ATOM   2256 C CB   . TYR A 1 237 ? 13.073  60.143 -29.253 1.00 30.07 ? 237 TYR A CB   1 
ATOM   2257 C CG   . TYR A 1 237 ? 12.201  60.718 -30.363 1.00 31.26 ? 237 TYR A CG   1 
ATOM   2258 C CD1  . TYR A 1 237 ? 12.760  61.155 -31.568 1.00 30.66 ? 237 TYR A CD1  1 
ATOM   2259 C CD2  . TYR A 1 237 ? 10.816  60.776 -30.227 1.00 30.40 ? 237 TYR A CD2  1 
ATOM   2260 C CE1  . TYR A 1 237 ? 11.956  61.628 -32.615 1.00 31.16 ? 237 TYR A CE1  1 
ATOM   2261 C CE2  . TYR A 1 237 ? 10.001  61.259 -31.278 1.00 31.20 ? 237 TYR A CE2  1 
ATOM   2262 C CZ   . TYR A 1 237 ? 10.585  61.676 -32.461 1.00 30.83 ? 237 TYR A CZ   1 
ATOM   2263 O OH   . TYR A 1 237 ? 9.798   62.116 -33.498 1.00 30.88 ? 237 TYR A OH   1 
ATOM   2264 H H    . TYR A 1 237 ? 11.320  58.320 -29.457 1.00 0.00  ? 237 TYR A H    1 
ATOM   2265 H HH   . TYR A 1 237 ? 8.873   62.070 -33.250 1.00 0.00  ? 237 TYR A HH   1 
ATOM   2266 N N    . VAL A 1 238 ? 14.852  57.063 -28.365 1.00 30.69 ? 238 VAL A N    1 
ATOM   2267 C CA   . VAL A 1 238 ? 15.452  56.349 -27.245 1.00 30.96 ? 238 VAL A CA   1 
ATOM   2268 C C    . VAL A 1 238 ? 16.812  55.751 -27.636 1.00 31.70 ? 238 VAL A C    1 
ATOM   2269 O O    . VAL A 1 238 ? 17.063  55.518 -28.814 1.00 35.60 ? 238 VAL A O    1 
ATOM   2270 C CB   . VAL A 1 238 ? 14.448  55.246 -26.826 1.00 32.07 ? 238 VAL A CB   1 
ATOM   2271 C CG1  . VAL A 1 238 ? 14.261  54.201 -27.950 1.00 31.40 ? 238 VAL A CG1  1 
ATOM   2272 C CG2  . VAL A 1 238 ? 14.854  54.604 -25.583 1.00 32.81 ? 238 VAL A CG2  1 
ATOM   2273 H H    . VAL A 1 238 ? 15.063  56.757 -29.276 1.00 0.00  ? 238 VAL A H    1 
ATOM   2274 N N    . THR A 1 239 ? 17.644  55.418 -26.648 1.00 31.60 ? 239 THR A N    1 
ATOM   2275 C CA   . THR A 1 239 ? 19.005  54.897 -26.886 1.00 29.37 ? 239 THR A CA   1 
ATOM   2276 C C    . THR A 1 239 ? 19.125  53.432 -27.283 1.00 28.46 ? 239 THR A C    1 
ATOM   2277 O O    . THR A 1 239 ? 18.180  52.643 -27.185 1.00 27.84 ? 239 THR A O    1 
ATOM   2278 C CB   . THR A 1 239 ? 19.976  55.167 -25.629 1.00 29.64 ? 239 THR A CB   1 
ATOM   2279 O OG1  . THR A 1 239 ? 21.288  55.556 -26.068 1.00 28.19 ? 239 THR A OG1  1 
ATOM   2280 C CG2  . THR A 1 239 ? 20.148  53.939 -24.772 1.00 27.52 ? 239 THR A CG2  1 
ATOM   2281 H H    . THR A 1 239 ? 17.330  55.412 -25.714 1.00 0.00  ? 239 THR A H    1 
ATOM   2282 H HG1  . THR A 1 239 ? 21.216  56.399 -26.532 1.00 0.00  ? 239 THR A HG1  1 
ATOM   2283 N N    . SER A 1 240 ? 20.361  53.062 -27.598 1.00 28.57 ? 240 SER A N    1 
ATOM   2284 C CA   . SER A 1 240 ? 20.695  51.701 -28.008 1.00 27.04 ? 240 SER A CA   1 
ATOM   2285 C C    . SER A 1 240 ? 20.366  50.604 -26.978 1.00 25.99 ? 240 SER A C    1 
ATOM   2286 O O    . SER A 1 240 ? 20.149  49.475 -27.391 1.00 27.55 ? 240 SER A O    1 
ATOM   2287 C CB   . SER A 1 240 ? 22.190  51.608 -28.401 1.00 24.91 ? 240 SER A CB   1 
ATOM   2288 O OG   . SER A 1 240 ? 22.649  52.746 -29.113 1.00 15.82 ? 240 SER A OG   1 
ATOM   2289 H H    . SER A 1 240 ? 21.087  53.715 -27.527 1.00 0.00  ? 240 SER A H    1 
ATOM   2290 H HG   . SER A 1 240 ? 22.241  52.679 -29.987 1.00 0.00  ? 240 SER A HG   1 
ATOM   2291 N N    . SER A 1 241 ? 20.339  50.908 -25.671 1.00 25.51 ? 241 SER A N    1 
ATOM   2292 C CA   . SER A 1 241 ? 20.051  49.875 -24.654 1.00 24.53 ? 241 SER A CA   1 
ATOM   2293 C C    . SER A 1 241 ? 19.505  50.258 -23.246 1.00 23.58 ? 241 SER A C    1 
ATOM   2294 O O    . SER A 1 241 ? 19.684  51.381 -22.768 1.00 22.23 ? 241 SER A O    1 
ATOM   2295 C CB   . SER A 1 241 ? 21.303  49.038 -24.442 1.00 24.29 ? 241 SER A CB   1 
ATOM   2296 O OG   . SER A 1 241 ? 22.364  49.859 -23.988 1.00 23.58 ? 241 SER A OG   1 
ATOM   2297 H H    . SER A 1 241 ? 20.541  51.791 -25.345 1.00 0.00  ? 241 SER A H    1 
ATOM   2298 H HG   . SER A 1 241 ? 23.083  49.218 -23.925 1.00 0.00  ? 241 SER A HG   1 
ATOM   2299 N N    . ASN A 1 242 ? 18.937  49.269 -22.546 1.00 23.15 ? 242 ASN A N    1 
ATOM   2300 C CA   . ASN A 1 242 ? 18.396  49.477 -21.199 1.00 21.91 ? 242 ASN A CA   1 
ATOM   2301 C C    . ASN A 1 242 ? 19.336  50.355 -20.346 1.00 21.03 ? 242 ASN A C    1 
ATOM   2302 O O    . ASN A 1 242 ? 20.542  50.055 -20.192 1.00 16.72 ? 242 ASN A O    1 
ATOM   2303 C CB   . ASN A 1 242 ? 18.132  48.134 -20.518 1.00 21.72 ? 242 ASN A CB   1 
ATOM   2304 C CG   . ASN A 1 242 ? 16.944  47.385 -21.135 1.00 22.11 ? 242 ASN A CG   1 
ATOM   2305 O OD1  . ASN A 1 242 ? 17.099  46.334 -21.764 1.00 25.13 ? 242 ASN A OD1  1 
ATOM   2306 N ND2  . ASN A 1 242 ? 15.763  47.926 -20.960 1.00 20.35 ? 242 ASN A ND2  1 
ATOM   2307 H H    . ASN A 1 242 ? 18.956  48.362 -22.921 1.00 0.00  ? 242 ASN A H    1 
ATOM   2308 H HD21 . ASN A 1 242 ? 14.980  47.451 -21.330 1.00 0.00  ? 242 ASN A HD21 1 
ATOM   2309 H HD22 . ASN A 1 242 ? 15.685  48.765 -20.450 1.00 0.00  ? 242 ASN A HD22 1 
ATOM   2310 N N    . THR A 1 243 ? 18.788  51.436 -19.794 1.00 19.76 ? 243 THR A N    1 
ATOM   2311 C CA   . THR A 1 243 ? 19.599  52.357 -19.011 1.00 17.71 ? 243 THR A CA   1 
ATOM   2312 C C    . THR A 1 243 ? 19.262  52.394 -17.559 1.00 19.06 ? 243 THR A C    1 
ATOM   2313 O O    . THR A 1 243 ? 19.980  53.036 -16.804 1.00 21.28 ? 243 THR A O    1 
ATOM   2314 C CB   . THR A 1 243 ? 19.498  53.840 -19.519 1.00 17.19 ? 243 THR A CB   1 
ATOM   2315 O OG1  . THR A 1 243 ? 18.117  54.219 -19.645 1.00 14.01 ? 243 THR A OG1  1 
ATOM   2316 C CG2  . THR A 1 243 ? 20.250  54.051 -20.861 1.00 15.06 ? 243 THR A CG2  1 
ATOM   2317 H H    . THR A 1 243 ? 17.830  51.635 -19.889 1.00 0.00  ? 243 THR A H    1 
ATOM   2318 H HG1  . THR A 1 243 ? 18.121  55.147 -19.910 1.00 0.00  ? 243 THR A HG1  1 
ATOM   2319 N N    . THR A 1 244 ? 18.164  51.764 -17.162 1.00 18.99 ? 244 THR A N    1 
ATOM   2320 C CA   . THR A 1 244 ? 17.734  51.761 -15.757 1.00 16.38 ? 244 THR A CA   1 
ATOM   2321 C C    . THR A 1 244 ? 18.584  50.850 -14.871 1.00 14.38 ? 244 THR A C    1 
ATOM   2322 O O    . THR A 1 244 ? 19.511  50.206 -15.364 1.00 17.58 ? 244 THR A O    1 
ATOM   2323 C CB   . THR A 1 244 ? 16.251  51.346 -15.654 1.00 15.62 ? 244 THR A CB   1 
ATOM   2324 O OG1  . THR A 1 244 ? 16.123  49.937 -15.942 1.00 16.18 ? 244 THR A OG1  1 
ATOM   2325 C CG2  . THR A 1 244 ? 15.394  52.163 -16.672 1.00 11.07 ? 244 THR A CG2  1 
ATOM   2326 H H    . THR A 1 244 ? 17.608  51.298 -17.822 1.00 0.00  ? 244 THR A H    1 
ATOM   2327 H HG1  . THR A 1 244 ? 15.184  49.726 -16.039 1.00 0.00  ? 244 THR A HG1  1 
ATOM   2328 N N    . ALA A 1 245 ? 18.286  50.812 -13.568 1.00 13.30 ? 245 ALA A N    1 
ATOM   2329 C CA   . ALA A 1 245 ? 18.997  49.970 -12.583 1.00 11.96 ? 245 ALA A CA   1 
ATOM   2330 C C    . ALA A 1 245 ? 18.667  48.471 -12.690 1.00 12.18 ? 245 ALA A C    1 
ATOM   2331 O O    . ALA A 1 245 ? 19.394  47.618 -12.166 1.00 12.43 ? 245 ALA A O    1 
ATOM   2332 C CB   . ALA A 1 245 ? 18.704  50.430 -11.172 1.00 12.16 ? 245 ALA A CB   1 
ATOM   2333 H H    . ALA A 1 245 ? 17.614  51.471 -13.262 1.00 0.00  ? 245 ALA A H    1 
ATOM   2334 N N    . GLY A 1 246 ? 17.585  48.141 -13.385 1.00 14.33 ? 246 GLY A N    1 
ATOM   2335 C CA   . GLY A 1 246 ? 17.232  46.742 -13.523 1.00 16.74 ? 246 GLY A CA   1 
ATOM   2336 C C    . GLY A 1 246 ? 18.225  45.927 -14.346 1.00 16.88 ? 246 GLY A C    1 
ATOM   2337 O O    . GLY A 1 246 ? 18.085  44.709 -14.430 1.00 18.93 ? 246 GLY A O    1 
ATOM   2338 H H    . GLY A 1 246 ? 17.060  48.817 -13.863 1.00 0.00  ? 246 GLY A H    1 
ATOM   2339 N N    . GLY A 1 247 ? 19.181  46.594 -14.988 1.00 14.81 ? 247 GLY A N    1 
ATOM   2340 C CA   . GLY A 1 247 ? 20.154  45.906 -15.801 1.00 14.82 ? 247 GLY A CA   1 
ATOM   2341 C C    . GLY A 1 247 ? 21.456  45.728 -15.055 1.00 15.94 ? 247 GLY A C    1 
ATOM   2342 O O    . GLY A 1 247 ? 22.482  45.401 -15.664 1.00 15.44 ? 247 GLY A O    1 
ATOM   2343 H H    . GLY A 1 247 ? 19.240  47.568 -14.940 1.00 0.00  ? 247 GLY A H    1 
ATOM   2344 N N    . VAL A 1 248 ? 21.442  45.990 -13.751 1.00 14.80 ? 248 VAL A N    1 
ATOM   2345 C CA   . VAL A 1 248 ? 22.652  45.813 -12.928 1.00 13.61 ? 248 VAL A CA   1 
ATOM   2346 C C    . VAL A 1 248 ? 22.861  44.278 -12.764 1.00 12.32 ? 248 VAL A C    1 
ATOM   2347 O O    . VAL A 1 248 ? 23.956  43.742 -13.021 1.00 10.45 ? 248 VAL A O    1 
ATOM   2348 C CB   . VAL A 1 248 ? 22.514  46.482 -11.495 1.00 13.72 ? 248 VAL A CB   1 
ATOM   2349 C CG1  . VAL A 1 248 ? 23.729  46.229 -10.652 1.00 12.94 ? 248 VAL A CG1  1 
ATOM   2350 C CG2  . VAL A 1 248 ? 22.326  47.936 -11.630 1.00 13.36 ? 248 VAL A CG2  1 
ATOM   2351 H H    . VAL A 1 248 ? 20.628  46.321 -13.304 1.00 0.00  ? 248 VAL A H    1 
ATOM   2352 N N    . ALA A 1 249 ? 21.781  43.598 -12.394 1.00 11.75 ? 249 ALA A N    1 
ATOM   2353 C CA   . ALA A 1 249 ? 21.774  42.163 -12.190 1.00 14.81 ? 249 ALA A CA   1 
ATOM   2354 C C    . ALA A 1 249 ? 22.085  41.469 -13.516 1.00 15.18 ? 249 ALA A C    1 
ATOM   2355 O O    . ALA A 1 249 ? 23.066  40.764 -13.645 1.00 15.55 ? 249 ALA A O    1 
ATOM   2356 C CB   . ALA A 1 249 ? 20.436  41.725 -11.652 1.00 12.51 ? 249 ALA A CB   1 
ATOM   2357 H H    . ALA A 1 249 ? 20.954  44.099 -12.214 1.00 0.00  ? 249 ALA A H    1 
ATOM   2358 N N    . THR A 1 250 ? 21.259  41.724 -14.512 1.00 18.98 ? 250 THR A N    1 
ATOM   2359 C CA   . THR A 1 250 ? 21.433  41.142 -15.840 1.00 21.23 ? 250 THR A CA   1 
ATOM   2360 C C    . THR A 1 250 ? 22.840  41.399 -16.395 1.00 19.18 ? 250 THR A C    1 
ATOM   2361 O O    . THR A 1 250 ? 23.582  40.457 -16.747 1.00 18.23 ? 250 THR A O    1 
ATOM   2362 C CB   . THR A 1 250 ? 20.351  41.740 -16.761 1.00 21.94 ? 250 THR A CB   1 
ATOM   2363 O OG1  . THR A 1 250 ? 19.117  41.048 -16.515 1.00 26.06 ? 250 THR A OG1  1 
ATOM   2364 C CG2  . THR A 1 250 ? 20.745  41.700 -18.231 1.00 22.32 ? 250 THR A CG2  1 
ATOM   2365 H H    . THR A 1 250 ? 20.469  42.279 -14.351 1.00 0.00  ? 250 THR A H    1 
ATOM   2366 H HG1  . THR A 1 250 ? 18.430  41.513 -17.004 1.00 0.00  ? 250 THR A HG1  1 
ATOM   2367 N N    . GLY A 1 251 ? 23.225  42.673 -16.386 1.00 17.70 ? 251 GLY A N    1 
ATOM   2368 C CA   . GLY A 1 251 ? 24.516  43.069 -16.894 1.00 19.04 ? 251 GLY A CA   1 
ATOM   2369 C C    . GLY A 1 251 ? 25.749  42.648 -16.122 1.00 16.34 ? 251 GLY A C    1 
ATOM   2370 O O    . GLY A 1 251 ? 26.817  42.591 -16.726 1.00 16.93 ? 251 GLY A O    1 
ATOM   2371 H H    . GLY A 1 251 ? 22.653  43.398 -16.056 1.00 0.00  ? 251 GLY A H    1 
ATOM   2372 N N    . SER A 1 252 ? 25.627  42.369 -14.832 1.00 15.33 ? 252 SER A N    1 
ATOM   2373 C CA   . SER A 1 252 ? 26.790  41.939 -14.016 1.00 12.97 ? 252 SER A CA   1 
ATOM   2374 C C    . SER A 1 252 ? 26.791  40.507 -13.502 1.00 11.92 ? 252 SER A C    1 
ATOM   2375 O O    . SER A 1 252 ? 27.887  39.950 -13.309 1.00 15.29 ? 252 SER A O    1 
ATOM   2376 C CB   . SER A 1 252 ? 27.018  42.856 -12.794 1.00 12.28 ? 252 SER A CB   1 
ATOM   2377 O OG   . SER A 1 252 ? 25.861  42.942 -11.974 1.00 15.31 ? 252 SER A OG   1 
ATOM   2378 H H    . SER A 1 252 ? 24.769  42.476 -14.375 1.00 0.00  ? 252 SER A H    1 
ATOM   2379 H HG   . SER A 1 252 ? 25.099  43.333 -12.473 1.00 0.00  ? 252 SER A HG   1 
ATOM   2380 N N    . GLY A 1 253 ? 25.600  39.927 -13.270 1.00 7.90  ? 253 GLY A N    1 
ATOM   2381 C CA   . GLY A 1 253 ? 25.462  38.580 -12.742 1.00 8.97  ? 253 GLY A CA   1 
ATOM   2382 C C    . GLY A 1 253 ? 25.180  38.568 -11.237 1.00 12.67 ? 253 GLY A C    1 
ATOM   2383 O O    . GLY A 1 253 ? 25.157  37.533 -10.584 1.00 13.95 ? 253 GLY A O    1 
ATOM   2384 H H    . GLY A 1 253 ? 24.754  40.401 -13.451 1.00 0.00  ? 253 GLY A H    1 
ATOM   2385 N N    . LEU A 1 254 ? 24.913  39.730 -10.662 1.00 14.37 ? 254 LEU A N    1 
ATOM   2386 C CA   . LEU A 1 254 ? 24.673  39.851 -9.227  1.00 12.90 ? 254 LEU A CA   1 
ATOM   2387 C C    . LEU A 1 254 ? 23.177  39.787 -8.999  1.00 13.48 ? 254 LEU A C    1 
ATOM   2388 O O    . LEU A 1 254 ? 22.407  40.420 -9.714  1.00 17.46 ? 254 LEU A O    1 
ATOM   2389 C CB   . LEU A 1 254 ? 25.240  41.178 -8.771  1.00 12.12 ? 254 LEU A CB   1 
ATOM   2390 C CG   . LEU A 1 254 ? 25.063  41.638 -7.341  1.00 14.09 ? 254 LEU A CG   1 
ATOM   2391 C CD1  . LEU A 1 254 ? 26.014  40.903 -6.413  1.00 15.38 ? 254 LEU A CD1  1 
ATOM   2392 C CD2  . LEU A 1 254 ? 25.366  43.127 -7.313  1.00 18.61 ? 254 LEU A CD2  1 
ATOM   2393 H H    . LEU A 1 254 ? 24.874  40.545 -11.200 1.00 0.00  ? 254 LEU A H    1 
ATOM   2394 N N    . GLY A 1 255 ? 22.748  39.001 -8.025  1.00 10.16 ? 255 GLY A N    1 
ATOM   2395 C CA   . GLY A 1 255 ? 21.322  38.870 -7.776  1.00 8.41  ? 255 GLY A CA   1 
ATOM   2396 C C    . GLY A 1 255 ? 20.555  40.131 -7.398  1.00 7.87  ? 255 GLY A C    1 
ATOM   2397 O O    . GLY A 1 255 ? 20.967  40.898 -6.499  1.00 8.22  ? 255 GLY A O    1 
ATOM   2398 H H    . GLY A 1 255 ? 23.395  38.524 -7.460  1.00 0.00  ? 255 GLY A H    1 
ATOM   2399 N N    . PRO A 1 256 ? 19.363  40.294 -7.964  1.00 6.51  ? 256 PRO A N    1 
ATOM   2400 C CA   . PRO A 1 256 ? 18.559  41.497 -7.656  1.00 7.25  ? 256 PRO A CA   1 
ATOM   2401 C C    . PRO A 1 256 ? 18.471  42.024 -6.232  1.00 7.80  ? 256 PRO A C    1 
ATOM   2402 O O    . PRO A 1 256 ? 18.633  43.235 -6.031  1.00 10.09 ? 256 PRO A O    1 
ATOM   2403 C CB   . PRO A 1 256 ? 17.186  41.203 -8.297  1.00 5.01  ? 256 PRO A CB   1 
ATOM   2404 C CG   . PRO A 1 256 ? 17.171  39.692 -8.523  1.00 5.01  ? 256 PRO A CG   1 
ATOM   2405 C CD   . PRO A 1 256 ? 18.645  39.397 -8.885  1.00 5.01  ? 256 PRO A CD   1 
ATOM   2406 N N    . ARG A 1 257 ? 18.286  41.161 -5.242  1.00 6.89  ? 257 ARG A N    1 
ATOM   2407 C CA   . ARG A 1 257 ? 18.179  41.610 -3.845  1.00 8.33  ? 257 ARG A CA   1 
ATOM   2408 C C    . ARG A 1 257 ? 19.443  42.171 -3.169  1.00 8.17  ? 257 ARG A C    1 
ATOM   2409 O O    . ARG A 1 257 ? 19.398  42.652 -2.028  1.00 6.92  ? 257 ARG A O    1 
ATOM   2410 C CB   . ARG A 1 257 ? 17.614  40.516 -2.960  1.00 6.25  ? 257 ARG A CB   1 
ATOM   2411 C CG   . ARG A 1 257 ? 16.389  39.791 -3.510  1.00 10.99 ? 257 ARG A CG   1 
ATOM   2412 C CD   . ARG A 1 257 ? 15.838  38.796 -2.505  1.00 14.12 ? 257 ARG A CD   1 
ATOM   2413 N NE   . ARG A 1 257 ? 16.783  37.697 -2.281  1.00 18.51 ? 257 ARG A NE   1 
ATOM   2414 C CZ   . ARG A 1 257 ? 17.277  37.339 -1.100  1.00 19.47 ? 257 ARG A CZ   1 
ATOM   2415 N NH1  . ARG A 1 257 ? 16.928  37.978 0.014   1.00 22.12 ? 257 ARG A NH1  1 
ATOM   2416 N NH2  . ARG A 1 257 ? 18.137  36.341 -1.043  1.00 21.87 ? 257 ARG A NH2  1 
ATOM   2417 H H    . ARG A 1 257 ? 18.248  40.200 -5.428  1.00 0.00  ? 257 ARG A H    1 
ATOM   2418 H HE   . ARG A 1 257 ? 17.035  37.143 -3.062  1.00 0.00  ? 257 ARG A HE   1 
ATOM   2419 H HH11 . ARG A 1 257 ? 16.301  38.760 -0.037  1.00 0.00  ? 257 ARG A HH11 1 
ATOM   2420 H HH12 . ARG A 1 257 ? 17.286  37.738 0.920   1.00 0.00  ? 257 ARG A HH12 1 
ATOM   2421 H HH21 . ARG A 1 257 ? 18.369  35.866 -1.893  1.00 0.00  ? 257 ARG A HH21 1 
ATOM   2422 H HH22 . ARG A 1 257 ? 18.539  36.026 -0.183  1.00 0.00  ? 257 ARG A HH22 1 
ATOM   2423 N N    . TYR A 1 258 ? 20.581  42.127 -3.850  1.00 12.78 ? 258 TYR A N    1 
ATOM   2424 C CA   . TYR A 1 258 ? 21.815  42.656 -3.242  1.00 11.11 ? 258 TYR A CA   1 
ATOM   2425 C C    . TYR A 1 258 ? 22.104  44.111 -3.679  1.00 11.33 ? 258 TYR A C    1 
ATOM   2426 O O    . TYR A 1 258 ? 23.190  44.620 -3.397  1.00 12.32 ? 258 TYR A O    1 
ATOM   2427 C CB   . TYR A 1 258 ? 23.024  41.783 -3.568  1.00 12.66 ? 258 TYR A CB   1 
ATOM   2428 C CG   . TYR A 1 258 ? 22.862  40.321 -3.252  1.00 13.52 ? 258 TYR A CG   1 
ATOM   2429 C CD1  . TYR A 1 258 ? 22.246  39.905 -2.085  1.00 17.75 ? 258 TYR A CD1  1 
ATOM   2430 C CD2  . TYR A 1 258 ? 23.315  39.342 -4.142  1.00 14.09 ? 258 TYR A CD2  1 
ATOM   2431 C CE1  . TYR A 1 258 ? 22.086  38.560 -1.810  1.00 14.98 ? 258 TYR A CE1  1 
ATOM   2432 C CE2  . TYR A 1 258 ? 23.154  38.000 -3.870  1.00 11.06 ? 258 TYR A CE2  1 
ATOM   2433 C CZ   . TYR A 1 258 ? 22.547  37.615 -2.709  1.00 12.58 ? 258 TYR A CZ   1 
ATOM   2434 O OH   . TYR A 1 258 ? 22.415  36.275 -2.407  1.00 14.55 ? 258 TYR A OH   1 
ATOM   2435 H H    . TYR A 1 258 ? 20.633  41.751 -4.760  1.00 0.00  ? 258 TYR A H    1 
ATOM   2436 H HH   . TYR A 1 258 ? 21.907  36.120 -1.603  1.00 0.00  ? 258 TYR A HH   1 
ATOM   2437 N N    . VAL A 1 259 ? 21.239  44.719 -4.494  1.00 11.38 ? 259 VAL A N    1 
ATOM   2438 C CA   . VAL A 1 259 ? 21.466  46.130 -4.824  1.00 14.95 ? 259 VAL A CA   1 
ATOM   2439 C C    . VAL A 1 259 ? 21.057  46.897 -3.541  1.00 15.50 ? 259 VAL A C    1 
ATOM   2440 O O    . VAL A 1 259 ? 19.877  46.890 -3.144  1.00 14.97 ? 259 VAL A O    1 
ATOM   2441 C CB   . VAL A 1 259 ? 20.610  46.635 -5.993  1.00 15.30 ? 259 VAL A CB   1 
ATOM   2442 C CG1  . VAL A 1 259 ? 21.153  47.999 -6.455  1.00 12.19 ? 259 VAL A CG1  1 
ATOM   2443 C CG2  . VAL A 1 259 ? 20.677  45.664 -7.170  1.00 14.71 ? 259 VAL A CG2  1 
ATOM   2444 H H    . VAL A 1 259 ? 20.451  44.248 -4.843  1.00 0.00  ? 259 VAL A H    1 
ATOM   2445 N N    . ASP A 1 260 ? 22.022  47.555 -2.892  1.00 17.02 ? 260 ASP A N    1 
ATOM   2446 C CA   . ASP A 1 260 ? 21.737  48.289 -1.654  1.00 15.75 ? 260 ASP A CA   1 
ATOM   2447 C C    . ASP A 1 260 ? 21.295  49.766 -1.780  1.00 13.94 ? 260 ASP A C    1 
ATOM   2448 O O    . ASP A 1 260 ? 20.426  50.234 -1.023  1.00 14.62 ? 260 ASP A O    1 
ATOM   2449 C CB   . ASP A 1 260 ? 22.955  48.276 -0.721  1.00 13.50 ? 260 ASP A CB   1 
ATOM   2450 C CG   . ASP A 1 260 ? 23.535  46.885 -0.508  1.00 13.77 ? 260 ASP A CG   1 
ATOM   2451 O OD1  . ASP A 1 260 ? 22.844  46.065 0.135   1.00 16.14 ? 260 ASP A OD1  1 
ATOM   2452 O OD2  . ASP A 1 260 ? 24.688  46.634 -0.947  1.00 15.30 ? 260 ASP A OD2  1 
ATOM   2453 H H    . ASP A 1 260 ? 22.942  47.555 -3.228  1.00 0.00  ? 260 ASP A H    1 
ATOM   2454 N N    . TYR A 1 261 ? 21.873  50.491 -2.726  1.00 10.93 ? 261 TYR A N    1 
ATOM   2455 C CA   . TYR A 1 261 ? 21.606  51.919 -2.792  1.00 10.66 ? 261 TYR A CA   1 
ATOM   2456 C C    . TYR A 1 261 ? 21.776  52.395 -4.203  1.00 11.52 ? 261 TYR A C    1 
ATOM   2457 O O    . TYR A 1 261 ? 22.839  52.179 -4.793  1.00 13.95 ? 261 TYR A O    1 
ATOM   2458 C CB   . TYR A 1 261 ? 22.618  52.634 -1.847  1.00 10.29 ? 261 TYR A CB   1 
ATOM   2459 C CG   . TYR A 1 261 ? 22.372  54.115 -1.656  1.00 9.06  ? 261 TYR A CG   1 
ATOM   2460 C CD1  . TYR A 1 261 ? 22.621  55.021 -2.703  1.00 9.07  ? 261 TYR A CD1  1 
ATOM   2461 C CD2  . TYR A 1 261 ? 21.794  54.591 -0.488  1.00 6.40  ? 261 TYR A CD2  1 
ATOM   2462 C CE1  . TYR A 1 261 ? 22.280  56.356 -2.591  1.00 10.03 ? 261 TYR A CE1  1 
ATOM   2463 C CE2  . TYR A 1 261 ? 21.439  55.945 -0.363  1.00 9.75  ? 261 TYR A CE2  1 
ATOM   2464 C CZ   . TYR A 1 261 ? 21.674  56.822 -1.417  1.00 11.28 ? 261 TYR A CZ   1 
ATOM   2465 O OH   . TYR A 1 261 ? 21.271  58.130 -1.369  1.00 9.51  ? 261 TYR A OH   1 
ATOM   2466 H H    . TYR A 1 261 ? 22.541  50.085 -3.319  1.00 0.00  ? 261 TYR A H    1 
ATOM   2467 H HH   . TYR A 1 261 ? 20.906  58.511 -0.549  1.00 0.00  ? 261 TYR A HH   1 
ATOM   2468 N N    . VAL A 1 262 ? 20.726  53.019 -4.740  1.00 11.58 ? 262 VAL A N    1 
ATOM   2469 C CA   . VAL A 1 262 ? 20.681  53.544 -6.126  1.00 9.08  ? 262 VAL A CA   1 
ATOM   2470 C C    . VAL A 1 262 ? 20.734  55.095 -6.063  1.00 10.15 ? 262 VAL A C    1 
ATOM   2471 O O    . VAL A 1 262 ? 19.761  55.728 -5.609  1.00 10.11 ? 262 VAL A O    1 
ATOM   2472 C CB   . VAL A 1 262 ? 19.350  53.114 -6.827  1.00 9.67  ? 262 VAL A CB   1 
ATOM   2473 C CG1  . VAL A 1 262 ? 19.242  53.746 -8.158  1.00 9.14  ? 262 VAL A CG1  1 
ATOM   2474 C CG2  . VAL A 1 262 ? 19.244  51.582 -6.956  1.00 9.32  ? 262 VAL A CG2  1 
ATOM   2475 H H    . VAL A 1 262 ? 19.932  53.146 -4.184  1.00 0.00  ? 262 VAL A H    1 
ATOM   2476 N N    . LEU A 1 263 ? 21.870  55.690 -6.461  1.00 11.27 ? 263 LEU A N    1 
ATOM   2477 C CA   . LEU A 1 263 ? 22.047  57.151 -6.409  1.00 13.78 ? 263 LEU A CA   1 
ATOM   2478 C C    . LEU A 1 263 ? 21.557  57.723 -7.724  1.00 15.62 ? 263 LEU A C    1 
ATOM   2479 O O    . LEU A 1 263 ? 22.148  57.460 -8.764  1.00 19.24 ? 263 LEU A O    1 
ATOM   2480 C CB   . LEU A 1 263 ? 23.537  57.553 -6.192  1.00 11.42 ? 263 LEU A CB   1 
ATOM   2481 C CG   . LEU A 1 263 ? 23.826  59.078 -6.110  1.00 8.96  ? 263 LEU A CG   1 
ATOM   2482 C CD1  . LEU A 1 263 ? 23.415  59.636 -4.791  1.00 11.03 ? 263 LEU A CD1  1 
ATOM   2483 C CD2  . LEU A 1 263 ? 25.273  59.423 -6.361  1.00 14.02 ? 263 LEU A CD2  1 
ATOM   2484 H H    . LEU A 1 263 ? 22.553  55.137 -6.909  1.00 0.00  ? 263 LEU A H    1 
ATOM   2485 N N    . GLY A 1 264 ? 20.508  58.531 -7.701  1.00 15.88 ? 264 GLY A N    1 
ATOM   2486 C CA   . GLY A 1 264 ? 20.026  59.070 -8.969  1.00 16.79 ? 264 GLY A CA   1 
ATOM   2487 C C    . GLY A 1 264 ? 20.535  60.466 -9.236  1.00 17.23 ? 264 GLY A C    1 
ATOM   2488 O O    . GLY A 1 264 ? 20.082  61.396 -8.587  1.00 19.54 ? 264 GLY A O    1 
ATOM   2489 H H    . GLY A 1 264 ? 20.107  58.791 -6.839  1.00 0.00  ? 264 GLY A H    1 
ATOM   2490 N N    . ILE A 1 265 ? 21.492  60.615 -10.143 1.00 16.66 ? 265 ILE A N    1 
ATOM   2491 C CA   . ILE A 1 265 ? 22.063  61.919 -10.468 1.00 16.77 ? 265 ILE A CA   1 
ATOM   2492 C C    . ILE A 1 265 ? 21.004  62.884 -11.065 1.00 17.24 ? 265 ILE A C    1 
ATOM   2493 O O    . ILE A 1 265 ? 20.461  62.675 -12.165 1.00 17.55 ? 265 ILE A O    1 
ATOM   2494 C CB   . ILE A 1 265 ? 23.282  61.765 -11.408 1.00 16.03 ? 265 ILE A CB   1 
ATOM   2495 C CG1  . ILE A 1 265 ? 24.224  60.662 -10.886 1.00 14.96 ? 265 ILE A CG1  1 
ATOM   2496 C CG2  . ILE A 1 265 ? 24.049  63.101 -11.513 1.00 15.58 ? 265 ILE A CG2  1 
ATOM   2497 C CD1  . ILE A 1 265 ? 25.294  61.104 -9.896  1.00 9.62  ? 265 ILE A CD1  1 
ATOM   2498 H H    . ILE A 1 265 ? 21.744  59.790 -10.623 1.00 0.00  ? 265 ILE A H    1 
ATOM   2499 N N    . LEU A 1 266 ? 20.723  63.951 -10.339 1.00 17.44 ? 266 LEU A N    1 
ATOM   2500 C CA   . LEU A 1 266 ? 19.701  64.915 -10.766 1.00 18.20 ? 266 LEU A CA   1 
ATOM   2501 C C    . LEU A 1 266 ? 20.232  66.336 -11.086 1.00 17.66 ? 266 LEU A C    1 
ATOM   2502 O O    . LEU A 1 266 ? 20.817  66.976 -10.206 1.00 17.25 ? 266 LEU A O    1 
ATOM   2503 C CB   . LEU A 1 266 ? 18.668  65.042 -9.646  1.00 17.10 ? 266 LEU A CB   1 
ATOM   2504 C CG   . LEU A 1 266 ? 17.436  65.866 -9.989  1.00 21.35 ? 266 LEU A CG   1 
ATOM   2505 C CD1  . LEU A 1 266 ? 16.588  65.064 -10.971 1.00 22.82 ? 266 LEU A CD1  1 
ATOM   2506 C CD2  . LEU A 1 266 ? 16.616  66.168 -8.711  1.00 21.04 ? 266 LEU A CD2  1 
ATOM   2507 H H    . LEU A 1 266 ? 21.245  64.151 -9.538  1.00 0.00  ? 266 LEU A H    1 
ATOM   2508 N N    . LYS A 1 267 ? 19.972  66.854 -12.293 1.00 17.45 ? 267 LYS A N    1 
ATOM   2509 C CA   . LYS A 1 267 ? 20.400  68.218 -12.627 1.00 17.94 ? 267 LYS A CA   1 
ATOM   2510 C C    . LYS A 1 267 ? 19.270  69.161 -12.272 1.00 17.35 ? 267 LYS A C    1 
ATOM   2511 O O    . LYS A 1 267 ? 18.162  68.962 -12.731 1.00 22.90 ? 267 LYS A O    1 
ATOM   2512 C CB   . LYS A 1 267 ? 20.749  68.368 -14.109 1.00 19.50 ? 267 LYS A CB   1 
ATOM   2513 C CG   . LYS A 1 267 ? 21.036  69.833 -14.551 1.00 19.76 ? 267 LYS A CG   1 
ATOM   2514 C CD   . LYS A 1 267 ? 21.957  69.904 -15.807 1.00 24.97 ? 267 LYS A CD   1 
ATOM   2515 C CE   . LYS A 1 267 ? 21.194  69.532 -17.061 1.00 23.51 ? 267 LYS A CE   1 
ATOM   2516 N NZ   . LYS A 1 267 ? 21.988  69.486 -18.325 1.00 21.07 ? 267 LYS A NZ   1 
ATOM   2517 H H    . LYS A 1 267 ? 19.477  66.336 -12.974 1.00 0.00  ? 267 LYS A H    1 
ATOM   2518 H HZ1  . LYS A 1 267 ? 22.457  70.402 -18.491 1.00 0.00  ? 267 LYS A HZ1  1 
ATOM   2519 H HZ2  . LYS A 1 267 ? 22.734  68.762 -18.231 1.00 0.00  ? 267 LYS A HZ2  1 
ATOM   2520 H HZ3  . LYS A 1 267 ? 21.408  69.250 -19.163 1.00 0.00  ? 267 LYS A HZ3  1 
ATOM   2521 N N    . ALA A 1 268 ? 19.553  70.203 -11.497 1.00 17.08 ? 268 ALA A N    1 
ATOM   2522 C CA   . ALA A 1 268 ? 18.534  71.200 -11.055 1.00 18.48 ? 268 ALA A CA   1 
ATOM   2523 C C    . ALA A 1 268 ? 17.557  71.802 -12.087 1.00 18.36 ? 268 ALA A C    1 
ATOM   2524 O O    . ALA A 1 268 ? 16.584  72.464 -11.719 1.00 16.65 ? 268 ALA A O    1 
ATOM   2525 C CB   . ALA A 1 268 ? 19.215  72.333 -10.240 1.00 16.21 ? 268 ALA A CB   1 
ATOM   2526 H H    . ALA A 1 268 ? 20.484  70.336 -11.184 1.00 0.00  ? 268 ALA A H    1 
ATOM   2527 N N    . TYR A 1 269 ? 17.813  71.557 -13.363 1.00 18.87 ? 269 TYR A N    1 
ATOM   2528 C CA   . TYR A 1 269 ? 16.978  72.029 -14.463 1.00 20.15 ? 269 TYR A CA   1 
ATOM   2529 C C    . TYR A 1 269 ? 17.194  71.017 -15.561 1.00 19.74 ? 269 TYR A C    1 
ATOM   2530 O O    . TYR A 1 269 ? 18.272  70.446 -15.656 1.00 22.07 ? 269 TYR A O    1 
ATOM   2531 C CB   . TYR A 1 269 ? 17.406  73.430 -14.938 1.00 19.98 ? 269 TYR A CB   1 
ATOM   2532 C CG   . TYR A 1 269 ? 18.794  73.522 -15.530 1.00 22.98 ? 269 TYR A CG   1 
ATOM   2533 C CD1  . TYR A 1 269 ? 19.905  73.753 -14.716 1.00 22.21 ? 269 TYR A CD1  1 
ATOM   2534 C CD2  . TYR A 1 269 ? 19.002  73.363 -16.886 1.00 20.70 ? 269 TYR A CD2  1 
ATOM   2535 C CE1  . TYR A 1 269 ? 21.169  73.809 -15.244 1.00 20.74 ? 269 TYR A CE1  1 
ATOM   2536 C CE2  . TYR A 1 269 ? 20.269  73.430 -17.418 1.00 20.89 ? 269 TYR A CE2  1 
ATOM   2537 C CZ   . TYR A 1 269 ? 21.349  73.649 -16.589 1.00 20.88 ? 269 TYR A CZ   1 
ATOM   2538 O OH   . TYR A 1 269 ? 22.621  73.704 -17.104 1.00 18.26 ? 269 TYR A OH   1 
ATOM   2539 H H    . TYR A 1 269 ? 18.575  71.000 -13.619 1.00 0.00  ? 269 TYR A H    1 
ATOM   2540 H HH   . TYR A 1 269 ? 22.628  73.506 -18.051 1.00 0.00  ? 269 TYR A HH   1 
ATOM   2541 N N    . SER A 1 270 ? 16.173  70.806 -16.378 1.00 23.99 ? 270 SER A N    1 
ATOM   2542 C CA   . SER A 1 270 ? 16.216  69.834 -17.486 1.00 26.60 ? 270 SER A CA   1 
ATOM   2543 C C    . SER A 1 270 ? 16.823  70.362 -18.782 1.00 28.81 ? 270 SER A C    1 
ATOM   2544 O O    . SER A 1 270 ? 16.765  71.569 -19.093 1.00 30.69 ? 270 SER A O    1 
ATOM   2545 C CB   . SER A 1 270 ? 14.802  69.337 -17.871 1.00 21.17 ? 270 SER A CB   1 
ATOM   2546 O OG   . SER A 1 270 ? 13.924  69.333 -16.765 1.00 22.50 ? 270 SER A OG   1 
ATOM   2547 H H    . SER A 1 270 ? 15.374  71.361 -16.296 1.00 0.00  ? 270 SER A H    1 
ATOM   2548 H HG   . SER A 1 270 ? 13.248  70.030 -16.850 1.00 0.00  ? 270 SER A HG   1 
ATOM   2549 N N    . THR A 1 271 ? 17.378  69.425 -19.545 1.00 29.24 ? 271 THR A N    1 
ATOM   2550 C CA   . THR A 1 271 ? 17.918  69.691 -20.866 1.00 27.17 ? 271 THR A CA   1 
ATOM   2551 C C    . THR A 1 271 ? 17.780  68.367 -21.637 1.00 27.15 ? 271 THR A C    1 
ATOM   2552 O O    . THR A 1 271 ? 17.637  67.291 -21.040 1.00 25.63 ? 271 THR A O    1 
ATOM   2553 C CB   . THR A 1 271 ? 19.387  70.163 -20.844 1.00 25.71 ? 271 THR A CB   1 
ATOM   2554 O OG1  . THR A 1 271 ? 20.276  69.039 -20.882 1.00 26.30 ? 271 THR A OG1  1 
ATOM   2555 C CG2  . THR A 1 271 ? 19.655  70.960 -19.607 1.00 23.94 ? 271 THR A CG2  1 
ATOM   2556 H H    . THR A 1 271 ? 17.433  68.490 -19.251 1.00 0.00  ? 271 THR A H    1 
ATOM   2557 H HG1  . THR A 1 271 ? 20.296  68.535 -21.712 1.00 0.00  ? 271 THR A HG1  1 
ATOM   2558 N N    . ARG A 1 272 ? 17.800  68.462 -22.959 1.00 27.01 ? 272 ARG A N    1 
ATOM   2559 C CA   . ARG A 1 272 ? 17.687  67.318 -23.827 1.00 24.48 ? 272 ARG A CA   1 
ATOM   2560 C C    . ARG A 1 272 ? 18.368  67.699 -25.097 1.00 25.54 ? 272 ARG A C    1 
ATOM   2561 O O    . ARG A 1 272 ? 18.155  68.789 -25.624 1.00 25.86 ? 272 ARG A O    1 
ATOM   2562 C CB   . ARG A 1 272 ? 16.248  67.050 -24.172 1.00 24.49 ? 272 ARG A CB   1 
ATOM   2563 C CG   . ARG A 1 272 ? 16.129  66.086 -25.318 1.00 24.57 ? 272 ARG A CG   1 
ATOM   2564 C CD   . ARG A 1 272 ? 14.730  66.003 -25.847 1.00 19.10 ? 272 ARG A CD   1 
ATOM   2565 N NE   . ARG A 1 272 ? 13.968  64.913 -25.254 1.00 18.97 ? 272 ARG A NE   1 
ATOM   2566 C CZ   . ARG A 1 272 ? 14.214  63.622 -25.482 1.00 18.31 ? 272 ARG A CZ   1 
ATOM   2567 N NH1  . ARG A 1 272 ? 15.245  63.280 -26.268 1.00 19.08 ? 272 ARG A NH1  1 
ATOM   2568 N NH2  . ARG A 1 272 ? 13.333  62.699 -25.083 1.00 10.80 ? 272 ARG A NH2  1 
ATOM   2569 H H    . ARG A 1 272 ? 17.907  69.343 -23.382 1.00 0.00  ? 272 ARG A H    1 
ATOM   2570 H HE   . ARG A 1 272 ? 13.191  65.144 -24.687 1.00 0.00  ? 272 ARG A HE   1 
ATOM   2571 H HH11 . ARG A 1 272 ? 15.841  63.960 -26.710 1.00 0.00  ? 272 ARG A HH11 1 
ATOM   2572 H HH12 . ARG A 1 272 ? 15.440  62.319 -26.462 1.00 0.00  ? 272 ARG A HH12 1 
ATOM   2573 H HH21 . ARG A 1 272 ? 12.505  63.036 -24.633 1.00 0.00  ? 272 ARG A HH21 1 
ATOM   2574 H HH22 . ARG A 1 272 ? 13.432  61.706 -25.217 1.00 0.00  ? 272 ARG A HH22 1 
ATOM   2575 N N    . VAL A 1 273 ? 19.195  66.799 -25.590 1.00 27.90 ? 273 VAL A N    1 
ATOM   2576 C CA   . VAL A 1 273 ? 19.902  67.014 -26.834 1.00 29.73 ? 273 VAL A CA   1 
ATOM   2577 C C    . VAL A 1 273 ? 19.089  66.312 -27.910 1.00 30.72 ? 273 VAL A C    1 
ATOM   2578 O O    . VAL A 1 273 ? 18.336  65.364 -27.610 1.00 29.67 ? 273 VAL A O    1 
ATOM   2579 C CB   . VAL A 1 273 ? 21.321  66.422 -26.770 1.00 29.30 ? 273 VAL A CB   1 
ATOM   2580 C CG1  . VAL A 1 273 ? 22.045  66.676 -28.076 1.00 29.43 ? 273 VAL A CG1  1 
ATOM   2581 C CG2  . VAL A 1 273 ? 22.075  67.045 -25.615 1.00 27.18 ? 273 VAL A CG2  1 
ATOM   2582 H H    . VAL A 1 273 ? 19.315  65.936 -25.146 1.00 0.00  ? 273 VAL A H    1 
ATOM   2583 N N    . GLY A 1 274 ? 19.227  66.775 -29.154 1.00 30.27 ? 274 GLY A N    1 
ATOM   2584 C CA   . GLY A 1 274 ? 18.494  66.172 -30.252 1.00 28.06 ? 274 GLY A CA   1 
ATOM   2585 C C    . GLY A 1 274 ? 17.013  66.333 -30.033 1.00 27.18 ? 274 GLY A C    1 
ATOM   2586 O O    . GLY A 1 274 ? 16.596  66.984 -29.082 1.00 25.63 ? 274 GLY A O    1 
ATOM   2587 H H    . GLY A 1 274 ? 19.773  67.579 -29.312 1.00 0.00  ? 274 GLY A H    1 
ATOM   2588 N N    . ALA A 1 275 ? 16.219  65.715 -30.895 1.00 27.75 ? 275 ALA A N    1 
ATOM   2589 C CA   . ALA A 1 275 ? 14.768  65.822 -30.805 1.00 29.58 ? 275 ALA A CA   1 
ATOM   2590 C C    . ALA A 1 275 ? 14.198  64.848 -29.792 1.00 28.59 ? 275 ALA A C    1 
ATOM   2591 O O    . ALA A 1 275 ? 14.938  64.223 -29.033 1.00 29.88 ? 275 ALA A O    1 
ATOM   2592 C CB   . ALA A 1 275 ? 14.121  65.603 -32.193 1.00 31.54 ? 275 ALA A CB   1 
ATOM   2593 H H    . ALA A 1 275 ? 16.606  65.166 -31.600 1.00 0.00  ? 275 ALA A H    1 
ATOM   2594 N N    . GLY A 1 276 ? 12.882  64.702 -29.801 1.00 25.46 ? 276 GLY A N    1 
ATOM   2595 C CA   . GLY A 1 276 ? 12.250  63.803 -28.867 1.00 24.75 ? 276 GLY A CA   1 
ATOM   2596 C C    . GLY A 1 276 ? 11.447  64.703 -27.976 1.00 24.04 ? 276 GLY A C    1 
ATOM   2597 O O    . GLY A 1 276 ? 11.803  65.903 -27.828 1.00 26.50 ? 276 GLY A O    1 
ATOM   2598 H H    . GLY A 1 276 ? 12.322  65.221 -30.415 1.00 0.00  ? 276 GLY A H    1 
ATOM   2599 N N    . PRO A 1 277 ? 10.417  64.168 -27.304 1.00 20.87 ? 277 PRO A N    1 
ATOM   2600 C CA   . PRO A 1 277 ? 9.542   64.962 -26.405 1.00 18.31 ? 277 PRO A CA   1 
ATOM   2601 C C    . PRO A 1 277 ? 10.298  65.652 -25.272 1.00 17.27 ? 277 PRO A C    1 
ATOM   2602 O O    . PRO A 1 277 ? 11.318  65.098 -24.759 1.00 15.64 ? 277 PRO A O    1 
ATOM   2603 C CB   . PRO A 1 277 ? 8.545   63.921 -25.877 1.00 18.83 ? 277 PRO A CB   1 
ATOM   2604 C CG   . PRO A 1 277 ? 8.641   62.745 -26.915 1.00 18.09 ? 277 PRO A CG   1 
ATOM   2605 C CD   . PRO A 1 277 ? 10.095  62.733 -27.255 1.00 17.72 ? 277 PRO A CD   1 
ATOM   2606 N N    . PHE A 1 278 ? 9.750   66.793 -24.834 1.00 14.39 ? 278 PHE A N    1 
ATOM   2607 C CA   . PHE A 1 278 ? 10.345  67.628 -23.763 1.00 13.21 ? 278 PHE A CA   1 
ATOM   2608 C C    . PHE A 1 278 ? 9.273   68.680 -23.368 1.00 13.44 ? 278 PHE A C    1 
ATOM   2609 O O    . PHE A 1 278 ? 9.464   69.872 -23.533 1.00 10.45 ? 278 PHE A O    1 
ATOM   2610 C CB   . PHE A 1 278 ? 11.609  68.298 -24.353 1.00 15.21 ? 278 PHE A CB   1 
ATOM   2611 C CG   . PHE A 1 278 ? 12.550  68.927 -23.355 1.00 19.57 ? 278 PHE A CG   1 
ATOM   2612 C CD1  . PHE A 1 278 ? 12.370  68.811 -21.985 1.00 22.91 ? 278 PHE A CD1  1 
ATOM   2613 C CD2  . PHE A 1 278 ? 13.657  69.649 -23.822 1.00 21.13 ? 278 PHE A CD2  1 
ATOM   2614 C CE1  . PHE A 1 278 ? 13.282  69.411 -21.077 1.00 24.02 ? 278 PHE A CE1  1 
ATOM   2615 C CE2  . PHE A 1 278 ? 14.571  70.254 -22.936 1.00 22.18 ? 278 PHE A CE2  1 
ATOM   2616 C CZ   . PHE A 1 278 ? 14.386  70.133 -21.557 1.00 22.24 ? 278 PHE A CZ   1 
ATOM   2617 H H    . PHE A 1 278 ? 8.942   67.126 -25.283 1.00 0.00  ? 278 PHE A H    1 
ATOM   2618 N N    . PRO A 1 279 ? 8.193   68.242 -22.717 1.00 13.79 ? 279 PRO A N    1 
ATOM   2619 C CA   . PRO A 1 279 ? 7.067   69.059 -22.272 1.00 19.36 ? 279 PRO A CA   1 
ATOM   2620 C C    . PRO A 1 279 ? 7.304   70.360 -21.536 1.00 21.79 ? 279 PRO A C    1 
ATOM   2621 O O    . PRO A 1 279 ? 6.451   71.260 -21.555 1.00 25.57 ? 279 PRO A O    1 
ATOM   2622 C CB   . PRO A 1 279 ? 6.267   68.089 -21.381 1.00 17.34 ? 279 PRO A CB   1 
ATOM   2623 C CG   . PRO A 1 279 ? 7.294   67.164 -20.883 1.00 16.73 ? 279 PRO A CG   1 
ATOM   2624 C CD   . PRO A 1 279 ? 8.094   66.899 -22.129 1.00 16.88 ? 279 PRO A CD   1 
ATOM   2625 N N    . THR A 1 280 ? 8.440   70.433 -20.863 1.00 23.72 ? 280 THR A N    1 
ATOM   2626 C CA   . THR A 1 280 ? 8.787   71.559 -20.028 1.00 23.25 ? 280 THR A CA   1 
ATOM   2627 C C    . THR A 1 280 ? 9.715   72.602 -20.732 1.00 24.23 ? 280 THR A C    1 
ATOM   2628 O O    . THR A 1 280 ? 10.174  73.601 -20.127 1.00 23.13 ? 280 THR A O    1 
ATOM   2629 C CB   . THR A 1 280 ? 9.363   70.944 -18.724 1.00 25.03 ? 280 THR A CB   1 
ATOM   2630 O OG1  . THR A 1 280 ? 8.645   71.419 -17.580 1.00 29.02 ? 280 THR A OG1  1 
ATOM   2631 C CG2  . THR A 1 280 ? 10.855  71.138 -18.603 1.00 25.24 ? 280 THR A CG2  1 
ATOM   2632 H H    . THR A 1 280 ? 9.066   69.684 -20.891 1.00 0.00  ? 280 THR A H    1 
ATOM   2633 H HG1  . THR A 1 280 ? 8.211   72.239 -17.836 1.00 0.00  ? 280 THR A HG1  1 
ATOM   2634 N N    . GLU A 1 281 ? 9.925   72.424 -22.028 1.00 24.51 ? 281 GLU A N    1 
ATOM   2635 C CA   . GLU A 1 281 ? 10.795  73.334 -22.768 1.00 24.81 ? 281 GLU A CA   1 
ATOM   2636 C C    . GLU A 1 281 ? 10.437  74.831 -22.673 1.00 24.33 ? 281 GLU A C    1 
ATOM   2637 O O    . GLU A 1 281 ? 9.279   75.192 -22.530 1.00 25.88 ? 281 GLU A O    1 
ATOM   2638 C CB   . GLU A 1 281 ? 10.866  72.908 -24.226 1.00 23.87 ? 281 GLU A CB   1 
ATOM   2639 C CG   . GLU A 1 281 ? 12.069  73.456 -24.889 1.00 22.26 ? 281 GLU A CG   1 
ATOM   2640 C CD   . GLU A 1 281 ? 12.293  72.897 -26.246 1.00 22.63 ? 281 GLU A CD   1 
ATOM   2641 O OE1  . GLU A 1 281 ? 11.428  72.156 -26.770 1.00 24.66 ? 281 GLU A OE1  1 
ATOM   2642 O OE2  . GLU A 1 281 ? 13.355  73.224 -26.800 1.00 25.20 ? 281 GLU A OE2  1 
ATOM   2643 H H    . GLU A 1 281 ? 9.534   71.671 -22.521 1.00 0.00  ? 281 GLU A H    1 
ATOM   2644 N N    . LEU A 1 282 ? 11.453  75.688 -22.736 1.00 24.95 ? 282 LEU A N    1 
ATOM   2645 C CA   . LEU A 1 282 ? 11.306  77.141 -22.651 1.00 23.53 ? 282 LEU A CA   1 
ATOM   2646 C C    . LEU A 1 282 ? 11.588  77.746 -24.008 1.00 24.45 ? 282 LEU A C    1 
ATOM   2647 O O    . LEU A 1 282 ? 12.597  77.414 -24.639 1.00 21.46 ? 282 LEU A O    1 
ATOM   2648 C CB   . LEU A 1 282 ? 12.303  77.704 -21.646 1.00 24.17 ? 282 LEU A CB   1 
ATOM   2649 C CG   . LEU A 1 282 ? 12.202  77.068 -20.263 1.00 22.74 ? 282 LEU A CG   1 
ATOM   2650 C CD1  . LEU A 1 282 ? 13.255  77.653 -19.324 1.00 24.65 ? 282 LEU A CD1  1 
ATOM   2651 C CD2  . LEU A 1 282 ? 10.820  77.292 -19.692 1.00 18.85 ? 282 LEU A CD2  1 
ATOM   2652 H H    . LEU A 1 282 ? 12.359  75.307 -22.810 1.00 0.00  ? 282 LEU A H    1 
ATOM   2653 N N    . PHE A 1 283 ? 10.699  78.642 -24.445 1.00 26.85 ? 283 PHE A N    1 
ATOM   2654 C CA   . PHE A 1 283 ? 10.831  79.300 -25.742 1.00 26.52 ? 283 PHE A CA   1 
ATOM   2655 C C    . PHE A 1 283 ? 10.898  80.823 -25.632 1.00 27.95 ? 283 PHE A C    1 
ATOM   2656 O O    . PHE A 1 283 ? 10.565  81.537 -26.599 1.00 28.15 ? 283 PHE A O    1 
ATOM   2657 C CB   . PHE A 1 283 ? 9.666   78.903 -26.646 1.00 24.26 ? 283 PHE A CB   1 
ATOM   2658 C CG   . PHE A 1 283 ? 9.669   77.458 -27.042 1.00 22.84 ? 283 PHE A CG   1 
ATOM   2659 C CD1  . PHE A 1 283 ? 10.649  76.955 -27.892 1.00 20.07 ? 283 PHE A CD1  1 
ATOM   2660 C CD2  . PHE A 1 283 ? 8.689   76.589 -26.562 1.00 24.59 ? 283 PHE A CD2  1 
ATOM   2661 C CE1  . PHE A 1 283 ? 10.657  75.605 -28.261 1.00 20.06 ? 283 PHE A CE1  1 
ATOM   2662 C CE2  . PHE A 1 283 ? 8.687   75.233 -26.924 1.00 22.87 ? 283 PHE A CE2  1 
ATOM   2663 C CZ   . PHE A 1 283 ? 9.667   74.746 -27.770 1.00 20.32 ? 283 PHE A CZ   1 
ATOM   2664 H H    . PHE A 1 283 ? 9.920   78.866 -23.894 1.00 0.00  ? 283 PHE A H    1 
ATOM   2665 N N    A ASP A 1 284 ? 11.307  81.294 -24.451 0.50 26.87 ? 284 ASP A N    1 
ATOM   2666 N N    B ASP A 1 284 ? 11.286  81.321 -24.452 0.50 28.03 ? 284 ASP A N    1 
ATOM   2667 C CA   A ASP A 1 284 ? 11.434  82.712 -24.137 0.50 24.66 ? 284 ASP A CA   1 
ATOM   2668 C CA   B ASP A 1 284 ? 11.423  82.761 -24.205 0.50 26.77 ? 284 ASP A CA   1 
ATOM   2669 C C    A ASP A 1 284 ? 12.861  83.031 -23.702 0.50 25.07 ? 284 ASP A C    1 
ATOM   2670 C C    B ASP A 1 284 ? 12.845  83.043 -23.714 0.50 26.40 ? 284 ASP A C    1 
ATOM   2671 O O    A ASP A 1 284 ? 13.801  82.298 -24.037 0.50 23.57 ? 284 ASP A O    1 
ATOM   2672 O O    B ASP A 1 284 ? 13.765  82.265 -23.995 0.50 24.78 ? 284 ASP A O    1 
ATOM   2673 C CB   A ASP A 1 284 ? 10.454  83.077 -23.018 0.50 23.51 ? 284 ASP A CB   1 
ATOM   2674 C CB   B ASP A 1 284 ? 10.393  83.252 -23.183 0.50 28.10 ? 284 ASP A CB   1 
ATOM   2675 C CG   A ASP A 1 284 ? 10.647  82.247 -21.761 0.50 21.53 ? 284 ASP A CG   1 
ATOM   2676 C CG   B ASP A 1 284 ? 9.986   84.729 -23.406 0.50 29.72 ? 284 ASP A CG   1 
ATOM   2677 O OD1  A ASP A 1 284 ? 11.768  81.763 -21.521 0.50 17.71 ? 284 ASP A OD1  1 
ATOM   2678 O OD1  B ASP A 1 284 ? 10.864  85.627 -23.358 0.50 29.22 ? 284 ASP A OD1  1 
ATOM   2679 O OD2  A ASP A 1 284 ? 9.667   82.086 -20.995 0.50 23.26 ? 284 ASP A OD2  1 
ATOM   2680 O OD2  B ASP A 1 284 ? 8.775   84.990 -23.607 0.50 28.32 ? 284 ASP A OD2  1 
ATOM   2681 H H    A ASP A 1 284 ? 11.568  80.667 -23.749 0.50 0.00  ? 284 ASP A H    1 
ATOM   2682 H H    B ASP A 1 284 ? 11.532  80.697 -23.750 0.50 0.00  ? 284 ASP A H    1 
ATOM   2683 N N    . GLU A 1 285 ? 13.017  84.122 -22.957 1.00 26.76 ? 285 GLU A N    1 
ATOM   2684 C CA   . GLU A 1 285 ? 14.330  84.531 -22.433 1.00 29.11 ? 285 GLU A CA   1 
ATOM   2685 C C    . GLU A 1 285 ? 14.970  83.622 -21.393 1.00 27.68 ? 285 GLU A C    1 
ATOM   2686 O O    . GLU A 1 285 ? 16.204  83.523 -21.302 1.00 28.95 ? 285 GLU A O    1 
ATOM   2687 C CB   . GLU A 1 285 ? 14.289  85.960 -21.901 1.00 31.92 ? 285 GLU A CB   1 
ATOM   2688 C CG   . GLU A 1 285 ? 14.633  86.983 -22.978 1.00 39.34 ? 285 GLU A CG   1 
ATOM   2689 C CD   . GLU A 1 285 ? 15.925  86.634 -23.707 1.00 39.54 ? 285 GLU A CD   1 
ATOM   2690 O OE1  . GLU A 1 285 ? 15.915  85.699 -24.541 1.00 40.44 ? 285 GLU A OE1  1 
ATOM   2691 O OE2  . GLU A 1 285 ? 16.951  87.290 -23.437 1.00 43.48 ? 285 GLU A OE2  1 
ATOM   2692 H H    . GLU A 1 285 ? 12.254  84.704 -22.767 1.00 0.00  ? 285 GLU A H    1 
ATOM   2693 N N    . THR A 1 286 ? 14.144  82.902 -20.654 1.00 26.77 ? 286 THR A N    1 
ATOM   2694 C CA   . THR A 1 286 ? 14.672  82.013 -19.650 1.00 28.15 ? 286 THR A CA   1 
ATOM   2695 C C    . THR A 1 286 ? 15.499  80.839 -20.176 1.00 27.66 ? 286 THR A C    1 
ATOM   2696 O O    . THR A 1 286 ? 16.522  80.509 -19.597 1.00 27.50 ? 286 THR A O    1 
ATOM   2697 C CB   . THR A 1 286 ? 13.574  81.572 -18.754 1.00 26.87 ? 286 THR A CB   1 
ATOM   2698 O OG1  . THR A 1 286 ? 12.808  82.744 -18.428 1.00 26.92 ? 286 THR A OG1  1 
ATOM   2699 C CG2  . THR A 1 286 ? 14.153  80.935 -17.476 1.00 26.04 ? 286 THR A CG2  1 
ATOM   2700 H H    . THR A 1 286 ? 13.171  82.928 -20.780 1.00 0.00  ? 286 THR A H    1 
ATOM   2701 H HG1  . THR A 1 286 ? 12.036  82.446 -17.931 1.00 0.00  ? 286 THR A HG1  1 
ATOM   2702 N N    . GLY A 1 287 ? 15.119  80.291 -21.322 1.00 29.59 ? 287 GLY A N    1 
ATOM   2703 C CA   . GLY A 1 287 ? 15.856  79.174 -21.893 1.00 32.47 ? 287 GLY A CA   1 
ATOM   2704 C C    . GLY A 1 287 ? 17.296  79.495 -22.261 1.00 34.14 ? 287 GLY A C    1 
ATOM   2705 O O    . GLY A 1 287 ? 18.235  78.824 -21.832 1.00 34.15 ? 287 GLY A O    1 
ATOM   2706 H H    . GLY A 1 287 ? 14.337  80.669 -21.778 1.00 0.00  ? 287 GLY A H    1 
ATOM   2707 N N    . GLU A 1 288 ? 17.471  80.522 -23.082 1.00 37.10 ? 288 GLU A N    1 
ATOM   2708 C CA   . GLU A 1 288 ? 18.797  80.941 -23.486 1.00 39.81 ? 288 GLU A CA   1 
ATOM   2709 C C    . GLU A 1 288 ? 19.563  81.337 -22.246 1.00 41.36 ? 288 GLU A C    1 
ATOM   2710 O O    . GLU A 1 288 ? 20.747  81.002 -22.112 1.00 42.12 ? 288 GLU A O    1 
ATOM   2711 C CB   . GLU A 1 288 ? 18.706  82.066 -24.507 1.00 42.48 ? 288 GLU A CB   1 
ATOM   2712 C CG   . GLU A 1 288 ? 17.946  81.629 -25.771 1.00 43.95 ? 288 GLU A CG   1 
ATOM   2713 C CD   . GLU A 1 288 ? 18.439  80.282 -26.343 1.00 44.43 ? 288 GLU A CD   1 
ATOM   2714 O OE1  . GLU A 1 288 ? 19.570  80.247 -26.884 1.00 45.07 ? 288 GLU A OE1  1 
ATOM   2715 O OE2  . GLU A 1 288 ? 17.702  79.268 -26.249 1.00 41.85 ? 288 GLU A OE2  1 
ATOM   2716 H H    . GLU A 1 288 ? 16.683  80.997 -23.418 1.00 0.00  ? 288 GLU A H    1 
ATOM   2717 N N    . PHE A 1 289 ? 18.888  82.002 -21.309 1.00 41.84 ? 289 PHE A N    1 
ATOM   2718 C CA   . PHE A 1 289 ? 19.545  82.336 -20.049 1.00 42.79 ? 289 PHE A CA   1 
ATOM   2719 C C    . PHE A 1 289 ? 20.130  81.022 -19.503 1.00 43.23 ? 289 PHE A C    1 
ATOM   2720 O O    . PHE A 1 289 ? 21.341  80.915 -19.278 1.00 42.28 ? 289 PHE A O    1 
ATOM   2721 C CB   . PHE A 1 289 ? 18.531  82.884 -19.058 1.00 44.02 ? 289 PHE A CB   1 
ATOM   2722 C CG   . PHE A 1 289 ? 19.100  83.175 -17.696 1.00 44.82 ? 289 PHE A CG   1 
ATOM   2723 C CD1  . PHE A 1 289 ? 19.838  84.333 -17.468 1.00 46.39 ? 289 PHE A CD1  1 
ATOM   2724 C CD2  . PHE A 1 289 ? 18.840  82.330 -16.630 1.00 45.21 ? 289 PHE A CD2  1 
ATOM   2725 C CE1  . PHE A 1 289 ? 20.306  84.650 -16.188 1.00 45.52 ? 289 PHE A CE1  1 
ATOM   2726 C CE2  . PHE A 1 289 ? 19.300  82.633 -15.351 1.00 46.38 ? 289 PHE A CE2  1 
ATOM   2727 C CZ   . PHE A 1 289 ? 20.034  83.799 -15.130 1.00 46.69 ? 289 PHE A CZ   1 
ATOM   2728 H H    . PHE A 1 289 ? 17.975  82.339 -21.451 1.00 0.00  ? 289 PHE A H    1 
ATOM   2729 N N    . LEU A 1 290 ? 19.259  80.021 -19.340 1.00 42.79 ? 290 LEU A N    1 
ATOM   2730 C CA   . LEU A 1 290 ? 19.646  78.705 -18.849 1.00 44.11 ? 290 LEU A CA   1 
ATOM   2731 C C    . LEU A 1 290 ? 20.807  78.113 -19.643 1.00 45.93 ? 290 LEU A C    1 
ATOM   2732 O O    . LEU A 1 290 ? 21.833  77.737 -19.077 1.00 45.79 ? 290 LEU A O    1 
ATOM   2733 C CB   . LEU A 1 290 ? 18.460  77.745 -18.893 1.00 42.83 ? 290 LEU A CB   1 
ATOM   2734 C CG   . LEU A 1 290 ? 17.475  77.841 -17.738 1.00 42.35 ? 290 LEU A CG   1 
ATOM   2735 C CD1  . LEU A 1 290 ? 16.453  76.716 -17.879 1.00 40.69 ? 290 LEU A CD1  1 
ATOM   2736 C CD2  . LEU A 1 290 ? 18.234  77.747 -16.394 1.00 43.91 ? 290 LEU A CD2  1 
ATOM   2737 H H    . LEU A 1 290 ? 18.304  80.190 -19.517 1.00 0.00  ? 290 LEU A H    1 
ATOM   2738 N N    . CYS A 1 291 ? 20.652  78.039 -20.957 1.00 48.10 ? 291 CYS A N    1 
ATOM   2739 C CA   . CYS A 1 291 ? 21.717  77.494 -21.782 1.00 49.08 ? 291 CYS A CA   1 
ATOM   2740 C C    . CYS A 1 291 ? 23.017  78.272 -21.615 1.00 47.49 ? 291 CYS A C    1 
ATOM   2741 O O    . CYS A 1 291 ? 24.089  77.679 -21.498 1.00 46.47 ? 291 CYS A O    1 
ATOM   2742 C CB   . CYS A 1 291 ? 21.319  77.480 -23.255 1.00 50.94 ? 291 CYS A CB   1 
ATOM   2743 S SG   . CYS A 1 291 ? 22.743  77.101 -24.315 1.00 54.66 ? 291 CYS A SG   1 
ATOM   2744 H H    . CYS A 1 291 ? 19.799  78.353 -21.345 1.00 0.00  ? 291 CYS A H    1 
ATOM   2745 N N    . LYS A 1 292 ? 22.901  79.597 -21.574 1.00 47.52 ? 292 LYS A N    1 
ATOM   2746 C CA   . LYS A 1 292 ? 24.047  80.502 -21.440 1.00 47.77 ? 292 LYS A CA   1 
ATOM   2747 C C    . LYS A 1 292 ? 24.799  80.248 -20.155 1.00 46.19 ? 292 LYS A C    1 
ATOM   2748 O O    . LYS A 1 292 ? 25.873  79.676 -20.167 1.00 47.86 ? 292 LYS A O    1 
ATOM   2749 C CB   . LYS A 1 292 ? 23.573  81.971 -21.473 1.00 48.42 ? 292 LYS A CB   1 
ATOM   2750 C CG   . LYS A 1 292 ? 24.547  82.955 -22.117 1.00 48.28 ? 292 LYS A CG   1 
ATOM   2751 C CD   . LYS A 1 292 ? 24.605  82.753 -23.644 1.00 47.76 ? 292 LYS A CD   1 
ATOM   2752 C CE   . LYS A 1 292 ? 25.545  83.747 -24.335 1.00 44.87 ? 292 LYS A CE   1 
ATOM   2753 N NZ   . LYS A 1 292 ? 25.255  85.175 -23.968 1.00 42.32 ? 292 LYS A NZ   1 
ATOM   2754 H H    . LYS A 1 292 ? 22.015  80.031 -21.660 1.00 0.00  ? 292 LYS A H    1 
ATOM   2755 H HZ1  . LYS A 1 292 ? 24.253  85.417 -24.137 1.00 0.00  ? 292 LYS A HZ1  1 
ATOM   2756 H HZ2  . LYS A 1 292 ? 25.418  85.299 -22.945 1.00 0.00  ? 292 LYS A HZ2  1 
ATOM   2757 H HZ3  . LYS A 1 292 ? 25.878  85.828 -24.481 1.00 0.00  ? 292 LYS A HZ3  1 
ATOM   2758 N N    . GLN A 1 293 ? 24.167  80.600 -19.045 1.00 46.47 ? 293 GLN A N    1 
ATOM   2759 C CA   . GLN A 1 293 ? 24.734  80.463 -17.710 1.00 45.30 ? 293 GLN A CA   1 
ATOM   2760 C C    . GLN A 1 293 ? 25.180  79.031 -17.431 1.00 45.55 ? 293 GLN A C    1 
ATOM   2761 O O    . GLN A 1 293 ? 26.243  78.804 -16.832 1.00 44.83 ? 293 GLN A O    1 
ATOM   2762 C CB   . GLN A 1 293 ? 23.681  80.888 -16.692 1.00 47.29 ? 293 GLN A CB   1 
ATOM   2763 C CG   . GLN A 1 293 ? 24.234  81.341 -15.354 1.00 49.23 ? 293 GLN A CG   1 
ATOM   2764 C CD   . GLN A 1 293 ? 23.284  82.273 -14.614 1.00 48.69 ? 293 GLN A CD   1 
ATOM   2765 O OE1  . GLN A 1 293 ? 23.684  83.340 -14.149 1.00 50.61 ? 293 GLN A OE1  1 
ATOM   2766 N NE2  . GLN A 1 293 ? 22.029  81.885 -14.518 1.00 47.31 ? 293 GLN A NE2  1 
ATOM   2767 H H    . GLN A 1 293 ? 23.230  80.884 -19.138 1.00 0.00  ? 293 GLN A H    1 
ATOM   2768 H HE21 . GLN A 1 293 ? 21.445  82.430 -13.951 1.00 0.00  ? 293 GLN A HE21 1 
ATOM   2769 H HE22 . GLN A 1 293 ? 21.704  81.059 -14.929 1.00 0.00  ? 293 GLN A HE22 1 
ATOM   2770 N N    . GLY A 1 294 ? 24.362  78.073 -17.874 1.00 44.57 ? 294 GLY A N    1 
ATOM   2771 C CA   . GLY A 1 294 ? 24.664  76.666 -17.680 1.00 44.11 ? 294 GLY A CA   1 
ATOM   2772 C C    . GLY A 1 294 ? 25.834  76.180 -18.520 1.00 43.77 ? 294 GLY A C    1 
ATOM   2773 O O    . GLY A 1 294 ? 26.483  75.164 -18.197 1.00 45.02 ? 294 GLY A O    1 
ATOM   2774 H H    . GLY A 1 294 ? 23.521  78.263 -18.347 1.00 0.00  ? 294 GLY A H    1 
ATOM   2775 N N    . ASN A 1 295 ? 26.124  76.914 -19.584 1.00 42.69 ? 295 ASN A N    1 
ATOM   2776 C CA   . ASN A 1 295 ? 27.222  76.560 -20.478 1.00 42.27 ? 295 ASN A CA   1 
ATOM   2777 C C    . ASN A 1 295 ? 26.969  75.179 -21.088 1.00 41.46 ? 295 ASN A C    1 
ATOM   2778 O O    . ASN A 1 295 ? 27.818  74.290 -21.056 1.00 40.01 ? 295 ASN A O    1 
ATOM   2779 C CB   . ASN A 1 295 ? 28.567  76.616 -19.738 1.00 40.56 ? 295 ASN A CB   1 
ATOM   2780 C CG   . ASN A 1 295 ? 28.858  77.991 -19.151 1.00 42.51 ? 295 ASN A CG   1 
ATOM   2781 O OD1  . ASN A 1 295 ? 28.653  79.035 -19.798 1.00 40.40 ? 295 ASN A OD1  1 
ATOM   2782 N ND2  . ASN A 1 295 ? 29.356  78.002 -17.922 1.00 43.88 ? 295 ASN A ND2  1 
ATOM   2783 H H    . ASN A 1 295 ? 25.615  77.728 -19.793 1.00 0.00  ? 295 ASN A H    1 
ATOM   2784 H HD21 . ASN A 1 295 ? 29.480  78.858 -17.475 1.00 0.00  ? 295 ASN A HD21 1 
ATOM   2785 H HD22 . ASN A 1 295 ? 29.533  77.137 -17.498 1.00 0.00  ? 295 ASN A HD22 1 
ATOM   2786 N N    . GLU A 1 296 ? 25.791  75.040 -21.687 1.00 42.21 ? 296 GLU A N    1 
ATOM   2787 C CA   . GLU A 1 296 ? 25.357  73.793 -22.310 1.00 43.48 ? 296 GLU A CA   1 
ATOM   2788 C C    . GLU A 1 296 ? 25.644  73.691 -23.810 1.00 45.90 ? 296 GLU A C    1 
ATOM   2789 O O    . GLU A 1 296 ? 24.846  73.149 -24.583 1.00 46.91 ? 296 GLU A O    1 
ATOM   2790 C CB   . GLU A 1 296 ? 23.868  73.565 -22.040 1.00 40.18 ? 296 GLU A CB   1 
ATOM   2791 C CG   . GLU A 1 296 ? 23.509  73.412 -20.564 1.00 35.73 ? 296 GLU A CG   1 
ATOM   2792 C CD   . GLU A 1 296 ? 24.088  72.168 -19.904 1.00 32.53 ? 296 GLU A CD   1 
ATOM   2793 O OE1  . GLU A 1 296 ? 24.655  71.302 -20.602 1.00 28.21 ? 296 GLU A OE1  1 
ATOM   2794 O OE2  . GLU A 1 296 ? 23.969  72.060 -18.667 1.00 32.77 ? 296 GLU A OE2  1 
ATOM   2795 H H    . GLU A 1 296 ? 25.202  75.830 -21.687 1.00 0.00  ? 296 GLU A H    1 
ATOM   2796 N N    . PHE A 1 297 ? 26.832  74.123 -24.200 1.00 47.31 ? 297 PHE A N    1 
ATOM   2797 C CA   . PHE A 1 297 ? 27.239  74.087 -25.592 1.00 48.52 ? 297 PHE A CA   1 
ATOM   2798 C C    . PHE A 1 297 ? 28.448  73.143 -25.748 1.00 49.88 ? 297 PHE A C    1 
ATOM   2799 O O    . PHE A 1 297 ? 29.184  73.199 -26.743 1.00 48.09 ? 297 PHE A O    1 
ATOM   2800 C CB   . PHE A 1 297 ? 27.568  75.520 -26.049 1.00 49.16 ? 297 PHE A CB   1 
ATOM   2801 C CG   . PHE A 1 297 ? 28.390  76.310 -25.045 1.00 48.69 ? 297 PHE A CG   1 
ATOM   2802 C CD1  . PHE A 1 297 ? 29.769  76.134 -24.950 1.00 49.22 ? 297 PHE A CD1  1 
ATOM   2803 C CD2  . PHE A 1 297 ? 27.781  77.207 -24.179 1.00 48.15 ? 297 PHE A CD2  1 
ATOM   2804 C CE1  . PHE A 1 297 ? 30.517  76.843 -24.007 1.00 49.32 ? 297 PHE A CE1  1 
ATOM   2805 C CE2  . PHE A 1 297 ? 28.525  77.913 -23.236 1.00 47.25 ? 297 PHE A CE2  1 
ATOM   2806 C CZ   . PHE A 1 297 ? 29.887  77.733 -23.150 1.00 47.93 ? 297 PHE A CZ   1 
ATOM   2807 H H    . PHE A 1 297 ? 27.449  74.478 -23.527 1.00 0.00  ? 297 PHE A H    1 
ATOM   2808 N N    . GLY A 1 298 ? 28.631  72.278 -24.749 1.00 52.12 ? 298 GLY A N    1 
ATOM   2809 C CA   . GLY A 1 298 ? 29.728  71.320 -24.742 1.00 59.98 ? 298 GLY A CA   1 
ATOM   2810 C C    . GLY A 1 298 ? 29.580  70.226 -23.696 1.00 65.84 ? 298 GLY A C    1 
ATOM   2811 O O    . GLY A 1 298 ? 28.464  69.779 -23.418 1.00 71.73 ? 298 GLY A O    1 
ATOM   2812 H H    . GLY A 1 298 ? 28.031  72.276 -23.982 1.00 0.00  ? 298 GLY A H    1 
ATOM   2813 N N    . ALA A 1 299 ? 30.712  69.779 -23.156 1.00 68.14 ? 299 ALA A N    1 
ATOM   2814 C CA   . ALA A 1 299 ? 30.805  68.729 -22.136 1.00 70.11 ? 299 ALA A CA   1 
ATOM   2815 C C    . ALA A 1 299 ? 30.034  67.494 -22.579 1.00 71.94 ? 299 ALA A C    1 
ATOM   2816 O O    . ALA A 1 299 ? 28.915  67.269 -22.122 1.00 73.08 ? 299 ALA A O    1 
ATOM   2817 C CB   . ALA A 1 299 ? 30.290  69.235 -20.798 1.00 75.01 ? 299 ALA A CB   1 
ATOM   2818 H H    . ALA A 1 299 ? 31.544  70.096 -23.494 1.00 0.00  ? 299 ALA A H    1 
ATOM   2819 N N    . THR A 1 300 ? 30.649  66.691 -23.452 1.00 78.77 ? 300 THR A N    1 
ATOM   2820 C CA   . THR A 1 300 ? 30.021  65.491 -24.015 1.00 79.72 ? 300 THR A CA   1 
ATOM   2821 C C    . THR A 1 300 ? 28.791  66.014 -24.806 1.00 85.74 ? 300 THR A C    1 
ATOM   2822 O O    . THR A 1 300 ? 27.646  65.570 -24.682 1.00 85.16 ? 300 THR A O    1 
ATOM   2823 C CB   . THR A 1 300 ? 29.752  64.402 -22.899 1.00 84.41 ? 300 THR A CB   1 
ATOM   2824 O OG1  . THR A 1 300 ? 29.967  63.094 -23.443 1.00 90.28 ? 300 THR A OG1  1 
ATOM   2825 C CG2  . THR A 1 300 ? 28.350  64.479 -22.305 1.00 94.29 ? 300 THR A CG2  1 
ATOM   2826 H H    . THR A 1 300 ? 31.571  66.911 -23.694 1.00 0.00  ? 300 THR A H    1 
ATOM   2827 H HG1  . THR A 1 300 ? 29.232  62.920 -24.039 1.00 0.00  ? 300 THR A HG1  1 
ATOM   2828 N N    . THR A 1 301 ? 29.122  66.970 -25.667 1.00 87.03 ? 301 THR A N    1 
ATOM   2829 C CA   . THR A 1 301 ? 28.194  67.714 -26.515 1.00 88.29 ? 301 THR A CA   1 
ATOM   2830 C C    . THR A 1 301 ? 27.312  66.968 -27.515 1.00 89.02 ? 301 THR A C    1 
ATOM   2831 O O    . THR A 1 301 ? 27.258  65.732 -27.529 1.00 80.61 ? 301 THR A O    1 
ATOM   2832 C CB   . THR A 1 301 ? 28.943  68.914 -27.222 1.00 97.92 ? 301 THR A CB   1 
ATOM   2833 O OG1  . THR A 1 301 ? 28.693  68.917 -28.633 1.00 97.84 ? 301 THR A OG1  1 
ATOM   2834 C CG2  . THR A 1 301 ? 30.450  68.842 -26.996 1.00 97.81 ? 301 THR A CG2  1 
ATOM   2835 H H    . THR A 1 301 ? 30.079  67.110 -25.675 1.00 0.00  ? 301 THR A H    1 
ATOM   2836 H HG1  . THR A 1 301 ? 29.179  68.225 -29.092 1.00 0.00  ? 301 THR A HG1  1 
ATOM   2837 N N    . GLY A 1 302 ? 26.604  67.765 -28.321 1.00 88.43 ? 302 GLY A N    1 
ATOM   2838 C CA   . GLY A 1 302 ? 25.709  67.273 -29.352 1.00 86.21 ? 302 GLY A CA   1 
ATOM   2839 C C    . GLY A 1 302 ? 25.077  68.424 -30.127 1.00 75.02 ? 302 GLY A C    1 
ATOM   2840 O O    . GLY A 1 302 ? 25.523  69.577 -30.066 1.00 74.80 ? 302 GLY A O    1 
ATOM   2841 H H    . GLY A 1 302 ? 26.713  68.740 -28.294 1.00 0.00  ? 302 GLY A H    1 
ATOM   2842 N N    . ARG A 1 303 ? 24.013  68.098 -30.848 1.00 73.06 ? 303 ARG A N    1 
ATOM   2843 C CA   . ARG A 1 303 ? 23.275  69.069 -31.654 1.00 70.97 ? 303 ARG A CA   1 
ATOM   2844 C C    . ARG A 1 303 ? 22.016  69.536 -30.928 1.00 69.03 ? 303 ARG A C    1 
ATOM   2845 O O    . ARG A 1 303 ? 21.273  68.714 -30.394 1.00 69.74 ? 303 ARG A O    1 
ATOM   2846 C CB   . ARG A 1 303 ? 22.886  68.436 -32.996 1.00 83.22 ? 303 ARG A CB   1 
ATOM   2847 C CG   . ARG A 1 303 ? 22.742  66.916 -32.932 1.00 85.53 ? 303 ARG A CG   1 
ATOM   2848 C CD   . ARG A 1 303 ? 21.518  66.396 -33.666 1.00 89.88 ? 303 ARG A CD   1 
ATOM   2849 N NE   . ARG A 1 303 ? 21.282  64.977 -33.390 1.00 90.16 ? 303 ARG A NE   1 
ATOM   2850 C CZ   . ARG A 1 303 ? 21.066  64.469 -32.178 1.00 92.35 ? 303 ARG A CZ   1 
ATOM   2851 N NH1  . ARG A 1 303 ? 21.056  65.257 -31.110 1.00 92.39 ? 303 ARG A NH1  1 
ATOM   2852 N NH2  . ARG A 1 303 ? 20.848  63.168 -32.030 1.00 92.41 ? 303 ARG A NH2  1 
ATOM   2853 H H    . ARG A 1 303 ? 23.720  67.175 -30.784 1.00 0.00  ? 303 ARG A H    1 
ATOM   2854 H HE   . ARG A 1 303 ? 21.299  64.382 -34.173 1.00 0.00  ? 303 ARG A HE   1 
ATOM   2855 H HH11 . ARG A 1 303 ? 21.184  66.252 -31.176 1.00 0.00  ? 303 ARG A HH11 1 
ATOM   2856 H HH12 . ARG A 1 303 ? 20.886  64.887 -30.191 1.00 0.00  ? 303 ARG A HH12 1 
ATOM   2857 H HH21 . ARG A 1 303 ? 20.847  62.561 -32.829 1.00 0.00  ? 303 ARG A HH21 1 
ATOM   2858 H HH22 . ARG A 1 303 ? 20.686  62.757 -31.129 1.00 0.00  ? 303 ARG A HH22 1 
ATOM   2859 N N    . ARG A 1 304 ? 21.787  70.845 -30.899 1.00 65.41 ? 304 ARG A N    1 
ATOM   2860 C CA   . ARG A 1 304 ? 20.605  71.406 -30.260 1.00 66.72 ? 304 ARG A CA   1 
ATOM   2861 C C    . ARG A 1 304 ? 20.316  70.815 -28.869 1.00 59.14 ? 304 ARG A C    1 
ATOM   2862 O O    . ARG A 1 304 ? 19.799  69.698 -28.744 1.00 57.83 ? 304 ARG A O    1 
ATOM   2863 C CB   . ARG A 1 304 ? 19.402  71.233 -31.190 1.00 70.63 ? 304 ARG A CB   1 
ATOM   2864 C CG   . ARG A 1 304 ? 18.071  71.628 -30.601 1.00 77.01 ? 304 ARG A CG   1 
ATOM   2865 C CD   . ARG A 1 304 ? 16.967  71.368 -31.600 1.00 83.58 ? 304 ARG A CD   1 
ATOM   2866 N NE   . ARG A 1 304 ? 15.648  71.393 -30.977 1.00 87.06 ? 304 ARG A NE   1 
ATOM   2867 C CZ   . ARG A 1 304 ? 14.573  70.799 -31.485 1.00 89.81 ? 304 ARG A CZ   1 
ATOM   2868 N NH1  . ARG A 1 304 ? 14.654  70.135 -32.632 1.00 99.58 ? 304 ARG A NH1  1 
ATOM   2869 N NH2  . ARG A 1 304 ? 13.419  70.849 -30.832 1.00 99.60 ? 304 ARG A NH2  1 
ATOM   2870 H H    . ARG A 1 304 ? 22.447  71.447 -31.296 1.00 0.00  ? 304 ARG A H    1 
ATOM   2871 H HE   . ARG A 1 304 ? 15.585  71.900 -30.134 1.00 0.00  ? 304 ARG A HE   1 
ATOM   2872 H HH11 . ARG A 1 304 ? 15.533  70.041 -33.111 1.00 0.00  ? 304 ARG A HH11 1 
ATOM   2873 H HH12 . ARG A 1 304 ? 13.873  69.663 -33.042 1.00 0.00  ? 304 ARG A HH12 1 
ATOM   2874 H HH21 . ARG A 1 304 ? 13.361  71.349 -29.962 1.00 0.00  ? 304 ARG A HH21 1 
ATOM   2875 H HH22 . ARG A 1 304 ? 12.595  70.416 -31.196 1.00 0.00  ? 304 ARG A HH22 1 
ATOM   2876 N N    . ARG A 1 305 ? 20.710  71.562 -27.835 1.00 45.18 ? 305 ARG A N    1 
ATOM   2877 C CA   . ARG A 1 305 ? 20.501  71.176 -26.445 1.00 40.64 ? 305 ARG A CA   1 
ATOM   2878 C C    . ARG A 1 305 ? 19.533  72.192 -25.864 1.00 40.10 ? 305 ARG A C    1 
ATOM   2879 O O    . ARG A 1 305 ? 19.928  73.327 -25.571 1.00 38.48 ? 305 ARG A O    1 
ATOM   2880 C CB   . ARG A 1 305 ? 21.813  71.222 -25.647 1.00 37.52 ? 305 ARG A CB   1 
ATOM   2881 C CG   . ARG A 1 305 ? 21.645  70.850 -24.159 1.00 36.41 ? 305 ARG A CG   1 
ATOM   2882 C CD   . ARG A 1 305 ? 22.977  70.763 -23.332 1.00 33.93 ? 305 ARG A CD   1 
ATOM   2883 N NE   . ARG A 1 305 ? 23.832  69.586 -23.575 1.00 29.69 ? 305 ARG A NE   1 
ATOM   2884 C CZ   . ARG A 1 305 ? 25.168  69.597 -23.522 1.00 26.73 ? 305 ARG A CZ   1 
ATOM   2885 N NH1  . ARG A 1 305 ? 25.824  70.705 -23.239 1.00 23.55 ? 305 ARG A NH1  1 
ATOM   2886 N NH2  . ARG A 1 305 ? 25.863  68.497 -23.735 1.00 24.41 ? 305 ARG A NH2  1 
ATOM   2887 H H    . ARG A 1 305 ? 21.179  72.398 -28.012 1.00 0.00  ? 305 ARG A H    1 
ATOM   2888 H HE   . ARG A 1 305 ? 23.392  68.717 -23.714 1.00 0.00  ? 305 ARG A HE   1 
ATOM   2889 H HH11 . ARG A 1 305 ? 25.307  71.526 -23.012 1.00 0.00  ? 305 ARG A HH11 1 
ATOM   2890 H HH12 . ARG A 1 305 ? 26.822  70.641 -23.155 1.00 0.00  ? 305 ARG A HH12 1 
ATOM   2891 H HH21 . ARG A 1 305 ? 25.426  67.603 -23.882 1.00 0.00  ? 305 ARG A HH21 1 
ATOM   2892 H HH22 . ARG A 1 305 ? 26.861  68.528 -23.634 1.00 0.00  ? 305 ARG A HH22 1 
ATOM   2893 N N    . ARG A 1 306 ? 18.269  71.810 -25.732 1.00 37.00 ? 306 ARG A N    1 
ATOM   2894 C CA   . ARG A 1 306 ? 17.284  72.726 -25.179 1.00 36.92 ? 306 ARG A CA   1 
ATOM   2895 C C    . ARG A 1 306 ? 17.352  72.785 -23.659 1.00 37.61 ? 306 ARG A C    1 
ATOM   2896 O O    . ARG A 1 306 ? 18.203  72.130 -23.052 1.00 38.23 ? 306 ARG A O    1 
ATOM   2897 C CB   . ARG A 1 306 ? 15.855  72.376 -25.626 1.00 36.51 ? 306 ARG A CB   1 
ATOM   2898 C CG   . ARG A 1 306 ? 15.595  70.957 -26.085 1.00 31.30 ? 306 ARG A CG   1 
ATOM   2899 C CD   . ARG A 1 306 ? 15.794  70.829 -27.580 1.00 27.43 ? 306 ARG A CD   1 
ATOM   2900 N NE   . ARG A 1 306 ? 15.423  69.500 -28.057 1.00 24.56 ? 306 ARG A NE   1 
ATOM   2901 C CZ   . ARG A 1 306 ? 14.176  69.030 -28.089 1.00 20.56 ? 306 ARG A CZ   1 
ATOM   2902 N NH1  . ARG A 1 306 ? 13.159  69.782 -27.683 1.00 20.48 ? 306 ARG A NH1  1 
ATOM   2903 N NH2  . ARG A 1 306 ? 13.968  67.762 -28.435 1.00 18.88 ? 306 ARG A NH2  1 
ATOM   2904 H H    . ARG A 1 306 ? 18.070  70.877 -25.963 1.00 0.00  ? 306 ARG A H    1 
ATOM   2905 H HE   . ARG A 1 306 ? 16.135  68.883 -28.356 1.00 0.00  ? 306 ARG A HE   1 
ATOM   2906 H HH11 . ARG A 1 306 ? 13.283  70.713 -27.323 1.00 0.00  ? 306 ARG A HH11 1 
ATOM   2907 H HH12 . ARG A 1 306 ? 12.223  69.419 -27.670 1.00 0.00  ? 306 ARG A HH12 1 
ATOM   2908 H HH21 . ARG A 1 306 ? 14.805  67.225 -28.619 1.00 0.00  ? 306 ARG A HH21 1 
ATOM   2909 H HH22 . ARG A 1 306 ? 13.074  67.298 -28.401 1.00 0.00  ? 306 ARG A HH22 1 
ATOM   2910 N N    . THR A 1 307 ? 16.438  73.542 -23.045 1.00 37.18 ? 307 THR A N    1 
ATOM   2911 C CA   . THR A 1 307 ? 16.388  73.691 -21.591 1.00 36.03 ? 307 THR A CA   1 
ATOM   2912 C C    . THR A 1 307 ? 14.948  73.830 -21.101 1.00 35.68 ? 307 THR A C    1 
ATOM   2913 O O    . THR A 1 307 ? 14.043  74.168 -21.893 1.00 36.79 ? 307 THR A O    1 
ATOM   2914 C CB   . THR A 1 307 ? 17.142  74.949 -21.154 1.00 36.58 ? 307 THR A CB   1 
ATOM   2915 O OG1  . THR A 1 307 ? 16.562  76.087 -21.809 1.00 36.61 ? 307 THR A OG1  1 
ATOM   2916 C CG2  . THR A 1 307 ? 18.625  74.849 -21.526 1.00 36.29 ? 307 THR A CG2  1 
ATOM   2917 H H    . THR A 1 307 ? 15.759  74.041 -23.544 1.00 0.00  ? 307 THR A H    1 
ATOM   2918 H HG1  . THR A 1 307 ? 17.153  76.825 -21.646 1.00 0.00  ? 307 THR A HG1  1 
ATOM   2919 N N    . GLY A 1 308 ? 14.734  73.597 -19.802 1.00 32.94 ? 308 GLY A N    1 
ATOM   2920 C CA   . GLY A 1 308 ? 13.401  73.715 -19.226 1.00 27.97 ? 308 GLY A CA   1 
ATOM   2921 C C    . GLY A 1 308 ? 13.389  73.563 -17.719 1.00 26.97 ? 308 GLY A C    1 
ATOM   2922 O O    . GLY A 1 308 ? 14.391  73.185 -17.081 1.00 24.92 ? 308 GLY A O    1 
ATOM   2923 H H    . GLY A 1 308 ? 15.470  73.290 -19.227 1.00 0.00  ? 308 GLY A H    1 
ATOM   2924 N N    . TRP A 1 309 ? 12.252  73.863 -17.112 1.00 27.19 ? 309 TRP A N    1 
ATOM   2925 C CA   . TRP A 1 309 ? 12.159  73.717 -15.654 1.00 28.33 ? 309 TRP A CA   1 
ATOM   2926 C C    . TRP A 1 309 ? 12.173  72.235 -15.335 1.00 26.76 ? 309 TRP A C    1 
ATOM   2927 O O    . TRP A 1 309 ? 11.855  71.427 -16.182 1.00 28.66 ? 309 TRP A O    1 
ATOM   2928 C CB   . TRP A 1 309 ? 10.869  74.352 -15.098 1.00 30.03 ? 309 TRP A CB   1 
ATOM   2929 C CG   . TRP A 1 309 ? 10.783  75.861 -15.280 1.00 30.94 ? 309 TRP A CG   1 
ATOM   2930 C CD1  . TRP A 1 309 ? 9.791   76.537 -15.913 1.00 32.63 ? 309 TRP A CD1  1 
ATOM   2931 C CD2  . TRP A 1 309 ? 11.735  76.855 -14.856 1.00 31.87 ? 309 TRP A CD2  1 
ATOM   2932 N NE1  . TRP A 1 309 ? 10.057  77.881 -15.917 1.00 32.93 ? 309 TRP A NE1  1 
ATOM   2933 C CE2  . TRP A 1 309 ? 11.244  78.105 -15.275 1.00 32.09 ? 309 TRP A CE2  1 
ATOM   2934 C CE3  . TRP A 1 309 ? 12.961  76.807 -14.173 1.00 34.31 ? 309 TRP A CE3  1 
ATOM   2935 C CZ2  . TRP A 1 309 ? 11.929  79.300 -15.036 1.00 32.03 ? 309 TRP A CZ2  1 
ATOM   2936 C CZ3  . TRP A 1 309 ? 13.642  77.989 -13.938 1.00 32.12 ? 309 TRP A CZ3  1 
ATOM   2937 C CH2  . TRP A 1 309 ? 13.124  79.221 -14.370 1.00 32.69 ? 309 TRP A CH2  1 
ATOM   2938 H H    . TRP A 1 309 ? 11.471  74.124 -17.641 1.00 0.00  ? 309 TRP A H    1 
ATOM   2939 H HE1  . TRP A 1 309 ? 9.546   78.541 -16.427 1.00 0.00  ? 309 TRP A HE1  1 
ATOM   2940 N N    . LEU A 1 310 ? 12.604  71.864 -14.144 1.00 25.30 ? 310 LEU A N    1 
ATOM   2941 C CA   . LEU A 1 310 ? 12.616  70.460 -13.756 1.00 20.75 ? 310 LEU A CA   1 
ATOM   2942 C C    . LEU A 1 310 ? 11.211  69.886 -13.935 1.00 19.33 ? 310 LEU A C    1 
ATOM   2943 O O    . LEU A 1 310 ? 10.209  70.535 -13.623 1.00 19.05 ? 310 LEU A O    1 
ATOM   2944 C CB   . LEU A 1 310 ? 12.987  70.345 -12.293 1.00 21.44 ? 310 LEU A CB   1 
ATOM   2945 C CG   . LEU A 1 310 ? 13.511  69.027 -11.773 1.00 23.72 ? 310 LEU A CG   1 
ATOM   2946 C CD1  . LEU A 1 310 ? 14.693  68.548 -12.652 1.00 23.92 ? 310 LEU A CD1  1 
ATOM   2947 C CD2  . LEU A 1 310 ? 13.949  69.239 -10.324 1.00 24.23 ? 310 LEU A CD2  1 
ATOM   2948 H H    . LEU A 1 310 ? 12.897  72.537 -13.498 1.00 0.00  ? 310 LEU A H    1 
ATOM   2949 N N    . ASP A 1 311 ? 11.155  68.662 -14.440 1.00 18.28 ? 311 ASP A N    1 
ATOM   2950 C CA   . ASP A 1 311 ? 9.913   67.964 -14.683 1.00 15.60 ? 311 ASP A CA   1 
ATOM   2951 C C    . ASP A 1 311 ? 9.740   66.946 -13.570 1.00 13.07 ? 311 ASP A C    1 
ATOM   2952 O O    . ASP A 1 311 ? 10.243  65.849 -13.694 1.00 14.81 ? 311 ASP A O    1 
ATOM   2953 C CB   . ASP A 1 311 ? 10.009  67.239 -16.039 1.00 15.43 ? 311 ASP A CB   1 
ATOM   2954 C CG   . ASP A 1 311 ? 8.668   67.103 -16.732 1.00 19.82 ? 311 ASP A CG   1 
ATOM   2955 O OD1  . ASP A 1 311 ? 7.659   66.768 -16.068 1.00 18.42 ? 311 ASP A OD1  1 
ATOM   2956 O OD2  . ASP A 1 311 ? 8.606   67.319 -17.962 1.00 20.69 ? 311 ASP A OD2  1 
ATOM   2957 H H    . ASP A 1 311 ? 11.990  68.224 -14.691 1.00 0.00  ? 311 ASP A H    1 
ATOM   2958 N N    . THR A 1 312 ? 9.061   67.287 -12.476 1.00 12.99 ? 312 THR A N    1 
ATOM   2959 C CA   . THR A 1 312 ? 8.881   66.309 -11.403 1.00 12.98 ? 312 THR A CA   1 
ATOM   2960 C C    . THR A 1 312 ? 7.870   65.207 -11.726 1.00 14.80 ? 312 THR A C    1 
ATOM   2961 O O    . THR A 1 312 ? 7.494   64.430 -10.842 1.00 16.75 ? 312 THR A O    1 
ATOM   2962 C CB   . THR A 1 312 ? 8.517   66.927 -10.050 1.00 11.43 ? 312 THR A CB   1 
ATOM   2963 O OG1  . THR A 1 312 ? 7.187   67.459 -10.092 1.00 12.05 ? 312 THR A OG1  1 
ATOM   2964 C CG2  . THR A 1 312 ? 9.527   67.993 -9.637  1.00 6.93  ? 312 THR A CG2  1 
ATOM   2965 H H    . THR A 1 312 ? 8.668   68.180 -12.380 1.00 0.00  ? 312 THR A H    1 
ATOM   2966 H HG1  . THR A 1 312 ? 7.081   68.253 -10.678 1.00 0.00  ? 312 THR A HG1  1 
ATOM   2967 N N    . VAL A 1 313 ? 7.435   65.129 -12.986 1.00 15.91 ? 313 VAL A N    1 
ATOM   2968 C CA   . VAL A 1 313 ? 6.501   64.092 -13.396 1.00 15.02 ? 313 VAL A CA   1 
ATOM   2969 C C    . VAL A 1 313 ? 7.396   62.964 -13.966 1.00 18.61 ? 313 VAL A C    1 
ATOM   2970 O O    . VAL A 1 313 ? 7.272   61.773 -13.611 1.00 19.18 ? 313 VAL A O    1 
ATOM   2971 C CB   . VAL A 1 313 ? 5.541   64.626 -14.472 1.00 15.93 ? 313 VAL A CB   1 
ATOM   2972 C CG1  . VAL A 1 313 ? 4.866   63.488 -15.168 1.00 14.09 ? 313 VAL A CG1  1 
ATOM   2973 C CG2  . VAL A 1 313 ? 4.508   65.576 -13.853 1.00 9.46  ? 313 VAL A CG2  1 
ATOM   2974 H H    . VAL A 1 313 ? 7.697   65.776 -13.673 1.00 0.00  ? 313 VAL A H    1 
ATOM   2975 N N    . ALA A 1 314 ? 8.337   63.369 -14.812 1.00 19.54 ? 314 ALA A N    1 
ATOM   2976 C CA   . ALA A 1 314 ? 9.284   62.448 -15.406 1.00 17.21 ? 314 ALA A CA   1 
ATOM   2977 C C    . ALA A 1 314 ? 10.300  61.992 -14.338 1.00 17.30 ? 314 ALA A C    1 
ATOM   2978 O O    . ALA A 1 314 ? 10.729  60.845 -14.332 1.00 17.93 ? 314 ALA A O    1 
ATOM   2979 C CB   . ALA A 1 314 ? 10.001  63.133 -16.560 1.00 17.17 ? 314 ALA A CB   1 
ATOM   2980 H H    . ALA A 1 314 ? 8.361   64.312 -15.090 1.00 0.00  ? 314 ALA A H    1 
ATOM   2981 N N    . VAL A 1 315 ? 10.712  62.877 -13.443 1.00 16.93 ? 315 VAL A N    1 
ATOM   2982 C CA   . VAL A 1 315 ? 11.657  62.472 -12.404 1.00 16.79 ? 315 VAL A CA   1 
ATOM   2983 C C    . VAL A 1 315 ? 10.991  61.503 -11.406 1.00 18.54 ? 315 VAL A C    1 
ATOM   2984 O O    . VAL A 1 315 ? 11.663  60.670 -10.779 1.00 20.99 ? 315 VAL A O    1 
ATOM   2985 C CB   . VAL A 1 315 ? 12.231  63.680 -11.718 1.00 15.15 ? 315 VAL A CB   1 
ATOM   2986 C CG1  . VAL A 1 315 ? 13.093  63.295 -10.570 1.00 10.98 ? 315 VAL A CG1  1 
ATOM   2987 C CG2  . VAL A 1 315 ? 12.986  64.466 -12.711 1.00 15.76 ? 315 VAL A CG2  1 
ATOM   2988 H H    . VAL A 1 315 ? 10.446  63.819 -13.510 1.00 0.00  ? 315 VAL A H    1 
ATOM   2989 N N    . ARG A 1 316 ? 9.665   61.604 -11.284 1.00 18.71 ? 316 ARG A N    1 
ATOM   2990 C CA   . ARG A 1 316 ? 8.889   60.712 -10.419 1.00 19.61 ? 316 ARG A CA   1 
ATOM   2991 C C    . ARG A 1 316 ? 8.806   59.355 -11.177 1.00 19.83 ? 316 ARG A C    1 
ATOM   2992 O O    . ARG A 1 316 ? 8.526   58.297 -10.599 1.00 20.69 ? 316 ARG A O    1 
ATOM   2993 C CB   . ARG A 1 316 ? 7.481   61.325 -10.206 1.00 20.34 ? 316 ARG A CB   1 
ATOM   2994 C CG   . ARG A 1 316 ? 6.574   60.619 -9.190  1.00 24.78 ? 316 ARG A CG   1 
ATOM   2995 C CD   . ARG A 1 316 ? 5.220   61.314 -9.007  1.00 26.18 ? 316 ARG A CD   1 
ATOM   2996 N NE   . ARG A 1 316 ? 5.330   62.731 -8.597  1.00 25.75 ? 316 ARG A NE   1 
ATOM   2997 C CZ   . ARG A 1 316 ? 4.865   63.764 -9.309  1.00 25.28 ? 316 ARG A CZ   1 
ATOM   2998 N NH1  . ARG A 1 316 ? 4.258   63.551 -10.476 1.00 27.97 ? 316 ARG A NH1  1 
ATOM   2999 N NH2  . ARG A 1 316 ? 4.980   65.013 -8.850  1.00 24.27 ? 316 ARG A NH2  1 
ATOM   3000 H H    . ARG A 1 316 ? 9.186   62.296 -11.783 1.00 0.00  ? 316 ARG A H    1 
ATOM   3001 H HE   . ARG A 1 316 ? 5.777   62.946 -7.746  1.00 0.00  ? 316 ARG A HE   1 
ATOM   3002 H HH11 . ARG A 1 316 ? 4.127   62.631 -10.844 1.00 0.00  ? 316 ARG A HH11 1 
ATOM   3003 H HH12 . ARG A 1 316 ? 3.903   64.312 -11.013 1.00 0.00  ? 316 ARG A HH12 1 
ATOM   3004 H HH21 . ARG A 1 316 ? 5.416   65.165 -7.965  1.00 0.00  ? 316 ARG A HH21 1 
ATOM   3005 H HH22 . ARG A 1 316 ? 4.651   65.804 -9.363  1.00 0.00  ? 316 ARG A HH22 1 
ATOM   3006 N N    . ARG A 1 317 ? 9.006   59.394 -12.486 1.00 19.26 ? 317 ARG A N    1 
ATOM   3007 C CA   . ARG A 1 317 ? 8.948   58.190 -13.280 1.00 16.39 ? 317 ARG A CA   1 
ATOM   3008 C C    . ARG A 1 317 ? 10.287  57.487 -13.177 1.00 16.55 ? 317 ARG A C    1 
ATOM   3009 O O    . ARG A 1 317 ? 10.360  56.256 -13.320 1.00 16.36 ? 317 ARG A O    1 
ATOM   3010 C CB   . ARG A 1 317 ? 8.655   58.526 -14.733 1.00 17.50 ? 317 ARG A CB   1 
ATOM   3011 C CG   . ARG A 1 317 ? 8.783   57.365 -15.705 1.00 16.46 ? 317 ARG A CG   1 
ATOM   3012 C CD   . ARG A 1 317 ? 7.677   56.308 -15.559 1.00 19.58 ? 317 ARG A CD   1 
ATOM   3013 N NE   . ARG A 1 317 ? 6.318   56.808 -15.768 1.00 20.76 ? 317 ARG A NE   1 
ATOM   3014 C CZ   . ARG A 1 317 ? 5.234   56.031 -15.932 1.00 22.43 ? 317 ARG A CZ   1 
ATOM   3015 N NH1  . ARG A 1 317 ? 5.341   54.713 -15.944 1.00 22.92 ? 317 ARG A NH1  1 
ATOM   3016 N NH2  . ARG A 1 317 ? 4.006   56.565 -15.979 1.00 27.80 ? 317 ARG A NH2  1 
ATOM   3017 H H    . ARG A 1 317 ? 9.167   60.242 -12.939 1.00 0.00  ? 317 ARG A H    1 
ATOM   3018 H HE   . ARG A 1 317 ? 6.232   57.781 -15.796 1.00 0.00  ? 317 ARG A HE   1 
ATOM   3019 H HH11 . ARG A 1 317 ? 6.213   54.234 -15.838 1.00 0.00  ? 317 ARG A HH11 1 
ATOM   3020 H HH12 . ARG A 1 317 ? 4.506   54.155 -16.058 1.00 0.00  ? 317 ARG A HH12 1 
ATOM   3021 H HH21 . ARG A 1 317 ? 3.823   57.545 -15.940 1.00 0.00  ? 317 ARG A HH21 1 
ATOM   3022 H HH22 . ARG A 1 317 ? 3.188   55.965 -16.106 1.00 0.00  ? 317 ARG A HH22 1 
ATOM   3023 N N    . ALA A 1 318 ? 11.356  58.279 -13.059 1.00 14.61 ? 318 ALA A N    1 
ATOM   3024 C CA   . ALA A 1 318 ? 12.693  57.733 -12.918 1.00 12.83 ? 318 ALA A CA   1 
ATOM   3025 C C    . ALA A 1 318 ? 12.756  57.038 -11.531 1.00 15.73 ? 318 ALA A C    1 
ATOM   3026 O O    . ALA A 1 318 ? 13.225  55.904 -11.420 1.00 16.60 ? 318 ALA A O    1 
ATOM   3027 C CB   . ALA A 1 318 ? 13.710  58.835 -13.046 1.00 12.02 ? 318 ALA A CB   1 
ATOM   3028 H H    . ALA A 1 318 ? 11.225  59.249 -13.148 1.00 0.00  ? 318 ALA A H    1 
ATOM   3029 N N    . VAL A 1 319 ? 12.199  57.678 -10.496 1.00 16.99 ? 319 VAL A N    1 
ATOM   3030 C CA   . VAL A 1 319 ? 12.166  57.096 -9.147  1.00 15.17 ? 319 VAL A CA   1 
ATOM   3031 C C    . VAL A 1 319 ? 11.701  55.607 -9.128  1.00 15.78 ? 319 VAL A C    1 
ATOM   3032 O O    . VAL A 1 319 ? 12.334  54.750 -8.483  1.00 14.71 ? 319 VAL A O    1 
ATOM   3033 C CB   . VAL A 1 319 ? 11.321  57.965 -8.198  1.00 11.34 ? 319 VAL A CB   1 
ATOM   3034 C CG1  . VAL A 1 319 ? 11.039  57.209 -6.915  1.00 11.45 ? 319 VAL A CG1  1 
ATOM   3035 C CG2  . VAL A 1 319 ? 12.092  59.212 -7.839  1.00 5.01  ? 319 VAL A CG2  1 
ATOM   3036 H H    . VAL A 1 319 ? 11.861  58.592 -10.631 1.00 0.00  ? 319 VAL A H    1 
ATOM   3037 N N    . GLN A 1 320 ? 10.622  55.326 -9.861  1.00 15.56 ? 320 GLN A N    1 
ATOM   3038 C CA   . GLN A 1 320 ? 10.076  53.962 -10.014 1.00 15.79 ? 320 GLN A CA   1 
ATOM   3039 C C    . GLN A 1 320 ? 11.036  53.091 -10.820 1.00 13.69 ? 320 GLN A C    1 
ATOM   3040 O O    . GLN A 1 320 ? 11.611  52.138 -10.288 1.00 18.12 ? 320 GLN A O    1 
ATOM   3041 C CB   . GLN A 1 320 ? 8.699   53.963 -10.734 1.00 19.10 ? 320 GLN A CB   1 
ATOM   3042 C CG   . GLN A 1 320 ? 7.653   54.794 -10.004 1.00 21.68 ? 320 GLN A CG   1 
ATOM   3043 C CD   . GLN A 1 320 ? 6.325   54.881 -10.710 1.00 25.84 ? 320 GLN A CD   1 
ATOM   3044 O OE1  . GLN A 1 320 ? 6.241   54.723 -11.928 1.00 28.88 ? 320 GLN A OE1  1 
ATOM   3045 N NE2  . GLN A 1 320 ? 5.264   55.133 -9.944  1.00 29.29 ? 320 GLN A NE2  1 
ATOM   3046 H H    . GLN A 1 320 ? 10.156  56.068 -10.296 1.00 0.00  ? 320 GLN A H    1 
ATOM   3047 H HE21 . GLN A 1 320 ? 4.399   55.236 -10.387 1.00 0.00  ? 320 GLN A HE21 1 
ATOM   3048 H HE22 . GLN A 1 320 ? 5.381   55.212 -8.973  1.00 0.00  ? 320 GLN A HE22 1 
ATOM   3049 N N    . LEU A 1 321 ? 11.319  53.471 -12.053 1.00 10.22 ? 321 LEU A N    1 
ATOM   3050 C CA   . LEU A 1 321 ? 12.159  52.616 -12.873 1.00 8.90  ? 321 LEU A CA   1 
ATOM   3051 C C    . LEU A 1 321 ? 13.403  52.044 -12.201 1.00 9.49  ? 321 LEU A C    1 
ATOM   3052 O O    . LEU A 1 321 ? 13.668  50.841 -12.311 1.00 5.01  ? 321 LEU A O    1 
ATOM   3053 C CB   . LEU A 1 321 ? 12.532  53.315 -14.178 1.00 9.69  ? 321 LEU A CB   1 
ATOM   3054 C CG   . LEU A 1 321 ? 11.355  53.684 -15.086 1.00 9.00  ? 321 LEU A CG   1 
ATOM   3055 C CD1  . LEU A 1 321 ? 11.870  54.420 -16.323 1.00 10.15 ? 321 LEU A CD1  1 
ATOM   3056 C CD2  . LEU A 1 321 ? 10.540  52.452 -15.471 1.00 5.01  ? 321 LEU A CD2  1 
ATOM   3057 H H    . LEU A 1 321 ? 10.974  54.311 -12.428 1.00 0.00  ? 321 LEU A H    1 
ATOM   3058 N N    . ASN A 1 322 ? 14.080  52.906 -11.426 1.00 10.63 ? 322 ASN A N    1 
ATOM   3059 C CA   . ASN A 1 322 ? 15.343  52.629 -10.752 1.00 10.03 ? 322 ASN A CA   1 
ATOM   3060 C C    . ASN A 1 322 ? 15.252  52.352 -9.264  1.00 12.72 ? 322 ASN A C    1 
ATOM   3061 O O    . ASN A 1 322 ? 16.282  52.067 -8.622  1.00 11.14 ? 322 ASN A O    1 
ATOM   3062 C CB   . ASN A 1 322 ? 16.241  53.847 -10.947 1.00 10.41 ? 322 ASN A CB   1 
ATOM   3063 C CG   . ASN A 1 322 ? 16.760  53.984 -12.385 1.00 10.36 ? 322 ASN A CG   1 
ATOM   3064 O OD1  . ASN A 1 322 ? 17.136  52.997 -13.000 1.00 8.22  ? 322 ASN A OD1  1 
ATOM   3065 N ND2  . ASN A 1 322 ? 16.800  55.195 -12.906 1.00 8.09  ? 322 ASN A ND2  1 
ATOM   3066 H H    . ASN A 1 322 ? 13.706  53.808 -11.339 1.00 0.00  ? 322 ASN A H    1 
ATOM   3067 H HD21 . ASN A 1 322 ? 17.147  55.368 -13.812 1.00 0.00  ? 322 ASN A HD21 1 
ATOM   3068 H HD22 . ASN A 1 322 ? 16.480  55.922 -12.340 1.00 0.00  ? 322 ASN A HD22 1 
ATOM   3069 N N    . SER A 1 323 ? 14.034  52.355 -8.718  1.00 14.37 ? 323 SER A N    1 
ATOM   3070 C CA   . SER A 1 323 ? 13.861  52.197 -7.270  1.00 15.07 ? 323 SER A CA   1 
ATOM   3071 C C    . SER A 1 323 ? 14.902  53.105 -6.541  1.00 14.06 ? 323 SER A C    1 
ATOM   3072 O O    . SER A 1 323 ? 15.688  52.631 -5.678  1.00 14.31 ? 323 SER A O    1 
ATOM   3073 C CB   . SER A 1 323 ? 13.949  50.705 -6.822  1.00 12.86 ? 323 SER A CB   1 
ATOM   3074 O OG   . SER A 1 323 ? 15.052  50.009 -7.400  1.00 19.86 ? 323 SER A OG   1 
ATOM   3075 H H    . SER A 1 323 ? 13.233  52.415 -9.286  1.00 0.00  ? 323 SER A H    1 
ATOM   3076 H HG   . SER A 1 323 ? 15.772  50.666 -7.519  1.00 0.00  ? 323 SER A HG   1 
ATOM   3077 N N    . LEU A 1 324 ? 14.922  54.398 -6.897  1.00 14.78 ? 324 LEU A N    1 
ATOM   3078 C CA   . LEU A 1 324 ? 15.913  55.333 -6.292  1.00 15.58 ? 324 LEU A CA   1 
ATOM   3079 C C    . LEU A 1 324 ? 15.784  55.449 -4.809  1.00 15.39 ? 324 LEU A C    1 
ATOM   3080 O O    . LEU A 1 324 ? 14.677  55.459 -4.279  1.00 15.83 ? 324 LEU A O    1 
ATOM   3081 C CB   . LEU A 1 324 ? 15.805  56.743 -6.822  1.00 12.42 ? 324 LEU A CB   1 
ATOM   3082 C CG   . LEU A 1 324 ? 15.942  56.897 -8.300  1.00 11.11 ? 324 LEU A CG   1 
ATOM   3083 C CD1  . LEU A 1 324 ? 15.431  58.272 -8.756  1.00 5.10  ? 324 LEU A CD1  1 
ATOM   3084 C CD2  . LEU A 1 324 ? 17.364  56.614 -8.663  1.00 7.96  ? 324 LEU A CD2  1 
ATOM   3085 H H    . LEU A 1 324 ? 14.226  54.694 -7.522  1.00 0.00  ? 324 LEU A H    1 
ATOM   3086 N N    . SER A 1 325 ? 16.934  55.640 -4.172  1.00 15.76 ? 325 SER A N    1 
ATOM   3087 C CA   . SER A 1 325 ? 17.019  55.798 -2.727  1.00 12.19 ? 325 SER A CA   1 
ATOM   3088 C C    . SER A 1 325 ? 17.311  57.250 -2.332  1.00 13.25 ? 325 SER A C    1 
ATOM   3089 O O    . SER A 1 325 ? 16.859  57.699 -1.254  1.00 15.55 ? 325 SER A O    1 
ATOM   3090 C CB   . SER A 1 325 ? 18.136  54.909 -2.165  1.00 7.94  ? 325 SER A CB   1 
ATOM   3091 O OG   . SER A 1 325 ? 18.024  53.625 -2.705  1.00 5.01  ? 325 SER A OG   1 
ATOM   3092 H H    . SER A 1 325 ? 17.771  55.673 -4.685  1.00 0.00  ? 325 SER A H    1 
ATOM   3093 H HG   . SER A 1 325 ? 17.146  53.303 -2.489  1.00 0.00  ? 325 SER A HG   1 
ATOM   3094 N N    . GLY A 1 326 ? 18.116  57.945 -3.154  1.00 13.39 ? 326 GLY A N    1 
ATOM   3095 C CA   . GLY A 1 326 ? 18.474  59.312 -2.845  1.00 10.26 ? 326 GLY A CA   1 
ATOM   3096 C C    . GLY A 1 326 ? 18.978  60.075 -4.042  1.00 12.29 ? 326 GLY A C    1 
ATOM   3097 O O    . GLY A 1 326 ? 19.486  59.462 -5.000  1.00 12.01 ? 326 GLY A O    1 
ATOM   3098 H H    . GLY A 1 326 ? 18.497  57.546 -3.965  1.00 0.00  ? 326 GLY A H    1 
ATOM   3099 N N    . PHE A 1 327 ? 18.848  61.405 -4.013  1.00 11.79 ? 327 PHE A N    1 
ATOM   3100 C CA   . PHE A 1 327 ? 19.312  62.233 -5.131  1.00 11.78 ? 327 PHE A CA   1 
ATOM   3101 C C    . PHE A 1 327 ? 20.654  62.881 -4.921  1.00 13.40 ? 327 PHE A C    1 
ATOM   3102 O O    . PHE A 1 327 ? 21.072  63.054 -3.811  1.00 16.03 ? 327 PHE A O    1 
ATOM   3103 C CB   . PHE A 1 327 ? 18.338  63.376 -5.388  1.00 10.23 ? 327 PHE A CB   1 
ATOM   3104 C CG   . PHE A 1 327 ? 17.105  62.976 -6.089  1.00 10.06 ? 327 PHE A CG   1 
ATOM   3105 C CD1  . PHE A 1 327 ? 17.165  62.273 -7.277  1.00 9.80  ? 327 PHE A CD1  1 
ATOM   3106 C CD2  . PHE A 1 327 ? 15.858  63.311 -5.566  1.00 9.43  ? 327 PHE A CD2  1 
ATOM   3107 C CE1  . PHE A 1 327 ? 15.992  61.909 -7.927  1.00 11.42 ? 327 PHE A CE1  1 
ATOM   3108 C CE2  . PHE A 1 327 ? 14.670  62.933 -6.240  1.00 10.58 ? 327 PHE A CE2  1 
ATOM   3109 C CZ   . PHE A 1 327 ? 14.741  62.245 -7.393  1.00 6.97  ? 327 PHE A CZ   1 
ATOM   3110 H H    . PHE A 1 327 ? 18.396  61.776 -3.218  1.00 0.00  ? 327 PHE A H    1 
ATOM   3111 N N    . CYS A 1 328 ? 21.351  63.204 -6.005  1.00 16.53 ? 328 CYS A N    1 
ATOM   3112 C CA   . CYS A 1 328 ? 22.603  63.972 -5.910  1.00 16.73 ? 328 CYS A CA   1 
ATOM   3113 C C    . CYS A 1 328 ? 22.362  65.149 -6.848  1.00 18.64 ? 328 CYS A C    1 
ATOM   3114 O O    . CYS A 1 328 ? 22.701  65.094 -8.053  1.00 16.26 ? 328 CYS A O    1 
ATOM   3115 C CB   . CYS A 1 328 ? 23.843  63.226 -6.377  1.00 18.36 ? 328 CYS A CB   1 
ATOM   3116 S SG   . CYS A 1 328 ? 25.208  64.459 -6.718  1.00 21.33 ? 328 CYS A SG   1 
ATOM   3117 H H    . CYS A 1 328 ? 21.019  62.909 -6.881  1.00 0.00  ? 328 CYS A H    1 
ATOM   3118 N N    . LEU A 1 329 ? 21.667  66.158 -6.304  1.00 19.07 ? 329 LEU A N    1 
ATOM   3119 C CA   . LEU A 1 329 ? 21.301  67.375 -7.026  1.00 19.39 ? 329 LEU A CA   1 
ATOM   3120 C C    . LEU A 1 329 ? 22.515  68.087 -7.574  1.00 21.25 ? 329 LEU A C    1 
ATOM   3121 O O    . LEU A 1 329 ? 23.450  68.330 -6.828  1.00 22.74 ? 329 LEU A O    1 
ATOM   3122 C CB   . LEU A 1 329 ? 20.562  68.347 -6.105  1.00 20.84 ? 329 LEU A CB   1 
ATOM   3123 C CG   . LEU A 1 329 ? 20.077  69.602 -6.853  1.00 21.04 ? 329 LEU A CG   1 
ATOM   3124 C CD1  . LEU A 1 329 ? 19.270  69.115 -8.087  1.00 19.93 ? 329 LEU A CD1  1 
ATOM   3125 C CD2  . LEU A 1 329 ? 19.256  70.538 -5.937  1.00 21.83 ? 329 LEU A CD2  1 
ATOM   3126 H H    . LEU A 1 329 ? 21.475  66.101 -5.350  1.00 0.00  ? 329 LEU A H    1 
ATOM   3127 N N    . THR A 1 330 ? 22.477  68.415 -8.862  1.00 22.38 ? 330 THR A N    1 
ATOM   3128 C CA   . THR A 1 330 ? 23.558  69.107 -9.545  1.00 23.08 ? 330 THR A CA   1 
ATOM   3129 C C    . THR A 1 330 ? 23.153  70.455 -10.186 1.00 25.43 ? 330 THR A C    1 
ATOM   3130 O O    . THR A 1 330 ? 21.953  70.707 -10.491 1.00 20.99 ? 330 THR A O    1 
ATOM   3131 C CB   . THR A 1 330 ? 24.187  68.226 -10.684 1.00 26.22 ? 330 THR A CB   1 
ATOM   3132 O OG1  . THR A 1 330 ? 23.222  68.003 -11.753 1.00 21.60 ? 330 THR A OG1  1 
ATOM   3133 C CG2  . THR A 1 330 ? 24.730  66.893 -10.118 1.00 17.88 ? 330 THR A CG2  1 
ATOM   3134 H H    . THR A 1 330 ? 21.727  68.081 -9.411  1.00 0.00  ? 330 THR A H    1 
ATOM   3135 H HG1  . THR A 1 330 ? 23.687  67.465 -12.424 1.00 0.00  ? 330 THR A HG1  1 
ATOM   3136 N N    . LYS A 1 331 ? 24.181  71.304 -10.356 1.00 28.03 ? 331 LYS A N    1 
ATOM   3137 C CA   . LYS A 1 331 ? 24.094  72.627 -10.994 1.00 30.50 ? 331 LYS A CA   1 
ATOM   3138 C C    . LYS A 1 331 ? 22.950  73.559 -10.614 1.00 30.53 ? 331 LYS A C    1 
ATOM   3139 O O    . LYS A 1 331 ? 22.273  74.112 -11.494 1.00 32.75 ? 331 LYS A O    1 
ATOM   3140 C CB   . LYS A 1 331 ? 24.219  72.495 -12.536 1.00 27.74 ? 331 LYS A CB   1 
ATOM   3141 C CG   . LYS A 1 331 ? 25.660  72.712 -13.001 1.00 29.73 ? 331 LYS A CG   1 
ATOM   3142 C CD   . LYS A 1 331 ? 25.962  72.292 -14.433 1.00 30.08 ? 331 LYS A CD   1 
ATOM   3143 C CE   . LYS A 1 331 ? 25.281  73.168 -15.491 1.00 32.34 ? 331 LYS A CE   1 
ATOM   3144 N NZ   . LYS A 1 331 ? 25.864  72.988 -16.863 1.00 31.48 ? 331 LYS A NZ   1 
ATOM   3145 H H    . LYS A 1 331 ? 25.058  71.034 -10.010 1.00 0.00  ? 331 LYS A H    1 
ATOM   3146 H HZ1  . LYS A 1 331 ? 26.900  72.902 -16.784 1.00 0.00  ? 331 LYS A HZ1  1 
ATOM   3147 H HZ2  . LYS A 1 331 ? 25.467  72.166 -17.362 1.00 0.00  ? 331 LYS A HZ2  1 
ATOM   3148 H HZ3  . LYS A 1 331 ? 25.700  73.833 -17.455 1.00 0.00  ? 331 LYS A HZ3  1 
ATOM   3149 N N    . LEU A 1 332 ? 22.789  73.790 -9.316  1.00 31.41 ? 332 LEU A N    1 
ATOM   3150 C CA   . LEU A 1 332 ? 21.711  74.656 -8.800  1.00 33.23 ? 332 LEU A CA   1 
ATOM   3151 C C    . LEU A 1 332 ? 21.970  76.139 -9.094  1.00 32.44 ? 332 LEU A C    1 
ATOM   3152 O O    . LEU A 1 332 ? 21.053  76.878 -9.454  1.00 32.61 ? 332 LEU A O    1 
ATOM   3153 C CB   . LEU A 1 332 ? 21.521  74.443 -7.273  1.00 34.52 ? 332 LEU A CB   1 
ATOM   3154 C CG   . LEU A 1 332 ? 20.567  75.321 -6.436  1.00 33.31 ? 332 LEU A CG   1 
ATOM   3155 C CD1  . LEU A 1 332 ? 19.116  74.913 -6.637  1.00 36.18 ? 332 LEU A CD1  1 
ATOM   3156 C CD2  . LEU A 1 332 ? 20.928  75.227 -4.936  1.00 32.06 ? 332 LEU A CD2  1 
ATOM   3157 H H    . LEU A 1 332 ? 23.422  73.364 -8.702  1.00 0.00  ? 332 LEU A H    1 
ATOM   3158 N N    . ASP A 1 333 ? 23.228  76.543 -8.938  1.00 31.37 ? 333 ASP A N    1 
ATOM   3159 C CA   . ASP A 1 333 ? 23.653  77.911 -9.159  1.00 31.98 ? 333 ASP A CA   1 
ATOM   3160 C C    . ASP A 1 333 ? 23.075  78.498 -10.422 1.00 30.88 ? 333 ASP A C    1 
ATOM   3161 O O    . ASP A 1 333 ? 22.599  79.619 -10.439 1.00 30.87 ? 333 ASP A O    1 
ATOM   3162 C CB   . ASP A 1 333 ? 25.176  77.996 -9.191  1.00 34.25 ? 333 ASP A CB   1 
ATOM   3163 C CG   . ASP A 1 333 ? 25.801  76.862 -9.953  1.00 38.96 ? 333 ASP A CG   1 
ATOM   3164 O OD1  . ASP A 1 333 ? 25.081  76.192 -10.725 1.00 40.65 ? 333 ASP A OD1  1 
ATOM   3165 O OD2  . ASP A 1 333 ? 27.009  76.608 -9.765  1.00 39.56 ? 333 ASP A OD2  1 
ATOM   3166 H H    . ASP A 1 333 ? 23.899  75.883 -8.682  1.00 0.00  ? 333 ASP A H    1 
ATOM   3167 N N    . VAL A 1 334 ? 23.106  77.726 -11.487 1.00 31.61 ? 334 VAL A N    1 
ATOM   3168 C CA   . VAL A 1 334 ? 22.560  78.153 -12.773 1.00 29.73 ? 334 VAL A CA   1 
ATOM   3169 C C    . VAL A 1 334 ? 21.221  78.900 -12.598 1.00 27.95 ? 334 VAL A C    1 
ATOM   3170 O O    . VAL A 1 334 ? 20.962  79.873 -13.292 1.00 28.33 ? 334 VAL A O    1 
ATOM   3171 C CB   . VAL A 1 334 ? 22.368  76.920 -13.684 1.00 26.61 ? 334 VAL A CB   1 
ATOM   3172 C CG1  . VAL A 1 334 ? 21.829  77.324 -15.044 1.00 24.35 ? 334 VAL A CG1  1 
ATOM   3173 C CG2  . VAL A 1 334 ? 23.694  76.189 -13.807 1.00 24.78 ? 334 VAL A CG2  1 
ATOM   3174 H H    . VAL A 1 334 ? 23.554  76.858 -11.369 1.00 0.00  ? 334 VAL A H    1 
ATOM   3175 N N    . LEU A 1 335 ? 20.406  78.470 -11.639 1.00 28.74 ? 335 LEU A N    1 
ATOM   3176 C CA   . LEU A 1 335 ? 19.117  79.094 -11.394 1.00 27.02 ? 335 LEU A CA   1 
ATOM   3177 C C    . LEU A 1 335 ? 19.230  80.315 -10.494 1.00 28.94 ? 335 LEU A C    1 
ATOM   3178 O O    . LEU A 1 335 ? 18.199  80.826 -10.027 1.00 28.81 ? 335 LEU A O    1 
ATOM   3179 C CB   . LEU A 1 335 ? 18.156  78.096 -10.772 1.00 29.33 ? 335 LEU A CB   1 
ATOM   3180 C CG   . LEU A 1 335 ? 17.686  76.892 -11.587 1.00 29.53 ? 335 LEU A CG   1 
ATOM   3181 C CD1  . LEU A 1 335 ? 16.950  75.954 -10.657 1.00 29.12 ? 335 LEU A CD1  1 
ATOM   3182 C CD2  . LEU A 1 335 ? 16.811  77.311 -12.765 1.00 28.56 ? 335 LEU A CD2  1 
ATOM   3183 H H    . LEU A 1 335 ? 20.680  77.765 -11.008 1.00 0.00  ? 335 LEU A H    1 
ATOM   3184 N N    . ASP A 1 336 ? 20.467  80.737 -10.199 1.00 29.61 ? 336 ASP A N    1 
ATOM   3185 C CA   . ASP A 1 336 ? 20.708  81.915 -9.371  1.00 33.34 ? 336 ASP A CA   1 
ATOM   3186 C C    . ASP A 1 336 ? 20.366  83.148 -10.214 1.00 35.73 ? 336 ASP A C    1 
ATOM   3187 O O    . ASP A 1 336 ? 20.037  83.019 -11.397 1.00 37.50 ? 336 ASP A O    1 
ATOM   3188 C CB   . ASP A 1 336 ? 22.188  82.012 -8.937  1.00 36.80 ? 336 ASP A CB   1 
ATOM   3189 C CG   . ASP A 1 336 ? 22.571  81.012 -7.832  1.00 36.76 ? 336 ASP A CG   1 
ATOM   3190 O OD1  . ASP A 1 336 ? 21.813  80.053 -7.616  1.00 38.31 ? 336 ASP A OD1  1 
ATOM   3191 O OD2  . ASP A 1 336 ? 23.654  81.163 -7.207  1.00 36.09 ? 336 ASP A OD2  1 
ATOM   3192 H H    . ASP A 1 336 ? 21.281  80.253 -10.485 1.00 0.00  ? 336 ASP A H    1 
ATOM   3193 N N    . GLY A 1 337 ? 20.416  84.332 -9.599  1.00 35.06 ? 337 GLY A N    1 
ATOM   3194 C CA   . GLY A 1 337 ? 20.132  85.571 -10.304 1.00 34.86 ? 337 GLY A CA   1 
ATOM   3195 C C    . GLY A 1 337 ? 18.784  85.675 -11.000 1.00 36.06 ? 337 GLY A C    1 
ATOM   3196 O O    . GLY A 1 337 ? 18.596  86.541 -11.861 1.00 34.61 ? 337 GLY A O    1 
ATOM   3197 H H    . GLY A 1 337 ? 20.655  84.327 -8.647  1.00 0.00  ? 337 GLY A H    1 
ATOM   3198 N N    . LEU A 1 338 ? 17.844  84.800 -10.643 1.00 37.57 ? 338 LEU A N    1 
ATOM   3199 C CA   . LEU A 1 338 ? 16.521  84.822 -11.249 1.00 36.33 ? 338 LEU A CA   1 
ATOM   3200 C C    . LEU A 1 338 ? 15.588  85.375 -10.216 1.00 37.67 ? 338 LEU A C    1 
ATOM   3201 O O    . LEU A 1 338 ? 15.994  85.602 -9.081  1.00 40.51 ? 338 LEU A O    1 
ATOM   3202 C CB   . LEU A 1 338 ? 16.060  83.424 -11.634 1.00 35.29 ? 338 LEU A CB   1 
ATOM   3203 C CG   . LEU A 1 338 ? 16.703  82.676 -12.806 1.00 35.67 ? 338 LEU A CG   1 
ATOM   3204 C CD1  . LEU A 1 338 ? 16.098  81.264 -12.878 1.00 32.45 ? 338 LEU A CD1  1 
ATOM   3205 C CD2  . LEU A 1 338 ? 16.466  83.419 -14.105 1.00 36.20 ? 338 LEU A CD2  1 
ATOM   3206 H H    . LEU A 1 338 ? 18.036  84.141 -9.946  1.00 0.00  ? 338 LEU A H    1 
ATOM   3207 N N    A LYS A 1 339 ? 14.353  85.630 -10.631 0.50 37.96 ? 339 LYS A N    1 
ATOM   3208 N N    B LYS A 1 339 ? 14.339  85.612 -10.599 0.50 37.73 ? 339 LYS A N    1 
ATOM   3209 C CA   A LYS A 1 339 ? 13.309  86.180 -9.773  0.50 38.01 ? 339 LYS A CA   1 
ATOM   3210 C CA   B LYS A 1 339 ? 13.341  86.138 -9.673  0.50 37.63 ? 339 LYS A CA   1 
ATOM   3211 C C    A LYS A 1 339 ? 12.358  85.039 -9.415  0.50 37.79 ? 339 LYS A C    1 
ATOM   3212 C C    B LYS A 1 339 ? 12.374  84.996 -9.380  0.50 37.55 ? 339 LYS A C    1 
ATOM   3213 O O    A LYS A 1 339 ? 11.917  84.908 -8.274  0.50 36.92 ? 339 LYS A O    1 
ATOM   3214 O O    B LYS A 1 339 ? 11.906  84.840 -8.253  0.50 36.72 ? 339 LYS A O    1 
ATOM   3215 C CB   A LYS A 1 339 ? 12.552  87.300 -10.532 0.50 39.24 ? 339 LYS A CB   1 
ATOM   3216 C CB   B LYS A 1 339 ? 12.585  87.335 -10.290 0.50 38.60 ? 339 LYS A CB   1 
ATOM   3217 C CG   A LYS A 1 339 ? 11.287  87.843 -9.842  0.50 39.68 ? 339 LYS A CG   1 
ATOM   3218 C CG   B LYS A 1 339 ? 11.787  88.187 -9.285  0.50 38.86 ? 339 LYS A CG   1 
ATOM   3219 C CD   A LYS A 1 339 ? 10.466  88.803 -10.737 0.50 40.25 ? 339 LYS A CD   1 
ATOM   3220 C CD   B LYS A 1 339 ? 10.682  89.001 -9.981  0.50 39.44 ? 339 LYS A CD   1 
ATOM   3221 C CE   A LYS A 1 339 ? 11.195  90.129 -11.012 0.50 40.91 ? 339 LYS A CE   1 
ATOM   3222 C CE   B LYS A 1 339 ? 10.049  90.072 -9.068  0.50 39.43 ? 339 LYS A CE   1 
ATOM   3223 N NZ   A LYS A 1 339 ? 10.311  91.205 -11.566 0.50 37.48 ? 339 LYS A NZ   1 
ATOM   3224 N NZ   B LYS A 1 339 ? 10.920  91.279 -8.852  0.50 39.28 ? 339 LYS A NZ   1 
ATOM   3225 H H    A LYS A 1 339 ? 14.144  85.438 -11.566 0.50 0.00  ? 339 LYS A H    1 
ATOM   3226 H H    B LYS A 1 339 ? 14.094  85.434 -11.528 0.50 0.00  ? 339 LYS A H    1 
ATOM   3227 H HZ1  A LYS A 1 339 ? 9.873   90.919 -12.464 0.50 0.00  ? 339 LYS A HZ1  1 
ATOM   3228 H HZ1  B LYS A 1 339 ? 11.839  91.017 -8.429  0.50 0.00  ? 339 LYS A HZ1  1 
ATOM   3229 H HZ2  A LYS A 1 339 ? 9.573   91.432 -10.875 0.50 0.00  ? 339 LYS A HZ2  1 
ATOM   3230 H HZ2  B LYS A 1 339 ? 11.117  91.741 -9.765  0.50 0.00  ? 339 LYS A HZ2  1 
ATOM   3231 H HZ3  A LYS A 1 339 ? 10.875  92.075 -11.721 0.50 0.00  ? 339 LYS A HZ3  1 
ATOM   3232 H HZ3  B LYS A 1 339 ? 10.465  91.969 -8.224  0.50 0.00  ? 339 LYS A HZ3  1 
ATOM   3233 N N    . GLU A 1 340 ? 12.083  84.199 -10.407 1.00 37.74 ? 340 GLU A N    1 
ATOM   3234 C CA   . GLU A 1 340 ? 11.188  83.058 -10.255 1.00 37.02 ? 340 GLU A CA   1 
ATOM   3235 C C    . GLU A 1 340 ? 11.763  81.717 -10.730 1.00 34.53 ? 340 GLU A C    1 
ATOM   3236 O O    . GLU A 1 340 ? 12.683  81.654 -11.557 1.00 31.74 ? 340 GLU A O    1 
ATOM   3237 C CB   . GLU A 1 340 ? 9.853   83.315 -10.950 1.00 39.01 ? 340 GLU A CB   1 
ATOM   3238 C CG   . GLU A 1 340 ? 8.830   84.017 -10.055 1.00 45.05 ? 340 GLU A CG   1 
ATOM   3239 C CD   . GLU A 1 340 ? 7.465   84.161 -10.704 1.00 46.11 ? 340 GLU A CD   1 
ATOM   3240 O OE1  . GLU A 1 340 ? 7.119   83.346 -11.595 1.00 47.93 ? 340 GLU A OE1  1 
ATOM   3241 O OE2  . GLU A 1 340 ? 6.722   85.087 -10.310 1.00 48.16 ? 340 GLU A OE2  1 
ATOM   3242 H H    . GLU A 1 340 ? 12.482  84.331 -11.280 1.00 0.00  ? 340 GLU A H    1 
ATOM   3243 N N    . VAL A 1 341 ? 11.275  80.657 -10.099 1.00 32.32 ? 341 VAL A N    1 
ATOM   3244 C CA   . VAL A 1 341 ? 11.657  79.309 -10.438 1.00 32.88 ? 341 VAL A CA   1 
ATOM   3245 C C    . VAL A 1 341 ? 10.378  78.512 -10.397 1.00 32.23 ? 341 VAL A C    1 
ATOM   3246 O O    . VAL A 1 341 ? 9.488   78.773 -9.567  1.00 33.24 ? 341 VAL A O    1 
ATOM   3247 C CB   . VAL A 1 341 ? 12.693  78.683 -9.453  1.00 32.68 ? 341 VAL A CB   1 
ATOM   3248 C CG1  . VAL A 1 341 ? 14.033  79.437 -9.513  1.00 34.69 ? 341 VAL A CG1  1 
ATOM   3249 C CG2  . VAL A 1 341 ? 12.145  78.644 -8.052  1.00 34.74 ? 341 VAL A CG2  1 
ATOM   3250 H H    . VAL A 1 341 ? 10.692  80.771 -9.307  1.00 0.00  ? 341 VAL A H    1 
ATOM   3251 N N    . LYS A 1 342 ? 10.266  77.574 -11.327 1.00 31.73 ? 342 LYS A N    1 
ATOM   3252 C CA   . LYS A 1 342 ? 9.090   76.720 -11.398 1.00 32.80 ? 342 LYS A CA   1 
ATOM   3253 C C    . LYS A 1 342 ? 9.554   75.270 -11.535 1.00 30.80 ? 342 LYS A C    1 
ATOM   3254 O O    . LYS A 1 342 ? 10.724  75.011 -11.881 1.00 32.42 ? 342 LYS A O    1 
ATOM   3255 C CB   . LYS A 1 342 ? 8.219   77.076 -12.622 1.00 33.83 ? 342 LYS A CB   1 
ATOM   3256 C CG   . LYS A 1 342 ? 8.454   78.446 -13.268 1.00 37.65 ? 342 LYS A CG   1 
ATOM   3257 C CD   . LYS A 1 342 ? 7.473   78.633 -14.429 1.00 41.18 ? 342 LYS A CD   1 
ATOM   3258 C CE   . LYS A 1 342 ? 7.826   79.799 -15.329 1.00 40.52 ? 342 LYS A CE   1 
ATOM   3259 N NZ   . LYS A 1 342 ? 6.745   79.968 -16.316 1.00 40.96 ? 342 LYS A NZ   1 
ATOM   3260 H H    . LYS A 1 342 ? 10.997  77.399 -11.954 1.00 0.00  ? 342 LYS A H    1 
ATOM   3261 H HZ1  . LYS A 1 342 ? 6.608   79.084 -16.849 1.00 0.00  ? 342 LYS A HZ1  1 
ATOM   3262 H HZ2  . LYS A 1 342 ? 5.887   80.234 -15.786 1.00 0.00  ? 342 LYS A HZ2  1 
ATOM   3263 H HZ3  . LYS A 1 342 ? 7.016   80.726 -16.985 1.00 0.00  ? 342 LYS A HZ3  1 
ATOM   3264 N N    . LEU A 1 343 ? 8.648   74.344 -11.222 1.00 27.84 ? 343 LEU A N    1 
ATOM   3265 C CA   . LEU A 1 343 ? 8.892   72.904 -11.359 1.00 26.42 ? 343 LEU A CA   1 
ATOM   3266 C C    . LEU A 1 343 ? 7.557   72.292 -11.784 1.00 25.95 ? 343 LEU A C    1 
ATOM   3267 O O    . LEU A 1 343 ? 6.511   72.585 -11.183 1.00 27.03 ? 343 LEU A O    1 
ATOM   3268 C CB   . LEU A 1 343 ? 9.411   72.273 -10.050 1.00 23.86 ? 343 LEU A CB   1 
ATOM   3269 C CG   . LEU A 1 343 ? 8.752   72.719 -8.737  1.00 23.52 ? 343 LEU A CG   1 
ATOM   3270 C CD1  . LEU A 1 343 ? 8.823   71.669 -7.650  1.00 22.20 ? 343 LEU A CD1  1 
ATOM   3271 C CD2  . LEU A 1 343 ? 9.372   74.021 -8.257  1.00 21.93 ? 343 LEU A CD2  1 
ATOM   3272 H H    . LEU A 1 343 ? 7.792   74.663 -10.859 1.00 0.00  ? 343 LEU A H    1 
ATOM   3273 N N    . CYS A 1 344 ? 7.565   71.542 -12.889 1.00 25.31 ? 344 CYS A N    1 
ATOM   3274 C CA   . CYS A 1 344 ? 6.354   70.898 -13.404 1.00 23.33 ? 344 CYS A CA   1 
ATOM   3275 C C    . CYS A 1 344 ? 5.833   69.903 -12.341 1.00 24.44 ? 344 CYS A C    1 
ATOM   3276 O O    . CYS A 1 344 ? 6.627   69.308 -11.578 1.00 23.67 ? 344 CYS A O    1 
ATOM   3277 C CB   . CYS A 1 344 ? 6.694   70.188 -14.696 1.00 22.25 ? 344 CYS A CB   1 
ATOM   3278 S SG   . CYS A 1 344 ? 5.281   69.612 -15.646 1.00 21.25 ? 344 CYS A SG   1 
ATOM   3279 H H    . CYS A 1 344 ? 8.434   71.348 -13.316 1.00 0.00  ? 344 CYS A H    1 
ATOM   3280 N N    . VAL A 1 345 ? 4.516   69.776 -12.212 1.00 23.43 ? 345 VAL A N    1 
ATOM   3281 C CA   . VAL A 1 345 ? 3.941   68.863 -11.205 1.00 25.66 ? 345 VAL A CA   1 
ATOM   3282 C C    . VAL A 1 345 ? 2.693   68.150 -11.725 1.00 26.16 ? 345 VAL A C    1 
ATOM   3283 O O    . VAL A 1 345 ? 2.009   67.439 -10.990 1.00 27.44 ? 345 VAL A O    1 
ATOM   3284 C CB   . VAL A 1 345 ? 3.556   69.605 -9.924  1.00 24.01 ? 345 VAL A CB   1 
ATOM   3285 C CG1  . VAL A 1 345 ? 4.764   70.326 -9.337  1.00 25.74 ? 345 VAL A CG1  1 
ATOM   3286 C CG2  . VAL A 1 345 ? 2.448   70.621 -10.219 1.00 27.50 ? 345 VAL A CG2  1 
ATOM   3287 H H    . VAL A 1 345 ? 3.923   70.360 -12.740 1.00 0.00  ? 345 VAL A H    1 
ATOM   3288 N N    . ALA A 1 346 ? 2.441   68.289 -13.018 1.00 26.96 ? 346 ALA A N    1 
ATOM   3289 C CA   . ALA A 1 346 ? 1.273   67.700 -13.641 1.00 24.89 ? 346 ALA A CA   1 
ATOM   3290 C C    . ALA A 1 346 ? 1.381   68.135 -15.066 1.00 24.29 ? 346 ALA A C    1 
ATOM   3291 O O    . ALA A 1 346 ? 2.091   69.119 -15.364 1.00 24.93 ? 346 ALA A O    1 
ATOM   3292 C CB   . ALA A 1 346 ? 0.017   68.280 -13.051 1.00 24.28 ? 346 ALA A CB   1 
ATOM   3293 H H    . ALA A 1 346 ? 3.024   68.823 -13.603 1.00 0.00  ? 346 ALA A H    1 
ATOM   3294 N N    . TYR A 1 347 ? 0.668   67.418 -15.926 1.00 24.21 ? 347 TYR A N    1 
ATOM   3295 C CA   . TYR A 1 347 ? 0.606   67.668 -17.365 1.00 24.87 ? 347 TYR A CA   1 
ATOM   3296 C C    . TYR A 1 347 ? -0.853  67.592 -17.675 1.00 26.83 ? 347 TYR A C    1 
ATOM   3297 O O    . TYR A 1 347 ? -1.585  66.867 -16.992 1.00 26.73 ? 347 TYR A O    1 
ATOM   3298 C CB   . TYR A 1 347 ? 1.212   66.522 -18.174 1.00 21.16 ? 347 TYR A CB   1 
ATOM   3299 C CG   . TYR A 1 347 ? 2.690   66.315 -18.069 1.00 18.55 ? 347 TYR A CG   1 
ATOM   3300 C CD1  . TYR A 1 347 ? 3.562   67.370 -17.826 1.00 16.96 ? 347 TYR A CD1  1 
ATOM   3301 C CD2  . TYR A 1 347 ? 3.225   65.059 -18.291 1.00 19.89 ? 347 TYR A CD2  1 
ATOM   3302 C CE1  . TYR A 1 347 ? 4.913   67.164 -17.818 1.00 15.04 ? 347 TYR A CE1  1 
ATOM   3303 C CE2  . TYR A 1 347 ? 4.566   64.851 -18.290 1.00 14.92 ? 347 TYR A CE2  1 
ATOM   3304 C CZ   . TYR A 1 347 ? 5.411   65.893 -18.061 1.00 14.79 ? 347 TYR A CZ   1 
ATOM   3305 O OH   . TYR A 1 347 ? 6.762   65.641 -18.135 1.00 16.38 ? 347 TYR A OH   1 
ATOM   3306 H H    . TYR A 1 347 ? 0.140   66.659 -15.579 1.00 0.00  ? 347 TYR A H    1 
ATOM   3307 H HH   . TYR A 1 347 ? 7.234   66.487 -18.093 1.00 0.00  ? 347 TYR A HH   1 
ATOM   3308 N N    . ARG A 1 348 ? -1.259  68.310 -18.714 1.00 30.54 ? 348 ARG A N    1 
ATOM   3309 C CA   . ARG A 1 348 ? -2.641  68.304 -19.191 1.00 33.31 ? 348 ARG A CA   1 
ATOM   3310 C C    . ARG A 1 348 ? -2.598  67.673 -20.578 1.00 33.18 ? 348 ARG A C    1 
ATOM   3311 O O    . ARG A 1 348 ? -1.830  68.104 -21.439 1.00 32.38 ? 348 ARG A O    1 
ATOM   3312 C CB   . ARG A 1 348 ? -3.237  69.717 -19.265 1.00 34.56 ? 348 ARG A CB   1 
ATOM   3313 C CG   . ARG A 1 348 ? -4.690  69.687 -19.747 1.00 36.63 ? 348 ARG A CG   1 
ATOM   3314 C CD   . ARG A 1 348 ? -5.475  70.973 -19.545 1.00 35.42 ? 348 ARG A CD   1 
ATOM   3315 N NE   . ARG A 1 348 ? -5.254  71.570 -18.232 1.00 37.14 ? 348 ARG A NE   1 
ATOM   3316 C CZ   . ARG A 1 348 ? -4.500  72.649 -18.029 1.00 34.47 ? 348 ARG A CZ   1 
ATOM   3317 N NH1  . ARG A 1 348 ? -3.893  73.237 -19.066 1.00 31.64 ? 348 ARG A NH1  1 
ATOM   3318 N NH2  . ARG A 1 348 ? -4.394  73.159 -16.805 1.00 31.10 ? 348 ARG A NH2  1 
ATOM   3319 H H    . ARG A 1 348 ? -0.627  68.937 -19.144 1.00 0.00  ? 348 ARG A H    1 
ATOM   3320 H HE   . ARG A 1 348 ? -5.685  71.122 -17.461 1.00 0.00  ? 348 ARG A HE   1 
ATOM   3321 H HH11 . ARG A 1 348 ? -4.018  72.862 -19.986 1.00 0.00  ? 348 ARG A HH11 1 
ATOM   3322 H HH12 . ARG A 1 348 ? -3.305  74.051 -18.998 1.00 0.00  ? 348 ARG A HH12 1 
ATOM   3323 H HH21 . ARG A 1 348 ? -4.889  72.688 -16.061 1.00 0.00  ? 348 ARG A HH21 1 
ATOM   3324 H HH22 . ARG A 1 348 ? -3.824  73.958 -16.594 1.00 0.00  ? 348 ARG A HH22 1 
ATOM   3325 N N    . MET A 1 349 ? -3.377  66.614 -20.765 1.00 35.08 ? 349 MET A N    1 
ATOM   3326 C CA   . MET A 1 349 ? -3.398  65.892 -22.037 1.00 36.10 ? 349 MET A CA   1 
ATOM   3327 C C    . MET A 1 349 ? -4.205  66.635 -23.078 1.00 37.92 ? 349 MET A C    1 
ATOM   3328 O O    . MET A 1 349 ? -5.052  67.461 -22.743 1.00 36.58 ? 349 MET A O    1 
ATOM   3329 C CB   . MET A 1 349 ? -4.011  64.501 -21.872 1.00 35.00 ? 349 MET A CB   1 
ATOM   3330 C CG   . MET A 1 349 ? -3.298  63.602 -20.904 1.00 36.42 ? 349 MET A CG   1 
ATOM   3331 S SD   . MET A 1 349 ? -1.558  63.552 -21.266 1.00 38.26 ? 349 MET A SD   1 
ATOM   3332 C CE   . MET A 1 349 ? -0.987  64.512 -19.873 1.00 33.92 ? 349 MET A CE   1 
ATOM   3333 H H    . MET A 1 349 ? -4.001  66.416 -20.011 1.00 0.00  ? 349 MET A H    1 
ATOM   3334 N N    . PRO A 1 350 ? -3.940  66.364 -24.369 1.00 40.48 ? 350 PRO A N    1 
ATOM   3335 C CA   . PRO A 1 350 ? -4.705  67.050 -25.413 1.00 40.34 ? 350 PRO A CA   1 
ATOM   3336 C C    . PRO A 1 350 ? -6.185  66.641 -25.351 1.00 40.70 ? 350 PRO A C    1 
ATOM   3337 O O    . PRO A 1 350 ? -6.767  66.275 -26.358 1.00 40.51 ? 350 PRO A O    1 
ATOM   3338 C CB   . PRO A 1 350 ? -4.040  66.554 -26.707 1.00 39.60 ? 350 PRO A CB   1 
ATOM   3339 C CG   . PRO A 1 350 ? -2.643  66.225 -26.287 1.00 39.36 ? 350 PRO A CG   1 
ATOM   3340 C CD   . PRO A 1 350 ? -2.832  65.576 -24.955 1.00 38.54 ? 350 PRO A CD   1 
ATOM   3341 N N    . ASP A 1 351 ? -6.795  66.728 -24.177 1.00 41.21 ? 351 ASP A N    1 
ATOM   3342 C CA   . ASP A 1 351 ? -8.200  66.370 -24.019 1.00 42.51 ? 351 ASP A CA   1 
ATOM   3343 C C    . ASP A 1 351 ? -8.794  66.968 -22.740 1.00 44.19 ? 351 ASP A C    1 
ATOM   3344 O O    . ASP A 1 351 ? -9.918  66.628 -22.355 1.00 46.68 ? 351 ASP A O    1 
ATOM   3345 C CB   . ASP A 1 351 ? -8.390  64.840 -24.016 1.00 40.97 ? 351 ASP A CB   1 
ATOM   3346 C CG   . ASP A 1 351 ? -7.964  64.189 -22.694 1.00 38.27 ? 351 ASP A CG   1 
ATOM   3347 O OD1  . ASP A 1 351 ? -7.085  64.753 -21.995 1.00 34.32 ? 351 ASP A OD1  1 
ATOM   3348 O OD2  . ASP A 1 351 ? -8.512  63.110 -22.365 1.00 36.74 ? 351 ASP A OD2  1 
ATOM   3349 H H    . ASP A 1 351 ? -6.313  67.056 -23.383 1.00 0.00  ? 351 ASP A H    1 
ATOM   3350 N N    . GLY A 1 352 ? -8.020  67.790 -22.041 1.00 43.75 ? 352 GLY A N    1 
ATOM   3351 C CA   . GLY A 1 352 ? -8.539  68.421 -20.842 1.00 43.82 ? 352 GLY A CA   1 
ATOM   3352 C C    . GLY A 1 352 ? -8.152  67.865 -19.477 1.00 43.98 ? 352 GLY A C    1 
ATOM   3353 O O    . GLY A 1 352 ? -8.140  68.612 -18.488 1.00 42.89 ? 352 GLY A O    1 
ATOM   3354 H H    . GLY A 1 352 ? -7.075  67.902 -22.264 1.00 0.00  ? 352 GLY A H    1 
ATOM   3355 N N    A ARG A 1 353 ? -7.848  66.574 -19.406 0.50 44.03 ? 353 ARG A N    1 
ATOM   3356 N N    B ARG A 1 353 ? -7.882  66.567 -19.385 0.50 43.86 ? 353 ARG A N    1 
ATOM   3357 C CA   A ARG A 1 353 ? -7.473  65.965 -18.135 0.50 44.11 ? 353 ARG A CA   1 
ATOM   3358 C CA   B ARG A 1 353 ? -7.502  66.013 -18.094 0.50 43.80 ? 353 ARG A CA   1 
ATOM   3359 C C    A ARG A 1 353 ? -6.010  66.249 -17.767 0.50 44.91 ? 353 ARG A C    1 
ATOM   3360 C C    B ARG A 1 353 ? -6.023  66.226 -17.761 0.50 44.77 ? 353 ARG A C    1 
ATOM   3361 O O    A ARG A 1 353 ? -5.133  66.382 -18.640 0.50 44.18 ? 353 ARG A O    1 
ATOM   3362 O O    B ARG A 1 353 ? -5.154  66.308 -18.646 0.50 44.14 ? 353 ARG A O    1 
ATOM   3363 C CB   A ARG A 1 353 ? -7.734  64.453 -18.154 0.50 43.53 ? 353 ARG A CB   1 
ATOM   3364 C CB   B ARG A 1 353 ? -7.945  64.552 -17.927 0.50 42.91 ? 353 ARG A CB   1 
ATOM   3365 C CG   A ARG A 1 353 ? -6.745  63.656 -18.979 0.50 43.52 ? 353 ARG A CG   1 
ATOM   3366 C CG   B ARG A 1 353 ? -7.467  63.561 -18.966 0.50 42.59 ? 353 ARG A CG   1 
ATOM   3367 C CD   A ARG A 1 353 ? -7.009  62.163 -18.894 0.50 43.61 ? 353 ARG A CD   1 
ATOM   3368 C CD   B ARG A 1 353 ? -8.193  62.232 -18.791 0.50 42.33 ? 353 ARG A CD   1 
ATOM   3369 N NE   A ARG A 1 353 ? -5.876  61.405 -19.417 0.50 43.61 ? 353 ARG A NE   1 
ATOM   3370 N NE   B ARG A 1 353 ? -8.098  61.727 -17.418 0.50 43.02 ? 353 ARG A NE   1 
ATOM   3371 C CZ   A ARG A 1 353 ? -5.672  61.148 -20.705 0.50 44.16 ? 353 ARG A CZ   1 
ATOM   3372 C CZ   B ARG A 1 353 ? -9.131  61.300 -16.691 0.50 42.73 ? 353 ARG A CZ   1 
ATOM   3373 N NH1  A ARG A 1 353 ? -6.531  61.575 -21.623 0.50 43.30 ? 353 ARG A NH1  1 
ATOM   3374 N NH1  B ARG A 1 353 ? -10.358 61.299 -17.191 0.50 43.17 ? 353 ARG A NH1  1 
ATOM   3375 N NH2  A ARG A 1 353 ? -4.573  60.506 -21.077 0.50 44.48 ? 353 ARG A NH2  1 
ATOM   3376 N NH2  B ARG A 1 353 ? -8.940  60.902 -15.443 0.50 42.88 ? 353 ARG A NH2  1 
ATOM   3377 H H    A ARG A 1 353 ? -7.851  66.026 -20.222 0.50 0.00  ? 353 ARG A H    1 
ATOM   3378 H H    B ARG A 1 353 ? -7.904  65.992 -20.185 0.50 0.00  ? 353 ARG A H    1 
ATOM   3379 H HE   A ARG A 1 353 ? -5.232  61.074 -18.756 0.50 0.00  ? 353 ARG A HE   1 
ATOM   3380 H HE   B ARG A 1 353 ? -7.196  61.702 -17.025 0.50 0.00  ? 353 ARG A HE   1 
ATOM   3381 H HH11 A ARG A 1 353 ? -7.354  62.128 -21.415 0.50 0.00  ? 353 ARG A HH11 1 
ATOM   3382 H HH11 B ARG A 1 353 ? -10.517 61.615 -18.129 0.50 0.00  ? 353 ARG A HH11 1 
ATOM   3383 H HH12 A ARG A 1 353 ? -6.377  61.399 -22.597 0.50 0.00  ? 353 ARG A HH12 1 
ATOM   3384 H HH12 B ARG A 1 353 ? -11.134 60.971 -16.647 0.50 0.00  ? 353 ARG A HH12 1 
ATOM   3385 H HH21 A ARG A 1 353 ? -3.875  60.221 -20.423 0.50 0.00  ? 353 ARG A HH21 1 
ATOM   3386 H HH21 B ARG A 1 353 ? -8.033  60.908 -15.017 0.50 0.00  ? 353 ARG A HH21 1 
ATOM   3387 H HH22 A ARG A 1 353 ? -4.384  60.343 -22.057 0.50 0.00  ? 353 ARG A HH22 1 
ATOM   3388 H HH22 B ARG A 1 353 ? -9.717  60.564 -14.890 0.50 0.00  ? 353 ARG A HH22 1 
ATOM   3389 N N    . GLU A 1 354 ? -5.763  66.357 -16.467 1.00 44.59 ? 354 GLU A N    1 
ATOM   3390 C CA   . GLU A 1 354 ? -4.432  66.617 -15.967 1.00 43.81 ? 354 GLU A CA   1 
ATOM   3391 C C    . GLU A 1 354 ? -3.983  65.407 -15.171 1.00 41.86 ? 354 GLU A C    1 
ATOM   3392 O O    . GLU A 1 354 ? -4.583  65.063 -14.147 1.00 41.41 ? 354 GLU A O    1 
ATOM   3393 C CB   . GLU A 1 354 ? -4.476  67.877 -15.094 1.00 44.64 ? 354 GLU A CB   1 
ATOM   3394 C CG   . GLU A 1 354 ? -5.622  68.811 -15.507 1.00 47.58 ? 354 GLU A CG   1 
ATOM   3395 C CD   . GLU A 1 354 ? -5.652  70.124 -14.764 1.00 47.78 ? 354 GLU A CD   1 
ATOM   3396 O OE1  . GLU A 1 354 ? -5.279  70.169 -13.573 1.00 48.25 ? 354 GLU A OE1  1 
ATOM   3397 O OE2  . GLU A 1 354 ? -6.056  71.123 -15.392 1.00 50.36 ? 354 GLU A OE2  1 
ATOM   3398 H H    . GLU A 1 354 ? -6.491  66.271 -15.827 1.00 0.00  ? 354 GLU A H    1 
ATOM   3399 N N    . VAL A 1 355 ? -2.952  64.738 -15.673 1.00 40.69 ? 355 VAL A N    1 
ATOM   3400 C CA   . VAL A 1 355 ? -2.416  63.548 -15.017 1.00 37.15 ? 355 VAL A CA   1 
ATOM   3401 C C    . VAL A 1 355 ? -1.104  63.925 -14.368 1.00 36.42 ? 355 VAL A C    1 
ATOM   3402 O O    . VAL A 1 355 ? -0.499  64.926 -14.744 1.00 36.21 ? 355 VAL A O    1 
ATOM   3403 C CB   . VAL A 1 355 ? -2.210  62.400 -16.000 1.00 34.21 ? 355 VAL A CB   1 
ATOM   3404 C CG1  . VAL A 1 355 ? -3.554  61.960 -16.568 1.00 34.68 ? 355 VAL A CG1  1 
ATOM   3405 C CG2  . VAL A 1 355 ? -1.285  62.819 -17.101 1.00 35.44 ? 355 VAL A CG2  1 
ATOM   3406 H H    . VAL A 1 355 ? -2.494  65.144 -16.444 1.00 0.00  ? 355 VAL A H    1 
ATOM   3407 N N    . THR A 1 356 ? -0.720  63.168 -13.344 1.00 36.69 ? 356 THR A N    1 
ATOM   3408 C CA   . THR A 1 356 ? 0.515   63.407 -12.614 1.00 35.67 ? 356 THR A CA   1 
ATOM   3409 C C    . THR A 1 356 ? 1.543   62.338 -12.869 1.00 35.73 ? 356 THR A C    1 
ATOM   3410 O O    . THR A 1 356 ? 2.650   62.389 -12.328 1.00 36.78 ? 356 THR A O    1 
ATOM   3411 C CB   . THR A 1 356 ? 0.287   63.447 -11.118 1.00 36.48 ? 356 THR A CB   1 
ATOM   3412 O OG1  . THR A 1 356 ? -1.103  63.248 -10.821 1.00 35.66 ? 356 THR A OG1  1 
ATOM   3413 C CG2  . THR A 1 356 ? 0.743   64.780 -10.590 1.00 38.99 ? 356 THR A CG2  1 
ATOM   3414 H H    . THR A 1 356 ? -1.303  62.455 -13.013 1.00 0.00  ? 356 THR A H    1 
ATOM   3415 H HG1  . THR A 1 356 ? -1.342  63.388 -9.896  1.00 0.00  ? 356 THR A HG1  1 
ATOM   3416 N N    . THR A 1 357 ? 1.177   61.361 -13.683 1.00 34.12 ? 357 THR A N    1 
ATOM   3417 C CA   . THR A 1 357 ? 2.071   60.269 -14.019 1.00 32.46 ? 357 THR A CA   1 
ATOM   3418 C C    . THR A 1 357 ? 2.394   60.381 -15.496 1.00 33.69 ? 357 THR A C    1 
ATOM   3419 O O    . THR A 1 357 ? 1.500   60.662 -16.291 1.00 34.19 ? 357 THR A O    1 
ATOM   3420 C CB   . THR A 1 357 ? 1.392   58.904 -13.714 1.00 31.41 ? 357 THR A CB   1 
ATOM   3421 O OG1  . THR A 1 357 ? 0.093   58.872 -14.295 1.00 29.04 ? 357 THR A OG1  1 
ATOM   3422 C CG2  . THR A 1 357 ? 1.197   58.718 -12.229 1.00 32.14 ? 357 THR A CG2  1 
ATOM   3423 H H    . THR A 1 357 ? 0.301   61.332 -14.117 1.00 0.00  ? 357 THR A H    1 
ATOM   3424 H HG1  . THR A 1 357 ? -0.243  57.978 -14.134 1.00 0.00  ? 357 THR A HG1  1 
ATOM   3425 N N    . THR A 1 358 ? 3.677   60.328 -15.842 1.00 35.33 ? 358 THR A N    1 
ATOM   3426 C CA   . THR A 1 358 ? 4.107   60.366 -17.238 1.00 36.12 ? 358 THR A CA   1 
ATOM   3427 C C    . THR A 1 358 ? 3.084   59.473 -17.934 1.00 39.51 ? 358 THR A C    1 
ATOM   3428 O O    . THR A 1 358 ? 2.855   58.330 -17.515 1.00 38.07 ? 358 THR A O    1 
ATOM   3429 C CB   . THR A 1 358 ? 5.517   59.742 -17.404 1.00 35.26 ? 358 THR A CB   1 
ATOM   3430 O OG1  . THR A 1 358 ? 6.531   60.681 -17.011 1.00 37.41 ? 358 THR A OG1  1 
ATOM   3431 C CG2  . THR A 1 358 ? 5.752   59.297 -18.822 1.00 34.72 ? 358 THR A CG2  1 
ATOM   3432 H H    . THR A 1 358 ? 4.365   60.289 -15.146 1.00 0.00  ? 358 THR A H    1 
ATOM   3433 H HG1  . THR A 1 358 ? 6.523   61.457 -17.584 1.00 0.00  ? 358 THR A HG1  1 
ATOM   3434 N N    . PRO A 1 359 ? 2.400   60.004 -18.955 1.00 42.57 ? 359 PRO A N    1 
ATOM   3435 C CA   . PRO A 1 359 ? 1.404   59.159 -19.620 1.00 43.26 ? 359 PRO A CA   1 
ATOM   3436 C C    . PRO A 1 359 ? 2.082   58.124 -20.510 1.00 44.14 ? 359 PRO A C    1 
ATOM   3437 O O    . PRO A 1 359 ? 3.322   58.017 -20.556 1.00 43.03 ? 359 PRO A O    1 
ATOM   3438 C CB   . PRO A 1 359 ? 0.589   60.172 -20.425 1.00 43.62 ? 359 PRO A CB   1 
ATOM   3439 C CG   . PRO A 1 359 ? 1.692   61.133 -20.919 1.00 45.11 ? 359 PRO A CG   1 
ATOM   3440 C CD   . PRO A 1 359 ? 2.630   61.269 -19.696 1.00 42.27 ? 359 PRO A CD   1 
ATOM   3441 N N    . LEU A 1 360 ? 1.272   57.379 -21.248 1.00 44.21 ? 360 LEU A N    1 
ATOM   3442 C CA   . LEU A 1 360 ? 1.816   56.363 -22.117 1.00 43.79 ? 360 LEU A CA   1 
ATOM   3443 C C    . LEU A 1 360 ? 2.606   57.027 -23.234 1.00 44.29 ? 360 LEU A C    1 
ATOM   3444 O O    . LEU A 1 360 ? 2.376   58.202 -23.566 1.00 43.36 ? 360 LEU A O    1 
ATOM   3445 C CB   . LEU A 1 360 ? 0.697   55.490 -22.661 1.00 44.19 ? 360 LEU A CB   1 
ATOM   3446 C CG   . LEU A 1 360 ? -0.170  54.873 -21.560 1.00 45.25 ? 360 LEU A CG   1 
ATOM   3447 C CD1  . LEU A 1 360 ? -1.140  53.892 -22.176 1.00 45.16 ? 360 LEU A CD1  1 
ATOM   3448 C CD2  . LEU A 1 360 ? 0.702   54.175 -20.505 1.00 45.94 ? 360 LEU A CD2  1 
ATOM   3449 H H    . LEU A 1 360 ? 0.305   57.538 -21.240 1.00 0.00  ? 360 LEU A H    1 
ATOM   3450 N N    . ALA A 1 361 ? 3.574   56.288 -23.767 1.00 44.11 ? 361 ALA A N    1 
ATOM   3451 C CA   . ALA A 1 361 ? 4.418   56.755 -24.855 1.00 43.58 ? 361 ALA A CA   1 
ATOM   3452 C C    . ALA A 1 361 ? 3.557   56.984 -26.099 1.00 43.53 ? 361 ALA A C    1 
ATOM   3453 O O    . ALA A 1 361 ? 3.917   57.751 -26.994 1.00 41.78 ? 361 ALA A O    1 
ATOM   3454 C CB   . ALA A 1 361 ? 5.505   55.741 -25.142 1.00 42.76 ? 361 ALA A CB   1 
ATOM   3455 H H    . ALA A 1 361 ? 3.666   55.354 -23.439 1.00 0.00  ? 361 ALA A H    1 
ATOM   3456 N N    . ALA A 1 362 ? 2.392   56.359 -26.144 1.00 43.81 ? 362 ALA A N    1 
ATOM   3457 C CA   . ALA A 1 362 ? 1.547   56.552 -27.293 1.00 44.52 ? 362 ALA A CA   1 
ATOM   3458 C C    . ALA A 1 362 ? 0.273   57.387 -27.105 1.00 44.96 ? 362 ALA A C    1 
ATOM   3459 O O    . ALA A 1 362 ? -0.801  56.996 -27.593 1.00 45.46 ? 362 ALA A O    1 
ATOM   3460 C CB   . ALA A 1 362 ? 1.239   55.226 -27.960 1.00 45.65 ? 362 ALA A CB   1 
ATOM   3461 H H    . ALA A 1 362 ? 2.098   55.767 -25.418 1.00 0.00  ? 362 ALA A H    1 
ATOM   3462 N N    A ASP A 1 363 ? 0.393   58.531 -26.428 0.50 44.50 ? 363 ASP A N    1 
ATOM   3463 N N    B ASP A 1 363 ? 0.387   58.510 -26.381 0.50 45.21 ? 363 ASP A N    1 
ATOM   3464 C CA   A ASP A 1 363 ? -0.765  59.408 -26.265 0.50 45.17 ? 363 ASP A CA   1 
ATOM   3465 C CA   B ASP A 1 363 ? -0.760  59.419 -26.132 0.50 46.38 ? 363 ASP A CA   1 
ATOM   3466 C C    A ASP A 1 363 ? -0.768  60.651 -27.120 0.50 46.26 ? 363 ASP A C    1 
ATOM   3467 C C    B ASP A 1 363 ? -0.843  60.721 -26.934 0.50 46.98 ? 363 ASP A C    1 
ATOM   3468 O O    A ASP A 1 363 ? -1.669  60.852 -27.938 0.50 46.31 ? 363 ASP A O    1 
ATOM   3469 O O    B ASP A 1 363 ? -1.912  61.071 -27.440 0.50 47.03 ? 363 ASP A O    1 
ATOM   3470 C CB   A ASP A 1 363 ? -1.036  59.728 -24.791 0.50 42.87 ? 363 ASP A CB   1 
ATOM   3471 C CB   B ASP A 1 363 ? -0.927  59.668 -24.615 0.50 46.10 ? 363 ASP A CB   1 
ATOM   3472 C CG   A ASP A 1 363 ? -2.385  60.383 -24.590 0.50 40.75 ? 363 ASP A CG   1 
ATOM   3473 C CG   B ASP A 1 363 ? -1.932  58.707 -23.963 0.50 45.83 ? 363 ASP A CG   1 
ATOM   3474 O OD1  A ASP A 1 363 ? -3.285  60.155 -25.431 0.50 39.25 ? 363 ASP A OD1  1 
ATOM   3475 O OD1  B ASP A 1 363 ? -1.551  57.558 -23.627 0.50 45.28 ? 363 ASP A OD1  1 
ATOM   3476 O OD2  A ASP A 1 363 ? -2.554  61.123 -23.602 0.50 40.56 ? 363 ASP A OD2  1 
ATOM   3477 O OD2  B ASP A 1 363 ? -3.095  59.129 -23.756 0.50 45.88 ? 363 ASP A OD2  1 
ATOM   3478 H H    A ASP A 1 363 ? 1.244   58.794 -26.041 0.50 0.00  ? 363 ASP A H    1 
ATOM   3479 H H    B ASP A 1 363 ? 1.244   58.728 -25.976 0.50 0.00  ? 363 ASP A H    1 
ATOM   3480 N N    . ASP A 1 364 ? 0.217   61.500 -26.945 1.00 38.19 ? 364 ASP A N    1 
ATOM   3481 C CA   . ASP A 1 364 ? 0.466   62.790 -27.676 1.00 37.66 ? 364 ASP A CA   1 
ATOM   3482 C C    . ASP A 1 364 ? 1.550   63.557 -26.919 1.00 36.59 ? 364 ASP A C    1 
ATOM   3483 O O    . ASP A 1 364 ? 1.241   64.282 -25.942 1.00 34.59 ? 364 ASP A O    1 
ATOM   3484 C CB   . ASP A 1 364 ? -0.768  63.759 -27.834 1.00 38.13 ? 364 ASP A CB   1 
ATOM   3485 C CG   . ASP A 1 364 ? -0.516  64.867 -28.953 1.00 39.92 ? 364 ASP A CG   1 
ATOM   3486 O OD1  . ASP A 1 364 ? 0.633   65.300 -29.208 1.00 39.28 ? 364 ASP A OD1  1 
ATOM   3487 O OD2  . ASP A 1 364 ? -1.527  65.308 -29.547 1.00 39.74 ? 364 ASP A OD2  1 
ATOM   3488 H H    . ASP A 1 364 ? 0.581   61.146 -26.296 1.00 0.00  ? 364 ASP A H    1 
ATOM   3489 N N    . TRP A 1 365 ? 2.814   63.250 -27.162 1.00 44.35 ? 365 TRP A N    1 
ATOM   3490 C CA   . TRP A 1 365 ? 3.871   63.958 -26.451 1.00 42.57 ? 365 TRP A CA   1 
ATOM   3491 C C    . TRP A 1 365 ? 3.935   65.434 -26.661 1.00 42.71 ? 365 TRP A C    1 
ATOM   3492 O O    . TRP A 1 365 ? 3.978   66.194 -25.659 1.00 40.59 ? 365 TRP A O    1 
ATOM   3493 C CB   . TRP A 1 365 ? 5.230   63.238 -26.584 1.00 42.61 ? 365 TRP A CB   1 
ATOM   3494 C CG   . TRP A 1 365 ? 5.490   62.235 -25.453 1.00 43.27 ? 365 TRP A CG   1 
ATOM   3495 C CD1  . TRP A 1 365 ? 5.397   60.865 -25.531 1.00 42.45 ? 365 TRP A CD1  1 
ATOM   3496 C CD2  . TRP A 1 365 ? 5.783   62.553 -24.089 1.00 44.01 ? 365 TRP A CD2  1 
ATOM   3497 N NE1  . TRP A 1 365 ? 5.593   60.322 -24.278 1.00 42.51 ? 365 TRP A NE1  1 
ATOM   3498 C CE2  . TRP A 1 365 ? 5.843   61.326 -23.400 1.00 45.34 ? 365 TRP A CE2  1 
ATOM   3499 C CE3  . TRP A 1 365 ? 6.005   63.754 -23.381 1.00 43.66 ? 365 TRP A CE3  1 
ATOM   3500 C CZ2  . TRP A 1 365 ? 6.120   61.255 -21.991 1.00 46.07 ? 365 TRP A CZ2  1 
ATOM   3501 C CZ3  . TRP A 1 365 ? 6.275   63.692 -22.020 1.00 44.85 ? 365 TRP A CZ3  1 
ATOM   3502 C CH2  . TRP A 1 365 ? 6.340   62.467 -21.335 1.00 44.95 ? 365 TRP A CH2  1 
ATOM   3503 H H    . TRP A 1 365 ? 3.099   62.400 -27.647 1.00 0.00  ? 365 TRP A H    1 
ATOM   3504 H HE1  . TRP A 1 365 ? 5.517   59.383 -24.041 1.00 0.00  ? 365 TRP A HE1  1 
ATOM   3505 N N    A LYS A 1 366 ? 3.903   65.940 -27.915 0.50 40.45 ? 366 LYS A N    1 
ATOM   3506 N N    B LYS A 1 366 ? 3.898   65.942 -27.918 0.50 40.66 ? 366 LYS A N    1 
ATOM   3507 C CA   A LYS A 1 366 ? 3.960   67.378 -28.168 0.50 39.82 ? 366 LYS A CA   1 
ATOM   3508 C CA   B LYS A 1 366 ? 3.950   67.382 -28.168 0.50 40.16 ? 366 LYS A CA   1 
ATOM   3509 C C    A LYS A 1 366 ? 2.605   68.041 -27.897 0.50 39.75 ? 366 LYS A C    1 
ATOM   3510 C C    B LYS A 1 366 ? 2.602   68.044 -27.889 0.50 40.02 ? 366 LYS A C    1 
ATOM   3511 O O    A LYS A 1 366 ? 2.476   69.270 -27.947 0.50 38.51 ? 366 LYS A O    1 
ATOM   3512 O O    B LYS A 1 366 ? 2.471   69.272 -27.931 0.50 38.94 ? 366 LYS A O    1 
ATOM   3513 C CB   A LYS A 1 366 ? 4.428   67.678 -29.586 0.50 40.57 ? 366 LYS A CB   1 
ATOM   3514 C CB   B LYS A 1 366 ? 4.403   67.733 -29.585 0.50 41.40 ? 366 LYS A CB   1 
ATOM   3515 C CG   A LYS A 1 366 ? 4.626   69.155 -29.938 0.50 41.34 ? 366 LYS A CG   1 
ATOM   3516 C CG   B LYS A 1 366 ? 4.757   69.217 -29.758 0.50 42.47 ? 366 LYS A CG   1 
ATOM   3517 C CD   A LYS A 1 366 ? 6.018   69.706 -29.587 0.50 40.92 ? 366 LYS A CD   1 
ATOM   3518 C CD   B LYS A 1 366 ? 5.024   69.647 -31.214 0.50 42.61 ? 366 LYS A CD   1 
ATOM   3519 C CE   A LYS A 1 366 ? 6.330   70.915 -30.495 0.50 40.91 ? 366 LYS A CE   1 
ATOM   3520 C CE   B LYS A 1 366 ? 5.508   71.109 -31.248 0.50 43.19 ? 366 LYS A CE   1 
ATOM   3521 N NZ   A LYS A 1 366 ? 7.662   71.556 -30.321 0.50 38.12 ? 366 LYS A NZ   1 
ATOM   3522 N NZ   B LYS A 1 366 ? 5.744   71.697 -32.608 0.50 41.50 ? 366 LYS A NZ   1 
ATOM   3523 H H    A LYS A 1 366 ? 3.766   65.318 -28.646 0.50 0.00  ? 366 LYS A H    1 
ATOM   3524 H H    B LYS A 1 366 ? 3.758   65.321 -28.651 0.50 0.00  ? 366 LYS A H    1 
ATOM   3525 H HZ1  A LYS A 1 366 ? 8.411   70.859 -30.478 0.50 0.00  ? 366 LYS A HZ1  1 
ATOM   3526 H HZ1  B LYS A 1 366 ? 6.481   71.206 -33.145 0.50 0.00  ? 366 LYS A HZ1  1 
ATOM   3527 H HZ2  A LYS A 1 366 ? 7.733   72.314 -31.046 0.50 0.00  ? 366 LYS A HZ2  1 
ATOM   3528 H HZ2  B LYS A 1 366 ? 4.851   71.756 -33.136 0.50 0.00  ? 366 LYS A HZ2  1 
ATOM   3529 H HZ3  A LYS A 1 366 ? 7.731   71.953 -29.365 0.50 0.00  ? 366 LYS A HZ3  1 
ATOM   3530 H HZ3  B LYS A 1 366 ? 6.107   72.677 -32.481 0.50 0.00  ? 366 LYS A HZ3  1 
ATOM   3531 N N    . GLY A 1 367 ? 1.589   67.219 -27.639 1.00 39.58 ? 367 GLY A N    1 
ATOM   3532 C CA   . GLY A 1 367 ? 0.273   67.742 -27.339 1.00 39.95 ? 367 GLY A CA   1 
ATOM   3533 C C    . GLY A 1 367 ? 0.316   68.250 -25.902 1.00 40.32 ? 367 GLY A C    1 
ATOM   3534 O O    . GLY A 1 367 ? 0.005   69.424 -25.613 1.00 40.38 ? 367 GLY A O    1 
ATOM   3535 H H    . GLY A 1 367 ? 1.710   66.254 -27.664 1.00 0.00  ? 367 GLY A H    1 
ATOM   3536 N N    . VAL A 1 368 ? 0.772   67.361 -25.019 1.00 39.13 ? 368 VAL A N    1 
ATOM   3537 C CA   . VAL A 1 368 ? 0.904   67.614 -23.588 1.00 38.35 ? 368 VAL A CA   1 
ATOM   3538 C C    . VAL A 1 368 ? 1.269   69.043 -23.184 1.00 36.98 ? 368 VAL A C    1 
ATOM   3539 O O    . VAL A 1 368 ? 2.193   69.655 -23.743 1.00 36.68 ? 368 VAL A O    1 
ATOM   3540 C CB   . VAL A 1 368 ? 1.929   66.633 -22.954 1.00 39.21 ? 368 VAL A CB   1 
ATOM   3541 C CG1  . VAL A 1 368 ? 3.334   67.017 -23.309 1.00 39.85 ? 368 VAL A CG1  1 
ATOM   3542 C CG2  . VAL A 1 368 ? 1.779   66.609 -21.470 1.00 40.55 ? 368 VAL A CG2  1 
ATOM   3543 H H    . VAL A 1 368 ? 1.014   66.480 -25.371 1.00 0.00  ? 368 VAL A H    1 
ATOM   3544 N N    . GLU A 1 369 ? 0.532   69.562 -22.207 1.00 35.40 ? 369 GLU A N    1 
ATOM   3545 C CA   . GLU A 1 369 ? 0.760   70.903 -21.675 1.00 34.11 ? 369 GLU A CA   1 
ATOM   3546 C C    . GLU A 1 369 ? 1.026   70.798 -20.171 1.00 33.80 ? 369 GLU A C    1 
ATOM   3547 O O    . GLU A 1 369 ? 0.224   70.193 -19.434 1.00 32.64 ? 369 GLU A O    1 
ATOM   3548 C CB   . GLU A 1 369 ? -0.454  71.805 -21.934 1.00 33.53 ? 369 GLU A CB   1 
ATOM   3549 C CG   . GLU A 1 369 ? -0.052  73.188 -22.439 1.00 34.63 ? 369 GLU A CG   1 
ATOM   3550 C CD   . GLU A 1 369 ? -1.183  74.211 -22.353 1.00 36.66 ? 369 GLU A CD   1 
ATOM   3551 O OE1  . GLU A 1 369 ? -2.114  74.137 -23.200 1.00 34.68 ? 369 GLU A OE1  1 
ATOM   3552 O OE2  . GLU A 1 369 ? -1.126  75.089 -21.441 1.00 35.94 ? 369 GLU A OE2  1 
ATOM   3553 H H    . GLU A 1 369 ? -0.235  69.043 -21.867 1.00 0.00  ? 369 GLU A H    1 
ATOM   3554 N N    . PRO A 1 370 ? 2.142   71.398 -19.699 1.00 32.77 ? 370 PRO A N    1 
ATOM   3555 C CA   . PRO A 1 370 ? 2.670   71.468 -18.324 1.00 33.90 ? 370 PRO A CA   1 
ATOM   3556 C C    . PRO A 1 370 ? 2.045   72.440 -17.316 1.00 34.30 ? 370 PRO A C    1 
ATOM   3557 O O    . PRO A 1 370 ? 1.935   73.643 -17.564 1.00 34.45 ? 370 PRO A O    1 
ATOM   3558 C CB   . PRO A 1 370 ? 4.131   71.818 -18.549 1.00 34.29 ? 370 PRO A CB   1 
ATOM   3559 C CG   . PRO A 1 370 ? 4.050   72.730 -19.720 1.00 32.95 ? 370 PRO A CG   1 
ATOM   3560 C CD   . PRO A 1 370 ? 3.081   72.029 -20.639 1.00 31.81 ? 370 PRO A CD   1 
ATOM   3561 N N    . ILE A 1 371 ? 1.703   71.904 -16.148 1.00 35.99 ? 371 ILE A N    1 
ATOM   3562 C CA   . ILE A 1 371 ? 1.120   72.673 -15.049 1.00 35.36 ? 371 ILE A CA   1 
ATOM   3563 C C    . ILE A 1 371 ? 2.307   72.924 -14.128 1.00 37.18 ? 371 ILE A C    1 
ATOM   3564 O O    . ILE A 1 371 ? 2.833   71.985 -13.542 1.00 38.01 ? 371 ILE A O    1 
ATOM   3565 C CB   . ILE A 1 371 ? 0.058   71.842 -14.292 1.00 34.46 ? 371 ILE A CB   1 
ATOM   3566 C CG1  . ILE A 1 371 ? -1.024  71.376 -15.259 1.00 30.63 ? 371 ILE A CG1  1 
ATOM   3567 C CG2  . ILE A 1 371 ? -0.550  72.645 -13.136 1.00 32.19 ? 371 ILE A CG2  1 
ATOM   3568 C CD1  . ILE A 1 371 ? -2.146  70.644 -14.580 1.00 27.66 ? 371 ILE A CD1  1 
ATOM   3569 H H    . ILE A 1 371 ? 1.879   70.947 -15.980 1.00 0.00  ? 371 ILE A H    1 
ATOM   3570 N N    . TYR A 1 372 ? 2.760   74.170 -14.042 1.00 38.05 ? 372 TYR A N    1 
ATOM   3571 C CA   . TYR A 1 372 ? 3.919   74.496 -13.216 1.00 37.53 ? 372 TYR A CA   1 
ATOM   3572 C C    . TYR A 1 372 ? 3.510   74.965 -11.855 1.00 37.15 ? 372 TYR A C    1 
ATOM   3573 O O    . TYR A 1 372 ? 2.400   75.482 -11.691 1.00 36.25 ? 372 TYR A O    1 
ATOM   3574 C CB   . TYR A 1 372 ? 4.780   75.606 -13.850 1.00 35.70 ? 372 TYR A CB   1 
ATOM   3575 C CG   . TYR A 1 372 ? 5.405   75.216 -15.148 1.00 36.30 ? 372 TYR A CG   1 
ATOM   3576 C CD1  . TYR A 1 372 ? 6.599   74.498 -15.183 1.00 35.94 ? 372 TYR A CD1  1 
ATOM   3577 C CD2  . TYR A 1 372 ? 4.767   75.510 -16.360 1.00 38.04 ? 372 TYR A CD2  1 
ATOM   3578 C CE1  . TYR A 1 372 ? 7.140   74.075 -16.405 1.00 38.13 ? 372 TYR A CE1  1 
ATOM   3579 C CE2  . TYR A 1 372 ? 5.293   75.092 -17.576 1.00 37.77 ? 372 TYR A CE2  1 
ATOM   3580 C CZ   . TYR A 1 372 ? 6.474   74.382 -17.595 1.00 38.96 ? 372 TYR A CZ   1 
ATOM   3581 O OH   . TYR A 1 372 ? 6.991   73.999 -18.800 1.00 39.73 ? 372 TYR A OH   1 
ATOM   3582 H H    . TYR A 1 372 ? 2.267   74.879 -14.509 1.00 0.00  ? 372 TYR A H    1 
ATOM   3583 H HH   . TYR A 1 372 ? 6.457   74.415 -19.496 1.00 0.00  ? 372 TYR A HH   1 
ATOM   3584 N N    . GLU A 1 373 ? 4.396   74.734 -10.883 1.00 36.70 ? 373 GLU A N    1 
ATOM   3585 C CA   . GLU A 1 373 ? 4.207   75.206 -9.513  1.00 35.53 ? 373 GLU A CA   1 
ATOM   3586 C C    . GLU A 1 373 ? 5.283   76.302 -9.468  1.00 33.95 ? 373 GLU A C    1 
ATOM   3587 O O    . GLU A 1 373 ? 6.413   76.055 -9.956  1.00 34.57 ? 373 GLU A O    1 
ATOM   3588 C CB   . GLU A 1 373 ? 4.467   74.075 -8.491  1.00 37.46 ? 373 GLU A CB   1 
ATOM   3589 C CG   . GLU A 1 373 ? 4.223   74.454 -7.020  1.00 38.32 ? 373 GLU A CG   1 
ATOM   3590 C CD   . GLU A 1 373 ? 3.632   73.321 -6.151  1.00 39.07 ? 373 GLU A CD   1 
ATOM   3591 O OE1  . GLU A 1 373 ? 3.051   72.346 -6.693  1.00 38.05 ? 373 GLU A OE1  1 
ATOM   3592 O OE2  . GLU A 1 373 ? 3.717   73.427 -4.902  1.00 40.20 ? 373 GLU A OE2  1 
ATOM   3593 H H    . GLU A 1 373 ? 5.193   74.186 -11.055 1.00 0.00  ? 373 GLU A H    1 
ATOM   3594 N N    . THR A 1 374 ? 4.905   77.512 -9.009  1.00 31.57 ? 374 THR A N    1 
ATOM   3595 C CA   . THR A 1 374 ? 5.826   78.682 -8.940  1.00 32.24 ? 374 THR A CA   1 
ATOM   3596 C C    . THR A 1 374 ? 6.499   78.970 -7.571  1.00 31.19 ? 374 THR A C    1 
ATOM   3597 O O    . THR A 1 374 ? 5.858   78.876 -6.515  1.00 30.11 ? 374 THR A O    1 
ATOM   3598 C CB   . THR A 1 374 ? 5.144   79.987 -9.437  1.00 30.99 ? 374 THR A CB   1 
ATOM   3599 O OG1  . THR A 1 374 ? 4.360   79.725 -10.613 1.00 35.72 ? 374 THR A OG1  1 
ATOM   3600 C CG2  . THR A 1 374 ? 6.198   81.000 -9.827  1.00 32.95 ? 374 THR A CG2  1 
ATOM   3601 H H    . THR A 1 374 ? 3.993   77.642 -8.677  1.00 0.00  ? 374 THR A H    1 
ATOM   3602 H HG1  . THR A 1 374 ? 3.502   79.309 -10.399 1.00 0.00  ? 374 THR A HG1  1 
ATOM   3603 N N    . MET A 1 375 ? 7.788   79.316 -7.600  1.00 31.79 ? 375 MET A N    1 
ATOM   3604 C CA   . MET A 1 375 ? 8.582   79.615 -6.385  1.00 32.25 ? 375 MET A CA   1 
ATOM   3605 C C    . MET A 1 375 ? 9.585   80.777 -6.573  1.00 33.51 ? 375 MET A C    1 
ATOM   3606 O O    . MET A 1 375 ? 10.327  80.812 -7.552  1.00 35.99 ? 375 MET A O    1 
ATOM   3607 C CB   . MET A 1 375 ? 9.353   78.356 -5.928  1.00 30.39 ? 375 MET A CB   1 
ATOM   3608 C CG   . MET A 1 375 ? 8.509   77.363 -5.110  1.00 29.82 ? 375 MET A CG   1 
ATOM   3609 S SD   . MET A 1 375 ? 9.237   75.690 -4.912  1.00 29.58 ? 375 MET A SD   1 
ATOM   3610 C CE   . MET A 1 375 ? 10.648  75.996 -3.903  1.00 32.22 ? 375 MET A CE   1 
ATOM   3611 H H    . MET A 1 375 ? 8.297   79.314 -8.447  1.00 0.00  ? 375 MET A H    1 
ATOM   3612 N N    . PRO A 1 376 ? 9.621   81.732 -5.637  1.00 33.05 ? 376 PRO A N    1 
ATOM   3613 C CA   . PRO A 1 376 ? 10.544  82.873 -5.731  1.00 34.03 ? 376 PRO A CA   1 
ATOM   3614 C C    . PRO A 1 376 ? 11.981  82.377 -5.752  1.00 35.70 ? 376 PRO A C    1 
ATOM   3615 O O    . PRO A 1 376 ? 12.317  81.444 -5.034  1.00 36.75 ? 376 PRO A O    1 
ATOM   3616 C CB   . PRO A 1 376 ? 10.283  83.641 -4.424  1.00 34.27 ? 376 PRO A CB   1 
ATOM   3617 C CG   . PRO A 1 376 ? 8.880   83.270 -4.066  1.00 35.05 ? 376 PRO A CG   1 
ATOM   3618 C CD   . PRO A 1 376 ? 8.828   81.795 -4.400  1.00 34.89 ? 376 PRO A CD   1 
ATOM   3619 N N    . GLY A 1 377 ? 12.826  83.016 -6.542  1.00 36.12 ? 377 GLY A N    1 
ATOM   3620 C CA   . GLY A 1 377 ? 14.209  82.610 -6.622  1.00 36.86 ? 377 GLY A CA   1 
ATOM   3621 C C    . GLY A 1 377 ? 15.079  83.283 -5.578  1.00 39.23 ? 377 GLY A C    1 
ATOM   3622 O O    . GLY A 1 377 ? 14.588  83.936 -4.661  1.00 41.11 ? 377 GLY A O    1 
ATOM   3623 H H    . GLY A 1 377 ? 12.473  83.782 -7.073  1.00 0.00  ? 377 GLY A H    1 
ATOM   3624 N N    . TRP A 1 378 ? 16.386  83.082 -5.687  1.00 38.46 ? 378 TRP A N    1 
ATOM   3625 C CA   . TRP A 1 378 ? 17.315  83.678 -4.755  1.00 36.55 ? 378 TRP A CA   1 
ATOM   3626 C C    . TRP A 1 378 ? 18.259  84.517 -5.587  1.00 37.85 ? 378 TRP A C    1 
ATOM   3627 O O    . TRP A 1 378 ? 18.651  84.152 -6.710  1.00 37.89 ? 378 TRP A O    1 
ATOM   3628 C CB   . TRP A 1 378 ? 18.094  82.613 -3.963  1.00 35.08 ? 378 TRP A CB   1 
ATOM   3629 C CG   . TRP A 1 378 ? 18.618  81.517 -4.836  1.00 30.24 ? 378 TRP A CG   1 
ATOM   3630 C CD1  . TRP A 1 378 ? 19.868  81.442 -5.420  1.00 28.20 ? 378 TRP A CD1  1 
ATOM   3631 C CD2  . TRP A 1 378 ? 17.857  80.430 -5.372  1.00 26.55 ? 378 TRP A CD2  1 
ATOM   3632 N NE1  . TRP A 1 378 ? 19.907  80.399 -6.303  1.00 23.92 ? 378 TRP A NE1  1 
ATOM   3633 C CE2  . TRP A 1 378 ? 18.697  79.752 -6.297  1.00 26.43 ? 378 TRP A CE2  1 
ATOM   3634 C CE3  . TRP A 1 378 ? 16.546  79.967 -5.171  1.00 19.78 ? 378 TRP A CE3  1 
ATOM   3635 C CZ2  . TRP A 1 378 ? 18.261  78.632 -7.023  1.00 22.60 ? 378 TRP A CZ2  1 
ATOM   3636 C CZ3  . TRP A 1 378 ? 16.115  78.870 -5.888  1.00 20.25 ? 378 TRP A CZ3  1 
ATOM   3637 C CH2  . TRP A 1 378 ? 16.969  78.210 -6.806  1.00 22.24 ? 378 TRP A CH2  1 
ATOM   3638 H H    . TRP A 1 378 ? 16.738  82.562 -6.440  1.00 0.00  ? 378 TRP A H    1 
ATOM   3639 H HE1  . TRP A 1 378 ? 20.710  80.165 -6.864  1.00 0.00  ? 378 TRP A HE1  1 
ATOM   3640 N N    . SER A 1 379 ? 18.593  85.663 -5.019  1.00 38.62 ? 379 SER A N    1 
ATOM   3641 C CA   . SER A 1 379 ? 19.469  86.638 -5.631  1.00 39.44 ? 379 SER A CA   1 
ATOM   3642 C C    . SER A 1 379 ? 20.925  86.442 -5.174  1.00 39.10 ? 379 SER A C    1 
ATOM   3643 O O    . SER A 1 379 ? 21.845  87.029 -5.743  1.00 39.92 ? 379 SER A O    1 
ATOM   3644 C CB   . SER A 1 379 ? 18.930  88.016 -5.260  1.00 40.44 ? 379 SER A CB   1 
ATOM   3645 O OG   . SER A 1 379 ? 18.027  87.892 -4.152  1.00 40.17 ? 379 SER A OG   1 
ATOM   3646 H H    . SER A 1 379 ? 18.239  85.879 -4.130  1.00 0.00  ? 379 SER A H    1 
ATOM   3647 H HG   . SER A 1 379 ? 18.493  87.426 -3.431  1.00 0.00  ? 379 SER A HG   1 
ATOM   3648 N N    . GLU A 1 380 ? 21.127  85.609 -4.155  1.00 39.01 ? 380 GLU A N    1 
ATOM   3649 C CA   . GLU A 1 380 ? 22.457  85.327 -3.654  1.00 39.72 ? 380 GLU A CA   1 
ATOM   3650 C C    . GLU A 1 380 ? 23.188  84.337 -4.578  1.00 40.95 ? 380 GLU A C    1 
ATOM   3651 O O    . GLU A 1 380 ? 22.695  83.978 -5.648  1.00 41.76 ? 380 GLU A O    1 
ATOM   3652 C CB   . GLU A 1 380 ? 22.390  84.812 -2.229  1.00 41.23 ? 380 GLU A CB   1 
ATOM   3653 C CG   . GLU A 1 380 ? 21.569  85.684 -1.277  1.00 43.99 ? 380 GLU A CG   1 
ATOM   3654 C CD   . GLU A 1 380 ? 20.046  85.479 -1.414  1.00 46.00 ? 380 GLU A CD   1 
ATOM   3655 O OE1  . GLU A 1 380 ? 19.416  86.088 -2.328  1.00 45.86 ? 380 GLU A OE1  1 
ATOM   3656 O OE2  . GLU A 1 380 ? 19.478  84.701 -0.599  1.00 47.63 ? 380 GLU A OE2  1 
ATOM   3657 H H    . GLU A 1 380 ? 20.359  85.188 -3.723  1.00 0.00  ? 380 GLU A H    1 
ATOM   3658 N N    . SER A 1 381 ? 24.398  83.945 -4.206  1.00 41.24 ? 381 SER A N    1 
ATOM   3659 C CA   . SER A 1 381 ? 25.165  83.045 -5.047  1.00 39.04 ? 381 SER A CA   1 
ATOM   3660 C C    . SER A 1 381 ? 25.125  81.667 -4.456  1.00 39.63 ? 381 SER A C    1 
ATOM   3661 O O    . SER A 1 381 ? 24.528  81.422 -3.406  1.00 40.26 ? 381 SER A O    1 
ATOM   3662 C CB   . SER A 1 381 ? 26.621  83.509 -5.163  1.00 39.99 ? 381 SER A CB   1 
ATOM   3663 O OG   . SER A 1 381 ? 27.273  82.926 -6.297  1.00 39.35 ? 381 SER A OG   1 
ATOM   3664 H H    . SER A 1 381 ? 24.775  84.233 -3.355  1.00 0.00  ? 381 SER A H    1 
ATOM   3665 H HG   . SER A 1 381 ? 28.116  83.374 -6.413  1.00 0.00  ? 381 SER A HG   1 
ATOM   3666 N N    . THR A 1 382 ? 25.766  80.743 -5.142  1.00 39.33 ? 382 THR A N    1 
ATOM   3667 C CA   . THR A 1 382 ? 25.791  79.395 -4.650  1.00 37.20 ? 382 THR A CA   1 
ATOM   3668 C C    . THR A 1 382 ? 26.997  78.614 -5.129  1.00 38.53 ? 382 THR A C    1 
ATOM   3669 O O    . THR A 1 382 ? 27.511  77.756 -4.384  1.00 38.35 ? 382 THR A O    1 
ATOM   3670 C CB   . THR A 1 382 ? 24.454  78.727 -4.950  1.00 33.29 ? 382 THR A CB   1 
ATOM   3671 O OG1  . THR A 1 382 ? 23.546  79.065 -3.892  1.00 30.87 ? 382 THR A OG1  1 
ATOM   3672 C CG2  . THR A 1 382 ? 24.587  77.237 -5.083  1.00 30.25 ? 382 THR A CG2  1 
ATOM   3673 H H    . THR A 1 382 ? 26.179  81.030 -5.981  1.00 0.00  ? 382 THR A H    1 
ATOM   3674 H HG1  . THR A 1 382 ? 23.598  80.029 -3.759  1.00 0.00  ? 382 THR A HG1  1 
ATOM   3675 N N    . PHE A 1 383 ? 27.549  79.016 -6.276  1.00 38.05 ? 383 PHE A N    1 
ATOM   3676 C CA   . PHE A 1 383 ? 28.688  78.295 -6.833  1.00 39.05 ? 383 PHE A CA   1 
ATOM   3677 C C    . PHE A 1 383 ? 29.916  78.174 -5.941  1.00 38.68 ? 383 PHE A C    1 
ATOM   3678 O O    . PHE A 1 383 ? 30.787  79.037 -5.955  1.00 39.43 ? 383 PHE A O    1 
ATOM   3679 C CB   . PHE A 1 383 ? 29.103  78.864 -8.179  1.00 40.65 ? 383 PHE A CB   1 
ATOM   3680 C CG   . PHE A 1 383 ? 30.184  78.067 -8.858  1.00 43.52 ? 383 PHE A CG   1 
ATOM   3681 C CD1  . PHE A 1 383 ? 31.525  78.250 -8.525  1.00 43.31 ? 383 PHE A CD1  1 
ATOM   3682 C CD2  . PHE A 1 383 ? 29.861  77.132 -9.837  1.00 44.65 ? 383 PHE A CD2  1 
ATOM   3683 C CE1  . PHE A 1 383 ? 32.521  77.523 -9.149  1.00 44.14 ? 383 PHE A CE1  1 
ATOM   3684 C CE2  . PHE A 1 383 ? 30.851  76.402 -10.468 1.00 44.15 ? 383 PHE A CE2  1 
ATOM   3685 C CZ   . PHE A 1 383 ? 32.183  76.600 -10.123 1.00 44.87 ? 383 PHE A CZ   1 
ATOM   3686 H H    . PHE A 1 383 ? 27.201  79.803 -6.742  1.00 0.00  ? 383 PHE A H    1 
ATOM   3687 N N    . GLY A 1 384 ? 30.007  77.074 -5.206  1.00 37.37 ? 384 GLY A N    1 
ATOM   3688 C CA   . GLY A 1 384 ? 31.164  76.873 -4.356  1.00 37.33 ? 384 GLY A CA   1 
ATOM   3689 C C    . GLY A 1 384 ? 30.900  76.778 -2.871  1.00 36.89 ? 384 GLY A C    1 
ATOM   3690 O O    . GLY A 1 384 ? 31.839  76.577 -2.107  1.00 35.26 ? 384 GLY A O    1 
ATOM   3691 H H    . GLY A 1 384 ? 29.312  76.387 -5.248  1.00 0.00  ? 384 GLY A H    1 
ATOM   3692 N N    . VAL A 1 385 ? 29.639  76.920 -2.466  1.00 35.25 ? 385 VAL A N    1 
ATOM   3693 C CA   . VAL A 1 385 ? 29.281  76.840 -1.063  1.00 35.10 ? 385 VAL A CA   1 
ATOM   3694 C C    . VAL A 1 385 ? 29.375  75.428 -0.506  1.00 37.31 ? 385 VAL A C    1 
ATOM   3695 O O    . VAL A 1 385 ? 29.076  74.454 -1.200  1.00 38.69 ? 385 VAL A O    1 
ATOM   3696 C CB   . VAL A 1 385 ? 27.885  77.386 -0.827  1.00 34.46 ? 385 VAL A CB   1 
ATOM   3697 C CG1  . VAL A 1 385 ? 27.356  76.923 0.518   1.00 33.20 ? 385 VAL A CG1  1 
ATOM   3698 C CG2  . VAL A 1 385 ? 27.947  78.907 -0.855  1.00 34.66 ? 385 VAL A CG2  1 
ATOM   3699 H H    . VAL A 1 385 ? 28.939  77.090 -3.134  1.00 0.00  ? 385 VAL A H    1 
ATOM   3700 N N    . LYS A 1 386 ? 29.789  75.305 0.749   1.00 38.08 ? 386 LYS A N    1 
ATOM   3701 C CA   . LYS A 1 386 ? 29.891  73.985 1.334   1.00 38.48 ? 386 LYS A CA   1 
ATOM   3702 C C    . LYS A 1 386 ? 29.095  73.883 2.621   1.00 39.22 ? 386 LYS A C    1 
ATOM   3703 O O    . LYS A 1 386 ? 29.630  73.466 3.643   1.00 40.68 ? 386 LYS A O    1 
ATOM   3704 C CB   . LYS A 1 386 ? 31.361  73.597 1.554   1.00 38.43 ? 386 LYS A CB   1 
ATOM   3705 C CG   . LYS A 1 386 ? 31.559  72.096 1.668   1.00 37.78 ? 386 LYS A CG   1 
ATOM   3706 C CD   . LYS A 1 386 ? 32.978  71.712 2.004   1.00 41.33 ? 386 LYS A CD   1 
ATOM   3707 C CE   . LYS A 1 386 ? 33.154  70.198 2.115   1.00 40.55 ? 386 LYS A CE   1 
ATOM   3708 N NZ   . LYS A 1 386 ? 34.582  69.883 2.440   1.00 43.99 ? 386 LYS A NZ   1 
ATOM   3709 H H    . LYS A 1 386 ? 30.027  76.095 1.277   1.00 0.00  ? 386 LYS A H    1 
ATOM   3710 H HZ1  . LYS A 1 386 ? 34.812  70.382 3.336   1.00 0.00  ? 386 LYS A HZ1  1 
ATOM   3711 H HZ2  . LYS A 1 386 ? 34.743  68.860 2.540   1.00 0.00  ? 386 LYS A HZ2  1 
ATOM   3712 H HZ3  . LYS A 1 386 ? 35.180  70.248 1.683   1.00 0.00  ? 386 LYS A HZ3  1 
ATOM   3713 N N    . ASP A 1 387 ? 27.819  74.266 2.583   1.00 39.34 ? 387 ASP A N    1 
ATOM   3714 C CA   . ASP A 1 387 ? 26.971  74.196 3.770   1.00 37.70 ? 387 ASP A CA   1 
ATOM   3715 C C    . ASP A 1 387 ? 25.555  74.686 3.589   1.00 37.58 ? 387 ASP A C    1 
ATOM   3716 O O    . ASP A 1 387 ? 25.280  75.638 2.863   1.00 37.84 ? 387 ASP A O    1 
ATOM   3717 C CB   . ASP A 1 387 ? 27.625  74.931 4.944   1.00 39.17 ? 387 ASP A CB   1 
ATOM   3718 C CG   . ASP A 1 387 ? 26.618  75.449 5.973   1.00 41.76 ? 387 ASP A CG   1 
ATOM   3719 O OD1  . ASP A 1 387 ? 25.805  74.655 6.515   1.00 42.39 ? 387 ASP A OD1  1 
ATOM   3720 O OD2  . ASP A 1 387 ? 26.652  76.671 6.263   1.00 39.35 ? 387 ASP A OD2  1 
ATOM   3721 H H    . ASP A 1 387 ? 27.404  74.608 1.764   1.00 0.00  ? 387 ASP A H    1 
ATOM   3722 N N    . ARG A 1 388 ? 24.666  74.031 4.320   1.00 38.27 ? 388 ARG A N    1 
ATOM   3723 C CA   . ARG A 1 388 ? 23.247  74.332 4.341   1.00 37.24 ? 388 ARG A CA   1 
ATOM   3724 C C    . ARG A 1 388 ? 23.069  75.738 4.898   1.00 36.08 ? 388 ARG A C    1 
ATOM   3725 O O    . ARG A 1 388 ? 22.498  76.613 4.243   1.00 33.16 ? 388 ARG A O    1 
ATOM   3726 C CB   . ARG A 1 388 ? 22.549  73.321 5.259   1.00 37.62 ? 388 ARG A CB   1 
ATOM   3727 C CG   . ARG A 1 388 ? 21.025  73.530 5.487   1.00 41.34 ? 388 ARG A CG   1 
ATOM   3728 C CD   . ARG A 1 388 ? 20.426  72.254 6.112   1.00 42.39 ? 388 ARG A CD   1 
ATOM   3729 N NE   . ARG A 1 388 ? 19.004  72.368 6.403   1.00 43.26 ? 388 ARG A NE   1 
ATOM   3730 C CZ   . ARG A 1 388 ? 18.064  71.547 5.935   1.00 42.00 ? 388 ARG A CZ   1 
ATOM   3731 N NH1  . ARG A 1 388 ? 18.384  70.537 5.135   1.00 42.07 ? 388 ARG A NH1  1 
ATOM   3732 N NH2  . ARG A 1 388 ? 16.803  71.706 6.310   1.00 42.19 ? 388 ARG A NH2  1 
ATOM   3733 H H    . ARG A 1 388 ? 25.016  73.342 4.919   1.00 0.00  ? 388 ARG A H    1 
ATOM   3734 H HE   . ARG A 1 388 ? 18.742  73.109 6.991   1.00 0.00  ? 388 ARG A HE   1 
ATOM   3735 H HH11 . ARG A 1 388 ? 19.335  70.403 4.852   1.00 0.00  ? 388 ARG A HH11 1 
ATOM   3736 H HH12 . ARG A 1 388 ? 17.682  69.949 4.726   1.00 0.00  ? 388 ARG A HH12 1 
ATOM   3737 H HH21 . ARG A 1 388 ? 16.549  72.432 6.950   1.00 0.00  ? 388 ARG A HH21 1 
ATOM   3738 H HH22 . ARG A 1 388 ? 16.088  71.100 5.959   1.00 0.00  ? 388 ARG A HH22 1 
ATOM   3739 N N    . SER A 1 389 ? 23.583  75.945 6.106   1.00 37.05 ? 389 SER A N    1 
ATOM   3740 C CA   . SER A 1 389 ? 23.477  77.233 6.791   1.00 38.79 ? 389 SER A CA   1 
ATOM   3741 C C    . SER A 1 389 ? 23.775  78.362 5.796   1.00 38.87 ? 389 SER A C    1 
ATOM   3742 O O    . SER A 1 389 ? 22.879  79.129 5.423   1.00 38.11 ? 389 SER A O    1 
ATOM   3743 C CB   . SER A 1 389 ? 24.428  77.266 8.010   1.00 40.78 ? 389 SER A CB   1 
ATOM   3744 O OG   . SER A 1 389 ? 24.398  76.032 8.747   1.00 38.40 ? 389 SER A OG   1 
ATOM   3745 H H    . SER A 1 389 ? 24.112  75.232 6.524   1.00 0.00  ? 389 SER A H    1 
ATOM   3746 H HG   . SER A 1 389 ? 24.934  75.421 8.214   1.00 0.00  ? 389 SER A HG   1 
ATOM   3747 N N    . GLY A 1 390 ? 24.997  78.371 5.272   1.00 39.80 ? 390 GLY A N    1 
ATOM   3748 C CA   . GLY A 1 390 ? 25.389  79.371 4.303   1.00 38.74 ? 390 GLY A CA   1 
ATOM   3749 C C    . GLY A 1 390 ? 24.825  79.138 2.914   1.00 39.51 ? 390 GLY A C    1 
ATOM   3750 O O    . GLY A 1 390 ? 25.529  79.350 1.934   1.00 39.62 ? 390 GLY A O    1 
ATOM   3751 H H    . GLY A 1 390 ? 25.654  77.690 5.557   1.00 0.00  ? 390 GLY A H    1 
ATOM   3752 N N    . LEU A 1 391 ? 23.553  78.754 2.824   1.00 39.30 ? 391 LEU A N    1 
ATOM   3753 C CA   . LEU A 1 391 ? 22.878  78.520 1.550   1.00 38.72 ? 391 LEU A CA   1 
ATOM   3754 C C    . LEU A 1 391 ? 21.577  79.338 1.672   1.00 38.59 ? 391 LEU A C    1 
ATOM   3755 O O    . LEU A 1 391 ? 20.921  79.315 2.704   1.00 38.55 ? 391 LEU A O    1 
ATOM   3756 C CB   . LEU A 1 391 ? 22.570  77.011 1.412   1.00 41.91 ? 391 LEU A CB   1 
ATOM   3757 C CG   . LEU A 1 391 ? 22.761  76.081 0.195   1.00 41.25 ? 391 LEU A CG   1 
ATOM   3758 C CD1  . LEU A 1 391 ? 21.545  76.099 -0.733  1.00 40.33 ? 391 LEU A CD1  1 
ATOM   3759 C CD2  . LEU A 1 391 ? 24.065  76.425 -0.529  1.00 41.82 ? 391 LEU A CD2  1 
ATOM   3760 H H    . LEU A 1 391 ? 23.001  78.601 3.629   1.00 0.00  ? 391 LEU A H    1 
ATOM   3761 N N    . PRO A 1 392 ? 21.214  80.114 0.644   1.00 37.91 ? 392 PRO A N    1 
ATOM   3762 C CA   . PRO A 1 392 ? 19.983  80.901 0.745   1.00 38.43 ? 392 PRO A CA   1 
ATOM   3763 C C    . PRO A 1 392 ? 18.700  80.166 1.160   1.00 38.09 ? 392 PRO A C    1 
ATOM   3764 O O    . PRO A 1 392 ? 18.404  79.065 0.689   1.00 38.25 ? 392 PRO A O    1 
ATOM   3765 C CB   . PRO A 1 392 ? 19.866  81.557 -0.639  1.00 37.41 ? 392 PRO A CB   1 
ATOM   3766 C CG   . PRO A 1 392 ? 20.671  80.690 -1.505  1.00 37.98 ? 392 PRO A CG   1 
ATOM   3767 C CD   . PRO A 1 392 ? 21.862  80.356 -0.645  1.00 37.72 ? 392 PRO A CD   1 
ATOM   3768 N N    A GLN A 1 393 ? 17.929  80.775 2.059   0.50 37.69 ? 393 GLN A N    1 
ATOM   3769 N N    B GLN A 1 393 ? 17.941  80.866 2.000   0.50 38.11 ? 393 GLN A N    1 
ATOM   3770 C CA   A GLN A 1 393 ? 16.695  80.158 2.523   0.50 36.48 ? 393 GLN A CA   1 
ATOM   3771 C CA   B GLN A 1 393 ? 16.666  80.454 2.570   0.50 37.38 ? 393 GLN A CA   1 
ATOM   3772 C C    A GLN A 1 393 ? 15.791  79.857 1.339   0.50 36.70 ? 393 GLN A C    1 
ATOM   3773 C C    B GLN A 1 393 ? 15.721  80.025 1.450   0.50 37.34 ? 393 GLN A C    1 
ATOM   3774 O O    A GLN A 1 393 ? 15.111  78.836 1.330   0.50 36.36 ? 393 GLN A O    1 
ATOM   3775 O O    B GLN A 1 393 ? 14.952  79.085 1.602   0.50 37.34 ? 393 GLN A O    1 
ATOM   3776 C CB   A GLN A 1 393 ? 15.978  81.054 3.532   0.50 36.51 ? 393 GLN A CB   1 
ATOM   3777 C CB   B GLN A 1 393 ? 16.092  81.680 3.291   0.50 38.01 ? 393 GLN A CB   1 
ATOM   3778 C CG   A GLN A 1 393 ? 14.668  80.475 4.091   0.50 36.42 ? 393 GLN A CG   1 
ATOM   3779 C CG   B GLN A 1 393 ? 15.138  81.448 4.452   0.50 38.77 ? 393 GLN A CG   1 
ATOM   3780 C CD   A GLN A 1 393 ? 14.863  79.360 5.112   0.50 34.65 ? 393 GLN A CD   1 
ATOM   3781 C CD   B GLN A 1 393 ? 14.596  82.769 5.010   0.50 38.09 ? 393 GLN A CD   1 
ATOM   3782 O OE1  A GLN A 1 393 ? 15.365  79.586 6.218   0.50 34.54 ? 393 GLN A OE1  1 
ATOM   3783 O OE1  B GLN A 1 393 ? 14.475  83.753 4.275   0.50 37.34 ? 393 GLN A OE1  1 
ATOM   3784 N NE2  A GLN A 1 393 ? 14.422  78.160 4.762   0.50 33.87 ? 393 GLN A NE2  1 
ATOM   3785 N NE2  B GLN A 1 393 ? 14.274  82.795 6.306   0.50 36.35 ? 393 GLN A NE2  1 
ATOM   3786 H H    A GLN A 1 393 ? 18.209  81.642 2.416   0.50 0.00  ? 393 GLN A H    1 
ATOM   3787 H H    B GLN A 1 393 ? 18.284  81.743 2.266   0.50 0.00  ? 393 GLN A H    1 
ATOM   3788 H HE21 A GLN A 1 393 ? 14.561  77.454 5.418   0.50 0.00  ? 393 GLN A HE21 1 
ATOM   3789 H HE21 B GLN A 1 393 ? 13.904  83.638 6.644   0.50 0.00  ? 393 GLN A HE21 1 
ATOM   3790 H HE22 A GLN A 1 393 ? 14.003  78.074 3.880   0.50 0.00  ? 393 GLN A HE22 1 
ATOM   3791 H HE22 B GLN A 1 393 ? 14.398  81.995 6.850   0.50 0.00  ? 393 GLN A HE22 1 
ATOM   3792 N N    . ALA A 1 394 ? 15.827  80.707 0.313   1.00 37.41 ? 394 ALA A N    1 
ATOM   3793 C CA   . ALA A 1 394 ? 14.988  80.469 -0.869  1.00 37.76 ? 394 ALA A CA   1 
ATOM   3794 C C    . ALA A 1 394 ? 15.411  79.233 -1.653  1.00 35.79 ? 394 ALA A C    1 
ATOM   3795 O O    . ALA A 1 394 ? 14.564  78.460 -2.102  1.00 37.48 ? 394 ALA A O    1 
ATOM   3796 C CB   . ALA A 1 394 ? 14.961  81.711 -1.795  1.00 37.24 ? 394 ALA A CB   1 
ATOM   3797 H H    . ALA A 1 394 ? 16.450  81.453 0.311   1.00 0.00  ? 394 ALA A H    1 
ATOM   3798 N N    . ALA A 1 395 ? 16.721  79.068 -1.837  1.00 33.88 ? 395 ALA A N    1 
ATOM   3799 C CA   . ALA A 1 395 ? 17.242  77.905 -2.554  1.00 31.56 ? 395 ALA A CA   1 
ATOM   3800 C C    . ALA A 1 395 ? 16.828  76.695 -1.743  1.00 30.84 ? 395 ALA A C    1 
ATOM   3801 O O    . ALA A 1 395 ? 16.142  75.819 -2.245  1.00 30.94 ? 395 ALA A O    1 
ATOM   3802 C CB   . ALA A 1 395 ? 18.752  77.970 -2.676  1.00 28.47 ? 395 ALA A CB   1 
ATOM   3803 H H    . ALA A 1 395 ? 17.347  79.721 -1.479  1.00 0.00  ? 395 ALA A H    1 
ATOM   3804 N N    . LEU A 1 396 ? 17.157  76.701 -0.461  1.00 31.18 ? 396 LEU A N    1 
ATOM   3805 C CA   . LEU A 1 396 ? 16.805  75.594 0.408   1.00 31.61 ? 396 LEU A CA   1 
ATOM   3806 C C    . LEU A 1 396 ? 15.368  75.171 0.263   1.00 31.89 ? 396 LEU A C    1 
ATOM   3807 O O    . LEU A 1 396 ? 15.043  74.006 0.497   1.00 31.24 ? 396 LEU A O    1 
ATOM   3808 C CB   . LEU A 1 396 ? 17.018  75.940 1.867   1.00 32.95 ? 396 LEU A CB   1 
ATOM   3809 C CG   . LEU A 1 396 ? 18.220  75.366 2.587   1.00 30.64 ? 396 LEU A CG   1 
ATOM   3810 C CD1  . LEU A 1 396 ? 19.465  76.194 2.303   1.00 34.03 ? 396 LEU A CD1  1 
ATOM   3811 C CD2  . LEU A 1 396 ? 17.888  75.436 4.051   1.00 35.85 ? 396 LEU A CD2  1 
ATOM   3812 H H    . LEU A 1 396 ? 17.631  77.473 -0.073  1.00 0.00  ? 396 LEU A H    1 
ATOM   3813 N N    . ASN A 1 397 ? 14.485  76.098 -0.083  1.00 32.95 ? 397 ASN A N    1 
ATOM   3814 C CA   . ASN A 1 397 ? 13.088  75.705 -0.200  1.00 35.44 ? 397 ASN A CA   1 
ATOM   3815 C C    . ASN A 1 397 ? 12.738  75.025 -1.519  1.00 34.39 ? 397 ASN A C    1 
ATOM   3816 O O    . ASN A 1 397 ? 11.698  74.395 -1.638  1.00 33.35 ? 397 ASN A O    1 
ATOM   3817 C CB   . ASN A 1 397 ? 12.140  76.866 0.120   1.00 37.40 ? 397 ASN A CB   1 
ATOM   3818 C CG   . ASN A 1 397 ? 11.062  76.460 1.112   1.00 38.30 ? 397 ASN A CG   1 
ATOM   3819 O OD1  . ASN A 1 397 ? 11.161  76.756 2.301   1.00 38.78 ? 397 ASN A OD1  1 
ATOM   3820 N ND2  . ASN A 1 397 ? 10.078  75.694 0.643   1.00 36.57 ? 397 ASN A ND2  1 
ATOM   3821 H H    . ASN A 1 397 ? 14.741  77.042 -0.161  1.00 0.00  ? 397 ASN A H    1 
ATOM   3822 H HD21 . ASN A 1 397 ? 9.341   75.442 1.235   1.00 0.00  ? 397 ASN A HD21 1 
ATOM   3823 H HD22 . ASN A 1 397 ? 10.129  75.423 -0.302  1.00 0.00  ? 397 ASN A HD22 1 
ATOM   3824 N N    . TYR A 1 398 ? 13.630  75.152 -2.494  1.00 34.02 ? 398 TYR A N    1 
ATOM   3825 C CA   . TYR A 1 398 ? 13.490  74.537 -3.811  1.00 32.42 ? 398 TYR A CA   1 
ATOM   3826 C C    . TYR A 1 398 ? 13.732  73.015 -3.574  1.00 31.06 ? 398 TYR A C    1 
ATOM   3827 O O    . TYR A 1 398 ? 13.013  72.149 -4.087  1.00 29.27 ? 398 TYR A O    1 
ATOM   3828 C CB   . TYR A 1 398 ? 14.560  75.170 -4.738  1.00 33.29 ? 398 TYR A CB   1 
ATOM   3829 C CG   . TYR A 1 398 ? 14.551  74.733 -6.182  1.00 34.20 ? 398 TYR A CG   1 
ATOM   3830 C CD1  . TYR A 1 398 ? 13.355  74.555 -6.877  1.00 35.55 ? 398 TYR A CD1  1 
ATOM   3831 C CD2  . TYR A 1 398 ? 15.741  74.455 -6.842  1.00 36.72 ? 398 TYR A CD2  1 
ATOM   3832 C CE1  . TYR A 1 398 ? 13.347  74.095 -8.194  1.00 36.63 ? 398 TYR A CE1  1 
ATOM   3833 C CE2  . TYR A 1 398 ? 15.745  73.998 -8.161  1.00 38.57 ? 398 TYR A CE2  1 
ATOM   3834 C CZ   . TYR A 1 398 ? 14.544  73.814 -8.831  1.00 37.44 ? 398 TYR A CZ   1 
ATOM   3835 O OH   . TYR A 1 398 ? 14.535  73.316 -10.116 1.00 36.10 ? 398 TYR A OH   1 
ATOM   3836 H H    . TYR A 1 398 ? 14.452  75.672 -2.323  1.00 0.00  ? 398 TYR A H    1 
ATOM   3837 H HH   . TYR A 1 398 ? 15.404  73.124 -10.510 1.00 0.00  ? 398 TYR A HH   1 
ATOM   3838 N N    . ILE A 1 399 ? 14.676  72.726 -2.686  1.00 29.13 ? 399 ILE A N    1 
ATOM   3839 C CA   . ILE A 1 399 ? 15.050  71.364 -2.339  1.00 30.10 ? 399 ILE A CA   1 
ATOM   3840 C C    . ILE A 1 399 ? 13.896  70.533 -1.778  1.00 32.85 ? 399 ILE A C    1 
ATOM   3841 O O    . ILE A 1 399 ? 13.492  69.509 -2.337  1.00 36.31 ? 399 ILE A O    1 
ATOM   3842 C CB   . ILE A 1 399 ? 16.120  71.346 -1.223  1.00 28.29 ? 399 ILE A CB   1 
ATOM   3843 C CG1  . ILE A 1 399 ? 17.321  72.236 -1.553  1.00 25.47 ? 399 ILE A CG1  1 
ATOM   3844 C CG2  . ILE A 1 399 ? 16.481  69.911 -0.888  1.00 27.52 ? 399 ILE A CG2  1 
ATOM   3845 C CD1  . ILE A 1 399 ? 18.216  71.696 -2.605  1.00 24.69 ? 399 ILE A CD1  1 
ATOM   3846 H H    . ILE A 1 399 ? 15.136  73.495 -2.296  1.00 0.00  ? 399 ILE A H    1 
ATOM   3847 N N    . LYS A 1 400 ? 13.387  70.978 -0.641  1.00 32.69 ? 400 LYS A N    1 
ATOM   3848 C CA   . LYS A 1 400 ? 12.347  70.262 0.078   1.00 32.05 ? 400 LYS A CA   1 
ATOM   3849 C C    . LYS A 1 400 ? 11.168  69.919 -0.804  1.00 33.19 ? 400 LYS A C    1 
ATOM   3850 O O    . LYS A 1 400 ? 10.559  68.826 -0.684  1.00 30.98 ? 400 LYS A O    1 
ATOM   3851 C CB   . LYS A 1 400 ? 11.969  71.064 1.322   1.00 30.17 ? 400 LYS A CB   1 
ATOM   3852 C CG   . LYS A 1 400 ? 13.256  71.594 2.004   1.00 27.17 ? 400 LYS A CG   1 
ATOM   3853 C CD   . LYS A 1 400 ? 12.978  72.387 3.234   1.00 26.83 ? 400 LYS A CD   1 
ATOM   3854 C CE   . LYS A 1 400 ? 12.119  73.618 2.992   1.00 24.95 ? 400 LYS A CE   1 
ATOM   3855 N NZ   . LYS A 1 400 ? 12.008  74.356 4.302   1.00 23.69 ? 400 LYS A NZ   1 
ATOM   3856 H H    . LYS A 1 400 ? 13.749  71.823 -0.310  1.00 0.00  ? 400 LYS A H    1 
ATOM   3857 H HZ1  . LYS A 1 400 ? 12.957  74.640 4.610   1.00 0.00  ? 400 LYS A HZ1  1 
ATOM   3858 H HZ2  . LYS A 1 400 ? 11.457  75.220 4.103   1.00 0.00  ? 400 LYS A HZ2  1 
ATOM   3859 H HZ3  . LYS A 1 400 ? 11.539  73.779 5.027   1.00 0.00  ? 400 LYS A HZ3  1 
ATOM   3860 N N    . ARG A 1 401 ? 10.929  70.821 -1.755  1.00 33.22 ? 401 ARG A N    1 
ATOM   3861 C CA   . ARG A 1 401 ? 9.860   70.682 -2.714  1.00 32.55 ? 401 ARG A CA   1 
ATOM   3862 C C    . ARG A 1 401 ? 10.230  69.570 -3.683  1.00 31.08 ? 401 ARG A C    1 
ATOM   3863 O O    . ARG A 1 401 ? 9.381   68.745 -4.055  1.00 29.62 ? 401 ARG A O    1 
ATOM   3864 C CB   . ARG A 1 401 ? 9.673   71.995 -3.454  1.00 35.53 ? 401 ARG A CB   1 
ATOM   3865 C CG   . ARG A 1 401 ? 8.517   72.824 -2.909  1.00 38.27 ? 401 ARG A CG   1 
ATOM   3866 C CD   . ARG A 1 401 ? 7.161   72.308 -3.427  1.00 40.19 ? 401 ARG A CD   1 
ATOM   3867 N NE   . ARG A 1 401 ? 6.636   71.123 -2.753  1.00 39.42 ? 401 ARG A NE   1 
ATOM   3868 C CZ   . ARG A 1 401 ? 5.420   70.642 -2.987  1.00 42.53 ? 401 ARG A CZ   1 
ATOM   3869 N NH1  . ARG A 1 401 ? 4.631   71.249 -3.858  1.00 42.92 ? 401 ARG A NH1  1 
ATOM   3870 N NH2  . ARG A 1 401 ? 4.973   69.570 -2.342  1.00 45.23 ? 401 ARG A NH2  1 
ATOM   3871 H H    . ARG A 1 401 ? 11.473  71.629 -1.804  1.00 0.00  ? 401 ARG A H    1 
ATOM   3872 H HE   . ARG A 1 401 ? 7.169   70.714 -2.021  1.00 0.00  ? 401 ARG A HE   1 
ATOM   3873 H HH11 . ARG A 1 401 ? 4.901   72.081 -4.356  1.00 0.00  ? 401 ARG A HH11 1 
ATOM   3874 H HH12 . ARG A 1 401 ? 3.711   70.915 -4.072  1.00 0.00  ? 401 ARG A HH12 1 
ATOM   3875 H HH21 . ARG A 1 401 ? 5.577   69.151 -1.652  1.00 0.00  ? 401 ARG A HH21 1 
ATOM   3876 H HH22 . ARG A 1 401 ? 4.066   69.190 -2.500  1.00 0.00  ? 401 ARG A HH22 1 
ATOM   3877 N N    . ILE A 1 402 ? 11.506  69.533 -4.065  1.00 27.39 ? 402 ILE A N    1 
ATOM   3878 C CA   . ILE A 1 402 ? 11.999  68.505 -4.977  1.00 24.35 ? 402 ILE A CA   1 
ATOM   3879 C C    . ILE A 1 402 ? 11.827  67.153 -4.249  1.00 23.20 ? 402 ILE A C    1 
ATOM   3880 O O    . ILE A 1 402 ? 11.450  66.151 -4.854  1.00 24.90 ? 402 ILE A O    1 
ATOM   3881 C CB   . ILE A 1 402 ? 13.497  68.792 -5.418  1.00 21.35 ? 402 ILE A CB   1 
ATOM   3882 C CG1  . ILE A 1 402 ? 13.576  70.098 -6.244  1.00 16.31 ? 402 ILE A CG1  1 
ATOM   3883 C CG2  . ILE A 1 402 ? 14.045  67.623 -6.234  1.00 22.21 ? 402 ILE A CG2  1 
ATOM   3884 C CD1  . ILE A 1 402 ? 14.978  70.497 -6.800  1.00 15.17 ? 402 ILE A CD1  1 
ATOM   3885 H H    . ILE A 1 402 ? 12.122  70.239 -3.774  1.00 0.00  ? 402 ILE A H    1 
ATOM   3886 N N    . GLU A 1 403 ? 11.984  67.161 -2.930  1.00 21.18 ? 403 GLU A N    1 
ATOM   3887 C CA   . GLU A 1 403 ? 11.824  65.949 -2.131  1.00 18.98 ? 403 GLU A CA   1 
ATOM   3888 C C    . GLU A 1 403 ? 10.375  65.511 -1.994  1.00 19.43 ? 403 GLU A C    1 
ATOM   3889 O O    . GLU A 1 403 ? 10.045  64.400 -2.384  1.00 18.00 ? 403 GLU A O    1 
ATOM   3890 C CB   . GLU A 1 403 ? 12.456  66.106 -0.754  1.00 19.00 ? 403 GLU A CB   1 
ATOM   3891 C CG   . GLU A 1 403 ? 13.914  66.531 -0.816  1.00 20.09 ? 403 GLU A CG   1 
ATOM   3892 C CD   . GLU A 1 403 ? 14.589  66.536 0.530   1.00 19.90 ? 403 GLU A CD   1 
ATOM   3893 O OE1  . GLU A 1 403 ? 13.905  66.730 1.574   1.00 17.30 ? 403 GLU A OE1  1 
ATOM   3894 O OE2  . GLU A 1 403 ? 15.823  66.309 0.545   1.00 23.35 ? 403 GLU A OE2  1 
ATOM   3895 H H    . GLU A 1 403 ? 12.303  67.996 -2.525  1.00 0.00  ? 403 GLU A H    1 
ATOM   3896 N N    . GLU A 1 404 ? 9.516   66.386 -1.477  1.00 18.71 ? 404 GLU A N    1 
ATOM   3897 C CA   . GLU A 1 404 ? 8.100   66.103 -1.277  1.00 19.90 ? 404 GLU A CA   1 
ATOM   3898 C C    . GLU A 1 404 ? 7.367   65.606 -2.537  1.00 20.17 ? 404 GLU A C    1 
ATOM   3899 O O    . GLU A 1 404 ? 6.495   64.766 -2.458  1.00 20.77 ? 404 GLU A O    1 
ATOM   3900 C CB   . GLU A 1 404 ? 7.403   67.372 -0.765  1.00 21.76 ? 404 GLU A CB   1 
ATOM   3901 C CG   . GLU A 1 404 ? 7.895   67.884 0.576   1.00 22.92 ? 404 GLU A CG   1 
ATOM   3902 C CD   . GLU A 1 404 ? 7.673   69.404 0.785   1.00 28.61 ? 404 GLU A CD   1 
ATOM   3903 O OE1  . GLU A 1 404 ? 7.502   70.158 -0.218  1.00 30.94 ? 404 GLU A OE1  1 
ATOM   3904 O OE2  . GLU A 1 404 ? 7.704   69.845 1.968   1.00 30.84 ? 404 GLU A OE2  1 
ATOM   3905 H H    . GLU A 1 404 ? 9.864   67.269 -1.190  1.00 0.00  ? 404 GLU A H    1 
ATOM   3906 N N    . LEU A 1 405 ? 7.678   66.181 -3.694  1.00 21.27 ? 405 LEU A N    1 
ATOM   3907 C CA   . LEU A 1 405 ? 7.045   65.797 -4.960  1.00 17.02 ? 405 LEU A CA   1 
ATOM   3908 C C    . LEU A 1 405 ? 7.531   64.452 -5.519  1.00 15.41 ? 405 LEU A C    1 
ATOM   3909 O O    . LEU A 1 405 ? 6.776   63.746 -6.194  1.00 15.29 ? 405 LEU A O    1 
ATOM   3910 C CB   . LEU A 1 405 ? 7.308   66.895 -5.998  1.00 15.46 ? 405 LEU A CB   1 
ATOM   3911 C CG   . LEU A 1 405 ? 6.713   68.272 -5.625  1.00 18.34 ? 405 LEU A CG   1 
ATOM   3912 C CD1  . LEU A 1 405 ? 7.077   69.333 -6.681  1.00 9.85  ? 405 LEU A CD1  1 
ATOM   3913 C CD2  . LEU A 1 405 ? 5.160   68.156 -5.456  1.00 20.41 ? 405 LEU A CD2  1 
ATOM   3914 H H    . LEU A 1 405 ? 8.328   66.920 -3.707  1.00 0.00  ? 405 LEU A H    1 
ATOM   3915 N N    . THR A 1 406 ? 8.820   64.151 -5.340  1.00 12.88 ? 406 THR A N    1 
ATOM   3916 C CA   . THR A 1 406 ? 9.376   62.887 -5.829  1.00 14.63 ? 406 THR A CA   1 
ATOM   3917 C C    . THR A 1 406 ? 9.216   61.902 -4.685  1.00 13.21 ? 406 THR A C    1 
ATOM   3918 O O    . THR A 1 406 ? 9.193   60.690 -4.866  1.00 14.95 ? 406 THR A O    1 
ATOM   3919 C CB   . THR A 1 406 ? 10.918  63.010 -6.196  1.00 17.43 ? 406 THR A CB   1 
ATOM   3920 O OG1  . THR A 1 406 ? 11.712  63.211 -5.000  1.00 15.91 ? 406 THR A OG1  1 
ATOM   3921 C CG2  . THR A 1 406 ? 11.139  64.202 -7.124  1.00 15.54 ? 406 THR A CG2  1 
ATOM   3922 H H    . THR A 1 406 ? 9.430   64.778 -4.903  1.00 0.00  ? 406 THR A H    1 
ATOM   3923 H HG1  . THR A 1 406 ? 11.721  64.169 -4.832  1.00 0.00  ? 406 THR A HG1  1 
ATOM   3924 N N    . GLY A 1 407 ? 9.156   62.443 -3.491  1.00 15.68 ? 407 GLY A N    1 
ATOM   3925 C CA   . GLY A 1 407 ? 9.046   61.604 -2.331  1.00 16.32 ? 407 GLY A CA   1 
ATOM   3926 C C    . GLY A 1 407 ? 10.375  60.889 -2.091  1.00 16.69 ? 407 GLY A C    1 
ATOM   3927 O O    . GLY A 1 407 ? 10.347  59.879 -1.403  1.00 15.97 ? 407 GLY A O    1 
ATOM   3928 H H    . GLY A 1 407 ? 9.285   63.404 -3.320  1.00 0.00  ? 407 GLY A H    1 
ATOM   3929 N N    . VAL A 1 408 ? 11.490  61.375 -2.666  1.00 16.39 ? 408 VAL A N    1 
ATOM   3930 C CA   . VAL A 1 408 ? 12.856  60.802 -2.489  1.00 17.70 ? 408 VAL A CA   1 
ATOM   3931 C C    . VAL A 1 408 ? 13.797  61.906 -1.930  1.00 19.11 ? 408 VAL A C    1 
ATOM   3932 O O    . VAL A 1 408 ? 13.887  62.988 -2.517  1.00 21.41 ? 408 VAL A O    1 
ATOM   3933 C CB   . VAL A 1 408 ? 13.483  60.280 -3.855  1.00 15.49 ? 408 VAL A CB   1 
ATOM   3934 C CG1  . VAL A 1 408 ? 15.033  60.122 -3.733  1.00 14.58 ? 408 VAL A CG1  1 
ATOM   3935 C CG2  . VAL A 1 408 ? 12.902  58.956 -4.229  1.00 12.46 ? 408 VAL A CG2  1 
ATOM   3936 H H    . VAL A 1 408 ? 11.444  62.144 -3.277  1.00 0.00  ? 408 VAL A H    1 
ATOM   3937 N N    . PRO A 1 409 ? 14.611  61.600 -0.896  1.00 19.60 ? 409 PRO A N    1 
ATOM   3938 C CA   . PRO A 1 409 ? 15.511  62.597 -0.303  1.00 18.99 ? 409 PRO A CA   1 
ATOM   3939 C C    . PRO A 1 409 ? 16.720  62.961 -1.149  1.00 18.23 ? 409 PRO A C    1 
ATOM   3940 O O    . PRO A 1 409 ? 17.214  62.118 -1.893  1.00 16.49 ? 409 PRO A O    1 
ATOM   3941 C CB   . PRO A 1 409 ? 15.964  61.906 0.979   1.00 16.09 ? 409 PRO A CB   1 
ATOM   3942 C CG   . PRO A 1 409 ? 16.144  60.516 0.516   1.00 16.86 ? 409 PRO A CG   1 
ATOM   3943 C CD   . PRO A 1 409 ? 14.856  60.279 -0.288  1.00 18.42 ? 409 PRO A CD   1 
ATOM   3944 N N    . ILE A 1 410 ? 17.145  64.230 -1.097  1.00 17.49 ? 410 ILE A N    1 
ATOM   3945 C CA   . ILE A 1 410 ? 18.358  64.669 -1.811  1.00 16.46 ? 410 ILE A CA   1 
ATOM   3946 C C    . ILE A 1 410 ? 19.432  64.393 -0.775  1.00 16.57 ? 410 ILE A C    1 
ATOM   3947 O O    . ILE A 1 410 ? 19.329  64.903 0.333   1.00 20.51 ? 410 ILE A O    1 
ATOM   3948 C CB   . ILE A 1 410 ? 18.320  66.206 -2.141  1.00 15.21 ? 410 ILE A CB   1 
ATOM   3949 C CG1  . ILE A 1 410 ? 17.297  66.464 -3.264  1.00 13.97 ? 410 ILE A CG1  1 
ATOM   3950 C CG2  . ILE A 1 410 ? 19.732  66.758 -2.371  1.00 17.23 ? 410 ILE A CG2  1 
ATOM   3951 C CD1  . ILE A 1 410 ? 17.613  67.496 -4.251  1.00 9.32  ? 410 ILE A CD1  1 
ATOM   3952 H H    . ILE A 1 410 ? 16.668  64.896 -0.541  1.00 0.00  ? 410 ILE A H    1 
ATOM   3953 N N    . ASP A 1 411 ? 20.455  63.606 -1.094  1.00 18.42 ? 411 ASP A N    1 
ATOM   3954 C CA   . ASP A 1 411 ? 21.495  63.292 -0.097  1.00 14.27 ? 411 ASP A CA   1 
ATOM   3955 C C    . ASP A 1 411 ? 22.847  63.955 -0.324  1.00 16.22 ? 411 ASP A C    1 
ATOM   3956 O O    . ASP A 1 411 ? 23.697  63.985 0.593   1.00 17.10 ? 411 ASP A O    1 
ATOM   3957 C CB   . ASP A 1 411 ? 21.733  61.786 -0.016  1.00 10.59 ? 411 ASP A CB   1 
ATOM   3958 C CG   . ASP A 1 411 ? 20.568  61.029 0.609   1.00 5.01  ? 411 ASP A CG   1 
ATOM   3959 O OD1  . ASP A 1 411 ? 19.825  61.570 1.449   1.00 6.73  ? 411 ASP A OD1  1 
ATOM   3960 O OD2  . ASP A 1 411 ? 20.420  59.838 0.305   1.00 5.99  ? 411 ASP A OD2  1 
ATOM   3961 H H    . ASP A 1 411 ? 20.564  63.253 -2.007  1.00 0.00  ? 411 ASP A H    1 
ATOM   3962 N N    . ILE A 1 412 ? 23.111  64.394 -1.549  1.00 18.45 ? 412 ILE A N    1 
ATOM   3963 C CA   . ILE A 1 412 ? 24.404  65.030 -1.854  1.00 17.27 ? 412 ILE A CA   1 
ATOM   3964 C C    . ILE A 1 412 ? 24.106  66.227 -2.749  1.00 17.57 ? 412 ILE A C    1 
ATOM   3965 O O    . ILE A 1 412 ? 23.289  66.156 -3.695  1.00 18.97 ? 412 ILE A O    1 
ATOM   3966 C CB   . ILE A 1 412 ? 25.412  64.039 -2.567  1.00 16.26 ? 412 ILE A CB   1 
ATOM   3967 C CG1  . ILE A 1 412 ? 25.459  62.668 -1.880  1.00 15.46 ? 412 ILE A CG1  1 
ATOM   3968 C CG2  . ILE A 1 412 ? 26.834  64.594 -2.556  1.00 18.33 ? 412 ILE A CG2  1 
ATOM   3969 C CD1  . ILE A 1 412 ? 26.473  61.746 -2.547  1.00 19.63 ? 412 ILE A CD1  1 
ATOM   3970 H H    . ILE A 1 412 ? 22.451  64.272 -2.264  1.00 0.00  ? 412 ILE A H    1 
ATOM   3971 N N    . ILE A 1 413 ? 24.729  67.346 -2.419  1.00 20.49 ? 413 ILE A N    1 
ATOM   3972 C CA   . ILE A 1 413 ? 24.503  68.594 -3.140  1.00 22.65 ? 413 ILE A CA   1 
ATOM   3973 C C    . ILE A 1 413 ? 25.789  69.140 -3.763  1.00 26.66 ? 413 ILE A C    1 
ATOM   3974 O O    . ILE A 1 413 ? 26.421  70.030 -3.212  1.00 29.61 ? 413 ILE A O    1 
ATOM   3975 C CB   . ILE A 1 413 ? 23.824  69.619 -2.169  1.00 21.13 ? 413 ILE A CB   1 
ATOM   3976 C CG1  . ILE A 1 413 ? 22.423  69.083 -1.783  1.00 21.37 ? 413 ILE A CG1  1 
ATOM   3977 C CG2  . ILE A 1 413 ? 23.773  71.056 -2.771  1.00 19.18 ? 413 ILE A CG2  1 
ATOM   3978 C CD1  . ILE A 1 413 ? 21.694  69.862 -0.684  1.00 19.93 ? 413 ILE A CD1  1 
ATOM   3979 H H    . ILE A 1 413 ? 25.330  67.284 -1.640  1.00 0.00  ? 413 ILE A H    1 
ATOM   3980 N N    . SER A 1 414 ? 26.212  68.567 -4.883  1.00 28.93 ? 414 SER A N    1 
ATOM   3981 C CA   . SER A 1 414 ? 27.423  69.039 -5.549  1.00 31.53 ? 414 SER A CA   1 
ATOM   3982 C C    . SER A 1 414 ? 27.236  70.484 -6.009  1.00 32.31 ? 414 SER A C    1 
ATOM   3983 O O    . SER A 1 414 ? 26.454  70.747 -6.932  1.00 33.49 ? 414 SER A O    1 
ATOM   3984 C CB   . SER A 1 414 ? 27.764  68.161 -6.750  1.00 32.55 ? 414 SER A CB   1 
ATOM   3985 O OG   . SER A 1 414 ? 28.709  68.797 -7.590  1.00 33.22 ? 414 SER A OG   1 
ATOM   3986 H H    . SER A 1 414 ? 25.658  67.873 -5.296  1.00 0.00  ? 414 SER A H    1 
ATOM   3987 H HG   . SER A 1 414 ? 28.225  69.405 -8.173  1.00 0.00  ? 414 SER A HG   1 
ATOM   3988 N N    . THR A 1 415 ? 27.994  71.395 -5.396  1.00 32.44 ? 415 THR A N    1 
ATOM   3989 C CA   . THR A 1 415 ? 27.934  72.829 -5.702  1.00 31.65 ? 415 THR A CA   1 
ATOM   3990 C C    . THR A 1 415 ? 28.968  73.339 -6.697  1.00 30.69 ? 415 THR A C    1 
ATOM   3991 O O    . THR A 1 415 ? 28.791  74.426 -7.253  1.00 31.80 ? 415 THR A O    1 
ATOM   3992 C CB   . THR A 1 415 ? 28.094  73.700 -4.429  1.00 31.92 ? 415 THR A CB   1 
ATOM   3993 O OG1  . THR A 1 415 ? 29.313  73.344 -3.771  1.00 31.20 ? 415 THR A OG1  1 
ATOM   3994 C CG2  . THR A 1 415 ? 26.885  73.556 -3.487  1.00 26.85 ? 415 THR A CG2  1 
ATOM   3995 H H    . THR A 1 415 ? 28.654  71.135 -4.715  1.00 0.00  ? 415 THR A H    1 
ATOM   3996 H HG1  . THR A 1 415 ? 29.271  73.701 -2.862  1.00 0.00  ? 415 THR A HG1  1 
ATOM   3997 N N    . GLY A 1 416 ? 30.066  72.612 -6.870  1.00 30.44 ? 416 GLY A N    1 
ATOM   3998 C CA   . GLY A 1 416 ? 31.095  73.056 -7.802  1.00 30.61 ? 416 GLY A CA   1 
ATOM   3999 C C    . GLY A 1 416 ? 32.117  72.003 -8.211  1.00 31.05 ? 416 GLY A C    1 
ATOM   4000 O O    . GLY A 1 416 ? 32.434  71.100 -7.441  1.00 31.53 ? 416 GLY A O    1 
ATOM   4001 H H    . GLY A 1 416 ? 30.229  71.815 -6.320  1.00 0.00  ? 416 GLY A H    1 
ATOM   4002 N N    . PRO A 1 417 ? 32.678  72.124 -9.415  1.00 32.72 ? 417 PRO A N    1 
ATOM   4003 C CA   . PRO A 1 417 ? 33.673  71.231 -10.020 1.00 34.23 ? 417 PRO A CA   1 
ATOM   4004 C C    . PRO A 1 417 ? 34.664  70.589 -9.048  1.00 33.72 ? 417 PRO A C    1 
ATOM   4005 O O    . PRO A 1 417 ? 34.845  69.363 -9.051  1.00 31.30 ? 417 PRO A O    1 
ATOM   4006 C CB   . PRO A 1 417 ? 34.362  72.140 -11.051 1.00 36.07 ? 417 PRO A CB   1 
ATOM   4007 C CG   . PRO A 1 417 ? 34.063  73.545 -10.546 1.00 35.85 ? 417 PRO A CG   1 
ATOM   4008 C CD   . PRO A 1 417 ? 32.631  73.388 -10.161 1.00 34.45 ? 417 PRO A CD   1 
ATOM   4009 N N    . ASP A 1 418 ? 35.314  71.404 -8.228  1.00 33.95 ? 418 ASP A N    1 
ATOM   4010 C CA   . ASP A 1 418 ? 36.240  70.840 -7.276  1.00 34.42 ? 418 ASP A CA   1 
ATOM   4011 C C    . ASP A 1 418 ? 35.497  69.908 -6.335  1.00 35.69 ? 418 ASP A C    1 
ATOM   4012 O O    . ASP A 1 418 ? 34.303  70.093 -6.033  1.00 33.61 ? 418 ASP A O    1 
ATOM   4013 C CB   . ASP A 1 418 ? 36.939  71.909 -6.445  1.00 33.52 ? 418 ASP A CB   1 
ATOM   4014 C CG   . ASP A 1 418 ? 37.855  71.299 -5.391  1.00 35.37 ? 418 ASP A CG   1 
ATOM   4015 O OD1  . ASP A 1 418 ? 38.801  70.551 -5.749  1.00 34.94 ? 418 ASP A OD1  1 
ATOM   4016 O OD2  . ASP A 1 418 ? 37.581  71.493 -4.197  1.00 35.82 ? 418 ASP A OD2  1 
ATOM   4017 H H    . ASP A 1 418 ? 35.131  72.366 -8.173  1.00 0.00  ? 418 ASP A H    1 
ATOM   4018 N N    . ARG A 1 419 ? 36.255  68.975 -5.776  1.00 37.62 ? 419 ARG A N    1 
ATOM   4019 C CA   . ARG A 1 419 ? 35.722  67.995 -4.858  1.00 38.43 ? 419 ARG A CA   1 
ATOM   4020 C C    . ARG A 1 419 ? 35.115  68.618 -3.625  1.00 37.39 ? 419 ARG A C    1 
ATOM   4021 O O    . ARG A 1 419 ? 34.007  68.242 -3.245  1.00 39.19 ? 419 ARG A O    1 
ATOM   4022 C CB   . ARG A 1 419 ? 36.819  67.034 -4.436  1.00 40.54 ? 419 ARG A CB   1 
ATOM   4023 C CG   . ARG A 1 419 ? 36.381  65.596 -4.392  1.00 44.39 ? 419 ARG A CG   1 
ATOM   4024 C CD   . ARG A 1 419 ? 37.420  64.784 -3.646  1.00 48.59 ? 419 ARG A CD   1 
ATOM   4025 N NE   . ARG A 1 419 ? 37.187  64.769 -2.199  1.00 50.40 ? 419 ARG A NE   1 
ATOM   4026 C CZ   . ARG A 1 419 ? 38.005  64.199 -1.320  1.00 49.68 ? 419 ARG A CZ   1 
ATOM   4027 N NH1  . ARG A 1 419 ? 39.128  63.618 -1.735  1.00 49.29 ? 419 ARG A NH1  1 
ATOM   4028 N NH2  . ARG A 1 419 ? 37.635  64.094 -0.048  1.00 49.27 ? 419 ARG A NH2  1 
ATOM   4029 H H    . ARG A 1 419 ? 37.213  68.981 -5.989  1.00 0.00  ? 419 ARG A H    1 
ATOM   4030 H HE   . ARG A 1 419 ? 36.368  65.199 -1.870  1.00 0.00  ? 419 ARG A HE   1 
ATOM   4031 H HH11 . ARG A 1 419 ? 39.354  63.593 -2.708  1.00 0.00  ? 419 ARG A HH11 1 
ATOM   4032 H HH12 . ARG A 1 419 ? 39.745  63.163 -1.096  1.00 0.00  ? 419 ARG A HH12 1 
ATOM   4033 H HH21 . ARG A 1 419 ? 36.736  64.419 0.255   1.00 0.00  ? 419 ARG A HH21 1 
ATOM   4034 H HH22 . ARG A 1 419 ? 38.229  63.662 0.630   1.00 0.00  ? 419 ARG A HH22 1 
ATOM   4035 N N    . THR A 1 420 ? 35.824  69.571 -3.013  1.00 36.45 ? 420 THR A N    1 
ATOM   4036 C CA   . THR A 1 420 ? 35.349  70.214 -1.779  1.00 36.26 ? 420 THR A CA   1 
ATOM   4037 C C    . THR A 1 420 ? 34.034  70.946 -1.944  1.00 36.51 ? 420 THR A C    1 
ATOM   4038 O O    . THR A 1 420 ? 33.287  71.124 -0.987  1.00 38.88 ? 420 THR A O    1 
ATOM   4039 C CB   . THR A 1 420 ? 36.385  71.174 -1.160  1.00 35.90 ? 420 THR A CB   1 
ATOM   4040 O OG1  . THR A 1 420 ? 36.725  72.191 -2.104  1.00 36.51 ? 420 THR A OG1  1 
ATOM   4041 C CG2  . THR A 1 420 ? 37.630  70.428 -0.743  1.00 34.58 ? 420 THR A CG2  1 
ATOM   4042 H H    . THR A 1 420 ? 36.665  69.896 -3.406  1.00 0.00  ? 420 THR A H    1 
ATOM   4043 H HG1  . THR A 1 420 ? 37.141  71.854 -2.942  1.00 0.00  ? 420 THR A HG1  1 
ATOM   4044 N N    . GLU A 1 421 ? 33.726  71.340 -3.169  1.00 35.95 ? 421 GLU A N    1 
ATOM   4045 C CA   . GLU A 1 421 ? 32.483  72.027 -3.426  1.00 34.17 ? 421 GLU A CA   1 
ATOM   4046 C C    . GLU A 1 421 ? 31.373  70.960 -3.483  1.00 32.86 ? 421 GLU A C    1 
ATOM   4047 O O    . GLU A 1 421 ? 30.682  70.803 -4.499  1.00 32.39 ? 421 GLU A O    1 
ATOM   4048 C CB   . GLU A 1 421 ? 32.598  72.830 -4.728  1.00 36.17 ? 421 GLU A CB   1 
ATOM   4049 C CG   . GLU A 1 421 ? 33.583  74.003 -4.653  1.00 39.59 ? 421 GLU A CG   1 
ATOM   4050 C CD   . GLU A 1 421 ? 33.824  74.673 -5.995  1.00 41.68 ? 421 GLU A CD   1 
ATOM   4051 O OE1  . GLU A 1 421 ? 34.695  74.196 -6.752  1.00 47.42 ? 421 GLU A OE1  1 
ATOM   4052 O OE2  . GLU A 1 421 ? 33.163  75.686 -6.309  1.00 42.62 ? 421 GLU A OE2  1 
ATOM   4053 H H    . GLU A 1 421 ? 34.321  71.176 -3.932  1.00 0.00  ? 421 GLU A H    1 
ATOM   4054 N N    . THR A 1 422 ? 31.238  70.206 -2.395  1.00 30.07 ? 422 THR A N    1 
ATOM   4055 C CA   . THR A 1 422 ? 30.223  69.147 -2.298  1.00 28.56 ? 422 THR A CA   1 
ATOM   4056 C C    . THR A 1 422 ? 29.593  69.117 -0.910  1.00 28.81 ? 422 THR A C    1 
ATOM   4057 O O    . THR A 1 422 ? 30.247  69.452 0.078   1.00 31.43 ? 422 THR A O    1 
ATOM   4058 C CB   . THR A 1 422 ? 30.832  67.714 -2.562  1.00 25.36 ? 422 THR A CB   1 
ATOM   4059 O OG1  . THR A 1 422 ? 31.456  67.666 -3.855  1.00 21.92 ? 422 THR A OG1  1 
ATOM   4060 C CG2  . THR A 1 422 ? 29.741  66.650 -2.484  1.00 18.45 ? 422 THR A CG2  1 
ATOM   4061 H H    . THR A 1 422 ? 31.799  70.390 -1.608  1.00 0.00  ? 422 THR A H    1 
ATOM   4062 H HG1  . THR A 1 422 ? 32.388  67.911 -3.645  1.00 0.00  ? 422 THR A HG1  1 
ATOM   4063 N N    . MET A 1 423 ? 28.324  68.744 -0.840  1.00 27.49 ? 423 MET A N    1 
ATOM   4064 C CA   . MET A 1 423 ? 27.632  68.601 0.441   1.00 24.75 ? 423 MET A CA   1 
ATOM   4065 C C    . MET A 1 423 ? 27.074  67.171 0.507   1.00 24.35 ? 423 MET A C    1 
ATOM   4066 O O    . MET A 1 423 ? 26.154  66.783 -0.263  1.00 22.59 ? 423 MET A O    1 
ATOM   4067 C CB   . MET A 1 423 ? 26.491  69.621 0.611   1.00 29.53 ? 423 MET A CB   1 
ATOM   4068 C CG   . MET A 1 423 ? 26.925  71.084 0.968   1.00 33.43 ? 423 MET A CG   1 
ATOM   4069 S SD   . MET A 1 423 ? 25.475  72.165 1.455   1.00 40.42 ? 423 MET A SD   1 
ATOM   4070 C CE   . MET A 1 423 ? 25.016  72.821 -0.165  1.00 34.25 ? 423 MET A CE   1 
ATOM   4071 H H    . MET A 1 423 ? 27.822  68.596 -1.665  1.00 0.00  ? 423 MET A H    1 
ATOM   4072 N N    . ILE A 1 424 ? 27.677  66.372 1.387   1.00 23.18 ? 424 ILE A N    1 
ATOM   4073 C CA   . ILE A 1 424 ? 27.284  64.985 1.590   1.00 20.25 ? 424 ILE A CA   1 
ATOM   4074 C C    . ILE A 1 424 ? 26.357  64.943 2.799   1.00 22.52 ? 424 ILE A C    1 
ATOM   4075 O O    . ILE A 1 424 ? 26.807  65.094 3.932   1.00 22.68 ? 424 ILE A O    1 
ATOM   4076 C CB   . ILE A 1 424 ? 28.550  64.094 1.821   1.00 18.83 ? 424 ILE A CB   1 
ATOM   4077 C CG1  . ILE A 1 424 ? 29.477  64.142 0.587   1.00 17.11 ? 424 ILE A CG1  1 
ATOM   4078 C CG2  . ILE A 1 424 ? 28.169  62.658 2.114   1.00 16.65 ? 424 ILE A CG2  1 
ATOM   4079 C CD1  . ILE A 1 424 ? 30.873  63.575 0.821   1.00 16.26 ? 424 ILE A CD1  1 
ATOM   4080 H H    . ILE A 1 424 ? 28.391  66.729 1.952   1.00 0.00  ? 424 ILE A H    1 
ATOM   4081 N N    . LEU A 1 425 ? 25.051  64.810 2.575   1.00 24.17 ? 425 LEU A N    1 
ATOM   4082 C CA   . LEU A 1 425 ? 24.123  64.736 3.713   1.00 22.91 ? 425 LEU A CA   1 
ATOM   4083 C C    . LEU A 1 425 ? 24.020  63.285 4.202   1.00 23.16 ? 425 LEU A C    1 
ATOM   4084 O O    . LEU A 1 425 ? 24.051  63.005 5.407   1.00 24.58 ? 425 LEU A O    1 
ATOM   4085 C CB   . LEU A 1 425 ? 22.721  65.235 3.340   1.00 21.62 ? 425 LEU A CB   1 
ATOM   4086 C CG   . LEU A 1 425 ? 22.491  66.631 2.749   1.00 20.02 ? 425 LEU A CG   1 
ATOM   4087 C CD1  . LEU A 1 425 ? 21.082  66.674 2.176   1.00 22.24 ? 425 LEU A CD1  1 
ATOM   4088 C CD2  . LEU A 1 425 ? 22.683  67.730 3.786   1.00 19.09 ? 425 LEU A CD2  1 
ATOM   4089 H H    . LEU A 1 425 ? 24.670  64.701 1.668   1.00 0.00  ? 425 LEU A H    1 
ATOM   4090 N N    . ARG A 1 426 ? 23.984  62.337 3.276   1.00 22.30 ? 426 ARG A N    1 
ATOM   4091 C CA   . ARG A 1 426 ? 23.840  60.964 3.729   1.00 19.35 ? 426 ARG A CA   1 
ATOM   4092 C C    . ARG A 1 426 ? 24.905  59.941 3.312   1.00 18.57 ? 426 ARG A C    1 
ATOM   4093 O O    . ARG A 1 426 ? 24.993  58.918 3.950   1.00 23.27 ? 426 ARG A O    1 
ATOM   4094 C CB   . ARG A 1 426 ? 22.429  60.476 3.434   1.00 16.93 ? 426 ARG A CB   1 
ATOM   4095 C CG   . ARG A 1 426 ? 21.911  59.323 4.253   1.00 19.16 ? 426 ARG A CG   1 
ATOM   4096 C CD   . ARG A 1 426 ? 21.118  58.359 3.344   1.00 28.08 ? 426 ARG A CD   1 
ATOM   4097 N NE   . ARG A 1 426 ? 19.734  58.112 3.784   1.00 32.01 ? 426 ARG A NE   1 
ATOM   4098 C CZ   . ARG A 1 426 ? 18.688  57.933 2.967   1.00 33.06 ? 426 ARG A CZ   1 
ATOM   4099 N NH1  . ARG A 1 426 ? 18.842  57.969 1.648   1.00 31.52 ? 426 ARG A NH1  1 
ATOM   4100 N NH2  . ARG A 1 426 ? 17.466  57.767 3.471   1.00 34.84 ? 426 ARG A NH2  1 
ATOM   4101 H H    . ARG A 1 426 ? 24.012  62.598 2.333   1.00 0.00  ? 426 ARG A H    1 
ATOM   4102 H HE   . ARG A 1 426 ? 19.593  58.060 4.757   1.00 0.00  ? 426 ARG A HE   1 
ATOM   4103 H HH11 . ARG A 1 426 ? 19.729  58.193 1.235   1.00 0.00  ? 426 ARG A HH11 1 
ATOM   4104 H HH12 . ARG A 1 426 ? 18.065  57.855 1.026   1.00 0.00  ? 426 ARG A HH12 1 
ATOM   4105 H HH21 . ARG A 1 426 ? 17.299  57.764 4.463   1.00 0.00  ? 426 ARG A HH21 1 
ATOM   4106 H HH22 . ARG A 1 426 ? 16.668  57.650 2.874   1.00 0.00  ? 426 ARG A HH22 1 
ATOM   4107 N N    . ASP A 1 427 ? 25.755  60.208 2.326   1.00 16.76 ? 427 ASP A N    1 
ATOM   4108 C CA   . ASP A 1 427 ? 26.784  59.216 1.939   1.00 15.81 ? 427 ASP A CA   1 
ATOM   4109 C C    . ASP A 1 427 ? 26.196  57.840 1.577   1.00 17.74 ? 427 ASP A C    1 
ATOM   4110 O O    . ASP A 1 427 ? 25.970  56.996 2.455   1.00 16.95 ? 427 ASP A O    1 
ATOM   4111 C CB   . ASP A 1 427 ? 27.812  59.008 3.035   1.00 15.16 ? 427 ASP A CB   1 
ATOM   4112 C CG   . ASP A 1 427 ? 29.093  58.392 2.508   1.00 17.58 ? 427 ASP A CG   1 
ATOM   4113 O OD1  . ASP A 1 427 ? 29.054  57.351 1.826   1.00 16.24 ? 427 ASP A OD1  1 
ATOM   4114 O OD2  . ASP A 1 427 ? 30.171  58.982 2.740   1.00 20.42 ? 427 ASP A OD2  1 
ATOM   4115 H H    . ASP A 1 427 ? 25.699  61.061 1.865   1.00 0.00  ? 427 ASP A H    1 
ATOM   4116 N N    . PRO A 1 428 ? 26.115  57.541 0.262   1.00 17.17 ? 428 PRO A N    1 
ATOM   4117 C CA   . PRO A 1 428 ? 25.565  56.291 -0.239  1.00 16.18 ? 428 PRO A CA   1 
ATOM   4118 C C    . PRO A 1 428 ? 26.101  55.014 0.363   1.00 15.23 ? 428 PRO A C    1 
ATOM   4119 O O    . PRO A 1 428 ? 25.316  54.134 0.716   1.00 13.52 ? 428 PRO A O    1 
ATOM   4120 C CB   . PRO A 1 428 ? 25.823  56.387 -1.734  1.00 18.71 ? 428 PRO A CB   1 
ATOM   4121 C CG   . PRO A 1 428 ? 25.777  57.906 -1.989  1.00 16.77 ? 428 PRO A CG   1 
ATOM   4122 C CD   . PRO A 1 428 ? 26.661  58.335 -0.855  1.00 15.86 ? 428 PRO A CD   1 
ATOM   4123 N N    . PHE A 1 429 ? 27.420  54.920 0.529   1.00 17.58 ? 429 PHE A N    1 
ATOM   4124 C CA   . PHE A 1 429 ? 28.031  53.703 1.090   1.00 16.01 ? 429 PHE A CA   1 
ATOM   4125 C C    . PHE A 1 429 ? 27.727  53.465 2.568   1.00 14.52 ? 429 PHE A C    1 
ATOM   4126 O O    . PHE A 1 429 ? 27.613  52.332 2.999   1.00 12.25 ? 429 PHE A O    1 
ATOM   4127 C CB   . PHE A 1 429 ? 29.541  53.679 0.862   1.00 16.79 ? 429 PHE A CB   1 
ATOM   4128 C CG   . PHE A 1 429 ? 29.946  53.371 -0.558  1.00 17.27 ? 429 PHE A CG   1 
ATOM   4129 C CD1  . PHE A 1 429 ? 29.808  52.085 -1.077  1.00 16.41 ? 429 PHE A CD1  1 
ATOM   4130 C CD2  . PHE A 1 429 ? 30.489  54.357 -1.373  1.00 17.83 ? 429 PHE A CD2  1 
ATOM   4131 C CE1  . PHE A 1 429 ? 30.210  51.786 -2.394  1.00 14.06 ? 429 PHE A CE1  1 
ATOM   4132 C CE2  . PHE A 1 429 ? 30.896  54.058 -2.702  1.00 18.49 ? 429 PHE A CE2  1 
ATOM   4133 C CZ   . PHE A 1 429 ? 30.753  52.772 -3.204  1.00 15.38 ? 429 PHE A CZ   1 
ATOM   4134 H H    . PHE A 1 429 ? 27.988  55.695 0.344   1.00 0.00  ? 429 PHE A H    1 
ATOM   4135 N N    . ASP A 1 430 ? 27.527  54.527 3.334   1.00 17.44 ? 430 ASP A N    1 
ATOM   4136 C CA   . ASP A 1 430 ? 27.268  54.374 4.766   1.00 17.37 ? 430 ASP A CA   1 
ATOM   4137 C C    . ASP A 1 430 ? 25.805  54.189 5.069   1.00 15.00 ? 430 ASP A C    1 
ATOM   4138 O O    . ASP A 1 430 ? 25.436  53.708 6.141   1.00 14.11 ? 430 ASP A O    1 
ATOM   4139 C CB   . ASP A 1 430 ? 27.871  55.540 5.583   1.00 13.93 ? 430 ASP A CB   1 
ATOM   4140 C CG   . ASP A 1 430 ? 29.375  55.389 5.788   1.00 15.65 ? 430 ASP A CG   1 
ATOM   4141 O OD1  . ASP A 1 430 ? 29.806  54.221 5.882   1.00 16.67 ? 430 ASP A OD1  1 
ATOM   4142 O OD2  . ASP A 1 430 ? 30.150  56.401 5.865   1.00 11.77 ? 430 ASP A OD2  1 
ATOM   4143 H H    . ASP A 1 430 ? 27.525  55.436 2.963   1.00 0.00  ? 430 ASP A H    1 
ATOM   4144 N N    . ALA A 1 431 ? 24.981  54.585 4.118   1.00 17.72 ? 431 ALA A N    1 
ATOM   4145 C CA   . ALA A 1 431 ? 23.530  54.467 4.252   1.00 17.56 ? 431 ALA A CA   1 
ATOM   4146 C C    . ALA A 1 431 ? 23.120  53.012 4.294   1.00 19.59 ? 431 ALA A C    1 
ATOM   4147 O O    . ALA A 1 431 ? 22.426  52.624 5.239   1.00 23.73 ? 431 ALA A O    1 
ATOM   4148 C CB   . ALA A 1 431 ? 22.820  55.189 3.107   1.00 16.24 ? 431 ALA A CB   1 
ATOM   4149 O OXT  . ALA A 1 431 ? 23.521  52.262 3.405   1.00 24.86 ? 431 ALA A OXT  1 
ATOM   4150 H H    . ALA A 1 431 ? 25.340  55.068 3.351   1.00 0.00  ? 431 ALA A H    1 
ATOM   4151 N N    . GLY B 1 1   ? 7.516   38.872 2.605   1.00 30.71 ? 1   GLY B N    1 
ATOM   4152 C CA   . GLY B 1 1   ? 7.795   39.174 1.187   1.00 28.24 ? 1   GLY B CA   1 
ATOM   4153 C C    . GLY B 1 1   ? 6.541   39.460 0.372   1.00 27.23 ? 1   GLY B C    1 
ATOM   4154 O O    . GLY B 1 1   ? 5.925   38.513 -0.112  1.00 28.33 ? 1   GLY B O    1 
ATOM   4155 H H1   . GLY B 1 1   ? 6.705   38.228 2.661   1.00 0.00  ? 1   GLY B H1   1 
ATOM   4156 H H2   . GLY B 1 1   ? 8.286   38.375 3.167   1.00 0.00  ? 1   GLY B H2   1 
ATOM   4157 H H3   . GLY B 1 1   ? 7.261   39.723 3.159   1.00 0.00  ? 1   GLY B H3   1 
ATOM   4158 N N    . ASN B 1 2   ? 6.141   40.736 0.253   1.00 26.15 ? 2   ASN B N    1 
ATOM   4159 C CA   . ASN B 1 2   ? 4.963   41.135 -0.531  1.00 24.07 ? 2   ASN B CA   1 
ATOM   4160 C C    . ASN B 1 2   ? 5.078   40.900 -2.055  1.00 22.08 ? 2   ASN B C    1 
ATOM   4161 O O    . ASN B 1 2   ? 4.069   40.654 -2.743  1.00 17.87 ? 2   ASN B O    1 
ATOM   4162 C CB   . ASN B 1 2   ? 4.603   42.607 -0.256  1.00 26.86 ? 2   ASN B CB   1 
ATOM   4163 C CG   . ASN B 1 2   ? 3.663   42.782 0.976   1.00 31.90 ? 2   ASN B CG   1 
ATOM   4164 O OD1  . ASN B 1 2   ? 3.150   43.896 1.248   1.00 28.42 ? 2   ASN B OD1  1 
ATOM   4165 N ND2  . ASN B 1 2   ? 3.431   41.681 1.718   1.00 32.07 ? 2   ASN B ND2  1 
ATOM   4166 H H    . ASN B 1 2   ? 6.686   41.438 0.672   1.00 0.00  ? 2   ASN B H    1 
ATOM   4167 H HD21 . ASN B 1 2   ? 2.826   41.829 2.477   1.00 0.00  ? 2   ASN B HD21 1 
ATOM   4168 H HD22 . ASN B 1 2   ? 3.810   40.806 1.530   1.00 0.00  ? 2   ASN B HD22 1 
ATOM   4169 N N    . ASN B 1 3   ? 6.276   41.096 -2.608  1.00 22.75 ? 3   ASN B N    1 
ATOM   4170 C CA   . ASN B 1 3   ? 6.482   40.867 -4.036  1.00 18.91 ? 3   ASN B CA   1 
ATOM   4171 C C    . ASN B 1 3   ? 7.274   39.606 -4.130  1.00 19.24 ? 3   ASN B C    1 
ATOM   4172 O O    . ASN B 1 3   ? 8.403   39.537 -3.604  1.00 19.86 ? 3   ASN B O    1 
ATOM   4173 C CB   . ASN B 1 3   ? 7.221   42.022 -4.722  1.00 15.21 ? 3   ASN B CB   1 
ATOM   4174 C CG   . ASN B 1 3   ? 6.355   43.259 -4.848  1.00 9.48  ? 3   ASN B CG   1 
ATOM   4175 O OD1  . ASN B 1 3   ? 5.150   43.175 -4.781  1.00 13.54 ? 3   ASN B OD1  1 
ATOM   4176 N ND2  . ASN B 1 3   ? 6.972   44.405 -4.990  1.00 13.41 ? 3   ASN B ND2  1 
ATOM   4177 H H    . ASN B 1 3   ? 7.028   41.464 -2.079  1.00 0.00  ? 3   ASN B H    1 
ATOM   4178 H HD21 . ASN B 1 3   ? 6.431   45.210 -5.112  1.00 0.00  ? 3   ASN B HD21 1 
ATOM   4179 H HD22 . ASN B 1 3   ? 7.961   44.386 -4.963  1.00 0.00  ? 3   ASN B HD22 1 
ATOM   4180 N N    . VAL B 1 4   ? 6.633   38.592 -4.714  1.00 16.97 ? 4   VAL B N    1 
ATOM   4181 C CA   . VAL B 1 4   ? 7.226   37.268 -4.875  1.00 15.74 ? 4   VAL B CA   1 
ATOM   4182 C C    . VAL B 1 4   ? 7.545   36.869 -6.312  1.00 12.88 ? 4   VAL B C    1 
ATOM   4183 O O    . VAL B 1 4   ? 6.763   37.101 -7.226  1.00 13.72 ? 4   VAL B O    1 
ATOM   4184 C CB   . VAL B 1 4   ? 6.364   36.210 -4.182  1.00 13.92 ? 4   VAL B CB   1 
ATOM   4185 C CG1  . VAL B 1 4   ? 6.836   34.794 -4.560  1.00 13.49 ? 4   VAL B CG1  1 
ATOM   4186 C CG2  . VAL B 1 4   ? 6.443   36.439 -2.680  1.00 16.00 ? 4   VAL B CG2  1 
ATOM   4187 H H    . VAL B 1 4   ? 5.726   38.748 -5.072  1.00 0.00  ? 4   VAL B H    1 
ATOM   4188 N N    . VAL B 1 5   ? 8.698   36.244 -6.499  1.00 12.53 ? 5   VAL B N    1 
ATOM   4189 C CA   . VAL B 1 5   ? 9.171   35.856 -7.823  1.00 10.58 ? 5   VAL B CA   1 
ATOM   4190 C C    . VAL B 1 5   ? 9.339   34.337 -7.803  1.00 12.96 ? 5   VAL B C    1 
ATOM   4191 O O    . VAL B 1 5   ? 9.882   33.794 -6.808  1.00 16.84 ? 5   VAL B O    1 
ATOM   4192 C CB   . VAL B 1 5   ? 10.546  36.586 -8.072  1.00 11.79 ? 5   VAL B CB   1 
ATOM   4193 C CG1  . VAL B 1 5   ? 11.157  36.266 -9.449  1.00 9.97  ? 5   VAL B CG1  1 
ATOM   4194 C CG2  . VAL B 1 5   ? 10.359  38.072 -7.913  1.00 6.27  ? 5   VAL B CG2  1 
ATOM   4195 H H    . VAL B 1 5   ? 9.263   36.068 -5.720  1.00 0.00  ? 5   VAL B H    1 
ATOM   4196 N N    . VAL B 1 6   ? 8.777   33.662 -8.821  1.00 16.13 ? 6   VAL B N    1 
ATOM   4197 C CA   . VAL B 1 6   ? 8.835   32.194 -8.984  1.00 17.42 ? 6   VAL B CA   1 
ATOM   4198 C C    . VAL B 1 6   ? 9.519   31.791 -10.290 1.00 17.97 ? 6   VAL B C    1 
ATOM   4199 O O    . VAL B 1 6   ? 9.132   32.271 -11.375 1.00 17.31 ? 6   VAL B O    1 
ATOM   4200 C CB   . VAL B 1 6   ? 7.388   31.545 -9.043  1.00 19.21 ? 6   VAL B CB   1 
ATOM   4201 C CG1  . VAL B 1 6   ? 7.469   30.117 -9.605  1.00 17.57 ? 6   VAL B CG1  1 
ATOM   4202 C CG2  . VAL B 1 6   ? 6.698   31.536 -7.639  1.00 18.42 ? 6   VAL B CG2  1 
ATOM   4203 H H    . VAL B 1 6   ? 8.244   34.176 -9.475  1.00 0.00  ? 6   VAL B H    1 
ATOM   4204 N N    . LEU B 1 7   ? 10.439  30.824 -10.211 1.00 15.91 ? 7   LEU B N    1 
ATOM   4205 C CA   . LEU B 1 7   ? 11.142  30.350 -11.415 1.00 13.97 ? 7   LEU B CA   1 
ATOM   4206 C C    . LEU B 1 7   ? 11.905  29.029 -11.257 1.00 14.54 ? 7   LEU B C    1 
ATOM   4207 O O    . LEU B 1 7   ? 12.297  28.642 -10.142 1.00 16.14 ? 7   LEU B O    1 
ATOM   4208 C CB   . LEU B 1 7   ? 12.118  31.423 -11.938 1.00 12.53 ? 7   LEU B CB   1 
ATOM   4209 C CG   . LEU B 1 7   ? 12.904  32.221 -10.888 1.00 14.23 ? 7   LEU B CG   1 
ATOM   4210 C CD1  . LEU B 1 7   ? 13.731  31.332 -9.938  1.00 7.28  ? 7   LEU B CD1  1 
ATOM   4211 C CD2  . LEU B 1 7   ? 13.768  33.227 -11.597 1.00 11.51 ? 7   LEU B CD2  1 
ATOM   4212 H H    . LEU B 1 7   ? 10.667  30.450 -9.329  1.00 0.00  ? 7   LEU B H    1 
ATOM   4213 N N    . GLY B 1 8   ? 12.174  28.394 -12.396 1.00 13.92 ? 8   GLY B N    1 
ATOM   4214 C CA   . GLY B 1 8   ? 12.899  27.132 -12.419 1.00 12.12 ? 8   GLY B CA   1 
ATOM   4215 C C    . GLY B 1 8   ? 14.359  27.392 -12.167 1.00 11.78 ? 8   GLY B C    1 
ATOM   4216 O O    . GLY B 1 8   ? 14.911  28.278 -12.808 1.00 11.70 ? 8   GLY B O    1 
ATOM   4217 H H    . GLY B 1 8   ? 11.921  28.803 -13.243 1.00 0.00  ? 8   GLY B H    1 
ATOM   4218 N N    . THR B 1 9   ? 14.987  26.692 -11.222 1.00 11.06 ? 9   THR B N    1 
ATOM   4219 C CA   . THR B 1 9   ? 16.418  26.937 -10.931 1.00 11.82 ? 9   THR B CA   1 
ATOM   4220 C C    . THR B 1 9   ? 17.386  26.076 -11.735 1.00 11.09 ? 9   THR B C    1 
ATOM   4221 O O    . THR B 1 9   ? 18.585  26.081 -11.447 1.00 7.19  ? 9   THR B O    1 
ATOM   4222 C CB   . THR B 1 9   ? 16.764  26.624 -9.473  1.00 12.59 ? 9   THR B CB   1 
ATOM   4223 O OG1  . THR B 1 9   ? 16.171  25.369 -9.111  1.00 14.19 ? 9   THR B OG1  1 
ATOM   4224 C CG2  . THR B 1 9   ? 16.296  27.702 -8.543  1.00 15.38 ? 9   THR B CG2  1 
ATOM   4225 H H    . THR B 1 9   ? 14.475  25.996 -10.754 1.00 0.00  ? 9   THR B H    1 
ATOM   4226 H HG1  . THR B 1 9   ? 15.216  25.345 -9.238  1.00 0.00  ? 9   THR B HG1  1 
ATOM   4227 N N    . GLN B 1 10  ? 16.874  25.358 -12.735 1.00 9.85  ? 10  GLN B N    1 
ATOM   4228 C CA   . GLN B 1 10  ? 17.701  24.428 -13.497 1.00 11.70 ? 10  GLN B CA   1 
ATOM   4229 C C    . GLN B 1 10  ? 17.650  24.616 -15.017 1.00 13.29 ? 10  GLN B C    1 
ATOM   4230 O O    . GLN B 1 10  ? 18.094  25.663 -15.521 1.00 16.04 ? 10  GLN B O    1 
ATOM   4231 C CB   . GLN B 1 10  ? 17.386  22.966 -13.038 1.00 10.93 ? 10  GLN B CB   1 
ATOM   4232 C CG   . GLN B 1 10  ? 17.504  22.735 -11.517 1.00 11.30 ? 10  GLN B CG   1 
ATOM   4233 C CD   . GLN B 1 10  ? 16.712  21.526 -10.961 1.00 12.57 ? 10  GLN B CD   1 
ATOM   4234 O OE1  . GLN B 1 10  ? 15.543  21.650 -10.586 1.00 7.56  ? 10  GLN B OE1  1 
ATOM   4235 N NE2  . GLN B 1 10  ? 17.393  20.380 -10.807 1.00 14.16 ? 10  GLN B NE2  1 
ATOM   4236 H H    . GLN B 1 10  ? 15.924  25.413 -12.984 1.00 0.00  ? 10  GLN B H    1 
ATOM   4237 H HE21 . GLN B 1 10  ? 16.899  19.619 -10.448 1.00 0.00  ? 10  GLN B HE21 1 
ATOM   4238 H HE22 . GLN B 1 10  ? 18.352  20.328 -11.032 1.00 0.00  ? 10  GLN B HE22 1 
ATOM   4239 N N    . TRP B 1 11  ? 17.182  23.629 -15.770 1.00 15.43 ? 11  TRP B N    1 
ATOM   4240 C CA   . TRP B 1 11  ? 17.120  23.805 -17.223 1.00 17.62 ? 11  TRP B CA   1 
ATOM   4241 C C    . TRP B 1 11  ? 15.698  23.655 -17.755 1.00 18.51 ? 11  TRP B C    1 
ATOM   4242 O O    . TRP B 1 11  ? 15.509  23.370 -18.951 1.00 21.34 ? 11  TRP B O    1 
ATOM   4243 C CB   . TRP B 1 11  ? 17.990  22.780 -17.936 1.00 17.42 ? 11  TRP B CB   1 
ATOM   4244 C CG   . TRP B 1 11  ? 19.426  22.817 -17.608 1.00 17.97 ? 11  TRP B CG   1 
ATOM   4245 C CD1  . TRP B 1 11  ? 20.392  23.573 -18.221 1.00 15.71 ? 11  TRP B CD1  1 
ATOM   4246 C CD2  . TRP B 1 11  ? 20.112  21.979 -16.655 1.00 18.50 ? 11  TRP B CD2  1 
ATOM   4247 N NE1  . TRP B 1 11  ? 21.636  23.253 -17.712 1.00 17.20 ? 11  TRP B NE1  1 
ATOM   4248 C CE2  . TRP B 1 11  ? 21.500  22.281 -16.755 1.00 16.53 ? 11  TRP B CE2  1 
ATOM   4249 C CE3  . TRP B 1 11  ? 19.693  21.007 -15.737 1.00 13.94 ? 11  TRP B CE3  1 
ATOM   4250 C CZ2  . TRP B 1 11  ? 22.470  21.641 -15.973 1.00 14.10 ? 11  TRP B CZ2  1 
ATOM   4251 C CZ3  . TRP B 1 11  ? 20.657  20.371 -14.956 1.00 13.47 ? 11  TRP B CZ3  1 
ATOM   4252 C CH2  . TRP B 1 11  ? 22.037  20.692 -15.083 1.00 14.42 ? 11  TRP B CH2  1 
ATOM   4253 H H    . TRP B 1 11  ? 16.867  22.776 -15.406 1.00 0.00  ? 11  TRP B H    1 
ATOM   4254 H HE1  . TRP B 1 11  ? 22.471  23.688 -17.984 1.00 0.00  ? 11  TRP B HE1  1 
ATOM   4255 N N    . GLY B 1 12  ? 14.711  23.827 -16.876 1.00 16.63 ? 12  GLY B N    1 
ATOM   4256 C CA   . GLY B 1 12  ? 13.322  23.683 -17.285 1.00 12.69 ? 12  GLY B CA   1 
ATOM   4257 C C    . GLY B 1 12  ? 12.584  22.472 -16.720 1.00 10.10 ? 12  GLY B C    1 
ATOM   4258 O O    . GLY B 1 12  ? 13.148  21.627 -16.007 1.00 9.31  ? 12  GLY B O    1 
ATOM   4259 H H    . GLY B 1 12  ? 14.878  24.013 -15.931 1.00 0.00  ? 12  GLY B H    1 
ATOM   4260 N N    . ASP B 1 13  ? 11.284  22.445 -16.924 1.00 10.46 ? 13  ASP B N    1 
ATOM   4261 C CA   . ASP B 1 13  ? 10.491  21.337 -16.450 1.00 13.16 ? 13  ASP B CA   1 
ATOM   4262 C C    . ASP B 1 13  ? 10.678  20.997 -14.967 1.00 15.08 ? 13  ASP B C    1 
ATOM   4263 O O    . ASP B 1 13  ? 10.553  19.828 -14.561 1.00 16.80 ? 13  ASP B O    1 
ATOM   4264 C CB   . ASP B 1 13  ? 10.775  20.084 -17.299 1.00 18.55 ? 13  ASP B CB   1 
ATOM   4265 C CG   . ASP B 1 13  ? 11.043  20.406 -18.769 1.00 21.52 ? 13  ASP B CG   1 
ATOM   4266 O OD1  . ASP B 1 13  ? 10.100  20.808 -19.497 1.00 23.92 ? 13  ASP B OD1  1 
ATOM   4267 O OD2  . ASP B 1 13  ? 12.203  20.225 -19.198 1.00 23.87 ? 13  ASP B OD2  1 
ATOM   4268 H H    . ASP B 1 13  ? 10.867  23.178 -17.412 1.00 0.00  ? 13  ASP B H    1 
ATOM   4269 N N    . GLU B 1 14  ? 10.952  21.999 -14.145 1.00 16.34 ? 14  GLU B N    1 
ATOM   4270 C CA   . GLU B 1 14  ? 11.132  21.770 -12.709 1.00 16.77 ? 14  GLU B CA   1 
ATOM   4271 C C    . GLU B 1 14  ? 9.792   21.540 -11.998 1.00 17.01 ? 14  GLU B C    1 
ATOM   4272 O O    . GLU B 1 14  ? 9.761   21.250 -10.811 1.00 20.06 ? 14  GLU B O    1 
ATOM   4273 C CB   . GLU B 1 14  ? 11.881  22.934 -12.055 1.00 12.78 ? 14  GLU B CB   1 
ATOM   4274 C CG   . GLU B 1 14  ? 13.250  23.227 -12.645 1.00 11.39 ? 14  GLU B CG   1 
ATOM   4275 C CD   . GLU B 1 14  ? 13.217  24.238 -13.809 1.00 15.96 ? 14  GLU B CD   1 
ATOM   4276 O OE1  . GLU B 1 14  ? 12.173  24.343 -14.517 1.00 22.47 ? 14  GLU B OE1  1 
ATOM   4277 O OE2  . GLU B 1 14  ? 14.235  24.930 -14.024 1.00 8.65  ? 14  GLU B OE2  1 
ATOM   4278 H H    . GLU B 1 14  ? 11.131  22.900 -14.491 1.00 0.00  ? 14  GLU B H    1 
ATOM   4279 N N    . GLY B 1 15  ? 8.686   21.715 -12.706 1.00 17.45 ? 15  GLY B N    1 
ATOM   4280 C CA   . GLY B 1 15  ? 7.384   21.493 -12.088 1.00 20.59 ? 15  GLY B CA   1 
ATOM   4281 C C    . GLY B 1 15  ? 6.746   22.682 -11.387 1.00 21.20 ? 15  GLY B C    1 
ATOM   4282 O O    . GLY B 1 15  ? 6.113   22.537 -10.327 1.00 22.87 ? 15  GLY B O    1 
ATOM   4283 H H    . GLY B 1 15  ? 8.752   21.944 -13.650 1.00 0.00  ? 15  GLY B H    1 
ATOM   4284 N N    A LYS B 1 16  ? 6.887   23.864 -11.981 0.50 20.82 ? 16  LYS B N    1 
ATOM   4285 N N    B LYS B 1 16  ? 6.884   23.845 -12.014 0.50 21.31 ? 16  LYS B N    1 
ATOM   4286 C CA   A LYS B 1 16  ? 6.314   25.087 -11.413 0.50 20.59 ? 16  LYS B CA   1 
ATOM   4287 C CA   B LYS B 1 16  ? 6.345   25.113 -11.525 0.50 21.59 ? 16  LYS B CA   1 
ATOM   4288 C C    A LYS B 1 16  ? 4.780   25.156 -11.412 0.50 19.70 ? 16  LYS B C    1 
ATOM   4289 C C    B LYS B 1 16  ? 4.806   25.160 -11.436 0.50 20.25 ? 16  LYS B C    1 
ATOM   4290 O O    A LYS B 1 16  ? 4.184   25.729 -10.491 0.50 20.02 ? 16  LYS B O    1 
ATOM   4291 O O    B LYS B 1 16  ? 4.242   25.713 -10.483 0.50 20.53 ? 16  LYS B O    1 
ATOM   4292 C CB   A LYS B 1 16  ? 6.930   26.339 -12.074 0.50 20.49 ? 16  LYS B CB   1 
ATOM   4293 C CB   B LYS B 1 16  ? 6.868   26.246 -12.438 0.50 21.98 ? 16  LYS B CB   1 
ATOM   4294 C CG   A LYS B 1 16  ? 7.047   26.301 -13.584 0.50 19.18 ? 16  LYS B CG   1 
ATOM   4295 C CG   B LYS B 1 16  ? 5.793   27.138 -13.029 0.50 23.69 ? 16  LYS B CG   1 
ATOM   4296 C CD   A LYS B 1 16  ? 7.951   27.420 -14.065 0.50 21.61 ? 16  LYS B CD   1 
ATOM   4297 C CD   B LYS B 1 16  ? 6.321   28.072 -14.116 0.50 24.57 ? 16  LYS B CD   1 
ATOM   4298 C CE   A LYS B 1 16  ? 8.191   27.374 -15.578 0.50 23.44 ? 16  LYS B CE   1 
ATOM   4299 C CE   B LYS B 1 16  ? 6.668   27.313 -15.371 0.50 24.42 ? 16  LYS B CE   1 
ATOM   4300 N NZ   A LYS B 1 16  ? 8.932   26.153 -16.056 0.50 18.66 ? 16  LYS B NZ   1 
ATOM   4301 N NZ   B LYS B 1 16  ? 6.485   28.135 -16.591 0.50 27.66 ? 16  LYS B NZ   1 
ATOM   4302 H H    A LYS B 1 16  ? 7.364   23.890 -12.831 0.50 0.00  ? 16  LYS B H    1 
ATOM   4303 H H    B LYS B 1 16  ? 7.357   23.847 -12.871 0.50 0.00  ? 16  LYS B H    1 
ATOM   4304 H HZ1  A LYS B 1 16  ? 9.847   26.019 -15.591 0.50 0.00  ? 16  LYS B HZ1  1 
ATOM   4305 H HZ1  B LYS B 1 16  ? 6.998   29.032 -16.474 0.50 0.00  ? 16  LYS B HZ1  1 
ATOM   4306 H HZ2  A LYS B 1 16  ? 8.341   25.313 -15.959 0.50 0.00  ? 16  LYS B HZ2  1 
ATOM   4307 H HZ2  B LYS B 1 16  ? 6.827   27.614 -17.428 0.50 0.00  ? 16  LYS B HZ2  1 
ATOM   4308 H HZ3  A LYS B 1 16  ? 9.078   26.286 -17.079 0.50 0.00  ? 16  LYS B HZ3  1 
ATOM   4309 H HZ3  B LYS B 1 16  ? 5.471   28.336 -16.703 0.50 0.00  ? 16  LYS B HZ3  1 
ATOM   4310 N N    . GLY B 1 17  ? 4.149   24.539 -12.408 1.00 20.37 ? 17  GLY B N    1 
ATOM   4311 C CA   . GLY B 1 17  ? 2.686   24.535 -12.500 1.00 20.83 ? 17  GLY B CA   1 
ATOM   4312 C C    . GLY B 1 17  ? 1.737   24.567 -11.296 1.00 18.67 ? 17  GLY B C    1 
ATOM   4313 O O    . GLY B 1 17  ? 0.759   25.319 -11.272 1.00 19.76 ? 17  GLY B O    1 
ATOM   4314 H H    . GLY B 1 17  ? 4.669   24.065 -13.082 1.00 0.00  ? 17  GLY B H    1 
ATOM   4315 N N    . LYS B 1 18  ? 2.036   23.767 -10.282 1.00 20.25 ? 18  LYS B N    1 
ATOM   4316 C CA   . LYS B 1 18  ? 1.205   23.667 -9.102  1.00 18.01 ? 18  LYS B CA   1 
ATOM   4317 C C    . LYS B 1 18  ? 1.543   24.672 -8.020  1.00 17.78 ? 18  LYS B C    1 
ATOM   4318 O O    . LYS B 1 18  ? 0.657   25.101 -7.292  1.00 18.40 ? 18  LYS B O    1 
ATOM   4319 C CB   . LYS B 1 18  ? 1.274   22.229 -8.581  1.00 20.29 ? 18  LYS B CB   1 
ATOM   4320 C CG   . LYS B 1 18  ? 0.662   21.964 -7.222  1.00 22.60 ? 18  LYS B CG   1 
ATOM   4321 C CD   . LYS B 1 18  ? 1.625   22.218 -6.107  1.00 24.58 ? 18  LYS B CD   1 
ATOM   4322 C CE   . LYS B 1 18  ? 1.079   21.579 -4.889  1.00 27.84 ? 18  LYS B CE   1 
ATOM   4323 N NZ   . LYS B 1 18  ? 0.647   20.204 -5.215  1.00 28.41 ? 18  LYS B NZ   1 
ATOM   4324 H H    . LYS B 1 18  ? 2.861   23.253 -10.323 1.00 0.00  ? 18  LYS B H    1 
ATOM   4325 H HZ1  . LYS B 1 18  ? -0.025  20.144 -5.996  1.00 0.00  ? 18  LYS B HZ1  1 
ATOM   4326 H HZ2  . LYS B 1 18  ? 1.459   19.572 -5.406  1.00 0.00  ? 18  LYS B HZ2  1 
ATOM   4327 H HZ3  . LYS B 1 18  ? 0.151   19.809 -4.386  1.00 0.00  ? 18  LYS B HZ3  1 
ATOM   4328 N N    . ILE B 1 19  ? 2.811   25.059 -7.894  1.00 17.85 ? 19  ILE B N    1 
ATOM   4329 C CA   . ILE B 1 19  ? 3.179   26.031 -6.850  1.00 17.69 ? 19  ILE B CA   1 
ATOM   4330 C C    . ILE B 1 19  ? 2.520   27.378 -7.238  1.00 16.35 ? 19  ILE B C    1 
ATOM   4331 O O    . ILE B 1 19  ? 1.922   28.095 -6.412  1.00 16.56 ? 19  ILE B O    1 
ATOM   4332 C CB   . ILE B 1 19  ? 4.708   26.211 -6.723  1.00 18.11 ? 19  ILE B CB   1 
ATOM   4333 C CG1  . ILE B 1 19  ? 5.423   24.866 -6.612  1.00 19.63 ? 19  ILE B CG1  1 
ATOM   4334 C CG2  . ILE B 1 19  ? 5.014   26.886 -5.449  1.00 22.50 ? 19  ILE B CG2  1 
ATOM   4335 C CD1  . ILE B 1 19  ? 5.777   24.248 -7.942  1.00 25.64 ? 19  ILE B CD1  1 
ATOM   4336 H H    . ILE B 1 19  ? 3.469   24.784 -8.566  1.00 0.00  ? 19  ILE B H    1 
ATOM   4337 N N    . VAL B 1 20  ? 2.525   27.609 -8.545  1.00 17.18 ? 20  VAL B N    1 
ATOM   4338 C CA   . VAL B 1 20  ? 1.972   28.802 -9.148  1.00 14.16 ? 20  VAL B CA   1 
ATOM   4339 C C    . VAL B 1 20  ? 0.487   28.919 -8.921  1.00 13.15 ? 20  VAL B C    1 
ATOM   4340 O O    . VAL B 1 20  ? 0.022   29.959 -8.436  1.00 10.39 ? 20  VAL B O    1 
ATOM   4341 C CB   . VAL B 1 20  ? 2.322   28.829 -10.622 1.00 15.13 ? 20  VAL B CB   1 
ATOM   4342 C CG1  . VAL B 1 20  ? 1.177   29.462 -11.423 1.00 13.95 ? 20  VAL B CG1  1 
ATOM   4343 C CG2  . VAL B 1 20  ? 3.730   29.554 -10.820 1.00 8.51  ? 20  VAL B CG2  1 
ATOM   4344 H H    . VAL B 1 20  ? 2.986   26.963 -9.136  1.00 0.00  ? 20  VAL B H    1 
ATOM   4345 N N    . ASP B 1 21  ? -0.262  27.850 -9.217  1.00 16.58 ? 21  ASP B N    1 
ATOM   4346 C CA   . ASP B 1 21  ? -1.718  27.854 -8.989  1.00 18.96 ? 21  ASP B CA   1 
ATOM   4347 C C    . ASP B 1 21  ? -2.007  27.842 -7.490  1.00 21.51 ? 21  ASP B C    1 
ATOM   4348 O O    . ASP B 1 21  ? -3.095  28.171 -7.050  1.00 21.80 ? 21  ASP B O    1 
ATOM   4349 C CB   . ASP B 1 21  ? -2.396  26.668 -9.649  1.00 18.56 ? 21  ASP B CB   1 
ATOM   4350 C CG   . ASP B 1 21  ? -2.322  26.724 -11.151 1.00 24.09 ? 21  ASP B CG   1 
ATOM   4351 O OD1  . ASP B 1 21  ? -1.997  27.813 -11.697 1.00 24.79 ? 21  ASP B OD1  1 
ATOM   4352 O OD2  . ASP B 1 21  ? -2.584  25.680 -11.811 1.00 24.12 ? 21  ASP B OD2  1 
ATOM   4353 H H    . ASP B 1 21  ? 0.146   27.060 -9.632  1.00 0.00  ? 21  ASP B H    1 
ATOM   4354 N N    . LEU B 1 22  ? -1.015  27.513 -6.686  1.00 23.64 ? 22  LEU B N    1 
ATOM   4355 C CA   . LEU B 1 22  ? -1.263  27.493 -5.278  1.00 24.64 ? 22  LEU B CA   1 
ATOM   4356 C C    . LEU B 1 22  ? -1.168  28.924 -4.732  1.00 23.89 ? 22  LEU B C    1 
ATOM   4357 O O    . LEU B 1 22  ? -2.143  29.449 -4.184  1.00 25.56 ? 22  LEU B O    1 
ATOM   4358 C CB   . LEU B 1 22  ? -0.310  26.507 -4.592  1.00 25.79 ? 22  LEU B CB   1 
ATOM   4359 C CG   . LEU B 1 22  ? -0.480  26.279 -3.087  1.00 27.74 ? 22  LEU B CG   1 
ATOM   4360 C CD1  . LEU B 1 22  ? -1.966  26.350 -2.722  1.00 25.62 ? 22  LEU B CD1  1 
ATOM   4361 C CD2  . LEU B 1 22  ? 0.160   24.932 -2.673  1.00 26.33 ? 22  LEU B CD2  1 
ATOM   4362 H H    . LEU B 1 22  ? -0.143  27.241 -7.034  1.00 0.00  ? 22  LEU B H    1 
ATOM   4363 N N    . LEU B 1 23  ? -0.017  29.560 -4.913  1.00 20.41 ? 23  LEU B N    1 
ATOM   4364 C CA   . LEU B 1 23  ? 0.181   30.927 -4.439  1.00 21.00 ? 23  LEU B CA   1 
ATOM   4365 C C    . LEU B 1 23  ? -0.765  31.938 -5.118  1.00 22.74 ? 23  LEU B C    1 
ATOM   4366 O O    . LEU B 1 23  ? -1.045  33.000 -4.560  1.00 24.96 ? 23  LEU B O    1 
ATOM   4367 C CB   . LEU B 1 23  ? 1.625   31.360 -4.671  1.00 22.90 ? 23  LEU B CB   1 
ATOM   4368 C CG   . LEU B 1 23  ? 2.673   30.742 -3.741  1.00 25.18 ? 23  LEU B CG   1 
ATOM   4369 C CD1  . LEU B 1 23  ? 3.815   30.156 -4.553  1.00 23.12 ? 23  LEU B CD1  1 
ATOM   4370 C CD2  . LEU B 1 23  ? 3.184   31.811 -2.777  1.00 25.92 ? 23  LEU B CD2  1 
ATOM   4371 H H    . LEU B 1 23  ? 0.707   29.085 -5.388  1.00 0.00  ? 23  LEU B H    1 
ATOM   4372 N N    . THR B 1 24  ? -1.258  31.593 -6.307  1.00 22.40 ? 24  THR B N    1 
ATOM   4373 C CA   . THR B 1 24  ? -2.165  32.426 -7.074  1.00 18.90 ? 24  THR B CA   1 
ATOM   4374 C C    . THR B 1 24  ? -3.319  32.820 -6.219  1.00 17.14 ? 24  THR B C    1 
ATOM   4375 O O    . THR B 1 24  ? -3.822  33.924 -6.323  1.00 16.34 ? 24  THR B O    1 
ATOM   4376 C CB   . THR B 1 24  ? -2.682  31.654 -8.311  1.00 21.84 ? 24  THR B CB   1 
ATOM   4377 O OG1  . THR B 1 24  ? -1.582  31.399 -9.190  1.00 20.31 ? 24  THR B OG1  1 
ATOM   4378 C CG2  . THR B 1 24  ? -3.789  32.439 -9.076  1.00 20.55 ? 24  THR B CG2  1 
ATOM   4379 H H    . THR B 1 24  ? -0.956  30.770 -6.734  1.00 0.00  ? 24  THR B H    1 
ATOM   4380 H HG1  . THR B 1 24  ? -0.883  30.822 -8.795  1.00 0.00  ? 24  THR B HG1  1 
ATOM   4381 N N    . GLU B 1 25  ? -3.653  31.938 -5.292  1.00 19.21 ? 25  GLU B N    1 
ATOM   4382 C CA   . GLU B 1 25  ? -4.759  32.106 -4.369  1.00 18.44 ? 25  GLU B CA   1 
ATOM   4383 C C    . GLU B 1 25  ? -4.665  33.280 -3.394  1.00 19.56 ? 25  GLU B C    1 
ATOM   4384 O O    . GLU B 1 25  ? -5.678  33.828 -2.976  1.00 19.85 ? 25  GLU B O    1 
ATOM   4385 C CB   . GLU B 1 25  ? -4.918  30.820 -3.566  1.00 16.03 ? 25  GLU B CB   1 
ATOM   4386 C CG   . GLU B 1 25  ? -5.268  29.648 -4.396  1.00 20.18 ? 25  GLU B CG   1 
ATOM   4387 C CD   . GLU B 1 25  ? -5.552  28.401 -3.587  1.00 20.83 ? 25  GLU B CD   1 
ATOM   4388 O OE1  . GLU B 1 25  ? -4.736  27.983 -2.738  1.00 29.09 ? 25  GLU B OE1  1 
ATOM   4389 O OE2  . GLU B 1 25  ? -6.609  27.808 -3.826  1.00 24.05 ? 25  GLU B OE2  1 
ATOM   4390 H H    . GLU B 1 25  ? -3.150  31.097 -5.209  1.00 0.00  ? 25  GLU B H    1 
ATOM   4391 N N    A ARG B 1 26  ? -3.443  33.599 -2.990  0.50 20.01 ? 26  ARG B N    1 
ATOM   4392 N N    B ARG B 1 26  ? -3.458  33.630 -2.968  0.50 19.64 ? 26  ARG B N    1 
ATOM   4393 C CA   A ARG B 1 26  ? -3.188  34.672 -2.037  0.50 20.25 ? 26  ARG B CA   1 
ATOM   4394 C CA   B ARG B 1 26  ? -3.296  34.748 -2.040  0.50 19.25 ? 26  ARG B CA   1 
ATOM   4395 C C    A ARG B 1 26  ? -2.777  35.944 -2.770  0.50 19.10 ? 26  ARG B C    1 
ATOM   4396 C C    B ARG B 1 26  ? -2.820  35.983 -2.787  0.50 18.64 ? 26  ARG B C    1 
ATOM   4397 O O    A ARG B 1 26  ? -2.776  37.024 -2.188  0.50 19.84 ? 26  ARG B O    1 
ATOM   4398 O O    B ARG B 1 26  ? -2.795  37.075 -2.227  0.50 19.26 ? 26  ARG B O    1 
ATOM   4399 C CB   A ARG B 1 26  ? -2.048  34.261 -1.080  0.50 23.23 ? 26  ARG B CB   1 
ATOM   4400 C CB   B ARG B 1 26  ? -2.324  34.397 -0.900  0.50 21.92 ? 26  ARG B CB   1 
ATOM   4401 C CG   A ARG B 1 26  ? -2.241  32.916 -0.324  0.50 23.40 ? 26  ARG B CG   1 
ATOM   4402 C CG   B ARG B 1 26  ? -2.949  33.508 0.199   0.50 21.07 ? 26  ARG B CG   1 
ATOM   4403 C CD   A ARG B 1 26  ? -1.612  31.700 -1.040  0.50 23.60 ? 26  ARG B CD   1 
ATOM   4404 C CD   B ARG B 1 26  ? -1.940  33.075 1.270   0.50 19.35 ? 26  ARG B CD   1 
ATOM   4405 N NE   A ARG B 1 26  ? -1.328  30.630 -0.082  0.50 26.36 ? 26  ARG B NE   1 
ATOM   4406 N NE   B ARG B 1 26  ? -1.398  34.188 2.048   0.50 21.62 ? 26  ARG B NE   1 
ATOM   4407 C CZ   A ARG B 1 26  ? -1.868  29.413 -0.108  0.50 28.39 ? 26  ARG B CZ   1 
ATOM   4408 C CZ   B ARG B 1 26  ? -0.563  34.047 3.077   0.50 22.05 ? 26  ARG B CZ   1 
ATOM   4409 N NH1  A ARG B 1 26  ? -2.732  29.084 -1.067  0.50 30.69 ? 26  ARG B NH1  1 
ATOM   4410 N NH1  B ARG B 1 26  ? -0.181  32.835 3.460   0.50 24.01 ? 26  ARG B NH1  1 
ATOM   4411 N NH2  A ARG B 1 26  ? -1.581  28.537 0.854   0.50 27.65 ? 26  ARG B NH2  1 
ATOM   4412 N NH2  B ARG B 1 26  ? -0.088  35.114 3.711   0.50 22.95 ? 26  ARG B NH2  1 
ATOM   4413 H H    A ARG B 1 26  ? -2.668  33.144 -3.383  0.50 0.00  ? 26  ARG B H    1 
ATOM   4414 H H    B ARG B 1 26  ? -2.660  33.167 -3.303  0.50 0.00  ? 26  ARG B H    1 
ATOM   4415 H HE   A ARG B 1 26  ? -0.686  30.858 0.633   0.50 0.00  ? 26  ARG B HE   1 
ATOM   4416 H HE   B ARG B 1 26  ? -1.683  35.090 1.782   0.50 0.00  ? 26  ARG B HE   1 
ATOM   4417 H HH11 A ARG B 1 26  ? -2.988  29.728 -1.786  0.50 0.00  ? 26  ARG B HH11 1 
ATOM   4418 H HH11 B ARG B 1 26  ? -0.458  31.993 2.997   0.50 0.00  ? 26  ARG B HH11 1 
ATOM   4419 H HH12 A ARG B 1 26  ? -3.169  28.184 -1.126  0.50 0.00  ? 26  ARG B HH12 1 
ATOM   4420 H HH12 B ARG B 1 26  ? 0.514   32.695 4.191   0.50 0.00  ? 26  ARG B HH12 1 
ATOM   4421 H HH21 A ARG B 1 26  ? -0.962  28.798 1.601   0.50 0.00  ? 26  ARG B HH21 1 
ATOM   4422 H HH21 B ARG B 1 26  ? -0.338  36.046 3.455   0.50 0.00  ? 26  ARG B HH21 1 
ATOM   4423 H HH22 A ARG B 1 26  ? -1.978  27.615 0.858   0.50 0.00  ? 26  ARG B HH22 1 
ATOM   4424 H HH22 B ARG B 1 26  ? 0.559   34.960 4.465   0.50 0.00  ? 26  ARG B HH22 1 
ATOM   4425 N N    . ALA B 1 27  ? -2.447  35.805 -4.050  1.00 18.51 ? 27  ALA B N    1 
ATOM   4426 C CA   . ALA B 1 27  ? -1.984  36.909 -4.885  1.00 18.62 ? 27  ALA B CA   1 
ATOM   4427 C C    . ALA B 1 27  ? -3.098  37.789 -5.452  1.00 18.13 ? 27  ALA B C    1 
ATOM   4428 O O    . ALA B 1 27  ? -4.045  37.293 -6.065  1.00 20.84 ? 27  ALA B O    1 
ATOM   4429 C CB   . ALA B 1 27  ? -1.122  36.362 -6.043  1.00 16.61 ? 27  ALA B CB   1 
ATOM   4430 H H    . ALA B 1 27  ? -2.508  34.924 -4.452  1.00 0.00  ? 27  ALA B H    1 
ATOM   4431 N N    . LYS B 1 28  ? -2.884  39.101 -5.371  1.00 16.32 ? 28  LYS B N    1 
ATOM   4432 C CA   . LYS B 1 28  ? -3.839  40.091 -5.860  1.00 18.12 ? 28  LYS B CA   1 
ATOM   4433 C C    . LYS B 1 28  ? -3.563  40.308 -7.321  1.00 18.45 ? 28  LYS B C    1 
ATOM   4434 O O    . LYS B 1 28  ? -4.491  40.474 -8.133  1.00 16.42 ? 28  LYS B O    1 
ATOM   4435 C CB   . LYS B 1 28  ? -3.647  41.411 -5.106  1.00 19.36 ? 28  LYS B CB   1 
ATOM   4436 C CG   . LYS B 1 28  ? -4.668  42.506 -5.425  1.00 21.89 ? 28  LYS B CG   1 
ATOM   4437 C CD   . LYS B 1 28  ? -5.923  42.339 -4.621  1.00 29.69 ? 28  LYS B CD   1 
ATOM   4438 C CE   . LYS B 1 28  ? -6.801  43.597 -4.725  1.00 33.82 ? 28  LYS B CE   1 
ATOM   4439 N NZ   . LYS B 1 28  ? -8.201  43.367 -4.214  1.00 35.39 ? 28  LYS B NZ   1 
ATOM   4440 H H    . LYS B 1 28  ? -2.042  39.425 -4.990  1.00 0.00  ? 28  LYS B H    1 
ATOM   4441 H HZ1  . LYS B 1 28  ? -8.152  43.071 -3.220  1.00 0.00  ? 28  LYS B HZ1  1 
ATOM   4442 H HZ2  . LYS B 1 28  ? -8.733  44.258 -4.283  1.00 0.00  ? 28  LYS B HZ2  1 
ATOM   4443 H HZ3  . LYS B 1 28  ? -8.648  42.631 -4.795  1.00 0.00  ? 28  LYS B HZ3  1 
ATOM   4444 N N    . TYR B 1 29  ? -2.266  40.355 -7.628  1.00 19.47 ? 29  TYR B N    1 
ATOM   4445 C CA   . TYR B 1 29  ? -1.748  40.561 -8.977  1.00 15.73 ? 29  TYR B CA   1 
ATOM   4446 C C    . TYR B 1 29  ? -0.851  39.412 -9.357  1.00 14.54 ? 29  TYR B C    1 
ATOM   4447 O O    . TYR B 1 29  ? -0.050  38.934 -8.537  1.00 15.72 ? 29  TYR B O    1 
ATOM   4448 C CB   . TYR B 1 29  ? -0.896  41.832 -9.032  1.00 15.81 ? 29  TYR B CB   1 
ATOM   4449 C CG   . TYR B 1 29  ? -1.689  43.106 -8.889  1.00 21.37 ? 29  TYR B CG   1 
ATOM   4450 C CD1  . TYR B 1 29  ? -2.378  43.627 -9.986  1.00 20.57 ? 29  TYR B CD1  1 
ATOM   4451 C CD2  . TYR B 1 29  ? -1.847  43.728 -7.648  1.00 20.06 ? 29  TYR B CD2  1 
ATOM   4452 C CE1  . TYR B 1 29  ? -3.210  44.708 -9.866  1.00 20.70 ? 29  TYR B CE1  1 
ATOM   4453 C CE2  . TYR B 1 29  ? -2.698  44.810 -7.522  1.00 21.21 ? 29  TYR B CE2  1 
ATOM   4454 C CZ   . TYR B 1 29  ? -3.386  45.287 -8.646  1.00 20.59 ? 29  TYR B CZ   1 
ATOM   4455 O OH   . TYR B 1 29  ? -4.335  46.273 -8.569  1.00 18.52 ? 29  TYR B OH   1 
ATOM   4456 H H    . TYR B 1 29  ? -1.620  40.247 -6.900  1.00 0.00  ? 29  TYR B H    1 
ATOM   4457 H HH   . TYR B 1 29  ? -4.494  46.561 -9.480  1.00 0.00  ? 29  TYR B HH   1 
ATOM   4458 N N    . VAL B 1 30  ? -0.945  39.012 -10.614 1.00 12.66 ? 30  VAL B N    1 
ATOM   4459 C CA   . VAL B 1 30  ? -0.117  37.964 -11.186 1.00 11.94 ? 30  VAL B CA   1 
ATOM   4460 C C    . VAL B 1 30  ? 0.549   38.559 -12.420 1.00 11.36 ? 30  VAL B C    1 
ATOM   4461 O O    . VAL B 1 30  ? -0.126  39.057 -13.295 1.00 15.87 ? 30  VAL B O    1 
ATOM   4462 C CB   . VAL B 1 30  ? -0.975  36.706 -11.466 1.00 7.84  ? 30  VAL B CB   1 
ATOM   4463 C CG1  . VAL B 1 30  ? -0.300  35.810 -12.460 1.00 11.73 ? 30  VAL B CG1  1 
ATOM   4464 C CG2  . VAL B 1 30  ? -1.094  35.941 -10.185 1.00 8.51  ? 30  VAL B CG2  1 
ATOM   4465 H H    . VAL B 1 30  ? -1.625  39.414 -11.202 1.00 0.00  ? 30  VAL B H    1 
ATOM   4466 N N    . VAL B 1 31  ? 1.860   38.454 -12.522 1.00 14.58 ? 31  VAL B N    1 
ATOM   4467 C CA   . VAL B 1 31  ? 2.649   39.085 -13.621 1.00 11.43 ? 31  VAL B CA   1 
ATOM   4468 C C    . VAL B 1 31  ? 3.619   38.257 -14.540 1.00 10.34 ? 31  VAL B C    1 
ATOM   4469 O O    . VAL B 1 31  ? 4.534   37.624 -14.034 1.00 11.27 ? 31  VAL B O    1 
ATOM   4470 C CB   . VAL B 1 31  ? 3.570   40.177 -12.938 1.00 11.66 ? 31  VAL B CB   1 
ATOM   4471 C CG1  . VAL B 1 31  ? 4.290   41.064 -13.982 1.00 12.10 ? 31  VAL B CG1  1 
ATOM   4472 C CG2  . VAL B 1 31  ? 2.755   41.055 -11.938 1.00 9.70  ? 31  VAL B CG2  1 
ATOM   4473 H H    . VAL B 1 31  ? 2.357   37.976 -11.817 1.00 0.00  ? 31  VAL B H    1 
ATOM   4474 N N    . ARG B 1 32  ? 3.514   38.360 -15.864 1.00 9.09  ? 32  ARG B N    1 
ATOM   4475 C CA   . ARG B 1 32  ? 4.460   37.719 -16.793 1.00 7.21  ? 32  ARG B CA   1 
ATOM   4476 C C    . ARG B 1 32  ? 5.523   38.792 -17.205 1.00 7.15  ? 32  ARG B C    1 
ATOM   4477 O O    . ARG B 1 32  ? 5.144   39.890 -17.635 1.00 5.01  ? 32  ARG B O    1 
ATOM   4478 C CB   . ARG B 1 32  ? 3.758   37.266 -18.065 1.00 12.15 ? 32  ARG B CB   1 
ATOM   4479 C CG   . ARG B 1 32  ? 3.011   35.914 -17.995 1.00 15.07 ? 32  ARG B CG   1 
ATOM   4480 C CD   . ARG B 1 32  ? 3.904   34.732 -17.815 1.00 12.34 ? 32  ARG B CD   1 
ATOM   4481 N NE   . ARG B 1 32  ? 4.910   34.587 -18.870 1.00 16.00 ? 32  ARG B NE   1 
ATOM   4482 C CZ   . ARG B 1 32  ? 4.701   34.023 -20.048 1.00 16.47 ? 32  ARG B CZ   1 
ATOM   4483 N NH1  . ARG B 1 32  ? 3.513   33.547 -20.356 1.00 16.67 ? 32  ARG B NH1  1 
ATOM   4484 N NH2  . ARG B 1 32  ? 5.693   33.918 -20.909 1.00 17.60 ? 32  ARG B NH2  1 
ATOM   4485 H H    . ARG B 1 32  ? 2.771   38.898 -16.221 1.00 0.00  ? 32  ARG B H    1 
ATOM   4486 H HE   . ARG B 1 32  ? 5.813   34.928 -18.682 1.00 0.00  ? 32  ARG B HE   1 
ATOM   4487 H HH11 . ARG B 1 32  ? 2.751   33.582 -19.700 1.00 0.00  ? 32  ARG B HH11 1 
ATOM   4488 H HH12 . ARG B 1 32  ? 3.352   33.135 -21.251 1.00 0.00  ? 32  ARG B HH12 1 
ATOM   4489 H HH21 . ARG B 1 32  ? 6.599   34.288 -20.685 1.00 0.00  ? 32  ARG B HH21 1 
ATOM   4490 H HH22 . ARG B 1 32  ? 5.535   33.518 -21.820 1.00 0.00  ? 32  ARG B HH22 1 
ATOM   4491 N N    . TYR B 1 33  ? 6.826   38.445 -17.159 1.00 8.60  ? 33  TYR B N    1 
ATOM   4492 C CA   . TYR B 1 33  ? 7.882   39.401 -17.472 1.00 8.99  ? 33  TYR B CA   1 
ATOM   4493 C C    . TYR B 1 33  ? 8.965   39.039 -18.460 1.00 7.96  ? 33  TYR B C    1 
ATOM   4494 O O    . TYR B 1 33  ? 9.922   39.845 -18.652 1.00 6.45  ? 33  TYR B O    1 
ATOM   4495 C CB   . TYR B 1 33  ? 8.566   39.897 -16.201 1.00 10.77 ? 33  TYR B CB   1 
ATOM   4496 C CG   . TYR B 1 33  ? 9.399   38.839 -15.534 1.00 10.03 ? 33  TYR B CG   1 
ATOM   4497 C CD1  . TYR B 1 33  ? 10.750  38.631 -15.899 1.00 9.55  ? 33  TYR B CD1  1 
ATOM   4498 C CD2  . TYR B 1 33  ? 8.827   37.986 -14.595 1.00 5.79  ? 33  TYR B CD2  1 
ATOM   4499 C CE1  . TYR B 1 33  ? 11.484  37.560 -15.328 1.00 9.75  ? 33  TYR B CE1  1 
ATOM   4500 C CE2  . TYR B 1 33  ? 9.549   36.924 -14.023 1.00 7.39  ? 33  TYR B CE2  1 
ATOM   4501 C CZ   . TYR B 1 33  ? 10.857  36.710 -14.378 1.00 8.46  ? 33  TYR B CZ   1 
ATOM   4502 O OH   . TYR B 1 33  ? 11.543  35.696 -13.733 1.00 10.05 ? 33  TYR B OH   1 
ATOM   4503 H H    . TYR B 1 33  ? 7.058   37.531 -16.908 1.00 0.00  ? 33  TYR B H    1 
ATOM   4504 H HH   . TYR B 1 33  ? 12.468  35.717 -14.010 1.00 0.00  ? 33  TYR B HH   1 
ATOM   4505 N N    . GLN B 1 34  ? 8.867   37.841 -19.042 1.00 7.30  ? 34  GLN B N    1 
ATOM   4506 C CA   . GLN B 1 34  ? 9.832   37.378 -20.037 1.00 8.04  ? 34  GLN B CA   1 
ATOM   4507 C C    . GLN B 1 34  ? 9.265   36.240 -20.865 1.00 8.09  ? 34  GLN B C    1 
ATOM   4508 O O    . GLN B 1 34  ? 8.301   35.583 -20.432 1.00 5.40  ? 34  GLN B O    1 
ATOM   4509 C CB   . GLN B 1 34  ? 11.155  36.953 -19.393 1.00 5.47  ? 34  GLN B CB   1 
ATOM   4510 C CG   . GLN B 1 34  ? 11.105  35.766 -18.424 1.00 6.18  ? 34  GLN B CG   1 
ATOM   4511 C CD   . GLN B 1 34  ? 10.925  34.394 -19.101 1.00 8.99  ? 34  GLN B CD   1 
ATOM   4512 O OE1  . GLN B 1 34  ? 9.932   33.708 -18.869 1.00 5.19  ? 34  GLN B OE1  1 
ATOM   4513 N NE2  . GLN B 1 34  ? 11.868  34.015 -19.957 1.00 10.96 ? 34  GLN B NE2  1 
ATOM   4514 H H    . GLN B 1 34  ? 8.133   37.229 -18.816 1.00 0.00  ? 34  GLN B H    1 
ATOM   4515 H HE21 . GLN B 1 34  ? 11.769  33.155 -20.406 1.00 0.00  ? 34  GLN B HE21 1 
ATOM   4516 H HE22 . GLN B 1 34  ? 12.616  34.632 -20.097 1.00 0.00  ? 34  GLN B HE22 1 
ATOM   4517 N N    . GLY B 1 35  ? 9.846   36.041 -22.051 1.00 6.34  ? 35  GLY B N    1 
ATOM   4518 C CA   . GLY B 1 35  ? 9.445   34.962 -22.923 1.00 8.54  ? 35  GLY B CA   1 
ATOM   4519 C C    . GLY B 1 35  ? 8.319   35.323 -23.859 1.00 8.52  ? 35  GLY B C    1 
ATOM   4520 O O    . GLY B 1 35  ? 8.102   36.516 -24.128 1.00 6.80  ? 35  GLY B O    1 
ATOM   4521 H H    . GLY B 1 35  ? 10.492  36.685 -22.409 1.00 0.00  ? 35  GLY B H    1 
ATOM   4522 N N    . GLY B 1 36  ? 7.633   34.310 -24.389 1.00 11.82 ? 36  GLY B N    1 
ATOM   4523 C CA   . GLY B 1 36  ? 6.504   34.551 -25.270 1.00 13.94 ? 36  GLY B CA   1 
ATOM   4524 C C    . GLY B 1 36  ? 5.382   33.569 -24.970 1.00 18.13 ? 36  GLY B C    1 
ATOM   4525 O O    . GLY B 1 36  ? 4.968   33.360 -23.802 1.00 17.14 ? 36  GLY B O    1 
ATOM   4526 H H    . GLY B 1 36  ? 7.885   33.388 -24.156 1.00 0.00  ? 36  GLY B H    1 
ATOM   4527 N N    . HIS B 1 37  ? 4.831   33.011 -26.043 1.00 20.03 ? 37  HIS B N    1 
ATOM   4528 C CA   . HIS B 1 37  ? 3.771   31.997 -25.935 1.00 20.08 ? 37  HIS B CA   1 
ATOM   4529 C C    . HIS B 1 37  ? 4.503   30.595 -25.908 1.00 20.75 ? 37  HIS B C    1 
ATOM   4530 O O    . HIS B 1 37  ? 4.479   29.797 -26.877 1.00 17.65 ? 37  HIS B O    1 
ATOM   4531 C CB   . HIS B 1 37  ? 2.774   32.151 -27.093 1.00 15.43 ? 37  HIS B CB   1 
ATOM   4532 C CG   . HIS B 1 37  ? 3.421   32.304 -28.423 1.00 15.34 ? 37  HIS B CG   1 
ATOM   4533 N ND1  . HIS B 1 37  ? 4.339   33.296 -28.686 1.00 15.61 ? 37  HIS B ND1  1 
ATOM   4534 C CD2  . HIS B 1 37  ? 3.271   31.615 -29.578 1.00 11.04 ? 37  HIS B CD2  1 
ATOM   4535 C CE1  . HIS B 1 37  ? 4.721   33.221 -29.950 1.00 10.74 ? 37  HIS B CE1  1 
ATOM   4536 N NE2  . HIS B 1 37  ? 4.090   32.207 -30.514 1.00 7.74  ? 37  HIS B NE2  1 
ATOM   4537 H H    . HIS B 1 37  ? 5.144   33.314 -26.915 1.00 0.00  ? 37  HIS B H    1 
ATOM   4538 H HE2  . HIS B 1 37  ? 4.253   31.928 -31.439 1.00 0.00  ? 37  HIS B HE2  1 
ATOM   4539 N N    . ASN B 1 38  ? 5.205   30.368 -24.796 1.00 22.08 ? 38  ASN B N    1 
ATOM   4540 C CA   . ASN B 1 38  ? 5.974   29.142 -24.602 1.00 22.85 ? 38  ASN B CA   1 
ATOM   4541 C C    . ASN B 1 38  ? 6.101   28.785 -23.122 1.00 22.33 ? 38  ASN B C    1 
ATOM   4542 O O    . ASN B 1 38  ? 7.139   28.271 -22.698 1.00 24.30 ? 38  ASN B O    1 
ATOM   4543 C CB   . ASN B 1 38  ? 7.375   29.318 -25.200 1.00 22.73 ? 38  ASN B CB   1 
ATOM   4544 C CG   . ASN B 1 38  ? 8.216   30.330 -24.428 1.00 24.21 ? 38  ASN B CG   1 
ATOM   4545 O OD1  . ASN B 1 38  ? 7.731   30.953 -23.480 1.00 24.88 ? 38  ASN B OD1  1 
ATOM   4546 N ND2  . ASN B 1 38  ? 9.477   30.507 -24.839 1.00 16.15 ? 38  ASN B ND2  1 
ATOM   4547 H H    . ASN B 1 38  ? 5.215   31.042 -24.086 1.00 0.00  ? 38  ASN B H    1 
ATOM   4548 H HD21 . ASN B 1 38  ? 10.036  31.160 -24.362 1.00 0.00  ? 38  ASN B HD21 1 
ATOM   4549 H HD22 . ASN B 1 38  ? 9.768   29.971 -25.598 1.00 0.00  ? 38  ASN B HD22 1 
ATOM   4550 N N    . ALA B 1 39  ? 5.063   29.088 -22.341 1.00 23.75 ? 39  ALA B N    1 
ATOM   4551 C CA   . ALA B 1 39  ? 5.065   28.813 -20.909 1.00 22.87 ? 39  ALA B CA   1 
ATOM   4552 C C    . ALA B 1 39  ? 4.624   27.386 -20.614 1.00 23.85 ? 39  ALA B C    1 
ATOM   4553 O O    . ALA B 1 39  ? 5.206   26.695 -19.788 1.00 24.47 ? 39  ALA B O    1 
ATOM   4554 C CB   . ALA B 1 39  ? 4.175   29.796 -20.191 1.00 24.15 ? 39  ALA B CB   1 
ATOM   4555 H H    . ALA B 1 39  ? 4.294   29.535 -22.746 1.00 0.00  ? 39  ALA B H    1 
ATOM   4556 N N    . GLY B 1 40  ? 3.580   26.954 -21.291 1.00 24.92 ? 40  GLY B N    1 
ATOM   4557 C CA   . GLY B 1 40  ? 3.087   25.603 -21.113 1.00 27.37 ? 40  GLY B CA   1 
ATOM   4558 C C    . GLY B 1 40  ? 2.436   25.324 -19.776 1.00 29.94 ? 40  GLY B C    1 
ATOM   4559 O O    . GLY B 1 40  ? 3.010   24.601 -18.977 1.00 33.50 ? 40  GLY B O    1 
ATOM   4560 H H    . GLY B 1 40  ? 3.131   27.567 -21.898 1.00 0.00  ? 40  GLY B H    1 
ATOM   4561 N N    . HIS B 1 41  ? 1.282   25.931 -19.508 1.00 28.93 ? 41  HIS B N    1 
ATOM   4562 C CA   . HIS B 1 41  ? 0.570   25.686 -18.271 1.00 27.56 ? 41  HIS B CA   1 
ATOM   4563 C C    . HIS B 1 41  ? -0.605  24.740 -18.592 1.00 29.32 ? 41  HIS B C    1 
ATOM   4564 O O    . HIS B 1 41  ? -1.595  25.129 -19.257 1.00 26.82 ? 41  HIS B O    1 
ATOM   4565 C CB   . HIS B 1 41  ? 0.063   27.006 -17.686 1.00 29.95 ? 41  HIS B CB   1 
ATOM   4566 C CG   . HIS B 1 41  ? -0.144  26.982 -16.196 1.00 30.93 ? 41  HIS B CG   1 
ATOM   4567 N ND1  . HIS B 1 41  ? 0.810   27.435 -15.302 1.00 26.14 ? 41  HIS B ND1  1 
ATOM   4568 C CD2  . HIS B 1 41  ? -1.183  26.542 -15.446 1.00 27.05 ? 41  HIS B CD2  1 
ATOM   4569 C CE1  . HIS B 1 41  ? 0.368   27.268 -14.069 1.00 27.48 ? 41  HIS B CE1  1 
ATOM   4570 N NE2  . HIS B 1 41  ? -0.836  26.728 -14.128 1.00 27.00 ? 41  HIS B NE2  1 
ATOM   4571 H H    . HIS B 1 41  ? 0.881   26.576 -20.127 1.00 0.00  ? 41  HIS B H    1 
ATOM   4572 H HE2  . HIS B 1 41  ? -1.383  26.484 -13.338 1.00 0.00  ? 41  HIS B HE2  1 
ATOM   4573 N N    . THR B 1 42  ? -0.464  23.477 -18.172 1.00 30.18 ? 42  THR B N    1 
ATOM   4574 C CA   . THR B 1 42  ? -1.506  22.462 -18.393 1.00 27.84 ? 42  THR B CA   1 
ATOM   4575 C C    . THR B 1 42  ? -2.435  22.504 -17.189 1.00 28.59 ? 42  THR B C    1 
ATOM   4576 O O    . THR B 1 42  ? -1.997  22.240 -16.078 1.00 26.23 ? 42  THR B O    1 
ATOM   4577 C CB   . THR B 1 42  ? -0.904  21.014 -18.516 1.00 26.01 ? 42  THR B CB   1 
ATOM   4578 O OG1  . THR B 1 42  ? 0.118   20.967 -19.526 1.00 29.30 ? 42  THR B OG1  1 
ATOM   4579 C CG2  . THR B 1 42  ? -1.962  20.031 -18.908 1.00 21.78 ? 42  THR B CG2  1 
ATOM   4580 H H    . THR B 1 42  ? 0.355   23.190 -17.723 1.00 0.00  ? 42  THR B H    1 
ATOM   4581 H HG1  . THR B 1 42  ? -0.263  20.992 -20.402 1.00 0.00  ? 42  THR B HG1  1 
ATOM   4582 N N    . LEU B 1 43  ? -3.681  22.933 -17.403 1.00 31.10 ? 43  LEU B N    1 
ATOM   4583 C CA   . LEU B 1 43  ? -4.698  22.990 -16.345 1.00 31.30 ? 43  LEU B CA   1 
ATOM   4584 C C    . LEU B 1 43  ? -6.011  22.355 -16.788 1.00 33.20 ? 43  LEU B C    1 
ATOM   4585 O O    . LEU B 1 43  ? -6.221  22.101 -17.984 1.00 33.53 ? 43  LEU B O    1 
ATOM   4586 C CB   . LEU B 1 43  ? -4.941  24.420 -15.861 1.00 32.20 ? 43  LEU B CB   1 
ATOM   4587 C CG   . LEU B 1 43  ? -5.454  25.556 -16.751 1.00 32.48 ? 43  LEU B CG   1 
ATOM   4588 C CD1  . LEU B 1 43  ? -6.938  25.403 -17.107 1.00 31.77 ? 43  LEU B CD1  1 
ATOM   4589 C CD2  . LEU B 1 43  ? -5.253  26.837 -15.977 1.00 30.38 ? 43  LEU B CD2  1 
ATOM   4590 H H    . LEU B 1 43  ? -3.952  23.248 -18.293 1.00 0.00  ? 43  LEU B H    1 
ATOM   4591 N N    . VAL B 1 44  ? -6.899  22.141 -15.817 1.00 35.95 ? 44  VAL B N    1 
ATOM   4592 C CA   . VAL B 1 44  ? -8.212  21.507 -16.032 1.00 35.97 ? 44  VAL B CA   1 
ATOM   4593 C C    . VAL B 1 44  ? -9.473  22.379 -15.861 1.00 37.27 ? 44  VAL B C    1 
ATOM   4594 O O    . VAL B 1 44  ? -9.904  22.651 -14.739 1.00 37.30 ? 44  VAL B O    1 
ATOM   4595 C CB   . VAL B 1 44  ? -8.388  20.305 -15.081 1.00 33.56 ? 44  VAL B CB   1 
ATOM   4596 C CG1  . VAL B 1 44  ? -9.527  19.397 -15.578 1.00 28.01 ? 44  VAL B CG1  1 
ATOM   4597 C CG2  . VAL B 1 44  ? -7.053  19.557 -14.925 1.00 32.31 ? 44  VAL B CG2  1 
ATOM   4598 H H    . VAL B 1 44  ? -6.672  22.435 -14.907 1.00 0.00  ? 44  VAL B H    1 
ATOM   4599 N N    . ILE B 1 45  ? -10.111 22.741 -16.967 1.00 39.11 ? 45  ILE B N    1 
ATOM   4600 C CA   . ILE B 1 45  ? -11.341 23.534 -16.889 1.00 41.37 ? 45  ILE B CA   1 
ATOM   4601 C C    . ILE B 1 45  ? -12.536 22.584 -16.887 1.00 43.81 ? 45  ILE B C    1 
ATOM   4602 O O    . ILE B 1 45  ? -12.864 21.997 -17.922 1.00 44.61 ? 45  ILE B O    1 
ATOM   4603 C CB   . ILE B 1 45  ? -11.479 24.507 -18.066 1.00 39.89 ? 45  ILE B CB   1 
ATOM   4604 C CG1  . ILE B 1 45  ? -10.338 25.529 -18.023 1.00 38.13 ? 45  ILE B CG1  1 
ATOM   4605 C CG2  . ILE B 1 45  ? -12.850 25.192 -18.012 1.00 39.60 ? 45  ILE B CG2  1 
ATOM   4606 C CD1  . ILE B 1 45  ? -10.198 26.360 -19.249 1.00 36.36 ? 45  ILE B CD1  1 
ATOM   4607 H H    . ILE B 1 45  ? -9.775  22.425 -17.839 1.00 0.00  ? 45  ILE B H    1 
ATOM   4608 N N    . ASN B 1 46  ? -13.140 22.398 -15.711 1.00 45.25 ? 46  ASN B N    1 
ATOM   4609 C CA   . ASN B 1 46  ? -14.289 21.506 -15.541 1.00 45.86 ? 46  ASN B CA   1 
ATOM   4610 C C    . ASN B 1 46  ? -14.029 20.104 -16.124 1.00 47.07 ? 46  ASN B C    1 
ATOM   4611 O O    . ASN B 1 46  ? -14.827 19.597 -16.914 1.00 49.03 ? 46  ASN B O    1 
ATOM   4612 C CB   . ASN B 1 46  ? -15.546 22.106 -16.202 1.00 45.84 ? 46  ASN B CB   1 
ATOM   4613 C CG   . ASN B 1 46  ? -16.141 23.270 -15.421 1.00 46.23 ? 46  ASN B CG   1 
ATOM   4614 O OD1  . ASN B 1 46  ? -15.479 23.897 -14.591 1.00 46.20 ? 46  ASN B OD1  1 
ATOM   4615 N ND2  . ASN B 1 46  ? -17.409 23.565 -15.690 1.00 45.79 ? 46  ASN B ND2  1 
ATOM   4616 H H    . ASN B 1 46  ? -12.805 22.897 -14.936 1.00 0.00  ? 46  ASN B H    1 
ATOM   4617 H HD21 . ASN B 1 46  ? -17.835 24.274 -15.155 1.00 0.00  ? 46  ASN B HD21 1 
ATOM   4618 H HD22 . ASN B 1 46  ? -17.878 23.052 -16.374 1.00 0.00  ? 46  ASN B HD22 1 
ATOM   4619 N N    . GLY B 1 47  ? -12.898 19.493 -15.786 1.00 47.45 ? 47  GLY B N    1 
ATOM   4620 C CA   . GLY B 1 47  ? -12.620 18.157 -16.297 1.00 49.03 ? 47  GLY B CA   1 
ATOM   4621 C C    . GLY B 1 47  ? -12.152 18.050 -17.743 1.00 50.94 ? 47  GLY B C    1 
ATOM   4622 O O    . GLY B 1 47  ? -12.417 17.053 -18.421 1.00 51.84 ? 47  GLY B O    1 
ATOM   4623 H H    . GLY B 1 47  ? -12.262 19.947 -15.202 1.00 0.00  ? 47  GLY B H    1 
ATOM   4624 N N    . GLU B 1 48  ? -11.428 19.062 -18.211 1.00 51.65 ? 48  GLU B N    1 
ATOM   4625 C CA   . GLU B 1 48  ? -10.888 19.073 -19.571 1.00 51.53 ? 48  GLU B CA   1 
ATOM   4626 C C    . GLU B 1 48  ? -9.483  19.702 -19.574 1.00 50.30 ? 48  GLU B C    1 
ATOM   4627 O O    . GLU B 1 48  ? -9.305  20.828 -19.099 1.00 50.58 ? 48  GLU B O    1 
ATOM   4628 C CB   . GLU B 1 48  ? -11.815 19.861 -20.500 1.00 53.27 ? 48  GLU B CB   1 
ATOM   4629 C CG   . GLU B 1 48  ? -11.298 19.939 -21.916 1.00 54.49 ? 48  GLU B CG   1 
ATOM   4630 C CD   . GLU B 1 48  ? -11.921 21.049 -22.730 1.00 54.86 ? 48  GLU B CD   1 
ATOM   4631 O OE1  . GLU B 1 48  ? -12.920 21.656 -22.269 1.00 55.15 ? 48  GLU B OE1  1 
ATOM   4632 O OE2  . GLU B 1 48  ? -11.394 21.312 -23.844 1.00 55.03 ? 48  GLU B OE2  1 
ATOM   4633 H H    . GLU B 1 48  ? -11.266 19.856 -17.668 1.00 0.00  ? 48  GLU B H    1 
ATOM   4634 N N    . LYS B 1 49  ? -8.483  18.956 -20.041 1.00 49.11 ? 49  LYS B N    1 
ATOM   4635 C CA   . LYS B 1 49  ? -7.109  19.468 -20.099 1.00 48.08 ? 49  LYS B CA   1 
ATOM   4636 C C    . LYS B 1 49  ? -7.070  20.623 -21.107 1.00 46.64 ? 49  LYS B C    1 
ATOM   4637 O O    . LYS B 1 49  ? -7.672  20.514 -22.176 1.00 46.42 ? 49  LYS B O    1 
ATOM   4638 C CB   . LYS B 1 49  ? -6.135  18.392 -20.605 1.00 48.73 ? 49  LYS B CB   1 
ATOM   4639 C CG   . LYS B 1 49  ? -5.675  17.310 -19.625 1.00 48.13 ? 49  LYS B CG   1 
ATOM   4640 C CD   . LYS B 1 49  ? -4.732  16.306 -20.348 1.00 47.25 ? 49  LYS B CD   1 
ATOM   4641 C CE   . LYS B 1 49  ? -4.554  15.005 -19.572 1.00 47.44 ? 49  LYS B CE   1 
ATOM   4642 N NZ   . LYS B 1 49  ? -3.763  13.952 -20.294 1.00 48.36 ? 49  LYS B NZ   1 
ATOM   4643 H H    . LYS B 1 49  ? -8.691  18.075 -20.401 1.00 0.00  ? 49  LYS B H    1 
ATOM   4644 H HZ1  . LYS B 1 49  ? -4.224  13.686 -21.189 1.00 0.00  ? 49  LYS B HZ1  1 
ATOM   4645 H HZ2  . LYS B 1 49  ? -2.794  14.269 -20.493 1.00 0.00  ? 49  LYS B HZ2  1 
ATOM   4646 H HZ3  . LYS B 1 49  ? -3.713  13.090 -19.702 1.00 0.00  ? 49  LYS B HZ3  1 
ATOM   4647 N N    . THR B 1 50  ? -6.392  21.721 -20.775 1.00 43.79 ? 50  THR B N    1 
ATOM   4648 C CA   . THR B 1 50  ? -6.289  22.845 -21.704 1.00 41.64 ? 50  THR B CA   1 
ATOM   4649 C C    . THR B 1 50  ? -5.065  23.677 -21.366 1.00 40.36 ? 50  THR B C    1 
ATOM   4650 O O    . THR B 1 50  ? -5.032  24.336 -20.323 1.00 41.09 ? 50  THR B O    1 
ATOM   4651 C CB   . THR B 1 50  ? -7.512  23.789 -21.654 1.00 41.75 ? 50  THR B CB   1 
ATOM   4652 O OG1  . THR B 1 50  ? -8.734  23.040 -21.676 1.00 43.15 ? 50  THR B OG1  1 
ATOM   4653 C CG2  . THR B 1 50  ? -7.497  24.694 -22.858 1.00 39.62 ? 50  THR B CG2  1 
ATOM   4654 H H    . THR B 1 50  ? -6.059  21.824 -19.855 1.00 0.00  ? 50  THR B H    1 
ATOM   4655 H HG1  . THR B 1 50  ? -8.771  22.357 -20.996 1.00 0.00  ? 50  THR B HG1  1 
ATOM   4656 N N    . VAL B 1 51  ? -4.107  23.708 -22.293 1.00 36.97 ? 51  VAL B N    1 
ATOM   4657 C CA   . VAL B 1 51  ? -2.850  24.432 -22.121 1.00 33.54 ? 51  VAL B CA   1 
ATOM   4658 C C    . VAL B 1 51  ? -2.756  25.911 -22.478 1.00 31.58 ? 51  VAL B C    1 
ATOM   4659 O O    . VAL B 1 51  ? -2.581  26.264 -23.638 1.00 31.40 ? 51  VAL B O    1 
ATOM   4660 C CB   . VAL B 1 51  ? -1.675  23.727 -22.849 1.00 34.64 ? 51  VAL B CB   1 
ATOM   4661 C CG1  . VAL B 1 51  ? -1.083  22.656 -21.973 1.00 34.10 ? 51  VAL B CG1  1 
ATOM   4662 C CG2  . VAL B 1 51  ? -2.131  23.137 -24.196 1.00 32.84 ? 51  VAL B CG2  1 
ATOM   4663 H H    . VAL B 1 51  ? -4.288  23.234 -23.125 1.00 0.00  ? 51  VAL B H    1 
ATOM   4664 N N    . LEU B 1 52  ? -2.753  26.771 -21.467 1.00 29.77 ? 52  LEU B N    1 
ATOM   4665 C CA   . LEU B 1 52  ? -2.591  28.194 -21.709 1.00 26.47 ? 52  LEU B CA   1 
ATOM   4666 C C    . LEU B 1 52  ? -1.104  28.461 -21.809 1.00 24.27 ? 52  LEU B C    1 
ATOM   4667 O O    . LEU B 1 52  ? -0.356  28.269 -20.858 1.00 23.84 ? 52  LEU B O    1 
ATOM   4668 C CB   . LEU B 1 52  ? -3.201  29.053 -20.602 1.00 26.30 ? 52  LEU B CB   1 
ATOM   4669 C CG   . LEU B 1 52  ? -4.706  28.907 -20.491 1.00 27.58 ? 52  LEU B CG   1 
ATOM   4670 C CD1  . LEU B 1 52  ? -5.260  29.949 -19.508 1.00 27.76 ? 52  LEU B CD1  1 
ATOM   4671 C CD2  . LEU B 1 52  ? -5.323  29.063 -21.888 1.00 29.80 ? 52  LEU B CD2  1 
ATOM   4672 H H    . LEU B 1 52  ? -2.802  26.413 -20.555 1.00 0.00  ? 52  LEU B H    1 
ATOM   4673 N N    . HIS B 1 53  ? -0.709  28.878 -23.003 1.00 21.00 ? 53  HIS B N    1 
ATOM   4674 C CA   . HIS B 1 53  ? 0.650   29.198 -23.373 1.00 15.14 ? 53  HIS B CA   1 
ATOM   4675 C C    . HIS B 1 53  ? 1.091   30.666 -23.231 1.00 15.68 ? 53  HIS B C    1 
ATOM   4676 O O    . HIS B 1 53  ? 2.291   30.950 -23.312 1.00 14.72 ? 53  HIS B O    1 
ATOM   4677 C CB   . HIS B 1 53  ? 0.841   28.814 -24.836 1.00 13.09 ? 53  HIS B CB   1 
ATOM   4678 C CG   . HIS B 1 53  ? 1.017   27.345 -25.066 1.00 5.73  ? 53  HIS B CG   1 
ATOM   4679 N ND1  . HIS B 1 53  ? 2.108   26.645 -24.589 1.00 7.41  ? 53  HIS B ND1  1 
ATOM   4680 C CD2  . HIS B 1 53  ? 0.251   26.450 -25.726 1.00 5.01  ? 53  HIS B CD2  1 
ATOM   4681 C CE1  . HIS B 1 53  ? 2.010   25.377 -24.951 1.00 5.91  ? 53  HIS B CE1  1 
ATOM   4682 N NE2  . HIS B 1 53  ? 0.888   25.233 -25.638 1.00 7.47  ? 53  HIS B NE2  1 
ATOM   4683 H H    . HIS B 1 53  ? -1.415  29.020 -23.666 1.00 0.00  ? 53  HIS B H    1 
ATOM   4684 H HE2  . HIS B 1 53  ? 0.564   24.391 -26.020 1.00 0.00  ? 53  HIS B HE2  1 
ATOM   4685 N N    . LEU B 1 54  ? 0.143   31.592 -23.087 1.00 15.37 ? 54  LEU B N    1 
ATOM   4686 C CA   . LEU B 1 54  ? 0.486   33.008 -23.022 1.00 13.93 ? 54  LEU B CA   1 
ATOM   4687 C C    . LEU B 1 54  ? -0.246  33.713 -21.882 1.00 14.64 ? 54  LEU B C    1 
ATOM   4688 O O    . LEU B 1 54  ? 0.342   34.447 -21.092 1.00 14.78 ? 54  LEU B O    1 
ATOM   4689 C CB   . LEU B 1 54  ? 0.115   33.644 -24.357 1.00 12.44 ? 54  LEU B CB   1 
ATOM   4690 C CG   . LEU B 1 54  ? 0.416   35.115 -24.610 1.00 14.11 ? 54  LEU B CG   1 
ATOM   4691 C CD1  . LEU B 1 54  ? 1.911   35.313 -24.912 1.00 14.55 ? 54  LEU B CD1  1 
ATOM   4692 C CD2  . LEU B 1 54  ? -0.430  35.590 -25.796 1.00 15.82 ? 54  LEU B CD2  1 
ATOM   4693 H H    . LEU B 1 54  ? -0.810  31.354 -23.026 1.00 0.00  ? 54  LEU B H    1 
ATOM   4694 N N    . ILE B 1 55  ? -1.542  33.475 -21.787 1.00 16.59 ? 55  ILE B N    1 
ATOM   4695 C CA   . ILE B 1 55  ? -2.324  34.086 -20.728 1.00 13.86 ? 55  ILE B CA   1 
ATOM   4696 C C    . ILE B 1 55  ? -1.968  33.415 -19.435 1.00 13.50 ? 55  ILE B C    1 
ATOM   4697 O O    . ILE B 1 55  ? -1.923  32.187 -19.358 1.00 16.31 ? 55  ILE B O    1 
ATOM   4698 C CB   . ILE B 1 55  ? -3.854  34.001 -20.998 1.00 9.19  ? 55  ILE B CB   1 
ATOM   4699 C CG1  . ILE B 1 55  ? -4.228  35.031 -22.079 1.00 8.52  ? 55  ILE B CG1  1 
ATOM   4700 C CG2  . ILE B 1 55  ? -4.620  34.389 -19.748 1.00 5.94  ? 55  ILE B CG2  1 
ATOM   4701 C CD1  . ILE B 1 55  ? -5.655  34.991 -22.580 1.00 5.52  ? 55  ILE B CD1  1 
ATOM   4702 H H    . ILE B 1 55  ? -2.004  32.910 -22.462 1.00 0.00  ? 55  ILE B H    1 
ATOM   4703 N N    . PRO B 1 56  ? -1.612  34.204 -18.417 1.00 13.01 ? 56  PRO B N    1 
ATOM   4704 C CA   . PRO B 1 56  ? -1.259  33.635 -17.101 1.00 13.44 ? 56  PRO B CA   1 
ATOM   4705 C C    . PRO B 1 56  ? -2.484  32.886 -16.520 1.00 12.77 ? 56  PRO B C    1 
ATOM   4706 O O    . PRO B 1 56  ? -3.655  33.299 -16.711 1.00 11.67 ? 56  PRO B O    1 
ATOM   4707 C CB   . PRO B 1 56  ? -0.945  34.882 -16.259 1.00 13.57 ? 56  PRO B CB   1 
ATOM   4708 C CG   . PRO B 1 56  ? -0.462  35.835 -17.274 1.00 15.46 ? 56  PRO B CG   1 
ATOM   4709 C CD   . PRO B 1 56  ? -1.449  35.659 -18.417 1.00 12.13 ? 56  PRO B CD   1 
ATOM   4710 N N    . SER B 1 57  ? -2.189  31.808 -15.805 1.00 12.17 ? 57  SER B N    1 
ATOM   4711 C CA   . SER B 1 57  ? -3.176  30.949 -15.161 1.00 13.27 ? 57  SER B CA   1 
ATOM   4712 C C    . SER B 1 57  ? -3.986  31.640 -14.054 1.00 15.80 ? 57  SER B C    1 
ATOM   4713 O O    . SER B 1 57  ? -4.959  31.071 -13.524 1.00 17.03 ? 57  SER B O    1 
ATOM   4714 C CB   . SER B 1 57  ? -2.458  29.735 -14.562 1.00 14.04 ? 57  SER B CB   1 
ATOM   4715 O OG   . SER B 1 57  ? -1.848  30.047 -13.310 1.00 10.85 ? 57  SER B OG   1 
ATOM   4716 H H    . SER B 1 57  ? -1.245  31.582 -15.674 1.00 0.00  ? 57  SER B H    1 
ATOM   4717 H HG   . SER B 1 57  ? -1.819  29.249 -12.732 1.00 0.00  ? 57  SER B HG   1 
ATOM   4718 N N    . GLY B 1 58  ? -3.535  32.829 -13.651 1.00 16.97 ? 58  GLY B N    1 
ATOM   4719 C CA   . GLY B 1 58  ? -4.222  33.567 -12.607 1.00 18.83 ? 58  GLY B CA   1 
ATOM   4720 C C    . GLY B 1 58  ? -5.590  33.996 -13.073 1.00 18.76 ? 58  GLY B C    1 
ATOM   4721 O O    . GLY B 1 58  ? -6.488  34.218 -12.267 1.00 21.38 ? 58  GLY B O    1 
ATOM   4722 H H    . GLY B 1 58  ? -2.715  33.202 -14.022 1.00 0.00  ? 58  GLY B H    1 
ATOM   4723 N N    . ILE B 1 59  ? -5.734  34.073 -14.393 1.00 18.82 ? 59  ILE B N    1 
ATOM   4724 C CA   . ILE B 1 59  ? -6.958  34.472 -15.089 1.00 15.71 ? 59  ILE B CA   1 
ATOM   4725 C C    . ILE B 1 59  ? -8.211  33.694 -14.638 1.00 18.01 ? 59  ILE B C    1 
ATOM   4726 O O    . ILE B 1 59  ? -9.357  34.160 -14.880 1.00 15.12 ? 59  ILE B O    1 
ATOM   4727 C CB   . ILE B 1 59  ? -6.758  34.244 -16.589 1.00 11.47 ? 59  ILE B CB   1 
ATOM   4728 C CG1  . ILE B 1 59  ? -7.936  34.741 -17.400 1.00 5.77  ? 59  ILE B CG1  1 
ATOM   4729 C CG2  . ILE B 1 59  ? -6.560  32.788 -16.855 1.00 13.26 ? 59  ILE B CG2  1 
ATOM   4730 C CD1  . ILE B 1 59  ? -8.099  36.198 -17.314 1.00 5.01  ? 59  ILE B CD1  1 
ATOM   4731 H H    . ILE B 1 59  ? -4.961  33.879 -14.966 1.00 0.00  ? 59  ILE B H    1 
ATOM   4732 N N    . LEU B 1 60  ? -7.977  32.470 -14.113 1.00 19.59 ? 60  LEU B N    1 
ATOM   4733 C CA   . LEU B 1 60  ? -9.037  31.569 -13.650 1.00 24.13 ? 60  LEU B CA   1 
ATOM   4734 C C    . LEU B 1 60  ? -9.669  32.100 -12.376 1.00 24.74 ? 60  LEU B C    1 
ATOM   4735 O O    . LEU B 1 60  ? -10.883 32.089 -12.217 1.00 22.52 ? 60  LEU B O    1 
ATOM   4736 C CB   . LEU B 1 60  ? -8.489  30.168 -13.370 1.00 26.47 ? 60  LEU B CB   1 
ATOM   4737 C CG   . LEU B 1 60  ? -8.064  29.147 -14.450 1.00 26.64 ? 60  LEU B CG   1 
ATOM   4738 C CD1  . LEU B 1 60  ? -7.156  28.084 -13.780 1.00 23.03 ? 60  LEU B CD1  1 
ATOM   4739 C CD2  . LEU B 1 60  ? -9.282  28.499 -15.105 1.00 26.52 ? 60  LEU B CD2  1 
ATOM   4740 H H    . LEU B 1 60  ? -7.051  32.157 -14.032 1.00 0.00  ? 60  LEU B H    1 
ATOM   4741 N N    . ARG B 1 61  ? -8.824  32.611 -11.491 1.00 27.80 ? 61  ARG B N    1 
ATOM   4742 C CA   . ARG B 1 61  ? -9.278  33.139 -10.213 1.00 28.27 ? 61  ARG B CA   1 
ATOM   4743 C C    . ARG B 1 61  ? -10.031 34.464 -10.395 1.00 26.58 ? 61  ARG B C    1 
ATOM   4744 O O    . ARG B 1 61  ? -9.740  35.224 -11.321 1.00 24.71 ? 61  ARG B O    1 
ATOM   4745 C CB   . ARG B 1 61  ? -8.083  33.304 -9.295  1.00 27.73 ? 61  ARG B CB   1 
ATOM   4746 C CG   . ARG B 1 61  ? -7.150  32.140 -9.385  1.00 32.00 ? 61  ARG B CG   1 
ATOM   4747 C CD   . ARG B 1 61  ? -6.916  31.420 -8.044  1.00 32.40 ? 61  ARG B CD   1 
ATOM   4748 N NE   . ARG B 1 61  ? -7.806  30.277 -7.880  1.00 33.83 ? 61  ARG B NE   1 
ATOM   4749 C CZ   . ARG B 1 61  ? -8.980  30.335 -7.261  1.00 35.92 ? 61  ARG B CZ   1 
ATOM   4750 N NH1  . ARG B 1 61  ? -9.406  31.480 -6.736  1.00 35.69 ? 61  ARG B NH1  1 
ATOM   4751 N NH2  . ARG B 1 61  ? -9.725  29.249 -7.170  1.00 32.38 ? 61  ARG B NH2  1 
ATOM   4752 H H    . ARG B 1 61  ? -7.883  32.707 -11.735 1.00 0.00  ? 61  ARG B H    1 
ATOM   4753 H HE   . ARG B 1 61  ? -7.512  29.418 -8.258  1.00 0.00  ? 61  ARG B HE   1 
ATOM   4754 H HH11 . ARG B 1 61  ? -8.852  32.319 -6.777  1.00 0.00  ? 61  ARG B HH11 1 
ATOM   4755 H HH12 . ARG B 1 61  ? -10.293 31.541 -6.271  1.00 0.00  ? 61  ARG B HH12 1 
ATOM   4756 H HH21 . ARG B 1 61  ? -9.444  28.360 -7.548  1.00 0.00  ? 61  ARG B HH21 1 
ATOM   4757 H HH22 . ARG B 1 61  ? -10.627 29.233 -6.716  1.00 0.00  ? 61  ARG B HH22 1 
ATOM   4758 N N    . GLU B 1 62  ? -11.011 34.716 -9.540  1.00 25.97 ? 62  GLU B N    1 
ATOM   4759 C CA   . GLU B 1 62  ? -11.780 35.935 -9.647  1.00 25.90 ? 62  GLU B CA   1 
ATOM   4760 C C    . GLU B 1 62  ? -11.108 37.169 -9.046  1.00 25.63 ? 62  GLU B C    1 
ATOM   4761 O O    . GLU B 1 62  ? -10.988 38.164 -9.732  1.00 25.70 ? 62  GLU B O    1 
ATOM   4762 C CB   . GLU B 1 62  ? -13.220 35.760 -9.120  1.00 28.56 ? 62  GLU B CB   1 
ATOM   4763 C CG   . GLU B 1 62  ? -13.385 35.685 -7.598  1.00 32.62 ? 62  GLU B CG   1 
ATOM   4764 C CD   . GLU B 1 62  ? -12.985 34.340 -7.020  1.00 35.57 ? 62  GLU B CD   1 
ATOM   4765 O OE1  . GLU B 1 62  ? -13.481 33.326 -7.562  1.00 35.26 ? 62  GLU B OE1  1 
ATOM   4766 O OE2  . GLU B 1 62  ? -12.175 34.295 -6.049  1.00 36.69 ? 62  GLU B OE2  1 
ATOM   4767 H H    . GLU B 1 62  ? -11.240 34.072 -8.837  1.00 0.00  ? 62  GLU B H    1 
ATOM   4768 N N    . ASN B 1 63  ? -10.593 37.083 -7.822  1.00 25.85 ? 63  ASN B N    1 
ATOM   4769 C CA   . ASN B 1 63  ? -9.964  38.232 -7.173  1.00 27.10 ? 63  ASN B CA   1 
ATOM   4770 C C    . ASN B 1 63  ? -8.544  38.594 -7.709  1.00 25.86 ? 63  ASN B C    1 
ATOM   4771 O O    . ASN B 1 63  ? -7.773  39.346 -7.086  1.00 22.45 ? 63  ASN B O    1 
ATOM   4772 C CB   . ASN B 1 63  ? -9.964  38.030 -5.646  1.00 31.63 ? 63  ASN B CB   1 
ATOM   4773 C CG   . ASN B 1 63  ? -11.377 38.011 -5.052  1.00 36.07 ? 63  ASN B CG   1 
ATOM   4774 O OD1  . ASN B 1 63  ? -12.372 38.202 -5.769  1.00 40.11 ? 63  ASN B OD1  1 
ATOM   4775 N ND2  . ASN B 1 63  ? -11.472 37.799 -3.736  1.00 36.00 ? 63  ASN B ND2  1 
ATOM   4776 H H    . ASN B 1 63  ? -10.672 36.235 -7.340  1.00 0.00  ? 63  ASN B H    1 
ATOM   4777 H HD21 . ASN B 1 63  ? -12.366 37.778 -3.348  1.00 0.00  ? 63  ASN B HD21 1 
ATOM   4778 H HD22 . ASN B 1 63  ? -10.668 37.645 -3.199  1.00 0.00  ? 63  ASN B HD22 1 
ATOM   4779 N N    . VAL B 1 64  ? -8.231  38.081 -8.894  1.00 23.89 ? 64  VAL B N    1 
ATOM   4780 C CA   . VAL B 1 64  ? -6.959  38.343 -9.528  1.00 20.51 ? 64  VAL B CA   1 
ATOM   4781 C C    . VAL B 1 64  ? -7.023  39.115 -10.828 1.00 19.18 ? 64  VAL B C    1 
ATOM   4782 O O    . VAL B 1 64  ? -8.043  39.132 -11.546 1.00 17.81 ? 64  VAL B O    1 
ATOM   4783 C CB   . VAL B 1 64  ? -6.163  37.045 -9.737  1.00 18.82 ? 64  VAL B CB   1 
ATOM   4784 C CG1  . VAL B 1 64  ? -4.933  37.255 -10.615 1.00 10.20 ? 64  VAL B CG1  1 
ATOM   4785 C CG2  . VAL B 1 64  ? -5.726  36.541 -8.371  1.00 22.23 ? 64  VAL B CG2  1 
ATOM   4786 H H    . VAL B 1 64  ? -8.874  37.562 -9.404  1.00 0.00  ? 64  VAL B H    1 
ATOM   4787 N N    . THR B 1 65  ? -5.889  39.767 -11.078 1.00 18.95 ? 65  THR B N    1 
ATOM   4788 C CA   . THR B 1 65  ? -5.600  40.555 -12.248 1.00 18.54 ? 65  THR B CA   1 
ATOM   4789 C C    . THR B 1 65  ? -4.277  40.046 -12.843 1.00 17.75 ? 65  THR B C    1 
ATOM   4790 O O    . THR B 1 65  ? -3.247  39.962 -12.143 1.00 14.74 ? 65  THR B O    1 
ATOM   4791 C CB   . THR B 1 65  ? -5.475  42.021 -11.859 1.00 20.25 ? 65  THR B CB   1 
ATOM   4792 O OG1  . THR B 1 65  ? -6.791  42.526 -11.553 1.00 25.16 ? 65  THR B OG1  1 
ATOM   4793 C CG2  . THR B 1 65  ? -4.849  42.819 -12.984 1.00 19.63 ? 65  THR B CG2  1 
ATOM   4794 H H    . THR B 1 65  ? -5.203  39.749 -10.380 1.00 0.00  ? 65  THR B H    1 
ATOM   4795 H HG1  . THR B 1 65  ? -7.282  41.978 -10.914 1.00 0.00  ? 65  THR B HG1  1 
ATOM   4796 N N    . SER B 1 66  ? -4.322  39.657 -14.114 1.00 13.99 ? 66  SER B N    1 
ATOM   4797 C CA   . SER B 1 66  ? -3.123  39.178 -14.781 1.00 13.11 ? 66  SER B CA   1 
ATOM   4798 C C    . SER B 1 66  ? -2.557  40.268 -15.690 1.00 13.88 ? 66  SER B C    1 
ATOM   4799 O O    . SER B 1 66  ? -3.282  40.947 -16.434 1.00 14.11 ? 66  SER B O    1 
ATOM   4800 C CB   . SER B 1 66  ? -3.398  37.862 -15.508 1.00 12.55 ? 66  SER B CB   1 
ATOM   4801 O OG   . SER B 1 66  ? -3.965  36.948 -14.573 1.00 11.98 ? 66  SER B OG   1 
ATOM   4802 H H    . SER B 1 66  ? -5.173  39.744 -14.604 1.00 0.00  ? 66  SER B H    1 
ATOM   4803 H HG   . SER B 1 66  ? -4.826  37.307 -14.296 1.00 0.00  ? 66  SER B HG   1 
ATOM   4804 N N    . ILE B 1 67  ? -1.250  40.437 -15.612 1.00 13.40 ? 67  ILE B N    1 
ATOM   4805 C CA   . ILE B 1 67  ? -0.573  41.488 -16.352 1.00 11.99 ? 67  ILE B CA   1 
ATOM   4806 C C    . ILE B 1 67  ? 0.508   40.886 -17.266 1.00 13.14 ? 67  ILE B C    1 
ATOM   4807 O O    . ILE B 1 67  ? 1.213   39.960 -16.851 1.00 11.63 ? 67  ILE B O    1 
ATOM   4808 C CB   . ILE B 1 67  ? 0.094   42.454 -15.334 1.00 9.06  ? 67  ILE B CB   1 
ATOM   4809 C CG1  . ILE B 1 67  ? -0.915  43.004 -14.366 1.00 12.88 ? 67  ILE B CG1  1 
ATOM   4810 C CG2  . ILE B 1 67  ? 0.705   43.611 -16.018 1.00 12.24 ? 67  ILE B CG2  1 
ATOM   4811 C CD1  . ILE B 1 67  ? -0.328  43.234 -13.007 1.00 11.93 ? 67  ILE B CD1  1 
ATOM   4812 H H    . ILE B 1 67  ? -0.740  39.865 -14.992 1.00 0.00  ? 67  ILE B H    1 
ATOM   4813 N N    . ILE B 1 68  ? 0.615   41.381 -18.503 1.00 12.66 ? 68  ILE B N    1 
ATOM   4814 C CA   . ILE B 1 68  ? 1.646   40.880 -19.412 1.00 11.87 ? 68  ILE B CA   1 
ATOM   4815 C C    . ILE B 1 68  ? 2.668   42.012 -19.401 1.00 10.84 ? 68  ILE B C    1 
ATOM   4816 O O    . ILE B 1 68  ? 2.396   43.068 -19.908 1.00 8.67  ? 68  ILE B O    1 
ATOM   4817 C CB   . ILE B 1 68  ? 1.065   40.606 -20.863 1.00 13.73 ? 68  ILE B CB   1 
ATOM   4818 C CG1  . ILE B 1 68  ? -0.225  39.765 -20.753 1.00 20.87 ? 68  ILE B CG1  1 
ATOM   4819 C CG2  . ILE B 1 68  ? 2.028   39.755 -21.695 1.00 14.00 ? 68  ILE B CG2  1 
ATOM   4820 C CD1  . ILE B 1 68  ? -0.657  39.032 -22.049 1.00 24.05 ? 68  ILE B CD1  1 
ATOM   4821 H H    . ILE B 1 68  ? -0.035  42.060 -18.790 1.00 0.00  ? 68  ILE B H    1 
ATOM   4822 N N    . GLY B 1 69  ? 3.760   41.839 -18.658 1.00 12.89 ? 69  GLY B N    1 
ATOM   4823 C CA   . GLY B 1 69  ? 4.786   42.865 -18.561 1.00 11.05 ? 69  GLY B CA   1 
ATOM   4824 C C    . GLY B 1 69  ? 5.390   43.166 -19.916 1.00 12.40 ? 69  GLY B C    1 
ATOM   4825 O O    . GLY B 1 69  ? 5.273   42.360 -20.854 1.00 13.99 ? 69  GLY B O    1 
ATOM   4826 H H    . GLY B 1 69  ? 3.971   40.997 -18.197 1.00 0.00  ? 69  GLY B H    1 
ATOM   4827 N N    . ASN B 1 70  ? 6.046   44.315 -20.030 1.00 9.43  ? 70  ASN B N    1 
ATOM   4828 C CA   . ASN B 1 70  ? 6.669   44.713 -21.271 1.00 8.87  ? 70  ASN B CA   1 
ATOM   4829 C C    . ASN B 1 70  ? 7.708   43.731 -21.817 1.00 8.18  ? 70  ASN B C    1 
ATOM   4830 O O    . ASN B 1 70  ? 8.075   43.843 -22.969 1.00 8.45  ? 70  ASN B O    1 
ATOM   4831 C CB   . ASN B 1 70  ? 7.302   46.092 -21.109 1.00 5.27  ? 70  ASN B CB   1 
ATOM   4832 C CG   . ASN B 1 70  ? 8.376   46.092 -20.076 1.00 10.86 ? 70  ASN B CG   1 
ATOM   4833 O OD1  . ASN B 1 70  ? 8.095   45.905 -18.921 1.00 9.23  ? 70  ASN B OD1  1 
ATOM   4834 N ND2  . ASN B 1 70  ? 9.624   46.182 -20.495 1.00 6.36  ? 70  ASN B ND2  1 
ATOM   4835 H H    . ASN B 1 70  ? 6.098   44.918 -19.257 1.00 0.00  ? 70  ASN B H    1 
ATOM   4836 H HD21 . ASN B 1 70  ? 10.359  46.154 -19.845 1.00 0.00  ? 70  ASN B HD21 1 
ATOM   4837 H HD22 . ASN B 1 70  ? 9.794   46.271 -21.465 1.00 0.00  ? 70  ASN B HD22 1 
ATOM   4838 N N    . GLY B 1 71  ? 8.194   42.790 -21.000 1.00 11.44 ? 71  GLY B N    1 
ATOM   4839 C CA   . GLY B 1 71  ? 9.218   41.850 -21.455 1.00 10.81 ? 71  GLY B CA   1 
ATOM   4840 C C    . GLY B 1 71  ? 8.759   40.605 -22.219 1.00 12.05 ? 71  GLY B C    1 
ATOM   4841 O O    . GLY B 1 71  ? 9.578   39.886 -22.815 1.00 14.45 ? 71  GLY B O    1 
ATOM   4842 H H    . GLY B 1 71  ? 7.860   42.723 -20.079 1.00 0.00  ? 71  GLY B H    1 
ATOM   4843 N N    . VAL B 1 72  ? 7.473   40.301 -22.143 1.00 14.96 ? 72  VAL B N    1 
ATOM   4844 C CA   . VAL B 1 72  ? 6.902   39.156 -22.825 1.00 16.76 ? 72  VAL B CA   1 
ATOM   4845 C C    . VAL B 1 72  ? 6.843   39.594 -24.292 1.00 16.11 ? 72  VAL B C    1 
ATOM   4846 O O    . VAL B 1 72  ? 6.711   40.773 -24.542 1.00 16.05 ? 72  VAL B O    1 
ATOM   4847 C CB   . VAL B 1 72  ? 5.443   38.955 -22.335 1.00 19.03 ? 72  VAL B CB   1 
ATOM   4848 C CG1  . VAL B 1 72  ? 4.781   37.712 -22.972 1.00 19.11 ? 72  VAL B CG1  1 
ATOM   4849 C CG2  . VAL B 1 72  ? 5.414   38.866 -20.877 1.00 17.96 ? 72  VAL B CG2  1 
ATOM   4850 H H    . VAL B 1 72  ? 6.865   40.917 -21.681 1.00 0.00  ? 72  VAL B H    1 
ATOM   4851 N N    . VAL B 1 73  ? 6.976   38.674 -25.251 1.00 16.63 ? 73  VAL B N    1 
ATOM   4852 C CA   . VAL B 1 73  ? 6.860   39.047 -26.670 1.00 16.28 ? 73  VAL B CA   1 
ATOM   4853 C C    . VAL B 1 73  ? 5.444   38.645 -27.092 1.00 15.04 ? 73  VAL B C    1 
ATOM   4854 O O    . VAL B 1 73  ? 4.987   37.524 -26.824 1.00 14.92 ? 73  VAL B O    1 
ATOM   4855 C CB   . VAL B 1 73  ? 7.996   38.472 -27.502 1.00 17.14 ? 73  VAL B CB   1 
ATOM   4856 C CG1  . VAL B 1 73  ? 9.165   39.428 -27.436 1.00 12.63 ? 73  VAL B CG1  1 
ATOM   4857 C CG2  . VAL B 1 73  ? 8.467   37.170 -26.905 1.00 16.16 ? 73  VAL B CG2  1 
ATOM   4858 H H    . VAL B 1 73  ? 7.199   37.765 -24.945 1.00 0.00  ? 73  VAL B H    1 
ATOM   4859 N N    . LEU B 1 74  ? 4.725   39.571 -27.712 1.00 12.80 ? 74  LEU B N    1 
ATOM   4860 C CA   . LEU B 1 74  ? 3.311   39.352 -27.987 1.00 15.63 ? 74  LEU B CA   1 
ATOM   4861 C C    . LEU B 1 74  ? 2.856   39.014 -29.370 1.00 13.69 ? 74  LEU B C    1 
ATOM   4862 O O    . LEU B 1 74  ? 2.987   39.845 -30.274 1.00 17.17 ? 74  LEU B O    1 
ATOM   4863 C CB   . LEU B 1 74  ? 2.529   40.607 -27.525 1.00 14.31 ? 74  LEU B CB   1 
ATOM   4864 C CG   . LEU B 1 74  ? 1.130   40.541 -26.902 1.00 15.63 ? 74  LEU B CG   1 
ATOM   4865 C CD1  . LEU B 1 74  ? 1.178   41.009 -25.455 1.00 11.60 ? 74  LEU B CD1  1 
ATOM   4866 C CD2  . LEU B 1 74  ? 0.174   41.425 -27.734 1.00 17.29 ? 74  LEU B CD2  1 
ATOM   4867 H H    . LEU B 1 74  ? 5.111   40.432 -28.015 1.00 0.00  ? 74  LEU B H    1 
ATOM   4868 N N    . SER B 1 75  ? 2.166   37.879 -29.514 1.00 13.30 ? 75  SER B N    1 
ATOM   4869 C CA   . SER B 1 75  ? 1.630   37.478 -30.825 1.00 12.37 ? 75  SER B CA   1 
ATOM   4870 C C    . SER B 1 75  ? 0.121   37.607 -30.788 1.00 8.76  ? 75  SER B C    1 
ATOM   4871 O O    . SER B 1 75  ? -0.536  36.977 -29.953 1.00 10.85 ? 75  SER B O    1 
ATOM   4872 C CB   . SER B 1 75  ? 2.030   36.056 -31.143 1.00 11.52 ? 75  SER B CB   1 
ATOM   4873 O OG   . SER B 1 75  ? 1.842   35.764 -32.504 1.00 12.38 ? 75  SER B OG   1 
ATOM   4874 H H    . SER B 1 75  ? 1.998   37.295 -28.748 1.00 0.00  ? 75  SER B H    1 
ATOM   4875 H HG   . SER B 1 75  ? 2.312   36.434 -33.038 1.00 0.00  ? 75  SER B HG   1 
ATOM   4876 N N    . PRO B 1 76  ? -0.454  38.508 -31.608 1.00 8.99  ? 76  PRO B N    1 
ATOM   4877 C CA   . PRO B 1 76  ? -1.914  38.653 -31.586 1.00 6.20  ? 76  PRO B CA   1 
ATOM   4878 C C    . PRO B 1 76  ? -2.721  37.386 -31.803 1.00 7.24  ? 76  PRO B C    1 
ATOM   4879 O O    . PRO B 1 76  ? -3.731  37.174 -31.125 1.00 10.65 ? 76  PRO B O    1 
ATOM   4880 C CB   . PRO B 1 76  ? -2.177  39.718 -32.653 1.00 5.01  ? 76  PRO B CB   1 
ATOM   4881 C CG   . PRO B 1 76  ? -1.118  40.671 -32.405 1.00 5.01  ? 76  PRO B CG   1 
ATOM   4882 C CD   . PRO B 1 76  ? 0.155   39.709 -32.218 1.00 8.59  ? 76  PRO B CD   1 
ATOM   4883 N N    . ALA B 1 77  ? -2.273  36.520 -32.701 1.00 9.45  ? 77  ALA B N    1 
ATOM   4884 C CA   . ALA B 1 77  ? -3.026  35.299 -32.981 1.00 13.29 ? 77  ALA B CA   1 
ATOM   4885 C C    . ALA B 1 77  ? -3.102  34.298 -31.817 1.00 14.45 ? 77  ALA B C    1 
ATOM   4886 O O    . ALA B 1 77  ? -4.093  33.616 -31.675 1.00 16.74 ? 77  ALA B O    1 
ATOM   4887 C CB   . ALA B 1 77  ? -2.510  34.647 -34.219 1.00 17.00 ? 77  ALA B CB   1 
ATOM   4888 H H    . ALA B 1 77  ? -1.430  36.694 -33.161 1.00 0.00  ? 77  ALA B H    1 
ATOM   4889 N N    . ALA B 1 78  ? -2.076  34.259 -30.965 1.00 17.16 ? 78  ALA B N    1 
ATOM   4890 C CA   . ALA B 1 78  ? -2.026  33.370 -29.802 1.00 16.74 ? 78  ALA B CA   1 
ATOM   4891 C C    . ALA B 1 78  ? -3.053  33.858 -28.784 1.00 17.59 ? 78  ALA B C    1 
ATOM   4892 O O    . ALA B 1 78  ? -3.998  33.122 -28.405 1.00 15.67 ? 78  ALA B O    1 
ATOM   4893 C CB   . ALA B 1 78  ? -0.646  33.399 -29.178 1.00 13.84 ? 78  ALA B CB   1 
ATOM   4894 H H    . ALA B 1 78  ? -1.314  34.849 -31.133 1.00 0.00  ? 78  ALA B H    1 
ATOM   4895 N N    . LEU B 1 79  ? -2.841  35.099 -28.325 1.00 17.09 ? 79  LEU B N    1 
ATOM   4896 C CA   . LEU B 1 79  ? -3.754  35.724 -27.361 1.00 17.96 ? 79  LEU B CA   1 
ATOM   4897 C C    . LEU B 1 79  ? -5.205  35.663 -27.876 1.00 18.72 ? 79  LEU B C    1 
ATOM   4898 O O    . LEU B 1 79  ? -6.119  35.274 -27.129 1.00 20.19 ? 79  LEU B O    1 
ATOM   4899 C CB   . LEU B 1 79  ? -3.365  37.179 -27.067 1.00 12.74 ? 79  LEU B CB   1 
ATOM   4900 C CG   . LEU B 1 79  ? -4.233  37.638 -25.895 1.00 14.81 ? 79  LEU B CG   1 
ATOM   4901 C CD1  . LEU B 1 79  ? -3.462  37.580 -24.582 1.00 15.12 ? 79  LEU B CD1  1 
ATOM   4902 C CD2  . LEU B 1 79  ? -4.773  39.017 -26.159 1.00 14.66 ? 79  LEU B CD2  1 
ATOM   4903 H H    . LEU B 1 79  ? -2.075  35.611 -28.663 1.00 0.00  ? 79  LEU B H    1 
ATOM   4904 N N    . MET B 1 80  ? -5.434  36.031 -29.139 1.00 20.87 ? 80  MET B N    1 
ATOM   4905 C CA   . MET B 1 80  ? -6.804  35.963 -29.674 1.00 21.04 ? 80  MET B CA   1 
ATOM   4906 C C    . MET B 1 80  ? -7.317  34.547 -29.529 1.00 17.82 ? 80  MET B C    1 
ATOM   4907 O O    . MET B 1 80  ? -8.330  34.342 -28.899 1.00 15.21 ? 80  MET B O    1 
ATOM   4908 C CB   . MET B 1 80  ? -6.877  36.426 -31.118 1.00 22.86 ? 80  MET B CB   1 
ATOM   4909 C CG   . MET B 1 80  ? -6.810  37.912 -31.260 1.00 27.35 ? 80  MET B CG   1 
ATOM   4910 S SD   . MET B 1 80  ? -7.700  38.710 -29.912 1.00 28.12 ? 80  MET B SD   1 
ATOM   4911 C CE   . MET B 1 80  ? -9.328  38.877 -30.617 1.00 32.75 ? 80  MET B CE   1 
ATOM   4912 H H    . MET B 1 80  ? -4.729  36.383 -29.724 1.00 0.00  ? 80  MET B H    1 
ATOM   4913 N N    . LYS B 1 81  ? -6.539  33.572 -30.008 1.00 18.59 ? 81  LYS B N    1 
ATOM   4914 C CA   . LYS B 1 81  ? -6.890  32.160 -29.873 1.00 19.34 ? 81  LYS B CA   1 
ATOM   4915 C C    . LYS B 1 81  ? -7.198  31.701 -28.416 1.00 18.63 ? 81  LYS B C    1 
ATOM   4916 O O    . LYS B 1 81  ? -8.175  30.974 -28.208 1.00 16.05 ? 81  LYS B O    1 
ATOM   4917 C CB   . LYS B 1 81  ? -5.789  31.279 -30.502 1.00 22.13 ? 81  LYS B CB   1 
ATOM   4918 C CG   . LYS B 1 81  ? -5.392  30.002 -29.708 1.00 27.87 ? 81  LYS B CG   1 
ATOM   4919 C CD   . LYS B 1 81  ? -4.096  30.214 -28.860 1.00 28.16 ? 81  LYS B CD   1 
ATOM   4920 C CE   . LYS B 1 81  ? -3.601  28.908 -28.233 1.00 32.86 ? 81  LYS B CE   1 
ATOM   4921 N NZ   . LYS B 1 81  ? -2.224  28.988 -27.623 1.00 37.25 ? 81  LYS B NZ   1 
ATOM   4922 H H    . LYS B 1 81  ? -5.704  33.767 -30.486 1.00 0.00  ? 81  LYS B H    1 
ATOM   4923 H HZ1  . LYS B 1 81  ? -1.530  29.241 -28.351 1.00 0.00  ? 81  LYS B HZ1  1 
ATOM   4924 H HZ2  . LYS B 1 81  ? -2.231  29.682 -26.840 1.00 0.00  ? 81  LYS B HZ2  1 
ATOM   4925 H HZ3  . LYS B 1 81  ? -2.027  28.047 -27.232 1.00 0.00  ? 81  LYS B HZ3  1 
ATOM   4926 N N    . GLU B 1 82  ? -6.384  32.127 -27.431 1.00 17.40 ? 82  GLU B N    1 
ATOM   4927 C CA   . GLU B 1 82  ? -6.577  31.766 -26.009 1.00 17.19 ? 82  GLU B CA   1 
ATOM   4928 C C    . GLU B 1 82  ? -7.814  32.401 -25.356 1.00 18.37 ? 82  GLU B C    1 
ATOM   4929 O O    . GLU B 1 82  ? -8.456  31.791 -24.480 1.00 14.74 ? 82  GLU B O    1 
ATOM   4930 C CB   . GLU B 1 82  ? -5.347  32.149 -25.182 1.00 17.72 ? 82  GLU B CB   1 
ATOM   4931 C CG   . GLU B 1 82  ? -4.641  31.014 -24.500 1.00 17.13 ? 82  GLU B CG   1 
ATOM   4932 C CD   . GLU B 1 82  ? -3.145  31.244 -24.365 1.00 20.36 ? 82  GLU B CD   1 
ATOM   4933 O OE1  . GLU B 1 82  ? -2.749  32.129 -23.587 1.00 21.88 ? 82  GLU B OE1  1 
ATOM   4934 O OE2  . GLU B 1 82  ? -2.345  30.538 -25.037 1.00 23.44 ? 82  GLU B OE2  1 
ATOM   4935 H H    . GLU B 1 82  ? -5.590  32.653 -27.694 1.00 0.00  ? 82  GLU B H    1 
ATOM   4936 N N    . MET B 1 83  ? -8.109  33.653 -25.736 1.00 20.25 ? 83  MET B N    1 
ATOM   4937 C CA   . MET B 1 83  ? -9.267  34.402 -25.197 1.00 19.49 ? 83  MET B CA   1 
ATOM   4938 C C    . MET B 1 83  ? -10.569 33.727 -25.576 1.00 20.86 ? 83  MET B C    1 
ATOM   4939 O O    . MET B 1 83  ? -11.392 33.439 -24.745 1.00 21.80 ? 83  MET B O    1 
ATOM   4940 C CB   . MET B 1 83  ? -9.283  35.841 -25.725 1.00 16.74 ? 83  MET B CB   1 
ATOM   4941 C CG   . MET B 1 83  ? -8.049  36.680 -25.384 1.00 11.62 ? 83  MET B CG   1 
ATOM   4942 S SD   . MET B 1 83  ? -8.402  38.436 -25.780 1.00 13.59 ? 83  MET B SD   1 
ATOM   4943 C CE   . MET B 1 83  ? -9.840  38.556 -24.698 1.00 16.61 ? 83  MET B CE   1 
ATOM   4944 H H    . MET B 1 83  ? -7.496  34.118 -26.353 1.00 0.00  ? 83  MET B H    1 
ATOM   4945 N N    . LYS B 1 84  ? -10.730 33.487 -26.865 1.00 25.55 ? 84  LYS B N    1 
ATOM   4946 C CA   . LYS B 1 84  ? -11.908 32.821 -27.420 1.00 25.81 ? 84  LYS B CA   1 
ATOM   4947 C C    . LYS B 1 84  ? -12.040 31.489 -26.670 1.00 24.47 ? 84  LYS B C    1 
ATOM   4948 O O    . LYS B 1 84  ? -13.087 31.179 -26.120 1.00 23.70 ? 84  LYS B O    1 
ATOM   4949 C CB   . LYS B 1 84  ? -11.672 32.611 -28.931 1.00 29.55 ? 84  LYS B CB   1 
ATOM   4950 C CG   . LYS B 1 84  ? -12.719 31.777 -29.682 1.00 34.00 ? 84  LYS B CG   1 
ATOM   4951 C CD   . LYS B 1 84  ? -13.966 32.573 -30.062 1.00 35.62 ? 84  LYS B CD   1 
ATOM   4952 C CE   . LYS B 1 84  ? -14.929 31.669 -30.845 1.00 40.22 ? 84  LYS B CE   1 
ATOM   4953 N NZ   . LYS B 1 84  ? -16.193 32.329 -31.292 1.00 36.29 ? 84  LYS B NZ   1 
ATOM   4954 H H    . LYS B 1 84  ? -10.024 33.786 -27.482 1.00 0.00  ? 84  LYS B H    1 
ATOM   4955 H HZ1  . LYS B 1 84  ? -16.703 32.734 -30.479 1.00 0.00  ? 84  LYS B HZ1  1 
ATOM   4956 H HZ2  . LYS B 1 84  ? -15.932 33.080 -31.948 1.00 0.00  ? 84  LYS B HZ2  1 
ATOM   4957 H HZ3  . LYS B 1 84  ? -16.811 31.697 -31.828 1.00 0.00  ? 84  LYS B HZ3  1 
ATOM   4958 N N    . GLU B 1 85  ? -10.924 30.769 -26.578 1.00 25.79 ? 85  GLU B N    1 
ATOM   4959 C CA   . GLU B 1 85  ? -10.851 29.490 -25.877 1.00 28.15 ? 85  GLU B CA   1 
ATOM   4960 C C    . GLU B 1 85  ? -11.281 29.587 -24.406 1.00 28.30 ? 85  GLU B C    1 
ATOM   4961 O O    . GLU B 1 85  ? -11.930 28.656 -23.881 1.00 28.33 ? 85  GLU B O    1 
ATOM   4962 C CB   . GLU B 1 85  ? -9.435  28.911 -25.997 1.00 29.19 ? 85  GLU B CB   1 
ATOM   4963 C CG   . GLU B 1 85  ? -9.118  27.737 -25.094 1.00 35.09 ? 85  GLU B CG   1 
ATOM   4964 C CD   . GLU B 1 85  ? -8.054  26.843 -25.712 1.00 39.61 ? 85  GLU B CD   1 
ATOM   4965 O OE1  . GLU B 1 85  ? -8.315  26.294 -26.804 1.00 44.07 ? 85  GLU B OE1  1 
ATOM   4966 O OE2  . GLU B 1 85  ? -6.932  26.722 -25.173 1.00 44.70 ? 85  GLU B OE2  1 
ATOM   4967 H H    . GLU B 1 85  ? -10.111 31.065 -27.037 1.00 0.00  ? 85  GLU B H    1 
ATOM   4968 N N    . LEU B 1 86  ? -10.893 30.664 -23.718 1.00 26.53 ? 86  LEU B N    1 
ATOM   4969 C CA   . LEU B 1 86  ? -11.306 30.821 -22.311 1.00 26.28 ? 86  LEU B CA   1 
ATOM   4970 C C    . LEU B 1 86  ? -12.721 31.389 -22.206 1.00 25.09 ? 86  LEU B C    1 
ATOM   4971 O O    . LEU B 1 86  ? -13.513 30.919 -21.394 1.00 24.54 ? 86  LEU B O    1 
ATOM   4972 C CB   . LEU B 1 86  ? -10.284 31.643 -21.499 1.00 24.45 ? 86  LEU B CB   1 
ATOM   4973 C CG   . LEU B 1 86  ? -8.989  30.887 -21.125 1.00 21.74 ? 86  LEU B CG   1 
ATOM   4974 C CD1  . LEU B 1 86  ? -7.845  31.850 -20.921 1.00 20.46 ? 86  LEU B CD1  1 
ATOM   4975 C CD2  . LEU B 1 86  ? -9.199  30.075 -19.879 1.00 18.84 ? 86  LEU B CD2  1 
ATOM   4976 H H    . LEU B 1 86  ? -10.269 31.304 -24.121 1.00 0.00  ? 86  LEU B H    1 
ATOM   4977 N N    . GLU B 1 87  ? -13.047 32.341 -23.077 1.00 24.69 ? 87  GLU B N    1 
ATOM   4978 C CA   . GLU B 1 87  ? -14.367 32.960 -23.142 1.00 26.65 ? 87  GLU B CA   1 
ATOM   4979 C C    . GLU B 1 87  ? -15.445 31.942 -23.475 1.00 28.82 ? 87  GLU B C    1 
ATOM   4980 O O    . GLU B 1 87  ? -16.490 31.905 -22.809 1.00 31.33 ? 87  GLU B O    1 
ATOM   4981 C CB   . GLU B 1 87  ? -14.390 34.084 -24.174 1.00 28.16 ? 87  GLU B CB   1 
ATOM   4982 C CG   . GLU B 1 87  ? -13.772 35.399 -23.676 1.00 30.30 ? 87  GLU B CG   1 
ATOM   4983 C CD   . GLU B 1 87  ? -13.533 36.409 -24.787 1.00 34.21 ? 87  GLU B CD   1 
ATOM   4984 O OE1  . GLU B 1 87  ? -14.296 36.427 -25.767 1.00 36.61 ? 87  GLU B OE1  1 
ATOM   4985 O OE2  . GLU B 1 87  ? -12.569 37.194 -24.686 1.00 37.46 ? 87  GLU B OE2  1 
ATOM   4986 H H    . GLU B 1 87  ? -12.378 32.688 -23.721 1.00 0.00  ? 87  GLU B H    1 
ATOM   4987 N N    . ASP B 1 88  ? -15.194 31.100 -24.478 1.00 30.28 ? 88  ASP B N    1 
ATOM   4988 C CA   . ASP B 1 88  ? -16.152 30.053 -24.856 1.00 33.79 ? 88  ASP B CA   1 
ATOM   4989 C C    . ASP B 1 88  ? -16.541 29.168 -23.646 1.00 34.88 ? 88  ASP B C    1 
ATOM   4990 O O    . ASP B 1 88  ? -17.602 28.563 -23.633 1.00 36.45 ? 88  ASP B O    1 
ATOM   4991 C CB   . ASP B 1 88  ? -15.596 29.172 -25.997 1.00 35.46 ? 88  ASP B CB   1 
ATOM   4992 C CG   . ASP B 1 88  ? -15.444 29.934 -27.316 1.00 36.33 ? 88  ASP B CG   1 
ATOM   4993 O OD1  . ASP B 1 88  ? -16.213 30.883 -27.585 1.00 37.06 ? 88  ASP B OD1  1 
ATOM   4994 O OD2  . ASP B 1 88  ? -14.551 29.583 -28.104 1.00 36.57 ? 88  ASP B OD2  1 
ATOM   4995 H H    . ASP B 1 88  ? -14.374 31.175 -25.030 1.00 0.00  ? 88  ASP B H    1 
ATOM   4996 N N    . ARG B 1 89  ? -15.684 29.121 -22.627 1.00 36.05 ? 89  ARG B N    1 
ATOM   4997 C CA   . ARG B 1 89  ? -15.933 28.348 -21.424 1.00 34.53 ? 89  ARG B CA   1 
ATOM   4998 C C    . ARG B 1 89  ? -16.393 29.247 -20.256 1.00 33.69 ? 89  ARG B C    1 
ATOM   4999 O O    . ARG B 1 89  ? -16.493 28.781 -19.112 1.00 33.40 ? 89  ARG B O    1 
ATOM   5000 C CB   . ARG B 1 89  ? -14.673 27.586 -20.999 1.00 36.43 ? 89  ARG B CB   1 
ATOM   5001 C CG   . ARG B 1 89  ? -13.922 26.768 -22.064 1.00 38.10 ? 89  ARG B CG   1 
ATOM   5002 C CD   . ARG B 1 89  ? -13.002 25.796 -21.332 1.00 41.07 ? 89  ARG B CD   1 
ATOM   5003 N NE   . ARG B 1 89  ? -11.775 25.393 -22.021 1.00 45.49 ? 89  ARG B NE   1 
ATOM   5004 C CZ   . ARG B 1 89  ? -11.717 24.598 -23.088 1.00 47.91 ? 89  ARG B CZ   1 
ATOM   5005 N NH1  . ARG B 1 89  ? -12.824 24.106 -23.627 1.00 50.59 ? 89  ARG B NH1  1 
ATOM   5006 N NH2  . ARG B 1 89  ? -10.541 24.250 -23.594 1.00 51.05 ? 89  ARG B NH2  1 
ATOM   5007 H H    . ARG B 1 89  ? -14.841 29.618 -22.699 1.00 0.00  ? 89  ARG B H    1 
ATOM   5008 H HE   . ARG B 1 89  ? -10.928 25.725 -21.657 1.00 0.00  ? 89  ARG B HE   1 
ATOM   5009 H HH11 . ARG B 1 89  ? -13.714 24.299 -23.213 1.00 0.00  ? 89  ARG B HH11 1 
ATOM   5010 H HH12 . ARG B 1 89  ? -12.760 23.462 -24.384 1.00 0.00  ? 89  ARG B HH12 1 
ATOM   5011 H HH21 . ARG B 1 89  ? -9.705  24.518 -23.123 1.00 0.00  ? 89  ARG B HH21 1 
ATOM   5012 H HH22 . ARG B 1 89  ? -10.473 23.600 -24.348 1.00 0.00  ? 89  ARG B HH22 1 
ATOM   5013 N N    . GLY B 1 90  ? -16.646 30.531 -20.513 1.00 32.19 ? 90  GLY B N    1 
ATOM   5014 C CA   . GLY B 1 90  ? -17.105 31.412 -19.442 1.00 30.60 ? 90  GLY B CA   1 
ATOM   5015 C C    . GLY B 1 90  ? -16.112 32.129 -18.519 1.00 30.04 ? 90  GLY B C    1 
ATOM   5016 O O    . GLY B 1 90  ? -16.484 32.558 -17.403 1.00 32.42 ? 90  GLY B O    1 
ATOM   5017 H H    . GLY B 1 90  ? -16.553 30.918 -21.417 1.00 0.00  ? 90  GLY B H    1 
ATOM   5018 N N    . ILE B 1 91  ? -14.854 32.257 -18.923 1.00 26.03 ? 91  ILE B N    1 
ATOM   5019 C CA   . ILE B 1 91  ? -13.908 32.968 -18.076 1.00 21.16 ? 91  ILE B CA   1 
ATOM   5020 C C    . ILE B 1 91  ? -13.759 34.333 -18.726 1.00 20.08 ? 91  ILE B C    1 
ATOM   5021 O O    . ILE B 1 91  ? -13.271 34.425 -19.824 1.00 21.46 ? 91  ILE B O    1 
ATOM   5022 C CB   . ILE B 1 91  ? -12.535 32.242 -17.974 1.00 18.06 ? 91  ILE B CB   1 
ATOM   5023 C CG1  . ILE B 1 91  ? -12.739 30.769 -17.618 1.00 21.21 ? 91  ILE B CG1  1 
ATOM   5024 C CG2  . ILE B 1 91  ? -11.658 32.867 -16.906 1.00 19.94 ? 91  ILE B CG2  1 
ATOM   5025 C CD1  . ILE B 1 91  ? -13.432 30.507 -16.246 1.00 21.37 ? 91  ILE B CD1  1 
ATOM   5026 H H    . ILE B 1 91  ? -14.549 31.868 -19.777 1.00 0.00  ? 91  ILE B H    1 
ATOM   5027 N N    . PRO B 1 92  ? -14.294 35.393 -18.097 1.00 19.27 ? 92  PRO B N    1 
ATOM   5028 C CA   . PRO B 1 92  ? -14.273 36.798 -18.519 1.00 19.25 ? 92  PRO B CA   1 
ATOM   5029 C C    . PRO B 1 92  ? -12.867 37.352 -18.621 1.00 18.57 ? 92  PRO B C    1 
ATOM   5030 O O    . PRO B 1 92  ? -12.455 38.180 -17.817 1.00 14.03 ? 92  PRO B O    1 
ATOM   5031 C CB   . PRO B 1 92  ? -15.042 37.492 -17.386 1.00 19.08 ? 92  PRO B CB   1 
ATOM   5032 C CG   . PRO B 1 92  ? -14.768 36.630 -16.216 1.00 17.93 ? 92  PRO B CG   1 
ATOM   5033 C CD   . PRO B 1 92  ? -14.989 35.280 -16.804 1.00 19.82 ? 92  PRO B CD   1 
ATOM   5034 N N    . VAL B 1 93  ? -12.153 36.889 -19.643 1.00 25.31 ? 93  VAL B N    1 
ATOM   5035 C CA   . VAL B 1 93  ? -10.750 37.244 -19.922 1.00 27.66 ? 93  VAL B CA   1 
ATOM   5036 C C    . VAL B 1 93  ? -10.511 38.751 -20.064 1.00 30.06 ? 93  VAL B C    1 
ATOM   5037 O O    . VAL B 1 93  ? -9.821  39.347 -19.242 1.00 30.66 ? 93  VAL B O    1 
ATOM   5038 C CB   . VAL B 1 93  ? -10.248 36.491 -21.187 1.00 28.14 ? 93  VAL B CB   1 
ATOM   5039 C CG1  . VAL B 1 93  ? -8.733  36.713 -21.419 1.00 27.96 ? 93  VAL B CG1  1 
ATOM   5040 C CG2  . VAL B 1 93  ? -10.562 35.015 -21.065 1.00 22.81 ? 93  VAL B CG2  1 
ATOM   5041 H H    . VAL B 1 93  ? -12.607 36.241 -20.232 1.00 0.00  ? 93  VAL B H    1 
ATOM   5042 N N    . ARG B 1 94  ? -11.156 39.376 -21.048 1.00 32.03 ? 94  ARG B N    1 
ATOM   5043 C CA   . ARG B 1 94  ? -11.003 40.813 -21.274 1.00 32.80 ? 94  ARG B CA   1 
ATOM   5044 C C    . ARG B 1 94  ? -11.144 41.682 -20.014 1.00 31.80 ? 94  ARG B C    1 
ATOM   5045 O O    . ARG B 1 94  ? -10.645 42.807 -19.991 1.00 30.86 ? 94  ARG B O    1 
ATOM   5046 C CB   . ARG B 1 94  ? -12.004 41.325 -22.334 1.00 36.08 ? 94  ARG B CB   1 
ATOM   5047 C CG   . ARG B 1 94  ? -11.957 40.628 -23.691 1.00 40.41 ? 94  ARG B CG   1 
ATOM   5048 C CD   . ARG B 1 94  ? -12.862 41.297 -24.723 1.00 44.25 ? 94  ARG B CD   1 
ATOM   5049 N NE   . ARG B 1 94  ? -12.336 42.610 -25.123 1.00 49.07 ? 94  ARG B NE   1 
ATOM   5050 C CZ   . ARG B 1 94  ? -12.650 43.242 -26.257 1.00 48.93 ? 94  ARG B CZ   1 
ATOM   5051 N NH1  . ARG B 1 94  ? -13.512 42.703 -27.121 1.00 49.07 ? 94  ARG B NH1  1 
ATOM   5052 N NH2  . ARG B 1 94  ? -12.014 44.362 -26.579 1.00 48.86 ? 94  ARG B NH2  1 
ATOM   5053 H H    . ARG B 1 94  ? -11.738 38.852 -21.639 1.00 0.00  ? 94  ARG B H    1 
ATOM   5054 H HE   . ARG B 1 94  ? -11.713 43.053 -24.503 1.00 0.00  ? 94  ARG B HE   1 
ATOM   5055 H HH11 . ARG B 1 94  ? -13.923 41.804 -26.934 1.00 0.00  ? 94  ARG B HH11 1 
ATOM   5056 H HH12 . ARG B 1 94  ? -13.757 43.145 -27.988 1.00 0.00  ? 94  ARG B HH12 1 
ATOM   5057 H HH21 . ARG B 1 94  ? -11.300 44.764 -25.988 1.00 0.00  ? 94  ARG B HH21 1 
ATOM   5058 H HH22 . ARG B 1 94  ? -12.232 44.856 -27.425 1.00 0.00  ? 94  ARG B HH22 1 
ATOM   5059 N N    . GLU B 1 95  ? -11.842 41.203 -18.988 1.00 29.92 ? 95  GLU B N    1 
ATOM   5060 C CA   . GLU B 1 95  ? -11.993 42.008 -17.792 1.00 29.43 ? 95  GLU B CA   1 
ATOM   5061 C C    . GLU B 1 95  ? -11.030 41.666 -16.643 1.00 28.56 ? 95  GLU B C    1 
ATOM   5062 O O    . GLU B 1 95  ? -10.964 42.380 -15.625 1.00 26.10 ? 95  GLU B O    1 
ATOM   5063 C CB   . GLU B 1 95  ? -13.455 42.057 -17.333 1.00 32.75 ? 95  GLU B CB   1 
ATOM   5064 C CG   . GLU B 1 95  ? -13.976 40.943 -16.435 1.00 36.56 ? 95  GLU B CG   1 
ATOM   5065 C CD   . GLU B 1 95  ? -15.204 41.409 -15.626 1.00 43.06 ? 95  GLU B CD   1 
ATOM   5066 O OE1  . GLU B 1 95  ? -16.338 41.419 -16.169 1.00 46.31 ? 95  GLU B OE1  1 
ATOM   5067 O OE2  . GLU B 1 95  ? -15.042 41.810 -14.446 1.00 45.77 ? 95  GLU B OE2  1 
ATOM   5068 H H    . GLU B 1 95  ? -12.252 40.315 -18.990 1.00 0.00  ? 95  GLU B H    1 
ATOM   5069 N N    . ARG B 1 96  ? -10.217 40.632 -16.829 1.00 24.23 ? 96  ARG B N    1 
ATOM   5070 C CA   . ARG B 1 96  ? -9.274  40.268 -15.777 1.00 23.39 ? 96  ARG B CA   1 
ATOM   5071 C C    . ARG B 1 96  ? -7.820  40.385 -16.213 1.00 22.08 ? 96  ARG B C    1 
ATOM   5072 O O    . ARG B 1 96  ? -6.930  40.289 -15.386 1.00 20.68 ? 96  ARG B O    1 
ATOM   5073 C CB   . ARG B 1 96  ? -9.573  38.860 -15.239 1.00 20.07 ? 96  ARG B CB   1 
ATOM   5074 C CG   . ARG B 1 96  ? -10.404 38.855 -13.930 1.00 17.85 ? 96  ARG B CG   1 
ATOM   5075 C CD   . ARG B 1 96  ? -11.597 37.850 -13.910 1.00 12.70 ? 96  ARG B CD   1 
ATOM   5076 N NE   . ARG B 1 96  ? -11.167 36.458 -13.890 1.00 5.01  ? 96  ARG B NE   1 
ATOM   5077 C CZ   . ARG B 1 96  ? -11.944 35.392 -13.642 1.00 8.68  ? 96  ARG B CZ   1 
ATOM   5078 N NH1  . ARG B 1 96  ? -13.259 35.467 -13.377 1.00 5.01  ? 96  ARG B NH1  1 
ATOM   5079 N NH2  . ARG B 1 96  ? -11.370 34.199 -13.648 1.00 14.67 ? 96  ARG B NH2  1 
ATOM   5080 H H    . ARG B 1 96  ? -10.211 40.128 -17.681 1.00 0.00  ? 96  ARG B H    1 
ATOM   5081 H HE   . ARG B 1 96  ? -10.218 36.275 -14.074 1.00 0.00  ? 96  ARG B HE   1 
ATOM   5082 H HH11 . ARG B 1 96  ? -13.705 36.361 -13.343 1.00 0.00  ? 96  ARG B HH11 1 
ATOM   5083 H HH12 . ARG B 1 96  ? -13.796 34.644 -13.181 1.00 0.00  ? 96  ARG B HH12 1 
ATOM   5084 H HH21 . ARG B 1 96  ? -10.386 34.165 -13.896 1.00 0.00  ? 96  ARG B HH21 1 
ATOM   5085 H HH22 . ARG B 1 96  ? -11.837 33.338 -13.437 1.00 0.00  ? 96  ARG B HH22 1 
ATOM   5086 N N    . LEU B 1 97  ? -7.606  40.693 -17.493 1.00 19.86 ? 97  LEU B N    1 
ATOM   5087 C CA   . LEU B 1 97  ? -6.272  40.781 -18.088 1.00 16.16 ? 97  LEU B CA   1 
ATOM   5088 C C    . LEU B 1 97  ? -5.931  42.167 -18.655 1.00 15.29 ? 97  LEU B C    1 
ATOM   5089 O O    . LEU B 1 97  ? -6.756  42.756 -19.284 1.00 10.67 ? 97  LEU B O    1 
ATOM   5090 C CB   . LEU B 1 97  ? -6.182  39.736 -19.218 1.00 15.13 ? 97  LEU B CB   1 
ATOM   5091 C CG   . LEU B 1 97  ? -4.864  39.496 -19.962 1.00 9.93  ? 97  LEU B CG   1 
ATOM   5092 C CD1  . LEU B 1 97  ? -4.016  38.562 -19.149 1.00 9.07  ? 97  LEU B CD1  1 
ATOM   5093 C CD2  . LEU B 1 97  ? -5.112  38.906 -21.314 1.00 9.81  ? 97  LEU B CD2  1 
ATOM   5094 H H    . LEU B 1 97  ? -8.371  40.860 -18.081 1.00 0.00  ? 97  LEU B H    1 
ATOM   5095 N N    . LEU B 1 98  ? -4.673  42.590 -18.536 1.00 17.37 ? 98  LEU B N    1 
ATOM   5096 C CA   . LEU B 1 98  ? -4.193  43.906 -19.016 1.00 18.31 ? 98  LEU B CA   1 
ATOM   5097 C C    . LEU B 1 98  ? -2.794  43.756 -19.634 1.00 18.36 ? 98  LEU B C    1 
ATOM   5098 O O    . LEU B 1 98  ? -1.978  42.968 -19.128 1.00 17.17 ? 98  LEU B O    1 
ATOM   5099 C CB   . LEU B 1 98  ? -4.071  44.891 -17.840 1.00 18.71 ? 98  LEU B CB   1 
ATOM   5100 C CG   . LEU B 1 98  ? -5.253  45.102 -16.872 1.00 19.18 ? 98  LEU B CG   1 
ATOM   5101 C CD1  . LEU B 1 98  ? -4.760  45.644 -15.543 1.00 18.05 ? 98  LEU B CD1  1 
ATOM   5102 C CD2  . LEU B 1 98  ? -6.349  46.000 -17.505 1.00 16.30 ? 98  LEU B CD2  1 
ATOM   5103 H H    . LEU B 1 98  ? -4.041  42.016 -18.048 1.00 0.00  ? 98  LEU B H    1 
ATOM   5104 N N    . LEU B 1 99  ? -2.511  44.515 -20.700 1.00 17.21 ? 99  LEU B N    1 
ATOM   5105 C CA   . LEU B 1 99  ? -1.210  44.446 -21.370 1.00 15.20 ? 99  LEU B CA   1 
ATOM   5106 C C    . LEU B 1 99  ? -0.366  45.712 -21.171 1.00 15.93 ? 99  LEU B C    1 
ATOM   5107 O O    . LEU B 1 99  ? -0.857  46.751 -20.697 1.00 16.78 ? 99  LEU B O    1 
ATOM   5108 C CB   . LEU B 1 99  ? -1.351  44.218 -22.887 1.00 13.22 ? 99  LEU B CB   1 
ATOM   5109 C CG   . LEU B 1 99  ? -2.361  43.246 -23.525 1.00 11.42 ? 99  LEU B CG   1 
ATOM   5110 C CD1  . LEU B 1 99  ? -2.265  43.282 -25.045 1.00 7.07  ? 99  LEU B CD1  1 
ATOM   5111 C CD2  . LEU B 1 99  ? -2.209  41.850 -22.996 1.00 12.86 ? 99  LEU B CD2  1 
ATOM   5112 H H    . LEU B 1 99  ? -3.175  45.180 -20.984 1.00 0.00  ? 99  LEU B H    1 
ATOM   5113 N N    . SER B 1 100 ? 0.903   45.635 -21.559 1.00 16.16 ? 100 SER B N    1 
ATOM   5114 C CA   . SER B 1 100 ? 1.781   46.795 -21.482 1.00 14.85 ? 100 SER B CA   1 
ATOM   5115 C C    . SER B 1 100 ? 1.999   47.261 -22.919 1.00 14.49 ? 100 SER B C    1 
ATOM   5116 O O    . SER B 1 100 ? 1.976   46.415 -23.837 1.00 14.05 ? 100 SER B O    1 
ATOM   5117 C CB   . SER B 1 100 ? 3.115   46.419 -20.860 1.00 13.66 ? 100 SER B CB   1 
ATOM   5118 O OG   . SER B 1 100 ? 4.068   47.433 -21.108 1.00 15.36 ? 100 SER B OG   1 
ATOM   5119 H H    . SER B 1 100 ? 1.282   44.798 -21.903 1.00 0.00  ? 100 SER B H    1 
ATOM   5120 H HG   . SER B 1 100 ? 4.547   47.538 -20.273 1.00 0.00  ? 100 SER B HG   1 
ATOM   5121 N N    . GLU B 1 101 ? 2.232   48.570 -23.110 1.00 13.30 ? 101 GLU B N    1 
ATOM   5122 C CA   . GLU B 1 101 ? 2.461   49.166 -24.446 1.00 15.90 ? 101 GLU B CA   1 
ATOM   5123 C C    . GLU B 1 101 ? 3.844   48.894 -25.055 1.00 17.83 ? 101 GLU B C    1 
ATOM   5124 O O    . GLU B 1 101 ? 4.050   48.992 -26.290 1.00 18.78 ? 101 GLU B O    1 
ATOM   5125 C CB   . GLU B 1 101 ? 2.226   50.688 -24.431 1.00 16.10 ? 101 GLU B CB   1 
ATOM   5126 C CG   . GLU B 1 101 ? 3.324   51.514 -23.801 1.00 17.70 ? 101 GLU B CG   1 
ATOM   5127 C CD   . GLU B 1 101 ? 3.326   52.971 -24.306 1.00 24.66 ? 101 GLU B CD   1 
ATOM   5128 O OE1  . GLU B 1 101 ? 3.377   53.192 -25.548 1.00 24.32 ? 101 GLU B OE1  1 
ATOM   5129 O OE2  . GLU B 1 101 ? 3.343   53.906 -23.449 1.00 26.29 ? 101 GLU B OE2  1 
ATOM   5130 H H    . GLU B 1 101 ? 2.268   49.149 -22.318 1.00 0.00  ? 101 GLU B H    1 
ATOM   5131 N N    . ALA B 1 102 ? 4.803   48.592 -24.193 1.00 16.37 ? 102 ALA B N    1 
ATOM   5132 C CA   . ALA B 1 102 ? 6.126   48.326 -24.661 1.00 14.36 ? 102 ALA B CA   1 
ATOM   5133 C C    . ALA B 1 102 ? 6.245   46.899 -25.242 1.00 12.82 ? 102 ALA B C    1 
ATOM   5134 O O    . ALA B 1 102 ? 7.235   46.556 -25.893 1.00 14.62 ? 102 ALA B O    1 
ATOM   5135 C CB   . ALA B 1 102 ? 7.110   48.547 -23.529 1.00 16.79 ? 102 ALA B CB   1 
ATOM   5136 H H    . ALA B 1 102 ? 4.593   48.498 -23.237 1.00 0.00  ? 102 ALA B H    1 
ATOM   5137 N N    . CYS B 1 103 ? 5.222   46.084 -25.025 1.00 13.51 ? 103 CYS B N    1 
ATOM   5138 C CA   . CYS B 1 103 ? 5.214   44.718 -25.519 1.00 17.93 ? 103 CYS B CA   1 
ATOM   5139 C C    . CYS B 1 103 ? 5.605   44.617 -26.990 1.00 20.18 ? 103 CYS B C    1 
ATOM   5140 O O    . CYS B 1 103 ? 5.016   45.275 -27.831 1.00 21.97 ? 103 CYS B O    1 
ATOM   5141 C CB   . CYS B 1 103 ? 3.841   44.065 -25.285 1.00 17.15 ? 103 CYS B CB   1 
ATOM   5142 S SG   . CYS B 1 103 ? 3.660   43.320 -23.624 1.00 13.41 ? 103 CYS B SG   1 
ATOM   5143 H H    . CYS B 1 103 ? 4.449   46.381 -24.509 1.00 0.00  ? 103 CYS B H    1 
ATOM   5144 N N    . PRO B 1 104 ? 6.663   43.850 -27.300 1.00 21.05 ? 104 PRO B N    1 
ATOM   5145 C CA   . PRO B 1 104 ? 7.032   43.755 -28.709 1.00 21.28 ? 104 PRO B CA   1 
ATOM   5146 C C    . PRO B 1 104 ? 6.054   42.841 -29.383 1.00 20.58 ? 104 PRO B C    1 
ATOM   5147 O O    . PRO B 1 104 ? 5.503   41.955 -28.729 1.00 20.33 ? 104 PRO B O    1 
ATOM   5148 C CB   . PRO B 1 104 ? 8.453   43.192 -28.646 1.00 20.36 ? 104 PRO B CB   1 
ATOM   5149 C CG   . PRO B 1 104 ? 8.968   43.786 -27.377 1.00 18.26 ? 104 PRO B CG   1 
ATOM   5150 C CD   . PRO B 1 104 ? 7.800   43.445 -26.459 1.00 19.97 ? 104 PRO B CD   1 
ATOM   5151 N N    . LEU B 1 105 ? 5.749   43.113 -30.649 1.00 21.00 ? 105 LEU B N    1 
ATOM   5152 C CA   . LEU B 1 105 ? 4.773   42.290 -31.349 1.00 19.68 ? 105 LEU B CA   1 
ATOM   5153 C C    . LEU B 1 105 ? 5.389   41.214 -32.239 1.00 17.67 ? 105 LEU B C    1 
ATOM   5154 O O    . LEU B 1 105 ? 6.401   41.446 -32.894 1.00 17.03 ? 105 LEU B O    1 
ATOM   5155 C CB   . LEU B 1 105 ? 3.765   43.163 -32.127 1.00 18.05 ? 105 LEU B CB   1 
ATOM   5156 C CG   . LEU B 1 105 ? 2.782   44.046 -31.318 1.00 15.06 ? 105 LEU B CG   1 
ATOM   5157 C CD1  . LEU B 1 105 ? 2.135   45.131 -32.178 1.00 5.86  ? 105 LEU B CD1  1 
ATOM   5158 C CD2  . LEU B 1 105 ? 1.702   43.195 -30.688 1.00 14.87 ? 105 LEU B CD2  1 
ATOM   5159 H H    . LEU B 1 105 ? 6.125   43.910 -31.081 1.00 0.00  ? 105 LEU B H    1 
ATOM   5160 N N    . ILE B 1 106 ? 4.791   40.018 -32.165 1.00 18.10 ? 106 ILE B N    1 
ATOM   5161 C CA   . ILE B 1 106 ? 5.154   38.834 -32.938 1.00 17.94 ? 106 ILE B CA   1 
ATOM   5162 C C    . ILE B 1 106 ? 4.133   38.739 -34.087 1.00 20.75 ? 106 ILE B C    1 
ATOM   5163 O O    . ILE B 1 106 ? 2.942   38.474 -33.882 1.00 19.80 ? 106 ILE B O    1 
ATOM   5164 C CB   . ILE B 1 106 ? 5.053   37.534 -32.088 1.00 18.01 ? 106 ILE B CB   1 
ATOM   5165 C CG1  . ILE B 1 106 ? 6.071   37.538 -30.947 1.00 17.85 ? 106 ILE B CG1  1 
ATOM   5166 C CG2  . ILE B 1 106 ? 5.380   36.332 -32.956 1.00 12.77 ? 106 ILE B CG2  1 
ATOM   5167 C CD1  . ILE B 1 106 ? 5.722   36.585 -29.801 1.00 15.62 ? 106 ILE B CD1  1 
ATOM   5168 H H    . ILE B 1 106 ? 4.027   39.954 -31.533 1.00 0.00  ? 106 ILE B H    1 
ATOM   5169 N N    . LEU B 1 107 ? 4.589   39.032 -35.291 1.00 21.98 ? 107 LEU B N    1 
ATOM   5170 C CA   . LEU B 1 107 ? 3.721   38.981 -36.466 1.00 19.63 ? 107 LEU B CA   1 
ATOM   5171 C C    . LEU B 1 107 ? 4.195   37.874 -37.433 1.00 18.54 ? 107 LEU B C    1 
ATOM   5172 O O    . LEU B 1 107 ? 5.239   37.205 -37.185 1.00 19.28 ? 107 LEU B O    1 
ATOM   5173 C CB   . LEU B 1 107 ? 3.670   40.385 -37.117 1.00 17.99 ? 107 LEU B CB   1 
ATOM   5174 C CG   . LEU B 1 107 ? 3.170   41.426 -36.089 1.00 17.73 ? 107 LEU B CG   1 
ATOM   5175 C CD1  . LEU B 1 107 ? 3.505   42.818 -36.511 1.00 16.25 ? 107 LEU B CD1  1 
ATOM   5176 C CD2  . LEU B 1 107 ? 1.668   41.272 -35.818 1.00 16.80 ? 107 LEU B CD2  1 
ATOM   5177 H H    . LEU B 1 107 ? 5.524   39.285 -35.389 1.00 0.00  ? 107 LEU B H    1 
ATOM   5178 N N    . ASP B 1 108 ? 3.505   37.745 -38.558 1.00 15.97 ? 108 ASP B N    1 
ATOM   5179 C CA   . ASP B 1 108 ? 3.801   36.699 -39.525 1.00 17.65 ? 108 ASP B CA   1 
ATOM   5180 C C    . ASP B 1 108 ? 5.210   36.458 -40.052 1.00 15.50 ? 108 ASP B C    1 
ATOM   5181 O O    . ASP B 1 108 ? 5.632   35.317 -40.153 1.00 16.93 ? 108 ASP B O    1 
ATOM   5182 C CB   . ASP B 1 108 ? 2.828   36.758 -40.702 1.00 20.59 ? 108 ASP B CB   1 
ATOM   5183 C CG   . ASP B 1 108 ? 1.536   36.030 -40.418 1.00 23.55 ? 108 ASP B CG   1 
ATOM   5184 O OD1  . ASP B 1 108 ? 1.411   35.486 -39.291 1.00 25.69 ? 108 ASP B OD1  1 
ATOM   5185 O OD2  . ASP B 1 108 ? 0.654   36.001 -41.320 1.00 24.72 ? 108 ASP B OD2  1 
ATOM   5186 H H    . ASP B 1 108 ? 2.763   38.355 -38.744 1.00 0.00  ? 108 ASP B H    1 
ATOM   5187 N N    . TYR B 1 109 ? 5.923   37.507 -40.422 1.00 11.83 ? 109 TYR B N    1 
ATOM   5188 C CA   . TYR B 1 109 ? 7.273   37.374 -40.933 1.00 14.26 ? 109 TYR B CA   1 
ATOM   5189 C C    . TYR B 1 109 ? 8.267   36.933 -39.833 1.00 15.98 ? 109 TYR B C    1 
ATOM   5190 O O    . TYR B 1 109 ? 9.347   36.381 -40.116 1.00 15.02 ? 109 TYR B O    1 
ATOM   5191 C CB   . TYR B 1 109 ? 7.680   38.698 -41.581 1.00 12.87 ? 109 TYR B CB   1 
ATOM   5192 C CG   . TYR B 1 109 ? 7.453   39.902 -40.692 1.00 11.12 ? 109 TYR B CG   1 
ATOM   5193 C CD1  . TYR B 1 109 ? 6.214   40.540 -40.618 1.00 8.45  ? 109 TYR B CD1  1 
ATOM   5194 C CD2  . TYR B 1 109 ? 8.480   40.381 -39.890 1.00 10.21 ? 109 TYR B CD2  1 
ATOM   5195 C CE1  . TYR B 1 109 ? 6.024   41.635 -39.757 1.00 9.67  ? 109 TYR B CE1  1 
ATOM   5196 C CE2  . TYR B 1 109 ? 8.296   41.464 -39.022 1.00 5.67  ? 109 TYR B CE2  1 
ATOM   5197 C CZ   . TYR B 1 109 ? 7.088   42.080 -38.961 1.00 10.18 ? 109 TYR B CZ   1 
ATOM   5198 O OH   . TYR B 1 109 ? 6.993   43.124 -38.081 1.00 11.39 ? 109 TYR B OH   1 
ATOM   5199 H H    . TYR B 1 109 ? 5.473   38.370 -40.351 1.00 0.00  ? 109 TYR B H    1 
ATOM   5200 H HH   . TYR B 1 109 ? 6.138   43.555 -38.188 1.00 0.00  ? 109 TYR B HH   1 
ATOM   5201 N N    . HIS B 1 110 ? 7.893   37.142 -38.570 1.00 15.54 ? 110 HIS B N    1 
ATOM   5202 C CA   . HIS B 1 110 ? 8.756   36.726 -37.462 1.00 12.72 ? 110 HIS B CA   1 
ATOM   5203 C C    . HIS B 1 110 ? 8.750   35.217 -37.376 1.00 13.49 ? 110 HIS B C    1 
ATOM   5204 O O    . HIS B 1 110 ? 9.791   34.574 -37.183 1.00 9.22  ? 110 HIS B O    1 
ATOM   5205 C CB   . HIS B 1 110 ? 8.207   37.244 -36.165 1.00 10.32 ? 110 HIS B CB   1 
ATOM   5206 C CG   . HIS B 1 110 ? 8.610   38.644 -35.875 1.00 5.38  ? 110 HIS B CG   1 
ATOM   5207 N ND1  . HIS B 1 110 ? 7.733   39.581 -35.386 1.00 5.01  ? 110 HIS B ND1  1 
ATOM   5208 C CD2  . HIS B 1 110 ? 9.808   39.266 -36.003 1.00 6.79  ? 110 HIS B CD2  1 
ATOM   5209 C CE1  . HIS B 1 110 ? 8.380   40.727 -35.227 1.00 6.25  ? 110 HIS B CE1  1 
ATOM   5210 N NE2  . HIS B 1 110 ? 9.638   40.560 -35.591 1.00 5.02  ? 110 HIS B NE2  1 
ATOM   5211 H H    . HIS B 1 110 ? 7.014   37.522 -38.372 1.00 0.00  ? 110 HIS B H    1 
ATOM   5212 H HE2  . HIS B 1 110 ? 10.333  41.263 -35.636 1.00 0.00  ? 110 HIS B HE2  1 
ATOM   5213 N N    . VAL B 1 111 ? 7.544   34.661 -37.492 1.00 13.59 ? 111 VAL B N    1 
ATOM   5214 C CA   . VAL B 1 111 ? 7.341   33.231 -37.433 1.00 15.61 ? 111 VAL B CA   1 
ATOM   5215 C C    . VAL B 1 111 ? 7.909   32.661 -38.730 1.00 17.78 ? 111 VAL B C    1 
ATOM   5216 O O    . VAL B 1 111 ? 8.653   31.676 -38.710 1.00 14.75 ? 111 VAL B O    1 
ATOM   5217 C CB   . VAL B 1 111 ? 5.836   32.888 -37.203 1.00 15.28 ? 111 VAL B CB   1 
ATOM   5218 C CG1  . VAL B 1 111 ? 5.560   31.462 -37.597 1.00 17.52 ? 111 VAL B CG1  1 
ATOM   5219 C CG2  . VAL B 1 111 ? 5.518   33.060 -35.736 1.00 13.40 ? 111 VAL B CG2  1 
ATOM   5220 H H    . VAL B 1 111 ? 6.767   35.248 -37.596 1.00 0.00  ? 111 VAL B H    1 
ATOM   5221 N N    . ALA B 1 112 ? 7.649   33.363 -39.838 1.00 18.14 ? 112 ALA B N    1 
ATOM   5222 C CA   . ALA B 1 112 ? 8.174   32.949 -41.125 1.00 18.33 ? 112 ALA B CA   1 
ATOM   5223 C C    . ALA B 1 112 ? 9.734   32.926 -41.204 1.00 18.66 ? 112 ALA B C    1 
ATOM   5224 O O    . ALA B 1 112 ? 10.304  32.169 -42.000 1.00 18.22 ? 112 ALA B O    1 
ATOM   5225 C CB   . ALA B 1 112 ? 7.603   33.794 -42.176 1.00 14.81 ? 112 ALA B CB   1 
ATOM   5226 H H    . ALA B 1 112 ? 7.025   34.123 -39.819 1.00 0.00  ? 112 ALA B H    1 
ATOM   5227 N N    . LEU B 1 113 ? 10.409  33.729 -40.375 1.00 17.91 ? 113 LEU B N    1 
ATOM   5228 C CA   . LEU B 1 113 ? 11.889  33.803 -40.308 1.00 16.60 ? 113 LEU B CA   1 
ATOM   5229 C C    . LEU B 1 113 ? 12.478  32.647 -39.528 1.00 17.24 ? 113 LEU B C    1 
ATOM   5230 O O    . LEU B 1 113 ? 13.562  32.178 -39.858 1.00 17.82 ? 113 LEU B O    1 
ATOM   5231 C CB   . LEU B 1 113 ? 12.347  35.034 -39.562 1.00 11.90 ? 113 LEU B CB   1 
ATOM   5232 C CG   . LEU B 1 113 ? 12.878  36.239 -40.274 1.00 12.89 ? 113 LEU B CG   1 
ATOM   5233 C CD1  . LEU B 1 113 ? 11.803  36.851 -41.153 1.00 7.50  ? 113 LEU B CD1  1 
ATOM   5234 C CD2  . LEU B 1 113 ? 13.300  37.213 -39.158 1.00 10.85 ? 113 LEU B CD2  1 
ATOM   5235 H H    . LEU B 1 113 ? 9.902   34.347 -39.810 1.00 0.00  ? 113 LEU B H    1 
ATOM   5236 N N    . ASP B 1 114 ? 11.844  32.325 -38.397 1.00 16.84 ? 114 ASP B N    1 
ATOM   5237 C CA   . ASP B 1 114 ? 12.265  31.205 -37.567 1.00 16.34 ? 114 ASP B CA   1 
ATOM   5238 C C    . ASP B 1 114 ? 12.066  29.920 -38.356 1.00 17.27 ? 114 ASP B C    1 
ATOM   5239 O O    . ASP B 1 114 ? 12.982  29.110 -38.475 1.00 14.97 ? 114 ASP B O    1 
ATOM   5240 C CB   . ASP B 1 114 ? 11.428  31.151 -36.305 1.00 19.03 ? 114 ASP B CB   1 
ATOM   5241 C CG   . ASP B 1 114 ? 12.226  31.461 -35.043 1.00 18.08 ? 114 ASP B CG   1 
ATOM   5242 O OD1  . ASP B 1 114 ? 13.492  31.511 -35.118 1.00 19.16 ? 114 ASP B OD1  1 
ATOM   5243 O OD2  . ASP B 1 114 ? 11.565  31.613 -33.976 1.00 15.91 ? 114 ASP B OD2  1 
ATOM   5244 H H    . ASP B 1 114 ? 11.101  32.883 -38.089 1.00 0.00  ? 114 ASP B H    1 
ATOM   5245 N N    . ASN B 1 115 ? 10.866  29.746 -38.906 1.00 21.36 ? 115 ASN B N    1 
ATOM   5246 C CA   . ASN B 1 115 ? 10.530  28.581 -39.731 1.00 24.81 ? 115 ASN B CA   1 
ATOM   5247 C C    . ASN B 1 115 ? 11.766  28.231 -40.590 1.00 24.91 ? 115 ASN B C    1 
ATOM   5248 O O    . ASN B 1 115 ? 12.298  27.152 -40.492 1.00 26.10 ? 115 ASN B O    1 
ATOM   5249 C CB   . ASN B 1 115 ? 9.334   28.920 -40.653 1.00 27.39 ? 115 ASN B CB   1 
ATOM   5250 C CG   . ASN B 1 115 ? 8.067   28.045 -40.409 1.00 29.42 ? 115 ASN B CG   1 
ATOM   5251 O OD1  . ASN B 1 115 ? 7.541   27.957 -39.303 1.00 29.39 ? 115 ASN B OD1  1 
ATOM   5252 N ND2  . ASN B 1 115 ? 7.530   27.481 -41.490 1.00 33.22 ? 115 ASN B ND2  1 
ATOM   5253 H H    . ASN B 1 115 ? 10.164  30.418 -38.742 1.00 0.00  ? 115 ASN B H    1 
ATOM   5254 H HD21 . ASN B 1 115 ? 6.765   26.900 -41.329 1.00 0.00  ? 115 ASN B HD21 1 
ATOM   5255 H HD22 . ASN B 1 115 ? 7.931   27.653 -42.369 1.00 0.00  ? 115 ASN B HD22 1 
ATOM   5256 N N    . ALA B 1 116 ? 12.298  29.201 -41.328 1.00 27.70 ? 116 ALA B N    1 
ATOM   5257 C CA   . ALA B 1 116 ? 13.460  28.997 -42.217 1.00 27.81 ? 116 ALA B CA   1 
ATOM   5258 C C    . ALA B 1 116 ? 14.795  28.641 -41.557 1.00 27.62 ? 116 ALA B C    1 
ATOM   5259 O O    . ALA B 1 116 ? 15.536  27.810 -42.073 1.00 31.41 ? 116 ALA B O    1 
ATOM   5260 C CB   . ALA B 1 116 ? 13.635  30.212 -43.171 1.00 25.43 ? 116 ALA B CB   1 
ATOM   5261 H H    . ALA B 1 116 ? 11.899  30.093 -41.278 1.00 0.00  ? 116 ALA B H    1 
ATOM   5262 N N    . ARG B 1 117 ? 15.148  29.309 -40.467 1.00 27.29 ? 117 ARG B N    1 
ATOM   5263 C CA   . ARG B 1 117 ? 16.398  29.011 -39.752 1.00 26.18 ? 117 ARG B CA   1 
ATOM   5264 C C    . ARG B 1 117 ? 16.434  27.539 -39.280 1.00 27.73 ? 117 ARG B C    1 
ATOM   5265 O O    . ARG B 1 117 ? 17.487  27.056 -38.868 1.00 29.27 ? 117 ARG B O    1 
ATOM   5266 C CB   . ARG B 1 117 ? 16.588  29.977 -38.577 1.00 22.86 ? 117 ARG B CB   1 
ATOM   5267 C CG   . ARG B 1 117 ? 16.495  31.426 -39.000 1.00 24.25 ? 117 ARG B CG   1 
ATOM   5268 C CD   . ARG B 1 117 ? 16.275  32.421 -37.848 1.00 27.48 ? 117 ARG B CD   1 
ATOM   5269 N NE   . ARG B 1 117 ? 16.855  33.742 -38.180 1.00 29.12 ? 117 ARG B NE   1 
ATOM   5270 C CZ   . ARG B 1 117 ? 16.931  34.795 -37.355 1.00 31.27 ? 117 ARG B CZ   1 
ATOM   5271 N NH1  . ARG B 1 117 ? 16.456  34.754 -36.118 1.00 31.16 ? 117 ARG B NH1  1 
ATOM   5272 N NH2  . ARG B 1 117 ? 17.552  35.890 -37.766 1.00 31.83 ? 117 ARG B NH2  1 
ATOM   5273 H H    . ARG B 1 117 ? 14.569  30.036 -40.142 1.00 0.00  ? 117 ARG B H    1 
ATOM   5274 H HE   . ARG B 1 117 ? 17.212  33.808 -39.091 1.00 0.00  ? 117 ARG B HE   1 
ATOM   5275 H HH11 . ARG B 1 117 ? 16.014  33.924 -35.778 1.00 0.00  ? 117 ARG B HH11 1 
ATOM   5276 H HH12 . ARG B 1 117 ? 16.557  35.544 -35.481 1.00 0.00  ? 117 ARG B HH12 1 
ATOM   5277 H HH21 . ARG B 1 117 ? 17.948  35.971 -38.676 1.00 0.00  ? 117 ARG B HH21 1 
ATOM   5278 H HH22 . ARG B 1 117 ? 17.587  36.690 -37.143 1.00 0.00  ? 117 ARG B HH22 1 
ATOM   5279 N N    . GLU B 1 118 ? 15.281  26.857 -39.294 1.00 29.98 ? 118 GLU B N    1 
ATOM   5280 C CA   . GLU B 1 118 ? 15.198  25.426 -38.939 1.00 33.91 ? 118 GLU B CA   1 
ATOM   5281 C C    . GLU B 1 118 ? 15.357  24.612 -40.228 1.00 36.36 ? 118 GLU B C    1 
ATOM   5282 O O    . GLU B 1 118 ? 16.121  23.644 -40.289 1.00 36.50 ? 118 GLU B O    1 
ATOM   5283 C CB   . GLU B 1 118 ? 13.864  25.030 -38.300 1.00 33.63 ? 118 GLU B CB   1 
ATOM   5284 C CG   . GLU B 1 118 ? 12.974  26.146 -37.847 1.00 37.64 ? 118 GLU B CG   1 
ATOM   5285 C CD   . GLU B 1 118 ? 11.628  25.640 -37.350 1.00 42.69 ? 118 GLU B CD   1 
ATOM   5286 O OE1  . GLU B 1 118 ? 11.043  24.749 -38.001 1.00 46.27 ? 118 GLU B OE1  1 
ATOM   5287 O OE2  . GLU B 1 118 ? 11.140  26.127 -36.303 1.00 46.46 ? 118 GLU B OE2  1 
ATOM   5288 H H    . GLU B 1 118 ? 14.447  27.337 -39.469 1.00 0.00  ? 118 GLU B H    1 
ATOM   5289 N N    . LYS B 1 119 ? 14.629  25.009 -41.260 1.00 39.80 ? 119 LYS B N    1 
ATOM   5290 C CA   . LYS B 1 119 ? 14.710  24.353 -42.554 1.00 44.55 ? 119 LYS B CA   1 
ATOM   5291 C C    . LYS B 1 119 ? 16.165  24.351 -43.076 1.00 47.91 ? 119 LYS B C    1 
ATOM   5292 O O    . LYS B 1 119 ? 16.593  23.402 -43.748 1.00 49.32 ? 119 LYS B O    1 
ATOM   5293 C CB   . LYS B 1 119 ? 13.753  25.050 -43.523 1.00 42.83 ? 119 LYS B CB   1 
ATOM   5294 C CG   . LYS B 1 119 ? 13.960  24.766 -45.009 1.00 41.64 ? 119 LYS B CG   1 
ATOM   5295 C CD   . LYS B 1 119 ? 12.883  25.482 -45.854 1.00 40.95 ? 119 LYS B CD   1 
ATOM   5296 C CE   . LYS B 1 119 ? 12.438  26.826 -45.214 1.00 40.76 ? 119 LYS B CE   1 
ATOM   5297 N NZ   . LYS B 1 119 ? 11.404  27.586 -45.969 1.00 40.78 ? 119 LYS B NZ   1 
ATOM   5298 H H    . LYS B 1 119 ? 13.969  25.719 -41.095 1.00 0.00  ? 119 LYS B H    1 
ATOM   5299 H HZ1  . LYS B 1 119 ? 11.716  27.808 -46.934 1.00 0.00  ? 119 LYS B HZ1  1 
ATOM   5300 H HZ2  . LYS B 1 119 ? 10.519  27.036 -46.084 1.00 0.00  ? 119 LYS B HZ2  1 
ATOM   5301 H HZ3  . LYS B 1 119 ? 11.143  28.468 -45.492 1.00 0.00  ? 119 LYS B HZ3  1 
ATOM   5302 N N    . ALA B 1 120 ? 16.926  25.390 -42.729 1.00 55.82 ? 120 ALA B N    1 
ATOM   5303 C CA   . ALA B 1 120 ? 18.324  25.516 -43.134 1.00 63.90 ? 120 ALA B CA   1 
ATOM   5304 C C    . ALA B 1 120 ? 19.309  24.630 -42.351 1.00 67.28 ? 120 ALA B C    1 
ATOM   5305 O O    . ALA B 1 120 ? 20.490  24.568 -42.702 1.00 69.61 ? 120 ALA B O    1 
ATOM   5306 C CB   . ALA B 1 120 ? 18.756  26.975 -43.058 1.00 73.76 ? 120 ALA B CB   1 
ATOM   5307 H H    . ALA B 1 120 ? 16.493  26.144 -42.270 1.00 0.00  ? 120 ALA B H    1 
ATOM   5308 N N    . ARG B 1 121 ? 18.846  23.986 -41.277 1.00 73.79 ? 121 ARG B N    1 
ATOM   5309 C CA   . ARG B 1 121 ? 19.693  23.109 -40.450 1.00 75.63 ? 121 ARG B CA   1 
ATOM   5310 C C    . ARG B 1 121 ? 19.138  21.671 -40.406 1.00 78.36 ? 121 ARG B C    1 
ATOM   5311 O O    . ARG B 1 121 ? 19.895  20.690 -40.306 1.00 84.52 ? 121 ARG B O    1 
ATOM   5312 C CB   . ARG B 1 121 ? 19.813  23.661 -39.021 1.00 79.91 ? 121 ARG B CB   1 
ATOM   5313 C CG   . ARG B 1 121 ? 20.890  24.735 -38.798 1.00 82.78 ? 121 ARG B CG   1 
ATOM   5314 C CD   . ARG B 1 121 ? 20.588  26.049 -39.507 1.00 85.88 ? 121 ARG B CD   1 
ATOM   5315 N NE   . ARG B 1 121 ? 21.317  27.173 -38.918 1.00 88.27 ? 121 ARG B NE   1 
ATOM   5316 C CZ   . ARG B 1 121 ? 21.283  28.418 -39.387 1.00 93.46 ? 121 ARG B CZ   1 
ATOM   5317 N NH1  . ARG B 1 121 ? 20.561  28.707 -40.461 1.00 92.91 ? 121 ARG B NH1  1 
ATOM   5318 N NH2  . ARG B 1 121 ? 21.947  29.385 -38.765 1.00 92.92 ? 121 ARG B NH2  1 
ATOM   5319 H H    . ARG B 1 121 ? 17.898  24.055 -41.036 1.00 0.00  ? 121 ARG B H    1 
ATOM   5320 H HE   . ARG B 1 121 ? 21.839  26.976 -38.111 1.00 0.00  ? 121 ARG B HE   1 
ATOM   5321 H HH11 . ARG B 1 121 ? 20.032  28.004 -40.932 1.00 0.00  ? 121 ARG B HH11 1 
ATOM   5322 H HH12 . ARG B 1 121 ? 20.517  29.658 -40.784 1.00 0.00  ? 121 ARG B HH12 1 
ATOM   5323 H HH21 . ARG B 1 121 ? 22.480  29.238 -37.934 1.00 0.00  ? 121 ARG B HH21 1 
ATOM   5324 H HH22 . ARG B 1 121 ? 21.870  30.318 -39.137 1.00 0.00  ? 121 ARG B HH22 1 
ATOM   5325 N N    . GLY B 1 122 ? 17.809  21.568 -40.433 1.00 76.47 ? 122 GLY B N    1 
ATOM   5326 C CA   . GLY B 1 122 ? 17.133  20.285 -40.412 1.00 78.59 ? 122 GLY B CA   1 
ATOM   5327 C C    . GLY B 1 122 ? 17.579  19.346 -39.308 1.00 80.86 ? 122 GLY B C    1 
ATOM   5328 O O    . GLY B 1 122 ? 17.219  19.522 -38.143 1.00 89.93 ? 122 GLY B O    1 
ATOM   5329 H H    . GLY B 1 122 ? 17.232  22.372 -40.425 1.00 0.00  ? 122 GLY B H    1 
ATOM   5330 N N    . ALA B 1 123 ? 18.421  18.383 -39.677 1.00 83.36 ? 123 ALA B N    1 
ATOM   5331 C CA   . ALA B 1 123 ? 18.930  17.369 -38.752 1.00 85.21 ? 123 ALA B CA   1 
ATOM   5332 C C    . ALA B 1 123 ? 19.500  17.957 -37.472 1.00 86.02 ? 123 ALA B C    1 
ATOM   5333 O O    . ALA B 1 123 ? 19.484  17.309 -36.425 1.00 86.63 ? 123 ALA B O    1 
ATOM   5334 C CB   . ALA B 1 123 ? 19.967  16.495 -39.442 1.00 94.71 ? 123 ALA B CB   1 
ATOM   5335 H H    . ALA B 1 123 ? 18.751  18.397 -40.602 1.00 0.00  ? 123 ALA B H    1 
ATOM   5336 N N    . LYS B 1 124 ? 20.041  19.165 -37.564 1.00 86.64 ? 124 LYS B N    1 
ATOM   5337 C CA   . LYS B 1 124 ? 20.580  19.820 -36.385 1.00 86.87 ? 124 LYS B CA   1 
ATOM   5338 C C    . LYS B 1 124 ? 19.753  21.056 -36.072 1.00 87.19 ? 124 LYS B C    1 
ATOM   5339 O O    . LYS B 1 124 ? 20.296  22.112 -35.744 1.00 88.14 ? 124 LYS B O    1 
ATOM   5340 C CB   . LYS B 1 124 ? 22.047  20.198 -36.573 1.00 86.30 ? 124 LYS B CB   1 
ATOM   5341 C CG   . LYS B 1 124 ? 22.727  20.584 -35.263 1.00 88.65 ? 124 LYS B CG   1 
ATOM   5342 C CD   . LYS B 1 124 ? 24.048  21.270 -35.507 1.00 90.09 ? 124 LYS B CD   1 
ATOM   5343 C CE   . LYS B 1 124 ? 25.017  20.349 -36.213 1.00 95.74 ? 124 LYS B CE   1 
ATOM   5344 N NZ   . LYS B 1 124 ? 26.052  21.136 -36.929 1.00 99.46 ? 124 LYS B NZ   1 
ATOM   5345 H H    . LYS B 1 124 ? 20.097  19.613 -38.440 1.00 0.00  ? 124 LYS B H    1 
ATOM   5346 H HZ1  . LYS B 1 124 ? 26.564  21.772 -36.288 1.00 0.00  ? 124 LYS B HZ1  1 
ATOM   5347 H HZ2  . LYS B 1 124 ? 26.710  20.503 -37.414 1.00 0.00  ? 124 LYS B HZ2  1 
ATOM   5348 H HZ3  . LYS B 1 124 ? 25.562  21.727 -37.647 1.00 0.00  ? 124 LYS B HZ3  1 
ATOM   5349 N N    . ALA B 1 125 ? 18.440  20.949 -36.252 1.00 87.26 ? 125 ALA B N    1 
ATOM   5350 C CA   . ALA B 1 125 ? 17.565  22.067 -35.943 1.00 87.37 ? 125 ALA B CA   1 
ATOM   5351 C C    . ALA B 1 125 ? 17.643  22.211 -34.430 1.00 87.42 ? 125 ALA B C    1 
ATOM   5352 O O    . ALA B 1 125 ? 17.646  21.208 -33.701 1.00 87.16 ? 125 ALA B O    1 
ATOM   5353 C CB   . ALA B 1 125 ? 16.135  21.774 -36.380 1.00 93.22 ? 125 ALA B CB   1 
ATOM   5354 H H    . ALA B 1 125 ? 18.043  20.118 -36.602 1.00 0.00  ? 125 ALA B H    1 
ATOM   5355 N N    . ILE B 1 126 ? 17.721  23.453 -33.955 1.00 86.66 ? 126 ILE B N    1 
ATOM   5356 C CA   . ILE B 1 126 ? 17.808  23.704 -32.520 1.00 84.73 ? 126 ILE B CA   1 
ATOM   5357 C C    . ILE B 1 126 ? 16.459  23.392 -31.879 1.00 72.37 ? 126 ILE B C    1 
ATOM   5358 O O    . ILE B 1 126 ? 16.309  23.522 -30.654 1.00 72.22 ? 126 ILE B O    1 
ATOM   5359 C CB   . ILE B 1 126 ? 18.245  25.162 -32.211 1.00 86.24 ? 126 ILE B CB   1 
ATOM   5360 C CG1  . ILE B 1 126 ? 19.489  25.522 -33.030 1.00 94.10 ? 126 ILE B CG1  1 
ATOM   5361 C CG2  . ILE B 1 126 ? 18.585  25.307 -30.727 1.00 90.14 ? 126 ILE B CG2  1 
ATOM   5362 C CD1  . ILE B 1 126 ? 20.023  26.919 -32.764 1.00 93.87 ? 126 ILE B CD1  1 
ATOM   5363 H H    . ILE B 1 126 ? 17.713  24.202 -34.576 1.00 0.00  ? 126 ILE B H    1 
ATOM   5364 N N    . GLY B 1 127 ? 15.507  22.953 -32.679 1.00 77.43 ? 127 GLY B N    1 
ATOM   5365 C CA   . GLY B 1 127 ? 14.195  22.635 -32.165 1.00 80.16 ? 127 GLY B CA   1 
ATOM   5366 C C    . GLY B 1 127 ? 13.543  23.893 -31.626 1.00 75.99 ? 127 GLY B C    1 
ATOM   5367 O O    . GLY B 1 127 ? 14.192  24.733 -30.998 1.00 78.74 ? 127 GLY B O    1 
ATOM   5368 H H    . GLY B 1 127 ? 15.675  22.859 -33.618 1.00 0.00  ? 127 GLY B H    1 
ATOM   5369 N N    . THR B 1 128 ? 12.249  24.045 -31.864 1.00 73.47 ? 128 THR B N    1 
ATOM   5370 C CA   . THR B 1 128 ? 11.609  25.243 -31.355 1.00 71.31 ? 128 THR B CA   1 
ATOM   5371 C C    . THR B 1 128 ? 10.214  25.006 -30.831 1.00 73.24 ? 128 THR B C    1 
ATOM   5372 O O    . THR B 1 128 ? 9.545   24.044 -31.209 1.00 60.35 ? 128 THR B O    1 
ATOM   5373 C CB   . THR B 1 128 ? 11.558  26.355 -32.412 1.00 75.29 ? 128 THR B CB   1 
ATOM   5374 O OG1  . THR B 1 128 ? 11.126  27.579 -31.801 1.00 80.50 ? 128 THR B OG1  1 
ATOM   5375 C CG2  . THR B 1 128 ? 10.593  25.983 -33.486 1.00 78.69 ? 128 THR B CG2  1 
ATOM   5376 H H    . THR B 1 128 ? 11.702  23.372 -32.336 1.00 0.00  ? 128 THR B H    1 
ATOM   5377 H HG1  . THR B 1 128 ? 11.264  28.273 -32.453 1.00 0.00  ? 128 THR B HG1  1 
ATOM   5378 N N    . THR B 1 129 ? 9.790   25.906 -29.956 1.00 64.58 ? 129 THR B N    1 
ATOM   5379 C CA   . THR B 1 129 ? 8.462   25.839 -29.366 1.00 60.68 ? 129 THR B CA   1 
ATOM   5380 C C    . THR B 1 129 ? 7.617   27.025 -29.868 1.00 57.16 ? 129 THR B C    1 
ATOM   5381 O O    . THR B 1 129 ? 6.973   26.944 -30.918 1.00 57.36 ? 129 THR B O    1 
ATOM   5382 C CB   . THR B 1 129 ? 8.547   25.831 -27.814 1.00 65.96 ? 129 THR B CB   1 
ATOM   5383 O OG1  . THR B 1 129 ? 9.402   26.895 -27.368 1.00 71.86 ? 129 THR B OG1  1 
ATOM   5384 C CG2  . THR B 1 129 ? 9.112   24.500 -27.318 1.00 70.85 ? 129 THR B CG2  1 
ATOM   5385 H H    . THR B 1 129 ? 10.384  26.661 -29.747 1.00 0.00  ? 129 THR B H    1 
ATOM   5386 H HG1  . THR B 1 129 ? 10.308  26.541 -27.460 1.00 0.00  ? 129 THR B HG1  1 
ATOM   5387 N N    . GLY B 1 130 ? 7.751   28.163 -29.194 1.00 53.12 ? 130 GLY B N    1 
ATOM   5388 C CA   . GLY B 1 130 ? 6.983   29.348 -29.526 1.00 47.48 ? 130 GLY B CA   1 
ATOM   5389 C C    . GLY B 1 130 ? 7.140   30.114 -30.820 1.00 44.38 ? 130 GLY B C    1 
ATOM   5390 O O    . GLY B 1 130 ? 6.628   31.205 -30.890 1.00 48.40 ? 130 GLY B O    1 
ATOM   5391 H H    . GLY B 1 130 ? 8.371   28.166 -28.435 1.00 0.00  ? 130 GLY B H    1 
ATOM   5392 N N    . ARG B 1 131 ? 7.916   29.653 -31.782 1.00 35.56 ? 131 ARG B N    1 
ATOM   5393 C CA   . ARG B 1 131 ? 8.029   30.349 -33.083 1.00 28.84 ? 131 ARG B CA   1 
ATOM   5394 C C    . ARG B 1 131 ? 7.953   31.903 -33.174 1.00 24.49 ? 131 ARG B C    1 
ATOM   5395 O O    . ARG B 1 131 ? 6.893   32.527 -32.957 1.00 20.93 ? 131 ARG B O    1 
ATOM   5396 C CB   . ARG B 1 131 ? 7.010   29.737 -34.051 1.00 33.09 ? 131 ARG B CB   1 
ATOM   5397 C CG   . ARG B 1 131 ? 7.120   28.215 -34.166 1.00 37.37 ? 131 ARG B CG   1 
ATOM   5398 C CD   . ARG B 1 131 ? 8.080   27.783 -35.263 1.00 39.34 ? 131 ARG B CD   1 
ATOM   5399 N NE   . ARG B 1 131 ? 8.398   26.350 -35.212 1.00 43.87 ? 131 ARG B NE   1 
ATOM   5400 C CZ   . ARG B 1 131 ? 7.516   25.336 -35.185 1.00 45.83 ? 131 ARG B CZ   1 
ATOM   5401 N NH1  . ARG B 1 131 ? 6.196   25.542 -35.227 1.00 47.77 ? 131 ARG B NH1  1 
ATOM   5402 N NH2  . ARG B 1 131 ? 7.971   24.093 -35.059 1.00 45.38 ? 131 ARG B NH2  1 
ATOM   5403 H H    . ARG B 1 131 ? 8.447   28.846 -31.625 1.00 0.00  ? 131 ARG B H    1 
ATOM   5404 H HE   . ARG B 1 131 ? 9.355   26.163 -35.338 1.00 0.00  ? 131 ARG B HE   1 
ATOM   5405 H HH11 . ARG B 1 131 ? 5.843   26.472 -35.302 1.00 0.00  ? 131 ARG B HH11 1 
ATOM   5406 H HH12 . ARG B 1 131 ? 5.537   24.787 -35.227 1.00 0.00  ? 131 ARG B HH12 1 
ATOM   5407 H HH21 . ARG B 1 131 ? 8.969   23.944 -34.984 1.00 0.00  ? 131 ARG B HH21 1 
ATOM   5408 H HH22 . ARG B 1 131 ? 7.380   23.295 -35.016 1.00 0.00  ? 131 ARG B HH22 1 
ATOM   5409 N N    . GLY B 1 132 ? 9.077   32.507 -33.559 1.00 20.04 ? 132 GLY B N    1 
ATOM   5410 C CA   . GLY B 1 132 ? 9.147   33.957 -33.678 1.00 17.43 ? 132 GLY B CA   1 
ATOM   5411 C C    . GLY B 1 132 ? 9.602   34.700 -32.446 1.00 17.26 ? 132 GLY B C    1 
ATOM   5412 O O    . GLY B 1 132 ? 9.942   35.865 -32.495 1.00 16.94 ? 132 GLY B O    1 
ATOM   5413 H H    . GLY B 1 132 ? 9.907   32.001 -33.747 1.00 0.00  ? 132 GLY B H    1 
ATOM   5414 N N    . ILE B 1 133 ? 9.497   34.031 -31.294 1.00 16.47 ? 133 ILE B N    1 
ATOM   5415 C CA   . ILE B 1 133 ? 9.920   34.623 -30.038 1.00 12.51 ? 133 ILE B CA   1 
ATOM   5416 C C    . ILE B 1 133 ? 11.245  35.414 -30.344 1.00 10.44 ? 133 ILE B C    1 
ATOM   5417 O O    . ILE B 1 133 ? 11.233  36.641 -30.431 1.00 6.45  ? 133 ILE B O    1 
ATOM   5418 C CB   . ILE B 1 133 ? 10.112  33.468 -28.977 1.00 14.38 ? 133 ILE B CB   1 
ATOM   5419 C CG1  . ILE B 1 133 ? 8.882   32.498 -29.012 1.00 12.43 ? 133 ILE B CG1  1 
ATOM   5420 C CG2  . ILE B 1 133 ? 10.451  34.028 -27.596 1.00 12.92 ? 133 ILE B CG2  1 
ATOM   5421 C CD1  . ILE B 1 133 ? 7.892   32.460 -27.838 1.00 5.96  ? 133 ILE B CD1  1 
ATOM   5422 H H    . ILE B 1 133 ? 9.048   33.158 -31.309 1.00 0.00  ? 133 ILE B H    1 
ATOM   5423 N N    . GLY B 1 134 ? 12.334  34.715 -30.668 1.00 11.28 ? 134 GLY B N    1 
ATOM   5424 C CA   . GLY B 1 134 ? 13.607  35.380 -30.977 1.00 11.19 ? 134 GLY B CA   1 
ATOM   5425 C C    . GLY B 1 134 ? 13.625  36.526 -32.007 1.00 10.85 ? 134 GLY B C    1 
ATOM   5426 O O    . GLY B 1 134 ? 14.085  37.622 -31.684 1.00 9.70  ? 134 GLY B O    1 
ATOM   5427 H H    . GLY B 1 134 ? 12.279  33.740 -30.698 1.00 0.00  ? 134 GLY B H    1 
ATOM   5428 N N    . PRO B 1 135 ? 13.232  36.289 -33.275 1.00 9.90  ? 135 PRO B N    1 
ATOM   5429 C CA   . PRO B 1 135 ? 13.244  37.387 -34.238 1.00 10.26 ? 135 PRO B CA   1 
ATOM   5430 C C    . PRO B 1 135 ? 12.458  38.666 -33.772 1.00 12.57 ? 135 PRO B C    1 
ATOM   5431 O O    . PRO B 1 135 ? 12.576  39.742 -34.390 1.00 16.89 ? 135 PRO B O    1 
ATOM   5432 C CB   . PRO B 1 135 ? 12.688  36.730 -35.518 1.00 7.18  ? 135 PRO B CB   1 
ATOM   5433 C CG   . PRO B 1 135 ? 12.135  35.390 -35.108 1.00 5.01  ? 135 PRO B CG   1 
ATOM   5434 C CD   . PRO B 1 135 ? 12.979  34.998 -33.958 1.00 9.22  ? 135 PRO B CD   1 
ATOM   5435 N N    . ALA B 1 136 ? 11.649  38.554 -32.716 1.00 9.69  ? 136 ALA B N    1 
ATOM   5436 C CA   . ALA B 1 136 ? 10.979  39.733 -32.181 1.00 10.19 ? 136 ALA B CA   1 
ATOM   5437 C C    . ALA B 1 136 ? 12.014  40.483 -31.299 1.00 11.67 ? 136 ALA B C    1 
ATOM   5438 O O    . ALA B 1 136 ? 12.033  41.715 -31.218 1.00 14.17 ? 136 ALA B O    1 
ATOM   5439 C CB   . ALA B 1 136 ? 9.777   39.339 -31.328 1.00 5.31  ? 136 ALA B CB   1 
ATOM   5440 H H    . ALA B 1 136 ? 11.438  37.688 -32.297 1.00 0.00  ? 136 ALA B H    1 
ATOM   5441 N N    . TYR B 1 137 ? 12.851  39.727 -30.605 1.00 11.38 ? 137 TYR B N    1 
ATOM   5442 C CA   . TYR B 1 137 ? 13.823  40.334 -29.731 1.00 10.76 ? 137 TYR B CA   1 
ATOM   5443 C C    . TYR B 1 137 ? 14.846  41.050 -30.589 1.00 13.34 ? 137 TYR B C    1 
ATOM   5444 O O    . TYR B 1 137 ? 15.092  42.251 -30.395 1.00 14.52 ? 137 TYR B O    1 
ATOM   5445 C CB   . TYR B 1 137 ? 14.432  39.280 -28.795 1.00 6.79  ? 137 TYR B CB   1 
ATOM   5446 C CG   . TYR B 1 137 ? 13.601  39.025 -27.550 1.00 7.05  ? 137 TYR B CG   1 
ATOM   5447 C CD1  . TYR B 1 137 ? 13.220  40.068 -26.734 1.00 5.27  ? 137 TYR B CD1  1 
ATOM   5448 C CD2  . TYR B 1 137 ? 13.190  37.743 -27.196 1.00 5.01  ? 137 TYR B CD2  1 
ATOM   5449 C CE1  . TYR B 1 137 ? 12.439  39.847 -25.596 1.00 5.23  ? 137 TYR B CE1  1 
ATOM   5450 C CE2  . TYR B 1 137 ? 12.435  37.513 -26.065 1.00 5.01  ? 137 TYR B CE2  1 
ATOM   5451 C CZ   . TYR B 1 137 ? 12.048  38.573 -25.258 1.00 6.00  ? 137 TYR B CZ   1 
ATOM   5452 O OH   . TYR B 1 137 ? 11.264  38.369 -24.122 1.00 5.01  ? 137 TYR B OH   1 
ATOM   5453 H H    . TYR B 1 137 ? 12.794  38.754 -30.703 1.00 0.00  ? 137 TYR B H    1 
ATOM   5454 H HH   . TYR B 1 137 ? 10.759  39.142 -23.812 1.00 0.00  ? 137 TYR B HH   1 
ATOM   5455 N N    . GLU B 1 138 ? 15.387  40.364 -31.591 1.00 12.79 ? 138 GLU B N    1 
ATOM   5456 C CA   . GLU B 1 138 ? 16.357  41.023 -32.466 1.00 11.29 ? 138 GLU B CA   1 
ATOM   5457 C C    . GLU B 1 138 ? 15.707  42.336 -32.959 1.00 8.51  ? 138 GLU B C    1 
ATOM   5458 O O    . GLU B 1 138 ? 16.197  43.409 -32.644 1.00 12.31 ? 138 GLU B O    1 
ATOM   5459 C CB   . GLU B 1 138 ? 16.727  40.111 -33.657 1.00 11.81 ? 138 GLU B CB   1 
ATOM   5460 C CG   . GLU B 1 138 ? 16.741  38.580 -33.312 1.00 7.00  ? 138 GLU B CG   1 
ATOM   5461 C CD   . GLU B 1 138 ? 17.183  37.706 -34.477 1.00 9.93  ? 138 GLU B CD   1 
ATOM   5462 O OE1  . GLU B 1 138 ? 17.566  38.191 -35.562 1.00 14.51 ? 138 GLU B OE1  1 
ATOM   5463 O OE2  . GLU B 1 138 ? 17.133  36.485 -34.336 1.00 11.45 ? 138 GLU B OE2  1 
ATOM   5464 H H    . GLU B 1 138 ? 15.102  39.434 -31.705 1.00 0.00  ? 138 GLU B H    1 
ATOM   5465 N N    . ASP B 1 139 ? 14.544  42.243 -33.606 1.00 11.42 ? 139 ASP B N    1 
ATOM   5466 C CA   . ASP B 1 139 ? 13.822  43.416 -34.143 1.00 12.72 ? 139 ASP B CA   1 
ATOM   5467 C C    . ASP B 1 139 ? 13.682  44.543 -33.108 1.00 13.10 ? 139 ASP B C    1 
ATOM   5468 O O    . ASP B 1 139 ? 13.796  45.719 -33.462 1.00 12.95 ? 139 ASP B O    1 
ATOM   5469 C CB   . ASP B 1 139 ? 12.446  43.029 -34.721 1.00 14.24 ? 139 ASP B CB   1 
ATOM   5470 C CG   . ASP B 1 139 ? 12.509  42.635 -36.192 1.00 16.74 ? 139 ASP B CG   1 
ATOM   5471 O OD1  . ASP B 1 139 ? 13.602  42.661 -36.801 1.00 22.53 ? 139 ASP B OD1  1 
ATOM   5472 O OD2  . ASP B 1 139 ? 11.455  42.316 -36.784 1.00 17.59 ? 139 ASP B OD2  1 
ATOM   5473 H H    . ASP B 1 139 ? 14.153  41.357 -33.770 1.00 0.00  ? 139 ASP B H    1 
ATOM   5474 N N    . LYS B 1 140 ? 13.511  44.186 -31.835 1.00 14.13 ? 140 LYS B N    1 
ATOM   5475 C CA   . LYS B 1 140 ? 13.411  45.186 -30.769 1.00 17.32 ? 140 LYS B CA   1 
ATOM   5476 C C    . LYS B 1 140 ? 14.728  45.861 -30.377 1.00 15.36 ? 140 LYS B C    1 
ATOM   5477 O O    . LYS B 1 140 ? 14.735  47.015 -29.937 1.00 17.34 ? 140 LYS B O    1 
ATOM   5478 C CB   . LYS B 1 140 ? 12.851  44.592 -29.464 1.00 19.55 ? 140 LYS B CB   1 
ATOM   5479 C CG   . LYS B 1 140 ? 12.491  45.675 -28.442 1.00 18.87 ? 140 LYS B CG   1 
ATOM   5480 C CD   . LYS B 1 140 ? 12.430  45.152 -27.029 1.00 22.18 ? 140 LYS B CD   1 
ATOM   5481 C CE   . LYS B 1 140 ? 13.782  45.287 -26.313 1.00 25.83 ? 140 LYS B CE   1 
ATOM   5482 N NZ   . LYS B 1 140 ? 13.688  45.066 -24.833 1.00 25.51 ? 140 LYS B NZ   1 
ATOM   5483 H H    . LYS B 1 140 ? 13.408  43.242 -31.602 1.00 0.00  ? 140 LYS B H    1 
ATOM   5484 H HZ1  . LYS B 1 140 ? 13.021  45.745 -24.395 1.00 0.00  ? 140 LYS B HZ1  1 
ATOM   5485 H HZ2  . LYS B 1 140 ? 13.336  44.109 -24.623 1.00 0.00  ? 140 LYS B HZ2  1 
ATOM   5486 H HZ3  . LYS B 1 140 ? 14.615  45.183 -24.376 1.00 0.00  ? 140 LYS B HZ3  1 
ATOM   5487 N N    . VAL B 1 141 ? 15.826  45.116 -30.393 1.00 13.38 ? 141 VAL B N    1 
ATOM   5488 C CA   . VAL B 1 141 ? 17.074  45.730 -29.959 1.00 12.48 ? 141 VAL B CA   1 
ATOM   5489 C C    . VAL B 1 141 ? 17.753  46.445 -31.128 1.00 15.80 ? 141 VAL B C    1 
ATOM   5490 O O    . VAL B 1 141 ? 18.587  47.337 -30.924 1.00 16.77 ? 141 VAL B O    1 
ATOM   5491 C CB   . VAL B 1 141 ? 17.977  44.734 -29.152 1.00 7.34  ? 141 VAL B CB   1 
ATOM   5492 C CG1  . VAL B 1 141 ? 17.106  43.751 -28.334 1.00 9.45  ? 141 VAL B CG1  1 
ATOM   5493 C CG2  . VAL B 1 141 ? 18.887  43.976 -30.035 1.00 7.99  ? 141 VAL B CG2  1 
ATOM   5494 H H    . VAL B 1 141 ? 15.759  44.168 -30.644 1.00 0.00  ? 141 VAL B H    1 
ATOM   5495 N N    . ALA B 1 142 ? 17.417  46.047 -32.355 1.00 16.16 ? 142 ALA B N    1 
ATOM   5496 C CA   . ALA B 1 142 ? 17.970  46.750 -33.512 1.00 17.90 ? 142 ALA B CA   1 
ATOM   5497 C C    . ALA B 1 142 ? 17.094  47.984 -33.768 1.00 16.39 ? 142 ALA B C    1 
ATOM   5498 O O    . ALA B 1 142 ? 17.334  48.732 -34.698 1.00 17.81 ? 142 ALA B O    1 
ATOM   5499 C CB   . ALA B 1 142 ? 18.021  45.874 -34.747 1.00 17.44 ? 142 ALA B CB   1 
ATOM   5500 H H    . ALA B 1 142 ? 16.875  45.233 -32.460 1.00 0.00  ? 142 ALA B H    1 
ATOM   5501 N N    . ARG B 1 143 ? 16.088  48.173 -32.919 1.00 13.89 ? 143 ARG B N    1 
ATOM   5502 C CA   . ARG B 1 143 ? 15.163  49.293 -32.994 1.00 14.39 ? 143 ARG B CA   1 
ATOM   5503 C C    . ARG B 1 143 ? 14.334  49.369 -34.268 1.00 14.82 ? 143 ARG B C    1 
ATOM   5504 O O    . ARG B 1 143 ? 13.743  50.412 -34.573 1.00 13.39 ? 143 ARG B O    1 
ATOM   5505 C CB   . ARG B 1 143 ? 15.890  50.613 -32.719 1.00 18.82 ? 143 ARG B CB   1 
ATOM   5506 C CG   . ARG B 1 143 ? 16.847  50.503 -31.518 1.00 23.72 ? 143 ARG B CG   1 
ATOM   5507 C CD   . ARG B 1 143 ? 16.684  51.609 -30.530 1.00 23.02 ? 143 ARG B CD   1 
ATOM   5508 N NE   . ARG B 1 143 ? 17.545  52.760 -30.832 1.00 27.52 ? 143 ARG B NE   1 
ATOM   5509 C CZ   . ARG B 1 143 ? 17.167  53.831 -31.532 1.00 27.13 ? 143 ARG B CZ   1 
ATOM   5510 N NH1  . ARG B 1 143 ? 15.950  53.927 -32.065 1.00 27.01 ? 143 ARG B NH1  1 
ATOM   5511 N NH2  . ARG B 1 143 ? 17.938  54.894 -31.509 1.00 29.07 ? 143 ARG B NH2  1 
ATOM   5512 H H    . ARG B 1 143 ? 15.933  47.529 -32.201 1.00 0.00  ? 143 ARG B H    1 
ATOM   5513 H HE   . ARG B 1 143 ? 18.475  52.706 -30.518 1.00 0.00  ? 143 ARG B HE   1 
ATOM   5514 H HH11 . ARG B 1 143 ? 15.258  53.202 -31.945 1.00 0.00  ? 143 ARG B HH11 1 
ATOM   5515 H HH12 . ARG B 1 143 ? 15.701  54.722 -32.617 1.00 0.00  ? 143 ARG B HH12 1 
ATOM   5516 H HH21 . ARG B 1 143 ? 18.778  54.885 -30.971 1.00 0.00  ? 143 ARG B HH21 1 
ATOM   5517 H HH22 . ARG B 1 143 ? 17.684  55.708 -32.025 1.00 0.00  ? 143 ARG B HH22 1 
ATOM   5518 N N    . ARG B 1 144 ? 14.232  48.264 -34.991 1.00 12.98 ? 144 ARG B N    1 
ATOM   5519 C CA   . ARG B 1 144 ? 13.405  48.302 -36.193 1.00 14.19 ? 144 ARG B CA   1 
ATOM   5520 C C    . ARG B 1 144 ? 11.966  47.833 -35.934 1.00 13.48 ? 144 ARG B C    1 
ATOM   5521 O O    . ARG B 1 144 ? 11.082  48.084 -36.750 1.00 11.80 ? 144 ARG B O    1 
ATOM   5522 C CB   . ARG B 1 144 ? 14.029  47.469 -37.341 1.00 12.62 ? 144 ARG B CB   1 
ATOM   5523 C CG   . ARG B 1 144 ? 13.647  46.011 -37.357 1.00 11.73 ? 144 ARG B CG   1 
ATOM   5524 C CD   . ARG B 1 144 ? 14.365  45.278 -38.462 1.00 11.40 ? 144 ARG B CD   1 
ATOM   5525 N NE   . ARG B 1 144 ? 15.242  44.217 -37.953 1.00 13.06 ? 144 ARG B NE   1 
ATOM   5526 C CZ   . ARG B 1 144 ? 16.580  44.299 -37.897 1.00 13.35 ? 144 ARG B CZ   1 
ATOM   5527 N NH1  . ARG B 1 144 ? 17.192  45.406 -38.287 1.00 7.19  ? 144 ARG B NH1  1 
ATOM   5528 N NH2  . ARG B 1 144 ? 17.319  43.219 -37.639 1.00 11.84 ? 144 ARG B NH2  1 
ATOM   5529 H H    . ARG B 1 144 ? 14.631  47.423 -34.682 1.00 0.00  ? 144 ARG B H    1 
ATOM   5530 H HE   . ARG B 1 144 ? 14.757  43.426 -37.585 1.00 0.00  ? 144 ARG B HE   1 
ATOM   5531 H HH11 . ARG B 1 144 ? 16.671  46.190 -38.625 1.00 0.00  ? 144 ARG B HH11 1 
ATOM   5532 H HH12 . ARG B 1 144 ? 18.186  45.463 -38.236 1.00 0.00  ? 144 ARG B HH12 1 
ATOM   5533 H HH21 . ARG B 1 144 ? 16.887  42.339 -37.444 1.00 0.00  ? 144 ARG B HH21 1 
ATOM   5534 H HH22 . ARG B 1 144 ? 18.325  43.230 -37.537 1.00 0.00  ? 144 ARG B HH22 1 
ATOM   5535 N N    . GLY B 1 145 ? 11.735  47.199 -34.788 1.00 12.75 ? 145 GLY B N    1 
ATOM   5536 C CA   . GLY B 1 145 ? 10.430  46.629 -34.505 1.00 9.73  ? 145 GLY B CA   1 
ATOM   5537 C C    . GLY B 1 145 ? 9.186   47.470 -34.278 1.00 7.37  ? 145 GLY B C    1 
ATOM   5538 O O    . GLY B 1 145 ? 9.175   48.649 -34.623 1.00 6.43  ? 145 GLY B O    1 
ATOM   5539 H H    . GLY B 1 145 ? 12.451  47.062 -34.136 1.00 0.00  ? 145 GLY B H    1 
ATOM   5540 N N    . LEU B 1 146 ? 8.158   46.848 -33.663 1.00 7.10  ? 146 LEU B N    1 
ATOM   5541 C CA   . LEU B 1 146 ? 6.888   47.494 -33.343 1.00 8.54  ? 146 LEU B CA   1 
ATOM   5542 C C    . LEU B 1 146 ? 6.377   47.026 -31.982 1.00 6.56  ? 146 LEU B C    1 
ATOM   5543 O O    . LEU B 1 146 ? 6.441   45.821 -31.670 1.00 5.01  ? 146 LEU B O    1 
ATOM   5544 C CB   . LEU B 1 146 ? 5.853   47.202 -34.417 1.00 6.25  ? 146 LEU B CB   1 
ATOM   5545 C CG   . LEU B 1 146 ? 6.132   47.633 -35.847 1.00 6.74  ? 146 LEU B CG   1 
ATOM   5546 C CD1  . LEU B 1 146 ? 6.120   46.428 -36.773 1.00 5.01  ? 146 LEU B CD1  1 
ATOM   5547 C CD2  . LEU B 1 146 ? 5.025   48.537 -36.290 1.00 7.61  ? 146 LEU B CD2  1 
ATOM   5548 H H    . LEU B 1 146 ? 8.276   45.916 -33.383 1.00 0.00  ? 146 LEU B H    1 
ATOM   5549 N N    . ARG B 1 147 ? 5.887   47.957 -31.168 1.00 8.98  ? 147 ARG B N    1 
ATOM   5550 C CA   . ARG B 1 147 ? 5.385   47.636 -29.836 1.00 12.65 ? 147 ARG B CA   1 
ATOM   5551 C C    . ARG B 1 147 ? 3.889   47.542 -29.981 1.00 13.26 ? 147 ARG B C    1 
ATOM   5552 O O    . ARG B 1 147 ? 3.388   47.741 -31.059 1.00 16.40 ? 147 ARG B O    1 
ATOM   5553 C CB   . ARG B 1 147 ? 5.708   48.767 -28.827 1.00 10.16 ? 147 ARG B CB   1 
ATOM   5554 C CG   . ARG B 1 147 ? 7.202   49.195 -28.690 1.00 14.23 ? 147 ARG B CG   1 
ATOM   5555 C CD   . ARG B 1 147 ? 7.420   50.329 -27.630 1.00 16.66 ? 147 ARG B CD   1 
ATOM   5556 N NE   . ARG B 1 147 ? 6.591   51.503 -27.932 1.00 18.28 ? 147 ARG B NE   1 
ATOM   5557 C CZ   . ARG B 1 147 ? 5.777   52.101 -27.059 1.00 22.89 ? 147 ARG B CZ   1 
ATOM   5558 N NH1  . ARG B 1 147 ? 5.690   51.647 -25.818 1.00 25.02 ? 147 ARG B NH1  1 
ATOM   5559 N NH2  . ARG B 1 147 ? 5.015   53.128 -27.428 1.00 21.03 ? 147 ARG B NH2  1 
ATOM   5560 H H    . ARG B 1 147 ? 5.722   48.864 -31.514 1.00 0.00  ? 147 ARG B H    1 
ATOM   5561 H HE   . ARG B 1 147 ? 6.616   51.835 -28.852 1.00 0.00  ? 147 ARG B HE   1 
ATOM   5562 H HH11 . ARG B 1 147 ? 6.224   50.866 -25.504 1.00 0.00  ? 147 ARG B HH11 1 
ATOM   5563 H HH12 . ARG B 1 147 ? 5.087   52.114 -25.171 1.00 0.00  ? 147 ARG B HH12 1 
ATOM   5564 H HH21 . ARG B 1 147 ? 5.000   53.496 -28.357 1.00 0.00  ? 147 ARG B HH21 1 
ATOM   5565 H HH22 . ARG B 1 147 ? 4.374   53.495 -26.728 1.00 0.00  ? 147 ARG B HH22 1 
ATOM   5566 N N    . VAL B 1 148 ? 3.176   47.274 -28.892 1.00 15.53 ? 148 VAL B N    1 
ATOM   5567 C CA   . VAL B 1 148 ? 1.716   47.221 -28.895 1.00 14.71 ? 148 VAL B CA   1 
ATOM   5568 C C    . VAL B 1 148 ? 1.220   48.693 -28.985 1.00 17.82 ? 148 VAL B C    1 
ATOM   5569 O O    . VAL B 1 148 ? 0.099   48.976 -29.491 1.00 18.64 ? 148 VAL B O    1 
ATOM   5570 C CB   . VAL B 1 148 ? 1.187   46.585 -27.575 1.00 15.42 ? 148 VAL B CB   1 
ATOM   5571 C CG1  . VAL B 1 148 ? -0.340  46.598 -27.531 1.00 19.10 ? 148 VAL B CG1  1 
ATOM   5572 C CG2  . VAL B 1 148 ? 1.654   45.164 -27.449 1.00 16.41 ? 148 VAL B CG2  1 
ATOM   5573 H H    . VAL B 1 148 ? 3.673   47.063 -28.075 1.00 0.00  ? 148 VAL B H    1 
ATOM   5574 N N    . GLY B 1 149 ? 2.019   49.613 -28.417 1.00 17.91 ? 149 GLY B N    1 
ATOM   5575 C CA   . GLY B 1 149 ? 1.688   51.031 -28.445 1.00 19.30 ? 149 GLY B CA   1 
ATOM   5576 C C    . GLY B 1 149 ? 1.369   51.583 -29.831 1.00 19.26 ? 149 GLY B C    1 
ATOM   5577 O O    . GLY B 1 149 ? 0.284   52.128 -30.035 1.00 22.12 ? 149 GLY B O    1 
ATOM   5578 H H    . GLY B 1 149 ? 2.833   49.316 -27.955 1.00 0.00  ? 149 GLY B H    1 
ATOM   5579 N N    . ASP B 1 150 ? 2.244   51.341 -30.807 1.00 18.70 ? 150 ASP B N    1 
ATOM   5580 C CA   . ASP B 1 150 ? 2.064   51.837 -32.176 1.00 15.23 ? 150 ASP B CA   1 
ATOM   5581 C C    . ASP B 1 150 ? 0.704   51.612 -32.801 1.00 15.41 ? 150 ASP B C    1 
ATOM   5582 O O    . ASP B 1 150 ? 0.392   52.214 -33.838 1.00 17.02 ? 150 ASP B O    1 
ATOM   5583 C CB   . ASP B 1 150 ? 3.121   51.266 -33.117 1.00 11.68 ? 150 ASP B CB   1 
ATOM   5584 C CG   . ASP B 1 150 ? 4.445   51.227 -32.492 1.00 7.84  ? 150 ASP B CG   1 
ATOM   5585 O OD1  . ASP B 1 150 ? 5.069   52.295 -32.266 1.00 8.82  ? 150 ASP B OD1  1 
ATOM   5586 O OD2  . ASP B 1 150 ? 4.863   50.128 -32.126 1.00 10.31 ? 150 ASP B OD2  1 
ATOM   5587 H H    . ASP B 1 150 ? 3.020   50.780 -30.620 1.00 0.00  ? 150 ASP B H    1 
ATOM   5588 N N    . LEU B 1 151 ? -0.109  50.746 -32.216 1.00 14.93 ? 151 LEU B N    1 
ATOM   5589 C CA   . LEU B 1 151 ? -1.447  50.506 -32.788 1.00 18.44 ? 151 LEU B CA   1 
ATOM   5590 C C    . LEU B 1 151 ? -2.354  51.705 -32.550 1.00 18.38 ? 151 LEU B C    1 
ATOM   5591 O O    . LEU B 1 151 ? -3.313  51.899 -33.260 1.00 20.99 ? 151 LEU B O    1 
ATOM   5592 C CB   . LEU B 1 151 ? -2.094  49.253 -32.181 1.00 13.26 ? 151 LEU B CB   1 
ATOM   5593 C CG   . LEU B 1 151 ? -1.252  48.000 -32.404 1.00 13.00 ? 151 LEU B CG   1 
ATOM   5594 C CD1  . LEU B 1 151 ? -1.718  46.876 -31.481 1.00 5.01  ? 151 LEU B CD1  1 
ATOM   5595 C CD2  . LEU B 1 151 ? -1.306  47.648 -33.865 1.00 6.49  ? 151 LEU B CD2  1 
ATOM   5596 H H    . LEU B 1 151 ? 0.160   50.256 -31.410 1.00 0.00  ? 151 LEU B H    1 
ATOM   5597 N N    . PHE B 1 152 ? -2.024  52.485 -31.533 1.00 21.33 ? 152 PHE B N    1 
ATOM   5598 C CA   . PHE B 1 152 ? -2.762  53.672 -31.152 1.00 25.34 ? 152 PHE B CA   1 
ATOM   5599 C C    . PHE B 1 152 ? -2.795  54.679 -32.320 1.00 25.50 ? 152 PHE B C    1 
ATOM   5600 O O    . PHE B 1 152 ? -3.794  55.381 -32.519 1.00 28.44 ? 152 PHE B O    1 
ATOM   5601 C CB   . PHE B 1 152 ? -2.098  54.321 -29.926 1.00 26.92 ? 152 PHE B CB   1 
ATOM   5602 C CG   . PHE B 1 152 ? -2.392  53.640 -28.604 1.00 26.12 ? 152 PHE B CG   1 
ATOM   5603 C CD1  . PHE B 1 152 ? -3.670  53.590 -28.095 1.00 27.48 ? 152 PHE B CD1  1 
ATOM   5604 C CD2  . PHE B 1 152 ? -1.369  53.139 -27.820 1.00 27.79 ? 152 PHE B CD2  1 
ATOM   5605 C CE1  . PHE B 1 152 ? -3.924  53.059 -26.823 1.00 23.41 ? 152 PHE B CE1  1 
ATOM   5606 C CE2  . PHE B 1 152 ? -1.627  52.608 -26.539 1.00 25.53 ? 152 PHE B CE2  1 
ATOM   5607 C CZ   . PHE B 1 152 ? -2.906  52.576 -26.059 1.00 23.61 ? 152 PHE B CZ   1 
ATOM   5608 H H    . PHE B 1 152 ? -1.226  52.272 -30.991 1.00 0.00  ? 152 PHE B H    1 
ATOM   5609 N N    . ASP B 1 153 ? -1.718  54.739 -33.096 1.00 25.81 ? 153 ASP B N    1 
ATOM   5610 C CA   . ASP B 1 153 ? -1.651  55.653 -34.232 1.00 25.69 ? 153 ASP B CA   1 
ATOM   5611 C C    . ASP B 1 153 ? -1.707  54.791 -35.498 1.00 24.82 ? 153 ASP B C    1 
ATOM   5612 O O    . ASP B 1 153 ? -0.694  54.301 -36.010 1.00 24.13 ? 153 ASP B O    1 
ATOM   5613 C CB   . ASP B 1 153 ? -0.363  56.478 -34.146 1.00 25.83 ? 153 ASP B CB   1 
ATOM   5614 C CG   . ASP B 1 153 ? -0.262  57.556 -35.223 1.00 31.05 ? 153 ASP B CG   1 
ATOM   5615 O OD1  . ASP B 1 153 ? -1.196  57.738 -36.045 1.00 34.22 ? 153 ASP B OD1  1 
ATOM   5616 O OD2  . ASP B 1 153 ? 0.799   58.227 -35.264 1.00 32.15 ? 153 ASP B OD2  1 
ATOM   5617 H H    . ASP B 1 153 ? -0.960  54.139 -32.942 1.00 0.00  ? 153 ASP B H    1 
ATOM   5618 N N    . LYS B 1 154 ? -2.913  54.599 -36.001 1.00 25.54 ? 154 LYS B N    1 
ATOM   5619 C CA   . LYS B 1 154 ? -3.115  53.748 -37.172 1.00 27.29 ? 154 LYS B CA   1 
ATOM   5620 C C    . LYS B 1 154 ? -2.486  54.155 -38.508 1.00 26.31 ? 154 LYS B C    1 
ATOM   5621 O O    . LYS B 1 154 ? -2.220  53.297 -39.342 1.00 25.79 ? 154 LYS B O    1 
ATOM   5622 C CB   . LYS B 1 154 ? -4.598  53.384 -37.309 1.00 28.78 ? 154 LYS B CB   1 
ATOM   5623 C CG   . LYS B 1 154 ? -4.993  52.354 -36.272 1.00 32.42 ? 154 LYS B CG   1 
ATOM   5624 C CD   . LYS B 1 154 ? -6.289  51.657 -36.610 1.00 38.24 ? 154 LYS B CD   1 
ATOM   5625 C CE   . LYS B 1 154 ? -7.493  52.362 -36.038 1.00 38.72 ? 154 LYS B CE   1 
ATOM   5626 N NZ   . LYS B 1 154 ? -8.718  51.960 -36.781 1.00 42.79 ? 154 LYS B NZ   1 
ATOM   5627 H H    . LYS B 1 154 ? -3.688  55.031 -35.580 1.00 0.00  ? 154 LYS B H    1 
ATOM   5628 H HZ1  . LYS B 1 154 ? -8.856  50.933 -36.713 1.00 0.00  ? 154 LYS B HZ1  1 
ATOM   5629 H HZ2  . LYS B 1 154 ? -9.531  52.465 -36.371 1.00 0.00  ? 154 LYS B HZ2  1 
ATOM   5630 H HZ3  . LYS B 1 154 ? -8.607  52.230 -37.780 1.00 0.00  ? 154 LYS B HZ3  1 
ATOM   5631 N N    . GLU B 1 155 ? -2.240  55.451 -38.716 1.00 26.77 ? 155 GLU B N    1 
ATOM   5632 C CA   . GLU B 1 155 ? -1.601  55.935 -39.944 1.00 23.93 ? 155 GLU B CA   1 
ATOM   5633 C C    . GLU B 1 155 ? -0.123  55.539 -39.881 1.00 23.54 ? 155 GLU B C    1 
ATOM   5634 O O    . GLU B 1 155 ? 0.358   54.830 -40.757 1.00 26.50 ? 155 GLU B O    1 
ATOM   5635 C CB   . GLU B 1 155 ? -1.755  57.443 -40.054 1.00 25.66 ? 155 GLU B CB   1 
ATOM   5636 C CG   . GLU B 1 155 ? -1.255  58.079 -41.338 1.00 26.17 ? 155 GLU B CG   1 
ATOM   5637 C CD   . GLU B 1 155 ? -1.791  59.503 -41.512 1.00 28.74 ? 155 GLU B CD   1 
ATOM   5638 O OE1  . GLU B 1 155 ? -3.050  59.677 -41.476 1.00 32.65 ? 155 GLU B OE1  1 
ATOM   5639 O OE2  . GLU B 1 155 ? -0.965  60.437 -41.671 1.00 26.13 ? 155 GLU B OE2  1 
ATOM   5640 H H    . GLU B 1 155 ? -2.506  56.103 -38.026 1.00 0.00  ? 155 GLU B H    1 
ATOM   5641 N N    . THR B 1 156 ? 0.569   55.910 -38.810 1.00 20.92 ? 156 THR B N    1 
ATOM   5642 C CA   . THR B 1 156 ? 1.983   55.567 -38.649 1.00 18.54 ? 156 THR B CA   1 
ATOM   5643 C C    . THR B 1 156 ? 2.290   54.055 -38.578 1.00 17.98 ? 156 THR B C    1 
ATOM   5644 O O    . THR B 1 156 ? 3.412   53.632 -38.918 1.00 16.06 ? 156 THR B O    1 
ATOM   5645 C CB   . THR B 1 156 ? 2.576   56.157 -37.371 1.00 17.90 ? 156 THR B CB   1 
ATOM   5646 O OG1  . THR B 1 156 ? 2.190   57.520 -37.231 1.00 23.09 ? 156 THR B OG1  1 
ATOM   5647 C CG2  . THR B 1 156 ? 4.074   56.088 -37.420 1.00 19.51 ? 156 THR B CG2  1 
ATOM   5648 H H    . THR B 1 156 ? 0.148   56.437 -38.097 1.00 0.00  ? 156 THR B H    1 
ATOM   5649 H HG1  . THR B 1 156 ? 1.721   57.719 -36.385 1.00 0.00  ? 156 THR B HG1  1 
ATOM   5650 N N    . PHE B 1 157 ? 1.376   53.267 -38.012 1.00 16.19 ? 157 PHE B N    1 
ATOM   5651 C CA   . PHE B 1 157 ? 1.576   51.814 -37.922 1.00 17.04 ? 157 PHE B CA   1 
ATOM   5652 C C    . PHE B 1 157 ? 2.011   51.204 -39.296 1.00 19.29 ? 157 PHE B C    1 
ATOM   5653 O O    . PHE B 1 157 ? 3.178   50.809 -39.499 1.00 20.01 ? 157 PHE B O    1 
ATOM   5654 C CB   . PHE B 1 157 ? 0.288   51.156 -37.421 1.00 13.87 ? 157 PHE B CB   1 
ATOM   5655 C CG   . PHE B 1 157 ? 0.348   49.653 -37.374 1.00 11.30 ? 157 PHE B CG   1 
ATOM   5656 C CD1  . PHE B 1 157 ? 1.273   49.008 -36.564 1.00 10.38 ? 157 PHE B CD1  1 
ATOM   5657 C CD2  . PHE B 1 157 ? -0.496  48.897 -38.175 1.00 9.09  ? 157 PHE B CD2  1 
ATOM   5658 C CE1  . PHE B 1 157 ? 1.362   47.616 -36.552 1.00 14.03 ? 157 PHE B CE1  1 
ATOM   5659 C CE2  . PHE B 1 157 ? -0.431  47.517 -38.193 1.00 8.15  ? 157 PHE B CE2  1 
ATOM   5660 C CZ   . PHE B 1 157 ? 0.509   46.852 -37.374 1.00 14.15 ? 157 PHE B CZ   1 
ATOM   5661 H H    . PHE B 1 157 ? 0.593   53.660 -37.564 1.00 0.00  ? 157 PHE B H    1 
ATOM   5662 N N    . ALA B 1 158 ? 1.074   51.233 -40.243 1.00 18.97 ? 158 ALA B N    1 
ATOM   5663 C CA   . ALA B 1 158 ? 1.235   50.758 -41.614 1.00 16.57 ? 158 ALA B CA   1 
ATOM   5664 C C    . ALA B 1 158 ? 2.490   51.271 -42.303 1.00 15.56 ? 158 ALA B C    1 
ATOM   5665 O O    . ALA B 1 158 ? 2.984   50.649 -43.256 1.00 13.23 ? 158 ALA B O    1 
ATOM   5666 C CB   . ALA B 1 158 ? 0.022   51.185 -42.429 1.00 15.10 ? 158 ALA B CB   1 
ATOM   5667 H H    . ALA B 1 158 ? 0.206   51.618 -40.004 1.00 0.00  ? 158 ALA B H    1 
ATOM   5668 N N    A GLU B 1 159 ? 2.945   52.434 -41.852 0.50 15.11 ? 159 GLU B N    1 
ATOM   5669 N N    B GLU B 1 159 ? 2.968   52.439 -41.883 0.50 15.20 ? 159 GLU B N    1 
ATOM   5670 C CA   A GLU B 1 159 ? 4.129   53.112 -42.380 0.50 16.79 ? 159 GLU B CA   1 
ATOM   5671 C CA   B GLU B 1 159 ? 4.177   53.030 -42.468 0.50 17.05 ? 159 GLU B CA   1 
ATOM   5672 C C    A GLU B 1 159 ? 5.382   52.365 -41.946 0.50 17.85 ? 159 GLU B C    1 
ATOM   5673 C C    B GLU B 1 159 ? 5.403   52.297 -41.960 0.50 18.05 ? 159 GLU B C    1 
ATOM   5674 O O    A GLU B 1 159 ? 6.226   52.013 -42.771 0.50 19.15 ? 159 GLU B O    1 
ATOM   5675 O O    B GLU B 1 159 ? 6.270   51.906 -42.744 0.50 19.37 ? 159 GLU B O    1 
ATOM   5676 C CB   A GLU B 1 159 ? 4.146   54.559 -41.852 0.50 18.27 ? 159 GLU B CB   1 
ATOM   5677 C CB   B GLU B 1 159 ? 4.268   54.535 -42.151 0.50 18.49 ? 159 GLU B CB   1 
ATOM   5678 C CG   A GLU B 1 159 ? 5.134   55.503 -42.486 0.50 21.01 ? 159 GLU B CG   1 
ATOM   5679 C CG   B GLU B 1 159 ? 5.658   55.158 -42.275 0.50 23.02 ? 159 GLU B CG   1 
ATOM   5680 C CD   A GLU B 1 159 ? 6.143   56.063 -41.485 0.50 22.86 ? 159 GLU B CD   1 
ATOM   5681 C CD   B GLU B 1 159 ? 6.123   55.381 -43.707 0.50 24.14 ? 159 GLU B CD   1 
ATOM   5682 O OE1  A GLU B 1 159 ? 5.794   56.945 -40.661 0.50 20.73 ? 159 GLU B OE1  1 
ATOM   5683 O OE1  B GLU B 1 159 ? 6.323   54.395 -44.449 0.50 23.65 ? 159 GLU B OE1  1 
ATOM   5684 O OE2  A GLU B 1 159 ? 7.309   55.626 -41.543 0.50 23.49 ? 159 GLU B OE2  1 
ATOM   5685 O OE2  B GLU B 1 159 ? 6.307   56.565 -44.085 0.50 26.55 ? 159 GLU B OE2  1 
ATOM   5686 H H    A GLU B 1 159 ? 2.450   52.903 -41.156 0.50 0.00  ? 159 GLU B H    1 
ATOM   5687 H H    B GLU B 1 159 ? 2.486   52.947 -41.206 0.50 0.00  ? 159 GLU B H    1 
ATOM   5688 N N    . LYS B 1 160 ? 5.467   52.094 -40.646 1.00 19.07 ? 160 LYS B N    1 
ATOM   5689 C CA   . LYS B 1 160 ? 6.585   51.383 -40.040 1.00 17.80 ? 160 LYS B CA   1 
ATOM   5690 C C    . LYS B 1 160 ? 6.549   49.948 -40.565 1.00 17.81 ? 160 LYS B C    1 
ATOM   5691 O O    . LYS B 1 160 ? 7.587   49.413 -41.014 1.00 17.90 ? 160 LYS B O    1 
ATOM   5692 C CB   . LYS B 1 160 ? 6.435   51.341 -38.515 1.00 22.23 ? 160 LYS B CB   1 
ATOM   5693 C CG   . LYS B 1 160 ? 6.326   52.685 -37.808 1.00 27.30 ? 160 LYS B CG   1 
ATOM   5694 C CD   . LYS B 1 160 ? 7.493   52.913 -36.857 1.00 28.88 ? 160 LYS B CD   1 
ATOM   5695 C CE   . LYS B 1 160 ? 7.148   53.989 -35.811 1.00 34.18 ? 160 LYS B CE   1 
ATOM   5696 N NZ   . LYS B 1 160 ? 5.874   53.757 -35.025 1.00 33.13 ? 160 LYS B NZ   1 
ATOM   5697 H H    . LYS B 1 160 ? 4.745   52.436 -40.086 1.00 0.00  ? 160 LYS B H    1 
ATOM   5698 H HZ1  . LYS B 1 160 ? 5.051   53.696 -35.655 1.00 0.00  ? 160 LYS B HZ1  1 
ATOM   5699 H HZ2  . LYS B 1 160 ? 5.953   52.867 -34.483 1.00 0.00  ? 160 LYS B HZ2  1 
ATOM   5700 H HZ3  . LYS B 1 160 ? 5.730   54.518 -34.335 1.00 0.00  ? 160 LYS B HZ3  1 
ATOM   5701 N N    . LEU B 1 161 ? 5.352   49.329 -40.493 1.00 14.92 ? 161 LEU B N    1 
ATOM   5702 C CA   . LEU B 1 161 ? 5.139   47.947 -40.939 1.00 13.87 ? 161 LEU B CA   1 
ATOM   5703 C C    . LEU B 1 161 ? 5.794   47.753 -42.293 1.00 17.33 ? 161 LEU B C    1 
ATOM   5704 O O    . LEU B 1 161 ? 6.678   46.881 -42.449 1.00 17.64 ? 161 LEU B O    1 
ATOM   5705 C CB   . LEU B 1 161 ? 3.658   47.665 -41.054 1.00 10.19 ? 161 LEU B CB   1 
ATOM   5706 C CG   . LEU B 1 161 ? 3.141   46.259 -41.352 1.00 9.47  ? 161 LEU B CG   1 
ATOM   5707 C CD1  . LEU B 1 161 ? 3.805   45.226 -40.467 1.00 5.01  ? 161 LEU B CD1  1 
ATOM   5708 C CD2  . LEU B 1 161 ? 1.570   46.241 -41.112 1.00 6.43  ? 161 LEU B CD2  1 
ATOM   5709 H H    . LEU B 1 161 ? 4.597   49.839 -40.124 1.00 0.00  ? 161 LEU B H    1 
ATOM   5710 N N    . LYS B 1 162 ? 5.447   48.655 -43.217 1.00 18.12 ? 162 LYS B N    1 
ATOM   5711 C CA   . LYS B 1 162 ? 5.949   48.634 -44.577 1.00 19.76 ? 162 LYS B CA   1 
ATOM   5712 C C    . LYS B 1 162 ? 7.466   48.462 -44.641 1.00 19.39 ? 162 LYS B C    1 
ATOM   5713 O O    . LYS B 1 162 ? 7.973   47.541 -45.302 1.00 18.13 ? 162 LYS B O    1 
ATOM   5714 C CB   . LYS B 1 162 ? 5.539   49.915 -45.294 1.00 21.04 ? 162 LYS B CB   1 
ATOM   5715 C CG   . LYS B 1 162 ? 6.042   50.048 -46.771 1.00 25.61 ? 162 LYS B CG   1 
ATOM   5716 C CD   . LYS B 1 162 ? 5.273   49.143 -47.729 1.00 23.94 ? 162 LYS B CD   1 
ATOM   5717 C CE   . LYS B 1 162 ? 3.758   49.390 -47.670 1.00 26.27 ? 162 LYS B CE   1 
ATOM   5718 N NZ   . LYS B 1 162 ? 3.307   50.682 -48.280 1.00 26.30 ? 162 LYS B NZ   1 
ATOM   5719 H H    . LYS B 1 162 ? 4.818   49.373 -42.998 1.00 0.00  ? 162 LYS B H    1 
ATOM   5720 H HZ1  . LYS B 1 162 ? 3.772   51.470 -47.783 1.00 0.00  ? 162 LYS B HZ1  1 
ATOM   5721 H HZ2  . LYS B 1 162 ? 3.580   50.681 -49.286 1.00 0.00  ? 162 LYS B HZ2  1 
ATOM   5722 H HZ3  . LYS B 1 162 ? 2.274   50.769 -48.195 1.00 0.00  ? 162 LYS B HZ3  1 
ATOM   5723 N N    . GLU B 1 163 ? 8.177   49.345 -43.945 1.00 19.60 ? 163 GLU B N    1 
ATOM   5724 C CA   . GLU B 1 163 ? 9.630   49.325 -43.916 1.00 16.71 ? 163 GLU B CA   1 
ATOM   5725 C C    . GLU B 1 163 ? 10.181  48.010 -43.387 1.00 16.89 ? 163 GLU B C    1 
ATOM   5726 O O    . GLU B 1 163 ? 10.935  47.332 -44.088 1.00 17.66 ? 163 GLU B O    1 
ATOM   5727 C CB   . GLU B 1 163 ? 10.187  50.447 -43.035 1.00 19.12 ? 163 GLU B CB   1 
ATOM   5728 C CG   . GLU B 1 163 ? 9.786   51.858 -43.382 1.00 23.48 ? 163 GLU B CG   1 
ATOM   5729 C CD   . GLU B 1 163 ? 10.818  52.891 -42.884 1.00 29.68 ? 163 GLU B CD   1 
ATOM   5730 O OE1  . GLU B 1 163 ? 11.633  52.577 -41.948 1.00 27.24 ? 163 GLU B OE1  1 
ATOM   5731 O OE2  . GLU B 1 163 ? 10.824  54.017 -43.461 1.00 31.85 ? 163 GLU B OE2  1 
ATOM   5732 H H    . GLU B 1 163 ? 7.696   50.078 -43.484 1.00 0.00  ? 163 GLU B H    1 
ATOM   5733 N N    . VAL B 1 164 ? 9.839   47.663 -42.143 1.00 12.95 ? 164 VAL B N    1 
ATOM   5734 C CA   . VAL B 1 164 ? 10.370  46.440 -41.550 1.00 13.90 ? 164 VAL B CA   1 
ATOM   5735 C C    . VAL B 1 164 ? 10.021  45.148 -42.337 1.00 13.56 ? 164 VAL B C    1 
ATOM   5736 O O    . VAL B 1 164 ? 10.693  44.132 -42.173 1.00 9.58  ? 164 VAL B O    1 
ATOM   5737 C CB   . VAL B 1 164 ? 10.006  46.317 -40.037 1.00 17.37 ? 164 VAL B CB   1 
ATOM   5738 C CG1  . VAL B 1 164 ? 8.502   46.069 -39.862 1.00 16.91 ? 164 VAL B CG1  1 
ATOM   5739 C CG2  . VAL B 1 164 ? 10.858  45.237 -39.370 1.00 12.79 ? 164 VAL B CG2  1 
ATOM   5740 H H    . VAL B 1 164 ? 9.195   48.238 -41.661 1.00 0.00  ? 164 VAL B H    1 
ATOM   5741 N N    . MET B 1 165 ? 9.033   45.225 -43.242 1.00 15.84 ? 165 MET B N    1 
ATOM   5742 C CA   . MET B 1 165 ? 8.659   44.070 -44.043 1.00 17.23 ? 165 MET B CA   1 
ATOM   5743 C C    . MET B 1 165 ? 9.466   43.932 -45.296 1.00 18.03 ? 165 MET B C    1 
ATOM   5744 O O    . MET B 1 165 ? 9.548   42.840 -45.856 1.00 19.08 ? 165 MET B O    1 
ATOM   5745 C CB   . MET B 1 165 ? 7.160   43.972 -44.334 1.00 17.37 ? 165 MET B CB   1 
ATOM   5746 C CG   . MET B 1 165 ? 6.359   43.670 -43.071 1.00 17.03 ? 165 MET B CG   1 
ATOM   5747 S SD   . MET B 1 165 ? 4.836   42.814 -43.382 1.00 18.80 ? 165 MET B SD   1 
ATOM   5748 C CE   . MET B 1 165 ? 5.459   41.529 -44.473 1.00 15.59 ? 165 MET B CE   1 
ATOM   5749 H H    . MET B 1 165 ? 8.497   46.047 -43.304 1.00 0.00  ? 165 MET B H    1 
ATOM   5750 N N    . GLU B 1 166 ? 10.064  45.007 -45.776 1.00 19.88 ? 166 GLU B N    1 
ATOM   5751 C CA   . GLU B 1 166 ? 10.885  44.803 -46.949 1.00 21.07 ? 166 GLU B CA   1 
ATOM   5752 C C    . GLU B 1 166 ? 12.266  44.386 -46.468 1.00 23.34 ? 166 GLU B C    1 
ATOM   5753 O O    . GLU B 1 166 ? 12.939  43.575 -47.116 1.00 26.77 ? 166 GLU B O    1 
ATOM   5754 C CB   . GLU B 1 166 ? 10.857  45.955 -47.951 1.00 21.75 ? 166 GLU B CB   1 
ATOM   5755 C CG   . GLU B 1 166 ? 11.038  47.325 -47.419 1.00 25.78 ? 166 GLU B CG   1 
ATOM   5756 C CD   . GLU B 1 166 ? 11.857  48.146 -48.384 1.00 33.05 ? 166 GLU B CD   1 
ATOM   5757 O OE1  . GLU B 1 166 ? 13.094  47.927 -48.423 1.00 34.09 ? 166 GLU B OE1  1 
ATOM   5758 O OE2  . GLU B 1 166 ? 11.275  48.977 -49.122 1.00 34.76 ? 166 GLU B OE2  1 
ATOM   5759 H H    . GLU B 1 166 ? 9.948   45.894 -45.370 1.00 0.00  ? 166 GLU B H    1 
ATOM   5760 N N    . TYR B 1 167 ? 12.668  44.838 -45.289 1.00 21.10 ? 167 TYR B N    1 
ATOM   5761 C CA   . TYR B 1 167 ? 13.940  44.360 -44.774 1.00 22.18 ? 167 TYR B CA   1 
ATOM   5762 C C    . TYR B 1 167 ? 13.855  42.813 -44.656 1.00 22.04 ? 167 TYR B C    1 
ATOM   5763 O O    . TYR B 1 167 ? 14.708  42.101 -45.175 1.00 23.56 ? 167 TYR B O    1 
ATOM   5764 C CB   . TYR B 1 167 ? 14.244  44.948 -43.406 1.00 22.27 ? 167 TYR B CB   1 
ATOM   5765 C CG   . TYR B 1 167 ? 15.460  44.334 -42.778 1.00 21.41 ? 167 TYR B CG   1 
ATOM   5766 C CD1  . TYR B 1 167 ? 16.730  44.724 -43.181 1.00 23.65 ? 167 TYR B CD1  1 
ATOM   5767 C CD2  . TYR B 1 167 ? 15.350  43.356 -41.799 1.00 19.65 ? 167 TYR B CD2  1 
ATOM   5768 C CE1  . TYR B 1 167 ? 17.845  44.166 -42.640 1.00 22.52 ? 167 TYR B CE1  1 
ATOM   5769 C CE2  . TYR B 1 167 ? 16.470  42.784 -41.241 1.00 20.76 ? 167 TYR B CE2  1 
ATOM   5770 C CZ   . TYR B 1 167 ? 17.715  43.199 -41.674 1.00 23.21 ? 167 TYR B CZ   1 
ATOM   5771 O OH   . TYR B 1 167 ? 18.861  42.661 -41.152 1.00 23.55 ? 167 TYR B OH   1 
ATOM   5772 H H    . TYR B 1 167 ? 12.133  45.521 -44.825 1.00 0.00  ? 167 TYR B H    1 
ATOM   5773 H HH   . TYR B 1 167 ? 19.592  43.148 -41.582 1.00 0.00  ? 167 TYR B HH   1 
ATOM   5774 N N    . HIS B 1 168 ? 12.787  42.305 -44.036 1.00 23.75 ? 168 HIS B N    1 
ATOM   5775 C CA   . HIS B 1 168 ? 12.607  40.865 -43.845 1.00 23.39 ? 168 HIS B CA   1 
ATOM   5776 C C    . HIS B 1 168 ? 12.335  40.051 -45.103 1.00 23.03 ? 168 HIS B C    1 
ATOM   5777 O O    . HIS B 1 168 ? 12.946  39.002 -45.286 1.00 24.47 ? 168 HIS B O    1 
ATOM   5778 C CB   . HIS B 1 168 ? 11.522  40.570 -42.799 1.00 26.62 ? 168 HIS B CB   1 
ATOM   5779 C CG   . HIS B 1 168 ? 11.933  40.884 -41.393 1.00 28.02 ? 168 HIS B CG   1 
ATOM   5780 N ND1  . HIS B 1 168 ? 13.218  40.698 -40.931 1.00 29.93 ? 168 HIS B ND1  1 
ATOM   5781 C CD2  . HIS B 1 168 ? 11.219  41.340 -40.338 1.00 27.79 ? 168 HIS B CD2  1 
ATOM   5782 C CE1  . HIS B 1 168 ? 13.271  41.017 -39.649 1.00 28.55 ? 168 HIS B CE1  1 
ATOM   5783 N NE2  . HIS B 1 168 ? 12.070  41.410 -39.264 1.00 27.37 ? 168 HIS B NE2  1 
ATOM   5784 H H    . HIS B 1 168 ? 12.122  42.926 -43.665 1.00 0.00  ? 168 HIS B H    1 
ATOM   5785 H HE2  . HIS B 1 168 ? 11.839  41.731 -38.354 1.00 0.00  ? 168 HIS B HE2  1 
ATOM   5786 N N    . ASN B 1 169 ? 11.383  40.484 -45.934 1.00 22.81 ? 169 ASN B N    1 
ATOM   5787 C CA   . ASN B 1 169 ? 11.056  39.764 -47.168 1.00 20.27 ? 169 ASN B CA   1 
ATOM   5788 C C    . ASN B 1 169 ? 12.301  39.666 -48.040 1.00 20.30 ? 169 ASN B C    1 
ATOM   5789 O O    . ASN B 1 169 ? 12.451  38.710 -48.823 1.00 18.92 ? 169 ASN B O    1 
ATOM   5790 C CB   . ASN B 1 169 ? 9.955   40.464 -47.958 1.00 14.07 ? 169 ASN B CB   1 
ATOM   5791 C CG   . ASN B 1 169 ? 8.569   40.149 -47.441 1.00 15.39 ? 169 ASN B CG   1 
ATOM   5792 O OD1  . ASN B 1 169 ? 8.297   39.036 -47.004 1.00 18.39 ? 169 ASN B OD1  1 
ATOM   5793 N ND2  . ASN B 1 169 ? 7.660   41.118 -47.531 1.00 17.99 ? 169 ASN B ND2  1 
ATOM   5794 H H    . ASN B 1 169 ? 10.863  41.295 -45.752 1.00 0.00  ? 169 ASN B H    1 
ATOM   5795 H HD21 . ASN B 1 169 ? 6.754   40.846 -47.259 1.00 0.00  ? 169 ASN B HD21 1 
ATOM   5796 H HD22 . ASN B 1 169 ? 7.913   42.000 -47.870 1.00 0.00  ? 169 ASN B HD22 1 
ATOM   5797 N N    . PHE B 1 170 ? 13.208  40.639 -47.896 1.00 20.30 ? 170 PHE B N    1 
ATOM   5798 C CA   . PHE B 1 170 ? 14.421  40.612 -48.689 1.00 20.44 ? 170 PHE B CA   1 
ATOM   5799 C C    . PHE B 1 170 ? 15.211  39.395 -48.308 1.00 20.66 ? 170 PHE B C    1 
ATOM   5800 O O    . PHE B 1 170 ? 15.758  38.731 -49.177 1.00 20.89 ? 170 PHE B O    1 
ATOM   5801 C CB   . PHE B 1 170 ? 15.267  41.866 -48.490 1.00 22.75 ? 170 PHE B CB   1 
ATOM   5802 C CG   . PHE B 1 170 ? 16.625  41.763 -49.115 1.00 27.70 ? 170 PHE B CG   1 
ATOM   5803 C CD1  . PHE B 1 170 ? 16.815  42.063 -50.458 1.00 30.35 ? 170 PHE B CD1  1 
ATOM   5804 C CD2  . PHE B 1 170 ? 17.700  41.301 -48.384 1.00 29.50 ? 170 PHE B CD2  1 
ATOM   5805 C CE1  . PHE B 1 170 ? 18.062  41.901 -51.053 1.00 32.19 ? 170 PHE B CE1  1 
ATOM   5806 C CE2  . PHE B 1 170 ? 18.948  41.136 -48.975 1.00 31.08 ? 170 PHE B CE2  1 
ATOM   5807 C CZ   . PHE B 1 170 ? 19.125  41.436 -50.309 1.00 31.11 ? 170 PHE B CZ   1 
ATOM   5808 H H    . PHE B 1 170 ? 13.057  41.410 -47.308 1.00 0.00  ? 170 PHE B H    1 
ATOM   5809 N N    . GLN B 1 171 ? 15.269  39.111 -47.002 1.00 20.74 ? 171 GLN B N    1 
ATOM   5810 C CA   . GLN B 1 171 ? 15.995  37.947 -46.446 1.00 20.35 ? 171 GLN B CA   1 
ATOM   5811 C C    . GLN B 1 171 ? 15.293  36.626 -46.717 1.00 17.92 ? 171 GLN B C    1 
ATOM   5812 O O    . GLN B 1 171 ? 15.940  35.592 -46.940 1.00 19.73 ? 171 GLN B O    1 
ATOM   5813 C CB   . GLN B 1 171 ? 16.100  38.032 -44.936 1.00 21.96 ? 171 GLN B CB   1 
ATOM   5814 C CG   . GLN B 1 171 ? 16.499  39.337 -44.427 1.00 25.33 ? 171 GLN B CG   1 
ATOM   5815 C CD   . GLN B 1 171 ? 17.354  39.172 -43.231 1.00 29.18 ? 171 GLN B CD   1 
ATOM   5816 O OE1  . GLN B 1 171 ? 18.584  39.131 -43.334 1.00 29.38 ? 171 GLN B OE1  1 
ATOM   5817 N NE2  . GLN B 1 171 ? 16.718  38.979 -42.080 1.00 30.69 ? 171 GLN B NE2  1 
ATOM   5818 H H    . GLN B 1 171 ? 14.822  39.738 -46.398 1.00 0.00  ? 171 GLN B H    1 
ATOM   5819 H HE21 . GLN B 1 171 ? 17.312  38.858 -41.306 1.00 0.00  ? 171 GLN B HE21 1 
ATOM   5820 H HE22 . GLN B 1 171 ? 15.741  38.965 -42.056 1.00 0.00  ? 171 GLN B HE22 1 
ATOM   5821 N N    . LEU B 1 172 ? 13.977  36.647 -46.592 1.00 15.69 ? 172 LEU B N    1 
ATOM   5822 C CA   . LEU B 1 172 ? 13.204  35.450 -46.813 1.00 14.49 ? 172 LEU B CA   1 
ATOM   5823 C C    . LEU B 1 172 ? 13.406  34.939 -48.229 1.00 14.14 ? 172 LEU B C    1 
ATOM   5824 O O    . LEU B 1 172 ? 13.929  33.850 -48.425 1.00 13.71 ? 172 LEU B O    1 
ATOM   5825 C CB   . LEU B 1 172 ? 11.729  35.696 -46.501 1.00 14.29 ? 172 LEU B CB   1 
ATOM   5826 C CG   . LEU B 1 172 ? 11.459  35.897 -45.010 1.00 16.22 ? 172 LEU B CG   1 
ATOM   5827 C CD1  . LEU B 1 172 ? 9.951   36.156 -44.679 1.00 8.25  ? 172 LEU B CD1  1 
ATOM   5828 C CD2  . LEU B 1 172 ? 11.934  34.620 -44.344 1.00 16.21 ? 172 LEU B CD2  1 
ATOM   5829 H H    . LEU B 1 172 ? 13.546  37.475 -46.294 1.00 0.00  ? 172 LEU B H    1 
ATOM   5830 N N    . VAL B 1 173 ? 13.185  35.796 -49.211 1.00 13.90 ? 173 VAL B N    1 
ATOM   5831 C CA   . VAL B 1 173 ? 13.313  35.358 -50.590 1.00 15.09 ? 173 VAL B CA   1 
ATOM   5832 C C    . VAL B 1 173 ? 14.735  35.354 -51.191 1.00 14.29 ? 173 VAL B C    1 
ATOM   5833 O O    . VAL B 1 173 ? 15.080  34.458 -51.927 1.00 17.12 ? 173 VAL B O    1 
ATOM   5834 C CB   . VAL B 1 173 ? 12.210  36.013 -51.502 1.00 13.25 ? 173 VAL B CB   1 
ATOM   5835 C CG1  . VAL B 1 173 ? 11.143  36.663 -50.655 1.00 10.46 ? 173 VAL B CG1  1 
ATOM   5836 C CG2  . VAL B 1 173 ? 12.773  36.984 -52.453 1.00 14.72 ? 173 VAL B CG2  1 
ATOM   5837 H H    . VAL B 1 173 ? 12.932  36.727 -49.019 1.00 0.00  ? 173 VAL B H    1 
ATOM   5838 N N    . ASN B 1 174 ? 15.624  36.198 -50.708 1.00 17.07 ? 174 ASN B N    1 
ATOM   5839 C CA   . ASN B 1 174 ? 16.981  36.231 -51.262 1.00 21.21 ? 174 ASN B CA   1 
ATOM   5840 C C    . ASN B 1 174 ? 18.130  35.472 -50.579 1.00 21.80 ? 174 ASN B C    1 
ATOM   5841 O O    . ASN B 1 174 ? 19.167  35.266 -51.195 1.00 22.58 ? 174 ASN B O    1 
ATOM   5842 C CB   . ASN B 1 174 ? 17.412  37.681 -51.497 1.00 20.20 ? 174 ASN B CB   1 
ATOM   5843 C CG   . ASN B 1 174 ? 16.712  38.278 -52.664 1.00 19.37 ? 174 ASN B CG   1 
ATOM   5844 O OD1  . ASN B 1 174 ? 16.832  37.764 -53.757 1.00 24.51 ? 174 ASN B OD1  1 
ATOM   5845 N ND2  . ASN B 1 174 ? 15.935  39.320 -52.445 1.00 14.38 ? 174 ASN B ND2  1 
ATOM   5846 H H    . ASN B 1 174 ? 15.379  36.850 -50.017 1.00 0.00  ? 174 ASN B H    1 
ATOM   5847 H HD21 . ASN B 1 174 ? 15.466  39.736 -53.216 1.00 0.00  ? 174 ASN B HD21 1 
ATOM   5848 H HD22 . ASN B 1 174 ? 15.849  39.644 -51.531 1.00 0.00  ? 174 ASN B HD22 1 
ATOM   5849 N N    . TYR B 1 175 ? 17.953  35.039 -49.339 1.00 22.34 ? 175 TYR B N    1 
ATOM   5850 C CA   . TYR B 1 175 ? 19.017  34.341 -48.616 1.00 23.28 ? 175 TYR B CA   1 
ATOM   5851 C C    . TYR B 1 175 ? 18.548  32.955 -48.233 1.00 21.94 ? 175 TYR B C    1 
ATOM   5852 O O    . TYR B 1 175 ? 19.301  31.973 -48.338 1.00 23.95 ? 175 TYR B O    1 
ATOM   5853 C CB   . TYR B 1 175 ? 19.361  35.116 -47.320 1.00 23.63 ? 175 TYR B CB   1 
ATOM   5854 C CG   . TYR B 1 175 ? 20.501  34.548 -46.487 1.00 22.25 ? 175 TYR B CG   1 
ATOM   5855 C CD1  . TYR B 1 175 ? 21.823  34.806 -46.821 1.00 19.96 ? 175 TYR B CD1  1 
ATOM   5856 C CD2  . TYR B 1 175 ? 20.253  33.756 -45.353 1.00 23.95 ? 175 TYR B CD2  1 
ATOM   5857 C CE1  . TYR B 1 175 ? 22.869  34.297 -46.066 1.00 20.16 ? 175 TYR B CE1  1 
ATOM   5858 C CE2  . TYR B 1 175 ? 21.308  33.239 -44.583 1.00 20.99 ? 175 TYR B CE2  1 
ATOM   5859 C CZ   . TYR B 1 175 ? 22.613  33.522 -44.956 1.00 20.63 ? 175 TYR B CZ   1 
ATOM   5860 O OH   . TYR B 1 175 ? 23.667  33.046 -44.219 1.00 19.49 ? 175 TYR B OH   1 
ATOM   5861 H H    . TYR B 1 175 ? 17.103  35.198 -48.881 1.00 0.00  ? 175 TYR B H    1 
ATOM   5862 H HH   . TYR B 1 175 ? 24.509  33.339 -44.615 1.00 0.00  ? 175 TYR B HH   1 
ATOM   5863 N N    . TYR B 1 176 ? 17.335  32.908 -47.690 1.00 19.45 ? 176 TYR B N    1 
ATOM   5864 C CA   . TYR B 1 176 ? 16.752  31.680 -47.233 1.00 19.50 ? 176 TYR B CA   1 
ATOM   5865 C C    . TYR B 1 176 ? 16.057  30.961 -48.375 1.00 18.97 ? 176 TYR B C    1 
ATOM   5866 O O    . TYR B 1 176 ? 15.930  29.748 -48.345 1.00 17.41 ? 176 TYR B O    1 
ATOM   5867 C CB   . TYR B 1 176 ? 15.807  31.969 -46.046 1.00 22.35 ? 176 TYR B CB   1 
ATOM   5868 C CG   . TYR B 1 176 ? 16.526  32.317 -44.738 1.00 22.86 ? 176 TYR B CG   1 
ATOM   5869 C CD1  . TYR B 1 176 ? 17.060  31.305 -43.930 1.00 25.91 ? 176 TYR B CD1  1 
ATOM   5870 C CD2  . TYR B 1 176 ? 16.787  33.633 -44.381 1.00 23.07 ? 176 TYR B CD2  1 
ATOM   5871 C CE1  . TYR B 1 176 ? 17.839  31.584 -42.830 1.00 24.37 ? 176 TYR B CE1  1 
ATOM   5872 C CE2  . TYR B 1 176 ? 17.580  33.928 -43.262 1.00 24.12 ? 176 TYR B CE2  1 
ATOM   5873 C CZ   . TYR B 1 176 ? 18.102  32.896 -42.495 1.00 26.19 ? 176 TYR B CZ   1 
ATOM   5874 O OH   . TYR B 1 176 ? 18.877  33.149 -41.371 1.00 27.53 ? 176 TYR B OH   1 
ATOM   5875 H H    . TYR B 1 176 ? 16.838  33.746 -47.551 1.00 0.00  ? 176 TYR B H    1 
ATOM   5876 H HH   . TYR B 1 176 ? 19.016  34.104 -41.345 1.00 0.00  ? 176 TYR B HH   1 
ATOM   5877 N N    . LYS B 1 177 ? 15.725  31.693 -49.434 1.00 20.83 ? 177 LYS B N    1 
ATOM   5878 C CA   . LYS B 1 177 ? 15.033  31.142 -50.616 1.00 21.95 ? 177 LYS B CA   1 
ATOM   5879 C C    . LYS B 1 177 ? 13.639  30.637 -50.254 1.00 20.91 ? 177 LYS B C    1 
ATOM   5880 O O    . LYS B 1 177 ? 13.184  29.621 -50.810 1.00 18.30 ? 177 LYS B O    1 
ATOM   5881 C CB   . LYS B 1 177 ? 15.821  30.001 -51.285 1.00 24.01 ? 177 LYS B CB   1 
ATOM   5882 C CG   . LYS B 1 177 ? 17.088  30.442 -52.018 1.00 30.17 ? 177 LYS B CG   1 
ATOM   5883 C CD   . LYS B 1 177 ? 17.708  29.316 -52.889 1.00 33.69 ? 177 LYS B CD   1 
ATOM   5884 C CE   . LYS B 1 177 ? 18.360  28.193 -52.073 1.00 35.42 ? 177 LYS B CE   1 
ATOM   5885 N NZ   . LYS B 1 177 ? 17.407  27.281 -51.354 1.00 40.20 ? 177 LYS B NZ   1 
ATOM   5886 H H    . LYS B 1 177 ? 15.917  32.647 -49.425 1.00 0.00  ? 177 LYS B H    1 
ATOM   5887 H HZ1  . LYS B 1 177 ? 16.746  26.843 -52.023 1.00 0.00  ? 177 LYS B HZ1  1 
ATOM   5888 H HZ2  . LYS B 1 177 ? 17.902  26.540 -50.819 1.00 0.00  ? 177 LYS B HZ2  1 
ATOM   5889 H HZ3  . LYS B 1 177 ? 16.823  27.803 -50.664 1.00 0.00  ? 177 LYS B HZ3  1 
ATOM   5890 N N    . ALA B 1 178 ? 12.990  31.341 -49.318 1.00 20.06 ? 178 ALA B N    1 
ATOM   5891 C CA   . ALA B 1 178 ? 11.657  31.018 -48.836 1.00 20.10 ? 178 ALA B CA   1 
ATOM   5892 C C    . ALA B 1 178 ? 10.649  32.053 -49.318 1.00 21.36 ? 178 ALA B C    1 
ATOM   5893 O O    . ALA B 1 178 ? 11.028  33.058 -49.891 1.00 23.58 ? 178 ALA B O    1 
ATOM   5894 C CB   . ALA B 1 178 ? 11.676  30.957 -47.349 1.00 19.76 ? 178 ALA B CB   1 
ATOM   5895 H H    . ALA B 1 178 ? 13.409  32.165 -48.984 1.00 0.00  ? 178 ALA B H    1 
ATOM   5896 N N    . GLU B 1 179 ? 9.360   31.817 -49.117 1.00 21.85 ? 179 GLU B N    1 
ATOM   5897 C CA   . GLU B 1 179 ? 8.355   32.786 -49.572 1.00 24.31 ? 179 GLU B CA   1 
ATOM   5898 C C    . GLU B 1 179 ? 8.348   34.133 -48.819 1.00 24.11 ? 179 GLU B C    1 
ATOM   5899 O O    . GLU B 1 179 ? 8.672   34.206 -47.622 1.00 24.84 ? 179 GLU B O    1 
ATOM   5900 C CB   . GLU B 1 179 ? 6.958   32.206 -49.466 1.00 27.34 ? 179 GLU B CB   1 
ATOM   5901 C CG   . GLU B 1 179 ? 6.745   30.891 -50.139 1.00 35.76 ? 179 GLU B CG   1 
ATOM   5902 C CD   . GLU B 1 179 ? 5.317   30.479 -50.005 1.00 39.47 ? 179 GLU B CD   1 
ATOM   5903 O OE1  . GLU B 1 179 ? 4.907   30.117 -48.883 1.00 43.87 ? 179 GLU B OE1  1 
ATOM   5904 O OE2  . GLU B 1 179 ? 4.584   30.563 -51.001 1.00 42.25 ? 179 GLU B OE2  1 
ATOM   5905 H H    . GLU B 1 179 ? 9.072   31.008 -48.654 1.00 0.00  ? 179 GLU B H    1 
ATOM   5906 N N    . ALA B 1 180 ? 7.971   35.190 -49.529 1.00 22.70 ? 180 ALA B N    1 
ATOM   5907 C CA   . ALA B 1 180 ? 7.879   36.500 -48.922 1.00 22.56 ? 180 ALA B CA   1 
ATOM   5908 C C    . ALA B 1 180 ? 6.528   36.530 -48.235 1.00 22.63 ? 180 ALA B C    1 
ATOM   5909 O O    . ALA B 1 180 ? 5.564   35.934 -48.710 1.00 24.61 ? 180 ALA B O    1 
ATOM   5910 C CB   . ALA B 1 180 ? 7.938   37.587 -49.972 1.00 22.38 ? 180 ALA B CB   1 
ATOM   5911 H H    . ALA B 1 180 ? 7.708   35.068 -50.462 1.00 0.00  ? 180 ALA B H    1 
ATOM   5912 N N    . VAL B 1 181 ? 6.460   37.189 -47.093 1.00 21.95 ? 181 VAL B N    1 
ATOM   5913 C CA   . VAL B 1 181 ? 5.194   37.276 -46.371 1.00 19.49 ? 181 VAL B CA   1 
ATOM   5914 C C    . VAL B 1 181 ? 4.496   38.512 -46.934 1.00 20.43 ? 181 VAL B C    1 
ATOM   5915 O O    . VAL B 1 181 ? 5.156   39.546 -47.167 1.00 20.88 ? 181 VAL B O    1 
ATOM   5916 C CB   . VAL B 1 181 ? 5.452   37.440 -44.887 1.00 15.33 ? 181 VAL B CB   1 
ATOM   5917 C CG1  . VAL B 1 181 ? 4.166   37.561 -44.164 1.00 14.34 ? 181 VAL B CG1  1 
ATOM   5918 C CG2  . VAL B 1 181 ? 6.239   36.274 -44.391 1.00 10.78 ? 181 VAL B CG2  1 
ATOM   5919 H H    . VAL B 1 181 ? 7.245   37.711 -46.802 1.00 0.00  ? 181 VAL B H    1 
ATOM   5920 N N    . ASP B 1 182 ? 3.198   38.370 -47.214 1.00 21.42 ? 182 ASP B N    1 
ATOM   5921 C CA   . ASP B 1 182 ? 2.360   39.428 -47.790 1.00 21.03 ? 182 ASP B CA   1 
ATOM   5922 C C    . ASP B 1 182 ? 1.955   40.469 -46.764 1.00 19.79 ? 182 ASP B C    1 
ATOM   5923 O O    . ASP B 1 182 ? 1.185   40.199 -45.840 1.00 18.00 ? 182 ASP B O    1 
ATOM   5924 C CB   . ASP B 1 182 ? 1.112   38.813 -48.404 1.00 24.63 ? 182 ASP B CB   1 
ATOM   5925 C CG   . ASP B 1 182 ? 0.462   39.706 -49.425 1.00 26.73 ? 182 ASP B CG   1 
ATOM   5926 O OD1  . ASP B 1 182 ? -0.360  40.559 -49.032 1.00 30.98 ? 182 ASP B OD1  1 
ATOM   5927 O OD2  . ASP B 1 182 ? 0.755   39.538 -50.627 1.00 32.28 ? 182 ASP B OD2  1 
ATOM   5928 H H    . ASP B 1 182 ? 2.790   37.500 -47.033 1.00 0.00  ? 182 ASP B H    1 
ATOM   5929 N N    . TYR B 1 183 ? 2.446   41.682 -46.988 1.00 21.48 ? 183 TYR B N    1 
ATOM   5930 C CA   . TYR B 1 183 ? 2.229   42.844 -46.132 1.00 21.92 ? 183 TYR B CA   1 
ATOM   5931 C C    . TYR B 1 183 ? 0.768   43.220 -45.890 1.00 25.18 ? 183 TYR B C    1 
ATOM   5932 O O    . TYR B 1 183 ? 0.326   43.393 -44.747 1.00 27.11 ? 183 TYR B O    1 
ATOM   5933 C CB   . TYR B 1 183 ? 2.974   44.031 -46.745 1.00 19.84 ? 183 TYR B CB   1 
ATOM   5934 C CG   . TYR B 1 183 ? 2.530   45.418 -46.301 1.00 19.51 ? 183 TYR B CG   1 
ATOM   5935 C CD1  . TYR B 1 183 ? 1.477   46.099 -46.959 1.00 17.09 ? 183 TYR B CD1  1 
ATOM   5936 C CD2  . TYR B 1 183 ? 3.164   46.052 -45.252 1.00 12.78 ? 183 TYR B CD2  1 
ATOM   5937 C CE1  . TYR B 1 183 ? 1.077   47.380 -46.553 1.00 14.93 ? 183 TYR B CE1  1 
ATOM   5938 C CE2  . TYR B 1 183 ? 2.788   47.299 -44.856 1.00 16.66 ? 183 TYR B CE2  1 
ATOM   5939 C CZ   . TYR B 1 183 ? 1.738   47.965 -45.494 1.00 18.62 ? 183 TYR B CZ   1 
ATOM   5940 O OH   . TYR B 1 183 ? 1.330   49.176 -44.973 1.00 18.72 ? 183 TYR B OH   1 
ATOM   5941 H H    . TYR B 1 183 ? 2.986   41.790 -47.796 1.00 0.00  ? 183 TYR B H    1 
ATOM   5942 H HH   . TYR B 1 183 ? 0.484   49.416 -45.358 1.00 0.00  ? 183 TYR B HH   1 
ATOM   5943 N N    . GLN B 1 184 ? 0.018   43.374 -46.968 1.00 26.20 ? 184 GLN B N    1 
ATOM   5944 C CA   . GLN B 1 184 ? -1.370  43.776 -46.844 1.00 23.85 ? 184 GLN B CA   1 
ATOM   5945 C C    . GLN B 1 184 ? -2.098  42.851 -45.869 1.00 23.01 ? 184 GLN B C    1 
ATOM   5946 O O    . GLN B 1 184 ? -2.863  43.316 -45.035 1.00 24.31 ? 184 GLN B O    1 
ATOM   5947 C CB   . GLN B 1 184 ? -2.025  43.814 -48.237 1.00 25.64 ? 184 GLN B CB   1 
ATOM   5948 C CG   . GLN B 1 184 ? -3.465  44.394 -48.335 1.00 25.09 ? 184 GLN B CG   1 
ATOM   5949 C CD   . GLN B 1 184 ? -3.522  45.854 -47.997 1.00 26.22 ? 184 GLN B CD   1 
ATOM   5950 O OE1  . GLN B 1 184 ? -2.969  46.688 -48.719 1.00 28.47 ? 184 GLN B OE1  1 
ATOM   5951 N NE2  . GLN B 1 184 ? -4.138  46.179 -46.870 1.00 28.22 ? 184 GLN B NE2  1 
ATOM   5952 H H    . GLN B 1 184 ? 0.394   43.188 -47.855 1.00 0.00  ? 184 GLN B H    1 
ATOM   5953 H HE21 . GLN B 1 184 ? -4.203  47.113 -46.607 1.00 0.00  ? 184 GLN B HE21 1 
ATOM   5954 H HE22 . GLN B 1 184 ? -4.510  45.422 -46.343 1.00 0.00  ? 184 GLN B HE22 1 
ATOM   5955 N N    A LYS B 1 185 ? -1.786  41.561 -45.923 0.50 22.25 ? 185 LYS B N    1 
ATOM   5956 N N    B LYS B 1 185 ? -1.810  41.552 -45.916 0.50 21.95 ? 185 LYS B N    1 
ATOM   5957 C CA   A LYS B 1 185 ? -2.425  40.579 -45.054 0.50 22.87 ? 185 LYS B CA   1 
ATOM   5958 C CA   B LYS B 1 185 ? -2.489  40.617 -45.020 0.50 22.26 ? 185 LYS B CA   1 
ATOM   5959 C C    A LYS B 1 185 ? -2.159  40.858 -43.573 0.50 22.62 ? 185 LYS B C    1 
ATOM   5960 C C    B LYS B 1 185 ? -2.170  40.878 -43.549 0.50 22.28 ? 185 LYS B C    1 
ATOM   5961 O O    A LYS B 1 185 ? -3.086  40.918 -42.753 0.50 23.26 ? 185 LYS B O    1 
ATOM   5962 O O    B LYS B 1 185 ? -3.079  40.954 -42.712 0.50 22.96 ? 185 LYS B O    1 
ATOM   5963 C CB   A LYS B 1 185 ? -1.921  39.188 -45.431 0.50 24.12 ? 185 LYS B CB   1 
ATOM   5964 C CB   B LYS B 1 185 ? -2.167  39.170 -45.398 0.50 22.75 ? 185 LYS B CB   1 
ATOM   5965 C CG   A LYS B 1 185 ? -2.981  38.110 -45.499 0.50 26.77 ? 185 LYS B CG   1 
ATOM   5966 C CG   B LYS B 1 185 ? -2.999  38.107 -44.672 0.50 23.59 ? 185 LYS B CG   1 
ATOM   5967 C CD   A LYS B 1 185 ? -3.091  37.350 -44.207 0.50 27.17 ? 185 LYS B CD   1 
ATOM   5968 C CD   B LYS B 1 185 ? -4.370  37.822 -45.327 0.50 23.18 ? 185 LYS B CD   1 
ATOM   5969 C CE   A LYS B 1 185 ? -1.761  36.728 -43.809 0.50 27.65 ? 185 LYS B CE   1 
ATOM   5970 C CE   B LYS B 1 185 ? -5.390  38.929 -45.118 0.50 24.94 ? 185 LYS B CE   1 
ATOM   5971 N NZ   A LYS B 1 185 ? -1.879  35.997 -42.507 0.50 29.81 ? 185 LYS B NZ   1 
ATOM   5972 N NZ   B LYS B 1 185 ? -5.417  39.977 -46.190 0.50 25.63 ? 185 LYS B NZ   1 
ATOM   5973 H H    A LYS B 1 185 ? -1.145  41.257 -46.598 0.50 0.00  ? 185 LYS B H    1 
ATOM   5974 H H    B LYS B 1 185 ? -1.154  41.229 -46.571 0.50 0.00  ? 185 LYS B H    1 
ATOM   5975 H HZ1  A LYS B 1 185 ? -2.408  36.660 -41.877 0.50 0.00  ? 185 LYS B HZ1  1 
ATOM   5976 H HZ1  B LYS B 1 185 ? -4.491  40.423 -46.298 0.50 0.00  ? 185 LYS B HZ1  1 
ATOM   5977 H HZ2  A LYS B 1 185 ? -2.408  35.116 -42.590 0.50 0.00  ? 185 LYS B HZ2  1 
ATOM   5978 H HZ2  B LYS B 1 185 ? -5.710  39.540 -47.094 0.50 0.00  ? 185 LYS B HZ2  1 
ATOM   5979 H HZ3  A LYS B 1 185 ? -0.919  35.853 -42.095 0.50 0.00  ? 185 LYS B HZ3  1 
ATOM   5980 H HZ3  B LYS B 1 185 ? -6.107  40.714 -45.924 0.50 0.00  ? 185 LYS B HZ3  1 
ATOM   5981 N N    . VAL B 1 186 ? -0.886  41.062 -43.243 1.00 22.70 ? 186 VAL B N    1 
ATOM   5982 C CA   . VAL B 1 186 ? -0.450  41.338 -41.868 1.00 19.09 ? 186 VAL B CA   1 
ATOM   5983 C C    . VAL B 1 186 ? -1.078  42.624 -41.322 1.00 18.33 ? 186 VAL B C    1 
ATOM   5984 O O    . VAL B 1 186 ? -1.501  42.681 -40.179 1.00 17.23 ? 186 VAL B O    1 
ATOM   5985 C CB   . VAL B 1 186 ? 1.054   41.411 -41.816 1.00 18.82 ? 186 VAL B CB   1 
ATOM   5986 C CG1  . VAL B 1 186 ? 1.527   41.759 -40.405 1.00 19.96 ? 186 VAL B CG1  1 
ATOM   5987 C CG2  . VAL B 1 186 ? 1.660   40.080 -42.323 1.00 15.52 ? 186 VAL B CG2  1 
ATOM   5988 H H    . VAL B 1 186 ? -0.227  41.011 -43.958 1.00 0.00  ? 186 VAL B H    1 
ATOM   5989 N N    . LEU B 1 187 ? -1.148  43.664 -42.144 1.00 20.84 ? 187 LEU B N    1 
ATOM   5990 C CA   . LEU B 1 187 ? -1.776  44.916 -41.732 1.00 23.76 ? 187 LEU B CA   1 
ATOM   5991 C C    . LEU B 1 187 ? -3.252  44.657 -41.469 1.00 24.92 ? 187 LEU B C    1 
ATOM   5992 O O    . LEU B 1 187 ? -3.775  45.087 -40.446 1.00 29.56 ? 187 LEU B O    1 
ATOM   5993 C CB   . LEU B 1 187 ? -1.657  46.007 -42.813 1.00 22.14 ? 187 LEU B CB   1 
ATOM   5994 C CG   . LEU B 1 187 ? -2.209  47.406 -42.457 1.00 23.47 ? 187 LEU B CG   1 
ATOM   5995 C CD1  . LEU B 1 187 ? -1.398  48.031 -41.358 1.00 22.38 ? 187 LEU B CD1  1 
ATOM   5996 C CD2  . LEU B 1 187 ? -2.176  48.340 -43.668 1.00 24.38 ? 187 LEU B CD2  1 
ATOM   5997 H H    . LEU B 1 187 ? -0.737  43.595 -43.032 1.00 0.00  ? 187 LEU B H    1 
ATOM   5998 N N    . ASP B 1 188 ? -3.904  43.958 -42.394 1.00 22.70 ? 188 ASP B N    1 
ATOM   5999 C CA   . ASP B 1 188 ? -5.320  43.649 -42.280 1.00 21.44 ? 188 ASP B CA   1 
ATOM   6000 C C    . ASP B 1 188 ? -5.576  42.740 -41.111 1.00 20.24 ? 188 ASP B C    1 
ATOM   6001 O O    . ASP B 1 188 ? -6.558  42.914 -40.386 1.00 17.22 ? 188 ASP B O    1 
ATOM   6002 C CB   . ASP B 1 188 ? -5.862  42.994 -43.560 1.00 24.43 ? 188 ASP B CB   1 
ATOM   6003 C CG   . ASP B 1 188 ? -6.012  43.978 -44.710 1.00 25.73 ? 188 ASP B CG   1 
ATOM   6004 O OD1  . ASP B 1 188 ? -6.923  44.837 -44.690 1.00 25.20 ? 188 ASP B OD1  1 
ATOM   6005 O OD2  . ASP B 1 188 ? -5.210  43.883 -45.650 1.00 26.79 ? 188 ASP B OD2  1 
ATOM   6006 H H    . ASP B 1 188 ? -3.469  43.667 -43.221 1.00 0.00  ? 188 ASP B H    1 
ATOM   6007 N N    . ASP B 1 189 ? -4.717  41.744 -40.929 1.00 21.35 ? 189 ASP B N    1 
ATOM   6008 C CA   . ASP B 1 189 ? -4.906  40.854 -39.784 1.00 21.62 ? 189 ASP B CA   1 
ATOM   6009 C C    . ASP B 1 189 ? -4.772  41.653 -38.490 1.00 19.87 ? 189 ASP B C    1 
ATOM   6010 O O    . ASP B 1 189 ? -5.671  41.631 -37.646 1.00 20.26 ? 189 ASP B O    1 
ATOM   6011 C CB   . ASP B 1 189 ? -3.934  39.654 -39.833 1.00 23.11 ? 189 ASP B CB   1 
ATOM   6012 C CG   . ASP B 1 189 ? -4.279  38.657 -40.956 1.00 24.72 ? 189 ASP B CG   1 
ATOM   6013 O OD1  . ASP B 1 189 ? -5.358  38.765 -41.574 1.00 22.70 ? 189 ASP B OD1  1 
ATOM   6014 O OD2  . ASP B 1 189 ? -3.460  37.769 -41.241 1.00 26.42 ? 189 ASP B OD2  1 
ATOM   6015 H H    . ASP B 1 189 ? -4.040  41.499 -41.623 1.00 0.00  ? 189 ASP B H    1 
ATOM   6016 N N    . THR B 1 190 ? -3.710  42.453 -38.404 1.00 16.44 ? 190 THR B N    1 
ATOM   6017 C CA   . THR B 1 190 ? -3.454  43.278 -37.224 1.00 16.37 ? 190 THR B CA   1 
ATOM   6018 C C    . THR B 1 190 ? -4.529  44.358 -36.956 1.00 15.35 ? 190 THR B C    1 
ATOM   6019 O O    . THR B 1 190 ? -4.928  44.553 -35.804 1.00 16.62 ? 190 THR B O    1 
ATOM   6020 C CB   . THR B 1 190 ? -2.036  43.929 -37.269 1.00 15.57 ? 190 THR B CB   1 
ATOM   6021 O OG1  . THR B 1 190 ? -1.067  42.940 -37.612 1.00 8.76  ? 190 THR B OG1  1 
ATOM   6022 C CG2  . THR B 1 190 ? -1.661  44.516 -35.921 1.00 13.19 ? 190 THR B CG2  1 
ATOM   6023 H H    . THR B 1 190 ? -3.066  42.472 -39.142 1.00 0.00  ? 190 THR B H    1 
ATOM   6024 H HG1  . THR B 1 190 ? -1.217  42.746 -38.556 1.00 0.00  ? 190 THR B HG1  1 
ATOM   6025 N N    . MET B 1 191 ? -4.990  45.064 -37.985 1.00 15.24 ? 191 MET B N    1 
ATOM   6026 C CA   . MET B 1 191 ? -6.030  46.069 -37.785 1.00 13.75 ? 191 MET B CA   1 
ATOM   6027 C C    . MET B 1 191 ? -7.323  45.461 -37.236 1.00 13.42 ? 191 MET B C    1 
ATOM   6028 O O    . MET B 1 191 ? -8.114  46.188 -36.608 1.00 12.83 ? 191 MET B O    1 
ATOM   6029 C CB   . MET B 1 191 ? -6.342  46.834 -39.071 1.00 14.62 ? 191 MET B CB   1 
ATOM   6030 C CG   . MET B 1 191 ? -5.265  47.809 -39.461 1.00 19.07 ? 191 MET B CG   1 
ATOM   6031 S SD   . MET B 1 191 ? -4.837  48.979 -38.151 1.00 19.85 ? 191 MET B SD   1 
ATOM   6032 C CE   . MET B 1 191 ? -3.579  49.918 -39.043 1.00 21.29 ? 191 MET B CE   1 
ATOM   6033 H H    . MET B 1 191 ? -4.610  44.946 -38.891 1.00 0.00  ? 191 MET B H    1 
ATOM   6034 N N    . ALA B 1 192 ? -7.551  44.157 -37.471 1.00 12.37 ? 192 ALA B N    1 
ATOM   6035 C CA   . ALA B 1 192 ? -8.755  43.481 -36.955 1.00 17.03 ? 192 ALA B CA   1 
ATOM   6036 C C    . ALA B 1 192 ? -8.811  43.399 -35.407 1.00 18.02 ? 192 ALA B C    1 
ATOM   6037 O O    . ALA B 1 192 ? -9.807  43.764 -34.785 1.00 20.60 ? 192 ALA B O    1 
ATOM   6038 C CB   . ALA B 1 192 ? -8.927  42.075 -37.605 1.00 13.04 ? 192 ALA B CB   1 
ATOM   6039 H H    . ALA B 1 192 ? -6.924  43.633 -38.012 1.00 0.00  ? 192 ALA B H    1 
ATOM   6040 N N    . VAL B 1 193 ? -7.738  42.953 -34.772 1.00 21.19 ? 193 VAL B N    1 
ATOM   6041 C CA   . VAL B 1 193 ? -7.738  42.872 -33.307 1.00 20.20 ? 193 VAL B CA   1 
ATOM   6042 C C    . VAL B 1 193 ? -7.225  44.163 -32.646 1.00 20.78 ? 193 VAL B C    1 
ATOM   6043 O O    . VAL B 1 193 ? -7.092  44.222 -31.428 1.00 21.13 ? 193 VAL B O    1 
ATOM   6044 C CB   . VAL B 1 193 ? -6.856  41.713 -32.772 1.00 20.62 ? 193 VAL B CB   1 
ATOM   6045 C CG1  . VAL B 1 193 ? -7.201  41.440 -31.317 1.00 19.47 ? 193 VAL B CG1  1 
ATOM   6046 C CG2  . VAL B 1 193 ? -7.040  40.446 -33.593 1.00 19.39 ? 193 VAL B CG2  1 
ATOM   6047 H H    . VAL B 1 193 ? -6.970  42.669 -35.310 1.00 0.00  ? 193 VAL B H    1 
ATOM   6048 N N    . ALA B 1 194 ? -6.978  45.212 -33.419 1.00 18.69 ? 194 ALA B N    1 
ATOM   6049 C CA   . ALA B 1 194 ? -6.440  46.438 -32.836 1.00 22.92 ? 194 ALA B CA   1 
ATOM   6050 C C    . ALA B 1 194 ? -7.308  47.084 -31.717 1.00 24.73 ? 194 ALA B C    1 
ATOM   6051 O O    . ALA B 1 194 ? -6.803  47.452 -30.626 1.00 23.74 ? 194 ALA B O    1 
ATOM   6052 C CB   . ALA B 1 194 ? -6.096  47.443 -33.950 1.00 20.17 ? 194 ALA B CB   1 
ATOM   6053 H H    . ALA B 1 194 ? -7.159  45.166 -34.379 1.00 0.00  ? 194 ALA B H    1 
ATOM   6054 N N    . ASP B 1 195 ? -8.603  47.236 -31.996 1.00 25.31 ? 195 ASP B N    1 
ATOM   6055 C CA   . ASP B 1 195 ? -9.533  47.818 -31.022 1.00 27.04 ? 195 ASP B CA   1 
ATOM   6056 C C    . ASP B 1 195 ? -9.441  47.009 -29.738 1.00 24.81 ? 195 ASP B C    1 
ATOM   6057 O O    . ASP B 1 195 ? -9.320  47.567 -28.660 1.00 24.64 ? 195 ASP B O    1 
ATOM   6058 C CB   . ASP B 1 195 ? -10.993 47.843 -31.552 1.00 25.91 ? 195 ASP B CB   1 
ATOM   6059 C CG   . ASP B 1 195 ? -11.496 46.459 -32.080 1.00 27.92 ? 195 ASP B CG   1 
ATOM   6060 O OD1  . ASP B 1 195 ? -10.695 45.554 -32.502 1.00 26.67 ? 195 ASP B OD1  1 
ATOM   6061 O OD2  . ASP B 1 195 ? -12.737 46.301 -32.102 1.00 28.72 ? 195 ASP B OD2  1 
ATOM   6062 H H    . ASP B 1 195 ? -8.961  46.910 -32.855 1.00 0.00  ? 195 ASP B H    1 
ATOM   6063 N N    . ILE B 1 196 ? -9.336  45.693 -29.883 1.00 23.34 ? 196 ILE B N    1 
ATOM   6064 C CA   . ILE B 1 196 ? -9.252  44.794 -28.741 1.00 24.33 ? 196 ILE B CA   1 
ATOM   6065 C C    . ILE B 1 196 ? -7.970  44.894 -27.908 1.00 24.35 ? 196 ILE B C    1 
ATOM   6066 O O    . ILE B 1 196 ? -8.042  44.979 -26.697 1.00 23.77 ? 196 ILE B O    1 
ATOM   6067 C CB   . ILE B 1 196 ? -9.516  43.346 -29.168 1.00 25.13 ? 196 ILE B CB   1 
ATOM   6068 C CG1  . ILE B 1 196 ? -10.713 43.314 -30.153 1.00 28.93 ? 196 ILE B CG1  1 
ATOM   6069 C CG2  . ILE B 1 196 ? -9.871  42.530 -27.948 1.00 25.62 ? 196 ILE B CG2  1 
ATOM   6070 C CD1  . ILE B 1 196 ? -11.060 41.914 -30.736 1.00 28.90 ? 196 ILE B CD1  1 
ATOM   6071 H H    . ILE B 1 196 ? -9.344  45.342 -30.803 1.00 0.00  ? 196 ILE B H    1 
ATOM   6072 N N    . LEU B 1 197 ? -6.812  44.975 -28.537 1.00 23.53 ? 197 LEU B N    1 
ATOM   6073 C CA   . LEU B 1 197 ? -5.584  45.062 -27.756 1.00 23.60 ? 197 LEU B CA   1 
ATOM   6074 C C    . LEU B 1 197 ? -5.452  46.362 -26.981 1.00 22.62 ? 197 LEU B C    1 
ATOM   6075 O O    . LEU B 1 197 ? -5.242  46.346 -25.768 1.00 21.19 ? 197 LEU B O    1 
ATOM   6076 C CB   . LEU B 1 197 ? -4.314  44.812 -28.605 1.00 23.20 ? 197 LEU B CB   1 
ATOM   6077 C CG   . LEU B 1 197 ? -3.964  43.467 -29.300 1.00 20.32 ? 197 LEU B CG   1 
ATOM   6078 C CD1  . LEU B 1 197 ? -2.458  43.436 -29.440 1.00 20.09 ? 197 LEU B CD1  1 
ATOM   6079 C CD2  . LEU B 1 197 ? -4.460  42.209 -28.577 1.00 14.26 ? 197 LEU B CD2  1 
ATOM   6080 H H    . LEU B 1 197 ? -6.809  44.909 -29.517 1.00 0.00  ? 197 LEU B H    1 
ATOM   6081 N N    . THR B 1 198 ? -5.617  47.490 -27.665 1.00 24.19 ? 198 THR B N    1 
ATOM   6082 C CA   . THR B 1 198 ? -5.506  48.798 -27.005 1.00 21.84 ? 198 THR B CA   1 
ATOM   6083 C C    . THR B 1 198 ? -6.465  48.959 -25.852 1.00 20.69 ? 198 THR B C    1 
ATOM   6084 O O    . THR B 1 198 ? -6.173  49.677 -24.926 1.00 23.46 ? 198 THR B O    1 
ATOM   6085 C CB   . THR B 1 198 ? -5.574  50.024 -27.993 1.00 22.64 ? 198 THR B CB   1 
ATOM   6086 O OG1  . THR B 1 198 ? -6.734  49.956 -28.846 1.00 20.15 ? 198 THR B OG1  1 
ATOM   6087 C CG2  . THR B 1 198 ? -4.269  50.099 -28.850 1.00 20.24 ? 198 THR B CG2  1 
ATOM   6088 H H    . THR B 1 198 ? -5.859  47.449 -28.615 1.00 0.00  ? 198 THR B H    1 
ATOM   6089 H HG1  . THR B 1 198 ? -6.722  49.142 -29.372 1.00 0.00  ? 198 THR B HG1  1 
ATOM   6090 N N    . SER B 1 199 ? -7.553  48.201 -25.841 1.00 20.93 ? 199 SER B N    1 
ATOM   6091 C CA   . SER B 1 199 ? -8.505  48.288 -24.747 1.00 18.35 ? 199 SER B CA   1 
ATOM   6092 C C    . SER B 1 199 ? -7.936  47.720 -23.469 1.00 17.19 ? 199 SER B C    1 
ATOM   6093 O O    . SER B 1 199 ? -8.413  48.050 -22.381 1.00 19.68 ? 199 SER B O    1 
ATOM   6094 C CB   . SER B 1 199 ? -9.768  47.527 -25.080 1.00 19.72 ? 199 SER B CB   1 
ATOM   6095 O OG   . SER B 1 199 ? -9.574  46.131 -24.954 1.00 21.15 ? 199 SER B OG   1 
ATOM   6096 H H    . SER B 1 199 ? -7.760  47.617 -26.598 1.00 0.00  ? 199 SER B H    1 
ATOM   6097 H HG   . SER B 1 199 ? -8.904  45.764 -25.574 1.00 0.00  ? 199 SER B HG   1 
ATOM   6098 N N    . MET B 1 200 ? -6.911  46.881 -23.582 1.00 15.12 ? 200 MET B N    1 
ATOM   6099 C CA   . MET B 1 200 ? -6.301  46.257 -22.414 1.00 13.57 ? 200 MET B CA   1 
ATOM   6100 C C    . MET B 1 200 ? -5.020  46.970 -21.942 1.00 15.83 ? 200 MET B C    1 
ATOM   6101 O O    . MET B 1 200 ? -4.541  46.701 -20.850 1.00 18.83 ? 200 MET B O    1 
ATOM   6102 C CB   . MET B 1 200 ? -6.000  44.775 -22.713 1.00 16.42 ? 200 MET B CB   1 
ATOM   6103 C CG   . MET B 1 200 ? -7.040  44.086 -23.660 1.00 17.49 ? 200 MET B CG   1 
ATOM   6104 S SD   . MET B 1 200 ? -6.902  42.270 -23.938 1.00 17.11 ? 200 MET B SD   1 
ATOM   6105 C CE   . MET B 1 200 ? -7.590  41.793 -22.348 1.00 18.34 ? 200 MET B CE   1 
ATOM   6106 H H    . MET B 1 200 ? -6.510  46.682 -24.456 1.00 0.00  ? 200 MET B H    1 
ATOM   6107 N N    . VAL B 1 201 ? -4.439  47.849 -22.752 1.00 13.06 ? 201 VAL B N    1 
ATOM   6108 C CA   . VAL B 1 201 ? -3.217  48.551 -22.340 1.00 14.96 ? 201 VAL B CA   1 
ATOM   6109 C C    . VAL B 1 201 ? -3.379  49.432 -21.084 1.00 17.50 ? 201 VAL B C    1 
ATOM   6110 O O    . VAL B 1 201 ? -4.398  50.113 -20.906 1.00 16.80 ? 201 VAL B O    1 
ATOM   6111 C CB   . VAL B 1 201 ? -2.672  49.377 -23.487 1.00 14.25 ? 201 VAL B CB   1 
ATOM   6112 C CG1  . VAL B 1 201 ? -1.640  50.384 -22.996 1.00 18.30 ? 201 VAL B CG1  1 
ATOM   6113 C CG2  . VAL B 1 201 ? -2.092  48.473 -24.548 1.00 11.87 ? 201 VAL B CG2  1 
ATOM   6114 H H    . VAL B 1 201 ? -4.854  48.044 -23.617 1.00 0.00  ? 201 VAL B H    1 
ATOM   6115 N N    . VAL B 1 202 ? -2.326  49.472 -20.262 1.00 18.47 ? 202 VAL B N    1 
ATOM   6116 C CA   . VAL B 1 202 ? -2.307  50.203 -18.983 1.00 18.04 ? 202 VAL B CA   1 
ATOM   6117 C C    . VAL B 1 202 ? -0.852  50.595 -18.578 1.00 16.92 ? 202 VAL B C    1 
ATOM   6118 O O    . VAL B 1 202 ? 0.110   50.162 -19.216 1.00 17.14 ? 202 VAL B O    1 
ATOM   6119 C CB   . VAL B 1 202 ? -2.981  49.260 -17.878 1.00 18.98 ? 202 VAL B CB   1 
ATOM   6120 C CG1  . VAL B 1 202 ? -2.462  49.507 -16.476 1.00 15.73 ? 202 VAL B CG1  1 
ATOM   6121 C CG2  . VAL B 1 202 ? -4.490  49.403 -17.916 1.00 19.99 ? 202 VAL B CG2  1 
ATOM   6122 H H    . VAL B 1 202 ? -1.541  48.930 -20.486 1.00 0.00  ? 202 VAL B H    1 
ATOM   6123 N N    . ASP B 1 203 ? -0.696  51.449 -17.568 1.00 15.20 ? 203 ASP B N    1 
ATOM   6124 C CA   . ASP B 1 203 ? 0.633   51.843 -17.062 1.00 13.54 ? 203 ASP B CA   1 
ATOM   6125 C C    . ASP B 1 203 ? 1.156   50.839 -15.993 1.00 13.48 ? 203 ASP B C    1 
ATOM   6126 O O    . ASP B 1 203 ? 1.095   51.082 -14.773 1.00 13.25 ? 203 ASP B O    1 
ATOM   6127 C CB   . ASP B 1 203 ? 0.570   53.267 -16.465 1.00 13.05 ? 203 ASP B CB   1 
ATOM   6128 C CG   . ASP B 1 203 ? 1.962   53.880 -16.202 1.00 15.88 ? 203 ASP B CG   1 
ATOM   6129 O OD1  . ASP B 1 203 ? 2.982   53.140 -15.909 1.00 10.93 ? 203 ASP B OD1  1 
ATOM   6130 O OD2  . ASP B 1 203 ? 1.992   55.143 -16.261 1.00 13.01 ? 203 ASP B OD2  1 
ATOM   6131 H H    . ASP B 1 203 ? -1.487  51.859 -17.157 1.00 0.00  ? 203 ASP B H    1 
ATOM   6132 N N    . VAL B 1 204 ? 1.712   49.735 -16.469 1.00 14.11 ? 204 VAL B N    1 
ATOM   6133 C CA   . VAL B 1 204 ? 2.227   48.684 -15.594 1.00 16.95 ? 204 VAL B CA   1 
ATOM   6134 C C    . VAL B 1 204 ? 3.163   49.182 -14.463 1.00 19.91 ? 204 VAL B C    1 
ATOM   6135 O O    . VAL B 1 204 ? 2.957   48.749 -13.321 1.00 22.53 ? 204 VAL B O    1 
ATOM   6136 C CB   . VAL B 1 204 ? 2.869   47.496 -16.427 1.00 15.31 ? 204 VAL B CB   1 
ATOM   6137 C CG1  . VAL B 1 204 ? 3.617   46.543 -15.537 1.00 17.58 ? 204 VAL B CG1  1 
ATOM   6138 C CG2  . VAL B 1 204 ? 1.792   46.716 -17.186 1.00 11.44 ? 204 VAL B CG2  1 
ATOM   6139 H H    . VAL B 1 204 ? 1.774   49.627 -17.440 1.00 0.00  ? 204 VAL B H    1 
ATOM   6140 N N    . SER B 1 205 ? 4.109   50.113 -14.744 1.00 19.60 ? 205 SER B N    1 
ATOM   6141 C CA   . SER B 1 205 ? 5.033   50.635 -13.715 1.00 15.05 ? 205 SER B CA   1 
ATOM   6142 C C    . SER B 1 205 ? 4.249   51.192 -12.580 1.00 12.85 ? 205 SER B C    1 
ATOM   6143 O O    . SER B 1 205 ? 4.480   50.812 -11.432 1.00 12.46 ? 205 SER B O    1 
ATOM   6144 C CB   . SER B 1 205 ? 5.925   51.831 -14.150 1.00 15.14 ? 205 SER B CB   1 
ATOM   6145 O OG   . SER B 1 205 ? 6.713   51.676 -15.306 1.00 11.61 ? 205 SER B OG   1 
ATOM   6146 H H    . SER B 1 205 ? 4.197   50.466 -15.651 1.00 0.00  ? 205 SER B H    1 
ATOM   6147 H HG   . SER B 1 205 ? 7.556   52.110 -15.157 1.00 0.00  ? 205 SER B HG   1 
ATOM   6148 N N    . ASP B 1 206 ? 3.357   52.136 -12.925 1.00 14.88 ? 206 ASP B N    1 
ATOM   6149 C CA   . ASP B 1 206 ? 2.528   52.849 -11.954 1.00 16.70 ? 206 ASP B CA   1 
ATOM   6150 C C    . ASP B 1 206 ? 1.636   51.905 -11.237 1.00 16.26 ? 206 ASP B C    1 
ATOM   6151 O O    . ASP B 1 206 ? 1.640   51.856 -9.999  1.00 21.78 ? 206 ASP B O    1 
ATOM   6152 C CB   . ASP B 1 206 ? 1.640   53.950 -12.579 1.00 16.60 ? 206 ASP B CB   1 
ATOM   6153 C CG   . ASP B 1 206 ? 1.334   55.071 -11.582 1.00 17.31 ? 206 ASP B CG   1 
ATOM   6154 O OD1  . ASP B 1 206 ? 0.379   55.017 -10.807 1.00 17.90 ? 206 ASP B OD1  1 
ATOM   6155 O OD2  . ASP B 1 206 ? 2.120   56.008 -11.510 1.00 17.66 ? 206 ASP B OD2  1 
ATOM   6156 H H    . ASP B 1 206 ? 3.228   52.364 -13.873 1.00 0.00  ? 206 ASP B H    1 
ATOM   6157 N N    . LEU B 1 207 ? 0.902   51.115 -12.001 1.00 16.11 ? 207 LEU B N    1 
ATOM   6158 C CA   . LEU B 1 207 ? -0.007  50.155 -11.385 1.00 14.81 ? 207 LEU B CA   1 
ATOM   6159 C C    . LEU B 1 207 ? 0.691   49.289 -10.324 1.00 17.84 ? 207 LEU B C    1 
ATOM   6160 O O    . LEU B 1 207 ? 0.260   49.312 -9.161  1.00 20.66 ? 207 LEU B O    1 
ATOM   6161 C CB   . LEU B 1 207 ? -0.717  49.337 -12.453 1.00 5.90  ? 207 LEU B CB   1 
ATOM   6162 C CG   . LEU B 1 207 ? -1.478  48.110 -11.957 1.00 12.24 ? 207 LEU B CG   1 
ATOM   6163 C CD1  . LEU B 1 207 ? -2.827  48.458 -11.227 1.00 5.76  ? 207 LEU B CD1  1 
ATOM   6164 C CD2  . LEU B 1 207 ? -1.666  47.167 -13.143 1.00 8.00  ? 207 LEU B CD2  1 
ATOM   6165 H H    . LEU B 1 207 ? 0.976   51.180 -12.984 1.00 0.00  ? 207 LEU B H    1 
ATOM   6166 N N    . LEU B 1 208 ? 1.802   48.622 -10.665 1.00 17.83 ? 208 LEU B N    1 
ATOM   6167 C CA   . LEU B 1 208 ? 2.505   47.775 -9.681  1.00 22.87 ? 208 LEU B CA   1 
ATOM   6168 C C    . LEU B 1 208 ? 3.055   48.604 -8.529  1.00 23.26 ? 208 LEU B C    1 
ATOM   6169 O O    . LEU B 1 208 ? 3.045   48.153 -7.382  1.00 24.74 ? 208 LEU B O    1 
ATOM   6170 C CB   . LEU B 1 208 ? 3.673   46.950 -10.294 1.00 23.75 ? 208 LEU B CB   1 
ATOM   6171 C CG   . LEU B 1 208 ? 3.449   45.863 -11.366 1.00 25.91 ? 208 LEU B CG   1 
ATOM   6172 C CD1  . LEU B 1 208 ? 4.788   45.335 -11.867 1.00 26.44 ? 208 LEU B CD1  1 
ATOM   6173 C CD2  . LEU B 1 208 ? 2.636   44.722 -10.789 1.00 25.71 ? 208 LEU B CD2  1 
ATOM   6174 H H    . LEU B 1 208 ? 2.165   48.688 -11.580 1.00 0.00  ? 208 LEU B H    1 
ATOM   6175 N N    . ASP B 1 209 ? 3.610   49.774 -8.834  1.00 23.52 ? 209 ASP B N    1 
ATOM   6176 C CA   . ASP B 1 209 ? 4.145   50.652 -7.785  1.00 26.61 ? 209 ASP B CA   1 
ATOM   6177 C C    . ASP B 1 209 ? 3.019   51.017 -6.782  1.00 27.50 ? 209 ASP B C    1 
ATOM   6178 O O    . ASP B 1 209 ? 3.218   51.040 -5.559  1.00 26.16 ? 209 ASP B O    1 
ATOM   6179 C CB   . ASP B 1 209 ? 4.772   51.884 -8.445  1.00 28.05 ? 209 ASP B CB   1 
ATOM   6180 C CG   . ASP B 1 209 ? 5.218   52.912 -7.462  1.00 28.97 ? 209 ASP B CG   1 
ATOM   6181 O OD1  . ASP B 1 209 ? 6.164   52.641 -6.675  1.00 27.67 ? 209 ASP B OD1  1 
ATOM   6182 O OD2  . ASP B 1 209 ? 4.624   54.008 -7.502  1.00 31.63 ? 209 ASP B OD2  1 
ATOM   6183 H H    . ASP B 1 209 ? 3.714   50.065 -9.769  1.00 0.00  ? 209 ASP B H    1 
ATOM   6184 N N    . GLN B 1 210 ? 1.818   51.234 -7.298  1.00 28.09 ? 210 GLN B N    1 
ATOM   6185 C CA   . GLN B 1 210 ? 0.694   51.499 -6.411  1.00 27.67 ? 210 GLN B CA   1 
ATOM   6186 C C    . GLN B 1 210 ? 0.388   50.263 -5.552  1.00 24.89 ? 210 GLN B C    1 
ATOM   6187 O O    . GLN B 1 210 ? 0.184   50.399 -4.349  1.00 26.19 ? 210 GLN B O    1 
ATOM   6188 C CB   . GLN B 1 210 ? -0.541  51.950 -7.201  1.00 31.89 ? 210 GLN B CB   1 
ATOM   6189 C CG   . GLN B 1 210 ? -0.331  53.275 -7.971  1.00 34.10 ? 210 GLN B CG   1 
ATOM   6190 C CD   . GLN B 1 210 ? -0.229  54.464 -7.051  1.00 35.51 ? 210 GLN B CD   1 
ATOM   6191 O OE1  . GLN B 1 210 ? -1.189  55.213 -6.874  1.00 35.94 ? 210 GLN B OE1  1 
ATOM   6192 N NE2  . GLN B 1 210 ? 0.937   54.646 -6.452  1.00 36.59 ? 210 GLN B NE2  1 
ATOM   6193 H H    . GLN B 1 210 ? 1.722   51.301 -8.279  1.00 0.00  ? 210 GLN B H    1 
ATOM   6194 H HE21 . GLN B 1 210 ? 1.050   55.381 -5.812  1.00 0.00  ? 210 GLN B HE21 1 
ATOM   6195 H HE22 . GLN B 1 210 ? 1.682   54.049 -6.665  1.00 0.00  ? 210 GLN B HE22 1 
ATOM   6196 N N    . ALA B 1 211 ? 0.392   49.068 -6.146  1.00 21.39 ? 211 ALA B N    1 
ATOM   6197 C CA   . ALA B 1 211 ? 0.153   47.802 -5.398  1.00 21.09 ? 211 ALA B CA   1 
ATOM   6198 C C    . ALA B 1 211 ? 1.151   47.640 -4.248  1.00 21.09 ? 211 ALA B C    1 
ATOM   6199 O O    . ALA B 1 211 ? 0.788   47.304 -3.107  1.00 20.89 ? 211 ALA B O    1 
ATOM   6200 C CB   . ALA B 1 211 ? 0.284   46.593 -6.317  1.00 16.92 ? 211 ALA B CB   1 
ATOM   6201 H H    . ALA B 1 211 ? 0.502   49.058 -7.124  1.00 0.00  ? 211 ALA B H    1 
ATOM   6202 N N    . ARG B 1 212 ? 2.409   47.893 -4.581  1.00 22.11 ? 212 ARG B N    1 
ATOM   6203 C CA   . ARG B 1 212 ? 3.510   47.799 -3.644  1.00 22.89 ? 212 ARG B CA   1 
ATOM   6204 C C    . ARG B 1 212 ? 3.268   48.724 -2.455  1.00 24.24 ? 212 ARG B C    1 
ATOM   6205 O O    . ARG B 1 212 ? 3.258   48.261 -1.301  1.00 23.00 ? 212 ARG B O    1 
ATOM   6206 C CB   . ARG B 1 212 ? 4.829   48.096 -4.388  1.00 23.69 ? 212 ARG B CB   1 
ATOM   6207 C CG   . ARG B 1 212 ? 6.043   48.433 -3.571  1.00 20.67 ? 212 ARG B CG   1 
ATOM   6208 C CD   . ARG B 1 212 ? 7.076   49.127 -4.487  1.00 23.53 ? 212 ARG B CD   1 
ATOM   6209 N NE   . ARG B 1 212 ? 7.032   50.595 -4.417  1.00 22.07 ? 212 ARG B NE   1 
ATOM   6210 C CZ   . ARG B 1 212 ? 7.331   51.287 -3.315  1.00 22.56 ? 212 ARG B CZ   1 
ATOM   6211 N NH1  . ARG B 1 212 ? 7.692   50.647 -2.204  1.00 23.83 ? 212 ARG B NH1  1 
ATOM   6212 N NH2  . ARG B 1 212 ? 7.271   52.612 -3.308  1.00 20.96 ? 212 ARG B NH2  1 
ATOM   6213 H H    . ARG B 1 212 ? 2.601   48.096 -5.526  1.00 0.00  ? 212 ARG B H    1 
ATOM   6214 H HE   . ARG B 1 212 ? 6.778   51.094 -5.234  1.00 0.00  ? 212 ARG B HE   1 
ATOM   6215 H HH11 . ARG B 1 212 ? 7.743   49.647 -2.185  1.00 0.00  ? 212 ARG B HH11 1 
ATOM   6216 H HH12 . ARG B 1 212 ? 7.921   51.144 -1.364  1.00 0.00  ? 212 ARG B HH12 1 
ATOM   6217 H HH21 . ARG B 1 212 ? 7.030   53.071 -4.172  1.00 0.00  ? 212 ARG B HH21 1 
ATOM   6218 H HH22 . ARG B 1 212 ? 7.501   53.167 -2.505  1.00 0.00  ? 212 ARG B HH22 1 
ATOM   6219 N N    . GLN B 1 213 ? 3.003   50.007 -2.717  1.00 23.86 ? 213 GLN B N    1 
ATOM   6220 C CA   . GLN B 1 213 ? 2.761   50.927 -1.605  1.00 24.23 ? 213 GLN B CA   1 
ATOM   6221 C C    . GLN B 1 213 ? 1.460   50.644 -0.887  1.00 23.91 ? 213 GLN B C    1 
ATOM   6222 O O    . GLN B 1 213 ? 1.274   51.038 0.250   1.00 26.23 ? 213 GLN B O    1 
ATOM   6223 C CB   . GLN B 1 213 ? 2.930   52.420 -1.982  1.00 25.30 ? 213 GLN B CB   1 
ATOM   6224 C CG   . GLN B 1 213 ? 2.600   52.803 -3.382  1.00 27.32 ? 213 GLN B CG   1 
ATOM   6225 C CD   . GLN B 1 213 ? 3.263   54.120 -3.816  1.00 28.63 ? 213 GLN B CD   1 
ATOM   6226 O OE1  . GLN B 1 213 ? 2.594   55.156 -3.971  1.00 31.18 ? 213 GLN B OE1  1 
ATOM   6227 N NE2  . GLN B 1 213 ? 4.555   54.066 -4.084  1.00 27.93 ? 213 GLN B NE2  1 
ATOM   6228 H H    . GLN B 1 213 ? 2.983   50.320 -3.650  1.00 0.00  ? 213 GLN B H    1 
ATOM   6229 H HE21 . GLN B 1 213 ? 4.974   54.899 -4.370  1.00 0.00  ? 213 GLN B HE21 1 
ATOM   6230 H HE22 . GLN B 1 213 ? 5.000   53.203 -4.009  1.00 0.00  ? 213 GLN B HE22 1 
ATOM   6231 N N    . ARG B 1 214 ? 0.567   49.919 -1.528  1.00 23.85 ? 214 ARG B N    1 
ATOM   6232 C CA   . ARG B 1 214 ? -0.688  49.573 -0.870  1.00 22.13 ? 214 ARG B CA   1 
ATOM   6233 C C    . ARG B 1 214 ? -0.438  48.329 -0.022  1.00 21.59 ? 214 ARG B C    1 
ATOM   6234 O O    . ARG B 1 214 ? -1.183  48.039 0.893   1.00 22.90 ? 214 ARG B O    1 
ATOM   6235 C CB   . ARG B 1 214 ? -1.739  49.254 -1.927  1.00 25.32 ? 214 ARG B CB   1 
ATOM   6236 C CG   . ARG B 1 214 ? -3.114  49.835 -1.686  1.00 25.01 ? 214 ARG B CG   1 
ATOM   6237 C CD   . ARG B 1 214 ? -4.023  49.510 -2.824  1.00 25.52 ? 214 ARG B CD   1 
ATOM   6238 N NE   . ARG B 1 214 ? -3.606  50.196 -4.032  1.00 29.50 ? 214 ARG B NE   1 
ATOM   6239 C CZ   . ARG B 1 214 ? -3.735  49.712 -5.269  1.00 32.66 ? 214 ARG B CZ   1 
ATOM   6240 N NH1  . ARG B 1 214 ? -4.282  48.512 -5.484  1.00 31.14 ? 214 ARG B NH1  1 
ATOM   6241 N NH2  . ARG B 1 214 ? -3.322  50.451 -6.300  1.00 34.31 ? 214 ARG B NH2  1 
ATOM   6242 H H    . ARG B 1 214 ? 0.711   49.666 -2.464  1.00 0.00  ? 214 ARG B H    1 
ATOM   6243 H HE   . ARG B 1 214 ? -3.202  51.083 -3.924  1.00 0.00  ? 214 ARG B HE   1 
ATOM   6244 H HH11 . ARG B 1 214 ? -4.562  47.952 -4.699  1.00 0.00  ? 214 ARG B HH11 1 
ATOM   6245 H HH12 . ARG B 1 214 ? -4.364  48.102 -6.395  1.00 0.00  ? 214 ARG B HH12 1 
ATOM   6246 H HH21 . ARG B 1 214 ? -2.968  51.383 -6.154  1.00 0.00  ? 214 ARG B HH21 1 
ATOM   6247 H HH22 . ARG B 1 214 ? -3.423  50.137 -7.248  1.00 0.00  ? 214 ARG B HH22 1 
ATOM   6248 N N    . GLY B 1 215 ? 0.576   47.554 -0.390  1.00 22.05 ? 215 GLY B N    1 
ATOM   6249 C CA   . GLY B 1 215 ? 0.915   46.337 0.326   1.00 19.12 ? 215 GLY B CA   1 
ATOM   6250 C C    . GLY B 1 215 ? 0.254   45.110 -0.268  1.00 18.91 ? 215 GLY B C    1 
ATOM   6251 O O    . GLY B 1 215 ? 0.250   44.044 0.348   1.00 20.05 ? 215 GLY B O    1 
ATOM   6252 H H    . GLY B 1 215 ? 1.081   47.771 -1.202  1.00 0.00  ? 215 GLY B H    1 
ATOM   6253 N N    . ASP B 1 216 ? -0.280  45.227 -1.471  1.00 17.98 ? 216 ASP B N    1 
ATOM   6254 C CA   . ASP B 1 216 ? -0.944  44.097 -2.083  1.00 18.37 ? 216 ASP B CA   1 
ATOM   6255 C C    . ASP B 1 216 ? 0.075   42.985 -2.428  1.00 19.88 ? 216 ASP B C    1 
ATOM   6256 O O    . ASP B 1 216 ? 1.244   43.288 -2.716  1.00 22.30 ? 216 ASP B O    1 
ATOM   6257 C CB   . ASP B 1 216 ? -1.669  44.538 -3.348  1.00 22.18 ? 216 ASP B CB   1 
ATOM   6258 C CG   . ASP B 1 216 ? -2.679  45.647 -3.112  1.00 24.39 ? 216 ASP B CG   1 
ATOM   6259 O OD1  . ASP B 1 216 ? -3.196  45.797 -1.988  1.00 28.12 ? 216 ASP B OD1  1 
ATOM   6260 O OD2  . ASP B 1 216 ? -2.977  46.361 -4.091  1.00 21.25 ? 216 ASP B OD2  1 
ATOM   6261 H H    . ASP B 1 216 ? -0.158  46.059 -1.976  1.00 0.00  ? 216 ASP B H    1 
ATOM   6262 N N    . PHE B 1 217 ? -0.368  41.723 -2.443  1.00 18.22 ? 217 PHE B N    1 
ATOM   6263 C CA   . PHE B 1 217 ? 0.519   40.603 -2.741  1.00 20.15 ? 217 PHE B CA   1 
ATOM   6264 C C    . PHE B 1 217 ? 0.719   40.551 -4.219  1.00 19.22 ? 217 PHE B C    1 
ATOM   6265 O O    . PHE B 1 217 ? -0.264  40.474 -4.934  1.00 19.20 ? 217 PHE B O    1 
ATOM   6266 C CB   . PHE B 1 217 ? -0.124  39.250 -2.353  1.00 23.03 ? 217 PHE B CB   1 
ATOM   6267 C CG   . PHE B 1 217 ? -0.125  38.930 -0.854  1.00 23.80 ? 217 PHE B CG   1 
ATOM   6268 C CD1  . PHE B 1 217 ? 0.349   39.835 0.089   1.00 24.22 ? 217 PHE B CD1  1 
ATOM   6269 C CD2  . PHE B 1 217 ? -0.620  37.706 -0.412  1.00 21.40 ? 217 PHE B CD2  1 
ATOM   6270 C CE1  . PHE B 1 217 ? 0.335   39.540 1.427   1.00 22.12 ? 217 PHE B CE1  1 
ATOM   6271 C CE2  . PHE B 1 217 ? -0.643  37.400 0.922   1.00 20.78 ? 217 PHE B CE2  1 
ATOM   6272 C CZ   . PHE B 1 217 ? -0.160  38.323 1.852   1.00 21.74 ? 217 PHE B CZ   1 
ATOM   6273 H H    . PHE B 1 217 ? -1.310  41.563 -2.299  1.00 0.00  ? 217 PHE B H    1 
ATOM   6274 N N    . VAL B 1 218 ? 1.957   40.529 -4.701  1.00 19.16 ? 218 VAL B N    1 
ATOM   6275 C CA   . VAL B 1 218 ? 2.167   40.439 -6.156  1.00 15.95 ? 218 VAL B CA   1 
ATOM   6276 C C    . VAL B 1 218 ? 3.075   39.262 -6.491  1.00 15.34 ? 218 VAL B C    1 
ATOM   6277 O O    . VAL B 1 218 ? 4.123   39.070 -5.878  1.00 18.29 ? 218 VAL B O    1 
ATOM   6278 C CB   . VAL B 1 218 ? 2.822   41.752 -6.849  1.00 14.51 ? 218 VAL B CB   1 
ATOM   6279 C CG1  . VAL B 1 218 ? 2.894   41.523 -8.324  1.00 8.46  ? 218 VAL B CG1  1 
ATOM   6280 C CG2  . VAL B 1 218 ? 1.996   43.036 -6.647  1.00 10.03 ? 218 VAL B CG2  1 
ATOM   6281 H H    . VAL B 1 218 ? 2.728   40.563 -4.084  1.00 0.00  ? 218 VAL B H    1 
ATOM   6282 N N    . MET B 1 219 ? 2.704   38.503 -7.503  1.00 15.36 ? 219 MET B N    1 
ATOM   6283 C CA   . MET B 1 219 ? 3.532   37.396 -7.892  1.00 14.23 ? 219 MET B CA   1 
ATOM   6284 C C    . MET B 1 219 ? 4.079   37.503 -9.308  1.00 15.11 ? 219 MET B C    1 
ATOM   6285 O O    . MET B 1 219 ? 3.307   37.600 -10.288 1.00 16.61 ? 219 MET B O    1 
ATOM   6286 C CB   . MET B 1 219 ? 2.788   36.087 -7.749  1.00 14.58 ? 219 MET B CB   1 
ATOM   6287 C CG   . MET B 1 219 ? 3.679   34.906 -8.157  1.00 22.86 ? 219 MET B CG   1 
ATOM   6288 S SD   . MET B 1 219 ? 2.785   33.356 -8.146  1.00 28.22 ? 219 MET B SD   1 
ATOM   6289 C CE   . MET B 1 219 ? 1.694   33.572 -9.562  1.00 26.43 ? 219 MET B CE   1 
ATOM   6290 H H    . MET B 1 219 ? 1.847   38.668 -7.961  1.00 0.00  ? 219 MET B H    1 
ATOM   6291 N N    . PHE B 1 220 ? 5.401   37.453 -9.425  1.00 12.34 ? 220 PHE B N    1 
ATOM   6292 C CA   . PHE B 1 220 ? 6.057   37.475 -10.731 1.00 10.71 ? 220 PHE B CA   1 
ATOM   6293 C C    . PHE B 1 220 ? 6.377   36.016 -11.119 1.00 10.61 ? 220 PHE B C    1 
ATOM   6294 O O    . PHE B 1 220 ? 6.840   35.217 -10.261 1.00 11.34 ? 220 PHE B O    1 
ATOM   6295 C CB   . PHE B 1 220 ? 7.358   38.279 -10.667 1.00 7.03  ? 220 PHE B CB   1 
ATOM   6296 C CG   . PHE B 1 220 ? 7.159   39.736 -10.380 1.00 7.72  ? 220 PHE B CG   1 
ATOM   6297 C CD1  . PHE B 1 220 ? 6.794   40.623 -11.417 1.00 6.24  ? 220 PHE B CD1  1 
ATOM   6298 C CD2  . PHE B 1 220 ? 7.372   40.243 -9.090  1.00 9.19  ? 220 PHE B CD2  1 
ATOM   6299 C CE1  . PHE B 1 220 ? 6.654   41.980 -11.188 1.00 5.91  ? 220 PHE B CE1  1 
ATOM   6300 C CE2  . PHE B 1 220 ? 7.224   41.628 -8.837  1.00 12.18 ? 220 PHE B CE2  1 
ATOM   6301 C CZ   . PHE B 1 220 ? 6.863   42.503 -9.903  1.00 8.60  ? 220 PHE B CZ   1 
ATOM   6302 H H    . PHE B 1 220 ? 5.945   37.351 -8.602  1.00 0.00  ? 220 PHE B H    1 
ATOM   6303 N N    . GLU B 1 221 ? 6.111   35.641 -12.362 1.00 9.34  ? 221 GLU B N    1 
ATOM   6304 C CA   . GLU B 1 221 ? 6.431   34.277 -12.759 1.00 12.63 ? 221 GLU B CA   1 
ATOM   6305 C C    . GLU B 1 221 ? 7.287   34.032 -13.975 1.00 14.60 ? 221 GLU B C    1 
ATOM   6306 O O    . GLU B 1 221 ? 7.010   34.502 -15.083 1.00 16.31 ? 221 GLU B O    1 
ATOM   6307 C CB   . GLU B 1 221 ? 5.205   33.455 -12.850 1.00 11.23 ? 221 GLU B CB   1 
ATOM   6308 C CG   . GLU B 1 221 ? 4.227   34.054 -13.680 1.00 11.73 ? 221 GLU B CG   1 
ATOM   6309 C CD   . GLU B 1 221 ? 3.058   33.168 -13.766 1.00 11.65 ? 221 GLU B CD   1 
ATOM   6310 O OE1  . GLU B 1 221 ? 3.208   32.043 -14.348 1.00 7.90  ? 221 GLU B OE1  1 
ATOM   6311 O OE2  . GLU B 1 221 ? 2.016   33.622 -13.258 1.00 11.87 ? 221 GLU B OE2  1 
ATOM   6312 H H    . GLU B 1 221 ? 5.671   36.252 -12.992 1.00 0.00  ? 221 GLU B H    1 
ATOM   6313 N N    . GLY B 1 222 ? 8.378   33.331 -13.728 1.00 16.98 ? 222 GLY B N    1 
ATOM   6314 C CA   . GLY B 1 222 ? 9.318   33.014 -14.789 1.00 17.53 ? 222 GLY B CA   1 
ATOM   6315 C C    . GLY B 1 222 ? 8.754   31.972 -15.723 1.00 13.82 ? 222 GLY B C    1 
ATOM   6316 O O    . GLY B 1 222 ? 7.885   31.201 -15.357 1.00 14.73 ? 222 GLY B O    1 
ATOM   6317 H H    . GLY B 1 222 ? 8.567   32.979 -12.822 1.00 0.00  ? 222 GLY B H    1 
ATOM   6318 N N    . ALA B 1 223 ? 9.217   31.956 -16.951 1.00 14.06 ? 223 ALA B N    1 
ATOM   6319 C CA   . ALA B 1 223 ? 8.709   30.944 -17.852 1.00 12.92 ? 223 ALA B CA   1 
ATOM   6320 C C    . ALA B 1 223 ? 9.766   29.889 -18.198 1.00 14.94 ? 223 ALA B C    1 
ATOM   6321 O O    . ALA B 1 223 ? 9.360   28.781 -18.569 1.00 18.82 ? 223 ALA B O    1 
ATOM   6322 C CB   . ALA B 1 223 ? 8.101   31.563 -19.128 1.00 6.26  ? 223 ALA B CB   1 
ATOM   6323 H H    . ALA B 1 223 ? 9.870   32.616 -17.268 1.00 0.00  ? 223 ALA B H    1 
ATOM   6324 N N    . GLN B 1 224 ? 11.079  30.210 -18.101 1.00 11.96 ? 224 GLN B N    1 
ATOM   6325 C CA   . GLN B 1 224 ? 12.151  29.246 -18.436 1.00 11.56 ? 224 GLN B CA   1 
ATOM   6326 C C    . GLN B 1 224 ? 13.208  29.125 -17.361 1.00 11.89 ? 224 GLN B C    1 
ATOM   6327 O O    . GLN B 1 224 ? 13.477  30.091 -16.660 1.00 13.33 ? 224 GLN B O    1 
ATOM   6328 C CB   . GLN B 1 224 ? 12.868  29.590 -19.741 1.00 11.80 ? 224 GLN B CB   1 
ATOM   6329 C CG   . GLN B 1 224 ? 12.150  29.213 -21.004 1.00 16.87 ? 224 GLN B CG   1 
ATOM   6330 C CD   . GLN B 1 224 ? 11.204  30.311 -21.487 1.00 19.09 ? 224 GLN B CD   1 
ATOM   6331 O OE1  . GLN B 1 224 ? 11.580  31.141 -22.308 1.00 20.24 ? 224 GLN B OE1  1 
ATOM   6332 N NE2  . GLN B 1 224 ? 9.962   30.288 -21.013 1.00 22.42 ? 224 GLN B NE2  1 
ATOM   6333 H H    . GLN B 1 224 ? 11.347  31.099 -17.761 1.00 0.00  ? 224 GLN B H    1 
ATOM   6334 H HE21 . GLN B 1 224 ? 9.351   30.990 -21.316 1.00 0.00  ? 224 GLN B HE21 1 
ATOM   6335 H HE22 . GLN B 1 224 ? 9.700   29.559 -20.415 1.00 0.00  ? 224 GLN B HE22 1 
ATOM   6336 N N    . GLY B 1 225 ? 13.866  27.964 -17.298 1.00 9.13  ? 225 GLY B N    1 
ATOM   6337 C CA   . GLY B 1 225 ? 14.892  27.707 -16.308 1.00 9.42  ? 225 GLY B CA   1 
ATOM   6338 C C    . GLY B 1 225 ? 16.027  28.708 -16.295 1.00 11.79 ? 225 GLY B C    1 
ATOM   6339 O O    . GLY B 1 225 ? 16.364  29.291 -17.328 1.00 9.14  ? 225 GLY B O    1 
ATOM   6340 H H    . GLY B 1 225 ? 13.671  27.271 -17.960 1.00 0.00  ? 225 GLY B H    1 
ATOM   6341 N N    . THR B 1 226 ? 16.638  28.852 -15.118 1.00 14.14 ? 226 THR B N    1 
ATOM   6342 C CA   . THR B 1 226 ? 17.738  29.766 -14.873 1.00 14.36 ? 226 THR B CA   1 
ATOM   6343 C C    . THR B 1 226 ? 18.918  29.509 -15.822 1.00 14.19 ? 226 THR B C    1 
ATOM   6344 O O    . THR B 1 226 ? 19.439  30.433 -16.461 1.00 10.20 ? 226 THR B O    1 
ATOM   6345 C CB   . THR B 1 226 ? 18.241  29.637 -13.354 1.00 17.12 ? 226 THR B CB   1 
ATOM   6346 O OG1  . THR B 1 226 ? 17.279  30.190 -12.441 1.00 21.85 ? 226 THR B OG1  1 
ATOM   6347 C CG2  . THR B 1 226 ? 19.581  30.341 -13.115 1.00 19.26 ? 226 THR B CG2  1 
ATOM   6348 H H    . THR B 1 226 ? 16.273  28.353 -14.358 1.00 0.00  ? 226 THR B H    1 
ATOM   6349 H HG1  . THR B 1 226 ? 16.436  29.736 -12.608 1.00 0.00  ? 226 THR B HG1  1 
ATOM   6350 N N    . LEU B 1 227 ? 19.293  28.245 -15.992 1.00 15.49 ? 227 LEU B N    1 
ATOM   6351 C CA   . LEU B 1 227 ? 20.473  27.971 -16.797 1.00 16.83 ? 227 LEU B CA   1 
ATOM   6352 C C    . LEU B 1 227 ? 20.395  28.205 -18.288 1.00 19.32 ? 227 LEU B C    1 
ATOM   6353 O O    . LEU B 1 227 ? 21.419  28.067 -18.990 1.00 17.32 ? 227 LEU B O    1 
ATOM   6354 C CB   . LEU B 1 227 ? 21.079  26.614 -16.450 1.00 13.98 ? 227 LEU B CB   1 
ATOM   6355 C CG   . LEU B 1 227 ? 21.567  26.581 -15.010 1.00 15.20 ? 227 LEU B CG   1 
ATOM   6356 C CD1  . LEU B 1 227 ? 22.563  25.465 -14.903 1.00 17.19 ? 227 LEU B CD1  1 
ATOM   6357 C CD2  . LEU B 1 227 ? 22.230  27.874 -14.576 1.00 14.71 ? 227 LEU B CD2  1 
ATOM   6358 H H    . LEU B 1 227 ? 18.795  27.471 -15.649 1.00 0.00  ? 227 LEU B H    1 
ATOM   6359 N N    . LEU B 1 228 ? 19.205  28.577 -18.762 1.00 17.11 ? 228 LEU B N    1 
ATOM   6360 C CA   . LEU B 1 228 ? 18.995  28.882 -20.180 1.00 17.84 ? 228 LEU B CA   1 
ATOM   6361 C C    . LEU B 1 228 ? 19.176  30.382 -20.469 1.00 17.17 ? 228 LEU B C    1 
ATOM   6362 O O    . LEU B 1 228 ? 18.990  30.837 -21.603 1.00 17.76 ? 228 LEU B O    1 
ATOM   6363 C CB   . LEU B 1 228 ? 17.568  28.532 -20.588 1.00 19.36 ? 228 LEU B CB   1 
ATOM   6364 C CG   . LEU B 1 228 ? 17.151  27.082 -20.735 1.00 17.73 ? 228 LEU B CG   1 
ATOM   6365 C CD1  . LEU B 1 228 ? 15.666  27.136 -20.877 1.00 16.23 ? 228 LEU B CD1  1 
ATOM   6366 C CD2  . LEU B 1 228 ? 17.791  26.458 -21.965 1.00 18.78 ? 228 LEU B CD2  1 
ATOM   6367 H H    . LEU B 1 228 ? 18.444  28.692 -18.160 1.00 0.00  ? 228 LEU B H    1 
ATOM   6368 N N    . ASP B 1 229 ? 19.523  31.132 -19.434 1.00 17.28 ? 229 ASP B N    1 
ATOM   6369 C CA   . ASP B 1 229 ? 19.656  32.564 -19.525 1.00 16.25 ? 229 ASP B CA   1 
ATOM   6370 C C    . ASP B 1 229 ? 20.614  32.988 -20.602 1.00 18.21 ? 229 ASP B C    1 
ATOM   6371 O O    . ASP B 1 229 ? 21.749  32.499 -20.695 1.00 16.79 ? 229 ASP B O    1 
ATOM   6372 C CB   . ASP B 1 229 ? 20.044  33.127 -18.167 1.00 15.98 ? 229 ASP B CB   1 
ATOM   6373 C CG   . ASP B 1 229 ? 20.057  34.609 -18.147 1.00 16.06 ? 229 ASP B CG   1 
ATOM   6374 O OD1  . ASP B 1 229 ? 21.119  35.177 -18.484 1.00 14.11 ? 229 ASP B OD1  1 
ATOM   6375 O OD2  . ASP B 1 229 ? 19.014  35.202 -17.781 1.00 18.99 ? 229 ASP B OD2  1 
ATOM   6376 H H    . ASP B 1 229 ? 19.676  30.747 -18.548 1.00 0.00  ? 229 ASP B H    1 
ATOM   6377 N N    . ILE B 1 230 ? 20.112  33.902 -21.429 1.00 20.44 ? 230 ILE B N    1 
ATOM   6378 C CA   . ILE B 1 230 ? 20.837  34.449 -22.574 1.00 18.62 ? 230 ILE B CA   1 
ATOM   6379 C C    . ILE B 1 230 ? 22.165  35.040 -22.153 1.00 18.96 ? 230 ILE B C    1 
ATOM   6380 O O    . ILE B 1 230 ? 23.118  34.985 -22.898 1.00 21.64 ? 230 ILE B O    1 
ATOM   6381 C CB   . ILE B 1 230 ? 19.931  35.478 -23.388 1.00 17.80 ? 230 ILE B CB   1 
ATOM   6382 C CG1  . ILE B 1 230 ? 20.524  35.733 -24.794 1.00 16.75 ? 230 ILE B CG1  1 
ATOM   6383 C CG2  . ILE B 1 230 ? 19.621  36.749 -22.564 1.00 7.51  ? 230 ILE B CG2  1 
ATOM   6384 C CD1  . ILE B 1 230 ? 20.977  37.120 -25.034 1.00 13.12 ? 230 ILE B CD1  1 
ATOM   6385 H H    . ILE B 1 230 ? 19.195  34.194 -21.268 1.00 0.00  ? 230 ILE B H    1 
ATOM   6386 N N    . ASP B 1 231 ? 22.268  35.486 -20.913 1.00 20.35 ? 231 ASP B N    1 
ATOM   6387 C CA   . ASP B 1 231 ? 23.531  36.044 -20.431 1.00 21.57 ? 231 ASP B CA   1 
ATOM   6388 C C    . ASP B 1 231 ? 24.364  35.195 -19.476 1.00 22.13 ? 231 ASP B C    1 
ATOM   6389 O O    . ASP B 1 231 ? 25.602  35.322 -19.431 1.00 24.66 ? 231 ASP B O    1 
ATOM   6390 C CB   . ASP B 1 231 ? 23.270  37.368 -19.734 1.00 22.72 ? 231 ASP B CB   1 
ATOM   6391 C CG   . ASP B 1 231 ? 23.548  38.504 -20.614 1.00 22.83 ? 231 ASP B CG   1 
ATOM   6392 O OD1  . ASP B 1 231 ? 24.761  38.702 -20.839 1.00 28.27 ? 231 ASP B OD1  1 
ATOM   6393 O OD2  . ASP B 1 231 ? 22.589  39.136 -21.112 1.00 20.51 ? 231 ASP B OD2  1 
ATOM   6394 H H    . ASP B 1 231 ? 21.522  35.433 -20.279 1.00 0.00  ? 231 ASP B H    1 
ATOM   6395 N N    . HIS B 1 232 ? 23.705  34.333 -18.709 1.00 21.10 ? 232 HIS B N    1 
ATOM   6396 C CA   . HIS B 1 232 ? 24.417  33.578 -17.721 1.00 18.95 ? 232 HIS B CA   1 
ATOM   6397 C C    . HIS B 1 232 ? 24.375  32.053 -17.762 1.00 20.77 ? 232 HIS B C    1 
ATOM   6398 O O    . HIS B 1 232 ? 24.990  31.405 -16.917 1.00 22.32 ? 232 HIS B O    1 
ATOM   6399 C CB   . HIS B 1 232 ? 24.029  34.160 -16.343 1.00 19.87 ? 232 HIS B CB   1 
ATOM   6400 C CG   . HIS B 1 232 ? 24.659  35.502 -16.073 1.00 15.67 ? 232 HIS B CG   1 
ATOM   6401 N ND1  . HIS B 1 232 ? 26.006  35.639 -15.798 1.00 10.55 ? 232 HIS B ND1  1 
ATOM   6402 C CD2  . HIS B 1 232 ? 24.176  36.764 -16.211 1.00 14.38 ? 232 HIS B CD2  1 
ATOM   6403 C CE1  . HIS B 1 232 ? 26.331  36.922 -15.792 1.00 12.86 ? 232 HIS B CE1  1 
ATOM   6404 N NE2  . HIS B 1 232 ? 25.239  37.624 -16.041 1.00 13.62 ? 232 HIS B NE2  1 
ATOM   6405 H H    . HIS B 1 232 ? 22.729  34.255 -18.802 1.00 0.00  ? 232 HIS B H    1 
ATOM   6406 H HE2  . HIS B 1 232 ? 25.182  38.599 -16.116 1.00 0.00  ? 232 HIS B HE2  1 
ATOM   6407 N N    . GLY B 1 233 ? 23.701  31.506 -18.777 1.00 21.82 ? 233 GLY B N    1 
ATOM   6408 C CA   . GLY B 1 233 ? 23.572  30.081 -18.958 1.00 21.36 ? 233 GLY B CA   1 
ATOM   6409 C C    . GLY B 1 233 ? 24.540  29.546 -19.992 1.00 23.49 ? 233 GLY B C    1 
ATOM   6410 O O    . GLY B 1 233 ? 25.348  30.300 -20.510 1.00 25.58 ? 233 GLY B O    1 
ATOM   6411 H H    . GLY B 1 233 ? 23.265  32.060 -19.461 1.00 0.00  ? 233 GLY B H    1 
ATOM   6412 N N    . THR B 1 234 ? 24.400  28.279 -20.381 1.00 24.95 ? 234 THR B N    1 
ATOM   6413 C CA   . THR B 1 234 ? 25.331  27.659 -21.324 1.00 27.84 ? 234 THR B CA   1 
ATOM   6414 C C    . THR B 1 234 ? 25.336  28.119 -22.820 1.00 29.26 ? 234 THR B C    1 
ATOM   6415 O O    . THR B 1 234 ? 24.833  27.404 -23.726 1.00 29.58 ? 234 THR B O    1 
ATOM   6416 C CB   . THR B 1 234 ? 25.258  26.101 -21.209 1.00 29.97 ? 234 THR B CB   1 
ATOM   6417 O OG1  . THR B 1 234 ? 23.984  25.620 -21.680 1.00 34.89 ? 234 THR B OG1  1 
ATOM   6418 C CG2  . THR B 1 234 ? 25.417  25.675 -19.755 1.00 29.25 ? 234 THR B CG2  1 
ATOM   6419 H H    . THR B 1 234 ? 23.610  27.796 -20.052 1.00 0.00  ? 234 THR B H    1 
ATOM   6420 H HG1  . THR B 1 234 ? 23.815  26.048 -22.535 1.00 0.00  ? 234 THR B HG1  1 
ATOM   6421 N N    . TYR B 1 235 ? 25.924  29.289 -23.086 1.00 26.22 ? 235 TYR B N    1 
ATOM   6422 C CA   . TYR B 1 235 ? 25.998  29.801 -24.457 1.00 26.11 ? 235 TYR B CA   1 
ATOM   6423 C C    . TYR B 1 235 ? 26.621  28.738 -25.378 1.00 25.51 ? 235 TYR B C    1 
ATOM   6424 O O    . TYR B 1 235 ? 27.407  27.903 -24.923 1.00 26.70 ? 235 TYR B O    1 
ATOM   6425 C CB   . TYR B 1 235 ? 26.866  31.077 -24.535 1.00 27.13 ? 235 TYR B CB   1 
ATOM   6426 C CG   . TYR B 1 235 ? 26.482  32.009 -25.670 1.00 26.67 ? 235 TYR B CG   1 
ATOM   6427 C CD1  . TYR B 1 235 ? 25.466  32.952 -25.491 1.00 26.73 ? 235 TYR B CD1  1 
ATOM   6428 C CD2  . TYR B 1 235 ? 27.096  31.937 -26.928 1.00 27.97 ? 235 TYR B CD2  1 
ATOM   6429 C CE1  . TYR B 1 235 ? 25.053  33.800 -26.518 1.00 25.89 ? 235 TYR B CE1  1 
ATOM   6430 C CE2  . TYR B 1 235 ? 26.684  32.798 -27.982 1.00 27.26 ? 235 TYR B CE2  1 
ATOM   6431 C CZ   . TYR B 1 235 ? 25.654  33.727 -27.757 1.00 27.11 ? 235 TYR B CZ   1 
ATOM   6432 O OH   . TYR B 1 235 ? 25.201  34.588 -28.743 1.00 20.22 ? 235 TYR B OH   1 
ATOM   6433 H H    . TYR B 1 235 ? 26.286  29.797 -22.325 1.00 0.00  ? 235 TYR B H    1 
ATOM   6434 H HH   . TYR B 1 235 ? 25.745  34.488 -29.523 1.00 0.00  ? 235 TYR B HH   1 
ATOM   6435 N N    . PRO B 1 236 ? 26.074  28.586 -26.590 1.00 25.40 ? 236 PRO B N    1 
ATOM   6436 C CA   . PRO B 1 236 ? 24.921  29.359 -27.038 1.00 23.26 ? 236 PRO B CA   1 
ATOM   6437 C C    . PRO B 1 236 ? 23.677  28.511 -26.778 1.00 20.14 ? 236 PRO B C    1 
ATOM   6438 O O    . PRO B 1 236 ? 22.606  28.837 -27.312 1.00 21.80 ? 236 PRO B O    1 
ATOM   6439 C CB   . PRO B 1 236 ? 25.173  29.524 -28.534 1.00 21.67 ? 236 PRO B CB   1 
ATOM   6440 C CG   . PRO B 1 236 ? 25.731  28.203 -28.881 1.00 24.53 ? 236 PRO B CG   1 
ATOM   6441 C CD   . PRO B 1 236 ? 26.731  27.943 -27.739 1.00 26.44 ? 236 PRO B CD   1 
ATOM   6442 N N    . TYR B 1 237 ? 23.811  27.463 -25.945 1.00 16.94 ? 237 TYR B N    1 
ATOM   6443 C CA   . TYR B 1 237 ? 22.669  26.582 -25.624 1.00 19.33 ? 237 TYR B CA   1 
ATOM   6444 C C    . TYR B 1 237 ? 21.769  27.279 -24.634 1.00 18.22 ? 237 TYR B C    1 
ATOM   6445 O O    . TYR B 1 237 ? 21.532  26.810 -23.525 1.00 16.49 ? 237 TYR B O    1 
ATOM   6446 C CB   . TYR B 1 237 ? 23.111  25.220 -25.080 1.00 21.49 ? 237 TYR B CB   1 
ATOM   6447 C CG   . TYR B 1 237 ? 24.021  24.516 -26.017 1.00 24.50 ? 237 TYR B CG   1 
ATOM   6448 C CD1  . TYR B 1 237 ? 25.373  24.841 -26.051 1.00 27.54 ? 237 TYR B CD1  1 
ATOM   6449 C CD2  . TYR B 1 237 ? 23.523  23.626 -26.957 1.00 25.78 ? 237 TYR B CD2  1 
ATOM   6450 C CE1  . TYR B 1 237 ? 26.202  24.309 -27.007 1.00 30.56 ? 237 TYR B CE1  1 
ATOM   6451 C CE2  . TYR B 1 237 ? 24.346  23.084 -27.927 1.00 27.11 ? 237 TYR B CE2  1 
ATOM   6452 C CZ   . TYR B 1 237 ? 25.688  23.432 -27.949 1.00 28.62 ? 237 TYR B CZ   1 
ATOM   6453 O OH   . TYR B 1 237 ? 26.537  22.909 -28.896 1.00 31.44 ? 237 TYR B OH   1 
ATOM   6454 H H    . TYR B 1 237 ? 24.641  27.283 -25.446 1.00 0.00  ? 237 TYR B H    1 
ATOM   6455 H HH   . TYR B 1 237 ? 26.052  22.344 -29.499 1.00 0.00  ? 237 TYR B HH   1 
ATOM   6456 N N    . VAL B 1 238 ? 21.250  28.410 -25.076 1.00 18.88 ? 238 VAL B N    1 
ATOM   6457 C CA   . VAL B 1 238 ? 20.403  29.221 -24.242 1.00 20.81 ? 238 VAL B CA   1 
ATOM   6458 C C    . VAL B 1 238 ? 19.175  29.680 -25.010 1.00 21.73 ? 238 VAL B C    1 
ATOM   6459 O O    . VAL B 1 238 ? 18.982  29.321 -26.181 1.00 20.12 ? 238 VAL B O    1 
ATOM   6460 C CB   . VAL B 1 238 ? 21.191  30.436 -23.722 1.00 20.84 ? 238 VAL B CB   1 
ATOM   6461 C CG1  . VAL B 1 238 ? 22.348  29.976 -22.885 1.00 17.52 ? 238 VAL B CG1  1 
ATOM   6462 C CG2  . VAL B 1 238 ? 21.684  31.270 -24.873 1.00 19.90 ? 238 VAL B CG2  1 
ATOM   6463 H H    . VAL B 1 238 ? 21.416  28.690 -26.007 1.00 0.00  ? 238 VAL B H    1 
ATOM   6464 N N    . THR B 1 239 ? 18.328  30.432 -24.315 1.00 21.19 ? 239 THR B N    1 
ATOM   6465 C CA   . THR B 1 239 ? 17.109  30.979 -24.880 1.00 19.12 ? 239 THR B CA   1 
ATOM   6466 C C    . THR B 1 239 ? 17.427  32.447 -25.291 1.00 19.69 ? 239 THR B C    1 
ATOM   6467 O O    . THR B 1 239 ? 18.550  32.938 -25.032 1.00 20.24 ? 239 THR B O    1 
ATOM   6468 C CB   . THR B 1 239 ? 15.999  30.862 -23.841 1.00 18.93 ? 239 THR B CB   1 
ATOM   6469 O OG1  . THR B 1 239 ? 14.728  30.888 -24.491 1.00 22.84 ? 239 THR B OG1  1 
ATOM   6470 C CG2  . THR B 1 239 ? 16.091  31.981 -22.803 1.00 16.92 ? 239 THR B CG2  1 
ATOM   6471 H H    . THR B 1 239 ? 18.555  30.656 -23.380 1.00 0.00  ? 239 THR B H    1 
ATOM   6472 H HG1  . THR B 1 239 ? 14.607  30.039 -24.930 1.00 0.00  ? 239 THR B HG1  1 
ATOM   6473 N N    . SER B 1 240 ? 16.467  33.130 -25.926 1.00 21.14 ? 240 SER B N    1 
ATOM   6474 C CA   . SER B 1 240 ? 16.640  34.522 -26.406 1.00 22.42 ? 240 SER B CA   1 
ATOM   6475 C C    . SER B 1 240 ? 16.293  35.676 -25.412 1.00 22.63 ? 240 SER B C    1 
ATOM   6476 O O    . SER B 1 240 ? 16.329  36.885 -25.779 1.00 20.90 ? 240 SER B O    1 
ATOM   6477 C CB   . SER B 1 240 ? 15.805  34.713 -27.667 1.00 21.99 ? 240 SER B CB   1 
ATOM   6478 O OG   . SER B 1 240 ? 14.446  34.484 -27.347 1.00 22.71 ? 240 SER B OG   1 
ATOM   6479 H H    . SER B 1 240 ? 15.582  32.724 -26.057 1.00 0.00  ? 240 SER B H    1 
ATOM   6480 H HG   . SER B 1 240 ? 13.993  34.031 -28.076 1.00 0.00  ? 240 SER B HG   1 
ATOM   6481 N N    . SER B 1 241 ? 15.960  35.314 -24.175 1.00 22.02 ? 241 SER B N    1 
ATOM   6482 C CA   . SER B 1 241 ? 15.604  36.296 -23.175 1.00 22.02 ? 241 SER B CA   1 
ATOM   6483 C C    . SER B 1 241 ? 16.281  35.942 -21.867 1.00 22.70 ? 241 SER B C    1 
ATOM   6484 O O    . SER B 1 241 ? 16.713  34.792 -21.692 1.00 24.05 ? 241 SER B O    1 
ATOM   6485 C CB   . SER B 1 241 ? 14.095  36.263 -22.972 1.00 20.56 ? 241 SER B CB   1 
ATOM   6486 O OG   . SER B 1 241 ? 13.654  34.918 -22.856 1.00 21.69 ? 241 SER B OG   1 
ATOM   6487 H H    . SER B 1 241 ? 15.933  34.370 -23.925 1.00 0.00  ? 241 SER B H    1 
ATOM   6488 H HG   . SER B 1 241 ? 14.201  34.468 -22.195 1.00 0.00  ? 241 SER B HG   1 
ATOM   6489 N N    . ASN B 1 242 ? 16.404  36.922 -20.965 1.00 22.41 ? 242 ASN B N    1 
ATOM   6490 C CA   . ASN B 1 242 ? 16.987  36.703 -19.634 1.00 19.08 ? 242 ASN B CA   1 
ATOM   6491 C C    . ASN B 1 242 ? 15.857  35.952 -18.900 1.00 17.39 ? 242 ASN B C    1 
ATOM   6492 O O    . ASN B 1 242 ? 14.659  36.309 -19.049 1.00 12.63 ? 242 ASN B O    1 
ATOM   6493 C CB   . ASN B 1 242 ? 17.304  38.050 -18.935 1.00 18.52 ? 242 ASN B CB   1 
ATOM   6494 C CG   . ASN B 1 242 ? 18.629  38.678 -19.429 1.00 20.78 ? 242 ASN B CG   1 
ATOM   6495 O OD1  . ASN B 1 242 ? 18.638  39.775 -19.996 1.00 21.14 ? 242 ASN B OD1  1 
ATOM   6496 N ND2  . ASN B 1 242 ? 19.741  37.956 -19.256 1.00 20.68 ? 242 ASN B ND2  1 
ATOM   6497 H H    . ASN B 1 242 ? 16.041  37.803 -21.203 1.00 0.00  ? 242 ASN B H    1 
ATOM   6498 H HD21 . ASN B 1 242 ? 20.577  38.362 -19.582 1.00 0.00  ? 242 ASN B HD21 1 
ATOM   6499 H HD22 . ASN B 1 242 ? 19.703  37.074 -18.822 1.00 0.00  ? 242 ASN B HD22 1 
ATOM   6500 N N    . THR B 1 243 ? 16.232  34.910 -18.159 1.00 14.87 ? 243 THR B N    1 
ATOM   6501 C CA   . THR B 1 243 ? 15.280  34.073 -17.441 1.00 14.10 ? 243 THR B CA   1 
ATOM   6502 C C    . THR B 1 243 ? 15.345  34.196 -15.942 1.00 18.13 ? 243 THR B C    1 
ATOM   6503 O O    . THR B 1 243 ? 14.361  33.864 -15.252 1.00 18.61 ? 243 THR B O    1 
ATOM   6504 C CB   . THR B 1 243 ? 15.466  32.581 -17.764 1.00 14.36 ? 243 THR B CB   1 
ATOM   6505 O OG1  . THR B 1 243 ? 16.770  32.159 -17.333 1.00 15.52 ? 243 THR B OG1  1 
ATOM   6506 C CG2  . THR B 1 243 ? 15.304  32.328 -19.292 1.00 14.45 ? 243 THR B CG2  1 
ATOM   6507 H H    . THR B 1 243 ? 17.193  34.697 -18.073 1.00 0.00  ? 243 THR B H    1 
ATOM   6508 H HG1  . THR B 1 243 ? 16.772  31.192 -17.453 1.00 0.00  ? 243 THR B HG1  1 
ATOM   6509 N N    . THR B 1 244 ? 16.490  34.650 -15.430 1.00 17.24 ? 244 THR B N    1 
ATOM   6510 C CA   . THR B 1 244 ? 16.677  34.811 -14.001 1.00 15.49 ? 244 THR B CA   1 
ATOM   6511 C C    . THR B 1 244 ? 15.800  35.925 -13.404 1.00 14.48 ? 244 THR B C    1 
ATOM   6512 O O    . THR B 1 244 ? 14.936  36.492 -14.079 1.00 12.30 ? 244 THR B O    1 
ATOM   6513 C CB   . THR B 1 244 ? 18.137  35.086 -13.672 1.00 14.99 ? 244 THR B CB   1 
ATOM   6514 O OG1  . THR B 1 244 ? 18.498  36.376 -14.172 1.00 21.16 ? 244 THR B OG1  1 
ATOM   6515 C CG2  . THR B 1 244 ? 19.040  34.059 -14.326 1.00 14.95 ? 244 THR B CG2  1 
ATOM   6516 H H    . THR B 1 244 ? 17.216  34.851 -16.051 1.00 0.00  ? 244 THR B H    1 
ATOM   6517 H HG1  . THR B 1 244 ? 18.664  36.285 -15.123 1.00 0.00  ? 244 THR B HG1  1 
ATOM   6518 N N    . ALA B 1 245 ? 15.971  36.194 -12.111 1.00 14.87 ? 245 ALA B N    1 
ATOM   6519 C CA   . ALA B 1 245 ? 15.178  37.246 -11.455 1.00 12.78 ? 245 ALA B CA   1 
ATOM   6520 C C    . ALA B 1 245 ? 15.611  38.666 -11.906 1.00 12.07 ? 245 ALA B C    1 
ATOM   6521 O O    . ALA B 1 245 ? 14.788  39.544 -12.001 1.00 17.05 ? 245 ALA B O    1 
ATOM   6522 C CB   . ALA B 1 245 ? 15.232  37.109 -9.935  1.00 9.41  ? 245 ALA B CB   1 
ATOM   6523 H H    . ALA B 1 245 ? 16.608  35.634 -11.611 1.00 0.00  ? 245 ALA B H    1 
ATOM   6524 N N    . GLY B 1 246 ? 16.851  38.852 -12.333 1.00 12.27 ? 246 GLY B N    1 
ATOM   6525 C CA   . GLY B 1 246 ? 17.280  40.170 -12.752 1.00 11.44 ? 246 GLY B CA   1 
ATOM   6526 C C    . GLY B 1 246 ? 16.443  40.756 -13.883 1.00 12.20 ? 246 GLY B C    1 
ATOM   6527 O O    . GLY B 1 246 ? 16.471  41.979 -14.120 1.00 13.45 ? 246 GLY B O    1 
ATOM   6528 H H    . GLY B 1 246 ? 17.482  38.105 -12.413 1.00 0.00  ? 246 GLY B H    1 
ATOM   6529 N N    . GLY B 1 247 ? 15.654  39.910 -14.550 1.00 12.70 ? 247 GLY B N    1 
ATOM   6530 C CA   . GLY B 1 247 ? 14.861  40.364 -15.672 1.00 8.70  ? 247 GLY B CA   1 
ATOM   6531 C C    . GLY B 1 247 ? 13.491  40.830 -15.274 1.00 10.07 ? 247 GLY B C    1 
ATOM   6532 O O    . GLY B 1 247 ? 12.649  41.158 -16.133 1.00 11.42 ? 247 GLY B O    1 
ATOM   6533 H H    . GLY B 1 247 ? 15.605  38.967 -14.289 1.00 0.00  ? 247 GLY B H    1 
ATOM   6534 N N    . VAL B 1 248 ? 13.243  40.825 -13.976 1.00 5.62  ? 248 VAL B N    1 
ATOM   6535 C CA   . VAL B 1 248 ? 11.962  41.265 -13.442 1.00 5.01  ? 248 VAL B CA   1 
ATOM   6536 C C    . VAL B 1 248 ? 11.848  42.779 -13.453 1.00 5.01  ? 248 VAL B C    1 
ATOM   6537 O O    . VAL B 1 248 ? 10.839  43.346 -13.870 1.00 5.34  ? 248 VAL B O    1 
ATOM   6538 C CB   . VAL B 1 248 ? 11.799  40.788 -11.991 1.00 7.53  ? 248 VAL B CB   1 
ATOM   6539 C CG1  . VAL B 1 248 ? 10.502  41.367 -11.352 1.00 7.41  ? 248 VAL B CG1  1 
ATOM   6540 C CG2  . VAL B 1 248 ? 11.796  39.226 -11.960 1.00 6.22  ? 248 VAL B CG2  1 
ATOM   6541 H H    . VAL B 1 248 ? 13.904  40.483 -13.327 1.00 0.00  ? 248 VAL B H    1 
ATOM   6542 N N    . ALA B 1 249 ? 12.917  43.463 -13.078 1.00 6.23  ? 249 ALA B N    1 
ATOM   6543 C CA   . ALA B 1 249 ? 12.831  44.906 -13.041 1.00 11.51 ? 249 ALA B CA   1 
ATOM   6544 C C    . ALA B 1 249 ? 12.698  45.453 -14.440 1.00 12.62 ? 249 ALA B C    1 
ATOM   6545 O O    . ALA B 1 249 ? 12.031  46.438 -14.668 1.00 12.89 ? 249 ALA B O    1 
ATOM   6546 C CB   . ALA B 1 249 ? 14.048  45.479 -12.387 1.00 11.68 ? 249 ALA B CB   1 
ATOM   6547 H H    . ALA B 1 249 ? 13.731  42.987 -12.813 1.00 0.00  ? 249 ALA B H    1 
ATOM   6548 N N    . THR B 1 250 ? 13.339  44.743 -15.353 1.00 14.17 ? 250 THR B N    1 
ATOM   6549 C CA   . THR B 1 250 ? 13.453  45.066 -16.748 1.00 12.54 ? 250 THR B CA   1 
ATOM   6550 C C    . THR B 1 250 ? 12.235  44.749 -17.576 1.00 12.37 ? 250 THR B C    1 
ATOM   6551 O O    . THR B 1 250 ? 11.837  45.546 -18.412 1.00 14.16 ? 250 THR B O    1 
ATOM   6552 C CB   . THR B 1 250 ? 14.678  44.314 -17.300 1.00 13.87 ? 250 THR B CB   1 
ATOM   6553 O OG1  . THR B 1 250 ? 15.902  44.984 -16.897 1.00 11.13 ? 250 THR B OG1  1 
ATOM   6554 C CG2  . THR B 1 250 ? 14.558  44.111 -18.770 1.00 16.07 ? 250 THR B CG2  1 
ATOM   6555 H H    . THR B 1 250 ? 13.802  43.946 -15.044 1.00 0.00  ? 250 THR B H    1 
ATOM   6556 H HG1  . THR B 1 250 ? 16.247  44.570 -16.092 1.00 0.00  ? 250 THR B HG1  1 
ATOM   6557 N N    . GLY B 1 251 ? 11.684  43.553 -17.397 1.00 11.05 ? 251 GLY B N    1 
ATOM   6558 C CA   . GLY B 1 251 ? 10.519  43.167 -18.145 1.00 10.48 ? 251 GLY B CA   1 
ATOM   6559 C C    . GLY B 1 251 ? 9.236   43.552 -17.462 1.00 9.73  ? 251 GLY B C    1 
ATOM   6560 O O    . GLY B 1 251 ? 8.210   42.932 -17.785 1.00 11.59 ? 251 GLY B O    1 
ATOM   6561 H H    . GLY B 1 251 ? 12.035  42.862 -16.790 1.00 0.00  ? 251 GLY B H    1 
ATOM   6562 N N    . SER B 1 252 ? 9.291   44.484 -16.499 1.00 8.62  ? 252 SER B N    1 
ATOM   6563 C CA   . SER B 1 252 ? 8.075   44.976 -15.784 1.00 11.66 ? 252 SER B CA   1 
ATOM   6564 C C    . SER B 1 252 ? 8.067   46.500 -15.637 1.00 10.94 ? 252 SER B C    1 
ATOM   6565 O O    . SER B 1 252 ? 7.013   47.136 -15.742 1.00 7.50  ? 252 SER B O    1 
ATOM   6566 C CB   . SER B 1 252 ? 7.974   44.468 -14.334 1.00 13.91 ? 252 SER B CB   1 
ATOM   6567 O OG   . SER B 1 252 ? 8.427   43.152 -14.174 1.00 23.42 ? 252 SER B OG   1 
ATOM   6568 H H    . SER B 1 252 ? 10.153  44.852 -16.252 1.00 0.00  ? 252 SER B H    1 
ATOM   6569 H HG   . SER B 1 252 ? 9.404   43.184 -14.149 1.00 0.00  ? 252 SER B HG   1 
ATOM   6570 N N    . GLY B 1 253 ? 9.250   47.027 -15.281 1.00 10.02 ? 253 GLY B N    1 
ATOM   6571 C CA   . GLY B 1 253 ? 9.481   48.438 -15.051 1.00 12.73 ? 253 GLY B CA   1 
ATOM   6572 C C    . GLY B 1 253 ? 9.300   48.740 -13.588 1.00 14.78 ? 253 GLY B C    1 
ATOM   6573 O O    . GLY B 1 253 ? 8.844   49.850 -13.206 1.00 17.85 ? 253 GLY B O    1 
ATOM   6574 H H    . GLY B 1 253 ? 10.033  46.455 -15.146 1.00 0.00  ? 253 GLY B H    1 
ATOM   6575 N N    . LEU B 1 254 ? 9.558   47.730 -12.769 1.00 14.86 ? 254 LEU B N    1 
ATOM   6576 C CA   . LEU B 1 254 ? 9.433   47.830 -11.317 1.00 16.01 ? 254 LEU B CA   1 
ATOM   6577 C C    . LEU B 1 254 ? 10.847  47.667 -10.736 1.00 13.53 ? 254 LEU B C    1 
ATOM   6578 O O    . LEU B 1 254 ? 11.456  46.612 -10.843 1.00 13.75 ? 254 LEU B O    1 
ATOM   6579 C CB   . LEU B 1 254 ? 8.477   46.748 -10.799 1.00 16.96 ? 254 LEU B CB   1 
ATOM   6580 C CG   . LEU B 1 254 ? 8.344   46.769 -9.274  1.00 23.78 ? 254 LEU B CG   1 
ATOM   6581 C CD1  . LEU B 1 254 ? 7.310   47.837 -8.848  1.00 19.42 ? 254 LEU B CD1  1 
ATOM   6582 C CD2  . LEU B 1 254 ? 7.990   45.357 -8.706  1.00 25.29 ? 254 LEU B CD2  1 
ATOM   6583 H H    . LEU B 1 254 ? 9.903   46.893 -13.135 1.00 0.00  ? 254 LEU B H    1 
ATOM   6584 N N    . GLY B 1 255 ? 11.398  48.762 -10.218 1.00 15.40 ? 255 GLY B N    1 
ATOM   6585 C CA   . GLY B 1 255 ? 12.758  48.767 -9.670  1.00 13.98 ? 255 GLY B CA   1 
ATOM   6586 C C    . GLY B 1 255 ? 13.191  47.574 -8.828  1.00 13.45 ? 255 GLY B C    1 
ATOM   6587 O O    . GLY B 1 255 ? 12.482  47.135 -7.923  1.00 11.72 ? 255 GLY B O    1 
ATOM   6588 H H    . GLY B 1 255 ? 10.902  49.603 -10.205 1.00 0.00  ? 255 GLY B H    1 
ATOM   6589 N N    . PRO B 1 256 ? 14.428  47.119 -9.028  1.00 12.51 ? 256 PRO B N    1 
ATOM   6590 C CA   . PRO B 1 256 ? 15.075  45.979 -8.352  1.00 14.45 ? 256 PRO B CA   1 
ATOM   6591 C C    . PRO B 1 256 ? 14.923  45.841 -6.820  1.00 13.92 ? 256 PRO B C    1 
ATOM   6592 O O    . PRO B 1 256 ? 14.518  44.764 -6.310  1.00 7.37  ? 256 PRO B O    1 
ATOM   6593 C CB   . PRO B 1 256 ? 16.555  46.123 -8.767  1.00 12.81 ? 256 PRO B CB   1 
ATOM   6594 C CG   . PRO B 1 256 ? 16.705  47.637 -8.867  1.00 14.55 ? 256 PRO B CG   1 
ATOM   6595 C CD   . PRO B 1 256 ? 15.430  48.006 -9.650  1.00 11.84 ? 256 PRO B CD   1 
ATOM   6596 N N    . ARG B 1 257 ? 15.242  46.908 -6.082  1.00 16.26 ? 257 ARG B N    1 
ATOM   6597 C CA   . ARG B 1 257 ? 15.152  46.854 -4.626  1.00 18.80 ? 257 ARG B CA   1 
ATOM   6598 C C    . ARG B 1 257 ? 13.785  46.393 -4.151  1.00 19.59 ? 257 ARG B C    1 
ATOM   6599 O O    . ARG B 1 257 ? 13.674  45.914 -3.014  1.00 24.45 ? 257 ARG B O    1 
ATOM   6600 C CB   . ARG B 1 257 ? 15.480  48.203 -3.969  1.00 17.04 ? 257 ARG B CB   1 
ATOM   6601 C CG   . ARG B 1 257 ? 16.952  48.705 -4.091  1.00 15.43 ? 257 ARG B CG   1 
ATOM   6602 C CD   . ARG B 1 257 ? 17.054  50.190 -3.722  1.00 13.45 ? 257 ARG B CD   1 
ATOM   6603 N NE   . ARG B 1 257 ? 16.359  50.432 -2.466  1.00 20.47 ? 257 ARG B NE   1 
ATOM   6604 C CZ   . ARG B 1 257 ? 15.494  51.421 -2.246  1.00 21.56 ? 257 ARG B CZ   1 
ATOM   6605 N NH1  . ARG B 1 257 ? 15.213  52.314 -3.190  1.00 22.75 ? 257 ARG B NH1  1 
ATOM   6606 N NH2  . ARG B 1 257 ? 14.798  51.430 -1.123  1.00 24.93 ? 257 ARG B NH2  1 
ATOM   6607 H H    . ARG B 1 257 ? 15.473  47.756 -6.515  1.00 0.00  ? 257 ARG B H    1 
ATOM   6608 H HE   . ARG B 1 257 ? 16.575  49.802 -1.744  1.00 0.00  ? 257 ARG B HE   1 
ATOM   6609 H HH11 . ARG B 1 257 ? 15.619  52.275 -4.124  1.00 0.00  ? 257 ARG B HH11 1 
ATOM   6610 H HH12 . ARG B 1 257 ? 14.543  53.045 -3.031  1.00 0.00  ? 257 ARG B HH12 1 
ATOM   6611 H HH21 . ARG B 1 257 ? 14.912  50.707 -0.442  1.00 0.00  ? 257 ARG B HH21 1 
ATOM   6612 H HH22 . ARG B 1 257 ? 14.120  52.161 -0.961  1.00 0.00  ? 257 ARG B HH22 1 
ATOM   6613 N N    . TYR B 1 258 ? 12.757  46.503 -4.997  1.00 21.37 ? 258 TYR B N    1 
ATOM   6614 C CA   . TYR B 1 258 ? 11.402  46.099 -4.600  1.00 19.09 ? 258 TYR B CA   1 
ATOM   6615 C C    . TYR B 1 258 ? 11.033  44.616 -4.731  1.00 20.04 ? 258 TYR B C    1 
ATOM   6616 O O    . TYR B 1 258 ? 9.839   44.261 -4.666  1.00 20.66 ? 258 TYR B O    1 
ATOM   6617 C CB   . TYR B 1 258 ? 10.350  46.999 -5.243  1.00 20.13 ? 258 TYR B CB   1 
ATOM   6618 C CG   . TYR B 1 258 ? 10.593  48.464 -4.939  1.00 23.16 ? 258 TYR B CG   1 
ATOM   6619 C CD1  . TYR B 1 258 ? 11.155  48.860 -3.723  1.00 28.08 ? 258 TYR B CD1  1 
ATOM   6620 C CD2  . TYR B 1 258 ? 10.350  49.441 -5.891  1.00 24.59 ? 258 TYR B CD2  1 
ATOM   6621 C CE1  . TYR B 1 258 ? 11.485  50.198 -3.476  1.00 29.99 ? 258 TYR B CE1  1 
ATOM   6622 C CE2  . TYR B 1 258 ? 10.666  50.776 -5.661  1.00 27.08 ? 258 TYR B CE2  1 
ATOM   6623 C CZ   . TYR B 1 258 ? 11.243  51.153 -4.461  1.00 28.63 ? 258 TYR B CZ   1 
ATOM   6624 O OH   . TYR B 1 258 ? 11.662  52.457 -4.284  1.00 30.35 ? 258 TYR B OH   1 
ATOM   6625 H H    . TYR B 1 258 ? 12.857  46.823 -5.921  1.00 0.00  ? 258 TYR B H    1 
ATOM   6626 H HH   . TYR B 1 258 ? 12.026  52.588 -3.393  1.00 0.00  ? 258 TYR B HH   1 
ATOM   6627 N N    . VAL B 1 259 ? 12.037  43.750 -4.923  1.00 17.93 ? 259 VAL B N    1 
ATOM   6628 C CA   . VAL B 1 259 ? 11.800  42.306 -4.960  1.00 16.68 ? 259 VAL B CA   1 
ATOM   6629 C C    . VAL B 1 259 ? 11.985  41.842 -3.496  1.00 15.48 ? 259 VAL B C    1 
ATOM   6630 O O    . VAL B 1 259 ? 13.068  42.021 -2.921  1.00 15.97 ? 259 VAL B O    1 
ATOM   6631 C CB   . VAL B 1 259 ? 12.832  41.566 -5.863  1.00 16.40 ? 259 VAL B CB   1 
ATOM   6632 C CG1  . VAL B 1 259 ? 12.409  40.116 -6.071  1.00 12.30 ? 259 VAL B CG1  1 
ATOM   6633 C CG2  . VAL B 1 259 ? 12.949  42.278 -7.210  1.00 20.99 ? 259 VAL B CG2  1 
ATOM   6634 H H    . VAL B 1 259 ? 12.954  44.076 -5.068  1.00 0.00  ? 259 VAL B H    1 
ATOM   6635 N N    . ASP B 1 260 ? 10.981  41.194 -2.909  1.00 13.34 ? 260 ASP B N    1 
ATOM   6636 C CA   . ASP B 1 260 ? 11.120  40.782 -1.530  1.00 15.03 ? 260 ASP B CA   1 
ATOM   6637 C C    . ASP B 1 260 ? 11.649  39.357 -1.276  1.00 15.86 ? 260 ASP B C    1 
ATOM   6638 O O    . ASP B 1 260 ? 12.523  39.146 -0.408  1.00 14.69 ? 260 ASP B O    1 
ATOM   6639 C CB   . ASP B 1 260 ? 9.794   40.939 -0.778  1.00 13.97 ? 260 ASP B CB   1 
ATOM   6640 C CG   . ASP B 1 260 ? 9.201   42.353 -0.872  1.00 15.67 ? 260 ASP B CG   1 
ATOM   6641 O OD1  . ASP B 1 260 ? 9.769   43.322 -0.332  1.00 14.42 ? 260 ASP B OD1  1 
ATOM   6642 O OD2  . ASP B 1 260 ? 8.116   42.480 -1.448  1.00 13.66 ? 260 ASP B OD2  1 
ATOM   6643 H H    . ASP B 1 260 ? 10.155  40.958 -3.384  1.00 0.00  ? 260 ASP B H    1 
ATOM   6644 N N    . TYR B 1 261 ? 11.040  38.380 -1.958  1.00 16.34 ? 261 TYR B N    1 
ATOM   6645 C CA   . TYR B 1 261 ? 11.359  36.969 -1.787  1.00 15.13 ? 261 TYR B CA   1 
ATOM   6646 C C    . TYR B 1 261 ? 11.400  36.448 -3.173  1.00 14.38 ? 261 TYR B C    1 
ATOM   6647 O O    . TYR B 1 261 ? 10.631  36.909 -4.003  1.00 11.83 ? 261 TYR B O    1 
ATOM   6648 C CB   . TYR B 1 261 ? 10.234  36.257 -1.001  1.00 15.44 ? 261 TYR B CB   1 
ATOM   6649 C CG   . TYR B 1 261 ? 10.483  34.765 -0.669  1.00 15.04 ? 261 TYR B CG   1 
ATOM   6650 C CD1  . TYR B 1 261 ? 10.421  33.774 -1.673  1.00 12.89 ? 261 TYR B CD1  1 
ATOM   6651 C CD2  . TYR B 1 261 ? 10.708  34.347 0.666   1.00 15.37 ? 261 TYR B CD2  1 
ATOM   6652 C CE1  . TYR B 1 261 ? 10.563  32.403 -1.352  1.00 10.88 ? 261 TYR B CE1  1 
ATOM   6653 C CE2  . TYR B 1 261 ? 10.862  32.991 1.005   1.00 10.94 ? 261 TYR B CE2  1 
ATOM   6654 C CZ   . TYR B 1 261 ? 10.785  32.025 -0.011  1.00 12.92 ? 261 TYR B CZ   1 
ATOM   6655 O OH   . TYR B 1 261 ? 10.919  30.707 0.284   1.00 10.62 ? 261 TYR B OH   1 
ATOM   6656 H H    . TYR B 1 261 ? 10.339  38.634 -2.596  1.00 0.00  ? 261 TYR B H    1 
ATOM   6657 H HH   . TYR B 1 261 ? 11.303  30.510 1.168   1.00 0.00  ? 261 TYR B HH   1 
ATOM   6658 N N    . VAL B 1 262 ? 12.342  35.533 -3.430  1.00 14.45 ? 262 VAL B N    1 
ATOM   6659 C CA   . VAL B 1 262 ? 12.544  34.904 -4.760  1.00 12.24 ? 262 VAL B CA   1 
ATOM   6660 C C    . VAL B 1 262 ? 12.527  33.393 -4.491  1.00 11.47 ? 262 VAL B C    1 
ATOM   6661 O O    . VAL B 1 262 ? 13.381  32.899 -3.724  1.00 11.81 ? 262 VAL B O    1 
ATOM   6662 C CB   . VAL B 1 262 ? 13.914  35.302 -5.365  1.00 7.88  ? 262 VAL B CB   1 
ATOM   6663 C CG1  . VAL B 1 262 ? 14.125  34.627 -6.724  1.00 5.01  ? 262 VAL B CG1  1 
ATOM   6664 C CG2  . VAL B 1 262 ? 14.012  36.813 -5.461  1.00 5.01  ? 262 VAL B CG2  1 
ATOM   6665 H H    . VAL B 1 262 ? 12.963  35.310 -2.709  1.00 0.00  ? 262 VAL B H    1 
ATOM   6666 N N    . LEU B 1 263 ? 11.561  32.679 -5.083  1.00 10.82 ? 263 LEU B N    1 
ATOM   6667 C CA   . LEU B 1 263 ? 11.428  31.252 -4.821  1.00 10.45 ? 263 LEU B CA   1 
ATOM   6668 C C    . LEU B 1 263 ? 11.889  30.341 -5.940  1.00 9.35  ? 263 LEU B C    1 
ATOM   6669 O O    . LEU B 1 263 ? 11.213  30.237 -6.967  1.00 9.89  ? 263 LEU B O    1 
ATOM   6670 C CB   . LEU B 1 263 ? 9.975   30.932 -4.434  1.00 9.46  ? 263 LEU B CB   1 
ATOM   6671 C CG   . LEU B 1 263 ? 9.505   29.503 -4.075  1.00 10.06 ? 263 LEU B CG   1 
ATOM   6672 C CD1  . LEU B 1 263 ? 9.739   29.187 -2.607  1.00 9.27  ? 263 LEU B CD1  1 
ATOM   6673 C CD2  . LEU B 1 263 ? 7.981   29.369 -4.388  1.00 11.25 ? 263 LEU B CD2  1 
ATOM   6674 H H    . LEU B 1 263 ? 10.932  33.098 -5.721  1.00 0.00  ? 263 LEU B H    1 
ATOM   6675 N N    . GLY B 1 264 ? 12.953  29.574 -5.679  1.00 8.31  ? 264 GLY B N    1 
ATOM   6676 C CA   . GLY B 1 264 ? 13.494  28.656 -6.673  1.00 5.58  ? 264 GLY B CA   1 
ATOM   6677 C C    . GLY B 1 264 ? 12.754  27.329 -6.788  1.00 8.82  ? 264 GLY B C    1 
ATOM   6678 O O    . GLY B 1 264 ? 12.746  26.547 -5.815  1.00 5.43  ? 264 GLY B O    1 
ATOM   6679 H H    . GLY B 1 264 ? 13.338  29.561 -4.771  1.00 0.00  ? 264 GLY B H    1 
ATOM   6680 N N    . ILE B 1 265 ? 12.100  27.086 -7.943  1.00 10.04 ? 265 ILE B N    1 
ATOM   6681 C CA   . ILE B 1 265 ? 11.377  25.818 -8.180  1.00 9.87  ? 265 ILE B CA   1 
ATOM   6682 C C    . ILE B 1 265 ? 12.434  24.783 -8.527  1.00 8.19  ? 265 ILE B C    1 
ATOM   6683 O O    . ILE B 1 265 ? 13.008  24.830 -9.624  1.00 7.82  ? 265 ILE B O    1 
ATOM   6684 C CB   . ILE B 1 265 ? 10.384  25.889 -9.331  1.00 12.65 ? 265 ILE B CB   1 
ATOM   6685 C CG1  . ILE B 1 265 ? 9.417   27.087 -9.171  1.00 15.18 ? 265 ILE B CG1  1 
ATOM   6686 C CG2  . ILE B 1 265 ? 9.600   24.610 -9.381  1.00 16.30 ? 265 ILE B CG2  1 
ATOM   6687 C CD1  . ILE B 1 265 ? 8.395   27.011 -8.046  1.00 14.33 ? 265 ILE B CD1  1 
ATOM   6688 H H    . ILE B 1 265 ? 12.144  27.750 -8.674  1.00 0.00  ? 265 ILE B H    1 
ATOM   6689 N N    . LEU B 1 266 ? 12.671  23.848 -7.592  1.00 7.87  ? 266 LEU B N    1 
ATOM   6690 C CA   . LEU B 1 266 ? 13.730  22.841 -7.721  1.00 5.01  ? 266 LEU B CA   1 
ATOM   6691 C C    . LEU B 1 266 ? 13.320  21.353 -7.824  1.00 6.24  ? 266 LEU B C    1 
ATOM   6692 O O    . LEU B 1 266 ? 12.735  20.766 -6.887  1.00 8.52  ? 266 LEU B O    1 
ATOM   6693 C CB   . LEU B 1 266 ? 14.730  23.046 -6.547  1.00 8.37  ? 266 LEU B CB   1 
ATOM   6694 C CG   . LEU B 1 266 ? 15.945  22.086 -6.387  1.00 10.91 ? 266 LEU B CG   1 
ATOM   6695 C CD1  . LEU B 1 266 ? 16.963  22.253 -7.532  1.00 12.90 ? 266 LEU B CD1  1 
ATOM   6696 C CD2  . LEU B 1 266 ? 16.618  22.278 -5.038  1.00 8.14  ? 266 LEU B CD2  1 
ATOM   6697 H H    . LEU B 1 266 ? 12.085  23.754 -6.807  1.00 0.00  ? 266 LEU B H    1 
ATOM   6698 N N    . LYS B 1 267 ? 13.695  20.711 -8.930  1.00 5.01  ? 267 LYS B N    1 
ATOM   6699 C CA   . LYS B 1 267 ? 13.383  19.268 -9.085  1.00 6.93  ? 267 LYS B CA   1 
ATOM   6700 C C    . LYS B 1 267 ? 14.321  18.372 -8.280  1.00 6.44  ? 267 LYS B C    1 
ATOM   6701 O O    . LYS B 1 267 ? 15.506  18.658 -8.145  1.00 7.84  ? 267 LYS B O    1 
ATOM   6702 C CB   . LYS B 1 267 ? 13.412  18.832 -10.543 1.00 5.01  ? 267 LYS B CB   1 
ATOM   6703 C CG   . LYS B 1 267 ? 12.839  17.387 -10.792 1.00 6.27  ? 267 LYS B CG   1 
ATOM   6704 C CD   . LYS B 1 267 ? 12.146  17.285 -12.128 1.00 11.21 ? 267 LYS B CD   1 
ATOM   6705 C CE   . LYS B 1 267 ? 13.129  17.483 -13.269 1.00 9.01  ? 267 LYS B CE   1 
ATOM   6706 N NZ   . LYS B 1 267 ? 12.508  17.957 -14.551 1.00 8.97  ? 267 LYS B NZ   1 
ATOM   6707 H H    . LYS B 1 267 ? 14.250  21.166 -9.612  1.00 0.00  ? 267 LYS B H    1 
ATOM   6708 H HZ1  . LYS B 1 267 ? 11.954  18.842 -14.441 1.00 0.00  ? 267 LYS B HZ1  1 
ATOM   6709 H HZ2  . LYS B 1 267 ? 13.249  18.095 -15.288 1.00 0.00  ? 267 LYS B HZ2  1 
ATOM   6710 H HZ3  . LYS B 1 267 ? 11.857  17.238 -14.912 1.00 0.00  ? 267 LYS B HZ3  1 
ATOM   6711 N N    . ALA B 1 268 ? 13.768  17.305 -7.711  1.00 9.97  ? 268 ALA B N    1 
ATOM   6712 C CA   . ALA B 1 268 ? 14.554  16.360 -6.912  1.00 13.00 ? 268 ALA B CA   1 
ATOM   6713 C C    . ALA B 1 268 ? 15.827  15.845 -7.645  1.00 15.13 ? 268 ALA B C    1 
ATOM   6714 O O    . ALA B 1 268 ? 16.870  15.640 -7.011  1.00 12.85 ? 268 ALA B O    1 
ATOM   6715 C CB   . ALA B 1 268 ? 13.654  15.223 -6.425  1.00 12.62 ? 268 ALA B CB   1 
ATOM   6716 H H    . ALA B 1 268 ? 12.788  17.203 -7.727  1.00 0.00  ? 268 ALA B H    1 
ATOM   6717 N N    . TYR B 1 269 ? 15.764  15.819 -8.985  1.00 17.27 ? 269 TYR B N    1 
ATOM   6718 C CA   . TYR B 1 269 ? 16.862  15.404 -9.890  1.00 14.98 ? 269 TYR B CA   1 
ATOM   6719 C C    . TYR B 1 269 ? 16.912  16.331 -11.134 1.00 13.29 ? 269 TYR B C    1 
ATOM   6720 O O    . TYR B 1 269 ? 16.029  17.160 -11.327 1.00 11.71 ? 269 TYR B O    1 
ATOM   6721 C CB   . TYR B 1 269 ? 16.673  13.947 -10.356 1.00 16.63 ? 269 TYR B CB   1 
ATOM   6722 C CG   . TYR B 1 269 ? 15.331  13.713 -10.974 1.00 18.95 ? 269 TYR B CG   1 
ATOM   6723 C CD1  . TYR B 1 269 ? 14.179  13.718 -10.179 1.00 20.10 ? 269 TYR B CD1  1 
ATOM   6724 C CD2  . TYR B 1 269 ? 15.177  13.614 -12.350 1.00 19.97 ? 269 TYR B CD2  1 
ATOM   6725 C CE1  . TYR B 1 269 ? 12.920  13.651 -10.739 1.00 19.46 ? 269 TYR B CE1  1 
ATOM   6726 C CE2  . TYR B 1 269 ? 13.897  13.540 -12.909 1.00 17.45 ? 269 TYR B CE2  1 
ATOM   6727 C CZ   . TYR B 1 269 ? 12.791  13.566 -12.088 1.00 18.43 ? 269 TYR B CZ   1 
ATOM   6728 O OH   . TYR B 1 269 ? 11.538  13.534 -12.596 1.00 13.66 ? 269 TYR B OH   1 
ATOM   6729 H H    . TYR B 1 269 ? 14.944  16.141 -9.409  1.00 0.00  ? 269 TYR B H    1 
ATOM   6730 H HH   . TYR B 1 269 ? 11.580  13.312 -13.538 1.00 0.00  ? 269 TYR B HH   1 
ATOM   6731 N N    . SER B 1 270 ? 17.864  16.101 -12.036 1.00 12.88 ? 270 SER B N    1 
ATOM   6732 C CA   . SER B 1 270 ? 18.034  16.956 -13.210 1.00 10.91 ? 270 SER B CA   1 
ATOM   6733 C C    . SER B 1 270 ? 17.474  16.441 -14.554 1.00 8.01  ? 270 SER B C    1 
ATOM   6734 O O    . SER B 1 270 ? 17.309  15.256 -14.750 1.00 8.69  ? 270 SER B O    1 
ATOM   6735 C CB   . SER B 1 270 ? 19.532  17.337 -13.353 1.00 13.46 ? 270 SER B CB   1 
ATOM   6736 O OG   . SER B 1 270 ? 20.100  17.776 -12.118 1.00 7.02  ? 270 SER B OG   1 
ATOM   6737 H H    . SER B 1 270 ? 18.438  15.311 -11.974 1.00 0.00  ? 270 SER B H    1 
ATOM   6738 H HG   . SER B 1 270 ? 20.403  16.944 -11.712 1.00 0.00  ? 270 SER B HG   1 
ATOM   6739 N N    . THR B 1 271 ? 17.131  17.345 -15.461 1.00 10.64 ? 271 THR B N    1 
ATOM   6740 C CA   . THR B 1 271 ? 16.612  16.987 -16.785 1.00 11.37 ? 271 THR B CA   1 
ATOM   6741 C C    . THR B 1 271 ? 17.013  18.111 -17.732 1.00 12.71 ? 271 THR B C    1 
ATOM   6742 O O    . THR B 1 271 ? 17.304  19.215 -17.281 1.00 9.88  ? 271 THR B O    1 
ATOM   6743 C CB   . THR B 1 271 ? 15.059  16.827 -16.819 1.00 10.81 ? 271 THR B CB   1 
ATOM   6744 O OG1  . THR B 1 271 ? 14.429  18.055 -16.485 1.00 9.88  ? 271 THR B OG1  1 
ATOM   6745 C CG2  . THR B 1 271 ? 14.581  15.803 -15.813 1.00 13.23 ? 271 THR B CG2  1 
ATOM   6746 H H    . THR B 1 271 ? 17.215  18.308 -15.287 1.00 0.00  ? 271 THR B H    1 
ATOM   6747 H HG1  . THR B 1 271 ? 14.525  18.700 -17.198 1.00 0.00  ? 271 THR B HG1  1 
ATOM   6748 N N    . ARG B 1 272 ? 17.154  17.804 -19.018 1.00 15.02 ? 272 ARG B N    1 
ATOM   6749 C CA   . ARG B 1 272 ? 17.498  18.811 -20.019 1.00 14.67 ? 272 ARG B CA   1 
ATOM   6750 C C    . ARG B 1 272 ? 16.839  18.411 -21.313 1.00 14.25 ? 272 ARG B C    1 
ATOM   6751 O O    . ARG B 1 272 ? 16.660  17.219 -21.554 1.00 13.42 ? 272 ARG B O    1 
ATOM   6752 C CB   . ARG B 1 272 ? 18.998  18.880 -20.244 1.00 14.43 ? 272 ARG B CB   1 
ATOM   6753 C CG   . ARG B 1 272 ? 19.764  19.869 -19.389 1.00 20.28 ? 272 ARG B CG   1 
ATOM   6754 C CD   . ARG B 1 272 ? 21.122  20.197 -20.041 1.00 21.36 ? 272 ARG B CD   1 
ATOM   6755 N NE   . ARG B 1 272 ? 20.949  20.965 -21.279 1.00 26.02 ? 272 ARG B NE   1 
ATOM   6756 C CZ   . ARG B 1 272 ? 21.559  22.123 -21.548 1.00 25.81 ? 272 ARG B CZ   1 
ATOM   6757 N NH1  . ARG B 1 272 ? 22.408  22.633 -20.682 1.00 25.19 ? 272 ARG B NH1  1 
ATOM   6758 N NH2  . ARG B 1 272 ? 21.220  22.840 -22.621 1.00 25.32 ? 272 ARG B NH2  1 
ATOM   6759 H H    . ARG B 1 272 ? 17.011  16.873 -19.303 1.00 0.00  ? 272 ARG B H    1 
ATOM   6760 H HE   . ARG B 1 272 ? 20.342  20.596 -21.961 1.00 0.00  ? 272 ARG B HE   1 
ATOM   6761 H HH11 . ARG B 1 272 ? 22.633  22.132 -19.843 1.00 0.00  ? 272 ARG B HH11 1 
ATOM   6762 H HH12 . ARG B 1 272 ? 22.879  23.495 -20.882 1.00 0.00  ? 272 ARG B HH12 1 
ATOM   6763 H HH21 . ARG B 1 272 ? 20.514  22.520 -23.262 1.00 0.00  ? 272 ARG B HH21 1 
ATOM   6764 H HH22 . ARG B 1 272 ? 21.672  23.711 -22.819 1.00 0.00  ? 272 ARG B HH22 1 
ATOM   6765 N N    . VAL B 1 273 ? 16.419  19.385 -22.116 1.00 16.79 ? 273 VAL B N    1 
ATOM   6766 C CA   . VAL B 1 273 ? 15.816  19.101 -23.437 1.00 19.77 ? 273 VAL B CA   1 
ATOM   6767 C C    . VAL B 1 273 ? 16.798  19.593 -24.515 1.00 20.52 ? 273 VAL B C    1 
ATOM   6768 O O    . VAL B 1 273 ? 17.319  20.700 -24.423 1.00 17.24 ? 273 VAL B O    1 
ATOM   6769 C CB   . VAL B 1 273 ? 14.452  19.820 -23.660 1.00 18.86 ? 273 VAL B CB   1 
ATOM   6770 C CG1  . VAL B 1 273 ? 14.116  19.843 -25.148 1.00 17.13 ? 273 VAL B CG1  1 
ATOM   6771 C CG2  . VAL B 1 273 ? 13.367  19.131 -22.909 1.00 15.42 ? 273 VAL B CG2  1 
ATOM   6772 H H    . VAL B 1 273 ? 16.501  20.329 -21.853 1.00 0.00  ? 273 VAL B H    1 
ATOM   6773 N N    . GLY B 1 274 ? 17.047  18.794 -25.541 1.00 22.67 ? 274 GLY B N    1 
ATOM   6774 C CA   . GLY B 1 274 ? 17.983  19.245 -26.556 1.00 25.43 ? 274 GLY B CA   1 
ATOM   6775 C C    . GLY B 1 274 ? 19.448  19.335 -26.112 1.00 26.42 ? 274 GLY B C    1 
ATOM   6776 O O    . GLY B 1 274 ? 19.808  19.053 -24.955 1.00 26.36 ? 274 GLY B O    1 
ATOM   6777 H H    . GLY B 1 274 ? 16.634  17.908 -25.583 1.00 0.00  ? 274 GLY B H    1 
ATOM   6778 N N    . ALA B 1 275 ? 20.271  19.817 -27.037 1.00 26.49 ? 275 ALA B N    1 
ATOM   6779 C CA   . ALA B 1 275 ? 21.723  19.946 -26.878 1.00 26.42 ? 275 ALA B CA   1 
ATOM   6780 C C    . ALA B 1 275 ? 22.301  20.721 -25.677 1.00 23.32 ? 275 ALA B C    1 
ATOM   6781 O O    . ALA B 1 275 ? 21.639  21.543 -25.077 1.00 24.19 ? 275 ALA B O    1 
ATOM   6782 C CB   . ALA B 1 275 ? 22.315  20.479 -28.193 1.00 26.23 ? 275 ALA B CB   1 
ATOM   6783 H H    . ALA B 1 275 ? 19.868  20.138 -27.870 1.00 0.00  ? 275 ALA B H    1 
ATOM   6784 N N    . GLY B 1 276 ? 23.518  20.389 -25.272 1.00 21.78 ? 276 GLY B N    1 
ATOM   6785 C CA   . GLY B 1 276 ? 24.123  21.128 -24.170 1.00 19.30 ? 276 GLY B CA   1 
ATOM   6786 C C    . GLY B 1 276 ? 24.747  20.307 -23.062 1.00 18.52 ? 276 GLY B C    1 
ATOM   6787 O O    . GLY B 1 276 ? 24.294  19.180 -22.791 1.00 16.97 ? 276 GLY B O    1 
ATOM   6788 H H    . GLY B 1 276 ? 24.011  19.664 -25.703 1.00 0.00  ? 276 GLY B H    1 
ATOM   6789 N N    . PRO B 1 277 ? 25.767  20.865 -22.375 1.00 17.98 ? 277 PRO B N    1 
ATOM   6790 C CA   . PRO B 1 277 ? 26.485  20.207 -21.270 1.00 18.67 ? 277 PRO B CA   1 
ATOM   6791 C C    . PRO B 1 277 ? 25.530  19.873 -20.137 1.00 18.67 ? 277 PRO B C    1 
ATOM   6792 O O    . PRO B 1 277 ? 24.510  20.549 -19.963 1.00 16.86 ? 277 PRO B O    1 
ATOM   6793 C CB   . PRO B 1 277 ? 27.567  21.232 -20.879 1.00 15.10 ? 277 PRO B CB   1 
ATOM   6794 C CG   . PRO B 1 277 ? 26.978  22.549 -21.294 1.00 15.71 ? 277 PRO B CG   1 
ATOM   6795 C CD   . PRO B 1 277 ? 26.282  22.231 -22.603 1.00 18.31 ? 277 PRO B CD   1 
ATOM   6796 N N    . PHE B 1 278 ? 25.903  18.878 -19.334 1.00 18.30 ? 278 PHE B N    1 
ATOM   6797 C CA   . PHE B 1 278 ? 25.055  18.382 -18.245 1.00 19.27 ? 278 PHE B CA   1 
ATOM   6798 C C    . PHE B 1 278 ? 25.834  17.200 -17.639 1.00 17.75 ? 278 PHE B C    1 
ATOM   6799 O O    . PHE B 1 278 ? 25.351  16.072 -17.679 1.00 17.74 ? 278 PHE B O    1 
ATOM   6800 C CB   . PHE B 1 278 ? 23.759  17.854 -18.885 1.00 18.94 ? 278 PHE B CB   1 
ATOM   6801 C CG   . PHE B 1 278 ? 22.811  17.183 -17.942 1.00 21.05 ? 278 PHE B CG   1 
ATOM   6802 C CD1  . PHE B 1 278 ? 22.895  17.369 -16.572 1.00 20.98 ? 278 PHE B CD1  1 
ATOM   6803 C CD2  . PHE B 1 278 ? 21.750  16.423 -18.460 1.00 23.16 ? 278 PHE B CD2  1 
ATOM   6804 C CE1  . PHE B 1 278 ? 21.917  16.807 -15.718 1.00 26.18 ? 278 PHE B CE1  1 
ATOM   6805 C CE2  . PHE B 1 278 ? 20.768  15.855 -17.640 1.00 20.98 ? 278 PHE B CE2  1 
ATOM   6806 C CZ   . PHE B 1 278 ? 20.840  16.047 -16.264 1.00 22.00 ? 278 PHE B CZ   1 
ATOM   6807 H H    . PHE B 1 278 ? 26.772  18.456 -19.506 1.00 0.00  ? 278 PHE B H    1 
ATOM   6808 N N    . PRO B 1 279 ? 26.940  17.468 -16.924 1.00 14.69 ? 279 PRO B N    1 
ATOM   6809 C CA   . PRO B 1 279 ? 27.697  16.347 -16.364 1.00 15.58 ? 279 PRO B CA   1 
ATOM   6810 C C    . PRO B 1 279 ? 27.016  15.277 -15.505 1.00 17.54 ? 279 PRO B C    1 
ATOM   6811 O O    . PRO B 1 279 ? 27.558  14.196 -15.427 1.00 22.11 ? 279 PRO B O    1 
ATOM   6812 C CB   . PRO B 1 279 ? 28.879  17.022 -15.672 1.00 10.93 ? 279 PRO B CB   1 
ATOM   6813 C CG   . PRO B 1 279 ? 28.283  18.304 -15.178 1.00 12.91 ? 279 PRO B CG   1 
ATOM   6814 C CD   . PRO B 1 279 ? 27.359  18.746 -16.322 1.00 11.49 ? 279 PRO B CD   1 
ATOM   6815 N N    . THR B 1 280 ? 25.851  15.518 -14.893 1.00 18.26 ? 280 THR B N    1 
ATOM   6816 C CA   . THR B 1 280 ? 25.228  14.450 -14.091 1.00 17.14 ? 280 THR B CA   1 
ATOM   6817 C C    . THR B 1 280 ? 24.337  13.501 -14.909 1.00 19.44 ? 280 THR B C    1 
ATOM   6818 O O    . THR B 1 280 ? 23.791  12.494 -14.369 1.00 16.10 ? 280 THR B O    1 
ATOM   6819 C CB   . THR B 1 280 ? 24.420  14.967 -12.853 1.00 14.37 ? 280 THR B CB   1 
ATOM   6820 O OG1  . THR B 1 280 ? 23.496  15.998 -13.236 1.00 14.02 ? 280 THR B OG1  1 
ATOM   6821 C CG2  . THR B 1 280 ? 25.344  15.434 -11.767 1.00 8.23  ? 280 THR B CG2  1 
ATOM   6822 H H    . THR B 1 280 ? 25.393  16.391 -14.935 1.00 0.00  ? 280 THR B H    1 
ATOM   6823 H HG1  . THR B 1 280 ? 22.744  15.997 -12.616 1.00 0.00  ? 280 THR B HG1  1 
ATOM   6824 N N    . GLU B 1 281 ? 24.175  13.832 -16.194 1.00 21.66 ? 281 GLU B N    1 
ATOM   6825 C CA   . GLU B 1 281 ? 23.359  13.032 -17.098 1.00 24.27 ? 281 GLU B CA   1 
ATOM   6826 C C    . GLU B 1 281 ? 23.815  11.594 -16.951 1.00 23.85 ? 281 GLU B C    1 
ATOM   6827 O O    . GLU B 1 281 ? 25.001  11.357 -16.947 1.00 26.73 ? 281 GLU B O    1 
ATOM   6828 C CB   . GLU B 1 281 ? 23.564  13.477 -18.542 1.00 26.43 ? 281 GLU B CB   1 
ATOM   6829 C CG   . GLU B 1 281 ? 22.739  12.673 -19.539 1.00 25.14 ? 281 GLU B CG   1 
ATOM   6830 C CD   . GLU B 1 281 ? 23.046  13.045 -20.951 1.00 24.83 ? 281 GLU B CD   1 
ATOM   6831 O OE1  . GLU B 1 281 ? 24.178  13.558 -21.172 1.00 28.08 ? 281 GLU B OE1  1 
ATOM   6832 O OE2  . GLU B 1 281 ? 22.172  12.819 -21.834 1.00 25.06 ? 281 GLU B OE2  1 
ATOM   6833 H H    . GLU B 1 281 ? 24.630  14.605 -16.595 1.00 0.00  ? 281 GLU B H    1 
ATOM   6834 N N    . LEU B 1 282 ? 22.864  10.672 -16.782 1.00 24.18 ? 282 LEU B N    1 
ATOM   6835 C CA   . LEU B 1 282 ? 23.106  9.227  -16.593 1.00 22.51 ? 282 LEU B CA   1 
ATOM   6836 C C    . LEU B 1 282 ? 22.845  8.435  -17.838 1.00 23.25 ? 282 LEU B C    1 
ATOM   6837 O O    . LEU B 1 282 ? 21.876  8.697  -18.552 1.00 24.22 ? 282 LEU B O    1 
ATOM   6838 C CB   . LEU B 1 282 ? 22.174  8.648  -15.530 1.00 19.11 ? 282 LEU B CB   1 
ATOM   6839 C CG   . LEU B 1 282 ? 22.247  9.220  -14.117 1.00 17.96 ? 282 LEU B CG   1 
ATOM   6840 C CD1  . LEU B 1 282 ? 20.979  8.817  -13.293 1.00 15.80 ? 282 LEU B CD1  1 
ATOM   6841 C CD2  . LEU B 1 282 ? 23.561  8.811  -13.436 1.00 15.29 ? 282 LEU B CD2  1 
ATOM   6842 H H    . LEU B 1 282 ? 21.940  11.007 -16.845 1.00 0.00  ? 282 LEU B H    1 
ATOM   6843 N N    . PHE B 1 283 ? 23.661  7.407  -18.055 1.00 24.70 ? 283 PHE B N    1 
ATOM   6844 C CA   . PHE B 1 283 ? 23.486  6.536  -19.210 1.00 25.78 ? 283 PHE B CA   1 
ATOM   6845 C C    . PHE B 1 283 ? 23.271  5.057  -18.838 1.00 28.56 ? 283 PHE B C    1 
ATOM   6846 O O    . PHE B 1 283 ? 23.775  4.135  -19.508 1.00 30.83 ? 283 PHE B O    1 
ATOM   6847 C CB   . PHE B 1 283 ? 24.660  6.701  -20.140 1.00 24.80 ? 283 PHE B CB   1 
ATOM   6848 C CG   . PHE B 1 283 ? 24.741  8.037  -20.745 1.00 22.65 ? 283 PHE B CG   1 
ATOM   6849 C CD1  . PHE B 1 283 ? 23.903  8.385  -21.786 1.00 22.88 ? 283 PHE B CD1  1 
ATOM   6850 C CD2  . PHE B 1 283 ? 25.705  8.940  -20.324 1.00 25.29 ? 283 PHE B CD2  1 
ATOM   6851 C CE1  . PHE B 1 283 ? 24.031  9.616  -22.420 1.00 24.30 ? 283 PHE B CE1  1 
ATOM   6852 C CE2  . PHE B 1 283 ? 25.844  10.180 -20.951 1.00 23.80 ? 283 PHE B CE2  1 
ATOM   6853 C CZ   . PHE B 1 283 ? 25.003  10.515 -22.008 1.00 22.71 ? 283 PHE B CZ   1 
ATOM   6854 H H    . PHE B 1 283 ? 24.394  7.243  -17.426 1.00 0.00  ? 283 PHE B H    1 
ATOM   6855 N N    . ASP B 1 284 ? 22.495  4.841  -17.780 1.00 29.57 ? 284 ASP B N    1 
ATOM   6856 C CA   . ASP B 1 284 ? 22.196  3.507  -17.294 1.00 30.15 ? 284 ASP B CA   1 
ATOM   6857 C C    . ASP B 1 284 ? 20.686  3.374  -16.944 1.00 31.25 ? 284 ASP B C    1 
ATOM   6858 O O    . ASP B 1 284 ? 19.880  4.273  -17.212 1.00 29.88 ? 284 ASP B O    1 
ATOM   6859 C CB   . ASP B 1 284 ? 23.102  3.196  -16.094 1.00 29.46 ? 284 ASP B CB   1 
ATOM   6860 C CG   . ASP B 1 284 ? 22.940  4.206  -14.969 1.00 30.96 ? 284 ASP B CG   1 
ATOM   6861 O OD1  . ASP B 1 284 ? 21.875  4.851  -14.939 1.00 31.87 ? 284 ASP B OD1  1 
ATOM   6862 O OD2  . ASP B 1 284 ? 23.852  4.366  -14.111 1.00 29.20 ? 284 ASP B OD2  1 
ATOM   6863 H H    . ASP B 1 284 ? 22.081  5.594  -17.308 1.00 0.00  ? 284 ASP B H    1 
ATOM   6864 N N    . GLU B 1 285 ? 20.320  2.236  -16.369 1.00 32.32 ? 285 GLU B N    1 
ATOM   6865 C CA   . GLU B 1 285 ? 18.953  1.930  -15.998 1.00 32.49 ? 285 GLU B CA   1 
ATOM   6866 C C    . GLU B 1 285 ? 18.464  2.811  -14.862 1.00 33.30 ? 285 GLU B C    1 
ATOM   6867 O O    . GLU B 1 285 ? 17.270  3.061  -14.733 1.00 30.88 ? 285 GLU B O    1 
ATOM   6868 C CB   . GLU B 1 285 ? 18.840  0.444  -15.659 1.00 36.00 ? 285 GLU B CB   1 
ATOM   6869 C CG   . GLU B 1 285 ? 19.897  -0.089 -14.664 1.00 39.06 ? 285 GLU B CG   1 
ATOM   6870 C CD   . GLU B 1 285 ? 19.279  -0.554 -13.354 1.00 43.72 ? 285 GLU B CD   1 
ATOM   6871 O OE1  . GLU B 1 285 ? 18.160  -1.134 -13.376 1.00 42.45 ? 285 GLU B OE1  1 
ATOM   6872 O OE2  . GLU B 1 285 ? 19.905  -0.322 -12.298 1.00 42.31 ? 285 GLU B OE2  1 
ATOM   6873 H H    . GLU B 1 285 ? 21.019  1.572  -16.208 1.00 0.00  ? 285 GLU B H    1 
ATOM   6874 N N    . THR B 1 286 ? 19.411  3.278  -14.045 1.00 37.85 ? 286 THR B N    1 
ATOM   6875 C CA   . THR B 1 286 ? 19.165  4.195  -12.916 1.00 39.07 ? 286 THR B CA   1 
ATOM   6876 C C    . THR B 1 286 ? 18.702  5.500  -13.545 1.00 38.96 ? 286 THR B C    1 
ATOM   6877 O O    . THR B 1 286 ? 17.880  6.238  -12.978 1.00 39.15 ? 286 THR B O    1 
ATOM   6878 C CB   . THR B 1 286 ? 20.473  4.521  -12.203 1.00 40.51 ? 286 THR B CB   1 
ATOM   6879 O OG1  . THR B 1 286 ? 21.334  3.367  -12.210 1.00 41.30 ? 286 THR B OG1  1 
ATOM   6880 C CG2  . THR B 1 286 ? 20.197  4.969  -10.797 1.00 40.20 ? 286 THR B CG2  1 
ATOM   6881 H H    . THR B 1 286 ? 20.346  3.013  -14.169 1.00 0.00  ? 286 THR B H    1 
ATOM   6882 H HG1  . THR B 1 286 ? 20.835  2.644  -11.800 1.00 0.00  ? 286 THR B HG1  1 
ATOM   6883 N N    . GLY B 1 287 ? 19.312  5.798  -14.693 1.00 37.84 ? 287 GLY B N    1 
ATOM   6884 C CA   . GLY B 1 287 ? 18.962  6.972  -15.455 1.00 37.26 ? 287 GLY B CA   1 
ATOM   6885 C C    . GLY B 1 287 ? 17.525  6.767  -15.869 1.00 36.92 ? 287 GLY B C    1 
ATOM   6886 O O    . GLY B 1 287 ? 16.635  7.417  -15.322 1.00 38.32 ? 287 GLY B O    1 
ATOM   6887 H H    . GLY B 1 287 ? 20.083  5.256  -14.981 1.00 0.00  ? 287 GLY B H    1 
ATOM   6888 N N    . GLU B 1 288 ? 17.280  5.778  -16.730 1.00 34.61 ? 288 GLU B N    1 
ATOM   6889 C CA   . GLU B 1 288 ? 15.921  5.492  -17.220 1.00 32.85 ? 288 GLU B CA   1 
ATOM   6890 C C    . GLU B 1 288 ? 14.833  5.315  -16.158 1.00 30.45 ? 288 GLU B C    1 
ATOM   6891 O O    . GLU B 1 288 ? 13.681  5.640  -16.385 1.00 27.95 ? 288 GLU B O    1 
ATOM   6892 C CB   . GLU B 1 288 ? 15.915  4.351  -18.235 1.00 33.04 ? 288 GLU B CB   1 
ATOM   6893 C CG   . GLU B 1 288 ? 16.857  3.256  -17.909 1.00 38.61 ? 288 GLU B CG   1 
ATOM   6894 C CD   . GLU B 1 288 ? 17.580  2.716  -19.131 1.00 41.08 ? 288 GLU B CD   1 
ATOM   6895 O OE1  . GLU B 1 288 ? 17.316  3.225  -20.256 1.00 41.58 ? 288 GLU B OE1  1 
ATOM   6896 O OE2  . GLU B 1 288 ? 18.397  1.776  -18.950 1.00 37.63 ? 288 GLU B OE2  1 
ATOM   6897 H H    . GLU B 1 288 ? 18.059  5.243  -17.022 1.00 0.00  ? 288 GLU B H    1 
ATOM   6898 N N    . PHE B 1 289 ? 15.213  4.870  -14.982 1.00 29.99 ? 289 PHE B N    1 
ATOM   6899 C CA   . PHE B 1 289 ? 14.264  4.725  -13.901 1.00 29.01 ? 289 PHE B CA   1 
ATOM   6900 C C    . PHE B 1 289 ? 13.564  6.071  -13.764 1.00 29.40 ? 289 PHE B C    1 
ATOM   6901 O O    . PHE B 1 289 ? 12.356  6.187  -14.010 1.00 29.47 ? 289 PHE B O    1 
ATOM   6902 C CB   . PHE B 1 289 ? 15.009  4.403  -12.606 1.00 28.38 ? 289 PHE B CB   1 
ATOM   6903 C CG   . PHE B 1 289 ? 14.115  4.097  -11.442 1.00 28.22 ? 289 PHE B CG   1 
ATOM   6904 C CD1  . PHE B 1 289 ? 13.498  5.123  -10.729 1.00 28.45 ? 289 PHE B CD1  1 
ATOM   6905 C CD2  . PHE B 1 289 ? 13.950  2.780  -11.006 1.00 29.28 ? 289 PHE B CD2  1 
ATOM   6906 C CE1  . PHE B 1 289 ? 12.740  4.846  -9.600  1.00 29.35 ? 289 PHE B CE1  1 
ATOM   6907 C CE2  . PHE B 1 289 ? 13.196  2.488  -9.879  1.00 29.50 ? 289 PHE B CE2  1 
ATOM   6908 C CZ   . PHE B 1 289 ? 12.586  3.530  -9.170  1.00 30.19 ? 289 PHE B CZ   1 
ATOM   6909 H H    . PHE B 1 289 ? 16.131  4.543  -14.850 1.00 0.00  ? 289 PHE B H    1 
ATOM   6910 N N    . LEU B 1 290 ? 14.354  7.088  -13.416 1.00 30.50 ? 290 LEU B N    1 
ATOM   6911 C CA   . LEU B 1 290 ? 13.883  8.465  -13.229 1.00 29.84 ? 290 LEU B CA   1 
ATOM   6912 C C    . LEU B 1 290 ? 13.148  8.949  -14.489 1.00 30.17 ? 290 LEU B C    1 
ATOM   6913 O O    . LEU B 1 290 ? 12.317  9.871  -14.428 1.00 30.98 ? 290 LEU B O    1 
ATOM   6914 C CB   . LEU B 1 290 ? 15.059  9.400  -12.951 1.00 28.84 ? 290 LEU B CB   1 
ATOM   6915 C CG   . LEU B 1 290 ? 16.174  8.926  -12.030 1.00 26.53 ? 290 LEU B CG   1 
ATOM   6916 C CD1  . LEU B 1 290 ? 17.303  9.949  -12.064 1.00 25.07 ? 290 LEU B CD1  1 
ATOM   6917 C CD2  . LEU B 1 290 ? 15.639  8.716  -10.642 1.00 21.79 ? 290 LEU B CD2  1 
ATOM   6918 H H    . LEU B 1 290 ? 15.312  6.904  -13.301 1.00 0.00  ? 290 LEU B H    1 
ATOM   6919 N N    . CYS B 1 291 ? 13.483  8.391  -15.646 1.00 27.77 ? 291 CYS B N    1 
ATOM   6920 C CA   . CYS B 1 291 ? 12.726  8.839  -16.791 1.00 27.80 ? 291 CYS B CA   1 
ATOM   6921 C C    . CYS B 1 291 ? 11.287  8.343  -16.601 1.00 25.12 ? 291 CYS B C    1 
ATOM   6922 O O    . CYS B 1 291 ? 10.371  9.142  -16.414 1.00 21.64 ? 291 CYS B O    1 
ATOM   6923 C CB   . CYS B 1 291 ? 13.289  8.352  -18.125 1.00 30.29 ? 291 CYS B CB   1 
ATOM   6924 S SG   . CYS B 1 291 ? 12.447  9.201  -19.541 1.00 29.91 ? 291 CYS B SG   1 
ATOM   6925 H H    . CYS B 1 291 ? 14.206  7.738  -15.687 1.00 0.00  ? 291 CYS B H    1 
ATOM   6926 N N    . LYS B 1 292 ? 11.117  7.030  -16.491 1.00 25.27 ? 292 LYS B N    1 
ATOM   6927 C CA   . LYS B 1 292 ? 9.773   6.466  -16.359 1.00 27.64 ? 292 LYS B CA   1 
ATOM   6928 C C    . LYS B 1 292 ? 9.004   6.813  -15.102 1.00 27.56 ? 292 LYS B C    1 
ATOM   6929 O O    . LYS B 1 292 ? 7.796   7.042  -15.172 1.00 28.70 ? 292 LYS B O    1 
ATOM   6930 C CB   . LYS B 1 292 ? 9.768   4.960  -16.578 1.00 26.51 ? 292 LYS B CB   1 
ATOM   6931 C CG   . LYS B 1 292 ? 10.511  4.169  -15.533 1.00 30.99 ? 292 LYS B CG   1 
ATOM   6932 C CD   . LYS B 1 292 ? 10.204  2.690  -15.688 1.00 30.45 ? 292 LYS B CD   1 
ATOM   6933 C CE   . LYS B 1 292 ? 8.681   2.472  -15.651 1.00 35.18 ? 292 LYS B CE   1 
ATOM   6934 N NZ   . LYS B 1 292 ? 7.995   2.845  -14.363 1.00 32.52 ? 292 LYS B NZ   1 
ATOM   6935 H H    . LYS B 1 292 ? 11.915  6.456  -16.470 1.00 0.00  ? 292 LYS B H    1 
ATOM   6936 H HZ1  . LYS B 1 292 ? 8.172   3.817  -14.008 1.00 0.00  ? 292 LYS B HZ1  1 
ATOM   6937 H HZ2  . LYS B 1 292 ? 6.968   2.719  -14.432 1.00 0.00  ? 292 LYS B HZ2  1 
ATOM   6938 H HZ3  . LYS B 1 292 ? 8.350   2.227  -13.611 1.00 0.00  ? 292 LYS B HZ3  1 
ATOM   6939 N N    . GLN B 1 293 ? 9.694   6.880  -13.970 1.00 30.06 ? 293 GLN B N    1 
ATOM   6940 C CA   . GLN B 1 293 ? 9.035   7.197  -12.702 1.00 30.27 ? 293 GLN B CA   1 
ATOM   6941 C C    . GLN B 1 293 ? 8.431   8.592  -12.595 1.00 29.68 ? 293 GLN B C    1 
ATOM   6942 O O    . GLN B 1 293 ? 7.508   8.794  -11.797 1.00 30.09 ? 293 GLN B O    1 
ATOM   6943 C CB   . GLN B 1 293 ? 9.945   6.922  -11.505 1.00 29.52 ? 293 GLN B CB   1 
ATOM   6944 C CG   . GLN B 1 293 ? 9.976   5.469  -11.092 1.00 31.09 ? 293 GLN B CG   1 
ATOM   6945 C CD   . GLN B 1 293 ? 8.654   4.750  -11.377 1.00 32.38 ? 293 GLN B CD   1 
ATOM   6946 O OE1  . GLN B 1 293 ? 8.413   4.335  -12.510 1.00 35.37 ? 293 GLN B OE1  1 
ATOM   6947 N NE2  . GLN B 1 293 ? 7.815   4.584  -10.362 1.00 25.93 ? 293 GLN B NE2  1 
ATOM   6948 H H    . GLN B 1 293 ? 10.665  6.688  -14.000 1.00 0.00  ? 293 GLN B H    1 
ATOM   6949 H HE21 . GLN B 1 293 ? 6.963   4.134  -10.540 1.00 0.00  ? 293 GLN B HE21 1 
ATOM   6950 H HE22 . GLN B 1 293 ? 8.087   4.921  -9.478  1.00 0.00  ? 293 GLN B HE22 1 
ATOM   6951 N N    . GLY B 1 294 ? 8.928   9.533  -13.400 1.00 27.81 ? 294 GLY B N    1 
ATOM   6952 C CA   . GLY B 1 294 ? 8.392   10.888 -13.375 1.00 26.80 ? 294 GLY B CA   1 
ATOM   6953 C C    . GLY B 1 294 ? 7.820   11.354 -14.705 1.00 26.12 ? 294 GLY B C    1 
ATOM   6954 O O    . GLY B 1 294 ? 7.719   12.553 -14.969 1.00 25.80 ? 294 GLY B O    1 
ATOM   6955 H H    . GLY B 1 294 ? 9.668   9.344  -14.016 1.00 0.00  ? 294 GLY B H    1 
ATOM   6956 N N    . ASN B 1 295 ? 7.490   10.403 -15.565 1.00 25.99 ? 295 ASN B N    1 
ATOM   6957 C CA   . ASN B 1 295 ? 6.918   10.704 -16.862 1.00 28.90 ? 295 ASN B CA   1 
ATOM   6958 C C    . ASN B 1 295 ? 7.663   11.837 -17.565 1.00 28.71 ? 295 ASN B C    1 
ATOM   6959 O O    . ASN B 1 295 ? 7.115   12.911 -17.779 1.00 24.66 ? 295 ASN B O    1 
ATOM   6960 C CB   . ASN B 1 295 ? 5.424   11.034 -16.703 1.00 31.64 ? 295 ASN B CB   1 
ATOM   6961 C CG   . ASN B 1 295 ? 4.643   9.898  -16.031 1.00 32.46 ? 295 ASN B CG   1 
ATOM   6962 O OD1  . ASN B 1 295 ? 4.707   9.713  -14.804 1.00 29.44 ? 295 ASN B OD1  1 
ATOM   6963 N ND2  . ASN B 1 295 ? 3.932   9.114  -16.838 1.00 30.96 ? 295 ASN B ND2  1 
ATOM   6964 H H    . ASN B 1 295 ? 7.625   9.465  -15.302 1.00 0.00  ? 295 ASN B H    1 
ATOM   6965 H HD21 . ASN B 1 295 ? 3.422   8.386  -16.434 1.00 0.00  ? 295 ASN B HD21 1 
ATOM   6966 H HD22 . ASN B 1 295 ? 3.943   9.308  -17.798 1.00 0.00  ? 295 ASN B HD22 1 
ATOM   6967 N N    . GLU B 1 296 ? 8.948   11.606 -17.840 1.00 30.98 ? 296 GLU B N    1 
ATOM   6968 C CA   . GLU B 1 296 ? 9.783   12.600 -18.509 1.00 31.45 ? 296 GLU B CA   1 
ATOM   6969 C C    . GLU B 1 296 ? 9.876   12.269 -19.980 1.00 32.63 ? 296 GLU B C    1 
ATOM   6970 O O    . GLU B 1 296 ? 10.944  11.936 -20.486 1.00 31.34 ? 296 GLU B O    1 
ATOM   6971 C CB   . GLU B 1 296 ? 11.199  12.694 -17.906 1.00 28.71 ? 296 GLU B CB   1 
ATOM   6972 C CG   . GLU B 1 296 ? 11.336  13.369 -16.515 1.00 25.71 ? 296 GLU B CG   1 
ATOM   6973 C CD   . GLU B 1 296 ? 10.632  14.735 -16.403 1.00 26.23 ? 296 GLU B CD   1 
ATOM   6974 O OE1  . GLU B 1 296 ? 11.040  15.713 -17.061 1.00 19.38 ? 296 GLU B OE1  1 
ATOM   6975 O OE2  . GLU B 1 296 ? 9.646   14.830 -15.635 1.00 27.52 ? 296 GLU B OE2  1 
ATOM   6976 H H    . GLU B 1 296 ? 9.366   10.769 -17.544 1.00 0.00  ? 296 GLU B H    1 
ATOM   6977 N N    . PHE B 1 297 ? 8.738   12.370 -20.659 1.00 35.38 ? 297 PHE B N    1 
ATOM   6978 C CA   . PHE B 1 297 ? 8.655   12.115 -22.090 1.00 36.59 ? 297 PHE B CA   1 
ATOM   6979 C C    . PHE B 1 297 ? 8.211   13.426 -22.680 1.00 39.03 ? 297 PHE B C    1 
ATOM   6980 O O    . PHE B 1 297 ? 7.684   14.269 -21.954 1.00 36.94 ? 297 PHE B O    1 
ATOM   6981 C CB   . PHE B 1 297 ? 7.638   11.017 -22.382 1.00 34.10 ? 297 PHE B CB   1 
ATOM   6982 C CG   . PHE B 1 297 ? 7.935   9.727  -21.675 1.00 34.88 ? 297 PHE B CG   1 
ATOM   6983 C CD1  . PHE B 1 297 ? 9.045   8.960  -22.038 1.00 34.56 ? 297 PHE B CD1  1 
ATOM   6984 C CD2  . PHE B 1 297 ? 7.143   9.300  -20.605 1.00 33.82 ? 297 PHE B CD2  1 
ATOM   6985 C CE1  . PHE B 1 297 ? 9.368   7.792  -21.345 1.00 34.39 ? 297 PHE B CE1  1 
ATOM   6986 C CE2  . PHE B 1 297 ? 7.456   8.138  -19.911 1.00 32.81 ? 297 PHE B CE2  1 
ATOM   6987 C CZ   . PHE B 1 297 ? 8.575   7.384  -20.281 1.00 34.09 ? 297 PHE B CZ   1 
ATOM   6988 H H    . PHE B 1 297 ? 7.929   12.675 -20.194 1.00 0.00  ? 297 PHE B H    1 
ATOM   6989 N N    . GLY B 1 298 ? 8.539   13.638 -23.952 1.00 44.91 ? 298 GLY B N    1 
ATOM   6990 C CA   . GLY B 1 298 ? 8.178   14.868 -24.658 1.00 52.50 ? 298 GLY B CA   1 
ATOM   6991 C C    . GLY B 1 298 ? 6.688   14.992 -24.915 1.00 65.09 ? 298 GLY B C    1 
ATOM   6992 O O    . GLY B 1 298 ? 6.029   13.997 -25.183 1.00 67.49 ? 298 GLY B O    1 
ATOM   6993 H H    . GLY B 1 298 ? 9.099   12.983 -24.447 1.00 0.00  ? 298 GLY B H    1 
ATOM   6994 N N    . ALA B 1 299 ? 6.152   16.203 -24.866 1.00 69.12 ? 299 ALA B N    1 
ATOM   6995 C CA   . ALA B 1 299 ? 4.716   16.379 -25.077 1.00 77.26 ? 299 ALA B CA   1 
ATOM   6996 C C    . ALA B 1 299 ? 4.257   16.674 -26.512 1.00 77.44 ? 299 ALA B C    1 
ATOM   6997 O O    . ALA B 1 299 ? 3.144   16.309 -26.887 1.00 79.74 ? 299 ALA B O    1 
ATOM   6998 C CB   . ALA B 1 299 ? 4.172   17.432 -24.122 1.00 83.77 ? 299 ALA B CB   1 
ATOM   6999 H H    . ALA B 1 299 ? 6.730   16.946 -24.598 1.00 0.00  ? 299 ALA B H    1 
ATOM   7000 N N    . THR B 1 300 ? 5.122   17.281 -27.325 1.00 81.38 ? 300 THR B N    1 
ATOM   7001 C CA   . THR B 1 300 ? 4.760   17.642 -28.699 1.00 80.21 ? 300 THR B CA   1 
ATOM   7002 C C    . THR B 1 300 ? 5.661   17.012 -29.775 1.00 80.44 ? 300 THR B C    1 
ATOM   7003 O O    . THR B 1 300 ? 5.693   17.462 -30.914 1.00 80.36 ? 300 THR B O    1 
ATOM   7004 C CB   . THR B 1 300 ? 4.760   19.188 -28.843 1.00 83.09 ? 300 THR B CB   1 
ATOM   7005 O OG1  . THR B 1 300 ? 4.026   19.577 -30.007 1.00 88.23 ? 300 THR B OG1  1 
ATOM   7006 C CG2  . THR B 1 300 ? 6.186   19.720 -28.946 1.00 89.18 ? 300 THR B CG2  1 
ATOM   7007 H H    . THR B 1 300 ? 5.999   17.535 -26.997 1.00 0.00  ? 300 THR B H    1 
ATOM   7008 H HG1  . THR B 1 300 ? 3.725   20.483 -29.974 1.00 0.00  ? 300 THR B HG1  1 
ATOM   7009 N N    . THR B 1 301 ? 6.407   15.979 -29.403 1.00 87.65 ? 301 THR B N    1 
ATOM   7010 C CA   . THR B 1 301 ? 7.299   15.301 -30.344 1.00 80.77 ? 301 THR B CA   1 
ATOM   7011 C C    . THR B 1 301 ? 7.528   13.869 -29.873 1.00 80.43 ? 301 THR B C    1 
ATOM   7012 O O    . THR B 1 301 ? 7.924   12.997 -30.653 1.00 85.10 ? 301 THR B O    1 
ATOM   7013 C CB   . THR B 1 301 ? 8.672   16.021 -30.471 1.00 85.73 ? 301 THR B CB   1 
ATOM   7014 O OG1  . THR B 1 301 ? 9.084   16.507 -29.185 1.00 90.76 ? 301 THR B OG1  1 
ATOM   7015 C CG2  . THR B 1 301 ? 8.599   17.185 -31.457 1.00 90.83 ? 301 THR B CG2  1 
ATOM   7016 H H    . THR B 1 301 ? 6.270   15.635 -28.505 1.00 0.00  ? 301 THR B H    1 
ATOM   7017 H HG1  . THR B 1 301 ? 8.558   17.317 -29.144 1.00 0.00  ? 301 THR B HG1  1 
ATOM   7018 N N    . GLY B 1 302 ? 7.288   13.643 -28.584 1.00 90.38 ? 302 GLY B N    1 
ATOM   7019 C CA   . GLY B 1 302 ? 7.471   12.321 -28.013 1.00 89.75 ? 302 GLY B CA   1 
ATOM   7020 C C    . GLY B 1 302 ? 8.885   12.035 -27.530 1.00 89.52 ? 302 GLY B C    1 
ATOM   7021 O O    . GLY B 1 302 ? 9.105   11.088 -26.769 1.00 97.28 ? 302 GLY B O    1 
ATOM   7022 H H    . GLY B 1 302 ? 7.001   14.340 -27.970 1.00 0.00  ? 302 GLY B H    1 
ATOM   7023 N N    . ARG B 1 303 ? 9.838   12.865 -27.954 1.00 85.81 ? 303 ARG B N    1 
ATOM   7024 C CA   . ARG B 1 303 ? 11.238  12.709 -27.575 1.00 83.06 ? 303 ARG B CA   1 
ATOM   7025 C C    . ARG B 1 303 ? 11.378  12.453 -26.069 1.00 78.02 ? 303 ARG B C    1 
ATOM   7026 O O    . ARG B 1 303 ? 10.434  12.658 -25.307 1.00 81.74 ? 303 ARG B O    1 
ATOM   7027 C CB   . ARG B 1 303 ? 12.022  13.964 -27.979 1.00 80.44 ? 303 ARG B CB   1 
ATOM   7028 C CG   . ARG B 1 303 ? 11.954  14.282 -29.474 1.00 80.56 ? 303 ARG B CG   1 
ATOM   7029 C CD   . ARG B 1 303 ? 12.612  15.614 -29.813 1.00 83.71 ? 303 ARG B CD   1 
ATOM   7030 N NE   . ARG B 1 303 ? 11.892  16.754 -29.245 1.00 88.68 ? 303 ARG B NE   1 
ATOM   7031 C CZ   . ARG B 1 303 ? 12.371  17.995 -29.196 1.00 93.70 ? 303 ARG B CZ   1 
ATOM   7032 N NH1  . ARG B 1 303 ? 13.573  18.270 -29.688 1.00 93.72 ? 303 ARG B NH1  1 
ATOM   7033 N NH2  . ARG B 1 303 ? 11.654  18.959 -28.633 1.00 93.71 ? 303 ARG B NH2  1 
ATOM   7034 H H    . ARG B 1 303 ? 9.583   13.624 -28.507 1.00 0.00  ? 303 ARG B H    1 
ATOM   7035 H HE   . ARG B 1 303 ? 10.968  16.583 -28.949 1.00 0.00  ? 303 ARG B HE   1 
ATOM   7036 H HH11 . ARG B 1 303 ? 14.127  17.542 -30.099 1.00 0.00  ? 303 ARG B HH11 1 
ATOM   7037 H HH12 . ARG B 1 303 ? 13.957  19.194 -29.668 1.00 0.00  ? 303 ARG B HH12 1 
ATOM   7038 H HH21 . ARG B 1 303 ? 10.760  18.732 -28.249 1.00 0.00  ? 303 ARG B HH21 1 
ATOM   7039 H HH22 . ARG B 1 303 ? 11.979  19.904 -28.576 1.00 0.00  ? 303 ARG B HH22 1 
ATOM   7040 N N    . ARG B 1 304 ? 12.533  11.944 -25.658 1.00 86.92 ? 304 ARG B N    1 
ATOM   7041 C CA   . ARG B 1 304 ? 12.810  11.668 -24.251 1.00 82.79 ? 304 ARG B CA   1 
ATOM   7042 C C    . ARG B 1 304 ? 13.605  12.842 -23.671 1.00 59.25 ? 304 ARG B C    1 
ATOM   7043 O O    . ARG B 1 304 ? 14.239  13.601 -24.400 1.00 59.63 ? 304 ARG B O    1 
ATOM   7044 C CB   . ARG B 1 304 ? 13.634  10.383 -24.120 1.00 83.71 ? 304 ARG B CB   1 
ATOM   7045 C CG   . ARG B 1 304 ? 13.950  9.989  -22.686 1.00 84.58 ? 304 ARG B CG   1 
ATOM   7046 C CD   . ARG B 1 304 ? 15.240  9.190  -22.594 1.00 85.41 ? 304 ARG B CD   1 
ATOM   7047 N NE   . ARG B 1 304 ? 15.549  8.826  -21.213 1.00 86.20 ? 304 ARG B NE   1 
ATOM   7048 C CZ   . ARG B 1 304 ? 16.568  9.317  -20.510 1.00 96.50 ? 304 ARG B CZ   1 
ATOM   7049 N NH1  . ARG B 1 304 ? 17.395  10.202 -21.054 1.00 96.79 ? 304 ARG B NH1  1 
ATOM   7050 N NH2  . ARG B 1 304 ? 16.760  8.918  -19.259 1.00 96.77 ? 304 ARG B NH2  1 
ATOM   7051 H H    . ARG B 1 304 ? 13.231  11.764 -26.311 1.00 0.00  ? 304 ARG B H    1 
ATOM   7052 H HE   . ARG B 1 304 ? 14.941  8.178  -20.794 1.00 0.00  ? 304 ARG B HE   1 
ATOM   7053 H HH11 . ARG B 1 304 ? 17.257  10.508 -21.996 1.00 0.00  ? 304 ARG B HH11 1 
ATOM   7054 H HH12 . ARG B 1 304 ? 18.174  10.562 -20.541 1.00 0.00  ? 304 ARG B HH12 1 
ATOM   7055 H HH21 . ARG B 1 304 ? 16.151  8.240  -18.851 1.00 0.00  ? 304 ARG B HH21 1 
ATOM   7056 H HH22 . ARG B 1 304 ? 17.495  9.281  -18.678 1.00 0.00  ? 304 ARG B HH22 1 
ATOM   7057 N N    . ARG B 1 305 ? 13.562  13.002 -22.360 1.00 45.37 ? 305 ARG B N    1 
ATOM   7058 C CA   . ARG B 1 305 ? 14.312  14.074 -21.716 1.00 39.71 ? 305 ARG B CA   1 
ATOM   7059 C C    . ARG B 1 305 ? 15.535  13.469 -21.039 1.00 36.33 ? 305 ARG B C    1 
ATOM   7060 O O    . ARG B 1 305 ? 15.432  12.457 -20.327 1.00 36.46 ? 305 ARG B O    1 
ATOM   7061 C CB   . ARG B 1 305 ? 13.435  14.823 -20.702 1.00 38.60 ? 305 ARG B CB   1 
ATOM   7062 C CG   . ARG B 1 305 ? 12.222  15.439 -21.363 1.00 36.59 ? 305 ARG B CG   1 
ATOM   7063 C CD   . ARG B 1 305 ? 11.854  16.786 -20.766 1.00 37.27 ? 305 ARG B CD   1 
ATOM   7064 N NE   . ARG B 1 305 ? 10.791  16.646 -19.781 1.00 38.48 ? 305 ARG B NE   1 
ATOM   7065 C CZ   . ARG B 1 305 ? 9.496   16.772 -20.046 1.00 34.41 ? 305 ARG B CZ   1 
ATOM   7066 N NH1  . ARG B 1 305 ? 9.077   17.063 -21.271 1.00 34.52 ? 305 ARG B NH1  1 
ATOM   7067 N NH2  . ARG B 1 305 ? 8.625   16.520 -19.089 1.00 34.09 ? 305 ARG B NH2  1 
ATOM   7068 H H    . ARG B 1 305 ? 13.007  12.427 -21.783 1.00 0.00  ? 305 ARG B H    1 
ATOM   7069 H HE   . ARG B 1 305 ? 11.050  16.442 -18.848 1.00 0.00  ? 305 ARG B HE   1 
ATOM   7070 H HH11 . ARG B 1 305 ? 9.717   17.214 -22.030 1.00 0.00  ? 305 ARG B HH11 1 
ATOM   7071 H HH12 . ARG B 1 305 ? 8.098   17.176 -21.473 1.00 0.00  ? 305 ARG B HH12 1 
ATOM   7072 H HH21 . ARG B 1 305 ? 8.961   16.235 -18.189 1.00 0.00  ? 305 ARG B HH21 1 
ATOM   7073 H HH22 . ARG B 1 305 ? 7.638   16.595 -19.247 1.00 0.00  ? 305 ARG B HH22 1 
ATOM   7074 N N    . ARG B 1 306 ? 16.702  14.043 -21.307 1.00 30.69 ? 306 ARG B N    1 
ATOM   7075 C CA   . ARG B 1 306 ? 17.908  13.547 -20.693 1.00 25.39 ? 306 ARG B CA   1 
ATOM   7076 C C    . ARG B 1 306 ? 17.709  13.590 -19.189 1.00 24.58 ? 306 ARG B C    1 
ATOM   7077 O O    . ARG B 1 306 ? 17.044  14.533 -18.683 1.00 23.16 ? 306 ARG B O    1 
ATOM   7078 C CB   . ARG B 1 306 ? 19.082  14.450 -21.015 1.00 24.21 ? 306 ARG B CB   1 
ATOM   7079 C CG   . ARG B 1 306 ? 19.201  14.879 -22.434 1.00 22.55 ? 306 ARG B CG   1 
ATOM   7080 C CD   . ARG B 1 306 ? 20.671  15.092 -22.757 1.00 17.42 ? 306 ARG B CD   1 
ATOM   7081 N NE   . ARG B 1 306 ? 20.963  16.409 -23.319 1.00 14.50 ? 306 ARG B NE   1 
ATOM   7082 C CZ   . ARG B 1 306 ? 22.155  16.993 -23.274 1.00 9.97  ? 306 ARG B CZ   1 
ATOM   7083 N NH1  . ARG B 1 306 ? 23.215  16.403 -22.701 1.00 5.21  ? 306 ARG B NH1  1 
ATOM   7084 N NH2  . ARG B 1 306 ? 22.275  18.185 -23.800 1.00 11.99 ? 306 ARG B NH2  1 
ATOM   7085 H H    . ARG B 1 306 ? 16.711  14.854 -21.854 1.00 0.00  ? 306 ARG B H    1 
ATOM   7086 H HE   . ARG B 1 306 ? 20.232  16.896 -23.756 1.00 0.00  ? 306 ARG B HE   1 
ATOM   7087 H HH11 . ARG B 1 306 ? 23.147  15.482 -22.281 1.00 0.00  ? 306 ARG B HH11 1 
ATOM   7088 H HH12 . ARG B 1 306 ? 24.094  16.875 -22.660 1.00 0.00  ? 306 ARG B HH12 1 
ATOM   7089 H HH21 . ARG B 1 306 ? 21.464  18.641 -24.194 1.00 0.00  ? 306 ARG B HH21 1 
ATOM   7090 H HH22 . ARG B 1 306 ? 23.160  18.662 -23.700 1.00 0.00  ? 306 ARG B HH22 1 
ATOM   7091 N N    . THR B 1 307 ? 18.247  12.592 -18.475 1.00 23.57 ? 307 THR B N    1 
ATOM   7092 C CA   . THR B 1 307 ? 18.155  12.590 -17.016 1.00 21.73 ? 307 THR B CA   1 
ATOM   7093 C C    . THR B 1 307 ? 19.493  12.324 -16.367 1.00 21.70 ? 307 THR B C    1 
ATOM   7094 O O    . THR B 1 307 ? 20.471  11.915 -17.015 1.00 17.86 ? 307 THR B O    1 
ATOM   7095 C CB   . THR B 1 307 ? 17.048  11.651 -16.428 1.00 23.61 ? 307 THR B CB   1 
ATOM   7096 O OG1  . THR B 1 307 ? 17.469  10.275 -16.464 1.00 23.98 ? 307 THR B OG1  1 
ATOM   7097 C CG2  . THR B 1 307 ? 15.717  11.825 -17.183 1.00 20.76 ? 307 THR B CG2  1 
ATOM   7098 H H    . THR B 1 307 ? 18.768  11.878 -18.884 1.00 0.00  ? 307 THR B H    1 
ATOM   7099 H HG1  . THR B 1 307 ? 16.965  9.806  -15.782 1.00 0.00  ? 307 THR B HG1  1 
ATOM   7100 N N    . GLY B 1 308 ? 19.547  12.631 -15.077 1.00 22.51 ? 308 GLY B N    1 
ATOM   7101 C CA   . GLY B 1 308 ? 20.771  12.475 -14.309 1.00 18.03 ? 308 GLY B CA   1 
ATOM   7102 C C    . GLY B 1 308 ? 20.472  12.920 -12.910 1.00 15.70 ? 308 GLY B C    1 
ATOM   7103 O O    . GLY B 1 308 ? 19.385  13.432 -12.644 1.00 15.32 ? 308 GLY B O    1 
ATOM   7104 H H    . GLY B 1 308 ? 18.763  13.007 -14.609 1.00 0.00  ? 308 GLY B H    1 
ATOM   7105 N N    . TRP B 1 309 ? 21.424  12.732 -12.007 1.00 17.59 ? 309 TRP B N    1 
ATOM   7106 C CA   . TRP B 1 309 ? 21.239  13.119 -10.605 1.00 15.93 ? 309 TRP B CA   1 
ATOM   7107 C C    . TRP B 1 309 ? 21.140  14.645 -10.405 1.00 16.82 ? 309 TRP B C    1 
ATOM   7108 O O    . TRP B 1 309 ? 21.280  15.426 -11.373 1.00 18.07 ? 309 TRP B O    1 
ATOM   7109 C CB   . TRP B 1 309 ? 22.397  12.601 -9.773  1.00 11.79 ? 309 TRP B CB   1 
ATOM   7110 C CG   . TRP B 1 309 ? 22.580  11.119 -9.820  1.00 12.49 ? 309 TRP B CG   1 
ATOM   7111 C CD1  . TRP B 1 309 ? 23.600  10.460 -10.411 1.00 13.72 ? 309 TRP B CD1  1 
ATOM   7112 C CD2  . TRP B 1 309 ? 21.772  10.116 -9.175  1.00 12.66 ? 309 TRP B CD2  1 
ATOM   7113 N NE1  . TRP B 1 309 ? 23.493  9.110  -10.175 1.00 16.19 ? 309 TRP B NE1  1 
ATOM   7114 C CE2  . TRP B 1 309 ? 22.382  8.877  -9.411  1.00 13.36 ? 309 TRP B CE2  1 
ATOM   7115 C CE3  . TRP B 1 309 ? 20.600  10.153 -8.409  1.00 15.68 ? 309 TRP B CE3  1 
ATOM   7116 C CZ2  . TRP B 1 309 ? 21.869  7.676  -8.904  1.00 14.31 ? 309 TRP B CZ2  1 
ATOM   7117 C CZ3  . TRP B 1 309 ? 20.093  8.966  -7.904  1.00 13.52 ? 309 TRP B CZ3  1 
ATOM   7118 C CH2  . TRP B 1 309 ? 20.731  7.744  -8.155  1.00 12.39 ? 309 TRP B CH2  1 
ATOM   7119 H H    . TRP B 1 309 ? 22.271  12.346 -12.313 1.00 0.00  ? 309 TRP B H    1 
ATOM   7120 H HE1  . TRP B 1 309 ? 24.063  8.431  -10.590 1.00 0.00  ? 309 TRP B HE1  1 
ATOM   7121 N N    . LEU B 1 310 ? 20.883  15.065 -9.161  1.00 13.66 ? 310 LEU B N    1 
ATOM   7122 C CA   . LEU B 1 310 ? 20.820  16.488 -8.820  1.00 13.25 ? 310 LEU B CA   1 
ATOM   7123 C C    . LEU B 1 310 ? 22.296  17.013 -8.777  1.00 14.96 ? 310 LEU B C    1 
ATOM   7124 O O    . LEU B 1 310 ? 23.177  16.412 -8.131  1.00 9.34  ? 310 LEU B O    1 
ATOM   7125 C CB   . LEU B 1 310 ? 20.163  16.621 -7.452  1.00 11.57 ? 310 LEU B CB   1 
ATOM   7126 C CG   . LEU B 1 310 ? 19.676  17.872 -6.708  1.00 13.39 ? 310 LEU B CG   1 
ATOM   7127 C CD1  . LEU B 1 310 ? 20.667  18.934 -6.806  1.00 11.39 ? 310 LEU B CD1  1 
ATOM   7128 C CD2  . LEU B 1 310 ? 18.325  18.362 -7.205  1.00 17.17 ? 310 LEU B CD2  1 
ATOM   7129 H H    . LEU B 1 310 ? 20.747  14.405 -8.455  1.00 0.00  ? 310 LEU B H    1 
ATOM   7130 N N    . ASP B 1 311 ? 22.546  18.131 -9.460  1.00 14.86 ? 311 ASP B N    1 
ATOM   7131 C CA   . ASP B 1 311 ? 23.876  18.767 -9.521  1.00 16.71 ? 311 ASP B CA   1 
ATOM   7132 C C    . ASP B 1 311 ? 23.866  20.014 -8.675  1.00 16.06 ? 311 ASP B C    1 
ATOM   7133 O O    . ASP B 1 311 ? 23.404  21.054 -9.126  1.00 18.47 ? 311 ASP B O    1 
ATOM   7134 C CB   . ASP B 1 311 ? 24.179  19.153 -10.975 1.00 19.73 ? 311 ASP B CB   1 
ATOM   7135 C CG   . ASP B 1 311 ? 25.509  19.894 -11.146 1.00 22.59 ? 311 ASP B CG   1 
ATOM   7136 O OD1  . ASP B 1 311 ? 26.384  19.840 -10.258 1.00 23.23 ? 311 ASP B OD1  1 
ATOM   7137 O OD2  . ASP B 1 311 ? 25.668  20.529 -12.212 1.00 23.33 ? 311 ASP B OD2  1 
ATOM   7138 H H    . ASP B 1 311 ? 21.806  18.563 -9.937  1.00 0.00  ? 311 ASP B H    1 
ATOM   7139 N N    . THR B 1 312 ? 24.451  19.956 -7.487  1.00 17.55 ? 312 THR B N    1 
ATOM   7140 C CA   . THR B 1 312 ? 24.439  21.122 -6.597  1.00 18.14 ? 312 THR B CA   1 
ATOM   7141 C C    . THR B 1 312 ? 25.406  22.302 -6.924  1.00 16.90 ? 312 THR B C    1 
ATOM   7142 O O    . THR B 1 312 ? 25.435  23.326 -6.214  1.00 12.93 ? 312 THR B O    1 
ATOM   7143 C CB   . THR B 1 312 ? 24.615  20.676 -5.139  1.00 21.54 ? 312 THR B CB   1 
ATOM   7144 O OG1  . THR B 1 312 ? 25.851  19.957 -5.005  1.00 23.13 ? 312 THR B OG1  1 
ATOM   7145 C CG2  . THR B 1 312 ? 23.453  19.794 -4.727  1.00 18.71 ? 312 THR B CG2  1 
ATOM   7146 H H    . THR B 1 312 ? 24.947  19.163 -7.196  1.00 0.00  ? 312 THR B H    1 
ATOM   7147 H HG1  . THR B 1 312 ? 26.035  19.197 -5.610  1.00 0.00  ? 312 THR B HG1  1 
ATOM   7148 N N    . VAL B 1 313 ? 26.253  22.125 -7.936  1.00 17.89 ? 313 VAL B N    1 
ATOM   7149 C CA   . VAL B 1 313 ? 27.164  23.177 -8.340  1.00 14.27 ? 313 VAL B CA   1 
ATOM   7150 C C    . VAL B 1 313 ? 26.355  24.129 -9.250  1.00 14.81 ? 313 VAL B C    1 
ATOM   7151 O O    . VAL B 1 313 ? 26.319  25.331 -9.051  1.00 16.53 ? 313 VAL B O    1 
ATOM   7152 C CB   . VAL B 1 313 ? 28.329  22.606 -9.141  1.00 17.11 ? 313 VAL B CB   1 
ATOM   7153 C CG1  . VAL B 1 313 ? 29.320  23.749 -9.551  1.00 17.32 ? 313 VAL B CG1  1 
ATOM   7154 C CG2  . VAL B 1 313 ? 28.981  21.477 -8.378  1.00 11.30 ? 313 VAL B CG2  1 
ATOM   7155 H H    . VAL B 1 313 ? 26.259  21.271 -8.431  1.00 0.00  ? 313 VAL B H    1 
ATOM   7156 N N    . ALA B 1 314 ? 25.657  23.552 -10.213 1.00 15.14 ? 314 ALA B N    1 
ATOM   7157 C CA   . ALA B 1 314 ? 24.816  24.300 -11.129 1.00 13.30 ? 314 ALA B CA   1 
ATOM   7158 C C    . ALA B 1 314 ? 23.774  25.020 -10.290 1.00 14.11 ? 314 ALA B C    1 
ATOM   7159 O O    . ALA B 1 314 ? 23.517  26.205 -10.491 1.00 15.02 ? 314 ALA B O    1 
ATOM   7160 C CB   . ALA B 1 314 ? 24.120  23.318 -12.094 1.00 8.79  ? 314 ALA B CB   1 
ATOM   7161 H H    . ALA B 1 314 ? 25.731  22.583 -10.337 1.00 0.00  ? 314 ALA B H    1 
ATOM   7162 N N    . VAL B 1 315 ? 23.117  24.257 -9.418  1.00 14.44 ? 315 VAL B N    1 
ATOM   7163 C CA   . VAL B 1 315 ? 22.086  24.783 -8.524  1.00 10.59 ? 315 VAL B CA   1 
ATOM   7164 C C    . VAL B 1 315 ? 22.685  25.960 -7.729  1.00 11.60 ? 315 VAL B C    1 
ATOM   7165 O O    . VAL B 1 315 ? 22.036  27.008 -7.589  1.00 15.26 ? 315 VAL B O    1 
ATOM   7166 C CB   . VAL B 1 315 ? 21.556  23.693 -7.527  1.00 8.07  ? 315 VAL B CB   1 
ATOM   7167 C CG1  . VAL B 1 315 ? 20.565  24.257 -6.586  1.00 5.67  ? 315 VAL B CG1  1 
ATOM   7168 C CG2  . VAL B 1 315 ? 20.945  22.566 -8.257  1.00 9.12  ? 315 VAL B CG2  1 
ATOM   7169 H H    . VAL B 1 315 ? 23.299  23.293 -9.383  1.00 0.00  ? 315 VAL B H    1 
ATOM   7170 N N    . ARG B 1 316 ? 23.890  25.786 -7.193  1.00 9.38  ? 316 ARG B N    1 
ATOM   7171 C CA   . ARG B 1 316 ? 24.533  26.863 -6.436  1.00 13.82 ? 316 ARG B CA   1 
ATOM   7172 C C    . ARG B 1 316 ? 24.725  28.118 -7.337  1.00 13.87 ? 316 ARG B C    1 
ATOM   7173 O O    . ARG B 1 316 ? 24.678  29.263 -6.846  1.00 15.14 ? 316 ARG B O    1 
ATOM   7174 C CB   . ARG B 1 316 ? 25.890  26.405 -5.807  1.00 18.01 ? 316 ARG B CB   1 
ATOM   7175 C CG   . ARG B 1 316 ? 25.831  26.083 -4.291  1.00 18.87 ? 316 ARG B CG   1 
ATOM   7176 C CD   . ARG B 1 316 ? 27.225  26.031 -3.594  1.00 18.20 ? 316 ARG B CD   1 
ATOM   7177 N NE   . ARG B 1 316 ? 27.982  24.860 -4.064  1.00 22.70 ? 316 ARG B NE   1 
ATOM   7178 C CZ   . ARG B 1 316 ? 28.332  23.803 -3.313  1.00 21.99 ? 316 ARG B CZ   1 
ATOM   7179 N NH1  . ARG B 1 316 ? 28.018  23.789 -2.029  1.00 22.87 ? 316 ARG B NH1  1 
ATOM   7180 N NH2  . ARG B 1 316 ? 28.847  22.687 -3.879  1.00 17.67 ? 316 ARG B NH2  1 
ATOM   7181 H H    . ARG B 1 316 ? 24.360  24.928 -7.264  1.00 0.00  ? 316 ARG B H    1 
ATOM   7182 H HE   . ARG B 1 316 ? 28.255  24.884 -5.005  1.00 0.00  ? 316 ARG B HE   1 
ATOM   7183 H HH11 . ARG B 1 316 ? 27.450  24.516 -1.614  1.00 0.00  ? 316 ARG B HH11 1 
ATOM   7184 H HH12 . ARG B 1 316 ? 28.280  23.011 -1.464  1.00 0.00  ? 316 ARG B HH12 1 
ATOM   7185 H HH21 . ARG B 1 316 ? 28.969  22.613 -4.868  1.00 0.00  ? 316 ARG B HH21 1 
ATOM   7186 H HH22 . ARG B 1 316 ? 29.113  21.899 -3.314  1.00 0.00  ? 316 ARG B HH22 1 
ATOM   7187 N N    . ARG B 1 317 ? 24.903  27.913 -8.639  1.00 12.40 ? 317 ARG B N    1 
ATOM   7188 C CA   . ARG B 1 317 ? 25.073  29.036 -9.541  1.00 10.32 ? 317 ARG B CA   1 
ATOM   7189 C C    . ARG B 1 317 ? 23.782  29.782 -9.589  1.00 8.29  ? 317 ARG B C    1 
ATOM   7190 O O    . ARG B 1 317 ? 23.787  30.998 -9.505  1.00 8.06  ? 317 ARG B O    1 
ATOM   7191 C CB   . ARG B 1 317 ? 25.448  28.606 -10.960 1.00 13.17 ? 317 ARG B CB   1 
ATOM   7192 C CG   . ARG B 1 317 ? 25.867  29.754 -11.916 1.00 8.79  ? 317 ARG B CG   1 
ATOM   7193 C CD   . ARG B 1 317 ? 27.047  30.629 -11.358 1.00 10.23 ? 317 ARG B CD   1 
ATOM   7194 N NE   . ARG B 1 317 ? 28.324  30.371 -12.008 1.00 11.80 ? 317 ARG B NE   1 
ATOM   7195 C CZ   . ARG B 1 317 ? 29.373  31.186 -11.955 1.00 11.06 ? 317 ARG B CZ   1 
ATOM   7196 N NH1  . ARG B 1 317 ? 29.317  32.315 -11.280 1.00 12.93 ? 317 ARG B NH1  1 
ATOM   7197 N NH2  . ARG B 1 317 ? 30.486  30.885 -12.609 1.00 15.10 ? 317 ARG B NH2  1 
ATOM   7198 H H    . ARG B 1 317 ? 24.959  26.999 -8.982  1.00 0.00  ? 317 ARG B H    1 
ATOM   7199 H HE   . ARG B 1 317 ? 28.424  29.519 -12.498 1.00 0.00  ? 317 ARG B HE   1 
ATOM   7200 H HH11 . ARG B 1 317 ? 28.511  32.602 -10.752 1.00 0.00  ? 317 ARG B HH11 1 
ATOM   7201 H HH12 . ARG B 1 317 ? 30.127  32.904 -11.261 1.00 0.00  ? 317 ARG B HH12 1 
ATOM   7202 H HH21 . ARG B 1 317 ? 30.540  30.049 -13.160 1.00 0.00  ? 317 ARG B HH21 1 
ATOM   7203 H HH22 . ARG B 1 317 ? 31.312  31.469 -12.545 1.00 0.00  ? 317 ARG B HH22 1 
ATOM   7204 N N    . ALA B 1 318 ? 22.675  29.042 -9.658  1.00 10.15 ? 318 ALA B N    1 
ATOM   7205 C CA   . ALA B 1 318 ? 21.315  29.631 -9.718  1.00 9.00  ? 318 ALA B CA   1 
ATOM   7206 C C    . ALA B 1 318 ? 20.988  30.394 -8.473  1.00 10.02 ? 318 ALA B C    1 
ATOM   7207 O O    . ALA B 1 318 ? 20.159  31.293 -8.514  1.00 11.03 ? 318 ALA B O    1 
ATOM   7208 C CB   . ALA B 1 318 ? 20.262  28.580 -9.943  1.00 9.28  ? 318 ALA B CB   1 
ATOM   7209 H H    . ALA B 1 318 ? 22.789  28.068 -9.718  1.00 0.00  ? 318 ALA B H    1 
ATOM   7210 N N    . VAL B 1 319 ? 21.571  30.008 -7.355  1.00 10.98 ? 319 VAL B N    1 
ATOM   7211 C CA   . VAL B 1 319 ? 21.335  30.758 -6.130  1.00 12.80 ? 319 VAL B CA   1 
ATOM   7212 C C    . VAL B 1 319 ? 22.027  32.148 -6.282  1.00 16.40 ? 319 VAL B C    1 
ATOM   7213 O O    . VAL B 1 319 ? 21.365  33.178 -6.109  1.00 18.02 ? 319 VAL B O    1 
ATOM   7214 C CB   . VAL B 1 319 ? 21.819  29.976 -4.882  1.00 15.07 ? 319 VAL B CB   1 
ATOM   7215 C CG1  . VAL B 1 319 ? 21.774  30.845 -3.641  1.00 12.08 ? 319 VAL B CG1  1 
ATOM   7216 C CG2  . VAL B 1 319 ? 20.942  28.779 -4.667  1.00 9.22  ? 319 VAL B CG2  1 
ATOM   7217 H H    . VAL B 1 319 ? 22.095  29.175 -7.359  1.00 0.00  ? 319 VAL B H    1 
ATOM   7218 N N    . GLN B 1 320 ? 23.318  32.166 -6.657  1.00 17.89 ? 320 GLN B N    1 
ATOM   7219 C CA   . GLN B 1 320 ? 24.087  33.424 -6.882  1.00 16.97 ? 320 GLN B CA   1 
ATOM   7220 C C    . GLN B 1 320 ? 23.269  34.401 -7.743  1.00 16.23 ? 320 GLN B C    1 
ATOM   7221 O O    . GLN B 1 320 ? 22.830  35.443 -7.237  1.00 18.47 ? 320 GLN B O    1 
ATOM   7222 C CB   . GLN B 1 320 ? 25.419  33.191 -7.643  1.00 17.35 ? 320 GLN B CB   1 
ATOM   7223 C CG   . GLN B 1 320 ? 26.660  32.783 -6.823  1.00 17.31 ? 320 GLN B CG   1 
ATOM   7224 C CD   . GLN B 1 320 ? 27.946  32.763 -7.668  1.00 16.37 ? 320 GLN B CD   1 
ATOM   7225 O OE1  . GLN B 1 320 ? 27.959  33.177 -8.824  1.00 16.49 ? 320 GLN B OE1  1 
ATOM   7226 N NE2  . GLN B 1 320 ? 29.015  32.280 -7.089  1.00 19.09 ? 320 GLN B NE2  1 
ATOM   7227 H H    . GLN B 1 320 ? 23.765  31.300 -6.779  1.00 0.00  ? 320 GLN B H    1 
ATOM   7228 H HE21 . GLN B 1 320 ? 29.892  32.236 -7.537  1.00 0.00  ? 320 GLN B HE21 1 
ATOM   7229 H HE22 . GLN B 1 320 ? 28.916  31.980 -6.160  1.00 0.00  ? 320 GLN B HE22 1 
ATOM   7230 N N    . LEU B 1 321 ? 23.054  34.030 -9.011  1.00 10.90 ? 321 LEU B N    1 
ATOM   7231 C CA   . LEU B 1 321 ? 22.311  34.830 -9.980  1.00 10.34 ? 321 LEU B CA   1 
ATOM   7232 C C    . LEU B 1 321 ? 20.885  35.277 -9.629  1.00 13.95 ? 321 LEU B C    1 
ATOM   7233 O O    . LEU B 1 321 ? 20.421  36.312 -10.109 1.00 12.54 ? 321 LEU B O    1 
ATOM   7234 C CB   . LEU B 1 321 ? 22.245  34.105 -11.313 1.00 13.01 ? 321 LEU B CB   1 
ATOM   7235 C CG   . LEU B 1 321 ? 23.459  33.493 -12.031 1.00 7.81  ? 321 LEU B CG   1 
ATOM   7236 C CD1  . LEU B 1 321 ? 22.958  33.058 -13.336 1.00 13.09 ? 321 LEU B CD1  1 
ATOM   7237 C CD2  . LEU B 1 321 ? 24.627  34.436 -12.197 1.00 7.51  ? 321 LEU B CD2  1 
ATOM   7238 H H    . LEU B 1 321 ? 23.398  33.149 -9.276  1.00 0.00  ? 321 LEU B H    1 
ATOM   7239 N N    . ASN B 1 322 ? 20.153  34.480 -8.855  1.00 15.26 ? 322 ASN B N    1 
ATOM   7240 C CA   . ASN B 1 322 ? 18.790  34.853 -8.463  1.00 11.91 ? 322 ASN B CA   1 
ATOM   7241 C C    . ASN B 1 322 ? 18.670  35.371 -7.032  1.00 13.86 ? 322 ASN B C    1 
ATOM   7242 O O    . ASN B 1 322 ? 17.560  35.690 -6.561  1.00 13.54 ? 322 ASN B O    1 
ATOM   7243 C CB   . ASN B 1 322 ? 17.886  33.670 -8.575  1.00 9.14  ? 322 ASN B CB   1 
ATOM   7244 C CG   . ASN B 1 322 ? 17.728  33.170 -9.980  1.00 6.84  ? 322 ASN B CG   1 
ATOM   7245 O OD1  . ASN B 1 322 ? 17.693  33.960 -10.945 1.00 9.90  ? 322 ASN B OD1  1 
ATOM   7246 N ND2  . ASN B 1 322 ? 17.512  31.849 -10.109 1.00 5.01  ? 322 ASN B ND2  1 
ATOM   7247 H H    . ASN B 1 322 ? 20.506  33.614 -8.557  1.00 0.00  ? 322 ASN B H    1 
ATOM   7248 H HD21 . ASN B 1 322 ? 17.413  31.429 -10.997 1.00 0.00  ? 322 ASN B HD21 1 
ATOM   7249 H HD22 . ASN B 1 322 ? 17.473  31.332 -9.281  1.00 0.00  ? 322 ASN B HD22 1 
ATOM   7250 N N    . SER B 1 323 ? 19.795  35.509 -6.343  1.00 12.21 ? 323 SER B N    1 
ATOM   7251 C CA   . SER B 1 323 ? 19.760  35.951 -4.953  1.00 8.68  ? 323 SER B CA   1 
ATOM   7252 C C    . SER B 1 323 ? 18.555  35.216 -4.341  1.00 11.63 ? 323 SER B C    1 
ATOM   7253 O O    . SER B 1 323 ? 17.567  35.807 -3.834  1.00 9.53  ? 323 SER B O    1 
ATOM   7254 C CB   . SER B 1 323 ? 19.639  37.493 -4.838  1.00 5.01  ? 323 SER B CB   1 
ATOM   7255 O OG   . SER B 1 323 ? 18.517  37.950 -5.534  1.00 5.01  ? 323 SER B OG   1 
ATOM   7256 H H    . SER B 1 323 ? 20.668  35.310 -6.749  1.00 0.00  ? 323 SER B H    1 
ATOM   7257 H HG   . SER B 1 323 ? 17.843  37.233 -5.562  1.00 0.00  ? 323 SER B HG   1 
ATOM   7258 N N    . LEU B 1 324 ? 18.592  33.908 -4.563  1.00 10.68 ? 324 LEU B N    1 
ATOM   7259 C CA   . LEU B 1 324 ? 17.550  33.020 -4.088  1.00 10.49 ? 324 LEU B CA   1 
ATOM   7260 C C    . LEU B 1 324 ? 17.198  33.101 -2.625  1.00 9.75  ? 324 LEU B C    1 
ATOM   7261 O O    . LEU B 1 324 ? 18.046  33.154 -1.768  1.00 7.84  ? 324 LEU B O    1 
ATOM   7262 C CB   . LEU B 1 324 ? 17.887  31.590 -4.472  1.00 12.45 ? 324 LEU B CB   1 
ATOM   7263 C CG   . LEU B 1 324 ? 16.927  31.188 -5.591  1.00 13.17 ? 324 LEU B CG   1 
ATOM   7264 C CD1  . LEU B 1 324 ? 16.958  29.670 -5.740  1.00 15.47 ? 324 LEU B CD1  1 
ATOM   7265 C CD2  . LEU B 1 324 ? 15.504  31.635 -5.222  1.00 18.18 ? 324 LEU B CD2  1 
ATOM   7266 H H    . LEU B 1 324 ? 19.373  33.561 -5.041  1.00 0.00  ? 324 LEU B H    1 
ATOM   7267 N N    . SER B 1 325 ? 15.922  33.174 -2.341  1.00 10.53 ? 325 SER B N    1 
ATOM   7268 C CA   . SER B 1 325 ? 15.488  33.198 -0.954  1.00 9.16  ? 325 SER B CA   1 
ATOM   7269 C C    . SER B 1 325 ? 15.224  31.762 -0.361  1.00 11.24 ? 325 SER B C    1 
ATOM   7270 O O    . SER B 1 325 ? 15.757  31.401 0.712   1.00 10.84 ? 325 SER B O    1 
ATOM   7271 C CB   . SER B 1 325 ? 14.244  34.080 -0.841  1.00 8.30  ? 325 SER B CB   1 
ATOM   7272 O OG   . SER B 1 325 ? 14.615  35.457 -0.943  1.00 7.70  ? 325 SER B OG   1 
ATOM   7273 H H    . SER B 1 325 ? 15.220  33.194 -3.032  1.00 0.00  ? 325 SER B H    1 
ATOM   7274 H HG   . SER B 1 325 ? 14.784  35.790 -0.045  1.00 0.00  ? 325 SER B HG   1 
ATOM   7275 N N    . GLY B 1 326 ? 14.396  30.984 -1.067  1.00 12.07 ? 326 GLY B N    1 
ATOM   7276 C CA   . GLY B 1 326 ? 14.047  29.655 -0.633  1.00 12.36 ? 326 GLY B CA   1 
ATOM   7277 C C    . GLY B 1 326 ? 13.819  28.706 -1.796  1.00 13.37 ? 326 GLY B C    1 
ATOM   7278 O O    . GLY B 1 326 ? 13.860  29.133 -2.945  1.00 11.94 ? 326 GLY B O    1 
ATOM   7279 H H    . GLY B 1 326 ? 14.036  31.310 -1.919  1.00 0.00  ? 326 GLY B H    1 
ATOM   7280 N N    . PHE B 1 327 ? 13.660  27.411 -1.485  1.00 14.81 ? 327 PHE B N    1 
ATOM   7281 C CA   . PHE B 1 327 ? 13.398  26.363 -2.483  1.00 13.77 ? 327 PHE B CA   1 
ATOM   7282 C C    . PHE B 1 327 ? 12.040  25.739 -2.309  1.00 13.71 ? 327 PHE B C    1 
ATOM   7283 O O    . PHE B 1 327 ? 11.535  25.571 -1.205  1.00 15.17 ? 327 PHE B O    1 
ATOM   7284 C CB   . PHE B 1 327 ? 14.370  25.182 -2.383  1.00 12.03 ? 327 PHE B CB   1 
ATOM   7285 C CG   . PHE B 1 327 ? 15.682  25.394 -3.054  1.00 13.96 ? 327 PHE B CG   1 
ATOM   7286 C CD1  . PHE B 1 327 ? 15.759  25.969 -4.325  1.00 14.93 ? 327 PHE B CD1  1 
ATOM   7287 C CD2  . PHE B 1 327 ? 16.865  25.058 -2.394  1.00 12.55 ? 327 PHE B CD2  1 
ATOM   7288 C CE1  . PHE B 1 327 ? 17.012  26.220 -4.933  1.00 7.63  ? 327 PHE B CE1  1 
ATOM   7289 C CE2  . PHE B 1 327 ? 18.088  25.302 -2.983  1.00 8.48  ? 327 PHE B CE2  1 
ATOM   7290 C CZ   . PHE B 1 327 ? 18.162  25.886 -4.251  1.00 11.11 ? 327 PHE B CZ   1 
ATOM   7291 H H    . PHE B 1 327 ? 13.793  27.177 -0.539  1.00 0.00  ? 327 PHE B H    1 
ATOM   7292 N N    . CYS B 1 328 ? 11.493  25.346 -3.435  1.00 13.00 ? 328 CYS B N    1 
ATOM   7293 C CA   . CYS B 1 328 ? 10.277  24.616 -3.508  1.00 12.88 ? 328 CYS B CA   1 
ATOM   7294 C C    . CYS B 1 328 ? 10.766  23.302 -4.174  1.00 12.77 ? 328 CYS B C    1 
ATOM   7295 O O    . CYS B 1 328 ? 11.083  23.266 -5.381  1.00 13.56 ? 328 CYS B O    1 
ATOM   7296 C CB   . CYS B 1 328 ? 9.274   25.305 -4.432  1.00 16.61 ? 328 CYS B CB   1 
ATOM   7297 S SG   . CYS B 1 328 ? 7.673   24.415 -4.506  1.00 15.88 ? 328 CYS B SG   1 
ATOM   7298 H H    . CYS B 1 328 ? 11.949  25.594 -4.275  1.00 0.00  ? 328 CYS B H    1 
ATOM   7299 N N    . LEU B 1 329 ? 10.937  22.261 -3.360  1.00 11.32 ? 329 LEU B N    1 
ATOM   7300 C CA   . LEU B 1 329 ? 11.357  20.956 -3.865  1.00 9.31  ? 329 LEU B CA   1 
ATOM   7301 C C    . LEU B 1 329 ? 10.217  20.181 -4.590  1.00 6.84  ? 329 LEU B C    1 
ATOM   7302 O O    . LEU B 1 329 ? 9.128   20.005 -4.029  1.00 7.45  ? 329 LEU B O    1 
ATOM   7303 C CB   . LEU B 1 329 ? 11.839  20.134 -2.668  1.00 8.95  ? 329 LEU B CB   1 
ATOM   7304 C CG   . LEU B 1 329 ? 12.485  18.765 -2.848  1.00 5.01  ? 329 LEU B CG   1 
ATOM   7305 C CD1  . LEU B 1 329 ? 13.707  18.875 -3.786  1.00 9.28  ? 329 LEU B CD1  1 
ATOM   7306 C CD2  . LEU B 1 329 ? 12.888  18.282 -1.496  1.00 10.65 ? 329 LEU B CD2  1 
ATOM   7307 H H    . LEU B 1 329 ? 10.674  22.378 -2.419  1.00 0.00  ? 329 LEU B H    1 
ATOM   7308 N N    . THR B 1 330 ? 10.451  19.711 -5.808  1.00 6.62  ? 330 THR B N    1 
ATOM   7309 C CA   . THR B 1 330 ? 9.423   18.917 -6.517  1.00 11.78 ? 330 THR B CA   1 
ATOM   7310 C C    . THR B 1 330 ? 9.921   17.484 -6.888  1.00 11.19 ? 330 THR B C    1 
ATOM   7311 O O    . THR B 1 330 ? 11.128  17.215 -6.936  1.00 14.36 ? 330 THR B O    1 
ATOM   7312 C CB   . THR B 1 330 ? 8.933   19.563 -7.858  1.00 8.89  ? 330 THR B CB   1 
ATOM   7313 O OG1  . THR B 1 330 ? 10.069  19.768 -8.698  1.00 13.69 ? 330 THR B OG1  1 
ATOM   7314 C CG2  . THR B 1 330 ? 8.267   20.891 -7.645  1.00 8.01  ? 330 THR B CG2  1 
ATOM   7315 H H    . THR B 1 330 ? 11.303  19.938 -6.261  1.00 0.00  ? 330 THR B H    1 
ATOM   7316 H HG1  . THR B 1 330 ? 9.873   20.357 -9.464  1.00 0.00  ? 330 THR B HG1  1 
ATOM   7317 N N    . LYS B 1 331 ? 8.959   16.635 -7.255  1.00 11.03 ? 331 LYS B N    1 
ATOM   7318 C CA   . LYS B 1 331 ? 9.142   15.254 -7.682  1.00 13.74 ? 331 LYS B CA   1 
ATOM   7319 C C    . LYS B 1 331 ? 10.103  14.372 -6.895  1.00 14.87 ? 331 LYS B C    1 
ATOM   7320 O O    . LYS B 1 331 ? 10.876  13.649 -7.531  1.00 14.03 ? 331 LYS B O    1 
ATOM   7321 C CB   . LYS B 1 331 ? 9.489   15.188 -9.178  1.00 12.43 ? 331 LYS B CB   1 
ATOM   7322 C CG   . LYS B 1 331 ? 8.407   15.782 -10.105 1.00 12.47 ? 331 LYS B CG   1 
ATOM   7323 C CD   . LYS B 1 331 ? 8.192   14.913 -11.372 1.00 20.95 ? 331 LYS B CD   1 
ATOM   7324 C CE   . LYS B 1 331 ? 7.251   15.584 -12.398 1.00 20.08 ? 331 LYS B CE   1 
ATOM   7325 N NZ   . LYS B 1 331 ? 7.474   15.185 -13.832 1.00 21.18 ? 331 LYS B NZ   1 
ATOM   7326 H H    . LYS B 1 331 ? 8.041   16.958 -7.197  1.00 0.00  ? 331 LYS B H    1 
ATOM   7327 H HZ1  . LYS B 1 331 ? 8.446   15.352 -14.174 1.00 0.00  ? 331 LYS B HZ1  1 
ATOM   7328 H HZ2  . LYS B 1 331 ? 7.335   14.171 -14.035 1.00 0.00  ? 331 LYS B HZ2  1 
ATOM   7329 H HZ3  . LYS B 1 331 ? 6.856   15.729 -14.465 1.00 0.00  ? 331 LYS B HZ3  1 
ATOM   7330 N N    . LEU B 1 332 ? 10.003  14.376 -5.556  1.00 13.56 ? 332 LEU B N    1 
ATOM   7331 C CA   . LEU B 1 332 ? 10.909  13.592 -4.681  1.00 15.56 ? 332 LEU B CA   1 
ATOM   7332 C C    . LEU B 1 332 ? 10.602  12.092 -4.769  1.00 15.69 ? 332 LEU B C    1 
ATOM   7333 O O    . LEU B 1 332 ? 11.455  11.291 -5.128  1.00 18.67 ? 332 LEU B O    1 
ATOM   7334 C CB   . LEU B 1 332 ? 10.847  14.058 -3.206  1.00 14.79 ? 332 LEU B CB   1 
ATOM   7335 C CG   . LEU B 1 332 ? 11.786  13.366 -2.200  1.00 8.81  ? 332 LEU B CG   1 
ATOM   7336 C CD1  . LEU B 1 332 ? 13.162  13.965 -2.177  1.00 7.95  ? 332 LEU B CD1  1 
ATOM   7337 C CD2  . LEU B 1 332 ? 11.202  13.493 -0.817  1.00 15.75 ? 332 LEU B CD2  1 
ATOM   7338 H H    . LEU B 1 332 ? 9.297   14.919 -5.145  1.00 0.00  ? 332 LEU B H    1 
ATOM   7339 N N    . ASP B 1 333 ? 9.329   11.780 -4.572  1.00 16.59 ? 333 ASP B N    1 
ATOM   7340 C CA   . ASP B 1 333 ? 8.763   10.441 -4.657  1.00 18.33 ? 333 ASP B CA   1 
ATOM   7341 C C    . ASP B 1 333 ? 9.173   9.773  -5.949  1.00 17.66 ? 333 ASP B C    1 
ATOM   7342 O O    . ASP B 1 333 ? 8.807   8.649  -6.186  1.00 20.91 ? 333 ASP B O    1 
ATOM   7343 C CB   . ASP B 1 333 ? 7.251   10.528 -4.634  1.00 16.26 ? 333 ASP B CB   1 
ATOM   7344 C CG   . ASP B 1 333 ? 6.749   11.559 -5.594  1.00 21.09 ? 333 ASP B CG   1 
ATOM   7345 O OD1  . ASP B 1 333 ? 7.196   12.742 -5.500  1.00 21.07 ? 333 ASP B OD1  1 
ATOM   7346 O OD2  . ASP B 1 333 ? 5.963   11.189 -6.476  1.00 19.25 ? 333 ASP B OD2  1 
ATOM   7347 H H    . ASP B 1 333 ? 8.691   12.503 -4.389  1.00 0.00  ? 333 ASP B H    1 
ATOM   7348 N N    . VAL B 1 334 ? 9.847   10.485 -6.840  1.00 19.11 ? 334 VAL B N    1 
ATOM   7349 C CA   . VAL B 1 334 ? 10.318  9.861  -8.065  1.00 14.71 ? 334 VAL B CA   1 
ATOM   7350 C C    . VAL B 1 334 ? 11.500  8.990  -7.687  1.00 15.03 ? 334 VAL B C    1 
ATOM   7351 O O    . VAL B 1 334 ? 11.813  8.041  -8.383  1.00 15.60 ? 334 VAL B O    1 
ATOM   7352 C CB   . VAL B 1 334 ? 10.736  10.894 -9.099  1.00 11.93 ? 334 VAL B CB   1 
ATOM   7353 C CG1  . VAL B 1 334 ? 11.850  10.333 -10.029 1.00 6.70  ? 334 VAL B CG1  1 
ATOM   7354 C CG2  . VAL B 1 334 ? 9.553   11.267 -9.885  1.00 10.64 ? 334 VAL B CG2  1 
ATOM   7355 H H    . VAL B 1 334 ? 10.000  11.442 -6.759  1.00 0.00  ? 334 VAL B H    1 
ATOM   7356 N N    . LEU B 1 335 ? 12.165  9.338  -6.593  1.00 15.76 ? 335 LEU B N    1 
ATOM   7357 C CA   . LEU B 1 335 ? 13.311  8.569  -6.132  1.00 19.33 ? 335 LEU B CA   1 
ATOM   7358 C C    . LEU B 1 335 ? 12.900  7.361  -5.264  1.00 18.22 ? 335 LEU B C    1 
ATOM   7359 O O    . LEU B 1 335 ? 13.712  6.469  -5.008  1.00 18.66 ? 335 LEU B O    1 
ATOM   7360 C CB   . LEU B 1 335 ? 14.314  9.482  -5.406  1.00 22.58 ? 335 LEU B CB   1 
ATOM   7361 C CG   . LEU B 1 335 ? 14.764  10.698 -6.229  1.00 21.83 ? 335 LEU B CG   1 
ATOM   7362 C CD1  . LEU B 1 335 ? 15.882  11.492 -5.544  1.00 18.41 ? 335 LEU B CD1  1 
ATOM   7363 C CD2  . LEU B 1 335 ? 15.213  10.218 -7.599  1.00 26.17 ? 335 LEU B CD2  1 
ATOM   7364 H H    . LEU B 1 335 ? 11.887  10.131 -6.063  1.00 0.00  ? 335 LEU B H    1 
ATOM   7365 N N    . ASP B 1 336 ? 11.648  7.359  -4.799  1.00 18.66 ? 336 ASP B N    1 
ATOM   7366 C CA   . ASP B 1 336 ? 11.083  6.254  -4.020  1.00 19.18 ? 336 ASP B CA   1 
ATOM   7367 C C    . ASP B 1 336 ? 11.409  4.945  -4.733  1.00 19.69 ? 336 ASP B C    1 
ATOM   7368 O O    . ASP B 1 336 ? 11.015  4.760  -5.893  1.00 17.18 ? 336 ASP B O    1 
ATOM   7369 C CB   . ASP B 1 336 ? 9.553   6.325  -4.014  1.00 19.41 ? 336 ASP B CB   1 
ATOM   7370 C CG   . ASP B 1 336 ? 9.010   7.468  -3.199  1.00 20.61 ? 336 ASP B CG   1 
ATOM   7371 O OD1  . ASP B 1 336 ? 9.822   8.249  -2.662  1.00 22.32 ? 336 ASP B OD1  1 
ATOM   7372 O OD2  . ASP B 1 336 ? 7.759   7.586  -3.084  1.00 22.95 ? 336 ASP B OD2  1 
ATOM   7373 H H    . ASP B 1 336 ? 11.060  8.114  -4.978  1.00 0.00  ? 336 ASP B H    1 
ATOM   7374 N N    . GLY B 1 337 ? 12.071  4.038  -4.015  1.00 20.75 ? 337 GLY B N    1 
ATOM   7375 C CA   . GLY B 1 337 ? 12.419  2.740  -4.553  1.00 22.21 ? 337 GLY B CA   1 
ATOM   7376 C C    . GLY B 1 337 ? 13.884  2.491  -4.848  1.00 24.83 ? 337 GLY B C    1 
ATOM   7377 O O    . GLY B 1 337 ? 14.244  1.356  -5.111  1.00 25.16 ? 337 GLY B O    1 
ATOM   7378 H H    . GLY B 1 337 ? 12.320  4.249  -3.085  1.00 0.00  ? 337 GLY B H    1 
ATOM   7379 N N    . LEU B 1 338 ? 14.726  3.535  -4.810  1.00 24.71 ? 338 LEU B N    1 
ATOM   7380 C CA   . LEU B 1 338 ? 16.154  3.383  -5.093  1.00 20.42 ? 338 LEU B CA   1 
ATOM   7381 C C    . LEU B 1 338 ? 17.005  2.883  -3.910  1.00 21.13 ? 338 LEU B C    1 
ATOM   7382 O O    . LEU B 1 338 ? 16.780  3.268  -2.753  1.00 22.52 ? 338 LEU B O    1 
ATOM   7383 C CB   . LEU B 1 338 ? 16.707  4.684  -5.672  1.00 17.71 ? 338 LEU B CB   1 
ATOM   7384 C CG   . LEU B 1 338 ? 16.194  5.311  -6.984  1.00 15.06 ? 338 LEU B CG   1 
ATOM   7385 C CD1  . LEU B 1 338 ? 17.234  6.402  -7.449  1.00 14.60 ? 338 LEU B CD1  1 
ATOM   7386 C CD2  . LEU B 1 338 ? 16.019  4.301  -8.109  1.00 15.20 ? 338 LEU B CD2  1 
ATOM   7387 H H    . LEU B 1 338 ? 14.362  4.431  -4.649  1.00 0.00  ? 338 LEU B H    1 
ATOM   7388 N N    . LYS B 1 339 ? 17.979  2.019  -4.189  1.00 20.98 ? 339 LYS B N    1 
ATOM   7389 C CA   . LYS B 1 339 ? 18.826  1.475  -3.118  1.00 21.86 ? 339 LYS B CA   1 
ATOM   7390 C C    . LYS B 1 339 ? 19.744  2.583  -2.572  1.00 22.75 ? 339 LYS B C    1 
ATOM   7391 O O    . LYS B 1 339 ? 19.961  2.723  -1.361  1.00 15.02 ? 339 LYS B O    1 
ATOM   7392 C CB   . LYS B 1 339 ? 19.664  0.284  -3.642  1.00 23.04 ? 339 LYS B CB   1 
ATOM   7393 C CG   . LYS B 1 339 ? 20.688  -0.277 -2.639  1.00 23.45 ? 339 LYS B CG   1 
ATOM   7394 C CD   . LYS B 1 339 ? 21.662  -1.263 -3.328  1.00 28.60 ? 339 LYS B CD   1 
ATOM   7395 C CE   . LYS B 1 339 ? 22.774  -1.813 -2.396  1.00 29.66 ? 339 LYS B CE   1 
ATOM   7396 N NZ   . LYS B 1 339 ? 23.750  -0.765 -1.877  1.00 28.63 ? 339 LYS B NZ   1 
ATOM   7397 H H    . LYS B 1 339 ? 18.130  1.754  -5.118  1.00 0.00  ? 339 LYS B H    1 
ATOM   7398 H HZ1  . LYS B 1 339 ? 24.077  -0.143 -2.667  1.00 0.00  ? 339 LYS B HZ1  1 
ATOM   7399 H HZ2  . LYS B 1 339 ? 23.267  -0.105 -1.234  1.00 0.00  ? 339 LYS B HZ2  1 
ATOM   7400 H HZ3  . LYS B 1 339 ? 24.571  -1.182 -1.398  1.00 0.00  ? 339 LYS B HZ3  1 
ATOM   7401 N N    . GLU B 1 340 ? 20.335  3.305  -3.527  1.00 24.87 ? 340 GLU B N    1 
ATOM   7402 C CA   . GLU B 1 340 ? 21.219  4.435  -3.273  1.00 22.52 ? 340 GLU B CA   1 
ATOM   7403 C C    . GLU B 1 340 ? 20.754  5.623  -4.123  1.00 19.57 ? 340 GLU B C    1 
ATOM   7404 O O    . GLU B 1 340 ? 20.130  5.452  -5.193  1.00 14.55 ? 340 GLU B O    1 
ATOM   7405 C CB   . GLU B 1 340 ? 22.660  4.105  -3.606  1.00 26.57 ? 340 GLU B CB   1 
ATOM   7406 C CG   . GLU B 1 340 ? 23.358  3.389  -2.515  1.00 32.43 ? 340 GLU B CG   1 
ATOM   7407 C CD   . GLU B 1 340 ? 24.355  2.442  -3.096  1.00 34.30 ? 340 GLU B CD   1 
ATOM   7408 O OE1  . GLU B 1 340 ? 25.492  2.883  -3.361  1.00 34.17 ? 340 GLU B OE1  1 
ATOM   7409 O OE2  . GLU B 1 340 ? 23.971  1.264  -3.341  1.00 38.09 ? 340 GLU B OE2  1 
ATOM   7410 H H    . GLU B 1 340 ? 20.168  3.101  -4.469  1.00 0.00  ? 340 GLU B H    1 
ATOM   7411 N N    . VAL B 1 341 ? 21.163  6.802  -3.651  1.00 16.95 ? 341 VAL B N    1 
ATOM   7412 C CA   . VAL B 1 341 ? 20.820  8.079  -4.212  1.00 14.85 ? 341 VAL B CA   1 
ATOM   7413 C C    . VAL B 1 341 ? 22.071  8.963  -4.088  1.00 16.39 ? 341 VAL B C    1 
ATOM   7414 O O    . VAL B 1 341 ? 22.764  8.938  -3.066  1.00 16.31 ? 341 VAL B O    1 
ATOM   7415 C CB   . VAL B 1 341 ? 19.581  8.606  -3.413  1.00 15.34 ? 341 VAL B CB   1 
ATOM   7416 C CG1  . VAL B 1 341 ? 19.542  10.087 -3.327  1.00 15.33 ? 341 VAL B CG1  1 
ATOM   7417 C CG2  . VAL B 1 341 ? 18.275  8.109  -4.083  1.00 17.36 ? 341 VAL B CG2  1 
ATOM   7418 H H    . VAL B 1 341 ? 21.688  6.802  -2.812  1.00 0.00  ? 341 VAL B H    1 
ATOM   7419 N N    . LYS B 1 342 ? 22.376  9.717  -5.144  1.00 17.28 ? 342 LYS B N    1 
ATOM   7420 C CA   . LYS B 1 342 ? 23.552  10.597 -5.175  1.00 19.06 ? 342 LYS B CA   1 
ATOM   7421 C C    . LYS B 1 342 ? 23.250  12.081 -5.370  1.00 19.86 ? 342 LYS B C    1 
ATOM   7422 O O    . LYS B 1 342 ? 22.163  12.468 -5.831  1.00 19.61 ? 342 LYS B O    1 
ATOM   7423 C CB   . LYS B 1 342 ? 24.486  10.169 -6.291  1.00 19.83 ? 342 LYS B CB   1 
ATOM   7424 C CG   . LYS B 1 342 ? 24.689  8.656  -6.433  1.00 20.70 ? 342 LYS B CG   1 
ATOM   7425 C CD   . LYS B 1 342 ? 25.243  8.380  -7.823  1.00 24.71 ? 342 LYS B CD   1 
ATOM   7426 C CE   . LYS B 1 342 ? 25.757  6.970  -7.989  1.00 28.24 ? 342 LYS B CE   1 
ATOM   7427 N NZ   . LYS B 1 342 ? 26.141  6.774  -9.411  1.00 30.98 ? 342 LYS B NZ   1 
ATOM   7428 H H    . LYS B 1 342 ? 21.775  9.739  -5.915  1.00 0.00  ? 342 LYS B H    1 
ATOM   7429 H HZ1  . LYS B 1 342 ? 26.870  7.454  -9.695  1.00 0.00  ? 342 LYS B HZ1  1 
ATOM   7430 H HZ2  . LYS B 1 342 ? 26.468  5.802  -9.571  1.00 0.00  ? 342 LYS B HZ2  1 
ATOM   7431 H HZ3  . LYS B 1 342 ? 25.293  6.929  -9.978  1.00 0.00  ? 342 LYS B HZ3  1 
ATOM   7432 N N    . LEU B 1 343 ? 24.254  12.891 -5.039  1.00 21.10 ? 343 LEU B N    1 
ATOM   7433 C CA   . LEU B 1 343 ? 24.235  14.359 -5.128  1.00 21.94 ? 343 LEU B CA   1 
ATOM   7434 C C    . LEU B 1 343 ? 25.625  14.796 -5.605  1.00 21.65 ? 343 LEU B C    1 
ATOM   7435 O O    . LEU B 1 343 ? 26.634  14.446 -4.984  1.00 22.12 ? 343 LEU B O    1 
ATOM   7436 C CB   . LEU B 1 343 ? 24.008  14.973 -3.735  1.00 26.30 ? 343 LEU B CB   1 
ATOM   7437 C CG   . LEU B 1 343 ? 22.605  15.012 -3.098  1.00 29.12 ? 343 LEU B CG   1 
ATOM   7438 C CD1  . LEU B 1 343 ? 22.688  15.424 -1.620  1.00 27.49 ? 343 LEU B CD1  1 
ATOM   7439 C CD2  . LEU B 1 343 ? 21.707  15.960 -3.876  1.00 26.60 ? 343 LEU B CD2  1 
ATOM   7440 H H    . LEU B 1 343 ? 25.051  12.468 -4.649  1.00 0.00  ? 343 LEU B H    1 
ATOM   7441 N N    . CYS B 1 344 ? 25.684  15.522 -6.718  1.00 20.03 ? 344 CYS B N    1 
ATOM   7442 C CA   . CYS B 1 344 ? 26.955  16.009 -7.268  1.00 17.49 ? 344 CYS B CA   1 
ATOM   7443 C C    . CYS B 1 344 ? 27.370  17.144 -6.372  1.00 16.17 ? 344 CYS B C    1 
ATOM   7444 O O    . CYS B 1 344 ? 26.700  18.179 -6.313  1.00 15.79 ? 344 CYS B O    1 
ATOM   7445 C CB   . CYS B 1 344 ? 26.772  16.510 -8.692  1.00 15.22 ? 344 CYS B CB   1 
ATOM   7446 S SG   . CYS B 1 344 ? 28.259  17.170 -9.445  1.00 21.46 ? 344 CYS B SG   1 
ATOM   7447 H H    . CYS B 1 344 ? 24.844  15.770 -7.169  1.00 0.00  ? 344 CYS B H    1 
ATOM   7448 N N    . VAL B 1 345 ? 28.426  16.931 -5.617  1.00 13.05 ? 345 VAL B N    1 
ATOM   7449 C CA   . VAL B 1 345 ? 28.879  17.937 -4.712  1.00 14.84 ? 345 VAL B CA   1 
ATOM   7450 C C    . VAL B 1 345 ? 30.050  18.763 -5.257  1.00 14.56 ? 345 VAL B C    1 
ATOM   7451 O O    . VAL B 1 345 ? 30.479  19.705 -4.600  1.00 14.35 ? 345 VAL B O    1 
ATOM   7452 C CB   . VAL B 1 345 ? 29.256  17.323 -3.348  1.00 13.03 ? 345 VAL B CB   1 
ATOM   7453 C CG1  . VAL B 1 345 ? 28.022  16.735 -2.676  1.00 12.07 ? 345 VAL B CG1  1 
ATOM   7454 C CG2  . VAL B 1 345 ? 30.297  16.218 -3.543  1.00 15.38 ? 345 VAL B CG2  1 
ATOM   7455 H H    . VAL B 1 345 ? 28.940  16.096 -5.675  1.00 0.00  ? 345 VAL B H    1 
ATOM   7456 N N    . ALA B 1 346 ? 30.458  18.499 -6.500  1.00 14.98 ? 346 ALA B N    1 
ATOM   7457 C CA   . ALA B 1 346 ? 31.605  19.172 -7.075  1.00 13.13 ? 346 ALA B CA   1 
ATOM   7458 C C    . ALA B 1 346 ? 31.984  18.631 -8.443  1.00 14.96 ? 346 ALA B C    1 
ATOM   7459 O O    . ALA B 1 346 ? 31.541  17.548 -8.853  1.00 12.89 ? 346 ALA B O    1 
ATOM   7460 C CB   . ALA B 1 346 ? 32.767  18.989 -6.172  1.00 12.29 ? 346 ALA B CB   1 
ATOM   7461 H H    . ALA B 1 346 ? 29.992  17.843 -7.058  1.00 0.00  ? 346 ALA B H    1 
ATOM   7462 N N    . TYR B 1 347 ? 32.839  19.401 -9.128  1.00 16.37 ? 347 TYR B N    1 
ATOM   7463 C CA   . TYR B 1 347 ? 33.376  19.079 -10.434 1.00 15.26 ? 347 TYR B CA   1 
ATOM   7464 C C    . TYR B 1 347 ? 34.908  18.933 -10.290 1.00 15.43 ? 347 TYR B C    1 
ATOM   7465 O O    . TYR B 1 347 ? 35.554  19.730 -9.598  1.00 11.94 ? 347 TYR B O    1 
ATOM   7466 C CB   . TYR B 1 347 ? 33.116  20.224 -11.405 1.00 15.39 ? 347 TYR B CB   1 
ATOM   7467 C CG   . TYR B 1 347 ? 31.686  20.464 -11.850 1.00 18.93 ? 347 TYR B CG   1 
ATOM   7468 C CD1  . TYR B 1 347 ? 30.610  19.680 -11.391 1.00 14.19 ? 347 TYR B CD1  1 
ATOM   7469 C CD2  . TYR B 1 347 ? 31.399  21.546 -12.705 1.00 18.33 ? 347 TYR B CD2  1 
ATOM   7470 C CE1  . TYR B 1 347 ? 29.280  20.000 -11.767 1.00 16.61 ? 347 TYR B CE1  1 
ATOM   7471 C CE2  . TYR B 1 347 ? 30.105  21.847 -13.090 1.00 15.14 ? 347 TYR B CE2  1 
ATOM   7472 C CZ   . TYR B 1 347 ? 29.056  21.084 -12.631 1.00 13.76 ? 347 TYR B CZ   1 
ATOM   7473 O OH   . TYR B 1 347 ? 27.830  21.364 -13.166 1.00 15.18 ? 347 TYR B OH   1 
ATOM   7474 H H    . TYR B 1 347 ? 33.128  20.251 -8.727  1.00 0.00  ? 347 TYR B H    1 
ATOM   7475 H HH   . TYR B 1 347 ? 27.109  20.854 -12.740 1.00 0.00  ? 347 TYR B HH   1 
ATOM   7476 N N    . ARG B 1 348 ? 35.466  17.915 -10.941 1.00 16.85 ? 348 ARG B N    1 
ATOM   7477 C CA   . ARG B 1 348 ? 36.890  17.649 -10.963 1.00 19.92 ? 348 ARG B CA   1 
ATOM   7478 C C    . ARG B 1 348 ? 37.318  18.003 -12.389 1.00 23.37 ? 348 ARG B C    1 
ATOM   7479 O O    . ARG B 1 348 ? 36.752  17.484 -13.356 1.00 22.53 ? 348 ARG B O    1 
ATOM   7480 C CB   . ARG B 1 348 ? 37.159  16.164 -10.736 1.00 20.36 ? 348 ARG B CB   1 
ATOM   7481 C CG   . ARG B 1 348 ? 38.637  15.865 -10.435 1.00 23.72 ? 348 ARG B CG   1 
ATOM   7482 C CD   . ARG B 1 348 ? 39.036  14.413 -10.659 1.00 23.03 ? 348 ARG B CD   1 
ATOM   7483 N NE   . ARG B 1 348 ? 38.612  13.490 -9.602  1.00 25.88 ? 348 ARG B NE   1 
ATOM   7484 C CZ   . ARG B 1 348 ? 37.587  12.632 -9.707  1.00 28.94 ? 348 ARG B CZ   1 
ATOM   7485 N NH1  . ARG B 1 348 ? 36.838  12.605 -10.821 1.00 29.08 ? 348 ARG B NH1  1 
ATOM   7486 N NH2  . ARG B 1 348 ? 37.417  11.681 -8.772  1.00 23.92 ? 348 ARG B NH2  1 
ATOM   7487 H H    . ARG B 1 348 ? 34.865  17.278 -11.388 1.00 0.00  ? 348 ARG B H    1 
ATOM   7488 H HE   . ARG B 1 348 ? 39.122  13.485 -8.747  1.00 0.00  ? 348 ARG B HE   1 
ATOM   7489 H HH11 . ARG B 1 348 ? 37.042  13.212 -11.595 1.00 0.00  ? 348 ARG B HH11 1 
ATOM   7490 H HH12 . ARG B 1 348 ? 36.061  11.981 -10.926 1.00 0.00  ? 348 ARG B HH12 1 
ATOM   7491 H HH21 . ARG B 1 348 ? 38.117  11.662 -8.028  1.00 0.00  ? 348 ARG B HH21 1 
ATOM   7492 H HH22 . ARG B 1 348 ? 36.679  11.011 -8.772  1.00 0.00  ? 348 ARG B HH22 1 
ATOM   7493 N N    . MET B 1 349 ? 38.295  18.882 -12.531 1.00 24.99 ? 349 MET B N    1 
ATOM   7494 C CA   . MET B 1 349 ? 38.734  19.294 -13.849 1.00 27.79 ? 349 MET B CA   1 
ATOM   7495 C C    . MET B 1 349 ? 39.977  18.517 -14.329 1.00 28.69 ? 349 MET B C    1 
ATOM   7496 O O    . MET B 1 349 ? 40.719  17.953 -13.523 1.00 27.03 ? 349 MET B O    1 
ATOM   7497 C CB   . MET B 1 349 ? 39.036  20.801 -13.828 1.00 30.92 ? 349 MET B CB   1 
ATOM   7498 C CG   . MET B 1 349 ? 37.874  21.707 -13.443 1.00 33.44 ? 349 MET B CG   1 
ATOM   7499 S SD   . MET B 1 349 ? 36.591  21.735 -14.692 1.00 41.26 ? 349 MET B SD   1 
ATOM   7500 C CE   . MET B 1 349 ? 35.101  21.956 -13.715 1.00 35.65 ? 349 MET B CE   1 
ATOM   7501 H H    . MET B 1 349 ? 38.682  19.299 -11.719 1.00 0.00  ? 349 MET B H    1 
ATOM   7502 N N    . PRO B 1 350 ? 40.241  18.521 -15.656 1.00 29.86 ? 350 PRO B N    1 
ATOM   7503 C CA   . PRO B 1 350 ? 41.383  17.841 -16.275 1.00 28.97 ? 350 PRO B CA   1 
ATOM   7504 C C    . PRO B 1 350 ? 42.683  17.917 -15.470 1.00 28.22 ? 350 PRO B C    1 
ATOM   7505 O O    . PRO B 1 350 ? 43.305  16.886 -15.191 1.00 27.15 ? 350 PRO B O    1 
ATOM   7506 C CB   . PRO B 1 350 ? 41.497  18.565 -17.600 1.00 31.28 ? 350 PRO B CB   1 
ATOM   7507 C CG   . PRO B 1 350 ? 40.069  18.705 -17.967 1.00 29.50 ? 350 PRO B CG   1 
ATOM   7508 C CD   . PRO B 1 350 ? 39.456  19.224 -16.688 1.00 28.04 ? 350 PRO B CD   1 
ATOM   7509 N N    . ASP B 1 351 ? 43.082  19.127 -15.082 1.00 28.62 ? 351 ASP B N    1 
ATOM   7510 C CA   . ASP B 1 351 ? 44.292  19.316 -14.268 1.00 27.40 ? 351 ASP B CA   1 
ATOM   7511 C C    . ASP B 1 351 ? 44.218  18.678 -12.868 1.00 28.06 ? 351 ASP B C    1 
ATOM   7512 O O    . ASP B 1 351 ? 45.227  18.632 -12.168 1.00 31.23 ? 351 ASP B O    1 
ATOM   7513 C CB   . ASP B 1 351 ? 44.596  20.804 -14.110 1.00 26.63 ? 351 ASP B CB   1 
ATOM   7514 C CG   . ASP B 1 351 ? 43.419  21.581 -13.559 1.00 30.21 ? 351 ASP B CG   1 
ATOM   7515 O OD1  . ASP B 1 351 ? 43.247  21.621 -12.324 1.00 31.70 ? 351 ASP B OD1  1 
ATOM   7516 O OD2  . ASP B 1 351 ? 42.656  22.151 -14.363 1.00 31.59 ? 351 ASP B OD2  1 
ATOM   7517 H H    . ASP B 1 351 ? 42.558  19.920 -15.322 1.00 0.00  ? 351 ASP B H    1 
ATOM   7518 N N    . GLY B 1 352 ? 43.044  18.216 -12.443 1.00 26.31 ? 352 GLY B N    1 
ATOM   7519 C CA   . GLY B 1 352 ? 42.924  17.602 -11.131 1.00 23.55 ? 352 GLY B CA   1 
ATOM   7520 C C    . GLY B 1 352 ? 42.276  18.439 -10.031 1.00 23.25 ? 352 GLY B C    1 
ATOM   7521 O O    . GLY B 1 352 ? 42.151  17.995 -8.881  1.00 22.47 ? 352 GLY B O    1 
ATOM   7522 H H    . GLY B 1 352 ? 42.225  18.230 -12.993 1.00 0.00  ? 352 GLY B H    1 
ATOM   7523 N N    . ARG B 1 353 ? 41.849  19.645 -10.370 1.00 21.90 ? 353 ARG B N    1 
ATOM   7524 C CA   . ARG B 1 353 ? 41.246  20.560 -9.399  1.00 21.80 ? 353 ARG B CA   1 
ATOM   7525 C C    . ARG B 1 353 ? 39.763  20.333 -9.223  1.00 23.24 ? 353 ARG B C    1 
ATOM   7526 O O    . ARG B 1 353 ? 39.035  20.239 -10.223 1.00 22.93 ? 353 ARG B O    1 
ATOM   7527 C CB   . ARG B 1 353 ? 41.377  21.964 -9.943  1.00 23.70 ? 353 ARG B CB   1 
ATOM   7528 C CG   . ARG B 1 353 ? 42.145  22.979 -9.146  1.00 27.60 ? 353 ARG B CG   1 
ATOM   7529 C CD   . ARG B 1 353 ? 42.000  24.293 -9.903  1.00 27.82 ? 353 ARG B CD   1 
ATOM   7530 N NE   . ARG B 1 353 ? 42.039  24.067 -11.348 1.00 28.82 ? 353 ARG B NE   1 
ATOM   7531 C CZ   . ARG B 1 353 ? 41.216  24.639 -12.231 1.00 29.86 ? 353 ARG B CZ   1 
ATOM   7532 N NH1  . ARG B 1 353 ? 40.263  25.470 -11.834 1.00 24.78 ? 353 ARG B NH1  1 
ATOM   7533 N NH2  . ARG B 1 353 ? 41.396  24.426 -13.529 1.00 30.13 ? 353 ARG B NH2  1 
ATOM   7534 H H    . ARG B 1 353 ? 41.971  19.951 -11.290 1.00 0.00  ? 353 ARG B H    1 
ATOM   7535 H HE   . ARG B 1 353 ? 42.719  23.425 -11.678 1.00 0.00  ? 353 ARG B HE   1 
ATOM   7536 H HH11 . ARG B 1 353 ? 40.158  25.676 -10.860 1.00 0.00  ? 353 ARG B HH11 1 
ATOM   7537 H HH12 . ARG B 1 353 ? 39.639  25.909 -12.480 1.00 0.00  ? 353 ARG B HH12 1 
ATOM   7538 H HH21 . ARG B 1 353 ? 42.120  23.786 -13.839 1.00 0.00  ? 353 ARG B HH21 1 
ATOM   7539 H HH22 . ARG B 1 353 ? 40.804  24.822 -14.227 1.00 0.00  ? 353 ARG B HH22 1 
ATOM   7540 N N    . GLU B 1 354 ? 39.303  20.260 -7.974  1.00 21.79 ? 354 GLU B N    1 
ATOM   7541 C CA   . GLU B 1 354 ? 37.870  20.128 -7.717  1.00 15.56 ? 354 GLU B CA   1 
ATOM   7542 C C    . GLU B 1 354 ? 37.417  21.542 -7.336  1.00 16.67 ? 354 GLU B C    1 
ATOM   7543 O O    . GLU B 1 354 ? 37.990  22.169 -6.400  1.00 17.63 ? 354 GLU B O    1 
ATOM   7544 C CB   . GLU B 1 354 ? 37.573  19.216 -6.537  1.00 15.15 ? 354 GLU B CB   1 
ATOM   7545 C CG   . GLU B 1 354 ? 38.168  17.882 -6.677  1.00 11.28 ? 354 GLU B CG   1 
ATOM   7546 C CD   . GLU B 1 354 ? 37.916  16.998 -5.481  1.00 10.46 ? 354 GLU B CD   1 
ATOM   7547 O OE1  . GLU B 1 354 ? 37.606  17.499 -4.369  1.00 9.17  ? 354 GLU B OE1  1 
ATOM   7548 O OE2  . GLU B 1 354 ? 38.046  15.771 -5.675  1.00 10.11 ? 354 GLU B OE2  1 
ATOM   7549 H H    . GLU B 1 354 ? 39.922  20.307 -7.214  1.00 0.00  ? 354 GLU B H    1 
ATOM   7550 N N    . VAL B 1 355 ? 36.358  22.000 -7.994  1.00 13.41 ? 355 VAL B N    1 
ATOM   7551 C CA   . VAL B 1 355 ? 35.811  23.330 -7.771  1.00 12.34 ? 355 VAL B CA   1 
ATOM   7552 C C    . VAL B 1 355 ? 34.295  23.204 -7.479  1.00 14.56 ? 355 VAL B C    1 
ATOM   7553 O O    . VAL B 1 355 ? 33.657  22.216 -7.911  1.00 15.39 ? 355 VAL B O    1 
ATOM   7554 C CB   . VAL B 1 355 ? 36.022  24.186 -9.051  1.00 13.03 ? 355 VAL B CB   1 
ATOM   7555 C CG1  . VAL B 1 355 ? 37.516  24.109 -9.509  1.00 12.35 ? 355 VAL B CG1  1 
ATOM   7556 C CG2  . VAL B 1 355 ? 35.134  23.641 -10.184 1.00 7.06  ? 355 VAL B CG2  1 
ATOM   7557 H H    . VAL B 1 355 ? 35.947  21.372 -8.636  1.00 0.00  ? 355 VAL B H    1 
ATOM   7558 N N    . THR B 1 356 ? 33.743  24.167 -6.730  1.00 12.82 ? 356 THR B N    1 
ATOM   7559 C CA   . THR B 1 356 ? 32.319  24.206 -6.397  1.00 15.21 ? 356 THR B CA   1 
ATOM   7560 C C    . THR B 1 356 ? 31.677  25.299 -7.238  1.00 15.02 ? 356 THR B C    1 
ATOM   7561 O O    . THR B 1 356 ? 30.623  25.854 -6.860  1.00 11.21 ? 356 THR B O    1 
ATOM   7562 C CB   . THR B 1 356 ? 32.041  24.567 -4.892  1.00 15.51 ? 356 THR B CB   1 
ATOM   7563 O OG1  . THR B 1 356 ? 32.738  25.759 -4.528  1.00 11.35 ? 356 THR B OG1  1 
ATOM   7564 C CG2  . THR B 1 356 ? 32.452  23.437 -3.928  1.00 16.82 ? 356 THR B CG2  1 
ATOM   7565 H H    . THR B 1 356 ? 34.293  24.908 -6.396  1.00 0.00  ? 356 THR B H    1 
ATOM   7566 H HG1  . THR B 1 356 ? 33.674  25.545 -4.409  1.00 0.00  ? 356 THR B HG1  1 
ATOM   7567 N N    . THR B 1 357 ? 32.231  25.526 -8.428  1.00 14.73 ? 357 THR B N    1 
ATOM   7568 C CA   . THR B 1 357 ? 31.749  26.603 -9.281  1.00 18.10 ? 357 THR B CA   1 
ATOM   7569 C C    . THR B 1 357 ? 31.704  26.148 -10.737 1.00 21.08 ? 357 THR B C    1 
ATOM   7570 O O    . THR B 1 357 ? 32.609  25.437 -11.209 1.00 19.64 ? 357 THR B O    1 
ATOM   7571 C CB   . THR B 1 357 ? 32.666  27.884 -9.112  1.00 20.13 ? 357 THR B CB   1 
ATOM   7572 O OG1  . THR B 1 357 ? 32.549  28.425 -7.780  1.00 19.28 ? 357 THR B OG1  1 
ATOM   7573 C CG2  . THR B 1 357 ? 32.348  28.943 -10.153 1.00 20.77 ? 357 THR B CG2  1 
ATOM   7574 H H    . THR B 1 357 ? 32.962  24.975 -8.772  1.00 0.00  ? 357 THR B H    1 
ATOM   7575 H HG1  . THR B 1 357 ? 32.562  29.395 -7.825  1.00 0.00  ? 357 THR B HG1  1 
ATOM   7576 N N    . THR B 1 358 ? 30.629  26.537 -11.432 1.00 23.85 ? 358 THR B N    1 
ATOM   7577 C CA   . THR B 1 358 ? 30.416  26.144 -12.821 1.00 24.24 ? 358 THR B CA   1 
ATOM   7578 C C    . THR B 1 358 ? 31.429  26.823 -13.709 1.00 25.54 ? 358 THR B C    1 
ATOM   7579 O O    . THR B 1 358 ? 32.010  27.822 -13.317 1.00 26.03 ? 358 THR B O    1 
ATOM   7580 C CB   . THR B 1 358 ? 28.968  26.486 -13.330 1.00 23.69 ? 358 THR B CB   1 
ATOM   7581 O OG1  . THR B 1 358 ? 28.719  27.904 -13.213 1.00 24.66 ? 358 THR B OG1  1 
ATOM   7582 C CG2  . THR B 1 358 ? 27.911  25.712 -12.547 1.00 22.29 ? 358 THR B CG2  1 
ATOM   7583 H H    . THR B 1 358 ? 29.956  27.125 -11.021 1.00 0.00  ? 358 THR B H    1 
ATOM   7584 H HG1  . THR B 1 358 ? 27.790  28.041 -13.479 1.00 0.00  ? 358 THR B HG1  1 
ATOM   7585 N N    . PRO B 1 359 ? 31.777  26.178 -14.830 1.00 25.82 ? 359 PRO B N    1 
ATOM   7586 C CA   . PRO B 1 359 ? 32.728  26.693 -15.805 1.00 28.03 ? 359 PRO B CA   1 
ATOM   7587 C C    . PRO B 1 359 ? 32.022  27.716 -16.674 1.00 31.20 ? 359 PRO B C    1 
ATOM   7588 O O    . PRO B 1 359 ? 30.799  27.747 -16.759 1.00 29.13 ? 359 PRO B O    1 
ATOM   7589 C CB   . PRO B 1 359 ? 33.099  25.448 -16.599 1.00 28.16 ? 359 PRO B CB   1 
ATOM   7590 C CG   . PRO B 1 359 ? 32.927  24.349 -15.598 1.00 26.93 ? 359 PRO B CG   1 
ATOM   7591 C CD   . PRO B 1 359 ? 31.623  24.719 -15.003 1.00 25.39 ? 359 PRO B CD   1 
ATOM   7592 N N    . LEU B 1 360 ? 32.816  28.520 -17.359 1.00 36.04 ? 360 LEU B N    1 
ATOM   7593 C CA   . LEU B 1 360 ? 32.319  29.590 -18.197 1.00 41.04 ? 360 LEU B CA   1 
ATOM   7594 C C    . LEU B 1 360 ? 32.133  29.206 -19.653 1.00 43.69 ? 360 LEU B C    1 
ATOM   7595 O O    . LEU B 1 360 ? 31.013  29.222 -20.181 1.00 43.25 ? 360 LEU B O    1 
ATOM   7596 C CB   . LEU B 1 360 ? 33.292  30.767 -18.108 1.00 44.83 ? 360 LEU B CB   1 
ATOM   7597 C CG   . LEU B 1 360 ? 34.802  30.484 -18.247 1.00 48.03 ? 360 LEU B CG   1 
ATOM   7598 C CD1  . LEU B 1 360 ? 35.570  31.752 -18.603 1.00 50.07 ? 360 LEU B CD1  1 
ATOM   7599 C CD2  . LEU B 1 360 ? 35.351  29.910 -16.958 1.00 48.98 ? 360 LEU B CD2  1 
ATOM   7600 H H    . LEU B 1 360 ? 33.762  28.310 -17.323 1.00 0.00  ? 360 LEU B H    1 
ATOM   7601 N N    . ALA B 1 361 ? 33.245  28.824 -20.279 1.00 46.07 ? 361 ALA B N    1 
ATOM   7602 C CA   . ALA B 1 361 ? 33.283  28.461 -21.692 1.00 47.16 ? 361 ALA B CA   1 
ATOM   7603 C C    . ALA B 1 361 ? 32.433  27.258 -22.081 1.00 48.29 ? 361 ALA B C    1 
ATOM   7604 O O    . ALA B 1 361 ? 32.126  26.400 -21.260 1.00 48.83 ? 361 ALA B O    1 
ATOM   7605 C CB   . ALA B 1 361 ? 34.725  28.243 -22.129 1.00 44.87 ? 361 ALA B CB   1 
ATOM   7606 H H    . ALA B 1 361 ? 34.077  28.753 -19.777 1.00 0.00  ? 361 ALA B H    1 
ATOM   7607 N N    . ALA B 1 362 ? 32.082  27.204 -23.362 1.00 49.25 ? 362 ALA B N    1 
ATOM   7608 C CA   . ALA B 1 362 ? 31.306  26.110 -23.923 1.00 48.62 ? 362 ALA B CA   1 
ATOM   7609 C C    . ALA B 1 362 ? 32.168  24.859 -23.797 1.00 48.33 ? 362 ALA B C    1 
ATOM   7610 O O    . ALA B 1 362 ? 31.741  23.850 -23.215 1.00 47.79 ? 362 ALA B O    1 
ATOM   7611 C CB   . ALA B 1 362 ? 31.000  26.395 -25.385 1.00 49.02 ? 362 ALA B CB   1 
ATOM   7612 H H    . ALA B 1 362 ? 32.341  27.956 -23.931 1.00 0.00  ? 362 ALA B H    1 
ATOM   7613 N N    . ASP B 1 363 ? 33.401  24.959 -24.295 1.00 46.42 ? 363 ASP B N    1 
ATOM   7614 C CA   . ASP B 1 363 ? 34.344  23.857 -24.237 1.00 46.01 ? 363 ASP B CA   1 
ATOM   7615 C C    . ASP B 1 363 ? 34.631  23.419 -22.808 1.00 45.65 ? 363 ASP B C    1 
ATOM   7616 O O    . ASP B 1 363 ? 34.562  22.227 -22.519 1.00 45.04 ? 363 ASP B O    1 
ATOM   7617 C CB   . ASP B 1 363 ? 35.667  24.207 -24.930 1.00 48.26 ? 363 ASP B CB   1 
ATOM   7618 C CG   . ASP B 1 363 ? 35.583  24.139 -26.463 1.00 51.08 ? 363 ASP B CG   1 
ATOM   7619 O OD1  . ASP B 1 363 ? 35.116  23.103 -27.001 1.00 49.76 ? 363 ASP B OD1  1 
ATOM   7620 O OD2  . ASP B 1 363 ? 36.019  25.110 -27.135 1.00 50.48 ? 363 ASP B OD2  1 
ATOM   7621 H H    . ASP B 1 363 ? 33.689  25.781 -24.735 1.00 0.00  ? 363 ASP B H    1 
ATOM   7622 N N    . ASP B 1 364 ? 34.884  24.365 -21.899 1.00 45.50 ? 364 ASP B N    1 
ATOM   7623 C CA   . ASP B 1 364 ? 35.215  24.018 -20.503 1.00 45.27 ? 364 ASP B CA   1 
ATOM   7624 C C    . ASP B 1 364 ? 34.329  22.934 -19.859 1.00 43.17 ? 364 ASP B C    1 
ATOM   7625 O O    . ASP B 1 364 ? 34.820  22.024 -19.188 1.00 40.69 ? 364 ASP B O    1 
ATOM   7626 C CB   . ASP B 1 364 ? 35.355  25.281 -19.640 1.00 47.85 ? 364 ASP B CB   1 
ATOM   7627 C CG   . ASP B 1 364 ? 36.700  25.992 -19.861 1.00 50.51 ? 364 ASP B CG   1 
ATOM   7628 O OD1  . ASP B 1 364 ? 37.627  25.368 -20.420 1.00 53.24 ? 364 ASP B OD1  1 
ATOM   7629 O OD2  . ASP B 1 364 ? 36.844  27.173 -19.488 1.00 52.38 ? 364 ASP B OD2  1 
ATOM   7630 H H    . ASP B 1 364 ? 34.853  25.303 -22.153 1.00 0.00  ? 364 ASP B H    1 
ATOM   7631 N N    . TRP B 1 365 ? 33.040  22.980 -20.166 1.00 41.70 ? 365 TRP B N    1 
ATOM   7632 C CA   . TRP B 1 365 ? 32.081  21.980 -19.706 1.00 40.70 ? 365 TRP B CA   1 
ATOM   7633 C C    . TRP B 1 365 ? 32.390  20.555 -20.292 1.00 42.70 ? 365 TRP B C    1 
ATOM   7634 O O    . TRP B 1 365 ? 31.608  19.621 -20.075 1.00 44.32 ? 365 TRP B O    1 
ATOM   7635 C CB   . TRP B 1 365 ? 30.674  22.374 -20.193 1.00 37.42 ? 365 TRP B CB   1 
ATOM   7636 C CG   . TRP B 1 365 ? 30.065  23.596 -19.575 1.00 34.02 ? 365 TRP B CG   1 
ATOM   7637 C CD1  . TRP B 1 365 ? 30.143  24.881 -20.043 1.00 34.26 ? 365 TRP B CD1  1 
ATOM   7638 C CD2  . TRP B 1 365 ? 29.249  23.650 -18.396 1.00 32.85 ? 365 TRP B CD2  1 
ATOM   7639 N NE1  . TRP B 1 365 ? 29.431  25.728 -19.230 1.00 34.66 ? 365 TRP B NE1  1 
ATOM   7640 C CE2  . TRP B 1 365 ? 28.872  25.003 -18.211 1.00 32.69 ? 365 TRP B CE2  1 
ATOM   7641 C CE3  . TRP B 1 365 ? 28.803  22.693 -17.478 1.00 28.44 ? 365 TRP B CE3  1 
ATOM   7642 C CZ2  . TRP B 1 365 ? 28.072  25.418 -17.149 1.00 29.75 ? 365 TRP B CZ2  1 
ATOM   7643 C CZ3  . TRP B 1 365 ? 28.013  23.104 -16.426 1.00 28.77 ? 365 TRP B CZ3  1 
ATOM   7644 C CH2  . TRP B 1 365 ? 27.655  24.452 -16.268 1.00 30.45 ? 365 TRP B CH2  1 
ATOM   7645 H H    . TRP B 1 365 ? 32.716  23.727 -20.715 1.00 0.00  ? 365 TRP B H    1 
ATOM   7646 H HE1  . TRP B 1 365 ? 29.372  26.701 -19.365 1.00 0.00  ? 365 TRP B HE1  1 
ATOM   7647 N N    . LYS B 1 366 ? 33.483  20.392 -21.049 1.00 43.14 ? 366 LYS B N    1 
ATOM   7648 C CA   . LYS B 1 366 ? 33.825  19.109 -21.684 1.00 42.05 ? 366 LYS B CA   1 
ATOM   7649 C C    . LYS B 1 366 ? 34.546  18.051 -20.857 1.00 41.03 ? 366 LYS B C    1 
ATOM   7650 O O    . LYS B 1 366 ? 34.263  16.857 -20.991 1.00 42.11 ? 366 LYS B O    1 
ATOM   7651 C CB   . LYS B 1 366 ? 34.634  19.354 -22.974 1.00 43.98 ? 366 LYS B CB   1 
ATOM   7652 C CG   . LYS B 1 366 ? 36.181  19.545 -22.777 1.00 46.71 ? 366 LYS B CG   1 
ATOM   7653 C CD   . LYS B 1 366 ? 36.843  20.512 -23.798 1.00 44.29 ? 366 LYS B CD   1 
ATOM   7654 C CE   . LYS B 1 366 ? 36.794  19.992 -25.230 1.00 45.72 ? 366 LYS B CE   1 
ATOM   7655 N NZ   . LYS B 1 366 ? 37.123  21.017 -26.285 1.00 46.76 ? 366 LYS B NZ   1 
ATOM   7656 H H    . LYS B 1 366 ? 34.047  21.158 -21.306 1.00 0.00  ? 366 LYS B H    1 
ATOM   7657 H HZ1  . LYS B 1 366 ? 38.055  21.464 -26.169 1.00 0.00  ? 366 LYS B HZ1  1 
ATOM   7658 H HZ2  . LYS B 1 366 ? 37.039  20.586 -27.221 1.00 0.00  ? 366 LYS B HZ2  1 
ATOM   7659 H HZ3  . LYS B 1 366 ? 36.390  21.769 -26.258 1.00 0.00  ? 366 LYS B HZ3  1 
ATOM   7660 N N    . GLY B 1 367 ? 35.497  18.474 -20.034 1.00 39.61 ? 367 GLY B N    1 
ATOM   7661 C CA   . GLY B 1 367 ? 36.281  17.526 -19.247 1.00 38.02 ? 367 GLY B CA   1 
ATOM   7662 C C    . GLY B 1 367 ? 35.819  17.247 -17.833 1.00 36.63 ? 367 GLY B C    1 
ATOM   7663 O O    . GLY B 1 367 ? 36.279  16.303 -17.219 1.00 38.36 ? 367 GLY B O    1 
ATOM   7664 H H    . GLY B 1 367 ? 35.648  19.438 -19.942 1.00 0.00  ? 367 GLY B H    1 
ATOM   7665 N N    . VAL B 1 368 ? 34.950  18.112 -17.320 1.00 34.53 ? 368 VAL B N    1 
ATOM   7666 C CA   . VAL B 1 368 ? 34.363  18.023 -15.983 1.00 28.67 ? 368 VAL B CA   1 
ATOM   7667 C C    . VAL B 1 368 ? 33.910  16.617 -15.620 1.00 27.95 ? 368 VAL B C    1 
ATOM   7668 O O    . VAL B 1 368 ? 33.339  15.932 -16.450 1.00 29.02 ? 368 VAL B O    1 
ATOM   7669 C CB   . VAL B 1 368 ? 33.069  18.911 -15.930 1.00 30.43 ? 368 VAL B CB   1 
ATOM   7670 C CG1  . VAL B 1 368 ? 32.191  18.576 -14.709 1.00 26.64 ? 368 VAL B CG1  1 
ATOM   7671 C CG2  . VAL B 1 368 ? 33.426  20.402 -15.991 1.00 28.69 ? 368 VAL B CG2  1 
ATOM   7672 H H    . VAL B 1 368 ? 34.689  18.862 -17.882 1.00 0.00  ? 368 VAL B H    1 
ATOM   7673 N N    . GLU B 1 369 ? 34.139  16.220 -14.369 1.00 26.98 ? 369 GLU B N    1 
ATOM   7674 C CA   . GLU B 1 369 ? 33.673  14.941 -13.843 1.00 24.67 ? 369 GLU B CA   1 
ATOM   7675 C C    . GLU B 1 369 ? 32.982  15.140 -12.477 1.00 22.18 ? 369 GLU B C    1 
ATOM   7676 O O    . GLU B 1 369 ? 33.510  15.770 -11.572 1.00 20.07 ? 369 GLU B O    1 
ATOM   7677 C CB   . GLU B 1 369 ? 34.777  13.866 -13.815 1.00 25.61 ? 369 GLU B CB   1 
ATOM   7678 C CG   . GLU B 1 369 ? 34.996  13.199 -15.229 1.00 29.73 ? 369 GLU B CG   1 
ATOM   7679 C CD   . GLU B 1 369 ? 35.807  11.866 -15.244 1.00 33.77 ? 369 GLU B CD   1 
ATOM   7680 O OE1  . GLU B 1 369 ? 36.767  11.685 -14.425 1.00 34.45 ? 369 GLU B OE1  1 
ATOM   7681 O OE2  . GLU B 1 369 ? 35.475  11.004 -16.103 1.00 29.66 ? 369 GLU B OE2  1 
ATOM   7682 H H    . GLU B 1 369 ? 34.711  16.780 -13.808 1.00 0.00  ? 369 GLU B H    1 
ATOM   7683 N N    . PRO B 1 370 ? 31.726  14.705 -12.363 1.00 22.05 ? 370 PRO B N    1 
ATOM   7684 C CA   . PRO B 1 370 ? 31.071  14.895 -11.075 1.00 20.69 ? 370 PRO B CA   1 
ATOM   7685 C C    . PRO B 1 370 ? 31.731  14.080 -9.987  1.00 19.43 ? 370 PRO B C    1 
ATOM   7686 O O    . PRO B 1 370 ? 32.184  12.956 -10.241 1.00 14.73 ? 370 PRO B O    1 
ATOM   7687 C CB   . PRO B 1 370 ? 29.641  14.423 -11.346 1.00 20.20 ? 370 PRO B CB   1 
ATOM   7688 C CG   . PRO B 1 370 ? 29.849  13.343 -12.368 1.00 20.21 ? 370 PRO B CG   1 
ATOM   7689 C CD   . PRO B 1 370 ? 30.855  13.974 -13.306 1.00 19.95 ? 370 PRO B CD   1 
ATOM   7690 N N    . ILE B 1 371 ? 31.895  14.710 -8.824  1.00 20.26 ? 371 ILE B N    1 
ATOM   7691 C CA   . ILE B 1 371 ? 32.454  14.086 -7.629  1.00 18.47 ? 371 ILE B CA   1 
ATOM   7692 C C    . ILE B 1 371 ? 31.205  13.837 -6.759  1.00 18.55 ? 371 ILE B C    1 
ATOM   7693 O O    . ILE B 1 371 ? 30.685  14.741 -6.072  1.00 15.88 ? 371 ILE B O    1 
ATOM   7694 C CB   . ILE B 1 371 ? 33.445  15.037 -6.891  1.00 18.37 ? 371 ILE B CB   1 
ATOM   7695 C CG1  . ILE B 1 371 ? 34.735  15.225 -7.693  1.00 12.39 ? 371 ILE B CG1  1 
ATOM   7696 C CG2  . ILE B 1 371 ? 33.758  14.536 -5.484  1.00 16.26 ? 371 ILE B CG2  1 
ATOM   7697 C CD1  . ILE B 1 371 ? 35.201  14.011 -8.375  1.00 13.30 ? 371 ILE B CD1  1 
ATOM   7698 H H    . ILE B 1 371 ? 31.658  15.664 -8.789  1.00 0.00  ? 371 ILE B H    1 
ATOM   7699 N N    . TYR B 1 372 ? 30.666  12.627 -6.856  1.00 19.53 ? 372 TYR B N    1 
ATOM   7700 C CA   . TYR B 1 372 ? 29.471  12.299 -6.103  1.00 18.82 ? 372 TYR B CA   1 
ATOM   7701 C C    . TYR B 1 372 ? 29.625  11.864 -4.661  1.00 20.16 ? 372 TYR B C    1 
ATOM   7702 O O    . TYR B 1 372 ? 30.668  11.366 -4.232  1.00 19.33 ? 372 TYR B O    1 
ATOM   7703 C CB   . TYR B 1 372 ? 28.649  11.271 -6.839  1.00 18.01 ? 372 TYR B CB   1 
ATOM   7704 C CG   . TYR B 1 372 ? 28.230  11.670 -8.239  1.00 22.17 ? 372 TYR B CG   1 
ATOM   7705 C CD1  . TYR B 1 372 ? 27.093  12.468 -8.447  1.00 20.13 ? 372 TYR B CD1  1 
ATOM   7706 C CD2  . TYR B 1 372 ? 28.867  11.115 -9.364  1.00 21.75 ? 372 TYR B CD2  1 
ATOM   7707 C CE1  . TYR B 1 372 ? 26.589  12.678 -9.740  1.00 23.74 ? 372 TYR B CE1  1 
ATOM   7708 C CE2  . TYR B 1 372 ? 28.381  11.320 -10.647 1.00 21.28 ? 372 TYR B CE2  1 
ATOM   7709 C CZ   . TYR B 1 372 ? 27.235  12.098 -10.830 1.00 22.93 ? 372 TYR B CZ   1 
ATOM   7710 O OH   . TYR B 1 372 ? 26.717  12.262 -12.093 1.00 21.81 ? 372 TYR B OH   1 
ATOM   7711 H H    . TYR B 1 372 ? 31.130  11.959 -7.403  1.00 0.00  ? 372 TYR B H    1 
ATOM   7712 H HH   . TYR B 1 372 ? 25.916  12.780 -12.066 1.00 0.00  ? 372 TYR B HH   1 
ATOM   7713 N N    . GLU B 1 373 ? 28.559  12.119 -3.915  1.00 20.55 ? 373 GLU B N    1 
ATOM   7714 C CA   . GLU B 1 373 ? 28.414  11.733 -2.524  1.00 18.25 ? 373 GLU B CA   1 
ATOM   7715 C C    . GLU B 1 373 ? 27.214  10.826 -2.653  1.00 17.80 ? 373 GLU B C    1 
ATOM   7716 O O    . GLU B 1 373 ? 26.208  11.240 -3.244  1.00 14.51 ? 373 GLU B O    1 
ATOM   7717 C CB   . GLU B 1 373 ? 28.043  12.933 -1.663  1.00 18.85 ? 373 GLU B CB   1 
ATOM   7718 C CG   . GLU B 1 373 ? 27.572  12.597 -0.288  1.00 18.26 ? 373 GLU B CG   1 
ATOM   7719 C CD   . GLU B 1 373 ? 27.510  13.817 0.607   1.00 23.80 ? 373 GLU B CD   1 
ATOM   7720 O OE1  . GLU B 1 373 ? 28.340  14.755 0.427   1.00 25.21 ? 373 GLU B OE1  1 
ATOM   7721 O OE2  . GLU B 1 373 ? 26.631  13.856 1.504   1.00 25.16 ? 373 GLU B OE2  1 
ATOM   7722 H H    . GLU B 1 373 ? 27.827  12.648 -4.296  1.00 0.00  ? 373 GLU B H    1 
ATOM   7723 N N    . THR B 1 374 ? 27.354  9.579  -2.200  1.00 18.33 ? 374 THR B N    1 
ATOM   7724 C CA   . THR B 1 374 ? 26.259  8.585  -2.292  1.00 21.06 ? 374 THR B CA   1 
ATOM   7725 C C    . THR B 1 374 ? 25.582  8.269  -0.972  1.00 19.47 ? 374 THR B C    1 
ATOM   7726 O O    . THR B 1 374 ? 26.216  7.822  -0.020  1.00 19.38 ? 374 THR B O    1 
ATOM   7727 C CB   . THR B 1 374 ? 26.768  7.270  -2.860  1.00 21.13 ? 374 THR B CB   1 
ATOM   7728 O OG1  . THR B 1 374 ? 28.024  6.991  -2.257  1.00 23.47 ? 374 THR B OG1  1 
ATOM   7729 C CG2  . THR B 1 374 ? 26.959  7.363  -4.360  1.00 21.68 ? 374 THR B CG2  1 
ATOM   7730 H H    . THR B 1 374 ? 28.183  9.303  -1.754  1.00 0.00  ? 374 THR B H    1 
ATOM   7731 H HG1  . THR B 1 374 ? 27.836  6.948  -1.303  1.00 0.00  ? 374 THR B HG1  1 
ATOM   7732 N N    . MET B 1 375 ? 24.284  8.475  -0.917  1.00 20.38 ? 375 MET B N    1 
ATOM   7733 C CA   . MET B 1 375 ? 23.576  8.192  0.321   1.00 21.18 ? 375 MET B CA   1 
ATOM   7734 C C    . MET B 1 375 ? 22.486  7.095  0.119   1.00 21.29 ? 375 MET B C    1 
ATOM   7735 O O    . MET B 1 375 ? 22.149  6.768  -1.034  1.00 19.39 ? 375 MET B O    1 
ATOM   7736 C CB   . MET B 1 375 ? 23.087  9.503  0.958   1.00 22.23 ? 375 MET B CB   1 
ATOM   7737 C CG   . MET B 1 375 ? 22.367  10.470 0.030   1.00 22.28 ? 375 MET B CG   1 
ATOM   7738 S SD   . MET B 1 375 ? 22.765  12.147 0.611   1.00 28.51 ? 375 MET B SD   1 
ATOM   7739 C CE   . MET B 1 375 ? 21.559  12.397 1.877   1.00 25.44 ? 375 MET B CE   1 
ATOM   7740 H H    . MET B 1 375 ? 23.761  8.749  -1.712  1.00 0.00  ? 375 MET B H    1 
ATOM   7741 N N    . PRO B 1 376 ? 22.017  6.453  1.225   1.00 20.59 ? 376 PRO B N    1 
ATOM   7742 C CA   . PRO B 1 376 ? 21.011  5.386  1.245   1.00 20.15 ? 376 PRO B CA   1 
ATOM   7743 C C    . PRO B 1 376 ? 19.722  5.816  0.657   1.00 22.23 ? 376 PRO B C    1 
ATOM   7744 O O    . PRO B 1 376 ? 19.319  6.950  0.827   1.00 23.74 ? 376 PRO B O    1 
ATOM   7745 C CB   . PRO B 1 376 ? 20.791  5.145  2.733   1.00 18.35 ? 376 PRO B CB   1 
ATOM   7746 C CG   . PRO B 1 376 ? 22.038  5.605  3.381   1.00 18.80 ? 376 PRO B CG   1 
ATOM   7747 C CD   . PRO B 1 376 ? 22.345  6.847  2.607   1.00 20.28 ? 376 PRO B CD   1 
ATOM   7748 N N    . GLY B 1 377 ? 19.039  4.890  0.009   1.00 26.61 ? 377 GLY B N    1 
ATOM   7749 C CA   . GLY B 1 377 ? 17.735  5.201  -0.569  1.00 30.26 ? 377 GLY B CA   1 
ATOM   7750 C C    . GLY B 1 377 ? 16.591  4.944  0.398   1.00 28.71 ? 377 GLY B C    1 
ATOM   7751 O O    . GLY B 1 377 ? 16.781  4.761  1.595   1.00 29.03 ? 377 GLY B O    1 
ATOM   7752 H H    . GLY B 1 377 ? 19.402  3.987  -0.127  1.00 0.00  ? 377 GLY B H    1 
ATOM   7753 N N    . TRP B 1 378 ? 15.386  4.898  -0.133  1.00 30.38 ? 378 TRP B N    1 
ATOM   7754 C CA   . TRP B 1 378 ? 14.218  4.664  0.709   1.00 31.44 ? 378 TRP B CA   1 
ATOM   7755 C C    . TRP B 1 378 ? 13.154  3.926  -0.096  1.00 31.08 ? 378 TRP B C    1 
ATOM   7756 O O    . TRP B 1 378 ? 12.849  4.284  -1.239  1.00 29.22 ? 378 TRP B O    1 
ATOM   7757 C CB   . TRP B 1 378 ? 13.670  5.995  1.269   1.00 29.21 ? 378 TRP B CB   1 
ATOM   7758 C CG   . TRP B 1 378 ? 13.200  6.988  0.206   1.00 27.31 ? 378 TRP B CG   1 
ATOM   7759 C CD1  . TRP B 1 378 ? 11.935  7.107  -0.303  1.00 28.24 ? 378 TRP B CD1  1 
ATOM   7760 C CD2  . TRP B 1 378 ? 13.958  8.056  -0.366  1.00 26.03 ? 378 TRP B CD2  1 
ATOM   7761 N NE1  . TRP B 1 378 ? 11.857  8.192  -1.133  1.00 26.40 ? 378 TRP B NE1  1 
ATOM   7762 C CE2  . TRP B 1 378 ? 13.082  8.798  -1.186  1.00 25.80 ? 378 TRP B CE2  1 
ATOM   7763 C CE3  . TRP B 1 378 ? 15.288  8.475  -0.247  1.00 22.48 ? 378 TRP B CE3  1 
ATOM   7764 C CZ2  . TRP B 1 378 ? 13.493  9.941  -1.877  1.00 26.15 ? 378 TRP B CZ2  1 
ATOM   7765 C CZ3  . TRP B 1 378 ? 15.692  9.599  -0.923  1.00 23.18 ? 378 TRP B CZ3  1 
ATOM   7766 C CH2  . TRP B 1 378 ? 14.801  10.326 -1.728  1.00 24.93 ? 378 TRP B CH2  1 
ATOM   7767 H H    . TRP B 1 378 ? 15.270  5.054  -1.095  1.00 0.00  ? 378 TRP B H    1 
ATOM   7768 H HE1  . TRP B 1 378 ? 11.042  8.418  -1.658  1.00 0.00  ? 378 TRP B HE1  1 
ATOM   7769 N N    . SER B 1 379 ? 12.588  2.891  0.506   1.00 33.48 ? 379 SER B N    1 
ATOM   7770 C CA   . SER B 1 379 ? 11.582  2.117  -0.198  1.00 34.24 ? 379 SER B CA   1 
ATOM   7771 C C    . SER B 1 379 ? 10.155  2.613  -0.001  1.00 33.35 ? 379 SER B C    1 
ATOM   7772 O O    . SER B 1 379 ? 9.322   2.451  -0.900  1.00 32.04 ? 379 SER B O    1 
ATOM   7773 C CB   . SER B 1 379 ? 11.710  0.629  0.147   1.00 36.68 ? 379 SER B CB   1 
ATOM   7774 O OG   . SER B 1 379 ? 11.466  -0.175 -1.011  1.00 38.67 ? 379 SER B OG   1 
ATOM   7775 H H    . SER B 1 379 ? 12.819  2.690  1.436   1.00 0.00  ? 379 SER B H    1 
ATOM   7776 H HG   . SER B 1 379 ? 12.191  -0.135 -1.666  1.00 0.00  ? 379 SER B HG   1 
ATOM   7777 N N    . GLU B 1 380 ? 9.880   3.251  1.141   1.00 32.12 ? 380 GLU B N    1 
ATOM   7778 C CA   . GLU B 1 380 ? 8.530   3.742  1.412   1.00 31.26 ? 380 GLU B CA   1 
ATOM   7779 C C    . GLU B 1 380 ? 8.101   4.851  0.441   1.00 30.33 ? 380 GLU B C    1 
ATOM   7780 O O    . GLU B 1 380 ? 8.921   5.402  -0.265  1.00 29.88 ? 380 GLU B O    1 
ATOM   7781 C CB   . GLU B 1 380 ? 8.323   4.088  2.899   1.00 31.65 ? 380 GLU B CB   1 
ATOM   7782 C CG   . GLU B 1 380 ? 9.500   4.690  3.661   1.00 36.40 ? 380 GLU B CG   1 
ATOM   7783 C CD   . GLU B 1 380 ? 10.479  3.680  4.284   1.00 37.22 ? 380 GLU B CD   1 
ATOM   7784 O OE1  . GLU B 1 380 ? 10.148  3.023  5.293   1.00 39.92 ? 380 GLU B OE1  1 
ATOM   7785 O OE2  . GLU B 1 380 ? 11.625  3.589  3.790   1.00 41.43 ? 380 GLU B OE2  1 
ATOM   7786 H H    . GLU B 1 380 ? 10.590  3.417  1.796   1.00 0.00  ? 380 GLU B H    1 
ATOM   7787 N N    . SER B 1 381 ? 6.801   5.069  0.302   1.00 29.78 ? 381 SER B N    1 
ATOM   7788 C CA   . SER B 1 381 ? 6.280   6.069  -0.635  1.00 28.21 ? 381 SER B CA   1 
ATOM   7789 C C    . SER B 1 381 ? 6.108   7.447  -0.044  1.00 27.15 ? 381 SER B C    1 
ATOM   7790 O O    . SER B 1 381 ? 5.471   7.608  0.985   1.00 30.53 ? 381 SER B O    1 
ATOM   7791 C CB   . SER B 1 381 ? 4.943   5.615  -1.220  1.00 28.09 ? 381 SER B CB   1 
ATOM   7792 O OG   . SER B 1 381 ? 4.658   6.346  -2.404  1.00 26.39 ? 381 SER B OG   1 
ATOM   7793 H H    . SER B 1 381 ? 6.165   4.546  0.824   1.00 0.00  ? 381 SER B H    1 
ATOM   7794 H HG   . SER B 1 381 ? 5.424   6.251  -2.990  1.00 0.00  ? 381 SER B HG   1 
ATOM   7795 N N    . THR B 1 382 ? 6.623   8.454  -0.728  1.00 24.79 ? 382 THR B N    1 
ATOM   7796 C CA   . THR B 1 382 ? 6.517   9.822  -0.243  1.00 22.12 ? 382 THR B CA   1 
ATOM   7797 C C    . THR B 1 382 ? 5.365   10.617 -0.922  1.00 20.70 ? 382 THR B C    1 
ATOM   7798 O O    . THR B 1 382 ? 5.008   11.720 -0.475  1.00 19.69 ? 382 THR B O    1 
ATOM   7799 C CB   . THR B 1 382 ? 7.898   10.525 -0.376  1.00 24.91 ? 382 THR B CB   1 
ATOM   7800 O OG1  . THR B 1 382 ? 8.439   10.309 -1.689  1.00 24.64 ? 382 THR B OG1  1 
ATOM   7801 C CG2  . THR B 1 382 ? 8.888   9.919  0.628   1.00 26.55 ? 382 THR B CG2  1 
ATOM   7802 H H    . THR B 1 382 ? 7.078   8.261  -1.588  1.00 0.00  ? 382 THR B H    1 
ATOM   7803 H HG1  . THR B 1 382 ? 8.785   9.399  -1.827  1.00 0.00  ? 382 THR B HG1  1 
ATOM   7804 N N    . PHE B 1 383 ? 4.759   10.031 -1.961  1.00 17.93 ? 383 PHE B N    1 
ATOM   7805 C CA   . PHE B 1 383 ? 3.662   10.649 -2.711  1.00 15.82 ? 383 PHE B CA   1 
ATOM   7806 C C    . PHE B 1 383 ? 2.481   10.963 -1.793  1.00 14.79 ? 383 PHE B C    1 
ATOM   7807 O O    . PHE B 1 383 ? 2.032   10.090 -1.041  1.00 12.55 ? 383 PHE B O    1 
ATOM   7808 C CB   . PHE B 1 383 ? 3.231   9.722  -3.857  1.00 16.99 ? 383 PHE B CB   1 
ATOM   7809 C CG   . PHE B 1 383 ? 2.011   10.189 -4.584  1.00 19.68 ? 383 PHE B CG   1 
ATOM   7810 C CD1  . PHE B 1 383 ? 2.117   11.086 -5.643  1.00 18.56 ? 383 PHE B CD1  1 
ATOM   7811 C CD2  . PHE B 1 383 ? 0.741   9.798  -4.149  1.00 20.36 ? 383 PHE B CD2  1 
ATOM   7812 C CE1  . PHE B 1 383 ? 0.989   11.594 -6.248  1.00 22.35 ? 383 PHE B CE1  1 
ATOM   7813 C CE2  . PHE B 1 383 ? -0.423  10.312 -4.759  1.00 23.01 ? 383 PHE B CE2  1 
ATOM   7814 C CZ   . PHE B 1 383 ? -0.302  11.215 -5.810  1.00 21.67 ? 383 PHE B CZ   1 
ATOM   7815 H H    . PHE B 1 383 ? 5.032   9.124  -2.206  1.00 0.00  ? 383 PHE B H    1 
ATOM   7816 N N    . GLY B 1 384 ? 2.000   12.212 -1.831  1.00 13.91 ? 384 GLY B N    1 
ATOM   7817 C CA   . GLY B 1 384 ? 0.889   12.643 -0.982  1.00 12.89 ? 384 GLY B CA   1 
ATOM   7818 C C    . GLY B 1 384 ? 1.168   12.934 0.491   1.00 13.98 ? 384 GLY B C    1 
ATOM   7819 O O    . GLY B 1 384 ? 0.313   13.467 1.191   1.00 12.32 ? 384 GLY B O    1 
ATOM   7820 H H    . GLY B 1 384 ? 2.346   12.911 -2.444  1.00 0.00  ? 384 GLY B H    1 
ATOM   7821 N N    . VAL B 1 385 ? 2.356   12.612 1.001   1.00 17.18 ? 385 VAL B N    1 
ATOM   7822 C CA   . VAL B 1 385 ? 2.630   12.868 2.418   1.00 16.18 ? 385 VAL B CA   1 
ATOM   7823 C C    . VAL B 1 385 ? 2.368   14.369 2.684   1.00 19.81 ? 385 VAL B C    1 
ATOM   7824 O O    . VAL B 1 385 ? 2.743   15.220 1.847   1.00 21.45 ? 385 VAL B O    1 
ATOM   7825 C CB   . VAL B 1 385 ? 4.066   12.470 2.792   1.00 14.67 ? 385 VAL B CB   1 
ATOM   7826 C CG1  . VAL B 1 385 ? 4.304   12.710 4.253   1.00 13.00 ? 385 VAL B CG1  1 
ATOM   7827 C CG2  . VAL B 1 385 ? 4.294   11.025 2.479   1.00 13.24 ? 385 VAL B CG2  1 
ATOM   7828 H H    . VAL B 1 385 ? 3.059   12.255 0.419   1.00 0.00  ? 385 VAL B H    1 
ATOM   7829 N N    . LYS B 1 386 ? 1.784   14.700 3.842   1.00 19.40 ? 386 LYS B N    1 
ATOM   7830 C CA   . LYS B 1 386 ? 1.432   16.101 4.141   1.00 17.89 ? 386 LYS B CA   1 
ATOM   7831 C C    . LYS B 1 386 ? 2.186   16.740 5.262   1.00 16.76 ? 386 LYS B C    1 
ATOM   7832 O O    . LYS B 1 386 ? 2.215   17.974 5.365   1.00 16.38 ? 386 LYS B O    1 
ATOM   7833 C CB   . LYS B 1 386 ? -0.064  16.247 4.444   1.00 16.10 ? 386 LYS B CB   1 
ATOM   7834 C CG   . LYS B 1 386 ? -0.963  15.635 3.385   1.00 18.37 ? 386 LYS B CG   1 
ATOM   7835 C CD   . LYS B 1 386 ? -2.358  16.166 3.475   1.00 19.44 ? 386 LYS B CD   1 
ATOM   7836 C CE   . LYS B 1 386 ? -2.849  16.436 2.092   1.00 20.53 ? 386 LYS B CE   1 
ATOM   7837 N NZ   . LYS B 1 386 ? -4.296  16.584 2.124   1.00 25.91 ? 386 LYS B NZ   1 
ATOM   7838 H H    . LYS B 1 386 ? 1.581   14.015 4.512   1.00 0.00  ? 386 LYS B H    1 
ATOM   7839 H HZ1  . LYS B 1 386 ? -4.581  17.312 2.814   1.00 0.00  ? 386 LYS B HZ1  1 
ATOM   7840 H HZ2  . LYS B 1 386 ? -4.579  16.922 1.163   1.00 0.00  ? 386 LYS B HZ2  1 
ATOM   7841 H HZ3  . LYS B 1 386 ? -4.763  15.682 2.345   1.00 0.00  ? 386 LYS B HZ3  1 
ATOM   7842 N N    . ASP B 1 387 ? 2.726   15.912 6.147   1.00 18.22 ? 387 ASP B N    1 
ATOM   7843 C CA   . ASP B 1 387 ? 3.488   16.417 7.282   1.00 21.36 ? 387 ASP B CA   1 
ATOM   7844 C C    . ASP B 1 387 ? 4.921   15.871 7.212   1.00 21.54 ? 387 ASP B C    1 
ATOM   7845 O O    . ASP B 1 387 ? 5.173   14.819 6.638   1.00 20.41 ? 387 ASP B O    1 
ATOM   7846 C CB   . ASP B 1 387 ? 2.793   16.033 8.607   1.00 21.62 ? 387 ASP B CB   1 
ATOM   7847 C CG   . ASP B 1 387 ? 3.520   16.578 9.834   1.00 20.02 ? 387 ASP B CG   1 
ATOM   7848 O OD1  . ASP B 1 387 ? 4.155   17.657 9.732   1.00 20.54 ? 387 ASP B OD1  1 
ATOM   7849 O OD2  . ASP B 1 387 ? 3.457   15.929 10.902  1.00 18.50 ? 387 ASP B OD2  1 
ATOM   7850 H H    . ASP B 1 387 ? 2.654   14.942 6.039   1.00 0.00  ? 387 ASP B H    1 
ATOM   7851 N N    . ARG B 1 388 ? 5.856   16.578 7.822   1.00 25.79 ? 388 ARG B N    1 
ATOM   7852 C CA   . ARG B 1 388 ? 7.251   16.174 7.778   1.00 27.45 ? 388 ARG B CA   1 
ATOM   7853 C C    . ARG B 1 388 ? 7.547   14.928 8.595   1.00 28.91 ? 388 ARG B C    1 
ATOM   7854 O O    . ARG B 1 388 ? 8.623   14.341 8.455   1.00 27.33 ? 388 ARG B O    1 
ATOM   7855 C CB   . ARG B 1 388 ? 8.137   17.330 8.219   1.00 29.62 ? 388 ARG B CB   1 
ATOM   7856 C CG   . ARG B 1 388 ? 9.618   17.018 8.195   1.00 32.15 ? 388 ARG B CG   1 
ATOM   7857 C CD   . ARG B 1 388 ? 10.424  18.206 8.606   1.00 31.55 ? 388 ARG B CD   1 
ATOM   7858 N NE   . ARG B 1 388 ? 11.810  17.869 8.932   1.00 36.60 ? 388 ARG B NE   1 
ATOM   7859 C CZ   . ARG B 1 388 ? 12.211  16.894 9.748   1.00 35.89 ? 388 ARG B CZ   1 
ATOM   7860 N NH1  . ARG B 1 388 ? 11.344  16.086 10.348  1.00 36.96 ? 388 ARG B NH1  1 
ATOM   7861 N NH2  . ARG B 1 388 ? 13.498  16.795 10.042  1.00 38.44 ? 388 ARG B NH2  1 
ATOM   7862 H H    . ARG B 1 388 ? 5.589   17.377 8.323   1.00 0.00  ? 388 ARG B H    1 
ATOM   7863 H HE   . ARG B 1 388 ? 12.499  18.398 8.482   1.00 0.00  ? 388 ARG B HE   1 
ATOM   7864 H HH11 . ARG B 1 388 ? 10.360  16.184 10.205  1.00 0.00  ? 388 ARG B HH11 1 
ATOM   7865 H HH12 . ARG B 1 388 ? 11.655  15.349 10.948  1.00 0.00  ? 388 ARG B HH12 1 
ATOM   7866 H HH21 . ARG B 1 388 ? 14.150  17.449 9.645   1.00 0.00  ? 388 ARG B HH21 1 
ATOM   7867 H HH22 . ARG B 1 388 ? 13.869  16.081 10.638  1.00 0.00  ? 388 ARG B HH22 1 
ATOM   7868 N N    . SER B 1 389 ? 6.583   14.508 9.417   1.00 30.00 ? 389 SER B N    1 
ATOM   7869 C CA   . SER B 1 389 ? 6.759   13.337 10.262  1.00 30.66 ? 389 SER B CA   1 
ATOM   7870 C C    . SER B 1 389 ? 6.742   12.081 9.419   1.00 31.87 ? 389 SER B C    1 
ATOM   7871 O O    . SER B 1 389 ? 7.736   11.335 9.393   1.00 33.92 ? 389 SER B O    1 
ATOM   7872 C CB   . SER B 1 389 ? 5.649   13.250 11.295  1.00 35.62 ? 389 SER B CB   1 
ATOM   7873 O OG   . SER B 1 389 ? 5.594   14.420 12.090  1.00 42.86 ? 389 SER B OG   1 
ATOM   7874 H H    . SER B 1 389 ? 5.744   15.005 9.495   1.00 0.00  ? 389 SER B H    1 
ATOM   7875 H HG   . SER B 1 389 ? 6.385   14.396 12.644  1.00 0.00  ? 389 SER B HG   1 
ATOM   7876 N N    . GLY B 1 390 ? 5.651   11.889 8.667   1.00 28.81 ? 390 GLY B N    1 
ATOM   7877 C CA   . GLY B 1 390 ? 5.506   10.703 7.830   1.00 25.37 ? 390 GLY B CA   1 
ATOM   7878 C C    . GLY B 1 390 ? 6.487   10.575 6.681   1.00 22.29 ? 390 GLY B C    1 
ATOM   7879 O O    . GLY B 1 390 ? 6.196   9.956  5.655   1.00 20.14 ? 390 GLY B O    1 
ATOM   7880 H H    . GLY B 1 390 ? 4.935   12.559 8.674   1.00 0.00  ? 390 GLY B H    1 
ATOM   7881 N N    . LEU B 1 391 ? 7.685   11.089 6.879   1.00 21.46 ? 391 LEU B N    1 
ATOM   7882 C CA   . LEU B 1 391 ? 8.695   11.069 5.839   1.00 20.05 ? 391 LEU B CA   1 
ATOM   7883 C C    . LEU B 1 391 ? 9.846   10.225 6.345   1.00 19.90 ? 391 LEU B C    1 
ATOM   7884 O O    . LEU B 1 391 ? 10.255  10.358 7.513   1.00 22.31 ? 391 LEU B O    1 
ATOM   7885 C CB   . LEU B 1 391 ? 9.193   12.507 5.572   1.00 17.08 ? 391 LEU B CB   1 
ATOM   7886 C CG   . LEU B 1 391 ? 9.249   13.093 4.161   1.00 11.10 ? 391 LEU B CG   1 
ATOM   7887 C CD1  . LEU B 1 391 ? 7.861   13.481 3.752   1.00 10.39 ? 391 LEU B CD1  1 
ATOM   7888 C CD2  . LEU B 1 391 ? 10.186  14.332 4.119   1.00 5.01  ? 391 LEU B CD2  1 
ATOM   7889 H H    . LEU B 1 391 ? 7.985   11.416 7.755   1.00 0.00  ? 391 LEU B H    1 
ATOM   7890 N N    . PRO B 1 392 ? 10.326  9.280  5.524   1.00 19.12 ? 392 PRO B N    1 
ATOM   7891 C CA   . PRO B 1 392 ? 11.450  8.492  6.041   1.00 18.95 ? 392 PRO B CA   1 
ATOM   7892 C C    . PRO B 1 392 ? 12.646  9.394  6.317   1.00 17.97 ? 392 PRO B C    1 
ATOM   7893 O O    . PRO B 1 392 ? 12.958  10.247 5.489   1.00 16.56 ? 392 PRO B O    1 
ATOM   7894 C CB   . PRO B 1 392 ? 11.781  7.540  4.884   1.00 18.58 ? 392 PRO B CB   1 
ATOM   7895 C CG   . PRO B 1 392 ? 11.198  8.195  3.670   1.00 17.04 ? 392 PRO B CG   1 
ATOM   7896 C CD   . PRO B 1 392 ? 9.876   8.749  4.231   1.00 18.44 ? 392 PRO B CD   1 
ATOM   7897 N N    . GLN B 1 393 ? 13.312  9.174  7.459   1.00 18.81 ? 393 GLN B N    1 
ATOM   7898 C CA   . GLN B 1 393 ? 14.521  9.887  7.856   1.00 18.86 ? 393 GLN B CA   1 
ATOM   7899 C C    . GLN B 1 393 ? 15.476  10.013 6.671   1.00 18.55 ? 393 GLN B C    1 
ATOM   7900 O O    . GLN B 1 393 ? 16.202  10.999 6.550   1.00 17.01 ? 393 GLN B O    1 
ATOM   7901 C CB   . GLN B 1 393 ? 15.232  9.103  8.954   1.00 22.87 ? 393 GLN B CB   1 
ATOM   7902 C CG   . GLN B 1 393 ? 16.357  9.866  9.667   1.00 25.79 ? 393 GLN B CG   1 
ATOM   7903 C CD   . GLN B 1 393 ? 15.877  11.174 10.310  1.00 24.88 ? 393 GLN B CD   1 
ATOM   7904 O OE1  . GLN B 1 393 ? 15.682  11.257 11.521  1.00 28.67 ? 393 GLN B OE1  1 
ATOM   7905 N NE2  . GLN B 1 393 ? 15.718  12.198 9.496   1.00 24.97 ? 393 GLN B NE2  1 
ATOM   7906 H H    . GLN B 1 393 ? 12.924  8.524  8.081   1.00 0.00  ? 393 GLN B H    1 
ATOM   7907 H HE21 . GLN B 1 393 ? 15.345  13.034 9.840   1.00 0.00  ? 393 GLN B HE21 1 
ATOM   7908 H HE22 . GLN B 1 393 ? 15.982  12.068 8.562   1.00 0.00  ? 393 GLN B HE22 1 
ATOM   7909 N N    . ALA B 1 394 ? 15.498  9.002  5.802   1.00 16.92 ? 394 ALA B N    1 
ATOM   7910 C CA   . ALA B 1 394 ? 16.346  9.054  4.615   1.00 14.24 ? 394 ALA B CA   1 
ATOM   7911 C C    . ALA B 1 394 ? 15.938  10.230 3.709   1.00 14.35 ? 394 ALA B C    1 
ATOM   7912 O O    . ALA B 1 394 ? 16.813  10.923 3.202   1.00 13.25 ? 394 ALA B O    1 
ATOM   7913 C CB   . ALA B 1 394 ? 16.287  7.762  3.862   1.00 10.35 ? 394 ALA B CB   1 
ATOM   7914 H H    . ALA B 1 394 ? 14.951  8.207  5.961   1.00 0.00  ? 394 ALA B H    1 
ATOM   7915 N N    . ALA B 1 395 ? 14.640  10.465 3.490   1.00 13.50 ? 395 ALA B N    1 
ATOM   7916 C CA   . ALA B 1 395 ? 14.258  11.623 2.642   1.00 16.68 ? 395 ALA B CA   1 
ATOM   7917 C C    . ALA B 1 395 ? 14.616  12.885 3.416   1.00 17.30 ? 395 ALA B C    1 
ATOM   7918 O O    . ALA B 1 395 ? 15.025  13.899 2.841   1.00 17.48 ? 395 ALA B O    1 
ATOM   7919 C CB   . ALA B 1 395 ? 12.745  11.630 2.240   1.00 16.18 ? 395 ALA B CB   1 
ATOM   7920 H H    . ALA B 1 395 ? 13.940  9.941  3.932   1.00 0.00  ? 395 ALA B H    1 
ATOM   7921 N N    . LEU B 1 396 ? 14.588  12.758 4.733   1.00 18.87 ? 396 LEU B N    1 
ATOM   7922 C CA   . LEU B 1 396 ? 14.938  13.860 5.594   1.00 18.16 ? 396 LEU B CA   1 
ATOM   7923 C C    . LEU B 1 396 ? 16.392  14.262 5.411   1.00 16.30 ? 396 LEU B C    1 
ATOM   7924 O O    . LEU B 1 396 ? 16.667  15.401 5.060   1.00 20.52 ? 396 LEU B O    1 
ATOM   7925 C CB   . LEU B 1 396 ? 14.599  13.551 7.051   1.00 16.09 ? 396 LEU B CB   1 
ATOM   7926 C CG   . LEU B 1 396 ? 13.101  13.669 7.336   1.00 18.45 ? 396 LEU B CG   1 
ATOM   7927 C CD1  . LEU B 1 396 ? 12.841  13.713 8.841   1.00 19.82 ? 396 LEU B CD1  1 
ATOM   7928 C CD2  . LEU B 1 396 ? 12.522  14.925 6.691   1.00 17.53 ? 396 LEU B CD2  1 
ATOM   7929 H H    . LEU B 1 396 ? 14.280  11.909 5.102   1.00 0.00  ? 396 LEU B H    1 
ATOM   7930 N N    . ASN B 1 397 ? 17.323  13.336 5.579   1.00 15.36 ? 397 ASN B N    1 
ATOM   7931 C CA   . ASN B 1 397 ? 18.742  13.647 5.417   1.00 15.87 ? 397 ASN B CA   1 
ATOM   7932 C C    . ASN B 1 397 ? 19.061  14.142 3.982   1.00 14.54 ? 397 ASN B C    1 
ATOM   7933 O O    . ASN B 1 397 ? 19.919  14.983 3.787   1.00 16.46 ? 397 ASN B O    1 
ATOM   7934 C CB   . ASN B 1 397 ? 19.608  12.415 5.740   1.00 17.69 ? 397 ASN B CB   1 
ATOM   7935 C CG   . ASN B 1 397 ? 19.137  11.640 6.985   1.00 18.39 ? 397 ASN B CG   1 
ATOM   7936 O OD1  . ASN B 1 397 ? 18.310  12.115 7.779   1.00 16.66 ? 397 ASN B OD1  1 
ATOM   7937 N ND2  . ASN B 1 397 ? 19.687  10.444 7.166   1.00 18.14 ? 397 ASN B ND2  1 
ATOM   7938 H H    . ASN B 1 397 ? 17.017  12.445 5.865   1.00 0.00  ? 397 ASN B H    1 
ATOM   7939 H HD21 . ASN B 1 397 ? 19.451  9.921  7.952   1.00 0.00  ? 397 ASN B HD21 1 
ATOM   7940 H HD22 . ASN B 1 397 ? 20.333  10.130 6.484   1.00 0.00  ? 397 ASN B HD22 1 
ATOM   7941 N N    . TYR B 1 398 ? 18.422  13.594 2.966   1.00 13.35 ? 398 TYR B N    1 
ATOM   7942 C CA   . TYR B 1 398 ? 18.679  14.055 1.600   1.00 12.10 ? 398 TYR B CA   1 
ATOM   7943 C C    . TYR B 1 398 ? 18.267  15.519 1.386   1.00 10.67 ? 398 TYR B C    1 
ATOM   7944 O O    . TYR B 1 398 ? 18.904  16.233 0.650   1.00 13.59 ? 398 TYR B O    1 
ATOM   7945 C CB   . TYR B 1 398 ? 17.946  13.165 0.590   1.00 15.37 ? 398 TYR B CB   1 
ATOM   7946 C CG   . TYR B 1 398 ? 18.139  13.544 -0.855  1.00 15.73 ? 398 TYR B CG   1 
ATOM   7947 C CD1  . TYR B 1 398 ? 19.218  13.042 -1.584  1.00 14.79 ? 398 TYR B CD1  1 
ATOM   7948 C CD2  . TYR B 1 398 ? 17.184  14.325 -1.533  1.00 14.35 ? 398 TYR B CD2  1 
ATOM   7949 C CE1  . TYR B 1 398 ? 19.332  13.280 -2.936  1.00 14.19 ? 398 TYR B CE1  1 
ATOM   7950 C CE2  . TYR B 1 398 ? 17.307  14.571 -2.891  1.00 12.90 ? 398 TYR B CE2  1 
ATOM   7951 C CZ   . TYR B 1 398 ? 18.379  14.034 -3.577  1.00 13.76 ? 398 TYR B CZ   1 
ATOM   7952 O OH   . TYR B 1 398 ? 18.483  14.185 -4.921  1.00 12.47 ? 398 TYR B OH   1 
ATOM   7953 H H    . TYR B 1 398 ? 17.810  12.839 3.118   1.00 0.00  ? 398 TYR B H    1 
ATOM   7954 H HH   . TYR B 1 398 ? 17.804  14.754 -5.326  1.00 0.00  ? 398 TYR B HH   1 
ATOM   7955 N N    . ILE B 1 399 ? 17.094  15.876 1.892   1.00 13.54 ? 399 ILE B N    1 
ATOM   7956 C CA   . ILE B 1 399 ? 16.555  17.222 1.827   1.00 12.44 ? 399 ILE B CA   1 
ATOM   7957 C C    . ILE B 1 399 ? 17.543  18.103 2.644   1.00 14.11 ? 399 ILE B C    1 
ATOM   7958 O O    . ILE B 1 399 ? 17.922  19.225 2.231   1.00 10.93 ? 399 ILE B O    1 
ATOM   7959 C CB   . ILE B 1 399 ? 15.143  17.263 2.479   1.00 11.86 ? 399 ILE B CB   1 
ATOM   7960 C CG1  . ILE B 1 399 ? 14.088  16.738 1.499   1.00 15.30 ? 399 ILE B CG1  1 
ATOM   7961 C CG2  . ILE B 1 399 ? 14.800  18.684 2.868   1.00 10.25 ? 399 ILE B CG2  1 
ATOM   7962 C CD1  . ILE B 1 399 ? 12.749  16.114 2.122   1.00 5.25  ? 399 ILE B CD1  1 
ATOM   7963 H H    . ILE B 1 399 ? 16.526  15.191 2.311   1.00 0.00  ? 399 ILE B H    1 
ATOM   7964 N N    . LYS B 1 400 ? 17.967  17.572 3.789   1.00 15.99 ? 400 LYS B N    1 
ATOM   7965 C CA   . LYS B 1 400 ? 18.920  18.268 4.661   1.00 16.86 ? 400 LYS B CA   1 
ATOM   7966 C C    . LYS B 1 400 ? 20.209  18.574 3.934   1.00 13.59 ? 400 LYS B C    1 
ATOM   7967 O O    . LYS B 1 400 ? 20.754  19.679 4.050   1.00 11.48 ? 400 LYS B O    1 
ATOM   7968 C CB   . LYS B 1 400 ? 19.298  17.411 5.874   1.00 20.52 ? 400 LYS B CB   1 
ATOM   7969 C CG   . LYS B 1 400 ? 20.146  18.113 6.908   1.00 16.40 ? 400 LYS B CG   1 
ATOM   7970 C CD   . LYS B 1 400 ? 19.244  18.898 7.854   1.00 22.35 ? 400 LYS B CD   1 
ATOM   7971 C CE   . LYS B 1 400 ? 19.720  20.355 8.057   1.00 24.70 ? 400 LYS B CE   1 
ATOM   7972 N NZ   . LYS B 1 400 ? 19.605  21.219 6.833   1.00 26.83 ? 400 LYS B NZ   1 
ATOM   7973 H H    . LYS B 1 400 ? 17.582  16.716 4.098   1.00 0.00  ? 400 LYS B H    1 
ATOM   7974 H HZ1  . LYS B 1 400 ? 20.177  20.803 6.068   1.00 0.00  ? 400 LYS B HZ1  1 
ATOM   7975 H HZ2  . LYS B 1 400 ? 18.642  21.364 6.436   1.00 0.00  ? 400 LYS B HZ2  1 
ATOM   7976 H HZ3  . LYS B 1 400 ? 19.980  22.164 7.028   1.00 0.00  ? 400 LYS B HZ3  1 
ATOM   7977 N N    . ARG B 1 401 ? 20.715  17.585 3.213   1.00 13.47 ? 401 ARG B N    1 
ATOM   7978 C CA   . ARG B 1 401 ? 21.981  17.744 2.520   1.00 16.35 ? 401 ARG B CA   1 
ATOM   7979 C C    . ARG B 1 401 ? 21.974  18.877 1.482   1.00 15.07 ? 401 ARG B C    1 
ATOM   7980 O O    . ARG B 1 401 ? 22.858  19.707 1.444   1.00 17.72 ? 401 ARG B O    1 
ATOM   7981 C CB   . ARG B 1 401 ? 22.402  16.412 1.901   1.00 16.22 ? 401 ARG B CB   1 
ATOM   7982 C CG   . ARG B 1 401 ? 23.833  16.363 1.418   1.00 18.28 ? 401 ARG B CG   1 
ATOM   7983 C CD   . ARG B 1 401 ? 24.821  16.572 2.523   1.00 18.65 ? 401 ARG B CD   1 
ATOM   7984 N NE   . ARG B 1 401 ? 26.183  16.584 1.999   1.00 16.37 ? 401 ARG B NE   1 
ATOM   7985 C CZ   . ARG B 1 401 ? 27.173  17.308 2.509   1.00 16.55 ? 401 ARG B CZ   1 
ATOM   7986 N NH1  . ARG B 1 401 ? 26.971  18.080 3.571   1.00 15.58 ? 401 ARG B NH1  1 
ATOM   7987 N NH2  . ARG B 1 401 ? 28.366  17.288 1.932   1.00 21.76 ? 401 ARG B NH2  1 
ATOM   7988 H H    . ARG B 1 401 ? 20.294  16.695 3.233   1.00 0.00  ? 401 ARG B H    1 
ATOM   7989 H HE   . ARG B 1 401 ? 26.379  15.974 1.246   1.00 0.00  ? 401 ARG B HE   1 
ATOM   7990 H HH11 . ARG B 1 401 ? 26.076  18.172 4.017   1.00 0.00  ? 401 ARG B HH11 1 
ATOM   7991 H HH12 . ARG B 1 401 ? 27.713  18.639 3.946   1.00 0.00  ? 401 ARG B HH12 1 
ATOM   7992 H HH21 . ARG B 1 401 ? 28.503  16.673 1.143   1.00 0.00  ? 401 ARG B HH21 1 
ATOM   7993 H HH22 . ARG B 1 401 ? 29.137  17.821 2.295   1.00 0.00  ? 401 ARG B HH22 1 
ATOM   7994 N N    . ILE B 1 402 ? 20.976  18.887 0.627   1.00 15.53 ? 402 ILE B N    1 
ATOM   7995 C CA   . ILE B 1 402 ? 20.850  19.906 -0.392  1.00 13.48 ? 402 ILE B CA   1 
ATOM   7996 C C    . ILE B 1 402 ? 20.977  21.311 0.222   1.00 14.95 ? 402 ILE B C    1 
ATOM   7997 O O    . ILE B 1 402 ? 21.580  22.187 -0.373  1.00 17.88 ? 402 ILE B O    1 
ATOM   7998 C CB   . ILE B 1 402 ? 19.511  19.691 -1.159  1.00 8.81  ? 402 ILE B CB   1 
ATOM   7999 C CG1  . ILE B 1 402 ? 19.494  18.276 -1.744  1.00 5.01  ? 402 ILE B CG1  1 
ATOM   8000 C CG2  . ILE B 1 402 ? 19.319  20.711 -2.286  1.00 7.15  ? 402 ILE B CG2  1 
ATOM   8001 C CD1  . ILE B 1 402 ? 18.215  17.974 -2.468  1.00 5.47  ? 402 ILE B CD1  1 
ATOM   8002 H H    . ILE B 1 402 ? 20.309  18.167 0.684   1.00 0.00  ? 402 ILE B H    1 
ATOM   8003 N N    . GLU B 1 403 ? 20.447  21.508 1.421   1.00 17.65 ? 403 GLU B N    1 
ATOM   8004 C CA   . GLU B 1 403 ? 20.519  22.796 2.121   1.00 15.81 ? 403 GLU B CA   1 
ATOM   8005 C C    . GLU B 1 403 ? 21.922  23.160 2.600   1.00 14.45 ? 403 GLU B C    1 
ATOM   8006 O O    . GLU B 1 403 ? 22.330  24.351 2.603   1.00 11.17 ? 403 GLU B O    1 
ATOM   8007 C CB   . GLU B 1 403 ? 19.593  22.788 3.344   1.00 14.53 ? 403 GLU B CB   1 
ATOM   8008 C CG   . GLU B 1 403 ? 18.146  22.592 2.992   1.00 17.89 ? 403 GLU B CG   1 
ATOM   8009 C CD   . GLU B 1 403 ? 17.220  22.483 4.209   1.00 18.37 ? 403 GLU B CD   1 
ATOM   8010 O OE1  . GLU B 1 403 ? 17.661  22.044 5.302   1.00 15.04 ? 403 GLU B OE1  1 
ATOM   8011 O OE2  . GLU B 1 403 ? 16.035  22.825 4.039   1.00 13.79 ? 403 GLU B OE2  1 
ATOM   8012 H H    . GLU B 1 403 ? 19.933  20.780 1.829   1.00 0.00  ? 403 GLU B H    1 
ATOM   8013 N N    . GLU B 1 404 ? 22.596  22.170 3.176   1.00 14.63 ? 404 GLU B N    1 
ATOM   8014 C CA   . GLU B 1 404 ? 23.948  22.353 3.659   1.00 15.14 ? 404 GLU B CA   1 
ATOM   8015 C C    . GLU B 1 404 ? 24.878  22.775 2.530   1.00 14.92 ? 404 GLU B C    1 
ATOM   8016 O O    . GLU B 1 404 ? 25.854  23.477 2.764   1.00 15.74 ? 404 GLU B O    1 
ATOM   8017 C CB   . GLU B 1 404 ? 24.472  21.051 4.157   1.00 19.68 ? 404 GLU B CB   1 
ATOM   8018 C CG   . GLU B 1 404 ? 24.349  20.810 5.605   1.00 26.14 ? 404 GLU B CG   1 
ATOM   8019 C CD   . GLU B 1 404 ? 25.026  19.518 5.916   1.00 27.97 ? 404 GLU B CD   1 
ATOM   8020 O OE1  . GLU B 1 404 ? 26.250  19.451 5.632   1.00 30.96 ? 404 GLU B OE1  1 
ATOM   8021 O OE2  . GLU B 1 404 ? 24.336  18.572 6.354   1.00 24.78 ? 404 GLU B OE2  1 
ATOM   8022 H H    . GLU B 1 404 ? 22.152  21.301 3.298   1.00 0.00  ? 404 GLU B H    1 
ATOM   8023 N N    . LEU B 1 405 ? 24.618  22.258 1.339   1.00 12.03 ? 405 LEU B N    1 
ATOM   8024 C CA   . LEU B 1 405 ? 25.407  22.553 0.178   1.00 12.62 ? 405 LEU B CA   1 
ATOM   8025 C C    . LEU B 1 405 ? 25.102  23.861 -0.534  1.00 14.51 ? 405 LEU B C    1 
ATOM   8026 O O    . LEU B 1 405 ? 25.981  24.421 -1.214  1.00 15.94 ? 405 LEU B O    1 
ATOM   8027 C CB   . LEU B 1 405 ? 25.282  21.419 -0.831  1.00 12.00 ? 405 LEU B CB   1 
ATOM   8028 C CG   . LEU B 1 405 ? 26.025  20.156 -0.396  1.00 9.88  ? 405 LEU B CG   1 
ATOM   8029 C CD1  . LEU B 1 405 ? 25.830  19.007 -1.383  1.00 6.90  ? 405 LEU B CD1  1 
ATOM   8030 C CD2  . LEU B 1 405 ? 27.470  20.544 -0.315  1.00 8.92  ? 405 LEU B CD2  1 
ATOM   8031 H H    . LEU B 1 405 ? 23.908  21.580 1.282   1.00 0.00  ? 405 LEU B H    1 
ATOM   8032 N N    . THR B 1 406 ? 23.912  24.403 -0.306  1.00 15.33 ? 406 THR B N    1 
ATOM   8033 C CA   . THR B 1 406 ? 23.485  25.610 -1.007  1.00 13.78 ? 406 THR B CA   1 
ATOM   8034 C C    . THR B 1 406 ? 23.277  26.870 -0.190  1.00 15.01 ? 406 THR B C    1 
ATOM   8035 O O    . THR B 1 406 ? 23.246  27.961 -0.740  1.00 12.47 ? 406 THR B O    1 
ATOM   8036 C CB   . THR B 1 406 ? 22.180  25.291 -1.760  1.00 18.80 ? 406 THR B CB   1 
ATOM   8037 O OG1  . THR B 1 406 ? 21.117  25.069 -0.806  1.00 16.85 ? 406 THR B OG1  1 
ATOM   8038 C CG2  . THR B 1 406 ? 22.395  24.009 -2.578  1.00 15.78 ? 406 THR B CG2  1 
ATOM   8039 H H    . THR B 1 406 ? 23.293  23.986 0.324   1.00 0.00  ? 406 THR B H    1 
ATOM   8040 H HG1  . THR B 1 406 ? 21.124  24.113 -0.632  1.00 0.00  ? 406 THR B HG1  1 
ATOM   8041 N N    . GLY B 1 407 ? 23.001  26.693 1.098   1.00 17.63 ? 407 GLY B N    1 
ATOM   8042 C CA   . GLY B 1 407 ? 22.772  27.810 1.996   1.00 16.81 ? 407 GLY B CA   1 
ATOM   8043 C C    . GLY B 1 407 ? 21.348  28.318 1.948   1.00 15.49 ? 407 GLY B C    1 
ATOM   8044 O O    . GLY B 1 407 ? 20.937  29.130 2.785   1.00 18.95 ? 407 GLY B O    1 
ATOM   8045 H H    . GLY B 1 407 ? 22.906  25.799 1.492   1.00 0.00  ? 407 GLY B H    1 
ATOM   8046 N N    . VAL B 1 408 ? 20.561  27.792 1.024   1.00 16.64 ? 408 VAL B N    1 
ATOM   8047 C CA   . VAL B 1 408 ? 19.184  28.230 0.875   1.00 13.14 ? 408 VAL B CA   1 
ATOM   8048 C C    . VAL B 1 408 ? 18.233  27.241 1.475   1.00 12.81 ? 408 VAL B C    1 
ATOM   8049 O O    . VAL B 1 408 ? 18.253  26.066 1.142   1.00 12.51 ? 408 VAL B O    1 
ATOM   8050 C CB   . VAL B 1 408 ? 18.834  28.459 -0.602  1.00 11.29 ? 408 VAL B CB   1 
ATOM   8051 C CG1  . VAL B 1 408 ? 17.381  28.878 -0.727  1.00 13.50 ? 408 VAL B CG1  1 
ATOM   8052 C CG2  . VAL B 1 408 ? 19.722  29.581 -1.182  1.00 6.81  ? 408 VAL B CG2  1 
ATOM   8053 H H    . VAL B 1 408 ? 20.854  27.052 0.448   1.00 0.00  ? 408 VAL B H    1 
ATOM   8054 N N    . PRO B 1 409 ? 17.293  27.718 2.295   1.00 13.86 ? 409 PRO B N    1 
ATOM   8055 C CA   . PRO B 1 409 ? 16.374  26.736 2.887   1.00 11.17 ? 409 PRO B CA   1 
ATOM   8056 C C    . PRO B 1 409 ? 15.308  26.212 1.956   1.00 11.83 ? 409 PRO B C    1 
ATOM   8057 O O    . PRO B 1 409 ? 14.868  26.904 1.026   1.00 11.25 ? 409 PRO B O    1 
ATOM   8058 C CB   . PRO B 1 409 ? 15.725  27.532 4.003   1.00 12.49 ? 409 PRO B CB   1 
ATOM   8059 C CG   . PRO B 1 409 ? 15.555  28.918 3.341   1.00 11.22 ? 409 PRO B CG   1 
ATOM   8060 C CD   . PRO B 1 409 ? 16.911  29.105 2.642   1.00 12.84 ? 409 PRO B CD   1 
ATOM   8061 N N    . ILE B 1 410 ? 14.881  24.979 2.193   1.00 12.31 ? 410 ILE B N    1 
ATOM   8062 C CA   . ILE B 1 410 ? 13.778  24.443 1.414   1.00 12.85 ? 410 ILE B CA   1 
ATOM   8063 C C    . ILE B 1 410 ? 12.565  24.942 2.232   1.00 13.32 ? 410 ILE B C    1 
ATOM   8064 O O    . ILE B 1 410 ? 12.399  24.547 3.386   1.00 16.61 ? 410 ILE B O    1 
ATOM   8065 C CB   . ILE B 1 410 ? 13.818  22.877 1.295   1.00 11.15 ? 410 ILE B CB   1 
ATOM   8066 C CG1  . ILE B 1 410 ? 15.040  22.464 0.446   1.00 6.71  ? 410 ILE B CG1  1 
ATOM   8067 C CG2  . ILE B 1 410 ? 12.475  22.331 0.688   1.00 9.31  ? 410 ILE B CG2  1 
ATOM   8068 C CD1  . ILE B 1 410 ? 15.268  20.943 0.277   1.00 5.01  ? 410 ILE B CD1  1 
ATOM   8069 H H    . ILE B 1 410 ? 15.284  24.399 2.879   1.00 0.00  ? 410 ILE B H    1 
ATOM   8070 N N    . ASP B 1 411 ? 11.783  25.863 1.668   1.00 14.35 ? 411 ASP B N    1 
ATOM   8071 C CA   . ASP B 1 411 ? 10.619  26.410 2.355   1.00 13.40 ? 411 ASP B CA   1 
ATOM   8072 C C    . ASP B 1 411 ? 9.287   25.761 1.996   1.00 15.39 ? 411 ASP B C    1 
ATOM   8073 O O    . ASP B 1 411 ? 8.242   25.990 2.674   1.00 14.03 ? 411 ASP B O    1 
ATOM   8074 C CB   . ASP B 1 411 ? 10.521  27.899 2.113   1.00 16.94 ? 411 ASP B CB   1 
ATOM   8075 C CG   . ASP B 1 411 ? 11.580  28.651 2.818   1.00 19.34 ? 411 ASP B CG   1 
ATOM   8076 O OD1  . ASP B 1 411 ? 11.871  28.253 3.973   1.00 27.20 ? 411 ASP B OD1  1 
ATOM   8077 O OD2  . ASP B 1 411 ? 12.106  29.640 2.244   1.00 15.16 ? 411 ASP B OD2  1 
ATOM   8078 H H    . ASP B 1 411 ? 11.965  26.155 0.752   1.00 0.00  ? 411 ASP B H    1 
ATOM   8079 N N    . ILE B 1 412 ? 9.289   24.990 0.912   1.00 12.66 ? 412 ILE B N    1 
ATOM   8080 C CA   . ILE B 1 412 ? 8.080   24.280 0.503   1.00 8.87  ? 412 ILE B CA   1 
ATOM   8081 C C    . ILE B 1 412 ? 8.400   22.920 -0.115  1.00 9.30  ? 412 ILE B C    1 
ATOM   8082 O O    . ILE B 1 412 ? 9.329   22.761 -0.928  1.00 11.19 ? 412 ILE B O    1 
ATOM   8083 C CB   . ILE B 1 412 ? 7.232   25.159 -0.473  1.00 6.21  ? 412 ILE B CB   1 
ATOM   8084 C CG1  . ILE B 1 412 ? 6.576   26.299 0.293   1.00 5.01  ? 412 ILE B CG1  1 
ATOM   8085 C CG2  . ILE B 1 412 ? 6.207   24.357 -1.280  1.00 5.01  ? 412 ILE B CG2  1 
ATOM   8086 C CD1  . ILE B 1 412 ? 6.310   27.547 -0.559  1.00 5.82  ? 412 ILE B CD1  1 
ATOM   8087 H H    . ILE B 1 412 ? 10.091  24.936 0.351   1.00 0.00  ? 412 ILE B H    1 
ATOM   8088 N N    . ILE B 1 413 ? 7.613   21.916 0.248   1.00 12.09 ? 413 ILE B N    1 
ATOM   8089 C CA   . ILE B 1 413 ? 7.791   20.609 -0.361  1.00 10.86 ? 413 ILE B CA   1 
ATOM   8090 C C    . ILE B 1 413 ? 6.458   20.223 -1.007  1.00 11.40 ? 413 ILE B C    1 
ATOM   8091 O O    . ILE B 1 413 ? 5.442   20.116 -0.321  1.00 15.15 ? 413 ILE B O    1 
ATOM   8092 C CB   . ILE B 1 413 ? 8.284   19.571 0.694   1.00 9.36  ? 413 ILE B CB   1 
ATOM   8093 C CG1  . ILE B 1 413 ? 9.627   20.073 1.281   1.00 15.21 ? 413 ILE B CG1  1 
ATOM   8094 C CG2  . ILE B 1 413 ? 8.441   18.174 0.037   1.00 9.07  ? 413 ILE B CG2  1 
ATOM   8095 C CD1  . ILE B 1 413 ? 10.248  19.252 2.373   1.00 14.37 ? 413 ILE B CD1  1 
ATOM   8096 H H    . ILE B 1 413 ? 6.899   22.113 0.904   1.00 0.00  ? 413 ILE B H    1 
ATOM   8097 N N    . SER B 1 414 ? 6.415   20.158 -2.330  1.00 13.58 ? 414 SER B N    1 
ATOM   8098 C CA   . SER B 1 414 ? 5.172   19.758 -3.015  1.00 12.58 ? 414 SER B CA   1 
ATOM   8099 C C    . SER B 1 414 ? 5.157   18.217 -3.201  1.00 10.56 ? 414 SER B C    1 
ATOM   8100 O O    . SER B 1 414 ? 5.841   17.685 -4.088  1.00 5.01  ? 414 SER B O    1 
ATOM   8101 C CB   . SER B 1 414 ? 5.035   20.472 -4.374  1.00 9.77  ? 414 SER B CB   1 
ATOM   8102 O OG   . SER B 1 414 ? 3.981   19.916 -5.175  1.00 14.58 ? 414 SER B OG   1 
ATOM   8103 H H    . SER B 1 414 ? 7.228   20.302 -2.862  1.00 0.00  ? 414 SER B H    1 
ATOM   8104 H HG   . SER B 1 414 ? 4.182   20.154 -6.095  1.00 0.00  ? 414 SER B HG   1 
ATOM   8105 N N    . THR B 1 415 ? 4.290   17.537 -2.446  1.00 9.43  ? 415 THR B N    1 
ATOM   8106 C CA   . THR B 1 415 ? 4.224   16.080 -2.505  1.00 14.80 ? 415 THR B CA   1 
ATOM   8107 C C    . THR B 1 415 ? 3.186   15.445 -3.471  1.00 17.15 ? 415 THR B C    1 
ATOM   8108 O O    . THR B 1 415 ? 2.779   14.290 -3.249  1.00 18.19 ? 415 THR B O    1 
ATOM   8109 C CB   . THR B 1 415 ? 4.031   15.464 -1.076  1.00 17.35 ? 415 THR B CB   1 
ATOM   8110 O OG1  . THR B 1 415 ? 2.676   15.635 -0.642  1.00 26.15 ? 415 THR B OG1  1 
ATOM   8111 C CG2  . THR B 1 415 ? 4.923   16.138 -0.056  1.00 19.88 ? 415 THR B CG2  1 
ATOM   8112 H H    . THR B 1 415 ? 3.586   17.986 -1.919  1.00 0.00  ? 415 THR B H    1 
ATOM   8113 H HG1  . THR B 1 415 ? 2.669   15.475 0.330   1.00 0.00  ? 415 THR B HG1  1 
ATOM   8114 N N    . GLY B 1 416 ? 2.812   16.161 -4.544  1.00 16.08 ? 416 GLY B N    1 
ATOM   8115 C CA   . GLY B 1 416 ? 1.841   15.646 -5.507  1.00 16.91 ? 416 GLY B CA   1 
ATOM   8116 C C    . GLY B 1 416 ? 0.952   16.747 -6.071  1.00 19.13 ? 416 GLY B C    1 
ATOM   8117 O O    . GLY B 1 416 ? 1.078   17.880 -5.642  1.00 21.08 ? 416 GLY B O    1 
ATOM   8118 H H    . GLY B 1 416 ? 3.161   17.063 -4.678  1.00 0.00  ? 416 GLY B H    1 
ATOM   8119 N N    . PRO B 1 417 ? -0.010  16.456 -6.955  1.00 19.92 ? 417 PRO B N    1 
ATOM   8120 C CA   . PRO B 1 417 ? -0.883  17.493 -7.536  1.00 18.52 ? 417 PRO B CA   1 
ATOM   8121 C C    . PRO B 1 417 ? -2.057  18.095 -6.703  1.00 18.12 ? 417 PRO B C    1 
ATOM   8122 O O    . PRO B 1 417 ? -2.464  19.209 -6.943  1.00 12.47 ? 417 PRO B O    1 
ATOM   8123 C CB   . PRO B 1 417 ? -1.373  16.824 -8.814  1.00 20.12 ? 417 PRO B CB   1 
ATOM   8124 C CG   . PRO B 1 417 ? -1.618  15.393 -8.328  1.00 20.83 ? 417 PRO B CG   1 
ATOM   8125 C CD   . PRO B 1 417 ? -0.371  15.113 -7.457  1.00 18.39 ? 417 PRO B CD   1 
ATOM   8126 N N    . ASP B 1 418 ? -2.625  17.405 -5.733  1.00 20.00 ? 418 ASP B N    1 
ATOM   8127 C CA   . ASP B 1 418 ? -3.701  18.086 -5.026  1.00 21.87 ? 418 ASP B CA   1 
ATOM   8128 C C    . ASP B 1 418 ? -3.124  19.355 -4.347  1.00 21.98 ? 418 ASP B C    1 
ATOM   8129 O O    . ASP B 1 418 ? -1.906  19.448 -4.159  1.00 22.07 ? 418 ASP B O    1 
ATOM   8130 C CB   . ASP B 1 418 ? -4.377  17.180 -4.004  1.00 24.80 ? 418 ASP B CB   1 
ATOM   8131 C CG   . ASP B 1 418 ? -5.591  17.834 -3.380  1.00 28.30 ? 418 ASP B CG   1 
ATOM   8132 O OD1  . ASP B 1 418 ? -6.631  17.872 -4.077  1.00 31.78 ? 418 ASP B OD1  1 
ATOM   8133 O OD2  . ASP B 1 418 ? -5.490  18.348 -2.227  1.00 29.23 ? 418 ASP B OD2  1 
ATOM   8134 H H    . ASP B 1 418 ? -2.339  16.508 -5.453  1.00 0.00  ? 418 ASP B H    1 
ATOM   8135 N N    . ARG B 1 419 ? -3.979  20.341 -4.049  1.00 19.35 ? 419 ARG B N    1 
ATOM   8136 C CA   . ARG B 1 419 ? -3.558  21.578 -3.417  1.00 17.33 ? 419 ARG B CA   1 
ATOM   8137 C C    . ARG B 1 419 ? -2.969  21.328 -2.041  1.00 19.82 ? 419 ARG B C    1 
ATOM   8138 O O    . ARG B 1 419 ? -2.035  22.032 -1.601  1.00 17.61 ? 419 ARG B O    1 
ATOM   8139 C CB   . ARG B 1 419 ? -4.748  22.522 -3.275  1.00 17.46 ? 419 ARG B CB   1 
ATOM   8140 C CG   . ARG B 1 419 ? -5.113  23.362 -4.532  1.00 20.57 ? 419 ARG B CG   1 
ATOM   8141 C CD   . ARG B 1 419 ? -4.135  24.549 -4.887  1.00 19.17 ? 419 ARG B CD   1 
ATOM   8142 N NE   . ARG B 1 419 ? -4.302  24.917 -6.292  1.00 20.23 ? 419 ARG B NE   1 
ATOM   8143 C CZ   . ARG B 1 419 ? -4.969  25.981 -6.727  1.00 22.42 ? 419 ARG B CZ   1 
ATOM   8144 N NH1  . ARG B 1 419 ? -5.412  26.879 -5.857  1.00 26.45 ? 419 ARG B NH1  1 
ATOM   8145 N NH2  . ARG B 1 419 ? -5.123  26.195 -8.037  1.00 24.24 ? 419 ARG B NH2  1 
ATOM   8146 H H    . ARG B 1 419 ? -4.926  20.191 -4.266  1.00 0.00  ? 419 ARG B H    1 
ATOM   8147 H HE   . ARG B 1 419 ? -3.884  24.319 -6.953  1.00 0.00  ? 419 ARG B HE   1 
ATOM   8148 H HH11 . ARG B 1 419 ? -5.258  26.749 -4.877  1.00 0.00  ? 419 ARG B HH11 1 
ATOM   8149 H HH12 . ARG B 1 419 ? -5.909  27.697 -6.126  1.00 0.00  ? 419 ARG B HH12 1 
ATOM   8150 H HH21 . ARG B 1 419 ? -4.737  25.567 -8.715  1.00 0.00  ? 419 ARG B HH21 1 
ATOM   8151 H HH22 . ARG B 1 419 ? -5.609  26.998 -8.377  1.00 0.00  ? 419 ARG B HH22 1 
ATOM   8152 N N    . THR B 1 420 ? -3.515  20.304 -1.379  1.00 20.63 ? 420 THR B N    1 
ATOM   8153 C CA   . THR B 1 420 ? -3.157  19.912 -0.006  1.00 20.91 ? 420 THR B CA   1 
ATOM   8154 C C    . THR B 1 420 ? -1.893  19.043 0.245   1.00 21.57 ? 420 THR B C    1 
ATOM   8155 O O    . THR B 1 420 ? -1.453  18.944 1.393   1.00 22.19 ? 420 THR B O    1 
ATOM   8156 C CB   . THR B 1 420 ? -4.374  19.202 0.690   1.00 18.86 ? 420 THR B CB   1 
ATOM   8157 O OG1  . THR B 1 420 ? -4.618  17.917 0.087   1.00 16.50 ? 420 THR B OG1  1 
ATOM   8158 C CG2  . THR B 1 420 ? -5.618  20.013 0.550   1.00 20.50 ? 420 THR B CG2  1 
ATOM   8159 H H    . THR B 1 420 ? -4.200  19.754 -1.829  1.00 0.00  ? 420 THR B H    1 
ATOM   8160 H HG1  . THR B 1 420 ? -4.992  18.066 -0.824  1.00 0.00  ? 420 THR B HG1  1 
ATOM   8161 N N    . GLU B 1 421 ? -1.361  18.365 -0.773  1.00 19.83 ? 421 GLU B N    1 
ATOM   8162 C CA   . GLU B 1 421 ? -0.169  17.537 -0.583  1.00 20.61 ? 421 GLU B CA   1 
ATOM   8163 C C    . GLU B 1 421 ? 1.028   18.511 -0.731  1.00 21.12 ? 421 GLU B C    1 
ATOM   8164 O O    . GLU B 1 421 ? 1.839   18.439 -1.683  1.00 23.42 ? 421 GLU B O    1 
ATOM   8165 C CB   . GLU B 1 421 ? -0.126  16.414 -1.640  1.00 23.24 ? 421 GLU B CB   1 
ATOM   8166 C CG   . GLU B 1 421 ? -1.486  15.658 -1.892  1.00 23.53 ? 421 GLU B CG   1 
ATOM   8167 C CD   . GLU B 1 421 ? -1.465  14.779 -3.144  1.00 27.48 ? 421 GLU B CD   1 
ATOM   8168 O OE1  . GLU B 1 421 ? -0.372  14.303 -3.540  1.00 32.45 ? 421 GLU B OE1  1 
ATOM   8169 O OE2  . GLU B 1 421 ? -2.535  14.556 -3.751  1.00 25.43 ? 421 GLU B OE2  1 
ATOM   8170 H H    . GLU B 1 421 ? -1.737  18.412 -1.675  1.00 0.00  ? 421 GLU B H    1 
ATOM   8171 N N    . THR B 1 422 ? 1.142   19.417 0.237   1.00 17.85 ? 422 THR B N    1 
ATOM   8172 C CA   . THR B 1 422 ? 2.166   20.407 0.172   1.00 16.24 ? 422 THR B CA   1 
ATOM   8173 C C    . THR B 1 422 ? 2.614   20.816 1.566   1.00 14.97 ? 422 THR B C    1 
ATOM   8174 O O    . THR B 1 422 ? 1.783   21.078 2.448   1.00 12.32 ? 422 THR B O    1 
ATOM   8175 C CB   . THR B 1 422 ? 1.648   21.647 -0.651  1.00 19.76 ? 422 THR B CB   1 
ATOM   8176 O OG1  . THR B 1 422 ? 0.584   21.239 -1.552  1.00 21.37 ? 422 THR B OG1  1 
ATOM   8177 C CG2  . THR B 1 422 ? 2.806   22.279 -1.475  1.00 14.70 ? 422 THR B CG2  1 
ATOM   8178 H H    . THR B 1 422 ? 0.539   19.393 1.007   1.00 0.00  ? 422 THR B H    1 
ATOM   8179 H HG1  . THR B 1 422 ? -0.230  21.762 -1.430  1.00 0.00  ? 422 THR B HG1  1 
ATOM   8180 N N    . MET B 1 423 ? 3.922   20.744 1.792   1.00 13.20 ? 423 MET B N    1 
ATOM   8181 C CA   . MET B 1 423 ? 4.498   21.139 3.063   1.00 10.43 ? 423 MET B CA   1 
ATOM   8182 C C    . MET B 1 423 ? 5.038   22.538 2.877   1.00 11.04 ? 423 MET B C    1 
ATOM   8183 O O    . MET B 1 423 ? 5.841   22.813 1.956   1.00 8.66  ? 423 MET B O    1 
ATOM   8184 C CB   . MET B 1 423 ? 5.604   20.200 3.497   1.00 10.58 ? 423 MET B CB   1 
ATOM   8185 C CG   . MET B 1 423 ? 5.069   19.014 4.332   1.00 10.42 ? 423 MET B CG   1 
ATOM   8186 S SD   . MET B 1 423 ? 6.249   17.657 4.375   1.00 17.35 ? 423 MET B SD   1 
ATOM   8187 C CE   . MET B 1 423 ? 5.974   16.910 2.766   1.00 12.14 ? 423 MET B CE   1 
ATOM   8188 H H    . MET B 1 423 ? 4.501   20.439 1.050   1.00 0.00  ? 423 MET B H    1 
ATOM   8189 N N    . ILE B 1 424 ? 4.433   23.446 3.632   1.00 12.99 ? 424 ILE B N    1 
ATOM   8190 C CA   . ILE B 1 424 ? 4.802   24.836 3.596   1.00 12.41 ? 424 ILE B CA   1 
ATOM   8191 C C    . ILE B 1 424 ? 5.524   25.122 4.856   1.00 12.53 ? 424 ILE B C    1 
ATOM   8192 O O    . ILE B 1 424 ? 4.925   25.387 5.866   1.00 12.73 ? 424 ILE B O    1 
ATOM   8193 C CB   . ILE B 1 424 ? 3.595   25.767 3.416   1.00 10.99 ? 424 ILE B CB   1 
ATOM   8194 C CG1  . ILE B 1 424 ? 3.167   25.770 1.943   1.00 14.47 ? 424 ILE B CG1  1 
ATOM   8195 C CG2  . ILE B 1 424 ? 3.967   27.169 3.782   1.00 11.95 ? 424 ILE B CG2  1 
ATOM   8196 C CD1  . ILE B 1 424 ? 1.933   26.653 1.635   1.00 11.15 ? 424 ILE B CD1  1 
ATOM   8197 H H    . ILE B 1 424 ? 3.718   23.165 4.242   1.00 0.00  ? 424 ILE B H    1 
ATOM   8198 N N    . LEU B 1 425 ? 6.837   25.015 4.783   1.00 16.56 ? 425 LEU B N    1 
ATOM   8199 C CA   . LEU B 1 425 ? 7.682   25.289 5.920   1.00 16.50 ? 425 LEU B CA   1 
ATOM   8200 C C    . LEU B 1 425 ? 7.825   26.807 6.236   1.00 18.86 ? 425 LEU B C    1 
ATOM   8201 O O    . LEU B 1 425 ? 8.083   27.194 7.387   1.00 19.83 ? 425 LEU B O    1 
ATOM   8202 C CB   . LEU B 1 425 ? 9.014   24.613 5.681   1.00 13.15 ? 425 LEU B CB   1 
ATOM   8203 C CG   . LEU B 1 425 ? 8.738   23.122 5.972   1.00 17.02 ? 425 LEU B CG   1 
ATOM   8204 C CD1  . LEU B 1 425 ? 9.856   22.265 5.369   1.00 16.53 ? 425 LEU B CD1  1 
ATOM   8205 C CD2  . LEU B 1 425 ? 8.603   22.872 7.539   1.00 13.48 ? 425 LEU B CD2  1 
ATOM   8206 H H    . LEU B 1 425 ? 7.256   24.810 3.919   1.00 0.00  ? 425 LEU B H    1 
ATOM   8207 N N    . ARG B 1 426 ? 7.580   27.656 5.230   1.00 20.55 ? 426 ARG B N    1 
ATOM   8208 C CA   . ARG B 1 426 ? 7.714   29.100 5.412   1.00 22.34 ? 426 ARG B CA   1 
ATOM   8209 C C    . ARG B 1 426 ? 6.627   30.016 4.860   1.00 25.20 ? 426 ARG B C    1 
ATOM   8210 O O    . ARG B 1 426 ? 6.177   30.905 5.561   1.00 30.69 ? 426 ARG B O    1 
ATOM   8211 C CB   . ARG B 1 426 ? 9.047   29.550 4.851   1.00 24.55 ? 426 ARG B CB   1 
ATOM   8212 C CG   . ARG B 1 426 ? 9.362   30.992 5.060   1.00 25.91 ? 426 ARG B CG   1 
ATOM   8213 C CD   . ARG B 1 426 ? 10.211  31.135 6.265   1.00 28.47 ? 426 ARG B CD   1 
ATOM   8214 N NE   . ARG B 1 426 ? 11.164  32.223 6.130   1.00 29.22 ? 426 ARG B NE   1 
ATOM   8215 C CZ   . ARG B 1 426 ? 12.348  32.082 5.549   1.00 29.84 ? 426 ARG B CZ   1 
ATOM   8216 N NH1  . ARG B 1 426 ? 12.677  30.911 5.033   1.00 31.26 ? 426 ARG B NH1  1 
ATOM   8217 N NH2  . ARG B 1 426 ? 13.255  33.048 5.624   1.00 27.25 ? 426 ARG B NH2  1 
ATOM   8218 H H    . ARG B 1 426 ? 7.346   27.274 4.358   1.00 0.00  ? 426 ARG B H    1 
ATOM   8219 H HE   . ARG B 1 426 ? 10.899  33.103 6.475   1.00 0.00  ? 426 ARG B HE   1 
ATOM   8220 H HH11 . ARG B 1 426 ? 12.096  30.089 5.087   1.00 0.00  ? 426 ARG B HH11 1 
ATOM   8221 H HH12 . ARG B 1 426 ? 13.568  30.793 4.606   1.00 0.00  ? 426 ARG B HH12 1 
ATOM   8222 H HH21 . ARG B 1 426 ? 13.086  33.912 6.102   1.00 0.00  ? 426 ARG B HH21 1 
ATOM   8223 H HH22 . ARG B 1 426 ? 14.132  32.936 5.145   1.00 0.00  ? 426 ARG B HH22 1 
ATOM   8224 N N    . ASP B 1 427 ? 6.183   29.808 3.633   1.00 23.89 ? 427 ASP B N    1 
ATOM   8225 C CA   . ASP B 1 427 ? 5.167   30.710 3.031   1.00 26.07 ? 427 ASP B CA   1 
ATOM   8226 C C    . ASP B 1 427 ? 5.911   31.972 2.627   1.00 23.98 ? 427 ASP B C    1 
ATOM   8227 O O    . ASP B 1 427 ? 6.151   32.861 3.444   1.00 25.22 ? 427 ASP B O    1 
ATOM   8228 C CB   . ASP B 1 427 ? 3.971   31.062 3.952   1.00 23.15 ? 427 ASP B CB   1 
ATOM   8229 C CG   . ASP B 1 427 ? 2.931   32.030 3.274   1.00 22.33 ? 427 ASP B CG   1 
ATOM   8230 O OD1  . ASP B 1 427 ? 2.613   31.962 2.064   1.00 21.43 ? 427 ASP B OD1  1 
ATOM   8231 O OD2  . ASP B 1 427 ? 2.389   32.882 3.982   1.00 24.82 ? 427 ASP B OD2  1 
ATOM   8232 H H    . ASP B 1 427 ? 6.538   29.054 3.122   1.00 0.00  ? 427 ASP B H    1 
ATOM   8233 N N    . PRO B 1 428 ? 6.243   32.070 1.330   1.00 23.10 ? 428 PRO B N    1 
ATOM   8234 C CA   . PRO B 1 428 ? 6.972   33.159 0.670   1.00 22.57 ? 428 PRO B CA   1 
ATOM   8235 C C    . PRO B 1 428 ? 6.423   34.566 0.920   1.00 21.85 ? 428 PRO B C    1 
ATOM   8236 O O    . PRO B 1 428 ? 7.207   35.497 1.064   1.00 20.59 ? 428 PRO B O    1 
ATOM   8237 C CB   . PRO B 1 428 ? 6.899   32.770 -0.814  1.00 23.61 ? 428 PRO B CB   1 
ATOM   8238 C CG   . PRO B 1 428 ? 6.625   31.235 -0.761  1.00 25.28 ? 428 PRO B CG   1 
ATOM   8239 C CD   . PRO B 1 428 ? 5.636   31.167 0.334   1.00 24.08 ? 428 PRO B CD   1 
ATOM   8240 N N    . PHE B 1 429 ? 5.095   34.718 0.956   1.00 23.24 ? 429 PHE B N    1 
ATOM   8241 C CA   . PHE B 1 429 ? 4.462   36.027 1.191   1.00 25.49 ? 429 PHE B CA   1 
ATOM   8242 C C    . PHE B 1 429 ? 4.641   36.545 2.623   1.00 28.05 ? 429 PHE B C    1 
ATOM   8243 O O    . PHE B 1 429 ? 4.751   37.763 2.873   1.00 26.96 ? 429 PHE B O    1 
ATOM   8244 C CB   . PHE B 1 429 ? 2.962   35.979 0.863   1.00 23.91 ? 429 PHE B CB   1 
ATOM   8245 C CG   . PHE B 1 429 ? 2.656   36.050 -0.608  1.00 23.39 ? 429 PHE B CG   1 
ATOM   8246 C CD1  . PHE B 1 429 ? 3.042   37.151 -1.357  1.00 22.88 ? 429 PHE B CD1  1 
ATOM   8247 C CD2  . PHE B 1 429 ? 1.992   35.014 -1.245  1.00 23.42 ? 429 PHE B CD2  1 
ATOM   8248 C CE1  . PHE B 1 429 ? 2.775   37.232 -2.722  1.00 21.24 ? 429 PHE B CE1  1 
ATOM   8249 C CE2  . PHE B 1 429 ? 1.712   35.079 -2.637  1.00 24.64 ? 429 PHE B CE2  1 
ATOM   8250 C CZ   . PHE B 1 429 ? 2.104   36.188 -3.367  1.00 19.95 ? 429 PHE B CZ   1 
ATOM   8251 H H    . PHE B 1 429 ? 4.517   33.933 0.842   1.00 0.00  ? 429 PHE B H    1 
ATOM   8252 N N    . ASP B 1 430 ? 4.744   35.609 3.551   1.00 30.06 ? 430 ASP B N    1 
ATOM   8253 C CA   . ASP B 1 430 ? 4.869   35.937 4.945   1.00 33.65 ? 430 ASP B CA   1 
ATOM   8254 C C    . ASP B 1 430 ? 6.254   36.140 5.491   1.00 36.46 ? 430 ASP B C    1 
ATOM   8255 O O    . ASP B 1 430 ? 6.405   36.849 6.480   1.00 36.68 ? 430 ASP B O    1 
ATOM   8256 C CB   . ASP B 1 430 ? 4.196   34.866 5.758   1.00 35.00 ? 430 ASP B CB   1 
ATOM   8257 C CG   . ASP B 1 430 ? 3.200   35.425 6.716   1.00 36.06 ? 430 ASP B CG   1 
ATOM   8258 O OD1  . ASP B 1 430 ? 2.839   36.630 6.594   1.00 32.37 ? 430 ASP B OD1  1 
ATOM   8259 O OD2  . ASP B 1 430 ? 2.782   34.639 7.596   1.00 37.60 ? 430 ASP B OD2  1 
ATOM   8260 H H    . ASP B 1 430 ? 4.735   34.651 3.333   1.00 0.00  ? 430 ASP B H    1 
ATOM   8261 N N    . ALA B 1 431 ? 7.241   35.458 4.907   1.00 39.71 ? 431 ALA B N    1 
ATOM   8262 C CA   . ALA B 1 431 ? 8.640   35.549 5.330   1.00 39.32 ? 431 ALA B CA   1 
ATOM   8263 C C    . ALA B 1 431 ? 9.225   36.943 5.124   1.00 42.52 ? 431 ALA B C    1 
ATOM   8264 O O    . ALA B 1 431 ? 8.877   37.555 4.079   1.00 44.76 ? 431 ALA B O    1 
ATOM   8265 C CB   . ALA B 1 431 ? 9.459   34.546 4.583   1.00 37.95 ? 431 ALA B CB   1 
ATOM   8266 O OXT  . ALA B 1 431 ? 10.051  37.386 5.974   1.00 42.52 ? 431 ALA B OXT  1 
ATOM   8267 H H    . ALA B 1 431 ? 6.980   34.812 4.223   1.00 0.00  ? 431 ALA B H    1 
HETATM 8268 O O    . HOH C 2 .   ? 19.437  63.868 3.341   1.00 22.78 ? 432 HOH A O    1 
HETATM 8269 H H1   . HOH C 2 .   ? 19.272  64.317 2.497   1.00 0.00  ? 432 HOH A H1   1 
HETATM 8270 H H2   . HOH C 2 .   ? 19.654  62.988 3.019   1.00 0.00  ? 432 HOH A H2   1 
HETATM 8271 O O    . HOH C 2 .   ? 38.776  37.553 -4.231  1.00 46.15 ? 433 HOH A O    1 
HETATM 8272 H H1   . HOH C 2 .   ? 38.646  37.349 -5.164  1.00 0.00  ? 433 HOH A H1   1 
HETATM 8273 H H2   . HOH C 2 .   ? 39.738  37.680 -4.180  1.00 0.00  ? 433 HOH A H2   1 
HETATM 8274 O O    . HOH C 2 .   ? 13.037  64.278 2.550   1.00 16.54 ? 434 HOH A O    1 
HETATM 8275 H H1   . HOH C 2 .   ? 13.779  64.885 2.447   1.00 0.00  ? 434 HOH A H1   1 
HETATM 8276 H H2   . HOH C 2 .   ? 12.311  64.877 2.323   1.00 0.00  ? 434 HOH A H2   1 
HETATM 8277 O O    . HOH C 2 .   ? 2.202   72.024 -26.836 1.00 43.12 ? 435 HOH A O    1 
HETATM 8278 H H1   . HOH C 2 .   ? 1.593   71.694 -26.173 1.00 0.00  ? 435 HOH A H1   1 
HETATM 8279 H H2   . HOH C 2 .   ? 2.327   71.212 -27.356 1.00 0.00  ? 435 HOH A H2   1 
HETATM 8280 O O    . HOH C 2 .   ? 20.041  63.965 -25.505 1.00 22.01 ? 436 HOH A O    1 
HETATM 8281 H H1   . HOH C 2 .   ? 19.975  63.832 -24.556 1.00 0.00  ? 436 HOH A H1   1 
HETATM 8282 H H2   . HOH C 2 .   ? 21.009  63.871 -25.640 1.00 0.00  ? 436 HOH A H2   1 
HETATM 8283 O O    . HOH C 2 .   ? 38.756  59.065 -27.882 1.00 44.38 ? 437 HOH A O    1 
HETATM 8284 H H1   . HOH C 2 .   ? 39.167  59.862 -27.537 1.00 0.00  ? 437 HOH A H1   1 
HETATM 8285 H H2   . HOH C 2 .   ? 38.744  58.469 -27.117 1.00 0.00  ? 437 HOH A H2   1 
HETATM 8286 O O    . HOH C 2 .   ? -8.501  71.446 -14.557 1.00 32.75 ? 438 HOH A O    1 
HETATM 8287 H H1   . HOH C 2 .   ? -8.395  71.061 -15.435 1.00 0.00  ? 438 HOH A H1   1 
HETATM 8288 H H2   . HOH C 2 .   ? -7.712  71.102 -14.126 1.00 0.00  ? 438 HOH A H2   1 
HETATM 8289 O O    . HOH C 2 .   ? 20.008  46.689 -22.442 1.00 42.94 ? 439 HOH A O    1 
HETATM 8290 H H1   . HOH C 2 .   ? 19.723  46.288 -21.614 1.00 0.00  ? 439 HOH A H1   1 
HETATM 8291 H H2   . HOH C 2 .   ? 20.407  45.912 -22.889 1.00 0.00  ? 439 HOH A H2   1 
HETATM 8292 O O    . HOH C 2 .   ? 40.022  57.551 -25.463 1.00 11.53 ? 440 HOH A O    1 
HETATM 8293 H H1   . HOH C 2 .   ? 40.794  57.119 -25.062 1.00 0.00  ? 440 HOH A H1   1 
HETATM 8294 H H2   . HOH C 2 .   ? 39.713  58.049 -24.689 1.00 0.00  ? 440 HOH A H2   1 
HETATM 8295 O O    . HOH C 2 .   ? 22.812  63.328 -25.567 1.00 50.28 ? 441 HOH A O    1 
HETATM 8296 H H1   . HOH C 2 .   ? 23.025  63.935 -24.842 1.00 0.00  ? 441 HOH A H1   1 
HETATM 8297 H H2   . HOH C 2 .   ? 23.599  63.402 -26.120 1.00 0.00  ? 441 HOH A H2   1 
HETATM 8298 O O    . HOH C 2 .   ? 21.008  40.356 -24.243 1.00 48.01 ? 442 HOH A O    1 
HETATM 8299 H H1   . HOH C 2 .   ? 20.179  40.355 -24.732 1.00 0.00  ? 442 HOH A H1   1 
HETATM 8300 H H2   . HOH C 2 .   ? 20.728  40.074 -23.365 1.00 0.00  ? 442 HOH A H2   1 
HETATM 8301 O O    . HOH C 2 .   ? 32.605  37.621 -46.106 1.00 21.02 ? 443 HOH A O    1 
HETATM 8302 H H1   . HOH C 2 .   ? 33.268  37.023 -45.729 1.00 0.00  ? 443 HOH A H1   1 
HETATM 8303 H H2   . HOH C 2 .   ? 33.140  38.300 -46.514 1.00 0.00  ? 443 HOH A H2   1 
HETATM 8304 O O    . HOH C 2 .   ? 24.233  51.462 -32.055 1.00 20.93 ? 444 HOH A O    1 
HETATM 8305 H H1   . HOH C 2 .   ? 24.298  51.501 -33.025 1.00 0.00  ? 444 HOH A H1   1 
HETATM 8306 H H2   . HOH C 2 .   ? 24.271  52.407 -31.824 1.00 0.00  ? 444 HOH A H2   1 
HETATM 8307 O O    . HOH C 2 .   ? 41.541  53.105 -3.427  1.00 15.86 ? 445 HOH A O    1 
HETATM 8308 H H1   . HOH C 2 .   ? 41.062  52.271 -3.388  1.00 0.00  ? 445 HOH A H1   1 
HETATM 8309 H H2   . HOH C 2 .   ? 40.834  53.713 -3.146  1.00 0.00  ? 445 HOH A H2   1 
HETATM 8310 O O    . HOH C 2 .   ? 38.685  56.169 -27.379 1.00 26.19 ? 446 HOH A O    1 
HETATM 8311 H H1   . HOH C 2 .   ? 39.137  56.536 -26.595 1.00 0.00  ? 446 HOH A H1   1 
HETATM 8312 H H2   . HOH C 2 .   ? 38.218  55.429 -26.970 1.00 0.00  ? 446 HOH A H2   1 
HETATM 8313 O O    . HOH C 2 .   ? 19.589  44.842 -10.991 1.00 5.01  ? 447 HOH A O    1 
HETATM 8314 H H1   . HOH C 2 .   ? 19.748  45.437 -10.251 1.00 0.00  ? 447 HOH A H1   1 
HETATM 8315 H H2   . HOH C 2 .   ? 18.712  44.492 -10.797 1.00 0.00  ? 447 HOH A H2   1 
HETATM 8316 O O    . HOH C 2 .   ? 43.471  45.036 -5.065  1.00 25.04 ? 448 HOH A O    1 
HETATM 8317 H H1   . HOH C 2 .   ? 44.363  44.655 -5.158  1.00 0.00  ? 448 HOH A H1   1 
HETATM 8318 H H2   . HOH C 2 .   ? 43.709  45.973 -5.034  1.00 0.00  ? 448 HOH A H2   1 
HETATM 8319 O O    . HOH C 2 .   ? 23.551  59.869 -21.708 1.00 33.19 ? 449 HOH A O    1 
HETATM 8320 H H1   . HOH C 2 .   ? 23.213  59.910 -22.613 1.00 0.00  ? 449 HOH A H1   1 
HETATM 8321 H H2   . HOH C 2 .   ? 24.311  59.268 -21.808 1.00 0.00  ? 449 HOH A H2   1 
HETATM 8322 O O    . HOH C 2 .   ? 29.728  71.797 -18.665 1.00 21.20 ? 450 HOH A O    1 
HETATM 8323 H H1   . HOH C 2 .   ? 28.940  72.234 -19.008 1.00 0.00  ? 450 HOH A H1   1 
HETATM 8324 H H2   . HOH C 2 .   ? 30.375  71.952 -19.364 1.00 0.00  ? 450 HOH A H2   1 
HETATM 8325 O O    . HOH C 2 .   ? 31.463  78.029 -14.295 1.00 31.02 ? 451 HOH A O    1 
HETATM 8326 H H1   . HOH C 2 .   ? 31.905  78.629 -13.692 1.00 0.00  ? 451 HOH A H1   1 
HETATM 8327 H H2   . HOH C 2 .   ? 31.295  78.599 -15.074 1.00 0.00  ? 451 HOH A H2   1 
HETATM 8328 O O    . HOH C 2 .   ? 35.489  47.842 0.728   1.00 14.45 ? 452 HOH A O    1 
HETATM 8329 H H1   . HOH C 2 .   ? 36.376  47.448 0.603   1.00 0.00  ? 452 HOH A H1   1 
HETATM 8330 H H2   . HOH C 2 .   ? 35.658  48.399 1.490   1.00 0.00  ? 452 HOH A H2   1 
HETATM 8331 O O    . HOH C 2 .   ? 29.742  57.989 -28.626 1.00 55.65 ? 453 HOH A O    1 
HETATM 8332 H H1   . HOH C 2 .   ? 30.613  58.403 -28.627 1.00 0.00  ? 453 HOH A H1   1 
HETATM 8333 H H2   . HOH C 2 .   ? 29.641  57.783 -27.688 1.00 0.00  ? 453 HOH A H2   1 
HETATM 8334 O O    . HOH C 2 .   ? 5.180   68.988 -25.843 1.00 52.15 ? 454 HOH A O    1 
HETATM 8335 H H1   . HOH C 2 .   ? 4.769   68.238 -25.399 1.00 0.00  ? 454 HOH A H1   1 
HETATM 8336 H H2   . HOH C 2 .   ? 4.460   69.642 -25.813 1.00 0.00  ? 454 HOH A H2   1 
HETATM 8337 O O    . HOH C 2 .   ? 16.153  42.967 -1.567  1.00 16.30 ? 455 HOH A O    1 
HETATM 8338 H H1   . HOH C 2 .   ? 15.196  43.051 -1.597  1.00 0.00  ? 455 HOH A H1   1 
HETATM 8339 H H2   . HOH C 2 .   ? 16.442  43.832 -1.902  1.00 0.00  ? 455 HOH A H2   1 
HETATM 8340 O O    . HOH C 2 .   ? 30.338  52.598 7.676   1.00 41.39 ? 456 HOH A O    1 
HETATM 8341 H H1   . HOH C 2 .   ? 29.415  52.498 7.379   1.00 0.00  ? 456 HOH A H1   1 
HETATM 8342 H H2   . HOH C 2 .   ? 30.430  53.551 7.586   1.00 0.00  ? 456 HOH A H2   1 
HETATM 8343 O O    . HOH C 2 .   ? 17.358  44.888 -24.057 1.00 5.01  ? 457 HOH A O    1 
HETATM 8344 H H1   . HOH C 2 .   ? 17.175  44.967 -23.108 1.00 0.00  ? 457 HOH A H1   1 
HETATM 8345 H H2   . HOH C 2 .   ? 17.908  45.664 -24.189 1.00 0.00  ? 457 HOH A H2   1 
HETATM 8346 O O    . HOH C 2 .   ? 44.557  57.857 -6.440  1.00 40.11 ? 458 HOH A O    1 
HETATM 8347 H H1   . HOH C 2 .   ? 45.161  57.914 -5.698  1.00 0.00  ? 458 HOH A H1   1 
HETATM 8348 H H2   . HOH C 2 .   ? 45.080  57.329 -7.063  1.00 0.00  ? 458 HOH A H2   1 
HETATM 8349 O O    . HOH C 2 .   ? 37.468  33.226 -12.935 1.00 42.19 ? 459 HOH A O    1 
HETATM 8350 H H1   . HOH C 2 .   ? 38.347  32.857 -13.085 1.00 0.00  ? 459 HOH A H1   1 
HETATM 8351 H H2   . HOH C 2 .   ? 37.013  32.446 -12.564 1.00 0.00  ? 459 HOH A H2   1 
HETATM 8352 O O    . HOH C 2 .   ? -0.435  71.577 -6.917  1.00 19.04 ? 460 HOH A O    1 
HETATM 8353 H H1   . HOH C 2 .   ? 0.079   72.185 -7.484  1.00 0.00  ? 460 HOH A H1   1 
HETATM 8354 H H2   . HOH C 2 .   ? -0.772  70.938 -7.539  1.00 0.00  ? 460 HOH A H2   1 
HETATM 8355 O O    . HOH C 2 .   ? 44.294  42.910 -14.630 1.00 42.86 ? 461 HOH A O    1 
HETATM 8356 H H1   . HOH C 2 .   ? 43.464  42.747 -15.100 1.00 0.00  ? 461 HOH A H1   1 
HETATM 8357 H H2   . HOH C 2 .   ? 44.946  42.658 -15.295 1.00 0.00  ? 461 HOH A H2   1 
HETATM 8358 O O    . HOH C 2 .   ? 38.085  47.019 1.005   1.00 44.66 ? 462 HOH A O    1 
HETATM 8359 H H1   . HOH C 2 .   ? 38.050  46.077 0.775   1.00 0.00  ? 462 HOH A H1   1 
HETATM 8360 H H2   . HOH C 2 .   ? 39.020  47.261 0.858   1.00 0.00  ? 462 HOH A H2   1 
HETATM 8361 O O    . HOH C 2 .   ? 7.648   77.774 -18.270 1.00 37.99 ? 463 HOH A O    1 
HETATM 8362 H H1   . HOH C 2 .   ? 7.445   77.729 -19.222 1.00 0.00  ? 463 HOH A H1   1 
HETATM 8363 H H2   . HOH C 2 .   ? 8.050   76.897 -18.206 1.00 0.00  ? 463 HOH A H2   1 
HETATM 8364 O O    . HOH C 2 .   ? 8.685   56.962 -21.175 1.00 64.17 ? 464 HOH A O    1 
HETATM 8365 H H1   . HOH C 2 .   ? 9.063   56.076 -21.234 1.00 0.00  ? 464 HOH A H1   1 
HETATM 8366 H H2   . HOH C 2 .   ? 7.915   56.824 -20.617 1.00 0.00  ? 464 HOH A H2   1 
HETATM 8367 O O    . HOH C 2 .   ? 17.531  88.064 -8.643  1.00 25.94 ? 465 HOH A O    1 
HETATM 8368 H H1   . HOH C 2 .   ? 17.047  87.226 -8.700  1.00 0.00  ? 465 HOH A H1   1 
HETATM 8369 H H2   . HOH C 2 .   ? 17.685  88.270 -9.571  1.00 0.00  ? 465 HOH A H2   1 
HETATM 8370 O O    . HOH C 2 .   ? 30.051  32.375 -30.186 1.00 27.89 ? 466 HOH A O    1 
HETATM 8371 H H1   . HOH C 2 .   ? 30.877  32.564 -29.711 1.00 0.00  ? 466 HOH A H1   1 
HETATM 8372 H H2   . HOH C 2 .   ? 29.805  33.249 -30.527 1.00 0.00  ? 466 HOH A H2   1 
HETATM 8373 O O    . HOH C 2 .   ? 53.923  58.185 -23.560 1.00 15.44 ? 467 HOH A O    1 
HETATM 8374 H H1   . HOH C 2 .   ? 53.553  57.678 -24.308 1.00 0.00  ? 467 HOH A H1   1 
HETATM 8375 H H2   . HOH C 2 .   ? 54.703  57.662 -23.342 1.00 0.00  ? 467 HOH A H2   1 
HETATM 8376 O O    . HOH C 2 .   ? 29.067  68.788 -10.701 1.00 41.07 ? 468 HOH A O    1 
HETATM 8377 H H1   . HOH C 2 .   ? 29.616  69.291 -11.313 1.00 0.00  ? 468 HOH A H1   1 
HETATM 8378 H H2   . HOH C 2 .   ? 28.248  69.300 -10.707 1.00 0.00  ? 468 HOH A H2   1 
HETATM 8379 O O    . HOH C 2 .   ? 26.342  40.005 -55.923 1.00 19.04 ? 469 HOH A O    1 
HETATM 8380 H H1   . HOH C 2 .   ? 25.682  40.583 -55.514 1.00 0.00  ? 469 HOH A H1   1 
HETATM 8381 H H2   . HOH C 2 .   ? 27.115  40.187 -55.387 1.00 0.00  ? 469 HOH A H2   1 
HETATM 8382 O O    . HOH C 2 .   ? 8.574   71.357 -26.448 1.00 5.01  ? 470 HOH A O    1 
HETATM 8383 H H1   . HOH C 2 .   ? 9.494   71.674 -26.400 1.00 0.00  ? 470 HOH A H1   1 
HETATM 8384 H H2   . HOH C 2 .   ? 8.211   71.703 -25.631 1.00 0.00  ? 470 HOH A H2   1 
HETATM 8385 O O    . HOH C 2 .   ? 22.814  86.078 -22.666 1.00 30.44 ? 471 HOH A O    1 
HETATM 8386 H H1   . HOH C 2 .   ? 22.542  86.944 -22.339 1.00 0.00  ? 471 HOH A H1   1 
HETATM 8387 H H2   . HOH C 2 .   ? 21.956  85.674 -22.865 1.00 0.00  ? 471 HOH A H2   1 
HETATM 8388 O O    . HOH C 2 .   ? 13.831  66.224 -15.602 1.00 52.69 ? 472 HOH A O    1 
HETATM 8389 H H1   . HOH C 2 .   ? 13.013  66.554 -15.988 1.00 0.00  ? 472 HOH A H1   1 
HETATM 8390 H H2   . HOH C 2 .   ? 13.571  65.364 -15.249 1.00 0.00  ? 472 HOH A H2   1 
HETATM 8391 O O    . HOH C 2 .   ? 3.746   63.181 -6.628  1.00 35.19 ? 473 HOH A O    1 
HETATM 8392 H H1   . HOH C 2 .   ? 4.574   62.872 -6.244  1.00 0.00  ? 473 HOH A H1   1 
HETATM 8393 H H2   . HOH C 2 .   ? 3.506   63.893 -6.006  1.00 0.00  ? 473 HOH A H2   1 
HETATM 8394 O O    . HOH C 2 .   ? 40.595  61.735 -3.967  1.00 17.75 ? 474 HOH A O    1 
HETATM 8395 H H1   . HOH C 2 .   ? 40.294  61.212 -3.217  1.00 0.00  ? 474 HOH A H1   1 
HETATM 8396 H H2   . HOH C 2 .   ? 39.773  62.163 -4.237  1.00 0.00  ? 474 HOH A H2   1 
HETATM 8397 O O    . HOH C 2 .   ? 42.510  32.835 -43.085 1.00 42.24 ? 475 HOH A O    1 
HETATM 8398 H H1   . HOH C 2 .   ? 42.361  33.751 -43.389 1.00 0.00  ? 475 HOH A H1   1 
HETATM 8399 H H2   . HOH C 2 .   ? 42.376  32.927 -42.134 1.00 0.00  ? 475 HOH A H2   1 
HETATM 8400 O O    . HOH C 2 .   ? 0.374   76.516 -10.189 1.00 66.79 ? 476 HOH A O    1 
HETATM 8401 H H1   . HOH C 2 .   ? -0.228  75.923 -9.720  1.00 0.00  ? 476 HOH A H1   1 
HETATM 8402 H H2   . HOH C 2 .   ? 1.102   75.921 -10.419 1.00 0.00  ? 476 HOH A H2   1 
HETATM 8403 O O    . HOH C 2 .   ? 8.172   54.552 -18.508 1.00 30.57 ? 477 HOH A O    1 
HETATM 8404 H H1   . HOH C 2 .   ? 8.304   54.034 -19.307 1.00 0.00  ? 477 HOH A H1   1 
HETATM 8405 H H2   . HOH C 2 .   ? 9.016   55.024 -18.491 1.00 0.00  ? 477 HOH A H2   1 
HETATM 8406 O O    . HOH C 2 .   ? 35.284  55.830 -18.110 1.00 14.00 ? 478 HOH A O    1 
HETATM 8407 H H1   . HOH C 2 .   ? 35.134  54.903 -18.290 1.00 0.00  ? 478 HOH A H1   1 
HETATM 8408 H H2   . HOH C 2 .   ? 36.241  55.874 -18.200 1.00 0.00  ? 478 HOH A H2   1 
HETATM 8409 O O    . HOH C 2 .   ? -4.980  73.348 -12.961 1.00 62.03 ? 479 HOH A O    1 
HETATM 8410 H H1   . HOH C 2 .   ? -5.451  72.698 -13.508 1.00 0.00  ? 479 HOH A H1   1 
HETATM 8411 H H2   . HOH C 2 .   ? -4.540  72.752 -12.339 1.00 0.00  ? 479 HOH A H2   1 
HETATM 8412 O O    . HOH C 2 .   ? 14.433  91.048 -8.330  1.00 16.94 ? 480 HOH A O    1 
HETATM 8413 H H1   . HOH C 2 .   ? 14.915  90.571 -7.617  1.00 0.00  ? 480 HOH A H1   1 
HETATM 8414 H H2   . HOH C 2 .   ? 15.075  91.735 -8.529  1.00 0.00  ? 480 HOH A H2   1 
HETATM 8415 O O    . HOH C 2 .   ? 36.480  76.177 -5.241  1.00 14.53 ? 481 HOH A O    1 
HETATM 8416 H H1   . HOH C 2 .   ? 36.242  75.368 -5.724  1.00 0.00  ? 481 HOH A H1   1 
HETATM 8417 H H2   . HOH C 2 .   ? 35.598  76.527 -5.055  1.00 0.00  ? 481 HOH A H2   1 
HETATM 8418 O O    . HOH C 2 .   ? 40.241  48.743 0.456   1.00 31.19 ? 482 HOH A O    1 
HETATM 8419 H H1   . HOH C 2 .   ? 39.506  49.366 0.590   1.00 0.00  ? 482 HOH A H1   1 
HETATM 8420 H H2   . HOH C 2 .   ? 40.651  49.092 -0.342  1.00 0.00  ? 482 HOH A H2   1 
HETATM 8421 O O    . HOH C 2 .   ? 13.411  82.765 1.518   1.00 33.17 ? 483 HOH A O    1 
HETATM 8422 H H1   . HOH C 2 .   ? 13.446  83.163 2.403   1.00 0.00  ? 483 HOH A H1   1 
HETATM 8423 H H2   . HOH C 2 .   ? 12.887  83.414 1.036   1.00 0.00  ? 483 HOH A H2   1 
HETATM 8424 O O    . HOH C 2 .   ? 52.123  60.151 -23.099 1.00 28.47 ? 484 HOH A O    1 
HETATM 8425 H H1   . HOH C 2 .   ? 52.723  59.387 -23.245 1.00 0.00  ? 484 HOH A H1   1 
HETATM 8426 H H2   . HOH C 2 .   ? 52.757  60.868 -23.017 1.00 0.00  ? 484 HOH A H2   1 
HETATM 8427 O O    . HOH C 2 .   ? 29.543  60.969 -16.791 1.00 18.81 ? 485 HOH A O    1 
HETATM 8428 H H1   . HOH C 2 .   ? 29.760  61.064 -17.735 1.00 0.00  ? 485 HOH A H1   1 
HETATM 8429 H H2   . HOH C 2 .   ? 30.335  61.404 -16.418 1.00 0.00  ? 485 HOH A H2   1 
HETATM 8430 O O    . HOH C 2 .   ? 32.281  63.422 -17.538 1.00 41.25 ? 486 HOH A O    1 
HETATM 8431 H H1   . HOH C 2 .   ? 32.318  64.302 -17.129 1.00 0.00  ? 486 HOH A H1   1 
HETATM 8432 H H2   . HOH C 2 .   ? 32.139  63.642 -18.468 1.00 0.00  ? 486 HOH A H2   1 
HETATM 8433 O O    . HOH C 2 .   ? 28.571  72.769 -16.284 1.00 23.53 ? 487 HOH A O    1 
HETATM 8434 H H1   . HOH C 2 .   ? 29.259  72.421 -16.871 1.00 0.00  ? 487 HOH A H1   1 
HETATM 8435 H H2   . HOH C 2 .   ? 28.943  73.632 -16.058 1.00 0.00  ? 487 HOH A H2   1 
HETATM 8436 O O    . HOH C 2 .   ? 28.991  38.399 -34.747 1.00 13.82 ? 488 HOH A O    1 
HETATM 8437 H H1   . HOH C 2 .   ? 28.174  38.057 -35.111 1.00 0.00  ? 488 HOH A H1   1 
HETATM 8438 H H2   . HOH C 2 .   ? 28.651  39.093 -34.171 1.00 0.00  ? 488 HOH A H2   1 
HETATM 8439 O O    . HOH C 2 .   ? 28.092  29.877 -31.121 1.00 27.00 ? 489 HOH A O    1 
HETATM 8440 H H1   . HOH C 2 .   ? 27.260  29.919 -31.593 1.00 0.00  ? 489 HOH A H1   1 
HETATM 8441 H H2   . HOH C 2 .   ? 28.267  30.811 -30.895 1.00 0.00  ? 489 HOH A H2   1 
HETATM 8442 O O    . HOH C 2 .   ? 15.880  60.146 -30.452 1.00 50.65 ? 490 HOH A O    1 
HETATM 8443 H H1   . HOH C 2 .   ? 16.542  59.763 -29.843 1.00 0.00  ? 490 HOH A H1   1 
HETATM 8444 H H2   . HOH C 2 .   ? 15.905  61.073 -30.202 1.00 0.00  ? 490 HOH A H2   1 
HETATM 8445 O O    . HOH C 2 .   ? 25.753  68.953 -17.668 1.00 30.47 ? 491 HOH A O    1 
HETATM 8446 H H1   . HOH C 2 .   ? 25.308  68.120 -17.470 1.00 0.00  ? 491 HOH A H1   1 
HETATM 8447 H H2   . HOH C 2 .   ? 26.677  68.765 -17.475 1.00 0.00  ? 491 HOH A H2   1 
HETATM 8448 O O    . HOH C 2 .   ? 17.869  49.712 4.697   1.00 27.14 ? 492 HOH A O    1 
HETATM 8449 H H1   . HOH C 2 .   ? 18.258  50.590 4.605   1.00 0.00  ? 492 HOH A H1   1 
HETATM 8450 H H2   . HOH C 2 .   ? 18.683  49.178 4.832   1.00 0.00  ? 492 HOH A H2   1 
HETATM 8451 O O    . HOH C 2 .   ? 49.240  69.766 -21.738 1.00 15.87 ? 493 HOH A O    1 
HETATM 8452 H H1   . HOH C 2 .   ? 49.242  69.728 -20.765 1.00 0.00  ? 493 HOH A H1   1 
HETATM 8453 H H2   . HOH C 2 .   ? 49.259  70.709 -21.915 1.00 0.00  ? 493 HOH A H2   1 
HETATM 8454 O O    . HOH C 2 .   ? 27.334  63.376 -16.951 1.00 45.22 ? 494 HOH A O    1 
HETATM 8455 H H1   . HOH C 2 .   ? 27.531  64.256 -17.311 1.00 0.00  ? 494 HOH A H1   1 
HETATM 8456 H H2   . HOH C 2 .   ? 28.038  62.852 -17.375 1.00 0.00  ? 494 HOH A H2   1 
HETATM 8457 O O    . HOH C 2 .   ? 37.692  51.138 0.181   1.00 18.86 ? 495 HOH A O    1 
HETATM 8458 H H1   . HOH C 2 .   ? 37.668  51.540 -0.693  1.00 0.00  ? 495 HOH A H1   1 
HETATM 8459 H H2   . HOH C 2 .   ? 36.750  50.990 0.317   1.00 0.00  ? 495 HOH A H2   1 
HETATM 8460 O O    . HOH C 2 .   ? 50.615  55.847 -12.332 1.00 12.57 ? 496 HOH A O    1 
HETATM 8461 H H1   . HOH C 2 .   ? 51.148  56.336 -12.964 1.00 0.00  ? 496 HOH A H1   1 
HETATM 8462 H H2   . HOH C 2 .   ? 50.119  56.571 -11.887 1.00 0.00  ? 496 HOH A H2   1 
HETATM 8463 O O    . HOH C 2 .   ? 34.202  49.930 -32.528 1.00 16.79 ? 497 HOH A O    1 
HETATM 8464 H H1   . HOH C 2 .   ? 33.269  50.138 -32.388 1.00 0.00  ? 497 HOH A H1   1 
HETATM 8465 H H2   . HOH C 2 .   ? 34.178  49.396 -33.332 1.00 0.00  ? 497 HOH A H2   1 
HETATM 8466 O O    . HOH C 2 .   ? 30.726  75.407 -16.650 1.00 24.10 ? 498 HOH A O    1 
HETATM 8467 H H1   . HOH C 2 .   ? 30.534  75.757 -15.766 1.00 0.00  ? 498 HOH A H1   1 
HETATM 8468 H H2   . HOH C 2 .   ? 31.493  75.922 -16.904 1.00 0.00  ? 498 HOH A H2   1 
HETATM 8469 O O    . HOH C 2 .   ? 38.005  63.746 -13.801 1.00 60.11 ? 499 HOH A O    1 
HETATM 8470 H H1   . HOH C 2 .   ? 38.027  63.107 -13.068 1.00 0.00  ? 499 HOH A H1   1 
HETATM 8471 H H2   . HOH C 2 .   ? 37.854  63.168 -14.559 1.00 0.00  ? 499 HOH A H2   1 
HETATM 8472 O O    . HOH C 2 .   ? 3.471   65.112 -4.496  1.00 70.86 ? 500 HOH A O    1 
HETATM 8473 H H1   . HOH C 2 .   ? 4.108   64.833 -3.822  1.00 0.00  ? 500 HOH A H1   1 
HETATM 8474 H H2   . HOH C 2 .   ? 2.626   64.971 -4.060  1.00 0.00  ? 500 HOH A H2   1 
HETATM 8475 O O    . HOH C 2 .   ? 27.962  28.295 -36.015 1.00 27.57 ? 501 HOH A O    1 
HETATM 8476 H H1   . HOH C 2 .   ? 28.194  28.242 -36.958 1.00 0.00  ? 501 HOH A H1   1 
HETATM 8477 H H2   . HOH C 2 .   ? 27.744  29.238 -35.935 1.00 0.00  ? 501 HOH A H2   1 
HETATM 8478 O O    . HOH C 2 .   ? 5.553   81.324 -4.795  1.00 27.85 ? 502 HOH A O    1 
HETATM 8479 H H1   . HOH C 2 .   ? 5.111   81.191 -3.953  1.00 0.00  ? 502 HOH A H1   1 
HETATM 8480 H H2   . HOH C 2 .   ? 5.508   80.429 -5.188  1.00 0.00  ? 502 HOH A H2   1 
HETATM 8481 O O    . HOH C 2 .   ? 16.711  41.065 0.603   1.00 24.83 ? 503 HOH A O    1 
HETATM 8482 H H1   . HOH C 2 .   ? 16.699  41.663 -0.171  1.00 0.00  ? 503 HOH A H1   1 
HETATM 8483 H H2   . HOH C 2 .   ? 16.280  41.622 1.264   1.00 0.00  ? 503 HOH A H2   1 
HETATM 8484 O O    . HOH C 2 .   ? 32.310  36.457 -16.621 1.00 29.34 ? 504 HOH A O    1 
HETATM 8485 H H1   . HOH C 2 .   ? 33.245  36.299 -16.410 1.00 0.00  ? 504 HOH A H1   1 
HETATM 8486 H H2   . HOH C 2 .   ? 31.953  35.563 -16.700 1.00 0.00  ? 504 HOH A H2   1 
HETATM 8487 O O    . HOH C 2 .   ? -3.803  65.662 -11.736 1.00 44.86 ? 505 HOH A O    1 
HETATM 8488 H H1   . HOH C 2 .   ? -3.229  66.356 -11.390 1.00 0.00  ? 505 HOH A H1   1 
HETATM 8489 H H2   . HOH C 2 .   ? -3.993  65.983 -12.624 1.00 0.00  ? 505 HOH A H2   1 
HETATM 8490 O O    . HOH C 2 .   ? 33.439  67.017 -13.350 1.00 27.90 ? 506 HOH A O    1 
HETATM 8491 H H1   . HOH C 2 .   ? 33.848  66.205 -13.683 1.00 0.00  ? 506 HOH A H1   1 
HETATM 8492 H H2   . HOH C 2 .   ? 34.032  67.287 -12.645 1.00 0.00  ? 506 HOH A H2   1 
HETATM 8493 O O    . HOH C 2 .   ? -3.825  63.514 -10.063 1.00 48.97 ? 507 HOH A O    1 
HETATM 8494 H H1   . HOH C 2 .   ? -4.439  62.991 -10.598 1.00 0.00  ? 507 HOH A H1   1 
HETATM 8495 H H2   . HOH C 2 .   ? -3.728  64.299 -10.634 1.00 0.00  ? 507 HOH A H2   1 
HETATM 8496 O O    . HOH C 2 .   ? 17.571  58.503 -28.991 1.00 41.72 ? 508 HOH A O    1 
HETATM 8497 H H1   . HOH C 2 .   ? 17.627  57.545 -28.928 1.00 0.00  ? 508 HOH A H1   1 
HETATM 8498 H H2   . HOH C 2 .   ? 18.332  58.833 -28.507 1.00 0.00  ? 508 HOH A H2   1 
HETATM 8499 O O    . HOH C 2 .   ? 7.004   74.040 -23.159 1.00 23.00 ? 509 HOH A O    1 
HETATM 8500 H H1   . HOH C 2 .   ? 7.954   74.103 -23.146 1.00 0.00  ? 509 HOH A H1   1 
HETATM 8501 H H2   . HOH C 2 .   ? 6.795   73.230 -22.676 1.00 0.00  ? 509 HOH A H2   1 
HETATM 8502 O O    . HOH C 2 .   ? 31.738  27.360 -34.769 1.00 38.79 ? 510 HOH A O    1 
HETATM 8503 H H1   . HOH C 2 .   ? 32.465  26.740 -34.979 1.00 0.00  ? 510 HOH A H1   1 
HETATM 8504 H H2   . HOH C 2 .   ? 31.497  27.643 -35.665 1.00 0.00  ? 510 HOH A H2   1 
HETATM 8505 O O    . HOH C 2 .   ? 45.155  43.211 -39.727 1.00 19.03 ? 511 HOH A O    1 
HETATM 8506 H H1   . HOH C 2 .   ? 44.440  42.979 -39.113 1.00 0.00  ? 511 HOH A H1   1 
HETATM 8507 H H2   . HOH C 2 .   ? 45.232  42.411 -40.265 1.00 0.00  ? 511 HOH A H2   1 
HETATM 8508 O O    . HOH C 2 .   ? 1.188   73.467 -8.116  1.00 16.74 ? 512 HOH A O    1 
HETATM 8509 H H1   . HOH C 2 .   ? 2.001   72.977 -8.329  1.00 0.00  ? 512 HOH A H1   1 
HETATM 8510 H H2   . HOH C 2 .   ? 1.339   73.577 -7.162  1.00 0.00  ? 512 HOH A H2   1 
HETATM 8511 O O    . HOH C 2 .   ? 47.170  64.296 -12.889 1.00 32.78 ? 513 HOH A O    1 
HETATM 8512 H H1   . HOH C 2 .   ? 46.206  64.339 -12.934 1.00 0.00  ? 513 HOH A H1   1 
HETATM 8513 H H2   . HOH C 2 .   ? 47.322  64.220 -11.941 1.00 0.00  ? 513 HOH A H2   1 
HETATM 8514 O O    . HOH C 2 .   ? 49.211  53.087 -11.179 1.00 48.19 ? 514 HOH A O    1 
HETATM 8515 H H1   . HOH C 2 .   ? 49.234  53.860 -10.593 1.00 0.00  ? 514 HOH A H1   1 
HETATM 8516 H H2   . HOH C 2 .   ? 49.938  53.337 -11.766 1.00 0.00  ? 514 HOH A H2   1 
HETATM 8517 O O    . HOH C 2 .   ? 30.876  32.470 -49.072 1.00 71.43 ? 515 HOH A O    1 
HETATM 8518 H H1   . HOH C 2 .   ? 30.361  31.818 -48.584 1.00 0.00  ? 515 HOH A H1   1 
HETATM 8519 H H2   . HOH C 2 .   ? 31.355  32.885 -48.347 1.00 0.00  ? 515 HOH A H2   1 
HETATM 8520 O O    . HOH C 2 .   ? 37.162  43.954 -36.705 1.00 14.96 ? 516 HOH A O    1 
HETATM 8521 H H1   . HOH C 2 .   ? 37.709  43.849 -35.909 1.00 0.00  ? 516 HOH A H1   1 
HETATM 8522 H H2   . HOH C 2 .   ? 37.571  44.704 -37.165 1.00 0.00  ? 516 HOH A H2   1 
HETATM 8523 O O    . HOH C 2 .   ? 24.782  62.368 -15.439 1.00 33.96 ? 517 HOH A O    1 
HETATM 8524 H H1   . HOH C 2 .   ? 24.160  62.181 -14.726 1.00 0.00  ? 517 HOH A H1   1 
HETATM 8525 H H2   . HOH C 2 .   ? 24.253  63.014 -15.934 1.00 0.00  ? 517 HOH A H2   1 
HETATM 8526 O O    . HOH C 2 .   ? 38.473  70.436 -19.953 1.00 21.30 ? 518 HOH A O    1 
HETATM 8527 H H1   . HOH C 2 .   ? 38.878  70.529 -19.072 1.00 0.00  ? 518 HOH A H1   1 
HETATM 8528 H H2   . HOH C 2 .   ? 38.654  71.317 -20.321 1.00 0.00  ? 518 HOH A H2   1 
HETATM 8529 O O    . HOH C 2 .   ? 18.656  46.250 2.287   1.00 36.23 ? 519 HOH A O    1 
HETATM 8530 H H1   . HOH C 2 .   ? 18.123  45.607 1.818   1.00 0.00  ? 519 HOH A H1   1 
HETATM 8531 H H2   . HOH C 2 .   ? 19.456  46.195 1.716   1.00 0.00  ? 519 HOH A H2   1 
HETATM 8532 O O    . HOH C 2 .   ? 32.717  52.649 -41.214 1.00 30.10 ? 520 HOH A O    1 
HETATM 8533 H H1   . HOH C 2 .   ? 33.594  52.685 -40.829 1.00 0.00  ? 520 HOH A H1   1 
HETATM 8534 H H2   . HOH C 2 .   ? 32.898  52.345 -42.114 1.00 0.00  ? 520 HOH A H2   1 
HETATM 8535 O O    . HOH C 2 .   ? 40.126  71.211 -17.597 1.00 26.20 ? 521 HOH A O    1 
HETATM 8536 H H1   . HOH C 2 .   ? 40.968  71.677 -17.682 1.00 0.00  ? 521 HOH A H1   1 
HETATM 8537 H H2   . HOH C 2 .   ? 40.365  70.467 -17.030 1.00 0.00  ? 521 HOH A H2   1 
HETATM 8538 O O    . HOH C 2 .   ? 35.017  64.595 -13.772 1.00 19.21 ? 522 HOH A O    1 
HETATM 8539 H H1   . HOH C 2 .   ? 35.880  64.594 -14.211 1.00 0.00  ? 522 HOH A H1   1 
HETATM 8540 H H2   . HOH C 2 .   ? 35.159  63.878 -13.141 1.00 0.00  ? 522 HOH A H2   1 
HETATM 8541 O O    . HOH C 2 .   ? 7.574   75.893 -20.289 1.00 6.11  ? 523 HOH A O    1 
HETATM 8542 H H1   . HOH C 2 .   ? 8.165   75.175 -20.009 1.00 0.00  ? 523 HOH A H1   1 
HETATM 8543 H H2   . HOH C 2 .   ? 7.641   75.822 -21.250 1.00 0.00  ? 523 HOH A H2   1 
HETATM 8544 O O    . HOH C 2 .   ? 28.242  31.725 -35.397 1.00 67.99 ? 524 HOH A O    1 
HETATM 8545 H H1   . HOH C 2 .   ? 28.252  32.503 -34.817 1.00 0.00  ? 524 HOH A H1   1 
HETATM 8546 H H2   . HOH C 2 .   ? 28.914  31.932 -36.052 1.00 0.00  ? 524 HOH A H2   1 
HETATM 8547 O O    . HOH C 2 .   ? -0.304  75.976 -13.379 1.00 27.21 ? 525 HOH A O    1 
HETATM 8548 H H1   . HOH C 2 .   ? 0.046   76.196 -12.504 1.00 0.00  ? 525 HOH A H1   1 
HETATM 8549 H H2   . HOH C 2 .   ? -1.259  76.115 -13.254 1.00 0.00  ? 525 HOH A H2   1 
HETATM 8550 O O    . HOH C 2 .   ? -11.233 59.590 -14.252 1.00 35.56 ? 526 HOH A O    1 
HETATM 8551 H H1   . HOH C 2 .   ? -11.378 58.641 -14.170 1.00 0.00  ? 526 HOH A H1   1 
HETATM 8552 H H2   . HOH C 2 .   ? -11.872 59.939 -13.611 1.00 0.00  ? 526 HOH A H2   1 
HETATM 8553 O O    . HOH C 2 .   ? 55.145  56.581 -21.848 1.00 51.20 ? 527 HOH A O    1 
HETATM 8554 H H1   . HOH C 2 .   ? 54.305  56.862 -21.445 1.00 0.00  ? 527 HOH A H1   1 
HETATM 8555 H H2   . HOH C 2 .   ? 55.236  55.677 -21.529 1.00 0.00  ? 527 HOH A H2   1 
HETATM 8556 O O    . HOH C 2 .   ? 20.346  45.591 0.573   1.00 45.41 ? 528 HOH A O    1 
HETATM 8557 H H1   . HOH C 2 .   ? 20.804  46.283 0.073   1.00 0.00  ? 528 HOH A H1   1 
HETATM 8558 H H2   . HOH C 2 .   ? 21.072  44.951 0.604   1.00 0.00  ? 528 HOH A H2   1 
HETATM 8559 O O    . HOH C 2 .   ? -4.163  69.817 -11.167 1.00 5.01  ? 529 HOH A O    1 
HETATM 8560 H H1   . HOH C 2 .   ? -5.122  69.837 -11.266 1.00 0.00  ? 529 HOH A H1   1 
HETATM 8561 H H2   . HOH C 2 .   ? -3.913  69.857 -12.100 1.00 0.00  ? 529 HOH A H2   1 
HETATM 8562 O O    . HOH C 2 .   ? 43.804  42.739 -11.761 1.00 31.62 ? 530 HOH A O    1 
HETATM 8563 H H1   . HOH C 2 .   ? 44.122  42.906 -12.671 1.00 0.00  ? 530 HOH A H1   1 
HETATM 8564 H H2   . HOH C 2 .   ? 44.457  43.248 -11.276 1.00 0.00  ? 530 HOH A H2   1 
HETATM 8565 O O    . HOH C 2 .   ? 24.824  37.243 -54.375 1.00 20.53 ? 531 HOH A O    1 
HETATM 8566 H H1   . HOH C 2 .   ? 25.507  36.566 -54.407 1.00 0.00  ? 531 HOH A H1   1 
HETATM 8567 H H2   . HOH C 2 .   ? 25.047  37.806 -55.131 1.00 0.00  ? 531 HOH A H2   1 
HETATM 8568 O O    . HOH C 2 .   ? 43.226  54.922 -4.803  1.00 14.93 ? 532 HOH A O    1 
HETATM 8569 H H1   . HOH C 2 .   ? 43.354  55.619 -4.155  1.00 0.00  ? 532 HOH A H1   1 
HETATM 8570 H H2   . HOH C 2 .   ? 42.554  54.355 -4.379  1.00 0.00  ? 532 HOH A H2   1 
HETATM 8571 O O    . HOH C 2 .   ? 43.888  48.120 -7.794  1.00 16.58 ? 533 HOH A O    1 
HETATM 8572 H H1   . HOH C 2 .   ? 44.724  48.570 -7.655  1.00 0.00  ? 533 HOH A H1   1 
HETATM 8573 H H2   . HOH C 2 .   ? 43.472  48.698 -8.443  1.00 0.00  ? 533 HOH A H2   1 
HETATM 8574 O O    . HOH C 2 .   ? 31.600  46.818 4.349   1.00 51.16 ? 534 HOH A O    1 
HETATM 8575 H H1   . HOH C 2 .   ? 31.970  46.623 3.477   1.00 0.00  ? 534 HOH A H1   1 
HETATM 8576 H H2   . HOH C 2 .   ? 32.116  46.247 4.917   1.00 0.00  ? 534 HOH A H2   1 
HETATM 8577 O O    . HOH C 2 .   ? 29.342  72.793 6.992   1.00 45.49 ? 535 HOH A O    1 
HETATM 8578 H H1   . HOH C 2 .   ? 28.492  73.237 6.953   1.00 0.00  ? 535 HOH A H1   1 
HETATM 8579 H H2   . HOH C 2 .   ? 29.960  73.499 7.195   1.00 0.00  ? 535 HOH A H2   1 
HETATM 8580 O O    . HOH C 2 .   ? 27.799  26.309 -31.201 1.00 25.27 ? 536 HOH A O    1 
HETATM 8581 H H1   . HOH C 2 .   ? 28.242  26.148 -32.061 1.00 0.00  ? 536 HOH A H1   1 
HETATM 8582 H H2   . HOH C 2 .   ? 27.799  25.441 -30.811 1.00 0.00  ? 536 HOH A H2   1 
HETATM 8583 O O    . HOH C 2 .   ? 32.062  30.032 -44.655 1.00 28.83 ? 537 HOH A O    1 
HETATM 8584 H H1   . HOH C 2 .   ? 31.643  30.109 -45.530 1.00 0.00  ? 537 HOH A H1   1 
HETATM 8585 H H2   . HOH C 2 .   ? 31.427  30.584 -44.165 1.00 0.00  ? 537 HOH A H2   1 
HETATM 8586 O O    . HOH C 2 .   ? 16.784  70.560 2.628   1.00 55.40 ? 538 HOH A O    1 
HETATM 8587 H H1   . HOH C 2 .   ? 16.506  69.666 2.383   1.00 0.00  ? 538 HOH A H1   1 
HETATM 8588 H H2   . HOH C 2 .   ? 16.537  71.059 1.843   1.00 0.00  ? 538 HOH A H2   1 
HETATM 8589 O O    . HOH C 2 .   ? 26.399  73.900 -8.918  1.00 33.70 ? 539 HOH A O    1 
HETATM 8590 H H1   . HOH C 2 .   ? 27.069  74.309 -8.344  1.00 0.00  ? 539 HOH A H1   1 
HETATM 8591 H H2   . HOH C 2 .   ? 26.342  74.616 -9.581  1.00 0.00  ? 539 HOH A H2   1 
HETATM 8592 O O    . HOH C 2 .   ? 7.471   83.299 -25.619 1.00 32.48 ? 540 HOH A O    1 
HETATM 8593 H H1   . HOH C 2 .   ? 7.455   83.939 -24.888 1.00 0.00  ? 540 HOH A H1   1 
HETATM 8594 H H2   . HOH C 2 .   ? 8.422   83.167 -25.704 1.00 0.00  ? 540 HOH A H2   1 
HETATM 8595 O O    . HOH C 2 .   ? 4.079   81.946 -7.019  1.00 26.41 ? 541 HOH A O    1 
HETATM 8596 H H1   . HOH C 2 .   ? 4.653   81.950 -6.232  1.00 0.00  ? 541 HOH A H1   1 
HETATM 8597 H H2   . HOH C 2 .   ? 4.442   82.636 -7.574  1.00 0.00  ? 541 HOH A H2   1 
HETATM 8598 O O    . HOH C 2 .   ? 27.124  39.645 -30.710 1.00 21.81 ? 542 HOH A O    1 
HETATM 8599 H H1   . HOH C 2 .   ? 27.702  40.394 -30.875 1.00 0.00  ? 542 HOH A H1   1 
HETATM 8600 H H2   . HOH C 2 .   ? 26.318  40.089 -30.432 1.00 0.00  ? 542 HOH A H2   1 
HETATM 8601 O O    . HOH C 2 .   ? 33.865  35.775 -44.665 1.00 45.99 ? 543 HOH A O    1 
HETATM 8602 H H1   . HOH C 2 .   ? 33.316  35.706 -43.882 1.00 0.00  ? 543 HOH A H1   1 
HETATM 8603 H H2   . HOH C 2 .   ? 33.464  35.119 -45.247 1.00 0.00  ? 543 HOH A H2   1 
HETATM 8604 O O    . HOH C 2 .   ? 32.215  66.176 -18.812 1.00 26.25 ? 544 HOH A O    1 
HETATM 8605 H H1   . HOH C 2 .   ? 33.150  66.130 -19.055 1.00 0.00  ? 544 HOH A H1   1 
HETATM 8606 H H2   . HOH C 2 .   ? 31.849  66.780 -19.458 1.00 0.00  ? 544 HOH A H2   1 
HETATM 8607 O O    . HOH C 2 .   ? 21.654  51.208 1.756   1.00 6.22  ? 545 HOH A O    1 
HETATM 8608 H H1   . HOH C 2 .   ? 20.713  51.282 1.593   1.00 0.00  ? 545 HOH A H1   1 
HETATM 8609 H H2   . HOH C 2 .   ? 21.802  51.771 2.536   1.00 0.00  ? 545 HOH A H2   1 
HETATM 8610 O O    . HOH C 2 .   ? 46.238  39.829 -15.395 1.00 65.04 ? 546 HOH A O    1 
HETATM 8611 H H1   . HOH C 2 .   ? 47.121  40.116 -15.628 1.00 0.00  ? 546 HOH A H1   1 
HETATM 8612 H H2   . HOH C 2 .   ? 45.988  40.410 -14.656 1.00 0.00  ? 546 HOH A H2   1 
HETATM 8613 O O    . HOH C 2 .   ? 7.970   68.457 -26.778 1.00 18.60 ? 547 HOH A O    1 
HETATM 8614 H H1   . HOH C 2 .   ? 7.035   68.532 -26.537 1.00 0.00  ? 547 HOH A H1   1 
HETATM 8615 H H2   . HOH C 2 .   ? 8.253   69.386 -26.639 1.00 0.00  ? 547 HOH A H2   1 
HETATM 8616 O O    . HOH C 2 .   ? 38.727  42.700 -34.379 1.00 39.45 ? 548 HOH A O    1 
HETATM 8617 H H1   . HOH C 2 .   ? 39.373  42.265 -34.940 1.00 0.00  ? 548 HOH A H1   1 
HETATM 8618 H H2   . HOH C 2 .   ? 38.420  41.943 -33.868 1.00 0.00  ? 548 HOH A H2   1 
HETATM 8619 O O    . HOH C 2 .   ? 24.560  85.639 -15.677 1.00 32.75 ? 549 HOH A O    1 
HETATM 8620 H H1   . HOH C 2 .   ? 24.062  85.064 -15.085 1.00 0.00  ? 549 HOH A H1   1 
HETATM 8621 H H2   . HOH C 2 .   ? 24.787  85.052 -16.404 1.00 0.00  ? 549 HOH A H2   1 
HETATM 8622 O O    . HOH C 2 .   ? 27.040  52.625 7.724   1.00 40.44 ? 550 HOH A O    1 
HETATM 8623 H H1   . HOH C 2 .   ? 26.780  53.515 7.460   1.00 0.00  ? 550 HOH A H1   1 
HETATM 8624 H H2   . HOH C 2 .   ? 26.192  52.181 7.621   1.00 0.00  ? 550 HOH A H2   1 
HETATM 8625 O O    . HOH C 2 .   ? 16.842  37.316 3.122   1.00 50.46 ? 551 HOH A O    1 
HETATM 8626 H H1   . HOH C 2 .   ? 16.892  36.456 3.553   1.00 0.00  ? 551 HOH A H1   1 
HETATM 8627 H H2   . HOH C 2 .   ? 15.916  37.366 2.852   1.00 0.00  ? 551 HOH A H2   1 
HETATM 8628 O O    . HOH C 2 .   ? 2.759   73.739 -2.142  1.00 32.86 ? 552 HOH A O    1 
HETATM 8629 H H1   . HOH C 2 .   ? 3.721   73.749 -2.138  1.00 0.00  ? 552 HOH A H1   1 
HETATM 8630 H H2   . HOH C 2 .   ? 2.596   73.761 -3.102  1.00 0.00  ? 552 HOH A H2   1 
HETATM 8631 O O    . HOH C 2 .   ? 41.904  60.292 -27.740 1.00 25.02 ? 553 HOH A O    1 
HETATM 8632 H H1   . HOH C 2 .   ? 42.037  59.848 -26.884 1.00 0.00  ? 553 HOH A H1   1 
HETATM 8633 H H2   . HOH C 2 .   ? 42.810  60.488 -27.988 1.00 0.00  ? 553 HOH A H2   1 
HETATM 8634 O O    . HOH C 2 .   ? 28.329  26.254 -40.200 1.00 21.20 ? 554 HOH A O    1 
HETATM 8635 H H1   . HOH C 2 .   ? 27.598  26.863 -40.064 1.00 0.00  ? 554 HOH A H1   1 
HETATM 8636 H H2   . HOH C 2 .   ? 28.978  26.614 -39.571 1.00 0.00  ? 554 HOH A H2   1 
HETATM 8637 O O    . HOH C 2 .   ? 20.427  44.377 -23.625 1.00 12.79 ? 555 HOH A O    1 
HETATM 8638 H H1   . HOH C 2 .   ? 20.104  44.362 -24.539 1.00 0.00  ? 555 HOH A H1   1 
HETATM 8639 H H2   . HOH C 2 .   ? 19.874  43.690 -23.228 1.00 0.00  ? 555 HOH A H2   1 
HETATM 8640 O O    . HOH C 2 .   ? 45.917  70.233 -20.473 1.00 38.17 ? 556 HOH A O    1 
HETATM 8641 H H1   . HOH C 2 .   ? 45.546  71.086 -20.173 1.00 0.00  ? 556 HOH A H1   1 
HETATM 8642 H H2   . HOH C 2 .   ? 46.583  70.056 -19.807 1.00 0.00  ? 556 HOH A H2   1 
HETATM 8643 O O    . HOH C 2 .   ? 29.282  29.323 -44.719 1.00 35.15 ? 557 HOH A O    1 
HETATM 8644 H H1   . HOH C 2 .   ? 28.825  29.973 -44.171 1.00 0.00  ? 557 HOH A H1   1 
HETATM 8645 H H2   . HOH C 2 .   ? 29.385  29.833 -45.534 1.00 0.00  ? 557 HOH A H2   1 
HETATM 8646 O O    . HOH C 2 .   ? 24.830  61.935 -20.315 1.00 11.41 ? 558 HOH A O    1 
HETATM 8647 H H1   . HOH C 2 .   ? 24.261  61.296 -20.790 1.00 0.00  ? 558 HOH A H1   1 
HETATM 8648 H H2   . HOH C 2 .   ? 25.258  62.393 -21.064 1.00 0.00  ? 558 HOH A H2   1 
HETATM 8649 O O    . HOH C 2 .   ? 44.374  60.212 -23.786 1.00 62.51 ? 559 HOH A O    1 
HETATM 8650 H H1   . HOH C 2 .   ? 44.996  60.893 -23.489 1.00 0.00  ? 559 HOH A H1   1 
HETATM 8651 H H2   . HOH C 2 .   ? 44.386  60.293 -24.740 1.00 0.00  ? 559 HOH A H2   1 
HETATM 8652 O O    . HOH C 2 .   ? 31.577  73.625 5.078   1.00 51.02 ? 560 HOH A O    1 
HETATM 8653 H H1   . HOH C 2 .   ? 31.310  72.959 4.424   1.00 0.00  ? 560 HOH A H1   1 
HETATM 8654 H H2   . HOH C 2 .   ? 30.747  74.116 5.118   1.00 0.00  ? 560 HOH A H2   1 
HETATM 8655 O O    . HOH C 2 .   ? 1.621   78.861 -10.671 1.00 23.82 ? 561 HOH A O    1 
HETATM 8656 H H1   . HOH C 2 .   ? 1.043   78.079 -10.551 1.00 0.00  ? 561 HOH A H1   1 
HETATM 8657 H H2   . HOH C 2 .   ? 0.990   79.600 -10.601 1.00 0.00  ? 561 HOH A H2   1 
HETATM 8658 O O    . HOH C 2 .   ? 48.194  49.443 -24.720 1.00 27.83 ? 562 HOH A O    1 
HETATM 8659 H H1   . HOH C 2 .   ? 47.673  48.648 -24.862 1.00 0.00  ? 562 HOH A H1   1 
HETATM 8660 H H2   . HOH C 2 .   ? 48.398  49.376 -23.770 1.00 0.00  ? 562 HOH A H2   1 
HETATM 8661 O O    . HOH C 2 .   ? 5.142   80.817 -13.037 1.00 37.44 ? 563 HOH A O    1 
HETATM 8662 H H1   . HOH C 2 .   ? 4.752   80.452 -12.230 1.00 0.00  ? 563 HOH A H1   1 
HETATM 8663 H H2   . HOH C 2 .   ? 5.700   81.509 -12.629 1.00 0.00  ? 563 HOH A H2   1 
HETATM 8664 O O    . HOH C 2 .   ? 8.992   52.174 -34.252 1.00 57.61 ? 564 HOH A O    1 
HETATM 8665 H H1   . HOH C 2 .   ? 8.841   51.276 -34.588 1.00 0.00  ? 564 HOH A H1   1 
HETATM 8666 H H2   . HOH C 2 .   ? 9.892   52.091 -33.922 1.00 0.00  ? 564 HOH A H2   1 
HETATM 8667 O O    . HOH C 2 .   ? 45.409  35.152 -21.380 1.00 41.66 ? 565 HOH A O    1 
HETATM 8668 H H1   . HOH C 2 .   ? 46.012  34.406 -21.457 1.00 0.00  ? 565 HOH A H1   1 
HETATM 8669 H H2   . HOH C 2 .   ? 45.791  35.796 -21.996 1.00 0.00  ? 565 HOH A H2   1 
HETATM 8670 O O    . HOH C 2 .   ? 23.069  71.532 -28.318 1.00 12.58 ? 566 HOH A O    1 
HETATM 8671 H H1   . HOH C 2 .   ? 23.901  71.325 -28.760 1.00 0.00  ? 566 HOH A H1   1 
HETATM 8672 H H2   . HOH C 2 .   ? 23.354  71.881 -27.479 1.00 0.00  ? 566 HOH A H2   1 
HETATM 8673 O O    . HOH C 2 .   ? -5.701  63.185 -12.114 1.00 20.17 ? 567 HOH A O    1 
HETATM 8674 H H1   . HOH C 2 .   ? -5.033  63.780 -12.496 1.00 0.00  ? 567 HOH A H1   1 
HETATM 8675 H H2   . HOH C 2 .   ? -6.358  63.808 -11.807 1.00 0.00  ? 567 HOH A H2   1 
HETATM 8676 O O    . HOH C 2 .   ? 13.368  61.803 -14.621 1.00 21.89 ? 568 HOH A O    1 
HETATM 8677 H H1   . HOH C 2 .   ? 12.725  61.096 -14.739 1.00 0.00  ? 568 HOH A H1   1 
HETATM 8678 H H2   . HOH C 2 .   ? 14.049  61.566 -15.247 1.00 0.00  ? 568 HOH A H2   1 
HETATM 8679 O O    . HOH C 2 .   ? 25.195  47.201 3.866   1.00 6.88  ? 569 HOH A O    1 
HETATM 8680 H H1   . HOH C 2 .   ? 26.113  46.889 3.794   1.00 0.00  ? 569 HOH A H1   1 
HETATM 8681 H H2   . HOH C 2 .   ? 24.720  46.496 3.415   1.00 0.00  ? 569 HOH A H2   1 
HETATM 8682 O O    . HOH C 2 .   ? 17.300  45.657 -2.045  1.00 31.52 ? 570 HOH A O    1 
HETATM 8683 H H1   . HOH C 2 .   ? 17.885  45.200 -1.431  1.00 0.00  ? 570 HOH A H1   1 
HETATM 8684 H H2   . HOH C 2 .   ? 17.951  46.150 -2.570  1.00 0.00  ? 570 HOH A H2   1 
HETATM 8685 O O    . HOH C 2 .   ? 27.209  71.566 -9.900  1.00 23.69 ? 571 HOH A O    1 
HETATM 8686 H H1   . HOH C 2 .   ? 26.955  71.541 -8.962  1.00 0.00  ? 571 HOH A H1   1 
HETATM 8687 H H2   . HOH C 2 .   ? 27.076  72.529 -10.028 1.00 0.00  ? 571 HOH A H2   1 
HETATM 8688 O O    . HOH C 2 .   ? 31.437  65.330 -15.366 1.00 20.23 ? 572 HOH A O    1 
HETATM 8689 H H1   . HOH C 2 .   ? 31.701  65.942 -14.669 1.00 0.00  ? 572 HOH A H1   1 
HETATM 8690 H H2   . HOH C 2 .   ? 31.650  65.814 -16.171 1.00 0.00  ? 572 HOH A H2   1 
HETATM 8691 O O    . HOH C 2 .   ? 14.204  56.320 -1.249  1.00 36.18 ? 573 HOH A O    1 
HETATM 8692 H H1   . HOH C 2 .   ? 14.872  56.941 -1.562  1.00 0.00  ? 573 HOH A H1   1 
HETATM 8693 H H2   . HOH C 2 .   ? 13.961  56.710 -0.404  1.00 0.00  ? 573 HOH A H2   1 
HETATM 8694 O O    . HOH C 2 .   ? 33.187  31.701 -50.324 1.00 62.09 ? 574 HOH A O    1 
HETATM 8695 H H1   . HOH C 2 .   ? 32.335  32.018 -49.992 1.00 0.00  ? 574 HOH A H1   1 
HETATM 8696 H H2   . HOH C 2 .   ? 33.753  32.473 -50.257 1.00 0.00  ? 574 HOH A H2   1 
HETATM 8697 O O    . HOH C 2 .   ? 26.149  50.109 4.341   1.00 33.18 ? 575 HOH A O    1 
HETATM 8698 H H1   . HOH C 2 .   ? 26.998  50.226 4.795   1.00 0.00  ? 575 HOH A H1   1 
HETATM 8699 H H2   . HOH C 2 .   ? 25.521  50.372 5.036   1.00 0.00  ? 575 HOH A H2   1 
HETATM 8700 O O    . HOH C 2 .   ? 42.025  42.739 -5.854  1.00 26.18 ? 576 HOH A O    1 
HETATM 8701 H H1   . HOH C 2 .   ? 42.340  41.916 -6.247  1.00 0.00  ? 576 HOH A H1   1 
HETATM 8702 H H2   . HOH C 2 .   ? 42.789  43.333 -5.912  1.00 0.00  ? 576 HOH A H2   1 
HETATM 8703 O O    . HOH C 2 .   ? 43.857  38.352 -14.995 1.00 17.15 ? 577 HOH A O    1 
HETATM 8704 H H1   . HOH C 2 .   ? 43.770  37.816 -15.782 1.00 0.00  ? 577 HOH A H1   1 
HETATM 8705 H H2   . HOH C 2 .   ? 44.622  38.913 -15.260 1.00 0.00  ? 577 HOH A H2   1 
HETATM 8706 O O    . HOH C 2 .   ? 16.343  89.807 -6.617  1.00 46.52 ? 578 HOH A O    1 
HETATM 8707 H H1   . HOH C 2 .   ? 16.840  89.326 -7.316  1.00 0.00  ? 578 HOH A H1   1 
HETATM 8708 H H2   . HOH C 2 .   ? 16.480  89.239 -5.849  1.00 0.00  ? 578 HOH A H2   1 
HETATM 8709 O O    . HOH C 2 .   ? 35.349  63.240 1.321   1.00 25.07 ? 579 HOH A O    1 
HETATM 8710 H H1   . HOH C 2 .   ? 34.617  62.905 1.847   1.00 0.00  ? 579 HOH A H1   1 
HETATM 8711 H H2   . HOH C 2 .   ? 35.691  62.426 0.915   1.00 0.00  ? 579 HOH A H2   1 
HETATM 8712 O O    . HOH C 2 .   ? 16.143  32.931 -32.141 1.00 42.67 ? 580 HOH A O    1 
HETATM 8713 H H1   . HOH C 2 .   ? 16.631  33.752 -32.279 1.00 0.00  ? 580 HOH A H1   1 
HETATM 8714 H H2   . HOH C 2 .   ? 15.663  32.828 -32.975 1.00 0.00  ? 580 HOH A H2   1 
HETATM 8715 O O    . HOH C 2 .   ? 16.245  30.357 -31.029 1.00 29.14 ? 581 HOH A O    1 
HETATM 8716 H H1   . HOH C 2 .   ? 15.703  29.742 -31.543 1.00 0.00  ? 581 HOH A H1   1 
HETATM 8717 H H2   . HOH C 2 .   ? 16.189  31.180 -31.556 1.00 0.00  ? 581 HOH A H2   1 
HETATM 8718 O O    . HOH C 2 .   ? 20.921  47.943 -35.872 1.00 34.30 ? 582 HOH A O    1 
HETATM 8719 H H1   . HOH C 2 .   ? 20.386  48.160 -35.096 1.00 0.00  ? 582 HOH A H1   1 
HETATM 8720 H H2   . HOH C 2 .   ? 21.574  48.656 -35.844 1.00 0.00  ? 582 HOH A H2   1 
HETATM 8721 O O    . HOH C 2 .   ? 37.255  39.401 -47.693 1.00 62.38 ? 583 HOH A O    1 
HETATM 8722 H H1   . HOH C 2 .   ? 38.167  39.127 -47.564 1.00 0.00  ? 583 HOH A H1   1 
HETATM 8723 H H2   . HOH C 2 .   ? 37.366  40.009 -48.440 1.00 0.00  ? 583 HOH A H2   1 
HETATM 8724 O O    . HOH C 2 .   ? 8.040   81.741 -18.107 1.00 28.58 ? 584 HOH A O    1 
HETATM 8725 H H1   . HOH C 2 .   ? 8.611   81.451 -18.841 1.00 0.00  ? 584 HOH A H1   1 
HETATM 8726 H H2   . HOH C 2 .   ? 7.825   82.629 -18.437 1.00 0.00  ? 584 HOH A H2   1 
HETATM 8727 O O    . HOH C 2 .   ? 15.400  57.322 5.419   1.00 37.21 ? 585 HOH A O    1 
HETATM 8728 H H1   . HOH C 2 .   ? 15.043  56.454 5.118   1.00 0.00  ? 585 HOH A H1   1 
HETATM 8729 H H2   . HOH C 2 .   ? 14.946  57.445 6.263   1.00 0.00  ? 585 HOH A H2   1 
HETATM 8730 O O    . HOH C 2 .   ? 24.661  54.028 -30.347 1.00 29.68 ? 586 HOH A O    1 
HETATM 8731 H H1   . HOH C 2 .   ? 23.961  54.669 -30.185 1.00 0.00  ? 586 HOH A H1   1 
HETATM 8732 H H2   . HOH C 2 .   ? 24.467  53.367 -29.668 1.00 0.00  ? 586 HOH A H2   1 
HETATM 8733 O O    . HOH C 2 .   ? 26.178  82.302 2.819   1.00 45.96 ? 587 HOH A O    1 
HETATM 8734 H H1   . HOH C 2 .   ? 25.258  82.417 3.127   1.00 0.00  ? 587 HOH A H1   1 
HETATM 8735 H H2   . HOH C 2 .   ? 26.150  81.386 2.510   1.00 0.00  ? 587 HOH A H2   1 
HETATM 8736 O O    . HOH C 2 .   ? 44.225  40.309 -13.139 1.00 35.54 ? 588 HOH A O    1 
HETATM 8737 H H1   . HOH C 2 .   ? 43.639  39.767 -13.699 1.00 0.00  ? 588 HOH A H1   1 
HETATM 8738 H H2   . HOH C 2 .   ? 43.668  41.028 -12.795 1.00 0.00  ? 588 HOH A H2   1 
HETATM 8739 O O    . HOH C 2 .   ? 45.520  41.137 -42.450 1.00 18.81 ? 589 HOH A O    1 
HETATM 8740 H H1   . HOH C 2 .   ? 44.794  40.527 -42.257 1.00 0.00  ? 589 HOH A H1   1 
HETATM 8741 H H2   . HOH C 2 .   ? 46.275  40.534 -42.434 1.00 0.00  ? 589 HOH A H2   1 
HETATM 8742 O O    . HOH C 2 .   ? 53.660  52.458 -19.934 1.00 46.03 ? 590 HOH A O    1 
HETATM 8743 H H1   . HOH C 2 .   ? 53.264  53.205 -19.480 1.00 0.00  ? 590 HOH A H1   1 
HETATM 8744 H H2   . HOH C 2 .   ? 53.020  51.762 -19.749 1.00 0.00  ? 590 HOH A H2   1 
HETATM 8745 O O    . HOH C 2 .   ? 44.036  28.560 -28.928 1.00 17.86 ? 591 HOH A O    1 
HETATM 8746 H H1   . HOH C 2 .   ? 44.122  28.110 -28.082 1.00 0.00  ? 591 HOH A H1   1 
HETATM 8747 H H2   . HOH C 2 .   ? 44.256  27.875 -29.569 1.00 0.00  ? 591 HOH A H2   1 
HETATM 8748 O O    . HOH C 2 .   ? 38.363  69.950 -8.836  1.00 23.10 ? 592 HOH A O    1 
HETATM 8749 H H1   . HOH C 2 .   ? 38.518  70.520 -8.079  1.00 0.00  ? 592 HOH A H1   1 
HETATM 8750 H H2   . HOH C 2 .   ? 37.450  69.660 -8.725  1.00 0.00  ? 592 HOH A H2   1 
HETATM 8751 O O    . HOH C 2 .   ? 41.877  63.382 -12.240 1.00 67.12 ? 593 HOH A O    1 
HETATM 8752 H H1   . HOH C 2 .   ? 41.742  62.745 -12.949 1.00 0.00  ? 593 HOH A H1   1 
HETATM 8753 H H2   . HOH C 2 .   ? 42.536  63.984 -12.606 1.00 0.00  ? 593 HOH A H2   1 
HETATM 8754 O O    . HOH C 2 .   ? 14.563  55.159 4.259   1.00 45.36 ? 594 HOH A O    1 
HETATM 8755 H H1   . HOH C 2 .   ? 14.857  54.851 3.393   1.00 0.00  ? 594 HOH A H1   1 
HETATM 8756 H H2   . HOH C 2 .   ? 14.085  54.390 4.600   1.00 0.00  ? 594 HOH A H2   1 
HETATM 8757 O O    . HOH C 2 .   ? 12.073  92.557 -6.736  1.00 16.57 ? 595 HOH A O    1 
HETATM 8758 H H1   . HOH C 2 .   ? 11.920  92.424 -5.786  1.00 0.00  ? 595 HOH A H1   1 
HETATM 8759 H H2   . HOH C 2 .   ? 12.880  93.082 -6.712  1.00 0.00  ? 595 HOH A H2   1 
HETATM 8760 O O    . HOH C 2 .   ? 23.381  82.061 3.078   1.00 22.25 ? 596 HOH A O    1 
HETATM 8761 H H1   . HOH C 2 .   ? 22.631  81.589 3.480   1.00 0.00  ? 596 HOH A H1   1 
HETATM 8762 H H2   . HOH C 2 .   ? 23.045  82.368 2.235   1.00 0.00  ? 596 HOH A H2   1 
HETATM 8763 O O    . HOH C 2 .   ? -0.912  75.403 -25.238 1.00 43.47 ? 597 HOH A O    1 
HETATM 8764 H H1   . HOH C 2 .   ? -0.323  75.223 -24.506 1.00 0.00  ? 597 HOH A H1   1 
HETATM 8765 H H2   . HOH C 2 .   ? -1.699  74.942 -24.932 1.00 0.00  ? 597 HOH A H2   1 
HETATM 8766 O O    . HOH C 2 .   ? 21.395  32.388 -36.222 1.00 57.48 ? 598 HOH A O    1 
HETATM 8767 H H1   . HOH C 2 .   ? 22.098  31.930 -35.711 1.00 0.00  ? 598 HOH A H1   1 
HETATM 8768 H H2   . HOH C 2 .   ? 20.882  32.719 -35.480 1.00 0.00  ? 598 HOH A H2   1 
HETATM 8769 O O    . HOH C 2 .   ? 33.646  58.596 -0.610  1.00 14.55 ? 599 HOH A O    1 
HETATM 8770 H H1   . HOH C 2 .   ? 32.750  58.455 -0.925  1.00 0.00  ? 599 HOH A H1   1 
HETATM 8771 H H2   . HOH C 2 .   ? 33.521  59.250 0.095   1.00 0.00  ? 599 HOH A H2   1 
HETATM 8772 O O    . HOH C 2 .   ? 22.698  48.429 4.066   1.00 17.96 ? 600 HOH A O    1 
HETATM 8773 H H1   . HOH C 2 .   ? 22.754  49.365 3.827   1.00 0.00  ? 600 HOH A H1   1 
HETATM 8774 H H2   . HOH C 2 .   ? 23.636  48.145 4.060   1.00 0.00  ? 600 HOH A H2   1 
HETATM 8775 O O    . HOH C 2 .   ? 14.983  79.022 -26.058 1.00 26.62 ? 601 HOH A O    1 
HETATM 8776 H H1   . HOH C 2 .   ? 15.796  78.849 -25.568 1.00 0.00  ? 601 HOH A H1   1 
HETATM 8777 H H2   . HOH C 2 .   ? 14.320  78.528 -25.547 1.00 0.00  ? 601 HOH A H2   1 
HETATM 8778 O O    . HOH C 2 .   ? 22.446  45.674 -18.474 1.00 19.90 ? 602 HOH A O    1 
HETATM 8779 H H1   . HOH C 2 .   ? 22.995  45.737 -17.691 1.00 0.00  ? 602 HOH A H1   1 
HETATM 8780 H H2   . HOH C 2 .   ? 23.094  45.779 -19.169 1.00 0.00  ? 602 HOH A H2   1 
HETATM 8781 O O    . HOH C 2 .   ? 19.806  79.585 -29.675 1.00 41.44 ? 603 HOH A O    1 
HETATM 8782 H H1   . HOH C 2 .   ? 19.354  78.753 -29.566 1.00 0.00  ? 603 HOH A H1   1 
HETATM 8783 H H2   . HOH C 2 .   ? 19.815  79.932 -28.781 1.00 0.00  ? 603 HOH A H2   1 
HETATM 8784 O O    . HOH C 2 .   ? 17.965  36.650 -42.023 1.00 23.96 ? 604 HOH A O    1 
HETATM 8785 H H1   . HOH C 2 .   ? 18.461  37.189 -42.667 1.00 0.00  ? 604 HOH A H1   1 
HETATM 8786 H H2   . HOH C 2 .   ? 17.109  36.561 -42.456 1.00 0.00  ? 604 HOH A H2   1 
HETATM 8787 O O    . HOH C 2 .   ? 39.117  60.080 -13.562 1.00 7.87  ? 605 HOH A O    1 
HETATM 8788 H H1   . HOH C 2 .   ? 38.502  60.487 -12.936 1.00 0.00  ? 605 HOH A H1   1 
HETATM 8789 H H2   . HOH C 2 .   ? 38.837  59.163 -13.513 1.00 0.00  ? 605 HOH A H2   1 
HETATM 8790 O O    . HOH C 2 .   ? 36.593  67.510 1.481   1.00 46.30 ? 606 HOH A O    1 
HETATM 8791 H H1   . HOH C 2 .   ? 37.556  67.384 1.599   1.00 0.00  ? 606 HOH A H1   1 
HETATM 8792 H H2   . HOH C 2 .   ? 36.261  66.633 1.684   1.00 0.00  ? 606 HOH A H2   1 
HETATM 8793 O O    . HOH C 2 .   ? 29.401  26.190 -33.587 1.00 26.23 ? 607 HOH A O    1 
HETATM 8794 H H1   . HOH C 2 .   ? 28.812  26.716 -34.162 1.00 0.00  ? 607 HOH A H1   1 
HETATM 8795 H H2   . HOH C 2 .   ? 30.262  26.549 -33.889 1.00 0.00  ? 607 HOH A H2   1 
HETATM 8796 O O    . HOH C 2 .   ? 38.246  74.947 -3.436  1.00 31.09 ? 608 HOH A O    1 
HETATM 8797 H H1   . HOH C 2 .   ? 37.660  75.434 -4.046  1.00 0.00  ? 608 HOH A H1   1 
HETATM 8798 H H2   . HOH C 2 .   ? 37.674  74.234 -3.115  1.00 0.00  ? 608 HOH A H2   1 
HETATM 8799 O O    . HOH C 2 .   ? 23.033  77.425 10.941  1.00 55.25 ? 609 HOH A O    1 
HETATM 8800 H H1   . HOH C 2 .   ? 22.307  76.814 11.053  1.00 0.00  ? 609 HOH A H1   1 
HETATM 8801 H H2   . HOH C 2 .   ? 23.661  76.916 10.409  1.00 0.00  ? 609 HOH A H2   1 
HETATM 8802 O O    . HOH C 2 .   ? 54.610  58.746 -18.905 1.00 29.54 ? 610 HOH A O    1 
HETATM 8803 H H1   . HOH C 2 .   ? 55.291  58.745 -19.574 1.00 0.00  ? 610 HOH A H1   1 
HETATM 8804 H H2   . HOH C 2 .   ? 53.836  58.405 -19.366 1.00 0.00  ? 610 HOH A H2   1 
HETATM 8805 O O    . HOH C 2 .   ? 34.670  71.984 4.573   1.00 51.16 ? 611 HOH A O    1 
HETATM 8806 H H1   . HOH C 2 .   ? 34.922  72.887 4.793   1.00 0.00  ? 611 HOH A H1   1 
HETATM 8807 H H2   . HOH C 2 .   ? 34.041  71.811 5.317   1.00 0.00  ? 611 HOH A H2   1 
HETATM 8808 O O    . HOH C 2 .   ? 40.126  45.259 -34.137 1.00 28.71 ? 612 HOH A O    1 
HETATM 8809 H H1   . HOH C 2 .   ? 39.895  45.094 -35.063 1.00 0.00  ? 612 HOH A H1   1 
HETATM 8810 H H2   . HOH C 2 .   ? 40.888  44.684 -34.023 1.00 0.00  ? 612 HOH A H2   1 
HETATM 8811 O O    . HOH C 2 .   ? 3.305   79.488 -14.584 1.00 9.64  ? 613 HOH A O    1 
HETATM 8812 H H1   . HOH C 2 .   ? 2.734   78.933 -14.050 1.00 0.00  ? 613 HOH A H1   1 
HETATM 8813 H H2   . HOH C 2 .   ? 3.891   79.876 -13.901 1.00 0.00  ? 613 HOH A H2   1 
HETATM 8814 O O    . HOH C 2 .   ? 29.017  26.711 -46.062 1.00 31.98 ? 614 HOH A O    1 
HETATM 8815 H H1   . HOH C 2 .   ? 28.620  27.521 -45.724 1.00 0.00  ? 614 HOH A H1   1 
HETATM 8816 H H2   . HOH C 2 .   ? 29.365  26.307 -45.265 1.00 0.00  ? 614 HOH A H2   1 
HETATM 8817 O O    . HOH C 2 .   ? 35.919  59.775 0.174   1.00 5.80  ? 615 HOH A O    1 
HETATM 8818 H H1   . HOH C 2 .   ? 35.319  59.226 -0.370  1.00 0.00  ? 615 HOH A H1   1 
HETATM 8819 H H2   . HOH C 2 .   ? 36.631  59.918 -0.466  1.00 0.00  ? 615 HOH A H2   1 
HETATM 8820 O O    . HOH C 2 .   ? 39.039  41.193 -49.944 1.00 46.85 ? 616 HOH A O    1 
HETATM 8821 H H1   . HOH C 2 .   ? 39.343  42.091 -50.081 1.00 0.00  ? 616 HOH A H1   1 
HETATM 8822 H H2   . HOH C 2 .   ? 39.520  40.923 -49.151 1.00 0.00  ? 616 HOH A H2   1 
HETATM 8823 O O    . HOH C 2 .   ? 32.838  71.863 6.436   1.00 41.13 ? 617 HOH A O    1 
HETATM 8824 H H1   . HOH C 2 .   ? 32.362  72.647 6.074   1.00 0.00  ? 617 HOH A H1   1 
HETATM 8825 H H2   . HOH C 2 .   ? 32.150  71.476 6.995   1.00 0.00  ? 617 HOH A H2   1 
HETATM 8826 O O    . HOH C 2 .   ? 35.882  32.124 -8.491  1.00 39.02 ? 618 HOH A O    1 
HETATM 8827 H H1   . HOH C 2 .   ? 35.091  31.737 -8.089  1.00 0.00  ? 618 HOH A H1   1 
HETATM 8828 H H2   . HOH C 2 .   ? 35.612  33.052 -8.414  1.00 0.00  ? 618 HOH A H2   1 
HETATM 8829 O O    . HOH C 2 .   ? 38.909  24.219 -27.184 1.00 26.37 ? 619 HOH A O    1 
HETATM 8830 H H1   . HOH C 2 .   ? 38.061  24.668 -27.041 1.00 0.00  ? 619 HOH A H1   1 
HETATM 8831 H H2   . HOH C 2 .   ? 39.050  24.536 -28.091 1.00 0.00  ? 619 HOH A H2   1 
HETATM 8832 O O    . HOH C 2 .   ? 22.834  31.426 -34.197 1.00 43.57 ? 620 HOH A O    1 
HETATM 8833 H H1   . HOH C 2 .   ? 22.160  31.510 -33.513 1.00 0.00  ? 620 HOH A H1   1 
HETATM 8834 H H2   . HOH C 2 .   ? 23.639  31.322 -33.670 1.00 0.00  ? 620 HOH A H2   1 
HETATM 8835 O O    . HOH C 2 .   ? 19.967  47.834 5.210   1.00 41.70 ? 621 HOH A O    1 
HETATM 8836 H H1   . HOH C 2 .   ? 19.835  47.208 4.479   1.00 0.00  ? 621 HOH A H1   1 
HETATM 8837 H H2   . HOH C 2 .   ? 20.908  48.060 5.051   1.00 0.00  ? 621 HOH A H2   1 
HETATM 8838 O O    . HOH C 2 .   ? 16.434  84.753 -27.113 1.00 40.79 ? 622 HOH A O    1 
HETATM 8839 H H1   . HOH C 2 .   ? 16.501  84.856 -26.153 1.00 0.00  ? 622 HOH A H1   1 
HETATM 8840 H H2   . HOH C 2 .   ? 17.222  84.219 -27.301 1.00 0.00  ? 622 HOH A H2   1 
HETATM 8841 O O    . HOH C 2 .   ? 26.663  46.172 -53.678 1.00 51.87 ? 623 HOH A O    1 
HETATM 8842 H H1   . HOH C 2 .   ? 26.027  45.746 -53.090 1.00 0.00  ? 623 HOH A H1   1 
HETATM 8843 H H2   . HOH C 2 .   ? 27.428  46.274 -53.094 1.00 0.00  ? 623 HOH A H2   1 
HETATM 8844 O O    . HOH C 2 .   ? 27.907  83.162 0.750   1.00 59.76 ? 624 HOH A O    1 
HETATM 8845 H H1   . HOH C 2 .   ? 28.249  82.278 0.642   1.00 0.00  ? 624 HOH A H1   1 
HETATM 8846 H H2   . HOH C 2 .   ? 27.280  83.041 1.490   1.00 0.00  ? 624 HOH A H2   1 
HETATM 8847 O O    . HOH C 2 .   ? 35.383  26.449 -45.502 1.00 69.80 ? 625 HOH A O    1 
HETATM 8848 H H1   . HOH C 2 .   ? 34.473  26.154 -45.619 1.00 0.00  ? 625 HOH A H1   1 
HETATM 8849 H H2   . HOH C 2 .   ? 35.853  25.999 -46.213 1.00 0.00  ? 625 HOH A H2   1 
HETATM 8850 O O    . HOH C 2 .   ? 42.344  50.437 -32.194 1.00 27.35 ? 626 HOH A O    1 
HETATM 8851 H H1   . HOH C 2 .   ? 42.755  49.574 -32.312 1.00 0.00  ? 626 HOH A H1   1 
HETATM 8852 H H2   . HOH C 2 .   ? 42.057  50.429 -31.278 1.00 0.00  ? 626 HOH A H2   1 
HETATM 8853 O O    . HOH C 2 .   ? 47.006  59.212 -12.010 1.00 20.37 ? 627 HOH A O    1 
HETATM 8854 H H1   . HOH C 2 .   ? 46.716  59.981 -11.499 1.00 0.00  ? 627 HOH A H1   1 
HETATM 8855 H H2   . HOH C 2 .   ? 46.703  59.403 -12.902 1.00 0.00  ? 627 HOH A H2   1 
HETATM 8856 O O    . HOH C 2 .   ? 19.388  85.682 -25.187 1.00 30.80 ? 628 HOH A O    1 
HETATM 8857 H H1   . HOH C 2 .   ? 19.140  86.462 -25.689 1.00 0.00  ? 628 HOH A H1   1 
HETATM 8858 H H2   . HOH C 2 .   ? 18.625  85.617 -24.585 1.00 0.00  ? 628 HOH A H2   1 
HETATM 8859 O O    . HOH C 2 .   ? 49.167  57.776 -11.160 1.00 46.10 ? 629 HOH A O    1 
HETATM 8860 H H1   . HOH C 2 .   ? 48.458  58.267 -11.636 1.00 0.00  ? 629 HOH A H1   1 
HETATM 8861 H H2   . HOH C 2 .   ? 48.655  57.318 -10.478 1.00 0.00  ? 629 HOH A H2   1 
HETATM 8862 O O    . HOH C 2 .   ? 31.100  45.917 -52.064 1.00 22.48 ? 630 HOH A O    1 
HETATM 8863 H H1   . HOH C 2 .   ? 30.419  46.095 -52.750 1.00 0.00  ? 630 HOH A H1   1 
HETATM 8864 H H2   . HOH C 2 .   ? 31.831  46.427 -52.412 1.00 0.00  ? 630 HOH A H2   1 
HETATM 8865 O O    . HOH C 2 .   ? 26.810  59.043 6.185   1.00 27.58 ? 631 HOH A O    1 
HETATM 8866 H H1   . HOH C 2 .   ? 27.541  59.508 5.764   1.00 0.00  ? 631 HOH A H1   1 
HETATM 8867 H H2   . HOH C 2 .   ? 26.210  58.838 5.463   1.00 0.00  ? 631 HOH A H2   1 
HETATM 8868 O O    . HOH C 2 .   ? 2.614   59.700 -28.865 1.00 37.59 ? 632 HOH A O    1 
HETATM 8869 H H1   . HOH C 2 .   ? 3.330   59.131 -28.533 1.00 0.00  ? 632 HOH A H1   1 
HETATM 8870 H H2   . HOH C 2 .   ? 2.246   59.182 -29.588 1.00 0.00  ? 632 HOH A H2   1 
HETATM 8871 O O    . HOH C 2 .   ? 29.388  66.303 -12.182 1.00 21.28 ? 633 HOH A O    1 
HETATM 8872 H H1   . HOH C 2 .   ? 28.478  66.042 -11.995 1.00 0.00  ? 633 HOH A H1   1 
HETATM 8873 H H2   . HOH C 2 .   ? 29.416  67.147 -11.696 1.00 0.00  ? 633 HOH A H2   1 
HETATM 8874 O O    . HOH C 2 .   ? 26.181  87.312 -14.017 1.00 63.26 ? 634 HOH A O    1 
HETATM 8875 H H1   . HOH C 2 .   ? 26.738  87.631 -14.734 1.00 0.00  ? 634 HOH A H1   1 
HETATM 8876 H H2   . HOH C 2 .   ? 25.532  86.784 -14.486 1.00 0.00  ? 634 HOH A H2   1 
HETATM 8877 O O    . HOH C 2 .   ? 41.166  71.549 -6.799  1.00 65.23 ? 635 HOH A O    1 
HETATM 8878 H H1   . HOH C 2 .   ? 40.678  71.049 -6.130  1.00 0.00  ? 635 HOH A H1   1 
HETATM 8879 H H2   . HOH C 2 .   ? 41.301  70.898 -7.488  1.00 0.00  ? 635 HOH A H2   1 
HETATM 8880 O O    . HOH C 2 .   ? 25.776  85.685 -2.786  1.00 18.48 ? 636 HOH A O    1 
HETATM 8881 H H1   . HOH C 2 .   ? 26.405  85.718 -2.055  1.00 0.00  ? 636 HOH A H1   1 
HETATM 8882 H H2   . HOH C 2 .   ? 25.295  86.514 -2.701  1.00 0.00  ? 636 HOH A H2   1 
HETATM 8883 O O    . HOH C 2 .   ? 16.902  89.406 -21.326 1.00 43.09 ? 637 HOH A O    1 
HETATM 8884 H H1   . HOH C 2 .   ? 16.275  89.492 -22.054 1.00 0.00  ? 637 HOH A H1   1 
HETATM 8885 H H2   . HOH C 2 .   ? 17.218  88.513 -21.510 1.00 0.00  ? 637 HOH A H2   1 
HETATM 8886 O O    . HOH C 2 .   ? 12.057  85.448 -17.462 1.00 50.78 ? 638 HOH A O    1 
HETATM 8887 H H1   . HOH C 2 .   ? 11.501  85.446 -18.245 1.00 0.00  ? 638 HOH A H1   1 
HETATM 8888 H H2   . HOH C 2 .   ? 12.708  84.767 -17.668 1.00 0.00  ? 638 HOH A H2   1 
HETATM 8889 O O    . HOH C 2 .   ? 7.334   67.946 4.304   1.00 24.11 ? 639 HOH A O    1 
HETATM 8890 H H1   . HOH C 2 .   ? 6.395   67.847 4.063   1.00 0.00  ? 639 HOH A H1   1 
HETATM 8891 H H2   . HOH C 2 .   ? 7.643   68.553 3.619   1.00 0.00  ? 639 HOH A H2   1 
HETATM 8892 O O    . HOH C 2 .   ? 29.635  25.860 -42.779 1.00 45.84 ? 640 HOH A O    1 
HETATM 8893 H H1   . HOH C 2 .   ? 29.675  26.807 -42.954 1.00 0.00  ? 640 HOH A H1   1 
HETATM 8894 H H2   . HOH C 2 .   ? 29.159  25.857 -41.921 1.00 0.00  ? 640 HOH A H2   1 
HETATM 8895 O O    . HOH C 2 .   ? 54.776  55.431 -24.561 1.00 39.03 ? 641 HOH A O    1 
HETATM 8896 H H1   . HOH C 2 .   ? 54.704  55.519 -23.607 1.00 0.00  ? 641 HOH A H1   1 
HETATM 8897 H H2   . HOH C 2 .   ? 53.859  55.318 -24.840 1.00 0.00  ? 641 HOH A H2   1 
HETATM 8898 O O    . HOH C 2 .   ? 11.130  94.101 -12.288 1.00 46.18 ? 642 HOH A O    1 
HETATM 8899 H H1   . HOH C 2 .   ? 11.255  95.023 -12.541 1.00 0.00  ? 642 HOH A H1   1 
HETATM 8900 H H2   . HOH C 2 .   ? 12.065  93.797 -12.290 1.00 0.00  ? 642 HOH A H2   1 
HETATM 8901 O O    . HOH C 2 .   ? 14.874  58.132 2.583   1.00 28.23 ? 643 HOH A O    1 
HETATM 8902 H H1   . HOH C 2 .   ? 14.741  57.791 3.487   1.00 0.00  ? 643 HOH A H1   1 
HETATM 8903 H H2   . HOH C 2 .   ? 14.582  59.046 2.675   1.00 0.00  ? 643 HOH A H2   1 
HETATM 8904 O O    . HOH C 2 .   ? 4.373   67.547 4.220   1.00 64.11 ? 644 HOH A O    1 
HETATM 8905 H H1   . HOH C 2 .   ? 4.409   67.709 5.177   1.00 0.00  ? 644 HOH A H1   1 
HETATM 8906 H H2   . HOH C 2 .   ? 3.510   67.130 4.100   1.00 0.00  ? 644 HOH A H2   1 
HETATM 8907 O O    . HOH C 2 .   ? 18.824  82.834 -28.215 1.00 48.04 ? 645 HOH A O    1 
HETATM 8908 H H1   . HOH C 2 .   ? 18.996  81.884 -28.147 1.00 0.00  ? 645 HOH A H1   1 
HETATM 8909 H H2   . HOH C 2 .   ? 19.593  83.185 -27.753 1.00 0.00  ? 645 HOH A H2   1 
HETATM 8910 O O    . HOH C 2 .   ? 16.276  68.135 -33.913 1.00 37.54 ? 646 HOH A O    1 
HETATM 8911 H H1   . HOH C 2 .   ? 15.693  67.483 -34.315 1.00 0.00  ? 646 HOH A H1   1 
HETATM 8912 H H2   . HOH C 2 .   ? 17.156  67.808 -34.154 1.00 0.00  ? 646 HOH A H2   1 
HETATM 8913 O O    . HOH C 2 .   ? 6.755   56.011 -7.673  1.00 62.27 ? 647 HOH A O    1 
HETATM 8914 H H1   . HOH C 2 .   ? 6.504   55.117 -7.401  1.00 0.00  ? 647 HOH A H1   1 
HETATM 8915 H H2   . HOH C 2 .   ? 6.025   56.533 -7.325  1.00 0.00  ? 647 HOH A H2   1 
HETATM 8916 O O    . HOH C 2 .   ? 26.412  33.855 -45.538 1.00 35.43 ? 648 HOH A O    1 
HETATM 8917 H H1   . HOH C 2 .   ? 27.079  33.164 -45.678 1.00 0.00  ? 648 HOH A H1   1 
HETATM 8918 H H2   . HOH C 2 .   ? 26.680  34.546 -46.150 1.00 0.00  ? 648 HOH A H2   1 
HETATM 8919 O O    . HOH C 2 .   ? 0.256   56.950 -18.306 1.00 6.39  ? 649 HOH A O    1 
HETATM 8920 H H1   . HOH C 2 .   ? 0.784   56.210 -17.987 1.00 0.00  ? 649 HOH A H1   1 
HETATM 8921 H H2   . HOH C 2 .   ? 0.493   57.620 -17.654 1.00 0.00  ? 649 HOH A H2   1 
HETATM 8922 O O    . HOH C 2 .   ? 25.755  37.534 -6.681  1.00 12.01 ? 650 HOH A O    1 
HETATM 8923 H H1   . HOH C 2 .   ? 26.488  37.038 -6.289  1.00 0.00  ? 650 HOH A H1   1 
HETATM 8924 H H2   . HOH C 2 .   ? 25.173  36.819 -6.962  1.00 0.00  ? 650 HOH A H2   1 
HETATM 8925 O O    . HOH C 2 .   ? 13.796  85.410 -28.212 1.00 29.40 ? 651 HOH A O    1 
HETATM 8926 H H1   . HOH C 2 .   ? 14.257  85.728 -28.994 1.00 0.00  ? 651 HOH A H1   1 
HETATM 8927 H H2   . HOH C 2 .   ? 12.951  85.103 -28.600 1.00 0.00  ? 651 HOH A H2   1 
HETATM 8928 O O    . HOH C 2 .   ? 36.872  30.722 -11.587 1.00 21.27 ? 652 HOH A O    1 
HETATM 8929 H H1   . HOH C 2 .   ? 37.374  29.990 -11.195 1.00 0.00  ? 652 HOH A H1   1 
HETATM 8930 H H2   . HOH C 2 .   ? 36.520  31.171 -10.796 1.00 0.00  ? 652 HOH A H2   1 
HETATM 8931 O O    . HOH C 2 .   ? 10.982  83.174 -28.535 1.00 51.91 ? 653 HOH A O    1 
HETATM 8932 H H1   . HOH C 2 .   ? 11.046  82.344 -29.057 1.00 0.00  ? 653 HOH A H1   1 
HETATM 8933 H H2   . HOH C 2 .   ? 10.066  83.407 -28.688 1.00 0.00  ? 653 HOH A H2   1 
HETATM 8934 O O    . HOH C 2 .   ? 39.274  34.291 -10.856 1.00 37.61 ? 654 HOH A O    1 
HETATM 8935 H H1   . HOH C 2 .   ? 38.355  34.500 -10.669 1.00 0.00  ? 654 HOH A H1   1 
HETATM 8936 H H2   . HOH C 2 .   ? 39.186  33.452 -11.326 1.00 0.00  ? 654 HOH A H2   1 
HETATM 8937 O O    . HOH D 2 .   ? 26.085  38.048 -23.240 1.00 5.01  ? 432 HOH B O    1 
HETATM 8938 H H1   . HOH D 2 .   ? 25.746  37.875 -22.357 1.00 0.00  ? 432 HOH B H1   1 
HETATM 8939 H H2   . HOH D 2 .   ? 27.023  38.227 -23.085 1.00 0.00  ? 432 HOH B H2   1 
HETATM 8940 O O    . HOH D 2 .   ? 20.827  50.611 -34.454 1.00 35.59 ? 433 HOH B O    1 
HETATM 8941 H H1   . HOH D 2 .   ? 21.705  50.890 -34.757 1.00 0.00  ? 433 HOH B H1   1 
HETATM 8942 H H2   . HOH D 2 .   ? 20.259  50.961 -35.157 1.00 0.00  ? 433 HOH B H2   1 
HETATM 8943 O O    . HOH D 2 .   ? 27.061  34.181 -14.090 1.00 44.57 ? 434 HOH B O    1 
HETATM 8944 H H1   . HOH D 2 .   ? 27.869  33.738 -14.347 1.00 0.00  ? 434 HOH B H1   1 
HETATM 8945 H H2   . HOH D 2 .   ? 27.126  34.207 -13.126 1.00 0.00  ? 434 HOH B H2   1 
HETATM 8946 O O    . HOH D 2 .   ? 17.689  0.777  -6.515  1.00 30.65 ? 435 HOH B O    1 
HETATM 8947 H H1   . HOH D 2 .   ? 17.665  1.631  -6.954  1.00 0.00  ? 435 HOH B H1   1 
HETATM 8948 H H2   . HOH D 2 .   ? 17.829  0.143  -7.215  1.00 0.00  ? 435 HOH B H2   1 
HETATM 8949 O O    . HOH D 2 .   ? 7.563   35.174 -17.778 1.00 9.74  ? 436 HOH B O    1 
HETATM 8950 H H1   . HOH D 2 .   ? 7.383   34.765 -16.919 1.00 0.00  ? 436 HOH B H1   1 
HETATM 8951 H H2   . HOH D 2 .   ? 8.248   34.601 -18.161 1.00 0.00  ? 436 HOH B H2   1 
HETATM 8952 O O    . HOH D 2 .   ? -5.144  29.715 -0.200  1.00 9.69  ? 437 HOH B O    1 
HETATM 8953 H H1   . HOH D 2 .   ? -5.656  30.520 -0.370  1.00 0.00  ? 437 HOH B H1   1 
HETATM 8954 H H2   . HOH D 2 .   ? -5.265  29.196 -1.001  1.00 0.00  ? 437 HOH B H2   1 
HETATM 8955 O O    . HOH D 2 .   ? 20.778  37.913 -12.337 1.00 29.77 ? 438 HOH B O    1 
HETATM 8956 H H1   . HOH D 2 .   ? 21.150  37.720 -11.468 1.00 0.00  ? 438 HOH B H1   1 
HETATM 8957 H H2   . HOH D 2 .   ? 20.425  37.063 -12.607 1.00 0.00  ? 438 HOH B H2   1 
HETATM 8958 O O    . HOH D 2 .   ? 19.856  51.914 -31.985 1.00 35.45 ? 439 HOH B O    1 
HETATM 8959 H H1   . HOH D 2 .   ? 20.237  51.554 -32.816 1.00 0.00  ? 439 HOH B H1   1 
HETATM 8960 H H2   . HOH D 2 .   ? 19.422  51.125 -31.642 1.00 0.00  ? 439 HOH B H2   1 
HETATM 8961 O O    . HOH D 2 .   ? 35.275  22.168 -1.852  1.00 16.96 ? 440 HOH B O    1 
HETATM 8962 H H1   . HOH D 2 .   ? 35.679  22.446 -2.685  1.00 0.00  ? 440 HOH B H1   1 
HETATM 8963 H H2   . HOH D 2 .   ? 35.430  22.929 -1.282  1.00 0.00  ? 440 HOH B H2   1 
HETATM 8964 O O    . HOH D 2 .   ? -5.479  25.426 -12.224 1.00 37.32 ? 441 HOH B O    1 
HETATM 8965 H H1   . HOH D 2 .   ? -4.538  25.197 -12.261 1.00 0.00  ? 441 HOH B H1   1 
HETATM 8966 H H2   . HOH D 2 .   ? -5.426  26.375 -12.060 1.00 0.00  ? 441 HOH B H2   1 
HETATM 8967 O O    . HOH D 2 .   ? 19.532  41.019 -39.251 1.00 13.66 ? 442 HOH B O    1 
HETATM 8968 H H1   . HOH D 2 .   ? 18.884  40.969 -38.546 1.00 0.00  ? 442 HOH B H1   1 
HETATM 8969 H H2   . HOH D 2 .   ? 19.015  41.159 -40.049 1.00 0.00  ? 442 HOH B H2   1 
HETATM 8970 O O    . HOH D 2 .   ? 8.590   42.299 2.141   1.00 16.78 ? 443 HOH B O    1 
HETATM 8971 H H1   . HOH D 2 .   ? 8.912   42.977 2.770   1.00 0.00  ? 443 HOH B H1   1 
HETATM 8972 H H2   . HOH D 2 .   ? 8.428   42.903 1.396   1.00 0.00  ? 443 HOH B H2   1 
HETATM 8973 O O    . HOH D 2 .   ? 29.968  17.404 -19.734 1.00 26.13 ? 444 HOH B O    1 
HETATM 8974 H H1   . HOH D 2 .   ? 30.629  18.099 -19.841 1.00 0.00  ? 444 HOH B H1   1 
HETATM 8975 H H2   . HOH D 2 .   ? 30.523  16.692 -19.376 1.00 0.00  ? 444 HOH B H2   1 
HETATM 8976 O O    . HOH D 2 .   ? 25.586  6.513  -16.165 1.00 26.09 ? 445 HOH B O    1 
HETATM 8977 H H1   . HOH D 2 .   ? 25.053  5.917  -15.607 1.00 0.00  ? 445 HOH B H1   1 
HETATM 8978 H H2   . HOH D 2 .   ? 26.467  6.154  -16.048 1.00 0.00  ? 445 HOH B H2   1 
HETATM 8979 O O    . HOH D 2 .   ? 20.245  12.982 -7.408  1.00 28.96 ? 446 HOH B O    1 
HETATM 8980 H H1   . HOH D 2 .   ? 20.898  13.298 -6.779  1.00 0.00  ? 446 HOH B H1   1 
HETATM 8981 H H2   . HOH D 2 .   ? 19.478  12.922 -6.825  1.00 0.00  ? 446 HOH B H2   1 
HETATM 8982 O O    . HOH D 2 .   ? 10.405  43.868 -32.365 1.00 10.22 ? 447 HOH B O    1 
HETATM 8983 H H1   . HOH D 2 .   ? 11.012  43.149 -32.150 1.00 0.00  ? 447 HOH B H1   1 
HETATM 8984 H H2   . HOH D 2 .   ? 9.914   43.525 -33.137 1.00 0.00  ? 447 HOH B H2   1 
HETATM 8985 O O    . HOH D 2 .   ? 13.942  36.770 1.289   1.00 38.07 ? 448 HOH B O    1 
HETATM 8986 H H1   . HOH D 2 .   ? 13.376  36.629 2.069   1.00 0.00  ? 448 HOH B H1   1 
HETATM 8987 H H2   . HOH D 2 .   ? 13.509  37.529 0.863   1.00 0.00  ? 448 HOH B H2   1 
HETATM 8988 O O    . HOH D 2 .   ? 27.902  17.611 -21.360 1.00 28.30 ? 449 HOH B O    1 
HETATM 8989 H H1   . HOH D 2 .   ? 27.678  16.692 -21.561 1.00 0.00  ? 449 HOH B H1   1 
HETATM 8990 H H2   . HOH D 2 .   ? 28.674  17.487 -20.759 1.00 0.00  ? 449 HOH B H2   1 
HETATM 8991 O O    . HOH D 2 .   ? 6.599   44.400 0.652   1.00 14.99 ? 450 HOH B O    1 
HETATM 8992 H H1   . HOH D 2 .   ? 7.308   44.260 0.010   1.00 0.00  ? 450 HOH B H1   1 
HETATM 8993 H H2   . HOH D 2 .   ? 6.070   45.085 0.184   1.00 0.00  ? 450 HOH B H2   1 
HETATM 8994 O O    . HOH D 2 .   ? 12.455  5.067  -18.665 1.00 43.61 ? 451 HOH B O    1 
HETATM 8995 H H1   . HOH D 2 .   ? 12.644  4.858  -17.741 1.00 0.00  ? 451 HOH B H1   1 
HETATM 8996 H H2   . HOH D 2 .   ? 13.134  4.574  -19.134 1.00 0.00  ? 451 HOH B H2   1 
HETATM 8997 O O    . HOH D 2 .   ? -18.281 34.252 -18.140 1.00 28.52 ? 452 HOH B O    1 
HETATM 8998 H H1   . HOH D 2 .   ? -19.187 33.943 -18.154 1.00 0.00  ? 452 HOH B H1   1 
HETATM 8999 H H2   . HOH D 2 .   ? -17.892 33.757 -17.413 1.00 0.00  ? 452 HOH B H2   1 
HETATM 9000 O O    . HOH D 2 .   ? 20.467  19.807 -10.632 1.00 18.60 ? 453 HOH B O    1 
HETATM 9001 H H1   . HOH D 2 .   ? 20.801  20.702 -10.847 1.00 0.00  ? 453 HOH B H1   1 
HETATM 9002 H H2   . HOH D 2 .   ? 20.570  19.398 -11.490 1.00 0.00  ? 453 HOH B H2   1 
HETATM 9003 O O    . HOH D 2 .   ? 12.316  26.139 6.079   1.00 17.85 ? 454 HOH B O    1 
HETATM 9004 H H1   . HOH D 2 .   ? 12.275  25.941 5.131   1.00 0.00  ? 454 HOH B H1   1 
HETATM 9005 H H2   . HOH D 2 .   ? 11.394  26.321 6.283   1.00 0.00  ? 454 HOH B H2   1 
HETATM 9006 O O    . HOH D 2 .   ? 11.800  28.454 9.256   1.00 36.94 ? 455 HOH B O    1 
HETATM 9007 H H1   . HOH D 2 .   ? 10.905  28.529 8.897   1.00 0.00  ? 455 HOH B H1   1 
HETATM 9008 H H2   . HOH D 2 .   ? 11.700  27.688 9.826   1.00 0.00  ? 455 HOH B H2   1 
HETATM 9009 O O    . HOH D 2 .   ? 18.520  15.412 10.164  1.00 56.71 ? 456 HOH B O    1 
HETATM 9010 H H1   . HOH D 2 .   ? 18.589  14.982 9.303   1.00 0.00  ? 456 HOH B H1   1 
HETATM 9011 H H2   . HOH D 2 .   ? 19.422  15.320 10.495  1.00 0.00  ? 456 HOH B H2   1 
HETATM 9012 O O    . HOH D 2 .   ? -3.421  52.693 -20.630 1.00 44.18 ? 457 HOH B O    1 
HETATM 9013 H H1   . HOH D 2 .   ? -3.986  51.910 -20.556 1.00 0.00  ? 457 HOH B H1   1 
HETATM 9014 H H2   . HOH D 2 .   ? -3.675  53.027 -21.495 1.00 0.00  ? 457 HOH B H2   1 
HETATM 9015 O O    . HOH D 2 .   ? 34.891  25.402 -3.063  1.00 14.03 ? 458 HOH B O    1 
HETATM 9016 H H1   . HOH D 2 .   ? 35.770  25.009 -2.932  1.00 0.00  ? 458 HOH B H1   1 
HETATM 9017 H H2   . HOH D 2 .   ? 35.045  26.312 -2.773  1.00 0.00  ? 458 HOH B H2   1 
HETATM 9018 O O    . HOH D 2 .   ? 8.629   48.598 -49.458 1.00 17.87 ? 459 HOH B O    1 
HETATM 9019 H H1   . HOH D 2 .   ? 9.034   47.870 -48.983 1.00 0.00  ? 459 HOH B H1   1 
HETATM 9020 H H2   . HOH D 2 .   ? 9.415   49.092 -49.708 1.00 0.00  ? 459 HOH B H2   1 
HETATM 9021 O O    . HOH D 2 .   ? -4.220  32.098 -34.128 1.00 7.14  ? 460 HOH B O    1 
HETATM 9022 H H1   . HOH D 2 .   ? -4.917  32.755 -33.939 1.00 0.00  ? 460 HOH B H1   1 
HETATM 9023 H H2   . HOH D 2 .   ? -4.044  31.805 -33.234 1.00 0.00  ? 460 HOH B H2   1 
HETATM 9024 O O    . HOH D 2 .   ? 13.111  22.947 -21.300 1.00 22.40 ? 461 HOH B O    1 
HETATM 9025 H H1   . HOH D 2 .   ? 12.678  22.267 -20.762 1.00 0.00  ? 461 HOH B H1   1 
HETATM 9026 H H2   . HOH D 2 .   ? 14.040  22.662 -21.256 1.00 0.00  ? 461 HOH B H2   1 
HETATM 9027 O O    . HOH D 2 .   ? 24.436  6.063  -11.043 1.00 9.94  ? 462 HOH B O    1 
HETATM 9028 H H1   . HOH D 2 .   ? 24.571  6.011  -12.014 1.00 0.00  ? 462 HOH B H1   1 
HETATM 9029 H H2   . HOH D 2 .   ? 23.679  5.451  -11.015 1.00 0.00  ? 462 HOH B H2   1 
HETATM 9030 O O    . HOH D 2 .   ? 20.884  8.585  4.956   1.00 38.85 ? 463 HOH B O    1 
HETATM 9031 H H1   . HOH D 2 .   ? 21.763  8.293  5.230   1.00 0.00  ? 463 HOH B H1   1 
HETATM 9032 H H2   . HOH D 2 .   ? 20.499  7.833  4.500   1.00 0.00  ? 463 HOH B H2   1 
HETATM 9033 O O    . HOH D 2 .   ? 8.166   58.563 -42.899 1.00 34.52 ? 464 HOH B O    1 
HETATM 9034 H H1   . HOH D 2 .   ? 8.173   57.949 -42.152 1.00 0.00  ? 464 HOH B H1   1 
HETATM 9035 H H2   . HOH D 2 .   ? 7.729   58.007 -43.554 1.00 0.00  ? 464 HOH B H2   1 
HETATM 9036 O O    . HOH D 2 .   ? 3.800   21.178 -13.218 1.00 45.79 ? 465 HOH B O    1 
HETATM 9037 H H1   . HOH D 2 .   ? 3.165   20.718 -13.779 1.00 0.00  ? 465 HOH B H1   1 
HETATM 9038 H H2   . HOH D 2 .   ? 3.747   20.683 -12.393 1.00 0.00  ? 465 HOH B H2   1 
HETATM 9039 O O    . HOH D 2 .   ? 20.508  33.380 -0.620  1.00 25.88 ? 466 HOH B O    1 
HETATM 9040 H H1   . HOH D 2 .   ? 20.940  32.577 -0.315  1.00 0.00  ? 466 HOH B H1   1 
HETATM 9041 H H2   . HOH D 2 .   ? 19.707  33.028 -1.039  1.00 0.00  ? 466 HOH B H2   1 
HETATM 9042 O O    . HOH D 2 .   ? 14.690  38.866 -22.169 1.00 18.89 ? 467 HOH B O    1 
HETATM 9043 H H1   . HOH D 2 .   ? 14.485  39.334 -21.334 1.00 0.00  ? 467 HOH B H1   1 
HETATM 9044 H H2   . HOH D 2 .   ? 14.802  39.593 -22.798 1.00 0.00  ? 467 HOH B H2   1 
HETATM 9045 O O    . HOH D 2 .   ? 34.298  29.598 -13.950 1.00 37.19 ? 468 HOH B O    1 
HETATM 9046 H H1   . HOH D 2 .   ? 33.526  29.573 -13.377 1.00 0.00  ? 468 HOH B H1   1 
HETATM 9047 H H2   . HOH D 2 .   ? 34.934  30.092 -13.412 1.00 0.00  ? 468 HOH B H2   1 
HETATM 9048 O O    . HOH D 2 .   ? 11.973  36.130 3.965   1.00 43.76 ? 469 HOH B O    1 
HETATM 9049 H H1   . HOH D 2 .   ? 11.657  36.591 4.765   1.00 0.00  ? 469 HOH B H1   1 
HETATM 9050 H H2   . HOH D 2 .   ? 11.148  36.171 3.470   1.00 0.00  ? 469 HOH B H2   1 
HETATM 9051 O O    . HOH D 2 .   ? -5.277  55.539 -34.923 1.00 18.62 ? 470 HOH B O    1 
HETATM 9052 H H1   . HOH D 2 .   ? -5.923  55.004 -34.407 1.00 0.00  ? 470 HOH B H1   1 
HETATM 9053 H H2   . HOH D 2 .   ? -4.722  55.811 -34.180 1.00 0.00  ? 470 HOH B H2   1 
HETATM 9054 O O    . HOH D 2 .   ? 27.270  20.995 8.064   1.00 30.43 ? 471 HOH B O    1 
HETATM 9055 H H1   . HOH D 2 .   ? 27.907  21.716 8.160   1.00 0.00  ? 471 HOH B H1   1 
HETATM 9056 H H2   . HOH D 2 .   ? 26.822  21.153 7.223   1.00 0.00  ? 471 HOH B H2   1 
HETATM 9057 O O    . HOH D 2 .   ? 5.276   7.863  -10.108 1.00 19.01 ? 472 HOH B O    1 
HETATM 9058 H H1   . HOH D 2 .   ? 5.651   7.681  -9.216  1.00 0.00  ? 472 HOH B H1   1 
HETATM 9059 H H2   . HOH D 2 .   ? 6.045   8.282  -10.528 1.00 0.00  ? 472 HOH B H2   1 
HETATM 9060 O O    . HOH D 2 .   ? -3.702  47.218 0.412   1.00 15.33 ? 473 HOH B O    1 
HETATM 9061 H H1   . HOH D 2 .   ? -3.730  46.725 -0.419  1.00 0.00  ? 473 HOH B H1   1 
HETATM 9062 H H2   . HOH D 2 .   ? -2.773  47.091 0.651   1.00 0.00  ? 473 HOH B H2   1 
HETATM 9063 O O    . HOH D 2 .   ? 2.700   44.288 3.970   1.00 49.43 ? 474 HOH B O    1 
HETATM 9064 H H1   . HOH D 2 .   ? 3.545   44.744 3.821   1.00 0.00  ? 474 HOH B H1   1 
HETATM 9065 H H2   . HOH D 2 .   ? 2.409   44.092 3.070   1.00 0.00  ? 474 HOH B H2   1 
HETATM 9066 O O    . HOH D 2 .   ? 4.685   45.664 3.033   1.00 17.70 ? 475 HOH B O    1 
HETATM 9067 H H1   . HOH D 2 .   ? 5.433   45.308 2.506   1.00 0.00  ? 475 HOH B H1   1 
HETATM 9068 H H2   . HOH D 2 .   ? 4.009   45.661 2.334   1.00 0.00  ? 475 HOH B H2   1 
HETATM 9069 O O    . HOH D 2 .   ? 2.156   32.207 -18.073 1.00 37.09 ? 476 HOH B O    1 
HETATM 9070 H H1   . HOH D 2 .   ? 1.367   31.664 -17.974 1.00 0.00  ? 476 HOH B H1   1 
HETATM 9071 H H2   . HOH D 2 .   ? 2.495   32.255 -17.163 1.00 0.00  ? 476 HOH B H2   1 
HETATM 9072 O O    . HOH D 2 .   ? 12.361  32.633 -16.435 1.00 10.59 ? 477 HOH B O    1 
HETATM 9073 H H1   . HOH D 2 .   ? 13.017  31.960 -16.196 1.00 0.00  ? 477 HOH B H1   1 
HETATM 9074 H H2   . HOH D 2 .   ? 12.623  33.343 -15.832 1.00 0.00  ? 477 HOH B H2   1 
HETATM 9075 O O    . HOH D 2 .   ? 37.338  8.708  -16.146 1.00 36.25 ? 478 HOH B O    1 
HETATM 9076 H H1   . HOH D 2 .   ? 36.542  9.191  -16.427 1.00 0.00  ? 478 HOH B H1   1 
HETATM 9077 H H2   . HOH D 2 .   ? 37.641  9.340  -15.484 1.00 0.00  ? 478 HOH B H2   1 
HETATM 9078 O O    . HOH D 2 .   ? 45.676  20.529 -10.291 1.00 22.33 ? 479 HOH B O    1 
HETATM 9079 H H1   . HOH D 2 .   ? 45.144  20.248 -9.532  1.00 0.00  ? 479 HOH B H1   1 
HETATM 9080 H H2   . HOH D 2 .   ? 45.134  20.237 -11.036 1.00 0.00  ? 479 HOH B H2   1 
HETATM 9081 O O    . HOH D 2 .   ? 10.076  49.651 -38.687 1.00 19.82 ? 480 HOH B O    1 
HETATM 9082 H H1   . HOH D 2 .   ? 11.030  49.815 -38.695 1.00 0.00  ? 480 HOH B H1   1 
HETATM 9083 H H2   . HOH D 2 .   ? 9.985   49.120 -37.886 1.00 0.00  ? 480 HOH B H2   1 
HETATM 9084 O O    . HOH D 2 .   ? 32.599  11.031 -6.368  1.00 37.93 ? 481 HOH B O    1 
HETATM 9085 H H1   . HOH D 2 .   ? 32.139  10.842 -5.536  1.00 0.00  ? 481 HOH B H1   1 
HETATM 9086 H H2   . HOH D 2 .   ? 32.673  10.167 -6.785  1.00 0.00  ? 481 HOH B H2   1 
HETATM 9087 O O    . HOH D 2 .   ? 9.491   45.893 -1.132  1.00 10.47 ? 482 HOH B O    1 
HETATM 9088 H H1   . HOH D 2 .   ? 9.182   45.042 -1.475  1.00 0.00  ? 482 HOH B H1   1 
HETATM 9089 H H2   . HOH D 2 .   ? 10.179  45.604 -0.531  1.00 0.00  ? 482 HOH B H2   1 
HETATM 9090 O O    . HOH D 2 .   ? 25.607  11.177 2.127   1.00 71.66 ? 483 HOH B O    1 
HETATM 9091 H H1   . HOH D 2 .   ? 25.931  11.923 1.598   1.00 0.00  ? 483 HOH B H1   1 
HETATM 9092 H H2   . HOH D 2 .   ? 25.170  11.643 2.848   1.00 0.00  ? 483 HOH B H2   1 
HETATM 9093 O O    . HOH D 2 .   ? 16.536  25.103 -47.177 1.00 34.57 ? 484 HOH B O    1 
HETATM 9094 H H1   . HOH D 2 .   ? 16.542  24.456 -46.463 1.00 0.00  ? 484 HOH B H1   1 
HETATM 9095 H H2   . HOH D 2 .   ? 16.606  25.952 -46.696 1.00 0.00  ? 484 HOH B H2   1 
HETATM 9096 O O    . HOH D 2 .   ? 2.712   7.707  -9.511  1.00 9.15  ? 485 HOH B O    1 
HETATM 9097 H H1   . HOH D 2 .   ? 2.535   8.154  -10.347 1.00 0.00  ? 485 HOH B H1   1 
HETATM 9098 H H2   . HOH D 2 .   ? 3.687   7.678  -9.556  1.00 0.00  ? 485 HOH B H2   1 
HETATM 9099 O O    . HOH D 2 .   ? 1.399   18.698 9.823   1.00 51.17 ? 486 HOH B O    1 
HETATM 9100 H H1   . HOH D 2 .   ? 1.063   18.895 8.943   1.00 0.00  ? 486 HOH B H1   1 
HETATM 9101 H H2   . HOH D 2 .   ? 2.318   18.480 9.658   1.00 0.00  ? 486 HOH B H2   1 
HETATM 9102 O O    . HOH D 2 .   ? -4.506  57.110 -37.743 1.00 63.51 ? 487 HOH B O    1 
HETATM 9103 H H1   . HOH D 2 .   ? -4.141  58.007 -37.787 1.00 0.00  ? 487 HOH B H1   1 
HETATM 9104 H H2   . HOH D 2 .   ? -4.912  57.103 -36.863 1.00 0.00  ? 487 HOH B H2   1 
HETATM 9105 O O    . HOH D 2 .   ? 8.774   20.772 -21.763 1.00 53.37 ? 488 HOH B O    1 
HETATM 9106 H H1   . HOH D 2 .   ? 8.693   20.571 -20.821 1.00 0.00  ? 488 HOH B H1   1 
HETATM 9107 H H2   . HOH D 2 .   ? 9.548   21.356 -21.705 1.00 0.00  ? 488 HOH B H2   1 
HETATM 9108 O O    . HOH D 2 .   ? 26.033  25.607 3.949   1.00 11.49 ? 489 HOH B O    1 
HETATM 9109 H H1   . HOH D 2 .   ? 26.487  25.468 3.109   1.00 0.00  ? 489 HOH B H1   1 
HETATM 9110 H H2   . HOH D 2 .   ? 26.034  24.711 4.286   1.00 0.00  ? 489 HOH B H2   1 
HETATM 9111 O O    . HOH D 2 .   ? 29.072  9.377  0.253   1.00 37.62 ? 490 HOH B O    1 
HETATM 9112 H H1   . HOH D 2 .   ? 28.739  10.179 0.674   1.00 0.00  ? 490 HOH B H1   1 
HETATM 9113 H H2   . HOH D 2 .   ? 29.475  8.898  0.984   1.00 0.00  ? 490 HOH B H2   1 
HETATM 9114 O O    . HOH D 2 .   ? -6.387  47.988 0.587   1.00 28.77 ? 491 HOH B O    1 
HETATM 9115 H H1   . HOH D 2 .   ? -6.398  47.627 1.479   1.00 0.00  ? 491 HOH B H1   1 
HETATM 9116 H H2   . HOH D 2 .   ? -5.443  47.847 0.370   1.00 0.00  ? 491 HOH B H2   1 
HETATM 9117 O O    . HOH D 2 .   ? 21.654  26.256 4.344   1.00 35.26 ? 492 HOH B O    1 
HETATM 9118 H H1   . HOH D 2 .   ? 22.595  26.061 4.350   1.00 0.00  ? 492 HOH B H1   1 
HETATM 9119 H H2   . HOH D 2 .   ? 21.330  25.659 3.665   1.00 0.00  ? 492 HOH B H2   1 
HETATM 9120 O O    . HOH D 2 .   ? 14.412  42.563 2.254   1.00 31.79 ? 493 HOH B O    1 
HETATM 9121 H H1   . HOH D 2 .   ? 13.891  41.843 1.890   1.00 0.00  ? 493 HOH B H1   1 
HETATM 9122 H H2   . HOH D 2 .   ? 13.731  43.263 2.307   1.00 0.00  ? 493 HOH B H2   1 
HETATM 9123 O O    . HOH D 2 .   ? 14.245  32.344 3.243   1.00 5.01  ? 494 HOH B O    1 
HETATM 9124 H H1   . HOH D 2 .   ? 13.613  31.704 2.867   1.00 0.00  ? 494 HOH B H1   1 
HETATM 9125 H H2   . HOH D 2 .   ? 15.005  32.201 2.671   1.00 0.00  ? 494 HOH B H2   1 
HETATM 9126 O O    . HOH D 2 .   ? 13.860  40.274 -19.819 1.00 42.09 ? 495 HOH B O    1 
HETATM 9127 H H1   . HOH D 2 .   ? 14.448  40.073 -19.086 1.00 0.00  ? 495 HOH B H1   1 
HETATM 9128 H H2   . HOH D 2 .   ? 13.000  40.333 -19.377 1.00 0.00  ? 495 HOH B H2   1 
HETATM 9129 O O    . HOH D 2 .   ? 7.509   12.264 13.103  1.00 23.71 ? 496 HOH B O    1 
HETATM 9130 H H1   . HOH D 2 .   ? 7.815   11.450 12.688  1.00 0.00  ? 496 HOH B H1   1 
HETATM 9131 H H2   . HOH D 2 .   ? 7.115   11.915 13.912  1.00 0.00  ? 496 HOH B H2   1 
HETATM 9132 O O    . HOH D 2 .   ? 21.341  21.766 -11.977 1.00 9.13  ? 497 HOH B O    1 
HETATM 9133 H H1   . HOH D 2 .   ? 22.212  21.536 -12.325 1.00 0.00  ? 497 HOH B H1   1 
HETATM 9134 H H2   . HOH D 2 .   ? 21.188  22.656 -12.303 1.00 0.00  ? 497 HOH B H2   1 
HETATM 9135 O O    . HOH D 2 .   ? 12.488  50.646 -40.044 1.00 53.78 ? 498 HOH B O    1 
HETATM 9136 H H1   . HOH D 2 .   ? 11.589  50.584 -40.403 1.00 0.00  ? 498 HOH B H1   1 
HETATM 9137 H H2   . HOH D 2 .   ? 12.751  51.471 -40.469 1.00 0.00  ? 498 HOH B H2   1 
HETATM 9138 O O    . HOH D 2 .   ? -12.970 43.579 -33.346 1.00 16.64 ? 499 HOH B O    1 
HETATM 9139 H H1   . HOH D 2 .   ? -13.086 44.386 -32.823 1.00 0.00  ? 499 HOH B H1   1 
HETATM 9140 H H2   . HOH D 2 .   ? -12.068 43.716 -33.652 1.00 0.00  ? 499 HOH B H2   1 
HETATM 9141 O O    . HOH D 2 .   ? 3.224   42.329 -49.814 1.00 35.58 ? 500 HOH B O    1 
HETATM 9142 H H1   . HOH D 2 .   ? 2.603   41.736 -50.242 1.00 0.00  ? 500 HOH B H1   1 
HETATM 9143 H H2   . HOH D 2 .   ? 4.082   42.092 -50.202 1.00 0.00  ? 500 HOH B H2   1 
HETATM 9144 O O    . HOH D 2 .   ? -8.491  34.210 -5.711  1.00 33.72 ? 501 HOH B O    1 
HETATM 9145 H H1   . HOH D 2 .   ? -7.573  34.357 -5.451  1.00 0.00  ? 501 HOH B H1   1 
HETATM 9146 H H2   . HOH D 2 .   ? -8.891  33.986 -4.862  1.00 0.00  ? 501 HOH B H2   1 
HETATM 9147 O O    . HOH D 2 .   ? 26.947  30.578 -15.043 1.00 31.19 ? 502 HOH B O    1 
HETATM 9148 H H1   . HOH D 2 .   ? 26.478  30.994 -15.777 1.00 0.00  ? 502 HOH B H1   1 
HETATM 9149 H H2   . HOH D 2 .   ? 27.887  30.699 -15.248 1.00 0.00  ? 502 HOH B H2   1 
HETATM 9150 O O    . HOH D 2 .   ? -2.739  60.294 -38.718 1.00 29.05 ? 503 HOH B O    1 
HETATM 9151 H H1   . HOH D 2 .   ? -3.238  60.382 -39.537 1.00 0.00  ? 503 HOH B H1   1 
HETATM 9152 H H2   . HOH D 2 .   ? -1.853  60.161 -39.055 1.00 0.00  ? 503 HOH B H2   1 
HETATM 9153 O O    . HOH D 2 .   ? -0.994  48.746 -49.869 1.00 56.71 ? 504 HOH B O    1 
HETATM 9154 H H1   . HOH D 2 .   ? -1.641  48.226 -49.367 1.00 0.00  ? 504 HOH B H1   1 
HETATM 9155 H H2   . HOH D 2 .   ? -1.053  48.332 -50.732 1.00 0.00  ? 504 HOH B H2   1 
HETATM 9156 O O    . HOH D 2 .   ? 1.370   13.626 -9.965  1.00 18.09 ? 505 HOH B O    1 
HETATM 9157 H H1   . HOH D 2 .   ? 1.038   13.118 -10.714 1.00 0.00  ? 505 HOH B H1   1 
HETATM 9158 H H2   . HOH D 2 .   ? 1.592   12.948 -9.323  1.00 0.00  ? 505 HOH B H2   1 
HETATM 9159 O O    . HOH D 2 .   ? 6.324   58.158 -46.266 1.00 62.04 ? 506 HOH B O    1 
HETATM 9160 H H1   . HOH D 2 .   ? 6.351   57.193 -46.168 1.00 0.00  ? 506 HOH B H1   1 
HETATM 9161 H H2   . HOH D 2 .   ? 6.163   58.362 -45.343 1.00 0.00  ? 506 HOH B H2   1 
HETATM 9162 O O    . HOH D 2 .   ? 12.037  41.225 -22.805 1.00 56.34 ? 507 HOH B O    1 
HETATM 9163 H H1   . HOH D 2 .   ? 12.438  41.168 -21.934 1.00 0.00  ? 507 HOH B H1   1 
HETATM 9164 H H2   . HOH D 2 .   ? 11.471  40.445 -22.818 1.00 0.00  ? 507 HOH B H2   1 
HETATM 9165 O O    . HOH D 2 .   ? 2.980   33.694 -46.811 1.00 71.14 ? 508 HOH B O    1 
HETATM 9166 H H1   . HOH D 2 .   ? 3.467   32.963 -46.428 1.00 0.00  ? 508 HOH B H1   1 
HETATM 9167 H H2   . HOH D 2 .   ? 2.728   33.331 -47.675 1.00 0.00  ? 508 HOH B H2   1 
HETATM 9168 O O    . HOH D 2 .   ? 18.848  26.534 -25.875 1.00 48.51 ? 509 HOH B O    1 
HETATM 9169 H H1   . HOH D 2 .   ? 19.352  26.571 -25.066 1.00 0.00  ? 509 HOH B H1   1 
HETATM 9170 H H2   . HOH D 2 .   ? 18.975  27.392 -26.297 1.00 0.00  ? 509 HOH B H2   1 
HETATM 9171 O O    . HOH D 2 .   ? -18.890 24.160 -13.255 1.00 37.90 ? 510 HOH B O    1 
HETATM 9172 H H1   . HOH D 2 .   ? -19.533 24.001 -12.537 1.00 0.00  ? 510 HOH B H1   1 
HETATM 9173 H H2   . HOH D 2 .   ? -18.056 24.290 -12.794 1.00 0.00  ? 510 HOH B H2   1 
HETATM 9174 O O    . HOH D 2 .   ? 6.581   3.126  -1.537  1.00 30.41 ? 511 HOH B O    1 
HETATM 9175 H H1   . HOH D 2 .   ? 7.297   3.677  -1.878  1.00 0.00  ? 511 HOH B H1   1 
HETATM 9176 H H2   . HOH D 2 .   ? 7.072   2.314  -1.353  1.00 0.00  ? 511 HOH B H2   1 
HETATM 9177 O O    . HOH D 2 .   ? -8.627  51.523 -27.909 1.00 19.91 ? 512 HOH B O    1 
HETATM 9178 H H1   . HOH D 2 .   ? -9.206  50.812 -28.185 1.00 0.00  ? 512 HOH B H1   1 
HETATM 9179 H H2   . HOH D 2 .   ? -7.843  51.362 -28.433 1.00 0.00  ? 512 HOH B H2   1 
HETATM 9180 O O    . HOH D 2 .   ? 8.951   56.606 -39.892 1.00 55.14 ? 513 HOH B O    1 
HETATM 9181 H H1   . HOH D 2 .   ? 9.091   55.976 -40.615 1.00 0.00  ? 513 HOH B H1   1 
HETATM 9182 H H2   . HOH D 2 .   ? 7.989   56.667 -39.959 1.00 0.00  ? 513 HOH B H2   1 
HETATM 9183 O O    . HOH D 2 .   ? 13.027  -1.018 -3.222  1.00 18.47 ? 514 HOH B O    1 
HETATM 9184 H H1   . HOH D 2 .   ? 13.892  -0.966 -3.643  1.00 0.00  ? 514 HOH B H1   1 
HETATM 9185 H H2   . HOH D 2 .   ? 12.806  -1.972 -3.304  1.00 0.00  ? 514 HOH B H2   1 
HETATM 9186 O O    . HOH D 2 .   ? 5.711   4.704  -12.835 1.00 44.49 ? 515 HOH B O    1 
HETATM 9187 H H1   . HOH D 2 .   ? 5.214   5.076  -12.100 1.00 0.00  ? 515 HOH B H1   1 
HETATM 9188 H H2   . HOH D 2 .   ? 5.742   5.447  -13.451 1.00 0.00  ? 515 HOH B H2   1 
HETATM 9189 O O    . HOH D 2 .   ? 10.303  54.131 -6.051  1.00 41.11 ? 516 HOH B O    1 
HETATM 9190 H H1   . HOH D 2 .   ? 10.853  53.779 -5.343  1.00 0.00  ? 516 HOH B H1   1 
HETATM 9191 H H2   . HOH D 2 .   ? 10.869  54.043 -6.817  1.00 0.00  ? 516 HOH B H2   1 
HETATM 9192 O O    . HOH D 2 .   ? -6.070  47.205 -10.080 1.00 9.71  ? 517 HOH B O    1 
HETATM 9193 H H1   . HOH D 2 .   ? -6.813  46.834 -10.570 1.00 0.00  ? 517 HOH B H1   1 
HETATM 9194 H H2   . HOH D 2 .   ? -6.245  46.905 -9.176  1.00 0.00  ? 517 HOH B H2   1 
HETATM 9195 O O    . HOH D 2 .   ? -0.283  42.517 -54.531 1.00 42.86 ? 518 HOH B O    1 
HETATM 9196 H H1   . HOH D 2 .   ? 0.226   41.739 -54.294 1.00 0.00  ? 518 HOH B H1   1 
HETATM 9197 H H2   . HOH D 2 .   ? -0.959  42.532 -53.848 1.00 0.00  ? 518 HOH B H2   1 
HETATM 9198 O O    . HOH D 2 .   ? -3.518  53.317 -6.286  1.00 71.58 ? 519 HOH B O    1 
HETATM 9199 H H1   . HOH D 2 .   ? -4.137  53.722 -6.901  1.00 0.00  ? 519 HOH B H1   1 
HETATM 9200 H H2   . HOH D 2 .   ? -2.850  54.019 -6.200  1.00 0.00  ? 519 HOH B H2   1 
HETATM 9201 O O    . HOH D 2 .   ? 13.183  32.212 -28.404 1.00 12.44 ? 520 HOH B O    1 
HETATM 9202 H H1   . HOH D 2 .   ? 13.244  31.419 -28.942 1.00 0.00  ? 520 HOH B H1   1 
HETATM 9203 H H2   . HOH D 2 .   ? 12.777  31.820 -27.599 1.00 0.00  ? 520 HOH B H2   1 
HETATM 9204 O O    . HOH D 2 .   ? 5.244   14.319 -7.083  1.00 15.06 ? 521 HOH B O    1 
HETATM 9205 H H1   . HOH D 2 .   ? 5.559   13.434 -7.325  1.00 0.00  ? 521 HOH B H1   1 
HETATM 9206 H H2   . HOH D 2 .   ? 5.269   14.217 -6.126  1.00 0.00  ? 521 HOH B H2   1 
HETATM 9207 O O    . HOH D 2 .   ? 12.293  44.140 1.821   1.00 44.39 ? 522 HOH B O    1 
HETATM 9208 H H1   . HOH D 2 .   ? 11.544  43.811 1.299   1.00 0.00  ? 522 HOH B H1   1 
HETATM 9209 H H2   . HOH D 2 .   ? 12.882  44.417 1.083   1.00 0.00  ? 522 HOH B H2   1 
HETATM 9210 O O    . HOH D 2 .   ? 1.988   56.002 -8.148  1.00 20.43 ? 523 HOH B O    1 
HETATM 9211 H H1   . HOH D 2 .   ? 1.065   56.268 -8.170  1.00 0.00  ? 523 HOH B H1   1 
HETATM 9212 H H2   . HOH D 2 .   ? 2.094   55.638 -9.042  1.00 0.00  ? 523 HOH B H2   1 
HETATM 9213 O O    . HOH D 2 .   ? 16.073  14.554 10.663  1.00 39.65 ? 524 HOH B O    1 
HETATM 9214 H H1   . HOH D 2 .   ? 16.337  13.821 11.237  1.00 0.00  ? 524 HOH B H1   1 
HETATM 9215 H H2   . HOH D 2 .   ? 16.946  14.991 10.529  1.00 0.00  ? 524 HOH B H2   1 
HETATM 9216 O O    . HOH D 2 .   ? 13.614  44.548 -0.749  1.00 16.70 ? 525 HOH B O    1 
HETATM 9217 H H1   . HOH D 2 .   ? 14.030  45.267 -1.256  1.00 0.00  ? 525 HOH B H1   1 
HETATM 9218 H H2   . HOH D 2 .   ? 13.217  44.047 -1.474  1.00 0.00  ? 525 HOH B H2   1 
HETATM 9219 O O    . HOH D 2 .   ? 6.426   7.381  -7.357  1.00 58.82 ? 526 HOH B O    1 
HETATM 9220 H H1   . HOH D 2 .   ? 7.277   7.555  -6.907  1.00 0.00  ? 526 HOH B H1   1 
HETATM 9221 H H2   . HOH D 2 .   ? 5.848   7.928  -6.814  1.00 0.00  ? 526 HOH B H2   1 
HETATM 9222 O O    . HOH D 2 .   ? 15.427  26.551 -49.170 1.00 20.39 ? 527 HOH B O    1 
HETATM 9223 H H1   . HOH D 2 .   ? 15.749  25.870 -48.539 1.00 0.00  ? 527 HOH B H1   1 
HETATM 9224 H H2   . HOH D 2 .   ? 14.984  27.175 -48.589 1.00 0.00  ? 527 HOH B H2   1 
HETATM 9225 O O    . HOH D 2 .   ? 23.036  1.078  -20.256 1.00 53.35 ? 528 HOH B O    1 
HETATM 9226 H H1   . HOH D 2 .   ? 22.231  0.707  -19.831 1.00 0.00  ? 528 HOH B H1   1 
HETATM 9227 H H2   . HOH D 2 .   ? 22.819  2.014  -20.324 1.00 0.00  ? 528 HOH B H2   1 
HETATM 9228 O O    . HOH D 2 .   ? 5.365   17.326 12.043  1.00 71.47 ? 529 HOH B O    1 
HETATM 9229 H H1   . HOH D 2 .   ? 4.462   17.551 11.801  1.00 0.00  ? 529 HOH B H1   1 
HETATM 9230 H H2   . HOH D 2 .   ? 5.276   16.360 12.023  1.00 0.00  ? 529 HOH B H2   1 
HETATM 9231 O O    . HOH D 2 .   ? 2.768   50.701 -20.214 1.00 15.17 ? 530 HOH B O    1 
HETATM 9232 H H1   . HOH D 2 .   ? 1.851   50.430 -20.049 1.00 0.00  ? 530 HOH B H1   1 
HETATM 9233 H H2   . HOH D 2 .   ? 2.668   51.655 -20.327 1.00 0.00  ? 530 HOH B H2   1 
HETATM 9234 O O    . HOH D 2 .   ? 12.519  30.944 -26.270 1.00 13.15 ? 531 HOH B O    1 
HETATM 9235 H H1   . HOH D 2 .   ? 12.512  30.195 -25.667 1.00 0.00  ? 531 HOH B H1   1 
HETATM 9236 H H2   . HOH D 2 .   ? 12.188  31.647 -25.678 1.00 0.00  ? 531 HOH B H2   1 
HETATM 9237 O O    . HOH D 2 .   ? 20.266  29.490 -49.708 1.00 21.77 ? 532 HOH B O    1 
HETATM 9238 H H1   . HOH D 2 .   ? 19.854  28.757 -49.229 1.00 0.00  ? 532 HOH B H1   1 
HETATM 9239 H H2   . HOH D 2 .   ? 20.109  30.236 -49.117 1.00 0.00  ? 532 HOH B H2   1 
HETATM 9240 O O    . HOH D 2 .   ? 8.048   16.475 -3.163  1.00 26.23 ? 533 HOH B O    1 
HETATM 9241 H H1   . HOH D 2 .   ? 7.158   16.141 -2.976  1.00 0.00  ? 533 HOH B H1   1 
HETATM 9242 H H2   . HOH D 2 .   ? 7.861   17.387 -3.411  1.00 0.00  ? 533 HOH B H2   1 
HETATM 9243 O O    . HOH D 2 .   ? 8.545   8.742  8.934   1.00 9.55  ? 534 HOH B O    1 
HETATM 9244 H H1   . HOH D 2 .   ? 8.449   8.633  9.883   1.00 0.00  ? 534 HOH B H1   1 
HETATM 9245 H H2   . HOH D 2 .   ? 8.884   9.654  8.868   1.00 0.00  ? 534 HOH B H2   1 
HETATM 9246 O O    . HOH D 2 .   ? 20.749  0.087  -18.968 1.00 56.87 ? 535 HOH B O    1 
HETATM 9247 H H1   . HOH D 2 .   ? 19.924  0.595  -19.031 1.00 0.00  ? 535 HOH B H1   1 
HETATM 9248 H H2   . HOH D 2 .   ? 20.429  -0.826 -19.048 1.00 0.00  ? 535 HOH B H2   1 
HETATM 9249 O O    . HOH D 2 .   ? 11.104  32.820 -24.375 1.00 85.20 ? 536 HOH B O    1 
HETATM 9250 H H1   . HOH D 2 .   ? 11.518  32.502 -23.559 1.00 0.00  ? 536 HOH B H1   1 
HETATM 9251 H H2   . HOH D 2 .   ? 11.632  33.611 -24.549 1.00 0.00  ? 536 HOH B H2   1 
HETATM 9252 O O    . HOH D 2 .   ? 10.133  3.364  -18.816 1.00 46.01 ? 537 HOH B O    1 
HETATM 9253 H H1   . HOH D 2 .   ? 10.565  2.514  -19.001 1.00 0.00  ? 537 HOH B H1   1 
HETATM 9254 H H2   . HOH D 2 .   ? 10.873  3.994  -18.818 1.00 0.00  ? 537 HOH B H2   1 
HETATM 9255 O O    . HOH D 2 .   ? 5.626   46.903 -19.015 1.00 21.70 ? 538 HOH B O    1 
HETATM 9256 H H1   . HOH D 2 .   ? 5.631   47.889 -19.019 1.00 0.00  ? 538 HOH B H1   1 
HETATM 9257 H H2   . HOH D 2 .   ? 6.184   46.749 -18.244 1.00 0.00  ? 538 HOH B H2   1 
HETATM 9258 O O    . HOH D 2 .   ? -6.829  54.121 -33.068 1.00 49.22 ? 539 HOH B O    1 
HETATM 9259 H H1   . HOH D 2 .   ? -6.776  54.471 -32.176 1.00 0.00  ? 539 HOH B H1   1 
HETATM 9260 H H2   . HOH D 2 .   ? -6.421  53.229 -32.966 1.00 0.00  ? 539 HOH B H2   1 
HETATM 9261 O O    . HOH D 2 .   ? 12.891  28.930 6.552   1.00 31.66 ? 540 HOH B O    1 
HETATM 9262 H H1   . HOH D 2 .   ? 12.844  28.094 6.065   1.00 0.00  ? 540 HOH B H1   1 
HETATM 9263 H H2   . HOH D 2 .   ? 12.758  28.626 7.465   1.00 0.00  ? 540 HOH B H2   1 
HETATM 9264 O O    . HOH D 2 .   ? 11.595  24.239 -40.474 1.00 13.66 ? 541 HOH B O    1 
HETATM 9265 H H1   . HOH D 2 .   ? 11.498  25.101 -40.053 1.00 0.00  ? 541 HOH B H1   1 
HETATM 9266 H H2   . HOH D 2 .   ? 11.389  23.681 -39.718 1.00 0.00  ? 541 HOH B H2   1 
HETATM 9267 O O    . HOH D 2 .   ? 14.757  52.421 -36.280 1.00 15.82 ? 542 HOH B O    1 
HETATM 9268 H H1   . HOH D 2 .   ? 14.158  51.852 -35.777 1.00 0.00  ? 542 HOH B H1   1 
HETATM 9269 H H2   . HOH D 2 .   ? 14.925  51.894 -37.064 1.00 0.00  ? 542 HOH B H2   1 
HETATM 9270 O O    . HOH D 2 .   ? -6.622  37.310 -13.616 1.00 43.87 ? 543 HOH B O    1 
HETATM 9271 H H1   . HOH D 2 .   ? -6.872  36.530 -13.105 1.00 0.00  ? 543 HOH B H1   1 
HETATM 9272 H H2   . HOH D 2 .   ? -7.329  37.934 -13.402 1.00 0.00  ? 543 HOH B H2   1 
HETATM 9273 O O    . HOH D 2 .   ? 15.336  35.106 6.006   1.00 25.73 ? 544 HOH B O    1 
HETATM 9274 H H1   . HOH D 2 .   ? 16.128  35.489 6.395   1.00 0.00  ? 544 HOH B H1   1 
HETATM 9275 H H2   . HOH D 2 .   ? 14.788  35.869 5.808   1.00 0.00  ? 544 HOH B H2   1 
HETATM 9276 O O    . HOH D 2 .   ? 20.678  12.605 9.649   1.00 34.68 ? 545 HOH B O    1 
HETATM 9277 H H1   . HOH D 2 .   ? 21.354  12.791 8.982   1.00 0.00  ? 545 HOH B H1   1 
HETATM 9278 H H2   . HOH D 2 .   ? 19.901  12.373 9.133   1.00 0.00  ? 545 HOH B H2   1 
HETATM 9279 O O    . HOH D 2 .   ? 15.721  24.480 6.476   1.00 16.67 ? 546 HOH B O    1 
HETATM 9280 H H1   . HOH D 2 .   ? 14.871  24.933 6.388   1.00 0.00  ? 546 HOH B H1   1 
HETATM 9281 H H2   . HOH D 2 .   ? 15.790  23.985 5.646   1.00 0.00  ? 546 HOH B H2   1 
HETATM 9282 O O    . HOH D 2 .   ? -3.997  49.660 2.279   1.00 26.25 ? 547 HOH B O    1 
HETATM 9283 H H1   . HOH D 2 .   ? -3.909  48.950 1.629   1.00 0.00  ? 547 HOH B H1   1 
HETATM 9284 H H2   . HOH D 2 .   ? -3.091  49.777 2.573   1.00 0.00  ? 547 HOH B H2   1 
HETATM 9285 O O    . HOH D 2 .   ? -6.340  27.781 -27.607 1.00 25.47 ? 548 HOH B O    1 
HETATM 9286 H H1   . HOH D 2 .   ? -7.188  28.209 -27.787 1.00 0.00  ? 548 HOH B H1   1 
HETATM 9287 H H2   . HOH D 2 .   ? -6.256  27.999 -26.666 1.00 0.00  ? 548 HOH B H2   1 
HETATM 9288 O O    . HOH D 2 .   ? 45.272  23.836 -14.726 1.00 27.49 ? 549 HOH B O    1 
HETATM 9289 H H1   . HOH D 2 .   ? 44.720  23.113 -15.038 1.00 0.00  ? 549 HOH B H1   1 
HETATM 9290 H H2   . HOH D 2 .   ? 45.427  23.607 -13.811 1.00 0.00  ? 549 HOH B H2   1 
HETATM 9291 O O    . HOH D 2 .   ? 25.226  1.844  -18.659 1.00 13.28 ? 550 HOH B O    1 
HETATM 9292 H H1   . HOH D 2 .   ? 24.526  1.510  -19.248 1.00 0.00  ? 550 HOH B H1   1 
HETATM 9293 H H2   . HOH D 2 .   ? 24.919  2.753  -18.542 1.00 0.00  ? 550 HOH B H2   1 
HETATM 9294 O O    . HOH D 2 .   ? -4.388  50.926 -9.049  1.00 42.38 ? 551 HOH B O    1 
HETATM 9295 H H1   . HOH D 2 .   ? -5.043  50.338 -9.441  1.00 0.00  ? 551 HOH B H1   1 
HETATM 9296 H H2   . HOH D 2 .   ? -4.001  51.364 -9.809  1.00 0.00  ? 551 HOH B H2   1 
HETATM 9297 O O    . HOH D 2 .   ? 18.638  1.994  -10.945 1.00 31.37 ? 552 HOH B O    1 
HETATM 9298 H H1   . HOH D 2 .   ? 19.022  1.126  -11.141 1.00 0.00  ? 552 HOH B H1   1 
HETATM 9299 H H2   . HOH D 2 .   ? 17.758  1.914  -11.330 1.00 0.00  ? 552 HOH B H2   1 
HETATM 9300 O O    . HOH D 2 .   ? 16.099  39.766 -24.767 1.00 28.56 ? 553 HOH B O    1 
HETATM 9301 H H1   . HOH D 2 .   ? 16.378  40.028 -25.649 1.00 0.00  ? 553 HOH B H1   1 
HETATM 9302 H H2   . HOH D 2 .   ? 16.009  38.807 -24.851 1.00 0.00  ? 553 HOH B H2   1 
HETATM 9303 O O    . HOH D 2 .   ? 19.359  -2.266 -19.715 1.00 21.30 ? 554 HOH B O    1 
HETATM 9304 H H1   . HOH D 2 .   ? 18.784  -3.007 -19.972 1.00 0.00  ? 554 HOH B H1   1 
HETATM 9305 H H2   . HOH D 2 .   ? 18.873  -1.528 -20.081 1.00 0.00  ? 554 HOH B H2   1 
HETATM 9306 O O    . HOH D 2 .   ? 3.411   8.964  -12.013 1.00 13.51 ? 555 HOH B O    1 
HETATM 9307 H H1   . HOH D 2 .   ? 3.796   9.229  -12.860 1.00 0.00  ? 555 HOH B H1   1 
HETATM 9308 H H2   . HOH D 2 .   ? 4.179   8.627  -11.527 1.00 0.00  ? 555 HOH B H2   1 
HETATM 9309 O O    . HOH D 2 .   ? 4.890   20.090 -8.682  1.00 46.55 ? 556 HOH B O    1 
HETATM 9310 H H1   . HOH D 2 .   ? 5.043   19.277 -9.164  1.00 0.00  ? 556 HOH B H1   1 
HETATM 9311 H H2   . HOH D 2 .   ? 5.380   20.762 -9.181  1.00 0.00  ? 556 HOH B H2   1 
HETATM 9312 O O    . HOH D 2 .   ? -8.511  24.353 -12.734 1.00 20.21 ? 557 HOH B O    1 
HETATM 9313 H H1   . HOH D 2 .   ? -9.195  23.888 -13.217 1.00 0.00  ? 557 HOH B H1   1 
HETATM 9314 H H2   . HOH D 2 .   ? -8.717  25.282 -12.828 1.00 0.00  ? 557 HOH B H2   1 
HETATM 9315 O O    . HOH D 2 .   ? -4.119  52.050 -41.272 1.00 33.79 ? 558 HOH B O    1 
HETATM 9316 H H1   . HOH D 2 .   ? -3.517  52.457 -40.638 1.00 0.00  ? 558 HOH B H1   1 
HETATM 9317 H H2   . HOH D 2 .   ? -3.587  51.975 -42.068 1.00 0.00  ? 558 HOH B H2   1 
HETATM 9318 O O    . HOH D 2 .   ? 30.318  28.788 -6.007  1.00 41.62 ? 559 HOH B O    1 
HETATM 9319 H H1   . HOH D 2 .   ? 30.004  27.899 -6.207  1.00 0.00  ? 559 HOH B H1   1 
HETATM 9320 H H2   . HOH D 2 .   ? 31.233  28.688 -6.307  1.00 0.00  ? 559 HOH B H2   1 
HETATM 9321 O O    . HOH D 2 .   ? 6.735   40.467 4.820   1.00 52.57 ? 560 HOH B O    1 
HETATM 9322 H H1   . HOH D 2 .   ? 6.479   41.275 5.275   1.00 0.00  ? 560 HOH B H1   1 
HETATM 9323 H H2   . HOH D 2 .   ? 7.089   39.925 5.548   1.00 0.00  ? 560 HOH B H2   1 
HETATM 9324 O O    . HOH D 2 .   ? 30.081  18.558 -22.919 1.00 18.44 ? 561 HOH B O    1 
HETATM 9325 H H1   . HOH D 2 .   ? 29.253  18.313 -22.473 1.00 0.00  ? 561 HOH B H1   1 
HETATM 9326 H H2   . HOH D 2 .   ? 30.562  19.041 -22.236 1.00 0.00  ? 561 HOH B H2   1 
HETATM 9327 O O    . HOH D 2 .   ? 4.853   46.213 -0.756  1.00 13.63 ? 562 HOH B O    1 
HETATM 9328 H H1   . HOH D 2 .   ? 4.454   45.621 -1.435  1.00 0.00  ? 562 HOH B H1   1 
HETATM 9329 H H2   . HOH D 2 .   ? 4.117   46.803 -0.570  1.00 0.00  ? 562 HOH B H2   1 
HETATM 9330 O O    . HOH D 2 .   ? 2.962   38.872 -52.411 1.00 20.16 ? 563 HOH B O    1 
HETATM 9331 H H1   . HOH D 2 .   ? 3.479   39.449 -51.841 1.00 0.00  ? 563 HOH B H1   1 
HETATM 9332 H H2   . HOH D 2 .   ? 2.120   38.825 -51.927 1.00 0.00  ? 563 HOH B H2   1 
HETATM 9333 O O    . HOH D 2 .   ? 20.086  29.052 5.687   1.00 5.30  ? 564 HOH B O    1 
HETATM 9334 H H1   . HOH D 2 .   ? 20.332  29.397 4.819   1.00 0.00  ? 564 HOH B H1   1 
HETATM 9335 H H2   . HOH D 2 .   ? 20.344  28.130 5.595   1.00 0.00  ? 564 HOH B H2   1 
HETATM 9336 O O    . HOH D 2 .   ? -5.784  51.714 -32.836 1.00 50.15 ? 565 HOH B O    1 
HETATM 9337 H H1   . HOH D 2 .   ? -5.010  51.330 -33.266 1.00 0.00  ? 565 HOH B H1   1 
HETATM 9338 H H2   . HOH D 2 .   ? -5.725  51.372 -31.940 1.00 0.00  ? 565 HOH B H2   1 
HETATM 9339 O O    . HOH D 2 .   ? 15.426  6.274  -2.728  1.00 11.68 ? 566 HOH B O    1 
HETATM 9340 H H1   . HOH D 2 .   ? 15.971  5.547  -3.034  1.00 0.00  ? 566 HOH B H1   1 
HETATM 9341 H H2   . HOH D 2 .   ? 14.931  6.542  -3.510  1.00 0.00  ? 566 HOH B H2   1 
HETATM 9342 O O    . HOH D 2 .   ? 3.199   29.365 -46.869 1.00 26.73 ? 567 HOH B O    1 
HETATM 9343 H H1   . HOH D 2 .   ? 3.930   28.738 -46.924 1.00 0.00  ? 567 HOH B H1   1 
HETATM 9344 H H2   . HOH D 2 .   ? 3.510   30.063 -47.463 1.00 0.00  ? 567 HOH B H2   1 
HETATM 9345 O O    . HOH D 2 .   ? -2.275  53.987 -17.631 1.00 42.94 ? 568 HOH B O    1 
HETATM 9346 H H1   . HOH D 2 .   ? -1.609  54.683 -17.598 1.00 0.00  ? 568 HOH B H1   1 
HETATM 9347 H H2   . HOH D 2 .   ? -2.505  53.933 -18.564 1.00 0.00  ? 568 HOH B H2   1 
HETATM 9348 O O    . HOH D 2 .   ? 8.045   43.406 -34.083 1.00 19.74 ? 569 HOH B O    1 
HETATM 9349 H H1   . HOH D 2 .   ? 7.744   43.558 -34.992 1.00 0.00  ? 569 HOH B H1   1 
HETATM 9350 H H2   . HOH D 2 .   ? 7.319   42.894 -33.697 1.00 0.00  ? 569 HOH B H2   1 
HETATM 9351 O O    . HOH D 2 .   ? 29.891  22.519 -1.133  1.00 6.55  ? 570 HOH B O    1 
HETATM 9352 H H1   . HOH D 2 .   ? 30.826  22.443 -1.392  1.00 0.00  ? 570 HOH B H1   1 
HETATM 9353 H H2   . HOH D 2 .   ? 29.905  22.079 -0.275  1.00 0.00  ? 570 HOH B H2   1 
HETATM 9354 O O    . HOH D 2 .   ? 16.597  27.949 -46.444 1.00 67.49 ? 571 HOH B O    1 
HETATM 9355 H H1   . HOH D 2 .   ? 16.906  28.633 -45.847 1.00 0.00  ? 571 HOH B H1   1 
HETATM 9356 H H2   . HOH D 2 .   ? 16.616  28.408 -47.293 1.00 0.00  ? 571 HOH B H2   1 
HETATM 9357 O O    . HOH D 2 .   ? 12.609  53.433 -1.662  1.00 36.29 ? 572 HOH B O    1 
HETATM 9358 H H1   . HOH D 2 .   ? 12.913  54.363 -1.713  1.00 0.00  ? 572 HOH B H1   1 
HETATM 9359 H H2   . HOH D 2 .   ? 11.725  53.567 -1.290  1.00 0.00  ? 572 HOH B H2   1 
HETATM 9360 O O    . HOH D 2 .   ? 8.168   50.755 -7.867  1.00 21.81 ? 573 HOH B O    1 
HETATM 9361 H H1   . HOH D 2 .   ? 7.510   51.375 -7.517  1.00 0.00  ? 573 HOH B H1   1 
HETATM 9362 H H2   . HOH D 2 .   ? 8.223   51.022 -8.784  1.00 0.00  ? 573 HOH B H2   1 
HETATM 9363 O O    . HOH D 2 .   ? 36.927  22.393 -3.885  1.00 24.88 ? 574 HOH B O    1 
HETATM 9364 H H1   . HOH D 2 .   ? 37.053  21.444 -4.010  1.00 0.00  ? 574 HOH B H1   1 
HETATM 9365 H H2   . HOH D 2 .   ? 37.371  22.729 -4.675  1.00 0.00  ? 574 HOH B H2   1 
HETATM 9366 O O    . HOH D 2 .   ? 3.052   15.546 -8.660  1.00 20.08 ? 575 HOH B O    1 
HETATM 9367 H H1   . HOH D 2 .   ? 3.757   15.071 -8.207  1.00 0.00  ? 575 HOH B H1   1 
HETATM 9368 H H2   . HOH D 2 .   ? 2.605   14.871 -9.206  1.00 0.00  ? 575 HOH B H2   1 
HETATM 9369 O O    . HOH D 2 .   ? 9.188   24.994 -18.210 1.00 29.83 ? 576 HOH B O    1 
HETATM 9370 H H1   . HOH D 2 .   ? 8.583   24.321 -18.563 1.00 0.00  ? 576 HOH B H1   1 
HETATM 9371 H H2   . HOH D 2 .   ? 9.580   25.300 -19.046 1.00 0.00  ? 576 HOH B H2   1 
HETATM 9372 O O    . HOH D 2 .   ? 6.451   14.327 -1.813  1.00 28.79 ? 577 HOH B O    1 
HETATM 9373 H H1   . HOH D 2 .   ? 7.264   14.002 -2.193  1.00 0.00  ? 577 HOH B H1   1 
HETATM 9374 H H2   . HOH D 2 .   ? 6.091   13.555 -1.354  1.00 0.00  ? 577 HOH B H2   1 
HETATM 9375 O O    . HOH D 2 .   ? 16.317  54.655 -34.576 1.00 36.72 ? 578 HOH B O    1 
HETATM 9376 H H1   . HOH D 2 .   ? 16.140  53.745 -34.869 1.00 0.00  ? 578 HOH B H1   1 
HETATM 9377 H H2   . HOH D 2 .   ? 15.744  55.139 -35.181 1.00 0.00  ? 578 HOH B H2   1 
HETATM 9378 O O    . HOH D 2 .   ? 3.466   35.445 -27.640 1.00 19.62 ? 579 HOH B O    1 
HETATM 9379 H H1   . HOH D 2 .   ? 3.095   35.872 -26.870 1.00 0.00  ? 579 HOH B H1   1 
HETATM 9380 H H2   . HOH D 2 .   ? 4.306   35.926 -27.690 1.00 0.00  ? 579 HOH B H2   1 
HETATM 9381 O O    . HOH D 2 .   ? 9.338   44.736 3.260   1.00 55.52 ? 580 HOH B O    1 
HETATM 9382 H H1   . HOH D 2 .   ? 10.271  44.805 3.012   1.00 0.00  ? 580 HOH B H1   1 
HETATM 9383 H H2   . HOH D 2 .   ? 9.245   45.379 3.968   1.00 0.00  ? 580 HOH B H2   1 
HETATM 9384 O O    . HOH D 2 .   ? -15.433 44.427 -13.361 1.00 22.76 ? 581 HOH B O    1 
HETATM 9385 H H1   . HOH D 2 .   ? -15.946 43.835 -13.927 1.00 0.00  ? 581 HOH B H1   1 
HETATM 9386 H H2   . HOH D 2 .   ? -14.646 43.885 -13.264 1.00 0.00  ? 581 HOH B H2   1 
HETATM 9387 O O    . HOH D 2 .   ? 27.877  11.484 -16.918 1.00 65.96 ? 582 HOH B O    1 
HETATM 9388 H H1   . HOH D 2 .   ? 27.552  11.786 -16.062 1.00 0.00  ? 582 HOH B H1   1 
HETATM 9389 H H2   . HOH D 2 .   ? 27.048  11.448 -17.409 1.00 0.00  ? 582 HOH B H2   1 
HETATM 9390 O O    . HOH D 2 .   ? -4.618  28.643 -11.137 1.00 20.78 ? 583 HOH B O    1 
HETATM 9391 H H1   . HOH D 2 .   ? -4.706  29.346 -11.791 1.00 0.00  ? 583 HOH B H1   1 
HETATM 9392 H H2   . HOH D 2 .   ? -3.672  28.669 -10.964 1.00 0.00  ? 583 HOH B H2   1 
HETATM 9393 O O    . HOH D 2 .   ? 3.752   36.491 -53.010 1.00 33.02 ? 584 HOH B O    1 
HETATM 9394 H H1   . HOH D 2 .   ? 4.714   36.541 -53.012 1.00 0.00  ? 584 HOH B H1   1 
HETATM 9395 H H2   . HOH D 2 .   ? 3.488   37.401 -52.783 1.00 0.00  ? 584 HOH B H2   1 
HETATM 9396 O O    . HOH D 2 .   ? -4.151  13.078 -5.532  1.00 30.20 ? 585 HOH B O    1 
HETATM 9397 H H1   . HOH D 2 .   ? -3.360  12.576 -5.327  1.00 0.00  ? 585 HOH B H1   1 
HETATM 9398 H H2   . HOH D 2 .   ? -4.060  13.809 -4.911  1.00 0.00  ? 585 HOH B H2   1 
HETATM 9399 O O    . HOH D 2 .   ? 13.524  52.242 -32.035 1.00 67.96 ? 586 HOH B O    1 
HETATM 9400 H H1   . HOH D 2 .   ? 12.827  51.807 -31.535 1.00 0.00  ? 586 HOH B H1   1 
HETATM 9401 H H2   . HOH D 2 .   ? 13.357  51.925 -32.935 1.00 0.00  ? 586 HOH B H2   1 
HETATM 9402 O O    . HOH D 2 .   ? -6.804  48.980 -2.466  1.00 16.24 ? 587 HOH B O    1 
HETATM 9403 H H1   . HOH D 2 .   ? -7.495  49.581 -2.800  1.00 0.00  ? 587 HOH B H1   1 
HETATM 9404 H H2   . HOH D 2 .   ? -7.192  48.664 -1.645  1.00 0.00  ? 587 HOH B H2   1 
HETATM 9405 O O    . HOH D 2 .   ? 9.099   27.771 -47.678 1.00 53.79 ? 588 HOH B O    1 
HETATM 9406 H H1   . HOH D 2 .   ? 8.149   28.026 -47.575 1.00 0.00  ? 588 HOH B H1   1 
HETATM 9407 H H2   . HOH D 2 .   ? 9.019   27.440 -48.583 1.00 0.00  ? 588 HOH B H2   1 
HETATM 9408 O O    . HOH D 2 .   ? 30.493  6.844  -1.619  1.00 19.96 ? 589 HOH B O    1 
HETATM 9409 H H1   . HOH D 2 .   ? 29.828  6.425  -2.181  1.00 0.00  ? 589 HOH B H1   1 
HETATM 9410 H H2   . HOH D 2 .   ? 30.139  7.728  -1.507  1.00 0.00  ? 589 HOH B H2   1 
HETATM 9411 O O    . HOH D 2 .   ? 5.268   49.344 -19.351 1.00 15.04 ? 590 HOH B O    1 
HETATM 9412 H H1   . HOH D 2 .   ? 4.472   49.812 -19.668 1.00 0.00  ? 590 HOH B H1   1 
HETATM 9413 H H2   . HOH D 2 .   ? 5.937   50.042 -19.355 1.00 0.00  ? 590 HOH B H2   1 
HETATM 9414 O O    . HOH D 2 .   ? 12.241  43.231 -49.959 1.00 21.13 ? 591 HOH B O    1 
HETATM 9415 H H1   . HOH D 2 .   ? 12.742  43.507 -49.186 1.00 0.00  ? 591 HOH B H1   1 
HETATM 9416 H H2   . HOH D 2 .   ? 12.913  42.970 -50.596 1.00 0.00  ? 591 HOH B H2   1 
HETATM 9417 O O    . HOH D 2 .   ? 12.872  55.510 -44.300 1.00 23.39 ? 592 HOH B O    1 
HETATM 9418 H H1   . HOH D 2 .   ? 12.971  54.884 -43.577 1.00 0.00  ? 592 HOH B H1   1 
HETATM 9419 H H2   . HOH D 2 .   ? 11.903  55.556 -44.310 1.00 0.00  ? 592 HOH B H2   1 
HETATM 9420 O O    . HOH D 2 .   ? 2.720   32.088 -49.413 1.00 32.14 ? 593 HOH B O    1 
HETATM 9421 H H1   . HOH D 2 .   ? 3.458   32.440 -49.930 1.00 0.00  ? 593 HOH B H1   1 
HETATM 9422 H H2   . HOH D 2 .   ? 2.893   31.145 -49.548 1.00 0.00  ? 593 HOH B H2   1 
HETATM 9423 O O    . HOH D 2 .   ? -9.147  16.263 -3.769  1.00 28.40 ? 594 HOH B O    1 
HETATM 9424 H H1   . HOH D 2 .   ? -8.214  16.460 -3.940  1.00 0.00  ? 594 HOH B H1   1 
HETATM 9425 H H2   . HOH D 2 .   ? -9.506  17.147 -3.676  1.00 0.00  ? 594 HOH B H2   1 
HETATM 9426 O O    . HOH D 2 .   ? -6.028  45.954 -2.294  1.00 62.42 ? 595 HOH B O    1 
HETATM 9427 H H1   . HOH D 2 .   ? -5.067  45.963 -2.438  1.00 0.00  ? 595 HOH B H1   1 
HETATM 9428 H H2   . HOH D 2 .   ? -6.154  46.745 -1.750  1.00 0.00  ? 595 HOH B H2   1 
HETATM 9429 O O    . HOH D 2 .   ? 5.619   19.329 8.484   1.00 26.75 ? 596 HOH B O    1 
HETATM 9430 H H1   . HOH D 2 .   ? 4.668   19.208 8.429   1.00 0.00  ? 596 HOH B H1   1 
HETATM 9431 H H2   . HOH D 2 .   ? 5.807   18.968 9.361   1.00 0.00  ? 596 HOH B H2   1 
HETATM 9432 O O    . HOH D 2 .   ? 20.050  26.874 -48.626 1.00 25.08 ? 597 HOH B O    1 
HETATM 9433 H H1   . HOH D 2 .   ? 19.836  25.938 -48.736 1.00 0.00  ? 597 HOH B H1   1 
HETATM 9434 H H2   . HOH D 2 .   ? 20.787  27.001 -49.221 1.00 0.00  ? 597 HOH B H2   1 
HETATM 9435 O O    . HOH D 2 .   ? 5.930   46.947 5.048   1.00 29.55 ? 598 HOH B O    1 
HETATM 9436 H H1   . HOH D 2 .   ? 5.505   46.286 4.462   1.00 0.00  ? 598 HOH B H1   1 
HETATM 9437 H H2   . HOH D 2 .   ? 5.849   47.736 4.506   1.00 0.00  ? 598 HOH B H2   1 
HETATM 9438 O O    . HOH D 2 .   ? -17.247 29.311 -29.595 1.00 51.19 ? 599 HOH B O    1 
HETATM 9439 H H1   . HOH D 2 .   ? -17.308 29.778 -28.749 1.00 0.00  ? 599 HOH B H1   1 
HETATM 9440 H H2   . HOH D 2 .   ? -16.369 29.591 -29.885 1.00 0.00  ? 599 HOH B H2   1 
HETATM 9441 O O    . HOH D 2 .   ? 24.626  18.319 -14.012 1.00 14.00 ? 600 HOH B O    1 
HETATM 9442 H H1   . HOH D 2 .   ? 24.036  17.866 -13.396 1.00 0.00  ? 600 HOH B H1   1 
HETATM 9443 H H2   . HOH D 2 .   ? 24.904  19.094 -13.500 1.00 0.00  ? 600 HOH B H2   1 
HETATM 9444 O O    . HOH D 2 .   ? -15.401 28.254 -16.457 1.00 56.07 ? 601 HOH B O    1 
HETATM 9445 H H1   . HOH D 2 .   ? -15.609 27.993 -17.358 1.00 0.00  ? 601 HOH B H1   1 
HETATM 9446 H H2   . HOH D 2 .   ? -15.761 29.138 -16.416 1.00 0.00  ? 601 HOH B H2   1 
HETATM 9447 O O    . HOH D 2 .   ? -2.782  41.269 -1.351  1.00 31.24 ? 602 HOH B O    1 
HETATM 9448 H H1   . HOH D 2 .   ? -3.268  41.623 -0.600  1.00 0.00  ? 602 HOH B H1   1 
HETATM 9449 H H2   . HOH D 2 .   ? -2.895  40.315 -1.234  1.00 0.00  ? 602 HOH B H2   1 
HETATM 9450 O O    . HOH D 2 .   ? 3.651   44.548 -2.602  1.00 16.72 ? 603 HOH B O    1 
HETATM 9451 H H1   . HOH D 2 .   ? 3.891   44.099 -3.432  1.00 0.00  ? 603 HOH B H1   1 
HETATM 9452 H H2   . HOH D 2 .   ? 2.874   44.034 -2.358  1.00 0.00  ? 603 HOH B H2   1 
HETATM 9453 O O    . HOH D 2 .   ? 16.213  0.612  -12.882 1.00 19.60 ? 604 HOH B O    1 
HETATM 9454 H H1   . HOH D 2 .   ? 16.664  0.773  -13.724 1.00 0.00  ? 604 HOH B H1   1 
HETATM 9455 H H2   . HOH D 2 .   ? 16.742  -0.125 -12.554 1.00 0.00  ? 604 HOH B H2   1 
HETATM 9456 O O    . HOH D 2 .   ? 15.839  22.928 -21.828 1.00 13.69 ? 605 HOH B O    1 
HETATM 9457 H H1   . HOH D 2 .   ? 15.942  23.179 -20.895 1.00 0.00  ? 605 HOH B H1   1 
HETATM 9458 H H2   . HOH D 2 .   ? 15.638  23.784 -22.240 1.00 0.00  ? 605 HOH B H2   1 
HETATM 9459 O O    . HOH D 2 .   ? 0.569   34.113 -49.540 1.00 26.60 ? 606 HOH B O    1 
HETATM 9460 H H1   . HOH D 2 .   ? 1.434   33.675 -49.533 1.00 0.00  ? 606 HOH B H1   1 
HETATM 9461 H H2   . HOH D 2 .   ? 0.748   34.928 -50.015 1.00 0.00  ? 606 HOH B H2   1 
HETATM 9462 O O    . HOH D 2 .   ? 21.962  14.670 5.509   1.00 50.42 ? 607 HOH B O    1 
HETATM 9463 H H1   . HOH D 2 .   ? 22.598  13.951 5.629   1.00 0.00  ? 607 HOH B H1   1 
HETATM 9464 H H2   . HOH D 2 .   ? 22.348  15.351 6.064   1.00 0.00  ? 607 HOH B H2   1 
HETATM 9465 O O    . HOH D 2 .   ? 9.412   18.602 -23.569 1.00 12.96 ? 608 HOH B O    1 
HETATM 9466 H H1   . HOH D 2 .   ? 9.356   19.253 -22.846 1.00 0.00  ? 608 HOH B H1   1 
HETATM 9467 H H2   . HOH D 2 .   ? 9.489   19.186 -24.324 1.00 0.00  ? 608 HOH B H2   1 
HETATM 9468 O O    . HOH D 2 .   ? -3.261  25.823 -26.037 1.00 7.47  ? 609 HOH B O    1 
HETATM 9469 H H1   . HOH D 2 .   ? -3.741  26.463 -25.483 1.00 0.00  ? 609 HOH B H1   1 
HETATM 9470 H H2   . HOH D 2 .   ? -2.643  25.496 -25.381 1.00 0.00  ? 609 HOH B H2   1 
HETATM 9471 O O    . HOH D 2 .   ? -20.840 23.877 -11.218 1.00 24.82 ? 610 HOH B O    1 
HETATM 9472 H H1   . HOH D 2 .   ? -20.863 23.439 -10.361 1.00 0.00  ? 610 HOH B H1   1 
HETATM 9473 H H2   . HOH D 2 .   ? -21.521 24.554 -11.139 1.00 0.00  ? 610 HOH B H2   1 
HETATM 9474 O O    . HOH D 2 .   ? -9.074  47.418 -19.548 1.00 11.43 ? 611 HOH B O    1 
HETATM 9475 H H1   . HOH D 2 .   ? -9.088  46.454 -19.523 1.00 0.00  ? 611 HOH B H1   1 
HETATM 9476 H H2   . HOH D 2 .   ? -8.806  47.593 -20.464 1.00 0.00  ? 611 HOH B H2   1 
HETATM 9477 O O    . HOH D 2 .   ? -10.215 40.450 -11.092 1.00 19.17 ? 612 HOH B O    1 
HETATM 9478 H H1   . HOH D 2 .   ? -10.562 39.763 -10.525 1.00 0.00  ? 612 HOH B H1   1 
HETATM 9479 H H2   . HOH D 2 .   ? -9.668  39.967 -11.705 1.00 0.00  ? 612 HOH B H2   1 
HETATM 9480 O O    . HOH D 2 .   ? 7.118   21.520 -16.422 1.00 37.50 ? 613 HOH B O    1 
HETATM 9481 H H1   . HOH D 2 .   ? 7.674   21.100 -17.089 1.00 0.00  ? 613 HOH B H1   1 
HETATM 9482 H H2   . HOH D 2 .   ? 6.417   20.871 -16.312 1.00 0.00  ? 613 HOH B H2   1 
HETATM 9483 O O    . HOH D 2 .   ? 5.213   23.135 -14.727 1.00 27.92 ? 614 HOH B O    1 
HETATM 9484 H H1   . HOH D 2 .   ? 4.764   22.338 -14.401 1.00 0.00  ? 614 HOH B H1   1 
HETATM 9485 H H2   . HOH D 2 .   ? 5.051   23.053 -15.686 1.00 0.00  ? 614 HOH B H2   1 
HETATM 9486 O O    . HOH D 2 .   ? 29.553  29.880 -15.025 1.00 63.28 ? 615 HOH B O    1 
HETATM 9487 H H1   . HOH D 2 .   ? 29.387  29.031 -14.598 1.00 0.00  ? 615 HOH B H1   1 
HETATM 9488 H H2   . HOH D 2 .   ? 29.772  29.581 -15.921 1.00 0.00  ? 615 HOH B H2   1 
HETATM 9489 O O    . HOH D 2 .   ? 13.629  -0.701 -12.163 1.00 37.43 ? 616 HOH B O    1 
HETATM 9490 H H1   . HOH D 2 .   ? 14.362  -0.065 -12.033 1.00 0.00  ? 616 HOH B H1   1 
HETATM 9491 H H2   . HOH D 2 .   ? 14.020  -1.195 -12.899 1.00 0.00  ? 616 HOH B H2   1 
HETATM 9492 O O    . HOH D 2 .   ? 39.579  28.415 -19.973 1.00 32.94 ? 617 HOH B O    1 
HETATM 9493 H H1   . HOH D 2 .   ? 39.578  27.490 -19.714 1.00 0.00  ? 617 HOH B H1   1 
HETATM 9494 H H2   . HOH D 2 .   ? 38.634  28.512 -20.156 1.00 0.00  ? 617 HOH B H2   1 
HETATM 9495 O O    . HOH D 2 .   ? 7.367   16.412 -15.983 1.00 60.28 ? 618 HOH B O    1 
HETATM 9496 H H1   . HOH D 2 .   ? 6.981   15.760 -16.588 1.00 0.00  ? 618 HOH B H1   1 
HETATM 9497 H H2   . HOH D 2 .   ? 8.316   16.257 -16.102 1.00 0.00  ? 618 HOH B H2   1 
HETATM 9498 O O    . HOH D 2 .   ? 6.547   28.216 -48.004 1.00 67.72 ? 619 HOH B O    1 
HETATM 9499 H H1   . HOH D 2 .   ? 6.047   28.816 -48.579 1.00 0.00  ? 619 HOH B H1   1 
HETATM 9500 H H2   . HOH D 2 .   ? 5.804   27.763 -47.554 1.00 0.00  ? 619 HOH B H2   1 
HETATM 9501 O O    . HOH D 2 .   ? -7.291  24.645 -9.507  1.00 23.86 ? 620 HOH B O    1 
HETATM 9502 H H1   . HOH D 2 .   ? -6.661  24.774 -10.235 1.00 0.00  ? 620 HOH B H1   1 
HETATM 9503 H H2   . HOH D 2 .   ? -8.061  24.407 -10.042 1.00 0.00  ? 620 HOH B H2   1 
HETATM 9504 O O    . HOH D 2 .   ? 15.926  20.715 7.053   1.00 12.49 ? 621 HOH B O    1 
HETATM 9505 H H1   . HOH D 2 .   ? 15.936  20.170 6.254   1.00 0.00  ? 621 HOH B H1   1 
HETATM 9506 H H2   . HOH D 2 .   ? 16.068  21.588 6.655   1.00 0.00  ? 621 HOH B H2   1 
HETATM 9507 O O    . HOH D 2 .   ? 13.950  24.542 -23.530 1.00 28.75 ? 622 HOH B O    1 
HETATM 9508 H H1   . HOH D 2 .   ? 13.487  24.043 -22.827 1.00 0.00  ? 622 HOH B H1   1 
HETATM 9509 H H2   . HOH D 2 .   ? 14.453  23.860 -23.980 1.00 0.00  ? 622 HOH B H2   1 
HETATM 9510 O O    . HOH D 2 .   ? 6.775   18.957 -21.971 1.00 38.58 ? 623 HOH B O    1 
HETATM 9511 H H1   . HOH D 2 .   ? 7.356   19.739 -22.000 1.00 0.00  ? 623 HOH B H1   1 
HETATM 9512 H H2   . HOH D 2 .   ? 6.350   18.979 -22.826 1.00 0.00  ? 623 HOH B H2   1 
HETATM 9513 O O    . HOH D 2 .   ? -9.095  49.352 -17.487 1.00 53.62 ? 624 HOH B O    1 
HETATM 9514 H H1   . HOH D 2 .   ? -8.456  49.693 -18.114 1.00 0.00  ? 624 HOH B H1   1 
HETATM 9515 H H2   . HOH D 2 .   ? -9.380  48.536 -17.927 1.00 0.00  ? 624 HOH B H2   1 
HETATM 9516 O O    . HOH D 2 .   ? -5.975  33.906 -33.109 1.00 9.06  ? 625 HOH B O    1 
HETATM 9517 H H1   . HOH D 2 .   ? -6.522  34.557 -33.579 1.00 0.00  ? 625 HOH B H1   1 
HETATM 9518 H H2   . HOH D 2 .   ? -5.671  34.410 -32.357 1.00 0.00  ? 625 HOH B H2   1 
HETATM 9519 O O    . HOH D 2 .   ? -16.572 40.043 -18.213 1.00 17.81 ? 626 HOH B O    1 
HETATM 9520 H H1   . HOH D 2 .   ? -16.652 40.991 -18.074 1.00 0.00  ? 626 HOH B H1   1 
HETATM 9521 H H2   . HOH D 2 .   ? -16.511 39.761 -17.290 1.00 0.00  ? 626 HOH B H2   1 
HETATM 9522 O O    . HOH D 2 .   ? 34.387  7.510  -9.332  1.00 33.03 ? 627 HOH B O    1 
HETATM 9523 H H1   . HOH D 2 .   ? 35.278  7.197  -9.154  1.00 0.00  ? 627 HOH B H1   1 
HETATM 9524 H H2   . HOH D 2 .   ? 34.421  7.893  -10.205 1.00 0.00  ? 627 HOH B H2   1 
HETATM 9525 O O    . HOH D 2 .   ? -8.309  50.093 0.975   1.00 55.83 ? 628 HOH B O    1 
HETATM 9526 H H1   . HOH D 2 .   ? -7.761  49.306 0.781   1.00 0.00  ? 628 HOH B H1   1 
HETATM 9527 H H2   . HOH D 2 .   ? -7.624  50.744 1.128   1.00 0.00  ? 628 HOH B H2   1 
HETATM 9528 O O    . HOH D 2 .   ? 10.917  0.627  -19.654 1.00 35.29 ? 629 HOH B O    1 
HETATM 9529 H H1   . HOH D 2 .   ? 11.145  -0.300 -19.576 1.00 0.00  ? 629 HOH B H1   1 
HETATM 9530 H H2   . HOH D 2 .   ? 10.377  0.646  -20.449 1.00 0.00  ? 629 HOH B H2   1 
HETATM 9531 O O    . HOH D 2 .   ? -15.919 34.722 -32.079 1.00 22.38 ? 630 HOH B O    1 
HETATM 9532 H H1   . HOH D 2 .   ? -15.446 34.398 -32.875 1.00 0.00  ? 630 HOH B H1   1 
HETATM 9533 H H2   . HOH D 2 .   ? -15.824 35.677 -32.231 1.00 0.00  ? 630 HOH B H2   1 
HETATM 9534 O O    . HOH D 2 .   ? -17.993 26.098 -22.339 1.00 30.79 ? 631 HOH B O    1 
HETATM 9535 H H1   . HOH D 2 .   ? -18.631 26.309 -21.661 1.00 0.00  ? 631 HOH B H1   1 
HETATM 9536 H H2   . HOH D 2 .   ? -17.961 26.920 -22.858 1.00 0.00  ? 631 HOH B H2   1 
HETATM 9537 O O    . HOH D 2 .   ? -3.659  62.481 -42.288 1.00 36.57 ? 632 HOH B O    1 
HETATM 9538 H H1   . HOH D 2 .   ? -2.717  62.379 -42.095 1.00 0.00  ? 632 HOH B H1   1 
HETATM 9539 H H2   . HOH D 2 .   ? -3.922  61.552 -42.208 1.00 0.00  ? 632 HOH B H2   1 
HETATM 9540 O O    . HOH D 2 .   ? 11.551  -3.527 -3.266  1.00 19.78 ? 633 HOH B O    1 
HETATM 9541 H H1   . HOH D 2 .   ? 10.945  -2.836 -2.909  1.00 0.00  ? 633 HOH B H1   1 
HETATM 9542 H H2   . HOH D 2 .   ? 11.058  -4.314 -3.016  1.00 0.00  ? 633 HOH B H2   1 
HETATM 9543 O O    . HOH D 2 .   ? 9.279   45.710 -31.092 1.00 18.77 ? 634 HOH B O    1 
HETATM 9544 H H1   . HOH D 2 .   ? 8.444   45.247 -31.138 1.00 0.00  ? 634 HOH B H1   1 
HETATM 9545 H H2   . HOH D 2 .   ? 9.899   45.068 -31.501 1.00 0.00  ? 634 HOH B H2   1 
HETATM 9546 O O    . HOH D 2 .   ? -1.338  20.245 6.213   1.00 40.86 ? 635 HOH B O    1 
HETATM 9547 H H1   . HOH D 2 .   ? -0.725  20.533 5.525   1.00 0.00  ? 635 HOH B H1   1 
HETATM 9548 H H2   . HOH D 2 .   ? -1.144  19.307 6.271   1.00 0.00  ? 635 HOH B H2   1 
HETATM 9549 O O    . HOH D 2 .   ? 12.828  20.095 7.963   1.00 48.77 ? 636 HOH B O    1 
HETATM 9550 H H1   . HOH D 2 .   ? 12.347  20.845 7.603   1.00 0.00  ? 636 HOH B H1   1 
HETATM 9551 H H2   . HOH D 2 .   ? 13.749  20.329 7.745   1.00 0.00  ? 636 HOH B H2   1 
HETATM 9552 O O    . HOH D 2 .   ? 1.706   38.872 6.067   1.00 16.06 ? 637 HOH B O    1 
HETATM 9553 H H1   . HOH D 2 .   ? 1.901   38.076 5.566   1.00 0.00  ? 637 HOH B H1   1 
HETATM 9554 H H2   . HOH D 2 .   ? 2.405   38.810 6.719   1.00 0.00  ? 637 HOH B H2   1 
HETATM 9555 O O    . HOH D 2 .   ? 9.903   -1.779 -2.016  1.00 61.69 ? 638 HOH B O    1 
HETATM 9556 H H1   . HOH D 2 .   ? 9.966   -0.864 -2.315  1.00 0.00  ? 638 HOH B H1   1 
HETATM 9557 H H2   . HOH D 2 .   ? 10.224  -1.657 -1.114  1.00 0.00  ? 638 HOH B H2   1 
HETATM 9558 O O    . HOH D 2 .   ? 0.934   38.473 -38.788 1.00 26.12 ? 639 HOH B O    1 
HETATM 9559 H H1   . HOH D 2 .   ? 0.833   37.510 -38.835 1.00 0.00  ? 639 HOH B H1   1 
HETATM 9560 H H2   . HOH D 2 .   ? 0.034   38.770 -38.646 1.00 0.00  ? 639 HOH B H2   1 
HETATM 9561 O O    . HOH D 2 .   ? 17.833  24.991 -36.206 1.00 53.56 ? 640 HOH B O    1 
HETATM 9562 H H1   . HOH D 2 .   ? 17.676  25.714 -36.834 1.00 0.00  ? 640 HOH B H1   1 
HETATM 9563 H H2   . HOH D 2 .   ? 18.700  24.665 -36.472 1.00 0.00  ? 640 HOH B H2   1 
HETATM 9564 O O    . HOH D 2 .   ? 8.633   31.989 -45.536 1.00 21.87 ? 641 HOH B O    1 
HETATM 9565 H H1   . HOH D 2 .   ? 8.513   32.760 -46.109 1.00 0.00  ? 641 HOH B H1   1 
HETATM 9566 H H2   . HOH D 2 .   ? 9.006   32.370 -44.738 1.00 0.00  ? 641 HOH B H2   1 
HETATM 9567 O O    . HOH D 2 .   ? -6.915  42.157 -8.974  1.00 15.86 ? 642 HOH B O    1 
HETATM 9568 H H1   . HOH D 2 .   ? -6.272  42.746 -9.372  1.00 0.00  ? 642 HOH B H1   1 
HETATM 9569 H H2   . HOH D 2 .   ? -6.392  41.494 -8.508  1.00 0.00  ? 642 HOH B H2   1 
HETATM 9570 O O    . HOH D 2 .   ? -7.101  47.973 -6.628  1.00 18.19 ? 643 HOH B O    1 
HETATM 9571 H H1   . HOH D 2 .   ? -7.084  48.622 -5.918  1.00 0.00  ? 643 HOH B H1   1 
HETATM 9572 H H2   . HOH D 2 .   ? -8.027  47.727 -6.683  1.00 0.00  ? 643 HOH B H2   1 
HETATM 9573 O O    . HOH D 2 .   ? -17.282 34.288 -30.042 1.00 41.44 ? 644 HOH B O    1 
HETATM 9574 H H1   . HOH D 2 .   ? -16.842 34.654 -30.834 1.00 0.00  ? 644 HOH B H1   1 
HETATM 9575 H H2   . HOH D 2 .   ? -17.850 35.022 -29.780 1.00 0.00  ? 644 HOH B H2   1 
HETATM 9576 O O    . HOH D 2 .   ? 27.957  27.797 -9.911  1.00 26.00 ? 645 HOH B O    1 
HETATM 9577 H H1   . HOH D 2 .   ? 28.155  28.294 -9.109  1.00 0.00  ? 645 HOH B H1   1 
HETATM 9578 H H2   . HOH D 2 .   ? 27.397  27.081 -9.573  1.00 0.00  ? 645 HOH B H2   1 
HETATM 9579 O O    . HOH D 2 .   ? 34.398  20.708 -26.914 1.00 37.05 ? 646 HOH B O    1 
HETATM 9580 H H1   . HOH D 2 .   ? 34.238  20.771 -27.859 1.00 0.00  ? 646 HOH B H1   1 
HETATM 9581 H H2   . HOH D 2 .   ? 33.948  21.504 -26.600 1.00 0.00  ? 646 HOH B H2   1 
HETATM 9582 O O    . HOH D 2 .   ? 20.373  31.248 -39.984 1.00 21.79 ? 647 HOH B O    1 
HETATM 9583 H H1   . HOH D 2 .   ? 19.951  31.625 -39.203 1.00 0.00  ? 647 HOH B H1   1 
HETATM 9584 H H2   . HOH D 2 .   ? 20.109  31.890 -40.668 1.00 0.00  ? 647 HOH B H2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   1   1   GLY GLY A . n 
A 1 2   ASN 2   2   2   ASN ASN A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   VAL 4   4   4   VAL VAL A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  GLN 10  10  10  GLN GLN A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  HIS 37  37  37  HIS HIS A . n 
A 1 38  ASN 38  38  38  ASN ASN A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  THR 50  50  50  THR THR A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  HIS 53  53  53  HIS HIS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  PRO 56  56  56  PRO PRO A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ARG 61  61  61  ARG ARG A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ASN 63  63  63  ASN ASN A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ILE 68  68  68  ILE ILE A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  MET 80  80  80  MET MET A . n 
A 1 81  LYS 81  81  81  LYS LYS A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  LYS 84  84  84  LYS LYS A . n 
A 1 85  GLU 85  85  85  GLU GLU A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  GLU 87  87  87  GLU GLU A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  ARG 89  89  89  ARG ARG A . n 
A 1 90  GLY 90  90  90  GLY GLY A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  PRO 92  92  92  PRO PRO A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLU 101 101 101 GLU GLU A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 CYS 103 103 103 CYS CYS A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 TYR 109 109 109 TYR TYR A . n 
A 1 110 HIS 110 110 110 HIS HIS A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 LYS 124 124 124 LYS LYS A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ILE 126 126 126 ILE ILE A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 THR 129 129 129 THR THR A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 ARG 131 131 131 ARG ARG A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 GLY 134 134 134 GLY GLY A . n 
A 1 135 PRO 135 135 135 PRO PRO A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 LYS 140 140 140 LYS LYS A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 PHE 157 157 157 PHE PHE A . n 
A 1 158 ALA 158 158 158 ALA ALA A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 LYS 160 160 160 LYS LYS A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LYS 162 162 162 LYS LYS A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 MET 165 165 165 MET MET A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 HIS 168 168 168 HIS HIS A . n 
A 1 169 ASN 169 169 169 ASN ASN A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 GLN 171 171 171 GLN GLN A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ASN 174 174 174 ASN ASN A . n 
A 1 175 TYR 175 175 175 TYR TYR A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 GLU 179 179 179 GLU GLU A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 TYR 183 183 183 TYR TYR A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 LYS 185 185 185 LYS LYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 ASP 188 188 188 ASP ASP A . n 
A 1 189 ASP 189 189 189 ASP ASP A . n 
A 1 190 THR 190 190 190 THR THR A . n 
A 1 191 MET 191 191 191 MET MET A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ASP 195 195 195 ASP ASP A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 VAL 204 204 204 VAL VAL A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 ASP 209 209 209 ASP ASP A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 ARG 214 214 214 ARG ARG A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 ASP 216 216 216 ASP ASP A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 MET 219 219 219 MET MET A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 ASP 229 229 229 ASP ASP A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 ASP 231 231 231 ASP ASP A . n 
A 1 232 HIS 232 232 232 HIS HIS A . n 
A 1 233 GLY 233 233 233 GLY GLY A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 TYR 235 235 235 TYR TYR A . n 
A 1 236 PRO 236 236 236 PRO PRO A . n 
A 1 237 TYR 237 237 237 TYR TYR A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 THR 239 239 239 THR THR A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ASN 242 242 242 ASN ASN A . n 
A 1 243 THR 243 243 243 THR THR A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 GLY 246 246 246 GLY GLY A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 THR 250 250 250 THR THR A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 SER 252 252 252 SER SER A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 GLY 255 255 255 GLY GLY A . n 
A 1 256 PRO 256 256 256 PRO PRO A . n 
A 1 257 ARG 257 257 257 ARG ARG A . n 
A 1 258 TYR 258 258 258 TYR TYR A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 TYR 261 261 261 TYR TYR A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 LYS 267 267 267 LYS LYS A . n 
A 1 268 ALA 268 268 268 ALA ALA A . n 
A 1 269 TYR 269 269 269 TYR TYR A . n 
A 1 270 SER 270 270 270 SER SER A . n 
A 1 271 THR 271 271 271 THR THR A . n 
A 1 272 ARG 272 272 272 ARG ARG A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 GLY 276 276 276 GLY GLY A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 PHE 278 278 278 PHE PHE A . n 
A 1 279 PRO 279 279 279 PRO PRO A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 GLU 281 281 281 GLU GLU A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PHE 283 283 283 PHE PHE A . n 
A 1 284 ASP 284 284 284 ASP ASP A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 THR 286 286 286 THR THR A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 PHE 289 289 289 PHE PHE A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 CYS 291 291 291 CYS CYS A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 GLY 294 294 294 GLY GLY A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ARG 303 303 303 ARG ARG A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 ARG 305 305 305 ARG ARG A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 THR 307 307 307 THR THR A . n 
A 1 308 GLY 308 308 308 GLY GLY A . n 
A 1 309 TRP 309 309 309 TRP TRP A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 THR 312 312 312 THR THR A . n 
A 1 313 VAL 313 313 313 VAL VAL A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 VAL 315 315 315 VAL VAL A . n 
A 1 316 ARG 316 316 316 ARG ARG A . n 
A 1 317 ARG 317 317 317 ARG ARG A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 GLN 320 320 320 GLN GLN A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 ASN 322 322 322 ASN ASN A . n 
A 1 323 SER 323 323 323 SER SER A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 SER 325 325 325 SER SER A . n 
A 1 326 GLY 326 326 326 GLY GLY A . n 
A 1 327 PHE 327 327 327 PHE PHE A . n 
A 1 328 CYS 328 328 328 CYS CYS A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 VAL 334 334 334 VAL VAL A . n 
A 1 335 LEU 335 335 335 LEU LEU A . n 
A 1 336 ASP 336 336 336 ASP ASP A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LYS 339 339 339 LYS LYS A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 LYS 342 342 342 LYS LYS A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 CYS 344 344 344 CYS CYS A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ALA 346 346 346 ALA ALA A . n 
A 1 347 TYR 347 347 347 TYR TYR A . n 
A 1 348 ARG 348 348 348 ARG ARG A . n 
A 1 349 MET 349 349 349 MET MET A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 ARG 353 353 353 ARG ARG A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 VAL 355 355 355 VAL VAL A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 THR 357 357 357 THR THR A . n 
A 1 358 THR 358 358 358 THR THR A . n 
A 1 359 PRO 359 359 359 PRO PRO A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 ALA 362 362 362 ALA ALA A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 ASP 364 364 364 ASP ASP A . n 
A 1 365 TRP 365 365 365 TRP TRP A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 VAL 368 368 368 VAL VAL A . n 
A 1 369 GLU 369 369 369 GLU GLU A . n 
A 1 370 PRO 370 370 370 PRO PRO A . n 
A 1 371 ILE 371 371 371 ILE ILE A . n 
A 1 372 TYR 372 372 372 TYR TYR A . n 
A 1 373 GLU 373 373 373 GLU GLU A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 MET 375 375 375 MET MET A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 GLY 377 377 377 GLY GLY A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 SER 379 379 379 SER SER A . n 
A 1 380 GLU 380 380 380 GLU GLU A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 VAL 385 385 385 VAL VAL A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASP 387 387 387 ASP ASP A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 SER 389 389 389 SER SER A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 LEU 396 396 396 LEU LEU A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 LYS 400 400 400 LYS LYS A . n 
A 1 401 ARG 401 401 401 ARG ARG A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 GLU 404 404 404 GLU GLU A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 PRO 409 409 409 PRO PRO A . n 
A 1 410 ILE 410 410 410 ILE ILE A . n 
A 1 411 ASP 411 411 411 ASP ASP A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 ILE 413 413 413 ILE ILE A . n 
A 1 414 SER 414 414 414 SER SER A . n 
A 1 415 THR 415 415 415 THR THR A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 PRO 417 417 417 PRO PRO A . n 
A 1 418 ASP 418 418 418 ASP ASP A . n 
A 1 419 ARG 419 419 419 ARG ARG A . n 
A 1 420 THR 420 420 420 THR THR A . n 
A 1 421 GLU 421 421 421 GLU GLU A . n 
A 1 422 THR 422 422 422 THR THR A . n 
A 1 423 MET 423 423 423 MET MET A . n 
A 1 424 ILE 424 424 424 ILE ILE A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ASP 427 427 427 ASP ASP A . n 
A 1 428 PRO 428 428 428 PRO PRO A . n 
A 1 429 PHE 429 429 429 PHE PHE A . n 
A 1 430 ASP 430 430 430 ASP ASP A . n 
A 1 431 ALA 431 431 431 ALA ALA A . n 
B 1 1   GLY 1   1   1   GLY GLY B . n 
B 1 2   ASN 2   2   2   ASN ASN B . n 
B 1 3   ASN 3   3   3   ASN ASN B . n 
B 1 4   VAL 4   4   4   VAL VAL B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   VAL 6   6   6   VAL VAL B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   GLY 8   8   8   GLY GLY B . n 
B 1 9   THR 9   9   9   THR THR B . n 
B 1 10  GLN 10  10  10  GLN GLN B . n 
B 1 11  TRP 11  11  11  TRP TRP B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ASP 13  13  13  ASP ASP B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  GLY 17  17  17  GLY GLY B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  ASP 21  21  21  ASP ASP B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  ALA 27  27  27  ALA ALA B . n 
B 1 28  LYS 28  28  28  LYS LYS B . n 
B 1 29  TYR 29  29  29  TYR TYR B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  ARG 32  32  32  ARG ARG B . n 
B 1 33  TYR 33  33  33  TYR TYR B . n 
B 1 34  GLN 34  34  34  GLN GLN B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  GLY 36  36  36  GLY GLY B . n 
B 1 37  HIS 37  37  37  HIS HIS B . n 
B 1 38  ASN 38  38  38  ASN ASN B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  HIS 41  41  41  HIS HIS B . n 
B 1 42  THR 42  42  42  THR THR B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  ASN 46  46  46  ASN ASN B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  GLU 48  48  48  GLU GLU B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  THR 50  50  50  THR THR B . n 
B 1 51  VAL 51  51  51  VAL VAL B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  HIS 53  53  53  HIS HIS B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  ILE 55  55  55  ILE ILE B . n 
B 1 56  PRO 56  56  56  PRO PRO B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  ILE 59  59  59  ILE ILE B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ARG 61  61  61  ARG ARG B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ASN 63  63  63  ASN ASN B . n 
B 1 64  VAL 64  64  64  VAL VAL B . n 
B 1 65  THR 65  65  65  THR THR B . n 
B 1 66  SER 66  66  66  SER SER B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  ILE 68  68  68  ILE ILE B . n 
B 1 69  GLY 69  69  69  GLY GLY B . n 
B 1 70  ASN 70  70  70  ASN ASN B . n 
B 1 71  GLY 71  71  71  GLY GLY B . n 
B 1 72  VAL 72  72  72  VAL VAL B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  ALA 77  77  77  ALA ALA B . n 
B 1 78  ALA 78  78  78  ALA ALA B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  MET 80  80  80  MET MET B . n 
B 1 81  LYS 81  81  81  LYS LYS B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  MET 83  83  83  MET MET B . n 
B 1 84  LYS 84  84  84  LYS LYS B . n 
B 1 85  GLU 85  85  85  GLU GLU B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  GLU 87  87  87  GLU GLU B . n 
B 1 88  ASP 88  88  88  ASP ASP B . n 
B 1 89  ARG 89  89  89  ARG ARG B . n 
B 1 90  GLY 90  90  90  GLY GLY B . n 
B 1 91  ILE 91  91  91  ILE ILE B . n 
B 1 92  PRO 92  92  92  PRO PRO B . n 
B 1 93  VAL 93  93  93  VAL VAL B . n 
B 1 94  ARG 94  94  94  ARG ARG B . n 
B 1 95  GLU 95  95  95  GLU GLU B . n 
B 1 96  ARG 96  96  96  ARG ARG B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  LEU 98  98  98  LEU LEU B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 GLU 101 101 101 GLU GLU B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 CYS 103 103 103 CYS CYS B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 ILE 106 106 106 ILE ILE B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 ASP 108 108 108 ASP ASP B . n 
B 1 109 TYR 109 109 109 TYR TYR B . n 
B 1 110 HIS 110 110 110 HIS HIS B . n 
B 1 111 VAL 111 111 111 VAL VAL B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 ASP 114 114 114 ASP ASP B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 GLU 118 118 118 GLU GLU B . n 
B 1 119 LYS 119 119 119 LYS LYS B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 ARG 121 121 121 ARG ARG B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 ALA 123 123 123 ALA ALA B . n 
B 1 124 LYS 124 124 124 LYS LYS B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 ILE 126 126 126 ILE ILE B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 THR 128 128 128 THR THR B . n 
B 1 129 THR 129 129 129 THR THR B . n 
B 1 130 GLY 130 130 130 GLY GLY B . n 
B 1 131 ARG 131 131 131 ARG ARG B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 GLY 134 134 134 GLY GLY B . n 
B 1 135 PRO 135 135 135 PRO PRO B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 LYS 140 140 140 LYS LYS B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 ARG 144 144 144 ARG ARG B . n 
B 1 145 GLY 145 145 145 GLY GLY B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ARG 147 147 147 ARG ARG B . n 
B 1 148 VAL 148 148 148 VAL VAL B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 LYS 154 154 154 LYS LYS B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 THR 156 156 156 THR THR B . n 
B 1 157 PHE 157 157 157 PHE PHE B . n 
B 1 158 ALA 158 158 158 ALA ALA B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 LYS 160 160 160 LYS LYS B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 LYS 162 162 162 LYS LYS B . n 
B 1 163 GLU 163 163 163 GLU GLU B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 MET 165 165 165 MET MET B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 TYR 167 167 167 TYR TYR B . n 
B 1 168 HIS 168 168 168 HIS HIS B . n 
B 1 169 ASN 169 169 169 ASN ASN B . n 
B 1 170 PHE 170 170 170 PHE PHE B . n 
B 1 171 GLN 171 171 171 GLN GLN B . n 
B 1 172 LEU 172 172 172 LEU LEU B . n 
B 1 173 VAL 173 173 173 VAL VAL B . n 
B 1 174 ASN 174 174 174 ASN ASN B . n 
B 1 175 TYR 175 175 175 TYR TYR B . n 
B 1 176 TYR 176 176 176 TYR TYR B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 GLU 179 179 179 GLU GLU B . n 
B 1 180 ALA 180 180 180 ALA ALA B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 TYR 183 183 183 TYR TYR B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 LYS 185 185 185 LYS LYS B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 ASP 188 188 188 ASP ASP B . n 
B 1 189 ASP 189 189 189 ASP ASP B . n 
B 1 190 THR 190 190 190 THR THR B . n 
B 1 191 MET 191 191 191 MET MET B . n 
B 1 192 ALA 192 192 192 ALA ALA B . n 
B 1 193 VAL 193 193 193 VAL VAL B . n 
B 1 194 ALA 194 194 194 ALA ALA B . n 
B 1 195 ASP 195 195 195 ASP ASP B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 LEU 197 197 197 LEU LEU B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 MET 200 200 200 MET MET B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 VAL 202 202 202 VAL VAL B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 VAL 204 204 204 VAL VAL B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 ASP 206 206 206 ASP ASP B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 LEU 208 208 208 LEU LEU B . n 
B 1 209 ASP 209 209 209 ASP ASP B . n 
B 1 210 GLN 210 210 210 GLN GLN B . n 
B 1 211 ALA 211 211 211 ALA ALA B . n 
B 1 212 ARG 212 212 212 ARG ARG B . n 
B 1 213 GLN 213 213 213 GLN GLN B . n 
B 1 214 ARG 214 214 214 ARG ARG B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 ASP 216 216 216 ASP ASP B . n 
B 1 217 PHE 217 217 217 PHE PHE B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 MET 219 219 219 MET MET B . n 
B 1 220 PHE 220 220 220 PHE PHE B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 GLY 222 222 222 GLY GLY B . n 
B 1 223 ALA 223 223 223 ALA ALA B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 GLY 225 225 225 GLY GLY B . n 
B 1 226 THR 226 226 226 THR THR B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 ASP 229 229 229 ASP ASP B . n 
B 1 230 ILE 230 230 230 ILE ILE B . n 
B 1 231 ASP 231 231 231 ASP ASP B . n 
B 1 232 HIS 232 232 232 HIS HIS B . n 
B 1 233 GLY 233 233 233 GLY GLY B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 TYR 235 235 235 TYR TYR B . n 
B 1 236 PRO 236 236 236 PRO PRO B . n 
B 1 237 TYR 237 237 237 TYR TYR B . n 
B 1 238 VAL 238 238 238 VAL VAL B . n 
B 1 239 THR 239 239 239 THR THR B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 SER 241 241 241 SER SER B . n 
B 1 242 ASN 242 242 242 ASN ASN B . n 
B 1 243 THR 243 243 243 THR THR B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 ALA 245 245 245 ALA ALA B . n 
B 1 246 GLY 246 246 246 GLY GLY B . n 
B 1 247 GLY 247 247 247 GLY GLY B . n 
B 1 248 VAL 248 248 248 VAL VAL B . n 
B 1 249 ALA 249 249 249 ALA ALA B . n 
B 1 250 THR 250 250 250 THR THR B . n 
B 1 251 GLY 251 251 251 GLY GLY B . n 
B 1 252 SER 252 252 252 SER SER B . n 
B 1 253 GLY 253 253 253 GLY GLY B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 GLY 255 255 255 GLY GLY B . n 
B 1 256 PRO 256 256 256 PRO PRO B . n 
B 1 257 ARG 257 257 257 ARG ARG B . n 
B 1 258 TYR 258 258 258 TYR TYR B . n 
B 1 259 VAL 259 259 259 VAL VAL B . n 
B 1 260 ASP 260 260 260 ASP ASP B . n 
B 1 261 TYR 261 261 261 TYR TYR B . n 
B 1 262 VAL 262 262 262 VAL VAL B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 GLY 264 264 264 GLY GLY B . n 
B 1 265 ILE 265 265 265 ILE ILE B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 LYS 267 267 267 LYS LYS B . n 
B 1 268 ALA 268 268 268 ALA ALA B . n 
B 1 269 TYR 269 269 269 TYR TYR B . n 
B 1 270 SER 270 270 270 SER SER B . n 
B 1 271 THR 271 271 271 THR THR B . n 
B 1 272 ARG 272 272 272 ARG ARG B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 GLY 274 274 274 GLY GLY B . n 
B 1 275 ALA 275 275 275 ALA ALA B . n 
B 1 276 GLY 276 276 276 GLY GLY B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 PHE 278 278 278 PHE PHE B . n 
B 1 279 PRO 279 279 279 PRO PRO B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 GLU 281 281 281 GLU GLU B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 PHE 283 283 283 PHE PHE B . n 
B 1 284 ASP 284 284 284 ASP ASP B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 THR 286 286 286 THR THR B . n 
B 1 287 GLY 287 287 287 GLY GLY B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 PHE 289 289 289 PHE PHE B . n 
B 1 290 LEU 290 290 290 LEU LEU B . n 
B 1 291 CYS 291 291 291 CYS CYS B . n 
B 1 292 LYS 292 292 292 LYS LYS B . n 
B 1 293 GLN 293 293 293 GLN GLN B . n 
B 1 294 GLY 294 294 294 GLY GLY B . n 
B 1 295 ASN 295 295 295 ASN ASN B . n 
B 1 296 GLU 296 296 296 GLU GLU B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 GLY 298 298 298 GLY GLY B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 THR 301 301 301 THR THR B . n 
B 1 302 GLY 302 302 302 GLY GLY B . n 
B 1 303 ARG 303 303 303 ARG ARG B . n 
B 1 304 ARG 304 304 304 ARG ARG B . n 
B 1 305 ARG 305 305 305 ARG ARG B . n 
B 1 306 ARG 306 306 306 ARG ARG B . n 
B 1 307 THR 307 307 307 THR THR B . n 
B 1 308 GLY 308 308 308 GLY GLY B . n 
B 1 309 TRP 309 309 309 TRP TRP B . n 
B 1 310 LEU 310 310 310 LEU LEU B . n 
B 1 311 ASP 311 311 311 ASP ASP B . n 
B 1 312 THR 312 312 312 THR THR B . n 
B 1 313 VAL 313 313 313 VAL VAL B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 VAL 315 315 315 VAL VAL B . n 
B 1 316 ARG 316 316 316 ARG ARG B . n 
B 1 317 ARG 317 317 317 ARG ARG B . n 
B 1 318 ALA 318 318 318 ALA ALA B . n 
B 1 319 VAL 319 319 319 VAL VAL B . n 
B 1 320 GLN 320 320 320 GLN GLN B . n 
B 1 321 LEU 321 321 321 LEU LEU B . n 
B 1 322 ASN 322 322 322 ASN ASN B . n 
B 1 323 SER 323 323 323 SER SER B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 SER 325 325 325 SER SER B . n 
B 1 326 GLY 326 326 326 GLY GLY B . n 
B 1 327 PHE 327 327 327 PHE PHE B . n 
B 1 328 CYS 328 328 328 CYS CYS B . n 
B 1 329 LEU 329 329 329 LEU LEU B . n 
B 1 330 THR 330 330 330 THR THR B . n 
B 1 331 LYS 331 331 331 LYS LYS B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 VAL 334 334 334 VAL VAL B . n 
B 1 335 LEU 335 335 335 LEU LEU B . n 
B 1 336 ASP 336 336 336 ASP ASP B . n 
B 1 337 GLY 337 337 337 GLY GLY B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 LYS 339 339 339 LYS LYS B . n 
B 1 340 GLU 340 340 340 GLU GLU B . n 
B 1 341 VAL 341 341 341 VAL VAL B . n 
B 1 342 LYS 342 342 342 LYS LYS B . n 
B 1 343 LEU 343 343 343 LEU LEU B . n 
B 1 344 CYS 344 344 344 CYS CYS B . n 
B 1 345 VAL 345 345 345 VAL VAL B . n 
B 1 346 ALA 346 346 346 ALA ALA B . n 
B 1 347 TYR 347 347 347 TYR TYR B . n 
B 1 348 ARG 348 348 348 ARG ARG B . n 
B 1 349 MET 349 349 349 MET MET B . n 
B 1 350 PRO 350 350 350 PRO PRO B . n 
B 1 351 ASP 351 351 351 ASP ASP B . n 
B 1 352 GLY 352 352 352 GLY GLY B . n 
B 1 353 ARG 353 353 353 ARG ARG B . n 
B 1 354 GLU 354 354 354 GLU GLU B . n 
B 1 355 VAL 355 355 355 VAL VAL B . n 
B 1 356 THR 356 356 356 THR THR B . n 
B 1 357 THR 357 357 357 THR THR B . n 
B 1 358 THR 358 358 358 THR THR B . n 
B 1 359 PRO 359 359 359 PRO PRO B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 ALA 362 362 362 ALA ALA B . n 
B 1 363 ASP 363 363 363 ASP ASP B . n 
B 1 364 ASP 364 364 364 ASP ASP B . n 
B 1 365 TRP 365 365 365 TRP TRP B . n 
B 1 366 LYS 366 366 366 LYS LYS B . n 
B 1 367 GLY 367 367 367 GLY GLY B . n 
B 1 368 VAL 368 368 368 VAL VAL B . n 
B 1 369 GLU 369 369 369 GLU GLU B . n 
B 1 370 PRO 370 370 370 PRO PRO B . n 
B 1 371 ILE 371 371 371 ILE ILE B . n 
B 1 372 TYR 372 372 372 TYR TYR B . n 
B 1 373 GLU 373 373 373 GLU GLU B . n 
B 1 374 THR 374 374 374 THR THR B . n 
B 1 375 MET 375 375 375 MET MET B . n 
B 1 376 PRO 376 376 376 PRO PRO B . n 
B 1 377 GLY 377 377 377 GLY GLY B . n 
B 1 378 TRP 378 378 378 TRP TRP B . n 
B 1 379 SER 379 379 379 SER SER B . n 
B 1 380 GLU 380 380 380 GLU GLU B . n 
B 1 381 SER 381 381 381 SER SER B . n 
B 1 382 THR 382 382 382 THR THR B . n 
B 1 383 PHE 383 383 383 PHE PHE B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 VAL 385 385 385 VAL VAL B . n 
B 1 386 LYS 386 386 386 LYS LYS B . n 
B 1 387 ASP 387 387 387 ASP ASP B . n 
B 1 388 ARG 388 388 388 ARG ARG B . n 
B 1 389 SER 389 389 389 SER SER B . n 
B 1 390 GLY 390 390 390 GLY GLY B . n 
B 1 391 LEU 391 391 391 LEU LEU B . n 
B 1 392 PRO 392 392 392 PRO PRO B . n 
B 1 393 GLN 393 393 393 GLN GLN B . n 
B 1 394 ALA 394 394 394 ALA ALA B . n 
B 1 395 ALA 395 395 395 ALA ALA B . n 
B 1 396 LEU 396 396 396 LEU LEU B . n 
B 1 397 ASN 397 397 397 ASN ASN B . n 
B 1 398 TYR 398 398 398 TYR TYR B . n 
B 1 399 ILE 399 399 399 ILE ILE B . n 
B 1 400 LYS 400 400 400 LYS LYS B . n 
B 1 401 ARG 401 401 401 ARG ARG B . n 
B 1 402 ILE 402 402 402 ILE ILE B . n 
B 1 403 GLU 403 403 403 GLU GLU B . n 
B 1 404 GLU 404 404 404 GLU GLU B . n 
B 1 405 LEU 405 405 405 LEU LEU B . n 
B 1 406 THR 406 406 406 THR THR B . n 
B 1 407 GLY 407 407 407 GLY GLY B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 PRO 409 409 409 PRO PRO B . n 
B 1 410 ILE 410 410 410 ILE ILE B . n 
B 1 411 ASP 411 411 411 ASP ASP B . n 
B 1 412 ILE 412 412 412 ILE ILE B . n 
B 1 413 ILE 413 413 413 ILE ILE B . n 
B 1 414 SER 414 414 414 SER SER B . n 
B 1 415 THR 415 415 415 THR THR B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 PRO 417 417 417 PRO PRO B . n 
B 1 418 ASP 418 418 418 ASP ASP B . n 
B 1 419 ARG 419 419 419 ARG ARG B . n 
B 1 420 THR 420 420 420 THR THR B . n 
B 1 421 GLU 421 421 421 GLU GLU B . n 
B 1 422 THR 422 422 422 THR THR B . n 
B 1 423 MET 423 423 423 MET MET B . n 
B 1 424 ILE 424 424 424 ILE ILE B . n 
B 1 425 LEU 425 425 425 LEU LEU B . n 
B 1 426 ARG 426 426 426 ARG ARG B . n 
B 1 427 ASP 427 427 427 ASP ASP B . n 
B 1 428 PRO 428 428 428 PRO PRO B . n 
B 1 429 PHE 429 429 429 PHE PHE B . n 
B 1 430 ASP 430 430 430 ASP ASP B . n 
B 1 431 ALA 431 431 431 ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   432 500 HOH HOH A . 
C 2 HOH 2   433 501 HOH HOH A . 
C 2 HOH 3   434 502 HOH HOH A . 
C 2 HOH 4   435 503 HOH HOH A . 
C 2 HOH 5   436 504 HOH HOH A . 
C 2 HOH 6   437 505 HOH HOH A . 
C 2 HOH 7   438 506 HOH HOH A . 
C 2 HOH 8   439 507 HOH HOH A . 
C 2 HOH 9   440 508 HOH HOH A . 
C 2 HOH 10  441 509 HOH HOH A . 
C 2 HOH 11  442 510 HOH HOH A . 
C 2 HOH 12  443 511 HOH HOH A . 
C 2 HOH 13  444 512 HOH HOH A . 
C 2 HOH 14  445 513 HOH HOH A . 
C 2 HOH 15  446 515 HOH HOH A . 
C 2 HOH 16  447 516 HOH HOH A . 
C 2 HOH 17  448 517 HOH HOH A . 
C 2 HOH 18  449 518 HOH HOH A . 
C 2 HOH 19  450 519 HOH HOH A . 
C 2 HOH 20  451 520 HOH HOH A . 
C 2 HOH 21  452 521 HOH HOH A . 
C 2 HOH 22  453 522 HOH HOH A . 
C 2 HOH 23  454 523 HOH HOH A . 
C 2 HOH 24  455 524 HOH HOH A . 
C 2 HOH 25  456 525 HOH HOH A . 
C 2 HOH 26  457 526 HOH HOH A . 
C 2 HOH 27  458 527 HOH HOH A . 
C 2 HOH 28  459 528 HOH HOH A . 
C 2 HOH 29  460 529 HOH HOH A . 
C 2 HOH 30  461 530 HOH HOH A . 
C 2 HOH 31  462 531 HOH HOH A . 
C 2 HOH 32  463 532 HOH HOH A . 
C 2 HOH 33  464 533 HOH HOH A . 
C 2 HOH 34  465 534 HOH HOH A . 
C 2 HOH 35  466 535 HOH HOH A . 
C 2 HOH 36  467 536 HOH HOH A . 
C 2 HOH 37  468 537 HOH HOH A . 
C 2 HOH 38  469 538 HOH HOH A . 
C 2 HOH 39  470 539 HOH HOH A . 
C 2 HOH 40  471 540 HOH HOH A . 
C 2 HOH 41  472 541 HOH HOH A . 
C 2 HOH 42  473 542 HOH HOH A . 
C 2 HOH 43  474 543 HOH HOH A . 
C 2 HOH 44  475 544 HOH HOH A . 
C 2 HOH 45  476 545 HOH HOH A . 
C 2 HOH 46  477 546 HOH HOH A . 
C 2 HOH 47  478 547 HOH HOH A . 
C 2 HOH 48  479 548 HOH HOH A . 
C 2 HOH 49  480 549 HOH HOH A . 
C 2 HOH 50  481 550 HOH HOH A . 
C 2 HOH 51  482 551 HOH HOH A . 
C 2 HOH 52  483 552 HOH HOH A . 
C 2 HOH 53  484 553 HOH HOH A . 
C 2 HOH 54  485 554 HOH HOH A . 
C 2 HOH 55  486 555 HOH HOH A . 
C 2 HOH 56  487 556 HOH HOH A . 
C 2 HOH 57  488 557 HOH HOH A . 
C 2 HOH 58  489 558 HOH HOH A . 
C 2 HOH 59  490 559 HOH HOH A . 
C 2 HOH 60  491 560 HOH HOH A . 
C 2 HOH 61  492 561 HOH HOH A . 
C 2 HOH 62  493 562 HOH HOH A . 
C 2 HOH 63  494 563 HOH HOH A . 
C 2 HOH 64  495 564 HOH HOH A . 
C 2 HOH 65  496 565 HOH HOH A . 
C 2 HOH 66  497 566 HOH HOH A . 
C 2 HOH 67  498 567 HOH HOH A . 
C 2 HOH 68  499 568 HOH HOH A . 
C 2 HOH 69  500 569 HOH HOH A . 
C 2 HOH 70  501 570 HOH HOH A . 
C 2 HOH 71  502 571 HOH HOH A . 
C 2 HOH 72  503 572 HOH HOH A . 
C 2 HOH 73  504 573 HOH HOH A . 
C 2 HOH 74  505 574 HOH HOH A . 
C 2 HOH 75  506 575 HOH HOH A . 
C 2 HOH 76  507 576 HOH HOH A . 
C 2 HOH 77  508 577 HOH HOH A . 
C 2 HOH 78  509 578 HOH HOH A . 
C 2 HOH 79  510 579 HOH HOH A . 
C 2 HOH 80  511 580 HOH HOH A . 
C 2 HOH 81  512 581 HOH HOH A . 
C 2 HOH 82  513 582 HOH HOH A . 
C 2 HOH 83  514 583 HOH HOH A . 
C 2 HOH 84  515 584 HOH HOH A . 
C 2 HOH 85  516 585 HOH HOH A . 
C 2 HOH 86  517 586 HOH HOH A . 
C 2 HOH 87  518 587 HOH HOH A . 
C 2 HOH 88  519 588 HOH HOH A . 
C 2 HOH 89  520 589 HOH HOH A . 
C 2 HOH 90  521 590 HOH HOH A . 
C 2 HOH 91  522 591 HOH HOH A . 
C 2 HOH 92  523 592 HOH HOH A . 
C 2 HOH 93  524 593 HOH HOH A . 
C 2 HOH 94  525 594 HOH HOH A . 
C 2 HOH 95  526 595 HOH HOH A . 
C 2 HOH 96  527 596 HOH HOH A . 
C 2 HOH 97  528 597 HOH HOH A . 
C 2 HOH 98  529 599 HOH HOH A . 
C 2 HOH 99  530 600 HOH HOH A . 
C 2 HOH 100 531 601 HOH HOH A . 
C 2 HOH 101 532 602 HOH HOH A . 
C 2 HOH 102 533 603 HOH HOH A . 
C 2 HOH 103 534 604 HOH HOH A . 
C 2 HOH 104 535 605 HOH HOH A . 
C 2 HOH 105 536 606 HOH HOH A . 
C 2 HOH 106 537 607 HOH HOH A . 
C 2 HOH 107 538 608 HOH HOH A . 
C 2 HOH 108 539 609 HOH HOH A . 
C 2 HOH 109 540 610 HOH HOH A . 
C 2 HOH 110 541 611 HOH HOH A . 
C 2 HOH 111 542 612 HOH HOH A . 
C 2 HOH 112 543 613 HOH HOH A . 
C 2 HOH 113 544 614 HOH HOH A . 
C 2 HOH 114 545 615 HOH HOH A . 
C 2 HOH 115 546 616 HOH HOH A . 
C 2 HOH 116 547 617 HOH HOH A . 
C 2 HOH 117 548 618 HOH HOH A . 
C 2 HOH 118 549 619 HOH HOH A . 
C 2 HOH 119 550 620 HOH HOH A . 
C 2 HOH 120 551 621 HOH HOH A . 
C 2 HOH 121 552 622 HOH HOH A . 
C 2 HOH 122 553 623 HOH HOH A . 
C 2 HOH 123 554 624 HOH HOH A . 
C 2 HOH 124 555 625 HOH HOH A . 
C 2 HOH 125 556 626 HOH HOH A . 
C 2 HOH 126 557 627 HOH HOH A . 
C 2 HOH 127 558 628 HOH HOH A . 
C 2 HOH 128 559 629 HOH HOH A . 
C 2 HOH 129 560 630 HOH HOH A . 
C 2 HOH 130 561 631 HOH HOH A . 
C 2 HOH 131 562 632 HOH HOH A . 
C 2 HOH 132 563 633 HOH HOH A . 
C 2 HOH 133 564 634 HOH HOH A . 
C 2 HOH 134 565 635 HOH HOH A . 
C 2 HOH 135 566 636 HOH HOH A . 
C 2 HOH 136 567 637 HOH HOH A . 
C 2 HOH 137 568 638 HOH HOH A . 
C 2 HOH 138 569 639 HOH HOH A . 
C 2 HOH 139 570 640 HOH HOH A . 
C 2 HOH 140 571 641 HOH HOH A . 
C 2 HOH 141 572 642 HOH HOH A . 
C 2 HOH 142 573 643 HOH HOH A . 
C 2 HOH 143 574 644 HOH HOH A . 
C 2 HOH 144 575 645 HOH HOH A . 
C 2 HOH 145 576 646 HOH HOH A . 
C 2 HOH 146 577 647 HOH HOH A . 
C 2 HOH 147 578 648 HOH HOH A . 
C 2 HOH 148 579 649 HOH HOH A . 
C 2 HOH 149 580 650 HOH HOH A . 
C 2 HOH 150 581 651 HOH HOH A . 
C 2 HOH 151 582 652 HOH HOH A . 
C 2 HOH 152 583 653 HOH HOH A . 
C 2 HOH 153 584 654 HOH HOH A . 
C 2 HOH 154 585 655 HOH HOH A . 
C 2 HOH 155 586 656 HOH HOH A . 
C 2 HOH 156 587 657 HOH HOH A . 
C 2 HOH 157 588 658 HOH HOH A . 
C 2 HOH 158 589 659 HOH HOH A . 
C 2 HOH 159 590 660 HOH HOH A . 
C 2 HOH 160 591 661 HOH HOH A . 
C 2 HOH 161 592 663 HOH HOH A . 
C 2 HOH 162 593 664 HOH HOH A . 
C 2 HOH 163 594 665 HOH HOH A . 
C 2 HOH 164 595 666 HOH HOH A . 
C 2 HOH 165 596 667 HOH HOH A . 
C 2 HOH 166 597 668 HOH HOH A . 
C 2 HOH 167 598 669 HOH HOH A . 
C 2 HOH 168 599 670 HOH HOH A . 
C 2 HOH 169 600 671 HOH HOH A . 
C 2 HOH 170 601 672 HOH HOH A . 
C 2 HOH 171 602 673 HOH HOH A . 
C 2 HOH 172 603 674 HOH HOH A . 
C 2 HOH 173 604 675 HOH HOH A . 
C 2 HOH 174 605 676 HOH HOH A . 
C 2 HOH 175 606 677 HOH HOH A . 
C 2 HOH 176 607 678 HOH HOH A . 
C 2 HOH 177 608 679 HOH HOH A . 
C 2 HOH 178 609 680 HOH HOH A . 
C 2 HOH 179 610 681 HOH HOH A . 
C 2 HOH 180 611 682 HOH HOH A . 
C 2 HOH 181 612 683 HOH HOH A . 
C 2 HOH 182 613 684 HOH HOH A . 
C 2 HOH 183 614 685 HOH HOH A . 
C 2 HOH 184 615 686 HOH HOH A . 
C 2 HOH 185 616 687 HOH HOH A . 
C 2 HOH 186 617 688 HOH HOH A . 
C 2 HOH 187 618 689 HOH HOH A . 
C 2 HOH 188 619 690 HOH HOH A . 
C 2 HOH 189 620 691 HOH HOH A . 
C 2 HOH 190 621 692 HOH HOH A . 
C 2 HOH 191 622 693 HOH HOH A . 
C 2 HOH 192 623 694 HOH HOH A . 
C 2 HOH 193 624 695 HOH HOH A . 
C 2 HOH 194 625 696 HOH HOH A . 
C 2 HOH 195 626 697 HOH HOH A . 
C 2 HOH 196 627 698 HOH HOH A . 
C 2 HOH 197 628 699 HOH HOH A . 
C 2 HOH 198 629 700 HOH HOH A . 
C 2 HOH 199 630 701 HOH HOH A . 
C 2 HOH 200 631 702 HOH HOH A . 
C 2 HOH 201 632 703 HOH HOH A . 
C 2 HOH 202 633 704 HOH HOH A . 
C 2 HOH 203 634 705 HOH HOH A . 
C 2 HOH 204 635 706 HOH HOH A . 
C 2 HOH 205 636 707 HOH HOH A . 
C 2 HOH 206 637 708 HOH HOH A . 
C 2 HOH 207 638 709 HOH HOH A . 
C 2 HOH 208 639 710 HOH HOH A . 
C 2 HOH 209 640 711 HOH HOH A . 
C 2 HOH 210 641 712 HOH HOH A . 
C 2 HOH 211 642 713 HOH HOH A . 
C 2 HOH 212 643 714 HOH HOH A . 
C 2 HOH 213 644 715 HOH HOH A . 
C 2 HOH 214 645 716 HOH HOH A . 
C 2 HOH 215 646 572 HOH HOH A . 
C 2 HOH 216 647 579 HOH HOH A . 
C 2 HOH 217 648 635 HOH HOH A . 
C 2 HOH 218 649 641 HOH HOH A . 
C 2 HOH 219 650 656 HOH HOH A . 
C 2 HOH 220 651 688 HOH HOH A . 
C 2 HOH 221 652 710 HOH HOH A . 
C 2 HOH 222 653 712 HOH HOH A . 
C 2 HOH 223 654 713 HOH HOH A . 
D 2 HOH 1   432 514 HOH HOH B . 
D 2 HOH 2   433 598 HOH HOH B . 
D 2 HOH 3   434 662 HOH HOH B . 
D 2 HOH 4   435 500 HOH HOH B . 
D 2 HOH 5   436 501 HOH HOH B . 
D 2 HOH 6   437 502 HOH HOH B . 
D 2 HOH 7   438 503 HOH HOH B . 
D 2 HOH 8   439 504 HOH HOH B . 
D 2 HOH 9   440 505 HOH HOH B . 
D 2 HOH 10  441 506 HOH HOH B . 
D 2 HOH 11  442 507 HOH HOH B . 
D 2 HOH 12  443 508 HOH HOH B . 
D 2 HOH 13  444 509 HOH HOH B . 
D 2 HOH 14  445 510 HOH HOH B . 
D 2 HOH 15  446 511 HOH HOH B . 
D 2 HOH 16  447 512 HOH HOH B . 
D 2 HOH 17  448 513 HOH HOH B . 
D 2 HOH 18  449 514 HOH HOH B . 
D 2 HOH 19  450 516 HOH HOH B . 
D 2 HOH 20  451 517 HOH HOH B . 
D 2 HOH 21  452 518 HOH HOH B . 
D 2 HOH 22  453 519 HOH HOH B . 
D 2 HOH 23  454 520 HOH HOH B . 
D 2 HOH 24  455 521 HOH HOH B . 
D 2 HOH 25  456 522 HOH HOH B . 
D 2 HOH 26  457 523 HOH HOH B . 
D 2 HOH 27  458 524 HOH HOH B . 
D 2 HOH 28  459 525 HOH HOH B . 
D 2 HOH 29  460 526 HOH HOH B . 
D 2 HOH 30  461 527 HOH HOH B . 
D 2 HOH 31  462 528 HOH HOH B . 
D 2 HOH 32  463 529 HOH HOH B . 
D 2 HOH 33  464 530 HOH HOH B . 
D 2 HOH 34  465 531 HOH HOH B . 
D 2 HOH 35  466 532 HOH HOH B . 
D 2 HOH 36  467 533 HOH HOH B . 
D 2 HOH 37  468 534 HOH HOH B . 
D 2 HOH 38  469 535 HOH HOH B . 
D 2 HOH 39  470 536 HOH HOH B . 
D 2 HOH 40  471 537 HOH HOH B . 
D 2 HOH 41  472 538 HOH HOH B . 
D 2 HOH 42  473 539 HOH HOH B . 
D 2 HOH 43  474 540 HOH HOH B . 
D 2 HOH 44  475 541 HOH HOH B . 
D 2 HOH 45  476 542 HOH HOH B . 
D 2 HOH 46  477 543 HOH HOH B . 
D 2 HOH 47  478 544 HOH HOH B . 
D 2 HOH 48  479 545 HOH HOH B . 
D 2 HOH 49  480 546 HOH HOH B . 
D 2 HOH 50  481 547 HOH HOH B . 
D 2 HOH 51  482 548 HOH HOH B . 
D 2 HOH 52  483 549 HOH HOH B . 
D 2 HOH 53  484 550 HOH HOH B . 
D 2 HOH 54  485 551 HOH HOH B . 
D 2 HOH 55  486 552 HOH HOH B . 
D 2 HOH 56  487 553 HOH HOH B . 
D 2 HOH 57  488 554 HOH HOH B . 
D 2 HOH 58  489 555 HOH HOH B . 
D 2 HOH 59  490 556 HOH HOH B . 
D 2 HOH 60  491 557 HOH HOH B . 
D 2 HOH 61  492 558 HOH HOH B . 
D 2 HOH 62  493 559 HOH HOH B . 
D 2 HOH 63  494 560 HOH HOH B . 
D 2 HOH 64  495 561 HOH HOH B . 
D 2 HOH 65  496 562 HOH HOH B . 
D 2 HOH 66  497 563 HOH HOH B . 
D 2 HOH 67  498 564 HOH HOH B . 
D 2 HOH 68  499 565 HOH HOH B . 
D 2 HOH 69  500 566 HOH HOH B . 
D 2 HOH 70  501 567 HOH HOH B . 
D 2 HOH 71  502 568 HOH HOH B . 
D 2 HOH 72  503 569 HOH HOH B . 
D 2 HOH 73  504 570 HOH HOH B . 
D 2 HOH 74  505 571 HOH HOH B . 
D 2 HOH 75  506 573 HOH HOH B . 
D 2 HOH 76  507 574 HOH HOH B . 
D 2 HOH 77  508 575 HOH HOH B . 
D 2 HOH 78  509 576 HOH HOH B . 
D 2 HOH 79  510 577 HOH HOH B . 
D 2 HOH 80  511 578 HOH HOH B . 
D 2 HOH 81  512 580 HOH HOH B . 
D 2 HOH 82  513 581 HOH HOH B . 
D 2 HOH 83  514 582 HOH HOH B . 
D 2 HOH 84  515 583 HOH HOH B . 
D 2 HOH 85  516 584 HOH HOH B . 
D 2 HOH 86  517 585 HOH HOH B . 
D 2 HOH 87  518 586 HOH HOH B . 
D 2 HOH 88  519 587 HOH HOH B . 
D 2 HOH 89  520 588 HOH HOH B . 
D 2 HOH 90  521 589 HOH HOH B . 
D 2 HOH 91  522 590 HOH HOH B . 
D 2 HOH 92  523 591 HOH HOH B . 
D 2 HOH 93  524 592 HOH HOH B . 
D 2 HOH 94  525 593 HOH HOH B . 
D 2 HOH 95  526 594 HOH HOH B . 
D 2 HOH 96  527 595 HOH HOH B . 
D 2 HOH 97  528 596 HOH HOH B . 
D 2 HOH 98  529 597 HOH HOH B . 
D 2 HOH 99  530 598 HOH HOH B . 
D 2 HOH 100 531 599 HOH HOH B . 
D 2 HOH 101 532 600 HOH HOH B . 
D 2 HOH 102 533 601 HOH HOH B . 
D 2 HOH 103 534 602 HOH HOH B . 
D 2 HOH 104 535 603 HOH HOH B . 
D 2 HOH 105 536 604 HOH HOH B . 
D 2 HOH 106 537 605 HOH HOH B . 
D 2 HOH 107 538 606 HOH HOH B . 
D 2 HOH 108 539 607 HOH HOH B . 
D 2 HOH 109 540 608 HOH HOH B . 
D 2 HOH 110 541 609 HOH HOH B . 
D 2 HOH 111 542 610 HOH HOH B . 
D 2 HOH 112 543 611 HOH HOH B . 
D 2 HOH 113 544 612 HOH HOH B . 
D 2 HOH 114 545 613 HOH HOH B . 
D 2 HOH 115 546 614 HOH HOH B . 
D 2 HOH 116 547 615 HOH HOH B . 
D 2 HOH 117 548 616 HOH HOH B . 
D 2 HOH 118 549 617 HOH HOH B . 
D 2 HOH 119 550 618 HOH HOH B . 
D 2 HOH 120 551 619 HOH HOH B . 
D 2 HOH 121 552 620 HOH HOH B . 
D 2 HOH 122 553 621 HOH HOH B . 
D 2 HOH 123 554 622 HOH HOH B . 
D 2 HOH 124 555 623 HOH HOH B . 
D 2 HOH 125 556 624 HOH HOH B . 
D 2 HOH 126 557 625 HOH HOH B . 
D 2 HOH 127 558 626 HOH HOH B . 
D 2 HOH 128 559 627 HOH HOH B . 
D 2 HOH 129 560 628 HOH HOH B . 
D 2 HOH 130 561 629 HOH HOH B . 
D 2 HOH 131 562 630 HOH HOH B . 
D 2 HOH 132 563 631 HOH HOH B . 
D 2 HOH 133 564 632 HOH HOH B . 
D 2 HOH 134 565 633 HOH HOH B . 
D 2 HOH 135 566 634 HOH HOH B . 
D 2 HOH 136 567 636 HOH HOH B . 
D 2 HOH 137 568 637 HOH HOH B . 
D 2 HOH 138 569 638 HOH HOH B . 
D 2 HOH 139 570 639 HOH HOH B . 
D 2 HOH 140 571 640 HOH HOH B . 
D 2 HOH 141 572 642 HOH HOH B . 
D 2 HOH 142 573 643 HOH HOH B . 
D 2 HOH 143 574 644 HOH HOH B . 
D 2 HOH 144 575 645 HOH HOH B . 
D 2 HOH 145 576 646 HOH HOH B . 
D 2 HOH 146 577 647 HOH HOH B . 
D 2 HOH 147 578 648 HOH HOH B . 
D 2 HOH 148 579 649 HOH HOH B . 
D 2 HOH 149 580 650 HOH HOH B . 
D 2 HOH 150 581 651 HOH HOH B . 
D 2 HOH 151 582 652 HOH HOH B . 
D 2 HOH 152 583 653 HOH HOH B . 
D 2 HOH 153 584 654 HOH HOH B . 
D 2 HOH 154 585 655 HOH HOH B . 
D 2 HOH 155 586 657 HOH HOH B . 
D 2 HOH 156 587 658 HOH HOH B . 
D 2 HOH 157 588 659 HOH HOH B . 
D 2 HOH 158 589 660 HOH HOH B . 
D 2 HOH 159 590 661 HOH HOH B . 
D 2 HOH 160 591 662 HOH HOH B . 
D 2 HOH 161 592 663 HOH HOH B . 
D 2 HOH 162 593 664 HOH HOH B . 
D 2 HOH 163 594 665 HOH HOH B . 
D 2 HOH 164 595 666 HOH HOH B . 
D 2 HOH 165 596 667 HOH HOH B . 
D 2 HOH 166 597 668 HOH HOH B . 
D 2 HOH 167 598 669 HOH HOH B . 
D 2 HOH 168 599 670 HOH HOH B . 
D 2 HOH 169 600 671 HOH HOH B . 
D 2 HOH 170 601 672 HOH HOH B . 
D 2 HOH 171 602 673 HOH HOH B . 
D 2 HOH 172 603 674 HOH HOH B . 
D 2 HOH 173 604 675 HOH HOH B . 
D 2 HOH 174 605 676 HOH HOH B . 
D 2 HOH 175 606 677 HOH HOH B . 
D 2 HOH 176 607 678 HOH HOH B . 
D 2 HOH 177 608 679 HOH HOH B . 
D 2 HOH 178 609 680 HOH HOH B . 
D 2 HOH 179 610 681 HOH HOH B . 
D 2 HOH 180 611 682 HOH HOH B . 
D 2 HOH 181 612 683 HOH HOH B . 
D 2 HOH 182 613 684 HOH HOH B . 
D 2 HOH 183 614 685 HOH HOH B . 
D 2 HOH 184 615 686 HOH HOH B . 
D 2 HOH 185 616 687 HOH HOH B . 
D 2 HOH 186 617 689 HOH HOH B . 
D 2 HOH 187 618 690 HOH HOH B . 
D 2 HOH 188 619 691 HOH HOH B . 
D 2 HOH 189 620 692 HOH HOH B . 
D 2 HOH 190 621 693 HOH HOH B . 
D 2 HOH 191 622 694 HOH HOH B . 
D 2 HOH 192 623 695 HOH HOH B . 
D 2 HOH 193 624 696 HOH HOH B . 
D 2 HOH 194 625 697 HOH HOH B . 
D 2 HOH 195 626 698 HOH HOH B . 
D 2 HOH 196 627 699 HOH HOH B . 
D 2 HOH 197 628 700 HOH HOH B . 
D 2 HOH 198 629 701 HOH HOH B . 
D 2 HOH 199 630 702 HOH HOH B . 
D 2 HOH 200 631 703 HOH HOH B . 
D 2 HOH 201 632 704 HOH HOH B . 
D 2 HOH 202 633 705 HOH HOH B . 
D 2 HOH 203 634 706 HOH HOH B . 
D 2 HOH 204 635 707 HOH HOH B . 
D 2 HOH 205 636 708 HOH HOH B . 
D 2 HOH 206 637 709 HOH HOH B . 
D 2 HOH 207 638 711 HOH HOH B . 
D 2 HOH 208 639 714 HOH HOH B . 
D 2 HOH 209 640 715 HOH HOH B . 
D 2 HOH 210 641 716 HOH HOH B . 
D 2 HOH 211 642 717 HOH HOH B . 
D 2 HOH 212 643 718 HOH HOH B . 
D 2 HOH 213 644 719 HOH HOH B . 
D 2 HOH 214 645 720 HOH HOH B . 
D 2 HOH 215 646 721 HOH HOH B . 
D 2 HOH 216 647 722 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5530  ? 
1 MORE         -15   ? 
1 'SSA (A^2)'  32950 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-06-10 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
5 'Structure model' 1 4 2018-03-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
5 5 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status 
2 4 'Structure model' struct_conf          
3 4 'Structure model' struct_conf_type     
4 5 'Structure model' diffrn_detector      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.process_site'    
2 5 'Structure model' '_diffrn_detector.pdbx_collection_date' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR refinement       . ? 1 
XENGEN 'data reduction' . ? 2 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 H3   A GLY 1   ? ? OXT  A ALA 431 ? ? 1.29 
2  1 O    B VAL 20  ? ? HG1  B THR 24  ? ? 1.30 
3  1 O    A VAL 248 ? ? HG   A SER 252 ? ? 1.33 
4  1 OD1  A ASP 336 ? ? HE1  A TRP 378 ? ? 1.34 
5  1 O    A VAL 20  ? ? HG1  A THR 24  ? ? 1.34 
6  1 H2   B GLY 1   ? ? O    B ALA 431 ? ? 1.36 
7  1 OD2  A ASP 418 ? ? HG1  A THR 420 ? ? 1.38 
8  1 O    A ASP 21  ? ? HH12 A ARG 61  ? ? 1.39 
9  1 HG1  B THR 312 ? ? O    B CYS 344 ? ? 1.40 
10 1 O    B ILE 59  ? ? HH21 B ARG 96  ? ? 1.42 
11 1 HG1  A THR 312 ? ? O    A CYS 344 ? ? 1.46 
12 1 HH22 A ARG 317 ? ? OD2  B ASP 203 ? ? 1.46 
13 1 O    A ASP 333 ? ? H    A ASP 336 ? ? 1.46 
14 1 HZ2  B LYS 386 ? ? OG1  B THR 420 ? ? 1.47 
15 1 O    A ASN 174 ? ? HZ3  A LYS 177 ? ? 1.47 
16 1 O    B VAL 248 ? ? HG   B SER 252 ? ? 1.47 
17 1 O    A MET 349 ? ? H    A ASP 351 ? ? 1.47 
18 1 OD2  A ASP 114 ? ? H    A GLY 132 ? ? 1.48 
19 1 H    A ALA 361 ? ? OE2  B GLU 101 ? ? 1.48 
20 1 O    A VAL 4   ? ? H    A PHE 220 ? ? 1.49 
21 1 OD2  B ASP 418 ? ? HG1  B THR 420 ? ? 1.52 
22 1 H    A ILE 45  ? ? O    A GLU 48  ? ? 1.52 
23 1 HH11 B ARG 316 ? ? O    B LEU 405 ? ? 1.53 
24 1 O    A GLY 8   ? ? HG1  A THR 226 ? ? 1.53 
25 1 H1   B HOH 538 ? ? O    B HOH 590 ? ? 1.54 
26 1 OD2  B ASP 153 ? ? HG1  B THR 156 ? ? 1.54 
27 1 O    B VAL 385 ? ? HG1  B THR 415 ? ? 1.54 
28 1 O    B GLY 276 ? ? HH22 B ARG 306 ? ? 1.54 
29 1 H    A ARG 348 ? ? O    A GLU 369 ? ? 1.54 
30 1 OE1  A GLN 171 ? ? HH   B TYR 167 ? ? 1.55 
31 1 O    B LEU 332 ? ? H    B LEU 335 ? ? 1.55 
32 1 O    B LYS 185 ? B H    B ASP 189 ? ? 1.55 
33 1 O    B HOH 630 ? ? H1   B HOH 644 ? ? 1.55 
34 1 O    A ALA 120 ? ? H    A GLY 122 ? ? 1.55 
35 1 H    B ILE 55  ? ? OE1  B GLU 82  ? ? 1.56 
36 1 OD1  A ASP 229 ? ? H    A HIS 232 ? ? 1.56 
37 1 O    B HOH 447 ? ? H2   B HOH 634 ? ? 1.56 
38 1 HZ1  B LYS 339 ? ? OE2  B GLU 340 ? ? 1.56 
39 1 O    A GLU 403 ? ? H    A GLY 407 ? ? 1.56 
40 1 OD2  B ASP 311 ? ? HH   B TYR 347 ? ? 1.57 
41 1 H2   A HOH 519 ? ? O    A HOH 528 ? ? 1.57 
42 1 OE1  B GLU 101 ? ? HH22 B ARG 147 ? ? 1.57 
43 1 O    A ASN 115 ? ? H    A LYS 119 ? ? 1.58 
44 1 OD2  A ASP 203 ? ? HH22 B ARG 317 ? ? 1.59 
45 1 O    B LYS 185 ? A H    B ASP 189 ? ? 1.59 
46 1 OD1  B ASP 336 ? ? HE1  B TRP 378 ? ? 1.59 
47 1 HH12 B ARG 117 ? ? OE2  B GLU 138 ? ? 1.59 
48 1 OD2  A ASP 387 ? ? H    A GLY 390 ? ? 1.59 
49 1 OD1  B ASP 139 ? ? HE   B ARG 144 ? ? 1.59 
50 1 HZ3  A LYS 162 ? ? O    A HOH 537 ? ? 1.59 
51 1 O    A SER 323 ? ? HH11 B ARG 257 ? ? 1.60 
52 1 HH22 A ARG 32  ? ? O    A GLY 36  ? ? 1.60 
53 1 HH   B TYR 261 ? ? OD2  B ASP 411 ? ? 1.60 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    HH21 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     348 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OD2 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    ASP 
_pdbx_validate_symm_contact.auth_seq_id_2     430 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_555 
_pdbx_validate_symm_contact.dist              1.53 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C  A GLU 369 ? ? N  A PRO 370 ? ? CA  A PRO 370 ? ? 129.95 119.30 10.65 1.50 Y 
2 1 CA A LEU 391 ? ? CB A LEU 391 ? ? CG  A LEU 391 ? ? 129.32 115.30 14.02 2.30 N 
3 1 NE B ARG 96  ? ? CZ B ARG 96  ? ? NH1 B ARG 96  ? ? 123.97 120.30 3.67  0.50 N 
4 1 CA B LEU 310 ? ? CB B LEU 310 ? ? CG  B LEU 310 ? ? 130.04 115.30 14.74 2.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 10  ? ? -117.98 -115.83 
2  1 THR A 24  ? ? -68.46  20.13   
3  1 HIS A 37  ? ? -100.02 66.40   
4  1 ASN A 38  ? ? -159.64 58.76   
5  1 LEU A 54  ? ? -124.95 -54.58  
6  1 ASN A 63  ? ? -87.15  33.09   
7  1 ARG A 89  ? ? -83.52  30.44   
8  1 GLU A 118 ? ? -98.51  -70.62  
9  1 ALA A 120 ? ? -68.83  -75.89  
10 1 ARG A 121 ? ? -71.57  46.29   
11 1 ALA A 123 ? ? 179.11  -42.50  
12 1 ILE A 126 ? ? -136.57 -47.43  
13 1 THR A 128 ? ? -170.88 -82.71  
14 1 THR A 129 ? ? -140.20 -2.25   
15 1 ARG A 131 ? ? 50.91   89.36   
16 1 ARG A 143 ? ? 74.41   42.13   
17 1 LYS A 177 ? ? 62.13   69.35   
18 1 ASP A 216 ? ? -47.08  153.01  
19 1 ALA A 268 ? ? -47.34  -10.42  
20 1 PHE A 278 ? ? -168.87 70.07   
21 1 ASP A 284 ? A -122.57 -157.13 
22 1 ASP A 284 ? B -124.13 -154.01 
23 1 GLU A 296 ? ? -94.06  42.48   
24 1 ALA A 299 ? ? 51.63   79.79   
25 1 THR A 301 ? ? -59.03  -173.78 
26 1 ARG A 304 ? ? 46.17   99.99   
27 1 ALA A 346 ? ? 178.69  160.82  
28 1 PRO A 350 ? ? -65.08  51.16   
29 1 ASP A 351 ? ? -161.34 5.53    
30 1 ALA A 362 ? ? -108.56 45.61   
31 1 ALA A 362 ? ? -108.56 43.15   
32 1 ASP A 363 ? A -105.02 -61.00  
33 1 ASP A 364 ? ? 168.01  83.44   
34 1 ASP A 364 ? ? 156.43  83.44   
35 1 VAL A 368 ? ? -33.58  132.65  
36 1 THR A 382 ? ? -154.21 -25.52  
37 1 PHE A 383 ? ? -57.37  93.82   
38 1 ASP A 387 ? ? 178.91  146.47  
39 1 ASP A 427 ? ? 55.61   102.92  
40 1 GLN B 10  ? ? -127.53 -117.54 
41 1 ASN B 38  ? ? -151.91 33.99   
42 1 LEU B 54  ? ? -133.87 -47.39  
43 1 PRO B 92  ? ? -61.45  71.43   
44 1 THR B 129 ? ? -112.57 -85.13  
45 1 ARG B 131 ? ? 34.21   113.66  
46 1 ASP B 150 ? ? -48.23  -14.78  
47 1 THR B 234 ? ? -69.49  76.28   
48 1 THR B 244 ? ? -67.55  -175.99 
49 1 SER B 252 ? ? -135.54 -43.08  
50 1 PHE B 278 ? ? 177.01  71.45   
51 1 THR B 301 ? ? -155.09 -20.91  
52 1 ARG B 303 ? ? -46.22  162.42  
53 1 ASP B 333 ? ? -50.23  -5.83   
54 1 ALA B 346 ? ? 174.31  166.25  
55 1 LEU B 360 ? ? -93.49  -61.10  
56 1 TRP B 365 ? ? -64.20  3.60    
57 1 ARG B 426 ? ? -135.40 -45.88  
58 1 ASP B 427 ? ? 76.72   99.68   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 235 ? ? 0.069 'SIDE CHAIN' 
2 1 TYR B 372 ? ? 0.062 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#