data_1ADN
# 
_entry.id   1ADN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ADN         
WWPDB D_1000170689 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ADN 
_pdbx_database_status.recvd_initial_deposition_date   1993-09-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Myers, L.C.'   1 
'Verdine, G.L.' 2 
'Wagner, G.'    3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solution structure of the DNA methyl phosphotriester repair domain of Escherichia coli Ada.' Biochemistry 32  14089 14094 
1993 BICHAW US 0006-2960 0033 ? 8260490 10.1021/bi00214a003 
1       'Repair of DNA Methylphosphotriesters Through a Metalloactivated Cysteine Nucleophile'        Science      261 1164  ?     
1993 SCIEAS US 0036-8075 0038 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Myers, L.C.'     1 
primary 'Verdine, G.L.'   2 
primary 'Wagner, G.'      3 
1       'Myers, L.C.'     4 
1       'Terranova, M.P.' 5 
1       'Ferentz, A.E.'   6 
1       'Wagner, G.'      7 
1       'Verdine, G.L.'   8 
# 
_cell.entry_id           1ADN 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ADN 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'N-ADA 10' 10469.978 1 ? ? ? ? 
2 non-polymer syn 'ZINC ION' 65.409    1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPR
QHRLDKITHACR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPR
QHRLDKITHACR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LYS n 
1 3  LYS n 
1 4  ALA n 
1 5  THR n 
1 6  CYS n 
1 7  LEU n 
1 8  THR n 
1 9  ASP n 
1 10 ASP n 
1 11 GLN n 
1 12 ARG n 
1 13 TRP n 
1 14 GLN n 
1 15 SER n 
1 16 VAL n 
1 17 LEU n 
1 18 ALA n 
1 19 ARG n 
1 20 ASP n 
1 21 PRO n 
1 22 ASN n 
1 23 ALA n 
1 24 ASP n 
1 25 GLY n 
1 26 GLU n 
1 27 PHE n 
1 28 VAL n 
1 29 PHE n 
1 30 ALA n 
1 31 VAL n 
1 32 ARG n 
1 33 THR n 
1 34 THR n 
1 35 GLY n 
1 36 ILE n 
1 37 PHE n 
1 38 CYS n 
1 39 ARG n 
1 40 PRO n 
1 41 SER n 
1 42 CYS n 
1 43 ARG n 
1 44 ALA n 
1 45 ARG n 
1 46 HIS n 
1 47 ALA n 
1 48 LEU n 
1 49 ARG n 
1 50 GLU n 
1 51 ASN n 
1 52 VAL n 
1 53 SER n 
1 54 PHE n 
1 55 TYR n 
1 56 ALA n 
1 57 ASN n 
1 58 ALA n 
1 59 SER n 
1 60 GLU n 
1 61 ALA n 
1 62 LEU n 
1 63 ALA n 
1 64 ALA n 
1 65 GLY n 
1 66 PHE n 
1 67 ARG n 
1 68 PRO n 
1 69 CYS n 
1 70 LYS n 
1 71 ARG n 
1 72 CYS n 
1 73 GLN n 
1 74 PRO n 
1 75 ASP n 
1 76 LYS n 
1 77 ALA n 
1 78 ASN n 
1 79 PRO n 
1 80 ARG n 
1 81 GLN n 
1 82 HIS n 
1 83 ARG n 
1 84 LEU n 
1 85 ASP n 
1 86 LYS n 
1 87 ILE n 
1 88 THR n 
1 89 HIS n 
1 90 ALA n 
1 91 CYS n 
1 92 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADA_ECOLI 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P06134 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRENVSFYANASEALAAGFRPCKRCQPDKANPR
QHRLDKITHACRLLEQETPVTLEALADQVAMSPFHLHRLFKATTGMTPKAWQQAWRARRLRESLAKGESVTTSILNAGFP
DSSSYYRKADETLGMTAKQFRHGGENLAVRYALADCELGRCLVAESERGICAILLGDDDATLISELQQMFPAADNAPADL
MFQQHVREVIASLNQRDTPLTLPLDIRGTAFQQQVWQALRTIPCGETVSYQQLANAIGKPKAVRAVASACAANKLAIVIP
CHRVVRGDGSLSGYRWGVSRKAQLLRREAENEER
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ADN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 92 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06134 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  92 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       92 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_pdbx_nmr_refine.entry_id           1ADN 
_pdbx_nmr_refine.method             ? 
_pdbx_nmr_refine.details            
;DATA WERE COLLECTED AT PH 6.4 AND AT 25 DEGREES CELSIUS. RESTRAINTS USED FOR THE STRUCTURE CALCULATIONS INCLUDED 547 NOE RESTRAINTS CONSISTING OF 108 INTRA-RESIDUE, 175 SEQUENTIAL, 91 MEDIUM (1<|I-J|<6) AND 173 LONG RANGE NOES.  ADDITIONALLY, 50 HYDROGEN BONDING DISTANCES AS WELL AS DIHEDRAL ANGLE RESTRAINTS FOR 69 PHI ANGLES AND 8 CHI-1 ANGLES WERE INCLUDED.  STEREOSPECIFIC ASSIGNMENTS HAVE BEEN MADE FOR THE METHYLENE PROTONS OF ASN 22, CYS 42, ASN 51, SER 53, PHE 54 AND TYR 55.  STEREOSPECIFIC ASSIGNMENTS HAVE ALSO BEEN MADE FOR THE METHYL GROUPS OF VAL 16, LEU 17, VAL 28, LEU 48, VAL 52, LEU 62, AND LEU 84. THIS STUDY AND REFERENCE 1 ABOVE SHOW THAT CYS 38, CYS 42, CYS 69, AND CYS 72 ARE THE LIGANDS FOR A TIGHTLY BOUND ZINC ION.  A 2.3 ANGSTROM THIOL - ZINC DISTANCE RESTRAINT WAS IMPOSED ON THE FOUR CYSTEINE METAL LIGANDS. ADDITIONAL DISTANCE AND DIHEDRAL RESTRAINTS WERE APPLIED TO ENFORCE A TETRAHEDRAL METAL LIGATION AND TO MAINTAIN PROPER SP3 HYBRIDIZATION GEOMETRIES OF THE COORDINATED SULFUR ATOMS.  A DIHEDRAL ANGLE RESTRAINT MAINTAINS AN S TYPE LIGAND CONFIGURATION.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1ADN 
_pdbx_nmr_ensemble.conformers_calculated_total_number            ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number             14 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             DGII 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          HAVEL 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1ADN 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1ADN 
_struct.title                     'SOLUTION STRUCTURE OF THE DNA METHYLPHOSPHOTRIESTER REPAIR DOMAIN OF ESCHERICHIA COLI ADA' 
_struct.pdbx_descriptor           'N-ADA 10 (DNA METHYLPHOSPHOTRIESTER REPAIR DOMAIN, RESIDUES 1 - 92) (NMR, 14 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ADN 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 THR A 8  ? ALA A 18 ? THR A 8  ALA A 18 1 ? 11 
HELX_P HELX_P2 H2 ASP A 24 ? PHE A 27 ? ASP A 24 PHE A 27 5 ? 4  
HELX_P HELX_P3 H3 ALA A 58 ? ALA A 64 ? ALA A 58 ALA A 64 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 42 SG ? ? A ZN 93 A CYS 42 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 69 SG ? ? A ZN 93 A CYS 69 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 72 SG ? ? A ZN 93 A CYS 72 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 38 SG ? ? A ZN 93 A CYS 38 1_555 ? ? ? ? ? ? ? 2.269 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               S1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
S1 1 2 ? parallel      
S1 2 3 ? parallel      
S1 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
S1 1 VAL A 52 ? TYR A 55 ? VAL A 52 TYR A 55 
S1 2 PHE A 27 ? ARG A 32 ? PHE A 27 ARG A 32 
S1 3 ILE A 36 ? ARG A 39 ? ILE A 36 ARG A 39 
S1 4 ARG A 67 ? CYS A 69 ? ARG A 67 CYS A 69 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
S1 1 2 N TYR A 55 ? N TYR A 55 O VAL A 28 ? O VAL A 28 
S1 2 3 O PHE A 29 ? O PHE A 29 N CYS A 38 ? N CYS A 38 
S1 3 4 O PHE A 37 ? O PHE A 37 N CYS A 69 ? N CYS A 69 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 93' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 
2 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 
3 AC1 4 CYS A 69 ? CYS A 69 . ? 1_555 ? 
4 AC1 4 CYS A 72 ? CYS A 72 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ADN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ADN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . MET A 1 1  ? 21.652  19.838  -17.715 1.00 0.00 ? 1  MET A N   1  
ATOM   2     C  CA  . MET A 1 1  ? 22.686  18.820  -17.876 1.00 0.00 ? 1  MET A CA  1  
ATOM   3     C  C   . MET A 1 1  ? 22.131  17.589  -18.554 1.00 0.00 ? 1  MET A C   1  
ATOM   4     O  O   . MET A 1 1  ? 22.197  17.435  -19.781 1.00 0.00 ? 1  MET A O   1  
ATOM   5     C  CB  . MET A 1 1  ? 23.296  18.464  -16.493 1.00 0.00 ? 1  MET A CB  1  
ATOM   6     C  CG  . MET A 1 1  ? 24.258  17.256  -16.472 1.00 0.00 ? 1  MET A CG  1  
ATOM   7     S  SD  . MET A 1 1  ? 24.781  16.922  -14.782 1.00 0.00 ? 1  MET A SD  1  
ATOM   8     C  CE  . MET A 1 1  ? 23.194  16.409  -14.110 1.00 0.00 ? 1  MET A CE  1  
ATOM   9     N  N   . LYS A 1 2  ? 21.513  16.577  -17.670 1.00 0.00 ? 2  LYS A N   1  
ATOM   10    C  CA  . LYS A 1 2  ? 20.870  15.377  -18.198 1.00 0.00 ? 2  LYS A CA  1  
ATOM   11    C  C   . LYS A 1 2  ? 19.368  15.463  -18.060 1.00 0.00 ? 2  LYS A C   1  
ATOM   12    O  O   . LYS A 1 2  ? 18.623  15.528  -19.047 1.00 0.00 ? 2  LYS A O   1  
ATOM   13    C  CB  . LYS A 1 2  ? 21.425  14.127  -17.462 1.00 0.00 ? 2  LYS A CB  1  
ATOM   14    C  CG  . LYS A 1 2  ? 22.622  13.465  -18.188 1.00 0.00 ? 2  LYS A CG  1  
ATOM   15    C  CD  . LYS A 1 2  ? 22.244  12.584  -19.382 1.00 0.00 ? 2  LYS A CD  1  
ATOM   16    C  CE  . LYS A 1 2  ? 23.421  11.659  -19.721 1.00 0.00 ? 2  LYS A CE  1  
ATOM   17    N  NZ  . LYS A 1 2  ? 23.214  10.347  -19.082 1.00 0.00 ? 2  LYS A NZ  1  
ATOM   18    N  N   . LYS A 1 3  ? 18.839  15.494  -16.678 1.00 0.00 ? 3  LYS A N   1  
ATOM   19    C  CA  . LYS A 1 3  ? 17.411  15.614  -16.400 1.00 0.00 ? 3  LYS A CA  1  
ATOM   20    C  C   . LYS A 1 3  ? 17.143  16.739  -15.428 1.00 0.00 ? 3  LYS A C   1  
ATOM   21    O  O   . LYS A 1 3  ? 17.834  16.905  -14.414 1.00 0.00 ? 3  LYS A O   1  
ATOM   22    C  CB  . LYS A 1 3  ? 16.876  14.264  -15.848 1.00 0.00 ? 3  LYS A CB  1  
ATOM   23    C  CG  . LYS A 1 3  ? 17.005  14.131  -14.310 1.00 0.00 ? 3  LYS A CG  1  
ATOM   24    C  CD  . LYS A 1 3  ? 18.434  13.933  -13.798 1.00 0.00 ? 3  LYS A CD  1  
ATOM   25    C  CE  . LYS A 1 3  ? 19.008  12.638  -14.388 1.00 0.00 ? 3  LYS A CE  1  
ATOM   26    N  NZ  . LYS A 1 3  ? 20.254  12.288  -13.683 1.00 0.00 ? 3  LYS A NZ  1  
ATOM   27    N  N   . ALA A 1 4  ? 15.993  17.616  -15.743 1.00 0.00 ? 4  ALA A N   1  
ATOM   28    C  CA  . ALA A 1 4  ? 15.636  18.753  -14.899 1.00 0.00 ? 4  ALA A CA  1  
ATOM   29    C  C   . ALA A 1 4  ? 15.329  18.305  -13.490 1.00 0.00 ? 4  ALA A C   1  
ATOM   30    O  O   . ALA A 1 4  ? 16.210  18.235  -12.622 1.00 0.00 ? 4  ALA A O   1  
ATOM   31    C  CB  . ALA A 1 4  ? 14.455  19.481  -15.564 1.00 0.00 ? 4  ALA A CB  1  
ATOM   32    N  N   . THR A 1 5  ? 13.917  17.973  -13.200 1.00 0.00 ? 5  THR A N   1  
ATOM   33    C  CA  . THR A 1 5  ? 13.507  17.372  -11.934 1.00 0.00 ? 5  THR A CA  1  
ATOM   34    C  C   . THR A 1 5  ? 13.058  15.944  -12.135 1.00 0.00 ? 5  THR A C   1  
ATOM   35    O  O   . THR A 1 5  ? 13.235  15.350  -13.208 1.00 0.00 ? 5  THR A O   1  
ATOM   36    C  CB  . THR A 1 5  ? 12.375  18.220  -11.263 1.00 0.00 ? 5  THR A CB  1  
ATOM   37    O  OG1 . THR A 1 5  ? 11.252  18.326  -12.129 1.00 0.00 ? 5  THR A OG1 1  
ATOM   38    C  CG2 . THR A 1 5  ? 12.731  19.681  -10.912 1.00 0.00 ? 5  THR A CG2 1  
ATOM   39    N  N   . CYS A 1 6  ? 12.430  15.282  -10.971 1.00 0.00 ? 6  CYS A N   1  
ATOM   40    C  CA  . CYS A 1 6  ? 11.851  13.945  -11.062 1.00 0.00 ? 6  CYS A CA  1  
ATOM   41    C  C   . CYS A 1 6  ? 11.087  13.774  -12.354 1.00 0.00 ? 6  CYS A C   1  
ATOM   42    O  O   . CYS A 1 6  ? 10.570  14.738  -12.937 1.00 0.00 ? 6  CYS A O   1  
ATOM   43    C  CB  . CYS A 1 6  ? 10.969  13.703  -9.821  1.00 0.00 ? 6  CYS A CB  1  
ATOM   44    S  SG  . CYS A 1 6  ? 11.987  13.331  -8.375  1.00 0.00 ? 6  CYS A SG  1  
ATOM   45    N  N   . LEU A 1 7  ? 10.957  12.392  -12.863 1.00 0.00 ? 7  LEU A N   1  
ATOM   46    C  CA  . LEU A 1 7  ? 10.393  12.103  -14.178 1.00 0.00 ? 7  LEU A CA  1  
ATOM   47    C  C   . LEU A 1 7  ? 8.890   12.246  -14.175 1.00 0.00 ? 7  LEU A C   1  
ATOM   48    O  O   . LEU A 1 7  ? 8.332   13.258  -14.626 1.00 0.00 ? 7  LEU A O   1  
ATOM   49    C  CB  . LEU A 1 7  ? 10.815  10.685  -14.658 1.00 0.00 ? 7  LEU A CB  1  
ATOM   50    C  CG  . LEU A 1 7  ? 11.097  10.482  -16.172 1.00 0.00 ? 7  LEU A CG  1  
ATOM   51    C  CD1 . LEU A 1 7  ? 9.781   10.251  -16.927 1.00 0.00 ? 7  LEU A CD1 1  
ATOM   52    C  CD2 . LEU A 1 7  ? 11.854  11.664  -16.799 1.00 0.00 ? 7  LEU A CD2 1  
ATOM   53    N  N   . THR A 1 8  ? 8.117   11.117  -13.612 1.00 0.00 ? 8  THR A N   1  
ATOM   54    C  CA  . THR A 1 8  ? 6.661   11.058  -13.706 1.00 0.00 ? 8  THR A CA  1  
ATOM   55    C  C   . THR A 1 8  ? 6.059   10.301  -12.546 1.00 0.00 ? 8  THR A C   1  
ATOM   56    O  O   . THR A 1 8  ? 6.706   9.464   -11.903 1.00 0.00 ? 8  THR A O   1  
ATOM   57    C  CB  . THR A 1 8  ? 6.225   10.416  -15.068 1.00 0.00 ? 8  THR A CB  1  
ATOM   58    O  OG1 . THR A 1 8  ? 7.078   9.328   -15.400 1.00 0.00 ? 8  THR A OG1 1  
ATOM   59    C  CG2 . THR A 1 8  ? 6.274   11.338  -16.305 1.00 0.00 ? 8  THR A CG2 1  
ATOM   60    N  N   . ASP A 1 9  ? 4.662   10.648  -12.197 1.00 0.00 ? 9  ASP A N   1  
ATOM   61    C  CA  . ASP A 1 9  ? 3.900   9.882   -11.216 1.00 0.00 ? 9  ASP A CA  1  
ATOM   62    C  C   . ASP A 1 9  ? 3.943   8.405   -11.537 1.00 0.00 ? 9  ASP A C   1  
ATOM   63    O  O   . ASP A 1 9  ? 3.681   7.546   -10.685 1.00 0.00 ? 9  ASP A O   1  
ATOM   64    C  CB  . ASP A 1 9  ? 2.444   10.409  -11.126 1.00 0.00 ? 9  ASP A CB  1  
ATOM   65    C  CG  . ASP A 1 9  ? 1.424   9.784   -12.089 1.00 0.00 ? 9  ASP A CG  1  
ATOM   66    O  OD1 . ASP A 1 9  ? 0.845   8.733   -11.856 1.00 0.00 ? 9  ASP A OD1 1  
ATOM   67    O  OD2 . ASP A 1 9  ? 1.258   10.513  -13.233 1.00 0.00 ? 9  ASP A OD2 1  
ATOM   68    N  N   . ASP A 1 10 ? 4.277   8.045   -12.933 1.00 0.00 ? 10 ASP A N   1  
ATOM   69    C  CA  . ASP A 1 10 ? 4.282   6.659   -13.391 1.00 0.00 ? 10 ASP A CA  1  
ATOM   70    C  C   . ASP A 1 10 ? 5.486   5.916   -12.862 1.00 0.00 ? 10 ASP A C   1  
ATOM   71    O  O   . ASP A 1 10 ? 5.389   4.759   -12.422 1.00 0.00 ? 10 ASP A O   1  
ATOM   72    C  CB  . ASP A 1 10 ? 4.185   6.596   -14.937 1.00 0.00 ? 10 ASP A CB  1  
ATOM   73    C  CG  . ASP A 1 10 ? 5.502   6.692   -15.721 1.00 0.00 ? 10 ASP A CG  1  
ATOM   74    O  OD1 . ASP A 1 10 ? 6.473   5.989   -15.483 1.00 0.00 ? 10 ASP A OD1 1  
ATOM   75    O  OD2 . ASP A 1 10 ? 5.456   7.624   -16.720 1.00 0.00 ? 10 ASP A OD2 1  
ATOM   76    N  N   . GLN A 1 11 ? 6.776   6.641   -12.855 1.00 0.00 ? 11 GLN A N   1  
ATOM   77    C  CA  . GLN A 1 11 ? 7.977   6.064   -12.253 1.00 0.00 ? 11 GLN A CA  1  
ATOM   78    C  C   . GLN A 1 11 ? 7.768   5.822   -10.775 1.00 0.00 ? 11 GLN A C   1  
ATOM   79    O  O   . GLN A 1 11 ? 8.030   4.740   -10.234 1.00 0.00 ? 11 GLN A O   1  
ATOM   80    C  CB  . GLN A 1 11 ? 9.162   7.022   -12.496 1.00 0.00 ? 11 GLN A CB  1  
ATOM   81    C  CG  . GLN A 1 11 ? 10.210  7.138   -11.339 1.00 0.00 ? 11 GLN A CG  1  
ATOM   82    C  CD  . GLN A 1 11 ? 11.705  7.115   -11.680 1.00 0.00 ? 11 GLN A CD  1  
ATOM   83    O  OE1 . GLN A 1 11 ? 12.548  6.946   -10.813 1.00 0.00 ? 11 GLN A OE1 1  
ATOM   84    N  NE2 . GLN A 1 11 ? 12.097  7.284   -12.917 1.00 0.00 ? 11 GLN A NE2 1  
ATOM   85    N  N   . ARG A 1 12 ? 7.193   6.953   -10.014 1.00 0.00 ? 12 ARG A N   1  
ATOM   86    C  CA  . ARG A 1 12 ? 6.764   6.857   -8.626  1.00 0.00 ? 12 ARG A CA  1  
ATOM   87    C  C   . ARG A 1 12 ? 6.032   5.569   -8.331  1.00 0.00 ? 12 ARG A C   1  
ATOM   88    O  O   . ARG A 1 12 ? 6.495   4.627   -7.654  1.00 0.00 ? 12 ARG A O   1  
ATOM   89    C  CB  . ARG A 1 12 ? 5.817   8.071   -8.338  1.00 0.00 ? 12 ARG A CB  1  
ATOM   90    C  CG  . ARG A 1 12 ? 6.495   9.323   -7.732  1.00 0.00 ? 12 ARG A CG  1  
ATOM   91    C  CD  . ARG A 1 12 ? 8.016   9.345   -7.935  1.00 0.00 ? 12 ARG A CD  1  
ATOM   92    N  NE  . ARG A 1 12 ? 8.493   10.732  -7.700  1.00 0.00 ? 12 ARG A NE  1  
ATOM   93    C  CZ  . ARG A 1 12 ? 8.371   11.742  -8.550  1.00 0.00 ? 12 ARG A CZ  1  
ATOM   94    N  NH1 . ARG A 1 12 ? 7.816   11.651  -9.723  1.00 0.00 ? 12 ARG A NH1 1  
ATOM   95    N  NH2 . ARG A 1 12 ? 8.833   12.885  -8.185  1.00 0.00 ? 12 ARG A NH2 1  
ATOM   96    N  N   . TRP A 1 13 ? 4.651   5.496   -8.884  1.00 0.00 ? 13 TRP A N   1  
ATOM   97    C  CA  . TRP A 1 13 ? 3.747   4.421   -8.504  1.00 0.00 ? 13 TRP A CA  1  
ATOM   98    C  C   . TRP A 1 13 ? 4.210   3.099   -9.064  1.00 0.00 ? 13 TRP A C   1  
ATOM   99    O  O   . TRP A 1 13 ? 3.875   2.023   -8.539  1.00 0.00 ? 13 TRP A O   1  
ATOM   100   C  CB  . TRP A 1 13 ? 2.301   4.742   -9.000  1.00 0.00 ? 13 TRP A CB  1  
ATOM   101   C  CG  . TRP A 1 13 ? 1.454   3.455   -8.999  1.00 0.00 ? 13 TRP A CG  1  
ATOM   102   C  CD1 . TRP A 1 13 ? 1.153   2.668   -10.127 1.00 0.00 ? 13 TRP A CD1 1  
ATOM   103   C  CD2 . TRP A 1 13 ? 0.946   2.786   -7.908  1.00 0.00 ? 13 TRP A CD2 1  
ATOM   104   N  NE1 . TRP A 1 13 ? 0.452   1.501   -9.762  1.00 0.00 ? 13 TRP A NE1 1  
ATOM   105   C  CE2 . TRP A 1 13 ? 0.343   1.594   -8.381  1.00 0.00 ? 13 TRP A CE2 1  
ATOM   106   C  CE3 . TRP A 1 13 ? 0.978   3.086   -6.521  1.00 0.00 ? 13 TRP A CE3 1  
ATOM   107   C  CZ2 . TRP A 1 13 ? -0.237  0.693   -7.460  1.00 0.00 ? 13 TRP A CZ2 1  
ATOM   108   C  CZ3 . TRP A 1 13 ? 0.383   2.187   -5.636  1.00 0.00 ? 13 TRP A CZ3 1  
ATOM   109   C  CH2 . TRP A 1 13 ? -0.218  1.008   -6.098  1.00 0.00 ? 13 TRP A CH2 1  
ATOM   110   N  N   . GLN A 1 14 ? 5.044   3.134   -10.289 1.00 0.00 ? 14 GLN A N   1  
ATOM   111   C  CA  . GLN A 1 14 ? 5.698   1.927   -10.793 1.00 0.00 ? 14 GLN A CA  1  
ATOM   112   C  C   . GLN A 1 14 ? 6.592   1.349   -9.712  1.00 0.00 ? 14 GLN A C   1  
ATOM   113   O  O   . GLN A 1 14 ? 6.686   0.130   -9.519  1.00 0.00 ? 14 GLN A O   1  
ATOM   114   C  CB  . GLN A 1 14 ? 6.513   2.258   -12.058 1.00 0.00 ? 14 GLN A CB  1  
ATOM   115   C  CG  . GLN A 1 14 ? 7.469   1.132   -12.579 1.00 0.00 ? 14 GLN A CG  1  
ATOM   116   C  CD  . GLN A 1 14 ? 8.195   1.316   -13.917 1.00 0.00 ? 14 GLN A CD  1  
ATOM   117   O  OE1 . GLN A 1 14 ? 9.267   0.773   -14.134 1.00 0.00 ? 14 GLN A OE1 1  
ATOM   118   N  NE2 . GLN A 1 14 ? 7.662   2.058   -14.855 1.00 0.00 ? 14 GLN A NE2 1  
ATOM   119   N  N   . SER A 1 15 ? 7.368   2.342   -8.931  1.00 0.00 ? 15 SER A N   1  
ATOM   120   C  CA  . SER A 1 15 ? 8.124   1.958   -7.743  1.00 0.00 ? 15 SER A CA  1  
ATOM   121   C  C   . SER A 1 15 ? 7.254   1.140   -6.812  1.00 0.00 ? 15 SER A C   1  
ATOM   122   O  O   . SER A 1 15 ? 7.724   0.194   -6.162  1.00 0.00 ? 15 SER A O   1  
ATOM   123   C  CB  . SER A 1 15 ? 8.743   3.183   -7.028  1.00 0.00 ? 15 SER A CB  1  
ATOM   124   O  OG  . SER A 1 15 ? 9.170   2.893   -5.692  1.00 0.00 ? 15 SER A OG  1  
ATOM   125   N  N   . VAL A 1 16 ? 5.826   1.556   -6.692  1.00 0.00 ? 16 VAL A N   1  
ATOM   126   C  CA  . VAL A 1 16 ? 4.883   0.718   -5.954  1.00 0.00 ? 16 VAL A CA  1  
ATOM   127   C  C   . VAL A 1 16 ? 4.651   -0.628  -6.593  1.00 0.00 ? 16 VAL A C   1  
ATOM   128   O  O   . VAL A 1 16 ? 4.824   -1.701  -5.955  1.00 0.00 ? 16 VAL A O   1  
ATOM   129   C  CB  . VAL A 1 16 ? 3.525   1.449   -5.634  1.00 0.00 ? 16 VAL A CB  1  
ATOM   130   C  CG1 . VAL A 1 16 ? 2.785   0.967   -4.343  1.00 0.00 ? 16 VAL A CG1 1  
ATOM   131   C  CG2 . VAL A 1 16 ? 3.659   2.979   -5.456  1.00 0.00 ? 16 VAL A CG2 1  
ATOM   132   N  N   . LEU A 1 17 ? 4.162   -0.670  -7.986  1.00 0.00 ? 17 LEU A N   1  
ATOM   133   C  CA  . LEU A 1 17 ? 3.740   -1.927  -8.637  1.00 0.00 ? 17 LEU A CA  1  
ATOM   134   C  C   . LEU A 1 17 ? 4.740   -3.015  -8.341  1.00 0.00 ? 17 LEU A C   1  
ATOM   135   O  O   . LEU A 1 17 ? 4.421   -4.147  -7.955  1.00 0.00 ? 17 LEU A O   1  
ATOM   136   C  CB  . LEU A 1 17 ? 3.595   -1.724  -10.172 1.00 0.00 ? 17 LEU A CB  1  
ATOM   137   C  CG  . LEU A 1 17 ? 2.322   -0.985  -10.676 1.00 0.00 ? 17 LEU A CG  1  
ATOM   138   C  CD1 . LEU A 1 17 ? 2.129   -1.225  -12.178 1.00 0.00 ? 17 LEU A CD1 1  
ATOM   139   C  CD2 . LEU A 1 17 ? 1.056   -1.414  -9.916  1.00 0.00 ? 17 LEU A CD2 1  
ATOM   140   N  N   . ALA A 1 18 ? 6.163   -2.614  -8.511  1.00 0.00 ? 18 ALA A N   1  
ATOM   141   C  CA  . ALA A 1 18 ? 7.270   -3.539  -8.312  1.00 0.00 ? 18 ALA A CA  1  
ATOM   142   C  C   . ALA A 1 18 ? 7.253   -4.157  -6.934  1.00 0.00 ? 18 ALA A C   1  
ATOM   143   O  O   . ALA A 1 18 ? 6.573   -5.162  -6.680  1.00 0.00 ? 18 ALA A O   1  
ATOM   144   C  CB  . ALA A 1 18 ? 8.576   -2.773  -8.599  1.00 0.00 ? 18 ALA A CB  1  
ATOM   145   N  N   . ARG A 1 19 ? 8.106   -3.513  -5.912  1.00 0.00 ? 19 ARG A N   1  
ATOM   146   C  CA  . ARG A 1 19 ? 8.337   -4.117  -4.604  1.00 0.00 ? 19 ARG A CA  1  
ATOM   147   C  C   . ARG A 1 19 ? 9.252   -3.256  -3.765  1.00 0.00 ? 19 ARG A C   1  
ATOM   148   O  O   . ARG A 1 19 ? 8.833   -2.440  -2.935  1.00 0.00 ? 19 ARG A O   1  
ATOM   149   C  CB  . ARG A 1 19 ? 8.938   -5.537  -4.814  1.00 0.00 ? 19 ARG A CB  1  
ATOM   150   C  CG  . ARG A 1 19 ? 9.499   -6.219  -3.538  1.00 0.00 ? 19 ARG A CG  1  
ATOM   151   C  CD  . ARG A 1 19 ? 10.379  -7.434  -3.861  1.00 0.00 ? 19 ARG A CD  1  
ATOM   152   N  NE  . ARG A 1 19 ? 9.670   -8.277  -4.856  1.00 0.00 ? 19 ARG A NE  1  
ATOM   153   C  CZ  . ARG A 1 19 ? 10.237  -9.175  -5.651  1.00 0.00 ? 19 ARG A CZ  1  
ATOM   154   N  NH1 . ARG A 1 19 ? 11.510  -9.441  -5.665  1.00 0.00 ? 19 ARG A NH1 1  
ATOM   155   N  NH2 . ARG A 1 19 ? 9.473   -9.821  -6.457  1.00 0.00 ? 19 ARG A NH2 1  
ATOM   156   N  N   . ASP A 1 20 ? 10.705  -3.475  -3.976  1.00 0.00 ? 20 ASP A N   1  
ATOM   157   C  CA  . ASP A 1 20 ? 11.735  -2.658  -3.344  1.00 0.00 ? 20 ASP A CA  1  
ATOM   158   C  C   . ASP A 1 20 ? 11.763  -1.269  -3.934  1.00 0.00 ? 20 ASP A C   1  
ATOM   159   O  O   . ASP A 1 20 ? 11.488  -1.057  -5.123  1.00 0.00 ? 20 ASP A O   1  
ATOM   160   C  CB  . ASP A 1 20 ? 13.114  -3.363  -3.465  1.00 0.00 ? 20 ASP A CB  1  
ATOM   161   C  CG  . ASP A 1 20 ? 14.315  -2.704  -2.774  1.00 0.00 ? 20 ASP A CG  1  
ATOM   162   O  OD1 . ASP A 1 20 ? 14.830  -1.656  -3.486  1.00 0.00 ? 20 ASP A OD1 1  
ATOM   163   O  OD2 . ASP A 1 20 ? 14.770  -3.098  -1.709  1.00 0.00 ? 20 ASP A OD2 1  
ATOM   164   N  N   . PRO A 1 21 ? 12.164  -0.183  -3.016  1.00 0.00 ? 21 PRO A N   1  
ATOM   165   C  CA  . PRO A 1 21 ? 12.295  1.308   -3.361  1.00 0.00 ? 21 PRO A CA  1  
ATOM   166   C  C   . PRO A 1 21 ? 13.094  1.579   -4.620  1.00 0.00 ? 21 PRO A C   1  
ATOM   167   O  O   . PRO A 1 21 ? 14.340  1.488   -4.606  1.00 0.00 ? 21 PRO A O   1  
ATOM   168   C  CB  . PRO A 1 21 ? 12.997  1.981   -2.191  1.00 0.00 ? 21 PRO A CB  1  
ATOM   169   C  CG  . PRO A 1 21 ? 13.555  0.814   -1.364  1.00 0.00 ? 21 PRO A CG  1  
ATOM   170   C  CD  . PRO A 1 21 ? 12.529  -0.308  -1.584  1.00 0.00 ? 21 PRO A CD  1  
ATOM   171   N  N   . ASN A 1 22 ? 12.376  1.953   -5.857  1.00 0.00 ? 22 ASN A N   1  
ATOM   172   C  CA  . ASN A 1 22 ? 13.051  2.049   -7.147  1.00 0.00 ? 22 ASN A CA  1  
ATOM   173   C  C   . ASN A 1 22 ? 13.619  3.437   -7.345  1.00 0.00 ? 22 ASN A C   1  
ATOM   174   O  O   . ASN A 1 22 ? 14.821  3.642   -7.557  1.00 0.00 ? 22 ASN A O   1  
ATOM   175   C  CB  . ASN A 1 22 ? 12.045  1.711   -8.286  1.00 0.00 ? 22 ASN A CB  1  
ATOM   176   C  CG  . ASN A 1 22 ? 12.283  2.381   -9.643  1.00 0.00 ? 22 ASN A CG  1  
ATOM   177   O  OD1 . ASN A 1 22 ? 12.884  1.825   -10.551 1.00 0.00 ? 22 ASN A OD1 1  
ATOM   178   N  ND2 . ASN A 1 22 ? 11.832  3.591   -9.833  1.00 0.00 ? 22 ASN A ND2 1  
ATOM   179   N  N   . ALA A 1 23 ? 12.640  4.543   -7.229  1.00 0.00 ? 23 ALA A N   1  
ATOM   180   C  CA  . ALA A 1 23 ? 13.033  5.947   -7.225  1.00 0.00 ? 23 ALA A CA  1  
ATOM   181   C  C   . ALA A 1 23 ? 13.274  6.436   -5.815  1.00 0.00 ? 23 ALA A C   1  
ATOM   182   O  O   . ALA A 1 23 ? 14.403  6.455   -5.307  1.00 0.00 ? 23 ALA A O   1  
ATOM   183   C  CB  . ALA A 1 23 ? 11.925  6.742   -7.943  1.00 0.00 ? 23 ALA A CB  1  
ATOM   184   N  N   . ASP A 1 24 ? 12.075  6.899   -5.081  1.00 0.00 ? 24 ASP A N   1  
ATOM   185   C  CA  . ASP A 1 24 ? 12.156  7.562   -3.783  1.00 0.00 ? 24 ASP A CA  1  
ATOM   186   C  C   . ASP A 1 24 ? 12.188  6.551   -2.662  1.00 0.00 ? 24 ASP A C   1  
ATOM   187   O  O   . ASP A 1 24 ? 11.151  6.054   -2.197  1.00 0.00 ? 24 ASP A O   1  
ATOM   188   C  CB  . ASP A 1 24 ? 10.989  8.569   -3.619  1.00 0.00 ? 24 ASP A CB  1  
ATOM   189   C  CG  . ASP A 1 24 ? 11.141  9.918   -4.342  1.00 0.00 ? 24 ASP A CG  1  
ATOM   190   O  OD1 . ASP A 1 24 ? 12.195  10.292  -4.835  1.00 0.00 ? 24 ASP A OD1 1  
ATOM   191   O  OD2 . ASP A 1 24 ? 9.975   10.629  -4.390  1.00 0.00 ? 24 ASP A OD2 1  
ATOM   192   N  N   . GLY A 1 25 ? 13.518  6.210   -2.112  1.00 0.00 ? 25 GLY A N   1  
ATOM   193   C  CA  . GLY A 1 25 ? 13.703  5.125   -1.155  1.00 0.00 ? 25 GLY A CA  1  
ATOM   194   C  C   . GLY A 1 25 ? 12.785  5.235   0.038   1.00 0.00 ? 25 GLY A C   1  
ATOM   195   O  O   . GLY A 1 25 ? 12.546  4.240   0.753   1.00 0.00 ? 25 GLY A O   1  
ATOM   196   N  N   . GLU A 1 26 ? 12.147  6.541   0.315   1.00 0.00 ? 26 GLU A N   1  
ATOM   197   C  CA  . GLU A 1 26 ? 11.402  6.789   1.544   1.00 0.00 ? 26 GLU A CA  1  
ATOM   198   C  C   . GLU A 1 26 ? 9.985   7.250   1.309   1.00 0.00 ? 26 GLU A C   1  
ATOM   199   O  O   . GLU A 1 26 ? 9.251   7.529   2.286   1.00 0.00 ? 26 GLU A O   1  
ATOM   200   C  CB  . GLU A 1 26 ? 12.195  7.837   2.384   1.00 0.00 ? 26 GLU A CB  1  
ATOM   201   C  CG  . GLU A 1 26 ? 11.700  8.122   3.839   1.00 0.00 ? 26 GLU A CG  1  
ATOM   202   C  CD  . GLU A 1 26 ? 12.742  8.459   4.909   1.00 0.00 ? 26 GLU A CD  1  
ATOM   203   O  OE1 . GLU A 1 26 ? 13.196  9.585   5.066   1.00 0.00 ? 26 GLU A OE1 1  
ATOM   204   O  OE2 . GLU A 1 26 ? 13.114  7.391   5.668   1.00 0.00 ? 26 GLU A OE2 1  
ATOM   205   N  N   . PHE A 1 27 ? 9.469   7.329   -0.074  1.00 0.00 ? 27 PHE A N   1  
ATOM   206   C  CA  . PHE A 1 27 ? 8.157   7.922   -0.367  1.00 0.00 ? 27 PHE A CA  1  
ATOM   207   C  C   . PHE A 1 27 ? 7.051   7.026   0.129   1.00 0.00 ? 27 PHE A C   1  
ATOM   208   O  O   . PHE A 1 27 ? 7.202   5.795   0.241   1.00 0.00 ? 27 PHE A O   1  
ATOM   209   C  CB  . PHE A 1 27 ? 8.012   8.231   -1.881  1.00 0.00 ? 27 PHE A CB  1  
ATOM   210   C  CG  . PHE A 1 27 ? 7.661   7.091   -2.857  1.00 0.00 ? 27 PHE A CG  1  
ATOM   211   C  CD1 . PHE A 1 27 ? 8.671   6.269   -3.361  1.00 0.00 ? 27 PHE A CD1 1  
ATOM   212   C  CD2 . PHE A 1 27 ? 6.338   6.887   -3.267  1.00 0.00 ? 27 PHE A CD2 1  
ATOM   213   C  CE1 . PHE A 1 27 ? 8.365   5.252   -4.259  1.00 0.00 ? 27 PHE A CE1 1  
ATOM   214   C  CE2 . PHE A 1 27 ? 6.032   5.869   -4.164  1.00 0.00 ? 27 PHE A CE2 1  
ATOM   215   C  CZ  . PHE A 1 27 ? 7.044   5.053   -4.662  1.00 0.00 ? 27 PHE A CZ  1  
ATOM   216   N  N   . VAL A 1 28 ? 5.781   7.672   0.517   1.00 0.00 ? 28 VAL A N   1  
ATOM   217   C  CA  . VAL A 1 28 ? 4.676   6.986   1.209   1.00 0.00 ? 28 VAL A CA  1  
ATOM   218   C  C   . VAL A 1 28 ? 3.415   7.096   0.390   1.00 0.00 ? 28 VAL A C   1  
ATOM   219   O  O   . VAL A 1 28 ? 3.245   8.070   -0.380  1.00 0.00 ? 28 VAL A O   1  
ATOM   220   C  CB  . VAL A 1 28 ? 4.509   7.658   2.630   1.00 0.00 ? 28 VAL A CB  1  
ATOM   221   C  CG1 . VAL A 1 28 ? 5.742   7.561   3.576   1.00 0.00 ? 28 VAL A CG1 1  
ATOM   222   C  CG2 . VAL A 1 28 ? 4.180   9.171   2.567   1.00 0.00 ? 28 VAL A CG2 1  
ATOM   223   N  N   . PHE A 1 29 ? 2.383   6.045   0.511   1.00 0.00 ? 29 PHE A N   1  
ATOM   224   C  CA  . PHE A 1 29 ? 1.221   5.992   -0.377  1.00 0.00 ? 29 PHE A CA  1  
ATOM   225   C  C   . PHE A 1 29 ? -0.038  5.732   0.415   1.00 0.00 ? 29 PHE A C   1  
ATOM   226   O  O   . PHE A 1 29 ? -0.089  4.848   1.283   1.00 0.00 ? 29 PHE A O   1  
ATOM   227   C  CB  . PHE A 1 29 ? 1.401   4.847   -1.418  1.00 0.00 ? 29 PHE A CB  1  
ATOM   228   C  CG  . PHE A 1 29 ? 0.737   3.503   -1.077  1.00 0.00 ? 29 PHE A CG  1  
ATOM   229   C  CD1 . PHE A 1 29 ? -0.593  3.253   -1.420  1.00 0.00 ? 29 PHE A CD1 1  
ATOM   230   C  CD2 . PHE A 1 29 ? 1.486   2.503   -0.446  1.00 0.00 ? 29 PHE A CD2 1  
ATOM   231   C  CE1 . PHE A 1 29 ? -1.170  2.019   -1.131  1.00 0.00 ? 29 PHE A CE1 1  
ATOM   232   C  CE2 . PHE A 1 29 ? 0.908   1.274   -0.151  1.00 0.00 ? 29 PHE A CE2 1  
ATOM   233   C  CZ  . PHE A 1 29 ? -0.420  1.030   -0.496  1.00 0.00 ? 29 PHE A CZ  1  
ATOM   234   N  N   . ALA A 1 30 ? -1.199  6.597   0.114   1.00 0.00 ? 30 ALA A N   1  
ATOM   235   C  CA  . ALA A 1 30 ? -2.418  6.561   0.917   1.00 0.00 ? 30 ALA A CA  1  
ATOM   236   C  C   . ALA A 1 30 ? -3.604  6.161   0.071   1.00 0.00 ? 30 ALA A C   1  
ATOM   237   O  O   . ALA A 1 30 ? -4.207  6.982   -0.635  1.00 0.00 ? 30 ALA A O   1  
ATOM   238   C  CB  . ALA A 1 30 ? -2.589  7.941   1.574   1.00 0.00 ? 30 ALA A CB  1  
ATOM   239   N  N   . VAL A 1 31 ? -4.025  4.747   0.162   1.00 0.00 ? 31 VAL A N   1  
ATOM   240   C  CA  . VAL A 1 31 ? -5.244  4.264   -0.485  1.00 0.00 ? 31 VAL A CA  1  
ATOM   241   C  C   . VAL A 1 31 ? -6.418  4.362   0.459   1.00 0.00 ? 31 VAL A C   1  
ATOM   242   O  O   . VAL A 1 31 ? -6.532  3.604   1.436   1.00 0.00 ? 31 VAL A O   1  
ATOM   243   C  CB  . VAL A 1 31 ? -5.032  2.784   -0.992  1.00 0.00 ? 31 VAL A CB  1  
ATOM   244   C  CG1 . VAL A 1 31 ? -4.207  1.844   -0.068  1.00 0.00 ? 31 VAL A CG1 1  
ATOM   245   C  CG2 . VAL A 1 31 ? -6.350  2.018   -1.266  1.00 0.00 ? 31 VAL A CG2 1  
ATOM   246   N  N   . ARG A 1 32 ? -7.447  5.378   0.142   1.00 0.00 ? 32 ARG A N   1  
ATOM   247   C  CA  . ARG A 1 32 ? -8.523  5.692   1.077   1.00 0.00 ? 32 ARG A CA  1  
ATOM   248   C  C   . ARG A 1 32 ? -9.672  4.716   1.001   1.00 0.00 ? 32 ARG A C   1  
ATOM   249   O  O   . ARG A 1 32 ? -10.795 5.018   1.457   1.00 0.00 ? 32 ARG A O   1  
ATOM   250   C  CB  . ARG A 1 32 ? -9.005  7.146   0.810   1.00 0.00 ? 32 ARG A CB  1  
ATOM   251   C  CG  . ARG A 1 32 ? -9.757  7.816   1.990   1.00 0.00 ? 32 ARG A CG  1  
ATOM   252   C  CD  . ARG A 1 32 ? -8.806  8.334   3.076   1.00 0.00 ? 32 ARG A CD  1  
ATOM   253   N  NE  . ARG A 1 32 ? -9.373  9.587   3.636   1.00 0.00 ? 32 ARG A NE  1  
ATOM   254   C  CZ  . ARG A 1 32 ? -10.155 9.668   4.704   1.00 0.00 ? 32 ARG A CZ  1  
ATOM   255   N  NH1 . ARG A 1 32 ? -10.539 8.647   5.411   1.00 0.00 ? 32 ARG A NH1 1  
ATOM   256   N  NH2 . ARG A 1 32 ? -10.555 10.837  5.059   1.00 0.00 ? 32 ARG A NH2 1  
ATOM   257   N  N   . THR A 1 33 ? -9.429  3.396   0.382   1.00 0.00 ? 33 THR A N   1  
ATOM   258   C  CA  . THR A 1 33 ? -10.464 2.364   0.331   1.00 0.00 ? 33 THR A CA  1  
ATOM   259   C  C   . THR A 1 33 ? -10.251 1.337   1.418   1.00 0.00 ? 33 THR A C   1  
ATOM   260   O  O   . THR A 1 33 ? -11.200 0.752   1.960   1.00 0.00 ? 33 THR A O   1  
ATOM   261   C  CB  . THR A 1 33 ? -10.501 1.683   -1.077  1.00 0.00 ? 33 THR A CB  1  
ATOM   262   O  OG1 . THR A 1 33 ? -11.825 1.273   -1.399  1.00 0.00 ? 33 THR A OG1 1  
ATOM   263   C  CG2 . THR A 1 33 ? -9.651  0.404   -1.242  1.00 0.00 ? 33 THR A CG2 1  
ATOM   264   N  N   . THR A 1 34 ? -8.846  1.046   1.775   1.00 0.00 ? 34 THR A N   1  
ATOM   265   C  CA  . THR A 1 34 ? -8.487  0.210   2.915   1.00 0.00 ? 34 THR A CA  1  
ATOM   266   C  C   . THR A 1 34 ? -8.157  1.051   4.127   1.00 0.00 ? 34 THR A C   1  
ATOM   267   O  O   . THR A 1 34 ? -7.918  0.522   5.226   1.00 0.00 ? 34 THR A O   1  
ATOM   268   C  CB  . THR A 1 34 ? -7.288  -0.731  2.555   1.00 0.00 ? 34 THR A CB  1  
ATOM   269   O  OG1 . THR A 1 34 ? -7.708  -1.756  1.664   1.00 0.00 ? 34 THR A OG1 1  
ATOM   270   C  CG2 . THR A 1 34 ? -6.633  -1.486  3.732   1.00 0.00 ? 34 THR A CG2 1  
ATOM   271   N  N   . GLY A 1 35 ? -8.166  2.521   3.963   1.00 0.00 ? 35 GLY A N   1  
ATOM   272   C  CA  . GLY A 1 35 ? -7.864  3.419   5.076   1.00 0.00 ? 35 GLY A CA  1  
ATOM   273   C  C   . GLY A 1 35 ? -6.482  3.152   5.622   1.00 0.00 ? 35 GLY A C   1  
ATOM   274   O  O   . GLY A 1 35 ? -6.252  3.160   6.841   1.00 0.00 ? 35 GLY A O   1  
ATOM   275   N  N   . ILE A 1 36 ? -5.403  2.918   4.632   1.00 0.00 ? 36 ILE A N   1  
ATOM   276   C  CA  . ILE A 1 36 ? -4.011  2.763   5.037   1.00 0.00 ? 36 ILE A CA  1  
ATOM   277   C  C   . ILE A 1 36 ? -3.080  3.661   4.260   1.00 0.00 ? 36 ILE A C   1  
ATOM   278   O  O   . ILE A 1 36 ? -3.132  3.763   3.024   1.00 0.00 ? 36 ILE A O   1  
ATOM   279   C  CB  . ILE A 1 36 ? -3.536  1.252   5.005   1.00 0.00 ? 36 ILE A CB  1  
ATOM   280   C  CG1 . ILE A 1 36 ? -3.114  0.677   3.617   1.00 0.00 ? 36 ILE A CG1 1  
ATOM   281   C  CG2 . ILE A 1 36 ? -4.595  0.282   5.625   1.00 0.00 ? 36 ILE A CG2 1  
ATOM   282   C  CD1 . ILE A 1 36 ? -1.824  -0.173  3.601   1.00 0.00 ? 36 ILE A CD1 1  
ATOM   283   N  N   . PHE A 1 37 ? -2.129  4.459   5.063   1.00 0.00 ? 37 PHE A N   1  
ATOM   284   C  CA  . PHE A 1 37 ? -1.019  5.212   4.451   1.00 0.00 ? 37 PHE A CA  1  
ATOM   285   C  C   . PHE A 1 37 ? 0.273   4.502   4.778   1.00 0.00 ? 37 PHE A C   1  
ATOM   286   O  O   . PHE A 1 37 ? 0.690   4.480   5.967   1.00 0.00 ? 37 PHE A O   1  
ATOM   287   C  CB  . PHE A 1 37 ? -1.000  6.679   4.965   1.00 0.00 ? 37 PHE A CB  1  
ATOM   288   C  CG  . PHE A 1 37 ? -0.091  7.053   6.146   1.00 0.00 ? 37 PHE A CG  1  
ATOM   289   C  CD1 . PHE A 1 37 ? 1.231   7.454   5.938   1.00 0.00 ? 37 PHE A CD1 1  
ATOM   290   C  CD2 . PHE A 1 37 ? -0.594  6.989   7.450   1.00 0.00 ? 37 PHE A CD2 1  
ATOM   291   C  CE1 . PHE A 1 37 ? 2.037   7.794   7.021   1.00 0.00 ? 37 PHE A CE1 1  
ATOM   292   C  CE2 . PHE A 1 37 ? 0.208   7.340   8.530   1.00 0.00 ? 37 PHE A CE2 1  
ATOM   293   C  CZ  . PHE A 1 37 ? 1.525   7.740   8.316   1.00 0.00 ? 37 PHE A CZ  1  
ATOM   294   N  N   . CYS A 1 38 ? 1.013   3.790   3.717   1.00 0.00 ? 38 CYS A N   1  
ATOM   295   C  CA  . CYS A 1 38 ? 2.144   2.904   4.030   1.00 0.00 ? 38 CYS A CA  1  
ATOM   296   C  C   . CYS A 1 38 ? 3.255   3.078   3.028   1.00 0.00 ? 38 CYS A C   1  
ATOM   297   O  O   . CYS A 1 38 ? 3.057   3.637   1.933   1.00 0.00 ? 38 CYS A O   1  
ATOM   298   C  CB  . CYS A 1 38 ? 1.592   1.470   4.116   1.00 0.00 ? 38 CYS A CB  1  
ATOM   299   S  SG  . CYS A 1 38 ? 2.484   0.284   3.096   1.00 0.00 ? 38 CYS A SG  1  
ATOM   300   N  N   . ARG A 1 39 ? 4.584   2.551   3.408   1.00 0.00 ? 39 ARG A N   1  
ATOM   301   C  CA  . ARG A 1 39 ? 5.705   2.578   2.452   1.00 0.00 ? 39 ARG A CA  1  
ATOM   302   C  C   . ARG A 1 39 ? 5.504   1.500   1.413   1.00 0.00 ? 39 ARG A C   1  
ATOM   303   O  O   . ARG A 1 39 ? 5.098   0.367   1.706   1.00 0.00 ? 39 ARG A O   1  
ATOM   304   C  CB  . ARG A 1 39 ? 7.036   2.464   3.233   1.00 0.00 ? 39 ARG A CB  1  
ATOM   305   C  CG  . ARG A 1 39 ? 8.180   1.694   2.522   1.00 0.00 ? 39 ARG A CG  1  
ATOM   306   C  CD  . ARG A 1 39 ? 9.514   1.808   3.274   1.00 0.00 ? 39 ARG A CD  1  
ATOM   307   N  NE  . ARG A 1 39 ? 10.587  1.235   2.424   1.00 0.00 ? 39 ARG A NE  1  
ATOM   308   C  CZ  . ARG A 1 39 ? 11.005  -0.024  2.456   1.00 0.00 ? 39 ARG A CZ  1  
ATOM   309   N  NH1 . ARG A 1 39 ? 10.519  -0.939  3.241   1.00 0.00 ? 39 ARG A NH1 1  
ATOM   310   N  NH2 . ARG A 1 39 ? 11.955  -0.354  1.654   1.00 0.00 ? 39 ARG A NH2 1  
ATOM   311   N  N   . PRO A 1 40 ? 5.872   1.842   0.026   1.00 0.00 ? 40 PRO A N   1  
ATOM   312   C  CA  . PRO A 1 40 ? 5.742   1.008   -1.248  1.00 0.00 ? 40 PRO A CA  1  
ATOM   313   C  C   . PRO A 1 40 ? 5.418   -0.460  -1.276  1.00 0.00 ? 40 PRO A C   1  
ATOM   314   O  O   . PRO A 1 40 ? 4.636   -0.892  -2.184  1.00 0.00 ? 40 PRO A O   1  
ATOM   315   C  CB  . PRO A 1 40 ? 7.072   1.272   -1.980  1.00 0.00 ? 40 PRO A CB  1  
ATOM   316   C  CG  . PRO A 1 40 ? 7.236   2.776   -1.714  1.00 0.00 ? 40 PRO A CG  1  
ATOM   317   C  CD  . PRO A 1 40 ? 6.474   3.130   -0.436  1.00 0.00 ? 40 PRO A CD  1  
ATOM   318   N  N   . SER A 1 41 ? 5.942   -1.403  -0.267  1.00 0.00 ? 41 SER A N   1  
ATOM   319   C  CA  . SER A 1 41 ? 5.808   -2.851  -0.405  1.00 0.00 ? 41 SER A CA  1  
ATOM   320   C  C   . SER A 1 41 ? 4.690   -3.521  0.350   1.00 0.00 ? 41 SER A C   1  
ATOM   321   O  O   . SER A 1 41 ? 4.879   -4.624  0.921   1.00 0.00 ? 41 SER A O   1  
ATOM   322   C  CB  . SER A 1 41 ? 7.179   -3.531  -0.114  1.00 0.00 ? 41 SER A CB  1  
ATOM   323   O  OG  . SER A 1 41 ? 7.350   -4.760  -0.825  1.00 0.00 ? 41 SER A OG  1  
ATOM   324   N  N   . CYS A 1 42 ? 3.341   -2.883  0.357   1.00 0.00 ? 42 CYS A N   1  
ATOM   325   C  CA  . CYS A 1 42 ? 2.187   -3.582  0.919   1.00 0.00 ? 42 CYS A CA  1  
ATOM   326   C  C   . CYS A 1 42 ? 1.783   -4.720  -0.017  1.00 0.00 ? 42 CYS A C   1  
ATOM   327   O  O   . CYS A 1 42 ? 1.188   -4.508  -1.081  1.00 0.00 ? 42 CYS A O   1  
ATOM   328   C  CB  . CYS A 1 42 ? 1.004   -2.692  1.311   1.00 0.00 ? 42 CYS A CB  1  
ATOM   329   S  SG  . CYS A 1 42 ? 0.752   -2.687  3.125   1.00 0.00 ? 42 CYS A SG  1  
ATOM   330   N  N   . ARG A 1 43 ? 2.176   -6.086  0.398   1.00 0.00 ? 43 ARG A N   1  
ATOM   331   C  CA  . ARG A 1 43 ? 2.039   -7.260  -0.457  1.00 0.00 ? 43 ARG A CA  1  
ATOM   332   C  C   . ARG A 1 43 ? 0.634   -7.814  -0.455  1.00 0.00 ? 43 ARG A C   1  
ATOM   333   O  O   . ARG A 1 43 ? 0.030   -8.049  -1.514  1.00 0.00 ? 43 ARG A O   1  
ATOM   334   C  CB  . ARG A 1 43 ? 3.062   -8.337  0.014   1.00 0.00 ? 43 ARG A CB  1  
ATOM   335   C  CG  . ARG A 1 43 ? 4.216   -7.805  0.904   1.00 0.00 ? 43 ARG A CG  1  
ATOM   336   C  CD  . ARG A 1 43 ? 4.534   -8.738  2.080   1.00 0.00 ? 43 ARG A CD  1  
ATOM   337   N  NE  . ARG A 1 43 ? 4.724   -10.111 1.548   1.00 0.00 ? 43 ARG A NE  1  
ATOM   338   C  CZ  . ARG A 1 43 ? 4.553   -11.234 2.233   1.00 0.00 ? 43 ARG A CZ  1  
ATOM   339   N  NH1 . ARG A 1 43 ? 4.196   -11.284 3.482   1.00 0.00 ? 43 ARG A NH1 1  
ATOM   340   N  NH2 . ARG A 1 43 ? 4.755   -12.343 1.614   1.00 0.00 ? 43 ARG A NH2 1  
ATOM   341   N  N   . ALA A 1 44 ? 0.034   -8.097  0.866   1.00 0.00 ? 44 ALA A N   1  
ATOM   342   C  CA  . ALA A 1 44 ? -1.361  -8.497  1.021   1.00 0.00 ? 44 ALA A CA  1  
ATOM   343   C  C   . ALA A 1 44 ? -2.239  -7.721  0.058   1.00 0.00 ? 44 ALA A C   1  
ATOM   344   O  O   . ALA A 1 44 ? -2.001  -6.548  -0.251  1.00 0.00 ? 44 ALA A O   1  
ATOM   345   C  CB  . ALA A 1 44 ? -1.760  -8.289  2.490   1.00 0.00 ? 44 ALA A CB  1  
ATOM   346   N  N   . ARG A 1 45 ? -3.371  -8.496  -0.509  1.00 0.00 ? 45 ARG A N   1  
ATOM   347   C  CA  . ARG A 1 45 ? -4.223  -7.983  -1.575  1.00 0.00 ? 45 ARG A CA  1  
ATOM   348   C  C   . ARG A 1 45 ? -4.512  -6.511  -1.371  1.00 0.00 ? 45 ARG A C   1  
ATOM   349   O  O   . ARG A 1 45 ? -5.412  -6.114  -0.620  1.00 0.00 ? 45 ARG A O   1  
ATOM   350   C  CB  . ARG A 1 45 ? -5.538  -8.808  -1.619  1.00 0.00 ? 45 ARG A CB  1  
ATOM   351   C  CG  . ARG A 1 45 ? -5.458  -10.140 -2.412  1.00 0.00 ? 45 ARG A CG  1  
ATOM   352   C  CD  . ARG A 1 45 ? -6.442  -10.187 -3.588  1.00 0.00 ? 45 ARG A CD  1  
ATOM   353   N  NE  . ARG A 1 45 ? -7.748  -9.647  -3.131  1.00 0.00 ? 45 ARG A NE  1  
ATOM   354   C  CZ  . ARG A 1 45 ? -8.816  -9.465  -3.896  1.00 0.00 ? 45 ARG A CZ  1  
ATOM   355   N  NH1 . ARG A 1 45 ? -8.862  -9.734  -5.168  1.00 0.00 ? 45 ARG A NH1 1  
ATOM   356   N  NH2 . ARG A 1 45 ? -9.873  -8.990  -3.338  1.00 0.00 ? 45 ARG A NH2 1  
ATOM   357   N  N   . HIS A 1 46 ? -3.633  -5.577  -2.113  1.00 0.00 ? 46 HIS A N   1  
ATOM   358   C  CA  . HIS A 1 46 ? -3.666  -4.134  -1.895  1.00 0.00 ? 46 HIS A CA  1  
ATOM   359   C  C   . HIS A 1 46 ? -4.538  -3.454  -2.924  1.00 0.00 ? 46 HIS A C   1  
ATOM   360   O  O   . HIS A 1 46 ? -4.505  -3.774  -4.120  1.00 0.00 ? 46 HIS A O   1  
ATOM   361   C  CB  . HIS A 1 46 ? -2.213  -3.645  -2.011  1.00 0.00 ? 46 HIS A CB  1  
ATOM   362   C  CG  . HIS A 1 46 ? -1.753  -3.532  -3.435  1.00 0.00 ? 46 HIS A CG  1  
ATOM   363   N  ND1 . HIS A 1 46 ? -1.586  -4.590  -4.325  1.00 0.00 ? 46 HIS A ND1 1  
ATOM   364   C  CD2 . HIS A 1 46 ? -1.436  -2.316  -4.026  1.00 0.00 ? 46 HIS A CD2 1  
ATOM   365   C  CE1 . HIS A 1 46 ? -1.168  -3.913  -5.411  1.00 0.00 ? 46 HIS A CE1 1  
ATOM   366   N  NE2 . HIS A 1 46 ? -1.054  -2.560  -5.319  1.00 0.00 ? 46 HIS A NE2 1  
ATOM   367   N  N   . ALA A 1 47 ? -5.460  -2.414  -2.415  1.00 0.00 ? 47 ALA A N   1  
ATOM   368   C  CA  . ALA A 1 47 ? -6.273  -1.603  -3.316  1.00 0.00 ? 47 ALA A CA  1  
ATOM   369   C  C   . ALA A 1 47 ? -5.431  -1.034  -4.434  1.00 0.00 ? 47 ALA A C   1  
ATOM   370   O  O   . ALA A 1 47 ? -4.195  -1.118  -4.431  1.00 0.00 ? 47 ALA A O   1  
ATOM   371   C  CB  . ALA A 1 47 ? -6.974  -0.522  -2.477  1.00 0.00 ? 47 ALA A CB  1  
ATOM   372   N  N   . LEU A 1 48 ? -6.164  -0.335  -5.512  1.00 0.00 ? 48 LEU A N   1  
ATOM   373   C  CA  . LEU A 1 48 ? -5.504  0.107   -6.735  1.00 0.00 ? 48 LEU A CA  1  
ATOM   374   C  C   . LEU A 1 48 ? -4.820  1.443   -6.552  1.00 0.00 ? 48 LEU A C   1  
ATOM   375   O  O   . LEU A 1 48 ? -4.748  2.014   -5.456  1.00 0.00 ? 48 LEU A O   1  
ATOM   376   C  CB  . LEU A 1 48 ? -6.521  0.167   -7.912  1.00 0.00 ? 48 LEU A CB  1  
ATOM   377   C  CG  . LEU A 1 48 ? -8.017  -0.120  -7.612  1.00 0.00 ? 48 LEU A CG  1  
ATOM   378   C  CD1 . LEU A 1 48 ? -8.629  1.036   -6.808  1.00 0.00 ? 48 LEU A CD1 1  
ATOM   379   C  CD2 . LEU A 1 48 ? -8.844  -0.353  -8.888  1.00 0.00 ? 48 LEU A CD2 1  
ATOM   380   N  N   . ARG A 1 49 ? -4.269  2.053   -7.784  1.00 0.00 ? 49 ARG A N   1  
ATOM   381   C  CA  . ARG A 1 49 ? -3.732  3.412   -7.840  1.00 0.00 ? 49 ARG A CA  1  
ATOM   382   C  C   . ARG A 1 49 ? -4.824  4.407   -8.152  1.00 0.00 ? 49 ARG A C   1  
ATOM   383   O  O   . ARG A 1 49 ? -4.576  5.555   -8.550  1.00 0.00 ? 49 ARG A O   1  
ATOM   384   C  CB  . ARG A 1 49 ? -2.615  3.440   -8.922  1.00 0.00 ? 49 ARG A CB  1  
ATOM   385   C  CG  . ARG A 1 49 ? -1.796  4.747   -9.071  1.00 0.00 ? 49 ARG A CG  1  
ATOM   386   C  CD  . ARG A 1 49 ? -1.543  5.111   -10.542 1.00 0.00 ? 49 ARG A CD  1  
ATOM   387   N  NE  . ARG A 1 49 ? -1.256  3.860   -11.289 1.00 0.00 ? 49 ARG A NE  1  
ATOM   388   C  CZ  . ARG A 1 49 ? -1.144  3.756   -12.607 1.00 0.00 ? 49 ARG A CZ  1  
ATOM   389   N  NH1 . ARG A 1 49 ? -1.275  4.749   -13.435 1.00 0.00 ? 49 ARG A NH1 1  
ATOM   390   N  NH2 . ARG A 1 49 ? -0.889  2.592   -13.091 1.00 0.00 ? 49 ARG A NH2 1  
ATOM   391   N  N   . GLU A 1 50 ? -6.215  3.952   -7.923  1.00 0.00 ? 50 GLU A N   1  
ATOM   392   C  CA  . GLU A 1 50 ? -7.378  4.719   -8.351  1.00 0.00 ? 50 GLU A CA  1  
ATOM   393   C  C   . GLU A 1 50 ? -7.824  5.737   -7.331  1.00 0.00 ? 50 GLU A C   1  
ATOM   394   O  O   . GLU A 1 50 ? -8.476  6.747   -7.689  1.00 0.00 ? 50 GLU A O   1  
ATOM   395   C  CB  . GLU A 1 50 ? -8.528  3.720   -8.679  1.00 0.00 ? 50 GLU A CB  1  
ATOM   396   C  CG  . GLU A 1 50 ? -9.692  3.596   -7.642  1.00 0.00 ? 50 GLU A CG  1  
ATOM   397   C  CD  . GLU A 1 50 ? -10.959 4.424   -7.868  1.00 0.00 ? 50 GLU A CD  1  
ATOM   398   O  OE1 . GLU A 1 50 ? -11.727 3.980   -8.901  1.00 0.00 ? 50 GLU A OE1 1  
ATOM   399   O  OE2 . GLU A 1 50 ? -11.251 5.394   -7.181  1.00 0.00 ? 50 GLU A OE2 1  
ATOM   400   N  N   . ASN A 1 51 ? -7.461  5.533   -5.920  1.00 0.00 ? 51 ASN A N   1  
ATOM   401   C  CA  . ASN A 1 51 ? -7.956  6.433   -4.847  1.00 0.00 ? 51 ASN A CA  1  
ATOM   402   C  C   . ASN A 1 51 ? -6.792  6.703   -3.917  1.00 0.00 ? 51 ASN A C   1  
ATOM   403   O  O   . ASN A 1 51 ? -6.887  6.993   -2.719  1.00 0.00 ? 51 ASN A O   1  
ATOM   404   C  CB  . ASN A 1 51 ? -9.109  5.709   -4.111  1.00 0.00 ? 51 ASN A CB  1  
ATOM   405   C  CG  . ASN A 1 51 ? -8.847  5.110   -2.723  1.00 0.00 ? 51 ASN A CG  1  
ATOM   406   O  OD1 . ASN A 1 51 ? -9.484  5.439   -1.734  1.00 0.00 ? 51 ASN A OD1 1  
ATOM   407   N  ND2 . ASN A 1 51 ? -7.919  4.199   -2.604  1.00 0.00 ? 51 ASN A ND2 1  
ATOM   408   N  N   . VAL A 1 52 ? -5.452  6.548   -4.569  1.00 0.00 ? 52 VAL A N   1  
ATOM   409   C  CA  . VAL A 1 52 ? -4.211  6.451   -3.809  1.00 0.00 ? 52 VAL A CA  1  
ATOM   410   C  C   . VAL A 1 52 ? -3.506  7.781   -3.770  1.00 0.00 ? 52 VAL A C   1  
ATOM   411   O  O   . VAL A 1 52 ? -3.546  8.534   -4.779  1.00 0.00 ? 52 VAL A O   1  
ATOM   412   C  CB  . VAL A 1 52 ? -3.296  5.317   -4.437  1.00 0.00 ? 52 VAL A CB  1  
ATOM   413   C  CG1 . VAL A 1 52 ? -2.127  5.785   -5.342  1.00 0.00 ? 52 VAL A CG1 1  
ATOM   414   C  CG2 . VAL A 1 52 ? -2.658  4.386   -3.377  1.00 0.00 ? 52 VAL A CG2 1  
ATOM   415   N  N   . SER A 1 53 ? -2.808  8.211   -2.542  1.00 0.00 ? 53 SER A N   1  
ATOM   416   C  CA  . SER A 1 53 ? -2.168  9.524   -2.435  1.00 0.00 ? 53 SER A CA  1  
ATOM   417   C  C   . SER A 1 53 ? -0.735  9.409   -1.978  1.00 0.00 ? 53 SER A C   1  
ATOM   418   O  O   . SER A 1 53 ? -0.429  8.856   -0.913  1.00 0.00 ? 53 SER A O   1  
ATOM   419   C  CB  . SER A 1 53 ? -2.995  10.473  -1.534  1.00 0.00 ? 53 SER A CB  1  
ATOM   420   O  OG  . SER A 1 53 ? -2.422  11.781  -1.429  1.00 0.00 ? 53 SER A OG  1  
ATOM   421   N  N   . PHE A 1 54 ? 0.288   10.033  -2.850  1.00 0.00 ? 54 PHE A N   1  
ATOM   422   C  CA  . PHE A 1 54 ? 1.716   9.838   -2.616  1.00 0.00 ? 54 PHE A CA  1  
ATOM   423   C  C   . PHE A 1 54 ? 2.356   11.032  -1.947  1.00 0.00 ? 54 PHE A C   1  
ATOM   424   O  O   . PHE A 1 54 ? 1.941   12.187  -2.113  1.00 0.00 ? 54 PHE A O   1  
ATOM   425   C  CB  . PHE A 1 54 ? 2.446   9.567   -3.966  1.00 0.00 ? 54 PHE A CB  1  
ATOM   426   C  CG  . PHE A 1 54 ? 1.873   8.447   -4.847  1.00 0.00 ? 54 PHE A CG  1  
ATOM   427   C  CD1 . PHE A 1 54 ? 1.234   7.352   -4.252  1.00 0.00 ? 54 PHE A CD1 1  
ATOM   428   C  CD2 . PHE A 1 54 ? 1.990   8.505   -6.238  1.00 0.00 ? 54 PHE A CD2 1  
ATOM   429   C  CE1 . PHE A 1 54 ? 0.715   6.329   -5.040  1.00 0.00 ? 54 PHE A CE1 1  
ATOM   430   C  CE2 . PHE A 1 54 ? 1.473   7.480   -7.026  1.00 0.00 ? 54 PHE A CE2 1  
ATOM   431   C  CZ  . PHE A 1 54 ? 0.837   6.393   -6.427  1.00 0.00 ? 54 PHE A CZ  1  
ATOM   432   N  N   . TYR A 1 55 ? 3.511   10.739  -1.072  1.00 0.00 ? 55 TYR A N   1  
ATOM   433   C  CA  . TYR A 1 55 ? 4.281   11.779  -0.380  1.00 0.00 ? 55 TYR A CA  1  
ATOM   434   C  C   . TYR A 1 55 ? 5.743   11.407  -0.327  1.00 0.00 ? 55 TYR A C   1  
ATOM   435   O  O   . TYR A 1 55 ? 6.104   10.227  -0.568  1.00 0.00 ? 55 TYR A O   1  
ATOM   436   C  CB  . TYR A 1 55 ? 3.760   11.915  1.081   1.00 0.00 ? 55 TYR A CB  1  
ATOM   437   C  CG  . TYR A 1 55 ? 2.274   11.569  1.299   1.00 0.00 ? 55 TYR A CG  1  
ATOM   438   C  CD1 . TYR A 1 55 ? 1.819   10.286  1.597   1.00 0.00 ? 55 TYR A CD1 1  
ATOM   439   C  CD2 . TYR A 1 55 ? 1.339   12.620  1.192   1.00 0.00 ? 55 TYR A CD2 1  
ATOM   440   C  CE1 . TYR A 1 55 ? 0.462   10.045  1.792   1.00 0.00 ? 55 TYR A CE1 1  
ATOM   441   C  CE2 . TYR A 1 55 ? -0.016  12.376  1.386   1.00 0.00 ? 55 TYR A CE2 1  
ATOM   442   C  CZ  . TYR A 1 55 ? -0.453  11.089  1.688   1.00 0.00 ? 55 TYR A CZ  1  
ATOM   443   O  OH  . TYR A 1 55 ? -1.785  10.851  1.886   1.00 0.00 ? 55 TYR A OH  1  
ATOM   444   N  N   . ALA A 1 56 ? 6.769   12.434  -0.031  1.00 0.00 ? 56 ALA A N   1  
ATOM   445   C  CA  . ALA A 1 56 ? 8.179   12.094  0.186   1.00 0.00 ? 56 ALA A CA  1  
ATOM   446   C  C   . ALA A 1 56 ? 8.403   11.417  1.516   1.00 0.00 ? 56 ALA A C   1  
ATOM   447   O  O   . ALA A 1 56 ? 9.200   10.467  1.630   1.00 0.00 ? 56 ALA A O   1  
ATOM   448   C  CB  . ALA A 1 56 ? 9.006   13.378  0.020   1.00 0.00 ? 56 ALA A CB  1  
ATOM   449   N  N   . ASN A 1 57 ? 7.670   11.951  2.684   1.00 0.00 ? 57 ASN A N   1  
ATOM   450   C  CA  . ASN A 1 57 ? 7.793   11.349  4.010   1.00 0.00 ? 57 ASN A CA  1  
ATOM   451   C  C   . ASN A 1 57 ? 6.436   11.126  4.634   1.00 0.00 ? 57 ASN A C   1  
ATOM   452   O  O   . ASN A 1 57 ? 5.455   11.816  4.326   1.00 0.00 ? 57 ASN A O   1  
ATOM   453   C  CB  . ASN A 1 57 ? 8.681   12.252  4.914   1.00 0.00 ? 57 ASN A CB  1  
ATOM   454   C  CG  . ASN A 1 57 ? 8.877   11.803  6.366   1.00 0.00 ? 57 ASN A CG  1  
ATOM   455   O  OD1 . ASN A 1 57 ? 8.429   12.434  7.312   1.00 0.00 ? 57 ASN A OD1 1  
ATOM   456   N  ND2 . ASN A 1 57 ? 9.545   10.706  6.599   1.00 0.00 ? 57 ASN A ND2 1  
ATOM   457   N  N   . ALA A 1 58 ? 6.336   10.012  5.603   1.00 0.00 ? 58 ALA A N   1  
ATOM   458   C  CA  . ALA A 1 58 ? 5.087   9.671   6.271   1.00 0.00 ? 58 ALA A CA  1  
ATOM   459   C  C   . ALA A 1 58 ? 4.647   10.735  7.249   1.00 0.00 ? 58 ALA A C   1  
ATOM   460   O  O   . ALA A 1 58 ? 3.501   10.716  7.739   1.00 0.00 ? 58 ALA A O   1  
ATOM   461   C  CB  . ALA A 1 58 ? 5.270   8.294   6.938   1.00 0.00 ? 58 ALA A CB  1  
ATOM   462   N  N   . SER A 1 59 ? 5.628   11.772  7.633   1.00 0.00 ? 59 SER A N   1  
ATOM   463   C  CA  . SER A 1 59 ? 5.276   12.865  8.539   1.00 0.00 ? 59 SER A CA  1  
ATOM   464   C  C   . SER A 1 59 ? 4.156   13.698  7.960   1.00 0.00 ? 59 SER A C   1  
ATOM   465   O  O   . SER A 1 59 ? 3.362   14.318  8.680   1.00 0.00 ? 59 SER A O   1  
ATOM   466   C  CB  . SER A 1 59 ? 6.514   13.729  8.882   1.00 0.00 ? 59 SER A CB  1  
ATOM   467   O  OG  . SER A 1 59 ? 6.169   15.026  9.382   1.00 0.00 ? 59 SER A OG  1  
ATOM   468   N  N   . GLU A 1 60 ? 4.072   13.736  6.483   1.00 0.00 ? 60 GLU A N   1  
ATOM   469   C  CA  . GLU A 1 60 ? 2.968   14.385  5.783   1.00 0.00 ? 60 GLU A CA  1  
ATOM   470   C  C   . GLU A 1 60 ? 1.680   13.612  5.936   1.00 0.00 ? 60 GLU A C   1  
ATOM   471   O  O   . GLU A 1 60 ? 0.692   14.102  6.507   1.00 0.00 ? 60 GLU A O   1  
ATOM   472   C  CB  . GLU A 1 60 ? 3.355   14.544  4.285   1.00 0.00 ? 60 GLU A CB  1  
ATOM   473   C  CG  . GLU A 1 60 ? 2.200   14.445  3.234   1.00 0.00 ? 60 GLU A CG  1  
ATOM   474   C  CD  . GLU A 1 60 ? 1.693   15.732  2.579   1.00 0.00 ? 60 GLU A CD  1  
ATOM   475   O  OE1 . GLU A 1 60 ? 0.882   16.476  3.115   1.00 0.00 ? 60 GLU A OE1 1  
ATOM   476   O  OE2 . GLU A 1 60 ? 2.227   15.969  1.349   1.00 0.00 ? 60 GLU A OE2 1  
ATOM   477   N  N   . ALA A 1 61 ? 1.633   12.258  5.337   1.00 0.00 ? 61 ALA A N   1  
ATOM   478   C  CA  . ALA A 1 61 ? 0.443   11.420  5.424   1.00 0.00 ? 61 ALA A CA  1  
ATOM   479   C  C   . ALA A 1 61 ? -0.071  11.290  6.839   1.00 0.00 ? 61 ALA A C   1  
ATOM   480   O  O   . ALA A 1 61 ? -1.260  10.983  7.059   1.00 0.00 ? 61 ALA A O   1  
ATOM   481   C  CB  . ALA A 1 61 ? 0.778   10.063  4.782   1.00 0.00 ? 61 ALA A CB  1  
ATOM   482   N  N   . LEU A 1 62 ? 0.885   11.493  7.947   1.00 0.00 ? 62 LEU A N   1  
ATOM   483   C  CA  . LEU A 1 62 ? 0.441   11.557  9.341   1.00 0.00 ? 62 LEU A CA  1  
ATOM   484   C  C   . LEU A 1 62 ? -0.187  12.900  9.632   1.00 0.00 ? 62 LEU A C   1  
ATOM   485   O  O   . LEU A 1 62 ? -1.263  12.999  10.238  1.00 0.00 ? 62 LEU A O   1  
ATOM   486   C  CB  . LEU A 1 62 ? 1.619   11.260  10.310  1.00 0.00 ? 62 LEU A CB  1  
ATOM   487   C  CG  . LEU A 1 62 ? 1.292   10.611  11.682  1.00 0.00 ? 62 LEU A CG  1  
ATOM   488   C  CD1 . LEU A 1 62 ? 0.076   11.300  12.316  1.00 0.00 ? 62 LEU A CD1 1  
ATOM   489   C  CD2 . LEU A 1 62 ? 1.035   9.099   11.578  1.00 0.00 ? 62 LEU A CD2 1  
ATOM   490   N  N   . ALA A 1 63 ? 0.576   14.087  9.192   1.00 0.00 ? 63 ALA A N   1  
ATOM   491   C  CA  . ALA A 1 63 ? 0.012   15.435  9.238   1.00 0.00 ? 63 ALA A CA  1  
ATOM   492   C  C   . ALA A 1 63 ? -1.346  15.470  8.578   1.00 0.00 ? 63 ALA A C   1  
ATOM   493   O  O   . ALA A 1 63 ? -2.190  16.329  8.865   1.00 0.00 ? 63 ALA A O   1  
ATOM   494   C  CB  . ALA A 1 63 ? 1.019   16.393  8.580   1.00 0.00 ? 63 ALA A CB  1  
ATOM   495   N  N   . ALA A 1 64 ? -1.626  14.397  7.597   1.00 0.00 ? 64 ALA A N   1  
ATOM   496   C  CA  . ALA A 1 64 ? -2.951  14.211  7.013   1.00 0.00 ? 64 ALA A CA  1  
ATOM   497   C  C   . ALA A 1 64 ? -3.900  13.654  8.057   1.00 0.00 ? 64 ALA A C   1  
ATOM   498   O  O   . ALA A 1 64 ? -5.049  14.087  8.212   1.00 0.00 ? 64 ALA A O   1  
ATOM   499   C  CB  . ALA A 1 64 ? -2.803  13.289  5.793   1.00 0.00 ? 64 ALA A CB  1  
ATOM   500   N  N   . GLY A 1 65 ? -3.333  12.577  8.904   1.00 0.00 ? 65 GLY A N   1  
ATOM   501   C  CA  . GLY A 1 65 ? -4.073  11.993  10.019  1.00 0.00 ? 65 GLY A CA  1  
ATOM   502   C  C   . GLY A 1 65 ? -4.538  10.594  9.651   1.00 0.00 ? 65 GLY A C   1  
ATOM   503   O  O   . GLY A 1 65 ? -5.643  10.152  9.988   1.00 0.00 ? 65 GLY A O   1  
ATOM   504   N  N   . PHE A 1 66 ? -3.589  9.814   8.827   1.00 0.00 ? 66 PHE A N   1  
ATOM   505   C  CA  . PHE A 1 66 ? -3.936  8.528   8.231   1.00 0.00 ? 66 PHE A CA  1  
ATOM   506   C  C   . PHE A 1 66 ? -3.273  7.377   8.945   1.00 0.00 ? 66 PHE A C   1  
ATOM   507   O  O   . PHE A 1 66 ? -2.655  7.564   10.019  1.00 0.00 ? 66 PHE A O   1  
ATOM   508   C  CB  . PHE A 1 66 ? -3.511  8.528   6.727   1.00 0.00 ? 66 PHE A CB  1  
ATOM   509   C  CG  . PHE A 1 66 ? -4.314  7.592   5.811   1.00 0.00 ? 66 PHE A CG  1  
ATOM   510   C  CD1 . PHE A 1 66 ? -5.564  7.126   6.247   1.00 0.00 ? 66 PHE A CD1 1  
ATOM   511   C  CD2 . PHE A 1 66 ? -3.817  7.180   4.574   1.00 0.00 ? 66 PHE A CD2 1  
ATOM   512   C  CE1 . PHE A 1 66 ? -6.306  6.262   5.449   1.00 0.00 ? 66 PHE A CE1 1  
ATOM   513   C  CE2 . PHE A 1 66 ? -4.562  6.314   3.776   1.00 0.00 ? 66 PHE A CE2 1  
ATOM   514   C  CZ  . PHE A 1 66 ? -5.802  5.856   4.215   1.00 0.00 ? 66 PHE A CZ  1  
ATOM   515   N  N   . ARG A 1 67 ? -3.391  6.022   8.363   1.00 0.00 ? 67 ARG A N   1  
ATOM   516   C  CA  . ARG A 1 67 ? -2.926  4.838   9.087   1.00 0.00 ? 67 ARG A CA  1  
ATOM   517   C  C   . ARG A 1 67 ? -1.532  4.424   8.680   1.00 0.00 ? 67 ARG A C   1  
ATOM   518   O  O   . ARG A 1 67 ? -1.310  3.796   7.637   1.00 0.00 ? 67 ARG A O   1  
ATOM   519   C  CB  . ARG A 1 67 ? -3.947  3.683   8.914   1.00 0.00 ? 67 ARG A CB  1  
ATOM   520   C  CG  . ARG A 1 67 ? -4.200  2.840   10.194  1.00 0.00 ? 67 ARG A CG  1  
ATOM   521   C  CD  . ARG A 1 67 ? -2.966  2.039   10.627  1.00 0.00 ? 67 ARG A CD  1  
ATOM   522   N  NE  . ARG A 1 67 ? -3.359  0.614   10.770  1.00 0.00 ? 67 ARG A NE  1  
ATOM   523   C  CZ  . ARG A 1 67 ? -3.494  -0.037  11.917  1.00 0.00 ? 67 ARG A CZ  1  
ATOM   524   N  NH1 . ARG A 1 67 ? -3.296  0.492   13.088  1.00 0.00 ? 67 ARG A NH1 1  
ATOM   525   N  NH2 . ARG A 1 67 ? -3.845  -1.273  11.861  1.00 0.00 ? 67 ARG A NH2 1  
ATOM   526   N  N   . PRO A 1 68 ? -0.449  4.790   9.618   1.00 0.00 ? 68 PRO A N   1  
ATOM   527   C  CA  . PRO A 1 68 ? 1.046   4.514   9.465   1.00 0.00 ? 68 PRO A CA  1  
ATOM   528   C  C   . PRO A 1 68 ? 1.439   3.055   9.432   1.00 0.00 ? 68 PRO A C   1  
ATOM   529   O  O   . PRO A 1 68 ? 1.573   2.402   10.488  1.00 0.00 ? 68 PRO A O   1  
ATOM   530   C  CB  . PRO A 1 68 ? 1.755   5.164   10.652  1.00 0.00 ? 68 PRO A CB  1  
ATOM   531   C  CG  . PRO A 1 68 ? 0.737   6.218   11.114  1.00 0.00 ? 68 PRO A CG  1  
ATOM   532   C  CD  . PRO A 1 68 ? -0.613  5.519   10.908  1.00 0.00 ? 68 PRO A CD  1  
ATOM   533   N  N   . CYS A 1 69 ? 1.614   2.402   8.112   1.00 0.00 ? 69 CYS A N   1  
ATOM   534   C  CA  . CYS A 1 69 ? 2.184   1.071   7.987   1.00 0.00 ? 69 CYS A CA  1  
ATOM   535   C  C   . CYS A 1 69 ? 3.648   1.085   7.606   1.00 0.00 ? 69 CYS A C   1  
ATOM   536   O  O   . CYS A 1 69 ? 4.075   1.525   6.529   1.00 0.00 ? 69 CYS A O   1  
ATOM   537   C  CB  . CYS A 1 69 ? 1.352   0.205   7.012   1.00 0.00 ? 69 CYS A CB  1  
ATOM   538   S  SG  . CYS A 1 69 ? 2.397   -1.085  6.327   1.00 0.00 ? 69 CYS A SG  1  
ATOM   539   N  N   . LYS A 1 70 ? 4.581   0.550   8.638   1.00 0.00 ? 70 LYS A N   1  
ATOM   540   C  CA  . LYS A 1 70 ? 5.994   0.291   8.411   1.00 0.00 ? 70 LYS A CA  1  
ATOM   541   C  C   . LYS A 1 70 ? 6.307   -1.174  8.666   1.00 0.00 ? 70 LYS A C   1  
ATOM   542   O  O   . LYS A 1 70 ? 7.421   -1.567  9.034   1.00 0.00 ? 70 LYS A O   1  
ATOM   543   C  CB  . LYS A 1 70 ? 6.857   1.203   9.322   1.00 0.00 ? 70 LYS A CB  1  
ATOM   544   C  CG  . LYS A 1 70 ? 6.670   2.714   9.037   1.00 0.00 ? 70 LYS A CG  1  
ATOM   545   C  CD  . LYS A 1 70 ? 6.980   3.635   10.221  1.00 0.00 ? 70 LYS A CD  1  
ATOM   546   C  CE  . LYS A 1 70 ? 8.470   3.525   10.570  1.00 0.00 ? 70 LYS A CE  1  
ATOM   547   N  NZ  . LYS A 1 70 ? 8.616   3.222   12.005  1.00 0.00 ? 70 LYS A NZ  1  
ATOM   548   N  N   . ARG A 1 71 ? 5.171   -2.106  8.481   1.00 0.00 ? 71 ARG A N   1  
ATOM   549   C  CA  . ARG A 1 71 ? 5.229   -3.525  8.824   1.00 0.00 ? 71 ARG A CA  1  
ATOM   550   C  C   . ARG A 1 71 ? 4.164   -4.296  8.070   1.00 0.00 ? 71 ARG A C   1  
ATOM   551   O  O   . ARG A 1 71 ? 3.568   -5.251  8.578   1.00 0.00 ? 71 ARG A O   1  
ATOM   552   C  CB  . ARG A 1 71 ? 5.085   -3.691  10.359  1.00 0.00 ? 71 ARG A CB  1  
ATOM   553   C  CG  . ARG A 1 71 ? 6.385   -4.114  11.097  1.00 0.00 ? 71 ARG A CG  1  
ATOM   554   C  CD  . ARG A 1 71 ? 6.832   -3.081  12.140  1.00 0.00 ? 71 ARG A CD  1  
ATOM   555   N  NE  . ARG A 1 71 ? 8.077   -3.574  12.782  1.00 0.00 ? 71 ARG A NE  1  
ATOM   556   C  CZ  . ARG A 1 71 ? 8.168   -4.635  13.572  1.00 0.00 ? 71 ARG A CZ  1  
ATOM   557   N  NH1 . ARG A 1 71 ? 7.167   -5.400  13.892  1.00 0.00 ? 71 ARG A NH1 1  
ATOM   558   N  NH2 . ARG A 1 71 ? 9.327   -4.920  14.051  1.00 0.00 ? 71 ARG A NH2 1  
ATOM   559   N  N   . CYS A 1 72 ? 3.956   -3.911  6.652   1.00 0.00 ? 72 CYS A N   1  
ATOM   560   C  CA  . CYS A 1 72 ? 2.877   -4.350  5.744   1.00 0.00 ? 72 CYS A CA  1  
ATOM   561   C  C   . CYS A 1 72 ? 1.883   -5.163  6.535   1.00 0.00 ? 72 CYS A C   1  
ATOM   562   O  O   . CYS A 1 72 ? 1.430   -6.292  6.345   1.00 0.00 ? 72 CYS A O   1  
ATOM   563   C  CB  . CYS A 1 72 ? 3.547   -4.850  4.456   1.00 0.00 ? 72 CYS A CB  1  
ATOM   564   S  SG  . CYS A 1 72 ? 4.260   -3.340  3.637   1.00 0.00 ? 72 CYS A SG  1  
ATOM   565   N  N   . GLN A 1 73 ? 1.389   -4.350  7.722   1.00 0.00 ? 73 GLN A N   1  
ATOM   566   C  CA  . GLN A 1 73 ? 0.284   -4.706  8.608   1.00 0.00 ? 73 GLN A CA  1  
ATOM   567   C  C   . GLN A 1 73 ? -0.911  -5.278  7.906   1.00 0.00 ? 73 GLN A C   1  
ATOM   568   O  O   . GLN A 1 73 ? -1.763  -4.556  7.365   1.00 0.00 ? 73 GLN A O   1  
ATOM   569   C  CB  . GLN A 1 73 ? -0.133  -3.394  9.369   1.00 0.00 ? 73 GLN A CB  1  
ATOM   570   C  CG  . GLN A 1 73 ? -0.895  -3.593  10.718  1.00 0.00 ? 73 GLN A CG  1  
ATOM   571   C  CD  . GLN A 1 73 ? -1.030  -2.401  11.678  1.00 0.00 ? 73 GLN A CD  1  
ATOM   572   O  OE1 . GLN A 1 73 ? -0.725  -1.273  11.325  1.00 0.00 ? 73 GLN A OE1 1  
ATOM   573   N  NE2 . GLN A 1 73 ? -1.453  -2.590  12.901  1.00 0.00 ? 73 GLN A NE2 1  
ATOM   574   N  N   . PRO A 1 74 ? -1.040  -6.751  7.917   1.00 0.00 ? 74 PRO A N   1  
ATOM   575   C  CA  . PRO A 1 74 ? -2.175  -7.574  7.301   1.00 0.00 ? 74 PRO A CA  1  
ATOM   576   C  C   . PRO A 1 74 ? -3.519  -7.367  7.992   1.00 0.00 ? 74 PRO A C   1  
ATOM   577   O  O   . PRO A 1 74 ? -3.585  -6.785  9.082   1.00 0.00 ? 74 PRO A O   1  
ATOM   578   C  CB  . PRO A 1 74 ? -1.801  -9.041  7.439   1.00 0.00 ? 74 PRO A CB  1  
ATOM   579   C  CG  . PRO A 1 74 ? -0.290  -9.004  7.708   1.00 0.00 ? 74 PRO A CG  1  
ATOM   580   C  CD  . PRO A 1 74 ? -0.101  -7.721  8.530   1.00 0.00 ? 74 PRO A CD  1  
ATOM   581   N  N   . ASP A 1 75 ? -4.705  -7.930  7.313   1.00 0.00 ? 75 ASP A N   1  
ATOM   582   C  CA  . ASP A 1 75 ? -6.022  -7.949  7.940   1.00 0.00 ? 75 ASP A CA  1  
ATOM   583   C  C   . ASP A 1 75 ? -7.104  -8.300  6.945   1.00 0.00 ? 75 ASP A C   1  
ATOM   584   O  O   . ASP A 1 75 ? -7.646  -7.437  6.241   1.00 0.00 ? 75 ASP A O   1  
ATOM   585   C  CB  . ASP A 1 75 ? -6.314  -6.600  8.649   1.00 0.00 ? 75 ASP A CB  1  
ATOM   586   C  CG  . ASP A 1 75 ? -7.514  -6.570  9.606   1.00 0.00 ? 75 ASP A CG  1  
ATOM   587   O  OD1 . ASP A 1 75 ? -8.629  -7.160  9.079   1.00 0.00 ? 75 ASP A OD1 1  
ATOM   588   O  OD2 . ASP A 1 75 ? -7.468  -6.062  10.718  1.00 0.00 ? 75 ASP A OD2 1  
ATOM   589   N  N   . LYS A 1 76 ? -7.504  -9.722  6.888   1.00 0.00 ? 76 LYS A N   1  
ATOM   590   C  CA  . LYS A 1 76 ? -8.650  -10.177 6.106   1.00 0.00 ? 76 LYS A CA  1  
ATOM   591   C  C   . LYS A 1 76 ? -9.636  -10.917 6.985   1.00 0.00 ? 76 LYS A C   1  
ATOM   592   O  O   . LYS A 1 76 ? -9.325  -11.968 7.560   1.00 0.00 ? 76 LYS A O   1  
ATOM   593   C  CB  . LYS A 1 76 ? -8.163  -11.077 4.938   1.00 0.00 ? 76 LYS A CB  1  
ATOM   594   C  CG  . LYS A 1 76 ? -8.249  -10.388 3.553   1.00 0.00 ? 76 LYS A CG  1  
ATOM   595   C  CD  . LYS A 1 76 ? -9.564  -9.653  3.278   1.00 0.00 ? 76 LYS A CD  1  
ATOM   596   C  CE  . LYS A 1 76 ? -9.989  -9.903  1.825   1.00 0.00 ? 76 LYS A CE  1  
ATOM   597   N  NZ  . LYS A 1 76 ? -8.996  -9.305  0.914   1.00 0.00 ? 76 LYS A NZ  1  
ATOM   598   N  N   . ALA A 1 77 ? -10.991 -10.337 7.078   1.00 0.00 ? 77 ALA A N   1  
ATOM   599   C  CA  . ALA A 1 77 ? -12.028 -10.788 7.997   1.00 0.00 ? 77 ALA A CA  1  
ATOM   600   C  C   . ALA A 1 77 ? -11.616 -11.927 8.893   1.00 0.00 ? 77 ALA A C   1  
ATOM   601   O  O   . ALA A 1 77 ? -11.992 -13.091 8.690   1.00 0.00 ? 77 ALA A O   1  
ATOM   602   C  CB  . ALA A 1 77 ? -13.274 -11.128 7.148   1.00 0.00 ? 77 ALA A CB  1  
ATOM   603   N  N   . ASN A 1 78 ? -10.719 -11.585 10.021  1.00 0.00 ? 78 ASN A N   1  
ATOM   604   C  CA  . ASN A 1 78 ? -10.107 -12.612 10.860  1.00 0.00 ? 78 ASN A CA  1  
ATOM   605   C  C   . ASN A 1 78 ? -9.387  -13.636 10.014  1.00 0.00 ? 78 ASN A C   1  
ATOM   606   O  O   . ASN A 1 78 ? -9.919  -14.702 9.681   1.00 0.00 ? 78 ASN A O   1  
ATOM   607   C  CB  . ASN A 1 78 ? -11.199 -13.290 11.737  1.00 0.00 ? 78 ASN A CB  1  
ATOM   608   C  CG  . ASN A 1 78 ? -10.854 -13.534 13.210  1.00 0.00 ? 78 ASN A CG  1  
ATOM   609   O  OD1 . ASN A 1 78 ? -9.704  -13.684 13.596  1.00 0.00 ? 78 ASN A OD1 1  
ATOM   610   N  ND2 . ASN A 1 78 ? -11.823 -13.572 14.084  1.00 0.00 ? 78 ASN A ND2 1  
ATOM   611   N  N   . PRO A 1 79 ? -7.999  -13.298 9.633   1.00 0.00 ? 79 PRO A N   1  
ATOM   612   C  CA  . PRO A 1 79 ? -7.061  -14.145 8.775   1.00 0.00 ? 79 PRO A CA  1  
ATOM   613   C  C   . PRO A 1 79 ? -6.779  -15.532 9.313   1.00 0.00 ? 79 PRO A C   1  
ATOM   614   O  O   . PRO A 1 79 ? -6.868  -16.535 8.590   1.00 0.00 ? 79 PRO A O   1  
ATOM   615   C  CB  . PRO A 1 79 ? -5.745  -13.391 8.660   1.00 0.00 ? 79 PRO A CB  1  
ATOM   616   C  CG  . PRO A 1 79 ? -5.773  -12.470 9.889   1.00 0.00 ? 79 PRO A CG  1  
ATOM   617   C  CD  . PRO A 1 79 ? -7.251  -12.073 10.008  1.00 0.00 ? 79 PRO A CD  1  
ATOM   618   N  N   . ARG A 1 80 ? -6.430  -15.633 10.746  1.00 0.00 ? 80 ARG A N   1  
ATOM   619   C  CA  . ARG A 1 80 ? -6.211  -16.922 11.398  1.00 0.00 ? 80 ARG A CA  1  
ATOM   620   C  C   . ARG A 1 80 ? -7.465  -17.764 11.365  1.00 0.00 ? 80 ARG A C   1  
ATOM   621   O  O   . ARG A 1 80 ? -7.509  -18.844 10.760  1.00 0.00 ? 80 ARG A O   1  
ATOM   622   C  CB  . ARG A 1 80 ? -5.727  -16.677 12.853  1.00 0.00 ? 80 ARG A CB  1  
ATOM   623   C  CG  . ARG A 1 80 ? -4.230  -17.001 13.106  1.00 0.00 ? 80 ARG A CG  1  
ATOM   624   C  CD  . ARG A 1 80 ? -3.689  -16.339 14.380  1.00 0.00 ? 80 ARG A CD  1  
ATOM   625   N  NE  . ARG A 1 80 ? -2.228  -16.593 14.455  1.00 0.00 ? 80 ARG A NE  1  
ATOM   626   C  CZ  . ARG A 1 80 ? -1.481  -16.476 15.544  1.00 0.00 ? 80 ARG A CZ  1  
ATOM   627   N  NH1 . ARG A 1 80 ? -1.933  -16.115 16.708  1.00 0.00 ? 80 ARG A NH1 1  
ATOM   628   N  NH2 . ARG A 1 80 ? -0.227  -16.740 15.435  1.00 0.00 ? 80 ARG A NH2 1  
ATOM   629   N  N   . GLN A 1 81 ? -8.622  -17.245 12.127  1.00 0.00 ? 81 GLN A N   1  
ATOM   630   C  CA  . GLN A 1 81 ? -9.878  -17.982 12.233  1.00 0.00 ? 81 GLN A CA  1  
ATOM   631   C  C   . GLN A 1 81 ? -10.328 -18.493 10.885  1.00 0.00 ? 81 GLN A C   1  
ATOM   632   O  O   . GLN A 1 81 ? -10.073 -19.644 10.504  1.00 0.00 ? 81 GLN A O   1  
ATOM   633   C  CB  . GLN A 1 81 ? -10.945 -17.053 12.854  1.00 0.00 ? 81 GLN A CB  1  
ATOM   634   C  CG  . GLN A 1 81 ? -10.880 -16.869 14.407  1.00 0.00 ? 81 GLN A CG  1  
ATOM   635   C  CD  . GLN A 1 81 ? -11.605 -17.875 15.309  1.00 0.00 ? 81 GLN A CD  1  
ATOM   636   O  OE1 . GLN A 1 81 ? -11.136 -18.981 15.527  1.00 0.00 ? 81 GLN A OE1 1  
ATOM   637   N  NE2 . GLN A 1 81 ? -12.748 -17.554 15.860  1.00 0.00 ? 81 GLN A NE2 1  
ATOM   638   N  N   . HIS A 1 82 ? -11.124 -17.557 10.061  1.00 0.00 ? 82 HIS A N   1  
ATOM   639   C  CA  . HIS A 1 82 ? -11.764 -17.971 8.816   1.00 0.00 ? 82 HIS A CA  1  
ATOM   640   C  C   . HIS A 1 82 ? -10.776 -17.973 7.673   1.00 0.00 ? 82 HIS A C   1  
ATOM   641   O  O   . HIS A 1 82 ? -9.561  -17.822 7.861   1.00 0.00 ? 82 HIS A O   1  
ATOM   642   C  CB  . HIS A 1 82 ? -12.889 -16.957 8.548   1.00 0.00 ? 82 HIS A CB  1  
ATOM   643   C  CG  . HIS A 1 82 ? -14.077 -17.176 9.438   1.00 0.00 ? 82 HIS A CG  1  
ATOM   644   N  ND1 . HIS A 1 82 ? -15.274 -16.465 9.389   1.00 0.00 ? 82 HIS A ND1 1  
ATOM   645   C  CD2 . HIS A 1 82 ? -14.101 -18.142 10.435  1.00 0.00 ? 82 HIS A CD2 1  
ATOM   646   C  CE1 . HIS A 1 82 ? -15.943 -17.071 10.388  1.00 0.00 ? 82 HIS A CE1 1  
ATOM   647   N  NE2 . HIS A 1 82 ? -15.320 -18.078 11.058  1.00 0.00 ? 82 HIS A NE2 1  
ATOM   648   N  N   . ARG A 1 83 ? -11.338 -18.185 6.322   1.00 0.00 ? 83 ARG A N   1  
ATOM   649   C  CA  . ARG A 1 83 ? -10.493 -18.250 5.133   1.00 0.00 ? 83 ARG A CA  1  
ATOM   650   C  C   . ARG A 1 83 ? -11.330 -18.363 3.880   1.00 0.00 ? 83 ARG A C   1  
ATOM   651   O  O   . ARG A 1 83 ? -11.842 -17.369 3.346   1.00 0.00 ? 83 ARG A O   1  
ATOM   652   C  CB  . ARG A 1 83 ? -9.516  -19.449 5.273   1.00 0.00 ? 83 ARG A CB  1  
ATOM   653   C  CG  . ARG A 1 83 ? -8.621  -19.712 4.033   1.00 0.00 ? 83 ARG A CG  1  
ATOM   654   C  CD  . ARG A 1 83 ? -7.179  -20.068 4.414   1.00 0.00 ? 83 ARG A CD  1  
ATOM   655   N  NE  . ARG A 1 83 ? -6.299  -19.751 3.260   1.00 0.00 ? 83 ARG A NE  1  
ATOM   656   C  CZ  . ARG A 1 83 ? -4.996  -19.990 3.197   1.00 0.00 ? 83 ARG A CZ  1  
ATOM   657   N  NH1 . ARG A 1 83 ? -4.305  -20.545 4.148   1.00 0.00 ? 83 ARG A NH1 1  
ATOM   658   N  NH2 . ARG A 1 83 ? -4.381  -19.646 2.121   1.00 0.00 ? 83 ARG A NH2 1  
ATOM   659   N  N   . LEU A 1 84 ? -11.530 -19.727 3.345   1.00 0.00 ? 84 LEU A N   1  
ATOM   660   C  CA  . LEU A 1 84 ? -12.184 -19.967 2.062   1.00 0.00 ? 84 LEU A CA  1  
ATOM   661   C  C   . LEU A 1 84 ? -11.576 -19.112 0.975   1.00 0.00 ? 84 LEU A C   1  
ATOM   662   O  O   . LEU A 1 84 ? -12.004 -17.978 0.721   1.00 0.00 ? 84 LEU A O   1  
ATOM   663   C  CB  . LEU A 1 84 ? -13.715 -19.716 2.173   1.00 0.00 ? 84 LEU A CB  1  
ATOM   664   C  CG  . LEU A 1 84 ? -14.648 -20.946 2.335   1.00 0.00 ? 84 LEU A CG  1  
ATOM   665   C  CD1 . LEU A 1 84 ? -15.027 -21.506 0.957   1.00 0.00 ? 84 LEU A CD1 1  
ATOM   666   C  CD2 . LEU A 1 84 ? -14.021 -22.059 3.192   1.00 0.00 ? 84 LEU A CD2 1  
ATOM   667   N  N   . ASP A 1 85 ? -10.466 -19.718 0.208   1.00 0.00 ? 85 ASP A N   1  
ATOM   668   C  CA  . ASP A 1 85 ? -9.752  -18.984 -0.832  1.00 0.00 ? 85 ASP A CA  1  
ATOM   669   C  C   . ASP A 1 85 ? -10.603 -18.834 -2.071  1.00 0.00 ? 85 ASP A C   1  
ATOM   670   O  O   . ASP A 1 85 ? -10.579 -17.803 -2.758  1.00 0.00 ? 85 ASP A O   1  
ATOM   671   C  CB  . ASP A 1 85 ? -8.396  -19.671 -1.142  1.00 0.00 ? 85 ASP A CB  1  
ATOM   672   C  CG  . ASP A 1 85 ? -7.347  -18.825 -1.877  1.00 0.00 ? 85 ASP A CG  1  
ATOM   673   O  OD1 . ASP A 1 85 ? -7.683  -18.578 -3.179  1.00 0.00 ? 85 ASP A OD1 1  
ATOM   674   O  OD2 . ASP A 1 85 ? -6.329  -18.412 -1.341  1.00 0.00 ? 85 ASP A OD2 1  
ATOM   675   N  N   . LYS A 1 86 ? -11.437 -19.999 -2.438  1.00 0.00 ? 86 LYS A N   1  
ATOM   676   C  CA  . LYS A 1 86 ? -12.381 -19.955 -3.550  1.00 0.00 ? 86 LYS A CA  1  
ATOM   677   C  C   . LYS A 1 86 ? -13.797 -20.168 -3.067  1.00 0.00 ? 86 LYS A C   1  
ATOM   678   O  O   . LYS A 1 86 ? -14.096 -20.083 -1.868  1.00 0.00 ? 86 LYS A O   1  
ATOM   679   C  CB  . LYS A 1 86 ? -11.988 -21.024 -4.606  1.00 0.00 ? 86 LYS A CB  1  
ATOM   680   C  CG  . LYS A 1 86 ? -10.466 -21.084 -4.885  1.00 0.00 ? 86 LYS A CG  1  
ATOM   681   C  CD  . LYS A 1 86 ? -10.076 -21.802 -6.181  1.00 0.00 ? 86 LYS A CD  1  
ATOM   682   C  CE  . LYS A 1 86 ? -10.875 -21.208 -7.348  1.00 0.00 ? 86 LYS A CE  1  
ATOM   683   N  NZ  . LYS A 1 86 ? -10.082 -21.309 -8.586  1.00 0.00 ? 86 LYS A NZ  1  
ATOM   684   N  N   . ILE A 1 87 ? -14.804 -20.476 -4.104  1.00 0.00 ? 87 ILE A N   1  
ATOM   685   C  CA  . ILE A 1 87 ? -16.209 -20.700 -3.777  1.00 0.00 ? 87 ILE A CA  1  
ATOM   686   C  C   . ILE A 1 87 ? -16.699 -22.005 -4.360  1.00 0.00 ? 87 ILE A C   1  
ATOM   687   O  O   . ILE A 1 87 ? -17.876 -22.161 -4.711  1.00 0.00 ? 87 ILE A O   1  
ATOM   688   C  CB  . ILE A 1 87 ? -17.110 -19.479 -4.230  1.00 0.00 ? 87 ILE A CB  1  
ATOM   689   C  CG1 . ILE A 1 87 ? -17.299 -19.346 -5.775  1.00 0.00 ? 87 ILE A CG1 1  
ATOM   690   C  CG2 . ILE A 1 87 ? -16.592 -18.112 -3.686  1.00 0.00 ? 87 ILE A CG2 1  
ATOM   691   C  CD1 . ILE A 1 87 ? -16.068 -18.855 -6.564  1.00 0.00 ? 87 ILE A CD1 1  
ATOM   692   N  N   . THR A 1 88 ? -15.699 -23.089 -4.471  1.00 0.00 ? 88 THR A N   1  
ATOM   693   C  CA  . THR A 1 88 ? -16.056 -24.426 -4.936  1.00 0.00 ? 88 THR A CA  1  
ATOM   694   C  C   . THR A 1 88 ? -15.932 -25.438 -3.821  1.00 0.00 ? 88 THR A C   1  
ATOM   695   O  O   . THR A 1 88 ? -15.040 -26.297 -3.816  1.00 0.00 ? 88 THR A O   1  
ATOM   696   C  CB  . THR A 1 88 ? -15.168 -24.839 -6.158  1.00 0.00 ? 88 THR A CB  1  
ATOM   697   O  OG1 . THR A 1 88 ? -15.316 -23.906 -7.220  1.00 0.00 ? 88 THR A OG1 1  
ATOM   698   C  CG2 . THR A 1 88 ? -15.481 -26.208 -6.800  1.00 0.00 ? 88 THR A CG2 1  
ATOM   699   N  N   . HIS A 1 89 ? -16.919 -25.329 -2.725  1.00 0.00 ? 89 HIS A N   1  
ATOM   700   C  CA  . HIS A 1 89 ? -16.970 -26.293 -1.629  1.00 0.00 ? 89 HIS A CA  1  
ATOM   701   C  C   . HIS A 1 89 ? -18.389 -26.736 -1.363  1.00 0.00 ? 89 HIS A C   1  
ATOM   702   O  O   . HIS A 1 89 ? -19.250 -25.949 -0.946  1.00 0.00 ? 89 HIS A O   1  
ATOM   703   C  CB  . HIS A 1 89 ? -16.391 -25.579 -0.397  1.00 0.00 ? 89 HIS A CB  1  
ATOM   704   C  CG  . HIS A 1 89 ? -16.797 -26.239 0.888   1.00 0.00 ? 89 HIS A CG  1  
ATOM   705   N  ND1 . HIS A 1 89 ? -16.390 -27.498 1.322   1.00 0.00 ? 89 HIS A ND1 1  
ATOM   706   C  CD2 . HIS A 1 89 ? -17.651 -25.638 1.803   1.00 0.00 ? 89 HIS A CD2 1  
ATOM   707   C  CE1 . HIS A 1 89 ? -17.046 -27.560 2.496   1.00 0.00 ? 89 HIS A CE1 1  
ATOM   708   N  NE2 . HIS A 1 89 ? -17.816 -26.498 2.857   1.00 0.00 ? 89 HIS A NE2 1  
ATOM   709   N  N   . ALA A 1 90 ? -18.694 -28.158 -1.632  1.00 0.00 ? 90 ALA A N   1  
ATOM   710   C  CA  . ALA A 1 90 ? -20.026 -28.717 -1.420  1.00 0.00 ? 90 ALA A CA  1  
ATOM   711   C  C   . ALA A 1 90 ? -19.941 -30.121 -0.869  1.00 0.00 ? 90 ALA A C   1  
ATOM   712   O  O   . ALA A 1 90 ? -20.667 -30.502 0.059   1.00 0.00 ? 90 ALA A O   1  
ATOM   713   C  CB  . ALA A 1 90 ? -20.780 -28.647 -2.759  1.00 0.00 ? 90 ALA A CB  1  
ATOM   714   N  N   . CYS A 1 91 ? -18.929 -31.007 -1.485  1.00 0.00 ? 91 CYS A N   1  
ATOM   715   C  CA  . CYS A 1 91 ? -18.705 -32.370 -1.014  1.00 0.00 ? 91 CYS A CA  1  
ATOM   716   C  C   . CYS A 1 91 ? -17.256 -32.582 -0.642  1.00 0.00 ? 91 CYS A C   1  
ATOM   717   O  O   . CYS A 1 91 ? -16.466 -31.635 -0.533  1.00 0.00 ? 91 CYS A O   1  
ATOM   718   C  CB  . CYS A 1 91 ? -19.182 -33.351 -2.103  1.00 0.00 ? 91 CYS A CB  1  
ATOM   719   S  SG  . CYS A 1 91 ? -20.602 -32.677 -2.994  1.00 0.00 ? 91 CYS A SG  1  
ATOM   720   N  N   . ARG A 1 92 ? -16.841 -33.980 -0.393  1.00 0.00 ? 92 ARG A N   1  
ATOM   721   C  CA  . ARG A 1 92 ? -15.514 -34.314 0.117   1.00 0.00 ? 92 ARG A CA  1  
ATOM   722   C  C   . ARG A 1 92 ? -15.221 -33.566 1.395   1.00 0.00 ? 92 ARG A C   1  
ATOM   723   O  O   . ARG A 1 92 ? -15.805 -33.819 2.446   1.00 0.00 ? 92 ARG A O   1  
ATOM   724   C  CB  . ARG A 1 92 ? -14.460 -33.999 -0.979  1.00 0.00 ? 92 ARG A CB  1  
ATOM   725   C  CG  . ARG A 1 92 ? -13.042 -34.568 -0.705  1.00 0.00 ? 92 ARG A CG  1  
ATOM   726   C  CD  . ARG A 1 92 ? -12.340 -35.038 -1.986  1.00 0.00 ? 92 ARG A CD  1  
ATOM   727   N  NE  . ARG A 1 92 ? -12.623 -36.485 -2.170  1.00 0.00 ? 92 ARG A NE  1  
ATOM   728   C  CZ  . ARG A 1 92 ? -12.003 -37.476 -1.544  1.00 0.00 ? 92 ARG A CZ  1  
ATOM   729   N  NH1 . ARG A 1 92 ? -11.051 -37.313 -0.673  1.00 0.00 ? 92 ARG A NH1 1  
ATOM   730   N  NH2 . ARG A 1 92 ? -12.373 -38.676 -1.821  1.00 0.00 ? 92 ARG A NH2 1  
ATOM   731   O  OXT . ARG A 1 92 ? -14.234 -32.535 1.306   1.00 0.00 ? 92 ARG A OXT 1  
HETATM 732   ZN ZN  . ZN  B 2 .  ? 2.604   -1.699  4.192   1.00 0.00 ? 93 ZN  A ZN  1  
ATOM   733   N  N   . MET A 1 1  ? 3.111   21.578  -7.993  1.00 0.00 ? 1  MET A N   2  
ATOM   734   C  CA  . MET A 1 1  ? 2.850   22.604  -8.998  1.00 0.00 ? 1  MET A CA  2  
ATOM   735   C  C   . MET A 1 1  ? 3.375   22.182  -10.351 1.00 0.00 ? 1  MET A C   2  
ATOM   736   O  O   . MET A 1 1  ? 3.760   21.025  -10.571 1.00 0.00 ? 1  MET A O   2  
ATOM   737   C  CB  . MET A 1 1  ? 1.327   22.903  -9.065  1.00 0.00 ? 1  MET A CB  2  
ATOM   738   C  CG  . MET A 1 1  ? 0.460   21.831  -9.760  1.00 0.00 ? 1  MET A CG  2  
ATOM   739   S  SD  . MET A 1 1  ? -0.843  22.625  -10.715 1.00 0.00 ? 1  MET A SD  2  
ATOM   740   C  CE  . MET A 1 1  ? -2.004  22.934  -9.377  1.00 0.00 ? 1  MET A CE  2  
ATOM   741   N  N   . LYS A 1 2  ? 3.423   23.234  -11.392 1.00 0.00 ? 2  LYS A N   2  
ATOM   742   C  CA  . LYS A 1 2  ? 4.005   22.988  -12.707 1.00 0.00 ? 2  LYS A CA  2  
ATOM   743   C  C   . LYS A 1 2  ? 3.279   21.870  -13.420 1.00 0.00 ? 2  LYS A C   2  
ATOM   744   O  O   . LYS A 1 2  ? 2.369   21.229  -12.876 1.00 0.00 ? 2  LYS A O   2  
ATOM   745   C  CB  . LYS A 1 2  ? 5.514   22.655  -12.550 1.00 0.00 ? 2  LYS A CB  2  
ATOM   746   C  CG  . LYS A 1 2  ? 6.430   23.902  -12.619 1.00 0.00 ? 2  LYS A CG  2  
ATOM   747   C  CD  . LYS A 1 2  ? 7.700   23.724  -13.456 1.00 0.00 ? 2  LYS A CD  2  
ATOM   748   C  CE  . LYS A 1 2  ? 8.862   24.460  -12.776 1.00 0.00 ? 2  LYS A CE  2  
ATOM   749   N  NZ  . LYS A 1 2  ? 8.464   25.851  -12.497 1.00 0.00 ? 2  LYS A NZ  2  
ATOM   750   N  N   . LYS A 1 3  ? 3.703   21.598  -14.811 1.00 0.00 ? 3  LYS A N   2  
ATOM   751   C  CA  . LYS A 1 3  ? 3.033   20.603  -15.643 1.00 0.00 ? 3  LYS A CA  2  
ATOM   752   C  C   . LYS A 1 3  ? 3.844   19.330  -15.723 1.00 0.00 ? 3  LYS A C   2  
ATOM   753   O  O   . LYS A 1 3  ? 4.457   19.010  -16.750 1.00 0.00 ? 3  LYS A O   2  
ATOM   754   C  CB  . LYS A 1 3  ? 2.786   21.193  -17.059 1.00 0.00 ? 3  LYS A CB  2  
ATOM   755   C  CG  . LYS A 1 3  ? 1.819   22.403  -17.062 1.00 0.00 ? 3  LYS A CG  2  
ATOM   756   C  CD  . LYS A 1 3  ? 1.618   23.063  -18.428 1.00 0.00 ? 3  LYS A CD  2  
ATOM   757   C  CE  . LYS A 1 3  ? 1.121   24.501  -18.227 1.00 0.00 ? 3  LYS A CE  2  
ATOM   758   N  NZ  . LYS A 1 3  ? 0.674   25.050  -19.520 1.00 0.00 ? 3  LYS A NZ  2  
ATOM   759   N  N   . ALA A 1 4  ? 3.855   18.484  -14.509 1.00 0.00 ? 4  ALA A N   2  
ATOM   760   C  CA  . ALA A 1 4  ? 4.552   17.202  -14.470 1.00 0.00 ? 4  ALA A CA  2  
ATOM   761   C  C   . ALA A 1 4  ? 4.067   16.289  -15.573 1.00 0.00 ? 4  ALA A C   2  
ATOM   762   O  O   . ALA A 1 4  ? 2.997   16.492  -16.163 1.00 0.00 ? 4  ALA A O   2  
ATOM   763   C  CB  . ALA A 1 4  ? 4.354   16.599  -13.069 1.00 0.00 ? 4  ALA A CB  2  
ATOM   764   N  N   . THR A 1 5  ? 4.935   15.138  -15.899 1.00 0.00 ? 5  THR A N   2  
ATOM   765   C  CA  . THR A 1 5  ? 4.630   14.217  -16.992 1.00 0.00 ? 5  THR A CA  2  
ATOM   766   C  C   . THR A 1 5  ? 4.905   12.790  -16.583 1.00 0.00 ? 5  THR A C   2  
ATOM   767   O  O   . THR A 1 5  ? 4.750   12.415  -15.407 1.00 0.00 ? 5  THR A O   2  
ATOM   768   C  CB  . THR A 1 5  ? 5.437   14.608  -18.276 1.00 0.00 ? 5  THR A CB  2  
ATOM   769   O  OG1 . THR A 1 5  ? 6.812   14.283  -18.120 1.00 0.00 ? 5  THR A OG1 2  
ATOM   770   C  CG2 . THR A 1 5  ? 5.433   16.104  -18.659 1.00 0.00 ? 5  THR A CG2 2  
ATOM   771   N  N   . CYS A 1 6  ? 5.327   11.847  -17.642 1.00 0.00 ? 6  CYS A N   2  
ATOM   772   C  CA  . CYS A 1 6  ? 5.497   10.421  -17.380 1.00 0.00 ? 6  CYS A CA  2  
ATOM   773   C  C   . CYS A 1 6  ? 6.672   10.165  -16.467 1.00 0.00 ? 6  CYS A C   2  
ATOM   774   O  O   . CYS A 1 6  ? 6.807   9.082   -15.873 1.00 0.00 ? 6  CYS A O   2  
ATOM   775   C  CB  . CYS A 1 6  ? 5.628   9.681   -18.726 1.00 0.00 ? 6  CYS A CB  2  
ATOM   776   S  SG  . CYS A 1 6  ? 7.299   9.852   -19.391 1.00 0.00 ? 6  CYS A SG  2  
ATOM   777   N  N   . LEU A 1 7  ? 7.675   11.244  -16.339 1.00 0.00 ? 7  LEU A N   2  
ATOM   778   C  CA  . LEU A 1 7  ? 8.915   11.062  -15.592 1.00 0.00 ? 7  LEU A CA  2  
ATOM   779   C  C   . LEU A 1 7  ? 8.737   11.367  -14.124 1.00 0.00 ? 7  LEU A C   2  
ATOM   780   O  O   . LEU A 1 7  ? 9.710   11.661  -13.405 1.00 0.00 ? 7  LEU A O   2  
ATOM   781   C  CB  . LEU A 1 7  ? 10.051  11.936  -16.200 1.00 0.00 ? 7  LEU A CB  2  
ATOM   782   C  CG  . LEU A 1 7  ? 9.826   13.469  -16.295 1.00 0.00 ? 7  LEU A CG  2  
ATOM   783   C  CD1 . LEU A 1 7  ? 10.324  14.156  -15.016 1.00 0.00 ? 7  LEU A CD1 2  
ATOM   784   C  CD2 . LEU A 1 7  ? 10.512  14.095  -17.520 1.00 0.00 ? 7  LEU A CD2 2  
ATOM   785   N  N   . THR A 1 8  ? 7.366   11.303  -13.574 1.00 0.00 ? 8  THR A N   2  
ATOM   786   C  CA  . THR A 1 8  ? 7.077   11.650  -12.184 1.00 0.00 ? 8  THR A CA  2  
ATOM   787   C  C   . THR A 1 8  ? 6.082   10.689  -11.577 1.00 0.00 ? 8  THR A C   2  
ATOM   788   O  O   . THR A 1 8  ? 6.406   9.896   -10.682 1.00 0.00 ? 8  THR A O   2  
ATOM   789   C  CB  . THR A 1 8  ? 6.557   13.123  -12.081 1.00 0.00 ? 8  THR A CB  2  
ATOM   790   O  OG1 . THR A 1 8  ? 6.039   13.558  -13.332 1.00 0.00 ? 8  THR A OG1 2  
ATOM   791   C  CG2 . THR A 1 8  ? 7.602   14.195  -11.703 1.00 0.00 ? 8  THR A CG2 2  
ATOM   792   N  N   . ASP A 1 9  ? 4.712   10.721  -12.133 1.00 0.00 ? 9  ASP A N   2  
ATOM   793   C  CA  . ASP A 1 9  ? 3.615   9.971   -11.529 1.00 0.00 ? 9  ASP A CA  2  
ATOM   794   C  C   . ASP A 1 9  ? 3.735   8.493   -11.816 1.00 0.00 ? 9  ASP A C   2  
ATOM   795   O  O   . ASP A 1 9  ? 3.333   7.640   -11.010 1.00 0.00 ? 9  ASP A O   2  
ATOM   796   C  CB  . ASP A 1 9  ? 2.250   10.541  -11.994 1.00 0.00 ? 9  ASP A CB  2  
ATOM   797   C  CG  . ASP A 1 9  ? 1.061   10.343  -11.042 1.00 0.00 ? 9  ASP A CG  2  
ATOM   798   O  OD1 . ASP A 1 9  ? 0.854   9.031   -10.719 1.00 0.00 ? 9  ASP A OD1 2  
ATOM   799   O  OD2 . ASP A 1 9  ? 0.392   11.270  -10.609 1.00 0.00 ? 9  ASP A OD2 2  
ATOM   800   N  N   . ASP A 1 10 ? 4.322   8.114   -13.121 1.00 0.00 ? 10 ASP A N   2  
ATOM   801   C  CA  . ASP A 1 10 ? 4.401   6.718   -13.548 1.00 0.00 ? 10 ASP A CA  2  
ATOM   802   C  C   . ASP A 1 10 ? 5.473   5.982   -12.782 1.00 0.00 ? 10 ASP A C   2  
ATOM   803   O  O   . ASP A 1 10 ? 5.239   4.925   -12.177 1.00 0.00 ? 10 ASP A O   2  
ATOM   804   C  CB  . ASP A 1 10 ? 4.614   6.628   -15.081 1.00 0.00 ? 10 ASP A CB  2  
ATOM   805   C  CG  . ASP A 1 10 ? 3.361   6.751   -15.960 1.00 0.00 ? 10 ASP A CG  2  
ATOM   806   O  OD1 . ASP A 1 10 ? 2.209   6.454   -15.285 1.00 0.00 ? 10 ASP A OD1 2  
ATOM   807   O  OD2 . ASP A 1 10 ? 3.403   7.062   -17.141 1.00 0.00 ? 10 ASP A OD2 2  
ATOM   808   N  N   . GLN A 1 11 ? 6.817   6.605   -12.754 1.00 0.00 ? 11 GLN A N   2  
ATOM   809   C  CA  . GLN A 1 11 ? 7.924   6.015   -12.006 1.00 0.00 ? 11 GLN A CA  2  
ATOM   810   C  C   . GLN A 1 11 ? 7.572   5.885   -10.541 1.00 0.00 ? 11 GLN A C   2  
ATOM   811   O  O   . GLN A 1 11 ? 7.849   4.874   -9.881  1.00 0.00 ? 11 GLN A O   2  
ATOM   812   C  CB  . GLN A 1 11 ? 9.176   6.897   -12.196 1.00 0.00 ? 11 GLN A CB  2  
ATOM   813   C  CG  . GLN A 1 11 ? 9.715   7.033   -13.658 1.00 0.00 ? 11 GLN A CG  2  
ATOM   814   C  CD  . GLN A 1 11 ? 11.225  7.180   -13.887 1.00 0.00 ? 11 GLN A CD  2  
ATOM   815   O  OE1 . GLN A 1 11 ? 11.662  7.893   -14.777 1.00 0.00 ? 11 GLN A OE1 2  
ATOM   816   N  NE2 . GLN A 1 11 ? 12.068  6.548   -13.111 1.00 0.00 ? 11 GLN A NE2 2  
ATOM   817   N  N   . ARG A 1 12 ? 6.871   7.041   -9.941  1.00 0.00 ? 12 ARG A N   2  
ATOM   818   C  CA  . ARG A 1 12 ? 6.330   7.037   -8.588  1.00 0.00 ? 12 ARG A CA  2  
ATOM   819   C  C   . ARG A 1 12 ? 5.644   5.740   -8.234  1.00 0.00 ? 12 ARG A C   2  
ATOM   820   O  O   . ARG A 1 12 ? 6.153   4.866   -7.503  1.00 0.00 ? 12 ARG A O   2  
ATOM   821   C  CB  . ARG A 1 12 ? 5.316   8.222   -8.470  1.00 0.00 ? 12 ARG A CB  2  
ATOM   822   C  CG  . ARG A 1 12 ? 5.910   9.554   -7.950  1.00 0.00 ? 12 ARG A CG  2  
ATOM   823   C  CD  . ARG A 1 12 ? 7.445   9.568   -7.965  1.00 0.00 ? 12 ARG A CD  2  
ATOM   824   N  NE  . ARG A 1 12 ? 7.896   10.982  -7.916  1.00 0.00 ? 12 ARG A NE  2  
ATOM   825   C  CZ  . ARG A 1 12 ? 7.665   11.830  -6.923  1.00 0.00 ? 12 ARG A CZ  2  
ATOM   826   N  NH1 . ARG A 1 12 ? 7.007   11.531  -5.842  1.00 0.00 ? 12 ARG A NH1 2  
ATOM   827   N  NH2 . ARG A 1 12 ? 8.124   13.025  -7.043  1.00 0.00 ? 12 ARG A NH2 2  
ATOM   828   N  N   . TRP A 1 13 ? 4.288   5.551   -8.813  1.00 0.00 ? 13 TRP A N   2  
ATOM   829   C  CA  . TRP A 1 13 ? 3.437   4.453   -8.385  1.00 0.00 ? 13 TRP A CA  2  
ATOM   830   C  C   . TRP A 1 13 ? 3.941   3.129   -8.907  1.00 0.00 ? 13 TRP A C   2  
ATOM   831   O  O   . TRP A 1 13 ? 3.751   2.073   -8.280  1.00 0.00 ? 13 TRP A O   2  
ATOM   832   C  CB  . TRP A 1 13 ? 1.970   4.666   -8.895  1.00 0.00 ? 13 TRP A CB  2  
ATOM   833   C  CG  . TRP A 1 13 ? 1.222   3.318   -8.839  1.00 0.00 ? 13 TRP A CG  2  
ATOM   834   C  CD1 . TRP A 1 13 ? 0.993   2.454   -9.928  1.00 0.00 ? 13 TRP A CD1 2  
ATOM   835   C  CD2 . TRP A 1 13 ? 0.760   2.667   -7.718  1.00 0.00 ? 13 TRP A CD2 2  
ATOM   836   N  NE1 . TRP A 1 13 ? 0.382   1.256   -9.508  1.00 0.00 ? 13 TRP A NE1 2  
ATOM   837   C  CE2 . TRP A 1 13 ? 0.254   1.409   -8.133  1.00 0.00 ? 13 TRP A CE2 2  
ATOM   838   C  CE3 . TRP A 1 13 ? 0.757   3.036   -6.347  1.00 0.00 ? 13 TRP A CE3 2  
ATOM   839   C  CZ2 . TRP A 1 13 ? -0.264  0.513   -7.172  1.00 0.00 ? 13 TRP A CZ2 2  
ATOM   840   C  CZ3 . TRP A 1 13 ? 0.224   2.140   -5.422  1.00 0.00 ? 13 TRP A CZ3 2  
ATOM   841   C  CH2 . TRP A 1 13 ? -0.282  0.896   -5.828  1.00 0.00 ? 13 TRP A CH2 2  
ATOM   842   N  N   . GLN A 1 14 ? 4.626   3.135   -10.220 1.00 0.00 ? 14 GLN A N   2  
ATOM   843   C  CA  . GLN A 1 14 ? 5.306   1.942   -10.725 1.00 0.00 ? 14 GLN A CA  2  
ATOM   844   C  C   . GLN A 1 14 ? 6.331   1.469   -9.714  1.00 0.00 ? 14 GLN A C   2  
ATOM   845   O  O   . GLN A 1 14 ? 6.631   0.274   -9.595  1.00 0.00 ? 14 GLN A O   2  
ATOM   846   C  CB  . GLN A 1 14 ? 5.966   2.249   -12.083 1.00 0.00 ? 14 GLN A CB  2  
ATOM   847   C  CG  . GLN A 1 14 ? 6.617   1.032   -12.824 1.00 0.00 ? 14 GLN A CG  2  
ATOM   848   C  CD  . GLN A 1 14 ? 7.575   1.287   -13.993 1.00 0.00 ? 14 GLN A CD  2  
ATOM   849   O  OE1 . GLN A 1 14 ? 8.189   2.338   -14.090 1.00 0.00 ? 14 GLN A OE1 2  
ATOM   850   N  NE2 . GLN A 1 14 ? 7.752   0.366   -14.906 1.00 0.00 ? 14 GLN A NE2 2  
ATOM   851   N  N   . SER A 1 15 ? 6.975   2.533   -8.907  1.00 0.00 ? 15 SER A N   2  
ATOM   852   C  CA  . SER A 1 15 ? 7.841   2.214   -7.776  1.00 0.00 ? 15 SER A CA  2  
ATOM   853   C  C   . SER A 1 15 ? 7.091   1.385   -6.756  1.00 0.00 ? 15 SER A C   2  
ATOM   854   O  O   . SER A 1 15 ? 7.649   0.438   -6.175  1.00 0.00 ? 15 SER A O   2  
ATOM   855   C  CB  . SER A 1 15 ? 8.482   3.476   -7.153  1.00 0.00 ? 15 SER A CB  2  
ATOM   856   O  OG  . SER A 1 15 ? 9.743   3.811   -7.744  1.00 0.00 ? 15 SER A OG  2  
ATOM   857   N  N   . VAL A 1 16 ? 5.682   1.783   -6.457  1.00 0.00 ? 16 VAL A N   2  
ATOM   858   C  CA  . VAL A 1 16 ? 4.850   0.919   -5.626  1.00 0.00 ? 16 VAL A CA  2  
ATOM   859   C  C   . VAL A 1 16 ? 4.894   -0.510  -6.113  1.00 0.00 ? 16 VAL A C   2  
ATOM   860   O  O   . VAL A 1 16 ? 5.201   -1.460  -5.350  1.00 0.00 ? 16 VAL A O   2  
ATOM   861   C  CB  . VAL A 1 16 ? 3.378   1.429   -5.401  1.00 0.00 ? 16 VAL A CB  2  
ATOM   862   C  CG1 . VAL A 1 16 ? 2.560   0.639   -4.320  1.00 0.00 ? 16 VAL A CG1 2  
ATOM   863   C  CG2 . VAL A 1 16 ? 3.284   2.908   -4.955  1.00 0.00 ? 16 VAL A CG2 2  
ATOM   864   N  N   . LEU A 1 17 ? 4.524   -0.774  -7.517  1.00 0.00 ? 17 LEU A N   2  
ATOM   865   C  CA  . LEU A 1 17 ? 4.535   -2.141  -8.087  1.00 0.00 ? 17 LEU A CA  2  
ATOM   866   C  C   . LEU A 1 17 ? 5.843   -2.815  -7.774  1.00 0.00 ? 17 LEU A C   2  
ATOM   867   O  O   . LEU A 1 17 ? 5.937   -4.006  -7.453  1.00 0.00 ? 17 LEU A O   2  
ATOM   868   C  CB  . LEU A 1 17 ? 4.263   -2.106  -9.617  1.00 0.00 ? 17 LEU A CB  2  
ATOM   869   C  CG  . LEU A 1 17 ? 3.031   -1.286  -10.102 1.00 0.00 ? 17 LEU A CG  2  
ATOM   870   C  CD1 . LEU A 1 17 ? 2.684   -1.662  -11.547 1.00 0.00 ? 17 LEU A CD1 2  
ATOM   871   C  CD2 . LEU A 1 17 ? 1.801   -1.481  -9.201  1.00 0.00 ? 17 LEU A CD2 2  
ATOM   872   N  N   . ALA A 1 18 ? 7.047   -1.956  -7.921  1.00 0.00 ? 18 ALA A N   2  
ATOM   873   C  CA  . ALA A 1 18 ? 8.399   -2.386  -7.583  1.00 0.00 ? 18 ALA A CA  2  
ATOM   874   C  C   . ALA A 1 18 ? 8.715   -2.138  -6.127  1.00 0.00 ? 18 ALA A C   2  
ATOM   875   O  O   . ALA A 1 18 ? 9.736   -1.533  -5.769  1.00 0.00 ? 18 ALA A O   2  
ATOM   876   C  CB  . ALA A 1 18 ? 9.368   -1.643  -8.528  1.00 0.00 ? 18 ALA A CB  2  
ATOM   877   N  N   . ARG A 1 19 ? 7.734   -2.652  -5.147  1.00 0.00 ? 19 ARG A N   2  
ATOM   878   C  CA  . ARG A 1 19 ? 7.789   -2.356  -3.722  1.00 0.00 ? 19 ARG A CA  2  
ATOM   879   C  C   . ARG A 1 19 ? 9.108   -2.700  -3.074  1.00 0.00 ? 19 ARG A C   2  
ATOM   880   O  O   . ARG A 1 19 ? 9.353   -2.302  -1.911  1.00 0.00 ? 19 ARG A O   2  
ATOM   881   C  CB  . ARG A 1 19 ? 6.621   -3.122  -3.020  1.00 0.00 ? 19 ARG A CB  2  
ATOM   882   C  CG  . ARG A 1 19 ? 6.423   -4.588  -3.482  1.00 0.00 ? 19 ARG A CG  2  
ATOM   883   C  CD  . ARG A 1 19 ? 6.966   -5.619  -2.482  1.00 0.00 ? 19 ARG A CD  2  
ATOM   884   N  NE  . ARG A 1 19 ? 6.912   -6.958  -3.123  1.00 0.00 ? 19 ARG A NE  2  
ATOM   885   C  CZ  . ARG A 1 19 ? 7.770   -7.948  -2.919  1.00 0.00 ? 19 ARG A CZ  2  
ATOM   886   N  NH1 . ARG A 1 19 ? 8.787   -7.882  -2.111  1.00 0.00 ? 19 ARG A NH1 2  
ATOM   887   N  NH2 . ARG A 1 19 ? 7.578   -9.043  -3.566  1.00 0.00 ? 19 ARG A NH2 2  
ATOM   888   N  N   . ASP A 1 20 ? 10.082  -3.533  -3.808  1.00 0.00 ? 20 ASP A N   2  
ATOM   889   C  CA  . ASP A 1 20 ? 11.280  -4.068  -3.166  1.00 0.00 ? 20 ASP A CA  2  
ATOM   890   C  C   . ASP A 1 20 ? 12.402  -3.102  -2.913  1.00 0.00 ? 20 ASP A C   2  
ATOM   891   O  O   . ASP A 1 20 ? 12.756  -2.756  -1.758  1.00 0.00 ? 20 ASP A O   2  
ATOM   892   C  CB  . ASP A 1 20 ? 11.725  -5.364  -3.913  1.00 0.00 ? 20 ASP A CB  2  
ATOM   893   C  CG  . ASP A 1 20 ? 13.151  -5.871  -3.675  1.00 0.00 ? 20 ASP A CG  2  
ATOM   894   O  OD1 . ASP A 1 20 ? 13.538  -6.296  -2.594  1.00 0.00 ? 20 ASP A OD1 2  
ATOM   895   O  OD2 . ASP A 1 20 ? 13.932  -5.823  -4.797  1.00 0.00 ? 20 ASP A OD2 2  
ATOM   896   N  N   . PRO A 1 21 ? 13.131  -2.568  -4.092  1.00 0.00 ? 21 PRO A N   2  
ATOM   897   C  CA  . PRO A 1 21 ? 14.333  -1.629  -4.090  1.00 0.00 ? 21 PRO A CA  2  
ATOM   898   C  C   . PRO A 1 21 ? 14.290  -0.128  -3.939  1.00 0.00 ? 21 PRO A C   2  
ATOM   899   O  O   . PRO A 1 21 ? 14.319  0.416   -2.827  1.00 0.00 ? 21 PRO A O   2  
ATOM   900   C  CB  . PRO A 1 21 ? 15.099  -1.969  -5.379  1.00 0.00 ? 21 PRO A CB  2  
ATOM   901   C  CG  . PRO A 1 21 ? 13.964  -2.306  -6.351  1.00 0.00 ? 21 PRO A CG  2  
ATOM   902   C  CD  . PRO A 1 21 ? 12.831  -2.892  -5.507  1.00 0.00 ? 21 PRO A CD  2  
ATOM   903   N  N   . ASN A 1 22 ? 14.297  0.671   -5.188  1.00 0.00 ? 22 ASN A N   2  
ATOM   904   C  CA  . ASN A 1 22 ? 14.514  2.092   -5.285  1.00 0.00 ? 22 ASN A CA  2  
ATOM   905   C  C   . ASN A 1 22 ? 13.085  2.724   -5.402  1.00 0.00 ? 22 ASN A C   2  
ATOM   906   O  O   . ASN A 1 22 ? 12.655  3.354   -6.369  1.00 0.00 ? 22 ASN A O   2  
ATOM   907   C  CB  . ASN A 1 22 ? 15.330  2.819   -6.388  1.00 0.00 ? 22 ASN A CB  2  
ATOM   908   C  CG  . ASN A 1 22 ? 15.307  4.352   -6.182  1.00 0.00 ? 22 ASN A CG  2  
ATOM   909   O  OD1 . ASN A 1 22 ? 15.784  5.132   -6.989  1.00 0.00 ? 22 ASN A OD1 2  
ATOM   910   N  ND2 . ASN A 1 22 ? 14.756  4.862   -5.085  1.00 0.00 ? 22 ASN A ND2 2  
ATOM   911   N  N   . ALA A 1 23 ? 12.279  2.442   -4.187  1.00 0.00 ? 23 ALA A N   2  
ATOM   912   C  CA  . ALA A 1 23 ? 10.891  2.860   -4.067  1.00 0.00 ? 23 ALA A CA  2  
ATOM   913   C  C   . ALA A 1 23 ? 10.503  3.045   -2.618  1.00 0.00 ? 23 ALA A C   2  
ATOM   914   O  O   . ALA A 1 23 ? 9.778   3.980   -2.254  1.00 0.00 ? 23 ALA A O   2  
ATOM   915   C  CB  . ALA A 1 23 ? 10.018  1.818   -4.788  1.00 0.00 ? 23 ALA A CB  2  
ATOM   916   N  N   . ASP A 1 24 ? 11.052  2.056   -1.667  1.00 0.00 ? 24 ASP A N   2  
ATOM   917   C  CA  . ASP A 1 24 ? 10.714  2.034   -0.250  1.00 0.00 ? 24 ASP A CA  2  
ATOM   918   C  C   . ASP A 1 24 ? 10.678  3.379   0.437   1.00 0.00 ? 24 ASP A C   2  
ATOM   919   O  O   . ASP A 1 24 ? 9.702   4.146   0.374   1.00 0.00 ? 24 ASP A O   2  
ATOM   920   C  CB  . ASP A 1 24 ? 11.669  1.056   0.502   1.00 0.00 ? 24 ASP A CB  2  
ATOM   921   C  CG  . ASP A 1 24 ? 11.203  -0.398  0.646   1.00 0.00 ? 24 ASP A CG  2  
ATOM   922   O  OD1 . ASP A 1 24 ? 11.158  -1.182  -0.292  1.00 0.00 ? 24 ASP A OD1 2  
ATOM   923   O  OD2 . ASP A 1 24 ? 10.868  -0.724  1.931   1.00 0.00 ? 24 ASP A OD2 2  
ATOM   924   N  N   . GLY A 1 25 ? 11.871  3.731   1.247   1.00 0.00 ? 25 GLY A N   2  
ATOM   925   C  CA  . GLY A 1 25 ? 11.916  4.881   2.143   1.00 0.00 ? 25 GLY A CA  2  
ATOM   926   C  C   . GLY A 1 25 ? 12.225  6.177   1.437   1.00 0.00 ? 25 GLY A C   2  
ATOM   927   O  O   . GLY A 1 25 ? 12.611  7.178   2.065   1.00 0.00 ? 25 GLY A O   2  
ATOM   928   N  N   . GLU A 1 26 ? 12.063  6.201   -0.032  1.00 0.00 ? 26 GLU A N   2  
ATOM   929   C  CA  . GLU A 1 26 ? 12.162  7.444   -0.791  1.00 0.00 ? 26 GLU A CA  2  
ATOM   930   C  C   . GLU A 1 26 ? 10.824  8.141   -0.864  1.00 0.00 ? 26 GLU A C   2  
ATOM   931   O  O   . GLU A 1 26 ? 10.739  9.329   -1.226  1.00 0.00 ? 26 GLU A O   2  
ATOM   932   C  CB  . GLU A 1 26 ? 12.724  7.123   -2.203  1.00 0.00 ? 26 GLU A CB  2  
ATOM   933   C  CG  . GLU A 1 26 ? 14.202  6.612   -2.282  1.00 0.00 ? 26 GLU A CG  2  
ATOM   934   C  CD  . GLU A 1 26 ? 15.317  7.637   -2.495  1.00 0.00 ? 26 GLU A CD  2  
ATOM   935   O  OE1 . GLU A 1 26 ? 15.028  8.873   -1.999  1.00 0.00 ? 26 GLU A OE1 2  
ATOM   936   O  OE2 . GLU A 1 26 ? 16.370  7.370   -3.058  1.00 0.00 ? 26 GLU A OE2 2  
ATOM   937   N  N   . PHE A 1 27 ? 9.632   7.363   -0.448  1.00 0.00 ? 27 PHE A N   2  
ATOM   938   C  CA  . PHE A 1 27 ? 8.294   7.964   -0.478  1.00 0.00 ? 27 PHE A CA  2  
ATOM   939   C  C   . PHE A 1 27 ? 7.266   7.050   0.137   1.00 0.00 ? 27 PHE A C   2  
ATOM   940   O  O   . PHE A 1 27 ? 7.559   5.923   0.569   1.00 0.00 ? 27 PHE A O   2  
ATOM   941   C  CB  . PHE A 1 27 ? 7.931   8.352   -1.940  1.00 0.00 ? 27 PHE A CB  2  
ATOM   942   C  CG  . PHE A 1 27 ? 7.492   7.226   -2.888  1.00 0.00 ? 27 PHE A CG  2  
ATOM   943   C  CD1 . PHE A 1 27 ? 8.408   6.215   -3.208  1.00 0.00 ? 27 PHE A CD1 2  
ATOM   944   C  CD2 . PHE A 1 27 ? 6.215   7.198   -3.452  1.00 0.00 ? 27 PHE A CD2 2  
ATOM   945   C  CE1 . PHE A 1 27 ? 8.048   5.189   -4.074  1.00 0.00 ? 27 PHE A CE1 2  
ATOM   946   C  CE2 . PHE A 1 27 ? 5.855   6.170   -4.320  1.00 0.00 ? 27 PHE A CE2 2  
ATOM   947   C  CZ  . PHE A 1 27 ? 6.771   5.166   -4.631  1.00 0.00 ? 27 PHE A CZ  2  
ATOM   948   N  N   . VAL A 1 28 ? 5.879   7.558   0.198   1.00 0.00 ? 28 VAL A N   2  
ATOM   949   C  CA  . VAL A 1 28 ? 4.801   6.899   0.941   1.00 0.00 ? 28 VAL A CA  2  
ATOM   950   C  C   . VAL A 1 28 ? 3.502   7.044   0.175   1.00 0.00 ? 28 VAL A C   2  
ATOM   951   O  O   . VAL A 1 28 ? 3.327   8.042   -0.563  1.00 0.00 ? 28 VAL A O   2  
ATOM   952   C  CB  . VAL A 1 28 ? 4.678   7.567   2.366   1.00 0.00 ? 28 VAL A CB  2  
ATOM   953   C  CG1 . VAL A 1 28 ? 5.857   7.322   3.348   1.00 0.00 ? 28 VAL A CG1 2  
ATOM   954   C  CG2 . VAL A 1 28 ? 4.522   9.110   2.316   1.00 0.00 ? 28 VAL A CG2 2  
ATOM   955   N  N   . PHE A 1 29 ? 2.454   6.015   0.323   1.00 0.00 ? 29 PHE A N   2  
ATOM   956   C  CA  . PHE A 1 29 ? 1.225   6.052   -0.476  1.00 0.00 ? 29 PHE A CA  2  
ATOM   957   C  C   . PHE A 1 29 ? 0.018   5.805   0.396   1.00 0.00 ? 29 PHE A C   2  
ATOM   958   O  O   . PHE A 1 29 ? 0.062   5.031   1.362   1.00 0.00 ? 29 PHE A O   2  
ATOM   959   C  CB  . PHE A 1 29 ? 1.275   4.999   -1.620  1.00 0.00 ? 29 PHE A CB  2  
ATOM   960   C  CG  . PHE A 1 29 ? 1.049   3.524   -1.255  1.00 0.00 ? 29 PHE A CG  2  
ATOM   961   C  CD1 . PHE A 1 29 ? -0.156  3.128   -0.664  1.00 0.00 ? 29 PHE A CD1 2  
ATOM   962   C  CD2 . PHE A 1 29 ? 2.011   2.558   -1.569  1.00 0.00 ? 29 PHE A CD2 2  
ATOM   963   C  CE1 . PHE A 1 29 ? -0.398  1.786   -0.391  1.00 0.00 ? 29 PHE A CE1 2  
ATOM   964   C  CE2 . PHE A 1 29 ? 1.766   1.214   -1.298  1.00 0.00 ? 29 PHE A CE2 2  
ATOM   965   C  CZ  . PHE A 1 29 ? 0.562   0.828   -0.711  1.00 0.00 ? 29 PHE A CZ  2  
ATOM   966   N  N   . ALA A 1 30 ? -1.204  6.566   0.059   1.00 0.00 ? 30 ALA A N   2  
ATOM   967   C  CA  . ALA A 1 30 ? -2.387  6.548   0.914   1.00 0.00 ? 30 ALA A CA  2  
ATOM   968   C  C   . ALA A 1 30 ? -3.624  6.199   0.121   1.00 0.00 ? 30 ALA A C   2  
ATOM   969   O  O   . ALA A 1 30 ? -4.263  7.058   -0.503  1.00 0.00 ? 30 ALA A O   2  
ATOM   970   C  CB  . ALA A 1 30 ? -2.489  7.919   1.602   1.00 0.00 ? 30 ALA A CB  2  
ATOM   971   N  N   . VAL A 1 31 ? -4.051  4.784   0.164   1.00 0.00 ? 31 VAL A N   2  
ATOM   972   C  CA  . VAL A 1 31 ? -5.245  4.315   -0.536  1.00 0.00 ? 31 VAL A CA  2  
ATOM   973   C  C   . VAL A 1 31 ? -6.452  4.382   0.369   1.00 0.00 ? 31 VAL A C   2  
ATOM   974   O  O   . VAL A 1 31 ? -6.576  3.606   1.334   1.00 0.00 ? 31 VAL A O   2  
ATOM   975   C  CB  . VAL A 1 31 ? -5.012  2.841   -1.054  1.00 0.00 ? 31 VAL A CB  2  
ATOM   976   C  CG1 . VAL A 1 31 ? -4.957  1.729   0.033   1.00 0.00 ? 31 VAL A CG1 2  
ATOM   977   C  CG2 . VAL A 1 31 ? -6.067  2.355   -2.077  1.00 0.00 ? 31 VAL A CG2 2  
ATOM   978   N  N   . ARG A 1 32 ? -7.496  5.380   0.041   1.00 0.00 ? 32 ARG A N   2  
ATOM   979   C  CA  . ARG A 1 32 ? -8.609  5.639   0.952   1.00 0.00 ? 32 ARG A CA  2  
ATOM   980   C  C   . ARG A 1 32 ? -9.747  4.663   0.776   1.00 0.00 ? 32 ARG A C   2  
ATOM   981   O  O   . ARG A 1 32 ? -10.924 5.002   1.017   1.00 0.00 ? 32 ARG A O   2  
ATOM   982   C  CB  . ARG A 1 32 ? -9.091  7.105   0.760   1.00 0.00 ? 32 ARG A CB  2  
ATOM   983   C  CG  . ARG A 1 32 ? -9.904  7.681   1.949   1.00 0.00 ? 32 ARG A CG  2  
ATOM   984   C  CD  . ARG A 1 32 ? -10.270 9.159   1.768   1.00 0.00 ? 32 ARG A CD  2  
ATOM   985   N  NE  . ARG A 1 32 ? -9.253  9.795   0.894   1.00 0.00 ? 32 ARG A NE  2  
ATOM   986   C  CZ  . ARG A 1 32 ? -9.396  10.072  -0.395  1.00 0.00 ? 32 ARG A CZ  2  
ATOM   987   N  NH1 . ARG A 1 32 ? -10.465 9.813   -1.087  1.00 0.00 ? 32 ARG A NH1 2  
ATOM   988   N  NH2 . ARG A 1 32 ? -8.407  10.636  -0.995  1.00 0.00 ? 32 ARG A NH2 2  
ATOM   989   N  N   . THR A 1 33 ? -9.428  3.300   0.302   1.00 0.00 ? 33 THR A N   2  
ATOM   990   C  CA  . THR A 1 33 ? -10.445 2.253   0.217   1.00 0.00 ? 33 THR A CA  2  
ATOM   991   C  C   . THR A 1 33 ? -10.355 1.316   1.398   1.00 0.00 ? 33 THR A C   2  
ATOM   992   O  O   . THR A 1 33 ? -11.360 0.780   1.884   1.00 0.00 ? 33 THR A O   2  
ATOM   993   C  CB  . THR A 1 33 ? -10.318 1.461   -1.127  1.00 0.00 ? 33 THR A CB  2  
ATOM   994   O  OG1 . THR A 1 33 ? -9.928  2.327   -2.185  1.00 0.00 ? 33 THR A OG1 2  
ATOM   995   C  CG2 . THR A 1 33 ? -11.605 0.778   -1.643  1.00 0.00 ? 33 THR A CG2 2  
ATOM   996   N  N   . THR A 1 34 ? -8.996  1.044   1.917   1.00 0.00 ? 34 THR A N   2  
ATOM   997   C  CA  . THR A 1 34 ? -8.774  0.290   3.146   1.00 0.00 ? 34 THR A CA  2  
ATOM   998   C  C   . THR A 1 34 ? -8.235  1.178   4.243   1.00 0.00 ? 34 THR A C   2  
ATOM   999   O  O   . THR A 1 34 ? -7.683  0.702   5.248   1.00 0.00 ? 34 THR A O   2  
ATOM   1000  C  CB  . THR A 1 34 ? -7.805  -0.913  2.886   1.00 0.00 ? 34 THR A CB  2  
ATOM   1001  O  OG1 . THR A 1 34 ? -8.193  -1.622  1.717   1.00 0.00 ? 34 THR A OG1 2  
ATOM   1002  C  CG2 . THR A 1 34 ? -7.740  -1.991  3.989   1.00 0.00 ? 34 THR A CG2 2  
ATOM   1003  N  N   . GLY A 1 35 ? -8.384  2.638   4.060   1.00 0.00 ? 35 GLY A N   2  
ATOM   1004  C  CA  . GLY A 1 35 ? -8.010  3.586   5.106   1.00 0.00 ? 35 GLY A CA  2  
ATOM   1005  C  C   . GLY A 1 35 ? -6.632  3.283   5.645   1.00 0.00 ? 35 GLY A C   2  
ATOM   1006  O  O   . GLY A 1 35 ? -6.358  3.433   6.847   1.00 0.00 ? 35 GLY A O   2  
ATOM   1007  N  N   . ILE A 1 36 ? -5.619  2.801   4.677   1.00 0.00 ? 36 ILE A N   2  
ATOM   1008  C  CA  . ILE A 1 36 ? -4.229  2.581   5.058   1.00 0.00 ? 36 ILE A CA  2  
ATOM   1009  C  C   . ILE A 1 36 ? -3.274  3.391   4.210   1.00 0.00 ? 36 ILE A C   2  
ATOM   1010  O  O   . ILE A 1 36 ? -3.402  3.502   2.983   1.00 0.00 ? 36 ILE A O   2  
ATOM   1011  C  CB  . ILE A 1 36 ? -3.842  1.046   5.078   1.00 0.00 ? 36 ILE A CB  2  
ATOM   1012  C  CG1 . ILE A 1 36 ? -3.489  0.412   3.695   1.00 0.00 ? 36 ILE A CG1 2  
ATOM   1013  C  CG2 . ILE A 1 36 ? -4.938  0.159   5.750   1.00 0.00 ? 36 ILE A CG2 2  
ATOM   1014  C  CD1 . ILE A 1 36 ? -2.290  -0.560  3.684   1.00 0.00 ? 36 ILE A CD1 2  
ATOM   1015  N  N   . PHE A 1 37 ? -2.193  4.081   4.944   1.00 0.00 ? 37 PHE A N   2  
ATOM   1016  C  CA  . PHE A 1 37 ? -1.069  4.757   4.273   1.00 0.00 ? 37 PHE A CA  2  
ATOM   1017  C  C   . PHE A 1 37 ? 0.202   4.012   4.608   1.00 0.00 ? 37 PHE A C   2  
ATOM   1018  O  O   . PHE A 1 37 ? 0.474   3.740   5.803   1.00 0.00 ? 37 PHE A O   2  
ATOM   1019  C  CB  . PHE A 1 37 ? -0.951  6.229   4.758   1.00 0.00 ? 37 PHE A CB  2  
ATOM   1020  C  CG  . PHE A 1 37 ? -0.024  6.514   5.951   1.00 0.00 ? 37 PHE A CG  2  
ATOM   1021  C  CD1 . PHE A 1 37 ? 1.361   6.378   5.835   1.00 0.00 ? 37 PHE A CD1 2  
ATOM   1022  C  CD2 . PHE A 1 37 ? -0.572  6.975   7.153   1.00 0.00 ? 37 PHE A CD2 2  
ATOM   1023  C  CE1 . PHE A 1 37 ? 2.188   6.707   6.907   1.00 0.00 ? 37 PHE A CE1 2  
ATOM   1024  C  CE2 . PHE A 1 37 ? 0.254   7.316   8.218   1.00 0.00 ? 37 PHE A CE2 2  
ATOM   1025  C  CZ  . PHE A 1 37 ? 1.635   7.179   8.095   1.00 0.00 ? 37 PHE A CZ  2  
ATOM   1026  N  N   . CYS A 1 38 ? 1.091   3.574   3.513   1.00 0.00 ? 38 CYS A N   2  
ATOM   1027  C  CA  . CYS A 1 38 ? 2.210   2.670   3.742   1.00 0.00 ? 38 CYS A CA  2  
ATOM   1028  C  C   . CYS A 1 38 ? 3.455   3.032   2.976   1.00 0.00 ? 38 CYS A C   2  
ATOM   1029  O  O   . CYS A 1 38 ? 3.401   3.725   1.942   1.00 0.00 ? 38 CYS A O   2  
ATOM   1030  C  CB  . CYS A 1 38 ? 1.739   1.237   3.349   1.00 0.00 ? 38 CYS A CB  2  
ATOM   1031  S  SG  . CYS A 1 38 ? 3.039   0.026   3.692   1.00 0.00 ? 38 CYS A SG  2  
ATOM   1032  N  N   . ARG A 1 39 ? 4.742   2.549   3.515   1.00 0.00 ? 39 ARG A N   2  
ATOM   1033  C  CA  . ARG A 1 39 ? 5.969   2.605   2.705   1.00 0.00 ? 39 ARG A CA  2  
ATOM   1034  C  C   . ARG A 1 39 ? 5.895   1.475   1.696   1.00 0.00 ? 39 ARG A C   2  
ATOM   1035  O  O   . ARG A 1 39 ? 5.957   0.291   2.051   1.00 0.00 ? 39 ARG A O   2  
ATOM   1036  C  CB  . ARG A 1 39 ? 7.206   2.512   3.629   1.00 0.00 ? 39 ARG A CB  2  
ATOM   1037  C  CG  . ARG A 1 39 ? 8.469   3.265   3.129   1.00 0.00 ? 39 ARG A CG  2  
ATOM   1038  C  CD  . ARG A 1 39 ? 9.550   3.385   4.211   1.00 0.00 ? 39 ARG A CD  2  
ATOM   1039  N  NE  . ARG A 1 39 ? 10.299  2.105   4.274   1.00 0.00 ? 39 ARG A NE  2  
ATOM   1040  C  CZ  . ARG A 1 39 ? 10.862  1.594   5.361   1.00 0.00 ? 39 ARG A CZ  2  
ATOM   1041  N  NH1 . ARG A 1 39 ? 10.833  2.155   6.534   1.00 0.00 ? 39 ARG A NH1 2  
ATOM   1042  N  NH2 . ARG A 1 39 ? 11.476  0.471   5.240   1.00 0.00 ? 39 ARG A NH2 2  
ATOM   1043  N  N   . PRO A 1 40 ? 5.776   1.873   0.285   1.00 0.00 ? 40 PRO A N   2  
ATOM   1044  C  CA  . PRO A 1 40 ? 5.632   0.918   -0.928  1.00 0.00 ? 40 PRO A CA  2  
ATOM   1045  C  C   . PRO A 1 40 ? 5.992   -0.514  -0.638  1.00 0.00 ? 40 PRO A C   2  
ATOM   1046  O  O   . PRO A 1 40 ? 7.099   -0.991  -0.920  1.00 0.00 ? 40 PRO A O   2  
ATOM   1047  C  CB  . PRO A 1 40 ? 6.531   1.566   -1.975  1.00 0.00 ? 40 PRO A CB  2  
ATOM   1048  C  CG  . PRO A 1 40 ? 6.139   3.047   -1.782  1.00 0.00 ? 40 PRO A CG  2  
ATOM   1049  C  CD  . PRO A 1 40 ? 5.769   3.233   -0.303  1.00 0.00 ? 40 PRO A CD  2  
ATOM   1050  N  N   . SER A 1 41 ? 4.932   -1.348  -0.002  1.00 0.00 ? 41 SER A N   2  
ATOM   1051  C  CA  . SER A 1 41 ? 5.211   -2.689  0.495   1.00 0.00 ? 41 SER A CA  2  
ATOM   1052  C  C   . SER A 1 41 ? 4.030   -3.629  0.502   1.00 0.00 ? 41 SER A C   2  
ATOM   1053  O  O   . SER A 1 41 ? 4.203   -4.845  0.241   1.00 0.00 ? 41 SER A O   2  
ATOM   1054  C  CB  . SER A 1 41 ? 5.878   -2.622  1.897   1.00 0.00 ? 41 SER A CB  2  
ATOM   1055  O  OG  . SER A 1 41 ? 6.337   -3.898  2.353   1.00 0.00 ? 41 SER A OG  2  
ATOM   1056  N  N   . CYS A 1 42 ? 2.671   -3.093  0.782   1.00 0.00 ? 42 CYS A N   2  
ATOM   1057  C  CA  . CYS A 1 42 ? 1.536   -3.997  0.976   1.00 0.00 ? 42 CYS A CA  2  
ATOM   1058  C  C   . CYS A 1 42 ? 1.403   -4.899  -0.239  1.00 0.00 ? 42 CYS A C   2  
ATOM   1059  O  O   . CYS A 1 42 ? 0.894   -4.514  -1.299  1.00 0.00 ? 42 CYS A O   2  
ATOM   1060  C  CB  . CYS A 1 42 ? 0.240   -3.292  1.393   1.00 0.00 ? 42 CYS A CB  2  
ATOM   1061  S  SG  . CYS A 1 42 ? 0.459   -1.713  2.241   1.00 0.00 ? 42 CYS A SG  2  
ATOM   1062  N  N   . ARG A 1 43 ? 1.957   -6.264  -0.098  1.00 0.00 ? 43 ARG A N   2  
ATOM   1063  C  CA  . ARG A 1 43 ? 2.124   -7.200  -1.201  1.00 0.00 ? 43 ARG A CA  2  
ATOM   1064  C  C   . ARG A 1 43 ? 0.830   -7.712  -1.780  1.00 0.00 ? 43 ARG A C   2  
ATOM   1065  O  O   . ARG A 1 43 ? 0.697   -7.858  -3.016  1.00 0.00 ? 43 ARG A O   2  
ATOM   1066  C  CB  . ARG A 1 43 ? 3.035   -8.368  -0.712  1.00 0.00 ? 43 ARG A CB  2  
ATOM   1067  C  CG  . ARG A 1 43 ? 4.032   -7.972  0.408   1.00 0.00 ? 43 ARG A CG  2  
ATOM   1068  C  CD  . ARG A 1 43 ? 4.459   -9.163  1.274   1.00 0.00 ? 43 ARG A CD  2  
ATOM   1069  N  NE  . ARG A 1 43 ? 5.929   -9.101  1.476   1.00 0.00 ? 43 ARG A NE  2  
ATOM   1070  C  CZ  . ARG A 1 43 ? 6.693   -10.104 1.886   1.00 0.00 ? 43 ARG A CZ  2  
ATOM   1071  N  NH1 . ARG A 1 43 ? 6.253   -11.295 2.166   1.00 0.00 ? 43 ARG A NH1 2  
ATOM   1072  N  NH2 . ARG A 1 43 ? 7.953   -9.878  2.014   1.00 0.00 ? 43 ARG A NH2 2  
ATOM   1073  N  N   . ALA A 1 44 ? -0.263  -8.064  -0.850  1.00 0.00 ? 44 ALA A N   2  
ATOM   1074  C  CA  . ALA A 1 44 ? -1.479  -8.725  -1.306  1.00 0.00 ? 44 ALA A CA  2  
ATOM   1075  C  C   . ALA A 1 44 ? -2.211  -7.845  -2.304  1.00 0.00 ? 44 ALA A C   2  
ATOM   1076  O  O   . ALA A 1 44 ? -1.800  -6.727  -2.634  1.00 0.00 ? 44 ALA A O   2  
ATOM   1077  C  CB  . ALA A 1 44 ? -2.344  -9.060  -0.080  1.00 0.00 ? 44 ALA A CB  2  
ATOM   1078  N  N   . ARG A 1 45 ? -3.439  -8.454  -2.880  1.00 0.00 ? 45 ARG A N   2  
ATOM   1079  C  CA  . ARG A 1 45 ? -4.267  -7.732  -3.841  1.00 0.00 ? 45 ARG A CA  2  
ATOM   1080  C  C   . ARG A 1 45 ? -4.599  -6.351  -3.313  1.00 0.00 ? 45 ARG A C   2  
ATOM   1081  O  O   . ARG A 1 45 ? -4.803  -5.391  -4.068  1.00 0.00 ? 45 ARG A O   2  
ATOM   1082  C  CB  . ARG A 1 45 ? -5.544  -8.561  -4.141  1.00 0.00 ? 45 ARG A CB  2  
ATOM   1083  C  CG  . ARG A 1 45 ? -5.286  -10.043 -4.524  1.00 0.00 ? 45 ARG A CG  2  
ATOM   1084  C  CD  . ARG A 1 45 ? -5.877  -10.411 -5.891  1.00 0.00 ? 45 ARG A CD  2  
ATOM   1085  N  NE  . ARG A 1 45 ? -7.265  -9.888  -5.956  1.00 0.00 ? 45 ARG A NE  2  
ATOM   1086  C  CZ  . ARG A 1 45 ? -8.034  -9.880  -7.037  1.00 0.00 ? 45 ARG A CZ  2  
ATOM   1087  N  NH1 . ARG A 1 45 ? -7.670  -10.332 -8.200  1.00 0.00 ? 45 ARG A NH1 2  
ATOM   1088  N  NH2 . ARG A 1 45 ? -9.218  -9.391  -6.918  1.00 0.00 ? 45 ARG A NH2 2  
ATOM   1089  N  N   . HIS A 1 46 ? -4.623  -6.215  -1.841  1.00 0.00 ? 46 HIS A N   2  
ATOM   1090  C  CA  . HIS A 1 46 ? -4.749  -4.930  -1.162  1.00 0.00 ? 46 HIS A CA  2  
ATOM   1091  C  C   . HIS A 1 46 ? -5.741  -4.020  -1.845  1.00 0.00 ? 46 HIS A C   2  
ATOM   1092  O  O   . HIS A 1 46 ? -6.963  -4.127  -1.648  1.00 0.00 ? 46 HIS A O   2  
ATOM   1093  C  CB  . HIS A 1 46 ? -3.345  -4.303  -1.157  1.00 0.00 ? 46 HIS A CB  2  
ATOM   1094  C  CG  . HIS A 1 46 ? -3.335  -2.923  -0.567  1.00 0.00 ? 46 HIS A CG  2  
ATOM   1095  N  ND1 . HIS A 1 46 ? -4.356  -2.353  0.189   1.00 0.00 ? 46 HIS A ND1 2  
ATOM   1096  C  CD2 . HIS A 1 46 ? -2.269  -2.048  -0.724  1.00 0.00 ? 46 HIS A CD2 2  
ATOM   1097  C  CE1 . HIS A 1 46 ? -3.810  -1.148  0.441   1.00 0.00 ? 46 HIS A CE1 2  
ATOM   1098  N  NE2 . HIS A 1 46 ? -2.576  -0.885  -0.067  1.00 0.00 ? 46 HIS A NE2 2  
ATOM   1099  N  N   . ALA A 1 47 ? -5.194  -3.020  -2.788  1.00 0.00 ? 47 ALA A N   2  
ATOM   1100  C  CA  . ALA A 1 47 ? -6.032  -1.977  -3.375  1.00 0.00 ? 47 ALA A CA  2  
ATOM   1101  C  C   . ALA A 1 47 ? -5.345  -1.327  -4.553  1.00 0.00 ? 47 ALA A C   2  
ATOM   1102  O  O   . ALA A 1 47 ? -4.113  -1.345  -4.682  1.00 0.00 ? 47 ALA A O   2  
ATOM   1103  C  CB  . ALA A 1 47 ? -6.376  -0.975  -2.260  1.00 0.00 ? 47 ALA A CB  2  
ATOM   1104  N  N   . LEU A 1 48 ? -6.223  -0.640  -5.525  1.00 0.00 ? 48 LEU A N   2  
ATOM   1105  C  CA  . LEU A 1 48 ? -5.691  0.035   -6.704  1.00 0.00 ? 48 LEU A CA  2  
ATOM   1106  C  C   . LEU A 1 48 ? -5.042  1.349   -6.334  1.00 0.00 ? 48 LEU A C   2  
ATOM   1107  O  O   . LEU A 1 48 ? -5.196  1.867   -5.220  1.00 0.00 ? 48 LEU A O   2  
ATOM   1108  C  CB  . LEU A 1 48 ? -6.809  0.250   -7.764  1.00 0.00 ? 48 LEU A CB  2  
ATOM   1109  C  CG  . LEU A 1 48 ? -8.270  0.420   -7.265  1.00 0.00 ? 48 LEU A CG  2  
ATOM   1110  C  CD1 . LEU A 1 48 ? -8.304  1.335   -6.033  1.00 0.00 ? 48 LEU A CD1 2  
ATOM   1111  C  CD2 . LEU A 1 48 ? -9.207  0.977   -8.349  1.00 0.00 ? 48 LEU A CD2 2  
ATOM   1112  N  N   . ARG A 1 49 ? -4.242  1.999   -7.395  1.00 0.00 ? 49 ARG A N   2  
ATOM   1113  C  CA  . ARG A 1 49 ? -3.694  3.349   -7.259  1.00 0.00 ? 49 ARG A CA  2  
ATOM   1114  C  C   . ARG A 1 49 ? -4.717  4.389   -7.639  1.00 0.00 ? 49 ARG A C   2  
ATOM   1115  O  O   . ARG A 1 49 ? -4.428  5.595   -7.715  1.00 0.00 ? 49 ARG A O   2  
ATOM   1116  C  CB  . ARG A 1 49 ? -2.417  3.439   -8.146  1.00 0.00 ? 49 ARG A CB  2  
ATOM   1117  C  CG  . ARG A 1 49 ? -1.870  4.861   -8.435  1.00 0.00 ? 49 ARG A CG  2  
ATOM   1118  C  CD  . ARG A 1 49 ? -2.474  5.475   -9.707  1.00 0.00 ? 49 ARG A CD  2  
ATOM   1119  N  NE  . ARG A 1 49 ? -1.364  5.899   -10.597 1.00 0.00 ? 49 ARG A NE  2  
ATOM   1120  C  CZ  . ARG A 1 49 ? -1.430  6.868   -11.501 1.00 0.00 ? 49 ARG A CZ  2  
ATOM   1121  N  NH1 . ARG A 1 49 ? -2.488  7.590   -11.727 1.00 0.00 ? 49 ARG A NH1 2  
ATOM   1122  N  NH2 . ARG A 1 49 ? -0.375  7.103   -12.197 1.00 0.00 ? 49 ARG A NH2 2  
ATOM   1123  N  N   . GLU A 1 50 ? -6.102  3.919   -7.873  1.00 0.00 ? 50 GLU A N   2  
ATOM   1124  C  CA  . GLU A 1 50 ? -7.135  4.775   -8.440  1.00 0.00 ? 50 GLU A CA  2  
ATOM   1125  C  C   . GLU A 1 50 ? -7.864  5.605   -7.415  1.00 0.00 ? 50 GLU A C   2  
ATOM   1126  O  O   . GLU A 1 50 ? -8.762  6.404   -7.783  1.00 0.00 ? 50 GLU A O   2  
ATOM   1127  C  CB  . GLU A 1 50 ? -8.130  3.874   -9.235  1.00 0.00 ? 50 GLU A CB  2  
ATOM   1128  C  CG  . GLU A 1 50 ? -7.507  2.762   -10.143 1.00 0.00 ? 50 GLU A CG  2  
ATOM   1129  C  CD  . GLU A 1 50 ? -7.932  2.696   -11.612 1.00 0.00 ? 50 GLU A CD  2  
ATOM   1130  O  OE1 . GLU A 1 50 ? -9.222  2.300   -11.792 1.00 0.00 ? 50 GLU A OE1 2  
ATOM   1131  O  OE2 . GLU A 1 50 ? -7.180  2.974   -12.536 1.00 0.00 ? 50 GLU A OE2 2  
ATOM   1132  N  N   . ASN A 1 51 ? -7.513  5.473   -5.993  1.00 0.00 ? 51 ASN A N   2  
ATOM   1133  C  CA  . ASN A 1 51 ? -8.066  6.390   -4.964  1.00 0.00 ? 51 ASN A CA  2  
ATOM   1134  C  C   . ASN A 1 51 ? -6.946  6.720   -4.005  1.00 0.00 ? 51 ASN A C   2  
ATOM   1135  O  O   . ASN A 1 51 ? -7.086  7.055   -2.822  1.00 0.00 ? 51 ASN A O   2  
ATOM   1136  C  CB  . ASN A 1 51 ? -9.221  5.655   -4.242  1.00 0.00 ? 51 ASN A CB  2  
ATOM   1137  C  CG  . ASN A 1 51 ? -8.993  5.126   -2.821  1.00 0.00 ? 51 ASN A CG  2  
ATOM   1138  O  OD1 . ASN A 1 51 ? -9.641  5.521   -1.864  1.00 0.00 ? 51 ASN A OD1 2  
ATOM   1139  N  ND2 . ASN A 1 51 ? -8.071  4.221   -2.632  1.00 0.00 ? 51 ASN A ND2 2  
ATOM   1140  N  N   . VAL A 1 52 ? -5.576  6.564   -4.600  1.00 0.00 ? 52 VAL A N   2  
ATOM   1141  C  CA  . VAL A 1 52 ? -4.364  6.523   -3.788  1.00 0.00 ? 52 VAL A CA  2  
ATOM   1142  C  C   . VAL A 1 52 ? -3.664  7.853   -3.807  1.00 0.00 ? 52 VAL A C   2  
ATOM   1143  O  O   . VAL A 1 52 ? -3.670  8.553   -4.851  1.00 0.00 ? 52 VAL A O   2  
ATOM   1144  C  CB  . VAL A 1 52 ? -3.434  5.340   -4.298  1.00 0.00 ? 52 VAL A CB  2  
ATOM   1145  C  CG1 . VAL A 1 52 ? -2.243  5.723   -5.212  1.00 0.00 ? 52 VAL A CG1 2  
ATOM   1146  C  CG2 . VAL A 1 52 ? -2.823  4.503   -3.144  1.00 0.00 ? 52 VAL A CG2 2  
ATOM   1147  N  N   . SER A 1 53 ? -3.006  8.345   -2.579  1.00 0.00 ? 53 SER A N   2  
ATOM   1148  C  CA  . SER A 1 53 ? -2.168  9.545   -2.580  1.00 0.00 ? 53 SER A CA  2  
ATOM   1149  C  C   . SER A 1 53 ? -0.705  9.180   -2.499  1.00 0.00 ? 53 SER A C   2  
ATOM   1150  O  O   . SER A 1 53 ? -0.339  8.002   -2.350  1.00 0.00 ? 53 SER A O   2  
ATOM   1151  C  CB  . SER A 1 53 ? -2.592  10.525  -1.461  1.00 0.00 ? 53 SER A CB  2  
ATOM   1152  O  OG  . SER A 1 53 ? -1.662  11.599  -1.276  1.00 0.00 ? 53 SER A OG  2  
ATOM   1153  N  N   . PHE A 1 54 ? 0.278   10.279  -2.646  1.00 0.00 ? 54 PHE A N   2  
ATOM   1154  C  CA  . PHE A 1 54 ? 1.710   10.053  -2.461  1.00 0.00 ? 54 PHE A CA  2  
ATOM   1155  C  C   . PHE A 1 54 ? 2.352   11.145  -1.638  1.00 0.00 ? 54 PHE A C   2  
ATOM   1156  O  O   . PHE A 1 54 ? 1.895   12.297  -1.614  1.00 0.00 ? 54 PHE A O   2  
ATOM   1157  C  CB  . PHE A 1 54 ? 2.431   9.980   -3.842  1.00 0.00 ? 54 PHE A CB  2  
ATOM   1158  C  CG  . PHE A 1 54 ? 1.946   8.901   -4.822  1.00 0.00 ? 54 PHE A CG  2  
ATOM   1159  C  CD1 . PHE A 1 54 ? 1.566   7.644   -4.339  1.00 0.00 ? 54 PHE A CD1 2  
ATOM   1160  C  CD2 . PHE A 1 54 ? 1.888   9.156   -6.195  1.00 0.00 ? 54 PHE A CD2 2  
ATOM   1161  C  CE1 . PHE A 1 54 ? 1.128   6.657   -5.215  1.00 0.00 ? 54 PHE A CE1 2  
ATOM   1162  C  CE2 . PHE A 1 54 ? 1.451   8.167   -7.072  1.00 0.00 ? 54 PHE A CE2 2  
ATOM   1163  C  CZ  . PHE A 1 54 ? 1.071   6.918   -6.582  1.00 0.00 ? 54 PHE A CZ  2  
ATOM   1164  N  N   . TYR A 1 55 ? 3.577   10.779  -0.890  1.00 0.00 ? 55 TYR A N   2  
ATOM   1165  C  CA  . TYR A 1 55 ? 4.383   11.767  -0.180  1.00 0.00 ? 55 TYR A CA  2  
ATOM   1166  C  C   . TYR A 1 55 ? 5.829   11.336  -0.109  1.00 0.00 ? 55 TYR A C   2  
ATOM   1167  O  O   . TYR A 1 55 ? 6.141   10.131  -0.162  1.00 0.00 ? 55 TYR A O   2  
ATOM   1168  C  CB  . TYR A 1 55 ? 3.867   11.942  1.281   1.00 0.00 ? 55 TYR A CB  2  
ATOM   1169  C  CG  . TYR A 1 55 ? 2.421   11.520  1.565   1.00 0.00 ? 55 TYR A CG  2  
ATOM   1170  C  CD1 . TYR A 1 55 ? 2.041   10.176  1.517   1.00 0.00 ? 55 TYR A CD1 2  
ATOM   1171  C  CD2 . TYR A 1 55 ? 1.450   12.491  1.871   1.00 0.00 ? 55 TYR A CD2 2  
ATOM   1172  C  CE1 . TYR A 1 55 ? 0.726   9.802   1.774   1.00 0.00 ? 55 TYR A CE1 2  
ATOM   1173  C  CE2 . TYR A 1 55 ? 0.136   12.115  2.128   1.00 0.00 ? 55 TYR A CE2 2  
ATOM   1174  C  CZ  . TYR A 1 55 ? -0.226  10.772  2.080   1.00 0.00 ? 55 TYR A CZ  2  
ATOM   1175  O  OH  . TYR A 1 55 ? -1.518  10.409  2.338   1.00 0.00 ? 55 TYR A OH  2  
ATOM   1176  N  N   . ALA A 1 56 ? 6.868   12.378  0.060   1.00 0.00 ? 56 ALA A N   2  
ATOM   1177  C  CA  . ALA A 1 56 ? 8.285   12.050  0.196   1.00 0.00 ? 56 ALA A CA  2  
ATOM   1178  C  C   . ALA A 1 56 ? 8.571   11.287  1.467   1.00 0.00 ? 56 ALA A C   2  
ATOM   1179  O  O   . ALA A 1 56 ? 9.487   10.445  1.520   1.00 0.00 ? 56 ALA A O   2  
ATOM   1180  C  CB  . ALA A 1 56 ? 9.088   13.359  0.096   1.00 0.00 ? 56 ALA A CB  2  
ATOM   1181  N  N   . ASN A 1 57 ? 7.749   11.603  2.656   1.00 0.00 ? 57 ASN A N   2  
ATOM   1182  C  CA  . ASN A 1 57 ? 7.862   10.837  3.894   1.00 0.00 ? 57 ASN A CA  2  
ATOM   1183  C  C   . ASN A 1 57 ? 6.520   10.681  4.570   1.00 0.00 ? 57 ASN A C   2  
ATOM   1184  O  O   . ASN A 1 57 ? 5.603   11.495  4.399   1.00 0.00 ? 57 ASN A O   2  
ATOM   1185  C  CB  . ASN A 1 57 ? 8.882   11.524  4.848   1.00 0.00 ? 57 ASN A CB  2  
ATOM   1186  C  CG  . ASN A 1 57 ? 9.071   10.894  6.232   1.00 0.00 ? 57 ASN A CG  2  
ATOM   1187  O  OD1 . ASN A 1 57 ? 8.697   11.444  7.258   1.00 0.00 ? 57 ASN A OD1 2  
ATOM   1188  N  ND2 . ASN A 1 57 ? 9.645   9.725   6.317   1.00 0.00 ? 57 ASN A ND2 2  
ATOM   1189  N  N   . ALA A 1 58 ? 6.353   9.479   5.418   1.00 0.00 ? 58 ALA A N   2  
ATOM   1190  C  CA  . ALA A 1 58 ? 5.092   9.170   6.085   1.00 0.00 ? 58 ALA A CA  2  
ATOM   1191  C  C   . ALA A 1 58 ? 4.701   10.248  7.067   1.00 0.00 ? 58 ALA A C   2  
ATOM   1192  O  O   . ALA A 1 58 ? 3.532   10.352  7.479   1.00 0.00 ? 58 ALA A O   2  
ATOM   1193  C  CB  . ALA A 1 58 ? 5.235   7.788   6.747   1.00 0.00 ? 58 ALA A CB  2  
ATOM   1194  N  N   . SER A 1 59 ? 5.772   11.148  7.547   1.00 0.00 ? 59 SER A N   2  
ATOM   1195  C  CA  . SER A 1 59 ? 5.492   12.259  8.454   1.00 0.00 ? 59 SER A CA  2  
ATOM   1196  C  C   . SER A 1 59 ? 4.316   13.070  7.960   1.00 0.00 ? 59 SER A C   2  
ATOM   1197  O  O   . SER A 1 59 ? 3.407   13.433  8.718   1.00 0.00 ? 59 SER A O   2  
ATOM   1198  C  CB  . SER A 1 59 ? 6.746   13.144  8.661   1.00 0.00 ? 59 SER A CB  2  
ATOM   1199  O  OG  . SER A 1 59 ? 6.633   14.427  8.035   1.00 0.00 ? 59 SER A OG  2  
ATOM   1200  N  N   . GLU A 1 60 ? 4.336   13.437  6.526   1.00 0.00 ? 60 GLU A N   2  
ATOM   1201  C  CA  . GLU A 1 60 ? 3.302   14.274  5.925   1.00 0.00 ? 60 GLU A CA  2  
ATOM   1202  C  C   . GLU A 1 60 ? 1.985   13.546  5.812   1.00 0.00 ? 60 GLU A C   2  
ATOM   1203  O  O   . GLU A 1 60 ? 0.917   14.095  6.151   1.00 0.00 ? 60 GLU A O   2  
ATOM   1204  C  CB  . GLU A 1 60 ? 3.815   14.781  4.549   1.00 0.00 ? 60 GLU A CB  2  
ATOM   1205  C  CG  . GLU A 1 60 ? 2.931   14.490  3.292   1.00 0.00 ? 60 GLU A CG  2  
ATOM   1206  C  CD  . GLU A 1 60 ? 2.872   15.544  2.184   1.00 0.00 ? 60 GLU A CD  2  
ATOM   1207  O  OE1 . GLU A 1 60 ? 4.096   15.989  1.785   1.00 0.00 ? 60 GLU A OE1 2  
ATOM   1208  O  OE2 . GLU A 1 60 ? 1.821   15.946  1.703   1.00 0.00 ? 60 GLU A OE2 2  
ATOM   1209  N  N   . ALA A 1 61 ? 1.993   12.176  5.250   1.00 0.00 ? 61 ALA A N   2  
ATOM   1210  C  CA  . ALA A 1 61 ? 0.800   11.336  5.258   1.00 0.00 ? 61 ALA A CA  2  
ATOM   1211  C  C   . ALA A 1 61 ? 0.164   11.257  6.626   1.00 0.00 ? 61 ALA A C   2  
ATOM   1212  O  O   . ALA A 1 61 ? -1.056  11.037  6.750   1.00 0.00 ? 61 ALA A O   2  
ATOM   1213  C  CB  . ALA A 1 61 ? 1.193   9.956   4.704   1.00 0.00 ? 61 ALA A CB  2  
ATOM   1214  N  N   . LEU A 1 62 ? 1.043   11.401  7.805   1.00 0.00 ? 62 LEU A N   2  
ATOM   1215  C  CA  . LEU A 1 62 ? 0.498   11.469  9.163   1.00 0.00 ? 62 LEU A CA  2  
ATOM   1216  C  C   . LEU A 1 62 ? -0.109  12.826  9.423   1.00 0.00 ? 62 LEU A C   2  
ATOM   1217  O  O   . LEU A 1 62 ? -1.183  12.950  10.035  1.00 0.00 ? 62 LEU A O   2  
ATOM   1218  C  CB  . LEU A 1 62 ? 1.583   11.113  10.216  1.00 0.00 ? 62 LEU A CB  2  
ATOM   1219  C  CG  . LEU A 1 62 ? 1.291   9.945   11.200  1.00 0.00 ? 62 LEU A CG  2  
ATOM   1220  C  CD1 . LEU A 1 62 ? 2.582   9.170   11.497  1.00 0.00 ? 62 LEU A CD1 2  
ATOM   1221  C  CD2 . LEU A 1 62 ? 0.656   10.422  12.516  1.00 0.00 ? 62 LEU A CD2 2  
ATOM   1222  N  N   . ALA A 1 63 ? 0.656   14.001  8.955   1.00 0.00 ? 63 ALA A N   2  
ATOM   1223  C  CA  . ALA A 1 63 ? 0.080   15.349  8.980   1.00 0.00 ? 63 ALA A CA  2  
ATOM   1224  C  C   . ALA A 1 63 ? -1.233  15.371  8.235   1.00 0.00 ? 63 ALA A C   2  
ATOM   1225  O  O   . ALA A 1 63 ? -2.116  16.202  8.488   1.00 0.00 ? 63 ALA A O   2  
ATOM   1226  C  CB  . ALA A 1 63 ? 1.120   16.328  8.414   1.00 0.00 ? 63 ALA A CB  2  
ATOM   1227  N  N   . ALA A 1 64 ? -1.422  14.319  7.208   1.00 0.00 ? 64 ALA A N   2  
ATOM   1228  C  CA  . ALA A 1 64 ? -2.708  14.115  6.548   1.00 0.00 ? 64 ALA A CA  2  
ATOM   1229  C  C   . ALA A 1 64 ? -3.712  13.602  7.570   1.00 0.00 ? 64 ALA A C   2  
ATOM   1230  O  O   . ALA A 1 64 ? -4.885  13.991  7.613   1.00 0.00 ? 64 ALA A O   2  
ATOM   1231  C  CB  . ALA A 1 64 ? -2.494  13.137  5.384   1.00 0.00 ? 64 ALA A CB  2  
ATOM   1232  N  N   . GLY A 1 65 ? -3.155  12.624  8.537   1.00 0.00 ? 65 GLY A N   2  
ATOM   1233  C  CA  . GLY A 1 65 ? -3.918  12.148  9.687   1.00 0.00 ? 65 GLY A CA  2  
ATOM   1234  C  C   . GLY A 1 65 ? -4.393  10.726  9.433   1.00 0.00 ? 65 GLY A C   2  
ATOM   1235  O  O   . GLY A 1 65 ? -5.406  10.257  9.966   1.00 0.00 ? 65 GLY A O   2  
ATOM   1236  N  N   . PHE A 1 66 ? -3.573  9.958   8.470   1.00 0.00 ? 66 PHE A N   2  
ATOM   1237  C  CA  . PHE A 1 66 ? -3.971  8.647   7.971   1.00 0.00 ? 66 PHE A CA  2  
ATOM   1238  C  C   . PHE A 1 66 ? -3.370  7.525   8.779   1.00 0.00 ? 66 PHE A C   2  
ATOM   1239  O  O   . PHE A 1 66 ? -2.699  7.766   9.808   1.00 0.00 ? 66 PHE A O   2  
ATOM   1240  C  CB  . PHE A 1 66 ? -3.536  8.502   6.478   1.00 0.00 ? 66 PHE A CB  2  
ATOM   1241  C  CG  . PHE A 1 66 ? -4.406  7.556   5.637   1.00 0.00 ? 66 PHE A CG  2  
ATOM   1242  C  CD1 . PHE A 1 66 ? -5.761  7.389   5.952   1.00 0.00 ? 66 PHE A CD1 2  
ATOM   1243  C  CD2 . PHE A 1 66 ? -3.847  6.833   4.580   1.00 0.00 ? 66 PHE A CD2 2  
ATOM   1244  C  CE1 . PHE A 1 66 ? -6.545  6.511   5.208   1.00 0.00 ? 66 PHE A CE1 2  
ATOM   1245  C  CE2 . PHE A 1 66 ? -4.632  5.957   3.838   1.00 0.00 ? 66 PHE A CE2 2  
ATOM   1246  C  CZ  . PHE A 1 66 ? -5.978  5.795   4.155   1.00 0.00 ? 66 PHE A CZ  2  
ATOM   1247  N  N   . ARG A 1 67 ? -3.562  6.136   8.306   1.00 0.00 ? 67 ARG A N   2  
ATOM   1248  C  CA  . ARG A 1 67 ? -3.163  4.990   9.130   1.00 0.00 ? 67 ARG A CA  2  
ATOM   1249  C  C   . ARG A 1 67 ? -1.801  4.457   8.763   1.00 0.00 ? 67 ARG A C   2  
ATOM   1250  O  O   . ARG A 1 67 ? -1.569  3.930   7.668   1.00 0.00 ? 67 ARG A O   2  
ATOM   1251  C  CB  . ARG A 1 67 ? -4.259  3.894   9.040   1.00 0.00 ? 67 ARG A CB  2  
ATOM   1252  C  CG  . ARG A 1 67 ? -4.360  2.971   10.285  1.00 0.00 ? 67 ARG A CG  2  
ATOM   1253  C  CD  . ARG A 1 67 ? -3.020  2.315   10.639  1.00 0.00 ? 67 ARG A CD  2  
ATOM   1254  N  NE  . ARG A 1 67 ? -3.292  0.974   11.215  1.00 0.00 ? 67 ARG A NE  2  
ATOM   1255  C  CZ  . ARG A 1 67 ? -3.066  0.615   12.472  1.00 0.00 ? 67 ARG A CZ  2  
ATOM   1256  N  NH1 . ARG A 1 67 ? -2.571  1.401   13.381  1.00 0.00 ? 67 ARG A NH1 2  
ATOM   1257  N  NH2 . ARG A 1 67 ? -3.360  -0.591  12.807  1.00 0.00 ? 67 ARG A NH2 2  
ATOM   1258  N  N   . PRO A 1 68 ? -0.753  4.565   9.805   1.00 0.00 ? 68 PRO A N   2  
ATOM   1259  C  CA  . PRO A 1 68 ? 0.705   4.124   9.687   1.00 0.00 ? 68 PRO A CA  2  
ATOM   1260  C  C   . PRO A 1 68 ? 0.911   2.656   9.383   1.00 0.00 ? 68 PRO A C   2  
ATOM   1261  O  O   . PRO A 1 68 ? 0.727   1.794   10.267  1.00 0.00 ? 68 PRO A O   2  
ATOM   1262  C  CB  . PRO A 1 68 ? 1.375   4.425   11.027  1.00 0.00 ? 68 PRO A CB  2  
ATOM   1263  C  CG  . PRO A 1 68 ? 0.185   4.471   11.996  1.00 0.00 ? 68 PRO A CG  2  
ATOM   1264  C  CD  . PRO A 1 68 ? -0.926  5.128   11.167  1.00 0.00 ? 68 PRO A CD  2  
ATOM   1265  N  N   . CYS A 1 69 ? 1.298   2.265   8.012   1.00 0.00 ? 69 CYS A N   2  
ATOM   1266  C  CA  . CYS A 1 69 ? 1.696   0.904   7.642   1.00 0.00 ? 69 CYS A CA  2  
ATOM   1267  C  C   . CYS A 1 69 ? 3.190   0.844   7.413   1.00 0.00 ? 69 CYS A C   2  
ATOM   1268  O  O   . CYS A 1 69 ? 3.758   1.312   6.418   1.00 0.00 ? 69 CYS A O   2  
ATOM   1269  C  CB  . CYS A 1 69 ? 0.826   0.474   6.446   1.00 0.00 ? 69 CYS A CB  2  
ATOM   1270  S  SG  . CYS A 1 69 ? 0.916   -1.284  6.071   1.00 0.00 ? 69 CYS A SG  2  
ATOM   1271  N  N   . LYS A 1 70 ? 3.970   0.207   8.519   1.00 0.00 ? 70 LYS A N   2  
ATOM   1272  C  CA  . LYS A 1 70 ? 5.424   0.205   8.579   1.00 0.00 ? 70 LYS A CA  2  
ATOM   1273  C  C   . LYS A 1 70 ? 6.000   -1.011  7.895   1.00 0.00 ? 70 LYS A C   2  
ATOM   1274  O  O   . LYS A 1 70 ? 6.478   -0.925  6.741   1.00 0.00 ? 70 LYS A O   2  
ATOM   1275  C  CB  . LYS A 1 70 ? 5.885   0.287   10.061  1.00 0.00 ? 70 LYS A CB  2  
ATOM   1276  C  CG  . LYS A 1 70 ? 5.544   1.641   10.733  1.00 0.00 ? 70 LYS A CG  2  
ATOM   1277  C  CD  . LYS A 1 70 ? 6.671   2.250   11.571  1.00 0.00 ? 70 LYS A CD  2  
ATOM   1278  C  CE  . LYS A 1 70 ? 7.287   1.159   12.458  1.00 0.00 ? 70 LYS A CE  2  
ATOM   1279  N  NZ  . LYS A 1 70 ? 7.828   1.774   13.684  1.00 0.00 ? 70 LYS A NZ  2  
ATOM   1280  N  N   . ARG A 1 71 ? 6.014   -2.286  8.641   1.00 0.00 ? 71 ARG A N   2  
ATOM   1281  C  CA  . ARG A 1 71 ? 6.382   -3.548  7.964   1.00 0.00 ? 71 ARG A CA  2  
ATOM   1282  C  C   . ARG A 1 71 ? 5.359   -3.787  6.872   1.00 0.00 ? 71 ARG A C   2  
ATOM   1283  O  O   . ARG A 1 71 ? 5.635   -3.644  5.675   1.00 0.00 ? 71 ARG A O   2  
ATOM   1284  C  CB  . ARG A 1 71 ? 6.431   -4.691  9.003   1.00 0.00 ? 71 ARG A CB  2  
ATOM   1285  C  CG  . ARG A 1 71 ? 6.112   -6.108  8.451   1.00 0.00 ? 71 ARG A CG  2  
ATOM   1286  C  CD  . ARG A 1 71 ? 6.994   -7.197  9.073   1.00 0.00 ? 71 ARG A CD  2  
ATOM   1287  N  NE  . ARG A 1 71 ? 6.313   -7.722  10.284  1.00 0.00 ? 71 ARG A NE  2  
ATOM   1288  C  CZ  . ARG A 1 71 ? 5.529   -8.791  10.325  1.00 0.00 ? 71 ARG A CZ  2  
ATOM   1289  N  NH1 . ARG A 1 71 ? 5.245   -9.532  9.295   1.00 0.00 ? 71 ARG A NH1 2  
ATOM   1290  N  NH2 . ARG A 1 71 ? 5.022   -9.112  11.462  1.00 0.00 ? 71 ARG A NH2 2  
ATOM   1291  N  N   . CYS A 1 72 ? 4.030   -4.239  7.335   1.00 0.00 ? 72 CYS A N   2  
ATOM   1292  C  CA  . CYS A 1 72 ? 2.857   -4.289  6.478   1.00 0.00 ? 72 CYS A CA  2  
ATOM   1293  C  C   . CYS A 1 72 ? 1.653   -4.827  7.237   1.00 0.00 ? 72 CYS A C   2  
ATOM   1294  O  O   . CYS A 1 72 ? 1.217   -5.973  7.066   1.00 0.00 ? 72 CYS A O   2  
ATOM   1295  C  CB  . CYS A 1 72 ? 3.164   -5.009  5.153   1.00 0.00 ? 72 CYS A CB  2  
ATOM   1296  S  SG  . CYS A 1 72 ? 3.264   -3.805  3.787   1.00 0.00 ? 72 CYS A SG  2  
ATOM   1297  N  N   . GLN A 1 73 ? 1.015   -3.877  8.166   1.00 0.00 ? 73 GLN A N   2  
ATOM   1298  C  CA  . GLN A 1 73 ? -0.226  -4.175  8.915   1.00 0.00 ? 73 GLN A CA  2  
ATOM   1299  C  C   . GLN A 1 73 ? -1.218  -4.931  8.081   1.00 0.00 ? 73 GLN A C   2  
ATOM   1300  O  O   . GLN A 1 73 ? -1.332  -4.748  6.860   1.00 0.00 ? 73 GLN A O   2  
ATOM   1301  C  CB  . GLN A 1 73 ? -0.820  -2.827  9.411   1.00 0.00 ? 73 GLN A CB  2  
ATOM   1302  C  CG  . GLN A 1 73 ? -1.071  -2.700  10.949  1.00 0.00 ? 73 GLN A CG  2  
ATOM   1303  C  CD  . GLN A 1 73 ? 0.067   -2.210  11.854  1.00 0.00 ? 73 GLN A CD  2  
ATOM   1304  O  OE1 . GLN A 1 73 ? 0.732   -2.994  12.513  1.00 0.00 ? 73 GLN A OE1 2  
ATOM   1305  N  NE2 . GLN A 1 73 ? 0.355   -0.934  11.908  1.00 0.00 ? 73 GLN A NE2 2  
ATOM   1306  N  N   . PRO A 1 74 ? -2.039  -5.938  8.793   1.00 0.00 ? 74 PRO A N   2  
ATOM   1307  C  CA  . PRO A 1 74 ? -3.103  -6.849  8.182   1.00 0.00 ? 74 PRO A CA  2  
ATOM   1308  C  C   . PRO A 1 74 ? -4.161  -6.144  7.359   1.00 0.00 ? 74 PRO A C   2  
ATOM   1309  O  O   . PRO A 1 74 ? -4.160  -6.209  6.119   1.00 0.00 ? 74 PRO A O   2  
ATOM   1310  C  CB  . PRO A 1 74 ? -3.789  -7.564  9.338   1.00 0.00 ? 74 PRO A CB  2  
ATOM   1311  C  CG  . PRO A 1 74 ? -2.656  -7.624  10.375  1.00 0.00 ? 74 PRO A CG  2  
ATOM   1312  C  CD  . PRO A 1 74 ? -1.978  -6.255  10.241  1.00 0.00 ? 74 PRO A CD  2  
ATOM   1313  N  N   . ASP A 1 75 ? -5.168  -5.348  8.093   1.00 0.00 ? 75 ASP A N   2  
ATOM   1314  C  CA  . ASP A 1 75 ? -6.329  -4.771  7.420   1.00 0.00 ? 75 ASP A CA  2  
ATOM   1315  C  C   . ASP A 1 75 ? -7.223  -4.034  8.387   1.00 0.00 ? 75 ASP A C   2  
ATOM   1316  O  O   . ASP A 1 75 ? -7.257  -2.795  8.440   1.00 0.00 ? 75 ASP A O   2  
ATOM   1317  C  CB  . ASP A 1 75 ? -7.102  -5.878  6.653   1.00 0.00 ? 75 ASP A CB  2  
ATOM   1318  C  CG  . ASP A 1 75 ? -7.704  -5.484  5.297   1.00 0.00 ? 75 ASP A CG  2  
ATOM   1319  O  OD1 . ASP A 1 75 ? -8.808  -4.972  5.180   1.00 0.00 ? 75 ASP A OD1 2  
ATOM   1320  O  OD2 . ASP A 1 75 ? -6.873  -5.761  4.247   1.00 0.00 ? 75 ASP A OD2 2  
ATOM   1321  N  N   . LYS A 1 76 ? -8.034  -4.870  9.301   1.00 0.00 ? 76 LYS A N   2  
ATOM   1322  C  CA  . LYS A 1 76 ? -9.065  -4.301  10.163  1.00 0.00 ? 76 LYS A CA  2  
ATOM   1323  C  C   . LYS A 1 76 ? -8.780  -4.610  11.617  1.00 0.00 ? 76 LYS A C   2  
ATOM   1324  O  O   . LYS A 1 76 ? -8.439  -5.737  11.993  1.00 0.00 ? 76 LYS A O   2  
ATOM   1325  C  CB  . LYS A 1 76 ? -10.461 -4.835  9.744   1.00 0.00 ? 76 LYS A CB  2  
ATOM   1326  C  CG  . LYS A 1 76 ? -10.428 -6.241  9.096   1.00 0.00 ? 76 LYS A CG  2  
ATOM   1327  C  CD  . LYS A 1 76 ? -11.671 -6.600  8.275   1.00 0.00 ? 76 LYS A CD  2  
ATOM   1328  C  CE  . LYS A 1 76 ? -11.961 -8.099  8.423   1.00 0.00 ? 76 LYS A CE  2  
ATOM   1329  N  NZ  . LYS A 1 76 ? -12.709 -8.571  7.243   1.00 0.00 ? 76 LYS A NZ  2  
ATOM   1330  N  N   . ALA A 1 77 ? -8.895  -3.468  12.549  1.00 0.00 ? 77 ALA A N   2  
ATOM   1331  C  CA  . ALA A 1 77 ? -8.662  -3.533  13.985  1.00 0.00 ? 77 ALA A CA  2  
ATOM   1332  C  C   . ALA A 1 77 ? -8.591  -4.926  14.558  1.00 0.00 ? 77 ALA A C   2  
ATOM   1333  O  O   . ALA A 1 77 ? -9.554  -5.445  15.139  1.00 0.00 ? 77 ALA A O   2  
ATOM   1334  C  CB  . ALA A 1 77 ? -9.759  -2.678  14.663  1.00 0.00 ? 77 ALA A CB  2  
ATOM   1335  N  N   . ASN A 1 78 ? -7.294  -5.624  14.422  1.00 0.00 ? 78 ASN A N   2  
ATOM   1336  C  CA  . ASN A 1 78 ? -6.997  -6.897  15.069  1.00 0.00 ? 78 ASN A CA  2  
ATOM   1337  C  C   . ASN A 1 78 ? -8.165  -7.850  15.062  1.00 0.00 ? 78 ASN A C   2  
ATOM   1338  O  O   . ASN A 1 78 ? -8.963  -7.919  16.007  1.00 0.00 ? 78 ASN A O   2  
ATOM   1339  C  CB  . ASN A 1 78 ? -6.516  -6.633  16.529  1.00 0.00 ? 78 ASN A CB  2  
ATOM   1340  C  CG  . ASN A 1 78 ? -5.928  -7.825  17.290  1.00 0.00 ? 78 ASN A CG  2  
ATOM   1341  O  OD1 . ASN A 1 78 ? -5.571  -8.850  16.727  1.00 0.00 ? 78 ASN A OD1 2  
ATOM   1342  N  ND2 . ASN A 1 78 ? -5.818  -7.749  18.589  1.00 0.00 ? 78 ASN A ND2 2  
ATOM   1343  N  N   . PRO A 1 79 ? -8.286  -8.722  13.874  1.00 0.00 ? 79 PRO A N   2  
ATOM   1344  C  CA  . PRO A 1 79 ? -9.364  -9.785  13.636  1.00 0.00 ? 79 PRO A CA  2  
ATOM   1345  C  C   . PRO A 1 79 ? -9.288  -10.965 14.586  1.00 0.00 ? 79 PRO A C   2  
ATOM   1346  O  O   . PRO A 1 79 ? -8.516  -10.949 15.561  1.00 0.00 ? 79 PRO A O   2  
ATOM   1347  C  CB  . PRO A 1 79 ? -9.176  -10.285 12.212  1.00 0.00 ? 79 PRO A CB  2  
ATOM   1348  C  CG  . PRO A 1 79 ? -7.666  -10.081 12.005  1.00 0.00 ? 79 PRO A CG  2  
ATOM   1349  C  CD  . PRO A 1 79 ? -7.389  -8.739  12.694  1.00 0.00 ? 79 PRO A CD  2  
ATOM   1350  N  N   . ARG A 1 80 ? -10.131 -12.140 14.286  1.00 0.00 ? 80 ARG A N   2  
ATOM   1351  C  CA  . ARG A 1 80 ? -10.211 -13.283 15.202  1.00 0.00 ? 80 ARG A CA  2  
ATOM   1352  C  C   . ARG A 1 80 ? -10.512 -14.558 14.448  1.00 0.00 ? 80 ARG A C   2  
ATOM   1353  O  O   . ARG A 1 80 ? -10.790 -14.552 13.241  1.00 0.00 ? 80 ARG A O   2  
ATOM   1354  C  CB  . ARG A 1 80 ? -11.275 -12.998 16.293  1.00 0.00 ? 80 ARG A CB  2  
ATOM   1355  C  CG  . ARG A 1 80 ? -11.450 -11.506 16.680  1.00 0.00 ? 80 ARG A CG  2  
ATOM   1356  C  CD  . ARG A 1 80 ? -12.299 -10.728 15.667  1.00 0.00 ? 80 ARG A CD  2  
ATOM   1357  N  NE  . ARG A 1 80 ? -13.485 -11.550 15.319  1.00 0.00 ? 80 ARG A NE  2  
ATOM   1358  C  CZ  . ARG A 1 80 ? -14.538 -11.753 16.100  1.00 0.00 ? 80 ARG A CZ  2  
ATOM   1359  N  NH1 . ARG A 1 80 ? -14.672 -11.257 17.294  1.00 0.00 ? 80 ARG A NH1 2  
ATOM   1360  N  NH2 . ARG A 1 80 ? -15.485 -12.491 15.640  1.00 0.00 ? 80 ARG A NH2 2  
ATOM   1361  N  N   . GLN A 1 81 ? -10.418 -15.812 15.226  1.00 0.00 ? 81 GLN A N   2  
ATOM   1362  C  CA  . GLN A 1 81 ? -10.513 -17.129 14.603  1.00 0.00 ? 81 GLN A CA  2  
ATOM   1363  C  C   . GLN A 1 81 ? -10.167 -18.218 15.593  1.00 0.00 ? 81 GLN A C   2  
ATOM   1364  O  O   . GLN A 1 81 ? -9.448  -17.997 16.578  1.00 0.00 ? 81 GLN A O   2  
ATOM   1365  C  CB  . GLN A 1 81 ? -9.566  -17.170 13.385  1.00 0.00 ? 81 GLN A CB  2  
ATOM   1366  C  CG  . GLN A 1 81 ? -10.243 -17.123 11.975  1.00 0.00 ? 81 GLN A CG  2  
ATOM   1367  C  CD  . GLN A 1 81 ? -9.565  -16.336 10.846  1.00 0.00 ? 81 GLN A CD  2  
ATOM   1368  O  OE1 . GLN A 1 81 ? -10.223 -15.764 9.992   1.00 0.00 ? 81 GLN A OE1 2  
ATOM   1369  N  NE2 . GLN A 1 81 ? -8.260  -16.265 10.792  1.00 0.00 ? 81 GLN A NE2 2  
ATOM   1370  N  N   . HIS A 1 82 ? -10.741 -19.555 15.329  1.00 0.00 ? 82 HIS A N   2  
ATOM   1371  C  CA  . HIS A 1 82 ? -10.449 -20.703 16.183  1.00 0.00 ? 82 HIS A CA  2  
ATOM   1372  C  C   . HIS A 1 82 ? -10.627 -21.999 15.427  1.00 0.00 ? 82 HIS A C   2  
ATOM   1373  O  O   . HIS A 1 82 ? -10.589 -22.043 14.190  1.00 0.00 ? 82 HIS A O   2  
ATOM   1374  C  CB  . HIS A 1 82 ? -11.437 -20.630 17.360  1.00 0.00 ? 82 HIS A CB  2  
ATOM   1375  C  CG  . HIS A 1 82 ? -12.804 -21.125 16.988  1.00 0.00 ? 82 HIS A CG  2  
ATOM   1376  N  ND1 . HIS A 1 82 ? -13.325 -21.189 15.698  1.00 0.00 ? 82 HIS A ND1 2  
ATOM   1377  C  CD2 . HIS A 1 82 ? -13.715 -21.587 17.927  1.00 0.00 ? 82 HIS A CD2 2  
ATOM   1378  C  CE1 . HIS A 1 82 ? -14.542 -21.697 15.966  1.00 0.00 ? 82 HIS A CE1 2  
ATOM   1379  N  NE2 . HIS A 1 82 ? -14.855 -21.962 17.264  1.00 0.00 ? 82 HIS A NE2 2  
ATOM   1380  N  N   . ARG A 1 83 ? -10.811 -23.216 16.248  1.00 0.00 ? 83 ARG A N   2  
ATOM   1381  C  CA  . ARG A 1 83 ? -11.055 -24.524 15.649  1.00 0.00 ? 83 ARG A CA  2  
ATOM   1382  C  C   . ARG A 1 83 ? -12.319 -24.512 14.821  1.00 0.00 ? 83 ARG A C   2  
ATOM   1383  O  O   . ARG A 1 83 ? -13.439 -24.434 15.343  1.00 0.00 ? 83 ARG A O   2  
ATOM   1384  C  CB  . ARG A 1 83 ? -11.127 -25.590 16.777  1.00 0.00 ? 83 ARG A CB  2  
ATOM   1385  C  CG  . ARG A 1 83 ? -10.416 -26.931 16.455  1.00 0.00 ? 83 ARG A CG  2  
ATOM   1386  C  CD  . ARG A 1 83 ? -11.328 -27.917 15.715  1.00 0.00 ? 83 ARG A CD  2  
ATOM   1387  N  NE  . ARG A 1 83 ? -10.476 -28.947 15.068  1.00 0.00 ? 83 ARG A NE  2  
ATOM   1388  C  CZ  . ARG A 1 83 ? -10.902 -29.886 14.234  1.00 0.00 ? 83 ARG A CZ  2  
ATOM   1389  N  NH1 . ARG A 1 83 ? -12.140 -30.033 13.865  1.00 0.00 ? 83 ARG A NH1 2  
ATOM   1390  N  NH2 . ARG A 1 83 ? -10.028 -30.704 13.764  1.00 0.00 ? 83 ARG A NH2 2  
ATOM   1391  N  N   . LEU A 1 84 ? -12.145 -24.637 13.358  1.00 0.00 ? 84 LEU A N   2  
ATOM   1392  C  CA  . LEU A 1 84 ? -13.283 -24.694 12.445  1.00 0.00 ? 84 LEU A CA  2  
ATOM   1393  C  C   . LEU A 1 84 ? -13.872 -23.319 12.229  1.00 0.00 ? 84 LEU A C   2  
ATOM   1394  O  O   . LEU A 1 84 ? -13.515 -22.344 12.904  1.00 0.00 ? 84 LEU A O   2  
ATOM   1395  C  CB  . LEU A 1 84 ? -14.360 -25.683 12.975  1.00 0.00 ? 84 LEU A CB  2  
ATOM   1396  C  CG  . LEU A 1 84 ? -14.773 -26.870 12.064  1.00 0.00 ? 84 LEU A CG  2  
ATOM   1397  C  CD1 . LEU A 1 84 ? -13.629 -27.890 11.975  1.00 0.00 ? 84 LEU A CD1 2  
ATOM   1398  C  CD2 . LEU A 1 84 ? -16.055 -27.570 12.545  1.00 0.00 ? 84 LEU A CD2 2  
ATOM   1399  N  N   . ASP A 1 85 ? -14.884 -23.201 11.158  1.00 0.00 ? 85 ASP A N   2  
ATOM   1400  C  CA  . ASP A 1 85 ? -15.634 -21.969 10.934  1.00 0.00 ? 85 ASP A CA  2  
ATOM   1401  C  C   . ASP A 1 85 ? -14.832 -20.989 10.111  1.00 0.00 ? 85 ASP A C   2  
ATOM   1402  O  O   . ASP A 1 85 ? -13.967 -20.264 10.620  1.00 0.00 ? 85 ASP A O   2  
ATOM   1403  C  CB  . ASP A 1 85 ? -16.080 -21.358 12.288  1.00 0.00 ? 85 ASP A CB  2  
ATOM   1404  C  CG  . ASP A 1 85 ? -17.306 -20.433 12.257  1.00 0.00 ? 85 ASP A CG  2  
ATOM   1405  O  OD1 . ASP A 1 85 ? -18.481 -21.116 12.115  1.00 0.00 ? 85 ASP A OD1 2  
ATOM   1406  O  OD2 . ASP A 1 85 ? -17.225 -19.217 12.341  1.00 0.00 ? 85 ASP A OD2 2  
ATOM   1407  N  N   . LYS A 1 86 ? -15.134 -20.948 8.663   1.00 0.00 ? 86 LYS A N   2  
ATOM   1408  C  CA  . LYS A 1 86 ? -14.529 -19.960 7.775   1.00 0.00 ? 86 LYS A CA  2  
ATOM   1409  C  C   . LYS A 1 86 ? -15.564 -19.357 6.854   1.00 0.00 ? 86 LYS A C   2  
ATOM   1410  O  O   . LYS A 1 86 ? -15.337 -19.174 5.650   1.00 0.00 ? 86 LYS A O   2  
ATOM   1411  C  CB  . LYS A 1 86 ? -13.384 -20.626 6.963   1.00 0.00 ? 86 LYS A CB  2  
ATOM   1412  C  CG  . LYS A 1 86 ? -12.400 -19.607 6.336   1.00 0.00 ? 86 LYS A CG  2  
ATOM   1413  C  CD  . LYS A 1 86 ? -11.421 -18.966 7.324   1.00 0.00 ? 86 LYS A CD  2  
ATOM   1414  C  CE  . LYS A 1 86 ? -11.882 -17.536 7.638   1.00 0.00 ? 86 LYS A CE  2  
ATOM   1415  N  NZ  . LYS A 1 86 ? -11.220 -16.595 6.717   1.00 0.00 ? 86 LYS A NZ  2  
ATOM   1416  N  N   . ILE A 1 87 ? -16.860 -18.997 7.469   1.00 0.00 ? 87 ILE A N   2  
ATOM   1417  C  CA  . ILE A 1 87 ? -17.922 -18.343 6.711   1.00 0.00 ? 87 ILE A CA  2  
ATOM   1418  C  C   . ILE A 1 87 ? -17.924 -16.853 6.959   1.00 0.00 ? 87 ILE A C   2  
ATOM   1419  O  O   . ILE A 1 87 ? -17.607 -16.374 8.057   1.00 0.00 ? 87 ILE A O   2  
ATOM   1420  C  CB  . ILE A 1 87 ? -19.333 -18.993 7.016   1.00 0.00 ? 87 ILE A CB  2  
ATOM   1421  C  CG1 . ILE A 1 87 ? -20.336 -18.964 5.818   1.00 0.00 ? 87 ILE A CG1 2  
ATOM   1422  C  CG2 . ILE A 1 87 ? -20.038 -18.355 8.253   1.00 0.00 ? 87 ILE A CG2 2  
ATOM   1423  C  CD1 . ILE A 1 87 ? -21.805 -19.282 6.163   1.00 0.00 ? 87 ILE A CD1 2  
ATOM   1424  N  N   . THR A 1 88 ? -18.334 -16.000 5.823   1.00 0.00 ? 88 THR A N   2  
ATOM   1425  C  CA  . THR A 1 88 ? -18.408 -14.546 5.933   1.00 0.00 ? 88 THR A CA  2  
ATOM   1426  C  C   . THR A 1 88 ? -19.771 -14.041 5.523   1.00 0.00 ? 88 THR A C   2  
ATOM   1427  O  O   . THR A 1 88 ? -19.951 -13.447 4.451   1.00 0.00 ? 88 THR A O   2  
ATOM   1428  C  CB  . THR A 1 88 ? -17.287 -13.871 5.074   1.00 0.00 ? 88 THR A CB  2  
ATOM   1429  O  OG1 . THR A 1 88 ? -16.113 -14.674 5.067   1.00 0.00 ? 88 THR A OG1 2  
ATOM   1430  C  CG2 . THR A 1 88 ? -16.803 -12.483 5.547   1.00 0.00 ? 88 THR A CG2 2  
ATOM   1431  N  N   . HIS A 1 89 ? -20.880 -14.308 6.465   1.00 0.00 ? 89 HIS A N   2  
ATOM   1432  C  CA  . HIS A 1 89 ? -22.266 -13.980 6.144   1.00 0.00 ? 89 HIS A CA  2  
ATOM   1433  C  C   . HIS A 1 89 ? -22.947 -13.307 7.312   1.00 0.00 ? 89 HIS A C   2  
ATOM   1434  O  O   . HIS A 1 89 ? -23.354 -13.951 8.289   1.00 0.00 ? 89 HIS A O   2  
ATOM   1435  C  CB  . HIS A 1 89 ? -22.961 -15.311 5.812   1.00 0.00 ? 89 HIS A CB  2  
ATOM   1436  C  CG  . HIS A 1 89 ? -23.992 -15.162 4.731   1.00 0.00 ? 89 HIS A CG  2  
ATOM   1437  N  ND1 . HIS A 1 89 ? -23.754 -14.711 3.435   1.00 0.00 ? 89 HIS A ND1 2  
ATOM   1438  C  CD2 . HIS A 1 89 ? -25.332 -15.468 4.925   1.00 0.00 ? 89 HIS A CD2 2  
ATOM   1439  C  CE1 . HIS A 1 89 ? -25.002 -14.787 2.934   1.00 0.00 ? 89 HIS A CE1 2  
ATOM   1440  N  NE2 . HIS A 1 89 ? -25.997 -15.224 3.752   1.00 0.00 ? 89 HIS A NE2 2  
ATOM   1441  N  N   . ALA A 1 90 ? -23.129 -11.843 7.210   1.00 0.00 ? 90 ALA A N   2  
ATOM   1442  C  CA  . ALA A 1 90 ? -23.663 -11.050 8.314   1.00 0.00 ? 90 ALA A CA  2  
ATOM   1443  C  C   . ALA A 1 90 ? -23.996 -9.648  7.861   1.00 0.00 ? 90 ALA A C   2  
ATOM   1444  O  O   . ALA A 1 90 ? -25.002 -9.052  8.268   1.00 0.00 ? 90 ALA A O   2  
ATOM   1445  C  CB  . ALA A 1 90 ? -22.628 -11.079 9.452   1.00 0.00 ? 90 ALA A CB  2  
ATOM   1446  N  N   . CYS A 1 91 ? -23.042 -9.020  6.919   1.00 0.00 ? 91 CYS A N   2  
ATOM   1447  C  CA  . CYS A 1 91 ? -23.296 -7.710  6.325   1.00 0.00 ? 91 CYS A CA  2  
ATOM   1448  C  C   . CYS A 1 91 ? -23.264 -6.626  7.377   1.00 0.00 ? 91 CYS A C   2  
ATOM   1449  O  O   . CYS A 1 91 ? -22.211 -6.057  7.695   1.00 0.00 ? 91 CYS A O   2  
ATOM   1450  C  CB  . CYS A 1 91 ? -24.643 -7.764  5.578   1.00 0.00 ? 91 CYS A CB  2  
ATOM   1451  S  SG  . CYS A 1 91 ? -24.397 -8.220  3.847   1.00 0.00 ? 91 CYS A SG  2  
ATOM   1452  N  N   . ARG A 1 92 ? -24.554 -6.306  8.027   1.00 0.00 ? 92 ARG A N   2  
ATOM   1453  C  CA  . ARG A 1 92 ? -24.659 -5.310  9.090   1.00 0.00 ? 92 ARG A CA  2  
ATOM   1454  C  C   . ARG A 1 92 ? -26.085 -5.177  9.568   1.00 0.00 ? 92 ARG A C   2  
ATOM   1455  O  O   . ARG A 1 92 ? -26.385 -5.274  10.756  1.00 0.00 ? 92 ARG A O   2  
ATOM   1456  C  CB  . ARG A 1 92 ? -24.108 -3.955  8.566   1.00 0.00 ? 92 ARG A CB  2  
ATOM   1457  C  CG  . ARG A 1 92 ? -24.419 -2.731  9.468   1.00 0.00 ? 92 ARG A CG  2  
ATOM   1458  C  CD  . ARG A 1 92 ? -23.270 -2.401  10.428  1.00 0.00 ? 92 ARG A CD  2  
ATOM   1459  N  NE  . ARG A 1 92 ? -22.757 -3.673  10.998  1.00 0.00 ? 92 ARG A NE  2  
ATOM   1460  C  CZ  . ARG A 1 92 ? -23.299 -4.337  12.010  1.00 0.00 ? 92 ARG A CZ  2  
ATOM   1461  N  NH1 . ARG A 1 92 ? -24.367 -3.958  12.647  1.00 0.00 ? 92 ARG A NH1 2  
ATOM   1462  N  NH2 . ARG A 1 92 ? -22.725 -5.427  12.380  1.00 0.00 ? 92 ARG A NH2 2  
ATOM   1463  O  OXT . ARG A 1 92 ? -27.066 -4.942  8.555   1.00 0.00 ? 92 ARG A OXT 2  
HETATM 1464  ZN ZN  . ZN  B 2 .  ? 1.847   -1.959  4.140   1.00 0.00 ? 93 ZN  A ZN  2  
ATOM   1465  N  N   . MET A 1 1  ? 11.665  22.036  -20.187 1.00 0.00 ? 1  MET A N   3  
ATOM   1466  C  CA  . MET A 1 1  ? 12.649  21.945  -19.114 1.00 0.00 ? 1  MET A CA  3  
ATOM   1467  C  C   . MET A 1 1  ? 12.007  22.114  -17.757 1.00 0.00 ? 1  MET A C   3  
ATOM   1468  O  O   . MET A 1 1  ? 12.660  21.940  -16.711 1.00 0.00 ? 1  MET A O   3  
ATOM   1469  C  CB  . MET A 1 1  ? 13.770  22.998  -19.332 1.00 0.00 ? 1  MET A CB  3  
ATOM   1470  C  CG  . MET A 1 1  ? 13.370  24.256  -20.133 1.00 0.00 ? 1  MET A CG  3  
ATOM   1471  S  SD  . MET A 1 1  ? 14.637  25.522  -19.953 1.00 0.00 ? 1  MET A SD  3  
ATOM   1472  C  CE  . MET A 1 1  ? 14.064  26.656  -21.224 1.00 0.00 ? 1  MET A CE  3  
ATOM   1473  N  N   . LYS A 1 2  ? 10.589  22.530  -17.718 1.00 0.00 ? 2  LYS A N   3  
ATOM   1474  C  CA  . LYS A 1 2  ? 9.889   22.770  -16.458 1.00 0.00 ? 2  LYS A CA  3  
ATOM   1475  C  C   . LYS A 1 2  ? 8.710   21.838  -16.308 1.00 0.00 ? 2  LYS A C   3  
ATOM   1476  O  O   . LYS A 1 2  ? 8.559   21.133  -15.301 1.00 0.00 ? 2  LYS A O   3  
ATOM   1477  C  CB  . LYS A 1 2  ? 9.437   24.255  -16.395 1.00 0.00 ? 2  LYS A CB  3  
ATOM   1478  C  CG  . LYS A 1 2  ? 8.637   24.602  -15.115 1.00 0.00 ? 2  LYS A CG  3  
ATOM   1479  C  CD  . LYS A 1 2  ? 8.849   26.025  -14.590 1.00 0.00 ? 2  LYS A CD  3  
ATOM   1480  C  CE  . LYS A 1 2  ? 8.715   27.018  -15.753 1.00 0.00 ? 2  LYS A CE  3  
ATOM   1481  N  NZ  . LYS A 1 2  ? 8.326   28.338  -15.228 1.00 0.00 ? 2  LYS A NZ  3  
ATOM   1482  N  N   . LYS A 1 3  ? 7.725   21.842  -17.413 1.00 0.00 ? 3  LYS A N   3  
ATOM   1483  C  CA  . LYS A 1 3  ? 6.587   20.929  -17.434 1.00 0.00 ? 3  LYS A CA  3  
ATOM   1484  C  C   . LYS A 1 3  ? 7.048   19.490  -17.402 1.00 0.00 ? 3  LYS A C   3  
ATOM   1485  O  O   . LYS A 1 3  ? 7.459   18.915  -18.419 1.00 0.00 ? 3  LYS A O   3  
ATOM   1486  C  CB  . LYS A 1 3  ? 5.718   21.205  -18.692 1.00 0.00 ? 3  LYS A CB  3  
ATOM   1487  C  CG  . LYS A 1 3  ? 4.651   20.114  -18.956 1.00 0.00 ? 3  LYS A CG  3  
ATOM   1488  C  CD  . LYS A 1 3  ? 3.793   19.744  -17.742 1.00 0.00 ? 3  LYS A CD  3  
ATOM   1489  C  CE  . LYS A 1 3  ? 2.452   19.176  -18.225 1.00 0.00 ? 3  LYS A CE  3  
ATOM   1490  N  NZ  . LYS A 1 3  ? 1.985   18.149  -17.277 1.00 0.00 ? 3  LYS A NZ  3  
ATOM   1491  N  N   . ALA A 1 4  ? 6.967   18.805  -16.094 1.00 0.00 ? 4  ALA A N   3  
ATOM   1492  C  CA  . ALA A 1 4  ? 7.449   17.440  -15.904 1.00 0.00 ? 4  ALA A CA  3  
ATOM   1493  C  C   . ALA A 1 4  ? 6.527   16.443  -16.565 1.00 0.00 ? 4  ALA A C   3  
ATOM   1494  O  O   . ALA A 1 4  ? 5.332   16.351  -16.251 1.00 0.00 ? 4  ALA A O   3  
ATOM   1495  C  CB  . ALA A 1 4  ? 7.594   17.204  -14.391 1.00 0.00 ? 4  ALA A CB  3  
ATOM   1496  N  N   . THR A 1 5  ? 7.120   15.610  -17.634 1.00 0.00 ? 5  THR A N   3  
ATOM   1497  C  CA  . THR A 1 5  ? 6.349   14.588  -18.336 1.00 0.00 ? 5  THR A CA  3  
ATOM   1498  C  C   . THR A 1 5  ? 6.994   13.229  -18.205 1.00 0.00 ? 5  THR A C   3  
ATOM   1499  O  O   . THR A 1 5  ? 6.323   12.186  -18.226 1.00 0.00 ? 5  THR A O   3  
ATOM   1500  C  CB  . THR A 1 5  ? 6.168   14.973  -19.843 1.00 0.00 ? 5  THR A CB  3  
ATOM   1501  O  OG1 . THR A 1 5  ? 7.417   14.929  -20.522 1.00 0.00 ? 5  THR A OG1 3  
ATOM   1502  C  CG2 . THR A 1 5  ? 5.623   16.389  -20.127 1.00 0.00 ? 5  THR A CG2 3  
ATOM   1503  N  N   . CYS A 1 6  ? 8.468   13.203  -18.088 1.00 0.00 ? 6  CYS A N   3  
ATOM   1504  C  CA  . CYS A 1 6  ? 9.216   11.947  -18.054 1.00 0.00 ? 6  CYS A CA  3  
ATOM   1505  C  C   . CYS A 1 6  ? 9.081   11.278  -16.708 1.00 0.00 ? 6  CYS A C   3  
ATOM   1506  O  O   . CYS A 1 6  ? 7.980   10.839  -16.320 1.00 0.00 ? 6  CYS A O   3  
ATOM   1507  C  CB  . CYS A 1 6  ? 10.675  12.236  -18.457 1.00 0.00 ? 6  CYS A CB  3  
ATOM   1508  S  SG  . CYS A 1 6  ? 11.581  10.698  -18.734 1.00 0.00 ? 6  CYS A SG  3  
ATOM   1509  N  N   . LEU A 1 7  ? 10.289  11.165  -15.863 1.00 0.00 ? 7  LEU A N   3  
ATOM   1510  C  CA  . LEU A 1 7  ? 10.286  10.409  -14.612 1.00 0.00 ? 7  LEU A CA  3  
ATOM   1511  C  C   . LEU A 1 7  ? 9.803   11.265  -13.465 1.00 0.00 ? 7  LEU A C   3  
ATOM   1512  O  O   . LEU A 1 7  ? 10.541  12.096  -12.916 1.00 0.00 ? 7  LEU A O   3  
ATOM   1513  C  CB  . LEU A 1 7  ? 11.698  9.828   -14.317 1.00 0.00 ? 7  LEU A CB  3  
ATOM   1514  C  CG  . LEU A 1 7  ? 12.912  10.796  -14.331 1.00 0.00 ? 7  LEU A CG  3  
ATOM   1515  C  CD1 . LEU A 1 7  ? 14.021  10.262  -13.414 1.00 0.00 ? 7  LEU A CD1 3  
ATOM   1516  C  CD2 . LEU A 1 7  ? 13.473  11.026  -15.743 1.00 0.00 ? 7  LEU A CD2 3  
ATOM   1517  N  N   . THR A 1 8  ? 8.392   11.087  -13.057 1.00 0.00 ? 8  THR A N   3  
ATOM   1518  C  CA  . THR A 1 8  ? 7.849   11.728  -11.863 1.00 0.00 ? 8  THR A CA  3  
ATOM   1519  C  C   . THR A 1 8  ? 6.797   10.862  -11.211 1.00 0.00 ? 8  THR A C   3  
ATOM   1520  O  O   . THR A 1 8  ? 7.063   10.148  -10.229 1.00 0.00 ? 8  THR A O   3  
ATOM   1521  C  CB  . THR A 1 8  ? 7.283   13.146  -12.206 1.00 0.00 ? 8  THR A CB  3  
ATOM   1522  O  OG1 . THR A 1 8  ? 6.678   13.146  -13.492 1.00 0.00 ? 8  THR A OG1 3  
ATOM   1523  C  CG2 . THR A 1 8  ? 8.313   14.297  -12.266 1.00 0.00 ? 8  THR A CG2 3  
ATOM   1524  N  N   . ASP A 1 9  ? 5.449   10.873  -11.818 1.00 0.00 ? 9  ASP A N   3  
ATOM   1525  C  CA  . ASP A 1 9  ? 4.385   9.990   -11.343 1.00 0.00 ? 9  ASP A CA  3  
ATOM   1526  C  C   . ASP A 1 9  ? 4.621   8.572   -11.808 1.00 0.00 ? 9  ASP A C   3  
ATOM   1527  O  O   . ASP A 1 9  ? 4.384   7.598   -11.080 1.00 0.00 ? 9  ASP A O   3  
ATOM   1528  C  CB  . ASP A 1 9  ? 2.999   10.525  -11.784 1.00 0.00 ? 9  ASP A CB  3  
ATOM   1529  C  CG  . ASP A 1 9  ? 1.917   10.615  -10.697 1.00 0.00 ? 9  ASP A CG  3  
ATOM   1530  O  OD1 . ASP A 1 9  ? 1.796   9.783   -9.809  1.00 0.00 ? 9  ASP A OD1 3  
ATOM   1531  O  OD2 . ASP A 1 9  ? 1.133   11.727  -10.819 1.00 0.00 ? 9  ASP A OD2 3  
ATOM   1532  N  N   . ASP A 1 10 ? 5.176   8.414   -13.170 1.00 0.00 ? 10 ASP A N   3  
ATOM   1533  C  CA  . ASP A 1 10 ? 5.612   7.115   -13.679 1.00 0.00 ? 10 ASP A CA  3  
ATOM   1534  C  C   . ASP A 1 10 ? 6.486   6.412   -12.666 1.00 0.00 ? 10 ASP A C   3  
ATOM   1535  O  O   . ASP A 1 10 ? 6.060   5.485   -11.964 1.00 0.00 ? 10 ASP A O   3  
ATOM   1536  C  CB  . ASP A 1 10 ? 6.325   7.286   -15.045 1.00 0.00 ? 10 ASP A CB  3  
ATOM   1537  C  CG  . ASP A 1 10 ? 6.451   6.030   -15.920 1.00 0.00 ? 10 ASP A CG  3  
ATOM   1538  O  OD1 . ASP A 1 10 ? 6.330   4.896   -15.481 1.00 0.00 ? 10 ASP A OD1 3  
ATOM   1539  O  OD2 . ASP A 1 10 ? 6.703   6.322   -17.232 1.00 0.00 ? 10 ASP A OD2 3  
ATOM   1540  N  N   . GLN A 1 11 ? 7.868   6.924   -12.530 1.00 0.00 ? 11 GLN A N   3  
ATOM   1541  C  CA  . GLN A 1 11 ? 8.860   6.280   -11.674 1.00 0.00 ? 11 GLN A CA  3  
ATOM   1542  C  C   . GLN A 1 11 ? 8.277   5.937   -10.323 1.00 0.00 ? 11 GLN A C   3  
ATOM   1543  O  O   . GLN A 1 11 ? 8.532   4.868   -9.751  1.00 0.00 ? 11 GLN A O   3  
ATOM   1544  C  CB  . GLN A 1 11 ? 10.069  7.231   -11.522 1.00 0.00 ? 11 GLN A CB  3  
ATOM   1545  C  CG  . GLN A 1 11 ? 10.029  8.204   -10.297 1.00 0.00 ? 11 GLN A CG  3  
ATOM   1546  C  CD  . GLN A 1 11 ? 11.330  8.859   -9.815  1.00 0.00 ? 11 GLN A CD  3  
ATOM   1547  O  OE1 . GLN A 1 11 ? 11.376  10.050  -9.551  1.00 0.00 ? 11 GLN A OE1 3  
ATOM   1548  N  NE2 . GLN A 1 11 ? 12.408  8.134   -9.658  1.00 0.00 ? 11 GLN A NE2 3  
ATOM   1549  N  N   . ARG A 1 12 ? 7.419   6.968   -9.703  1.00 0.00 ? 12 ARG A N   3  
ATOM   1550  C  CA  . ARG A 1 12 ? 6.830   6.829   -8.376  1.00 0.00 ? 12 ARG A CA  3  
ATOM   1551  C  C   . ARG A 1 12 ? 6.022   5.565   -8.218  1.00 0.00 ? 12 ARG A C   3  
ATOM   1552  O  O   . ARG A 1 12 ? 6.428   4.543   -7.618  1.00 0.00 ? 12 ARG A O   3  
ATOM   1553  C  CB  . ARG A 1 12 ? 5.925   8.078   -8.116  1.00 0.00 ? 12 ARG A CB  3  
ATOM   1554  C  CG  . ARG A 1 12 ? 6.617   9.270   -7.409  1.00 0.00 ? 12 ARG A CG  3  
ATOM   1555  C  CD  . ARG A 1 12 ? 5.614   10.315  -6.902  1.00 0.00 ? 12 ARG A CD  3  
ATOM   1556  N  NE  . ARG A 1 12 ? 5.837   11.579  -7.649  1.00 0.00 ? 12 ARG A NE  3  
ATOM   1557  C  CZ  . ARG A 1 12 ? 6.884   12.381  -7.509  1.00 0.00 ? 12 ARG A CZ  3  
ATOM   1558  N  NH1 . ARG A 1 12 ? 7.871   12.163  -6.691  1.00 0.00 ? 12 ARG A NH1 3  
ATOM   1559  N  NH2 . ARG A 1 12 ? 6.919   13.443  -8.233  1.00 0.00 ? 12 ARG A NH2 3  
ATOM   1560  N  N   . TRP A 1 13 ? 4.657   5.603   -8.813  1.00 0.00 ? 13 TRP A N   3  
ATOM   1561  C  CA  . TRP A 1 13 ? 3.708   4.526   -8.562  1.00 0.00 ? 13 TRP A CA  3  
ATOM   1562  C  C   . TRP A 1 13 ? 4.175   3.252   -9.238  1.00 0.00 ? 13 TRP A C   3  
ATOM   1563  O  O   . TRP A 1 13 ? 3.811   2.137   -8.842  1.00 0.00 ? 13 TRP A O   3  
ATOM   1564  C  CB  . TRP A 1 13 ? 2.288   4.894   -9.083  1.00 0.00 ? 13 TRP A CB  3  
ATOM   1565  C  CG  . TRP A 1 13 ? 1.458   3.612   -9.305  1.00 0.00 ? 13 TRP A CG  3  
ATOM   1566  C  CD1 . TRP A 1 13 ? 1.193   3.006   -10.548 1.00 0.00 ? 13 TRP A CD1 3  
ATOM   1567  C  CD2 . TRP A 1 13 ? 0.934   2.778   -8.344  1.00 0.00 ? 13 TRP A CD2 3  
ATOM   1568  N  NE1 . TRP A 1 13 ? 0.501   1.790   -10.386 1.00 0.00 ? 13 TRP A NE1 3  
ATOM   1569  C  CE2 . TRP A 1 13 ? 0.360   1.666   -9.010  1.00 0.00 ? 13 TRP A CE2 3  
ATOM   1570  C  CE3 . TRP A 1 13 ? 0.924   2.860   -6.927  1.00 0.00 ? 13 TRP A CE3 3  
ATOM   1571  C  CZ2 . TRP A 1 13 ? -0.227  0.626   -8.256  1.00 0.00 ? 13 TRP A CZ2 3  
ATOM   1572  C  CZ3 . TRP A 1 13 ? 0.320   1.830   -6.207  1.00 0.00 ? 13 TRP A CZ3 3  
ATOM   1573  C  CH2 . TRP A 1 13 ? -0.248  0.727   -6.863  1.00 0.00 ? 13 TRP A CH2 3  
ATOM   1574  N  N   . GLN A 1 14 ? 5.053   3.423   -10.418 1.00 0.00 ? 14 GLN A N   3  
ATOM   1575  C  CA  . GLN A 1 14 ? 5.725   2.280   -11.039 1.00 0.00 ? 14 GLN A CA  3  
ATOM   1576  C  C   . GLN A 1 14 ? 6.608   1.594   -10.017 1.00 0.00 ? 14 GLN A C   3  
ATOM   1577  O  O   . GLN A 1 14 ? 6.695   0.362   -9.945  1.00 0.00 ? 14 GLN A O   3  
ATOM   1578  C  CB  . GLN A 1 14 ? 6.544   2.762   -12.252 1.00 0.00 ? 14 GLN A CB  3  
ATOM   1579  C  CG  . GLN A 1 14 ? 7.228   1.648   -13.113 1.00 0.00 ? 14 GLN A CG  3  
ATOM   1580  C  CD  . GLN A 1 14 ? 8.558   1.953   -13.814 1.00 0.00 ? 14 GLN A CD  3  
ATOM   1581  O  OE1 . GLN A 1 14 ? 9.474   2.499   -13.219 1.00 0.00 ? 14 GLN A OE1 3  
ATOM   1582  N  NE2 . GLN A 1 14 ? 8.728   1.620   -15.068 1.00 0.00 ? 14 GLN A NE2 3  
ATOM   1583  N  N   . SER A 1 15 ? 7.381   2.495   -9.127  1.00 0.00 ? 15 SER A N   3  
ATOM   1584  C  CA  . SER A 1 15 ? 8.117   1.972   -7.977  1.00 0.00 ? 15 SER A CA  3  
ATOM   1585  C  C   . SER A 1 15 ? 7.244   0.993   -7.218  1.00 0.00 ? 15 SER A C   3  
ATOM   1586  O  O   . SER A 1 15 ? 7.719   -0.023  -6.694  1.00 0.00 ? 15 SER A O   3  
ATOM   1587  C  CB  . SER A 1 15 ? 8.665   3.094   -7.064  1.00 0.00 ? 15 SER A CB  3  
ATOM   1588  O  OG  . SER A 1 15 ? 9.065   2.619   -5.773  1.00 0.00 ? 15 SER A OG  3  
ATOM   1589  N  N   . VAL A 1 16 ? 5.797   1.347   -7.109  1.00 0.00 ? 16 VAL A N   3  
ATOM   1590  C  CA  . VAL A 1 16 ? 4.852   0.379   -6.561  1.00 0.00 ? 16 VAL A CA  3  
ATOM   1591  C  C   . VAL A 1 16 ? 4.648   -0.823  -7.452  1.00 0.00 ? 16 VAL A C   3  
ATOM   1592  O  O   . VAL A 1 16 ? 4.806   -1.995  -7.026  1.00 0.00 ? 16 VAL A O   3  
ATOM   1593  C  CB  . VAL A 1 16 ? 3.473   1.020   -6.150  1.00 0.00 ? 16 VAL A CB  3  
ATOM   1594  C  CG1 . VAL A 1 16 ? 2.705   0.289   -4.999  1.00 0.00 ? 16 VAL A CG1 3  
ATOM   1595  C  CG2 . VAL A 1 16 ? 3.570   2.492   -5.686  1.00 0.00 ? 16 VAL A CG2 3  
ATOM   1596  N  N   . LEU A 1 17 ? 4.207   -0.595  -8.843  1.00 0.00 ? 17 LEU A N   3  
ATOM   1597  C  CA  . LEU A 1 17 ? 3.806   -1.696  -9.737  1.00 0.00 ? 17 LEU A CA  3  
ATOM   1598  C  C   . LEU A 1 17 ? 4.779   -2.840  -9.624  1.00 0.00 ? 17 LEU A C   3  
ATOM   1599  O  O   . LEU A 1 17 ? 4.421   -4.023  -9.579  1.00 0.00 ? 17 LEU A O   3  
ATOM   1600  C  CB  . LEU A 1 17 ? 3.729   -1.195  -11.210 1.00 0.00 ? 17 LEU A CB  3  
ATOM   1601  C  CG  . LEU A 1 17 ? 2.459   -0.382  -11.600 1.00 0.00 ? 17 LEU A CG  3  
ATOM   1602  C  CD1 . LEU A 1 17 ? 2.374   -0.225  -13.122 1.00 0.00 ? 17 LEU A CD1 3  
ATOM   1603  C  CD2 . LEU A 1 17 ? 1.170   -1.032  -11.072 1.00 0.00 ? 17 LEU A CD2 3  
ATOM   1604  N  N   . ALA A 1 18 ? 6.213   -2.442  -9.618  1.00 0.00 ? 18 ALA A N   3  
ATOM   1605  C  CA  . ALA A 1 18 ? 7.302   -3.402  -9.507  1.00 0.00 ? 18 ALA A CA  3  
ATOM   1606  C  C   . ALA A 1 18 ? 7.115   -4.390  -8.382  1.00 0.00 ? 18 ALA A C   3  
ATOM   1607  O  O   . ALA A 1 18 ? 6.409   -5.403  -8.513  1.00 0.00 ? 18 ALA A O   3  
ATOM   1608  C  CB  . ALA A 1 18 ? 8.613   -2.599  -9.376  1.00 0.00 ? 18 ALA A CB  3  
ATOM   1609  N  N   . ARG A 1 19 ? 7.853   -4.123  -7.127  1.00 0.00 ? 19 ARG A N   3  
ATOM   1610  C  CA  . ARG A 1 19 ? 7.906   -5.097  -6.043  1.00 0.00 ? 19 ARG A CA  3  
ATOM   1611  C  C   . ARG A 1 19 ? 8.729   -4.588  -4.884  1.00 0.00 ? 19 ARG A C   3  
ATOM   1612  O  O   . ARG A 1 19 ? 8.247   -3.864  -4.002  1.00 0.00 ? 19 ARG A O   3  
ATOM   1613  C  CB  . ARG A 1 19 ? 8.466   -6.438  -6.603  1.00 0.00 ? 19 ARG A CB  3  
ATOM   1614  C  CG  . ARG A 1 19 ? 8.695   -7.549  -5.545  1.00 0.00 ? 19 ARG A CG  3  
ATOM   1615  C  CD  . ARG A 1 19 ? 7.912   -8.831  -5.859  1.00 0.00 ? 19 ARG A CD  3  
ATOM   1616  N  NE  . ARG A 1 19 ? 8.701   -9.641  -6.822  1.00 0.00 ? 19 ARG A NE  3  
ATOM   1617  C  CZ  . ARG A 1 19 ? 8.558   -10.943 -7.032  1.00 0.00 ? 19 ARG A CZ  3  
ATOM   1618  N  NH1 . ARG A 1 19 ? 7.699   -11.696 -6.411  1.00 0.00 ? 19 ARG A NH1 3  
ATOM   1619  N  NH2 . ARG A 1 19 ? 9.322   -11.490 -7.909  1.00 0.00 ? 19 ARG A NH2 3  
ATOM   1620  N  N   . ASP A 1 20 ? 10.157  -4.979  -4.876  1.00 0.00 ? 20 ASP A N   3  
ATOM   1621  C  CA  . ASP A 1 20 ? 11.123  -4.451  -3.911  1.00 0.00 ? 20 ASP A CA  3  
ATOM   1622  C  C   . ASP A 1 20 ? 11.615  -3.091  -4.339  1.00 0.00 ? 20 ASP A C   3  
ATOM   1623  O  O   . ASP A 1 20 ? 11.696  -2.772  -5.534  1.00 0.00 ? 20 ASP A O   3  
ATOM   1624  C  CB  . ASP A 1 20 ? 12.286  -5.465  -3.738  1.00 0.00 ? 20 ASP A CB  3  
ATOM   1625  C  CG  . ASP A 1 20 ? 13.548  -4.989  -3.007  1.00 0.00 ? 20 ASP A CG  3  
ATOM   1626  O  OD1 . ASP A 1 20 ? 14.293  -4.127  -3.451  1.00 0.00 ? 20 ASP A OD1 3  
ATOM   1627  O  OD2 . ASP A 1 20 ? 13.759  -5.648  -1.827  1.00 0.00 ? 20 ASP A OD2 3  
ATOM   1628  N  N   . PRO A 1 21 ? 12.020  -2.175  -3.254  1.00 0.00 ? 21 PRO A N   3  
ATOM   1629  C  CA  . PRO A 1 21 ? 12.559  -0.745  -3.416  1.00 0.00 ? 21 PRO A CA  3  
ATOM   1630  C  C   . PRO A 1 21 ? 13.294  -0.484  -4.709  1.00 0.00 ? 21 PRO A C   3  
ATOM   1631  O  O   . PRO A 1 21 ? 14.531  -0.500  -4.774  1.00 0.00 ? 21 PRO A O   3  
ATOM   1632  C  CB  . PRO A 1 21 ? 13.519  -0.561  -2.243  1.00 0.00 ? 21 PRO A CB  3  
ATOM   1633  C  CG  . PRO A 1 21 ? 12.757  -1.294  -1.129  1.00 0.00 ? 21 PRO A CG  3  
ATOM   1634  C  CD  . PRO A 1 21 ? 11.995  -2.442  -1.797  1.00 0.00 ? 21 PRO A CD  3  
ATOM   1635  N  N   . ASN A 1 22 ? 12.450  -0.214  -5.895  1.00 0.00 ? 22 ASN A N   3  
ATOM   1636  C  CA  . ASN A 1 22 ? 13.011  0.198   -7.178  1.00 0.00 ? 22 ASN A CA  3  
ATOM   1637  C  C   . ASN A 1 22 ? 13.266  1.688   -7.201  1.00 0.00 ? 22 ASN A C   3  
ATOM   1638  O  O   . ASN A 1 22 ? 14.267  2.170   -7.748  1.00 0.00 ? 22 ASN A O   3  
ATOM   1639  C  CB  . ASN A 1 22 ? 12.040  -0.210  -8.324  1.00 0.00 ? 22 ASN A CB  3  
ATOM   1640  C  CG  . ASN A 1 22 ? 12.021  0.682   -9.569  1.00 0.00 ? 22 ASN A CG  3  
ATOM   1641  O  OD1 . ASN A 1 22 ? 12.463  0.312   -10.647 1.00 0.00 ? 22 ASN A OD1 3  
ATOM   1642  N  ND2 . ASN A 1 22 ? 11.502  1.877   -9.478  1.00 0.00 ? 22 ASN A ND2 3  
ATOM   1643  N  N   . ALA A 1 23 ? 12.233  2.537   -6.567  1.00 0.00 ? 23 ALA A N   3  
ATOM   1644  C  CA  . ALA A 1 23 ? 12.362  3.989   -6.493  1.00 0.00 ? 23 ALA A CA  3  
ATOM   1645  C  C   . ALA A 1 23 ? 11.702  4.534   -5.249  1.00 0.00 ? 23 ALA A C   3  
ATOM   1646  O  O   . ALA A 1 23 ? 11.360  5.723   -5.163  1.00 0.00 ? 23 ALA A O   3  
ATOM   1647  C  CB  . ALA A 1 23 ? 11.769  4.575   -7.787  1.00 0.00 ? 23 ALA A CB  3  
ATOM   1648  N  N   . ASP A 1 24 ? 11.504  3.586   -4.131  1.00 0.00 ? 24 ASP A N   3  
ATOM   1649  C  CA  . ASP A 1 24 ? 11.034  4.027   -2.821  1.00 0.00 ? 24 ASP A CA  3  
ATOM   1650  C  C   . ASP A 1 24 ? 11.822  5.225   -2.343  1.00 0.00 ? 24 ASP A C   3  
ATOM   1651  O  O   . ASP A 1 24 ? 11.391  6.380   -2.457  1.00 0.00 ? 24 ASP A O   3  
ATOM   1652  C  CB  . ASP A 1 24 ? 11.083  2.857   -1.804  1.00 0.00 ? 24 ASP A CB  3  
ATOM   1653  C  CG  . ASP A 1 24 ? 10.235  1.620   -2.139  1.00 0.00 ? 24 ASP A CG  3  
ATOM   1654  O  OD1 . ASP A 1 24 ? 9.422   1.813   -3.221  1.00 0.00 ? 24 ASP A OD1 3  
ATOM   1655  O  OD2 . ASP A 1 24 ? 10.281  0.584   -1.492  1.00 0.00 ? 24 ASP A OD2 3  
ATOM   1656  N  N   . GLY A 1 25 ? 13.122  4.935   -1.699  1.00 0.00 ? 25 GLY A N   3  
ATOM   1657  C  CA  . GLY A 1 25 ? 13.953  5.983   -1.113  1.00 0.00 ? 25 GLY A CA  3  
ATOM   1658  C  C   . GLY A 1 25 ? 13.449  6.346   0.268   1.00 0.00 ? 25 GLY A C   3  
ATOM   1659  O  O   . GLY A 1 25 ? 13.952  5.865   1.292   1.00 0.00 ? 25 GLY A O   3  
ATOM   1660  N  N   . GLU A 1 26 ? 12.305  7.282   0.313   1.00 0.00 ? 26 GLU A N   3  
ATOM   1661  C  CA  . GLU A 1 26 ? 11.606  7.588   1.562   1.00 0.00 ? 26 GLU A CA  3  
ATOM   1662  C  C   . GLU A 1 26 ? 10.162  7.939   1.297   1.00 0.00 ? 26 GLU A C   3  
ATOM   1663  O  O   . GLU A 1 26 ? 9.457   8.477   2.170   1.00 0.00 ? 26 GLU A O   3  
ATOM   1664  C  CB  . GLU A 1 26 ? 12.391  8.724   2.276   1.00 0.00 ? 26 GLU A CB  3  
ATOM   1665  C  CG  . GLU A 1 26 ? 11.675  9.609   3.346   1.00 0.00 ? 26 GLU A CG  3  
ATOM   1666  C  CD  . GLU A 1 26 ? 12.511  10.646  4.103   1.00 0.00 ? 26 GLU A CD  3  
ATOM   1667  O  OE1 . GLU A 1 26 ? 13.277  10.352  5.011   1.00 0.00 ? 26 GLU A OE1 3  
ATOM   1668  O  OE2 . GLU A 1 26 ? 12.320  11.923  3.669   1.00 0.00 ? 26 GLU A OE2 3  
ATOM   1669  N  N   . PHE A 1 27 ? 9.597   7.572   -0.022  1.00 0.00 ? 27 PHE A N   3  
ATOM   1670  C  CA  . PHE A 1 27 ? 8.268   8.035   -0.437  1.00 0.00 ? 27 PHE A CA  3  
ATOM   1671  C  C   . PHE A 1 27 ? 7.172   7.141   0.081   1.00 0.00 ? 27 PHE A C   3  
ATOM   1672  O  O   . PHE A 1 27 ? 7.364   5.928   0.289   1.00 0.00 ? 27 PHE A O   3  
ATOM   1673  C  CB  . PHE A 1 27 ? 8.204   8.190   -1.982  1.00 0.00 ? 27 PHE A CB  3  
ATOM   1674  C  CG  . PHE A 1 27 ? 7.863   6.991   -2.879  1.00 0.00 ? 27 PHE A CG  3  
ATOM   1675  C  CD1 . PHE A 1 27 ? 6.569   6.458   -2.884  1.00 0.00 ? 27 PHE A CD1 3  
ATOM   1676  C  CD2 . PHE A 1 27 ? 8.835   6.437   -3.719  1.00 0.00 ? 27 PHE A CD2 3  
ATOM   1677  C  CE1 . PHE A 1 27 ? 6.254   5.384   -3.710  1.00 0.00 ? 27 PHE A CE1 3  
ATOM   1678  C  CE2 . PHE A 1 27 ? 8.517   5.364   -4.546  1.00 0.00 ? 27 PHE A CE2 3  
ATOM   1679  C  CZ  . PHE A 1 27 ? 7.227   4.838   -4.542  1.00 0.00 ? 27 PHE A CZ  3  
ATOM   1680  N  N   . VAL A 1 28 ? 5.853   7.758   0.336   1.00 0.00 ? 28 VAL A N   3  
ATOM   1681  C  CA  . VAL A 1 28 ? 4.752   7.066   1.022   1.00 0.00 ? 28 VAL A CA  3  
ATOM   1682  C  C   . VAL A 1 28 ? 3.489   7.157   0.199   1.00 0.00 ? 28 VAL A C   3  
ATOM   1683  O  O   . VAL A 1 28 ? 3.313   8.107   -0.595  1.00 0.00 ? 28 VAL A O   3  
ATOM   1684  C  CB  . VAL A 1 28 ? 4.566   7.716   2.449   1.00 0.00 ? 28 VAL A CB  3  
ATOM   1685  C  CG1 . VAL A 1 28 ? 5.877   8.160   3.169   1.00 0.00 ? 28 VAL A CG1 3  
ATOM   1686  C  CG2 . VAL A 1 28 ? 3.657   8.968   2.457   1.00 0.00 ? 28 VAL A CG2 3  
ATOM   1687  N  N   . PHE A 1 29 ? 2.449   6.123   0.383   1.00 0.00 ? 29 PHE A N   3  
ATOM   1688  C  CA  . PHE A 1 29 ? 1.280   6.015   -0.490  1.00 0.00 ? 29 PHE A CA  3  
ATOM   1689  C  C   . PHE A 1 29 ? 0.039   5.739   0.325   1.00 0.00 ? 29 PHE A C   3  
ATOM   1690  O  O   . PHE A 1 29 ? 0.046   4.879   1.229   1.00 0.00 ? 29 PHE A O   3  
ATOM   1691  C  CB  . PHE A 1 29 ? 1.473   4.849   -1.507  1.00 0.00 ? 29 PHE A CB  3  
ATOM   1692  C  CG  . PHE A 1 29 ? 0.784   3.514   -1.181  1.00 0.00 ? 29 PHE A CG  3  
ATOM   1693  C  CD1 . PHE A 1 29 ? 1.339   2.637   -0.244  1.00 0.00 ? 29 PHE A CD1 3  
ATOM   1694  C  CD2 . PHE A 1 29 ? -0.376  3.138   -1.871  1.00 0.00 ? 29 PHE A CD2 3  
ATOM   1695  C  CE1 . PHE A 1 29 ? 0.747   1.399   -0.007  1.00 0.00 ? 29 PHE A CE1 3  
ATOM   1696  C  CE2 . PHE A 1 29 ? -0.965  1.901   -1.634  1.00 0.00 ? 29 PHE A CE2 3  
ATOM   1697  C  CZ  . PHE A 1 29 ? -0.402  1.029   -0.704  1.00 0.00 ? 29 PHE A CZ  3  
ATOM   1698  N  N   . ALA A 1 30 ? -1.191  6.491   -0.005  1.00 0.00 ? 30 ALA A N   3  
ATOM   1699  C  CA  . ALA A 1 30 ? -2.399  6.385   0.807   1.00 0.00 ? 30 ALA A CA  3  
ATOM   1700  C  C   . ALA A 1 30 ? -3.572  5.858   0.014   1.00 0.00 ? 30 ALA A C   3  
ATOM   1701  O  O   . ALA A 1 30 ? -4.233  6.590   -0.736  1.00 0.00 ? 30 ALA A O   3  
ATOM   1702  C  CB  . ALA A 1 30 ? -2.679  7.768   1.419   1.00 0.00 ? 30 ALA A CB  3  
ATOM   1703  N  N   . VAL A 1 31 ? -3.909  4.435   0.217   1.00 0.00 ? 31 VAL A N   3  
ATOM   1704  C  CA  . VAL A 1 31 ? -5.129  3.840   -0.339  1.00 0.00 ? 31 VAL A CA  3  
ATOM   1705  C  C   . VAL A 1 31 ? -6.278  4.055   0.616   1.00 0.00 ? 31 VAL A C   3  
ATOM   1706  O  O   . VAL A 1 31 ? -6.498  3.268   1.553   1.00 0.00 ? 31 VAL A O   3  
ATOM   1707  C  CB  . VAL A 1 31 ? -4.874  2.313   -0.647  1.00 0.00 ? 31 VAL A CB  3  
ATOM   1708  C  CG1 . VAL A 1 31 ? -4.741  1.359   0.575   1.00 0.00 ? 31 VAL A CG1 3  
ATOM   1709  C  CG2 . VAL A 1 31 ? -5.930  1.652   -1.563  1.00 0.00 ? 31 VAL A CG2 3  
ATOM   1710  N  N   . ARG A 1 32 ? -7.102  5.271   0.417   1.00 0.00 ? 32 ARG A N   3  
ATOM   1711  C  CA  . ARG A 1 32 ? -8.093  5.686   1.405   1.00 0.00 ? 32 ARG A CA  3  
ATOM   1712  C  C   . ARG A 1 32 ? -9.432  5.015   1.240   1.00 0.00 ? 32 ARG A C   3  
ATOM   1713  O  O   . ARG A 1 32 ? -10.487 5.595   1.581   1.00 0.00 ? 32 ARG A O   3  
ATOM   1714  C  CB  . ARG A 1 32 ? -8.232  7.234   1.362   1.00 0.00 ? 32 ARG A CB  3  
ATOM   1715  C  CG  . ARG A 1 32 ? -8.534  7.847   -0.030  1.00 0.00 ? 32 ARG A CG  3  
ATOM   1716  C  CD  . ARG A 1 32 ? -9.965  7.574   -0.509  1.00 0.00 ? 32 ARG A CD  3  
ATOM   1717  N  NE  . ARG A 1 32 ? -10.119 8.135   -1.875  1.00 0.00 ? 32 ARG A NE  3  
ATOM   1718  C  CZ  . ARG A 1 32 ? -10.248 9.421   -2.172  1.00 0.00 ? 32 ARG A CZ  3  
ATOM   1719  N  NH1 . ARG A 1 32 ? -10.251 10.380  -1.293  1.00 0.00 ? 32 ARG A NH1 3  
ATOM   1720  N  NH2 . ARG A 1 32 ? -10.378 9.735   -3.412  1.00 0.00 ? 32 ARG A NH2 3  
ATOM   1721  N  N   . THR A 1 33 ? -9.466  3.639   0.701   1.00 0.00 ? 33 THR A N   3  
ATOM   1722  C  CA  . THR A 1 33 ? -10.717 2.904   0.492   1.00 0.00 ? 33 THR A CA  3  
ATOM   1723  C  C   . THR A 1 33 ? -10.926 1.915   1.618   1.00 0.00 ? 33 THR A C   3  
ATOM   1724  O  O   . THR A 1 33 ? -12.023 1.757   2.167   1.00 0.00 ? 33 THR A O   3  
ATOM   1725  C  CB  . THR A 1 33 ? -10.713 2.184   -0.895  1.00 0.00 ? 33 THR A CB  3  
ATOM   1726  O  OG1 . THR A 1 33 ? -12.014 1.705   -1.215  1.00 0.00 ? 33 THR A OG1 3  
ATOM   1727  C  CG2 . THR A 1 33 ? -9.805  0.939   -1.021  1.00 0.00 ? 33 THR A CG2 3  
ATOM   1728  N  N   . THR A 1 34 ? -9.723  1.160   2.034   1.00 0.00 ? 34 THR A N   3  
ATOM   1729  C  CA  . THR A 1 34 ? -9.692  0.322   3.228   1.00 0.00 ? 34 THR A CA  3  
ATOM   1730  C  C   . THR A 1 34 ? -9.102  1.094   4.389   1.00 0.00 ? 34 THR A C   3  
ATOM   1731  O  O   . THR A 1 34 ? -9.219  0.715   5.562   1.00 0.00 ? 34 THR A O   3  
ATOM   1732  C  CB  . THR A 1 34 ? -8.900  -1.002  2.965   1.00 0.00 ? 34 THR A CB  3  
ATOM   1733  O  OG1 . THR A 1 34 ? -9.411  -1.669  1.818   1.00 0.00 ? 34 THR A OG1 3  
ATOM   1734  C  CG2 . THR A 1 34 ? -8.949  -2.065  4.084   1.00 0.00 ? 34 THR A CG2 3  
ATOM   1735  N  N   . GLY A 1 35 ? -8.392  2.345   4.036   1.00 0.00 ? 35 GLY A N   3  
ATOM   1736  C  CA  . GLY A 1 35 ? -7.933  3.300   5.038   1.00 0.00 ? 35 GLY A CA  3  
ATOM   1737  C  C   . GLY A 1 35 ? -6.587  2.937   5.613   1.00 0.00 ? 35 GLY A C   3  
ATOM   1738  O  O   . GLY A 1 35 ? -6.461  2.639   6.817   1.00 0.00 ? 35 GLY A O   3  
ATOM   1739  N  N   . ILE A 1 36 ? -5.433  2.876   4.692   1.00 0.00 ? 36 ILE A N   3  
ATOM   1740  C  CA  . ILE A 1 36 ? -4.062  2.752   5.176   1.00 0.00 ? 36 ILE A CA  3  
ATOM   1741  C  C   . ILE A 1 36 ? -3.110  3.599   4.369   1.00 0.00 ? 36 ILE A C   3  
ATOM   1742  O  O   . ILE A 1 36 ? -3.181  3.654   3.128   1.00 0.00 ? 36 ILE A O   3  
ATOM   1743  C  CB  . ILE A 1 36 ? -3.595  1.234   5.218   1.00 0.00 ? 36 ILE A CB  3  
ATOM   1744  C  CG1 . ILE A 1 36 ? -3.387  0.552   3.829   1.00 0.00 ? 36 ILE A CG1 3  
ATOM   1745  C  CG2 . ILE A 1 36 ? -4.554  0.338   6.062   1.00 0.00 ? 36 ILE A CG2 3  
ATOM   1746  C  CD1 . ILE A 1 36 ? -2.092  -0.274  3.673   1.00 0.00 ? 36 ILE A CD1 3  
ATOM   1747  N  N   . PHE A 1 37 ? -2.086  4.355   5.119   1.00 0.00 ? 37 PHE A N   3  
ATOM   1748  C  CA  . PHE A 1 37 ? -0.981  5.056   4.441   1.00 0.00 ? 37 PHE A CA  3  
ATOM   1749  C  C   . PHE A 1 37 ? 0.296   4.279   4.644   1.00 0.00 ? 37 PHE A C   3  
ATOM   1750  O  O   . PHE A 1 37 ? 0.815   4.212   5.791   1.00 0.00 ? 37 PHE A O   3  
ATOM   1751  C  CB  . PHE A 1 37 ? -0.854  6.507   4.991   1.00 0.00 ? 37 PHE A CB  3  
ATOM   1752  C  CG  . PHE A 1 37 ? 0.254   6.873   5.989   1.00 0.00 ? 37 PHE A CG  3  
ATOM   1753  C  CD1 . PHE A 1 37 ? 1.595   6.895   5.599   1.00 0.00 ? 37 PHE A CD1 3  
ATOM   1754  C  CD2 . PHE A 1 37 ? -0.089  7.254   7.292   1.00 0.00 ? 37 PHE A CD2 3  
ATOM   1755  C  CE1 . PHE A 1 37 ? 2.581   7.289   6.501   1.00 0.00 ? 37 PHE A CE1 3  
ATOM   1756  C  CE2 . PHE A 1 37 ? 0.895   7.649   8.192   1.00 0.00 ? 37 PHE A CE2 3  
ATOM   1757  C  CZ  . PHE A 1 37 ? 2.230   7.664   7.797   1.00 0.00 ? 37 PHE A CZ  3  
ATOM   1758  N  N   . CYS A 1 38 ? 0.906   3.549   3.512   1.00 0.00 ? 38 CYS A N   3  
ATOM   1759  C  CA  . CYS A 1 38 ? 2.021   2.626   3.697   1.00 0.00 ? 38 CYS A CA  3  
ATOM   1760  C  C   . CYS A 1 38 ? 3.228   2.999   2.877   1.00 0.00 ? 38 CYS A C   3  
ATOM   1761  O  O   . CYS A 1 38 ? 3.127   3.718   1.865   1.00 0.00 ? 38 CYS A O   3  
ATOM   1762  C  CB  . CYS A 1 38 ? 1.528   1.203   3.310   1.00 0.00 ? 38 CYS A CB  3  
ATOM   1763  S  SG  . CYS A 1 38 ? 2.830   -0.012  3.630   1.00 0.00 ? 38 CYS A SG  3  
ATOM   1764  N  N   . ARG A 1 39 ? 4.535   2.500   3.346   1.00 0.00 ? 39 ARG A N   3  
ATOM   1765  C  CA  . ARG A 1 39 ? 5.722   2.573   2.476   1.00 0.00 ? 39 ARG A CA  3  
ATOM   1766  C  C   . ARG A 1 39 ? 5.590   1.471   1.442   1.00 0.00 ? 39 ARG A C   3  
ATOM   1767  O  O   . ARG A 1 39 ? 5.535   0.279   1.781   1.00 0.00 ? 39 ARG A O   3  
ATOM   1768  C  CB  . ARG A 1 39 ? 7.003   2.454   3.333   1.00 0.00 ? 39 ARG A CB  3  
ATOM   1769  C  CG  . ARG A 1 39 ? 7.875   3.736   3.413   1.00 0.00 ? 39 ARG A CG  3  
ATOM   1770  C  CD  . ARG A 1 39 ? 9.229   3.572   2.711   1.00 0.00 ? 39 ARG A CD  3  
ATOM   1771  N  NE  . ARG A 1 39 ? 9.931   2.409   3.310   1.00 0.00 ? 39 ARG A NE  3  
ATOM   1772  C  CZ  . ARG A 1 39 ? 10.826  2.468   4.287   1.00 0.00 ? 39 ARG A CZ  3  
ATOM   1773  N  NH1 . ARG A 1 39 ? 11.211  3.568   4.864   1.00 0.00 ? 39 ARG A NH1 3  
ATOM   1774  N  NH2 . ARG A 1 39 ? 11.343  1.360   4.686   1.00 0.00 ? 39 ARG A NH2 3  
ATOM   1775  N  N   . PRO A 1 40 ? 5.525   1.889   0.033   1.00 0.00 ? 40 PRO A N   3  
ATOM   1776  C  CA  . PRO A 1 40 ? 5.341   0.978   -1.200  1.00 0.00 ? 40 PRO A CA  3  
ATOM   1777  C  C   . PRO A 1 40 ? 5.620   -0.485  -0.978  1.00 0.00 ? 40 PRO A C   3  
ATOM   1778  O  O   . PRO A 1 40 ? 6.747   -0.971  -1.171  1.00 0.00 ? 40 PRO A O   3  
ATOM   1779  C  CB  . PRO A 1 40 ? 6.288   1.589   -2.231  1.00 0.00 ? 40 PRO A CB  3  
ATOM   1780  C  CG  . PRO A 1 40 ? 6.046   3.087   -1.978  1.00 0.00 ? 40 PRO A CG  3  
ATOM   1781  C  CD  . PRO A 1 40 ? 5.624   3.263   -0.516  1.00 0.00 ? 40 PRO A CD  3  
ATOM   1782  N  N   . SER A 1 41 ? 4.478   -1.338  -0.550  1.00 0.00 ? 41 SER A N   3  
ATOM   1783  C  CA  . SER A 1 41 ? 4.676   -2.722  -0.138  1.00 0.00 ? 41 SER A CA  3  
ATOM   1784  C  C   . SER A 1 41 ? 3.429   -3.572  -0.161  1.00 0.00 ? 41 SER A C   3  
ATOM   1785  O  O   . SER A 1 41 ? 3.169   -4.312  -1.120  1.00 0.00 ? 41 SER A O   3  
ATOM   1786  C  CB  . SER A 1 41 ? 5.361   -2.777  1.257   1.00 0.00 ? 41 SER A CB  3  
ATOM   1787  O  OG  . SER A 1 41 ? 5.944   -4.053  1.539   1.00 0.00 ? 41 SER A OG  3  
ATOM   1788  N  N   . CYS A 1 42 ? 2.506   -3.453  0.993   1.00 0.00 ? 42 CYS A N   3  
ATOM   1789  C  CA  . CYS A 1 42 ? 1.385   -4.334  1.278   1.00 0.00 ? 42 CYS A CA  3  
ATOM   1790  C  C   . CYS A 1 42 ? 1.210   -5.435  0.258   1.00 0.00 ? 42 CYS A C   3  
ATOM   1791  O  O   . CYS A 1 42 ? 0.546   -5.304  -0.777  1.00 0.00 ? 42 CYS A O   3  
ATOM   1792  C  CB  . CYS A 1 42 ? 0.091   -3.545  1.560   1.00 0.00 ? 42 CYS A CB  3  
ATOM   1793  S  SG  . CYS A 1 42 ? 0.304   -1.907  2.287   1.00 0.00 ? 42 CYS A SG  3  
ATOM   1794  N  N   . ARG A 1 43 ? 1.931   -6.700  0.560   1.00 0.00 ? 43 ARG A N   3  
ATOM   1795  C  CA  . ARG A 1 43 ? 2.048   -7.809  -0.377  1.00 0.00 ? 43 ARG A CA  3  
ATOM   1796  C  C   . ARG A 1 43 ? 0.751   -8.556  -0.564  1.00 0.00 ? 43 ARG A C   3  
ATOM   1797  O  O   . ARG A 1 43 ? 0.701   -9.590  -1.256  1.00 0.00 ? 43 ARG A O   3  
ATOM   1798  C  CB  . ARG A 1 43 ? 3.176   -8.762  0.121   1.00 0.00 ? 43 ARG A CB  3  
ATOM   1799  C  CG  . ARG A 1 43 ? 4.403   -8.048  0.745   1.00 0.00 ? 43 ARG A CG  3  
ATOM   1800  C  CD  . ARG A 1 43 ? 5.688   -8.276  -0.066  1.00 0.00 ? 43 ARG A CD  3  
ATOM   1801  N  NE  . ARG A 1 43 ? 5.798   -9.728  -0.359  1.00 0.00 ? 43 ARG A NE  3  
ATOM   1802  C  CZ  . ARG A 1 43 ? 6.280   -10.258 -1.474  1.00 0.00 ? 43 ARG A CZ  3  
ATOM   1803  N  NH1 . ARG A 1 43 ? 6.736   -9.569  -2.478  1.00 0.00 ? 43 ARG A NH1 3  
ATOM   1804  N  NH2 . ARG A 1 43 ? 6.295   -11.542 -1.563  1.00 0.00 ? 43 ARG A NH2 3  
ATOM   1805  N  N   . ALA A 1 44 ? -0.447  -8.041  0.132   1.00 0.00 ? 44 ALA A N   3  
ATOM   1806  C  CA  . ALA A 1 44 ? -1.774  -8.577  -0.125  1.00 0.00 ? 44 ALA A CA  3  
ATOM   1807  C  C   . ALA A 1 44 ? -2.100  -8.461  -1.610  1.00 0.00 ? 44 ALA A C   3  
ATOM   1808  O  O   . ALA A 1 44 ? -1.259  -8.158  -2.463  1.00 0.00 ? 44 ALA A O   3  
ATOM   1809  C  CB  . ALA A 1 44 ? -2.787  -7.803  0.739   1.00 0.00 ? 44 ALA A CB  3  
ATOM   1810  N  N   . ARG A 1 45 ? -3.513  -8.783  -1.947  1.00 0.00 ? 45 ARG A N   3  
ATOM   1811  C  CA  . ARG A 1 45 ? -4.046  -8.563  -3.288  1.00 0.00 ? 45 ARG A CA  3  
ATOM   1812  C  C   . ARG A 1 45 ? -3.609  -7.214  -3.817  1.00 0.00 ? 45 ARG A C   3  
ATOM   1813  O  O   . ARG A 1 45 ? -3.664  -6.939  -5.023  1.00 0.00 ? 45 ARG A O   3  
ATOM   1814  C  CB  . ARG A 1 45 ? -5.589  -8.722  -3.261  1.00 0.00 ? 45 ARG A CB  3  
ATOM   1815  C  CG  . ARG A 1 45 ? -6.413  -7.444  -3.565  1.00 0.00 ? 45 ARG A CG  3  
ATOM   1816  C  CD  . ARG A 1 45 ? -6.704  -6.618  -2.305  1.00 0.00 ? 45 ARG A CD  3  
ATOM   1817  N  NE  . ARG A 1 45 ? -7.943  -7.146  -1.679  1.00 0.00 ? 45 ARG A NE  3  
ATOM   1818  C  CZ  . ARG A 1 45 ? -9.148  -7.140  -2.233  1.00 0.00 ? 45 ARG A CZ  3  
ATOM   1819  N  NH1 . ARG A 1 45 ? -9.411  -6.659  -3.412  1.00 0.00 ? 45 ARG A NH1 3  
ATOM   1820  N  NH2 . ARG A 1 45 ? -10.116 -7.646  -1.554  1.00 0.00 ? 45 ARG A NH2 3  
ATOM   1821  N  N   . HIS A 1 46 ? -3.160  -6.229  -2.811  1.00 0.00 ? 46 HIS A N   3  
ATOM   1822  C  CA  . HIS A 1 46 ? -2.522  -4.960  -3.133  1.00 0.00 ? 46 HIS A CA  3  
ATOM   1823  C  C   . HIS A 1 46 ? -3.519  -3.837  -3.287  1.00 0.00 ? 46 HIS A C   3  
ATOM   1824  O  O   . HIS A 1 46 ? -4.565  -3.966  -3.937  1.00 0.00 ? 46 HIS A O   3  
ATOM   1825  C  CB  . HIS A 1 46 ? -1.702  -5.151  -4.417  1.00 0.00 ? 46 HIS A CB  3  
ATOM   1826  C  CG  . HIS A 1 46 ? -0.724  -4.032  -4.638  1.00 0.00 ? 46 HIS A CG  3  
ATOM   1827  N  ND1 . HIS A 1 46 ? -0.411  -3.453  -5.865  1.00 0.00 ? 46 HIS A ND1 3  
ATOM   1828  C  CD2 . HIS A 1 46 ? -0.011  -3.446  -3.602  1.00 0.00 ? 46 HIS A CD2 3  
ATOM   1829  C  CE1 . HIS A 1 46 ? 0.488   -2.535  -5.463  1.00 0.00 ? 46 HIS A CE1 3  
ATOM   1830  N  NE2 . HIS A 1 46 ? 0.784   -2.466  -4.136  1.00 0.00 ? 46 HIS A NE2 3  
ATOM   1831  N  N   . ALA A 1 47 ? -3.183  -2.578  -2.578  1.00 0.00 ? 47 ALA A N   3  
ATOM   1832  C  CA  . ALA A 1 47 ? -4.012  -1.381  -2.670  1.00 0.00 ? 47 ALA A CA  3  
ATOM   1833  C  C   . ALA A 1 47 ? -3.957  -0.791  -4.060  1.00 0.00 ? 47 ALA A C   3  
ATOM   1834  O  O   . ALA A 1 47 ? -2.887  -0.457  -4.587  1.00 0.00 ? 47 ALA A O   3  
ATOM   1835  C  CB  . ALA A 1 47 ? -3.536  -0.398  -1.587  1.00 0.00 ? 47 ALA A CB  3  
ATOM   1836  N  N   . LEU A 1 48 ? -5.252  -0.673  -4.767  1.00 0.00 ? 48 LEU A N   3  
ATOM   1837  C  CA  . LEU A 1 48 ? -5.351  -0.131  -6.118  1.00 0.00 ? 48 LEU A CA  3  
ATOM   1838  C  C   . LEU A 1 48 ? -4.753  1.255   -6.192  1.00 0.00 ? 48 LEU A C   3  
ATOM   1839  O  O   . LEU A 1 48 ? -4.647  1.975   -5.189  1.00 0.00 ? 48 LEU A O   3  
ATOM   1840  C  CB  . LEU A 1 48 ? -6.831  -0.116  -6.595  1.00 0.00 ? 48 LEU A CB  3  
ATOM   1841  C  CG  . LEU A 1 48 ? -7.868  -1.015  -5.870  1.00 0.00 ? 48 LEU A CG  3  
ATOM   1842  C  CD1 . LEU A 1 48 ? -8.369  -0.322  -4.595  1.00 0.00 ? 48 LEU A CD1 3  
ATOM   1843  C  CD2 . LEU A 1 48 ? -9.067  -1.375  -6.764  1.00 0.00 ? 48 LEU A CD2 3  
ATOM   1844  N  N   . ARG A 1 49 ? -4.322  1.711   -7.531  1.00 0.00 ? 49 ARG A N   3  
ATOM   1845  C  CA  . ARG A 1 49 ? -3.900  3.085   -7.795  1.00 0.00 ? 49 ARG A CA  3  
ATOM   1846  C  C   . ARG A 1 49 ? -5.086  3.967   -8.107  1.00 0.00 ? 49 ARG A C   3  
ATOM   1847  O  O   . ARG A 1 49 ? -4.944  5.098   -8.595  1.00 0.00 ? 49 ARG A O   3  
ATOM   1848  C  CB  . ARG A 1 49 ? -2.884  3.075   -8.972  1.00 0.00 ? 49 ARG A CB  3  
ATOM   1849  C  CG  . ARG A 1 49 ? -3.524  2.933   -10.379 1.00 0.00 ? 49 ARG A CG  3  
ATOM   1850  C  CD  . ARG A 1 49 ? -2.482  2.852   -11.502 1.00 0.00 ? 49 ARG A CD  3  
ATOM   1851  N  NE  . ARG A 1 49 ? -3.157  2.359   -12.730 1.00 0.00 ? 49 ARG A NE  3  
ATOM   1852  C  CZ  . ARG A 1 49 ? -3.223  1.091   -13.115 1.00 0.00 ? 49 ARG A CZ  3  
ATOM   1853  N  NH1 . ARG A 1 49 ? -2.697  0.097   -12.463 1.00 0.00 ? 49 ARG A NH1 3  
ATOM   1854  N  NH2 . ARG A 1 49 ? -3.852  0.835   -14.207 1.00 0.00 ? 49 ARG A NH2 3  
ATOM   1855  N  N   . GLU A 1 50 ? -6.425  3.403   -7.830  1.00 0.00 ? 50 GLU A N   3  
ATOM   1856  C  CA  . GLU A 1 50 ? -7.663  4.055   -8.245  1.00 0.00 ? 50 GLU A CA  3  
ATOM   1857  C  C   . GLU A 1 50 ? -8.164  5.042   -7.218  1.00 0.00 ? 50 GLU A C   3  
ATOM   1858  O  O   . GLU A 1 50 ? -8.910  5.989   -7.552  1.00 0.00 ? 50 GLU A O   3  
ATOM   1859  C  CB  . GLU A 1 50 ? -8.727  2.948   -8.515  1.00 0.00 ? 50 GLU A CB  3  
ATOM   1860  C  CG  . GLU A 1 50 ? -8.215  1.599   -9.118  1.00 0.00 ? 50 GLU A CG  3  
ATOM   1861  C  CD  . GLU A 1 50 ? -8.873  1.075   -10.397 1.00 0.00 ? 50 GLU A CD  3  
ATOM   1862  O  OE1 . GLU A 1 50 ? -8.514  1.412   -11.517 1.00 0.00 ? 50 GLU A OE1 3  
ATOM   1863  O  OE2 . GLU A 1 50 ? -9.892  0.201   -10.170 1.00 0.00 ? 50 GLU A OE2 3  
ATOM   1864  N  N   . ASN A 1 51 ? -7.768  4.842   -5.818  1.00 0.00 ? 51 ASN A N   3  
ATOM   1865  C  CA  . ASN A 1 51 ? -8.253  5.688   -4.700  1.00 0.00 ? 51 ASN A CA  3  
ATOM   1866  C  C   . ASN A 1 51 ? -7.027  6.090   -3.888  1.00 0.00 ? 51 ASN A C   3  
ATOM   1867  O  O   . ASN A 1 51 ? -7.102  6.443   -2.701  1.00 0.00 ? 51 ASN A O   3  
ATOM   1868  C  CB  . ASN A 1 51 ? -9.088  4.734   -3.805  1.00 0.00 ? 51 ASN A CB  3  
ATOM   1869  C  CG  . ASN A 1 51 ? -8.251  3.747   -2.955  1.00 0.00 ? 51 ASN A CG  3  
ATOM   1870  O  OD1 . ASN A 1 51 ? -7.556  2.878   -3.455  1.00 0.00 ? 51 ASN A OD1 3  
ATOM   1871  N  ND2 . ASN A 1 51 ? -8.299  3.875   -1.658  1.00 0.00 ? 51 ASN A ND2 3  
ATOM   1872  N  N   . VAL A 1 52 ? -5.733  5.951   -4.591  1.00 0.00 ? 52 VAL A N   3  
ATOM   1873  C  CA  . VAL A 1 52 ? -4.456  5.949   -3.885  1.00 0.00 ? 52 VAL A CA  3  
ATOM   1874  C  C   . VAL A 1 52 ? -3.828  7.315   -3.934  1.00 0.00 ? 52 VAL A C   3  
ATOM   1875  O  O   . VAL A 1 52 ? -3.999  8.050   -4.941  1.00 0.00 ? 52 VAL A O   3  
ATOM   1876  C  CB  . VAL A 1 52 ? -3.510  4.837   -4.500  1.00 0.00 ? 52 VAL A CB  3  
ATOM   1877  C  CG1 . VAL A 1 52 ? -2.287  5.331   -5.317  1.00 0.00 ? 52 VAL A CG1 3  
ATOM   1878  C  CG2 . VAL A 1 52 ? -2.934  3.848   -3.450  1.00 0.00 ? 52 VAL A CG2 3  
ATOM   1879  N  N   . SER A 1 53 ? -3.044  7.799   -2.779  1.00 0.00 ? 53 SER A N   3  
ATOM   1880  C  CA  . SER A 1 53 ? -2.286  9.051   -2.827  1.00 0.00 ? 53 SER A CA  3  
ATOM   1881  C  C   . SER A 1 53 ? -0.802  8.784   -2.772  1.00 0.00 ? 53 SER A C   3  
ATOM   1882  O  O   . SER A 1 53 ? -0.356  7.640   -2.581  1.00 0.00 ? 53 SER A O   3  
ATOM   1883  C  CB  . SER A 1 53 ? -2.771  10.024  -1.726  1.00 0.00 ? 53 SER A CB  3  
ATOM   1884  O  OG  . SER A 1 53 ? -1.704  10.694  -1.048  1.00 0.00 ? 53 SER A OG  3  
ATOM   1885  N  N   . PHE A 1 54 ? 0.106   9.934   -3.002  1.00 0.00 ? 54 PHE A N   3  
ATOM   1886  C  CA  . PHE A 1 54 ? 1.555   9.799   -2.903  1.00 0.00 ? 54 PHE A CA  3  
ATOM   1887  C  C   . PHE A 1 54 ? 2.193   10.970  -2.189  1.00 0.00 ? 54 PHE A C   3  
ATOM   1888  O  O   . PHE A 1 54 ? 1.728   12.117  -2.238  1.00 0.00 ? 54 PHE A O   3  
ATOM   1889  C  CB  . PHE A 1 54 ? 2.202   9.675   -4.315  1.00 0.00 ? 54 PHE A CB  3  
ATOM   1890  C  CG  . PHE A 1 54 ? 1.655   8.603   -5.269  1.00 0.00 ? 54 PHE A CG  3  
ATOM   1891  C  CD1 . PHE A 1 54 ? 1.894   7.251   -4.997  1.00 0.00 ? 54 PHE A CD1 3  
ATOM   1892  C  CD2 . PHE A 1 54 ? 0.941   8.958   -6.416  1.00 0.00 ? 54 PHE A CD2 3  
ATOM   1893  C  CE1 . PHE A 1 54 ? 1.418   6.267   -5.856  1.00 0.00 ? 54 PHE A CE1 3  
ATOM   1894  C  CE2 . PHE A 1 54 ? 0.466   7.972   -7.277  1.00 0.00 ? 54 PHE A CE2 3  
ATOM   1895  C  CZ  . PHE A 1 54 ? 0.704   6.627   -6.997  1.00 0.00 ? 54 PHE A CZ  3  
ATOM   1896  N  N   . TYR A 1 55 ? 3.431   10.668  -1.433  1.00 0.00 ? 55 TYR A N   3  
ATOM   1897  C  CA  . TYR A 1 55 ? 4.151   11.649  -0.626  1.00 0.00 ? 55 TYR A CA  3  
ATOM   1898  C  C   . TYR A 1 55 ? 5.641   11.364  -0.671  1.00 0.00 ? 55 TYR A C   3  
ATOM   1899  O  O   . TYR A 1 55 ? 6.051   10.222  -0.989  1.00 0.00 ? 55 TYR A O   3  
ATOM   1900  C  CB  . TYR A 1 55 ? 3.703   11.605  0.860   1.00 0.00 ? 55 TYR A CB  3  
ATOM   1901  C  CG  . TYR A 1 55 ? 2.290   11.135  1.248   1.00 0.00 ? 55 TYR A CG  3  
ATOM   1902  C  CD1 . TYR A 1 55 ? 1.537   10.251  0.476   1.00 0.00 ? 55 TYR A CD1 3  
ATOM   1903  C  CD2 . TYR A 1 55 ? 1.734   11.639  2.441   1.00 0.00 ? 55 TYR A CD2 3  
ATOM   1904  C  CE1 . TYR A 1 55 ? 0.258   9.876   0.874   1.00 0.00 ? 55 TYR A CE1 3  
ATOM   1905  C  CE2 . TYR A 1 55 ? 0.456   11.264  2.837   1.00 0.00 ? 55 TYR A CE2 3  
ATOM   1906  C  CZ  . TYR A 1 55 ? -0.283  10.384  2.052   1.00 0.00 ? 55 TYR A CZ  3  
ATOM   1907  O  OH  . TYR A 1 55 ? -1.541  10.024  2.445   1.00 0.00 ? 55 TYR A OH  3  
ATOM   1908  N  N   . ALA A 1 56 ? 6.612   12.440  -0.378  1.00 0.00 ? 56 ALA A N   3  
ATOM   1909  C  CA  . ALA A 1 56 ? 8.056   12.199  -0.293  1.00 0.00 ? 56 ALA A CA  3  
ATOM   1910  C  C   . ALA A 1 56 ? 8.476   11.667  1.055   1.00 0.00 ? 56 ALA A C   3  
ATOM   1911  O  O   . ALA A 1 56 ? 9.513   10.986  1.182   1.00 0.00 ? 56 ALA A O   3  
ATOM   1912  C  CB  . ALA A 1 56 ? 8.758   13.522  -0.654  1.00 0.00 ? 56 ALA A CB  3  
ATOM   1913  N  N   . ASN A 1 57 ? 7.641   12.016  2.226   1.00 0.00 ? 57 ASN A N   3  
ATOM   1914  C  CA  . ASN A 1 57 ? 7.912   11.470  3.553   1.00 0.00 ? 57 ASN A CA  3  
ATOM   1915  C  C   . ASN A 1 57 ? 6.638   11.244  4.332   1.00 0.00 ? 57 ASN A C   3  
ATOM   1916  O  O   . ASN A 1 57 ? 5.610   11.899  4.114   1.00 0.00 ? 57 ASN A O   3  
ATOM   1917  C  CB  . ASN A 1 57 ? 8.872   12.415  4.332   1.00 0.00 ? 57 ASN A CB  3  
ATOM   1918  C  CG  . ASN A 1 57 ? 8.910   12.261  5.857   1.00 0.00 ? 57 ASN A CG  3  
ATOM   1919  O  OD1 . ASN A 1 57 ? 8.430   13.094  6.611   1.00 0.00 ? 57 ASN A OD1 3  
ATOM   1920  N  ND2 . ASN A 1 57 ? 9.463   11.193  6.365   1.00 0.00 ? 57 ASN A ND2 3  
ATOM   1921  N  N   . ALA A 1 58 ? 6.692   10.188  5.370   1.00 0.00 ? 58 ALA A N   3  
ATOM   1922  C  CA  . ALA A 1 58 ? 5.512   9.777   6.122   1.00 0.00 ? 58 ALA A CA  3  
ATOM   1923  C  C   . ALA A 1 58 ? 4.924   10.926  6.909   1.00 0.00 ? 58 ALA A C   3  
ATOM   1924  O  O   . ALA A 1 58 ? 3.703   11.002  7.125   1.00 0.00 ? 58 ALA A O   3  
ATOM   1925  C  CB  . ALA A 1 58 ? 5.911   8.590   7.016   1.00 0.00 ? 58 ALA A CB  3  
ATOM   1926  N  N   . SER A 1 59 ? 5.875   11.927  7.440   1.00 0.00 ? 59 SER A N   3  
ATOM   1927  C  CA  . SER A 1 59 ? 5.454   13.014  8.319   1.00 0.00 ? 59 SER A CA  3  
ATOM   1928  C  C   . SER A 1 59 ? 4.175   13.646  7.823   1.00 0.00 ? 59 SER A C   3  
ATOM   1929  O  O   . SER A 1 59 ? 3.323   14.099  8.599   1.00 0.00 ? 59 SER A O   3  
ATOM   1930  C  CB  . SER A 1 59 ? 6.579   14.067  8.479   1.00 0.00 ? 59 SER A CB  3  
ATOM   1931  O  OG  . SER A 1 59 ? 7.634   13.635  9.345   1.00 0.00 ? 59 SER A OG  3  
ATOM   1932  N  N   . GLU A 1 60 ? 3.999   13.695  6.353   1.00 0.00 ? 60 GLU A N   3  
ATOM   1933  C  CA  . GLU A 1 60 ? 2.813   14.284  5.741   1.00 0.00 ? 60 GLU A CA  3  
ATOM   1934  C  C   . GLU A 1 60 ? 1.578   13.466  6.039   1.00 0.00 ? 60 GLU A C   3  
ATOM   1935  O  O   . GLU A 1 60 ? 0.572   13.977  6.552   1.00 0.00 ? 60 GLU A O   3  
ATOM   1936  C  CB  . GLU A 1 60 ? 3.043   14.414  4.210   1.00 0.00 ? 60 GLU A CB  3  
ATOM   1937  C  CG  . GLU A 1 60 ? 1.779   14.318  3.292   1.00 0.00 ? 60 GLU A CG  3  
ATOM   1938  C  CD  . GLU A 1 60 ? 1.083   15.604  2.846   1.00 0.00 ? 60 GLU A CD  3  
ATOM   1939  O  OE1 . GLU A 1 60 ? 1.895   16.465  2.171   1.00 0.00 ? 60 GLU A OE1 3  
ATOM   1940  O  OE2 . GLU A 1 60 ? -0.098  15.837  3.074   1.00 0.00 ? 60 GLU A OE2 3  
ATOM   1941  N  N   . ALA A 1 61 ? 1.612   12.038  5.650   1.00 0.00 ? 61 ALA A N   3  
ATOM   1942  C  CA  . ALA A 1 61 ? 0.436   11.181  5.746   1.00 0.00 ? 61 ALA A CA  3  
ATOM   1943  C  C   . ALA A 1 61 ? -0.160  11.144  7.133   1.00 0.00 ? 61 ALA A C   3  
ATOM   1944  O  O   . ALA A 1 61 ? -1.380  10.920  7.292   1.00 0.00 ? 61 ALA A O   3  
ATOM   1945  C  CB  . ALA A 1 61 ? 0.827   9.782   5.239   1.00 0.00 ? 61 ALA A CB  3  
ATOM   1946  N  N   . LEU A 1 62 ? 0.738   11.329  8.292   1.00 0.00 ? 62 LEU A N   3  
ATOM   1947  C  CA  . LEU A 1 62 ? 0.214   11.482  9.650   1.00 0.00 ? 62 LEU A CA  3  
ATOM   1948  C  C   . LEU A 1 62 ? -0.286  12.890  9.869   1.00 0.00 ? 62 LEU A C   3  
ATOM   1949  O  O   . LEU A 1 62 ? -1.330  13.117  10.502  1.00 0.00 ? 62 LEU A O   3  
ATOM   1950  C  CB  . LEU A 1 62 ? 1.260   11.061  10.717  1.00 0.00 ? 62 LEU A CB  3  
ATOM   1951  C  CG  . LEU A 1 62 ? 2.723   11.564  10.592  1.00 0.00 ? 62 LEU A CG  3  
ATOM   1952  C  CD1 . LEU A 1 62 ? 2.836   12.999  11.125  1.00 0.00 ? 62 LEU A CD1 3  
ATOM   1953  C  CD2 . LEU A 1 62 ? 3.726   10.658  11.330  1.00 0.00 ? 62 LEU A CD2 3  
ATOM   1954  N  N   . ALA A 1 63 ? 0.547   13.984  9.326   1.00 0.00 ? 63 ALA A N   3  
ATOM   1955  C  CA  . ALA A 1 63 ? 0.084   15.372  9.310   1.00 0.00 ? 63 ALA A CA  3  
ATOM   1956  C  C   . ALA A 1 63 ? -1.279  15.471  8.666   1.00 0.00 ? 63 ALA A C   3  
ATOM   1957  O  O   . ALA A 1 63 ? -2.061  16.395  8.928   1.00 0.00 ? 63 ALA A O   3  
ATOM   1958  C  CB  . ALA A 1 63 ? 1.146   16.221  8.592   1.00 0.00 ? 63 ALA A CB  3  
ATOM   1959  N  N   . ALA A 1 64 ? -1.640  14.380  7.733   1.00 0.00 ? 64 ALA A N   3  
ATOM   1960  C  CA  . ALA A 1 64 ? -2.981  14.250  7.169   1.00 0.00 ? 64 ALA A CA  3  
ATOM   1961  C  C   . ALA A 1 64 ? -3.934  13.743  8.236   1.00 0.00 ? 64 ALA A C   3  
ATOM   1962  O  O   . ALA A 1 64 ? -5.073  14.203  8.386   1.00 0.00 ? 64 ALA A O   3  
ATOM   1963  C  CB  . ALA A 1 64 ? -2.892  13.308  5.959   1.00 0.00 ? 64 ALA A CB  3  
ATOM   1964  N  N   . GLY A 1 65 ? -3.387  12.670  9.100   1.00 0.00 ? 65 GLY A N   3  
ATOM   1965  C  CA  . GLY A 1 65 ? -4.109  12.165  10.265  1.00 0.00 ? 65 GLY A CA  3  
ATOM   1966  C  C   . GLY A 1 65 ? -4.532  10.726  10.012  1.00 0.00 ? 65 GLY A C   3  
ATOM   1967  O  O   . GLY A 1 65 ? -5.600  10.260  10.426  1.00 0.00 ? 65 GLY A O   3  
ATOM   1968  N  N   . PHE A 1 66 ? -3.583  9.936   9.196   1.00 0.00 ? 66 PHE A N   3  
ATOM   1969  C  CA  . PHE A 1 66 ? -3.892  8.602   8.697   1.00 0.00 ? 66 PHE A CA  3  
ATOM   1970  C  C   . PHE A 1 66 ? -3.217  7.532   9.514   1.00 0.00 ? 66 PHE A C   3  
ATOM   1971  O  O   . PHE A 1 66 ? -2.790  7.797   10.668  1.00 0.00 ? 66 PHE A O   3  
ATOM   1972  C  CB  . PHE A 1 66 ? -3.399  8.476   7.216   1.00 0.00 ? 66 PHE A CB  3  
ATOM   1973  C  CG  . PHE A 1 66 ? -4.184  7.491   6.339   1.00 0.00 ? 66 PHE A CG  3  
ATOM   1974  C  CD1 . PHE A 1 66 ? -5.398  6.958   6.786   1.00 0.00 ? 66 PHE A CD1 3  
ATOM   1975  C  CD2 . PHE A 1 66 ? -3.680  7.110   5.092   1.00 0.00 ? 66 PHE A CD2 3  
ATOM   1976  C  CE1 . PHE A 1 66 ? -6.100  6.058   5.992   1.00 0.00 ? 66 PHE A CE1 3  
ATOM   1977  C  CE2 . PHE A 1 66 ? -4.382  6.211   4.297   1.00 0.00 ? 66 PHE A CE2 3  
ATOM   1978  C  CZ  . PHE A 1 66 ? -5.590  5.686   4.749   1.00 0.00 ? 66 PHE A CZ  3  
ATOM   1979  N  N   . ARG A 1 67 ? -3.095  6.158   8.967   1.00 0.00 ? 67 ARG A N   3  
ATOM   1980  C  CA  . ARG A 1 67 ? -2.269  5.148   9.632   1.00 0.00 ? 67 ARG A CA  3  
ATOM   1981  C  C   . ARG A 1 67 ? -1.022  4.873   8.816   1.00 0.00 ? 67 ARG A C   3  
ATOM   1982  O  O   . ARG A 1 67 ? -1.084  4.668   7.598   1.00 0.00 ? 67 ARG A O   3  
ATOM   1983  C  CB  . ARG A 1 67 ? -3.049  3.839   9.916   1.00 0.00 ? 67 ARG A CB  3  
ATOM   1984  C  CG  . ARG A 1 67 ? -4.558  4.034   10.229  1.00 0.00 ? 67 ARG A CG  3  
ATOM   1985  C  CD  . ARG A 1 67 ? -5.432  3.839   8.985   1.00 0.00 ? 67 ARG A CD  3  
ATOM   1986  N  NE  . ARG A 1 67 ? -6.835  4.167   9.340   1.00 0.00 ? 67 ARG A NE  3  
ATOM   1987  C  CZ  . ARG A 1 67 ? -7.319  5.389   9.518   1.00 0.00 ? 67 ARG A CZ  3  
ATOM   1988  N  NH1 . ARG A 1 67 ? -6.619  6.479   9.404   1.00 0.00 ? 67 ARG A NH1 3  
ATOM   1989  N  NH2 . ARG A 1 67 ? -8.563  5.497   9.824   1.00 0.00 ? 67 ARG A NH2 3  
ATOM   1990  N  N   . PRO A 1 68 ? 0.249   4.898   9.568   1.00 0.00 ? 68 PRO A N   3  
ATOM   1991  C  CA  . PRO A 1 68 ? 1.652   4.667   8.990   1.00 0.00 ? 68 PRO A CA  3  
ATOM   1992  C  C   . PRO A 1 68 ? 2.035   3.206   8.860   1.00 0.00 ? 68 PRO A C   3  
ATOM   1993  O  O   . PRO A 1 68 ? 2.963   2.703   9.506   1.00 0.00 ? 68 PRO A O   3  
ATOM   1994  C  CB  . PRO A 1 68 ? 2.603   5.343   9.968   1.00 0.00 ? 68 PRO A CB  3  
ATOM   1995  C  CG  . PRO A 1 68 ? 1.921   4.987   11.304  1.00 0.00 ? 68 PRO A CG  3  
ATOM   1996  C  CD  . PRO A 1 68 ? 0.425   5.155   11.018  1.00 0.00 ? 68 PRO A CD  3  
ATOM   1997  N  N   . CYS A 1 69 ? 1.193   2.409   7.937   1.00 0.00 ? 69 CYS A N   3  
ATOM   1998  C  CA  . CYS A 1 69 ? 1.557   1.035   7.578   1.00 0.00 ? 69 CYS A CA  3  
ATOM   1999  C  C   . CYS A 1 69 ? 3.048   0.947   7.334   1.00 0.00 ? 69 CYS A C   3  
ATOM   2000  O  O   . CYS A 1 69 ? 3.613   1.339   6.304   1.00 0.00 ? 69 CYS A O   3  
ATOM   2001  C  CB  . CYS A 1 69 ? 0.652   0.589   6.417   1.00 0.00 ? 69 CYS A CB  3  
ATOM   2002  S  SG  . CYS A 1 69 ? 0.721   -1.181  6.095   1.00 0.00 ? 69 CYS A SG  3  
ATOM   2003  N  N   . LYS A 1 70 ? 3.834   0.383   8.475   1.00 0.00 ? 70 LYS A N   3  
ATOM   2004  C  CA  . LYS A 1 70 ? 5.289   0.373   8.534   1.00 0.00 ? 70 LYS A CA  3  
ATOM   2005  C  C   . LYS A 1 70 ? 5.850   -0.888  7.921   1.00 0.00 ? 70 LYS A C   3  
ATOM   2006  O  O   . LYS A 1 70 ? 6.335   -0.874  6.770   1.00 0.00 ? 70 LYS A O   3  
ATOM   2007  C  CB  . LYS A 1 70 ? 5.749   0.522   10.012  1.00 0.00 ? 70 LYS A CB  3  
ATOM   2008  C  CG  . LYS A 1 70 ? 6.600   1.790   10.268  1.00 0.00 ? 70 LYS A CG  3  
ATOM   2009  C  CD  . LYS A 1 70 ? 7.833   1.929   9.371   1.00 0.00 ? 70 LYS A CD  3  
ATOM   2010  C  CE  . LYS A 1 70 ? 8.935   0.989   9.878   1.00 0.00 ? 70 LYS A CE  3  
ATOM   2011  N  NZ  . LYS A 1 70 ? 10.246  1.473   9.409   1.00 0.00 ? 70 LYS A NZ  3  
ATOM   2012  N  N   . ARG A 1 71 ? 5.833   -2.116  8.742   1.00 0.00 ? 71 ARG A N   3  
ATOM   2013  C  CA  . ARG A 1 71 ? 6.184   -3.421  8.140   1.00 0.00 ? 71 ARG A CA  3  
ATOM   2014  C  C   . ARG A 1 71 ? 5.158   -3.702  7.061   1.00 0.00 ? 71 ARG A C   3  
ATOM   2015  O  O   . ARG A 1 71 ? 5.443   -3.619  5.861   1.00 0.00 ? 71 ARG A O   3  
ATOM   2016  C  CB  . ARG A 1 71 ? 6.213   -4.506  9.239   1.00 0.00 ? 71 ARG A CB  3  
ATOM   2017  C  CG  . ARG A 1 71 ? 7.622   -5.059  9.592   1.00 0.00 ? 71 ARG A CG  3  
ATOM   2018  C  CD  . ARG A 1 71 ? 7.989   -6.306  8.779   1.00 0.00 ? 71 ARG A CD  3  
ATOM   2019  N  NE  . ARG A 1 71 ? 8.044   -7.471  9.697   1.00 0.00 ? 71 ARG A NE  3  
ATOM   2020  C  CZ  . ARG A 1 71 ? 9.088   -7.824  10.434  1.00 0.00 ? 71 ARG A CZ  3  
ATOM   2021  N  NH1 . ARG A 1 71 ? 10.220  -7.185  10.456  1.00 0.00 ? 71 ARG A NH1 3  
ATOM   2022  N  NH2 . ARG A 1 71 ? 8.967   -8.869  11.173  1.00 0.00 ? 71 ARG A NH2 3  
ATOM   2023  N  N   . CYS A 1 72 ? 3.825   -4.121  7.543   1.00 0.00 ? 72 CYS A N   3  
ATOM   2024  C  CA  . CYS A 1 72 ? 2.647   -4.202  6.697   1.00 0.00 ? 72 CYS A CA  3  
ATOM   2025  C  C   . CYS A 1 72 ? 1.447   -4.709  7.489   1.00 0.00 ? 72 CYS A C   3  
ATOM   2026  O  O   . CYS A 1 72 ? 0.749   -5.659  7.114   1.00 0.00 ? 72 CYS A O   3  
ATOM   2027  C  CB  . CYS A 1 72 ? 2.942   -4.970  5.398   1.00 0.00 ? 72 CYS A CB  3  
ATOM   2028  S  SG  . CYS A 1 72 ? 3.131   -3.798  4.012   1.00 0.00 ? 72 CYS A SG  3  
ATOM   2029  N  N   . GLN A 1 73 ? 1.151   -3.958  8.723   1.00 0.00 ? 73 GLN A N   3  
ATOM   2030  C  CA  . GLN A 1 73 ? -0.040  -4.191  9.561   1.00 0.00 ? 73 GLN A CA  3  
ATOM   2031  C  C   . GLN A 1 73 ? -1.289  -4.434  8.767   1.00 0.00 ? 73 GLN A C   3  
ATOM   2032  O  O   . GLN A 1 73 ? -2.009  -3.503  8.371   1.00 0.00 ? 73 GLN A O   3  
ATOM   2033  C  CB  . GLN A 1 73 ? -0.222  -2.947  10.487  1.00 0.00 ? 73 GLN A CB  3  
ATOM   2034  C  CG  . GLN A 1 73 ? -0.386  -3.237  12.013  1.00 0.00 ? 73 GLN A CG  3  
ATOM   2035  C  CD  . GLN A 1 73 ? -0.062  -2.128  13.023  1.00 0.00 ? 73 GLN A CD  3  
ATOM   2036  O  OE1 . GLN A 1 73 ? 1.091   -1.875  13.334  1.00 0.00 ? 73 GLN A OE1 3  
ATOM   2037  N  NE2 . GLN A 1 73 ? -1.029  -1.418  13.547  1.00 0.00 ? 73 GLN A NE2 3  
ATOM   2038  N  N   . PRO A 1 74 ? -1.637  -5.847  8.505   1.00 0.00 ? 74 PRO A N   3  
ATOM   2039  C  CA  . PRO A 1 74 ? -2.869  -6.365  7.748   1.00 0.00 ? 74 PRO A CA  3  
ATOM   2040  C  C   . PRO A 1 74 ? -4.095  -6.542  8.623   1.00 0.00 ? 74 PRO A C   3  
ATOM   2041  O  O   . PRO A 1 74 ? -4.184  -5.972  9.719   1.00 0.00 ? 74 PRO A O   3  
ATOM   2042  C  CB  . PRO A 1 74 ? -2.456  -7.733  7.217   1.00 0.00 ? 74 PRO A CB  3  
ATOM   2043  C  CG  . PRO A 1 74 ? -1.640  -8.259  8.410   1.00 0.00 ? 74 PRO A CG  3  
ATOM   2044  C  CD  . PRO A 1 74 ? -0.868  -7.042  8.927   1.00 0.00 ? 74 PRO A CD  3  
ATOM   2045  N  N   . ASP A 1 75 ? -5.189  -7.388  8.067   1.00 0.00 ? 75 ASP A N   3  
ATOM   2046  C  CA  . ASP A 1 75 ? -6.328  -7.794  8.875   1.00 0.00 ? 75 ASP A CA  3  
ATOM   2047  C  C   . ASP A 1 75 ? -7.474  -6.818  8.739   1.00 0.00 ? 75 ASP A C   3  
ATOM   2048  O  O   . ASP A 1 75 ? -7.499  -5.748  9.362   1.00 0.00 ? 75 ASP A O   3  
ATOM   2049  C  CB  . ASP A 1 75 ? -5.905  -7.959  10.367  1.00 0.00 ? 75 ASP A CB  3  
ATOM   2050  C  CG  . ASP A 1 75 ? -4.900  -9.078  10.671  1.00 0.00 ? 75 ASP A CG  3  
ATOM   2051  O  OD1 . ASP A 1 75 ? -4.328  -9.717  9.799   1.00 0.00 ? 75 ASP A OD1 3  
ATOM   2052  O  OD2 . ASP A 1 75 ? -4.699  -9.261  12.011  1.00 0.00 ? 75 ASP A OD2 3  
ATOM   2053  N  N   . LYS A 1 76 ? -8.543  -7.198  7.790   1.00 0.00 ? 76 LYS A N   3  
ATOM   2054  C  CA  . LYS A 1 76 ? -9.795  -6.455  7.684   1.00 0.00 ? 76 LYS A CA  3  
ATOM   2055  C  C   . LYS A 1 76 ? -10.977 -7.368  7.933   1.00 0.00 ? 76 LYS A C   3  
ATOM   2056  O  O   . LYS A 1 76 ? -11.484 -7.475  9.058   1.00 0.00 ? 76 LYS A O   3  
ATOM   2057  C  CB  . LYS A 1 76 ? -9.897  -5.777  6.292   1.00 0.00 ? 76 LYS A CB  3  
ATOM   2058  C  CG  . LYS A 1 76 ? -11.300 -5.191  5.994   1.00 0.00 ? 76 LYS A CG  3  
ATOM   2059  C  CD  . LYS A 1 76 ? -11.984 -4.516  7.186   1.00 0.00 ? 76 LYS A CD  3  
ATOM   2060  C  CE  . LYS A 1 76 ? -13.370 -4.014  6.757   1.00 0.00 ? 76 LYS A CE  3  
ATOM   2061  N  NZ  . LYS A 1 76 ? -13.917 -3.133  7.803   1.00 0.00 ? 76 LYS A NZ  3  
ATOM   2062  N  N   . ALA A 1 77 ? -11.517 -8.081  6.758   1.00 0.00 ? 77 ALA A N   3  
ATOM   2063  C  CA  . ALA A 1 77 ? -12.533 -9.130  6.841   1.00 0.00 ? 77 ALA A CA  3  
ATOM   2064  C  C   . ALA A 1 77 ? -12.585 -9.803  8.190   1.00 0.00 ? 77 ALA A C   3  
ATOM   2065  O  O   . ALA A 1 77 ? -13.632 -9.870  8.849   1.00 0.00 ? 77 ALA A O   3  
ATOM   2066  C  CB  . ALA A 1 77 ? -12.242 -10.130 5.698   1.00 0.00 ? 77 ALA A CB  3  
ATOM   2067  N  N   . ASN A 1 78 ? -11.323 -10.412 8.667   1.00 0.00 ? 78 ASN A N   3  
ATOM   2068  C  CA  . ASN A 1 78 ? -11.197 -11.003 9.995   1.00 0.00 ? 78 ASN A CA  3  
ATOM   2069  C  C   . ASN A 1 78 ? -9.810  -10.785 10.554  1.00 0.00 ? 78 ASN A C   3  
ATOM   2070  O  O   . ASN A 1 78 ? -8.803  -11.240 9.999   1.00 0.00 ? 78 ASN A O   3  
ATOM   2071  C  CB  . ASN A 1 78 ? -11.529 -12.522 9.922   1.00 0.00 ? 78 ASN A CB  3  
ATOM   2072  C  CG  . ASN A 1 78 ? -12.902 -12.906 9.359   1.00 0.00 ? 78 ASN A CG  3  
ATOM   2073  O  OD1 . ASN A 1 78 ? -13.864 -13.132 10.079  1.00 0.00 ? 78 ASN A OD1 3  
ATOM   2074  N  ND2 . ASN A 1 78 ? -13.047 -12.995 8.065   1.00 0.00 ? 78 ASN A ND2 3  
ATOM   2075  N  N   . PRO A 1 79 ? -9.733  -10.021 11.818  1.00 0.00 ? 79 PRO A N   3  
ATOM   2076  C  CA  . PRO A 1 79 ? -8.459  -9.654  12.579  1.00 0.00 ? 79 PRO A CA  3  
ATOM   2077  C  C   . PRO A 1 79 ? -7.771  -10.799 13.292  1.00 0.00 ? 79 PRO A C   3  
ATOM   2078  O  O   . PRO A 1 79 ? -6.552  -10.771 13.526  1.00 0.00 ? 79 PRO A O   3  
ATOM   2079  C  CB  . PRO A 1 79 ? -8.869  -8.616  13.619  1.00 0.00 ? 79 PRO A CB  3  
ATOM   2080  C  CG  . PRO A 1 79 ? -10.296 -9.082  13.949  1.00 0.00 ? 79 PRO A CG  3  
ATOM   2081  C  CD  . PRO A 1 79 ? -10.875 -9.466  12.583  1.00 0.00 ? 79 PRO A CD  3  
ATOM   2082  N  N   . ARG A 1 80 ? -8.622  -11.927 13.727  1.00 0.00 ? 80 ARG A N   3  
ATOM   2083  C  CA  . ARG A 1 80 ? -8.060  -13.149 14.294  1.00 0.00 ? 80 ARG A CA  3  
ATOM   2084  C  C   . ARG A 1 80 ? -7.536  -12.906 15.691  1.00 0.00 ? 80 ARG A C   3  
ATOM   2085  O  O   . ARG A 1 80 ? -6.735  -13.681 16.230  1.00 0.00 ? 80 ARG A O   3  
ATOM   2086  C  CB  . ARG A 1 80 ? -6.941  -13.676 13.355  1.00 0.00 ? 80 ARG A CB  3  
ATOM   2087  C  CG  . ARG A 1 80 ? -6.510  -15.146 13.608  1.00 0.00 ? 80 ARG A CG  3  
ATOM   2088  C  CD  . ARG A 1 80 ? -5.123  -15.459 13.032  1.00 0.00 ? 80 ARG A CD  3  
ATOM   2089  N  NE  . ARG A 1 80 ? -4.797  -16.874 13.339  1.00 0.00 ? 80 ARG A NE  3  
ATOM   2090  C  CZ  . ARG A 1 80 ? -3.888  -17.608 12.712  1.00 0.00 ? 80 ARG A CZ  3  
ATOM   2091  N  NH1 . ARG A 1 80 ? -3.155  -17.183 11.726  1.00 0.00 ? 80 ARG A NH1 3  
ATOM   2092  N  NH2 . ARG A 1 80 ? -3.726  -18.820 13.110  1.00 0.00 ? 80 ARG A NH2 3  
ATOM   2093  N  N   . GLN A 1 81 ? -8.050  -11.704 16.383  1.00 0.00 ? 81 GLN A N   3  
ATOM   2094  C  CA  . GLN A 1 81 ? -7.516  -11.264 17.668  1.00 0.00 ? 81 GLN A CA  3  
ATOM   2095  C  C   . GLN A 1 81 ? -6.121  -10.704 17.512  1.00 0.00 ? 81 GLN A C   3  
ATOM   2096  O  O   . GLN A 1 81 ? -5.653  -10.423 16.400  1.00 0.00 ? 81 GLN A O   3  
ATOM   2097  C  CB  . GLN A 1 81 ? -7.524  -12.461 18.645  1.00 0.00 ? 81 GLN A CB  3  
ATOM   2098  C  CG  . GLN A 1 81 ? -8.740  -13.439 18.530  1.00 0.00 ? 81 GLN A CG  3  
ATOM   2099  C  CD  . GLN A 1 81 ? -8.546  -14.917 18.889  1.00 0.00 ? 81 GLN A CD  3  
ATOM   2100  O  OE1 . GLN A 1 81 ? -7.691  -15.266 19.688  1.00 0.00 ? 81 GLN A OE1 3  
ATOM   2101  N  NE2 . GLN A 1 81 ? -9.300  -15.830 18.332  1.00 0.00 ? 81 GLN A NE2 3  
ATOM   2102  N  N   . HIS A 1 82 ? -5.364  -10.475 18.761  1.00 0.00 ? 82 HIS A N   3  
ATOM   2103  C  CA  . HIS A 1 82 ? -4.074  -9.788  18.771  1.00 0.00 ? 82 HIS A CA  3  
ATOM   2104  C  C   . HIS A 1 82 ? -2.934  -10.778 18.835  1.00 0.00 ? 82 HIS A C   3  
ATOM   2105  O  O   . HIS A 1 82 ? -2.352  -11.166 17.812  1.00 0.00 ? 82 HIS A O   3  
ATOM   2106  C  CB  . HIS A 1 82 ? -4.076  -8.885  20.015  1.00 0.00 ? 82 HIS A CB  3  
ATOM   2107  C  CG  . HIS A 1 82 ? -2.746  -8.231  20.248  1.00 0.00 ? 82 HIS A CG  3  
ATOM   2108  N  ND1 . HIS A 1 82 ? -2.118  -8.079  21.482  1.00 0.00 ? 82 HIS A ND1 3  
ATOM   2109  C  CD2 . HIS A 1 82 ? -1.983  -7.694  19.220  1.00 0.00 ? 82 HIS A CD2 3  
ATOM   2110  C  CE1 . HIS A 1 82 ? -0.997  -7.443  21.093  1.00 0.00 ? 82 HIS A CE1 3  
ATOM   2111  N  NE2 . HIS A 1 82 ? -0.838  -7.176  19.768  1.00 0.00 ? 82 HIS A NE2 3  
ATOM   2112  N  N   . ARG A 1 83 ? -2.578  -11.286 20.177  1.00 0.00 ? 83 ARG A N   3  
ATOM   2113  C  CA  . ARG A 1 83 ? -1.497  -12.247 20.385  1.00 0.00 ? 83 ARG A CA  3  
ATOM   2114  C  C   . ARG A 1 83 ? -1.780  -13.123 21.583  1.00 0.00 ? 83 ARG A C   3  
ATOM   2115  O  O   . ARG A 1 83 ? -0.887  -13.780 22.135  1.00 0.00 ? 83 ARG A O   3  
ATOM   2116  C  CB  . ARG A 1 83 ? -0.157  -11.480 20.549  1.00 0.00 ? 83 ARG A CB  3  
ATOM   2117  C  CG  . ARG A 1 83 ? 0.329   -10.722 19.285  1.00 0.00 ? 83 ARG A CG  3  
ATOM   2118  C  CD  . ARG A 1 83 ? 1.855   -10.758 19.129  1.00 0.00 ? 83 ARG A CD  3  
ATOM   2119  N  NE  . ARG A 1 83 ? 2.272   -12.171 18.944  1.00 0.00 ? 83 ARG A NE  3  
ATOM   2120  C  CZ  . ARG A 1 83 ? 3.454   -12.675 19.274  1.00 0.00 ? 83 ARG A CZ  3  
ATOM   2121  N  NH1 . ARG A 1 83 ? 4.422   -11.988 19.805  1.00 0.00 ? 83 ARG A NH1 3  
ATOM   2122  N  NH2 . ARG A 1 83 ? 3.649   -13.926 19.052  1.00 0.00 ? 83 ARG A NH2 3  
ATOM   2123  N  N   . LEU A 1 84 ? -3.184  -13.168 22.046  1.00 0.00 ? 84 LEU A N   3  
ATOM   2124  C  CA  . LEU A 1 84 ? -3.576  -13.872 23.263  1.00 0.00 ? 84 LEU A CA  3  
ATOM   2125  C  C   . LEU A 1 84 ? -3.955  -15.303 22.961  1.00 0.00 ? 84 LEU A C   3  
ATOM   2126  O  O   . LEU A 1 84 ? -5.069  -15.601 22.508  1.00 0.00 ? 84 LEU A O   3  
ATOM   2127  C  CB  . LEU A 1 84 ? -4.742  -13.128 23.973  1.00 0.00 ? 84 LEU A CB  3  
ATOM   2128  C  CG  . LEU A 1 84 ? -4.395  -11.901 24.859  1.00 0.00 ? 84 LEU A CG  3  
ATOM   2129  C  CD1 . LEU A 1 84 ? -5.046  -10.635 24.285  1.00 0.00 ? 84 LEU A CD1 3  
ATOM   2130  C  CD2 . LEU A 1 84 ? -4.824  -12.085 26.324  1.00 0.00 ? 84 LEU A CD2 3  
ATOM   2131  N  N   . ASP A 1 85 ? -2.916  -16.324 23.215  1.00 0.00 ? 85 ASP A N   3  
ATOM   2132  C  CA  . ASP A 1 85 ? -3.132  -17.738 22.919  1.00 0.00 ? 85 ASP A CA  3  
ATOM   2133  C  C   . ASP A 1 85 ? -2.653  -18.607 24.058  1.00 0.00 ? 85 ASP A C   3  
ATOM   2134  O  O   . ASP A 1 85 ? -1.854  -19.538 23.887  1.00 0.00 ? 85 ASP A O   3  
ATOM   2135  C  CB  . ASP A 1 85 ? -2.459  -18.114 21.574  1.00 0.00 ? 85 ASP A CB  3  
ATOM   2136  C  CG  . ASP A 1 85 ? -3.144  -19.208 20.742  1.00 0.00 ? 85 ASP A CG  3  
ATOM   2137  O  OD1 . ASP A 1 85 ? -4.328  -19.622 21.284  1.00 0.00 ? 85 ASP A OD1 3  
ATOM   2138  O  OD2 . ASP A 1 85 ? -2.671  -19.651 19.706  1.00 0.00 ? 85 ASP A OD2 3  
ATOM   2139  N  N   . LYS A 1 86 ? -3.224  -18.306 25.392  1.00 0.00 ? 86 LYS A N   3  
ATOM   2140  C  CA  . LYS A 1 86 ? -2.816  -19.039 26.586  1.00 0.00 ? 86 LYS A CA  3  
ATOM   2141  C  C   . LYS A 1 86 ? -1.371  -18.759 26.926  1.00 0.00 ? 86 LYS A C   3  
ATOM   2142  O  O   . LYS A 1 86 ? -0.698  -17.935 26.292  1.00 0.00 ? 86 LYS A O   3  
ATOM   2143  C  CB  . LYS A 1 86 ? -3.048  -20.559 26.363  1.00 0.00 ? 86 LYS A CB  3  
ATOM   2144  C  CG  . LYS A 1 86 ? -4.406  -20.883 25.691  1.00 0.00 ? 86 LYS A CG  3  
ATOM   2145  C  CD  . LYS A 1 86 ? -5.030  -22.217 26.110  1.00 0.00 ? 86 LYS A CD  3  
ATOM   2146  C  CE  . LYS A 1 86 ? -4.287  -23.364 25.413  1.00 0.00 ? 86 LYS A CE  3  
ATOM   2147  N  NZ  . LYS A 1 86 ? -3.911  -24.382 26.410  1.00 0.00 ? 86 LYS A NZ  3  
ATOM   2148  N  N   . ILE A 1 87 ? -0.817  -19.496 28.083  1.00 0.00 ? 87 ILE A N   3  
ATOM   2149  C  CA  . ILE A 1 87 ? 0.542   -19.270 28.566  1.00 0.00 ? 87 ILE A CA  3  
ATOM   2150  C  C   . ILE A 1 87 ? 1.091   -20.508 29.236  1.00 0.00 ? 87 ILE A C   3  
ATOM   2151  O  O   . ILE A 1 87 ? 0.369   -21.265 29.899  1.00 0.00 ? 87 ILE A O   3  
ATOM   2152  C  CB  . ILE A 1 87 ? 0.613   -18.006 29.517  1.00 0.00 ? 87 ILE A CB  3  
ATOM   2153  C  CG1 . ILE A 1 87 ? 1.122   -16.700 28.828  1.00 0.00 ? 87 ILE A CG1 3  
ATOM   2154  C  CG2 . ILE A 1 87 ? 1.483   -18.254 30.788  1.00 0.00 ? 87 ILE A CG2 3  
ATOM   2155  C  CD1 . ILE A 1 87 ? 0.487   -15.385 29.324  1.00 0.00 ? 87 ILE A CD1 3  
ATOM   2156  N  N   . THR A 1 88 ? 2.542   -20.749 29.078  1.00 0.00 ? 88 THR A N   3  
ATOM   2157  C  CA  . THR A 1 88 ? 3.204   -21.904 29.676  1.00 0.00 ? 88 THR A CA  3  
ATOM   2158  C  C   . THR A 1 88 ? 4.227   -21.472 30.699  1.00 0.00 ? 88 THR A C   3  
ATOM   2159  O  O   . THR A 1 88 ? 4.822   -20.389 30.608  1.00 0.00 ? 88 THR A O   3  
ATOM   2160  C  CB  . THR A 1 88 ? 3.868   -22.792 28.570  1.00 0.00 ? 88 THR A CB  3  
ATOM   2161  O  OG1 . THR A 1 88 ? 2.889   -23.259 27.651  1.00 0.00 ? 88 THR A OG1 3  
ATOM   2162  C  CG2 . THR A 1 88 ? 4.584   -24.070 29.056  1.00 0.00 ? 88 THR A CG2 3  
ATOM   2163  N  N   . HIS A 1 89 ? 4.486   -22.416 31.807  1.00 0.00 ? 89 HIS A N   3  
ATOM   2164  C  CA  . HIS A 1 89 ? 5.440   -22.119 32.872  1.00 0.00 ? 89 HIS A CA  3  
ATOM   2165  C  C   . HIS A 1 89 ? 6.740   -22.859 32.659  1.00 0.00 ? 89 HIS A C   3  
ATOM   2166  O  O   . HIS A 1 89 ? 6.767   -24.077 32.436  1.00 0.00 ? 89 HIS A O   3  
ATOM   2167  C  CB  . HIS A 1 89 ? 4.776   -22.565 34.185  1.00 0.00 ? 89 HIS A CB  3  
ATOM   2168  C  CG  . HIS A 1 89 ? 5.054   -21.618 35.316  1.00 0.00 ? 89 HIS A CG  3  
ATOM   2169  N  ND1 . HIS A 1 89 ? 4.332   -20.464 35.608  1.00 0.00 ? 89 HIS A ND1 3  
ATOM   2170  C  CD2 . HIS A 1 89 ? 6.097   -21.806 36.212  1.00 0.00 ? 89 HIS A CD2 3  
ATOM   2171  C  CE1 . HIS A 1 89 ? 5.012   -20.035 36.688  1.00 0.00 ? 89 HIS A CE1 3  
ATOM   2172  N  NE2 . HIS A 1 89 ? 6.075   -20.772 37.112  1.00 0.00 ? 89 HIS A NE2 3  
ATOM   2173  N  N   . ALA A 1 90 ? 7.975   -22.048 32.726  1.00 0.00 ? 90 ALA A N   3  
ATOM   2174  C  CA  . ALA A 1 90 ? 9.295   -22.631 32.508  1.00 0.00 ? 90 ALA A CA  3  
ATOM   2175  C  C   . ALA A 1 90 ? 9.322   -23.450 31.239  1.00 0.00 ? 90 ALA A C   3  
ATOM   2176  O  O   . ALA A 1 90 ? 9.516   -22.930 30.131  1.00 0.00 ? 90 ALA A O   3  
ATOM   2177  C  CB  . ALA A 1 90 ? 9.654   -23.453 33.757  1.00 0.00 ? 90 ALA A CB  3  
ATOM   2178  N  N   . CYS A 1 91 ? 9.127   -24.909 31.393  1.00 0.00 ? 91 CYS A N   3  
ATOM   2179  C  CA  . CYS A 1 91 ? 9.278   -25.831 30.272  1.00 0.00 ? 91 CYS A CA  3  
ATOM   2180  C  C   . CYS A 1 91 ? 10.735  -26.015 29.917  1.00 0.00 ? 91 CYS A C   3  
ATOM   2181  O  O   . CYS A 1 91 ? 11.599  -25.199 30.267  1.00 0.00 ? 91 CYS A O   3  
ATOM   2182  C  CB  . CYS A 1 91 ? 8.447   -25.303 29.087  1.00 0.00 ? 91 CYS A CB  3  
ATOM   2183  S  SG  . CYS A 1 91 ? 7.726   -26.670 28.151  1.00 0.00 ? 91 CYS A SG  3  
ATOM   2184  N  N   . ARG A 1 92 ? 11.065  -27.200 29.097  1.00 0.00 ? 92 ARG A N   3  
ATOM   2185  C  CA  . ARG A 1 92 ? 12.437  -27.517 28.710  1.00 0.00 ? 92 ARG A CA  3  
ATOM   2186  C  C   . ARG A 1 92 ? 13.290  -27.802 29.923  1.00 0.00 ? 92 ARG A C   3  
ATOM   2187  O  O   . ARG A 1 92 ? 14.504  -27.616 29.924  1.00 0.00 ? 92 ARG A O   3  
ATOM   2188  C  CB  . ARG A 1 92 ? 13.011  -26.336 27.879  1.00 0.00 ? 92 ARG A CB  3  
ATOM   2189  C  CG  . ARG A 1 92 ? 12.144  -25.909 26.665  1.00 0.00 ? 92 ARG A CG  3  
ATOM   2190  C  CD  . ARG A 1 92 ? 12.218  -24.401 26.391  1.00 0.00 ? 92 ARG A CD  3  
ATOM   2191  N  NE  . ARG A 1 92 ? 10.839  -23.900 26.160  1.00 0.00 ? 92 ARG A NE  3  
ATOM   2192  C  CZ  . ARG A 1 92 ? 10.472  -22.626 26.165  1.00 0.00 ? 92 ARG A CZ  3  
ATOM   2193  N  NH1 . ARG A 1 92 ? 11.282  -21.630 26.375  1.00 0.00 ? 92 ARG A NH1 3  
ATOM   2194  N  NH2 . ARG A 1 92 ? 9.232   -22.365 25.947  1.00 0.00 ? 92 ARG A NH2 3  
ATOM   2195  O  OXT . ARG A 1 92 ? 12.599  -28.304 31.070  1.00 0.00 ? 92 ARG A OXT 3  
HETATM 2196  ZN ZN  . ZN  B 2 .  ? 1.660   -1.967  4.214   1.00 0.00 ? 93 ZN  A ZN  3  
ATOM   2197  N  N   . MET A 1 1  ? 11.187  22.169  -19.111 1.00 0.00 ? 1  MET A N   4  
ATOM   2198  C  CA  . MET A 1 1  ? 10.548  21.159  -19.951 1.00 0.00 ? 1  MET A CA  4  
ATOM   2199  C  C   . MET A 1 1  ? 11.262  19.832  -19.837 1.00 0.00 ? 1  MET A C   4  
ATOM   2200  O  O   . MET A 1 1  ? 10.645  18.775  -19.649 1.00 0.00 ? 1  MET A O   4  
ATOM   2201  C  CB  . MET A 1 1  ? 10.512  21.645  -21.426 1.00 0.00 ? 1  MET A CB  4  
ATOM   2202  C  CG  . MET A 1 1  ? 9.296   22.510  -21.821 1.00 0.00 ? 1  MET A CG  4  
ATOM   2203  S  SD  . MET A 1 1  ? 9.789   23.730  -23.049 1.00 0.00 ? 1  MET A SD  4  
ATOM   2204  C  CE  . MET A 1 1  ? 9.074   22.950  -24.502 1.00 0.00 ? 1  MET A CE  4  
ATOM   2205  N  N   . LYS A 1 2  ? 12.737  19.871  -19.935 1.00 0.00 ? 2  LYS A N   4  
ATOM   2206  C  CA  . LYS A 1 2  ? 13.555  18.675  -19.765 1.00 0.00 ? 2  LYS A CA  4  
ATOM   2207  C  C   . LYS A 1 2  ? 14.785  18.973  -18.939 1.00 0.00 ? 2  LYS A C   4  
ATOM   2208  O  O   . LYS A 1 2  ? 15.593  19.853  -19.267 1.00 0.00 ? 2  LYS A O   4  
ATOM   2209  C  CB  . LYS A 1 2  ? 13.946  18.111  -21.159 1.00 0.00 ? 2  LYS A CB  4  
ATOM   2210  C  CG  . LYS A 1 2  ? 14.733  16.779  -21.086 1.00 0.00 ? 2  LYS A CG  4  
ATOM   2211  C  CD  . LYS A 1 2  ? 16.254  16.933  -21.011 1.00 0.00 ? 2  LYS A CD  4  
ATOM   2212  C  CE  . LYS A 1 2  ? 16.840  16.869  -22.428 1.00 0.00 ? 2  LYS A CE  4  
ATOM   2213  N  NZ  . LYS A 1 2  ? 17.000  15.460  -22.829 1.00 0.00 ? 2  LYS A NZ  4  
ATOM   2214  N  N   . LYS A 1 3  ? 14.956  18.174  -17.706 1.00 0.00 ? 3  LYS A N   4  
ATOM   2215  C  CA  . LYS A 1 3  ? 16.139  18.300  -16.860 1.00 0.00 ? 3  LYS A CA  4  
ATOM   2216  C  C   . LYS A 1 3  ? 16.635  16.943  -16.418 1.00 0.00 ? 3  LYS A C   4  
ATOM   2217  O  O   . LYS A 1 3  ? 16.236  15.898  -16.950 1.00 0.00 ? 3  LYS A O   4  
ATOM   2218  C  CB  . LYS A 1 3  ? 15.807  19.196  -15.635 1.00 0.00 ? 3  LYS A CB  4  
ATOM   2219  C  CG  . LYS A 1 3  ? 14.797  20.326  -15.953 1.00 0.00 ? 3  LYS A CG  4  
ATOM   2220  C  CD  . LYS A 1 3  ? 14.214  21.032  -14.725 1.00 0.00 ? 3  LYS A CD  4  
ATOM   2221  C  CE  . LYS A 1 3  ? 15.255  22.006  -14.159 1.00 0.00 ? 3  LYS A CE  4  
ATOM   2222  N  NZ  . LYS A 1 3  ? 15.914  21.395  -12.992 1.00 0.00 ? 3  LYS A NZ  4  
ATOM   2223  N  N   . ALA A 1 4  ? 17.623  16.933  -15.318 1.00 0.00 ? 4  ALA A N   4  
ATOM   2224  C  CA  . ALA A 1 4  ? 18.115  15.692  -14.728 1.00 0.00 ? 4  ALA A CA  4  
ATOM   2225  C  C   . ALA A 1 4  ? 17.108  15.106  -13.765 1.00 0.00 ? 4  ALA A C   4  
ATOM   2226  O  O   . ALA A 1 4  ? 17.147  13.911  -13.433 1.00 0.00 ? 4  ALA A O   4  
ATOM   2227  C  CB  . ALA A 1 4  ? 19.468  15.997  -14.062 1.00 0.00 ? 4  ALA A CB  4  
ATOM   2228  N  N   . THR A 1 5  ? 16.091  16.032  -13.222 1.00 0.00 ? 5  THR A N   4  
ATOM   2229  C  CA  . THR A 1 5  ? 15.170  15.633  -12.161 1.00 0.00 ? 5  THR A CA  4  
ATOM   2230  C  C   . THR A 1 5  ? 13.790  15.359  -12.712 1.00 0.00 ? 5  THR A C   4  
ATOM   2231  O  O   . THR A 1 5  ? 12.796  15.986  -12.324 1.00 0.00 ? 5  THR A O   4  
ATOM   2232  C  CB  . THR A 1 5  ? 15.108  16.734  -11.049 1.00 0.00 ? 5  THR A CB  4  
ATOM   2233  O  OG1 . THR A 1 5  ? 16.405  17.251  -10.784 1.00 0.00 ? 5  THR A OG1 4  
ATOM   2234  C  CG2 . THR A 1 5  ? 14.580  16.285  -9.669  1.00 0.00 ? 5  THR A CG2 4  
ATOM   2235  N  N   . CYS A 1 6  ? 13.702  14.326  -13.767 1.00 0.00 ? 6  CYS A N   4  
ATOM   2236  C  CA  . CYS A 1 6  ? 12.429  13.919  -14.354 1.00 0.00 ? 6  CYS A CA  4  
ATOM   2237  C  C   . CYS A 1 6  ? 11.764  12.837  -13.536 1.00 0.00 ? 6  CYS A C   4  
ATOM   2238  O  O   . CYS A 1 6  ? 10.923  12.071  -14.036 1.00 0.00 ? 6  CYS A O   4  
ATOM   2239  C  CB  . CYS A 1 6  ? 12.680  13.480  -15.811 1.00 0.00 ? 6  CYS A CB  4  
ATOM   2240  S  SG  . CYS A 1 6  ? 11.247  13.854  -16.847 1.00 0.00 ? 6  CYS A SG  4  
ATOM   2241  N  N   . LEU A 1 7  ? 12.187  12.709  -12.125 1.00 0.00 ? 7  LEU A N   4  
ATOM   2242  C  CA  . LEU A 1 7  ? 11.505  11.818  -11.190 1.00 0.00 ? 7  LEU A CA  4  
ATOM   2243  C  C   . LEU A 1 7  ? 10.057  12.216  -11.024 1.00 0.00 ? 7  LEU A C   4  
ATOM   2244  O  O   . LEU A 1 7  ? 9.720   13.176  -10.318 1.00 0.00 ? 7  LEU A O   4  
ATOM   2245  C  CB  . LEU A 1 7  ? 12.238  11.800  -9.819  1.00 0.00 ? 7  LEU A CB  4  
ATOM   2246  C  CG  . LEU A 1 7  ? 13.487  10.890  -9.670  1.00 0.00 ? 7  LEU A CG  4  
ATOM   2247  C  CD1 . LEU A 1 7  ? 14.385  11.020  -10.909 1.00 0.00 ? 7  LEU A CD1 4  
ATOM   2248  C  CD2 . LEU A 1 7  ? 14.303  11.203  -8.405  1.00 0.00 ? 7  LEU A CD2 4  
ATOM   2249  N  N   . THR A 1 8  ? 9.065   11.407  -11.768 1.00 0.00 ? 8  THR A N   4  
ATOM   2250  C  CA  . THR A 1 8  ? 7.656   11.780  -11.831 1.00 0.00 ? 8  THR A CA  4  
ATOM   2251  C  C   . THR A 1 8  ? 6.807   10.876  -10.969 1.00 0.00 ? 8  THR A C   4  
ATOM   2252  O  O   . THR A 1 8  ? 7.266   9.855   -10.439 1.00 0.00 ? 8  THR A O   4  
ATOM   2253  C  CB  . THR A 1 8  ? 7.147   11.768  -13.313 1.00 0.00 ? 8  THR A CB  4  
ATOM   2254  O  OG1 . THR A 1 8  ? 8.233   11.949  -14.213 1.00 0.00 ? 8  THR A OG1 4  
ATOM   2255  C  CG2 . THR A 1 8  ? 6.136   12.869  -13.698 1.00 0.00 ? 8  THR A CG2 4  
ATOM   2256  N  N   . ASP A 1 9  ? 5.403   11.302  -10.763 1.00 0.00 ? 9  ASP A N   4  
ATOM   2257  C  CA  . ASP A 1 9  ? 4.437   10.459  -10.064 1.00 0.00 ? 9  ASP A CA  4  
ATOM   2258  C  C   . ASP A 1 9  ? 4.313   9.113   -10.742 1.00 0.00 ? 9  ASP A C   4  
ATOM   2259  O  O   . ASP A 1 9  ? 3.887   8.116   -10.143 1.00 0.00 ? 9  ASP A O   4  
ATOM   2260  C  CB  . ASP A 1 9  ? 3.066   11.173  -9.950  1.00 0.00 ? 9  ASP A CB  4  
ATOM   2261  C  CG  . ASP A 1 9  ? 3.049   12.697  -10.133 1.00 0.00 ? 9  ASP A CG  4  
ATOM   2262  O  OD1 . ASP A 1 9  ? 3.486   13.474  -9.297  1.00 0.00 ? 9  ASP A OD1 4  
ATOM   2263  O  OD2 . ASP A 1 9  ? 2.490   13.082  -11.320 1.00 0.00 ? 9  ASP A OD2 4  
ATOM   2264  N  N   . ASP A 1 10 ? 4.693   9.067   -12.171 1.00 0.00 ? 10 ASP A N   4  
ATOM   2265  C  CA  . ASP A 1 10 ? 4.751   7.809   -12.911 1.00 0.00 ? 10 ASP A CA  4  
ATOM   2266  C  C   . ASP A 1 10 ? 5.725   6.851   -12.266 1.00 0.00 ? 10 ASP A C   4  
ATOM   2267  O  O   . ASP A 1 10 ? 5.381   5.729   -11.868 1.00 0.00 ? 10 ASP A O   4  
ATOM   2268  C  CB  . ASP A 1 10 ? 5.094   8.074   -14.400 1.00 0.00 ? 10 ASP A CB  4  
ATOM   2269  C  CG  . ASP A 1 10 ? 5.799   6.942   -15.162 1.00 0.00 ? 10 ASP A CG  4  
ATOM   2270  O  OD1 . ASP A 1 10 ? 5.287   5.708   -14.872 1.00 0.00 ? 10 ASP A OD1 4  
ATOM   2271  O  OD2 . ASP A 1 10 ? 6.705   7.138   -15.958 1.00 0.00 ? 10 ASP A OD2 4  
ATOM   2272  N  N   . GLN A 1 11 ? 7.111   7.344   -12.094 1.00 0.00 ? 11 GLN A N   4  
ATOM   2273  C  CA  . GLN A 1 11 ? 8.195   6.475   -11.647 1.00 0.00 ? 11 GLN A CA  4  
ATOM   2274  C  C   . GLN A 1 11 ? 7.964   5.993   -10.233 1.00 0.00 ? 11 GLN A C   4  
ATOM   2275  O  O   . GLN A 1 11 ? 8.361   4.888   -9.839  1.00 0.00 ? 11 GLN A O   4  
ATOM   2276  C  CB  . GLN A 1 11 ? 9.526   7.251   -11.754 1.00 0.00 ? 11 GLN A CB  4  
ATOM   2277  C  CG  . GLN A 1 11 ? 10.642  6.855   -10.731 1.00 0.00 ? 11 GLN A CG  4  
ATOM   2278  C  CD  . GLN A 1 11 ? 11.941  6.227   -11.248 1.00 0.00 ? 11 GLN A CD  4  
ATOM   2279  O  OE1 . GLN A 1 11 ? 12.227  5.068   -10.993 1.00 0.00 ? 11 GLN A OE1 4  
ATOM   2280  N  NE2 . GLN A 1 11 ? 12.753  6.928   -11.997 1.00 0.00 ? 11 GLN A NE2 4  
ATOM   2281  N  N   . ARG A 1 12 ? 7.273   6.937   -9.329  1.00 0.00 ? 12 ARG A N   4  
ATOM   2282  C  CA  . ARG A 1 12 ? 6.811   6.588   -7.992  1.00 0.00 ? 12 ARG A CA  4  
ATOM   2283  C  C   . ARG A 1 12 ? 6.062   5.276   -7.968  1.00 0.00 ? 12 ARG A C   4  
ATOM   2284  O  O   . ARG A 1 12 ? 6.468   4.226   -7.423  1.00 0.00 ? 12 ARG A O   4  
ATOM   2285  C  CB  . ARG A 1 12 ? 5.860   7.737   -7.512  1.00 0.00 ? 12 ARG A CB  4  
ATOM   2286  C  CG  . ARG A 1 12 ? 6.528   8.839   -6.657  1.00 0.00 ? 12 ARG A CG  4  
ATOM   2287  C  CD  . ARG A 1 12 ? 7.841   9.356   -7.261  1.00 0.00 ? 12 ARG A CD  4  
ATOM   2288  N  NE  . ARG A 1 12 ? 8.927   9.133   -6.276  1.00 0.00 ? 12 ARG A NE  4  
ATOM   2289  C  CZ  . ARG A 1 12 ? 9.902   8.240   -6.364  1.00 0.00 ? 12 ARG A CZ  4  
ATOM   2290  N  NH1 . ARG A 1 12 ? 10.048  7.405   -7.349  1.00 0.00 ? 12 ARG A NH1 4  
ATOM   2291  N  NH2 . ARG A 1 12 ? 10.762  8.200   -5.405  1.00 0.00 ? 12 ARG A NH2 4  
ATOM   2292  N  N   . TRP A 1 13 ? 4.722   5.321   -8.624  1.00 0.00 ? 13 TRP A N   4  
ATOM   2293  C  CA  . TRP A 1 13 ? 3.807   4.191   -8.512  1.00 0.00 ? 13 TRP A CA  4  
ATOM   2294  C  C   . TRP A 1 13 ? 4.308   3.040   -9.354  1.00 0.00 ? 13 TRP A C   4  
ATOM   2295  O  O   . TRP A 1 13 ? 3.883   1.888   -9.198  1.00 0.00 ? 13 TRP A O   4  
ATOM   2296  C  CB  . TRP A 1 13 ? 2.372   4.619   -8.935  1.00 0.00 ? 13 TRP A CB  4  
ATOM   2297  C  CG  . TRP A 1 13 ? 1.506   3.364   -9.170  1.00 0.00 ? 13 TRP A CG  4  
ATOM   2298  C  CD1 . TRP A 1 13 ? 1.212   2.792   -10.422 1.00 0.00 ? 13 TRP A CD1 4  
ATOM   2299  C  CD2 . TRP A 1 13 ? 0.977   2.523   -8.218  1.00 0.00 ? 13 TRP A CD2 4  
ATOM   2300  N  NE1 . TRP A 1 13 ? 0.490   1.590   -10.274 1.00 0.00 ? 13 TRP A NE1 4  
ATOM   2301  C  CE2 . TRP A 1 13 ? 0.362   1.442   -8.899  1.00 0.00 ? 13 TRP A CE2 4  
ATOM   2302  C  CE3 . TRP A 1 13 ? 0.998   2.574   -6.799  1.00 0.00 ? 13 TRP A CE3 4  
ATOM   2303  C  CZ2 . TRP A 1 13 ? -0.245  0.406   -8.156  1.00 0.00 ? 13 TRP A CZ2 4  
ATOM   2304  C  CZ3 . TRP A 1 13 ? 0.377   1.547   -6.091  1.00 0.00 ? 13 TRP A CZ3 4  
ATOM   2305  C  CH2 . TRP A 1 13 ? -0.239  0.478   -6.759  1.00 0.00 ? 13 TRP A CH2 4  
ATOM   2306  N  N   . GLN A 1 14 ? 5.304   3.377   -10.399 1.00 0.00 ? 14 GLN A N   4  
ATOM   2307  C  CA  . GLN A 1 14 ? 6.019   2.326   -11.128 1.00 0.00 ? 14 GLN A CA  4  
ATOM   2308  C  C   . GLN A 1 14 ? 6.874   1.548   -10.144 1.00 0.00 ? 14 GLN A C   4  
ATOM   2309  O  O   . GLN A 1 14 ? 7.035   0.325   -10.232 1.00 0.00 ? 14 GLN A O   4  
ATOM   2310  C  CB  . GLN A 1 14 ? 6.871   2.935   -12.255 1.00 0.00 ? 14 GLN A CB  4  
ATOM   2311  C  CG  . GLN A 1 14 ? 7.219   1.986   -13.454 1.00 0.00 ? 14 GLN A CG  4  
ATOM   2312  C  CD  . GLN A 1 14 ? 7.611   0.530   -13.178 1.00 0.00 ? 14 GLN A CD  4  
ATOM   2313  O  OE1 . GLN A 1 14 ? 6.766   -0.317  -12.937 1.00 0.00 ? 14 GLN A OE1 4  
ATOM   2314  N  NE2 . GLN A 1 14 ? 8.870   0.174   -13.211 1.00 0.00 ? 14 GLN A NE2 4  
ATOM   2315  N  N   . SER A 1 15 ? 7.536   2.364   -9.092  1.00 0.00 ? 15 SER A N   4  
ATOM   2316  C  CA  . SER A 1 15 ? 8.207   1.722   -7.963  1.00 0.00 ? 15 SER A CA  4  
ATOM   2317  C  C   . SER A 1 15 ? 7.315   0.608   -7.439  1.00 0.00 ? 15 SER A C   4  
ATOM   2318  O  O   . SER A 1 15 ? 7.756   -0.533  -7.258  1.00 0.00 ? 15 SER A O   4  
ATOM   2319  C  CB  . SER A 1 15 ? 8.611   2.702   -6.838  1.00 0.00 ? 15 SER A CB  4  
ATOM   2320  O  OG  . SER A 1 15 ? 9.200   3.911   -7.333  1.00 0.00 ? 15 SER A OG  4  
ATOM   2321  N  N   . VAL A 1 16 ? 5.885   0.975   -7.219  1.00 0.00 ? 16 VAL A N   4  
ATOM   2322  C  CA  . VAL A 1 16 ? 4.945   -0.053  -6.755  1.00 0.00 ? 16 VAL A CA  4  
ATOM   2323  C  C   . VAL A 1 16 ? 4.774   -1.186  -7.735  1.00 0.00 ? 16 VAL A C   4  
ATOM   2324  O  O   . VAL A 1 16 ? 5.031   -2.385  -7.418  1.00 0.00 ? 16 VAL A O   4  
ATOM   2325  C  CB  . VAL A 1 16 ? 3.590   0.565   -6.249  1.00 0.00 ? 16 VAL A CB  4  
ATOM   2326  C  CG1 . VAL A 1 16 ? 2.877   -0.216  -5.097  1.00 0.00 ? 16 VAL A CG1 4  
ATOM   2327  C  CG2 . VAL A 1 16 ? 3.718   2.015   -5.716  1.00 0.00 ? 16 VAL A CG2 4  
ATOM   2328  N  N   . LEU A 1 17 ? 4.251   -0.893  -9.084  1.00 0.00 ? 17 LEU A N   4  
ATOM   2329  C  CA  . LEU A 1 17 ? 3.898   -1.954  -10.049 1.00 0.00 ? 17 LEU A CA  4  
ATOM   2330  C  C   . LEU A 1 17 ? 4.998   -2.983  -10.114 1.00 0.00 ? 17 LEU A C   4  
ATOM   2331  O  O   . LEU A 1 17 ? 4.800   -4.203  -10.060 1.00 0.00 ? 17 LEU A O   4  
ATOM   2332  C  CB  . LEU A 1 17 ? 3.644   -1.350  -11.460 1.00 0.00 ? 17 LEU A CB  4  
ATOM   2333  C  CG  . LEU A 1 17 ? 2.315   -0.577  -11.685 1.00 0.00 ? 17 LEU A CG  4  
ATOM   2334  C  CD1 . LEU A 1 17 ? 2.042   -0.421  -13.186 1.00 0.00 ? 17 LEU A CD1 4  
ATOM   2335  C  CD2 . LEU A 1 17 ? 1.114   -1.258  -11.010 1.00 0.00 ? 17 LEU A CD2 4  
ATOM   2336  N  N   . ALA A 1 18 ? 6.366   -2.425  -10.288 1.00 0.00 ? 18 ALA A N   4  
ATOM   2337  C  CA  . ALA A 1 18 ? 7.536   -3.245  -10.564 1.00 0.00 ? 18 ALA A CA  4  
ATOM   2338  C  C   . ALA A 1 18 ? 7.787   -4.318  -9.534  1.00 0.00 ? 18 ALA A C   4  
ATOM   2339  O  O   . ALA A 1 18 ? 7.424   -5.491  -9.712  1.00 0.00 ? 18 ALA A O   4  
ATOM   2340  C  CB  . ALA A 1 18 ? 8.745   -2.296  -10.727 1.00 0.00 ? 18 ALA A CB  4  
ATOM   2341  N  N   . ARG A 1 19 ? 8.507   -3.905  -8.310  1.00 0.00 ? 19 ARG A N   4  
ATOM   2342  C  CA  . ARG A 1 19 ? 8.997   -4.874  -7.335  1.00 0.00 ? 19 ARG A CA  4  
ATOM   2343  C  C   . ARG A 1 19 ? 9.665   -4.170  -6.176  1.00 0.00 ? 19 ARG A C   4  
ATOM   2344  O  O   . ARG A 1 19 ? 10.606  -4.680  -5.553  1.00 0.00 ? 19 ARG A O   4  
ATOM   2345  C  CB  . ARG A 1 19 ? 9.982   -5.842  -8.047  1.00 0.00 ? 19 ARG A CB  4  
ATOM   2346  C  CG  . ARG A 1 19 ? 10.295  -7.155  -7.282  1.00 0.00 ? 19 ARG A CG  4  
ATOM   2347  C  CD  . ARG A 1 19 ? 11.651  -7.756  -7.677  1.00 0.00 ? 19 ARG A CD  4  
ATOM   2348  N  NE  . ARG A 1 19 ? 12.721  -6.994  -6.984  1.00 0.00 ? 19 ARG A NE  4  
ATOM   2349  C  CZ  . ARG A 1 19 ? 13.949  -6.798  -7.444  1.00 0.00 ? 19 ARG A CZ  4  
ATOM   2350  N  NH1 . ARG A 1 19 ? 14.386  -7.248  -8.583  1.00 0.00 ? 19 ARG A NH1 4  
ATOM   2351  N  NH2 . ARG A 1 19 ? 14.756  -6.116  -6.711  1.00 0.00 ? 19 ARG A NH2 4  
ATOM   2352  N  N   . ASP A 1 20 ? 9.151   -2.818  -5.858  1.00 0.00 ? 20 ASP A N   4  
ATOM   2353  C  CA  . ASP A 1 20 ? 9.809   -1.943  -4.892  1.00 0.00 ? 20 ASP A CA  4  
ATOM   2354  C  C   . ASP A 1 20 ? 9.872   -2.594  -3.532  1.00 0.00 ? 20 ASP A C   4  
ATOM   2355  O  O   . ASP A 1 20 ? 8.871   -3.075  -2.987  1.00 0.00 ? 20 ASP A O   4  
ATOM   2356  C  CB  . ASP A 1 20 ? 9.109   -0.561  -4.854  1.00 0.00 ? 20 ASP A CB  4  
ATOM   2357  C  CG  . ASP A 1 20 ? 9.322   0.325   -3.620  1.00 0.00 ? 20 ASP A CG  4  
ATOM   2358  O  OD1 . ASP A 1 20 ? 10.116  0.065   -2.728  1.00 0.00 ? 20 ASP A OD1 4  
ATOM   2359  O  OD2 . ASP A 1 20 ? 8.541   1.451   -3.644  1.00 0.00 ? 20 ASP A OD2 4  
ATOM   2360  N  N   . PRO A 1 21 ? 11.208  -2.634  -2.901  1.00 0.00 ? 21 PRO A N   4  
ATOM   2361  C  CA  . PRO A 1 21 ? 11.536  -3.221  -1.525  1.00 0.00 ? 21 PRO A CA  4  
ATOM   2362  C  C   . PRO A 1 21 ? 10.749  -2.603  -0.387  1.00 0.00 ? 21 PRO A C   4  
ATOM   2363  O  O   . PRO A 1 21 ? 9.666   -3.088  -0.019  1.00 0.00 ? 21 PRO A O   4  
ATOM   2364  C  CB  . PRO A 1 21 ? 13.020  -3.005  -1.281  1.00 0.00 ? 21 PRO A CB  4  
ATOM   2365  C  CG  . PRO A 1 21 ? 13.358  -1.845  -2.230  1.00 0.00 ? 21 PRO A CG  4  
ATOM   2366  C  CD  . PRO A 1 21 ? 12.480  -2.118  -3.459  1.00 0.00 ? 21 PRO A CD  4  
ATOM   2367  N  N   . ASN A 1 22 ? 11.316  -1.398  0.251   1.00 0.00 ? 22 ASN A N   4  
ATOM   2368  C  CA  . ASN A 1 22 ? 10.657  -0.742  1.376   1.00 0.00 ? 22 ASN A CA  4  
ATOM   2369  C  C   . ASN A 1 22 ? 9.715   0.320   0.846   1.00 0.00 ? 22 ASN A C   4  
ATOM   2370  O  O   . ASN A 1 22 ? 8.494   0.160   0.737   1.00 0.00 ? 22 ASN A O   4  
ATOM   2371  C  CB  . ASN A 1 22 ? 11.730  -0.075  2.285   1.00 0.00 ? 22 ASN A CB  4  
ATOM   2372  C  CG  . ASN A 1 22 ? 11.248  1.038   3.222   1.00 0.00 ? 22 ASN A CG  4  
ATOM   2373  O  OD1 . ASN A 1 22 ? 10.271  0.907   3.944   1.00 0.00 ? 22 ASN A OD1 4  
ATOM   2374  N  ND2 . ASN A 1 22 ? 11.894  2.172   3.234   1.00 0.00 ? 22 ASN A ND2 4  
ATOM   2375  N  N   . ALA A 1 23 ? 10.383  1.575   0.419   1.00 0.00 ? 23 ALA A N   4  
ATOM   2376  C  CA  . ALA A 1 23 ? 9.704   2.648   -0.295  1.00 0.00 ? 23 ALA A CA  4  
ATOM   2377  C  C   . ALA A 1 23 ? 10.721  3.531   -0.995  1.00 0.00 ? 23 ALA A C   4  
ATOM   2378  O  O   . ALA A 1 23 ? 11.272  4.470   -0.406  1.00 0.00 ? 23 ALA A O   4  
ATOM   2379  C  CB  . ALA A 1 23 ? 8.840   3.409   0.723   1.00 0.00 ? 23 ALA A CB  4  
ATOM   2380  N  N   . ASP A 1 24 ? 11.030  3.168   -2.393  1.00 0.00 ? 24 ASP A N   4  
ATOM   2381  C  CA  . ASP A 1 24 ? 12.109  3.801   -3.147  1.00 0.00 ? 24 ASP A CA  4  
ATOM   2382  C  C   . ASP A 1 24 ? 12.224  5.287   -2.851  1.00 0.00 ? 24 ASP A C   4  
ATOM   2383  O  O   . ASP A 1 24 ? 11.279  6.082   -2.794  1.00 0.00 ? 24 ASP A O   4  
ATOM   2384  C  CB  . ASP A 1 24 ? 11.926  3.538   -4.665  1.00 0.00 ? 24 ASP A CB  4  
ATOM   2385  C  CG  . ASP A 1 24 ? 12.400  2.175   -5.190  1.00 0.00 ? 24 ASP A CG  4  
ATOM   2386  O  OD1 . ASP A 1 24 ? 12.352  1.151   -4.523  1.00 0.00 ? 24 ASP A OD1 4  
ATOM   2387  O  OD2 . ASP A 1 24 ? 12.854  2.231   -6.478  1.00 0.00 ? 24 ASP A OD2 4  
ATOM   2388  N  N   . GLY A 1 25 ? 13.609  5.747   -2.544  1.00 0.00 ? 25 GLY A N   4  
ATOM   2389  C  CA  . GLY A 1 25 ? 13.969  7.139   -2.248  1.00 0.00 ? 25 GLY A CA  4  
ATOM   2390  C  C   . GLY A 1 25 ? 13.741  7.355   -0.754  1.00 0.00 ? 25 GLY A C   4  
ATOM   2391  O  O   . GLY A 1 25 ? 14.597  7.078   0.094   1.00 0.00 ? 25 GLY A O   4  
ATOM   2392  N  N   . GLU A 1 26 ? 12.408  7.879   -0.404  1.00 0.00 ? 26 GLU A N   4  
ATOM   2393  C  CA  . GLU A 1 26 ? 11.916  7.923   0.969   1.00 0.00 ? 26 GLU A CA  4  
ATOM   2394  C  C   . GLU A 1 26 ? 10.411  8.046   0.971   1.00 0.00 ? 26 GLU A C   4  
ATOM   2395  O  O   . GLU A 1 26 ? 9.799   8.497   1.948   1.00 0.00 ? 26 GLU A O   4  
ATOM   2396  C  CB  . GLU A 1 26 ? 12.620  9.108   1.692   1.00 0.00 ? 26 GLU A CB  4  
ATOM   2397  C  CG  . GLU A 1 26 ? 12.119  9.520   3.114   1.00 0.00 ? 26 GLU A CG  4  
ATOM   2398  C  CD  . GLU A 1 26 ? 13.011  10.439  3.957   1.00 0.00 ? 26 GLU A CD  4  
ATOM   2399  O  OE1 . GLU A 1 26 ? 14.206  9.879   4.296   1.00 0.00 ? 26 GLU A OE1 4  
ATOM   2400  O  OE2 . GLU A 1 26 ? 12.677  11.568  4.290   1.00 0.00 ? 26 GLU A OE2 4  
ATOM   2401  N  N   . PHE A 1 27 ? 9.693   7.550   -0.254  1.00 0.00 ? 27 PHE A N   4  
ATOM   2402  C  CA  . PHE A 1 27 ? 8.272   7.836   -0.420  1.00 0.00 ? 27 PHE A CA  4  
ATOM   2403  C  C   . PHE A 1 27 ? 7.331   6.942   0.344   1.00 0.00 ? 27 PHE A C   4  
ATOM   2404  O  O   . PHE A 1 27 ? 7.676   5.872   0.861   1.00 0.00 ? 27 PHE A O   4  
ATOM   2405  C  CB  . PHE A 1 27 ? 7.825   7.947   -1.905  1.00 0.00 ? 27 PHE A CB  4  
ATOM   2406  C  CG  . PHE A 1 27 ? 7.593   6.680   -2.742  1.00 0.00 ? 27 PHE A CG  4  
ATOM   2407  C  CD1 . PHE A 1 27 ? 8.686   5.936   -3.191  1.00 0.00 ? 27 PHE A CD1 4  
ATOM   2408  C  CD2 . PHE A 1 27 ? 6.299   6.271   -3.094  1.00 0.00 ? 27 PHE A CD2 4  
ATOM   2409  C  CE1 . PHE A 1 27 ? 8.497   4.800   -3.972  1.00 0.00 ? 27 PHE A CE1 4  
ATOM   2410  C  CE2 . PHE A 1 27 ? 6.109   5.135   -3.875  1.00 0.00 ? 27 PHE A CE2 4  
ATOM   2411  C  CZ  . PHE A 1 27 ? 7.206   4.401   -4.318  1.00 0.00 ? 27 PHE A CZ  4  
ATOM   2412  N  N   . VAL A 1 28 ? 5.939   7.440   0.494   1.00 0.00 ? 28 VAL A N   4  
ATOM   2413  C  CA  . VAL A 1 28 ? 4.853   6.720   1.160   1.00 0.00 ? 28 VAL A CA  4  
ATOM   2414  C  C   . VAL A 1 28 ? 3.575   6.873   0.349   1.00 0.00 ? 28 VAL A C   4  
ATOM   2415  O  O   . VAL A 1 28 ? 3.433   7.872   -0.402  1.00 0.00 ? 28 VAL A O   4  
ATOM   2416  C  CB  . VAL A 1 28 ? 4.643   7.302   2.610   1.00 0.00 ? 28 VAL A CB  4  
ATOM   2417  C  CG1 . VAL A 1 28 ? 5.928   7.606   3.432   1.00 0.00 ? 28 VAL A CG1 4  
ATOM   2418  C  CG2 . VAL A 1 28 ? 3.826   8.625   2.633   1.00 0.00 ? 28 VAL A CG2 4  
ATOM   2419  N  N   . PHE A 1 29 ? 2.489   5.880   0.475   1.00 0.00 ? 29 PHE A N   4  
ATOM   2420  C  CA  . PHE A 1 29 ? 1.278   5.935   -0.355  1.00 0.00 ? 29 PHE A CA  4  
ATOM   2421  C  C   . PHE A 1 29 ? 0.055   5.721   0.505   1.00 0.00 ? 29 PHE A C   4  
ATOM   2422  O  O   . PHE A 1 29 ? 0.075   4.944   1.476   1.00 0.00 ? 29 PHE A O   4  
ATOM   2423  C  CB  . PHE A 1 29 ? 1.324   4.847   -1.466  1.00 0.00 ? 29 PHE A CB  4  
ATOM   2424  C  CG  . PHE A 1 29 ? 1.234   3.385   -1.001  1.00 0.00 ? 29 PHE A CG  4  
ATOM   2425  C  CD1 . PHE A 1 29 ? 1.690   3.015   0.268   1.00 0.00 ? 29 PHE A CD1 4  
ATOM   2426  C  CD2 . PHE A 1 29 ? 0.700   2.411   -1.852  1.00 0.00 ? 29 PHE A CD2 4  
ATOM   2427  C  CE1 . PHE A 1 29 ? 1.606   1.689   0.680   1.00 0.00 ? 29 PHE A CE1 4  
ATOM   2428  C  CE2 . PHE A 1 29 ? 0.608   1.088   -1.435  1.00 0.00 ? 29 PHE A CE2 4  
ATOM   2429  C  CZ  . PHE A 1 29 ? 1.061   0.726   -0.168  1.00 0.00 ? 29 PHE A CZ  4  
ATOM   2430  N  N   . ALA A 1 30 ? -1.152  6.505   0.170   1.00 0.00 ? 30 ALA A N   4  
ATOM   2431  C  CA  . ALA A 1 30 ? -2.352  6.465   1.002   1.00 0.00 ? 30 ALA A CA  4  
ATOM   2432  C  C   . ALA A 1 30 ? -3.539  5.969   0.210   1.00 0.00 ? 30 ALA A C   4  
ATOM   2433  O  O   . ALA A 1 30 ? -4.157  6.714   -0.568  1.00 0.00 ? 30 ALA A O   4  
ATOM   2434  C  CB  . ALA A 1 30 ? -2.567  7.873   1.580   1.00 0.00 ? 30 ALA A CB  4  
ATOM   2435  N  N   . VAL A 1 31 ? -3.926  4.556   0.405   1.00 0.00 ? 31 VAL A N   4  
ATOM   2436  C  CA  . VAL A 1 31 ? -5.108  3.989   -0.246  1.00 0.00 ? 31 VAL A CA  4  
ATOM   2437  C  C   . VAL A 1 31 ? -6.314  4.116   0.654   1.00 0.00 ? 31 VAL A C   4  
ATOM   2438  O  O   . VAL A 1 31 ? -6.486  3.368   1.626   1.00 0.00 ? 31 VAL A O   4  
ATOM   2439  C  CB  . VAL A 1 31 ? -4.837  2.495   -0.672  1.00 0.00 ? 31 VAL A CB  4  
ATOM   2440  C  CG1 . VAL A 1 31 ? -3.791  1.704   0.164   1.00 0.00 ? 31 VAL A CG1 4  
ATOM   2441  C  CG2 . VAL A 1 31 ? -6.097  1.594   -0.683  1.00 0.00 ? 31 VAL A CG2 4  
ATOM   2442  N  N   . ARG A 1 32 ? -7.284  5.175   0.298   1.00 0.00 ? 32 ARG A N   4  
ATOM   2443  C  CA  . ARG A 1 32 ? -8.391  5.544   1.176   1.00 0.00 ? 32 ARG A CA  4  
ATOM   2444  C  C   . ARG A 1 32 ? -9.600  4.654   1.027   1.00 0.00 ? 32 ARG A C   4  
ATOM   2445  O  O   . ARG A 1 32 ? -10.744 5.077   1.292   1.00 0.00 ? 32 ARG A O   4  
ATOM   2446  C  CB  . ARG A 1 32 ? -8.756  7.034   0.902   1.00 0.00 ? 32 ARG A CB  4  
ATOM   2447  C  CG  . ARG A 1 32 ? -9.515  7.750   2.050   1.00 0.00 ? 32 ARG A CG  4  
ATOM   2448  C  CD  . ARG A 1 32 ? -10.126 9.085   1.604   1.00 0.00 ? 32 ARG A CD  4  
ATOM   2449  N  NE  . ARG A 1 32 ? -11.226 9.434   2.538   1.00 0.00 ? 32 ARG A NE  4  
ATOM   2450  C  CZ  . ARG A 1 32 ? -11.803 10.624  2.637   1.00 0.00 ? 32 ARG A CZ  4  
ATOM   2451  N  NH1 . ARG A 1 32 ? -11.477 11.660  1.922   1.00 0.00 ? 32 ARG A NH1 4  
ATOM   2452  N  NH2 . ARG A 1 32 ? -12.748 10.755  3.499   1.00 0.00 ? 32 ARG A NH2 4  
ATOM   2453  N  N   . THR A 1 33 ? -9.381  3.258   0.594   1.00 0.00 ? 33 THR A N   4  
ATOM   2454  C  CA  . THR A 1 33 ? -10.478 2.294   0.513   1.00 0.00 ? 33 THR A CA  4  
ATOM   2455  C  C   . THR A 1 33 ? -10.548 1.456   1.768   1.00 0.00 ? 33 THR A C   4  
ATOM   2456  O  O   . THR A 1 33 ? -11.627 1.161   2.299   1.00 0.00 ? 33 THR A O   4  
ATOM   2457  C  CB  . THR A 1 33 ? -10.325 1.389   -0.754  1.00 0.00 ? 33 THR A CB  4  
ATOM   2458  O  OG1 . THR A 1 33 ? -11.392 0.451   -0.828  1.00 0.00 ? 33 THR A OG1 4  
ATOM   2459  C  CG2 . THR A 1 33 ? -9.047  0.525   -0.829  1.00 0.00 ? 33 THR A CG2 4  
ATOM   2460  N  N   . THR A 1 34 ? -9.252  0.998   2.319   1.00 0.00 ? 34 THR A N   4  
ATOM   2461  C  CA  . THR A 1 34 ? -9.148  0.328   3.610   1.00 0.00 ? 34 THR A CA  4  
ATOM   2462  C  C   . THR A 1 34 ? -8.659  1.279   4.677   1.00 0.00 ? 34 THR A C   4  
ATOM   2463  O  O   . THR A 1 34 ? -8.597  0.931   5.868   1.00 0.00 ? 34 THR A O   4  
ATOM   2464  C  CB  . THR A 1 34 ? -8.208  -0.921  3.511   1.00 0.00 ? 34 THR A CB  4  
ATOM   2465  O  OG1 . THR A 1 34 ? -8.702  -1.842  2.548   1.00 0.00 ? 34 THR A OG1 4  
ATOM   2466  C  CG2 . THR A 1 34 ? -8.044  -1.757  4.799   1.00 0.00 ? 34 THR A CG2 4  
ATOM   2467  N  N   . GLY A 1 35 ? -8.267  2.638   4.247   1.00 0.00 ? 35 GLY A N   4  
ATOM   2468  C  CA  . GLY A 1 35 ? -7.922  3.680   5.213   1.00 0.00 ? 35 GLY A CA  4  
ATOM   2469  C  C   . GLY A 1 35 ? -6.574  3.412   5.836   1.00 0.00 ? 35 GLY A C   4  
ATOM   2470  O  O   . GLY A 1 35 ? -6.431  3.319   7.065   1.00 0.00 ? 35 GLY A O   4  
ATOM   2471  N  N   . ILE A 1 36 ? -5.434  3.229   4.907   1.00 0.00 ? 36 ILE A N   4  
ATOM   2472  C  CA  . ILE A 1 36 ? -4.068  3.076   5.395   1.00 0.00 ? 36 ILE A CA  4  
ATOM   2473  C  C   . ILE A 1 36 ? -3.076  3.900   4.609   1.00 0.00 ? 36 ILE A C   4  
ATOM   2474  O  O   . ILE A 1 36 ? -3.031  3.882   3.369   1.00 0.00 ? 36 ILE A O   4  
ATOM   2475  C  CB  . ILE A 1 36 ? -3.648  1.549   5.463   1.00 0.00 ? 36 ILE A CB  4  
ATOM   2476  C  CG1 . ILE A 1 36 ? -3.526  0.834   4.079   1.00 0.00 ? 36 ILE A CG1 4  
ATOM   2477  C  CG2 . ILE A 1 36 ? -4.601  0.703   6.363   1.00 0.00 ? 36 ILE A CG2 4  
ATOM   2478  C  CD1 . ILE A 1 36 ? -2.201  0.089   3.820   1.00 0.00 ? 36 ILE A CD1 4  
ATOM   2479  N  N   . PHE A 1 37 ? -2.180  4.767   5.406   1.00 0.00 ? 37 PHE A N   4  
ATOM   2480  C  CA  . PHE A 1 37 ? -1.038  5.484   4.825   1.00 0.00 ? 37 PHE A CA  4  
ATOM   2481  C  C   . PHE A 1 37 ? 0.236   4.793   5.267   1.00 0.00 ? 37 PHE A C   4  
ATOM   2482  O  O   . PHE A 1 37 ? 0.486   4.682   6.495   1.00 0.00 ? 37 PHE A O   4  
ATOM   2483  C  CB  . PHE A 1 37 ? -0.972  6.969   5.289   1.00 0.00 ? 37 PHE A CB  4  
ATOM   2484  C  CG  . PHE A 1 37 ? -0.024  7.319   6.450   1.00 0.00 ? 37 PHE A CG  4  
ATOM   2485  C  CD1 . PHE A 1 37 ? 1.367   7.338   6.261   1.00 0.00 ? 37 PHE A CD1 4  
ATOM   2486  C  CD2 . PHE A 1 37 ? -0.545  7.554   7.726   1.00 0.00 ? 37 PHE A CD2 4  
ATOM   2487  C  CE1 . PHE A 1 37 ? 2.216   7.589   7.334   1.00 0.00 ? 37 PHE A CE1 4  
ATOM   2488  C  CE2 . PHE A 1 37 ? 0.307   7.801   8.798   1.00 0.00 ? 37 PHE A CE2 4  
ATOM   2489  C  CZ  . PHE A 1 37 ? 1.686   7.819   8.601   1.00 0.00 ? 37 PHE A CZ  4  
ATOM   2490  N  N   . CYS A 1 38 ? 1.130   4.202   4.256   1.00 0.00 ? 38 CYS A N   4  
ATOM   2491  C  CA  . CYS A 1 38 ? 2.315   3.425   4.645   1.00 0.00 ? 38 CYS A CA  4  
ATOM   2492  C  C   . CYS A 1 38 ? 3.297   3.356   3.505   1.00 0.00 ? 38 CYS A C   4  
ATOM   2493  O  O   . CYS A 1 38 ? 3.289   4.200   2.590   1.00 0.00 ? 38 CYS A O   4  
ATOM   2494  C  CB  . CYS A 1 38 ? 1.825   2.044   5.116   1.00 0.00 ? 38 CYS A CB  4  
ATOM   2495  S  SG  . CYS A 1 38 ? 1.323   0.981   3.751   1.00 0.00 ? 38 CYS A SG  4  
ATOM   2496  N  N   . ARG A 1 39 ? 4.288   2.262   3.547   1.00 0.00 ? 39 ARG A N   4  
ATOM   2497  C  CA  . ARG A 1 39 ? 5.165   1.996   2.399   1.00 0.00 ? 39 ARG A CA  4  
ATOM   2498  C  C   . ARG A 1 39 ? 4.560   0.929   1.524   1.00 0.00 ? 39 ARG A C   4  
ATOM   2499  O  O   . ARG A 1 39 ? 3.665   0.175   1.946   1.00 0.00 ? 39 ARG A O   4  
ATOM   2500  C  CB  . ARG A 1 39 ? 6.573   1.611   2.921   1.00 0.00 ? 39 ARG A CB  4  
ATOM   2501  C  CG  . ARG A 1 39 ? 7.094   2.470   4.105   1.00 0.00 ? 39 ARG A CG  4  
ATOM   2502  C  CD  . ARG A 1 39 ? 7.524   3.877   3.671   1.00 0.00 ? 39 ARG A CD  4  
ATOM   2503  N  NE  . ARG A 1 39 ? 7.639   4.728   4.883   1.00 0.00 ? 39 ARG A NE  4  
ATOM   2504  C  CZ  . ARG A 1 39 ? 8.763   5.012   5.527   1.00 0.00 ? 39 ARG A CZ  4  
ATOM   2505  N  NH1 . ARG A 1 39 ? 9.937   4.571   5.185   1.00 0.00 ? 39 ARG A NH1 4  
ATOM   2506  N  NH2 . ARG A 1 39 ? 8.679   5.776   6.559   1.00 0.00 ? 39 ARG A NH2 4  
ATOM   2507  N  N   . PRO A 1 40 ? 5.053   0.833   0.136   1.00 0.00 ? 40 PRO A N   4  
ATOM   2508  C  CA  . PRO A 1 40 ? 4.611   -0.134  -0.965  1.00 0.00 ? 40 PRO A CA  4  
ATOM   2509  C  C   . PRO A 1 40 ? 3.981   -1.455  -0.593  1.00 0.00 ? 40 PRO A C   4  
ATOM   2510  O  O   . PRO A 1 40 ? 4.103   -1.981  0.520   1.00 0.00 ? 40 PRO A O   4  
ATOM   2511  C  CB  . PRO A 1 40 ? 5.899   -0.417  -1.752  1.00 0.00 ? 40 PRO A CB  4  
ATOM   2512  C  CG  . PRO A 1 40 ? 6.541   0.977   -1.760  1.00 0.00 ? 40 PRO A CG  4  
ATOM   2513  C  CD  . PRO A 1 40 ? 6.107   1.687   -0.477  1.00 0.00 ? 40 PRO A CD  4  
ATOM   2514  N  N   . SER A 1 41 ? 3.230   -2.138  -1.676  1.00 0.00 ? 41 SER A N   4  
ATOM   2515  C  CA  . SER A 1 41 ? 2.392   -3.320  -1.539  1.00 0.00 ? 41 SER A CA  4  
ATOM   2516  C  C   . SER A 1 41 ? 2.247   -3.919  -0.166  1.00 0.00 ? 41 SER A C   4  
ATOM   2517  O  O   . SER A 1 41 ? 3.195   -4.439  0.438   1.00 0.00 ? 41 SER A O   4  
ATOM   2518  C  CB  . SER A 1 41 ? 2.849   -4.410  -2.564  1.00 0.00 ? 41 SER A CB  4  
ATOM   2519  O  OG  . SER A 1 41 ? 4.016   -5.114  -2.138  1.00 0.00 ? 41 SER A OG  4  
ATOM   2520  N  N   . CYS A 1 42 ? 0.876   -3.922  0.417   1.00 0.00 ? 42 CYS A N   4  
ATOM   2521  C  CA  . CYS A 1 42 ? 0.561   -4.482  1.722   1.00 0.00 ? 42 CYS A CA  4  
ATOM   2522  C  C   . CYS A 1 42 ? 0.127   -5.936  1.648   1.00 0.00 ? 42 CYS A C   4  
ATOM   2523  O  O   . CYS A 1 42 ? -0.205  -6.491  0.595   1.00 0.00 ? 42 CYS A O   4  
ATOM   2524  C  CB  . CYS A 1 42 ? -0.518  -3.607  2.400   1.00 0.00 ? 42 CYS A CB  4  
ATOM   2525  S  SG  . CYS A 1 42 ? -0.042  -1.869  2.407   1.00 0.00 ? 42 CYS A SG  4  
ATOM   2526  N  N   . ARG A 1 43 ? 0.176   -6.665  2.934   1.00 0.00 ? 43 ARG A N   4  
ATOM   2527  C  CA  . ARG A 1 43 ? -0.357  -7.997  3.184   1.00 0.00 ? 43 ARG A CA  4  
ATOM   2528  C  C   . ARG A 1 43 ? -1.134  -8.577  2.036   1.00 0.00 ? 43 ARG A C   4  
ATOM   2529  O  O   . ARG A 1 43 ? -0.822  -9.662  1.513   1.00 0.00 ? 43 ARG A O   4  
ATOM   2530  C  CB  . ARG A 1 43 ? -1.273  -7.897  4.456   1.00 0.00 ? 43 ARG A CB  4  
ATOM   2531  C  CG  . ARG A 1 43 ? -2.231  -6.681  4.441   1.00 0.00 ? 43 ARG A CG  4  
ATOM   2532  C  CD  . ARG A 1 43 ? -3.615  -6.993  5.023   1.00 0.00 ? 43 ARG A CD  4  
ATOM   2533  N  NE  . ARG A 1 43 ? -4.597  -6.053  4.423   1.00 0.00 ? 43 ARG A NE  4  
ATOM   2534  C  CZ  . ARG A 1 43 ? -5.866  -5.927  4.788   1.00 0.00 ? 43 ARG A CZ  4  
ATOM   2535  N  NH1 . ARG A 1 43 ? -6.431  -6.623  5.730   1.00 0.00 ? 43 ARG A NH1 4  
ATOM   2536  N  NH2 . ARG A 1 43 ? -6.580  -5.058  4.165   1.00 0.00 ? 43 ARG A NH2 4  
ATOM   2537  N  N   . ALA A 1 44 ? -2.315  -7.816  1.579   1.00 0.00 ? 44 ALA A N   4  
ATOM   2538  C  CA  . ALA A 1 44 ? -3.288  -8.335  0.633   1.00 0.00 ? 44 ALA A CA  4  
ATOM   2539  C  C   . ALA A 1 44 ? -2.805  -8.275  -0.801  1.00 0.00 ? 44 ALA A C   4  
ATOM   2540  O  O   . ALA A 1 44 ? -1.658  -7.956  -1.132  1.00 0.00 ? 44 ALA A O   4  
ATOM   2541  C  CB  . ALA A 1 44 ? -4.594  -7.524  0.831   1.00 0.00 ? 44 ALA A CB  4  
ATOM   2542  N  N   . ARG A 1 45 ? -3.826  -8.675  -1.809  1.00 0.00 ? 45 ARG A N   4  
ATOM   2543  C  CA  . ARG A 1 45 ? -3.626  -8.530  -3.247  1.00 0.00 ? 45 ARG A CA  4  
ATOM   2544  C  C   . ARG A 1 45 ? -2.971  -7.207  -3.570  1.00 0.00 ? 45 ARG A C   4  
ATOM   2545  O  O   . ARG A 1 45 ? -2.389  -7.014  -4.646  1.00 0.00 ? 45 ARG A O   4  
ATOM   2546  C  CB  . ARG A 1 45 ? -5.000  -8.691  -3.957  1.00 0.00 ? 45 ARG A CB  4  
ATOM   2547  C  CG  . ARG A 1 45 ? -5.117  -8.087  -5.379  1.00 0.00 ? 45 ARG A CG  4  
ATOM   2548  C  CD  . ARG A 1 45 ? -5.942  -8.974  -6.326  1.00 0.00 ? 45 ARG A CD  4  
ATOM   2549  N  NE  . ARG A 1 45 ? -5.100  -10.130 -6.725  1.00 0.00 ? 45 ARG A NE  4  
ATOM   2550  C  CZ  . ARG A 1 45 ? -5.115  -10.725 -7.910  1.00 0.00 ? 45 ARG A CZ  4  
ATOM   2551  N  NH1 . ARG A 1 45 ? -5.886  -10.375 -8.897  1.00 0.00 ? 45 ARG A NH1 4  
ATOM   2552  N  NH2 . ARG A 1 45 ? -4.311  -11.712 -8.089  1.00 0.00 ? 45 ARG A NH2 4  
ATOM   2553  N  N   . HIS A 1 46 ? -3.098  -6.147  -2.548  1.00 0.00 ? 46 HIS A N   4  
ATOM   2554  C  CA  . HIS A 1 46 ? -2.389  -4.873  -2.609  1.00 0.00 ? 46 HIS A CA  4  
ATOM   2555  C  C   . HIS A 1 46 ? -3.194  -3.848  -3.371  1.00 0.00 ? 46 HIS A C   4  
ATOM   2556  O  O   . HIS A 1 46 ? -3.290  -3.864  -4.605  1.00 0.00 ? 46 HIS A O   4  
ATOM   2557  C  CB  . HIS A 1 46 ? -1.022  -5.125  -3.260  1.00 0.00 ? 46 HIS A CB  4  
ATOM   2558  C  CG  . HIS A 1 46 ? -0.559  -3.983  -4.117  1.00 0.00 ? 46 HIS A CG  4  
ATOM   2559  N  ND1 . HIS A 1 46 ? -0.376  -4.023  -5.498  1.00 0.00 ? 46 HIS A ND1 4  
ATOM   2560  C  CD2 . HIS A 1 46 ? -0.257  -2.731  -3.601  1.00 0.00 ? 46 HIS A CD2 4  
ATOM   2561  C  CE1 . HIS A 1 46 ? 0.036   -2.760  -5.712  1.00 0.00 ? 46 HIS A CE1 4  
ATOM   2562  N  NE2 . HIS A 1 46 ? 0.133   -1.926  -4.641  1.00 0.00 ? 46 HIS A NE2 4  
ATOM   2563  N  N   . ALA A 1 47 ? -3.904  -2.840  -2.547  1.00 0.00 ? 47 ALA A N   4  
ATOM   2564  C  CA  . ALA A 1 47 ? -4.852  -1.892  -3.123  1.00 0.00 ? 47 ALA A CA  4  
ATOM   2565  C  C   . ALA A 1 47 ? -4.289  -1.259  -4.375  1.00 0.00 ? 47 ALA A C   4  
ATOM   2566  O  O   . ALA A 1 47 ? -3.072  -1.101  -4.539  1.00 0.00 ? 47 ALA A O   4  
ATOM   2567  C  CB  . ALA A 1 47 ? -5.203  -0.861  -2.038  1.00 0.00 ? 47 ALA A CB  4  
ATOM   2568  N  N   . LEU A 1 48 ? -5.278  -0.874  -5.407  1.00 0.00 ? 48 LEU A N   4  
ATOM   2569  C  CA  . LEU A 1 48 ? -4.881  -0.295  -6.687  1.00 0.00 ? 48 LEU A CA  4  
ATOM   2570  C  C   . LEU A 1 48 ? -4.430  1.136   -6.515  1.00 0.00 ? 48 LEU A C   4  
ATOM   2571  O  O   . LEU A 1 48 ? -4.550  1.733   -5.434  1.00 0.00 ? 48 LEU A O   4  
ATOM   2572  C  CB  . LEU A 1 48 ? -6.041  -0.410  -7.716  1.00 0.00 ? 48 LEU A CB  4  
ATOM   2573  C  CG  . LEU A 1 48 ? -7.264  -1.295  -7.346  1.00 0.00 ? 48 LEU A CG  4  
ATOM   2574  C  CD1 . LEU A 1 48 ? -8.230  -0.521  -6.439  1.00 0.00 ? 48 LEU A CD1 4  
ATOM   2575  C  CD2 . LEU A 1 48 ? -8.019  -1.809  -8.584  1.00 0.00 ? 48 LEU A CD2 4  
ATOM   2576  N  N   . ARG A 1 49 ? -3.873  1.801   -7.713  1.00 0.00 ? 49 ARG A N   4  
ATOM   2577  C  CA  . ARG A 1 49 ? -3.520  3.217   -7.731  1.00 0.00 ? 49 ARG A CA  4  
ATOM   2578  C  C   . ARG A 1 49 ? -4.722  4.088   -8.004  1.00 0.00 ? 49 ARG A C   4  
ATOM   2579  O  O   . ARG A 1 49 ? -4.603  5.307   -8.214  1.00 0.00 ? 49 ARG A O   4  
ATOM   2580  C  CB  . ARG A 1 49 ? -2.420  3.438   -8.813  1.00 0.00 ? 49 ARG A CB  4  
ATOM   2581  C  CG  . ARG A 1 49 ? -2.844  3.051   -10.253 1.00 0.00 ? 49 ARG A CG  4  
ATOM   2582  C  CD  . ARG A 1 49 ? -2.541  4.152   -11.278 1.00 0.00 ? 49 ARG A CD  4  
ATOM   2583  N  NE  . ARG A 1 49 ? -3.080  3.724   -12.594 1.00 0.00 ? 49 ARG A NE  4  
ATOM   2584  C  CZ  . ARG A 1 49 ? -3.478  4.536   -13.564 1.00 0.00 ? 49 ARG A CZ  4  
ATOM   2585  N  NH1 . ARG A 1 49 ? -3.453  5.834   -13.491 1.00 0.00 ? 49 ARG A NH1 4  
ATOM   2586  N  NH2 . ARG A 1 49 ? -3.917  3.998   -14.646 1.00 0.00 ? 49 ARG A NH2 4  
ATOM   2587  N  N   . GLU A 1 50 ? -6.048  3.432   -7.994  1.00 0.00 ? 50 GLU A N   4  
ATOM   2588  C  CA  . GLU A 1 50 ? -7.262  4.101   -8.438  1.00 0.00 ? 50 GLU A CA  4  
ATOM   2589  C  C   . GLU A 1 50 ? -7.950  4.889   -7.350  1.00 0.00 ? 50 GLU A C   4  
ATOM   2590  O  O   . GLU A 1 50 ? -8.869  5.692   -7.648  1.00 0.00 ? 50 GLU A O   4  
ATOM   2591  C  CB  . GLU A 1 50 ? -8.225  3.031   -9.034  1.00 0.00 ? 50 GLU A CB  4  
ATOM   2592  C  CG  . GLU A 1 50 ? -8.519  1.765   -8.165  1.00 0.00 ? 50 GLU A CG  4  
ATOM   2593  C  CD  . GLU A 1 50 ? -9.965  1.495   -7.741  1.00 0.00 ? 50 GLU A CD  4  
ATOM   2594  O  OE1 . GLU A 1 50 ? -10.809 1.040   -8.502  1.00 0.00 ? 50 GLU A OE1 4  
ATOM   2595  O  OE2 . GLU A 1 50 ? -10.222 1.807   -6.440  1.00 0.00 ? 50 GLU A OE2 4  
ATOM   2596  N  N   . ASN A 1 51 ? -7.511  4.729   -5.956  1.00 0.00 ? 51 ASN A N   4  
ATOM   2597  C  CA  . ASN A 1 51 ? -8.030  5.598   -4.873  1.00 0.00 ? 51 ASN A CA  4  
ATOM   2598  C  C   . ASN A 1 51 ? -6.867  5.950   -3.974  1.00 0.00 ? 51 ASN A C   4  
ATOM   2599  O  O   . ASN A 1 51 ? -6.969  6.339   -2.804  1.00 0.00 ? 51 ASN A O   4  
ATOM   2600  C  CB  . ASN A 1 51 ? -9.104  4.798   -4.093  1.00 0.00 ? 51 ASN A CB  4  
ATOM   2601  C  CG  . ASN A 1 51 ? -8.749  4.271   -2.698  1.00 0.00 ? 51 ASN A CG  4  
ATOM   2602  O  OD1 . ASN A 1 51 ? -9.088  4.851   -1.678  1.00 0.00 ? 51 ASN A OD1 4  
ATOM   2603  N  ND2 . ASN A 1 51 ? -8.050  3.173   -2.601  1.00 0.00 ? 51 ASN A ND2 4  
ATOM   2604  N  N   . VAL A 1 52 ? -5.526  5.803   -4.620  1.00 0.00 ? 52 VAL A N   4  
ATOM   2605  C  CA  . VAL A 1 52 ? -4.282  5.782   -3.856  1.00 0.00 ? 52 VAL A CA  4  
ATOM   2606  C  C   . VAL A 1 52 ? -3.626  7.136   -3.885  1.00 0.00 ? 52 VAL A C   4  
ATOM   2607  O  O   . VAL A 1 52 ? -3.714  7.856   -4.911  1.00 0.00 ? 52 VAL A O   4  
ATOM   2608  C  CB  . VAL A 1 52 ? -3.325  4.652   -4.426  1.00 0.00 ? 52 VAL A CB  4  
ATOM   2609  C  CG1 . VAL A 1 52 ? -2.058  5.126   -5.186  1.00 0.00 ? 52 VAL A CG1 4  
ATOM   2610  C  CG2 . VAL A 1 52 ? -2.814  3.659   -3.349  1.00 0.00 ? 52 VAL A CG2 4  
ATOM   2611  N  N   . SER A 1 53 ? -2.915  7.621   -2.685  1.00 0.00 ? 53 SER A N   4  
ATOM   2612  C  CA  . SER A 1 53 ? -2.185  8.888   -2.677  1.00 0.00 ? 53 SER A CA  4  
ATOM   2613  C  C   . SER A 1 53 ? -0.698  8.650   -2.571  1.00 0.00 ? 53 SER A C   4  
ATOM   2614  O  O   . SER A 1 53 ? -0.223  7.508   -2.494  1.00 0.00 ? 53 SER A O   4  
ATOM   2615  C  CB  . SER A 1 53 ? -2.707  9.834   -1.569  1.00 0.00 ? 53 SER A CB  4  
ATOM   2616  O  OG  . SER A 1 53 ? -2.408  11.211  -1.829  1.00 0.00 ? 53 SER A OG  4  
ATOM   2617  N  N   . PHE A 1 54 ? 0.167   9.853   -2.609  1.00 0.00 ? 54 PHE A N   4  
ATOM   2618  C  CA  . PHE A 1 54 ? 1.621   9.747   -2.595  1.00 0.00 ? 54 PHE A CA  4  
ATOM   2619  C  C   . PHE A 1 54 ? 2.286   10.912  -1.901  1.00 0.00 ? 54 PHE A C   4  
ATOM   2620  O  O   . PHE A 1 54 ? 1.869   12.074  -1.998  1.00 0.00 ? 54 PHE A O   4  
ATOM   2621  C  CB  . PHE A 1 54 ? 2.173   9.644   -4.048  1.00 0.00 ? 54 PHE A CB  4  
ATOM   2622  C  CG  . PHE A 1 54 ? 2.386   8.221   -4.587  1.00 0.00 ? 54 PHE A CG  4  
ATOM   2623  C  CD1 . PHE A 1 54 ? 1.289   7.475   -5.032  1.00 0.00 ? 54 PHE A CD1 4  
ATOM   2624  C  CD2 . PHE A 1 54 ? 3.663   7.656   -4.621  1.00 0.00 ? 54 PHE A CD2 4  
ATOM   2625  C  CE1 . PHE A 1 54 ? 1.468   6.182   -5.512  1.00 0.00 ? 54 PHE A CE1 4  
ATOM   2626  C  CE2 . PHE A 1 54 ? 3.840   6.361   -5.101  1.00 0.00 ? 54 PHE A CE2 4  
ATOM   2627  C  CZ  . PHE A 1 54 ? 2.744   5.624   -5.547  1.00 0.00 ? 54 PHE A CZ  4  
ATOM   2628  N  N   . TYR A 1 55 ? 3.460   10.571  -1.069  1.00 0.00 ? 55 TYR A N   4  
ATOM   2629  C  CA  . TYR A 1 55 ? 4.160   11.544  -0.228  1.00 0.00 ? 55 TYR A CA  4  
ATOM   2630  C  C   . TYR A 1 55 ? 5.638   11.219  -0.195  1.00 0.00 ? 55 TYR A C   4  
ATOM   2631  O  O   . TYR A 1 55 ? 6.044   10.070  -0.472  1.00 0.00 ? 55 TYR A O   4  
ATOM   2632  C  CB  . TYR A 1 55 ? 3.609   11.464  1.225   1.00 0.00 ? 55 TYR A CB  4  
ATOM   2633  C  CG  . TYR A 1 55 ? 2.101   11.159  1.350   1.00 0.00 ? 55 TYR A CG  4  
ATOM   2634  C  CD1 . TYR A 1 55 ? 1.211   12.222  1.073   1.00 0.00 ? 55 TYR A CD1 4  
ATOM   2635  C  CD2 . TYR A 1 55 ? 1.581   9.923   1.725   1.00 0.00 ? 55 TYR A CD2 4  
ATOM   2636  C  CE1 . TYR A 1 55 ? -0.162  12.030  1.175   1.00 0.00 ? 55 TYR A CE1 4  
ATOM   2637  C  CE2 . TYR A 1 55 ? 0.206   9.737   1.828   1.00 0.00 ? 55 TYR A CE2 4  
ATOM   2638  C  CZ  . TYR A 1 55 ? -0.664  10.788  1.554   1.00 0.00 ? 55 TYR A CZ  4  
ATOM   2639  O  OH  . TYR A 1 55 ? -2.013  10.602  1.661   1.00 0.00 ? 55 TYR A OH  4  
ATOM   2640  N  N   . ALA A 1 56 ? 6.604   12.291  0.128   1.00 0.00 ? 56 ALA A N   4  
ATOM   2641  C  CA  . ALA A 1 56 ? 8.048   12.067  0.178   1.00 0.00 ? 56 ALA A CA  4  
ATOM   2642  C  C   . ALA A 1 56 ? 8.474   11.546  1.530   1.00 0.00 ? 56 ALA A C   4  
ATOM   2643  O  O   . ALA A 1 56 ? 9.639   11.168  1.738   1.00 0.00 ? 56 ALA A O   4  
ATOM   2644  C  CB  . ALA A 1 56 ? 8.735   13.393  -0.193  1.00 0.00 ? 56 ALA A CB  4  
ATOM   2645  N  N   . ASN A 1 57 ? 7.457   11.550  2.603   1.00 0.00 ? 57 ASN A N   4  
ATOM   2646  C  CA  . ASN A 1 57 ? 7.693   10.911  3.897   1.00 0.00 ? 57 ASN A CA  4  
ATOM   2647  C  C   . ASN A 1 57 ? 6.390   10.676  4.625   1.00 0.00 ? 57 ASN A C   4  
ATOM   2648  O  O   . ASN A 1 57 ? 5.352   11.277  4.315   1.00 0.00 ? 57 ASN A O   4  
ATOM   2649  C  CB  . ASN A 1 57 ? 8.654   11.790  4.749   1.00 0.00 ? 57 ASN A CB  4  
ATOM   2650  C  CG  . ASN A 1 57 ? 8.895   11.351  6.197   1.00 0.00 ? 57 ASN A CG  4  
ATOM   2651  O  OD1 . ASN A 1 57 ? 8.595   12.052  7.152   1.00 0.00 ? 57 ASN A OD1 4  
ATOM   2652  N  ND2 . ASN A 1 57 ? 9.427   10.179  6.417   1.00 0.00 ? 57 ASN A ND2 4  
ATOM   2653  N  N   . ALA A 1 58 ? 6.412   9.662   5.702   1.00 0.00 ? 58 ALA A N   4  
ATOM   2654  C  CA  . ALA A 1 58 ? 5.232   9.369   6.509   1.00 0.00 ? 58 ALA A CA  4  
ATOM   2655  C  C   . ALA A 1 58 ? 4.742   10.602  7.231   1.00 0.00 ? 58 ALA A C   4  
ATOM   2656  O  O   . ALA A 1 58 ? 3.543   10.762  7.504   1.00 0.00 ? 58 ALA A O   4  
ATOM   2657  C  CB  . ALA A 1 58 ? 5.588   8.220   7.468   1.00 0.00 ? 58 ALA A CB  4  
ATOM   2658  N  N   . SER A 1 59 ? 5.768   11.591  7.630   1.00 0.00 ? 59 SER A N   4  
ATOM   2659  C  CA  . SER A 1 59 ? 5.433   12.771  8.423   1.00 0.00 ? 59 SER A CA  4  
ATOM   2660  C  C   . SER A 1 59 ? 4.346   13.578  7.753   1.00 0.00 ? 59 SER A C   4  
ATOM   2661  O  O   . SER A 1 59 ? 3.570   14.293  8.402   1.00 0.00 ? 59 SER A O   4  
ATOM   2662  C  CB  . SER A 1 59 ? 6.690   13.630  8.704   1.00 0.00 ? 59 SER A CB  4  
ATOM   2663  O  OG  . SER A 1 59 ? 6.543   14.473  9.853   1.00 0.00 ? 59 SER A OG  4  
ATOM   2664  N  N   . GLU A 1 60 ? 4.282   13.491  6.277   1.00 0.00 ? 60 GLU A N   4  
ATOM   2665  C  CA  . GLU A 1 60 ? 3.206   14.110  5.510   1.00 0.00 ? 60 GLU A CA  4  
ATOM   2666  C  C   . GLU A 1 60 ? 1.891   13.400  5.734   1.00 0.00 ? 60 GLU A C   4  
ATOM   2667  O  O   . GLU A 1 60 ? 0.909   13.987  6.209   1.00 0.00 ? 60 GLU A O   4  
ATOM   2668  C  CB  . GLU A 1 60 ? 3.597   14.104  4.005   1.00 0.00 ? 60 GLU A CB  4  
ATOM   2669  C  CG  . GLU A 1 60 ? 2.430   14.111  2.964   1.00 0.00 ? 60 GLU A CG  4  
ATOM   2670  C  CD  . GLU A 1 60 ? 2.228   15.363  2.105   1.00 0.00 ? 60 GLU A CD  4  
ATOM   2671  O  OE1 . GLU A 1 60 ? 3.146   15.931  1.530   1.00 0.00 ? 60 GLU A OE1 4  
ATOM   2672  O  OE2 . GLU A 1 60 ? 0.933   15.781  2.042   1.00 0.00 ? 60 GLU A OE2 4  
ATOM   2673  N  N   . ALA A 1 61 ? 1.821   11.981  5.318   1.00 0.00 ? 61 ALA A N   4  
ATOM   2674  C  CA  . ALA A 1 61 ? 0.574   11.227  5.369   1.00 0.00 ? 61 ALA A CA  4  
ATOM   2675  C  C   . ALA A 1 61 ? -0.073  11.254  6.733   1.00 0.00 ? 61 ALA A C   4  
ATOM   2676  O  O   . ALA A 1 61 ? -1.293  11.001  6.859   1.00 0.00 ? 61 ALA A O   4  
ATOM   2677  C  CB  . ALA A 1 61 ? 0.865   9.803   4.865   1.00 0.00 ? 61 ALA A CB  4  
ATOM   2678  N  N   . LEU A 1 62 ? 0.765   11.548  7.914   1.00 0.00 ? 62 LEU A N   4  
ATOM   2679  C  CA  . LEU A 1 62 ? 0.179   11.762  9.239   1.00 0.00 ? 62 LEU A CA  4  
ATOM   2680  C  C   . LEU A 1 62 ? -0.338  13.175  9.372   1.00 0.00 ? 62 LEU A C   4  
ATOM   2681  O  O   . LEU A 1 62 ? -1.420  13.419  9.931   1.00 0.00 ? 62 LEU A O   4  
ATOM   2682  C  CB  . LEU A 1 62 ? 1.187   11.417  10.368  1.00 0.00 ? 62 LEU A CB  4  
ATOM   2683  C  CG  . LEU A 1 62 ? 2.616   12.021  10.308  1.00 0.00 ? 62 LEU A CG  4  
ATOM   2684  C  CD1 . LEU A 1 62 ? 2.670   13.330  11.108  1.00 0.00 ? 62 LEU A CD1 4  
ATOM   2685  C  CD2 . LEU A 1 62 ? 3.691   11.052  10.828  1.00 0.00 ? 62 LEU A CD2 4  
ATOM   2686  N  N   . ALA A 1 63 ? 0.524   14.257  8.851   1.00 0.00 ? 63 ALA A N   4  
ATOM   2687  C  CA  . ALA A 1 63 ? 0.051   15.639  8.753   1.00 0.00 ? 63 ALA A CA  4  
ATOM   2688  C  C   . ALA A 1 63 ? -1.267  15.697  8.018   1.00 0.00 ? 63 ALA A C   4  
ATOM   2689  O  O   . ALA A 1 63 ? -2.097  16.592  8.231   1.00 0.00 ? 63 ALA A O   4  
ATOM   2690  C  CB  . ALA A 1 63 ? 1.152   16.474  8.079   1.00 0.00 ? 63 ALA A CB  4  
ATOM   2691  N  N   . ALA A 1 64 ? -1.528  14.602  7.055   1.00 0.00 ? 64 ALA A N   4  
ATOM   2692  C  CA  . ALA A 1 64 ? -2.826  14.435  6.408   1.00 0.00 ? 64 ALA A CA  4  
ATOM   2693  C  C   . ALA A 1 64 ? -3.848  13.980  7.437   1.00 0.00 ? 64 ALA A C   4  
ATOM   2694  O  O   . ALA A 1 64 ? -5.009  14.404  7.465   1.00 0.00 ? 64 ALA A O   4  
ATOM   2695  C  CB  . ALA A 1 64 ? -2.653  13.430  5.260   1.00 0.00 ? 64 ALA A CB  4  
ATOM   2696  N  N   . GLY A 1 65 ? -3.344  12.973  8.402   1.00 0.00 ? 65 GLY A N   4  
ATOM   2697  C  CA  . GLY A 1 65 ? -4.128  12.530  9.552   1.00 0.00 ? 65 GLY A CA  4  
ATOM   2698  C  C   . GLY A 1 65 ? -4.599  11.102  9.314   1.00 0.00 ? 65 GLY A C   4  
ATOM   2699  O  O   . GLY A 1 65 ? -5.726  10.708  9.635   1.00 0.00 ? 65 GLY A O   4  
ATOM   2700  N  N   . PHE A 1 66 ? -3.614  10.233  8.630   1.00 0.00 ? 66 PHE A N   4  
ATOM   2701  C  CA  . PHE A 1 66 ? -3.950  8.902   8.143   1.00 0.00 ? 66 PHE A CA  4  
ATOM   2702  C  C   . PHE A 1 66 ? -3.334  7.814   8.984   1.00 0.00 ? 66 PHE A C   4  
ATOM   2703  O  O   . PHE A 1 66 ? -2.676  8.087   10.009  1.00 0.00 ? 66 PHE A O   4  
ATOM   2704  C  CB  . PHE A 1 66 ? -3.490  8.763   6.657   1.00 0.00 ? 66 PHE A CB  4  
ATOM   2705  C  CG  . PHE A 1 66 ? -4.290  7.760   5.812   1.00 0.00 ? 66 PHE A CG  4  
ATOM   2706  C  CD1 . PHE A 1 66 ? -5.575  7.387   6.238   1.00 0.00 ? 66 PHE A CD1 4  
ATOM   2707  C  CD2 . PHE A 1 66 ? -3.763  7.210   4.643   1.00 0.00 ? 66 PHE A CD2 4  
ATOM   2708  C  CE1 . PHE A 1 66 ? -6.314  6.467   5.504   1.00 0.00 ? 66 PHE A CE1 4  
ATOM   2709  C  CE2 . PHE A 1 66 ? -4.507  6.290   3.908   1.00 0.00 ? 66 PHE A CE2 4  
ATOM   2710  C  CZ  . PHE A 1 66 ? -5.777  5.917   4.342   1.00 0.00 ? 66 PHE A CZ  4  
ATOM   2711  N  N   . ARG A 1 67 ? -3.552  6.411   8.571   1.00 0.00 ? 67 ARG A N   4  
ATOM   2712  C  CA  . ARG A 1 67 ? -3.164  5.285   9.431   1.00 0.00 ? 67 ARG A CA  4  
ATOM   2713  C  C   . ARG A 1 67 ? -1.853  4.657   9.031   1.00 0.00 ? 67 ARG A C   4  
ATOM   2714  O  O   . ARG A 1 67 ? -1.698  4.073   7.952   1.00 0.00 ? 67 ARG A O   4  
ATOM   2715  C  CB  . ARG A 1 67 ? -4.337  4.269   9.462   1.00 0.00 ? 67 ARG A CB  4  
ATOM   2716  C  CG  . ARG A 1 67 ? -3.967  2.774   9.278   1.00 0.00 ? 67 ARG A CG  4  
ATOM   2717  C  CD  . ARG A 1 67 ? -3.155  2.206   10.448  1.00 0.00 ? 67 ARG A CD  4  
ATOM   2718  N  NE  . ARG A 1 67 ? -3.547  0.786   10.639  1.00 0.00 ? 67 ARG A NE  4  
ATOM   2719  C  CZ  . ARG A 1 67 ? -2.989  -0.060  11.495  1.00 0.00 ? 67 ARG A CZ  4  
ATOM   2720  N  NH1 . ARG A 1 67 ? -2.012  0.246   12.297  1.00 0.00 ? 67 ARG A NH1 4  
ATOM   2721  N  NH2 . ARG A 1 67 ? -3.449  -1.261  11.528  1.00 0.00 ? 67 ARG A NH2 4  
ATOM   2722  N  N   . PRO A 1 68 ? -0.749  4.752   10.020  1.00 0.00 ? 68 PRO A N   4  
ATOM   2723  C  CA  . PRO A 1 68 ? 0.673   4.213   9.866   1.00 0.00 ? 68 PRO A CA  4  
ATOM   2724  C  C   . PRO A 1 68 ? 0.774   2.733   9.544   1.00 0.00 ? 68 PRO A C   4  
ATOM   2725  O  O   . PRO A 1 68 ? 0.264   1.893   10.317  1.00 0.00 ? 68 PRO A O   4  
ATOM   2726  C  CB  . PRO A 1 68 ? 1.367   4.431   11.214  1.00 0.00 ? 68 PRO A CB  4  
ATOM   2727  C  CG  . PRO A 1 68 ? 0.631   5.671   11.743  1.00 0.00 ? 68 PRO A CG  4  
ATOM   2728  C  CD  . PRO A 1 68 ? -0.828  5.407   11.350  1.00 0.00 ? 68 PRO A CD  4  
ATOM   2729  N  N   . CYS A 1 69 ? 1.455   2.305   8.306   1.00 0.00 ? 69 CYS A N   4  
ATOM   2730  C  CA  . CYS A 1 69 ? 1.766   0.884   8.011   1.00 0.00 ? 69 CYS A CA  4  
ATOM   2731  C  C   . CYS A 1 69 ? 3.207   0.784   7.583   1.00 0.00 ? 69 CYS A C   4  
ATOM   2732  O  O   . CYS A 1 69 ? 3.646   0.735   6.423   1.00 0.00 ? 69 CYS A O   4  
ATOM   2733  C  CB  . CYS A 1 69 ? 0.592   0.339   7.194   1.00 0.00 ? 69 CYS A CB  4  
ATOM   2734  S  SG  . CYS A 1 69 ? 0.803   -1.231  6.350   1.00 0.00 ? 69 CYS A SG  4  
ATOM   2735  N  N   . LYS A 1 70 ? 4.181   0.688   8.727   1.00 0.00 ? 70 LYS A N   4  
ATOM   2736  C  CA  . LYS A 1 70 ? 5.621   0.838   8.606   1.00 0.00 ? 70 LYS A CA  4  
ATOM   2737  C  C   . LYS A 1 70 ? 6.213   -0.052  7.542   1.00 0.00 ? 70 LYS A C   4  
ATOM   2738  O  O   . LYS A 1 70 ? 6.347   0.330   6.371   1.00 0.00 ? 70 LYS A O   4  
ATOM   2739  C  CB  . LYS A 1 70 ? 6.295   0.581   9.983   1.00 0.00 ? 70 LYS A CB  4  
ATOM   2740  C  CG  . LYS A 1 70 ? 5.558   -0.456  10.866  1.00 0.00 ? 70 LYS A CG  4  
ATOM   2741  C  CD  . LYS A 1 70 ? 6.465   -1.394  11.667  1.00 0.00 ? 70 LYS A CD  4  
ATOM   2742  C  CE  . LYS A 1 70 ? 6.433   -0.986  13.146  1.00 0.00 ? 70 LYS A CE  4  
ATOM   2743  N  NZ  . LYS A 1 70 ? 7.812   -0.799  13.632  1.00 0.00 ? 70 LYS A NZ  4  
ATOM   2744  N  N   . ARG A 1 71 ? 6.656   -1.392  7.993   1.00 0.00 ? 71 ARG A N   4  
ATOM   2745  C  CA  . ARG A 1 71 ? 7.083   -2.403  7.006   1.00 0.00 ? 71 ARG A CA  4  
ATOM   2746  C  C   . ARG A 1 71 ? 5.902   -2.646  6.082   1.00 0.00 ? 71 ARG A C   4  
ATOM   2747  O  O   . ARG A 1 71 ? 5.884   -2.282  4.901   1.00 0.00 ? 71 ARG A O   4  
ATOM   2748  C  CB  . ARG A 1 71 ? 7.546   -3.681  7.740   1.00 0.00 ? 71 ARG A CB  4  
ATOM   2749  C  CG  . ARG A 1 71 ? 9.081   -3.927  7.733   1.00 0.00 ? 71 ARG A CG  4  
ATOM   2750  C  CD  . ARG A 1 71 ? 9.455   -5.289  7.137   1.00 0.00 ? 71 ARG A CD  4  
ATOM   2751  N  NE  . ARG A 1 71 ? 10.619  -5.824  7.888   1.00 0.00 ? 71 ARG A NE  4  
ATOM   2752  C  CZ  . ARG A 1 71 ? 11.118  -7.047  7.767   1.00 0.00 ? 71 ARG A CZ  4  
ATOM   2753  N  NH1 . ARG A 1 71 ? 10.651  -7.953  6.960   1.00 0.00 ? 71 ARG A NH1 4  
ATOM   2754  N  NH2 . ARG A 1 71 ? 12.130  -7.350  8.501   1.00 0.00 ? 71 ARG A NH2 4  
ATOM   2755  N  N   . CYS A 1 72 ? 4.750   -3.321  6.716   1.00 0.00 ? 72 CYS A N   4  
ATOM   2756  C  CA  . CYS A 1 72 ? 3.431   -3.403  6.102   1.00 0.00 ? 72 CYS A CA  4  
ATOM   2757  C  C   . CYS A 1 72 ? 2.453   -4.093  7.040   1.00 0.00 ? 72 CYS A C   4  
ATOM   2758  O  O   . CYS A 1 72 ? 1.966   -5.209  6.824   1.00 0.00 ? 72 CYS A O   4  
ATOM   2759  C  CB  . CYS A 1 72 ? 3.498   -3.973  4.677   1.00 0.00 ? 72 CYS A CB  4  
ATOM   2760  S  SG  . CYS A 1 72 ? 3.146   -2.673  3.442   1.00 0.00 ? 72 CYS A SG  4  
ATOM   2761  N  N   . GLN A 1 73 ? 2.146   -3.339  8.274   1.00 0.00 ? 73 GLN A N   4  
ATOM   2762  C  CA  . GLN A 1 73 ? 1.386   -3.876  9.414   1.00 0.00 ? 73 GLN A CA  4  
ATOM   2763  C  C   . GLN A 1 73 ? 0.195   -4.709  9.042   1.00 0.00 ? 73 GLN A C   4  
ATOM   2764  O  O   . GLN A 1 73 ? -0.922  -4.210  8.834   1.00 0.00 ? 73 GLN A O   4  
ATOM   2765  C  CB  . GLN A 1 73 ? 0.931   -2.664  10.295  1.00 0.00 ? 73 GLN A CB  4  
ATOM   2766  C  CG  . GLN A 1 73 ? 0.857   -2.937  11.832  1.00 0.00 ? 73 GLN A CG  4  
ATOM   2767  C  CD  . GLN A 1 73 ? 2.105   -3.445  12.565  1.00 0.00 ? 73 GLN A CD  4  
ATOM   2768  O  OE1 . GLN A 1 73 ? 2.051   -4.417  13.302  1.00 0.00 ? 73 GLN A OE1 4  
ATOM   2769  N  NE2 . GLN A 1 73 ? 3.246   -2.819  12.425  1.00 0.00 ? 73 GLN A NE2 4  
ATOM   2770  N  N   . PRO A 1 74 ? 0.417   -6.168  8.966   1.00 0.00 ? 74 PRO A N   4  
ATOM   2771  C  CA  . PRO A 1 74 ? -0.614  -7.259  8.650   1.00 0.00 ? 74 PRO A CA  4  
ATOM   2772  C  C   . PRO A 1 74 ? -1.415  -7.696  9.871   1.00 0.00 ? 74 PRO A C   4  
ATOM   2773  O  O   . PRO A 1 74 ? -1.516  -6.949  10.858  1.00 0.00 ? 74 PRO A O   4  
ATOM   2774  C  CB  . PRO A 1 74 ? 0.154   -8.461  8.130   1.00 0.00 ? 74 PRO A CB  4  
ATOM   2775  C  CG  . PRO A 1 74 ? 1.635   -8.071  8.218   1.00 0.00 ? 74 PRO A CG  4  
ATOM   2776  C  CD  . PRO A 1 74 ? 1.701   -6.887  9.188   1.00 0.00 ? 74 PRO A CD  4  
ATOM   2777  N  N   . ASP A 1 75 ? -2.028  -9.040  9.848   1.00 0.00 ? 75 ASP A N   4  
ATOM   2778  C  CA  . ASP A 1 75 ? -2.657  -9.622  11.030  1.00 0.00 ? 75 ASP A CA  4  
ATOM   2779  C  C   . ASP A 1 75 ? -2.117  -11.009 11.298  1.00 0.00 ? 75 ASP A C   4  
ATOM   2780  O  O   . ASP A 1 75 ? -1.045  -11.185 11.893  1.00 0.00 ? 75 ASP A O   4  
ATOM   2781  C  CB  . ASP A 1 75 ? -4.201  -9.619  10.906  1.00 0.00 ? 75 ASP A CB  4  
ATOM   2782  C  CG  . ASP A 1 75 ? -4.990  -9.224  12.166  1.00 0.00 ? 75 ASP A CG  4  
ATOM   2783  O  OD1 . ASP A 1 75 ? -4.369  -8.250  12.896  1.00 0.00 ? 75 ASP A OD1 4  
ATOM   2784  O  OD2 . ASP A 1 75 ? -6.048  -9.750  12.481  1.00 0.00 ? 75 ASP A OD2 4  
ATOM   2785  N  N   . LYS A 1 76 ? -2.919  -12.137 10.778  1.00 0.00 ? 76 LYS A N   4  
ATOM   2786  C  CA  . LYS A 1 76 ? -2.520  -13.528 10.966  1.00 0.00 ? 76 LYS A CA  4  
ATOM   2787  C  C   . LYS A 1 76 ? -3.163  -14.414 9.922   1.00 0.00 ? 76 LYS A C   4  
ATOM   2788  O  O   . LYS A 1 76 ? -4.347  -14.268 9.591   1.00 0.00 ? 76 LYS A O   4  
ATOM   2789  C  CB  . LYS A 1 76 ? -2.904  -13.988 12.399  1.00 0.00 ? 76 LYS A CB  4  
ATOM   2790  C  CG  . LYS A 1 76 ? -2.148  -15.258 12.864  1.00 0.00 ? 76 LYS A CG  4  
ATOM   2791  C  CD  . LYS A 1 76 ? -2.885  -16.098 13.911  1.00 0.00 ? 76 LYS A CD  4  
ATOM   2792  C  CE  . LYS A 1 76 ? -1.872  -16.969 14.666  1.00 0.00 ? 76 LYS A CE  4  
ATOM   2793  N  NZ  . LYS A 1 76 ? -1.363  -16.227 15.833  1.00 0.00 ? 76 LYS A NZ  4  
ATOM   2794  N  N   . ALA A 1 77 ? -2.290  -15.424 9.291   1.00 0.00 ? 77 ALA A N   4  
ATOM   2795  C  CA  . ALA A 1 77 ? -2.769  -16.472 8.395   1.00 0.00 ? 77 ALA A CA  4  
ATOM   2796  C  C   . ALA A 1 77 ? -4.249  -16.740 8.515   1.00 0.00 ? 77 ALA A C   4  
ATOM   2797  O  O   . ALA A 1 77 ? -5.001  -16.706 7.530   1.00 0.00 ? 77 ALA A O   4  
ATOM   2798  C  CB  . ALA A 1 77 ? -1.920  -17.733 8.675   1.00 0.00 ? 77 ALA A CB  4  
ATOM   2799  N  N   . ASN A 1 78 ? -4.756  -17.007 9.880   1.00 0.00 ? 78 ASN A N   4  
ATOM   2800  C  CA  . ASN A 1 78 ? -6.179  -17.142 10.177  1.00 0.00 ? 78 ASN A CA  4  
ATOM   2801  C  C   . ASN A 1 78 ? -6.390  -17.694 11.567  1.00 0.00 ? 78 ASN A C   4  
ATOM   2802  O  O   . ASN A 1 78 ? -6.221  -18.892 11.828  1.00 0.00 ? 78 ASN A O   4  
ATOM   2803  C  CB  . ASN A 1 78 ? -6.851  -18.060 9.114   1.00 0.00 ? 78 ASN A CB  4  
ATOM   2804  C  CG  . ASN A 1 78 ? -7.754  -17.381 8.079   1.00 0.00 ? 78 ASN A CG  4  
ATOM   2805  O  OD1 . ASN A 1 78 ? -7.931  -16.172 8.058   1.00 0.00 ? 78 ASN A OD1 4  
ATOM   2806  N  ND2 . ASN A 1 78 ? -8.342  -18.121 7.179   1.00 0.00 ? 78 ASN A ND2 4  
ATOM   2807  N  N   . PRO A 1 79 ? -6.830  -16.723 12.589  1.00 0.00 ? 79 PRO A N   4  
ATOM   2808  C  CA  . PRO A 1 79 ? -7.111  -17.022 14.066  1.00 0.00 ? 79 PRO A CA  4  
ATOM   2809  C  C   . PRO A 1 79 ? -7.756  -18.363 14.333  1.00 0.00 ? 79 PRO A C   4  
ATOM   2810  O  O   . PRO A 1 79 ? -8.422  -18.947 13.466  1.00 0.00 ? 79 PRO A O   4  
ATOM   2811  C  CB  . PRO A 1 79 ? -8.066  -15.921 14.522  1.00 0.00 ? 79 PRO A CB  4  
ATOM   2812  C  CG  . PRO A 1 79 ? -7.492  -14.719 13.757  1.00 0.00 ? 79 PRO A CG  4  
ATOM   2813  C  CD  . PRO A 1 79 ? -7.088  -15.277 12.389  1.00 0.00 ? 79 PRO A CD  4  
ATOM   2814  N  N   . ARG A 1 80 ? -7.540  -18.947 15.675  1.00 0.00 ? 80 ARG A N   4  
ATOM   2815  C  CA  . ARG A 1 80 ? -8.050  -20.262 16.048  1.00 0.00 ? 80 ARG A CA  4  
ATOM   2816  C  C   . ARG A 1 80 ? -7.247  -21.366 15.400  1.00 0.00 ? 80 ARG A C   4  
ATOM   2817  O  O   . ARG A 1 80 ? -7.493  -21.764 14.253  1.00 0.00 ? 80 ARG A O   4  
ATOM   2818  C  CB  . ARG A 1 80 ? -9.552  -20.354 15.661  1.00 0.00 ? 80 ARG A CB  4  
ATOM   2819  C  CG  . ARG A 1 80 ? -10.372 -21.393 16.472  1.00 0.00 ? 80 ARG A CG  4  
ATOM   2820  C  CD  . ARG A 1 80 ? -11.845 -21.446 16.045  1.00 0.00 ? 80 ARG A CD  4  
ATOM   2821  N  NE  . ARG A 1 80 ? -12.570 -22.339 16.984  1.00 0.00 ? 80 ARG A NE  4  
ATOM   2822  C  CZ  . ARG A 1 80 ? -13.881 -22.340 17.188  1.00 0.00 ? 80 ARG A CZ  4  
ATOM   2823  N  NH1 . ARG A 1 80 ? -14.719 -21.552 16.582  1.00 0.00 ? 80 ARG A NH1 4  
ATOM   2824  N  NH2 . ARG A 1 80 ? -14.347 -23.179 18.044  1.00 0.00 ? 80 ARG A NH2 4  
ATOM   2825  N  N   . GLN A 1 81 ? -6.172  -21.963 16.222  1.00 0.00 ? 81 GLN A N   4  
ATOM   2826  C  CA  . GLN A 1 81 ? -5.428  -23.143 15.793  1.00 0.00 ? 81 GLN A CA  4  
ATOM   2827  C  C   . GLN A 1 81 ? -6.358  -24.226 15.300  1.00 0.00 ? 81 GLN A C   4  
ATOM   2828  O  O   . GLN A 1 81 ? -7.582  -24.167 15.479  1.00 0.00 ? 81 GLN A O   4  
ATOM   2829  C  CB  . GLN A 1 81 ? -4.574  -23.647 16.978  1.00 0.00 ? 81 GLN A CB  4  
ATOM   2830  C  CG  . GLN A 1 81 ? -5.315  -24.521 18.043  1.00 0.00 ? 81 GLN A CG  4  
ATOM   2831  C  CD  . GLN A 1 81 ? -5.865  -23.853 19.308  1.00 0.00 ? 81 GLN A CD  4  
ATOM   2832  O  OE1 . GLN A 1 81 ? -5.118  -23.455 20.188  1.00 0.00 ? 81 GLN A OE1 4  
ATOM   2833  N  NE2 . GLN A 1 81 ? -7.157  -23.707 19.462  1.00 0.00 ? 81 GLN A NE2 4  
ATOM   2834  N  N   . HIS A 1 82 ? -5.721  -25.379 14.626  1.00 0.00 ? 82 HIS A N   4  
ATOM   2835  C  CA  . HIS A 1 82 ? -6.480  -26.561 14.227  1.00 0.00 ? 82 HIS A CA  4  
ATOM   2836  C  C   . HIS A 1 82 ? -5.653  -27.815 14.391  1.00 0.00 ? 82 HIS A C   4  
ATOM   2837  O  O   . HIS A 1 82 ? -4.518  -27.915 13.905  1.00 0.00 ? 82 HIS A O   4  
ATOM   2838  C  CB  . HIS A 1 82 ? -6.853  -26.357 12.749  1.00 0.00 ? 82 HIS A CB  4  
ATOM   2839  C  CG  . HIS A 1 82 ? -5.823  -25.557 12.007  1.00 0.00 ? 82 HIS A CG  4  
ATOM   2840  N  ND1 . HIS A 1 82 ? -5.552  -24.204 12.194  1.00 0.00 ? 82 HIS A ND1 4  
ATOM   2841  C  CD2 . HIS A 1 82 ? -5.009  -26.108 11.027  1.00 0.00 ? 82 HIS A CD2 4  
ATOM   2842  C  CE1 . HIS A 1 82 ? -4.567  -24.040 11.290  1.00 0.00 ? 82 HIS A CE1 4  
ATOM   2843  N  NE2 . HIS A 1 82 ? -4.185  -25.119 10.555  1.00 0.00 ? 82 HIS A NE2 4  
ATOM   2844  N  N   . ARG A 1 83 ? -6.288  -28.928 15.130  1.00 0.00 ? 83 ARG A N   4  
ATOM   2845  C  CA  . ARG A 1 83 ? -5.571  -30.163 15.433  1.00 0.00 ? 83 ARG A CA  4  
ATOM   2846  C  C   . ARG A 1 83 ? -5.437  -31.027 14.202  1.00 0.00 ? 83 ARG A C   4  
ATOM   2847  O  O   . ARG A 1 83 ? -4.425  -31.712 13.993  1.00 0.00 ? 83 ARG A O   4  
ATOM   2848  C  CB  . ARG A 1 83 ? -6.316  -30.912 16.572  1.00 0.00 ? 83 ARG A CB  4  
ATOM   2849  C  CG  . ARG A 1 83 ? -5.589  -32.173 17.110  1.00 0.00 ? 83 ARG A CG  4  
ATOM   2850  C  CD  . ARG A 1 83 ? -5.609  -32.254 18.642  1.00 0.00 ? 83 ARG A CD  4  
ATOM   2851  N  NE  . ARG A 1 83 ? -4.349  -31.660 19.158  1.00 0.00 ? 83 ARG A NE  4  
ATOM   2852  C  CZ  . ARG A 1 83 ? -4.007  -31.572 20.436  1.00 0.00 ? 83 ARG A CZ  4  
ATOM   2853  N  NH1 . ARG A 1 83 ? -4.736  -32.002 21.423  1.00 0.00 ? 83 ARG A NH1 4  
ATOM   2854  N  NH2 . ARG A 1 83 ? -2.877  -31.022 20.711  1.00 0.00 ? 83 ARG A NH2 4  
ATOM   2855  N  N   . LEU A 1 84 ? -6.592  -31.038 13.279  1.00 0.00 ? 84 LEU A N   4  
ATOM   2856  C  CA  . LEU A 1 84 ? -6.667  -31.953 12.141  1.00 0.00 ? 84 LEU A CA  4  
ATOM   2857  C  C   . LEU A 1 84 ? -5.713  -31.528 11.049  1.00 0.00 ? 84 LEU A C   4  
ATOM   2858  O  O   . LEU A 1 84 ? -4.514  -31.294 11.309  1.00 0.00 ? 84 LEU A O   4  
ATOM   2859  C  CB  . LEU A 1 84 ? -8.130  -32.066 11.632  1.00 0.00 ? 84 LEU A CB  4  
ATOM   2860  C  CG  . LEU A 1 84 ? -8.620  -33.447 11.116  1.00 0.00 ? 84 LEU A CG  4  
ATOM   2861  C  CD1 . LEU A 1 84 ? -8.756  -34.428 12.289  1.00 0.00 ? 84 LEU A CD1 4  
ATOM   2862  C  CD2 . LEU A 1 84 ? -9.952  -33.360 10.354  1.00 0.00 ? 84 LEU A CD2 4  
ATOM   2863  N  N   . ASP A 1 85 ? -6.225  -31.436 9.666   1.00 0.00 ? 85 ASP A N   4  
ATOM   2864  C  CA  . ASP A 1 85 ? -5.408  -30.900 8.575   1.00 0.00 ? 85 ASP A CA  4  
ATOM   2865  C  C   . ASP A 1 85 ? -4.511  -31.972 8.005   1.00 0.00 ? 85 ASP A C   4  
ATOM   2866  O  O   . ASP A 1 85 ? -4.721  -33.176 8.213   1.00 0.00 ? 85 ASP A O   4  
ATOM   2867  C  CB  . ASP A 1 85 ? -4.609  -29.661 9.053   1.00 0.00 ? 85 ASP A CB  4  
ATOM   2868  C  CG  . ASP A 1 85 ? -4.507  -28.484 8.072   1.00 0.00 ? 85 ASP A CG  4  
ATOM   2869  O  OD1 . ASP A 1 85 ? -5.606  -28.367 7.268   1.00 0.00 ? 85 ASP A OD1 4  
ATOM   2870  O  OD2 . ASP A 1 85 ? -3.549  -27.726 8.039   1.00 0.00 ? 85 ASP A OD2 4  
ATOM   2871  N  N   . LYS A 1 86 ? -3.392  -31.513 7.153   1.00 0.00 ? 86 LYS A N   4  
ATOM   2872  C  CA  . LYS A 1 86 ? -2.385  -32.438 6.641   1.00 0.00 ? 86 LYS A CA  4  
ATOM   2873  C  C   . LYS A 1 86 ? -3.033  -33.597 5.920   1.00 0.00 ? 86 LYS A C   4  
ATOM   2874  O  O   . LYS A 1 86 ? -2.489  -34.707 5.850   1.00 0.00 ? 86 LYS A O   4  
ATOM   2875  C  CB  . LYS A 1 86 ? -1.500  -32.940 7.815   1.00 0.00 ? 86 LYS A CB  4  
ATOM   2876  C  CG  . LYS A 1 86 ? -0.046  -33.270 7.394   1.00 0.00 ? 86 LYS A CG  4  
ATOM   2877  C  CD  . LYS A 1 86 ? 0.737   -32.092 6.806   1.00 0.00 ? 86 LYS A CD  4  
ATOM   2878  C  CE  . LYS A 1 86 ? 1.517   -31.393 7.927   1.00 0.00 ? 86 LYS A CE  4  
ATOM   2879  N  NZ  . LYS A 1 86 ? 2.718   -30.752 7.362   1.00 0.00 ? 86 LYS A NZ  4  
ATOM   2880  N  N   . ILE A 1 87 ? -4.368  -33.342 5.337   1.00 0.00 ? 87 ILE A N   4  
ATOM   2881  C  CA  . ILE A 1 87 ? -5.110  -34.374 4.620   1.00 0.00 ? 87 ILE A CA  4  
ATOM   2882  C  C   . ILE A 1 87 ? -4.991  -34.186 3.126   1.00 0.00 ? 87 ILE A C   4  
ATOM   2883  O  O   . ILE A 1 87 ? -4.880  -35.149 2.354   1.00 0.00 ? 87 ILE A O   4  
ATOM   2884  C  CB  . ILE A 1 87 ? -6.621  -34.429 5.087   1.00 0.00 ? 87 ILE A CB  4  
ATOM   2885  C  CG1 . ILE A 1 87 ? -7.268  -35.851 5.038   1.00 0.00 ? 87 ILE A CG1 4  
ATOM   2886  C  CG2 . ILE A 1 87 ? -7.538  -33.452 4.288   1.00 0.00 ? 87 ILE A CG2 4  
ATOM   2887  C  CD1 . ILE A 1 87 ? -7.175  -36.586 3.685   1.00 0.00 ? 87 ILE A CD1 4  
ATOM   2888  N  N   . THR A 1 88 ? -5.051  -32.793 2.634   1.00 0.00 ? 88 THR A N   4  
ATOM   2889  C  CA  . THR A 1 88 ? -4.812  -32.455 1.234   1.00 0.00 ? 88 THR A CA  4  
ATOM   2890  C  C   . THR A 1 88 ? -3.506  -31.712 1.072   1.00 0.00 ? 88 THR A C   4  
ATOM   2891  O  O   . THR A 1 88 ? -2.933  -31.184 2.034   1.00 0.00 ? 88 THR A O   4  
ATOM   2892  C  CB  . THR A 1 88 ? -6.002  -31.613 0.660   1.00 0.00 ? 88 THR A CB  4  
ATOM   2893  O  OG1 . THR A 1 88 ? -6.710  -30.970 1.711   1.00 0.00 ? 88 THR A OG1 4  
ATOM   2894  C  CG2 . THR A 1 88 ? -7.085  -32.397 -0.113  1.00 0.00 ? 88 THR A CG2 4  
ATOM   2895  N  N   . HIS A 1 89 ? -2.959  -31.642 -0.300  1.00 0.00 ? 89 HIS A N   4  
ATOM   2896  C  CA  . HIS A 1 89 ? -1.696  -30.970 -0.597  1.00 0.00 ? 89 HIS A CA  4  
ATOM   2897  C  C   . HIS A 1 89 ? -1.934  -29.613 -1.214  1.00 0.00 ? 89 HIS A C   4  
ATOM   2898  O  O   . HIS A 1 89 ? -1.702  -28.565 -0.595  1.00 0.00 ? 89 HIS A O   4  
ATOM   2899  C  CB  . HIS A 1 89 ? -0.942  -31.882 -1.580  1.00 0.00 ? 89 HIS A CB  4  
ATOM   2900  C  CG  . HIS A 1 89 ? 0.409   -31.338 -1.941  1.00 0.00 ? 89 HIS A CG  4  
ATOM   2901  N  ND1 . HIS A 1 89 ? 0.725   -29.993 -2.115  1.00 0.00 ? 89 HIS A ND1 4  
ATOM   2902  C  CD2 . HIS A 1 89 ? 1.515   -32.151 -2.144  1.00 0.00 ? 89 HIS A CD2 4  
ATOM   2903  C  CE1 . HIS A 1 89 ? 2.033   -30.102 -2.418  1.00 0.00 ? 89 HIS A CE1 4  
ATOM   2904  N  NE2 . HIS A 1 89 ? 2.581   -31.346 -2.456  1.00 0.00 ? 89 HIS A NE2 4  
ATOM   2905  N  N   . ALA A 1 90 ? -2.436  -29.604 -2.605  1.00 0.00 ? 90 ALA A N   4  
ATOM   2906  C  CA  . ALA A 1 90 ? -2.631  -28.363 -3.349  1.00 0.00 ? 90 ALA A CA  4  
ATOM   2907  C  C   . ALA A 1 90 ? -3.951  -27.720 -2.994  1.00 0.00 ? 90 ALA A C   4  
ATOM   2908  O  O   . ALA A 1 90 ? -4.930  -28.393 -2.642  1.00 0.00 ? 90 ALA A O   4  
ATOM   2909  C  CB  . ALA A 1 90 ? -2.514  -28.695 -4.847  1.00 0.00 ? 90 ALA A CB  4  
ATOM   2910  N  N   . CYS A 1 91 ? -4.017  -26.248 -3.117  1.00 0.00 ? 91 CYS A N   4  
ATOM   2911  C  CA  . CYS A 1 91 ? -5.213  -25.494 -2.755  1.00 0.00 ? 91 CYS A CA  4  
ATOM   2912  C  C   . CYS A 1 91 ? -5.418  -24.323 -3.688  1.00 0.00 ? 91 CYS A C   4  
ATOM   2913  O  O   . CYS A 1 91 ? -4.545  -23.460 -3.853  1.00 0.00 ? 91 CYS A O   4  
ATOM   2914  C  CB  . CYS A 1 91 ? -5.091  -25.057 -1.282  1.00 0.00 ? 91 CYS A CB  4  
ATOM   2915  S  SG  . CYS A 1 91 ? -6.651  -25.315 -0.407  1.00 0.00 ? 91 CYS A SG  4  
ATOM   2916  N  N   . ARG A 1 92 ? -6.732  -24.247 -4.363  1.00 0.00 ? 92 ARG A N   4  
ATOM   2917  C  CA  . ARG A 1 92 ? -7.024  -23.242 -5.383  1.00 0.00 ? 92 ARG A CA  4  
ATOM   2918  C  C   . ARG A 1 92 ? -8.503  -22.936 -5.428  1.00 0.00 ? 92 ARG A C   4  
ATOM   2919  O  O   . ARG A 1 92 ? -9.328  -23.764 -5.809  1.00 0.00 ? 92 ARG A O   4  
ATOM   2920  C  CB  . ARG A 1 92 ? -6.509  -23.745 -6.758  1.00 0.00 ? 92 ARG A CB  4  
ATOM   2921  C  CG  . ARG A 1 92 ? -5.212  -24.595 -6.709  1.00 0.00 ? 92 ARG A CG  4  
ATOM   2922  C  CD  . ARG A 1 92 ? -3.949  -23.734 -6.578  1.00 0.00 ? 92 ARG A CD  4  
ATOM   2923  N  NE  . ARG A 1 92 ? -3.454  -23.421 -7.942  1.00 0.00 ? 92 ARG A NE  4  
ATOM   2924  C  CZ  . ARG A 1 92 ? -3.755  -22.335 -8.641  1.00 0.00 ? 92 ARG A CZ  4  
ATOM   2925  N  NH1 . ARG A 1 92 ? -4.536  -21.385 -8.218  1.00 0.00 ? 92 ARG A NH1 4  
ATOM   2926  N  NH2 . ARG A 1 92 ? -3.238  -22.220 -9.812  1.00 0.00 ? 92 ARG A NH2 4  
ATOM   2927  O  OXT . ARG A 1 92 ? -8.887  -21.631 -4.985  1.00 0.00 ? 92 ARG A OXT 4  
HETATM 2928  ZN ZN  . ZN  B 2 .  ? 1.384   -1.279  4.181   1.00 0.00 ? 93 ZN  A ZN  4  
ATOM   2929  N  N   . MET A 1 1  ? 11.894  14.867  -26.712 1.00 0.00 ? 1  MET A N   5  
ATOM   2930  C  CA  . MET A 1 1  ? 12.418  13.564  -27.111 1.00 0.00 ? 1  MET A CA  5  
ATOM   2931  C  C   . MET A 1 1  ? 12.955  12.808  -25.919 1.00 0.00 ? 1  MET A C   5  
ATOM   2932  O  O   . MET A 1 1  ? 12.725  11.601  -25.755 1.00 0.00 ? 1  MET A O   5  
ATOM   2933  C  CB  . MET A 1 1  ? 13.516  13.745  -28.194 1.00 0.00 ? 1  MET A CB  5  
ATOM   2934  C  CG  . MET A 1 1  ? 14.502  14.911  -27.968 1.00 0.00 ? 1  MET A CG  5  
ATOM   2935  S  SD  . MET A 1 1  ? 13.965  16.354  -28.901 1.00 0.00 ? 1  MET A SD  5  
ATOM   2936  C  CE  . MET A 1 1  ? 15.004  16.135  -30.351 1.00 0.00 ? 1  MET A CE  5  
ATOM   2937  N  N   . LYS A 1 2  ? 13.788  13.580  -24.972 1.00 0.00 ? 2  LYS A N   5  
ATOM   2938  C  CA  . LYS A 1 2  ? 14.382  12.968  -23.787 1.00 0.00 ? 2  LYS A CA  5  
ATOM   2939  C  C   . LYS A 1 2  ? 14.412  13.942  -22.633 1.00 0.00 ? 2  LYS A C   5  
ATOM   2940  O  O   . LYS A 1 2  ? 15.159  14.930  -22.633 1.00 0.00 ? 2  LYS A O   5  
ATOM   2941  C  CB  . LYS A 1 2  ? 15.813  12.466  -24.126 1.00 0.00 ? 2  LYS A CB  5  
ATOM   2942  C  CG  . LYS A 1 2  ? 16.695  13.537  -24.813 1.00 0.00 ? 2  LYS A CG  5  
ATOM   2943  C  CD  . LYS A 1 2  ? 18.031  13.815  -24.117 1.00 0.00 ? 2  LYS A CD  5  
ATOM   2944  C  CE  . LYS A 1 2  ? 18.636  15.108  -24.680 1.00 0.00 ? 2  LYS A CE  5  
ATOM   2945  N  NZ  . LYS A 1 2  ? 18.845  16.069  -23.583 1.00 0.00 ? 2  LYS A NZ  5  
ATOM   2946  N  N   . LYS A 1 3  ? 13.499  13.652  -21.506 1.00 0.00 ? 3  LYS A N   5  
ATOM   2947  C  CA  . LYS A 1 3  ? 13.477  14.473  -20.298 1.00 0.00 ? 3  LYS A CA  5  
ATOM   2948  C  C   . LYS A 1 3  ? 13.054  13.658  -19.098 1.00 0.00 ? 3  LYS A C   5  
ATOM   2949  O  O   . LYS A 1 3  ? 11.970  13.844  -18.529 1.00 0.00 ? 3  LYS A O   5  
ATOM   2950  C  CB  . LYS A 1 3  ? 12.530  15.685  -20.515 1.00 0.00 ? 3  LYS A CB  5  
ATOM   2951  C  CG  . LYS A 1 3  ? 13.062  17.001  -19.893 1.00 0.00 ? 3  LYS A CG  5  
ATOM   2952  C  CD  . LYS A 1 3  ? 12.038  18.136  -19.813 1.00 0.00 ? 3  LYS A CD  5  
ATOM   2953  C  CE  . LYS A 1 3  ? 12.637  19.302  -19.015 1.00 0.00 ? 3  LYS A CE  5  
ATOM   2954  N  NZ  . LYS A 1 3  ? 13.350  20.208  -19.932 1.00 0.00 ? 3  LYS A NZ  5  
ATOM   2955  N  N   . ALA A 1 4  ? 14.025  12.649  -18.619 1.00 0.00 ? 4  ALA A N   5  
ATOM   2956  C  CA  . ALA A 1 4  ? 13.729  11.742  -17.515 1.00 0.00 ? 4  ALA A CA  5  
ATOM   2957  C  C   . ALA A 1 4  ? 14.064  12.367  -16.181 1.00 0.00 ? 4  ALA A C   5  
ATOM   2958  O  O   . ALA A 1 4  ? 14.215  11.673  -15.161 1.00 0.00 ? 4  ALA A O   5  
ATOM   2959  C  CB  . ALA A 1 4  ? 14.505  10.436  -17.766 1.00 0.00 ? 4  ALA A CB  5  
ATOM   2960  N  N   . THR A 1 5  ? 14.242  13.835  -16.151 1.00 0.00 ? 5  THR A N   5  
ATOM   2961  C  CA  . THR A 1 5  ? 14.656  14.538  -14.940 1.00 0.00 ? 5  THR A CA  5  
ATOM   2962  C  C   . THR A 1 5  ? 13.469  14.841  -14.055 1.00 0.00 ? 5  THR A C   5  
ATOM   2963  O  O   . THR A 1 5  ? 13.541  14.766  -12.820 1.00 0.00 ? 5  THR A O   5  
ATOM   2964  C  CB  . THR A 1 5  ? 15.426  15.852  -15.303 1.00 0.00 ? 5  THR A CB  5  
ATOM   2965  O  OG1 . THR A 1 5  ? 16.733  15.549  -15.773 1.00 0.00 ? 5  THR A OG1 5  
ATOM   2966  C  CG2 . THR A 1 5  ? 15.652  16.854  -14.150 1.00 0.00 ? 5  THR A CG2 5  
ATOM   2967  N  N   . CYS A 1 6  ? 12.229  15.268  -14.740 1.00 0.00 ? 6  CYS A N   5  
ATOM   2968  C  CA  . CYS A 1 6  ? 11.013  15.595  -14.002 1.00 0.00 ? 6  CYS A CA  5  
ATOM   2969  C  C   . CYS A 1 6  ? 10.519  14.400  -13.220 1.00 0.00 ? 6  CYS A C   5  
ATOM   2970  O  O   . CYS A 1 6  ? 10.496  13.263  -13.711 1.00 0.00 ? 6  CYS A O   5  
ATOM   2971  C  CB  . CYS A 1 6  ? 9.960   16.126  -14.994 1.00 0.00 ? 6  CYS A CB  5  
ATOM   2972  S  SG  . CYS A 1 6  ? 9.576   14.884  -16.248 1.00 0.00 ? 6  CYS A SG  5  
ATOM   2973  N  N   . LEU A 1 7  ? 10.100  14.658  -11.825 1.00 0.00 ? 7  LEU A N   5  
ATOM   2974  C  CA  . LEU A 1 7  ? 9.496   13.620  -10.994 1.00 0.00 ? 7  LEU A CA  5  
ATOM   2975  C  C   . LEU A 1 7  ? 8.023   13.475  -11.296 1.00 0.00 ? 7  LEU A C   5  
ATOM   2976  O  O   . LEU A 1 7  ? 7.192   14.304  -10.902 1.00 0.00 ? 7  LEU A O   5  
ATOM   2977  C  CB  . LEU A 1 7  ? 9.728   13.924  -9.487  1.00 0.00 ? 7  LEU A CB  5  
ATOM   2978  C  CG  . LEU A 1 7  ? 11.084  14.554  -9.068  1.00 0.00 ? 7  LEU A CG  5  
ATOM   2979  C  CD1 . LEU A 1 7  ? 11.227  14.533  -7.540  1.00 0.00 ? 7  LEU A CD1 5  
ATOM   2980  C  CD2 . LEU A 1 7  ? 12.290  13.851  -9.712  1.00 0.00 ? 7  LEU A CD2 5  
ATOM   2981  N  N   . THR A 1 8  ? 7.635   12.310  -12.121 1.00 0.00 ? 8  THR A N   5  
ATOM   2982  C  CA  . THR A 1 8  ? 6.248   12.058  -12.499 1.00 0.00 ? 8  THR A CA  5  
ATOM   2983  C  C   . THR A 1 8  ? 5.606   11.053  -11.571 1.00 0.00 ? 8  THR A C   5  
ATOM   2984  O  O   . THR A 1 8  ? 6.262   10.157  -11.023 1.00 0.00 ? 8  THR A O   5  
ATOM   2985  C  CB  . THR A 1 8  ? 6.160   11.572  -13.986 1.00 0.00 ? 8  THR A CB  5  
ATOM   2986  O  OG1 . THR A 1 8  ? 7.297   10.788  -14.322 1.00 0.00 ? 8  THR A OG1 5  
ATOM   2987  C  CG2 . THR A 1 8  ? 6.119   12.677  -15.064 1.00 0.00 ? 8  THR A CG2 5  
ATOM   2988  N  N   . ASP A 1 9  ? 4.156   11.224  -11.324 1.00 0.00 ? 9  ASP A N   5  
ATOM   2989  C  CA  . ASP A 1 9  ? 3.379   10.233  -10.587 1.00 0.00 ? 9  ASP A CA  5  
ATOM   2990  C  C   . ASP A 1 9  ? 3.518   8.865   -11.214 1.00 0.00 ? 9  ASP A C   5  
ATOM   2991  O  O   . ASP A 1 9  ? 3.282   7.828   -10.579 1.00 0.00 ? 9  ASP A O   5  
ATOM   2992  C  CB  . ASP A 1 9  ? 1.895   10.672  -10.485 1.00 0.00 ? 9  ASP A CB  5  
ATOM   2993  C  CG  . ASP A 1 9  ? 1.569   11.771  -9.463  1.00 0.00 ? 9  ASP A CG  5  
ATOM   2994  O  OD1 . ASP A 1 9  ? 1.826   12.951  -9.650  1.00 0.00 ? 9  ASP A OD1 5  
ATOM   2995  O  OD2 . ASP A 1 9  ? 0.988   11.282  -8.327  1.00 0.00 ? 9  ASP A OD2 5  
ATOM   2996  N  N   . ASP A 1 10 ? 3.977   8.833   -12.621 1.00 0.00 ? 10 ASP A N   5  
ATOM   2997  C  CA  . ASP A 1 10 ? 4.196   7.575   -13.330 1.00 0.00 ? 10 ASP A CA  5  
ATOM   2998  C  C   . ASP A 1 10 ? 5.334   6.799   -12.710 1.00 0.00 ? 10 ASP A C   5  
ATOM   2999  O  O   . ASP A 1 10 ? 5.213   5.611   -12.381 1.00 0.00 ? 10 ASP A O   5  
ATOM   3000  C  CB  . ASP A 1 10 ? 4.424   7.837   -14.841 1.00 0.00 ? 10 ASP A CB  5  
ATOM   3001  C  CG  . ASP A 1 10 ? 5.015   6.681   -15.662 1.00 0.00 ? 10 ASP A CG  5  
ATOM   3002  O  OD1 . ASP A 1 10 ? 4.389   5.667   -15.932 1.00 0.00 ? 10 ASP A OD1 5  
ATOM   3003  O  OD2 . ASP A 1 10 ? 6.297   6.923   -16.072 1.00 0.00 ? 10 ASP A OD2 5  
ATOM   3004  N  N   . GLN A 1 11 ? 6.592   7.546   -12.478 1.00 0.00 ? 11 GLN A N   5  
ATOM   3005  C  CA  . GLN A 1 11 ? 7.791   6.902   -11.951 1.00 0.00 ? 11 GLN A CA  5  
ATOM   3006  C  C   . GLN A 1 11 ? 7.588   6.475   -10.515 1.00 0.00 ? 11 GLN A C   5  
ATOM   3007  O  O   . GLN A 1 11 ? 7.879   5.341   -10.111 1.00 0.00 ? 11 GLN A O   5  
ATOM   3008  C  CB  . GLN A 1 11 ? 8.972   7.891   -12.066 1.00 0.00 ? 11 GLN A CB  5  
ATOM   3009  C  CG  . GLN A 1 11 ? 9.089   8.960   -10.928 1.00 0.00 ? 11 GLN A CG  5  
ATOM   3010  C  CD  . GLN A 1 11 ? 10.431  9.150   -10.211 1.00 0.00 ? 11 GLN A CD  5  
ATOM   3011  O  OE1 . GLN A 1 11 ? 10.571  8.837   -9.040  1.00 0.00 ? 11 GLN A OE1 5  
ATOM   3012  N  NE2 . GLN A 1 11 ? 11.444  9.678   -10.850 1.00 0.00 ? 11 GLN A NE2 5  
ATOM   3013  N  N   . ARG A 1 12 ? 6.981   7.488   -9.623  1.00 0.00 ? 12 ARG A N   5  
ATOM   3014  C  CA  . ARG A 1 12 ? 6.585   7.213   -8.248  1.00 0.00 ? 12 ARG A CA  5  
ATOM   3015  C  C   . ARG A 1 12 ? 5.930   5.859   -8.102  1.00 0.00 ? 12 ARG A C   5  
ATOM   3016  O  O   . ARG A 1 12 ? 6.429   4.892   -7.497  1.00 0.00 ? 12 ARG A O   5  
ATOM   3017  C  CB  . ARG A 1 12 ? 5.577   8.330   -7.813  1.00 0.00 ? 12 ARG A CB  5  
ATOM   3018  C  CG  . ARG A 1 12 ? 6.203   9.505   -7.024  1.00 0.00 ? 12 ARG A CG  5  
ATOM   3019  C  CD  . ARG A 1 12 ? 6.617   10.680  -7.919  1.00 0.00 ? 12 ARG A CD  5  
ATOM   3020  N  NE  . ARG A 1 12 ? 6.756   11.887  -7.065  1.00 0.00 ? 12 ARG A NE  5  
ATOM   3021  C  CZ  . ARG A 1 12 ? 6.475   13.130  -7.433  1.00 0.00 ? 12 ARG A CZ  5  
ATOM   3022  N  NH1 . ARG A 1 12 ? 6.039   13.466  -8.610  1.00 0.00 ? 12 ARG A NH1 5  
ATOM   3023  N  NH2 . ARG A 1 12 ? 6.647   14.060  -6.561  1.00 0.00 ? 12 ARG A NH2 5  
ATOM   3024  N  N   . TRP A 1 13 ? 4.576   5.755   -8.712  1.00 0.00 ? 13 TRP A N   5  
ATOM   3025  C  CA  . TRP A 1 13 ? 3.732   4.594   -8.485  1.00 0.00 ? 13 TRP A CA  5  
ATOM   3026  C  C   . TRP A 1 13 ? 4.252   3.388   -9.227  1.00 0.00 ? 13 TRP A C   5  
ATOM   3027  O  O   . TRP A 1 13 ? 4.026   2.233   -8.833  1.00 0.00 ? 13 TRP A O   5  
ATOM   3028  C  CB  . TRP A 1 13 ? 2.280   4.918   -8.978  1.00 0.00 ? 13 TRP A CB  5  
ATOM   3029  C  CG  . TRP A 1 13 ? 1.490   3.605   -9.132  1.00 0.00 ? 13 TRP A CG  5  
ATOM   3030  C  CD1 . TRP A 1 13 ? 1.262   2.917   -10.340 1.00 0.00 ? 13 TRP A CD1 5  
ATOM   3031  C  CD2 . TRP A 1 13 ? 0.977   2.815   -8.128  1.00 0.00 ? 13 TRP A CD2 5  
ATOM   3032  N  NE1 . TRP A 1 13 ? 0.601   1.693   -10.112 1.00 0.00 ? 13 TRP A NE1 5  
ATOM   3033  C  CE2 . TRP A 1 13 ? 0.442   1.650   -8.733  1.00 0.00 ? 13 TRP A CE2 5  
ATOM   3034  C  CE3 . TRP A 1 13 ? 0.953   2.981   -6.718  1.00 0.00 ? 13 TRP A CE3 5  
ATOM   3035  C  CZ2 . TRP A 1 13 ? -0.130  0.644   -7.923  1.00 0.00 ? 13 TRP A CZ2 5  
ATOM   3036  C  CZ3 . TRP A 1 13 ? 0.366   1.981   -5.944  1.00 0.00 ? 13 TRP A CZ3 5  
ATOM   3037  C  CH2 . TRP A 1 13 ? -0.170  0.829   -6.538  1.00 0.00 ? 13 TRP A CH2 5  
ATOM   3038  N  N   . GLN A 1 14 ? 5.011   3.645   -10.475 1.00 0.00 ? 14 GLN A N   5  
ATOM   3039  C  CA  . GLN A 1 14 ? 5.718   2.569   -11.167 1.00 0.00 ? 14 GLN A CA  5  
ATOM   3040  C  C   . GLN A 1 14 ? 6.678   1.892   -10.207 1.00 0.00 ? 14 GLN A C   5  
ATOM   3041  O  O   . GLN A 1 14 ? 6.946   0.686   -10.286 1.00 0.00 ? 14 GLN A O   5  
ATOM   3042  C  CB  . GLN A 1 14 ? 6.475   3.138   -12.383 1.00 0.00 ? 14 GLN A CB  5  
ATOM   3043  C  CG  . GLN A 1 14 ? 7.597   2.227   -12.988 1.00 0.00 ? 14 GLN A CG  5  
ATOM   3044  C  CD  . GLN A 1 14 ? 7.207   1.063   -13.908 1.00 0.00 ? 14 GLN A CD  5  
ATOM   3045  O  OE1 . GLN A 1 14 ? 6.781   0.014   -13.452 1.00 0.00 ? 14 GLN A OE1 5  
ATOM   3046  N  NE2 . GLN A 1 14 ? 7.339   1.182   -15.204 1.00 0.00 ? 14 GLN A NE2 5  
ATOM   3047  N  N   . SER A 1 15 ? 7.301   2.784   -9.201  1.00 0.00 ? 15 SER A N   5  
ATOM   3048  C  CA  . SER A 1 15 ? 8.101   2.261   -8.099  1.00 0.00 ? 15 SER A CA  5  
ATOM   3049  C  C   . SER A 1 15 ? 7.285   1.310   -7.252  1.00 0.00 ? 15 SER A C   5  
ATOM   3050  O  O   . SER A 1 15 ? 7.794   0.270   -6.796  1.00 0.00 ? 15 SER A O   5  
ATOM   3051  C  CB  . SER A 1 15 ? 8.722   3.398   -7.252  1.00 0.00 ? 15 SER A CB  5  
ATOM   3052  O  OG  . SER A 1 15 ? 9.938   3.010   -6.602  1.00 0.00 ? 15 SER A OG  5  
ATOM   3053  N  N   . VAL A 1 16 ? 5.871   1.693   -6.961  1.00 0.00 ? 16 VAL A N   5  
ATOM   3054  C  CA  . VAL A 1 16 ? 4.984   0.738   -6.300  1.00 0.00 ? 16 VAL A CA  5  
ATOM   3055  C  C   . VAL A 1 16 ? 4.938   -0.585  -7.023  1.00 0.00 ? 16 VAL A C   5  
ATOM   3056  O  O   . VAL A 1 16 ? 5.202   -1.670  -6.436  1.00 0.00 ? 16 VAL A O   5  
ATOM   3057  C  CB  . VAL A 1 16 ? 3.551   1.299   -5.972  1.00 0.00 ? 16 VAL A CB  5  
ATOM   3058  C  CG1 . VAL A 1 16 ? 2.758   0.504   -4.877  1.00 0.00 ? 16 VAL A CG1 5  
ATOM   3059  C  CG2 . VAL A 1 16 ? 3.544   2.762   -5.472  1.00 0.00 ? 16 VAL A CG2 5  
ATOM   3060  N  N   . LEU A 1 17 ? 4.531   -0.593  -8.442  1.00 0.00 ? 17 LEU A N   5  
ATOM   3061  C  CA  . LEU A 1 17 ? 4.439   -1.854  -9.219  1.00 0.00 ? 17 LEU A CA  5  
ATOM   3062  C  C   . LEU A 1 17 ? 5.695   -2.657  -9.005  1.00 0.00 ? 17 LEU A C   5  
ATOM   3063  O  O   . LEU A 1 17 ? 5.704   -3.877  -8.796  1.00 0.00 ? 17 LEU A O   5  
ATOM   3064  C  CB  . LEU A 1 17 ? 4.195   -1.564  -10.724 1.00 0.00 ? 17 LEU A CB  5  
ATOM   3065  C  CG  . LEU A 1 17 ? 2.856   -0.874  -11.115 1.00 0.00 ? 17 LEU A CG  5  
ATOM   3066  C  CD1 . LEU A 1 17 ? 2.625   -0.995  -12.627 1.00 0.00 ? 17 LEU A CD1 5  
ATOM   3067  C  CD2 . LEU A 1 17 ? 1.651   -1.451  -10.356 1.00 0.00 ? 17 LEU A CD2 5  
ATOM   3068  N  N   . ALA A 1 18 ? 6.959   -1.881  -9.102  1.00 0.00 ? 18 ALA A N   5  
ATOM   3069  C  CA  . ALA A 1 18 ? 8.282   -2.446  -8.870  1.00 0.00 ? 18 ALA A CA  5  
ATOM   3070  C  C   . ALA A 1 18 ? 8.658   -2.372  -7.409  1.00 0.00 ? 18 ALA A C   5  
ATOM   3071  O  O   . ALA A 1 18 ? 9.614   -1.690  -7.012  1.00 0.00 ? 18 ALA A O   5  
ATOM   3072  C  CB  . ALA A 1 18 ? 9.273   -1.681  -9.772  1.00 0.00 ? 18 ALA A CB  5  
ATOM   3073  N  N   . ARG A 1 19 ? 7.797   -3.124  -6.469  1.00 0.00 ? 19 ARG A N   5  
ATOM   3074  C  CA  . ARG A 1 19 ? 8.112   -3.295  -5.054  1.00 0.00 ? 19 ARG A CA  5  
ATOM   3075  C  C   . ARG A 1 19 ? 9.599   -3.289  -4.805  1.00 0.00 ? 19 ARG A C   5  
ATOM   3076  O  O   . ARG A 1 19 ? 10.093  -2.630  -3.870  1.00 0.00 ? 19 ARG A O   5  
ATOM   3077  C  CB  . ARG A 1 19 ? 7.465   -4.621  -4.557  1.00 0.00 ? 19 ARG A CB  5  
ATOM   3078  C  CG  . ARG A 1 19 ? 8.372   -5.479  -3.636  1.00 0.00 ? 19 ARG A CG  5  
ATOM   3079  C  CD  . ARG A 1 19 ? 7.651   -6.715  -3.083  1.00 0.00 ? 19 ARG A CD  5  
ATOM   3080  N  NE  . ARG A 1 19 ? 6.941   -7.382  -4.204  1.00 0.00 ? 19 ARG A NE  5  
ATOM   3081  C  CZ  . ARG A 1 19 ? 7.488   -8.228  -5.067  1.00 0.00 ? 19 ARG A CZ  5  
ATOM   3082  N  NH1 . ARG A 1 19 ? 8.735   -8.595  -5.045  1.00 0.00 ? 19 ARG A NH1 5  
ATOM   3083  N  NH2 . ARG A 1 19 ? 6.728   -8.714  -5.984  1.00 0.00 ? 19 ARG A NH2 5  
ATOM   3084  N  N   . ASP A 1 20 ? 10.448  -4.096  -5.708  1.00 0.00 ? 20 ASP A N   5  
ATOM   3085  C  CA  . ASP A 1 20 ? 11.907  -4.024  -5.657  1.00 0.00 ? 20 ASP A CA  5  
ATOM   3086  C  C   . ASP A 1 20 ? 12.373  -2.588  -5.726  1.00 0.00 ? 20 ASP A C   5  
ATOM   3087  O  O   . ASP A 1 20 ? 12.285  -1.923  -6.767  1.00 0.00 ? 20 ASP A O   5  
ATOM   3088  C  CB  . ASP A 1 20 ? 12.535  -4.892  -6.777  1.00 0.00 ? 20 ASP A CB  5  
ATOM   3089  C  CG  . ASP A 1 20 ? 14.061  -4.810  -6.938  1.00 0.00 ? 20 ASP A CG  5  
ATOM   3090  O  OD1 . ASP A 1 20 ? 14.733  -5.500  -5.968  1.00 0.00 ? 20 ASP A OD1 5  
ATOM   3091  O  OD2 . ASP A 1 20 ? 14.604  -4.175  -7.829  1.00 0.00 ? 20 ASP A OD2 5  
ATOM   3092  N  N   . PRO A 1 21 ? 12.967  -2.038  -4.489  1.00 0.00 ? 21 PRO A N   5  
ATOM   3093  C  CA  . PRO A 1 21 ? 13.497  -0.616  -4.285  1.00 0.00 ? 21 PRO A CA  5  
ATOM   3094  C  C   . PRO A 1 21 ? 14.245  -0.031  -5.461  1.00 0.00 ? 21 PRO A C   5  
ATOM   3095  O  O   . PRO A 1 21 ? 15.482  0.018   -5.489  1.00 0.00 ? 21 PRO A O   5  
ATOM   3096  C  CB  . PRO A 1 21 ? 14.447  -0.705  -3.093  1.00 0.00 ? 21 PRO A CB  5  
ATOM   3097  C  CG  . PRO A 1 21 ? 13.700  -1.723  -2.216  1.00 0.00 ? 21 PRO A CG  5  
ATOM   3098  C  CD  . PRO A 1 21 ? 13.161  -2.758  -3.208  1.00 0.00 ? 21 PRO A CD  5  
ATOM   3099  N  N   . ASN A 1 22 ? 13.413  0.514   -6.557  1.00 0.00 ? 22 ASN A N   5  
ATOM   3100  C  CA  . ASN A 1 22 ? 13.989  1.236   -7.687  1.00 0.00 ? 22 ASN A CA  5  
ATOM   3101  C  C   . ASN A 1 22 ? 14.115  2.709   -7.378  1.00 0.00 ? 22 ASN A C   5  
ATOM   3102  O  O   . ASN A 1 22 ? 15.211  3.239   -7.151  1.00 0.00 ? 22 ASN A O   5  
ATOM   3103  C  CB  . ASN A 1 22 ? 13.104  1.014   -8.948  1.00 0.00 ? 22 ASN A CB  5  
ATOM   3104  C  CG  . ASN A 1 22 ? 13.445  1.842   -10.192 1.00 0.00 ? 22 ASN A CG  5  
ATOM   3105  O  OD1 . ASN A 1 22 ? 14.467  1.662   -10.838 1.00 0.00 ? 22 ASN A OD1 5  
ATOM   3106  N  ND2 . ASN A 1 22 ? 12.606  2.763   -10.582 1.00 0.00 ? 22 ASN A ND2 5  
ATOM   3107  N  N   . ALA A 1 23 ? 12.857  3.489   -7.393  1.00 0.00 ? 23 ALA A N   5  
ATOM   3108  C  CA  . ALA A 1 23 ? 12.821  4.910   -7.063  1.00 0.00 ? 23 ALA A CA  5  
ATOM   3109  C  C   . ALA A 1 23 ? 12.261  5.140   -5.679  1.00 0.00 ? 23 ALA A C   5  
ATOM   3110  O  O   . ALA A 1 23 ? 11.950  6.276   -5.286  1.00 0.00 ? 23 ALA A O   5  
ATOM   3111  C  CB  . ALA A 1 23 ? 12.006  5.621   -8.159  1.00 0.00 ? 23 ALA A CB  5  
ATOM   3112  N  N   . ASP A 1 24 ? 12.114  3.951   -4.810  1.00 0.00 ? 24 ASP A N   5  
ATOM   3113  C  CA  . ASP A 1 24 ? 11.475  4.035   -3.498  1.00 0.00 ? 24 ASP A CA  5  
ATOM   3114  C  C   . ASP A 1 24 ? 12.162  5.068   -2.634  1.00 0.00 ? 24 ASP A C   5  
ATOM   3115  O  O   . ASP A 1 24 ? 11.715  6.218   -2.511  1.00 0.00 ? 24 ASP A O   5  
ATOM   3116  C  CB  . ASP A 1 24 ? 11.445  2.642   -2.818  1.00 0.00 ? 24 ASP A CB  5  
ATOM   3117  C  CG  . ASP A 1 24 ? 10.417  1.634   -3.351  1.00 0.00 ? 24 ASP A CG  5  
ATOM   3118  O  OD1 . ASP A 1 24 ? 10.335  1.326   -4.531  1.00 0.00 ? 24 ASP A OD1 5  
ATOM   3119  O  OD2 . ASP A 1 24 ? 9.631   1.107   -2.365  1.00 0.00 ? 24 ASP A OD2 5  
ATOM   3120  N  N   . GLY A 1 25 ? 13.368  4.616   -1.909  1.00 0.00 ? 25 GLY A N   5  
ATOM   3121  C  CA  . GLY A 1 25 ? 14.232  5.548   -1.183  1.00 0.00 ? 25 GLY A CA  5  
ATOM   3122  C  C   . GLY A 1 25 ? 13.732  5.713   0.236   1.00 0.00 ? 25 GLY A C   5  
ATOM   3123  O  O   . GLY A 1 25 ? 14.220  5.075   1.178   1.00 0.00 ? 25 GLY A O   5  
ATOM   3124  N  N   . GLU A 1 26 ? 12.638  6.689   0.426   1.00 0.00 ? 26 GLU A N   5  
ATOM   3125  C  CA  . GLU A 1 26 ? 11.948  6.822   1.711   1.00 0.00 ? 26 GLU A CA  5  
ATOM   3126  C  C   . GLU A 1 26 ? 10.496  7.179   1.512   1.00 0.00 ? 26 GLU A C   5  
ATOM   3127  O  O   . GLU A 1 26 ? 9.762   7.467   2.477   1.00 0.00 ? 26 GLU A O   5  
ATOM   3128  C  CB  . GLU A 1 26 ? 12.767  7.801   2.590   1.00 0.00 ? 26 GLU A CB  5  
ATOM   3129  C  CG  . GLU A 1 26 ? 12.164  9.105   3.203   1.00 0.00 ? 26 GLU A CG  5  
ATOM   3130  C  CD  . GLU A 1 26 ? 12.513  9.453   4.655   1.00 0.00 ? 26 GLU A CD  5  
ATOM   3131  O  OE1 . GLU A 1 26 ? 12.651  8.365   5.461   1.00 0.00 ? 26 GLU A OE1 5  
ATOM   3132  O  OE2 . GLU A 1 26 ? 12.653  10.605  5.045   1.00 0.00 ? 26 GLU A OE2 5  
ATOM   3133  N  N   . PHE A 1 27 ? 9.943   7.102   0.140   1.00 0.00 ? 27 PHE A N   5  
ATOM   3134  C  CA  . PHE A 1 27 ? 8.613   7.621   -0.184  1.00 0.00 ? 27 PHE A CA  5  
ATOM   3135  C  C   . PHE A 1 27 ? 7.501   6.709   0.267   1.00 0.00 ? 27 PHE A C   5  
ATOM   3136  O  O   . PHE A 1 27 ? 7.672   5.509   0.518   1.00 0.00 ? 27 PHE A O   5  
ATOM   3137  C  CB  . PHE A 1 27 ? 8.529   7.933   -1.706  1.00 0.00 ? 27 PHE A CB  5  
ATOM   3138  C  CG  . PHE A 1 27 ? 8.072   6.874   -2.719  1.00 0.00 ? 27 PHE A CG  5  
ATOM   3139  C  CD1 . PHE A 1 27 ? 7.168   5.865   -2.389  1.00 0.00 ? 27 PHE A CD1 5  
ATOM   3140  C  CD2 . PHE A 1 27 ? 8.578   6.937   -4.031  1.00 0.00 ? 27 PHE A CD2 5  
ATOM   3141  C  CE1 . PHE A 1 27 ? 6.778   4.929   -3.342  1.00 0.00 ? 27 PHE A CE1 5  
ATOM   3142  C  CE2 . PHE A 1 27 ? 8.190   6.000   -4.981  1.00 0.00 ? 27 PHE A CE2 5  
ATOM   3143  C  CZ  . PHE A 1 27 ? 7.290   4.995   -4.637  1.00 0.00 ? 27 PHE A CZ  5  
ATOM   3144  N  N   . VAL A 1 28 ? 6.159   7.330   0.377   1.00 0.00 ? 28 VAL A N   5  
ATOM   3145  C  CA  . VAL A 1 28 ? 4.984   6.668   0.951   1.00 0.00 ? 28 VAL A CA  5  
ATOM   3146  C  C   . VAL A 1 28 ? 3.816   6.772   -0.006  1.00 0.00 ? 28 VAL A C   5  
ATOM   3147  O  O   . VAL A 1 28 ? 3.796   7.655   -0.893  1.00 0.00 ? 28 VAL A O   5  
ATOM   3148  C  CB  . VAL A 1 28 ? 4.644   7.345   2.337   1.00 0.00 ? 28 VAL A CB  5  
ATOM   3149  C  CG1 . VAL A 1 28 ? 5.865   7.736   3.222   1.00 0.00 ? 28 VAL A CG1 5  
ATOM   3150  C  CG2 . VAL A 1 28 ? 3.800   8.638   2.209   1.00 0.00 ? 28 VAL A CG2 5  
ATOM   3151  N  N   . PHE A 1 29 ? 2.686   5.831   0.142   1.00 0.00 ? 29 PHE A N   5  
ATOM   3152  C  CA  . PHE A 1 29 ? 1.459   5.931   -0.656  1.00 0.00 ? 29 PHE A CA  5  
ATOM   3153  C  C   . PHE A 1 29 ? 0.251   5.761   0.235   1.00 0.00 ? 29 PHE A C   5  
ATOM   3154  O  O   . PHE A 1 29 ? 0.345   5.236   1.365   1.00 0.00 ? 29 PHE A O   5  
ATOM   3155  C  CB  . PHE A 1 29 ? 1.441   4.869   -1.793  1.00 0.00 ? 29 PHE A CB  5  
ATOM   3156  C  CG  . PHE A 1 29 ? 1.281   3.383   -1.440  1.00 0.00 ? 29 PHE A CG  5  
ATOM   3157  C  CD1 . PHE A 1 29 ? 0.730   2.997   -0.215  1.00 0.00 ? 29 PHE A CD1 5  
ATOM   3158  C  CD2 . PHE A 1 29 ? 1.639   2.393   -2.369  1.00 0.00 ? 29 PHE A CD2 5  
ATOM   3159  C  CE1 . PHE A 1 29 ? 0.523   1.655   0.078   1.00 0.00 ? 29 PHE A CE1 5  
ATOM   3160  C  CE2 . PHE A 1 29 ? 1.436   1.048   -2.073  1.00 0.00 ? 29 PHE A CE2 5  
ATOM   3161  C  CZ  . PHE A 1 29 ? 0.879   0.678   -0.851  1.00 0.00 ? 29 PHE A CZ  5  
ATOM   3162  N  N   . ALA A 1 30 ? -1.045  6.273   -0.261  1.00 0.00 ? 30 ALA A N   5  
ATOM   3163  C  CA  . ALA A 1 30 ? -2.253  6.224   0.557   1.00 0.00 ? 30 ALA A CA  5  
ATOM   3164  C  C   . ALA A 1 30 ? -3.452  5.782   -0.248  1.00 0.00 ? 30 ALA A C   5  
ATOM   3165  O  O   . ALA A 1 30 ? -4.034  6.553   -1.023  1.00 0.00 ? 30 ALA A O   5  
ATOM   3166  C  CB  . ALA A 1 30 ? -2.450  7.603   1.204   1.00 0.00 ? 30 ALA A CB  5  
ATOM   3167  N  N   . VAL A 1 31 ? -3.913  4.396   -0.018  1.00 0.00 ? 31 VAL A N   5  
ATOM   3168  C  CA  . VAL A 1 31 ? -5.111  3.865   -0.668  1.00 0.00 ? 31 VAL A CA  5  
ATOM   3169  C  C   . VAL A 1 31 ? -6.298  3.981   0.261   1.00 0.00 ? 31 VAL A C   5  
ATOM   3170  O  O   . VAL A 1 31 ? -6.434  3.215   1.228   1.00 0.00 ? 31 VAL A O   5  
ATOM   3171  C  CB  . VAL A 1 31 ? -4.857  2.374   -1.120  1.00 0.00 ? 31 VAL A CB  5  
ATOM   3172  C  CG1 . VAL A 1 31 ? -4.832  1.294   -0.004  1.00 0.00 ? 31 VAL A CG1 5  
ATOM   3173  C  CG2 . VAL A 1 31 ? -5.871  1.853   -2.167  1.00 0.00 ? 31 VAL A CG2 5  
ATOM   3174  N  N   . ARG A 1 32 ? -7.238  5.088   -0.011  1.00 0.00 ? 32 ARG A N   5  
ATOM   3175  C  CA  . ARG A 1 32 ? -8.321  5.432   0.907   1.00 0.00 ? 32 ARG A CA  5  
ATOM   3176  C  C   . ARG A 1 32 ? -9.587  4.657   0.635   1.00 0.00 ? 32 ARG A C   5  
ATOM   3177  O  O   . ARG A 1 32 ? -10.693 5.239   0.540   1.00 0.00 ? 32 ARG A O   5  
ATOM   3178  C  CB  . ARG A 1 32 ? -8.573  6.966   0.812   1.00 0.00 ? 32 ARG A CB  5  
ATOM   3179  C  CG  . ARG A 1 32 ? -9.076  7.467   -0.567  1.00 0.00 ? 32 ARG A CG  5  
ATOM   3180  C  CD  . ARG A 1 32 ? -8.480  8.828   -0.951  1.00 0.00 ? 32 ARG A CD  5  
ATOM   3181  N  NE  . ARG A 1 32 ? -9.502  9.874   -0.694  1.00 0.00 ? 32 ARG A NE  5  
ATOM   3182  C  CZ  . ARG A 1 32 ? -9.251  11.119  -0.311  1.00 0.00 ? 32 ARG A CZ  5  
ATOM   3183  N  NH1 . ARG A 1 32 ? -8.059  11.596  -0.102  1.00 0.00 ? 32 ARG A NH1 5  
ATOM   3184  N  NH2 . ARG A 1 32 ? -10.257 11.900  -0.137  1.00 0.00 ? 32 ARG A NH2 5  
ATOM   3185  N  N   . THR A 1 33 ? -9.502  3.186   0.514   1.00 0.00 ? 33 THR A N   5  
ATOM   3186  C  CA  . THR A 1 33 ? -10.687 2.351   0.280   1.00 0.00 ? 33 THR A CA  5  
ATOM   3187  C  C   . THR A 1 33 ? -11.229 1.841   1.595   1.00 0.00 ? 33 THR A C   5  
ATOM   3188  O  O   . THR A 1 33 ? -12.436 1.867   1.869   1.00 0.00 ? 33 THR A O   5  
ATOM   3189  C  CB  . THR A 1 33 ? -10.340 1.169   -0.682  1.00 0.00 ? 33 THR A CB  5  
ATOM   3190  O  OG1 . THR A 1 33 ? -9.269  1.526   -1.547  1.00 0.00 ? 33 THR A OG1 5  
ATOM   3191  C  CG2 . THR A 1 33 ? -11.464 0.702   -1.632  1.00 0.00 ? 33 THR A CG2 5  
ATOM   3192  N  N   . THR A 1 34 ? -10.219 1.334   2.552   1.00 0.00 ? 34 THR A N   5  
ATOM   3193  C  CA  . THR A 1 34 ? -10.546 0.975   3.928   1.00 0.00 ? 34 THR A CA  5  
ATOM   3194  C  C   . THR A 1 34 ? -9.890  1.948   4.888   1.00 0.00 ? 34 THR A C   5  
ATOM   3195  O  O   . THR A 1 34 ? -10.477 2.402   5.878   1.00 0.00 ? 34 THR A O   5  
ATOM   3196  C  CB  . THR A 1 34 ? -10.118 -0.495  4.245   1.00 0.00 ? 34 THR A CB  5  
ATOM   3197  O  OG1 . THR A 1 34 ? -10.902 -1.417  3.498   1.00 0.00 ? 34 THR A OG1 5  
ATOM   3198  C  CG2 . THR A 1 34 ? -10.277 -0.955  5.712   1.00 0.00 ? 34 THR A CG2 5  
ATOM   3199  N  N   . GLY A 1 35 ? -8.504  2.349   4.534   1.00 0.00 ? 35 GLY A N   5  
ATOM   3200  C  CA  . GLY A 1 35 ? -7.796  3.409   5.241   1.00 0.00 ? 35 GLY A CA  5  
ATOM   3201  C  C   . GLY A 1 35 ? -6.423  2.999   5.715   1.00 0.00 ? 35 GLY A C   5  
ATOM   3202  O  O   . GLY A 1 35 ? -6.203  2.772   6.922   1.00 0.00 ? 35 GLY A O   5  
ATOM   3203  N  N   . ILE A 1 36 ? -5.358  2.837   4.701   1.00 0.00 ? 36 ILE A N   5  
ATOM   3204  C  CA  . ILE A 1 36 ? -3.963  2.624   5.074   1.00 0.00 ? 36 ILE A CA  5  
ATOM   3205  C  C   . ILE A 1 36 ? -3.030  3.437   4.211   1.00 0.00 ? 36 ILE A C   5  
ATOM   3206  O  O   . ILE A 1 36 ? -3.204  3.547   2.981   1.00 0.00 ? 36 ILE A O   5  
ATOM   3207  C  CB  . ILE A 1 36 ? -3.582  1.082   5.067   1.00 0.00 ? 36 ILE A CB  5  
ATOM   3208  C  CG1 . ILE A 1 36 ? -3.136  0.486   3.696   1.00 0.00 ? 36 ILE A CG1 5  
ATOM   3209  C  CG2 . ILE A 1 36 ? -4.725  0.184   5.637   1.00 0.00 ? 36 ILE A CG2 5  
ATOM   3210  C  CD1 . ILE A 1 36 ? -1.971  -0.527  3.747   1.00 0.00 ? 36 ILE A CD1 5  
ATOM   3211  N  N   . PHE A 1 37 ? -1.923  4.135   4.898   1.00 0.00 ? 37 PHE A N   5  
ATOM   3212  C  CA  . PHE A 1 37 ? -0.835  4.801   4.163   1.00 0.00 ? 37 PHE A CA  5  
ATOM   3213  C  C   . PHE A 1 37 ? 0.458   4.061   4.413   1.00 0.00 ? 37 PHE A C   5  
ATOM   3214  O  O   . PHE A 1 37 ? 0.958   4.056   5.570   1.00 0.00 ? 37 PHE A O   5  
ATOM   3215  C  CB  . PHE A 1 37 ? -0.695  6.284   4.613   1.00 0.00 ? 37 PHE A CB  5  
ATOM   3216  C  CG  . PHE A 1 37 ? 0.100   6.631   5.883   1.00 0.00 ? 37 PHE A CG  5  
ATOM   3217  C  CD1 . PHE A 1 37 ? 1.483   6.835   5.812   1.00 0.00 ? 37 PHE A CD1 5  
ATOM   3218  C  CD2 . PHE A 1 37 ? -0.548  6.738   7.116   1.00 0.00 ? 37 PHE A CD2 5  
ATOM   3219  C  CE1 . PHE A 1 37 ? 2.206   7.149   6.959   1.00 0.00 ? 37 PHE A CE1 5  
ATOM   3220  C  CE2 . PHE A 1 37 ? 0.174   7.052   8.263   1.00 0.00 ? 37 PHE A CE2 5  
ATOM   3221  C  CZ  . PHE A 1 37 ? 1.551   7.261   8.184   1.00 0.00 ? 37 PHE A CZ  5  
ATOM   3222  N  N   . CYS A 1 38 ? 1.108   3.311   3.318   1.00 0.00 ? 38 CYS A N   5  
ATOM   3223  C  CA  . CYS A 1 38 ? 2.243   2.424   3.556   1.00 0.00 ? 38 CYS A CA  5  
ATOM   3224  C  C   . CYS A 1 38 ? 3.417   2.726   2.662   1.00 0.00 ? 38 CYS A C   5  
ATOM   3225  O  O   . CYS A 1 38 ? 3.282   3.366   1.605   1.00 0.00 ? 38 CYS A O   5  
ATOM   3226  C  CB  . CYS A 1 38 ? 1.760   0.964   3.334   1.00 0.00 ? 38 CYS A CB  5  
ATOM   3227  S  SG  . CYS A 1 38 ? 2.983   -0.210  3.982   1.00 0.00 ? 38 CYS A SG  5  
ATOM   3228  N  N   . ARG A 1 39 ? 4.734   2.241   3.116   1.00 0.00 ? 39 ARG A N   5  
ATOM   3229  C  CA  . ARG A 1 39 ? 5.890   2.236   2.198   1.00 0.00 ? 39 ARG A CA  5  
ATOM   3230  C  C   . ARG A 1 39 ? 5.699   1.063   1.257   1.00 0.00 ? 39 ARG A C   5  
ATOM   3231  O  O   . ARG A 1 39 ? 5.611   -0.094  1.705   1.00 0.00 ? 39 ARG A O   5  
ATOM   3232  C  CB  . ARG A 1 39 ? 7.197   2.161   3.019   1.00 0.00 ? 39 ARG A CB  5  
ATOM   3233  C  CG  . ARG A 1 39 ? 8.237   3.272   2.713   1.00 0.00 ? 39 ARG A CG  5  
ATOM   3234  C  CD  . ARG A 1 39 ? 9.679   2.838   3.003   1.00 0.00 ? 39 ARG A CD  5  
ATOM   3235  N  NE  . ARG A 1 39 ? 9.664   1.818   4.082   1.00 0.00 ? 39 ARG A NE  5  
ATOM   3236  C  CZ  . ARG A 1 39 ? 10.593  0.891   4.277   1.00 0.00 ? 39 ARG A CZ  5  
ATOM   3237  N  NH1 . ARG A 1 39 ? 11.651  0.745   3.536   1.00 0.00 ? 39 ARG A NH1 5  
ATOM   3238  N  NH2 . ARG A 1 39 ? 10.429  0.087   5.267   1.00 0.00 ? 39 ARG A NH2 5  
ATOM   3239  N  N   . PRO A 1 40 ? 5.669   1.341   -0.185  1.00 0.00 ? 40 PRO A N   5  
ATOM   3240  C  CA  . PRO A 1 40 ? 5.420   0.363   -1.345  1.00 0.00 ? 40 PRO A CA  5  
ATOM   3241  C  C   . PRO A 1 40 ? 5.470   -1.121  -1.104  1.00 0.00 ? 40 PRO A C   5  
ATOM   3242  O  O   . PRO A 1 40 ? 6.266   -1.851  -1.733  1.00 0.00 ? 40 PRO A O   5  
ATOM   3243  C  CB  . PRO A 1 40 ? 6.467   0.781   -2.385  1.00 0.00 ? 40 PRO A CB  5  
ATOM   3244  C  CG  . PRO A 1 40 ? 6.407   2.310   -2.245  1.00 0.00 ? 40 PRO A CG  5  
ATOM   3245  C  CD  . PRO A 1 40 ? 5.879   2.657   -0.850  1.00 0.00 ? 40 PRO A CD  5  
ATOM   3246  N  N   . SER A 1 41 ? 4.526   -1.699  -0.121  1.00 0.00 ? 41 SER A N   5  
ATOM   3247  C  CA  . SER A 1 41 ? 4.376   -3.137  0.056   1.00 0.00 ? 41 SER A CA  5  
ATOM   3248  C  C   . SER A 1 41 ? 3.386   -3.502  1.136   1.00 0.00 ? 41 SER A C   5  
ATOM   3249  O  O   . SER A 1 41 ? 3.612   -3.172  2.326   1.00 0.00 ? 41 SER A O   5  
ATOM   3250  C  CB  . SER A 1 41 ? 5.762   -3.793  0.338   1.00 0.00 ? 41 SER A CB  5  
ATOM   3251  O  OG  . SER A 1 41 ? 6.036   -4.902  -0.523  1.00 0.00 ? 41 SER A OG  5  
ATOM   3252  N  N   . CYS A 1 42 ? 2.177   -4.279  0.792   1.00 0.00 ? 42 CYS A N   5  
ATOM   3253  C  CA  . CYS A 1 42 ? 1.305   -4.868  1.798   1.00 0.00 ? 42 CYS A CA  5  
ATOM   3254  C  C   . CYS A 1 42 ? 0.802   -6.225  1.321   1.00 0.00 ? 42 CYS A C   5  
ATOM   3255  O  O   . CYS A 1 42 ? -0.150  -6.332  0.541   1.00 0.00 ? 42 CYS A O   5  
ATOM   3256  C  CB  . CYS A 1 42 ? 0.147   -3.964  2.251   1.00 0.00 ? 42 CYS A CB  5  
ATOM   3257  S  SG  . CYS A 1 42 ? 0.635   -2.261  2.579   1.00 0.00 ? 42 CYS A SG  5  
ATOM   3258  N  N   . ARG A 1 43 ? 1.559   -7.395  1.809   1.00 0.00 ? 43 ARG A N   5  
ATOM   3259  C  CA  . ARG A 1 43 ? 1.161   -8.789  1.654   1.00 0.00 ? 43 ARG A CA  5  
ATOM   3260  C  C   . ARG A 1 43 ? -0.168  -8.950  0.970   1.00 0.00 ? 43 ARG A C   5  
ATOM   3261  O  O   . ARG A 1 43 ? -0.263  -9.353  -0.200  1.00 0.00 ? 43 ARG A O   5  
ATOM   3262  C  CB  . ARG A 1 43 ? 1.130   -9.430  3.082   1.00 0.00 ? 43 ARG A CB  5  
ATOM   3263  C  CG  . ARG A 1 43 ? 1.090   -8.402  4.241   1.00 0.00 ? 43 ARG A CG  5  
ATOM   3264  C  CD  . ARG A 1 43 ? 1.137   -9.057  5.627   1.00 0.00 ? 43 ARG A CD  5  
ATOM   3265  N  NE  . ARG A 1 43 ? 2.499   -8.864  6.188   1.00 0.00 ? 43 ARG A NE  5  
ATOM   3266  C  CZ  . ARG A 1 43 ? 3.044   -9.588  7.156   1.00 0.00 ? 43 ARG A CZ  5  
ATOM   3267  N  NH1 . ARG A 1 43 ? 2.448   -10.575 7.758   1.00 0.00 ? 43 ARG A NH1 5  
ATOM   3268  N  NH2 . ARG A 1 43 ? 4.240   -9.288  7.520   1.00 0.00 ? 43 ARG A NH2 5  
ATOM   3269  N  N   . ALA A 1 44 ? -1.369  -8.616  1.773   1.00 0.00 ? 44 ALA A N   5  
ATOM   3270  C  CA  . ALA A 1 44 ? -2.703  -8.576  1.179   1.00 0.00 ? 44 ALA A CA  5  
ATOM   3271  C  C   . ALA A 1 44 ? -2.697  -7.706  -0.060  1.00 0.00 ? 44 ALA A C   5  
ATOM   3272  O  O   . ALA A 1 44 ? -2.749  -6.472  0.023   1.00 0.00 ? 44 ALA A O   5  
ATOM   3273  C  CB  . ALA A 1 44 ? -3.683  -8.080  2.254   1.00 0.00 ? 44 ALA A CB  5  
ATOM   3274  N  N   . ARG A 1 45 ? -2.675  -8.426  -1.354  1.00 0.00 ? 45 ARG A N   5  
ATOM   3275  C  CA  . ARG A 1 45 ? -2.473  -7.738  -2.627  1.00 0.00 ? 45 ARG A CA  5  
ATOM   3276  C  C   . ARG A 1 45 ? -3.189  -6.404  -2.637  1.00 0.00 ? 45 ARG A C   5  
ATOM   3277  O  O   . ARG A 1 45 ? -4.403  -6.296  -2.850  1.00 0.00 ? 45 ARG A O   5  
ATOM   3278  C  CB  . ARG A 1 45 ? -2.949  -8.654  -3.785  1.00 0.00 ? 45 ARG A CB  5  
ATOM   3279  C  CG  . ARG A 1 45 ? -4.340  -9.312  -3.583  1.00 0.00 ? 45 ARG A CG  5  
ATOM   3280  C  CD  . ARG A 1 45 ? -4.839  -10.029 -4.845  1.00 0.00 ? 45 ARG A CD  5  
ATOM   3281  N  NE  . ARG A 1 45 ? -5.199  -11.423 -4.482  1.00 0.00 ? 45 ARG A NE  5  
ATOM   3282  C  CZ  . ARG A 1 45 ? -5.267  -12.444 -5.326  1.00 0.00 ? 45 ARG A CZ  5  
ATOM   3283  N  NH1 . ARG A 1 45 ? -5.018  -12.362 -6.599  1.00 0.00 ? 45 ARG A NH1 5  
ATOM   3284  N  NH2 . ARG A 1 45 ? -5.603  -13.589 -4.845  1.00 0.00 ? 45 ARG A NH2 5  
ATOM   3285  N  N   . HIS A 1 46 ? -2.337  -5.229  -2.330  1.00 0.00 ? 46 HIS A N   5  
ATOM   3286  C  CA  . HIS A 1 46 ? -2.874  -3.893  -2.109  1.00 0.00 ? 46 HIS A CA  5  
ATOM   3287  C  C   . HIS A 1 46 ? -3.913  -3.508  -3.135  1.00 0.00 ? 46 HIS A C   5  
ATOM   3288  O  O   . HIS A 1 46 ? -3.982  -4.044  -4.250  1.00 0.00 ? 46 HIS A O   5  
ATOM   3289  C  CB  . HIS A 1 46 ? -1.680  -2.925  -2.157  1.00 0.00 ? 46 HIS A CB  5  
ATOM   3290  C  CG  . HIS A 1 46 ? -0.920  -2.994  -3.450  1.00 0.00 ? 46 HIS A CG  5  
ATOM   3291  N  ND1 . HIS A 1 46 ? -1.462  -3.248  -4.707  1.00 0.00 ? 46 HIS A ND1 5  
ATOM   3292  C  CD2 . HIS A 1 46 ? 0.454   -2.801  -3.520  1.00 0.00 ? 46 HIS A CD2 5  
ATOM   3293  C  CE1 . HIS A 1 46 ? -0.346  -3.185  -5.457  1.00 0.00 ? 46 HIS A CE1 5  
ATOM   3294  N  NE2 . HIS A 1 46 ? 0.834   -2.926  -4.831  1.00 0.00 ? 46 HIS A NE2 5  
ATOM   3295  N  N   . ALA A 1 47 ? -4.880  -2.467  -2.709  1.00 0.00 ? 47 ALA A N   5  
ATOM   3296  C  CA  . ALA A 1 47 ? -5.849  -1.885  -3.632  1.00 0.00 ? 47 ALA A CA  5  
ATOM   3297  C  C   . ALA A 1 47 ? -5.157  -1.316  -4.850  1.00 0.00 ? 47 ALA A C   5  
ATOM   3298  O  O   . ALA A 1 47 ? -3.939  -1.449  -5.034  1.00 0.00 ? 47 ALA A O   5  
ATOM   3299  C  CB  . ALA A 1 47 ? -6.661  -0.831  -2.860  1.00 0.00 ? 47 ALA A CB  5  
ATOM   3300  N  N   . LEU A 1 48 ? -6.013  -0.559  -5.788  1.00 0.00 ? 48 LEU A N   5  
ATOM   3301  C  CA  . LEU A 1 48 ? -5.500  -0.006  -7.039  1.00 0.00 ? 48 LEU A CA  5  
ATOM   3302  C  C   . LEU A 1 48 ? -4.846  1.335   -6.806  1.00 0.00 ? 48 LEU A C   5  
ATOM   3303  O  O   . LEU A 1 48 ? -4.866  1.890   -5.697  1.00 0.00 ? 48 LEU A O   5  
ATOM   3304  C  CB  . LEU A 1 48 ? -6.641  0.085   -8.093  1.00 0.00 ? 48 LEU A CB  5  
ATOM   3305  C  CG  . LEU A 1 48 ? -7.982  -0.634  -7.777  1.00 0.00 ? 48 LEU A CG  5  
ATOM   3306  C  CD1 . LEU A 1 48 ? -8.852  0.247   -6.869  1.00 0.00 ? 48 LEU A CD1 5  
ATOM   3307  C  CD2 . LEU A 1 48 ? -8.770  -1.010  -9.042  1.00 0.00 ? 48 LEU A CD2 5  
ATOM   3308  N  N   . ARG A 1 49 ? -4.210  1.974   -7.980  1.00 0.00 ? 49 ARG A N   5  
ATOM   3309  C  CA  . ARG A 1 49 ? -3.691  3.341   -7.948  1.00 0.00 ? 49 ARG A CA  5  
ATOM   3310  C  C   . ARG A 1 49 ? -4.769  4.347   -8.270  1.00 0.00 ? 49 ARG A C   5  
ATOM   3311  O  O   . ARG A 1 49 ? -4.515  5.535   -8.514  1.00 0.00 ? 49 ARG A O   5  
ATOM   3312  C  CB  . ARG A 1 49 ? -2.504  3.442   -8.947  1.00 0.00 ? 49 ARG A CB  5  
ATOM   3313  C  CG  . ARG A 1 49 ? -2.867  3.852   -10.398 1.00 0.00 ? 49 ARG A CG  5  
ATOM   3314  C  CD  . ARG A 1 49 ? -3.553  2.729   -11.186 1.00 0.00 ? 49 ARG A CD  5  
ATOM   3315  N  NE  . ARG A 1 49 ? -2.814  2.528   -12.459 1.00 0.00 ? 49 ARG A NE  5  
ATOM   3316  C  CZ  . ARG A 1 49 ? -3.249  1.829   -13.498 1.00 0.00 ? 49 ARG A CZ  5  
ATOM   3317  N  NH1 . ARG A 1 49 ? -4.398  1.224   -13.547 1.00 0.00 ? 49 ARG A NH1 5  
ATOM   3318  N  NH2 . ARG A 1 49 ? -2.476  1.748   -14.523 1.00 0.00 ? 49 ARG A NH2 5  
ATOM   3319  N  N   . GLU A 1 50 ? -6.166  3.850   -8.234  1.00 0.00 ? 50 GLU A N   5  
ATOM   3320  C  CA  . GLU A 1 50 ? -7.305  4.622   -8.710  1.00 0.00 ? 50 GLU A CA  5  
ATOM   3321  C  C   . GLU A 1 50 ? -7.902  5.505   -7.641  1.00 0.00 ? 50 GLU A C   5  
ATOM   3322  O  O   . GLU A 1 50 ? -8.645  6.463   -7.954  1.00 0.00 ? 50 GLU A O   5  
ATOM   3323  C  CB  . GLU A 1 50 ? -8.376  3.622   -9.250  1.00 0.00 ? 50 GLU A CB  5  
ATOM   3324  C  CG  . GLU A 1 50 ? -7.851  2.405   -10.080 1.00 0.00 ? 50 GLU A CG  5  
ATOM   3325  C  CD  . GLU A 1 50 ? -8.724  1.861   -11.213 1.00 0.00 ? 50 GLU A CD  5  
ATOM   3326  O  OE1 . GLU A 1 50 ? -9.946  1.423   -10.802 1.00 0.00 ? 50 GLU A OE1 5  
ATOM   3327  O  OE2 . GLU A 1 50 ? -8.355  1.826   -12.380 1.00 0.00 ? 50 GLU A OE2 5  
ATOM   3328  N  N   . ASN A 1 51 ? -7.561  5.235   -6.236  1.00 0.00 ? 51 ASN A N   5  
ATOM   3329  C  CA  . ASN A 1 51 ? -8.087  6.078   -5.128  1.00 0.00 ? 51 ASN A CA  5  
ATOM   3330  C  C   . ASN A 1 51 ? -6.933  6.349   -4.189  1.00 0.00 ? 51 ASN A C   5  
ATOM   3331  O  O   . ASN A 1 51 ? -7.034  6.598   -2.981  1.00 0.00 ? 51 ASN A O   5  
ATOM   3332  C  CB  . ASN A 1 51 ? -9.202  5.273   -4.417  1.00 0.00 ? 51 ASN A CB  5  
ATOM   3333  C  CG  . ASN A 1 51 ? -8.877  4.575   -3.091  1.00 0.00 ? 51 ASN A CG  5  
ATOM   3334  O  OD1 . ASN A 1 51 ? -9.627  4.627   -2.128  1.00 0.00 ? 51 ASN A OD1 5  
ATOM   3335  N  ND2 . ASN A 1 51 ? -7.774  3.883   -3.000  1.00 0.00 ? 51 ASN A ND2 5  
ATOM   3336  N  N   . VAL A 1 52 ? -5.587  6.243   -4.842  1.00 0.00 ? 52 VAL A N   5  
ATOM   3337  C  CA  . VAL A 1 52 ? -4.342  6.159   -4.083  1.00 0.00 ? 52 VAL A CA  5  
ATOM   3338  C  C   . VAL A 1 52 ? -3.665  7.502   -4.049  1.00 0.00 ? 52 VAL A C   5  
ATOM   3339  O  O   . VAL A 1 52 ? -3.862  8.318   -4.998  1.00 0.00 ? 52 VAL A O   5  
ATOM   3340  C  CB  . VAL A 1 52 ? -3.412  5.041   -4.719  1.00 0.00 ? 52 VAL A CB  5  
ATOM   3341  C  CG1 . VAL A 1 52 ? -2.135  5.524   -5.455  1.00 0.00 ? 52 VAL A CG1 5  
ATOM   3342  C  CG2 . VAL A 1 52 ? -2.924  3.972   -3.703  1.00 0.00 ? 52 VAL A CG2 5  
ATOM   3343  N  N   . SER A 1 53 ? -2.763  7.870   -2.940  1.00 0.00 ? 53 SER A N   5  
ATOM   3344  C  CA  . SER A 1 53 ? -1.954  9.091   -2.966  1.00 0.00 ? 53 SER A CA  5  
ATOM   3345  C  C   . SER A 1 53 ? -0.483  8.765   -2.873  1.00 0.00 ? 53 SER A C   5  
ATOM   3346  O  O   . SER A 1 53 ? -0.085  7.606   -2.685  1.00 0.00 ? 53 SER A O   5  
ATOM   3347  C  CB  . SER A 1 53 ? -2.408  10.093  -1.878  1.00 0.00 ? 53 SER A CB  5  
ATOM   3348  O  OG  . SER A 1 53 ? -1.894  11.415  -2.090  1.00 0.00 ? 53 SER A OG  5  
ATOM   3349  N  N   . PHE A 1 54 ? 0.462   9.890   -3.061  1.00 0.00 ? 54 PHE A N   5  
ATOM   3350  C  CA  . PHE A 1 54 ? 1.907   9.683   -3.065  1.00 0.00 ? 54 PHE A CA  5  
ATOM   3351  C  C   . PHE A 1 54 ? 2.635   10.834  -2.412  1.00 0.00 ? 54 PHE A C   5  
ATOM   3352  O  O   . PHE A 1 54 ? 2.371   12.021  -2.649  1.00 0.00 ? 54 PHE A O   5  
ATOM   3353  C  CB  . PHE A 1 54 ? 2.428   9.504   -4.522  1.00 0.00 ? 54 PHE A CB  5  
ATOM   3354  C  CG  . PHE A 1 54 ? 1.695   8.472   -5.395  1.00 0.00 ? 54 PHE A CG  5  
ATOM   3355  C  CD1 . PHE A 1 54 ? 1.590   7.141   -4.989  1.00 0.00 ? 54 PHE A CD1 5  
ATOM   3356  C  CD2 . PHE A 1 54 ? 1.118   8.871   -6.606  1.00 0.00 ? 54 PHE A CD2 5  
ATOM   3357  C  CE1 . PHE A 1 54 ? 0.918   6.217   -5.786  1.00 0.00 ? 54 PHE A CE1 5  
ATOM   3358  C  CE2 . PHE A 1 54 ? 0.449   7.948   -7.402  1.00 0.00 ? 54 PHE A CE2 5  
ATOM   3359  C  CZ  . PHE A 1 54 ? 0.348   6.621   -6.992  1.00 0.00 ? 54 PHE A CZ  5  
ATOM   3360  N  N   . TYR A 1 55 ? 3.677   10.460  -1.429  1.00 0.00 ? 55 TYR A N   5  
ATOM   3361  C  CA  . TYR A 1 55 ? 4.368   11.415  -0.560  1.00 0.00 ? 55 TYR A CA  5  
ATOM   3362  C  C   . TYR A 1 55 ? 5.837   11.060  -0.462  1.00 0.00 ? 55 TYR A C   5  
ATOM   3363  O  O   . TYR A 1 55 ? 6.231   9.913   -0.799  1.00 0.00 ? 55 TYR A O   5  
ATOM   3364  C  CB  . TYR A 1 55 ? 3.753   11.397  0.868   1.00 0.00 ? 55 TYR A CB  5  
ATOM   3365  C  CG  . TYR A 1 55 ? 2.275   11.012  1.075   1.00 0.00 ? 55 TYR A CG  5  
ATOM   3366  C  CD1 . TYR A 1 55 ? 1.534   10.264  0.162   1.00 0.00 ? 55 TYR A CD1 5  
ATOM   3367  C  CD2 . TYR A 1 55 ? 1.645   11.469  2.253   1.00 0.00 ? 55 TYR A CD2 5  
ATOM   3368  C  CE1 . TYR A 1 55 ? 0.194   9.975   0.404   1.00 0.00 ? 55 TYR A CE1 5  
ATOM   3369  C  CE2 . TYR A 1 55 ? 0.307   11.182  2.491   1.00 0.00 ? 55 TYR A CE2 5  
ATOM   3370  C  CZ  . TYR A 1 55 ? -0.420  10.438  1.565   1.00 0.00 ? 55 TYR A CZ  5  
ATOM   3371  O  OH  . TYR A 1 55 ? -1.741  10.169  1.804   1.00 0.00 ? 55 TYR A OH  5  
ATOM   3372  N  N   . ALA A 1 56 ? 6.827   12.066  -0.016  1.00 0.00 ? 56 ALA A N   5  
ATOM   3373  C  CA  . ALA A 1 56 ? 8.233   11.731  0.230   1.00 0.00 ? 56 ALA A CA  5  
ATOM   3374  C  C   . ALA A 1 56 ? 8.444   11.010  1.538   1.00 0.00 ? 56 ALA A C   5  
ATOM   3375  O  O   . ALA A 1 56 ? 9.410   10.233  1.691   1.00 0.00 ? 56 ALA A O   5  
ATOM   3376  C  CB  . ALA A 1 56 ? 9.046   13.033  0.129   1.00 0.00 ? 56 ALA A CB  5  
ATOM   3377  N  N   . ASN A 1 57 ? 7.498   11.280  2.643   1.00 0.00 ? 57 ASN A N   5  
ATOM   3378  C  CA  . ASN A 1 57 ? 7.588   10.578  3.920   1.00 0.00 ? 57 ASN A CA  5  
ATOM   3379  C  C   . ASN A 1 57 ? 6.229   10.345  4.536   1.00 0.00 ? 57 ASN A C   5  
ATOM   3380  O  O   . ASN A 1 57 ? 5.231   10.996  4.197   1.00 0.00 ? 57 ASN A O   5  
ATOM   3381  C  CB  . ASN A 1 57 ? 8.505   11.370  4.897   1.00 0.00 ? 57 ASN A CB  5  
ATOM   3382  C  CG  . ASN A 1 57 ? 8.926   10.653  6.185   1.00 0.00 ? 57 ASN A CG  5  
ATOM   3383  O  OD1 . ASN A 1 57 ? 8.750   11.138  7.292   1.00 0.00 ? 57 ASN A OD1 5  
ATOM   3384  N  ND2 . ASN A 1 57 ? 9.478   9.473   6.093   1.00 0.00 ? 57 ASN A ND2 5  
ATOM   3385  N  N   . ALA A 1 58 ? 6.152   9.260   5.543   1.00 0.00 ? 58 ALA A N   5  
ATOM   3386  C  CA  . ALA A 1 58 ? 4.951   9.005   6.329   1.00 0.00 ? 58 ALA A CA  5  
ATOM   3387  C  C   . ALA A 1 58 ? 4.664   10.119  7.308   1.00 0.00 ? 58 ALA A C   5  
ATOM   3388  O  O   . ALA A 1 58 ? 3.607   10.135  7.967   1.00 0.00 ? 58 ALA A O   5  
ATOM   3389  C  CB  . ALA A 1 58 ? 5.125   7.639   7.021   1.00 0.00 ? 58 ALA A CB  5  
ATOM   3390  N  N   . SER A 1 59 ? 5.694   11.165  7.483   1.00 0.00 ? 59 SER A N   5  
ATOM   3391  C  CA  . SER A 1 59 ? 5.447   12.358  8.293   1.00 0.00 ? 59 SER A CA  5  
ATOM   3392  C  C   . SER A 1 59 ? 4.383   13.224  7.660   1.00 0.00 ? 59 SER A C   5  
ATOM   3393  O  O   . SER A 1 59 ? 3.613   13.915  8.340   1.00 0.00 ? 59 SER A O   5  
ATOM   3394  C  CB  . SER A 1 59 ? 6.756   13.147  8.537   1.00 0.00 ? 59 SER A CB  5  
ATOM   3395  O  OG  . SER A 1 59 ? 6.926   14.240  7.628   1.00 0.00 ? 59 SER A OG  5  
ATOM   3396  N  N   . GLU A 1 60 ? 4.329   13.216  6.181   1.00 0.00 ? 60 GLU A N   5  
ATOM   3397  C  CA  . GLU A 1 60 ? 3.267   13.894  5.445   1.00 0.00 ? 60 GLU A CA  5  
ATOM   3398  C  C   . GLU A 1 60 ? 1.941   13.188  5.612   1.00 0.00 ? 60 GLU A C   5  
ATOM   3399  O  O   . GLU A 1 60 ? 0.937   13.787  6.023   1.00 0.00 ? 60 GLU A O   5  
ATOM   3400  C  CB  . GLU A 1 60 ? 3.671   13.976  3.944   1.00 0.00 ? 60 GLU A CB  5  
ATOM   3401  C  CG  . GLU A 1 60 ? 2.505   14.056  2.904   1.00 0.00 ? 60 GLU A CG  5  
ATOM   3402  C  CD  . GLU A 1 60 ? 2.308   15.348  2.110   1.00 0.00 ? 60 GLU A CD  5  
ATOM   3403  O  OE1 . GLU A 1 60 ? 3.212   15.897  1.493   1.00 0.00 ? 60 GLU A OE1 5  
ATOM   3404  O  OE2 . GLU A 1 60 ? 1.035   15.831  2.154   1.00 0.00 ? 60 GLU A OE2 5  
ATOM   3405  N  N   . ALA A 1 61 ? 1.890   11.764  5.217   1.00 0.00 ? 61 ALA A N   5  
ATOM   3406  C  CA  . ALA A 1 61 ? 0.685   10.959  5.377   1.00 0.00 ? 61 ALA A CA  5  
ATOM   3407  C  C   . ALA A 1 61 ? 0.186   10.916  6.800   1.00 0.00 ? 61 ALA A C   5  
ATOM   3408  O  O   . ALA A 1 61 ? -0.976  10.507  7.046   1.00 0.00 ? 61 ALA A O   5  
ATOM   3409  C  CB  . ALA A 1 61 ? 0.958   9.566   4.790   1.00 0.00 ? 61 ALA A CB  5  
ATOM   3410  N  N   . LEU A 1 62 ? 1.087   11.323  7.896   1.00 0.00 ? 62 LEU A N   5  
ATOM   3411  C  CA  . LEU A 1 62 ? 0.601   11.498  9.268   1.00 0.00 ? 62 LEU A CA  5  
ATOM   3412  C  C   . LEU A 1 62 ? -0.015  12.871  9.424   1.00 0.00 ? 62 LEU A C   5  
ATOM   3413  O  O   . LEU A 1 62 ? -1.117  13.041  9.961   1.00 0.00 ? 62 LEU A O   5  
ATOM   3414  C  CB  . LEU A 1 62 ? 1.738   11.262  10.298  1.00 0.00 ? 62 LEU A CB  5  
ATOM   3415  C  CG  . LEU A 1 62 ? 1.420   10.456  11.588  1.00 0.00 ? 62 LEU A CG  5  
ATOM   3416  C  CD1 . LEU A 1 62 ? 1.871   11.244  12.826  1.00 0.00 ? 62 LEU A CD1 5  
ATOM   3417  C  CD2 . LEU A 1 62 ? -0.068  10.093  11.719  1.00 0.00 ? 62 LEU A CD2 5  
ATOM   3418  N  N   . ALA A 1 63 ? 0.801   14.003  8.930   1.00 0.00 ? 63 ALA A N   5  
ATOM   3419  C  CA  . ALA A 1 63 ? 0.280   15.364  8.840   1.00 0.00 ? 63 ALA A CA  5  
ATOM   3420  C  C   . ALA A 1 63 ? -1.022  15.398  8.076   1.00 0.00 ? 63 ALA A C   5  
ATOM   3421  O  O   . ALA A 1 63 ? -1.847  16.309  8.235   1.00 0.00 ? 63 ALA A O   5  
ATOM   3422  C  CB  . ALA A 1 63 ? 1.365   16.247  8.195   1.00 0.00 ? 63 ALA A CB  5  
ATOM   3423  N  N   . ALA A 1 64 ? -1.280  14.266  7.158   1.00 0.00 ? 64 ALA A N   5  
ATOM   3424  C  CA  . ALA A 1 64 ? -2.567  14.096  6.489   1.00 0.00 ? 64 ALA A CA  5  
ATOM   3425  C  C   . ALA A 1 64 ? -3.612  13.662  7.501   1.00 0.00 ? 64 ALA A C   5  
ATOM   3426  O  O   . ALA A 1 64 ? -4.755  14.134  7.525   1.00 0.00 ? 64 ALA A O   5  
ATOM   3427  C  CB  . ALA A 1 64 ? -2.379  13.076  5.356   1.00 0.00 ? 64 ALA A CB  5  
ATOM   3428  N  N   . GLY A 1 65 ? -3.149  12.637  8.468   1.00 0.00 ? 65 GLY A N   5  
ATOM   3429  C  CA  . GLY A 1 65 ? -3.970  12.213  9.602   1.00 0.00 ? 65 GLY A CA  5  
ATOM   3430  C  C   . GLY A 1 65 ? -4.533  10.828  9.318   1.00 0.00 ? 65 GLY A C   5  
ATOM   3431  O  O   . GLY A 1 65 ? -5.674  10.485  9.646   1.00 0.00 ? 65 GLY A O   5  
ATOM   3432  N  N   . PHE A 1 66 ? -3.618  9.931   8.579   1.00 0.00 ? 66 PHE A N   5  
ATOM   3433  C  CA  . PHE A 1 66 ? -4.029  8.636   8.047   1.00 0.00 ? 66 PHE A CA  5  
ATOM   3434  C  C   . PHE A 1 66 ? -3.554  7.499   8.917   1.00 0.00 ? 66 PHE A C   5  
ATOM   3435  O  O   . PHE A 1 66 ? -3.169  7.724   10.092  1.00 0.00 ? 66 PHE A O   5  
ATOM   3436  C  CB  . PHE A 1 66 ? -3.461  8.482   6.598   1.00 0.00 ? 66 PHE A CB  5  
ATOM   3437  C  CG  . PHE A 1 66 ? -4.230  7.519   5.683   1.00 0.00 ? 66 PHE A CG  5  
ATOM   3438  C  CD1 . PHE A 1 66 ? -5.573  7.237   5.978   1.00 0.00 ? 66 PHE A CD1 5  
ATOM   3439  C  CD2 . PHE A 1 66 ? -3.620  6.902   4.590   1.00 0.00 ? 66 PHE A CD2 5  
ATOM   3440  C  CE1 . PHE A 1 66 ? -6.295  6.354   5.183   1.00 0.00 ? 66 PHE A CE1 5  
ATOM   3441  C  CE2 . PHE A 1 66 ? -4.345  6.017   3.795   1.00 0.00 ? 66 PHE A CE2 5  
ATOM   3442  C  CZ  . PHE A 1 66 ? -5.678  5.743   4.094   1.00 0.00 ? 66 PHE A CZ  5  
ATOM   3443  N  N   . ARG A 1 67 ? -3.588  6.120   8.384   1.00 0.00 ? 67 ARG A N   5  
ATOM   3444  C  CA  . ARG A 1 67 ? -3.103  4.983   9.174   1.00 0.00 ? 67 ARG A CA  5  
ATOM   3445  C  C   . ARG A 1 67 ? -1.690  4.598   8.815   1.00 0.00 ? 67 ARG A C   5  
ATOM   3446  O  O   . ARG A 1 67 ? -1.392  4.171   7.692   1.00 0.00 ? 67 ARG A O   5  
ATOM   3447  C  CB  . ARG A 1 67 ? -4.080  3.788   9.010   1.00 0.00 ? 67 ARG A CB  5  
ATOM   3448  C  CG  . ARG A 1 67 ? -3.556  2.437   9.569   1.00 0.00 ? 67 ARG A CG  5  
ATOM   3449  C  CD  . ARG A 1 67 ? -2.615  2.619   10.767  1.00 0.00 ? 67 ARG A CD  5  
ATOM   3450  N  NE  . ARG A 1 67 ? -3.378  3.253   11.873  1.00 0.00 ? 67 ARG A NE  5  
ATOM   3451  C  CZ  . ARG A 1 67 ? -4.071  2.606   12.800  1.00 0.00 ? 67 ARG A CZ  5  
ATOM   3452  N  NH1 . ARG A 1 67 ? -4.179  1.312   12.866  1.00 0.00 ? 67 ARG A NH1 5  
ATOM   3453  N  NH2 . ARG A 1 67 ? -4.674  3.311   13.690  1.00 0.00 ? 67 ARG A NH2 5  
ATOM   3454  N  N   . PRO A 1 68 ? -0.687  4.720   9.897   1.00 0.00 ? 68 PRO A N   5  
ATOM   3455  C  CA  . PRO A 1 68 ? 0.809   4.423   9.801   1.00 0.00 ? 68 PRO A CA  5  
ATOM   3456  C  C   . PRO A 1 68 ? 1.154   2.987   9.470   1.00 0.00 ? 68 PRO A C   5  
ATOM   3457  O  O   . PRO A 1 68 ? 1.095   2.101   10.346  1.00 0.00 ? 68 PRO A O   5  
ATOM   3458  C  CB  . PRO A 1 68 ? 1.419   4.755   11.162  1.00 0.00 ? 68 PRO A CB  5  
ATOM   3459  C  CG  . PRO A 1 68 ? 0.218   4.578   12.103  1.00 0.00 ? 68 PRO A CG  5  
ATOM   3460  C  CD  . PRO A 1 68 ? -0.950  5.158   11.291  1.00 0.00 ? 68 PRO A CD  5  
ATOM   3461  N  N   . CYS A 1 69 ? 1.584   2.670   8.092   1.00 0.00 ? 69 CYS A N   5  
ATOM   3462  C  CA  . CYS A 1 69 ? 1.947   1.318   7.661   1.00 0.00 ? 69 CYS A CA  5  
ATOM   3463  C  C   . CYS A 1 69 ? 3.426   1.268   7.323   1.00 0.00 ? 69 CYS A C   5  
ATOM   3464  O  O   . CYS A 1 69 ? 3.909   1.645   6.248   1.00 0.00 ? 69 CYS A O   5  
ATOM   3465  C  CB  . CYS A 1 69 ? 0.983   0.910   6.536   1.00 0.00 ? 69 CYS A CB  5  
ATOM   3466  S  SG  . CYS A 1 69 ? 0.652   -0.858  6.428   1.00 0.00 ? 69 CYS A SG  5  
ATOM   3467  N  N   . LYS A 1 70 ? 4.297   0.761   8.427   1.00 0.00 ? 70 LYS A N   5  
ATOM   3468  C  CA  . LYS A 1 70 ? 5.746   0.636   8.313   1.00 0.00 ? 70 LYS A CA  5  
ATOM   3469  C  C   . LYS A 1 70 ? 6.103   -0.711  7.725   1.00 0.00 ? 70 LYS A C   5  
ATOM   3470  O  O   . LYS A 1 70 ? 6.249   -0.848  6.493   1.00 0.00 ? 70 LYS A O   5  
ATOM   3471  C  CB  . LYS A 1 70 ? 6.395   0.836   9.709   1.00 0.00 ? 70 LYS A CB  5  
ATOM   3472  C  CG  . LYS A 1 70 ? 7.943   0.769   9.694   1.00 0.00 ? 70 LYS A CG  5  
ATOM   3473  C  CD  . LYS A 1 70 ? 8.648   2.027   10.209  1.00 0.00 ? 70 LYS A CD  5  
ATOM   3474  C  CE  . LYS A 1 70 ? 8.843   1.914   11.727  1.00 0.00 ? 70 LYS A CE  5  
ATOM   3475  N  NZ  . LYS A 1 70 ? 7.564   2.180   12.409  1.00 0.00 ? 70 LYS A NZ  5  
ATOM   3476  N  N   . ARG A 1 71 ? 6.308   -1.837  8.659   1.00 0.00 ? 71 ARG A N   5  
ATOM   3477  C  CA  . ARG A 1 71 ? 6.427   -3.216  8.155   1.00 0.00 ? 71 ARG A CA  5  
ATOM   3478  C  C   . ARG A 1 71 ? 5.149   -3.536  7.398   1.00 0.00 ? 71 ARG A C   5  
ATOM   3479  O  O   . ARG A 1 71 ? 5.121   -3.656  6.168   1.00 0.00 ? 71 ARG A O   5  
ATOM   3480  C  CB  . ARG A 1 71 ? 6.666   -4.174  9.344   1.00 0.00 ? 71 ARG A CB  5  
ATOM   3481  C  CG  . ARG A 1 71 ? 6.800   -5.675  8.969   1.00 0.00 ? 71 ARG A CG  5  
ATOM   3482  C  CD  . ARG A 1 71 ? 5.556   -6.490  9.345   1.00 0.00 ? 71 ARG A CD  5  
ATOM   3483  N  NE  . ARG A 1 71 ? 5.986   -7.667  10.142  1.00 0.00 ? 71 ARG A NE  5  
ATOM   3484  C  CZ  . ARG A 1 71 ? 6.388   -7.637  11.406  1.00 0.00 ? 71 ARG A CZ  5  
ATOM   3485  N  NH1 . ARG A 1 71 ? 6.466   -6.557  12.125  1.00 0.00 ? 71 ARG A NH1 5  
ATOM   3486  N  NH2 . ARG A 1 71 ? 6.721   -8.754  11.950  1.00 0.00 ? 71 ARG A NH2 5  
ATOM   3487  N  N   . CYS A 1 72 ? 3.936   -3.653  8.236   1.00 0.00 ? 72 CYS A N   5  
ATOM   3488  C  CA  . CYS A 1 72 ? 2.588   -3.724  7.692   1.00 0.00 ? 72 CYS A CA  5  
ATOM   3489  C  C   . CYS A 1 72 ? 1.559   -3.869  8.793   1.00 0.00 ? 72 CYS A C   5  
ATOM   3490  O  O   . CYS A 1 72 ? 0.910   -4.915  8.941   1.00 0.00 ? 72 CYS A O   5  
ATOM   3491  C  CB  . CYS A 1 72 ? 2.501   -4.837  6.630   1.00 0.00 ? 72 CYS A CB  5  
ATOM   3492  S  SG  . CYS A 1 72 ? 2.320   -4.129  4.979   1.00 0.00 ? 72 CYS A SG  5  
ATOM   3493  N  N   . GLN A 1 73 ? 1.401   -2.718  9.699   1.00 0.00 ? 73 GLN A N   5  
ATOM   3494  C  CA  . GLN A 1 73 ? 0.566   -2.756  10.921  1.00 0.00 ? 73 GLN A CA  5  
ATOM   3495  C  C   . GLN A 1 73 ? -0.710  -3.517  10.709  1.00 0.00 ? 73 GLN A C   5  
ATOM   3496  O  O   . GLN A 1 73 ? -0.967  -4.565  11.325  1.00 0.00 ? 73 GLN A O   5  
ATOM   3497  C  CB  . GLN A 1 73 ? 0.281   -1.293  11.357  1.00 0.00 ? 73 GLN A CB  5  
ATOM   3498  C  CG  . GLN A 1 73 ? 1.195   -0.714  12.487  1.00 0.00 ? 73 GLN A CG  5  
ATOM   3499  C  CD  . GLN A 1 73 ? 2.637   -1.220  12.615  1.00 0.00 ? 73 GLN A CD  5  
ATOM   3500  O  OE1 . GLN A 1 73 ? 3.572   -0.588  12.149  1.00 0.00 ? 73 GLN A OE1 5  
ATOM   3501  N  NE2 . GLN A 1 73 ? 2.883   -2.340  13.247  1.00 0.00 ? 73 GLN A NE2 5  
ATOM   3502  N  N   . PRO A 1 74 ? -1.658  -2.941  9.732   1.00 0.00 ? 74 PRO A N   5  
ATOM   3503  C  CA  . PRO A 1 74 ? -3.023  -3.515  9.344   1.00 0.00 ? 74 PRO A CA  5  
ATOM   3504  C  C   . PRO A 1 74 ? -3.016  -4.994  9.009   1.00 0.00 ? 74 PRO A C   5  
ATOM   3505  O  O   . PRO A 1 74 ? -1.970  -5.657  9.025   1.00 0.00 ? 74 PRO A O   5  
ATOM   3506  C  CB  . PRO A 1 74 ? -3.474  -2.746  8.108   1.00 0.00 ? 74 PRO A CB  5  
ATOM   3507  C  CG  . PRO A 1 74 ? -2.853  -1.366  8.379   1.00 0.00 ? 74 PRO A CG  5  
ATOM   3508  C  CD  . PRO A 1 74 ? -1.468  -1.700  8.944   1.00 0.00 ? 74 PRO A CD  5  
ATOM   3509  N  N   . ASP A 1 75 ? -4.319  -5.578  8.629   1.00 0.00 ? 75 ASP A N   5  
ATOM   3510  C  CA  . ASP A 1 75 ? -4.468  -6.979  8.247   1.00 0.00 ? 75 ASP A CA  5  
ATOM   3511  C  C   . ASP A 1 75 ? -5.926  -7.378  8.227   1.00 0.00 ? 75 ASP A C   5  
ATOM   3512  O  O   . ASP A 1 75 ? -6.477  -7.881  9.216   1.00 0.00 ? 75 ASP A O   5  
ATOM   3513  C  CB  . ASP A 1 75 ? -3.634  -7.892  9.182   1.00 0.00 ? 75 ASP A CB  5  
ATOM   3514  C  CG  . ASP A 1 75 ? -3.070  -9.180  8.563   1.00 0.00 ? 75 ASP A CG  5  
ATOM   3515  O  OD1 . ASP A 1 75 ? -3.727  -10.204 8.441   1.00 0.00 ? 75 ASP A OD1 5  
ATOM   3516  O  OD2 . ASP A 1 75 ? -1.775  -9.046  8.148   1.00 0.00 ? 75 ASP A OD2 5  
ATOM   3517  N  N   . LYS A 1 76 ? -6.651  -7.153  6.958   1.00 0.00 ? 76 LYS A N   5  
ATOM   3518  C  CA  . LYS A 1 76 ? -8.095  -7.336  6.848   1.00 0.00 ? 76 LYS A CA  5  
ATOM   3519  C  C   . LYS A 1 76 ? -8.447  -8.804  6.770   1.00 0.00 ? 76 LYS A C   5  
ATOM   3520  O  O   . LYS A 1 76 ? -9.612  -9.199  6.916   1.00 0.00 ? 76 LYS A O   5  
ATOM   3521  C  CB  . LYS A 1 76 ? -8.627  -6.566  5.610   1.00 0.00 ? 76 LYS A CB  5  
ATOM   3522  C  CG  . LYS A 1 76 ? -8.222  -7.206  4.258   1.00 0.00 ? 76 LYS A CG  5  
ATOM   3523  C  CD  . LYS A 1 76 ? -8.133  -6.227  3.084   1.00 0.00 ? 76 LYS A CD  5  
ATOM   3524  C  CE  . LYS A 1 76 ? -8.260  -7.002  1.766   1.00 0.00 ? 76 LYS A CE  5  
ATOM   3525  N  NZ  . LYS A 1 76 ? -8.686  -6.083  0.696   1.00 0.00 ? 76 LYS A NZ  5  
ATOM   3526  N  N   . ALA A 1 77 ? -7.338  -9.730  6.464   1.00 0.00 ? 77 ALA A N   5  
ATOM   3527  C  CA  . ALA A 1 77 ? -7.452  -11.186 6.523   1.00 0.00 ? 77 ALA A CA  5  
ATOM   3528  C  C   . ALA A 1 77 ? -8.581  -11.662 7.401   1.00 0.00 ? 77 ALA A C   5  
ATOM   3529  O  O   . ALA A 1 77 ? -9.691  -11.959 6.938   1.00 0.00 ? 77 ALA A O   5  
ATOM   3530  C  CB  . ALA A 1 77 ? -6.079  -11.727 6.989   1.00 0.00 ? 77 ALA A CB  5  
ATOM   3531  N  N   . ASN A 1 78 ? -8.303  -11.720 8.855   1.00 0.00 ? 78 ASN A N   5  
ATOM   3532  C  CA  . ASN A 1 78 ? -9.349  -12.016 9.832   1.00 0.00 ? 78 ASN A CA  5  
ATOM   3533  C  C   . ASN A 1 78 ? -8.760  -12.206 11.209  1.00 0.00 ? 78 ASN A C   5  
ATOM   3534  O  O   . ASN A 1 78 ? -8.903  -13.248 11.862  1.00 0.00 ? 78 ASN A O   5  
ATOM   3535  C  CB  . ASN A 1 78 ? -10.152 -13.264 9.368   1.00 0.00 ? 78 ASN A CB  5  
ATOM   3536  C  CG  . ASN A 1 78 ? -11.628 -13.047 9.008   1.00 0.00 ? 78 ASN A CG  5  
ATOM   3537  O  OD1 . ASN A 1 78 ? -12.179 -13.664 8.109   1.00 0.00 ? 78 ASN A OD1 5  
ATOM   3538  N  ND2 . ASN A 1 78 ? -12.312 -12.160 9.678   1.00 0.00 ? 78 ASN A ND2 5  
ATOM   3539  N  N   . PRO A 1 79 ? -8.013  -11.046 11.753  1.00 0.00 ? 79 PRO A N   5  
ATOM   3540  C  CA  . PRO A 1 79 ? -7.309  -10.977 13.109  1.00 0.00 ? 79 PRO A CA  5  
ATOM   3541  C  C   . PRO A 1 79 ? -8.220  -10.871 14.316  1.00 0.00 ? 79 PRO A C   5  
ATOM   3542  O  O   . PRO A 1 79 ? -7.851  -11.260 15.434  1.00 0.00 ? 79 PRO A O   5  
ATOM   3543  C  CB  . PRO A 1 79 ? -6.424  -9.736  13.065  1.00 0.00 ? 79 PRO A CB  5  
ATOM   3544  C  CG  . PRO A 1 79 ? -7.272  -8.807  12.181  1.00 0.00 ? 79 PRO A CG  5  
ATOM   3545  C  CD  . PRO A 1 79 ? -7.805  -9.738  11.087  1.00 0.00 ? 79 PRO A CD  5  
ATOM   3546  N  N   . ARG A 1 80 ? -9.543  -10.247 14.104  1.00 0.00 ? 80 ARG A N   5  
ATOM   3547  C  CA  . ARG A 1 80 ? -10.584 -10.229 15.126  1.00 0.00 ? 80 ARG A CA  5  
ATOM   3548  C  C   . ARG A 1 80 ? -10.446 -9.042  16.049  1.00 0.00 ? 80 ARG A C   5  
ATOM   3549  O  O   . ARG A 1 80 ? -11.415 -8.614  16.700  1.00 0.00 ? 80 ARG A O   5  
ATOM   3550  C  CB  . ARG A 1 80 ? -10.558 -11.568 15.912  1.00 0.00 ? 80 ARG A CB  5  
ATOM   3551  C  CG  . ARG A 1 80 ? -11.905 -11.971 16.569  1.00 0.00 ? 80 ARG A CG  5  
ATOM   3552  C  CD  . ARG A 1 80 ? -11.876 -13.392 17.146  1.00 0.00 ? 80 ARG A CD  5  
ATOM   3553  N  NE  . ARG A 1 80 ? -12.284 -14.338 16.077  1.00 0.00 ? 80 ARG A NE  5  
ATOM   3554  C  CZ  . ARG A 1 80 ? -13.527 -14.730 15.829  1.00 0.00 ? 80 ARG A CZ  5  
ATOM   3555  N  NH1 . ARG A 1 80 ? -14.568 -14.338 16.502  1.00 0.00 ? 80 ARG A NH1 5  
ATOM   3556  N  NH2 . ARG A 1 80 ? -13.708 -15.553 14.857  1.00 0.00 ? 80 ARG A NH2 5  
ATOM   3557  N  N   . GLN A 1 81 ? -9.121  -8.389  16.116  1.00 0.00 ? 81 GLN A N   5  
ATOM   3558  C  CA  . GLN A 1 81 ? -8.914  -7.138  16.842  1.00 0.00 ? 81 GLN A CA  5  
ATOM   3559  C  C   . GLN A 1 81 ? -9.229  -7.305  18.309  1.00 0.00 ? 81 GLN A C   5  
ATOM   3560  O  O   . GLN A 1 81 ? -10.347 -7.033  18.770  1.00 0.00 ? 81 GLN A O   5  
ATOM   3561  C  CB  . GLN A 1 81 ? -9.803  -6.046  16.207  1.00 0.00 ? 81 GLN A CB  5  
ATOM   3562  C  CG  . GLN A 1 81 ? -10.088 -6.188  14.675  1.00 0.00 ? 81 GLN A CG  5  
ATOM   3563  C  CD  . GLN A 1 81 ? -10.923 -5.115  13.968  1.00 0.00 ? 81 GLN A CD  5  
ATOM   3564  O  OE1 . GLN A 1 81 ? -10.525 -4.574  12.948  1.00 0.00 ? 81 GLN A OE1 5  
ATOM   3565  N  NE2 . GLN A 1 81 ? -12.083 -4.759  14.459  1.00 0.00 ? 81 GLN A NE2 5  
ATOM   3566  N  N   . HIS A 1 82 ? -8.124  -7.776  19.173  1.00 0.00 ? 82 HIS A N   5  
ATOM   3567  C  CA  . HIS A 1 82 ? -8.272  -7.887  20.621  1.00 0.00 ? 82 HIS A CA  5  
ATOM   3568  C  C   . HIS A 1 82 ? -7.832  -6.616  21.308  1.00 0.00 ? 82 HIS A C   5  
ATOM   3569  O  O   . HIS A 1 82 ? -6.759  -6.059  21.035  1.00 0.00 ? 82 HIS A O   5  
ATOM   3570  C  CB  . HIS A 1 82 ? -7.412  -9.085  21.055  1.00 0.00 ? 82 HIS A CB  5  
ATOM   3571  C  CG  . HIS A 1 82 ? -6.076  -8.684  21.608  1.00 0.00 ? 82 HIS A CG  5  
ATOM   3572  N  ND1 . HIS A 1 82 ? -5.765  -8.528  22.957  1.00 0.00 ? 82 HIS A ND1 5  
ATOM   3573  C  CD2 . HIS A 1 82 ? -4.978  -8.421  20.800  1.00 0.00 ? 82 HIS A CD2 5  
ATOM   3574  C  CE1 . HIS A 1 82 ? -4.470  -8.175  22.855  1.00 0.00 ? 82 HIS A CE1 5  
ATOM   3575  N  NE2 . HIS A 1 82 ? -3.925  -8.087  21.611  1.00 0.00 ? 82 HIS A NE2 5  
ATOM   3576  N  N   . ARG A 1 83 ? -8.777  -6.049  22.296  1.00 0.00 ? 83 ARG A N   5  
ATOM   3577  C  CA  . ARG A 1 83 ? -8.438  -4.924  23.162  1.00 0.00 ? 83 ARG A CA  5  
ATOM   3578  C  C   . ARG A 1 83 ? -7.703  -3.844  22.406  1.00 0.00 ? 83 ARG A C   5  
ATOM   3579  O  O   . ARG A 1 83 ? -8.301  -3.121  21.583  1.00 0.00 ? 83 ARG A O   5  
ATOM   3580  C  CB  . ARG A 1 83 ? -7.636  -5.450  24.382  1.00 0.00 ? 83 ARG A CB  5  
ATOM   3581  C  CG  . ARG A 1 83 ? -7.426  -4.418  25.522  1.00 0.00 ? 83 ARG A CG  5  
ATOM   3582  C  CD  . ARG A 1 83 ? -8.599  -4.388  26.511  1.00 0.00 ? 83 ARG A CD  5  
ATOM   3583  N  NE  . ARG A 1 83 ? -8.057  -4.149  27.873  1.00 0.00 ? 83 ARG A NE  5  
ATOM   3584  C  CZ  . ARG A 1 83 ? -8.763  -3.756  28.924  1.00 0.00 ? 83 ARG A CZ  5  
ATOM   3585  N  NH1 . ARG A 1 83 ? -10.041 -3.518  28.903  1.00 0.00 ? 83 ARG A NH1 5  
ATOM   3586  N  NH2 . ARG A 1 83 ? -8.135  -3.601  30.036  1.00 0.00 ? 83 ARG A NH2 5  
ATOM   3587  N  N   . LEU A 1 84 ? -6.251  -3.692  22.641  1.00 0.00 ? 84 LEU A N   5  
ATOM   3588  C  CA  . LEU A 1 84 ? -5.427  -2.792  21.833  1.00 0.00 ? 84 LEU A CA  5  
ATOM   3589  C  C   . LEU A 1 84 ? -6.082  -1.440  21.680  1.00 0.00 ? 84 LEU A C   5  
ATOM   3590  O  O   . LEU A 1 84 ? -6.262  -0.924  20.568  1.00 0.00 ? 84 LEU A O   5  
ATOM   3591  C  CB  . LEU A 1 84 ? -5.125  -3.427  20.447  1.00 0.00 ? 84 LEU A CB  5  
ATOM   3592  C  CG  . LEU A 1 84 ? -3.663  -3.853  20.141  1.00 0.00 ? 84 LEU A CG  5  
ATOM   3593  C  CD1 . LEU A 1 84 ? -3.425  -3.871  18.625  1.00 0.00 ? 84 LEU A CD1 5  
ATOM   3594  C  CD2 . LEU A 1 84 ? -2.626  -2.941  20.818  1.00 0.00 ? 84 LEU A CD2 5  
ATOM   3595  N  N   . ASP A 1 85 ? -6.488  -0.762  22.930  1.00 0.00 ? 85 ASP A N   5  
ATOM   3596  C  CA  . ASP A 1 85 ? -7.115  0.556   22.927  1.00 0.00 ? 85 ASP A CA  5  
ATOM   3597  C  C   . ASP A 1 85 ? -6.077  1.649   23.023  1.00 0.00 ? 85 ASP A C   5  
ATOM   3598  O  O   . ASP A 1 85 ? -5.025  1.495   23.657  1.00 0.00 ? 85 ASP A O   5  
ATOM   3599  C  CB  . ASP A 1 85 ? -8.166  0.655   24.063  1.00 0.00 ? 85 ASP A CB  5  
ATOM   3600  C  CG  . ASP A 1 85 ? -8.795  2.036   24.302  1.00 0.00 ? 85 ASP A CG  5  
ATOM   3601  O  OD1 . ASP A 1 85 ? -9.792  2.425   23.712  1.00 0.00 ? 85 ASP A OD1 5  
ATOM   3602  O  OD2 . ASP A 1 85 ? -8.112  2.776   25.226  1.00 0.00 ? 85 ASP A OD2 5  
ATOM   3603  N  N   . LYS A 1 86 ? -6.380  2.905   22.303  1.00 0.00 ? 86 LYS A N   5  
ATOM   3604  C  CA  . LYS A 1 86 ? -5.412  3.994   22.205  1.00 0.00 ? 86 LYS A CA  5  
ATOM   3605  C  C   . LYS A 1 86 ? -5.328  4.762   23.503  1.00 0.00 ? 86 LYS A C   5  
ATOM   3606  O  O   . LYS A 1 86 ? -6.341  5.069   24.146  1.00 0.00 ? 86 LYS A O   5  
ATOM   3607  C  CB  . LYS A 1 86 ? -5.804  4.930   21.029  1.00 0.00 ? 86 LYS A CB  5  
ATOM   3608  C  CG  . LYS A 1 86 ? -6.943  5.919   21.383  1.00 0.00 ? 86 LYS A CG  5  
ATOM   3609  C  CD  . LYS A 1 86 ? -7.284  6.928   20.283  1.00 0.00 ? 86 LYS A CD  5  
ATOM   3610  C  CE  . LYS A 1 86 ? -6.436  8.193   20.476  1.00 0.00 ? 86 LYS A CE  5  
ATOM   3611  N  NZ  . LYS A 1 86 ? -7.179  9.362   19.971  1.00 0.00 ? 86 LYS A NZ  5  
ATOM   3612  N  N   . ILE A 1 87 ? -3.970  5.129   23.960  1.00 0.00 ? 87 ILE A N   5  
ATOM   3613  C  CA  . ILE A 1 87 ? -3.744  5.875   25.195  1.00 0.00 ? 87 ILE A CA  5  
ATOM   3614  C  C   . ILE A 1 87 ? -2.767  7.005   24.973  1.00 0.00 ? 87 ILE A C   5  
ATOM   3615  O  O   . ILE A 1 87 ? -3.024  8.167   25.318  1.00 0.00 ? 87 ILE A O   5  
ATOM   3616  C  CB  . ILE A 1 87 ? -3.283  4.920   26.370  1.00 0.00 ? 87 ILE A CB  5  
ATOM   3617  C  CG1 . ILE A 1 87 ? -3.761  5.358   27.791  1.00 0.00 ? 87 ILE A CG1 5  
ATOM   3618  C  CG2 . ILE A 1 87 ? -1.736  4.723   26.418  1.00 0.00 ? 87 ILE A CG2 5  
ATOM   3619  C  CD1 . ILE A 1 87 ? -4.004  4.218   28.801  1.00 0.00 ? 87 ILE A CD1 5  
ATOM   3620  N  N   . THR A 1 88 ? -1.485  6.646   24.328  1.00 0.00 ? 88 THR A N   5  
ATOM   3621  C  CA  . THR A 1 88 ? -0.407  7.616   24.156  1.00 0.00 ? 88 THR A CA  5  
ATOM   3622  C  C   . THR A 1 88 ? -0.054  7.778   22.696  1.00 0.00 ? 88 THR A C   5  
ATOM   3623  O  O   . THR A 1 88 ? -0.276  6.883   21.869  1.00 0.00 ? 88 THR A O   5  
ATOM   3624  C  CB  . THR A 1 88 ? 0.851   7.194   24.986  1.00 0.00 ? 88 THR A CB  5  
ATOM   3625  O  OG1 . THR A 1 88 ? 1.771   8.275   25.081  1.00 0.00 ? 88 THR A OG1 5  
ATOM   3626  C  CG2 . THR A 1 88 ? 1.686   6.025   24.419  1.00 0.00 ? 88 THR A CG2 5  
ATOM   3627  N  N   . HIS A 1 89 ? 0.586   9.055   22.314  1.00 0.00 ? 89 HIS A N   5  
ATOM   3628  C  CA  . HIS A 1 89 ? 0.972   9.347   20.936  1.00 0.00 ? 89 HIS A CA  5  
ATOM   3629  C  C   . HIS A 1 89 ? 2.457   9.155   20.735  1.00 0.00 ? 89 HIS A C   5  
ATOM   3630  O  O   . HIS A 1 89 ? 3.283   9.980   21.150  1.00 0.00 ? 89 HIS A O   5  
ATOM   3631  C  CB  . HIS A 1 89 ? 0.581   10.812  20.679  1.00 0.00 ? 89 HIS A CB  5  
ATOM   3632  C  CG  . HIS A 1 89 ? 0.657   11.176  19.225  1.00 0.00 ? 89 HIS A CG  5  
ATOM   3633  N  ND1 . HIS A 1 89 ? 0.540   10.291  18.157  1.00 0.00 ? 89 HIS A ND1 5  
ATOM   3634  C  CD2 . HIS A 1 89 ? 0.858   12.478  18.788  1.00 0.00 ? 89 HIS A CD2 5  
ATOM   3635  C  CE1 . HIS A 1 89 ? 0.682   11.150  17.130  1.00 0.00 ? 89 HIS A CE1 5  
ATOM   3636  N  NE2 . HIS A 1 89 ? 0.876   12.466  17.417  1.00 0.00 ? 89 HIS A NE2 5  
ATOM   3637  N  N   . ALA A 1 90 ? 2.870   7.917   20.040  1.00 0.00 ? 90 ALA A N   5  
ATOM   3638  C  CA  . ALA A 1 90 ? 4.264   7.647   19.702  1.00 0.00 ? 90 ALA A CA  5  
ATOM   3639  C  C   . ALA A 1 90 ? 4.373   6.956   18.363  1.00 0.00 ? 90 ALA A C   5  
ATOM   3640  O  O   . ALA A 1 90 ? 3.581   7.195   17.441  1.00 0.00 ? 90 ALA A O   5  
ATOM   3641  C  CB  . ALA A 1 90 ? 4.872   6.822   20.850  1.00 0.00 ? 90 ALA A CB  5  
ATOM   3642  N  N   . CYS A 1 91 ? 5.489   5.998   18.209  1.00 0.00 ? 91 CYS A N   5  
ATOM   3643  C  CA  . CYS A 1 91 ? 5.642   5.175   17.013  1.00 0.00 ? 91 CYS A CA  5  
ATOM   3644  C  C   . CYS A 1 91 ? 5.180   3.759   17.269  1.00 0.00 ? 91 CYS A C   5  
ATOM   3645  O  O   . CYS A 1 91 ? 5.766   2.784   16.779  1.00 0.00 ? 91 CYS A O   5  
ATOM   3646  C  CB  . CYS A 1 91 ? 7.113   5.240   16.557  1.00 0.00 ? 91 CYS A CB  5  
ATOM   3647  S  SG  . CYS A 1 91 ? 7.441   6.784   15.677  1.00 0.00 ? 91 CYS A SG  5  
ATOM   3648  N  N   . ARG A 1 92 ? 4.005   3.603   18.153  1.00 0.00 ? 92 ARG A N   5  
ATOM   3649  C  CA  . ARG A 1 92 ? 3.445   2.292   18.471  1.00 0.00 ? 92 ARG A CA  5  
ATOM   3650  C  C   . ARG A 1 92 ? 2.144   2.429   19.226  1.00 0.00 ? 92 ARG A C   5  
ATOM   3651  O  O   . ARG A 1 92 ? 1.566   3.508   19.339  1.00 0.00 ? 92 ARG A O   5  
ATOM   3652  C  CB  . ARG A 1 92 ? 4.491   1.483   19.286  1.00 0.00 ? 92 ARG A CB  5  
ATOM   3653  C  CG  . ARG A 1 92 ? 4.683   1.953   20.752  1.00 0.00 ? 92 ARG A CG  5  
ATOM   3654  C  CD  . ARG A 1 92 ? 6.051   1.557   21.323  1.00 0.00 ? 92 ARG A CD  5  
ATOM   3655  N  NE  . ARG A 1 92 ? 6.328   0.149   20.938  1.00 0.00 ? 92 ARG A NE  5  
ATOM   3656  C  CZ  . ARG A 1 92 ? 5.734   -0.920  21.450  1.00 0.00 ? 92 ARG A CZ  5  
ATOM   3657  N  NH1 . ARG A 1 92 ? 4.818   -0.880  22.371  1.00 0.00 ? 92 ARG A NH1 5  
ATOM   3658  N  NH2 . ARG A 1 92 ? 6.094   -2.070  21.002  1.00 0.00 ? 92 ARG A NH2 5  
ATOM   3659  O  OXT . ARG A 1 92 ? 1.623   1.226   19.799  1.00 0.00 ? 92 ARG A OXT 5  
HETATM 3660  ZN ZN  . ZN  B 2 .  ? 1.617   -2.012  4.725   1.00 0.00 ? 93 ZN  A ZN  5  
ATOM   3661  N  N   . MET A 1 1  ? 8.508   11.151  -33.298 1.00 0.00 ? 1  MET A N   6  
ATOM   3662  C  CA  . MET A 1 1  ? 9.373   10.796  -32.176 1.00 0.00 ? 1  MET A CA  6  
ATOM   3663  C  C   . MET A 1 1  ? 9.504   11.951  -31.210 1.00 0.00 ? 1  MET A C   6  
ATOM   3664  O  O   . MET A 1 1  ? 10.600  12.465  -30.948 1.00 0.00 ? 1  MET A O   6  
ATOM   3665  C  CB  . MET A 1 1  ? 8.820   9.532   -31.463 1.00 0.00 ? 1  MET A CB  6  
ATOM   3666  C  CG  . MET A 1 1  ? 7.510   8.953   -32.038 1.00 0.00 ? 1  MET A CG  6  
ATOM   3667  S  SD  . MET A 1 1  ? 6.887   7.656   -30.956 1.00 0.00 ? 1  MET A SD  6  
ATOM   3668  C  CE  . MET A 1 1  ? 5.225   7.523   -31.629 1.00 0.00 ? 1  MET A CE  6  
ATOM   3669  N  N   . LYS A 1 2  ? 8.254   12.409  -30.565 1.00 0.00 ? 2  LYS A N   6  
ATOM   3670  C  CA  . LYS A 1 2  ? 8.204   13.617  -29.747 1.00 0.00 ? 2  LYS A CA  6  
ATOM   3671  C  C   . LYS A 1 2  ? 7.445   13.383  -28.462 1.00 0.00 ? 2  LYS A C   6  
ATOM   3672  O  O   . LYS A 1 2  ? 6.447   12.651  -28.419 1.00 0.00 ? 2  LYS A O   6  
ATOM   3673  C  CB  . LYS A 1 2  ? 7.555   14.767  -30.567 1.00 0.00 ? 2  LYS A CB  6  
ATOM   3674  C  CG  . LYS A 1 2  ? 6.172   14.393  -31.157 1.00 0.00 ? 2  LYS A CG  6  
ATOM   3675  C  CD  . LYS A 1 2  ? 5.701   15.284  -32.310 1.00 0.00 ? 2  LYS A CD  6  
ATOM   3676  C  CE  . LYS A 1 2  ? 5.661   16.743  -31.838 1.00 0.00 ? 2  LYS A CE  6  
ATOM   3677  N  NZ  . LYS A 1 2  ? 4.491   16.944  -30.965 1.00 0.00 ? 2  LYS A NZ  6  
ATOM   3678  N  N   . LYS A 1 3  ? 7.985   14.054  -27.256 1.00 0.00 ? 3  LYS A N   6  
ATOM   3679  C  CA  . LYS A 1 3  ? 7.269   14.064  -25.982 1.00 0.00 ? 3  LYS A CA  6  
ATOM   3680  C  C   . LYS A 1 3  ? 7.259   12.691  -25.355 1.00 0.00 ? 3  LYS A C   6  
ATOM   3681  O  O   . LYS A 1 3  ? 6.776   11.701  -25.925 1.00 0.00 ? 3  LYS A O   6  
ATOM   3682  C  CB  . LYS A 1 3  ? 5.850   14.652  -26.196 1.00 0.00 ? 3  LYS A CB  6  
ATOM   3683  C  CG  . LYS A 1 3  ? 4.676   13.644  -26.156 1.00 0.00 ? 3  LYS A CG  6  
ATOM   3684  C  CD  . LYS A 1 3  ? 3.363   14.170  -26.753 1.00 0.00 ? 3  LYS A CD  6  
ATOM   3685  C  CE  . LYS A 1 3  ? 3.095   15.590  -26.242 1.00 0.00 ? 3  LYS A CE  6  
ATOM   3686  N  NZ  . LYS A 1 3  ? 2.547   15.525  -24.875 1.00 0.00 ? 3  LYS A NZ  6  
ATOM   3687  N  N   . ALA A 1 4  ? 7.908   12.569  -24.026 1.00 0.00 ? 4  ALA A N   6  
ATOM   3688  C  CA  . ALA A 1 4  ? 8.043   11.291  -23.337 1.00 0.00 ? 4  ALA A CA  6  
ATOM   3689  C  C   . ALA A 1 4  ? 6.812   10.984  -22.514 1.00 0.00 ? 4  ALA A C   6  
ATOM   3690  O  O   . ALA A 1 4  ? 5.688   11.382  -22.847 1.00 0.00 ? 4  ALA A O   6  
ATOM   3691  C  CB  . ALA A 1 4  ? 9.323   11.351  -22.485 1.00 0.00 ? 4  ALA A CB  6  
ATOM   3692  N  N   . THR A 1 5  ? 7.036   10.214  -21.271 1.00 0.00 ? 5  THR A N   6  
ATOM   3693  C  CA  . THR A 1 5  ? 5.966   9.952   -20.313 1.00 0.00 ? 5  THR A CA  6  
ATOM   3694  C  C   . THR A 1 5  ? 6.106   10.829  -19.091 1.00 0.00 ? 5  THR A C   6  
ATOM   3695  O  O   . THR A 1 5  ? 6.905   11.776  -19.055 1.00 0.00 ? 5  THR A O   6  
ATOM   3696  C  CB  . THR A 1 5  ? 5.948   8.440   -19.908 1.00 0.00 ? 5  THR A CB  6  
ATOM   3697  O  OG1 . THR A 1 5  ? 6.928   8.180   -18.911 1.00 0.00 ? 5  THR A OG1 6  
ATOM   3698  C  CG2 . THR A 1 5  ? 6.260   7.427   -21.031 1.00 0.00 ? 5  THR A CG2 6  
ATOM   3699  N  N   . CYS A 1 6  ? 5.266   10.471  -17.928 1.00 0.00 ? 6  CYS A N   6  
ATOM   3700  C  CA  . CYS A 1 6  ? 5.276   11.251  -16.694 1.00 0.00 ? 6  CYS A CA  6  
ATOM   3701  C  C   . CYS A 1 6  ? 6.445   10.864  -15.819 1.00 0.00 ? 6  CYS A C   6  
ATOM   3702  O  O   . CYS A 1 6  ? 6.565   9.720   -15.360 1.00 0.00 ? 6  CYS A O   6  
ATOM   3703  C  CB  . CYS A 1 6  ? 3.922   11.063  -15.983 1.00 0.00 ? 6  CYS A CB  6  
ATOM   3704  S  SG  . CYS A 1 6  ? 2.797   12.421  -16.379 1.00 0.00 ? 6  CYS A SG  6  
ATOM   3705  N  N   . LEU A 1 7  ? 7.443   11.923  -15.549 1.00 0.00 ? 7  LEU A N   6  
ATOM   3706  C  CA  . LEU A 1 7  ? 8.696   11.645  -14.855 1.00 0.00 ? 7  LEU A CA  6  
ATOM   3707  C  C   . LEU A 1 7  ? 8.526   11.704  -13.356 1.00 0.00 ? 7  LEU A C   6  
ATOM   3708  O  O   . LEU A 1 7  ? 9.500   11.589  -12.591 1.00 0.00 ? 7  LEU A O   6  
ATOM   3709  C  CB  . LEU A 1 7  ? 9.808   12.628  -15.325 1.00 0.00 ? 7  LEU A CB  6  
ATOM   3710  C  CG  . LEU A 1 7  ? 10.595  12.278  -16.617 1.00 0.00 ? 7  LEU A CG  6  
ATOM   3711  C  CD1 . LEU A 1 7  ? 11.599  13.393  -16.940 1.00 0.00 ? 7  LEU A CD1 6  
ATOM   3712  C  CD2 . LEU A 1 7  ? 11.330  10.931  -16.519 1.00 0.00 ? 7  LEU A CD2 6  
ATOM   3713  N  N   . THR A 1 8  ? 7.157   11.908  -12.836 1.00 0.00 ? 8  THR A N   6  
ATOM   3714  C  CA  . THR A 1 8  ? 6.898   12.118  -11.412 1.00 0.00 ? 8  THR A CA  6  
ATOM   3715  C  C   . THR A 1 8  ? 5.863   11.142  -10.904 1.00 0.00 ? 8  THR A C   6  
ATOM   3716  O  O   . THR A 1 8  ? 6.110   10.354  -9.979  1.00 0.00 ? 8  THR A O   6  
ATOM   3717  C  CB  . THR A 1 8  ? 6.453   13.594  -11.144 1.00 0.00 ? 8  THR A CB  6  
ATOM   3718  O  OG1 . THR A 1 8  ? 5.711   14.100  -12.246 1.00 0.00 ? 8  THR A OG1 6  
ATOM   3719  C  CG2 . THR A 1 8  ? 7.586   14.624  -10.936 1.00 0.00 ? 8  THR A CG2 6  
ATOM   3720  N  N   . ASP A 1 9  ? 4.556   11.150  -11.595 1.00 0.00 ? 9  ASP A N   6  
ATOM   3721  C  CA  . ASP A 1 9  ? 3.453   10.288  -11.180 1.00 0.00 ? 9  ASP A CA  6  
ATOM   3722  C  C   . ASP A 1 9  ? 3.695   8.859   -11.605 1.00 0.00 ? 9  ASP A C   6  
ATOM   3723  O  O   . ASP A 1 9  ? 3.385   7.895   -10.889 1.00 0.00 ? 9  ASP A O   6  
ATOM   3724  C  CB  . ASP A 1 9  ? 2.109   10.835  -11.727 1.00 0.00 ? 9  ASP A CB  6  
ATOM   3725  C  CG  . ASP A 1 9  ? 1.112   11.376  -10.692 1.00 0.00 ? 9  ASP A CG  6  
ATOM   3726  O  OD1 . ASP A 1 9  ? 1.453   11.822  -9.606  1.00 0.00 ? 9  ASP A OD1 6  
ATOM   3727  O  OD2 . ASP A 1 9  ? -0.183  11.327  -11.128 1.00 0.00 ? 9  ASP A OD2 6  
ATOM   3728  N  N   . ASP A 1 10 ? 4.301   8.669   -12.943 1.00 0.00 ? 10 ASP A N   6  
ATOM   3729  C  CA  . ASP A 1 10 ? 4.456   7.345   -13.537 1.00 0.00 ? 10 ASP A CA  6  
ATOM   3730  C  C   . ASP A 1 10 ? 5.675   6.644   -12.985 1.00 0.00 ? 10 ASP A C   6  
ATOM   3731  O  O   . ASP A 1 10 ? 5.717   5.411   -12.869 1.00 0.00 ? 10 ASP A O   6  
ATOM   3732  C  CB  . ASP A 1 10 ? 4.492   7.445   -15.084 1.00 0.00 ? 10 ASP A CB  6  
ATOM   3733  C  CG  . ASP A 1 10 ? 3.365   6.732   -15.848 1.00 0.00 ? 10 ASP A CG  6  
ATOM   3734  O  OD1 . ASP A 1 10 ? 2.749   5.781   -15.390 1.00 0.00 ? 10 ASP A OD1 6  
ATOM   3735  O  OD2 . ASP A 1 10 ? 3.118   7.291   -17.071 1.00 0.00 ? 10 ASP A OD2 6  
ATOM   3736  N  N   . GLN A 1 11 ? 6.798   7.505   -12.554 1.00 0.00 ? 11 GLN A N   6  
ATOM   3737  C  CA  . GLN A 1 11 ? 7.962   6.970   -11.852 1.00 0.00 ? 11 GLN A CA  6  
ATOM   3738  C  C   . GLN A 1 11 ? 7.586   6.509   -10.462 1.00 0.00 ? 11 GLN A C   6  
ATOM   3739  O  O   . GLN A 1 11 ? 7.956   5.421   -10.000 1.00 0.00 ? 11 GLN A O   6  
ATOM   3740  C  CB  . GLN A 1 11 ? 9.048   8.066   -11.793 1.00 0.00 ? 11 GLN A CB  6  
ATOM   3741  C  CG  . GLN A 1 11 ? 9.739   8.427   -13.150 1.00 0.00 ? 11 GLN A CG  6  
ATOM   3742  C  CD  . GLN A 1 11 ? 11.043  7.717   -13.535 1.00 0.00 ? 11 GLN A CD  6  
ATOM   3743  O  OE1 . GLN A 1 11 ? 11.397  7.635   -14.700 1.00 0.00 ? 11 GLN A OE1 6  
ATOM   3744  N  NE2 . GLN A 1 11 ? 11.783  7.164   -12.608 1.00 0.00 ? 11 GLN A NE2 6  
ATOM   3745  N  N   . ARG A 1 12 ? 6.765   7.451   -9.671  1.00 0.00 ? 12 ARG A N   6  
ATOM   3746  C  CA  . ARG A 1 12 ? 6.259   7.161   -8.337  1.00 0.00 ? 12 ARG A CA  6  
ATOM   3747  C  C   . ARG A 1 12 ? 5.737   5.751   -8.194  1.00 0.00 ? 12 ARG A C   6  
ATOM   3748  O  O   . ARG A 1 12 ? 6.292   4.866   -7.508  1.00 0.00 ? 12 ARG A O   6  
ATOM   3749  C  CB  . ARG A 1 12 ? 5.098   8.170   -8.039  1.00 0.00 ? 12 ARG A CB  6  
ATOM   3750  C  CG  . ARG A 1 12 ? 5.488   9.518   -7.389  1.00 0.00 ? 12 ARG A CG  6  
ATOM   3751  C  CD  . ARG A 1 12 ? 6.631   9.410   -6.373  1.00 0.00 ? 12 ARG A CD  6  
ATOM   3752  N  NE  . ARG A 1 12 ? 7.859   9.966   -6.998  1.00 0.00 ? 12 ARG A NE  6  
ATOM   3753  C  CZ  . ARG A 1 12 ? 8.014   11.218  -7.406  1.00 0.00 ? 12 ARG A CZ  6  
ATOM   3754  N  NH1 . ARG A 1 12 ? 7.103   12.141  -7.307  1.00 0.00 ? 12 ARG A NH1 6  
ATOM   3755  N  NH2 . ARG A 1 12 ? 9.143   11.534  -7.935  1.00 0.00 ? 12 ARG A NH2 6  
ATOM   3756  N  N   . TRP A 1 13 ? 4.464   5.472   -8.903  1.00 0.00 ? 13 TRP A N   6  
ATOM   3757  C  CA  . TRP A 1 13 ? 3.720   4.245   -8.667  1.00 0.00 ? 13 TRP A CA  6  
ATOM   3758  C  C   . TRP A 1 13 ? 4.318   3.053   -9.367  1.00 0.00 ? 13 TRP A C   6  
ATOM   3759  O  O   . TRP A 1 13 ? 4.206   1.905   -8.886  1.00 0.00 ? 13 TRP A O   6  
ATOM   3760  C  CB  . TRP A 1 13 ? 2.241   4.467   -9.144  1.00 0.00 ? 13 TRP A CB  6  
ATOM   3761  C  CG  . TRP A 1 13 ? 1.506   3.115   -9.153  1.00 0.00 ? 13 TRP A CG  6  
ATOM   3762  C  CD1 . TRP A 1 13 ? 1.290   2.303   -10.284 1.00 0.00 ? 13 TRP A CD1 6  
ATOM   3763  C  CD2 . TRP A 1 13 ? 1.042   2.407   -8.067  1.00 0.00 ? 13 TRP A CD2 6  
ATOM   3764  N  NE1 . TRP A 1 13 ? 0.685   1.082   -9.925  1.00 0.00 ? 13 TRP A NE1 6  
ATOM   3765  C  CE2 . TRP A 1 13 ? 0.548   1.167   -8.546  1.00 0.00 ? 13 TRP A CE2 6  
ATOM   3766  C  CE3 . TRP A 1 13 ? 1.033   2.710   -6.680  1.00 0.00 ? 13 TRP A CE3 6  
ATOM   3767  C  CZ2 . TRP A 1 13 ? 0.032   0.224   -7.630  1.00 0.00 ? 13 TRP A CZ2 6  
ATOM   3768  C  CZ3 . TRP A 1 13 ? 0.501   1.768   -5.801  1.00 0.00 ? 13 TRP A CZ3 6  
ATOM   3769  C  CH2 . TRP A 1 13 ? 0.005   0.542   -6.270  1.00 0.00 ? 13 TRP A CH2 6  
ATOM   3770  N  N   . GLN A 1 14 ? 5.002   3.277   -10.661 1.00 0.00 ? 14 GLN A N   6  
ATOM   3771  C  CA  . GLN A 1 14 ? 5.773   2.213   -11.304 1.00 0.00 ? 14 GLN A CA  6  
ATOM   3772  C  C   . GLN A 1 14 ? 6.826   1.699   -10.340 1.00 0.00 ? 14 GLN A C   6  
ATOM   3773  O  O   . GLN A 1 14 ? 7.309   0.564   -10.435 1.00 0.00 ? 14 GLN A O   6  
ATOM   3774  C  CB  . GLN A 1 14 ? 6.421   2.741   -12.598 1.00 0.00 ? 14 GLN A CB  6  
ATOM   3775  C  CG  . GLN A 1 14 ? 7.259   1.707   -13.423 1.00 0.00 ? 14 GLN A CG  6  
ATOM   3776  C  CD  . GLN A 1 14 ? 6.544   0.521   -14.082 1.00 0.00 ? 14 GLN A CD  6  
ATOM   3777  O  OE1 . GLN A 1 14 ? 6.233   0.548   -15.262 1.00 0.00 ? 14 GLN A OE1 6  
ATOM   3778  N  NE2 . GLN A 1 14 ? 6.252   -0.541  -13.375 1.00 0.00 ? 14 GLN A NE2 6  
ATOM   3779  N  N   . SER A 1 15 ? 7.205   2.639   -9.257  1.00 0.00 ? 15 SER A N   6  
ATOM   3780  C  CA  . SER A 1 15 ? 8.066   2.236   -8.150  1.00 0.00 ? 15 SER A CA  6  
ATOM   3781  C  C   . SER A 1 15 ? 7.333   1.300   -7.216  1.00 0.00 ? 15 SER A C   6  
ATOM   3782  O  O   . SER A 1 15 ? 7.906   0.291   -6.757  1.00 0.00 ? 15 SER A O   6  
ATOM   3783  C  CB  . SER A 1 15 ? 8.663   3.454   -7.407  1.00 0.00 ? 15 SER A CB  6  
ATOM   3784  O  OG  . SER A 1 15 ? 9.595   4.194   -8.206  1.00 0.00 ? 15 SER A OG  6  
ATOM   3785  N  N   . VAL A 1 16 ? 5.929   1.654   -6.841  1.00 0.00 ? 16 VAL A N   6  
ATOM   3786  C  CA  . VAL A 1 16 ? 5.122   0.696   -6.091  1.00 0.00 ? 16 VAL A CA  6  
ATOM   3787  C  C   . VAL A 1 16 ? 5.162   -0.669  -6.737  1.00 0.00 ? 16 VAL A C   6  
ATOM   3788  O  O   . VAL A 1 16 ? 5.508   -1.695  -6.099  1.00 0.00 ? 16 VAL A O   6  
ATOM   3789  C  CB  . VAL A 1 16 ? 3.655   1.155   -5.760  1.00 0.00 ? 16 VAL A CB  6  
ATOM   3790  C  CG1 . VAL A 1 16 ? 2.914   0.277   -4.690  1.00 0.00 ? 16 VAL A CG1 6  
ATOM   3791  C  CG2 . VAL A 1 16 ? 3.547   2.600   -5.221  1.00 0.00 ? 16 VAL A CG2 6  
ATOM   3792  N  N   . LEU A 1 17 ? 4.739   -0.780  -8.147  1.00 0.00 ? 17 LEU A N   6  
ATOM   3793  C  CA  . LEU A 1 17 ? 4.723   -2.077  -8.861  1.00 0.00 ? 17 LEU A CA  6  
ATOM   3794  C  C   . LEU A 1 17 ? 6.037   -2.784  -8.663  1.00 0.00 ? 17 LEU A C   6  
ATOM   3795  O  O   . LEU A 1 17 ? 6.133   -3.998  -8.447  1.00 0.00 ? 17 LEU A O   6  
ATOM   3796  C  CB  . LEU A 1 17 ? 4.422   -1.874  -10.373 1.00 0.00 ? 17 LEU A CB  6  
ATOM   3797  C  CG  . LEU A 1 17 ? 2.997   -1.377  -10.755 1.00 0.00 ? 17 LEU A CG  6  
ATOM   3798  C  CD1 . LEU A 1 17 ? 2.752   -1.585  -12.254 1.00 0.00 ? 17 LEU A CD1 6  
ATOM   3799  C  CD2 . LEU A 1 17 ? 1.892   -2.077  -9.947  1.00 0.00 ? 17 LEU A CD2 6  
ATOM   3800  N  N   . ALA A 1 18 ? 7.240   -1.922  -8.795  1.00 0.00 ? 18 ALA A N   6  
ATOM   3801  C  CA  . ALA A 1 18 ? 8.604   -2.400  -8.607  1.00 0.00 ? 18 ALA A CA  6  
ATOM   3802  C  C   . ALA A 1 18 ? 9.031   -2.352  -7.159  1.00 0.00 ? 18 ALA A C   6  
ATOM   3803  O  O   . ALA A 1 18 ? 10.046  -1.735  -6.795  1.00 0.00 ? 18 ALA A O   6  
ATOM   3804  C  CB  . ALA A 1 18 ? 9.516   -1.552  -9.521  1.00 0.00 ? 18 ALA A CB  6  
ATOM   3805  N  N   . ARG A 1 19 ? 8.175   -3.070  -6.190  1.00 0.00 ? 19 ARG A N   6  
ATOM   3806  C  CA  . ARG A 1 19 ? 8.554   -3.255  -4.792  1.00 0.00 ? 19 ARG A CA  6  
ATOM   3807  C  C   . ARG A 1 19 ? 10.031  -3.536  -4.655  1.00 0.00 ? 19 ARG A C   6  
ATOM   3808  O  O   . ARG A 1 19 ? 10.674  -3.124  -3.671  1.00 0.00 ? 19 ARG A O   6  
ATOM   3809  C  CB  . ARG A 1 19 ? 7.702   -4.406  -4.189  1.00 0.00 ? 19 ARG A CB  6  
ATOM   3810  C  CG  . ARG A 1 19 ? 7.397   -5.575  -5.162  1.00 0.00 ? 19 ARG A CG  6  
ATOM   3811  C  CD  . ARG A 1 19 ? 8.061   -6.890  -4.730  1.00 0.00 ? 19 ARG A CD  6  
ATOM   3812  N  NE  . ARG A 1 19 ? 7.489   -7.991  -5.545  1.00 0.00 ? 19 ARG A NE  6  
ATOM   3813  C  CZ  . ARG A 1 19 ? 7.388   -9.258  -5.165  1.00 0.00 ? 19 ARG A CZ  6  
ATOM   3814  N  NH1 . ARG A 1 19 ? 7.790   -9.713  -4.016  1.00 0.00 ? 19 ARG A NH1 6  
ATOM   3815  N  NH2 . ARG A 1 19 ? 6.858   -10.085 -5.995  1.00 0.00 ? 19 ARG A NH2 6  
ATOM   3816  N  N   . ASP A 1 20 ? 10.672  -4.351  -5.709  1.00 0.00 ? 20 ASP A N   6  
ATOM   3817  C  CA  . ASP A 1 20 ? 12.124  -4.533  -5.760  1.00 0.00 ? 20 ASP A CA  6  
ATOM   3818  C  C   . ASP A 1 20 ? 12.825  -3.240  -5.411  1.00 0.00 ? 20 ASP A C   6  
ATOM   3819  O  O   . ASP A 1 20 ? 12.936  -2.319  -6.228  1.00 0.00 ? 20 ASP A O   6  
ATOM   3820  C  CB  . ASP A 1 20 ? 12.554  -5.077  -7.145  1.00 0.00 ? 20 ASP A CB  6  
ATOM   3821  C  CG  . ASP A 1 20 ? 13.996  -5.594  -7.268  1.00 0.00 ? 20 ASP A CG  6  
ATOM   3822  O  OD1 . ASP A 1 20 ? 14.925  -4.668  -6.883  1.00 0.00 ? 20 ASP A OD1 6  
ATOM   3823  O  OD2 . ASP A 1 20 ? 14.272  -6.708  -7.688  1.00 0.00 ? 20 ASP A OD2 6  
ATOM   3824  N  N   . PRO A 1 21 ? 13.396  -3.163  -4.052  1.00 0.00 ? 21 PRO A N   6  
ATOM   3825  C  CA  . PRO A 1 21 ? 14.129  -1.983  -3.402  1.00 0.00 ? 21 PRO A CA  6  
ATOM   3826  C  C   . PRO A 1 21 ? 14.778  -0.971  -4.314  1.00 0.00 ? 21 PRO A C   6  
ATOM   3827  O  O   . PRO A 1 21 ? 16.007  -0.843  -4.390  1.00 0.00 ? 21 PRO A O   6  
ATOM   3828  C  CB  . PRO A 1 21 ? 15.196  -2.642  -2.523  1.00 0.00 ? 21 PRO A CB  6  
ATOM   3829  C  CG  . PRO A 1 21 ? 14.397  -3.824  -1.954  1.00 0.00 ? 21 PRO A CG  6  
ATOM   3830  C  CD  . PRO A 1 21 ? 13.375  -4.234  -3.018  1.00 0.00 ? 21 PRO A CD  6  
ATOM   3831  N  N   . ASN A 1 22 ? 13.856  -0.107  -5.088  1.00 0.00 ? 22 ASN A N   6  
ATOM   3832  C  CA  . ASN A 1 22 ? 14.312  1.029   -5.880  1.00 0.00 ? 22 ASN A CA  6  
ATOM   3833  C  C   . ASN A 1 22 ? 14.348  2.289   -5.047  1.00 0.00 ? 22 ASN A C   6  
ATOM   3834  O  O   . ASN A 1 22 ? 15.408  2.783   -4.641  1.00 0.00 ? 22 ASN A O   6  
ATOM   3835  C  CB  . ASN A 1 22 ? 13.361  1.220   -7.101  1.00 0.00 ? 22 ASN A CB  6  
ATOM   3836  C  CG  . ASN A 1 22 ? 13.531  2.503   -7.919  1.00 0.00 ? 22 ASN A CG  6  
ATOM   3837  O  OD1 . ASN A 1 22 ? 14.505  2.701   -8.631  1.00 0.00 ? 22 ASN A OD1 6  
ATOM   3838  N  ND2 . ASN A 1 22 ? 12.603  3.419   -7.852  1.00 0.00 ? 22 ASN A ND2 6  
ATOM   3839  N  N   . ALA A 1 23 ? 13.031  2.901   -4.746  1.00 0.00 ? 23 ALA A N   6  
ATOM   3840  C  CA  . ALA A 1 23 ? 12.901  4.203   -4.103  1.00 0.00 ? 23 ALA A CA  6  
ATOM   3841  C  C   . ALA A 1 23 ? 11.782  4.202   -3.088  1.00 0.00 ? 23 ALA A C   6  
ATOM   3842  O  O   . ALA A 1 23 ? 11.073  5.202   -2.900  1.00 0.00 ? 23 ALA A O   6  
ATOM   3843  C  CB  . ALA A 1 23 ? 12.691  5.250   -5.213  1.00 0.00 ? 23 ALA A CB  6  
ATOM   3844  N  N   . ASP A 1 24 ? 11.574  2.947   -2.332  1.00 0.00 ? 24 ASP A N   6  
ATOM   3845  C  CA  . ASP A 1 24 ? 10.503  2.806   -1.350  1.00 0.00 ? 24 ASP A CA  6  
ATOM   3846  C  C   . ASP A 1 24 ? 10.755  3.690   -0.149  1.00 0.00 ? 24 ASP A C   6  
ATOM   3847  O  O   . ASP A 1 24 ? 9.848   4.347   0.380   1.00 0.00 ? 24 ASP A O   6  
ATOM   3848  C  CB  . ASP A 1 24 ? 10.321  1.322   -0.942  1.00 0.00 ? 24 ASP A CB  6  
ATOM   3849  C  CG  . ASP A 1 24 ? 10.971  0.263   -1.845  1.00 0.00 ? 24 ASP A CG  6  
ATOM   3850  O  OD1 . ASP A 1 24 ? 10.527  -0.042  -2.942  1.00 0.00 ? 24 ASP A OD1 6  
ATOM   3851  O  OD2 . ASP A 1 24 ? 12.093  -0.288  -1.291  1.00 0.00 ? 24 ASP A OD2 6  
ATOM   3852  N  N   . GLY A 1 25 ? 12.148  3.737   0.346   1.00 0.00 ? 25 GLY A N   6  
ATOM   3853  C  CA  . GLY A 1 25 ? 12.505  4.421   1.585   1.00 0.00 ? 25 GLY A CA  6  
ATOM   3854  C  C   . GLY A 1 25 ? 12.289  5.911   1.475   1.00 0.00 ? 25 GLY A C   6  
ATOM   3855  O  O   . GLY A 1 25 ? 12.236  6.634   2.485   1.00 0.00 ? 25 GLY A O   6  
ATOM   3856  N  N   . GLU A 1 26 ? 12.138  6.477   0.114   1.00 0.00 ? 26 GLU A N   6  
ATOM   3857  C  CA  . GLU A 1 26 ? 12.098  7.916   -0.118  1.00 0.00 ? 26 GLU A CA  6  
ATOM   3858  C  C   . GLU A 1 26 ? 10.714  8.396   -0.486  1.00 0.00 ? 26 GLU A C   6  
ATOM   3859  O  O   . GLU A 1 26 ? 10.550  9.550   -0.938  1.00 0.00 ? 26 GLU A O   6  
ATOM   3860  C  CB  . GLU A 1 26 ? 13.127  8.276   -1.227  1.00 0.00 ? 26 GLU A CB  6  
ATOM   3861  C  CG  . GLU A 1 26 ? 13.198  7.359   -2.493  1.00 0.00 ? 26 GLU A CG  6  
ATOM   3862  C  CD  . GLU A 1 26 ? 14.283  7.648   -3.534  1.00 0.00 ? 26 GLU A CD  6  
ATOM   3863  O  OE1 . GLU A 1 26 ? 15.499  7.934   -2.992  1.00 0.00 ? 26 GLU A OE1 6  
ATOM   3864  O  OE2 . GLU A 1 26 ? 14.075  7.625   -4.740  1.00 0.00 ? 26 GLU A OE2 6  
ATOM   3865  N  N   . PHE A 1 27 ? 9.571   7.481   -0.273  1.00 0.00 ? 27 PHE A N   6  
ATOM   3866  C  CA  . PHE A 1 27 ? 8.193   7.920   -0.520  1.00 0.00 ? 27 PHE A CA  6  
ATOM   3867  C  C   . PHE A 1 27 ? 7.162   6.951   -0.005  1.00 0.00 ? 27 PHE A C   6  
ATOM   3868  O  O   . PHE A 1 27 ? 7.416   5.766   0.249   1.00 0.00 ? 27 PHE A O   6  
ATOM   3869  C  CB  . PHE A 1 27 ? 8.002   8.184   -2.042  1.00 0.00 ? 27 PHE A CB  6  
ATOM   3870  C  CG  . PHE A 1 27 ? 7.664   7.011   -2.978  1.00 0.00 ? 27 PHE A CG  6  
ATOM   3871  C  CD1 . PHE A 1 27 ? 6.366   6.503   -3.070  1.00 0.00 ? 27 PHE A CD1 6  
ATOM   3872  C  CD2 . PHE A 1 27 ? 8.677   6.463   -3.775  1.00 0.00 ? 27 PHE A CD2 6  
ATOM   3873  C  CE1 . PHE A 1 27 ? 6.087   5.455   -3.944  1.00 0.00 ? 27 PHE A CE1 6  
ATOM   3874  C  CE2 . PHE A 1 27 ? 8.397   5.417   -4.646  1.00 0.00 ? 27 PHE A CE2 6  
ATOM   3875  C  CZ  . PHE A 1 27 ? 7.101   4.914   -4.732  1.00 0.00 ? 27 PHE A CZ  6  
ATOM   3876  N  N   . VAL A 1 28 ? 5.804   7.508   0.230   1.00 0.00 ? 28 VAL A N   6  
ATOM   3877  C  CA  . VAL A 1 28 ? 4.715   6.778   0.875   1.00 0.00 ? 28 VAL A CA  6  
ATOM   3878  C  C   . VAL A 1 28 ? 3.423   7.006   0.111   1.00 0.00 ? 28 VAL A C   6  
ATOM   3879  O  O   . VAL A 1 28 ? 3.272   8.039   -0.575  1.00 0.00 ? 28 VAL A O   6  
ATOM   3880  C  CB  . VAL A 1 28 ? 4.564   7.259   2.370   1.00 0.00 ? 28 VAL A CB  6  
ATOM   3881  C  CG1 . VAL A 1 28 ? 5.887   7.573   3.129   1.00 0.00 ? 28 VAL A CG1 6  
ATOM   3882  C  CG2 . VAL A 1 28 ? 3.683   8.525   2.542   1.00 0.00 ? 28 VAL A CG2 6  
ATOM   3883  N  N   . PHE A 1 29 ? 2.368   5.975   0.178   1.00 0.00 ? 29 PHE A N   6  
ATOM   3884  C  CA  . PHE A 1 29 ? 1.159   6.021   -0.647  1.00 0.00 ? 29 PHE A CA  6  
ATOM   3885  C  C   . PHE A 1 29 ? -0.055  5.691   0.192   1.00 0.00 ? 29 PHE A C   6  
ATOM   3886  O  O   . PHE A 1 29 ? 0.005   4.838   1.097   1.00 0.00 ? 29 PHE A O   6  
ATOM   3887  C  CB  . PHE A 1 29 ? 1.260   4.981   -1.803  1.00 0.00 ? 29 PHE A CB  6  
ATOM   3888  C  CG  . PHE A 1 29 ? 0.987   3.515   -1.430  1.00 0.00 ? 29 PHE A CG  6  
ATOM   3889  C  CD1 . PHE A 1 29 ? 2.026   2.677   -1.015  1.00 0.00 ? 29 PHE A CD1 6  
ATOM   3890  C  CD2 . PHE A 1 29 ? -0.310  3.002   -1.539  1.00 0.00 ? 29 PHE A CD2 6  
ATOM   3891  C  CE1 . PHE A 1 29 ? 1.770   1.342   -0.713  1.00 0.00 ? 29 PHE A CE1 6  
ATOM   3892  C  CE2 . PHE A 1 29 ? -0.567  1.670   -1.231  1.00 0.00 ? 29 PHE A CE2 6  
ATOM   3893  C  CZ  . PHE A 1 29 ? 0.474   0.839   -0.819  1.00 0.00 ? 29 PHE A CZ  6  
ATOM   3894  N  N   . ALA A 1 30 ? -1.303  6.434   -0.084  1.00 0.00 ? 30 ALA A N   6  
ATOM   3895  C  CA  . ALA A 1 30 ? -2.498  6.264   0.737   1.00 0.00 ? 30 ALA A CA  6  
ATOM   3896  C  C   . ALA A 1 30 ? -3.676  5.817   -0.095  1.00 0.00 ? 30 ALA A C   6  
ATOM   3897  O  O   . ALA A 1 30 ? -4.256  6.590   -0.871  1.00 0.00 ? 30 ALA A O   6  
ATOM   3898  C  CB  . ALA A 1 30 ? -2.755  7.594   1.467   1.00 0.00 ? 30 ALA A CB  6  
ATOM   3899  N  N   . VAL A 1 31 ? -4.101  4.410   0.067   1.00 0.00 ? 31 VAL A N   6  
ATOM   3900  C  CA  . VAL A 1 31 ? -5.331  3.902   -0.546  1.00 0.00 ? 31 VAL A CA  6  
ATOM   3901  C  C   . VAL A 1 31 ? -6.515  4.206   0.340   1.00 0.00 ? 31 VAL A C   6  
ATOM   3902  O  O   . VAL A 1 31 ? -6.698  3.607   1.412   1.00 0.00 ? 31 VAL A O   6  
ATOM   3903  C  CB  . VAL A 1 31 ? -5.192  2.359   -0.846  1.00 0.00 ? 31 VAL A CB  6  
ATOM   3904  C  CG1 . VAL A 1 31 ? -5.400  1.385   0.346   1.00 0.00 ? 31 VAL A CG1 6  
ATOM   3905  C  CG2 . VAL A 1 31 ? -6.149  1.848   -1.955  1.00 0.00 ? 31 VAL A CG2 6  
ATOM   3906  N  N   . ARG A 1 32 ? -7.428  5.279   -0.112  1.00 0.00 ? 32 ARG A N   6  
ATOM   3907  C  CA  . ARG A 1 32 ? -8.481  5.805   0.748   1.00 0.00 ? 32 ARG A CA  6  
ATOM   3908  C  C   . ARG A 1 32 ? -9.716  4.942   0.790   1.00 0.00 ? 32 ARG A C   6  
ATOM   3909  O  O   . ARG A 1 32 ? -10.772 5.376   1.302   1.00 0.00 ? 32 ARG A O   6  
ATOM   3910  C  CB  . ARG A 1 32 ? -8.826  7.251   0.283   1.00 0.00 ? 32 ARG A CB  6  
ATOM   3911  C  CG  . ARG A 1 32 ? -9.460  7.351   -1.129  1.00 0.00 ? 32 ARG A CG  6  
ATOM   3912  C  CD  . ARG A 1 32 ? -10.977 7.125   -1.120  1.00 0.00 ? 32 ARG A CD  6  
ATOM   3913  N  NE  . ARG A 1 32 ? -11.556 7.773   -2.324  1.00 0.00 ? 32 ARG A NE  6  
ATOM   3914  C  CZ  . ARG A 1 32 ? -12.811 7.651   -2.736  1.00 0.00 ? 32 ARG A CZ  6  
ATOM   3915  N  NH1 . ARG A 1 32 ? -13.715 6.936   -2.134  1.00 0.00 ? 32 ARG A NH1 6  
ATOM   3916  N  NH2 . ARG A 1 32 ? -13.150 8.285   -3.802  1.00 0.00 ? 32 ARG A NH2 6  
ATOM   3917  N  N   . THR A 1 33 ? -9.663  3.595   0.183   1.00 0.00 ? 33 THR A N   6  
ATOM   3918  C  CA  . THR A 1 33 ? -10.810 2.688   0.222   1.00 0.00 ? 33 THR A CA  6  
ATOM   3919  C  C   . THR A 1 33 ? -10.752 1.804   1.445   1.00 0.00 ? 33 THR A C   6  
ATOM   3920  O  O   . THR A 1 33 ? -11.778 1.406   2.013   1.00 0.00 ? 33 THR A O   6  
ATOM   3921  C  CB  . THR A 1 33 ? -10.906 1.835   -1.087  1.00 0.00 ? 33 THR A CB  6  
ATOM   3922  O  OG1 . THR A 1 33 ? -12.026 0.958   -1.026  1.00 0.00 ? 33 THR A OG1 6  
ATOM   3923  C  CG2 . THR A 1 33 ? -9.711  0.910   -1.400  1.00 0.00 ? 33 THR A CG2 6  
ATOM   3924  N  N   . THR A 1 34 ? -9.401  1.417   1.907   1.00 0.00 ? 34 THR A N   6  
ATOM   3925  C  CA  . THR A 1 34 ? -9.180  0.718   3.168   1.00 0.00 ? 34 THR A CA  6  
ATOM   3926  C  C   . THR A 1 34 ? -8.663  1.662   4.229   1.00 0.00 ? 34 THR A C   6  
ATOM   3927  O  O   . THR A 1 34 ? -8.346  1.246   5.357   1.00 0.00 ? 34 THR A O   6  
ATOM   3928  C  CB  . THR A 1 34 ? -8.193  -0.481  2.969   1.00 0.00 ? 34 THR A CB  6  
ATOM   3929  O  OG1 . THR A 1 34 ? -8.678  -1.366  1.969   1.00 0.00 ? 34 THR A OG1 6  
ATOM   3930  C  CG2 . THR A 1 34 ? -7.954  -1.382  4.200   1.00 0.00 ? 34 THR A CG2 6  
ATOM   3931  N  N   . GLY A 1 35 ? -8.526  3.091   3.868   1.00 0.00 ? 35 GLY A N   6  
ATOM   3932  C  CA  . GLY A 1 35 ? -8.157  4.100   4.858   1.00 0.00 ? 35 GLY A CA  6  
ATOM   3933  C  C   . GLY A 1 35 ? -6.832  3.767   5.502   1.00 0.00 ? 35 GLY A C   6  
ATOM   3934  O  O   . GLY A 1 35 ? -6.662  3.869   6.727   1.00 0.00 ? 35 GLY A O   6  
ATOM   3935  N  N   . ILE A 1 36 ? -5.735  3.350   4.598   1.00 0.00 ? 36 ILE A N   6  
ATOM   3936  C  CA  . ILE A 1 36 ? -4.380  3.126   5.091   1.00 0.00 ? 36 ILE A CA  6  
ATOM   3937  C  C   . ILE A 1 36 ? -3.338  3.802   4.231   1.00 0.00 ? 36 ILE A C   6  
ATOM   3938  O  O   . ILE A 1 36 ? -3.436  3.857   2.997   1.00 0.00 ? 36 ILE A O   6  
ATOM   3939  C  CB  . ILE A 1 36 ? -4.081  1.585   5.296   1.00 0.00 ? 36 ILE A CB  6  
ATOM   3940  C  CG1 . ILE A 1 36 ? -3.974  0.740   3.987   1.00 0.00 ? 36 ILE A CG1 6  
ATOM   3941  C  CG2 . ILE A 1 36 ? -5.122  0.892   6.233   1.00 0.00 ? 36 ILE A CG2 6  
ATOM   3942  C  CD1 . ILE A 1 36 ? -2.790  -0.246  3.916   1.00 0.00 ? 36 ILE A CD1 6  
ATOM   3943  N  N   . PHE A 1 37 ? -2.184  4.386   4.948   1.00 0.00 ? 37 PHE A N   6  
ATOM   3944  C  CA  . PHE A 1 37 ? -1.004  4.926   4.255   1.00 0.00 ? 37 PHE A CA  6  
ATOM   3945  C  C   . PHE A 1 37 ? 0.206   4.108   4.644   1.00 0.00 ? 37 PHE A C   6  
ATOM   3946  O  O   . PHE A 1 37 ? 0.432   3.858   5.851   1.00 0.00 ? 37 PHE A O   6  
ATOM   3947  C  CB  . PHE A 1 37 ? -0.746  6.407   4.659   1.00 0.00 ? 37 PHE A CB  6  
ATOM   3948  C  CG  . PHE A 1 37 ? 0.073   6.635   5.944   1.00 0.00 ? 37 PHE A CG  6  
ATOM   3949  C  CD1 . PHE A 1 37 ? -0.558  6.588   7.191   1.00 0.00 ? 37 PHE A CD1 6  
ATOM   3950  C  CD2 . PHE A 1 37 ? 1.447   6.897   5.878   1.00 0.00 ? 37 PHE A CD2 6  
ATOM   3951  C  CE1 . PHE A 1 37 ? 0.175   6.798   8.356   1.00 0.00 ? 37 PHE A CE1 6  
ATOM   3952  C  CE2 . PHE A 1 37 ? 2.179   7.104   7.044   1.00 0.00 ? 37 PHE A CE2 6  
ATOM   3953  C  CZ  . PHE A 1 37 ? 1.544   7.053   8.282   1.00 0.00 ? 37 PHE A CZ  6  
ATOM   3954  N  N   . CYS A 1 38 ? 1.086   3.583   3.583   1.00 0.00 ? 38 CYS A N   6  
ATOM   3955  C  CA  . CYS A 1 38 ? 2.157   2.633   3.868   1.00 0.00 ? 38 CYS A CA  6  
ATOM   3956  C  C   . CYS A 1 38 ? 3.347   2.847   2.965   1.00 0.00 ? 38 CYS A C   6  
ATOM   3957  O  O   . CYS A 1 38 ? 3.251   3.469   1.897   1.00 0.00 ? 38 CYS A O   6  
ATOM   3958  C  CB  . CYS A 1 38 ? 1.582   1.204   3.721   1.00 0.00 ? 38 CYS A CB  6  
ATOM   3959  S  SG  . CYS A 1 38 ? 2.869   -0.064  3.649   1.00 0.00 ? 38 CYS A SG  6  
ATOM   3960  N  N   . ARG A 1 39 ? 4.634   2.294   3.434   1.00 0.00 ? 39 ARG A N   6  
ATOM   3961  C  CA  . ARG A 1 39 ? 5.796   2.227   2.533   1.00 0.00 ? 39 ARG A CA  6  
ATOM   3962  C  C   . ARG A 1 39 ? 5.554   1.087   1.560   1.00 0.00 ? 39 ARG A C   6  
ATOM   3963  O  O   . ARG A 1 39 ? 5.518   -0.089  1.944   1.00 0.00 ? 39 ARG A O   6  
ATOM   3964  C  CB  . ARG A 1 39 ? 7.090   2.063   3.365   1.00 0.00 ? 39 ARG A CB  6  
ATOM   3965  C  CG  . ARG A 1 39 ? 7.777   3.374   3.830   1.00 0.00 ? 39 ARG A CG  6  
ATOM   3966  C  CD  . ARG A 1 39 ? 8.073   3.385   5.335   1.00 0.00 ? 39 ARG A CD  6  
ATOM   3967  N  NE  . ARG A 1 39 ? 9.228   2.489   5.600   1.00 0.00 ? 39 ARG A NE  6  
ATOM   3968  C  CZ  . ARG A 1 39 ? 10.499  2.863   5.645   1.00 0.00 ? 39 ARG A CZ  6  
ATOM   3969  N  NH1 . ARG A 1 39 ? 10.913  4.080   5.454   1.00 0.00 ? 39 ARG A NH1 6  
ATOM   3970  N  NH2 . ARG A 1 39 ? 11.376  1.956   5.897   1.00 0.00 ? 39 ARG A NH2 6  
ATOM   3971  N  N   . PRO A 1 40 ? 5.388   1.460   0.145   1.00 0.00 ? 40 PRO A N   6  
ATOM   3972  C  CA  . PRO A 1 40 ? 5.083   0.516   -1.033  1.00 0.00 ? 40 PRO A CA  6  
ATOM   3973  C  C   . PRO A 1 40 ? 5.400   -0.941  -0.823  1.00 0.00 ? 40 PRO A C   6  
ATOM   3974  O  O   . PRO A 1 40 ? 6.461   -1.431  -1.271  1.00 0.00 ? 40 PRO A O   6  
ATOM   3975  C  CB  . PRO A 1 40 ? 5.930   1.095   -2.173  1.00 0.00 ? 40 PRO A CB  6  
ATOM   3976  C  CG  . PRO A 1 40 ? 5.687   2.597   -1.956  1.00 0.00 ? 40 PRO A CG  6  
ATOM   3977  C  CD  . PRO A 1 40 ? 5.480   2.815   -0.453  1.00 0.00 ? 40 PRO A CD  6  
ATOM   3978  N  N   . SER A 1 41 ? 4.438   -1.769  -0.044  1.00 0.00 ? 41 SER A N   6  
ATOM   3979  C  CA  . SER A 1 41 ? 4.626   -3.207  0.091   1.00 0.00 ? 41 SER A CA  6  
ATOM   3980  C  C   . SER A 1 41 ? 3.559   -3.957  0.845   1.00 0.00 ? 41 SER A C   6  
ATOM   3981  O  O   . SER A 1 41 ? 3.831   -5.129  1.254   1.00 0.00 ? 41 SER A O   6  
ATOM   3982  C  CB  . SER A 1 41 ? 6.036   -3.495  0.699   1.00 0.00 ? 41 SER A CB  6  
ATOM   3983  O  OG  . SER A 1 41 ? 6.998   -3.885  -0.285  1.00 0.00 ? 41 SER A OG  6  
ATOM   3984  N  N   . CYS A 1 42 ? 2.241   -3.364  1.152   1.00 0.00 ? 42 CYS A N   6  
ATOM   3985  C  CA  . CYS A 1 42 ? 1.149   -4.155  1.713   1.00 0.00 ? 42 CYS A CA  6  
ATOM   3986  C  C   . CYS A 1 42 ? 1.037   -5.484  0.996   1.00 0.00 ? 42 CYS A C   6  
ATOM   3987  O  O   . CYS A 1 42 ? 1.181   -5.600  -0.228  1.00 0.00 ? 42 CYS A O   6  
ATOM   3988  C  CB  . CYS A 1 42 ? -0.150  -3.341  1.814   1.00 0.00 ? 42 CYS A CB  6  
ATOM   3989  S  SG  . CYS A 1 42 ? 0.080   -1.900  2.878   1.00 0.00 ? 42 CYS A SG  6  
ATOM   3990  N  N   . ARG A 1 43 ? 0.782   -6.654  1.864   1.00 0.00 ? 43 ARG A N   6  
ATOM   3991  C  CA  . ARG A 1 43 ? 0.873   -8.036  1.408   1.00 0.00 ? 43 ARG A CA  6  
ATOM   3992  C  C   . ARG A 1 43 ? -0.442  -8.633  0.987   1.00 0.00 ? 43 ARG A C   6  
ATOM   3993  O  O   . ARG A 1 43 ? -0.490  -9.781  0.495   1.00 0.00 ? 43 ARG A O   6  
ATOM   3994  C  CB  . ARG A 1 43 ? 1.557   -8.851  2.557   1.00 0.00 ? 43 ARG A CB  6  
ATOM   3995  C  CG  . ARG A 1 43 ? 2.456   -7.989  3.481   1.00 0.00 ? 43 ARG A CG  6  
ATOM   3996  C  CD  . ARG A 1 43 ? 3.366   -8.829  4.386   1.00 0.00 ? 43 ARG A CD  6  
ATOM   3997  N  NE  . ARG A 1 43 ? 4.693   -8.947  3.729   1.00 0.00 ? 43 ARG A NE  6  
ATOM   3998  C  CZ  . ARG A 1 43 ? 5.526   -9.971  3.855   1.00 0.00 ? 43 ARG A CZ  6  
ATOM   3999  N  NH1 . ARG A 1 43 ? 5.291   -11.022 4.583   1.00 0.00 ? 43 ARG A NH1 6  
ATOM   4000  N  NH2 . ARG A 1 43 ? 6.637   -9.915  3.210   1.00 0.00 ? 43 ARG A NH2 6  
ATOM   4001  N  N   . ALA A 1 44 ? -1.665  -7.818  1.137   1.00 0.00 ? 44 ALA A N   6  
ATOM   4002  C  CA  . ALA A 1 44 ? -2.945  -8.239  0.576   1.00 0.00 ? 44 ALA A CA  6  
ATOM   4003  C  C   . ALA A 1 44 ? -2.936  -8.038  -0.928  1.00 0.00 ? 44 ALA A C   6  
ATOM   4004  O  O   . ALA A 1 44 ? -1.946  -7.628  -1.546  1.00 0.00 ? 44 ALA A O   6  
ATOM   4005  C  CB  . ALA A 1 44 ? -4.049  -7.426  1.271   1.00 0.00 ? 44 ALA A CB  6  
ATOM   4006  N  N   . ARG A 1 45 ? -4.203  -8.410  -1.617  1.00 0.00 ? 45 ARG A N   6  
ATOM   4007  C  CA  . ARG A 1 45 ? -4.390  -8.113  -3.035  1.00 0.00 ? 45 ARG A CA  6  
ATOM   4008  C  C   . ARG A 1 45 ? -4.168  -6.631  -3.279  1.00 0.00 ? 45 ARG A C   6  
ATOM   4009  O  O   . ARG A 1 45 ? -5.071  -5.803  -3.104  1.00 0.00 ? 45 ARG A O   6  
ATOM   4010  C  CB  . ARG A 1 45 ? -5.785  -8.589  -3.512  1.00 0.00 ? 45 ARG A CB  6  
ATOM   4011  C  CG  . ARG A 1 45 ? -6.961  -8.371  -2.527  1.00 0.00 ? 45 ARG A CG  6  
ATOM   4012  C  CD  . ARG A 1 45 ? -7.262  -9.560  -1.608  1.00 0.00 ? 45 ARG A CD  6  
ATOM   4013  N  NE  . ARG A 1 45 ? -6.936  -10.830 -2.303  1.00 0.00 ? 45 ARG A NE  6  
ATOM   4014  C  CZ  . ARG A 1 45 ? -7.755  -11.512 -3.092  1.00 0.00 ? 45 ARG A CZ  6  
ATOM   4015  N  NH1 . ARG A 1 45 ? -8.972  -11.151 -3.373  1.00 0.00 ? 45 ARG A NH1 6  
ATOM   4016  N  NH2 . ARG A 1 45 ? -7.311  -12.602 -3.610  1.00 0.00 ? 45 ARG A NH2 6  
ATOM   4017  N  N   . HIS A 1 46 ? -2.803  -6.245  -3.692  1.00 0.00 ? 46 HIS A N   6  
ATOM   4018  C  CA  . HIS A 1 46 ? -2.332  -4.870  -3.792  1.00 0.00 ? 46 HIS A CA  6  
ATOM   4019  C  C   . HIS A 1 46 ? -3.436  -3.863  -3.994  1.00 0.00 ? 46 HIS A C   6  
ATOM   4020  O  O   . HIS A 1 46 ? -4.120  -3.836  -5.026  1.00 0.00 ? 46 HIS A O   6  
ATOM   4021  C  CB  . HIS A 1 46 ? -1.361  -4.838  -4.990  1.00 0.00 ? 46 HIS A CB  6  
ATOM   4022  C  CG  . HIS A 1 46 ? 0.035   -4.453  -4.595  1.00 0.00 ? 46 HIS A CG  6  
ATOM   4023  N  ND1 . HIS A 1 46 ? 1.198   -5.138  -4.940  1.00 0.00 ? 46 HIS A ND1 6  
ATOM   4024  C  CD2 . HIS A 1 46 ? 0.314   -3.337  -3.817  1.00 0.00 ? 46 HIS A CD2 6  
ATOM   4025  C  CE1 . HIS A 1 46 ? 2.112   -4.361  -4.327  1.00 0.00 ? 46 HIS A CE1 6  
ATOM   4026  N  NE2 . HIS A 1 46 ? 1.671   -3.272  -3.641  1.00 0.00 ? 46 HIS A NE2 6  
ATOM   4027  N  N   . ALA A 1 47 ? -3.684  -2.931  -2.869  1.00 0.00 ? 47 ALA A N   6  
ATOM   4028  C  CA  . ALA A 1 47 ? -4.641  -1.833  -2.952  1.00 0.00 ? 47 ALA A CA  6  
ATOM   4029  C  C   . ALA A 1 47 ? -4.582  -1.163  -4.305  1.00 0.00 ? 47 ALA A C   6  
ATOM   4030  O  O   . ALA A 1 47 ? -3.563  -1.198  -5.008  1.00 0.00 ? 47 ALA A O   6  
ATOM   4031  C  CB  . ALA A 1 47 ? -4.341  -0.864  -1.795  1.00 0.00 ? 47 ALA A CB  6  
ATOM   4032  N  N   . LEU A 1 48 ? -5.798  -0.431  -4.724  1.00 0.00 ? 48 LEU A N   6  
ATOM   4033  C  CA  . LEU A 1 48 ? -5.924  0.165   -6.049  1.00 0.00 ? 48 LEU A CA  6  
ATOM   4034  C  C   . LEU A 1 48 ? -5.182  1.480   -6.127  1.00 0.00 ? 48 LEU A C   6  
ATOM   4035  O  O   . LEU A 1 48 ? -5.328  2.357   -5.265  1.00 0.00 ? 48 LEU A O   6  
ATOM   4036  C  CB  . LEU A 1 48 ? -7.421  0.362   -6.425  1.00 0.00 ? 48 LEU A CB  6  
ATOM   4037  C  CG  . LEU A 1 48 ? -8.447  -0.720  -5.995  1.00 0.00 ? 48 LEU A CG  6  
ATOM   4038  C  CD1 . LEU A 1 48 ? -9.730  -0.054  -5.477  1.00 0.00 ? 48 LEU A CD1 6  
ATOM   4039  C  CD2 . LEU A 1 48 ? -8.794  -1.694  -7.134  1.00 0.00 ? 48 LEU A CD2 6  
ATOM   4040  N  N   . ARG A 1 49 ? -4.254  1.645   -7.266  1.00 0.00 ? 49 ARG A N   6  
ATOM   4041  C  CA  . ARG A 1 49 ? -3.609  2.914   -7.583  1.00 0.00 ? 49 ARG A CA  6  
ATOM   4042  C  C   . ARG A 1 49 ? -4.620  3.976   -7.948  1.00 0.00 ? 49 ARG A C   6  
ATOM   4043  O  O   . ARG A 1 49 ? -4.318  5.177   -7.988  1.00 0.00 ? 49 ARG A O   6  
ATOM   4044  C  CB  . ARG A 1 49 ? -2.623  2.676   -8.769  1.00 0.00 ? 49 ARG A CB  6  
ATOM   4045  C  CG  . ARG A 1 49 ? -3.308  2.538   -10.153 1.00 0.00 ? 49 ARG A CG  6  
ATOM   4046  C  CD  . ARG A 1 49 ? -2.460  3.081   -11.309 1.00 0.00 ? 49 ARG A CD  6  
ATOM   4047  N  NE  . ARG A 1 49 ? -3.350  3.303   -12.478 1.00 0.00 ? 49 ARG A NE  6  
ATOM   4048  C  CZ  . ARG A 1 49 ? -3.983  4.434   -12.760 1.00 0.00 ? 49 ARG A CZ  6  
ATOM   4049  N  NH1 . ARG A 1 49 ? -3.915  5.513   -12.039 1.00 0.00 ? 49 ARG A NH1 6  
ATOM   4050  N  NH2 . ARG A 1 49 ? -4.712  4.457   -13.819 1.00 0.00 ? 49 ARG A NH2 6  
ATOM   4051  N  N   . GLU A 1 50 ? -5.988  3.507   -8.264  1.00 0.00 ? 50 GLU A N   6  
ATOM   4052  C  CA  . GLU A 1 50 ? -7.013  4.372   -8.829  1.00 0.00 ? 50 GLU A CA  6  
ATOM   4053  C  C   . GLU A 1 50 ? -7.800  5.129   -7.789  1.00 0.00 ? 50 GLU A C   6  
ATOM   4054  O  O   . GLU A 1 50 ? -8.728  5.896   -8.140  1.00 0.00 ? 50 GLU A O   6  
ATOM   4055  C  CB  . GLU A 1 50 ? -7.954  3.506   -9.718  1.00 0.00 ? 50 GLU A CB  6  
ATOM   4056  C  CG  . GLU A 1 50 ? -8.478  2.161   -9.115  1.00 0.00 ? 50 GLU A CG  6  
ATOM   4057  C  CD  . GLU A 1 50 ? -9.929  2.100   -8.630  1.00 0.00 ? 50 GLU A CD  6  
ATOM   4058  O  OE1 . GLU A 1 50 ? -10.479 3.032   -8.059  1.00 0.00 ? 50 GLU A OE1 6  
ATOM   4059  O  OE2 . GLU A 1 50 ? -10.546 0.915   -8.895  1.00 0.00 ? 50 GLU A OE2 6  
ATOM   4060  N  N   . ASN A 1 51 ? -7.469  4.946   -6.369  1.00 0.00 ? 51 ASN A N   6  
ATOM   4061  C  CA  . ASN A 1 51 ? -8.066  5.801   -5.312  1.00 0.00 ? 51 ASN A CA  6  
ATOM   4062  C  C   . ASN A 1 51 ? -6.960  6.160   -4.345  1.00 0.00 ? 51 ASN A C   6  
ATOM   4063  O  O   . ASN A 1 51 ? -7.125  6.528   -3.176  1.00 0.00 ? 51 ASN A O   6  
ATOM   4064  C  CB  . ASN A 1 51 ? -9.181  4.991   -4.608  1.00 0.00 ? 51 ASN A CB  6  
ATOM   4065  C  CG  . ASN A 1 51 ? -8.955  4.481   -3.180  1.00 0.00 ? 51 ASN A CG  6  
ATOM   4066  O  OD1 . ASN A 1 51 ? -9.821  4.549   -2.321  1.00 0.00 ? 51 ASN A OD1 6  
ATOM   4067  N  ND2 . ASN A 1 51 ? -7.808  3.935   -2.881  1.00 0.00 ? 51 ASN A ND2 6  
ATOM   4068  N  N   . VAL A 1 52 ? -5.583  6.037   -4.920  1.00 0.00 ? 52 VAL A N   6  
ATOM   4069  C  CA  . VAL A 1 52 ? -4.375  6.015   -4.098  1.00 0.00 ? 52 VAL A CA  6  
ATOM   4070  C  C   . VAL A 1 52 ? -3.714  7.365   -4.105  1.00 0.00 ? 52 VAL A C   6  
ATOM   4071  O  O   . VAL A 1 52 ? -3.780  8.087   -5.136  1.00 0.00 ? 52 VAL A O   6  
ATOM   4072  C  CB  . VAL A 1 52 ? -3.416  4.861   -4.619  1.00 0.00 ? 52 VAL A CB  6  
ATOM   4073  C  CG1 . VAL A 1 52 ? -2.172  5.294   -5.437  1.00 0.00 ? 52 VAL A CG1 6  
ATOM   4074  C  CG2 . VAL A 1 52 ? -2.874  3.948   -3.488  1.00 0.00 ? 52 VAL A CG2 6  
ATOM   4075  N  N   . SER A 1 53 ? -3.026  7.856   -2.893  1.00 0.00 ? 53 SER A N   6  
ATOM   4076  C  CA  . SER A 1 53 ? -2.284  9.117   -2.882  1.00 0.00 ? 53 SER A CA  6  
ATOM   4077  C  C   . SER A 1 53 ? -0.796  8.866   -2.832  1.00 0.00 ? 53 SER A C   6  
ATOM   4078  O  O   . SER A 1 53 ? -0.330  7.717   -2.776  1.00 0.00 ? 53 SER A O   6  
ATOM   4079  C  CB  . SER A 1 53 ? -2.758  10.045  -1.738  1.00 0.00 ? 53 SER A CB  6  
ATOM   4080  O  OG  . SER A 1 53 ? -2.717  11.433  -2.098  1.00 0.00 ? 53 SER A OG  6  
ATOM   4081  N  N   . PHE A 1 54 ? 0.082   10.059  -2.894  1.00 0.00 ? 54 PHE A N   6  
ATOM   4082  C  CA  . PHE A 1 54 ? 1.530   9.943   -2.766  1.00 0.00 ? 54 PHE A CA  6  
ATOM   4083  C  C   . PHE A 1 54 ? 2.143   11.050  -1.940  1.00 0.00 ? 54 PHE A C   6  
ATOM   4084  O  O   . PHE A 1 54 ? 1.694   12.203  -1.906  1.00 0.00 ? 54 PHE A O   6  
ATOM   4085  C  CB  . PHE A 1 54 ? 2.206   9.923   -4.169  1.00 0.00 ? 54 PHE A CB  6  
ATOM   4086  C  CG  . PHE A 1 54 ? 1.841   8.747   -5.088  1.00 0.00 ? 54 PHE A CG  6  
ATOM   4087  C  CD1 . PHE A 1 54 ? 0.755   8.834   -5.963  1.00 0.00 ? 54 PHE A CD1 6  
ATOM   4088  C  CD2 . PHE A 1 54 ? 2.606   7.576   -5.052  1.00 0.00 ? 54 PHE A CD2 6  
ATOM   4089  C  CE1 . PHE A 1 54 ? 0.439   7.761   -6.793  1.00 0.00 ? 54 PHE A CE1 6  
ATOM   4090  C  CE2 . PHE A 1 54 ? 2.290   6.506   -5.881  1.00 0.00 ? 54 PHE A CE2 6  
ATOM   4091  C  CZ  . PHE A 1 54 ? 1.207   6.598   -6.752  1.00 0.00 ? 54 PHE A CZ  6  
ATOM   4092  N  N   . TYR A 1 55 ? 3.358   10.674  -1.180  1.00 0.00 ? 55 TYR A N   6  
ATOM   4093  C  CA  . TYR A 1 55 ? 4.098   11.571  -0.299  1.00 0.00 ? 55 TYR A CA  6  
ATOM   4094  C  C   . TYR A 1 55 ? 5.578   11.231  -0.342  1.00 0.00 ? 55 TYR A C   6  
ATOM   4095  O  O   . TYR A 1 55 ? 5.958   10.125  -0.800  1.00 0.00 ? 55 TYR A O   6  
ATOM   4096  C  CB  . TYR A 1 55 ? 3.622   11.384  1.171   1.00 0.00 ? 55 TYR A CB  6  
ATOM   4097  C  CG  . TYR A 1 55 ? 2.132   11.064  1.384   1.00 0.00 ? 55 TYR A CG  6  
ATOM   4098  C  CD1 . TYR A 1 55 ? 1.610   9.792   1.149   1.00 0.00 ? 55 TYR A CD1 6  
ATOM   4099  C  CD2 . TYR A 1 55 ? 1.265   12.087  1.831   1.00 0.00 ? 55 TYR A CD2 6  
ATOM   4100  C  CE1 . TYR A 1 55 ? 0.260   9.532   1.359   1.00 0.00 ? 55 TYR A CE1 6  
ATOM   4101  C  CE2 . TYR A 1 55 ? -0.084  11.821  2.038   1.00 0.00 ? 55 TYR A CE2 6  
ATOM   4102  C  CZ  . TYR A 1 55 ? -0.584  10.544  1.804   1.00 0.00 ? 55 TYR A CZ  6  
ATOM   4103  O  OH  . TYR A 1 55 ? -1.911  10.287  2.006   1.00 0.00 ? 55 TYR A OH  6  
ATOM   4104  N  N   . ALA A 1 56 ? 6.592   12.207  0.117   1.00 0.00 ? 56 ALA A N   6  
ATOM   4105  C  CA  . ALA A 1 56 ? 8.012   11.875  0.249   1.00 0.00 ? 56 ALA A CA  6  
ATOM   4106  C  C   . ALA A 1 56 ? 8.317   11.053  1.477   1.00 0.00 ? 56 ALA A C   6  
ATOM   4107  O  O   . ALA A 1 56 ? 9.341   10.338  1.525   1.00 0.00 ? 56 ALA A O   6  
ATOM   4108  C  CB  . ALA A 1 56 ? 8.804   13.194  0.204   1.00 0.00 ? 56 ALA A CB  6  
ATOM   4109  N  N   . ASN A 1 57 ? 7.398   11.147  2.633   1.00 0.00 ? 57 ASN A N   6  
ATOM   4110  C  CA  . ASN A 1 57 ? 7.604   10.360  3.846   1.00 0.00 ? 57 ASN A CA  6  
ATOM   4111  C  C   . ASN A 1 57 ? 6.347   10.259  4.677   1.00 0.00 ? 57 ASN A C   6  
ATOM   4112  O  O   . ASN A 1 57 ? 5.404   11.049  4.541   1.00 0.00 ? 57 ASN A O   6  
ATOM   4113  C  CB  . ASN A 1 57 ? 8.765   10.978  4.679   1.00 0.00 ? 57 ASN A CB  6  
ATOM   4114  C  CG  . ASN A 1 57 ? 9.090   10.307  6.019   1.00 0.00 ? 57 ASN A CG  6  
ATOM   4115  O  OD1 . ASN A 1 57 ? 8.816   10.823  7.092   1.00 0.00 ? 57 ASN A OD1 6  
ATOM   4116  N  ND2 . ASN A 1 57 ? 9.691   9.148   6.011   1.00 0.00 ? 57 ASN A ND2 6  
ATOM   4117  N  N   . ALA A 1 58 ? 6.326   9.180   5.693   1.00 0.00 ? 58 ALA A N   6  
ATOM   4118  C  CA  . ALA A 1 58 ? 5.227   9.020   6.639   1.00 0.00 ? 58 ALA A CA  6  
ATOM   4119  C  C   . ALA A 1 58 ? 4.925   10.318  7.349   1.00 0.00 ? 58 ALA A C   6  
ATOM   4120  O  O   . ALA A 1 58 ? 3.836   10.518  7.905   1.00 0.00 ? 58 ALA A O   6  
ATOM   4121  C  CB  . ALA A 1 58 ? 5.604   7.886   7.610   1.00 0.00 ? 58 ALA A CB  6  
ATOM   4122  N  N   . SER A 1 59 ? 6.013   11.321  7.380   1.00 0.00 ? 59 SER A N   6  
ATOM   4123  C  CA  . SER A 1 59 ? 5.870   12.592  8.083   1.00 0.00 ? 59 SER A CA  6  
ATOM   4124  C  C   . SER A 1 59 ? 4.603   13.303  7.664   1.00 0.00 ? 59 SER A C   6  
ATOM   4125  O  O   . SER A 1 59 ? 3.760   13.684  8.485   1.00 0.00 ? 59 SER A O   6  
ATOM   4126  C  CB  . SER A 1 59 ? 7.117   13.487  7.871   1.00 0.00 ? 59 SER A CB  6  
ATOM   4127  O  OG  . SER A 1 59 ? 7.018   14.310  6.702   1.00 0.00 ? 59 SER A OG  6  
ATOM   4128  N  N   . GLU A 1 60 ? 4.453   13.557  6.212   1.00 0.00 ? 60 GLU A N   6  
ATOM   4129  C  CA  . GLU A 1 60 ? 3.323   14.281  5.642   1.00 0.00 ? 60 GLU A CA  6  
ATOM   4130  C  C   . GLU A 1 60 ? 2.041   13.485  5.601   1.00 0.00 ? 60 GLU A C   6  
ATOM   4131  O  O   . GLU A 1 60 ? 0.948   14.037  5.855   1.00 0.00 ? 60 GLU A O   6  
ATOM   4132  C  CB  . GLU A 1 60 ? 3.725   14.752  4.208   1.00 0.00 ? 60 GLU A CB  6  
ATOM   4133  C  CG  . GLU A 1 60 ? 4.576   13.747  3.368   1.00 0.00 ? 60 GLU A CG  6  
ATOM   4134  C  CD  . GLU A 1 60 ? 5.678   14.292  2.460   1.00 0.00 ? 60 GLU A CD  6  
ATOM   4135  O  OE1 . GLU A 1 60 ? 5.209   14.997  1.390   1.00 0.00 ? 60 GLU A OE1 6  
ATOM   4136  O  OE2 . GLU A 1 60 ? 6.870   14.115  2.673   1.00 0.00 ? 60 GLU A OE2 6  
ATOM   4137  N  N   . ALA A 1 61 ? 2.096   12.064  5.199   1.00 0.00 ? 61 ALA A N   6  
ATOM   4138  C  CA  . ALA A 1 61 ? 0.935   11.188  5.313   1.00 0.00 ? 61 ALA A CA  6  
ATOM   4139  C  C   . ALA A 1 61 ? 0.405   11.068  6.722   1.00 0.00 ? 61 ALA A C   6  
ATOM   4140  O  O   . ALA A 1 61 ? -0.782  10.713  6.919   1.00 0.00 ? 61 ALA A O   6  
ATOM   4141  C  CB  . ALA A 1 61 ? 1.305   9.826   4.702   1.00 0.00 ? 61 ALA A CB  6  
ATOM   4142  N  N   . LEU A 1 62 ? 1.309   11.336  7.859   1.00 0.00 ? 62 LEU A N   6  
ATOM   4143  C  CA  . LEU A 1 62 ? 0.824   11.377  9.242   1.00 0.00 ? 62 LEU A CA  6  
ATOM   4144  C  C   . LEU A 1 62 ? 0.207   12.720  9.548   1.00 0.00 ? 62 LEU A C   6  
ATOM   4145  O  O   . LEU A 1 62 ? -0.917  12.822  10.058  1.00 0.00 ? 62 LEU A O   6  
ATOM   4146  C  CB  . LEU A 1 62 ? 1.975   11.044  10.230  1.00 0.00 ? 62 LEU A CB  6  
ATOM   4147  C  CG  . LEU A 1 62 ? 1.648   10.181  11.478  1.00 0.00 ? 62 LEU A CG  6  
ATOM   4148  C  CD1 . LEU A 1 62 ? 2.140   8.742   11.270  1.00 0.00 ? 62 LEU A CD1 6  
ATOM   4149  C  CD2 . LEU A 1 62 ? 2.252   10.753  12.771  1.00 0.00 ? 62 LEU A CD2 6  
ATOM   4150  N  N   . ALA A 1 63 ? 1.039   13.906  9.250   1.00 0.00 ? 63 ALA A N   6  
ATOM   4151  C  CA  . ALA A 1 63 ? 0.517   15.270  9.320   1.00 0.00 ? 63 ALA A CA  6  
ATOM   4152  C  C   . ALA A 1 63 ? -0.731  15.410  8.480   1.00 0.00 ? 63 ALA A C   6  
ATOM   4153  O  O   . ALA A 1 63 ? -1.539  16.333  8.667   1.00 0.00 ? 63 ALA A O   6  
ATOM   4154  C  CB  . ALA A 1 63 ? 1.638   16.234  8.899   1.00 0.00 ? 63 ALA A CB  6  
ATOM   4155  N  N   . ALA A 1 64 ? -0.947  14.387  7.434   1.00 0.00 ? 64 ALA A N   6  
ATOM   4156  C  CA  . ALA A 1 64 ? -2.197  14.305  6.680   1.00 0.00 ? 64 ALA A CA  6  
ATOM   4157  C  C   . ALA A 1 64 ? -3.299  13.864  7.636   1.00 0.00 ? 64 ALA A C   6  
ATOM   4158  O  O   . ALA A 1 64 ? -4.411  14.400  7.678   1.00 0.00 ? 64 ALA A O   6  
ATOM   4159  C  CB  . ALA A 1 64 ? -1.986  13.322  5.521   1.00 0.00 ? 64 ALA A CB  6  
ATOM   4160  N  N   . GLY A 1 65 ? -2.900  12.756  8.542   1.00 0.00 ? 65 GLY A N   6  
ATOM   4161  C  CA  . GLY A 1 65 ? -3.750  12.316  9.644   1.00 0.00 ? 65 GLY A CA  6  
ATOM   4162  C  C   . GLY A 1 65 ? -4.318  10.942  9.326   1.00 0.00 ? 65 GLY A C   6  
ATOM   4163  O  O   . GLY A 1 65 ? -5.475  10.616  9.616   1.00 0.00 ? 65 GLY A O   6  
ATOM   4164  N  N   . PHE A 1 66 ? -3.390  10.040  8.607   1.00 0.00 ? 66 PHE A N   6  
ATOM   4165  C  CA  . PHE A 1 66 ? -3.817  8.763   8.052   1.00 0.00 ? 66 PHE A CA  6  
ATOM   4166  C  C   . PHE A 1 66 ? -3.334  7.591   8.866   1.00 0.00 ? 66 PHE A C   6  
ATOM   4167  O  O   . PHE A 1 66 ? -2.734  7.771   9.949   1.00 0.00 ? 66 PHE A O   6  
ATOM   4168  C  CB  . PHE A 1 66 ? -3.277  8.628   6.590   1.00 0.00 ? 66 PHE A CB  6  
ATOM   4169  C  CG  . PHE A 1 66 ? -4.141  7.772   5.652   1.00 0.00 ? 66 PHE A CG  6  
ATOM   4170  C  CD1 . PHE A 1 66 ? -5.490  7.559   5.985   1.00 0.00 ? 66 PHE A CD1 6  
ATOM   4171  C  CD2 . PHE A 1 66 ? -3.617  7.194   4.495   1.00 0.00 ? 66 PHE A CD2 6  
ATOM   4172  C  CE1 . PHE A 1 66 ? -6.296  6.772   5.172   1.00 0.00 ? 66 PHE A CE1 6  
ATOM   4173  C  CE2 . PHE A 1 66 ? -4.428  6.407   3.680   1.00 0.00 ? 66 PHE A CE2 6  
ATOM   4174  C  CZ  . PHE A 1 66 ? -5.763  6.194   4.021   1.00 0.00 ? 66 PHE A CZ  6  
ATOM   4175  N  N   . ARG A 1 67 ? -3.581  6.229   8.346   1.00 0.00 ? 67 ARG A N   6  
ATOM   4176  C  CA  . ARG A 1 67 ? -3.282  5.041   9.150   1.00 0.00 ? 67 ARG A CA  6  
ATOM   4177  C  C   . ARG A 1 67 ? -1.912  4.497   8.832   1.00 0.00 ? 67 ARG A C   6  
ATOM   4178  O  O   . ARG A 1 67 ? -1.621  4.063   7.710   1.00 0.00 ? 67 ARG A O   6  
ATOM   4179  C  CB  . ARG A 1 67 ? -4.418  3.999   8.991   1.00 0.00 ? 67 ARG A CB  6  
ATOM   4180  C  CG  . ARG A 1 67 ? -4.142  2.620   9.646   1.00 0.00 ? 67 ARG A CG  6  
ATOM   4181  C  CD  . ARG A 1 67 ? -3.258  2.727   10.895  1.00 0.00 ? 67 ARG A CD  6  
ATOM   4182  N  NE  . ARG A 1 67 ? -4.134  2.936   12.077  1.00 0.00 ? 67 ARG A NE  6  
ATOM   4183  C  CZ  . ARG A 1 67 ? -4.600  1.979   12.868  1.00 0.00 ? 67 ARG A CZ  6  
ATOM   4184  N  NH1 . ARG A 1 67 ? -4.354  0.712   12.711  1.00 0.00 ? 67 ARG A NH1 6  
ATOM   4185  N  NH2 . ARG A 1 67 ? -5.344  2.336   13.855  1.00 0.00 ? 67 ARG A NH2 6  
ATOM   4186  N  N   . PRO A 1 68 ? -0.931  4.476   9.948   1.00 0.00 ? 68 PRO A N   6  
ATOM   4187  C  CA  . PRO A 1 68 ? 0.524   4.027   9.903   1.00 0.00 ? 68 PRO A CA  6  
ATOM   4188  C  C   . PRO A 1 68 ? 0.855   2.579   9.633   1.00 0.00 ? 68 PRO A C   6  
ATOM   4189  O  O   . PRO A 1 68 ? 0.914   1.747   10.559  1.00 0.00 ? 68 PRO A O   6  
ATOM   4190  C  CB  . PRO A 1 68 ? 1.137   4.395   11.262  1.00 0.00 ? 68 PRO A CB  6  
ATOM   4191  C  CG  . PRO A 1 68 ? -0.089  4.293   12.180  1.00 0.00 ? 68 PRO A CG  6  
ATOM   4192  C  CD  . PRO A 1 68 ? -1.208  4.921   11.343  1.00 0.00 ? 68 PRO A CD  6  
ATOM   4193  N  N   . CYS A 1 69 ? 1.075   2.171   8.228   1.00 0.00 ? 69 CYS A N   6  
ATOM   4194  C  CA  . CYS A 1 69 ? 1.604   0.864   7.841   1.00 0.00 ? 69 CYS A CA  6  
ATOM   4195  C  C   . CYS A 1 69 ? 3.061   0.986   7.442   1.00 0.00 ? 69 CYS A C   6  
ATOM   4196  O  O   . CYS A 1 69 ? 3.464   1.315   6.321   1.00 0.00 ? 69 CYS A O   6  
ATOM   4197  C  CB  . CYS A 1 69 ? 0.683   0.283   6.755   1.00 0.00 ? 69 CYS A CB  6  
ATOM   4198  S  SG  . CYS A 1 69 ? 1.070   -1.419  6.340   1.00 0.00 ? 69 CYS A SG  6  
ATOM   4199  N  N   . LYS A 1 70 ? 4.032   0.713   8.552   1.00 0.00 ? 70 LYS A N   6  
ATOM   4200  C  CA  . LYS A 1 70 ? 5.472   0.767   8.343   1.00 0.00 ? 70 LYS A CA  6  
ATOM   4201  C  C   . LYS A 1 70 ? 6.130   -0.548  8.697   1.00 0.00 ? 70 LYS A C   6  
ATOM   4202  O  O   . LYS A 1 70 ? 7.270   -0.625  9.174   1.00 0.00 ? 70 LYS A O   6  
ATOM   4203  C  CB  . LYS A 1 70 ? 6.074   1.949   9.149   1.00 0.00 ? 70 LYS A CB  6  
ATOM   4204  C  CG  . LYS A 1 70 ? 5.616   3.336   8.628   1.00 0.00 ? 70 LYS A CG  6  
ATOM   4205  C  CD  . LYS A 1 70 ? 5.683   4.466   9.658   1.00 0.00 ? 70 LYS A CD  6  
ATOM   4206  C  CE  . LYS A 1 70 ? 7.150   4.714   10.039  1.00 0.00 ? 70 LYS A CE  6  
ATOM   4207  N  NZ  . LYS A 1 70 ? 7.213   5.267   11.403  1.00 0.00 ? 70 LYS A NZ  6  
ATOM   4208  N  N   . ARG A 1 71 ? 5.300   -1.755  8.470   1.00 0.00 ? 71 ARG A N   6  
ATOM   4209  C  CA  . ARG A 1 71 ? 5.724   -3.108  8.815   1.00 0.00 ? 71 ARG A CA  6  
ATOM   4210  C  C   . ARG A 1 71 ? 4.624   -4.088  8.456   1.00 0.00 ? 71 ARG A C   6  
ATOM   4211  O  O   . ARG A 1 71 ? 4.303   -5.014  9.208   1.00 0.00 ? 71 ARG A O   6  
ATOM   4212  C  CB  . ARG A 1 71 ? 6.082   -3.178  10.324  1.00 0.00 ? 71 ARG A CB  6  
ATOM   4213  C  CG  . ARG A 1 71 ? 6.473   -4.590  10.838  1.00 0.00 ? 71 ARG A CG  6  
ATOM   4214  C  CD  . ARG A 1 71 ? 7.727   -4.595  11.720  1.00 0.00 ? 71 ARG A CD  6  
ATOM   4215  N  NE  . ARG A 1 71 ? 8.284   -5.973  11.729  1.00 0.00 ? 71 ARG A NE  6  
ATOM   4216  C  CZ  . ARG A 1 71 ? 8.998   -6.521  10.755  1.00 0.00 ? 71 ARG A CZ  6  
ATOM   4217  N  NH1 . ARG A 1 71 ? 9.310   -5.918  9.646   1.00 0.00 ? 71 ARG A NH1 6  
ATOM   4218  N  NH2 . ARG A 1 71 ? 9.407   -7.728  10.926  1.00 0.00 ? 71 ARG A NH2 6  
ATOM   4219  N  N   . CYS A 1 72 ? 4.035   -3.926  7.111   1.00 0.00 ? 72 CYS A N   6  
ATOM   4220  C  CA  . CYS A 1 72 ? 2.792   -4.557  6.604   1.00 0.00 ? 72 CYS A CA  6  
ATOM   4221  C  C   . CYS A 1 72 ? 2.130   -5.246  7.775   1.00 0.00 ? 72 CYS A C   6  
ATOM   4222  O  O   . CYS A 1 72 ? 1.726   -6.397  7.925   1.00 0.00 ? 72 CYS A O   6  
ATOM   4223  C  CB  . CYS A 1 72 ? 3.123   -5.214  5.261   1.00 0.00 ? 72 CYS A CB  6  
ATOM   4224  S  SG  . CYS A 1 72 ? 3.497   -3.825  4.086   1.00 0.00 ? 72 CYS A SG  6  
ATOM   4225  N  N   . GLN A 1 73 ? 1.940   -4.236  8.908   1.00 0.00 ? 73 GLN A N   6  
ATOM   4226  C  CA  . GLN A 1 73 ? 1.296   -4.490  10.192  1.00 0.00 ? 73 GLN A CA  6  
ATOM   4227  C  C   . GLN A 1 73 ? 0.051   -5.324  10.160  1.00 0.00 ? 73 GLN A C   6  
ATOM   4228  O  O   . GLN A 1 73 ? -1.079  -4.832  10.022  1.00 0.00 ? 73 GLN A O   6  
ATOM   4229  C  CB  . GLN A 1 73 ? 0.966   -3.083  10.827  1.00 0.00 ? 73 GLN A CB  6  
ATOM   4230  C  CG  . GLN A 1 73 ? 1.324   -2.920  12.338  1.00 0.00 ? 73 GLN A CG  6  
ATOM   4231  C  CD  . GLN A 1 73 ? 0.443   -3.579  13.407  1.00 0.00 ? 73 GLN A CD  6  
ATOM   4232  O  OE1 . GLN A 1 73 ? -0.554  -3.021  13.834  1.00 0.00 ? 73 GLN A OE1 6  
ATOM   4233  N  NE2 . GLN A 1 73 ? 0.772   -4.748  13.895  1.00 0.00 ? 73 GLN A NE2 6  
ATOM   4234  N  N   . PRO A 1 74 ? 0.243   -6.780  10.332  1.00 0.00 ? 74 PRO A N   6  
ATOM   4235  C  CA  . PRO A 1 74 ? -0.830  -7.874  10.387  1.00 0.00 ? 74 PRO A CA  6  
ATOM   4236  C  C   . PRO A 1 74 ? -1.237  -8.322  11.774  1.00 0.00 ? 74 PRO A C   6  
ATOM   4237  O  O   . PRO A 1 74 ? -1.887  -9.378  11.932  1.00 0.00 ? 74 PRO A O   6  
ATOM   4238  C  CB  . PRO A 1 74 ? -0.153  -9.072  9.701   1.00 0.00 ? 74 PRO A CB  6  
ATOM   4239  C  CG  . PRO A 1 74 ? 1.244   -8.984  10.332  1.00 0.00 ? 74 PRO A CG  6  
ATOM   4240  C  CD  . PRO A 1 74 ? 1.542   -7.491  10.495  1.00 0.00 ? 74 PRO A CD  6  
ATOM   4241  N  N   . ASP A 1 75 ? -0.819  -7.510  12.938  1.00 0.00 ? 75 ASP A N   6  
ATOM   4242  C  CA  . ASP A 1 75 ? -0.989  -7.955  14.317  1.00 0.00 ? 75 ASP A CA  6  
ATOM   4243  C  C   . ASP A 1 75 ? -2.215  -7.367  14.972  1.00 0.00 ? 75 ASP A C   6  
ATOM   4244  O  O   . ASP A 1 75 ? -2.186  -6.910  16.129  1.00 0.00 ? 75 ASP A O   6  
ATOM   4245  C  CB  . ASP A 1 75 ? 0.301   -7.657  15.132  1.00 0.00 ? 75 ASP A CB  6  
ATOM   4246  C  CG  . ASP A 1 75 ? 1.572   -8.408  14.710  1.00 0.00 ? 75 ASP A CG  6  
ATOM   4247  O  OD1 . ASP A 1 75 ? 2.125   -8.232  13.634  1.00 0.00 ? 75 ASP A OD1 6  
ATOM   4248  O  OD2 . ASP A 1 75 ? 2.025   -9.266  15.673  1.00 0.00 ? 75 ASP A OD2 6  
ATOM   4249  N  N   . LYS A 1 76 ? -3.469  -7.393  14.188  1.00 0.00 ? 76 LYS A N   6  
ATOM   4250  C  CA  . LYS A 1 76 ? -4.752  -7.022  14.777  1.00 0.00 ? 76 LYS A CA  6  
ATOM   4251  C  C   . LYS A 1 76 ? -5.393  -8.216  15.449  1.00 0.00 ? 76 LYS A C   6  
ATOM   4252  O  O   . LYS A 1 76 ? -6.133  -8.091  16.433  1.00 0.00 ? 76 LYS A O   6  
ATOM   4253  C  CB  . LYS A 1 76 ? -5.687  -6.425  13.691  1.00 0.00 ? 76 LYS A CB  6  
ATOM   4254  C  CG  . LYS A 1 76 ? -5.537  -7.095  12.302  1.00 0.00 ? 76 LYS A CG  6  
ATOM   4255  C  CD  . LYS A 1 76 ? -4.698  -6.304  11.294  1.00 0.00 ? 76 LYS A CD  6  
ATOM   4256  C  CE  . LYS A 1 76 ? -5.172  -6.635  9.873   1.00 0.00 ? 76 LYS A CE  6  
ATOM   4257  N  NZ  . LYS A 1 76 ? -4.743  -8.000  9.520   1.00 0.00 ? 76 LYS A NZ  6  
ATOM   4258  N  N   . ALA A 1 77 ? -5.121  -9.532  14.835  1.00 0.00 ? 77 ALA A N   6  
ATOM   4259  C  CA  . ALA A 1 77 ? -5.500  -10.808 15.434  1.00 0.00 ? 77 ALA A CA  6  
ATOM   4260  C  C   . ALA A 1 77 ? -5.720  -10.733 16.923  1.00 0.00 ? 77 ALA A C   6  
ATOM   4261  O  O   . ALA A 1 77 ? -6.718  -11.229 17.464  1.00 0.00 ? 77 ALA A O   6  
ATOM   4262  C  CB  . ALA A 1 77 ? -4.400  -11.829 15.055  1.00 0.00 ? 77 ALA A CB  6  
ATOM   4263  N  N   . ASN A 1 78 ? -4.657  -10.067 17.711  1.00 0.00 ? 78 ASN A N   6  
ATOM   4264  C  CA  . ASN A 1 78 ? -4.693  -10.027 19.171  1.00 0.00 ? 78 ASN A CA  6  
ATOM   4265  C  C   . ASN A 1 78 ? -4.396  -11.391 19.751  1.00 0.00 ? 78 ASN A C   6  
ATOM   4266  O  O   . ASN A 1 78 ? -5.165  -11.965 20.533  1.00 0.00 ? 78 ASN A O   6  
ATOM   4267  C  CB  . ASN A 1 78 ? -6.072  -9.485  19.641  1.00 0.00 ? 78 ASN A CB  6  
ATOM   4268  C  CG  . ASN A 1 78 ? -6.074  -8.159  20.413  1.00 0.00 ? 78 ASN A CG  6  
ATOM   4269  O  OD1 . ASN A 1 78 ? -5.135  -7.806  21.110  1.00 0.00 ? 78 ASN A OD1 6  
ATOM   4270  N  ND2 . ASN A 1 78 ? -7.112  -7.375  20.305  1.00 0.00 ? 78 ASN A ND2 6  
ATOM   4271  N  N   . PRO A 1 79 ? -3.106  -11.992 19.346  1.00 0.00 ? 79 PRO A N   6  
ATOM   4272  C  CA  . PRO A 1 79 ? -2.564  -13.354 19.782  1.00 0.00 ? 79 PRO A CA  6  
ATOM   4273  C  C   . PRO A 1 79 ? -2.375  -13.515 21.276  1.00 0.00 ? 79 PRO A C   6  
ATOM   4274  O  O   . PRO A 1 79 ? -3.291  -13.948 21.996  1.00 0.00 ? 79 PRO A O   6  
ATOM   4275  C  CB  . PRO A 1 79 ? -1.226  -13.552 19.087  1.00 0.00 ? 79 PRO A CB  6  
ATOM   4276  C  CG  . PRO A 1 79 ? -0.783  -12.111 18.793  1.00 0.00 ? 79 PRO A CG  6  
ATOM   4277  C  CD  . PRO A 1 79 ? -2.093  -11.394 18.444  1.00 0.00 ? 79 PRO A CD  6  
ATOM   4278  N  N   . ARG A 1 80 ? -1.068  -13.119 21.841  1.00 0.00 ? 80 ARG A N   6  
ATOM   4279  C  CA  . ARG A 1 80 ? -0.772  -13.249 23.266  1.00 0.00 ? 80 ARG A CA  6  
ATOM   4280  C  C   . ARG A 1 80 ? 0.558   -12.618 23.604  1.00 0.00 ? 80 ARG A C   6  
ATOM   4281  O  O   . ARG A 1 80 ? 0.726   -11.971 24.647  1.00 0.00 ? 80 ARG A O   6  
ATOM   4282  C  CB  . ARG A 1 80 ? -0.803  -14.753 23.650  1.00 0.00 ? 80 ARG A CB  6  
ATOM   4283  C  CG  . ARG A 1 80 ? -0.304  -15.074 25.084  1.00 0.00 ? 80 ARG A CG  6  
ATOM   4284  C  CD  . ARG A 1 80 ? -1.139  -16.165 25.767  1.00 0.00 ? 80 ARG A CD  6  
ATOM   4285  N  NE  . ARG A 1 80 ? -0.284  -16.851 26.768  1.00 0.00 ? 80 ARG A NE  6  
ATOM   4286  C  CZ  . ARG A 1 80 ? -0.464  -18.085 27.219  1.00 0.00 ? 80 ARG A CZ  6  
ATOM   4287  N  NH1 . ARG A 1 80 ? -1.424  -18.873 26.835  1.00 0.00 ? 80 ARG A NH1 6  
ATOM   4288  N  NH2 . ARG A 1 80 ? 0.370   -18.526 28.093  1.00 0.00 ? 80 ARG A NH2 6  
ATOM   4289  N  N   . GLN A 1 81 ? 1.658   -12.848 22.642  1.00 0.00 ? 81 GLN A N   6  
ATOM   4290  C  CA  . GLN A 1 81 ? 3.031   -12.436 22.921  1.00 0.00 ? 81 GLN A CA  6  
ATOM   4291  C  C   . GLN A 1 81 ? 3.077   -11.027 23.464  1.00 0.00 ? 81 GLN A C   6  
ATOM   4292  O  O   . GLN A 1 81 ? 2.647   -10.065 22.814  1.00 0.00 ? 81 GLN A O   6  
ATOM   4293  C  CB  . GLN A 1 81 ? 3.857   -12.554 21.621  1.00 0.00 ? 81 GLN A CB  6  
ATOM   4294  C  CG  . GLN A 1 81 ? 3.328   -11.747 20.389  1.00 0.00 ? 81 GLN A CG  6  
ATOM   4295  C  CD  . GLN A 1 81 ? 3.839   -10.320 20.156  1.00 0.00 ? 81 GLN A CD  6  
ATOM   4296  O  OE1 . GLN A 1 81 ? 4.907   -9.948  20.617  1.00 0.00 ? 81 GLN A OE1 6  
ATOM   4297  N  NE2 . GLN A 1 81 ? 3.127   -9.477  19.453  1.00 0.00 ? 81 GLN A NE2 6  
ATOM   4298  N  N   . HIS A 1 82 ? 3.642   -10.865 24.821  1.00 0.00 ? 82 HIS A N   6  
ATOM   4299  C  CA  . HIS A 1 82 ? 3.875   -9.546  25.409  1.00 0.00 ? 82 HIS A CA  6  
ATOM   4300  C  C   . HIS A 1 82 ? 4.402   -9.675  26.819  1.00 0.00 ? 82 HIS A C   6  
ATOM   4301  O  O   . HIS A 1 82 ? 3.723   -9.389  27.815  1.00 0.00 ? 82 HIS A O   6  
ATOM   4302  C  CB  . HIS A 1 82 ? 2.527   -8.812  25.372  1.00 0.00 ? 82 HIS A CB  6  
ATOM   4303  C  CG  . HIS A 1 82 ? 2.594   -7.533  24.586  1.00 0.00 ? 82 HIS A CG  6  
ATOM   4304  N  ND1 . HIS A 1 82 ? 1.564   -6.993  23.820  1.00 0.00 ? 82 HIS A ND1 6  
ATOM   4305  C  CD2 . HIS A 1 82 ? 3.729   -6.735  24.548  1.00 0.00 ? 82 HIS A CD2 6  
ATOM   4306  C  CE1 . HIS A 1 82 ? 2.173   -5.880  23.368  1.00 0.00 ? 82 HIS A CE1 6  
ATOM   4307  N  NE2 . HIS A 1 82 ? 3.459   -5.652  23.752  1.00 0.00 ? 82 HIS A NE2 6  
ATOM   4308  N  N   . ARG A 1 83 ? 5.780   -10.206 26.948  1.00 0.00 ? 83 ARG A N   6  
ATOM   4309  C  CA  . ARG A 1 83 ? 6.375   -10.521 28.245  1.00 0.00 ? 83 ARG A CA  6  
ATOM   4310  C  C   . ARG A 1 83 ? 7.118   -9.334  28.808  1.00 0.00 ? 83 ARG A C   6  
ATOM   4311  O  O   . ARG A 1 83 ? 7.697   -8.519  28.076  1.00 0.00 ? 83 ARG A O   6  
ATOM   4312  C  CB  . ARG A 1 83 ? 7.308   -11.753 28.078  1.00 0.00 ? 83 ARG A CB  6  
ATOM   4313  C  CG  . ARG A 1 83 ? 6.815   -12.808 27.052  1.00 0.00 ? 83 ARG A CG  6  
ATOM   4314  C  CD  . ARG A 1 83 ? 7.826   -13.939 26.829  1.00 0.00 ? 83 ARG A CD  6  
ATOM   4315  N  NE  . ARG A 1 83 ? 7.231   -14.916 25.882  1.00 0.00 ? 83 ARG A NE  6  
ATOM   4316  C  CZ  . ARG A 1 83 ? 6.476   -15.953 26.220  1.00 0.00 ? 83 ARG A CZ  6  
ATOM   4317  N  NH1 . ARG A 1 83 ? 6.156   -16.260 27.442  1.00 0.00 ? 83 ARG A NH1 6  
ATOM   4318  N  NH2 . ARG A 1 83 ? 6.033   -16.699 25.271  1.00 0.00 ? 83 ARG A NH2 6  
ATOM   4319  N  N   . LEU A 1 84 ? 7.150   -9.217  30.283  1.00 0.00 ? 84 LEU A N   6  
ATOM   4320  C  CA  . LEU A 1 84 ? 7.959   -8.210  30.961  1.00 0.00 ? 84 LEU A CA  6  
ATOM   4321  C  C   . LEU A 1 84 ? 9.363   -8.706  31.218  1.00 0.00 ? 84 LEU A C   6  
ATOM   4322  O  O   . LEU A 1 84 ? 10.190  -8.011  31.832  1.00 0.00 ? 84 LEU A O   6  
ATOM   4323  C  CB  . LEU A 1 84 ? 7.278   -7.769  32.290  1.00 0.00 ? 84 LEU A CB  6  
ATOM   4324  C  CG  . LEU A 1 84 ? 6.892   -8.870  33.313  1.00 0.00 ? 84 LEU A CG  6  
ATOM   4325  C  CD1 . LEU A 1 84 ? 7.846   -8.833  34.515  1.00 0.00 ? 84 LEU A CD1 6  
ATOM   4326  C  CD2 . LEU A 1 84 ? 5.439   -8.744  33.801  1.00 0.00 ? 84 LEU A CD2 6  
ATOM   4327  N  N   . ASP A 1 85 ? 9.721   -10.036 30.678  1.00 0.00 ? 85 ASP A N   6  
ATOM   4328  C  CA  . ASP A 1 85 ? 10.990  -10.683 31.008  1.00 0.00 ? 85 ASP A CA  6  
ATOM   4329  C  C   . ASP A 1 85 ? 11.265  -11.845 30.083  1.00 0.00 ? 85 ASP A C   6  
ATOM   4330  O  O   . ASP A 1 85 ? 10.812  -12.977 30.303  1.00 0.00 ? 85 ASP A O   6  
ATOM   4331  C  CB  . ASP A 1 85 ? 11.001  -11.114 32.497  1.00 0.00 ? 85 ASP A CB  6  
ATOM   4332  C  CG  . ASP A 1 85 ? 12.365  -11.110 33.205  1.00 0.00 ? 85 ASP A CG  6  
ATOM   4333  O  OD1 . ASP A 1 85 ? 13.327  -10.444 32.497  1.00 0.00 ? 85 ASP A OD1 6  
ATOM   4334  O  OD2 . ASP A 1 85 ? 12.557  -11.649 34.285  1.00 0.00 ? 85 ASP A OD2 6  
ATOM   4335  N  N   . LYS A 1 86 ? 12.087  -11.550 28.888  1.00 0.00 ? 86 LYS A N   6  
ATOM   4336  C  CA  . LYS A 1 86 ? 12.415  -12.578 27.905  1.00 0.00 ? 86 LYS A CA  6  
ATOM   4337  C  C   . LYS A 1 86 ? 13.366  -12.047 26.857  1.00 0.00 ? 86 LYS A C   6  
ATOM   4338  O  O   . LYS A 1 86 ? 14.311  -12.725 26.431  1.00 0.00 ? 86 LYS A O   6  
ATOM   4339  C  CB  . LYS A 1 86 ? 11.108  -13.106 27.252  1.00 0.00 ? 86 LYS A CB  6  
ATOM   4340  C  CG  . LYS A 1 86 ? 11.358  -14.088 26.080  1.00 0.00 ? 86 LYS A CG  6  
ATOM   4341  C  CD  . LYS A 1 86 ? 11.447  -15.562 26.484  1.00 0.00 ? 86 LYS A CD  6  
ATOM   4342  C  CE  . LYS A 1 86 ? 11.582  -16.425 25.222  1.00 0.00 ? 86 LYS A CE  6  
ATOM   4343  N  NZ  . LYS A 1 86 ? 11.399  -17.844 25.577  1.00 0.00 ? 86 LYS A NZ  6  
ATOM   4344  N  N   . ILE A 1 87 ? 13.117  -10.668 26.386  1.00 0.00 ? 87 ILE A N   6  
ATOM   4345  C  CA  . ILE A 1 87 ? 13.870  -10.078 25.283  1.00 0.00 ? 87 ILE A CA  6  
ATOM   4346  C  C   . ILE A 1 87 ? 14.969  -9.180  25.800  1.00 0.00 ? 87 ILE A C   6  
ATOM   4347  O  O   . ILE A 1 87 ? 15.372  -8.202  25.155  1.00 0.00 ? 87 ILE A O   6  
ATOM   4348  C  CB  . ILE A 1 87 ? 12.913  -9.326  24.271  1.00 0.00 ? 87 ILE A CB  6  
ATOM   4349  C  CG1 . ILE A 1 87 ? 13.500  -9.128  22.837  1.00 0.00 ? 87 ILE A CG1 6  
ATOM   4350  C  CG2 . ILE A 1 87 ? 12.432  -7.941  24.804  1.00 0.00 ? 87 ILE A CG2 6  
ATOM   4351  C  CD1 . ILE A 1 87 ? 14.076  -7.734  22.514  1.00 0.00 ? 87 ILE A CD1 6  
ATOM   4352  N  N   . THR A 1 88 ? 15.563  -9.556  27.102  1.00 0.00 ? 88 THR A N   6  
ATOM   4353  C  CA  . THR A 1 88 ? 16.677  -8.814  27.686  1.00 0.00 ? 88 THR A CA  6  
ATOM   4354  C  C   . THR A 1 88 ? 17.874  -9.710  27.898  1.00 0.00 ? 88 THR A C   6  
ATOM   4355  O  O   . THR A 1 88 ? 17.790  -10.943 27.806  1.00 0.00 ? 88 THR A O   6  
ATOM   4356  C  CB  . THR A 1 88 ? 16.245  -8.142  29.033  1.00 0.00 ? 88 THR A CB  6  
ATOM   4357  O  OG1 . THR A 1 88 ? 15.490  -9.050  29.824  1.00 0.00 ? 88 THR A OG1 6  
ATOM   4358  C  CG2 . THR A 1 88 ? 15.347  -6.891  28.917  1.00 0.00 ? 88 THR A CG2 6  
ATOM   4359  N  N   . HIS A 1 89 ? 19.153  -9.033  28.202  1.00 0.00 ? 89 HIS A N   6  
ATOM   4360  C  CA  . HIS A 1 89 ? 20.353  -9.773  28.586  1.00 0.00 ? 89 HIS A CA  6  
ATOM   4361  C  C   . HIS A 1 89 ? 20.693  -9.537  30.039  1.00 0.00 ? 89 HIS A C   6  
ATOM   4362  O  O   . HIS A 1 89 ? 21.337  -8.544  30.405  1.00 0.00 ? 89 HIS A O   6  
ATOM   4363  C  CB  . HIS A 1 89 ? 21.485  -9.259  27.680  1.00 0.00 ? 89 HIS A CB  6  
ATOM   4364  C  CG  . HIS A 1 89 ? 22.623  -10.233 27.580  1.00 0.00 ? 89 HIS A CG  6  
ATOM   4365  N  ND1 . HIS A 1 89 ? 22.910  -11.248 28.489  1.00 0.00 ? 89 HIS A ND1 6  
ATOM   4366  C  CD2 . HIS A 1 89 ? 23.534  -10.215 26.533  1.00 0.00 ? 89 HIS A CD2 6  
ATOM   4367  C  CE1 . HIS A 1 89 ? 24.003  -11.776 27.906  1.00 0.00 ? 89 HIS A CE1 6  
ATOM   4368  N  NE2 . HIS A 1 89 ? 24.439  -11.223 26.742  1.00 0.00 ? 89 HIS A NE2 6  
ATOM   4369  N  N   . ALA A 1 90 ? 20.247  -10.574 30.995  1.00 0.00 ? 90 ALA A N   6  
ATOM   4370  C  CA  . ALA A 1 90 ? 20.579  -10.511 32.415  1.00 0.00 ? 90 ALA A CA  6  
ATOM   4371  C  C   . ALA A 1 90 ? 21.821  -11.317 32.717  1.00 0.00 ? 90 ALA A C   6  
ATOM   4372  O  O   . ALA A 1 90 ? 22.701  -11.501 31.866  1.00 0.00 ? 90 ALA A O   6  
ATOM   4373  C  CB  . ALA A 1 90 ? 19.349  -10.992 33.204  1.00 0.00 ? 90 ALA A CB  6  
ATOM   4374  N  N   . CYS A 1 91 ? 21.933  -11.857 34.089  1.00 0.00 ? 91 CYS A N   6  
ATOM   4375  C  CA  . CYS A 1 91 ? 23.124  -12.568 34.545  1.00 0.00 ? 91 CYS A CA  6  
ATOM   4376  C  C   . CYS A 1 91 ? 23.148  -13.981 34.010  1.00 0.00 ? 91 CYS A C   6  
ATOM   4377  O  O   . CYS A 1 91 ? 22.150  -14.713 34.054  1.00 0.00 ? 91 CYS A O   6  
ATOM   4378  C  CB  . CYS A 1 91 ? 23.163  -12.522 36.085  1.00 0.00 ? 91 CYS A CB  6  
ATOM   4379  S  SG  . CYS A 1 91 ? 24.809  -12.948 36.697  1.00 0.00 ? 91 CYS A SG  6  
ATOM   4380  N  N   . ARG A 1 92 ? 24.430  -14.440 33.432  1.00 0.00 ? 92 ARG A N   6  
ATOM   4381  C  CA  . ARG A 1 92 ? 24.570  -15.750 32.803  1.00 0.00 ? 92 ARG A CA  6  
ATOM   4382  C  C   . ARG A 1 92 ? 26.025  -16.118 32.637  1.00 0.00 ? 92 ARG A C   6  
ATOM   4383  O  O   . ARG A 1 92 ? 26.884  -15.757 33.439  1.00 0.00 ? 92 ARG A O   6  
ATOM   4384  C  CB  . ARG A 1 92 ? 23.831  -15.734 31.437  1.00 0.00 ? 92 ARG A CB  6  
ATOM   4385  C  CG  . ARG A 1 92 ? 23.591  -17.132 30.807  1.00 0.00 ? 92 ARG A CG  6  
ATOM   4386  C  CD  . ARG A 1 92 ? 23.532  -18.248 31.857  1.00 0.00 ? 92 ARG A CD  6  
ATOM   4387  N  NE  . ARG A 1 92 ? 22.268  -18.104 32.622  1.00 0.00 ? 92 ARG A NE  6  
ATOM   4388  C  CZ  . ARG A 1 92 ? 21.922  -18.825 33.680  1.00 0.00 ? 92 ARG A CZ  6  
ATOM   4389  N  NH1 . ARG A 1 92 ? 22.652  -19.769 34.196  1.00 0.00 ? 92 ARG A NH1 6  
ATOM   4390  N  NH2 . ARG A 1 92 ? 20.786  -18.569 34.226  1.00 0.00 ? 92 ARG A NH2 6  
ATOM   4391  O  OXT . ARG A 1 92 ? 26.345  -16.913 31.492  1.00 0.00 ? 92 ARG A OXT 6  
HETATM 4392  ZN ZN  . ZN  B 2 .  ? 1.892   -2.088  4.364   1.00 0.00 ? 93 ZN  A ZN  6  
ATOM   4393  N  N   . MET A 1 1  ? 11.010  18.112  -8.046  1.00 0.00 ? 1  MET A N   7  
ATOM   4394  C  CA  . MET A 1 1  ? 9.717   18.559  -8.557  1.00 0.00 ? 1  MET A CA  7  
ATOM   4395  C  C   . MET A 1 1  ? 9.753   18.746  -10.055 1.00 0.00 ? 1  MET A C   7  
ATOM   4396  O  O   . MET A 1 1  ? 8.814   18.377  -10.778 1.00 0.00 ? 1  MET A O   7  
ATOM   4397  C  CB  . MET A 1 1  ? 9.290   19.872  -7.845  1.00 0.00 ? 1  MET A CB  7  
ATOM   4398  C  CG  . MET A 1 1  ? 10.027  20.201  -6.530  1.00 0.00 ? 1  MET A CG  7  
ATOM   4399  S  SD  . MET A 1 1  ? 9.177   19.428  -5.143  1.00 0.00 ? 1  MET A SD  7  
ATOM   4400  C  CE  . MET A 1 1  ? 9.628   20.608  -3.864  1.00 0.00 ? 1  MET A CE  7  
ATOM   4401  N  N   . LYS A 1 2  ? 10.943  19.423  -10.613 1.00 0.00 ? 2  LYS A N   7  
ATOM   4402  C  CA  . LYS A 1 2  ? 11.024  19.812  -12.018 1.00 0.00 ? 2  LYS A CA  7  
ATOM   4403  C  C   . LYS A 1 2  ? 12.460  19.879  -12.480 1.00 0.00 ? 2  LYS A C   7  
ATOM   4404  O  O   . LYS A 1 2  ? 12.867  20.792  -13.212 1.00 0.00 ? 2  LYS A O   7  
ATOM   4405  C  CB  . LYS A 1 2  ? 10.312  21.178  -12.217 1.00 0.00 ? 2  LYS A CB  7  
ATOM   4406  C  CG  . LYS A 1 2  ? 9.849   21.428  -13.673 1.00 0.00 ? 2  LYS A CG  7  
ATOM   4407  C  CD  . LYS A 1 2  ? 9.722   22.904  -14.064 1.00 0.00 ? 2  LYS A CD  7  
ATOM   4408  C  CE  . LYS A 1 2  ? 8.593   23.060  -15.091 1.00 0.00 ? 2  LYS A CE  7  
ATOM   4409  N  NZ  . LYS A 1 2  ? 8.983   24.064  -16.098 1.00 0.00 ? 2  LYS A NZ  7  
ATOM   4410  N  N   . LYS A 1 3  ? 13.348  18.784  -12.030 1.00 0.00 ? 3  LYS A N   7  
ATOM   4411  C  CA  . LYS A 1 3  ? 14.722  18.658  -12.506 1.00 0.00 ? 3  LYS A CA  7  
ATOM   4412  C  C   . LYS A 1 3  ? 14.889  17.420  -13.356 1.00 0.00 ? 3  LYS A C   7  
ATOM   4413  O  O   . LYS A 1 3  ? 13.918  16.743  -13.720 1.00 0.00 ? 3  LYS A O   7  
ATOM   4414  C  CB  . LYS A 1 3  ? 15.692  18.636  -11.293 1.00 0.00 ? 3  LYS A CB  7  
ATOM   4415  C  CG  . LYS A 1 3  ? 16.980  19.467  -11.520 1.00 0.00 ? 3  LYS A CG  7  
ATOM   4416  C  CD  . LYS A 1 3  ? 17.487  20.219  -10.286 1.00 0.00 ? 3  LYS A CD  7  
ATOM   4417  C  CE  . LYS A 1 3  ? 18.665  21.116  -10.690 1.00 0.00 ? 3  LYS A CE  7  
ATOM   4418  N  NZ  . LYS A 1 3  ? 18.814  22.202  -9.705  1.00 0.00 ? 3  LYS A NZ  7  
ATOM   4419  N  N   . ALA A 1 4  ? 16.276  17.051  -13.712 1.00 0.00 ? 4  ALA A N   7  
ATOM   4420  C  CA  . ALA A 1 4  ? 16.576  15.984  -14.660 1.00 0.00 ? 4  ALA A CA  7  
ATOM   4421  C  C   . ALA A 1 4  ? 16.618  14.635  -13.982 1.00 0.00 ? 4  ALA A C   7  
ATOM   4422  O  O   . ALA A 1 4  ? 17.021  13.623  -14.578 1.00 0.00 ? 4  ALA A O   7  
ATOM   4423  C  CB  . ALA A 1 4  ? 17.902  16.339  -15.357 1.00 0.00 ? 4  ALA A CB  7  
ATOM   4424  N  N   . THR A 1 5  ? 16.154  14.573  -12.579 1.00 0.00 ? 5  THR A N   7  
ATOM   4425  C  CA  . THR A 1 5  ? 16.297  13.363  -11.773 1.00 0.00 ? 5  THR A CA  7  
ATOM   4426  C  C   . THR A 1 5  ? 14.985  12.984  -11.127 1.00 0.00 ? 5  THR A C   7  
ATOM   4427  O  O   . THR A 1 5  ? 14.583  11.812  -11.107 1.00 0.00 ? 5  THR A O   7  
ATOM   4428  C  CB  . THR A 1 5  ? 17.414  13.548  -10.692 1.00 0.00 ? 5  THR A CB  7  
ATOM   4429  O  OG1 . THR A 1 5  ? 17.802  12.289  -10.156 1.00 0.00 ? 5  THR A OG1 7  
ATOM   4430  C  CG2 . THR A 1 5  ? 17.040  14.395  -9.456  1.00 0.00 ? 5  THR A CG2 7  
ATOM   4431  N  N   . CYS A 1 6  ? 14.196  14.091  -10.544 1.00 0.00 ? 6  CYS A N   7  
ATOM   4432  C  CA  . CYS A 1 6  ? 12.855  13.885  -10.007 1.00 0.00 ? 6  CYS A CA  7  
ATOM   4433  C  C   . CYS A 1 6  ? 11.814  13.989  -11.096 1.00 0.00 ? 6  CYS A C   7  
ATOM   4434  O  O   . CYS A 1 6  ? 11.476  15.081  -11.574 1.00 0.00 ? 6  CYS A O   7  
ATOM   4435  C  CB  . CYS A 1 6  ? 12.620  14.901  -8.871  1.00 0.00 ? 6  CYS A CB  7  
ATOM   4436  S  SG  . CYS A 1 6  ? 13.449  14.370  -7.356  1.00 0.00 ? 6  CYS A SG  7  
ATOM   4437  N  N   . LEU A 1 7  ? 11.202  12.718  -11.544 1.00 0.00 ? 7  LEU A N   7  
ATOM   4438  C  CA  . LEU A 1 7  ? 10.254  12.666  -12.654 1.00 0.00 ? 7  LEU A CA  7  
ATOM   4439  C  C   . LEU A 1 7  ? 8.881   13.113  -12.213 1.00 0.00 ? 7  LEU A C   7  
ATOM   4440  O  O   . LEU A 1 7  ? 8.605   14.316  -12.072 1.00 0.00 ? 7  LEU A O   7  
ATOM   4441  C  CB  . LEU A 1 7  ? 10.213  11.242  -13.276 1.00 0.00 ? 7  LEU A CB  7  
ATOM   4442  C  CG  . LEU A 1 7  ? 11.378  10.822  -14.213 1.00 0.00 ? 7  LEU A CG  7  
ATOM   4443  C  CD1 . LEU A 1 7  ? 11.145  9.400   -14.741 1.00 0.00 ? 7  LEU A CD1 7  
ATOM   4444  C  CD2 . LEU A 1 7  ? 11.568  11.788  -15.394 1.00 0.00 ? 7  LEU A CD2 7  
ATOM   4445  N  N   . THR A 1 8  ? 7.889   12.053  -11.922 1.00 0.00 ? 8  THR A N   7  
ATOM   4446  C  CA  . THR A 1 8  ? 6.500   12.372  -11.603 1.00 0.00 ? 8  THR A CA  7  
ATOM   4447  C  C   . THR A 1 8  ? 5.861   11.306  -10.744 1.00 0.00 ? 8  THR A C   7  
ATOM   4448  O  O   . THR A 1 8  ? 6.522   10.391  -10.236 1.00 0.00 ? 8  THR A O   7  
ATOM   4449  C  CB  . THR A 1 8  ? 5.671   12.601  -12.912 1.00 0.00 ? 8  THR A CB  7  
ATOM   4450  O  OG1 . THR A 1 8  ? 6.527   12.973  -13.985 1.00 0.00 ? 8  THR A OG1 7  
ATOM   4451  C  CG2 . THR A 1 8  ? 4.609   13.722  -12.861 1.00 0.00 ? 8  THR A CG2 7  
ATOM   4452  N  N   . ASP A 1 9  ? 4.405   11.448  -10.512 1.00 0.00 ? 9  ASP A N   7  
ATOM   4453  C  CA  . ASP A 1 9  ? 3.625   10.416  -9.837  1.00 0.00 ? 9  ASP A CA  7  
ATOM   4454  C  C   . ASP A 1 9  ? 3.763   9.086   -10.540 1.00 0.00 ? 9  ASP A C   7  
ATOM   4455  O  O   . ASP A 1 9  ? 3.578   8.014   -9.949  1.00 0.00 ? 9  ASP A O   7  
ATOM   4456  C  CB  . ASP A 1 9  ? 2.141   10.846  -9.701  1.00 0.00 ? 9  ASP A CB  7  
ATOM   4457  C  CG  . ASP A 1 9  ? 1.640   11.965  -10.624 1.00 0.00 ? 9  ASP A CG  7  
ATOM   4458  O  OD1 . ASP A 1 9  ? 1.275   11.770  -11.774 1.00 0.00 ? 9  ASP A OD1 7  
ATOM   4459  O  OD2 . ASP A 1 9  ? 1.663   13.195  -10.026 1.00 0.00 ? 9  ASP A OD2 7  
ATOM   4460  N  N   . ASP A 1 10 ? 4.167   9.135   -11.963 1.00 0.00 ? 10 ASP A N   7  
ATOM   4461  C  CA  . ASP A 1 10 ? 4.351   7.920   -12.752 1.00 0.00 ? 10 ASP A CA  7  
ATOM   4462  C  C   . ASP A 1 10 ? 5.494   7.093   -12.213 1.00 0.00 ? 10 ASP A C   7  
ATOM   4463  O  O   . ASP A 1 10 ? 5.403   5.862   -12.091 1.00 0.00 ? 10 ASP A O   7  
ATOM   4464  C  CB  . ASP A 1 10 ? 4.534   8.269   -14.251 1.00 0.00 ? 10 ASP A CB  7  
ATOM   4465  C  CG  . ASP A 1 10 ? 5.667   9.245   -14.604 1.00 0.00 ? 10 ASP A CG  7  
ATOM   4466  O  OD1 . ASP A 1 10 ? 6.847   8.995   -14.407 1.00 0.00 ? 10 ASP A OD1 7  
ATOM   4467  O  OD2 . ASP A 1 10 ? 5.212   10.399  -15.180 1.00 0.00 ? 10 ASP A OD2 7  
ATOM   4468  N  N   . GLN A 1 11 ? 6.710   7.829   -11.802 1.00 0.00 ? 11 GLN A N   7  
ATOM   4469  C  CA  . GLN A 1 11 ? 7.899   7.146   -11.299 1.00 0.00 ? 11 GLN A CA  7  
ATOM   4470  C  C   . GLN A 1 11 ? 7.641   6.532   -9.941  1.00 0.00 ? 11 GLN A C   7  
ATOM   4471  O  O   . GLN A 1 11 ? 7.948   5.364   -9.669  1.00 0.00 ? 11 GLN A O   7  
ATOM   4472  C  CB  . GLN A 1 11 ? 9.056   8.167   -11.229 1.00 0.00 ? 11 GLN A CB  7  
ATOM   4473  C  CG  . GLN A 1 11 ? 10.449  7.681   -11.749 1.00 0.00 ? 11 GLN A CG  7  
ATOM   4474  C  CD  . GLN A 1 11 ? 11.719  8.370   -11.233 1.00 0.00 ? 11 GLN A CD  7  
ATOM   4475  O  OE1 . GLN A 1 11 ? 12.720  8.451   -11.927 1.00 0.00 ? 11 GLN A OE1 7  
ATOM   4476  N  NE2 . GLN A 1 11 ? 11.731  8.908   -10.040 1.00 0.00 ? 11 GLN A NE2 7  
ATOM   4477  N  N   . ARG A 1 12 ? 6.960   7.405   -8.960  1.00 0.00 ? 12 ARG A N   7  
ATOM   4478  C  CA  . ARG A 1 12 ? 6.525   6.961   -7.643  1.00 0.00 ? 12 ARG A CA  7  
ATOM   4479  C  C   . ARG A 1 12 ? 5.913   5.580   -7.669  1.00 0.00 ? 12 ARG A C   7  
ATOM   4480  O  O   . ARG A 1 12 ? 6.398   4.566   -7.120  1.00 0.00 ? 12 ARG A O   7  
ATOM   4481  C  CB  . ARG A 1 12 ? 5.451   7.987   -7.137  1.00 0.00 ? 12 ARG A CB  7  
ATOM   4482  C  CG  . ARG A 1 12 ? 5.999   9.143   -6.269  1.00 0.00 ? 12 ARG A CG  7  
ATOM   4483  C  CD  . ARG A 1 12 ? 6.349   10.390  -7.092  1.00 0.00 ? 12 ARG A CD  7  
ATOM   4484  N  NE  . ARG A 1 12 ? 5.976   11.590  -6.301  1.00 0.00 ? 12 ARG A NE  7  
ATOM   4485  C  CZ  . ARG A 1 12 ? 6.720   12.150  -5.356  1.00 0.00 ? 12 ARG A CZ  7  
ATOM   4486  N  NH1 . ARG A 1 12 ? 7.893   11.721  -4.995  1.00 0.00 ? 12 ARG A NH1 7  
ATOM   4487  N  NH2 . ARG A 1 12 ? 6.243   13.187  -4.762  1.00 0.00 ? 12 ARG A NH2 7  
ATOM   4488  N  N   . TRP A 1 13 ? 4.605   5.501   -8.380  1.00 0.00 ? 13 TRP A N   7  
ATOM   4489  C  CA  . TRP A 1 13 ? 3.791   4.297   -8.315  1.00 0.00 ? 13 TRP A CA  7  
ATOM   4490  C  C   . TRP A 1 13 ? 4.367   3.216   -9.196  1.00 0.00 ? 13 TRP A C   7  
ATOM   4491  O  O   . TRP A 1 13 ? 4.016   2.034   -9.088  1.00 0.00 ? 13 TRP A O   7  
ATOM   4492  C  CB  . TRP A 1 13 ? 2.330   4.645   -8.745  1.00 0.00 ? 13 TRP A CB  7  
ATOM   4493  C  CG  . TRP A 1 13 ? 1.546   3.338   -8.975  1.00 0.00 ? 13 TRP A CG  7  
ATOM   4494  C  CD1 . TRP A 1 13 ? 1.305   2.733   -10.224 1.00 0.00 ? 13 TRP A CD1 7  
ATOM   4495  C  CD2 . TRP A 1 13 ? 1.055   2.478   -8.020  1.00 0.00 ? 13 TRP A CD2 7  
ATOM   4496  N  NE1 . TRP A 1 13 ? 0.655   1.492   -10.070 1.00 0.00 ? 13 TRP A NE1 7  
ATOM   4497  C  CE2 . TRP A 1 13 ? 0.516   1.353   -8.695  1.00 0.00 ? 13 TRP A CE2 7  
ATOM   4498  C  CE3 . TRP A 1 13 ? 1.054   2.548   -6.601  1.00 0.00 ? 13 TRP A CE3 7  
ATOM   4499  C  CZ2 . TRP A 1 13 ? -0.038  0.292   -7.945  1.00 0.00 ? 13 TRP A CZ2 7  
ATOM   4500  C  CZ3 . TRP A 1 13 ? 0.484   1.494   -5.888  1.00 0.00 ? 13 TRP A CZ3 7  
ATOM   4501  C  CH2 . TRP A 1 13 ? -0.058  0.383   -6.550  1.00 0.00 ? 13 TRP A CH2 7  
ATOM   4502  N  N   . GLN A 1 14 ? 5.339   3.647   -10.229 1.00 0.00 ? 14 GLN A N   7  
ATOM   4503  C  CA  . GLN A 1 14 ? 6.114   2.670   -10.994 1.00 0.00 ? 14 GLN A CA  7  
ATOM   4504  C  C   . GLN A 1 14 ? 7.054   1.939   -10.050 1.00 0.00 ? 14 GLN A C   7  
ATOM   4505  O  O   . GLN A 1 14 ? 7.400   0.766   -10.234 1.00 0.00 ? 14 GLN A O   7  
ATOM   4506  C  CB  . GLN A 1 14 ? 6.898   3.376   -12.115 1.00 0.00 ? 14 GLN A CB  7  
ATOM   4507  C  CG  . GLN A 1 14 ? 7.889   2.479   -12.934 1.00 0.00 ? 14 GLN A CG  7  
ATOM   4508  C  CD  . GLN A 1 14 ? 8.670   3.091   -14.102 1.00 0.00 ? 14 GLN A CD  7  
ATOM   4509  O  OE1 . GLN A 1 14 ? 9.888   3.172   -14.074 1.00 0.00 ? 14 GLN A OE1 7  
ATOM   4510  N  NE2 . GLN A 1 14 ? 8.032   3.528   -15.158 1.00 0.00 ? 14 GLN A NE2 7  
ATOM   4511  N  N   . SER A 1 15 ? 7.561   2.750   -8.917  1.00 0.00 ? 15 SER A N   7  
ATOM   4512  C  CA  . SER A 1 15 ? 8.305   2.153   -7.813  1.00 0.00 ? 15 SER A CA  7  
ATOM   4513  C  C   . SER A 1 15 ? 7.495   1.041   -7.177  1.00 0.00 ? 15 SER A C   7  
ATOM   4514  O  O   . SER A 1 15 ? 8.046   0.001   -6.782  1.00 0.00 ? 15 SER A O   7  
ATOM   4515  C  CB  . SER A 1 15 ? 8.747   3.205   -6.767  1.00 0.00 ? 15 SER A CB  7  
ATOM   4516  O  OG  . SER A 1 15 ? 10.086  2.999   -6.302  1.00 0.00 ? 15 SER A OG  7  
ATOM   4517  N  N   . VAL A 1 16 ? 6.024   1.280   -7.016  1.00 0.00 ? 16 VAL A N   7  
ATOM   4518  C  CA  . VAL A 1 16 ? 5.168   0.184   -6.569  1.00 0.00 ? 16 VAL A CA  7  
ATOM   4519  C  C   . VAL A 1 16 ? 5.075   -0.978  -7.527  1.00 0.00 ? 16 VAL A C   7  
ATOM   4520  O  O   . VAL A 1 16 ? 5.346   -2.161  -7.181  1.00 0.00 ? 16 VAL A O   7  
ATOM   4521  C  CB  . VAL A 1 16 ? 3.750   0.629   -6.048  1.00 0.00 ? 16 VAL A CB  7  
ATOM   4522  C  CG1 . VAL A 1 16 ? 3.033   -0.403  -5.108  1.00 0.00 ? 16 VAL A CG1 7  
ATOM   4523  C  CG2 . VAL A 1 16 ? 3.753   1.951   -5.247  1.00 0.00 ? 16 VAL A CG2 7  
ATOM   4524  N  N   . LEU A 1 17 ? 4.594   -0.719  -8.899  1.00 0.00 ? 17 LEU A N   7  
ATOM   4525  C  CA  . LEU A 1 17 ? 4.374   -1.784  -9.888  1.00 0.00 ? 17 LEU A CA  7  
ATOM   4526  C  C   . LEU A 1 17 ? 5.574   -2.682  -10.038 1.00 0.00 ? 17 LEU A C   7  
ATOM   4527  O  O   . LEU A 1 17 ? 5.525   -3.918  -10.008 1.00 0.00 ? 17 LEU A O   7  
ATOM   4528  C  CB  . LEU A 1 17 ? 4.011   -1.166  -11.280 1.00 0.00 ? 17 LEU A CB  7  
ATOM   4529  C  CG  . LEU A 1 17 ? 2.617   -0.495  -11.420 1.00 0.00 ? 17 LEU A CG  7  
ATOM   4530  C  CD1 . LEU A 1 17 ? 2.281   -0.280  -12.902 1.00 0.00 ? 17 LEU A CD1 7  
ATOM   4531  C  CD2 . LEU A 1 17 ? 1.497   -1.310  -10.752 1.00 0.00 ? 17 LEU A CD2 7  
ATOM   4532  N  N   . ALA A 1 18 ? 6.859   -1.970  -10.270 1.00 0.00 ? 18 ALA A N   7  
ATOM   4533  C  CA  . ALA A 1 18 ? 8.095   -2.618  -10.679 1.00 0.00 ? 18 ALA A CA  7  
ATOM   4534  C  C   . ALA A 1 18 ? 8.846   -3.293  -9.558  1.00 0.00 ? 18 ALA A C   7  
ATOM   4535  O  O   . ALA A 1 18 ? 9.902   -3.904  -9.769  1.00 0.00 ? 18 ALA A O   7  
ATOM   4536  C  CB  . ALA A 1 18 ? 8.957   -1.547  -11.394 1.00 0.00 ? 18 ALA A CB  7  
ATOM   4537  N  N   . ARG A 1 19 ? 8.229   -3.237  -8.218  1.00 0.00 ? 19 ARG A N   7  
ATOM   4538  C  CA  . ARG A 1 19 ? 8.870   -3.649  -6.976  1.00 0.00 ? 19 ARG A CA  7  
ATOM   4539  C  C   . ARG A 1 19 ? 10.280  -4.142  -7.137  1.00 0.00 ? 19 ARG A C   7  
ATOM   4540  O  O   . ARG A 1 19 ? 10.593  -5.324  -6.887  1.00 0.00 ? 19 ARG A O   7  
ATOM   4541  C  CB  . ARG A 1 19 ? 7.971   -4.725  -6.291  1.00 0.00 ? 19 ARG A CB  7  
ATOM   4542  C  CG  . ARG A 1 19 ? 7.757   -6.016  -7.121  1.00 0.00 ? 19 ARG A CG  7  
ATOM   4543  C  CD  . ARG A 1 19 ? 7.976   -7.292  -6.297  1.00 0.00 ? 19 ARG A CD  7  
ATOM   4544  N  NE  . ARG A 1 19 ? 7.105   -7.227  -5.097  1.00 0.00 ? 19 ARG A NE  7  
ATOM   4545  C  CZ  . ARG A 1 19 ? 6.519   -8.263  -4.512  1.00 0.00 ? 19 ARG A CZ  7  
ATOM   4546  N  NH1 . ARG A 1 19 ? 6.635   -9.495  -4.913  1.00 0.00 ? 19 ARG A NH1 7  
ATOM   4547  N  NH2 . ARG A 1 19 ? 5.789   -8.028  -3.480  1.00 0.00 ? 19 ARG A NH2 7  
ATOM   4548  N  N   . ASP A 1 20 ? 11.283  -3.181  -7.641  1.00 0.00 ? 20 ASP A N   7  
ATOM   4549  C  CA  . ASP A 1 20 ? 12.713  -3.484  -7.641  1.00 0.00 ? 20 ASP A CA  7  
ATOM   4550  C  C   . ASP A 1 20 ? 13.301  -3.141  -6.286  1.00 0.00 ? 20 ASP A C   7  
ATOM   4551  O  O   . ASP A 1 20 ? 14.064  -3.904  -5.681  1.00 0.00 ? 20 ASP A O   7  
ATOM   4552  C  CB  . ASP A 1 20 ? 13.441  -2.768  -8.804  1.00 0.00 ? 20 ASP A CB  7  
ATOM   4553  C  CG  . ASP A 1 20 ? 14.959  -2.990  -8.907  1.00 0.00 ? 20 ASP A CG  7  
ATOM   4554  O  OD1 . ASP A 1 20 ? 15.343  -4.229  -8.478  1.00 0.00 ? 20 ASP A OD1 7  
ATOM   4555  O  OD2 . ASP A 1 20 ? 15.726  -2.147  -9.349  1.00 0.00 ? 20 ASP A OD2 7  
ATOM   4556  N  N   . PRO A 1 21 ? 12.919  -1.817  -5.755  1.00 0.00 ? 21 PRO A N   7  
ATOM   4557  C  CA  . PRO A 1 21 ? 13.323  -1.215  -4.396  1.00 0.00 ? 21 PRO A CA  7  
ATOM   4558  C  C   . PRO A 1 21 ? 12.301  -1.469  -3.307  1.00 0.00 ? 21 PRO A C   7  
ATOM   4559  O  O   . PRO A 1 21 ? 11.301  -2.180  -3.530  1.00 0.00 ? 21 PRO A O   7  
ATOM   4560  C  CB  . PRO A 1 21 ? 13.392  0.285   -4.650  1.00 0.00 ? 21 PRO A CB  7  
ATOM   4561  C  CG  . PRO A 1 21 ? 12.167  0.474   -5.561  1.00 0.00 ? 21 PRO A CG  7  
ATOM   4562  C  CD  . PRO A 1 21 ? 12.063  -0.797  -6.408  1.00 0.00 ? 21 PRO A CD  7  
ATOM   4563  N  N   . ASN A 1 22 ? 12.509  -0.826  -1.995  1.00 0.00 ? 22 ASN A N   7  
ATOM   4564  C  CA  . ASN A 1 22 ? 11.492  -0.870  -0.946  1.00 0.00 ? 22 ASN A CA  7  
ATOM   4565  C  C   . ASN A 1 22 ? 10.557  0.311   -1.092  1.00 0.00 ? 22 ASN A C   7  
ATOM   4566  O  O   . ASN A 1 22 ? 9.412   0.222   -1.552  1.00 0.00 ? 22 ASN A O   7  
ATOM   4567  C  CB  . ASN A 1 22 ? 12.182  -0.836  0.447   1.00 0.00 ? 22 ASN A CB  7  
ATOM   4568  C  CG  . ASN A 1 22 ? 11.277  -0.607  1.663   1.00 0.00 ? 22 ASN A CG  7  
ATOM   4569  O  OD1 . ASN A 1 22 ? 10.331  -1.336  1.920   1.00 0.00 ? 22 ASN A OD1 7  
ATOM   4570  N  ND2 . ASN A 1 22 ? 11.516  0.415   2.440   1.00 0.00 ? 22 ASN A ND2 7  
ATOM   4571  N  N   . ALA A 1 23 ? 11.130  1.612   -0.676  1.00 0.00 ? 23 ALA A N   7  
ATOM   4572  C  CA  . ALA A 1 23 ? 10.485  2.897   -0.914  1.00 0.00 ? 23 ALA A CA  7  
ATOM   4573  C  C   . ALA A 1 23 ? 11.546  3.981   -1.021  1.00 0.00 ? 23 ALA A C   7  
ATOM   4574  O  O   . ALA A 1 23 ? 11.953  4.586   -0.021  1.00 0.00 ? 23 ALA A O   7  
ATOM   4575  C  CB  . ALA A 1 23 ? 9.474   3.161   0.210   1.00 0.00 ? 23 ALA A CB  7  
ATOM   4576  N  N   . ASP A 1 24 ? 12.076  4.219   -2.380  1.00 0.00 ? 24 ASP A N   7  
ATOM   4577  C  CA  . ASP A 1 24 ? 13.218  5.091   -2.634  1.00 0.00 ? 24 ASP A CA  7  
ATOM   4578  C  C   . ASP A 1 24 ? 13.185  6.319   -1.746  1.00 0.00 ? 24 ASP A C   7  
ATOM   4579  O  O   . ASP A 1 24 ? 12.272  7.163   -1.767  1.00 0.00 ? 24 ASP A O   7  
ATOM   4580  C  CB  . ASP A 1 24 ? 13.276  5.476   -4.136  1.00 0.00 ? 24 ASP A CB  7  
ATOM   4581  C  CG  . ASP A 1 24 ? 13.502  4.330   -5.132  1.00 0.00 ? 24 ASP A CG  7  
ATOM   4582  O  OD1 . ASP A 1 24 ? 14.806  3.921   -5.184  1.00 0.00 ? 24 ASP A OD1 7  
ATOM   4583  O  OD2 . ASP A 1 24 ? 12.601  3.832   -5.791  1.00 0.00 ? 24 ASP A OD2 7  
ATOM   4584  N  N   . GLY A 1 25 ? 14.281  6.410   -0.759  1.00 0.00 ? 25 GLY A N   7  
ATOM   4585  C  CA  . GLY A 1 25 ? 14.556  7.603   0.071   1.00 0.00 ? 25 GLY A CA  7  
ATOM   4586  C  C   . GLY A 1 25 ? 13.813  7.345   1.385   1.00 0.00 ? 25 GLY A C   7  
ATOM   4587  O  O   . GLY A 1 25 ? 14.362  6.835   2.369   1.00 0.00 ? 25 GLY A O   7  
ATOM   4588  N  N   . GLU A 1 26 ? 12.388  7.720   1.353   1.00 0.00 ? 26 GLU A N   7  
ATOM   4589  C  CA  . GLU A 1 26 ? 11.456  7.299   2.391   1.00 0.00 ? 26 GLU A CA  7  
ATOM   4590  C  C   . GLU A 1 26 ? 10.031  7.435   1.913   1.00 0.00 ? 26 GLU A C   7  
ATOM   4591  O  O   . GLU A 1 26 ? 9.089   7.483   2.730   1.00 0.00 ? 26 GLU A O   7  
ATOM   4592  C  CB  . GLU A 1 26 ? 11.779  8.146   3.663   1.00 0.00 ? 26 GLU A CB  7  
ATOM   4593  C  CG  . GLU A 1 26 ? 12.383  9.572   3.452   1.00 0.00 ? 26 GLU A CG  7  
ATOM   4594  C  CD  . GLU A 1 26 ? 12.641  10.440  4.687   1.00 0.00 ? 26 GLU A CD  7  
ATOM   4595  O  OE1 . GLU A 1 26 ? 13.882  10.276  5.223   1.00 0.00 ? 26 GLU A OE1 7  
ATOM   4596  O  OE2 . GLU A 1 26 ? 11.806  11.207  5.147   1.00 0.00 ? 26 GLU A OE2 7  
ATOM   4597  N  N   . PHE A 1 27 ? 9.785   7.465   0.447   1.00 0.00 ? 27 PHE A N   7  
ATOM   4598  C  CA  . PHE A 1 27 ? 8.462   7.811   -0.078  1.00 0.00 ? 27 PHE A CA  7  
ATOM   4599  C  C   . PHE A 1 27 ? 7.374   6.913   0.446   1.00 0.00 ? 27 PHE A C   7  
ATOM   4600  O  O   . PHE A 1 27 ? 7.621   5.901   1.120   1.00 0.00 ? 27 PHE A O   7  
ATOM   4601  C  CB  . PHE A 1 27 ? 8.467   7.936   -1.623  1.00 0.00 ? 27 PHE A CB  7  
ATOM   4602  C  CG  . PHE A 1 27 ? 8.051   6.757   -2.515  1.00 0.00 ? 27 PHE A CG  7  
ATOM   4603  C  CD1 . PHE A 1 27 ? 8.224   5.442   -2.076  1.00 0.00 ? 27 PHE A CD1 7  
ATOM   4604  C  CD2 . PHE A 1 27 ? 7.520   6.993   -3.789  1.00 0.00 ? 27 PHE A CD2 7  
ATOM   4605  C  CE1 . PHE A 1 27 ? 7.867   4.375   -2.893  1.00 0.00 ? 27 PHE A CE1 7  
ATOM   4606  C  CE2 . PHE A 1 27 ? 7.164   5.924   -4.606  1.00 0.00 ? 27 PHE A CE2 7  
ATOM   4607  C  CZ  . PHE A 1 27 ? 7.339   4.616   -4.159  1.00 0.00 ? 27 PHE A CZ  7  
ATOM   4608  N  N   . VAL A 1 28 ? 5.984   7.286   0.099   1.00 0.00 ? 28 VAL A N   7  
ATOM   4609  C  CA  . VAL A 1 28 ? 4.811   6.665   0.713   1.00 0.00 ? 28 VAL A CA  7  
ATOM   4610  C  C   . VAL A 1 28 ? 3.636   6.669   -0.234  1.00 0.00 ? 28 VAL A C   7  
ATOM   4611  O  O   . VAL A 1 28 ? 3.612   7.440   -1.215  1.00 0.00 ? 28 VAL A O   7  
ATOM   4612  C  CB  . VAL A 1 28 ? 4.461   7.435   2.051   1.00 0.00 ? 28 VAL A CB  7  
ATOM   4613  C  CG1 . VAL A 1 28 ? 4.982   6.792   3.366   1.00 0.00 ? 28 VAL A CG1 7  
ATOM   4614  C  CG2 . VAL A 1 28 ? 4.989   8.890   2.084   1.00 0.00 ? 28 VAL A CG2 7  
ATOM   4615  N  N   . PHE A 1 29 ? 2.538   5.709   0.009   1.00 0.00 ? 29 PHE A N   7  
ATOM   4616  C  CA  . PHE A 1 29 ? 1.349   5.661   -0.844  1.00 0.00 ? 29 PHE A CA  7  
ATOM   4617  C  C   . PHE A 1 29 ? 0.104   5.472   -0.011  1.00 0.00 ? 29 PHE A C   7  
ATOM   4618  O  O   . PHE A 1 29 ? 0.051   4.628   0.898   1.00 0.00 ? 29 PHE A O   7  
ATOM   4619  C  CB  . PHE A 1 29 ? 1.479   4.502   -1.876  1.00 0.00 ? 29 PHE A CB  7  
ATOM   4620  C  CG  . PHE A 1 29 ? 0.649   3.231   -1.644  1.00 0.00 ? 29 PHE A CG  7  
ATOM   4621  C  CD1 . PHE A 1 29 ? 0.925   2.412   -0.543  1.00 0.00 ? 29 PHE A CD1 7  
ATOM   4622  C  CD2 . PHE A 1 29 ? -0.336  2.845   -2.557  1.00 0.00 ? 29 PHE A CD2 7  
ATOM   4623  C  CE1 . PHE A 1 29 ? 0.227   1.224   -0.358  1.00 0.00 ? 29 PHE A CE1 7  
ATOM   4624  C  CE2 . PHE A 1 29 ? -1.031  1.653   -2.374  1.00 0.00 ? 29 PHE A CE2 7  
ATOM   4625  C  CZ  . PHE A 1 29 ? -0.750  0.843   -1.275  1.00 0.00 ? 29 PHE A CZ  7  
ATOM   4626  N  N   . ALA A 1 30 ? -1.038  6.370   -0.298  1.00 0.00 ? 30 ALA A N   7  
ATOM   4627  C  CA  . ALA A 1 30 ? -2.227  6.400   0.548   1.00 0.00 ? 30 ALA A CA  7  
ATOM   4628  C  C   . ALA A 1 30 ? -3.465  6.001   -0.220  1.00 0.00 ? 30 ALA A C   7  
ATOM   4629  O  O   . ALA A 1 30 ? -3.994  6.758   -1.046  1.00 0.00 ? 30 ALA A O   7  
ATOM   4630  C  CB  . ALA A 1 30 ? -2.332  7.810   1.154   1.00 0.00 ? 30 ALA A CB  7  
ATOM   4631  N  N   . VAL A 1 31 ? -4.033  4.674   0.100   1.00 0.00 ? 31 VAL A N   7  
ATOM   4632  C  CA  . VAL A 1 31 ? -5.226  4.151   -0.570  1.00 0.00 ? 31 VAL A CA  7  
ATOM   4633  C  C   . VAL A 1 31 ? -6.460  4.441   0.250   1.00 0.00 ? 31 VAL A C   7  
ATOM   4634  O  O   . VAL A 1 31 ? -6.776  3.718   1.214   1.00 0.00 ? 31 VAL A O   7  
ATOM   4635  C  CB  . VAL A 1 31 ? -5.045  2.603   -0.823  1.00 0.00 ? 31 VAL A CB  7  
ATOM   4636  C  CG1 . VAL A 1 31 ? -5.061  1.683   0.431   1.00 0.00 ? 31 VAL A CG1 7  
ATOM   4637  C  CG2 . VAL A 1 31 ? -6.082  1.984   -1.790  1.00 0.00 ? 31 VAL A CG2 7  
ATOM   4638  N  N   . ARG A 1 32 ? -7.256  5.637   -0.107  1.00 0.00 ? 32 ARG A N   7  
ATOM   4639  C  CA  . ARG A 1 32 ? -8.355  6.102   0.738   1.00 0.00 ? 32 ARG A CA  7  
ATOM   4640  C  C   . ARG A 1 32 ? -9.657  5.410   0.416   1.00 0.00 ? 32 ARG A C   7  
ATOM   4641  O  O   . ARG A 1 32 ? -10.519 5.955   -0.298  1.00 0.00 ? 32 ARG A O   7  
ATOM   4642  C  CB  . ARG A 1 32 ? -8.486  7.643   0.601   1.00 0.00 ? 32 ARG A CB  7  
ATOM   4643  C  CG  . ARG A 1 32 ? -8.702  8.167   -0.843  1.00 0.00 ? 32 ARG A CG  7  
ATOM   4644  C  CD  . ARG A 1 32 ? -7.934  9.468   -1.115  1.00 0.00 ? 32 ARG A CD  7  
ATOM   4645  N  NE  . ARG A 1 32 ? -8.829  10.395  -1.852  1.00 0.00 ? 32 ARG A NE  7  
ATOM   4646  C  CZ  . ARG A 1 32 ? -9.132  10.311  -3.140  1.00 0.00 ? 32 ARG A CZ  7  
ATOM   4647  N  NH1 . ARG A 1 32 ? -8.686  9.388   -3.940  1.00 0.00 ? 32 ARG A NH1 7  
ATOM   4648  N  NH2 . ARG A 1 32 ? -9.920  11.204  -3.624  1.00 0.00 ? 32 ARG A NH2 7  
ATOM   4649  N  N   . THR A 1 33 ? -9.857  4.051   0.961   1.00 0.00 ? 33 THR A N   7  
ATOM   4650  C  CA  . THR A 1 33 ? -11.133 3.346   0.841   1.00 0.00 ? 33 THR A CA  7  
ATOM   4651  C  C   . THR A 1 33 ? -11.466 2.628   2.128   1.00 0.00 ? 33 THR A C   7  
ATOM   4652  O  O   . THR A 1 33 ? -12.553 2.781   2.700   1.00 0.00 ? 33 THR A O   7  
ATOM   4653  C  CB  . THR A 1 33 ? -11.100 2.344   -0.361  1.00 0.00 ? 33 THR A CB  7  
ATOM   4654  O  OG1 . THR A 1 33 ? -11.561 2.975   -1.550  1.00 0.00 ? 33 THR A OG1 7  
ATOM   4655  C  CG2 . THR A 1 33 ? -11.982 1.083   -0.227  1.00 0.00 ? 33 THR A CG2 7  
ATOM   4656  N  N   . THR A 1 34 ? -10.431 1.704   2.643   1.00 0.00 ? 34 THR A N   7  
ATOM   4657  C  CA  . THR A 1 34 ? -10.527 1.076   3.956   1.00 0.00 ? 34 THR A CA  7  
ATOM   4658  C  C   . THR A 1 34 ? -9.711  1.833   4.979   1.00 0.00 ? 34 THR A C   7  
ATOM   4659  O  O   . THR A 1 34 ? -9.588  1.411   6.141   1.00 0.00 ? 34 THR A O   7  
ATOM   4660  C  CB  . THR A 1 34 ? -10.077 -0.422  3.890   1.00 0.00 ? 34 THR A CB  7  
ATOM   4661  O  OG1 . THR A 1 34 ? -10.376 -0.977  2.616   1.00 0.00 ? 34 THR A OG1 7  
ATOM   4662  C  CG2 . THR A 1 34 ? -10.747 -1.382  4.897   1.00 0.00 ? 34 THR A CG2 7  
ATOM   4663  N  N   . GLY A 1 35 ? -9.035  3.071   4.534   1.00 0.00 ? 35 GLY A N   7  
ATOM   4664  C  CA  . GLY A 1 35 ? -8.367  3.964   5.478   1.00 0.00 ? 35 GLY A CA  7  
ATOM   4665  C  C   . GLY A 1 35 ? -7.034  3.408   5.920   1.00 0.00 ? 35 GLY A C   7  
ATOM   4666  O  O   . GLY A 1 35 ? -6.749  3.287   7.124   1.00 0.00 ? 35 GLY A O   7  
ATOM   4667  N  N   . ILE A 1 36 ? -6.098  2.978   4.858   1.00 0.00 ? 36 ILE A N   7  
ATOM   4668  C  CA  . ILE A 1 36 ? -4.720  2.593   5.160   1.00 0.00 ? 36 ILE A CA  7  
ATOM   4669  C  C   . ILE A 1 36 ? -3.751  3.279   4.225   1.00 0.00 ? 36 ILE A C   7  
ATOM   4670  O  O   . ILE A 1 36 ? -3.946  3.345   3.002   1.00 0.00 ? 36 ILE A O   7  
ATOM   4671  C  CB  . ILE A 1 36 ? -4.529  1.024   5.214   1.00 0.00 ? 36 ILE A CB  7  
ATOM   4672  C  CG1 . ILE A 1 36 ? -4.078  0.318   3.897   1.00 0.00 ? 36 ILE A CG1 7  
ATOM   4673  C  CG2 . ILE A 1 36 ? -5.800  0.282   5.744   1.00 0.00 ? 36 ILE A CG2 7  
ATOM   4674  C  CD1 . ILE A 1 36 ? -2.893  -0.664  4.027   1.00 0.00 ? 36 ILE A CD1 7  
ATOM   4675  N  N   . PHE A 1 37 ? -2.575  3.912   4.856   1.00 0.00 ? 37 PHE A N   7  
ATOM   4676  C  CA  . PHE A 1 37 ? -1.445  4.460   4.084   1.00 0.00 ? 37 PHE A CA  7  
ATOM   4677  C  C   . PHE A 1 37 ? -0.192  3.723   4.496   1.00 0.00 ? 37 PHE A C   7  
ATOM   4678  O  O   . PHE A 1 37 ? -0.024  3.351   5.673   1.00 0.00 ? 37 PHE A O   7  
ATOM   4679  C  CB  . PHE A 1 37 ? -1.290  5.985   4.321   1.00 0.00 ? 37 PHE A CB  7  
ATOM   4680  C  CG  . PHE A 1 37 ? -0.350  6.454   5.441   1.00 0.00 ? 37 PHE A CG  7  
ATOM   4681  C  CD1 . PHE A 1 37 ? -0.767  6.381   6.775   1.00 0.00 ? 37 PHE A CD1 7  
ATOM   4682  C  CD2 . PHE A 1 37 ? 0.894   7.015   5.139   1.00 0.00 ? 37 PHE A CD2 7  
ATOM   4683  C  CE1 . PHE A 1 37 ? 0.039   6.881   7.792   1.00 0.00 ? 37 PHE A CE1 7  
ATOM   4684  C  CE2 . PHE A 1 37 ? 1.705   7.508   6.159   1.00 0.00 ? 37 PHE A CE2 7  
ATOM   4685  C  CZ  . PHE A 1 37 ? 1.274   7.447   7.482   1.00 0.00 ? 37 PHE A CZ  7  
ATOM   4686  N  N   . CYS A 1 38 ? 0.842   3.500   3.464   1.00 0.00 ? 38 CYS A N   7  
ATOM   4687  C  CA  . CYS A 1 38 ? 1.952   2.585   3.705   1.00 0.00 ? 38 CYS A CA  7  
ATOM   4688  C  C   . CYS A 1 38 ? 3.194   2.812   2.888   1.00 0.00 ? 38 CYS A C   7  
ATOM   4689  O  O   . CYS A 1 38 ? 3.166   3.454   1.822   1.00 0.00 ? 38 CYS A O   7  
ATOM   4690  C  CB  . CYS A 1 38 ? 1.395   1.149   3.453   1.00 0.00 ? 38 CYS A CB  7  
ATOM   4691  S  SG  . CYS A 1 38 ? 2.712   -0.103  3.317   1.00 0.00 ? 38 CYS A SG  7  
ATOM   4692  N  N   . ARG A 1 39 ? 4.454   2.270   3.431   1.00 0.00 ? 39 ARG A N   7  
ATOM   4693  C  CA  . ARG A 1 39 ? 5.663   2.178   2.593   1.00 0.00 ? 39 ARG A CA  7  
ATOM   4694  C  C   . ARG A 1 39 ? 5.485   0.979   1.689   1.00 0.00 ? 39 ARG A C   7  
ATOM   4695  O  O   . ARG A 1 39 ? 5.632   -0.177  2.125   1.00 0.00 ? 39 ARG A O   7  
ATOM   4696  C  CB  . ARG A 1 39 ? 6.892   2.052   3.527   1.00 0.00 ? 39 ARG A CB  7  
ATOM   4697  C  CG  . ARG A 1 39 ? 8.274   2.025   2.824   1.00 0.00 ? 39 ARG A CG  7  
ATOM   4698  C  CD  . ARG A 1 39 ? 9.100   3.288   3.101   1.00 0.00 ? 39 ARG A CD  7  
ATOM   4699  N  NE  . ARG A 1 39 ? 9.389   3.353   4.557   1.00 0.00 ? 39 ARG A NE  7  
ATOM   4700  C  CZ  . ARG A 1 39 ? 10.476  3.883   5.101   1.00 0.00 ? 39 ARG A CZ  7  
ATOM   4701  N  NH1 . ARG A 1 39 ? 11.444  4.429   4.427   1.00 0.00 ? 39 ARG A NH1 7  
ATOM   4702  N  NH2 . ARG A 1 39 ? 10.573  3.851   6.383   1.00 0.00 ? 39 ARG A NH2 7  
ATOM   4703  N  N   . PRO A 1 40 ? 5.162   1.238   0.277   1.00 0.00 ? 40 PRO A N   7  
ATOM   4704  C  CA  . PRO A 1 40 ? 4.863   0.197   -0.822  1.00 0.00 ? 40 PRO A CA  7  
ATOM   4705  C  C   . PRO A 1 40 ? 5.231   -1.238  -0.560  1.00 0.00 ? 40 PRO A C   7  
ATOM   4706  O  O   . PRO A 1 40 ? 6.298   -1.716  -1.003  1.00 0.00 ? 40 PRO A O   7  
ATOM   4707  C  CB  . PRO A 1 40 ? 5.607   0.762   -2.038  1.00 0.00 ? 40 PRO A CB  7  
ATOM   4708  C  CG  . PRO A 1 40 ? 5.239   2.251   -1.902  1.00 0.00 ? 40 PRO A CG  7  
ATOM   4709  C  CD  . PRO A 1 40 ? 5.050   2.551   -0.409  1.00 0.00 ? 40 PRO A CD  7  
ATOM   4710  N  N   . SER A 1 41 ? 4.272   -2.079  0.208   1.00 0.00 ? 41 SER A N   7  
ATOM   4711  C  CA  . SER A 1 41 ? 4.476   -3.514  0.353   1.00 0.00 ? 41 SER A CA  7  
ATOM   4712  C  C   . SER A 1 41 ? 3.438   -4.257  1.157   1.00 0.00 ? 41 SER A C   7  
ATOM   4713  O  O   . SER A 1 41 ? 3.778   -5.354  1.705   1.00 0.00 ? 41 SER A O   7  
ATOM   4714  C  CB  . SER A 1 41 ? 5.904   -3.782  0.938   1.00 0.00 ? 41 SER A CB  7  
ATOM   4715  O  OG  . SER A 1 41 ? 6.647   -4.737  0.178   1.00 0.00 ? 41 SER A OG  7  
ATOM   4716  N  N   . CYS A 1 42 ? 2.045   -3.775  1.293   1.00 0.00 ? 42 CYS A N   7  
ATOM   4717  C  CA  . CYS A 1 42 ? 1.009   -4.592  1.943   1.00 0.00 ? 42 CYS A CA  7  
ATOM   4718  C  C   . CYS A 1 42 ? 0.855   -5.893  1.188   1.00 0.00 ? 42 CYS A C   7  
ATOM   4719  O  O   . CYS A 1 42 ? 0.539   -5.934  -0.011  1.00 0.00 ? 42 CYS A O   7  
ATOM   4720  C  CB  . CYS A 1 42 ? -0.285  -3.820  2.231   1.00 0.00 ? 42 CYS A CB  7  
ATOM   4721  S  SG  . CYS A 1 42 ? 0.004   -2.093  2.663   1.00 0.00 ? 42 CYS A SG  7  
ATOM   4722  N  N   . ARG A 1 43 ? 1.140   -7.132  1.944   1.00 0.00 ? 43 ARG A N   7  
ATOM   4723  C  CA  . ARG A 1 43 ? 1.288   -8.458  1.356   1.00 0.00 ? 43 ARG A CA  7  
ATOM   4724  C  C   . ARG A 1 43 ? 0.001   -9.129  0.967   1.00 0.00 ? 43 ARG A C   7  
ATOM   4725  O  O   . ARG A 1 43 ? -0.040  -9.903  -0.021  1.00 0.00 ? 43 ARG A O   7  
ATOM   4726  C  CB  . ARG A 1 43 ? 2.154   -9.300  2.353   1.00 0.00 ? 43 ARG A CB  7  
ATOM   4727  C  CG  . ARG A 1 43 ? 3.095   -8.439  3.236   1.00 0.00 ? 43 ARG A CG  7  
ATOM   4728  C  CD  . ARG A 1 43 ? 3.682   -9.211  4.423   1.00 0.00 ? 43 ARG A CD  7  
ATOM   4729  N  NE  . ARG A 1 43 ? 4.266   -10.478 3.916   1.00 0.00 ? 43 ARG A NE  7  
ATOM   4730  C  CZ  . ARG A 1 43 ? 3.671   -11.663 3.926   1.00 0.00 ? 43 ARG A CZ  7  
ATOM   4731  N  NH1 . ARG A 1 43 ? 2.473   -11.879 4.384   1.00 0.00 ? 43 ARG A NH1 7  
ATOM   4732  N  NH2 . ARG A 1 43 ? 4.327   -12.661 3.448   1.00 0.00 ? 43 ARG A NH2 7  
ATOM   4733  N  N   . ALA A 1 44 ? -1.206  -8.893  1.788   1.00 0.00 ? 44 ALA A N   7  
ATOM   4734  C  CA  . ALA A 1 44 ? -2.525  -9.336  1.360   1.00 0.00 ? 44 ALA A CA  7  
ATOM   4735  C  C   . ALA A 1 44 ? -2.849  -8.720  0.002   1.00 0.00 ? 44 ALA A C   7  
ATOM   4736  O  O   . ALA A 1 44 ? -1.999  -8.142  -0.685  1.00 0.00 ? 44 ALA A O   7  
ATOM   4737  C  CB  . ALA A 1 44 ? -3.549  -8.922  2.430   1.00 0.00 ? 44 ALA A CB  7  
ATOM   4738  N  N   . ARG A 1 45 ? -4.254  -8.926  -0.442  1.00 0.00 ? 45 ARG A N   7  
ATOM   4739  C  CA  . ARG A 1 45 ? -4.774  -8.247  -1.627  1.00 0.00 ? 45 ARG A CA  7  
ATOM   4740  C  C   . ARG A 1 45 ? -4.562  -6.751  -1.493  1.00 0.00 ? 45 ARG A C   7  
ATOM   4741  O  O   . ARG A 1 45 ? -5.415  -6.012  -0.984  1.00 0.00 ? 45 ARG A O   7  
ATOM   4742  C  CB  . ARG A 1 45 ? -6.270  -8.604  -1.820  1.00 0.00 ? 45 ARG A CB  7  
ATOM   4743  C  CG  . ARG A 1 45 ? -6.887  -8.125  -3.163  1.00 0.00 ? 45 ARG A CG  7  
ATOM   4744  C  CD  . ARG A 1 45 ? -8.150  -8.906  -3.546  1.00 0.00 ? 45 ARG A CD  7  
ATOM   4745  N  NE  . ARG A 1 45 ? -9.232  -8.537  -2.599  1.00 0.00 ? 45 ARG A NE  7  
ATOM   4746  C  CZ  . ARG A 1 45 ? -9.811  -7.347  -2.517  1.00 0.00 ? 45 ARG A CZ  7  
ATOM   4747  N  NH1 . ARG A 1 45 ? -9.509  -6.331  -3.270  1.00 0.00 ? 45 ARG A NH1 7  
ATOM   4748  N  NH2 . ARG A 1 45 ? -10.732 -7.194  -1.632  1.00 0.00 ? 45 ARG A NH2 7  
ATOM   4749  N  N   . HIS A 1 46 ? -3.261  -6.235  -1.970  1.00 0.00 ? 46 HIS A N   7  
ATOM   4750  C  CA  . HIS A 1 46 ? -2.813  -4.871  -1.726  1.00 0.00 ? 46 HIS A CA  7  
ATOM   4751  C  C   . HIS A 1 46 ? -3.618  -3.836  -2.473  1.00 0.00 ? 46 HIS A C   7  
ATOM   4752  O  O   . HIS A 1 46 ? -4.254  -4.101  -3.501  1.00 0.00 ? 46 HIS A O   7  
ATOM   4753  C  CB  . HIS A 1 46 ? -1.334  -4.816  -2.141  1.00 0.00 ? 46 HIS A CB  7  
ATOM   4754  C  CG  . HIS A 1 46 ? -1.143  -4.863  -3.629  1.00 0.00 ? 46 HIS A CG  7  
ATOM   4755  N  ND1 . HIS A 1 46 ? -1.321  -5.981  -4.440  1.00 0.00 ? 46 HIS A ND1 7  
ATOM   4756  C  CD2 . HIS A 1 46 ? -0.752  -3.755  -4.369  1.00 0.00 ? 46 HIS A CD2 7  
ATOM   4757  C  CE1 . HIS A 1 46 ? -1.013  -5.448  -5.637  1.00 0.00 ? 46 HIS A CE1 7  
ATOM   4758  N  NE2 . HIS A 1 46 ? -0.667  -4.133  -5.684  1.00 0.00 ? 46 HIS A NE2 7  
ATOM   4759  N  N   . ALA A 1 47 ? -3.628  -2.479  -1.870  1.00 0.00 ? 47 ALA A N   7  
ATOM   4760  C  CA  . ALA A 1 47 ? -4.483  -1.407  -2.366  1.00 0.00 ? 47 ALA A CA  7  
ATOM   4761  C  C   . ALA A 1 47 ? -4.359  -1.265  -3.866  1.00 0.00 ? 47 ALA A C   7  
ATOM   4762  O  O   . ALA A 1 47 ? -3.306  -1.531  -4.462  1.00 0.00 ? 47 ALA A O   7  
ATOM   4763  C  CB  . ALA A 1 47 ? -4.100  -0.118  -1.617  1.00 0.00 ? 47 ALA A CB  7  
ATOM   4764  N  N   . LEU A 1 48 ? -5.576  -0.828  -4.583  1.00 0.00 ? 48 LEU A N   7  
ATOM   4765  C  CA  . LEU A 1 48 ? -5.552  -0.487  -6.003  1.00 0.00 ? 48 LEU A CA  7  
ATOM   4766  C  C   . LEU A 1 48 ? -5.000  0.905   -6.207  1.00 0.00 ? 48 LEU A C   7  
ATOM   4767  O  O   . LEU A 1 48 ? -5.019  1.752   -5.304  1.00 0.00 ? 48 LEU A O   7  
ATOM   4768  C  CB  . LEU A 1 48 ? -6.970  -0.629  -6.625  1.00 0.00 ? 48 LEU A CB  7  
ATOM   4769  C  CG  . LEU A 1 48 ? -8.100  -1.225  -5.742  1.00 0.00 ? 48 LEU A CG  7  
ATOM   4770  C  CD1 . LEU A 1 48 ? -8.655  -0.148  -4.799  1.00 0.00 ? 48 LEU A CD1 7  
ATOM   4771  C  CD2 . LEU A 1 48 ? -9.245  -1.830  -6.570  1.00 0.00 ? 48 LEU A CD2 7  
ATOM   4772  N  N   . ARG A 1 49 ? -4.472  1.209   -7.555  1.00 0.00 ? 49 ARG A N   7  
ATOM   4773  C  CA  . ARG A 1 49 ? -3.878  2.502   -7.879  1.00 0.00 ? 49 ARG A CA  7  
ATOM   4774  C  C   . ARG A 1 49 ? -4.939  3.488   -8.318  1.00 0.00 ? 49 ARG A C   7  
ATOM   4775  O  O   . ARG A 1 49 ? -4.636  4.573   -8.838  1.00 0.00 ? 49 ARG A O   7  
ATOM   4776  C  CB  . ARG A 1 49 ? -2.792  2.323   -8.975  1.00 0.00 ? 49 ARG A CB  7  
ATOM   4777  C  CG  . ARG A 1 49 ? -2.675  0.910   -9.604  1.00 0.00 ? 49 ARG A CG  7  
ATOM   4778  C  CD  . ARG A 1 49 ? -3.847  0.590   -10.545 1.00 0.00 ? 49 ARG A CD  7  
ATOM   4779  N  NE  . ARG A 1 49 ? -3.383  0.779   -11.942 1.00 0.00 ? 49 ARG A NE  7  
ATOM   4780  C  CZ  . ARG A 1 49 ? -4.060  1.360   -12.923 1.00 0.00 ? 49 ARG A CZ  7  
ATOM   4781  N  NH1 . ARG A 1 49 ? -5.257  1.851   -12.799 1.00 0.00 ? 49 ARG A NH1 7  
ATOM   4782  N  NH2 . ARG A 1 49 ? -3.489  1.440   -14.073 1.00 0.00 ? 49 ARG A NH2 7  
ATOM   4783  N  N   . GLU A 1 50 ? -6.348  3.115   -8.065  1.00 0.00 ? 50 GLU A N   7  
ATOM   4784  C  CA  . GLU A 1 50 ? -7.473  3.872   -8.601  1.00 0.00 ? 50 GLU A CA  7  
ATOM   4785  C  C   . GLU A 1 50 ? -7.892  5.004   -7.693  1.00 0.00 ? 50 GLU A C   7  
ATOM   4786  O  O   . GLU A 1 50 ? -8.501  5.997   -8.146  1.00 0.00 ? 50 GLU A O   7  
ATOM   4787  C  CB  . GLU A 1 50 ? -8.657  2.891   -8.841  1.00 0.00 ? 50 GLU A CB  7  
ATOM   4788  C  CG  . GLU A 1 50 ? -9.058  1.933   -7.671  1.00 0.00 ? 50 GLU A CG  7  
ATOM   4789  C  CD  . GLU A 1 50 ? -10.544 1.623   -7.466  1.00 0.00 ? 50 GLU A CD  7  
ATOM   4790  O  OE1 . GLU A 1 50 ? -11.360 2.472   -7.130  1.00 0.00 ? 50 GLU A OE1 7  
ATOM   4791  O  OE2 . GLU A 1 50 ? -10.869 0.321   -7.692  1.00 0.00 ? 50 GLU A OE2 7  
ATOM   4792  N  N   . ASN A 1 51 ? -7.595  4.882   -6.261  1.00 0.00 ? 51 ASN A N   7  
ATOM   4793  C  CA  . ASN A 1 51 ? -8.078  5.840   -5.233  1.00 0.00 ? 51 ASN A CA  7  
ATOM   4794  C  C   . ASN A 1 51 ? -6.870  6.232   -4.396  1.00 0.00 ? 51 ASN A C   7  
ATOM   4795  O  O   . ASN A 1 51 ? -6.969  6.687   -3.248  1.00 0.00 ? 51 ASN A O   7  
ATOM   4796  C  CB  . ASN A 1 51 ? -9.017  5.006   -4.321  1.00 0.00 ? 51 ASN A CB  7  
ATOM   4797  C  CG  . ASN A 1 51 ? -8.300  4.013   -3.372  1.00 0.00 ? 51 ASN A CG  7  
ATOM   4798  O  OD1 . ASN A 1 51 ? -7.674  3.051   -3.786  1.00 0.00 ? 51 ASN A OD1 7  
ATOM   4799  N  ND2 . ASN A 1 51 ? -8.402  4.221   -2.089  1.00 0.00 ? 51 ASN A ND2 7  
ATOM   4800  N  N   . VAL A 1 52 ? -5.556  5.964   -5.025  1.00 0.00 ? 52 VAL A N   7  
ATOM   4801  C  CA  . VAL A 1 52 ? -4.310  5.937   -4.264  1.00 0.00 ? 52 VAL A CA  7  
ATOM   4802  C  C   . VAL A 1 52 ? -3.586  7.248   -4.394  1.00 0.00 ? 52 VAL A C   7  
ATOM   4803  O  O   . VAL A 1 52 ? -3.667  7.907   -5.464  1.00 0.00 ? 52 VAL A O   7  
ATOM   4804  C  CB  . VAL A 1 52 ? -3.429  4.710   -4.747  1.00 0.00 ? 52 VAL A CB  7  
ATOM   4805  C  CG1 . VAL A 1 52 ? -2.184  5.040   -5.612  1.00 0.00 ? 52 VAL A CG1 7  
ATOM   4806  C  CG2 . VAL A 1 52 ? -2.903  3.824   -3.588  1.00 0.00 ? 52 VAL A CG2 7  
ATOM   4807  N  N   . SER A 1 53 ? -2.812  7.776   -3.252  1.00 0.00 ? 53 SER A N   7  
ATOM   4808  C  CA  . SER A 1 53 ? -1.970  8.970   -3.368  1.00 0.00 ? 53 SER A CA  7  
ATOM   4809  C  C   . SER A 1 53 ? -0.519  8.630   -3.131  1.00 0.00 ? 53 SER A C   7  
ATOM   4810  O  O   . SER A 1 53 ? -0.150  7.454   -2.956  1.00 0.00 ? 53 SER A O   7  
ATOM   4811  C  CB  . SER A 1 53 ? -2.483  10.095  -2.437  1.00 0.00 ? 53 SER A CB  7  
ATOM   4812  O  OG  . SER A 1 53 ? -2.060  11.400  -2.849  1.00 0.00 ? 53 SER A OG  7  
ATOM   4813  N  N   . PHE A 1 54 ? 0.457   9.743   -3.158  1.00 0.00 ? 54 PHE A N   7  
ATOM   4814  C  CA  . PHE A 1 54 ? 1.892   9.510   -3.009  1.00 0.00 ? 54 PHE A CA  7  
ATOM   4815  C  C   . PHE A 1 54 ? 2.597   10.683  -2.370  1.00 0.00 ? 54 PHE A C   7  
ATOM   4816  O  O   . PHE A 1 54 ? 2.421   11.846  -2.763  1.00 0.00 ? 54 PHE A O   7  
ATOM   4817  C  CB  . PHE A 1 54 ? 2.540   9.227   -4.397  1.00 0.00 ? 54 PHE A CB  7  
ATOM   4818  C  CG  . PHE A 1 54 ? 1.887   8.132   -5.255  1.00 0.00 ? 54 PHE A CG  7  
ATOM   4819  C  CD1 . PHE A 1 54 ? 0.747   8.400   -6.016  1.00 0.00 ? 54 PHE A CD1 7  
ATOM   4820  C  CD2 . PHE A 1 54 ? 2.448   6.849   -5.283  1.00 0.00 ? 54 PHE A CD2 7  
ATOM   4821  C  CE1 . PHE A 1 54 ? 0.173   7.396   -6.793  1.00 0.00 ? 54 PHE A CE1 7  
ATOM   4822  C  CE2 . PHE A 1 54 ? 1.873   5.848   -6.058  1.00 0.00 ? 54 PHE A CE2 7  
ATOM   4823  C  CZ  . PHE A 1 54 ? 0.736   6.122   -6.813  1.00 0.00 ? 54 PHE A CZ  7  
ATOM   4824  N  N   . TYR A 1 55 ? 3.537   10.367  -1.273  1.00 0.00 ? 55 TYR A N   7  
ATOM   4825  C  CA  . TYR A 1 55 ? 4.292   11.393  -0.548  1.00 0.00 ? 55 TYR A CA  7  
ATOM   4826  C  C   . TYR A 1 55 ? 5.731   10.963  -0.380  1.00 0.00 ? 55 TYR A C   7  
ATOM   4827  O  O   . TYR A 1 55 ? 6.032   9.750   -0.357  1.00 0.00 ? 55 TYR A O   7  
ATOM   4828  C  CB  . TYR A 1 55 ? 3.687   11.600  0.871   1.00 0.00 ? 55 TYR A CB  7  
ATOM   4829  C  CG  . TYR A 1 55 ? 2.192   11.283  1.053   1.00 0.00 ? 55 TYR A CG  7  
ATOM   4830  C  CD1 . TYR A 1 55 ? 1.744   9.985   1.300   1.00 0.00 ? 55 TYR A CD1 7  
ATOM   4831  C  CD2 . TYR A 1 55 ? 1.260   12.334  0.976   1.00 0.00 ? 55 TYR A CD2 7  
ATOM   4832  C  CE1 . TYR A 1 55 ? 0.385   9.733   1.467   1.00 0.00 ? 55 TYR A CE1 7  
ATOM   4833  C  CE2 . TYR A 1 55 ? -0.097  12.075  1.143   1.00 0.00 ? 55 TYR A CE2 7  
ATOM   4834  C  CZ  . TYR A 1 55 ? -0.533  10.776  1.389   1.00 0.00 ? 55 TYR A CZ  7  
ATOM   4835  O  OH  . TYR A 1 55 ? -1.868  10.531  1.556   1.00 0.00 ? 55 TYR A OH  7  
ATOM   4836  N  N   . ALA A 1 56 ? 6.776   11.997  -0.219  1.00 0.00 ? 56 ALA A N   7  
ATOM   4837  C  CA  . ALA A 1 56 ? 8.199   11.670  -0.139  1.00 0.00 ? 56 ALA A CA  7  
ATOM   4838  C  C   . ALA A 1 56 ? 8.559   11.041  1.185   1.00 0.00 ? 56 ALA A C   7  
ATOM   4839  O  O   . ALA A 1 56 ? 9.633   10.427  1.333   1.00 0.00 ? 56 ALA A O   7  
ATOM   4840  C  CB  . ALA A 1 56 ? 8.994   12.958  -0.421  1.00 0.00 ? 56 ALA A CB  7  
ATOM   4841  N  N   . ASN A 1 57 ? 7.608   11.204  2.309   1.00 0.00 ? 57 ASN A N   7  
ATOM   4842  C  CA  . ASN A 1 57 ? 7.784   10.488  3.568   1.00 0.00 ? 57 ASN A CA  7  
ATOM   4843  C  C   . ASN A 1 57 ? 6.505   10.414  4.369   1.00 0.00 ? 57 ASN A C   7  
ATOM   4844  O  O   . ASN A 1 57 ? 5.501   11.084  4.094   1.00 0.00 ? 57 ASN A O   7  
ATOM   4845  C  CB  . ASN A 1 57 ? 8.920   11.143  4.405   1.00 0.00 ? 57 ASN A CB  7  
ATOM   4846  C  CG  . ASN A 1 57 ? 8.499   11.918  5.660   1.00 0.00 ? 57 ASN A CG  7  
ATOM   4847  O  OD1 . ASN A 1 57 ? 9.093   11.824  6.724   1.00 0.00 ? 57 ASN A OD1 7  
ATOM   4848  N  ND2 . ASN A 1 57 ? 7.458   12.703  5.588   1.00 0.00 ? 57 ASN A ND2 7  
ATOM   4849  N  N   . ALA A 1 58 ? 6.514   9.452   5.497   1.00 0.00 ? 58 ALA A N   7  
ATOM   4850  C  CA  . ALA A 1 58 ? 5.423   9.332   6.455   1.00 0.00 ? 58 ALA A CA  7  
ATOM   4851  C  C   . ALA A 1 58 ? 4.940   10.660  6.984   1.00 0.00 ? 58 ALA A C   7  
ATOM   4852  O  O   . ALA A 1 58 ? 3.736   10.972  6.945   1.00 0.00 ? 58 ALA A O   7  
ATOM   4853  C  CB  . ALA A 1 58 ? 5.901   8.396   7.590   1.00 0.00 ? 58 ALA A CB  7  
ATOM   4854  N  N   . SER A 1 59 ? 5.943   11.562  7.591   1.00 0.00 ? 59 SER A N   7  
ATOM   4855  C  CA  . SER A 1 59 ? 5.559   12.772  8.310   1.00 0.00 ? 59 SER A CA  7  
ATOM   4856  C  C   . SER A 1 59 ? 4.566   13.616  7.549   1.00 0.00 ? 59 SER A C   7  
ATOM   4857  O  O   . SER A 1 59 ? 3.859   14.460  8.138   1.00 0.00 ? 59 SER A O   7  
ATOM   4858  C  CB  . SER A 1 59 ? 6.798   13.589  8.750   1.00 0.00 ? 59 SER A CB  7  
ATOM   4859  O  OG  . SER A 1 59 ? 6.537   14.441  9.871   1.00 0.00 ? 59 SER A OG  7  
ATOM   4860  N  N   . GLU A 1 60 ? 4.445   13.404  6.092   1.00 0.00 ? 60 GLU A N   7  
ATOM   4861  C  CA  . GLU A 1 60 ? 3.396   14.047  5.301   1.00 0.00 ? 60 GLU A CA  7  
ATOM   4862  C  C   . GLU A 1 60 ? 2.070   13.346  5.481   1.00 0.00 ? 60 GLU A C   7  
ATOM   4863  O  O   . GLU A 1 60 ? 1.116   13.890  6.051   1.00 0.00 ? 60 GLU A O   7  
ATOM   4864  C  CB  . GLU A 1 60 ? 3.834   14.052  3.810   1.00 0.00 ? 60 GLU A CB  7  
ATOM   4865  C  CG  . GLU A 1 60 ? 2.704   14.147  2.732   1.00 0.00 ? 60 GLU A CG  7  
ATOM   4866  C  CD  . GLU A 1 60 ? 2.276   15.534  2.246   1.00 0.00 ? 60 GLU A CD  7  
ATOM   4867  O  OE1 . GLU A 1 60 ? 3.092   16.054  1.287   1.00 0.00 ? 60 GLU A OE1 7  
ATOM   4868  O  OE2 . GLU A 1 60 ? 1.293   16.119  2.680   1.00 0.00 ? 60 GLU A OE2 7  
ATOM   4869  N  N   . ALA A 1 61 ? 1.964   11.989  4.901   1.00 0.00 ? 61 ALA A N   7  
ATOM   4870  C  CA  . ALA A 1 61 ? 0.757   11.180  5.017   1.00 0.00 ? 61 ALA A CA  7  
ATOM   4871  C  C   . ALA A 1 61 ? 0.247   11.089  6.435   1.00 0.00 ? 61 ALA A C   7  
ATOM   4872  O  O   . ALA A 1 61 ? -0.901  10.664  6.675   1.00 0.00 ? 61 ALA A O   7  
ATOM   4873  C  CB  . ALA A 1 61 ? 1.057   9.799   4.404   1.00 0.00 ? 61 ALA A CB  7  
ATOM   4874  N  N   . LEU A 1 62 ? 1.158   11.483  7.531   1.00 0.00 ? 62 LEU A N   7  
ATOM   4875  C  CA  . LEU A 1 62 ? 0.725   11.537  8.927   1.00 0.00 ? 62 LEU A CA  7  
ATOM   4876  C  C   . LEU A 1 62 ? 0.119   12.886  9.236   1.00 0.00 ? 62 LEU A C   7  
ATOM   4877  O  O   . LEU A 1 62 ? -0.909  13.004  9.916   1.00 0.00 ? 62 LEU A O   7  
ATOM   4878  C  CB  . LEU A 1 62 ? 1.917   11.236  9.877   1.00 0.00 ? 62 LEU A CB  7  
ATOM   4879  C  CG  . LEU A 1 62 ? 1.961   9.856   10.588  1.00 0.00 ? 62 LEU A CG  7  
ATOM   4880  C  CD1 . LEU A 1 62 ? 3.242   9.104   10.203  1.00 0.00 ? 62 LEU A CD1 7  
ATOM   4881  C  CD2 . LEU A 1 62 ? 1.868   9.972   12.118  1.00 0.00 ? 62 LEU A CD2 7  
ATOM   4882  N  N   . ALA A 1 63 ? 0.856   14.060  8.720   1.00 0.00 ? 63 ALA A N   7  
ATOM   4883  C  CA  . ALA A 1 63 ? 0.306   15.413  8.771   1.00 0.00 ? 63 ALA A CA  7  
ATOM   4884  C  C   . ALA A 1 63 ? -1.077  15.449  8.164   1.00 0.00 ? 63 ALA A C   7  
ATOM   4885  O  O   . ALA A 1 63 ? -1.948  16.229  8.571   1.00 0.00 ? 63 ALA A O   7  
ATOM   4886  C  CB  . ALA A 1 63 ? 1.293   16.356  8.062   1.00 0.00 ? 63 ALA A CB  7  
ATOM   4887  N  N   . ALA A 1 64 ? -1.347  14.473  7.082   1.00 0.00 ? 64 ALA A N   7  
ATOM   4888  C  CA  . ALA A 1 64 ? -2.693  14.290  6.540   1.00 0.00 ? 64 ALA A CA  7  
ATOM   4889  C  C   . ALA A 1 64 ? -3.580  13.697  7.624   1.00 0.00 ? 64 ALA A C   7  
ATOM   4890  O  O   . ALA A 1 64 ? -4.747  14.061  7.810   1.00 0.00 ? 64 ALA A O   7  
ATOM   4891  C  CB  . ALA A 1 64 ? -2.587  13.397  5.297   1.00 0.00 ? 64 ALA A CB  7  
ATOM   4892  N  N   . GLY A 1 65 ? -2.915  12.670  8.466   1.00 0.00 ? 65 GLY A N   7  
ATOM   4893  C  CA  . GLY A 1 65 ? -3.551  12.121  9.660   1.00 0.00 ? 65 GLY A CA  7  
ATOM   4894  C  C   . GLY A 1 65 ? -4.154  10.764  9.345   1.00 0.00 ? 65 GLY A C   7  
ATOM   4895  O  O   . GLY A 1 65 ? -5.303  10.454  9.681   1.00 0.00 ? 65 GLY A O   7  
ATOM   4896  N  N   . PHE A 1 66 ? -3.275  9.848   8.586   1.00 0.00 ? 66 PHE A N   7  
ATOM   4897  C  CA  . PHE A 1 66 ? -3.749  8.584   8.034   1.00 0.00 ? 66 PHE A CA  7  
ATOM   4898  C  C   . PHE A 1 66 ? -3.168  7.395   8.756   1.00 0.00 ? 66 PHE A C   7  
ATOM   4899  O  O   . PHE A 1 66 ? -2.376  7.550   9.713   1.00 0.00 ? 66 PHE A O   7  
ATOM   4900  C  CB  . PHE A 1 66 ? -3.372  8.515   6.518   1.00 0.00 ? 66 PHE A CB  7  
ATOM   4901  C  CG  . PHE A 1 66 ? -4.291  7.645   5.649   1.00 0.00 ? 66 PHE A CG  7  
ATOM   4902  C  CD1 . PHE A 1 66 ? -5.567  7.313   6.127   1.00 0.00 ? 66 PHE A CD1 7  
ATOM   4903  C  CD2 . PHE A 1 66 ? -3.876  7.175   4.403   1.00 0.00 ? 66 PHE A CD2 7  
ATOM   4904  C  CE1 . PHE A 1 66 ? -6.410  6.510   5.367   1.00 0.00 ? 66 PHE A CE1 7  
ATOM   4905  C  CE2 . PHE A 1 66 ? -4.723  6.372   3.642   1.00 0.00 ? 66 PHE A CE2 7  
ATOM   4906  C  CZ  . PHE A 1 66 ? -5.986  6.039   4.127   1.00 0.00 ? 66 PHE A CZ  7  
ATOM   4907  N  N   . ARG A 1 67 ? -3.527  6.043   8.278   1.00 0.00 ? 67 ARG A N   7  
ATOM   4908  C  CA  . ARG A 1 67 ? -3.152  4.844   9.030   1.00 0.00 ? 67 ARG A CA  7  
ATOM   4909  C  C   . ARG A 1 67 ? -1.865  4.251   8.508   1.00 0.00 ? 67 ARG A C   7  
ATOM   4910  O  O   . ARG A 1 67 ? -1.849  3.489   7.534   1.00 0.00 ? 67 ARG A O   7  
ATOM   4911  C  CB  . ARG A 1 67 ? -4.313  3.818   9.006   1.00 0.00 ? 67 ARG A CB  7  
ATOM   4912  C  CG  . ARG A 1 67 ? -3.976  2.437   9.631   1.00 0.00 ? 67 ARG A CG  7  
ATOM   4913  C  CD  . ARG A 1 67 ? -3.132  2.556   10.906  1.00 0.00 ? 67 ARG A CD  7  
ATOM   4914  N  NE  . ARG A 1 67 ? -3.908  1.986   12.037  1.00 0.00 ? 67 ARG A NE  7  
ATOM   4915  C  CZ  . ARG A 1 67 ? -4.066  2.551   13.226  1.00 0.00 ? 67 ARG A CZ  7  
ATOM   4916  N  NH1 . ARG A 1 67 ? -3.552  3.695   13.568  1.00 0.00 ? 67 ARG A NH1 7  
ATOM   4917  N  NH2 . ARG A 1 67 ? -4.777  1.922   14.093  1.00 0.00 ? 67 ARG A NH2 7  
ATOM   4918  N  N   . PRO A 1 68 ? -0.638  4.600   9.264   1.00 0.00 ? 68 PRO A N   7  
ATOM   4919  C  CA  . PRO A 1 68 ? 0.791   4.184   8.938   1.00 0.00 ? 68 PRO A CA  7  
ATOM   4920  C  C   . PRO A 1 68 ? 1.268   2.772   9.160   1.00 0.00 ? 68 PRO A C   7  
ATOM   4921  O  O   . PRO A 1 68 ? 1.540   2.377   10.325  1.00 0.00 ? 68 PRO A O   7  
ATOM   4922  C  CB  . PRO A 1 68 ? 1.694   5.095   9.799   1.00 0.00 ? 68 PRO A CB  7  
ATOM   4923  C  CG  . PRO A 1 68 ? 0.823   5.228   11.055  1.00 0.00 ? 68 PRO A CG  7  
ATOM   4924  C  CD  . PRO A 1 68 ? -0.583  5.448   10.487  1.00 0.00 ? 68 PRO A CD  7  
ATOM   4925  N  N   . CYS A 1 69 ? 1.431   1.850   8.016   1.00 0.00 ? 69 CYS A N   7  
ATOM   4926  C  CA  . CYS A 1 69 ? 2.153   0.589   8.115   1.00 0.00 ? 69 CYS A CA  7  
ATOM   4927  C  C   . CYS A 1 69 ? 3.511   0.746   7.449   1.00 0.00 ? 69 CYS A C   7  
ATOM   4928  O  O   . CYS A 1 69 ? 3.705   0.640   6.230   1.00 0.00 ? 69 CYS A O   7  
ATOM   4929  C  CB  . CYS A 1 69 ? 1.325   -0.639  7.712   1.00 0.00 ? 69 CYS A CB  7  
ATOM   4930  S  SG  . CYS A 1 69 ? 0.715   -0.674  6.027   1.00 0.00 ? 69 CYS A SG  7  
ATOM   4931  N  N   . LYS A 1 70 ? 4.623   1.126   8.375   1.00 0.00 ? 70 LYS A N   7  
ATOM   4932  C  CA  . LYS A 1 70 ? 5.993   1.354   7.926   1.00 0.00 ? 70 LYS A CA  7  
ATOM   4933  C  C   . LYS A 1 70 ? 6.579   0.062   7.406   1.00 0.00 ? 70 LYS A C   7  
ATOM   4934  O  O   . LYS A 1 70 ? 7.209   0.017   6.339   1.00 0.00 ? 70 LYS A O   7  
ATOM   4935  C  CB  . LYS A 1 70 ? 6.824   1.981   9.074   1.00 0.00 ? 70 LYS A CB  7  
ATOM   4936  C  CG  . LYS A 1 70 ? 7.541   0.961   9.992   1.00 0.00 ? 70 LYS A CG  7  
ATOM   4937  C  CD  . LYS A 1 70 ? 8.662   1.554   10.854  1.00 0.00 ? 70 LYS A CD  7  
ATOM   4938  C  CE  . LYS A 1 70 ? 9.337   0.431   11.651  1.00 0.00 ? 70 LYS A CE  7  
ATOM   4939  N  NZ  . LYS A 1 70 ? 8.556   0.157   12.871  1.00 0.00 ? 70 LYS A NZ  7  
ATOM   4940  N  N   . ARG A 1 71 ? 6.395   -1.132  8.256   1.00 0.00 ? 71 ARG A N   7  
ATOM   4941  C  CA  . ARG A 1 71 ? 6.702   -2.476  7.757   1.00 0.00 ? 71 ARG A CA  7  
ATOM   4942  C  C   . ARG A 1 71 ? 5.551   -2.925  6.877   1.00 0.00 ? 71 ARG A C   7  
ATOM   4943  O  O   . ARG A 1 71 ? 5.642   -2.900  5.645   1.00 0.00 ? 71 ARG A O   7  
ATOM   4944  C  CB  . ARG A 1 71 ? 6.955   -3.449  8.933   1.00 0.00 ? 71 ARG A CB  7  
ATOM   4945  C  CG  . ARG A 1 71 ? 7.049   -4.948  8.539   1.00 0.00 ? 71 ARG A CG  7  
ATOM   4946  C  CD  . ARG A 1 71 ? 7.668   -5.187  7.157   1.00 0.00 ? 71 ARG A CD  7  
ATOM   4947  N  NE  . ARG A 1 71 ? 8.993   -5.834  7.338   1.00 0.00 ? 71 ARG A NE  7  
ATOM   4948  C  CZ  . ARG A 1 71 ? 9.195   -7.125  7.566   1.00 0.00 ? 71 ARG A CZ  7  
ATOM   4949  N  NH1 . ARG A 1 71 ? 8.247   -8.009  7.666   1.00 0.00 ? 71 ARG A NH1 7  
ATOM   4950  N  NH2 . ARG A 1 71 ? 10.411  -7.522  7.692   1.00 0.00 ? 71 ARG A NH2 7  
ATOM   4951  N  N   . CYS A 1 72 ? 4.357   -3.425  7.590   1.00 0.00 ? 72 CYS A N   7  
ATOM   4952  C  CA  . CYS A 1 72 ? 3.080   -3.691  6.951   1.00 0.00 ? 72 CYS A CA  7  
ATOM   4953  C  C   . CYS A 1 72 ? 2.075   -4.244  7.950   1.00 0.00 ? 72 CYS A C   7  
ATOM   4954  O  O   . CYS A 1 72 ? 1.451   -5.293  7.748   1.00 0.00 ? 72 CYS A O   7  
ATOM   4955  C  CB  . CYS A 1 72 ? 3.284   -4.566  5.702   1.00 0.00 ? 72 CYS A CB  7  
ATOM   4956  S  SG  . CYS A 1 72 ? 3.190   -3.527  4.205   1.00 0.00 ? 72 CYS A SG  7  
ATOM   4957  N  N   . GLN A 1 73 ? 1.919   -3.469  9.194   1.00 0.00 ? 73 GLN A N   7  
ATOM   4958  C  CA  . GLN A 1 73 ? 1.036   -3.875  10.307  1.00 0.00 ? 73 GLN A CA  7  
ATOM   4959  C  C   . GLN A 1 73 ? -0.272  -4.443  9.842   1.00 0.00 ? 73 GLN A C   7  
ATOM   4960  O  O   . GLN A 1 73 ? -1.194  -3.721  9.434   1.00 0.00 ? 73 GLN A O   7  
ATOM   4961  C  CB  . GLN A 1 73 ? 0.801   -2.629  11.212  1.00 0.00 ? 73 GLN A CB  7  
ATOM   4962  C  CG  . GLN A 1 73 ? 1.062   -2.826  12.741  1.00 0.00 ? 73 GLN A CG  7  
ATOM   4963  C  CD  . GLN A 1 73 ? 2.045   -3.910  13.200  1.00 0.00 ? 73 GLN A CD  7  
ATOM   4964  O  OE1 . GLN A 1 73 ? 3.149   -3.619  13.632  1.00 0.00 ? 73 GLN A OE1 7  
ATOM   4965  N  NE2 . GLN A 1 73 ? 1.695   -5.171  13.155  1.00 0.00 ? 73 GLN A NE2 7  
ATOM   4966  N  N   . PRO A 1 74 ? -0.415  -5.912  9.923   1.00 0.00 ? 74 PRO A N   7  
ATOM   4967  C  CA  . PRO A 1 74 ? -1.640  -6.753  9.536   1.00 0.00 ? 74 PRO A CA  7  
ATOM   4968  C  C   . PRO A 1 74 ? -2.575  -7.066  10.681  1.00 0.00 ? 74 PRO A C   7  
ATOM   4969  O  O   . PRO A 1 74 ? -2.131  -7.401  11.793  1.00 0.00 ? 74 PRO A O   7  
ATOM   4970  C  CB  . PRO A 1 74 ? -1.041  -8.076  9.043   1.00 0.00 ? 74 PRO A CB  7  
ATOM   4971  C  CG  . PRO A 1 74 ? 0.073   -8.278  10.080  1.00 0.00 ? 74 PRO A CG  7  
ATOM   4972  C  CD  . PRO A 1 74 ? 0.608   -6.878  10.399  1.00 0.00 ? 74 PRO A CD  7  
ATOM   4973  N  N   . ASP A 1 75 ? -4.031  -6.992  10.425  1.00 0.00 ? 75 ASP A N   7  
ATOM   4974  C  CA  . ASP A 1 75 ? -5.042  -7.440  11.374  1.00 0.00 ? 75 ASP A CA  7  
ATOM   4975  C  C   . ASP A 1 75 ? -6.408  -6.885  11.031  1.00 0.00 ? 75 ASP A C   7  
ATOM   4976  O  O   . ASP A 1 75 ? -6.830  -5.840  11.546  1.00 0.00 ? 75 ASP A O   7  
ATOM   4977  C  CB  . ASP A 1 75 ? -4.652  -7.114  12.839  1.00 0.00 ? 75 ASP A CB  7  
ATOM   4978  C  CG  . ASP A 1 75 ? -5.737  -7.337  13.903  1.00 0.00 ? 75 ASP A CG  7  
ATOM   4979  O  OD1 . ASP A 1 75 ? -6.545  -8.253  13.848  1.00 0.00 ? 75 ASP A OD1 7  
ATOM   4980  O  OD2 . ASP A 1 75 ? -5.682  -6.422  14.917  1.00 0.00 ? 75 ASP A OD2 7  
ATOM   4981  N  N   . LYS A 1 76 ? -7.190  -7.633  10.025  1.00 0.00 ? 76 LYS A N   7  
ATOM   4982  C  CA  . LYS A 1 76 ? -8.589  -7.317  9.736   1.00 0.00 ? 76 LYS A CA  7  
ATOM   4983  C  C   . LYS A 1 76 ? -9.454  -8.540  9.952   1.00 0.00 ? 76 LYS A C   7  
ATOM   4984  O  O   . LYS A 1 76 ? -9.926  -8.793  11.077  1.00 0.00 ? 76 LYS A O   7  
ATOM   4985  C  CB  . LYS A 1 76 ? -8.720  -6.750  8.299   1.00 0.00 ? 76 LYS A CB  7  
ATOM   4986  C  CG  . LYS A 1 76 ? -7.545  -7.135  7.368   1.00 0.00 ? 76 LYS A CG  7  
ATOM   4987  C  CD  . LYS A 1 76 ? -7.759  -6.810  5.887   1.00 0.00 ? 76 LYS A CD  7  
ATOM   4988  C  CE  . LYS A 1 76 ? -8.064  -5.315  5.730   1.00 0.00 ? 76 LYS A CE  7  
ATOM   4989  N  NZ  . LYS A 1 76 ? -6.801  -4.567  5.595   1.00 0.00 ? 76 LYS A NZ  7  
ATOM   4990  N  N   . ALA A 1 77 ? -9.752  -9.383  8.779   1.00 0.00 ? 77 ALA A N   7  
ATOM   4991  C  CA  . ALA A 1 77 ? -10.407 -10.692 8.882   1.00 0.00 ? 77 ALA A CA  7  
ATOM   4992  C  C   . ALA A 1 77 ? -10.090 -11.365 10.193  1.00 0.00 ? 77 ALA A C   7  
ATOM   4993  O  O   . ALA A 1 77 ? -8.930  -11.713 10.472  1.00 0.00 ? 77 ALA A O   7  
ATOM   4994  C  CB  . ALA A 1 77 ? -9.955  -11.520 7.663   1.00 0.00 ? 77 ALA A CB  7  
ATOM   4995  N  N   . ASN A 1 78 ? -11.210 -11.553 11.139  1.00 0.00 ? 78 ASN A N   7  
ATOM   4996  C  CA  . ASN A 1 78 ? -11.020 -12.027 12.506  1.00 0.00 ? 78 ASN A CA  7  
ATOM   4997  C  C   . ASN A 1 78 ? -9.988  -13.126 12.581  1.00 0.00 ? 78 ASN A C   7  
ATOM   4998  O  O   . ASN A 1 78 ? -10.240 -14.288 12.238  1.00 0.00 ? 78 ASN A O   7  
ATOM   4999  C  CB  . ASN A 1 78 ? -12.384 -12.516 13.078  1.00 0.00 ? 78 ASN A CB  7  
ATOM   5000  C  CG  . ASN A 1 78 ? -12.451 -12.771 14.588  1.00 0.00 ? 78 ASN A CG  7  
ATOM   5001  O  OD1 . ASN A 1 78 ? -11.451 -12.955 15.265  1.00 0.00 ? 78 ASN A OD1 7  
ATOM   5002  N  ND2 . ASN A 1 78 ? -13.619 -12.779 15.172  1.00 0.00 ? 78 ASN A ND2 7  
ATOM   5003  N  N   . PRO A 1 79 ? -8.650  -12.724 13.065  1.00 0.00 ? 79 PRO A N   7  
ATOM   5004  C  CA  . PRO A 1 79 ? -7.431  -13.636 13.220  1.00 0.00 ? 79 PRO A CA  7  
ATOM   5005  C  C   . PRO A 1 79 ? -7.585  -14.732 14.254  1.00 0.00 ? 79 PRO A C   7  
ATOM   5006  O  O   . PRO A 1 79 ? -7.070  -15.848 14.095  1.00 0.00 ? 79 PRO A O   7  
ATOM   5007  C  CB  . PRO A 1 79 ? -6.261  -12.750 13.625  1.00 0.00 ? 79 PRO A CB  7  
ATOM   5008  C  CG  . PRO A 1 79 ? -6.977  -11.599 14.349  1.00 0.00 ? 79 PRO A CG  7  
ATOM   5009  C  CD  . PRO A 1 79 ? -8.229  -11.367 13.491  1.00 0.00 ? 79 PRO A CD  7  
ATOM   5010  N  N   . ARG A 1 80 ? -8.354  -14.390 15.470  1.00 0.00 ? 80 ARG A N   7  
ATOM   5011  C  CA  . ARG A 1 80 ? -8.584  -15.361 16.536  1.00 0.00 ? 80 ARG A CA  7  
ATOM   5012  C  C   . ARG A 1 80 ? -9.058  -16.680 15.972  1.00 0.00 ? 80 ARG A C   7  
ATOM   5013  O  O   . ARG A 1 80 ? -9.636  -16.751 14.878  1.00 0.00 ? 80 ARG A O   7  
ATOM   5014  C  CB  . ARG A 1 80 ? -9.612  -14.773 17.542  1.00 0.00 ? 80 ARG A CB  7  
ATOM   5015  C  CG  . ARG A 1 80 ? -9.188  -13.434 18.202  1.00 0.00 ? 80 ARG A CG  7  
ATOM   5016  C  CD  . ARG A 1 80 ? -9.999  -13.119 19.466  1.00 0.00 ? 80 ARG A CD  7  
ATOM   5017  N  NE  . ARG A 1 80 ? -11.433 -13.366 19.174  1.00 0.00 ? 80 ARG A NE  7  
ATOM   5018  C  CZ  . ARG A 1 80 ? -12.084 -14.497 19.412  1.00 0.00 ? 80 ARG A CZ  7  
ATOM   5019  N  NH1 . ARG A 1 80 ? -11.546 -15.555 19.944  1.00 0.00 ? 80 ARG A NH1 7  
ATOM   5020  N  NH2 . ARG A 1 80 ? -13.329 -14.544 19.093  1.00 0.00 ? 80 ARG A NH2 7  
ATOM   5021  N  N   . GLN A 1 81 ? -8.761  -17.883 16.779  1.00 0.00 ? 81 GLN A N   7  
ATOM   5022  C  CA  . GLN A 1 81 ? -9.220  -19.212 16.385  1.00 0.00 ? 81 GLN A CA  7  
ATOM   5023  C  C   . GLN A 1 81 ? -8.373  -19.767 15.264  1.00 0.00 ? 81 GLN A C   7  
ATOM   5024  O  O   . GLN A 1 81 ? -7.794  -19.027 14.457  1.00 0.00 ? 81 GLN A O   7  
ATOM   5025  C  CB  . GLN A 1 81 ? -10.703 -19.120 15.965  1.00 0.00 ? 81 GLN A CB  7  
ATOM   5026  C  CG  . GLN A 1 81 ? -10.991 -19.186 14.428  1.00 0.00 ? 81 GLN A CG  7  
ATOM   5027  C  CD  . GLN A 1 81 ? -12.206 -18.441 13.863  1.00 0.00 ? 81 GLN A CD  7  
ATOM   5028  O  OE1 . GLN A 1 81 ? -12.077 -17.384 13.266  1.00 0.00 ? 81 GLN A OE1 7  
ATOM   5029  N  NE2 . GLN A 1 81 ? -13.407 -18.940 14.013  1.00 0.00 ? 81 GLN A NE2 7  
ATOM   5030  N  N   . HIS A 1 82 ? -8.295  -21.241 15.169  1.00 0.00 ? 82 HIS A N   7  
ATOM   5031  C  CA  . HIS A 1 82 ? -7.422  -21.909 14.209  1.00 0.00 ? 82 HIS A CA  7  
ATOM   5032  C  C   . HIS A 1 82 ? -8.147  -22.170 12.909  1.00 0.00 ? 82 HIS A C   7  
ATOM   5033  O  O   . HIS A 1 82 ? -9.262  -22.707 12.881  1.00 0.00 ? 82 HIS A O   7  
ATOM   5034  C  CB  . HIS A 1 82 ? -6.997  -23.236 14.860  1.00 0.00 ? 82 HIS A CB  7  
ATOM   5035  C  CG  . HIS A 1 82 ? -6.339  -23.032 16.193  1.00 0.00 ? 82 HIS A CG  7  
ATOM   5036  N  ND1 . HIS A 1 82 ? -5.184  -22.289 16.426  1.00 0.00 ? 82 HIS A ND1 7  
ATOM   5037  C  CD2 . HIS A 1 82 ? -6.834  -23.585 17.366  1.00 0.00 ? 82 HIS A CD2 7  
ATOM   5038  C  CE1 . HIS A 1 82 ? -5.067  -22.458 17.757  1.00 0.00 ? 82 HIS A CE1 7  
ATOM   5039  N  NE2 . HIS A 1 82 ? -6.006  -23.211 18.393  1.00 0.00 ? 82 HIS A NE2 7  
ATOM   5040  N  N   . ARG A 1 83 ? -7.435  -21.779 11.672  1.00 0.00 ? 83 ARG A N   7  
ATOM   5041  C  CA  . ARG A 1 83 ? -7.961  -22.090 10.346  1.00 0.00 ? 83 ARG A CA  7  
ATOM   5042  C  C   . ARG A 1 83 ? -7.722  -23.540 9.995   1.00 0.00 ? 83 ARG A C   7  
ATOM   5043  O  O   . ARG A 1 83 ? -6.664  -24.115 10.284  1.00 0.00 ? 83 ARG A O   7  
ATOM   5044  C  CB  . ARG A 1 83 ? -7.302  -21.141 9.308   1.00 0.00 ? 83 ARG A CB  7  
ATOM   5045  C  CG  . ARG A 1 83 ? -8.242  -20.666 8.168   1.00 0.00 ? 83 ARG A CG  7  
ATOM   5046  C  CD  . ARG A 1 83 ? -7.903  -19.253 7.677   1.00 0.00 ? 83 ARG A CD  7  
ATOM   5047  N  NE  . ARG A 1 83 ? -6.451  -19.201 7.367   1.00 0.00 ? 83 ARG A NE  7  
ATOM   5048  C  CZ  . ARG A 1 83 ? -5.902  -19.511 6.200   1.00 0.00 ? 83 ARG A CZ  7  
ATOM   5049  N  NH1 . ARG A 1 83 ? -6.568  -19.909 5.158   1.00 0.00 ? 83 ARG A NH1 7  
ATOM   5050  N  NH2 . ARG A 1 83 ? -4.624  -19.407 6.101   1.00 0.00 ? 83 ARG A NH2 7  
ATOM   5051  N  N   . LEU A 1 84 ? -8.825  -24.235 9.296   1.00 0.00 ? 84 LEU A N   7  
ATOM   5052  C  CA  . LEU A 1 84 ? -8.683  -25.597 8.789   1.00 0.00 ? 84 LEU A CA  7  
ATOM   5053  C  C   . LEU A 1 84 ? -8.405  -25.596 7.305   1.00 0.00 ? 84 LEU A C   7  
ATOM   5054  O  O   . LEU A 1 84 ? -9.278  -25.301 6.477   1.00 0.00 ? 84 LEU A O   7  
ATOM   5055  C  CB  . LEU A 1 84 ? -9.951  -26.436 9.117   1.00 0.00 ? 84 LEU A CB  7  
ATOM   5056  C  CG  . LEU A 1 84 ? -10.273 -26.722 10.608  1.00 0.00 ? 84 LEU A CG  7  
ATOM   5057  C  CD1 . LEU A 1 84 ? -11.689 -27.298 10.742  1.00 0.00 ? 84 LEU A CD1 7  
ATOM   5058  C  CD2 . LEU A 1 84 ? -9.261  -27.678 11.261  1.00 0.00 ? 84 LEU A CD2 7  
ATOM   5059  N  N   . ASP A 1 85 ? -7.036  -25.978 6.894   1.00 0.00 ? 85 ASP A N   7  
ATOM   5060  C  CA  . ASP A 1 85 ? -6.671  -26.162 5.493   1.00 0.00 ? 85 ASP A CA  7  
ATOM   5061  C  C   . ASP A 1 85 ? -5.305  -26.794 5.367   1.00 0.00 ? 85 ASP A C   7  
ATOM   5062  O  O   . ASP A 1 85 ? -4.519  -26.844 6.323   1.00 0.00 ? 85 ASP A O   7  
ATOM   5063  C  CB  . ASP A 1 85 ? -6.755  -24.812 4.734   1.00 0.00 ? 85 ASP A CB  7  
ATOM   5064  C  CG  . ASP A 1 85 ? -7.241  -24.869 3.278   1.00 0.00 ? 85 ASP A CG  7  
ATOM   5065  O  OD1 . ASP A 1 85 ? -8.603  -24.824 3.172   1.00 0.00 ? 85 ASP A OD1 7  
ATOM   5066  O  OD2 . ASP A 1 85 ? -6.481  -24.944 2.324   1.00 0.00 ? 85 ASP A OD2 7  
ATOM   5067  N  N   . LYS A 1 86 ? -4.945  -27.316 4.031   1.00 0.00 ? 86 LYS A N   7  
ATOM   5068  C  CA  . LYS A 1 86 ? -3.691  -28.023 3.787   1.00 0.00 ? 86 LYS A CA  7  
ATOM   5069  C  C   . LYS A 1 86 ? -2.694  -27.130 3.087   1.00 0.00 ? 86 LYS A C   7  
ATOM   5070  O  O   . LYS A 1 86 ? -2.552  -27.152 1.856   1.00 0.00 ? 86 LYS A O   7  
ATOM   5071  C  CB  . LYS A 1 86 ? -3.972  -29.303 2.954   1.00 0.00 ? 86 LYS A CB  7  
ATOM   5072  C  CG  . LYS A 1 86 ? -2.904  -30.409 3.143   1.00 0.00 ? 86 LYS A CG  7  
ATOM   5073  C  CD  . LYS A 1 86 ? -1.742  -30.359 2.147   1.00 0.00 ? 86 LYS A CD  7  
ATOM   5074  C  CE  . LYS A 1 86 ? -0.633  -31.311 2.615   1.00 0.00 ? 86 LYS A CE  7  
ATOM   5075  N  NZ  . LYS A 1 86 ? 0.039   -31.895 1.441   1.00 0.00 ? 86 LYS A NZ  7  
ATOM   5076  N  N   . ILE A 1 87 ? -1.879  -26.252 3.953   1.00 0.00 ? 87 ILE A N   7  
ATOM   5077  C  CA  . ILE A 1 87 ? -0.789  -25.437 3.423   1.00 0.00 ? 87 ILE A CA  7  
ATOM   5078  C  C   . ILE A 1 87 ? 0.552   -25.976 3.863   1.00 0.00 ? 87 ILE A C   7  
ATOM   5079  O  O   . ILE A 1 87 ? 0.732   -26.428 5.002   1.00 0.00 ? 87 ILE A O   7  
ATOM   5080  C  CB  . ILE A 1 87 ? -0.967  -23.913 3.810   1.00 0.00 ? 87 ILE A CB  7  
ATOM   5081  C  CG1 . ILE A 1 87 ? -0.051  -22.928 3.016   1.00 0.00 ? 87 ILE A CG1 7  
ATOM   5082  C  CG2 . ILE A 1 87 ? -0.759  -23.647 5.333   1.00 0.00 ? 87 ILE A CG2 7  
ATOM   5083  C  CD1 . ILE A 1 87 ? -0.662  -22.323 1.735   1.00 0.00 ? 87 ILE A CD1 7  
ATOM   5084  N  N   . THR A 1 88 ? 1.642   -25.911 2.866   1.00 0.00 ? 88 THR A N   7  
ATOM   5085  C  CA  . THR A 1 88 ? 2.994   -26.375 3.165   1.00 0.00 ? 88 THR A CA  7  
ATOM   5086  C  C   . THR A 1 88 ? 3.942   -25.210 3.325   1.00 0.00 ? 88 THR A C   7  
ATOM   5087  O  O   . THR A 1 88 ? 4.467   -24.657 2.348   1.00 0.00 ? 88 THR A O   7  
ATOM   5088  C  CB  . THR A 1 88 ? 3.500   -27.352 2.051   1.00 0.00 ? 88 THR A CB  7  
ATOM   5089  O  OG1 . THR A 1 88 ? 2.602   -28.444 1.901   1.00 0.00 ? 88 THR A OG1 7  
ATOM   5090  C  CG2 . THR A 1 88 ? 4.875   -28.012 2.292   1.00 0.00 ? 88 THR A CG2 7  
ATOM   5091  N  N   . HIS A 1 89 ? 4.238   -24.791 4.712   1.00 0.00 ? 89 HIS A N   7  
ATOM   5092  C  CA  . HIS A 1 89 ? 5.094   -23.645 5.010   1.00 0.00 ? 89 HIS A CA  7  
ATOM   5093  C  C   . HIS A 1 89 ? 6.201   -24.030 5.963   1.00 0.00 ? 89 HIS A C   7  
ATOM   5094  O  O   . HIS A 1 89 ? 7.348   -23.576 5.847   1.00 0.00 ? 89 HIS A O   7  
ATOM   5095  C  CB  . HIS A 1 89 ? 4.186   -22.579 5.646   1.00 0.00 ? 89 HIS A CB  7  
ATOM   5096  C  CG  . HIS A 1 89 ? 4.930   -21.315 5.966   1.00 0.00 ? 89 HIS A CG  7  
ATOM   5097  N  ND1 . HIS A 1 89 ? 5.250   -20.306 5.060   1.00 0.00 ? 89 HIS A ND1 7  
ATOM   5098  C  CD2 . HIS A 1 89 ? 5.391   -21.018 7.241   1.00 0.00 ? 89 HIS A CD2 7  
ATOM   5099  C  CE1 . HIS A 1 89 ? 5.898   -19.457 5.881   1.00 0.00 ? 89 HIS A CE1 7  
ATOM   5100  N  NE2 . HIS A 1 89 ? 6.025   -19.804 7.190   1.00 0.00 ? 89 HIS A NE2 7  
ATOM   5101  N  N   . ALA A 1 90 ? 5.848   -24.999 7.025   1.00 0.00 ? 90 ALA A N   7  
ATOM   5102  C  CA  . ALA A 1 90 ? 6.852   -25.556 7.925   1.00 0.00 ? 90 ALA A CA  7  
ATOM   5103  C  C   . ALA A 1 90 ? 7.676   -24.460 8.560   1.00 0.00 ? 90 ALA A C   7  
ATOM   5104  O  O   . ALA A 1 90 ? 7.198   -23.344 8.805   1.00 0.00 ? 90 ALA A O   7  
ATOM   5105  C  CB  . ALA A 1 90 ? 7.705   -26.549 7.116   1.00 0.00 ? 90 ALA A CB  7  
ATOM   5106  N  N   . CYS A 1 91 ? 9.082   -24.795 8.874   1.00 0.00 ? 91 CYS A N   7  
ATOM   5107  C  CA  . CYS A 1 91 ? 9.979   -23.840 9.517   1.00 0.00 ? 91 CYS A CA  7  
ATOM   5108  C  C   . CYS A 1 91 ? 10.570  -22.887 8.504   1.00 0.00 ? 91 CYS A C   7  
ATOM   5109  O  O   . CYS A 1 91 ? 10.691  -21.677 8.740   1.00 0.00 ? 91 CYS A O   7  
ATOM   5110  C  CB  . CYS A 1 91 ? 11.060  -24.623 10.288  1.00 0.00 ? 91 CYS A CB  7  
ATOM   5111  S  SG  . CYS A 1 91 ? 12.516  -23.592 10.574  1.00 0.00 ? 91 CYS A SG  7  
ATOM   5112  N  N   . ARG A 1 92 ? 10.984  -23.477 7.213   1.00 0.00 ? 92 ARG A N   7  
ATOM   5113  C  CA  . ARG A 1 92 ? 11.582  -22.673 6.151   1.00 0.00 ? 92 ARG A CA  7  
ATOM   5114  C  C   . ARG A 1 92 ? 11.842  -23.509 4.921   1.00 0.00 ? 92 ARG A C   7  
ATOM   5115  O  O   . ARG A 1 92 ? 12.770  -23.266 4.152   1.00 0.00 ? 92 ARG A O   7  
ATOM   5116  C  CB  . ARG A 1 92 ? 12.890  -22.027 6.684   1.00 0.00 ? 92 ARG A CB  7  
ATOM   5117  C  CG  . ARG A 1 92 ? 13.128  -20.562 6.230   1.00 0.00 ? 92 ARG A CG  7  
ATOM   5118  C  CD  . ARG A 1 92 ? 14.008  -19.778 7.211   1.00 0.00 ? 92 ARG A CD  7  
ATOM   5119  N  NE  . ARG A 1 92 ? 13.806  -18.327 6.963   1.00 0.00 ? 92 ARG A NE  7  
ATOM   5120  C  CZ  . ARG A 1 92 ? 12.820  -17.592 7.459   1.00 0.00 ? 92 ARG A CZ  7  
ATOM   5121  N  NH1 . ARG A 1 92 ? 11.886  -18.047 8.240   1.00 0.00 ? 92 ARG A NH1 7  
ATOM   5122  N  NH2 . ARG A 1 92 ? 12.793  -16.346 7.143   1.00 0.00 ? 92 ARG A NH2 7  
ATOM   5123  O  OXT . ARG A 1 92 ? 10.931  -24.587 4.691   1.00 0.00 ? 92 ARG A OXT 7  
HETATM 5124  ZN ZN  . ZN  B 2 .  ? 1.610   -1.952  4.419   1.00 0.00 ? 93 ZN  A ZN  7  
ATOM   5125  N  N   . MET A 1 1  ? 7.670   14.402  -25.177 1.00 0.00 ? 1  MET A N   8  
ATOM   5126  C  CA  . MET A 1 1  ? 6.928   14.412  -23.920 1.00 0.00 ? 1  MET A CA  8  
ATOM   5127  C  C   . MET A 1 1  ? 6.221   15.732  -23.720 1.00 0.00 ? 1  MET A C   8  
ATOM   5128  O  O   . MET A 1 1  ? 6.084   16.545  -24.644 1.00 0.00 ? 1  MET A O   8  
ATOM   5129  C  CB  . MET A 1 1  ? 5.918   13.232  -23.893 1.00 0.00 ? 1  MET A CB  8  
ATOM   5130  C  CG  . MET A 1 1  ? 5.837   12.445  -22.568 1.00 0.00 ? 1  MET A CG  8  
ATOM   5131  S  SD  . MET A 1 1  ? 6.843   10.956  -22.681 1.00 0.00 ? 1  MET A SD  8  
ATOM   5132  C  CE  . MET A 1 1  ? 6.932   10.561  -20.929 1.00 0.00 ? 1  MET A CE  8  
ATOM   5133  N  N   . LYS A 1 2  ? 5.699   15.996  -22.361 1.00 0.00 ? 2  LYS A N   8  
ATOM   5134  C  CA  . LYS A 1 2  ? 5.041   17.253  -22.016 1.00 0.00 ? 2  LYS A CA  8  
ATOM   5135  C  C   . LYS A 1 2  ? 5.237   17.582  -20.555 1.00 0.00 ? 2  LYS A C   8  
ATOM   5136  O  O   . LYS A 1 2  ? 5.246   16.702  -19.683 1.00 0.00 ? 2  LYS A O   8  
ATOM   5137  C  CB  . LYS A 1 2  ? 3.531   17.160  -22.367 1.00 0.00 ? 2  LYS A CB  8  
ATOM   5138  C  CG  . LYS A 1 2  ? 2.689   16.442  -21.283 1.00 0.00 ? 2  LYS A CG  8  
ATOM   5139  C  CD  . LYS A 1 2  ? 3.030   14.964  -21.077 1.00 0.00 ? 2  LYS A CD  8  
ATOM   5140  C  CE  . LYS A 1 2  ? 1.921   14.300  -20.249 1.00 0.00 ? 2  LYS A CE  8  
ATOM   5141  N  NZ  . LYS A 1 2  ? 2.136   14.592  -18.821 1.00 0.00 ? 2  LYS A NZ  8  
ATOM   5142  N  N   . LYS A 1 3  ? 5.396   19.014  -20.221 1.00 0.00 ? 3  LYS A N   8  
ATOM   5143  C  CA  . LYS A 1 3  ? 5.505   19.481  -18.842 1.00 0.00 ? 3  LYS A CA  8  
ATOM   5144  C  C   . LYS A 1 3  ? 6.479   18.633  -18.060 1.00 0.00 ? 3  LYS A C   8  
ATOM   5145  O  O   . LYS A 1 3  ? 6.207   18.198  -16.932 1.00 0.00 ? 3  LYS A O   8  
ATOM   5146  C  CB  . LYS A 1 3  ? 4.100   19.468  -18.179 1.00 0.00 ? 3  LYS A CB  8  
ATOM   5147  C  CG  . LYS A 1 3  ? 3.275   20.749  -18.460 1.00 0.00 ? 3  LYS A CG  8  
ATOM   5148  C  CD  . LYS A 1 3  ? 1.766   20.527  -18.593 1.00 0.00 ? 3  LYS A CD  8  
ATOM   5149  C  CE  . LYS A 1 3  ? 1.459   19.962  -19.987 1.00 0.00 ? 3  LYS A CE  8  
ATOM   5150  N  NZ  . LYS A 1 3  ? 0.054   20.245  -20.331 1.00 0.00 ? 3  LYS A NZ  8  
ATOM   5151  N  N   . ALA A 1 4  ? 7.778   18.358  -18.711 1.00 0.00 ? 4  ALA A N   8  
ATOM   5152  C  CA  . ALA A 1 4  ? 8.748   17.427  -18.141 1.00 0.00 ? 4  ALA A CA  8  
ATOM   5153  C  C   . ALA A 1 4  ? 9.424   18.025  -16.928 1.00 0.00 ? 4  ALA A C   8  
ATOM   5154  O  O   . ALA A 1 4  ? 8.884   18.915  -16.258 1.00 0.00 ? 4  ALA A O   8  
ATOM   5155  C  CB  . ALA A 1 4  ? 9.743   17.049  -19.252 1.00 0.00 ? 4  ALA A CB  8  
ATOM   5156  N  N   . THR A 1 5  ? 10.742  17.459  -16.571 1.00 0.00 ? 5  THR A N   8  
ATOM   5157  C  CA  . THR A 1 5  ? 11.588  18.009  -15.518 1.00 0.00 ? 5  THR A CA  8  
ATOM   5158  C  C   . THR A 1 5  ? 11.338  17.323  -14.196 1.00 0.00 ? 5  THR A C   8  
ATOM   5159  O  O   . THR A 1 5  ? 12.265  16.816  -13.543 1.00 0.00 ? 5  THR A O   8  
ATOM   5160  C  CB  . THR A 1 5  ? 11.414  19.559  -15.382 1.00 0.00 ? 5  THR A CB  8  
ATOM   5161  O  OG1 . THR A 1 5  ? 11.282  20.161  -16.664 1.00 0.00 ? 5  THR A OG1 8  
ATOM   5162  C  CG2 . THR A 1 5  ? 12.576  20.325  -14.714 1.00 0.00 ? 5  THR A CG2 8  
ATOM   5163  N  N   . CYS A 1 6  ? 9.942   17.297  -13.711 1.00 0.00 ? 6  CYS A N   8  
ATOM   5164  C  CA  . CYS A 1 6  ? 9.594   16.817  -12.377 1.00 0.00 ? 6  CYS A CA  8  
ATOM   5165  C  C   . CYS A 1 6  ? 9.407   15.317  -12.363 1.00 0.00 ? 6  CYS A C   8  
ATOM   5166  O  O   . CYS A 1 6  ? 9.509   14.632  -13.389 1.00 0.00 ? 6  CYS A O   8  
ATOM   5167  C  CB  . CYS A 1 6  ? 8.336   17.569  -11.898 1.00 0.00 ? 6  CYS A CB  8  
ATOM   5168  S  SG  . CYS A 1 6  ? 8.543   18.140  -10.197 1.00 0.00 ? 6  CYS A SG  8  
ATOM   5169  N  N   . LEU A 1 7  ? 9.057   14.722  -11.053 1.00 0.00 ? 7  LEU A N   8  
ATOM   5170  C  CA  . LEU A 1 7  ? 8.883   13.286  -10.860 1.00 0.00 ? 7  LEU A CA  8  
ATOM   5171  C  C   . LEU A 1 7  ? 7.467   12.871  -11.189 1.00 0.00 ? 7  LEU A C   8  
ATOM   5172  O  O   . LEU A 1 7  ? 6.495   13.238  -10.515 1.00 0.00 ? 7  LEU A O   8  
ATOM   5173  C  CB  . LEU A 1 7  ? 9.256   12.882  -9.406  1.00 0.00 ? 7  LEU A CB  8  
ATOM   5174  C  CG  . LEU A 1 7  ? 10.475  13.580  -8.744  1.00 0.00 ? 7  LEU A CG  8  
ATOM   5175  C  CD1 . LEU A 1 7  ? 9.996   14.666  -7.770  1.00 0.00 ? 7  LEU A CD1 8  
ATOM   5176  C  CD2 . LEU A 1 7  ? 11.400  12.595  -8.011  1.00 0.00 ? 7  LEU A CD2 8  
ATOM   5177  N  N   . THR A 1 8  ? 7.316   12.000  -12.379 1.00 0.00 ? 8  THR A N   8  
ATOM   5178  C  CA  . THR A 1 8  ? 6.014   11.645  -12.930 1.00 0.00 ? 8  THR A CA  8  
ATOM   5179  C  C   . THR A 1 8  ? 5.328   10.593  -12.084 1.00 0.00 ? 8  THR A C   8  
ATOM   5180  O  O   . THR A 1 8  ? 5.966   9.750   -11.441 1.00 0.00 ? 8  THR A O   8  
ATOM   5181  C  CB  . THR A 1 8  ? 6.146   11.169  -14.416 1.00 0.00 ? 8  THR A CB  8  
ATOM   5182  O  OG1 . THR A 1 8  ? 7.093   10.115  -14.520 1.00 0.00 ? 8  THR A OG1 8  
ATOM   5183  C  CG2 . THR A 1 8  ? 6.628   12.226  -15.433 1.00 0.00 ? 8  THR A CG2 8  
ATOM   5184  N  N   . ASP A 1 9  ? 3.849   10.664  -12.043 1.00 0.00 ? 9  ASP A N   8  
ATOM   5185  C  CA  . ASP A 1 9  ? 3.050   9.688   -11.309 1.00 0.00 ? 9  ASP A CA  8  
ATOM   5186  C  C   . ASP A 1 9  ? 3.334   8.285   -11.793 1.00 0.00 ? 9  ASP A C   8  
ATOM   5187  O  O   . ASP A 1 9  ? 2.972   7.289   -11.150 1.00 0.00 ? 9  ASP A O   8  
ATOM   5188  C  CB  . ASP A 1 9  ? 1.542   10.037  -11.405 1.00 0.00 ? 9  ASP A CB  8  
ATOM   5189  C  CG  . ASP A 1 9  ? 0.680   9.708   -10.176 1.00 0.00 ? 9  ASP A CG  8  
ATOM   5190  O  OD1 . ASP A 1 9  ? 0.918   10.547  -9.123  1.00 0.00 ? 9  ASP A OD1 8  
ATOM   5191  O  OD2 . ASP A 1 9  ? -0.114  8.780   -10.148 1.00 0.00 ? 9  ASP A OD2 8  
ATOM   5192  N  N   . ASP A 1 10 ? 4.032   8.163   -13.092 1.00 0.00 ? 10 ASP A N   8  
ATOM   5193  C  CA  . ASP A 1 10 ? 4.467   6.870   -13.614 1.00 0.00 ? 10 ASP A CA  8  
ATOM   5194  C  C   . ASP A 1 10 ? 5.619   6.322   -12.806 1.00 0.00 ? 10 ASP A C   8  
ATOM   5195  O  O   . ASP A 1 10 ? 5.599   5.175   -12.334 1.00 0.00 ? 10 ASP A O   8  
ATOM   5196  C  CB  . ASP A 1 10 ? 4.818   6.987   -15.120 1.00 0.00 ? 10 ASP A CB  8  
ATOM   5197  C  CG  . ASP A 1 10 ? 4.237   5.909   -16.048 1.00 0.00 ? 10 ASP A CG  8  
ATOM   5198  O  OD1 . ASP A 1 10 ? 3.092   5.346   -15.556 1.00 0.00 ? 10 ASP A OD1 8  
ATOM   5199  O  OD2 . ASP A 1 10 ? 4.763   5.584   -17.102 1.00 0.00 ? 10 ASP A OD2 8  
ATOM   5200  N  N   . GLN A 1 11 ? 6.760   7.236   -12.571 1.00 0.00 ? 11 GLN A N   8  
ATOM   5201  C  CA  . GLN A 1 11 ? 7.906   6.842   -11.756 1.00 0.00 ? 11 GLN A CA  8  
ATOM   5202  C  C   . GLN A 1 11 ? 7.452   6.399   -10.380 1.00 0.00 ? 11 GLN A C   8  
ATOM   5203  O  O   . GLN A 1 11 ? 7.827   5.344   -9.853  1.00 0.00 ? 11 GLN A O   8  
ATOM   5204  C  CB  . GLN A 1 11 ? 8.870   8.043   -11.649 1.00 0.00 ? 11 GLN A CB  8  
ATOM   5205  C  CG  . GLN A 1 11 ? 10.228  7.917   -12.416 1.00 0.00 ? 11 GLN A CG  8  
ATOM   5206  C  CD  . GLN A 1 11 ? 11.529  8.297   -11.698 1.00 0.00 ? 11 GLN A CD  8  
ATOM   5207  O  OE1 . GLN A 1 11 ? 12.338  7.446   -11.364 1.00 0.00 ? 11 GLN A OE1 8  
ATOM   5208  N  NE2 . GLN A 1 11 ? 11.775  9.550   -11.411 1.00 0.00 ? 11 GLN A NE2 8  
ATOM   5209  N  N   . ARG A 1 12 ? 6.498   7.308   -9.707  1.00 0.00 ? 12 ARG A N   8  
ATOM   5210  C  CA  . ARG A 1 12 ? 5.884   7.038   -8.416  1.00 0.00 ? 12 ARG A CA  8  
ATOM   5211  C  C   . ARG A 1 12 ? 5.429   5.610   -8.248  1.00 0.00 ? 12 ARG A C   8  
ATOM   5212  O  O   . ARG A 1 12 ? 5.961   4.782   -7.471  1.00 0.00 ? 12 ARG A O   8  
ATOM   5213  C  CB  . ARG A 1 12 ? 4.632   7.983   -8.290  1.00 0.00 ? 12 ARG A CB  8  
ATOM   5214  C  CG  . ARG A 1 12 ? 4.903   9.420   -7.792  1.00 0.00 ? 12 ARG A CG  8  
ATOM   5215  C  CD  . ARG A 1 12 ? 5.631   9.476   -6.443  1.00 0.00 ? 12 ARG A CD  8  
ATOM   5216  N  NE  . ARG A 1 12 ? 6.184   10.845  -6.274  1.00 0.00 ? 12 ARG A NE  8  
ATOM   5217  C  CZ  . ARG A 1 12 ? 5.475   11.966  -6.276  1.00 0.00 ? 12 ARG A CZ  8  
ATOM   5218  N  NH1 . ARG A 1 12 ? 4.183   12.017  -6.419  1.00 0.00 ? 12 ARG A NH1 8  
ATOM   5219  N  NH2 . ARG A 1 12 ? 6.113   13.072  -6.127  1.00 0.00 ? 12 ARG A NH2 8  
ATOM   5220  N  N   . TRP A 1 13 ? 4.241   5.226   -9.052  1.00 0.00 ? 13 TRP A N   8  
ATOM   5221  C  CA  . TRP A 1 13 ? 3.548   3.967   -8.822  1.00 0.00 ? 13 TRP A CA  8  
ATOM   5222  C  C   . TRP A 1 13 ? 4.281   2.809   -9.444  1.00 0.00 ? 13 TRP A C   8  
ATOM   5223  O  O   . TRP A 1 13 ? 4.156   1.653   -9.000  1.00 0.00 ? 13 TRP A O   8  
ATOM   5224  C  CB  . TRP A 1 13 ? 2.092   4.100   -9.383  1.00 0.00 ? 13 TRP A CB  8  
ATOM   5225  C  CG  . TRP A 1 13 ? 1.399   2.727   -9.335  1.00 0.00 ? 13 TRP A CG  8  
ATOM   5226  C  CD1 . TRP A 1 13 ? 1.263   1.838   -10.418 1.00 0.00 ? 13 TRP A CD1 8  
ATOM   5227  C  CD2 . TRP A 1 13 ? 0.905   2.076   -8.227  1.00 0.00 ? 13 TRP A CD2 8  
ATOM   5228  N  NE1 . TRP A 1 13 ? 0.678   0.623   -10.009 1.00 0.00 ? 13 TRP A NE1 8  
ATOM   5229  C  CE2 . TRP A 1 13 ? 0.472   0.792   -8.646  1.00 0.00 ? 13 TRP A CE2 8  
ATOM   5230  C  CE3 . TRP A 1 13 ? 0.819   2.468   -6.865  1.00 0.00 ? 13 TRP A CE3 8  
ATOM   5231  C  CZ2 . TRP A 1 13 ? -0.058  -0.108  -7.695  1.00 0.00 ? 13 TRP A CZ2 8  
ATOM   5232  C  CZ3 . TRP A 1 13 ? 0.276   1.566   -5.951  1.00 0.00 ? 13 TRP A CZ3 8  
ATOM   5233  C  CH2 . TRP A 1 13 ? -0.159  0.296   -6.360  1.00 0.00 ? 13 TRP A CH2 8  
ATOM   5234  N  N   . GLN A 1 14 ? 5.127   3.090   -10.627 1.00 0.00 ? 14 GLN A N   8  
ATOM   5235  C  CA  . GLN A 1 14 ? 6.033   2.078   -11.169 1.00 0.00 ? 14 GLN A CA  8  
ATOM   5236  C  C   . GLN A 1 14 ? 7.000   1.643   -10.079 1.00 0.00 ? 14 GLN A C   8  
ATOM   5237  O  O   . GLN A 1 14 ? 7.516   0.519   -10.057 1.00 0.00 ? 14 GLN A O   8  
ATOM   5238  C  CB  . GLN A 1 14 ? 6.800   2.653   -12.374 1.00 0.00 ? 14 GLN A CB  8  
ATOM   5239  C  CG  . GLN A 1 14 ? 7.925   1.745   -12.979 1.00 0.00 ? 14 GLN A CG  8  
ATOM   5240  C  CD  . GLN A 1 14 ? 7.594   0.312   -13.410 1.00 0.00 ? 14 GLN A CD  8  
ATOM   5241  O  OE1 . GLN A 1 14 ? 6.548   -0.224  -13.079 1.00 0.00 ? 14 GLN A OE1 8  
ATOM   5242  N  NE2 . GLN A 1 14 ? 8.445   -0.363  -14.141 1.00 0.00 ? 14 GLN A NE2 8  
ATOM   5243  N  N   . SER A 1 15 ? 7.245   2.658   -9.023  1.00 0.00 ? 15 SER A N   8  
ATOM   5244  C  CA  . SER A 1 15 ? 8.006   2.354   -7.818  1.00 0.00 ? 15 SER A CA  8  
ATOM   5245  C  C   . SER A 1 15 ? 7.263   1.379   -6.936  1.00 0.00 ? 15 SER A C   8  
ATOM   5246  O  O   . SER A 1 15 ? 7.886   0.466   -6.350  1.00 0.00 ? 15 SER A O   8  
ATOM   5247  C  CB  . SER A 1 15 ? 8.421   3.635   -7.053  1.00 0.00 ? 15 SER A CB  8  
ATOM   5248  O  OG  . SER A 1 15 ? 9.591   3.449   -6.248  1.00 0.00 ? 15 SER A OG  8  
ATOM   5249  N  N   . VAL A 1 16 ? 5.792   1.566   -6.755  1.00 0.00 ? 16 VAL A N   8  
ATOM   5250  C  CA  . VAL A 1 16 ? 5.015   0.540   -6.060  1.00 0.00 ? 16 VAL A CA  8  
ATOM   5251  C  C   . VAL A 1 16 ? 5.097   -0.805  -6.739  1.00 0.00 ? 16 VAL A C   8  
ATOM   5252  O  O   . VAL A 1 16 ? 5.479   -1.843  -6.125  1.00 0.00 ? 16 VAL A O   8  
ATOM   5253  C  CB  . VAL A 1 16 ? 3.544   0.956   -5.690  1.00 0.00 ? 16 VAL A CB  8  
ATOM   5254  C  CG1 . VAL A 1 16 ? 2.883   0.111   -4.544  1.00 0.00 ? 16 VAL A CG1 8  
ATOM   5255  C  CG2 . VAL A 1 16 ? 3.399   2.423   -5.223  1.00 0.00 ? 16 VAL A CG2 8  
ATOM   5256  N  N   . LEU A 1 17 ? 4.677   -0.914  -8.150  1.00 0.00 ? 17 LEU A N   8  
ATOM   5257  C  CA  . LEU A 1 17 ? 4.799   -2.172  -8.921  1.00 0.00 ? 17 LEU A CA  8  
ATOM   5258  C  C   . LEU A 1 17 ? 6.176   -2.752  -8.739  1.00 0.00 ? 17 LEU A C   8  
ATOM   5259  O  O   . LEU A 1 17 ? 6.408   -3.967  -8.711  1.00 0.00 ? 17 LEU A O   8  
ATOM   5260  C  CB  . LEU A 1 17 ? 4.481   -1.930  -10.423 1.00 0.00 ? 17 LEU A CB  8  
ATOM   5261  C  CG  . LEU A 1 17 ? 3.089   -1.316  -10.757 1.00 0.00 ? 17 LEU A CG  8  
ATOM   5262  C  CD1 . LEU A 1 17 ? 2.857   -1.330  -12.272 1.00 0.00 ? 17 LEU A CD1 8  
ATOM   5263  C  CD2 . LEU A 1 17 ? 1.939   -2.049  -10.048 1.00 0.00 ? 17 LEU A CD2 8  
ATOM   5264  N  N   . ALA A 1 18 ? 7.272   -1.750  -8.641  1.00 0.00 ? 18 ALA A N   8  
ATOM   5265  C  CA  . ALA A 1 18 ? 8.649   -2.095  -8.310  1.00 0.00 ? 18 ALA A CA  8  
ATOM   5266  C  C   . ALA A 1 18 ? 8.883   -2.194  -6.822  1.00 0.00 ? 18 ALA A C   8  
ATOM   5267  O  O   . ALA A 1 18 ? 9.706   -1.475  -6.236  1.00 0.00 ? 18 ALA A O   8  
ATOM   5268  C  CB  . ALA A 1 18 ? 9.562   -1.047  -8.983  1.00 0.00 ? 18 ALA A CB  8  
ATOM   5269  N  N   . ARG A 1 19 ? 8.044   -3.167  -6.089  1.00 0.00 ? 19 ARG A N   8  
ATOM   5270  C  CA  . ARG A 1 19 ? 8.255   -3.533  -4.693  1.00 0.00 ? 19 ARG A CA  8  
ATOM   5271  C  C   . ARG A 1 19 ? 9.708   -3.468  -4.292  1.00 0.00 ? 19 ARG A C   8  
ATOM   5272  O  O   . ARG A 1 19 ? 10.031  -3.235  -3.108  1.00 0.00 ? 19 ARG A O   8  
ATOM   5273  C  CB  . ARG A 1 19 ? 7.688   -4.970  -4.473  1.00 0.00 ? 19 ARG A CB  8  
ATOM   5274  C  CG  . ARG A 1 19 ? 8.503   -6.097  -5.159  1.00 0.00 ? 19 ARG A CG  8  
ATOM   5275  C  CD  . ARG A 1 19 ? 8.606   -7.366  -4.303  1.00 0.00 ? 19 ARG A CD  8  
ATOM   5276  N  NE  . ARG A 1 19 ? 7.246   -7.943  -4.157  1.00 0.00 ? 19 ARG A NE  8  
ATOM   5277  C  CZ  . ARG A 1 19 ? 6.970   -9.223  -3.951  1.00 0.00 ? 19 ARG A CZ  8  
ATOM   5278  N  NH1 . ARG A 1 19 ? 7.866   -10.161 -3.854  1.00 0.00 ? 19 ARG A NH1 8  
ATOM   5279  N  NH2 . ARG A 1 19 ? 5.732   -9.554  -3.841  1.00 0.00 ? 19 ARG A NH2 8  
ATOM   5280  N  N   . ASP A 1 20 ? 10.731  -3.730  -5.326  1.00 0.00 ? 20 ASP A N   8  
ATOM   5281  C  CA  . ASP A 1 20 ? 12.160  -3.592  -5.052  1.00 0.00 ? 20 ASP A CA  8  
ATOM   5282  C  C   . ASP A 1 20 ? 12.427  -2.393  -4.172  1.00 0.00 ? 20 ASP A C   8  
ATOM   5283  O  O   . ASP A 1 20 ? 11.790  -1.339  -4.294  1.00 0.00 ? 20 ASP A O   8  
ATOM   5284  C  CB  . ASP A 1 20 ? 12.959  -3.525  -6.379  1.00 0.00 ? 20 ASP A CB  8  
ATOM   5285  C  CG  . ASP A 1 20 ? 14.463  -3.233  -6.264  1.00 0.00 ? 20 ASP A CG  8  
ATOM   5286  O  OD1 . ASP A 1 20 ? 14.736  -1.900  -6.141  1.00 0.00 ? 20 ASP A OD1 8  
ATOM   5287  O  OD2 . ASP A 1 20 ? 15.314  -4.110  -6.278  1.00 0.00 ? 20 ASP A OD2 8  
ATOM   5288  N  N   . PRO A 1 21 ? 13.471  -2.569  -3.140  1.00 0.00 ? 21 PRO A N   8  
ATOM   5289  C  CA  . PRO A 1 21 ? 13.923  -1.530  -2.105  1.00 0.00 ? 21 PRO A CA  8  
ATOM   5290  C  C   . PRO A 1 21 ? 14.899  -0.495  -2.612  1.00 0.00 ? 21 PRO A C   8  
ATOM   5291  O  O   . PRO A 1 21 ? 15.868  -0.108  -1.941  1.00 0.00 ? 21 PRO A O   8  
ATOM   5292  C  CB  . PRO A 1 21 ? 14.571  -2.343  -0.987  1.00 0.00 ? 21 PRO A CB  8  
ATOM   5293  C  CG  . PRO A 1 21 ? 15.294  -3.419  -1.815  1.00 0.00 ? 21 PRO A CG  8  
ATOM   5294  C  CD  . PRO A 1 21 ? 14.279  -3.789  -2.901  1.00 0.00 ? 21 PRO A CD  8  
ATOM   5295  N  N   . ASN A 1 22 ? 14.617  0.072   -3.952  1.00 0.00 ? 22 ASN A N   8  
ATOM   5296  C  CA  . ASN A 1 22 ? 15.377  1.198   -4.486  1.00 0.00 ? 22 ASN A CA  8  
ATOM   5297  C  C   . ASN A 1 22 ? 14.817  2.511   -3.990  1.00 0.00 ? 22 ASN A C   8  
ATOM   5298  O  O   . ASN A 1 22 ? 15.525  3.343   -3.408  1.00 0.00 ? 22 ASN A O   8  
ATOM   5299  C  CB  . ASN A 1 22 ? 15.366  1.148   -6.042  1.00 0.00 ? 22 ASN A CB  8  
ATOM   5300  C  CG  . ASN A 1 22 ? 15.621  2.467   -6.780  1.00 0.00 ? 22 ASN A CG  8  
ATOM   5301  O  OD1 . ASN A 1 22 ? 16.746  2.847   -7.071  1.00 0.00 ? 22 ASN A OD1 8  
ATOM   5302  N  ND2 . ASN A 1 22 ? 14.601  3.218   -7.093  1.00 0.00 ? 22 ASN A ND2 8  
ATOM   5303  N  N   . ALA A 1 23 ? 13.369  2.730   -4.205  1.00 0.00 ? 23 ALA A N   8  
ATOM   5304  C  CA  . ALA A 1 23 ? 12.731  4.013   -3.928  1.00 0.00 ? 23 ALA A CA  8  
ATOM   5305  C  C   . ALA A 1 23 ? 11.664  3.880   -2.867  1.00 0.00 ? 23 ALA A C   8  
ATOM   5306  O  O   . ALA A 1 23 ? 10.882  4.810   -2.614  1.00 0.00 ? 23 ALA A O   8  
ATOM   5307  C  CB  . ALA A 1 23 ? 12.180  4.555   -5.259  1.00 0.00 ? 23 ALA A CB  8  
ATOM   5308  N  N   . ASP A 1 24 ? 11.622  2.606   -2.117  1.00 0.00 ? 24 ASP A N   8  
ATOM   5309  C  CA  . ASP A 1 24 ? 10.538  2.294   -1.189  1.00 0.00 ? 24 ASP A CA  8  
ATOM   5310  C  C   . ASP A 1 24 ? 10.456  3.327   -0.089  1.00 0.00 ? 24 ASP A C   8  
ATOM   5311  O  O   . ASP A 1 24 ? 9.492   4.097   0.029   1.00 0.00 ? 24 ASP A O   8  
ATOM   5312  C  CB  . ASP A 1 24 ? 10.709  0.861   -0.619  1.00 0.00 ? 24 ASP A CB  8  
ATOM   5313  C  CG  . ASP A 1 24 ? 9.908   -0.254  -1.308  1.00 0.00 ? 24 ASP A CG  8  
ATOM   5314  O  OD1 . ASP A 1 24 ? 9.536   -0.186  -2.470  1.00 0.00 ? 24 ASP A OD1 8  
ATOM   5315  O  OD2 . ASP A 1 24 ? 9.640   -1.305  -0.477  1.00 0.00 ? 24 ASP A OD2 8  
ATOM   5316  N  N   . GLY A 1 25 ? 11.619  3.395   0.826   1.00 0.00 ? 25 GLY A N   8  
ATOM   5317  C  CA  . GLY A 1 25 ? 11.618  4.244   2.013   1.00 0.00 ? 25 GLY A CA  8  
ATOM   5318  C  C   . GLY A 1 25 ? 11.959  5.674   1.667   1.00 0.00 ? 25 GLY A C   8  
ATOM   5319  O  O   . GLY A 1 25 ? 12.212  6.510   2.550   1.00 0.00 ? 25 GLY A O   8  
ATOM   5320  N  N   . GLU A 1 26 ? 11.940  6.043   0.235   1.00 0.00 ? 26 GLU A N   8  
ATOM   5321  C  CA  . GLU A 1 26 ? 12.139  7.420   -0.207  1.00 0.00 ? 26 GLU A CA  8  
ATOM   5322  C  C   . GLU A 1 26 ? 10.823  8.147   -0.354  1.00 0.00 ? 26 GLU A C   8  
ATOM   5323  O  O   . GLU A 1 26 ? 10.799  9.371   -0.598  1.00 0.00 ? 26 GLU A O   8  
ATOM   5324  C  CB  . GLU A 1 26 ? 12.926  7.400   -1.547  1.00 0.00 ? 26 GLU A CB  8  
ATOM   5325  C  CG  . GLU A 1 26 ? 13.215  8.776   -2.233  1.00 0.00 ? 26 GLU A CG  8  
ATOM   5326  C  CD  . GLU A 1 26 ? 14.300  8.839   -3.311  1.00 0.00 ? 26 GLU A CD  8  
ATOM   5327  O  OE1 . GLU A 1 26 ? 14.604  7.879   -4.008  1.00 0.00 ? 26 GLU A OE1 8  
ATOM   5328  O  OE2 . GLU A 1 26 ? 14.893  10.060  -3.422  1.00 0.00 ? 26 GLU A OE2 8  
ATOM   5329  N  N   . PHE A 1 27 ? 9.578   7.368   -0.178  1.00 0.00 ? 27 PHE A N   8  
ATOM   5330  C  CA  . PHE A 1 27 ? 8.261   7.983   -0.425  1.00 0.00 ? 27 PHE A CA  8  
ATOM   5331  C  C   . PHE A 1 27 ? 7.132   7.108   0.053   1.00 0.00 ? 27 PHE A C   8  
ATOM   5332  O  O   . PHE A 1 27 ? 7.275   5.867   0.137   1.00 0.00 ? 27 PHE A O   8  
ATOM   5333  C  CB  . PHE A 1 27 ? 8.119   8.278   -1.948  1.00 0.00 ? 27 PHE A CB  8  
ATOM   5334  C  CG  . PHE A 1 27 ? 7.654   7.138   -2.868  1.00 0.00 ? 27 PHE A CG  8  
ATOM   5335  C  CD1 . PHE A 1 27 ? 8.182   5.852   -2.740  1.00 0.00 ? 27 PHE A CD1 8  
ATOM   5336  C  CD2 . PHE A 1 27 ? 6.700   7.396   -3.862  1.00 0.00 ? 27 PHE A CD2 8  
ATOM   5337  C  CE1 . PHE A 1 27 ? 7.760   4.835   -3.592  1.00 0.00 ? 27 PHE A CE1 8  
ATOM   5338  C  CE2 . PHE A 1 27 ? 6.279   6.379   -4.711  1.00 0.00 ? 27 PHE A CE2 8  
ATOM   5339  C  CZ  . PHE A 1 27 ? 6.810   5.098   -4.578  1.00 0.00 ? 27 PHE A CZ  8  
ATOM   5340  N  N   . VAL A 1 28 ? 5.858   7.745   0.459   1.00 0.00 ? 28 VAL A N   8  
ATOM   5341  C  CA  . VAL A 1 28 ? 4.715   6.996   0.989   1.00 0.00 ? 28 VAL A CA  8  
ATOM   5342  C  C   . VAL A 1 28 ? 3.610   6.905   -0.037  1.00 0.00 ? 28 VAL A C   8  
ATOM   5343  O  O   . VAL A 1 28 ? 3.614   7.603   -1.061  1.00 0.00 ? 28 VAL A O   8  
ATOM   5344  C  CB  . VAL A 1 28 ? 4.197   7.687   2.311   1.00 0.00 ? 28 VAL A CB  8  
ATOM   5345  C  CG1 . VAL A 1 28 ? 4.129   6.786   3.578   1.00 0.00 ? 28 VAL A CG1 8  
ATOM   5346  C  CG2 . VAL A 1 28 ? 5.037   8.909   2.754   1.00 0.00 ? 28 VAL A CG2 8  
ATOM   5347  N  N   . PHE A 1 29 ? 2.510   5.961   0.258   1.00 0.00 ? 29 PHE A N   8  
ATOM   5348  C  CA  . PHE A 1 29 ? 1.331   5.829   -0.597  1.00 0.00 ? 29 PHE A CA  8  
ATOM   5349  C  C   . PHE A 1 29 ? 0.089   5.662   0.246   1.00 0.00 ? 29 PHE A C   8  
ATOM   5350  O  O   . PHE A 1 29 ? 0.077   4.899   1.230   1.00 0.00 ? 29 PHE A O   8  
ATOM   5351  C  CB  . PHE A 1 29 ? 1.480   4.587   -1.528  1.00 0.00 ? 29 PHE A CB  8  
ATOM   5352  C  CG  . PHE A 1 29 ? 0.809   3.282   -1.076  1.00 0.00 ? 29 PHE A CG  8  
ATOM   5353  C  CD1 . PHE A 1 29 ? 1.346   2.562   -0.003  1.00 0.00 ? 29 PHE A CD1 8  
ATOM   5354  C  CD2 . PHE A 1 29 ? -0.304  2.776   -1.753  1.00 0.00 ? 29 PHE A CD2 8  
ATOM   5355  C  CE1 . PHE A 1 29 ? 0.767   1.363   0.402   1.00 0.00 ? 29 PHE A CE1 8  
ATOM   5356  C  CE2 . PHE A 1 29 ? -0.878  1.570   -1.355  1.00 0.00 ? 29 PHE A CE2 8  
ATOM   5357  C  CZ  . PHE A 1 29 ? -0.346  0.866   -0.276  1.00 0.00 ? 29 PHE A CZ  8  
ATOM   5358  N  N   . ALA A 1 30 ? -1.100  6.460   -0.122  1.00 0.00 ? 30 ALA A N   8  
ATOM   5359  C  CA  . ALA A 1 30 ? -2.289  6.505   0.727   1.00 0.00 ? 30 ALA A CA  8  
ATOM   5360  C  C   . ALA A 1 30 ? -3.524  6.092   -0.037  1.00 0.00 ? 30 ALA A C   8  
ATOM   5361  O  O   . ALA A 1 30 ? -4.213  6.920   -0.653  1.00 0.00 ? 30 ALA A O   8  
ATOM   5362  C  CB  . ALA A 1 30 ? -2.396  7.929   1.301   1.00 0.00 ? 30 ALA A CB  8  
ATOM   5363  N  N   . VAL A 1 31 ? -3.873  4.656   -0.007  1.00 0.00 ? 31 VAL A N   8  
ATOM   5364  C  CA  . VAL A 1 31 ? -5.098  4.155   -0.637  1.00 0.00 ? 31 VAL A CA  8  
ATOM   5365  C  C   . VAL A 1 31 ? -6.300  4.514   0.204   1.00 0.00 ? 31 VAL A C   8  
ATOM   5366  O  O   . VAL A 1 31 ? -6.590  3.876   1.227   1.00 0.00 ? 31 VAL A O   8  
ATOM   5367  C  CB  . VAL A 1 31 ? -4.982  2.598   -0.861  1.00 0.00 ? 31 VAL A CB  8  
ATOM   5368  C  CG1 . VAL A 1 31 ? -5.031  1.706   0.413   1.00 0.00 ? 31 VAL A CG1 8  
ATOM   5369  C  CG2 . VAL A 1 31 ? -6.061  2.012   -1.805  1.00 0.00 ? 31 VAL A CG2 8  
ATOM   5370  N  N   . ARG A 1 32 ? -7.089  5.691   -0.228  1.00 0.00 ? 32 ARG A N   8  
ATOM   5371  C  CA  . ARG A 1 32 ? -8.160  6.237   0.600   1.00 0.00 ? 32 ARG A CA  8  
ATOM   5372  C  C   . ARG A 1 32 ? -9.483  5.546   0.377   1.00 0.00 ? 32 ARG A C   8  
ATOM   5373  O  O   . ARG A 1 32 ? -10.555 6.181   0.420   1.00 0.00 ? 32 ARG A O   8  
ATOM   5374  C  CB  . ARG A 1 32 ? -8.271  7.765   0.333   1.00 0.00 ? 32 ARG A CB  8  
ATOM   5375  C  CG  . ARG A 1 32 ? -8.896  8.583   1.493   1.00 0.00 ? 32 ARG A CG  8  
ATOM   5376  C  CD  . ARG A 1 32 ? -9.506  9.908   1.017   1.00 0.00 ? 32 ARG A CD  8  
ATOM   5377  N  NE  . ARG A 1 32 ? -8.403  10.797  0.573   1.00 0.00 ? 32 ARG A NE  8  
ATOM   5378  C  CZ  . ARG A 1 32 ? -8.524  12.082  0.269   1.00 0.00 ? 32 ARG A CZ  8  
ATOM   5379  N  NH1 . ARG A 1 32 ? -9.640  12.747  0.324   1.00 0.00 ? 32 ARG A NH1 8  
ATOM   5380  N  NH2 . ARG A 1 32 ? -7.463  12.707  -0.104  1.00 0.00 ? 32 ARG A NH2 8  
ATOM   5381  N  N   . THR A 1 33 ? -9.466  4.087   0.144   1.00 0.00 ? 33 THR A N   8  
ATOM   5382  C  CA  . THR A 1 33 ? -10.696 3.298   0.094   1.00 0.00 ? 33 THR A CA  8  
ATOM   5383  C  C   . THR A 1 33 ? -10.750 2.327   1.253   1.00 0.00 ? 33 THR A C   8  
ATOM   5384  O  O   . THR A 1 33 ? -11.810 2.059   1.834   1.00 0.00 ? 33 THR A O   8  
ATOM   5385  C  CB  . THR A 1 33 ? -10.820 2.543   -1.271  1.00 0.00 ? 33 THR A CB  8  
ATOM   5386  O  OG1 . THR A 1 33 ? -10.910 3.468   -2.347  1.00 0.00 ? 33 THR A OG1 8  
ATOM   5387  C  CG2 . THR A 1 33 ? -12.058 1.635   -1.440  1.00 0.00 ? 33 THR A CG2 8  
ATOM   5388  N  N   . THR A 1 34 ? -9.465  1.697   1.632   1.00 0.00 ? 34 THR A N   8  
ATOM   5389  C  CA  . THR A 1 34 ? -9.320  0.878   2.829   1.00 0.00 ? 34 THR A CA  8  
ATOM   5390  C  C   . THR A 1 34 ? -8.747  1.685   3.972   1.00 0.00 ? 34 THR A C   8  
ATOM   5391  O  O   . THR A 1 34 ? -8.446  1.146   5.050   1.00 0.00 ? 34 THR A O   8  
ATOM   5392  C  CB  . THR A 1 34 ? -8.423  -0.373  2.536   1.00 0.00 ? 34 THR A CB  8  
ATOM   5393  O  OG1 . THR A 1 34 ? -8.896  -1.068  1.390   1.00 0.00 ? 34 THR A OG1 8  
ATOM   5394  C  CG2 . THR A 1 34 ? -8.363  -1.447  3.643   1.00 0.00 ? 34 THR A CG2 8  
ATOM   5395  N  N   . GLY A 1 35 ? -8.524  3.131   3.745   1.00 0.00 ? 35 GLY A N   8  
ATOM   5396  C  CA  . GLY A 1 35 ? -8.128  4.024   4.831   1.00 0.00 ? 35 GLY A CA  8  
ATOM   5397  C  C   . GLY A 1 35 ? -6.782  3.626   5.389   1.00 0.00 ? 35 GLY A C   8  
ATOM   5398  O  O   . GLY A 1 35 ? -6.594  3.498   6.608   1.00 0.00 ? 35 GLY A O   8  
ATOM   5399  N  N   . ILE A 1 36 ? -5.705  3.368   4.405   1.00 0.00 ? 36 ILE A N   8  
ATOM   5400  C  CA  . ILE A 1 36 ? -4.349  3.031   4.826   1.00 0.00 ? 36 ILE A CA  8  
ATOM   5401  C  C   . ILE A 1 36 ? -3.305  3.816   4.066   1.00 0.00 ? 36 ILE A C   8  
ATOM   5402  O  O   . ILE A 1 36 ? -3.349  3.961   2.837   1.00 0.00 ? 36 ILE A O   8  
ATOM   5403  C  CB  . ILE A 1 36 ? -4.086  1.472   4.773   1.00 0.00 ? 36 ILE A CB  8  
ATOM   5404  C  CG1 . ILE A 1 36 ? -3.939  0.865   3.342   1.00 0.00 ? 36 ILE A CG1 8  
ATOM   5405  C  CG2 . ILE A 1 36 ? -5.175  0.651   5.536   1.00 0.00 ? 36 ILE A CG2 8  
ATOM   5406  C  CD1 . ILE A 1 36 ? -2.673  0.017   3.097   1.00 0.00 ? 36 ILE A CD1 8  
ATOM   5407  N  N   . PHE A 1 37 ? -2.199  4.371   4.877   1.00 0.00 ? 37 PHE A N   8  
ATOM   5408  C  CA  . PHE A 1 37 ? -1.018  5.015   4.285   1.00 0.00 ? 37 PHE A CA  8  
ATOM   5409  C  C   . PHE A 1 37 ? 0.222   4.254   4.688   1.00 0.00 ? 37 PHE A C   8  
ATOM   5410  O  O   . PHE A 1 37 ? 0.445   4.022   5.904   1.00 0.00 ? 37 PHE A O   8  
ATOM   5411  C  CB  . PHE A 1 37 ? -0.899  6.484   4.789   1.00 0.00 ? 37 PHE A CB  8  
ATOM   5412  C  CG  . PHE A 1 37 ? -0.100  6.745   6.075   1.00 0.00 ? 37 PHE A CG  8  
ATOM   5413  C  CD1 . PHE A 1 37 ? 1.284   6.943   6.005   1.00 0.00 ? 37 PHE A CD1 8  
ATOM   5414  C  CD2 . PHE A 1 37 ? -0.744  6.833   7.311   1.00 0.00 ? 37 PHE A CD2 8  
ATOM   5415  C  CE1 . PHE A 1 37 ? 2.015   7.211   7.157   1.00 0.00 ? 37 PHE A CE1 8  
ATOM   5416  C  CE2 . PHE A 1 37 ? -0.013  7.109   8.464   1.00 0.00 ? 37 PHE A CE2 8  
ATOM   5417  C  CZ  . PHE A 1 37 ? 1.366   7.294   8.387   1.00 0.00 ? 37 PHE A CZ  8  
ATOM   5418  N  N   . CYS A 1 38 ? 1.142   3.752   3.648   1.00 0.00 ? 38 CYS A N   8  
ATOM   5419  C  CA  . CYS A 1 38 ? 2.249   2.845   3.967   1.00 0.00 ? 38 CYS A CA  8  
ATOM   5420  C  C   . CYS A 1 38 ? 3.364   2.970   2.960   1.00 0.00 ? 38 CYS A C   8  
ATOM   5421  O  O   . CYS A 1 38 ? 3.184   3.508   1.855   1.00 0.00 ? 38 CYS A O   8  
ATOM   5422  C  CB  . CYS A 1 38 ? 1.678   1.417   4.047   1.00 0.00 ? 38 CYS A CB  8  
ATOM   5423  S  SG  . CYS A 1 38 ? 2.561   0.219   3.009   1.00 0.00 ? 38 CYS A SG  8  
ATOM   5424  N  N   . ARG A 1 39 ? 4.689   2.462   3.371   1.00 0.00 ? 39 ARG A N   8  
ATOM   5425  C  CA  . ARG A 1 39 ? 5.788   2.354   2.399   1.00 0.00 ? 39 ARG A CA  8  
ATOM   5426  C  C   . ARG A 1 39 ? 5.534   1.156   1.509   1.00 0.00 ? 39 ARG A C   8  
ATOM   5427  O  O   . ARG A 1 39 ? 5.481   0.008   1.967   1.00 0.00 ? 39 ARG A O   8  
ATOM   5428  C  CB  . ARG A 1 39 ? 7.138   2.285   3.153   1.00 0.00 ? 39 ARG A CB  8  
ATOM   5429  C  CG  . ARG A 1 39 ? 8.072   1.102   2.789   1.00 0.00 ? 39 ARG A CG  8  
ATOM   5430  C  CD  . ARG A 1 39 ? 7.960   -0.062  3.782   1.00 0.00 ? 39 ARG A CD  8  
ATOM   5431  N  NE  . ARG A 1 39 ? 9.260   -0.781  3.808   1.00 0.00 ? 39 ARG A NE  8  
ATOM   5432  C  CZ  . ARG A 1 39 ? 10.252  -0.548  4.656   1.00 0.00 ? 39 ARG A CZ  8  
ATOM   5433  N  NH1 . ARG A 1 39 ? 10.223  0.359   5.588   1.00 0.00 ? 39 ARG A NH1 8  
ATOM   5434  N  NH2 . ARG A 1 39 ? 11.311  -1.269  4.544   1.00 0.00 ? 39 ARG A NH2 8  
ATOM   5435  N  N   . PRO A 1 40 ? 5.393   1.432   0.067   1.00 0.00 ? 40 PRO A N   8  
ATOM   5436  C  CA  . PRO A 1 40 ? 5.095   0.417   -1.051  1.00 0.00 ? 40 PRO A CA  8  
ATOM   5437  C  C   . PRO A 1 40 ? 5.413   -1.023  -0.743  1.00 0.00 ? 40 PRO A C   8  
ATOM   5438  O  O   . PRO A 1 40 ? 6.553   -1.486  -0.935  1.00 0.00 ? 40 PRO A O   8  
ATOM   5439  C  CB  . PRO A 1 40 ? 5.957   0.908   -2.219  1.00 0.00 ? 40 PRO A CB  8  
ATOM   5440  C  CG  . PRO A 1 40 ? 5.752   2.426   -2.096  1.00 0.00 ? 40 PRO A CG  8  
ATOM   5441  C  CD  . PRO A 1 40 ? 5.511   2.745   -0.617  1.00 0.00 ? 40 PRO A CD  8  
ATOM   5442  N  N   . SER A 1 41 ? 4.327   -1.862  -0.166  1.00 0.00 ? 41 SER A N   8  
ATOM   5443  C  CA  . SER A 1 41 ? 4.495   -3.298  0.004   1.00 0.00 ? 41 SER A CA  8  
ATOM   5444  C  C   . SER A 1 41 ? 3.272   -4.043  0.479   1.00 0.00 ? 41 SER A C   8  
ATOM   5445  O  O   . SER A 1 41 ? 3.216   -5.290  0.303   1.00 0.00 ? 41 SER A O   8  
ATOM   5446  C  CB  . SER A 1 41 ? 5.722   -3.602  0.910   1.00 0.00 ? 41 SER A CB  8  
ATOM   5447  O  OG  . SER A 1 41 ? 5.917   -2.633  1.943   1.00 0.00 ? 41 SER A OG  8  
ATOM   5448  N  N   . CYS A 1 42 ? 2.173   -3.340  1.175   1.00 0.00 ? 42 CYS A N   8  
ATOM   5449  C  CA  . CYS A 1 42 ? 1.060   -4.035  1.814   1.00 0.00 ? 42 CYS A CA  8  
ATOM   5450  C  C   . CYS A 1 42 ? 0.629   -5.273  1.053   1.00 0.00 ? 42 CYS A C   8  
ATOM   5451  O  O   . CYS A 1 42 ? -0.035  -5.218  0.010   1.00 0.00 ? 42 CYS A O   8  
ATOM   5452  C  CB  . CYS A 1 42 ? -0.117  -3.071  2.059   1.00 0.00 ? 42 CYS A CB  8  
ATOM   5453  S  SG  . CYS A 1 42 ? 0.128   -2.141  3.593   1.00 0.00 ? 42 CYS A SG  8  
ATOM   5454  N  N   . ARG A 1 43 ? 1.087   -6.565  1.617   1.00 0.00 ? 43 ARG A N   8  
ATOM   5455  C  CA  . ARG A 1 43 ? 0.912   -7.844  0.938   1.00 0.00 ? 43 ARG A CA  8  
ATOM   5456  C  C   . ARG A 1 43 ? -0.500  -8.361  1.082   1.00 0.00 ? 43 ARG A C   8  
ATOM   5457  O  O   . ARG A 1 43 ? -0.840  -9.447  0.580   1.00 0.00 ? 43 ARG A O   8  
ATOM   5458  C  CB  . ARG A 1 43 ? 1.943   -8.858  1.514   1.00 0.00 ? 43 ARG A CB  8  
ATOM   5459  C  CG  . ARG A 1 43 ? 3.213   -8.213  2.128   1.00 0.00 ? 43 ARG A CG  8  
ATOM   5460  C  CD  . ARG A 1 43 ? 3.921   -9.127  3.137   1.00 0.00 ? 43 ARG A CD  8  
ATOM   5461  N  NE  . ARG A 1 43 ? 5.204   -8.488  3.525   1.00 0.00 ? 43 ARG A NE  8  
ATOM   5462  C  CZ  . ARG A 1 43 ? 6.314   -9.131  3.864   1.00 0.00 ? 43 ARG A CZ  8  
ATOM   5463  N  NH1 . ARG A 1 43 ? 6.428   -10.425 3.908   1.00 0.00 ? 43 ARG A NH1 8  
ATOM   5464  N  NH2 . ARG A 1 43 ? 7.341   -8.420  4.168   1.00 0.00 ? 43 ARG A NH2 8  
ATOM   5465  N  N   . ALA A 1 44 ? -1.450  -7.547  1.871   1.00 0.00 ? 44 ALA A N   8  
ATOM   5466  C  CA  . ALA A 1 44 ? -2.869  -7.855  1.929   1.00 0.00 ? 44 ALA A CA  8  
ATOM   5467  C  C   . ALA A 1 44 ? -3.456  -7.910  0.525   1.00 0.00 ? 44 ALA A C   8  
ATOM   5468  O  O   . ALA A 1 44 ? -2.762  -7.857  -0.496  1.00 0.00 ? 44 ALA A O   8  
ATOM   5469  C  CB  . ALA A 1 44 ? -3.567  -6.788  2.794   1.00 0.00 ? 44 ALA A CB  8  
ATOM   5470  N  N   . ARG A 1 45 ? -4.936  -8.071  0.491   1.00 0.00 ? 45 ARG A N   8  
ATOM   5471  C  CA  . ARG A 1 45 ? -5.686  -7.981  -0.757  1.00 0.00 ? 45 ARG A CA  8  
ATOM   5472  C  C   . ARG A 1 45 ? -5.117  -6.889  -1.639  1.00 0.00 ? 45 ARG A C   8  
ATOM   5473  O  O   . ARG A 1 45 ? -5.183  -6.953  -2.874  1.00 0.00 ? 45 ARG A O   8  
ATOM   5474  C  CB  . ARG A 1 45 ? -7.183  -7.724  -0.439  1.00 0.00 ? 45 ARG A CB  8  
ATOM   5475  C  CG  . ARG A 1 45 ? -7.573  -6.230  -0.283  1.00 0.00 ? 45 ARG A CG  8  
ATOM   5476  C  CD  . ARG A 1 45 ? -8.785  -6.036  0.640   1.00 0.00 ? 45 ARG A CD  8  
ATOM   5477  N  NE  . ARG A 1 45 ? -9.692  -7.198  0.462   1.00 0.00 ? 45 ARG A NE  8  
ATOM   5478  C  CZ  . ARG A 1 45 ? -10.402 -7.782  1.418   1.00 0.00 ? 45 ARG A CZ  8  
ATOM   5479  N  NH1 . ARG A 1 45 ? -10.407 -7.407  2.662   1.00 0.00 ? 45 ARG A NH1 8  
ATOM   5480  N  NH2 . ARG A 1 45 ? -11.132 -8.788  1.085   1.00 0.00 ? 45 ARG A NH2 8  
ATOM   5481  N  N   . HIS A 1 46 ? -4.450  -5.770  -0.941  1.00 0.00 ? 46 HIS A N   8  
ATOM   5482  C  CA  . HIS A 1 46 ? -3.703  -4.740  -1.662  1.00 0.00 ? 46 HIS A CA  8  
ATOM   5483  C  C   . HIS A 1 46 ? -4.593  -4.026  -2.651  1.00 0.00 ? 46 HIS A C   8  
ATOM   5484  O  O   . HIS A 1 46 ? -4.790  -4.453  -3.796  1.00 0.00 ? 46 HIS A O   8  
ATOM   5485  C  CB  . HIS A 1 46 ? -2.547  -5.470  -2.366  1.00 0.00 ? 46 HIS A CB  8  
ATOM   5486  C  CG  . HIS A 1 46 ? -2.038  -4.756  -3.582  1.00 0.00 ? 46 HIS A CG  8  
ATOM   5487  N  ND1 . HIS A 1 46 ? -1.910  -5.310  -4.855  1.00 0.00 ? 46 HIS A ND1 8  
ATOM   5488  C  CD2 . HIS A 1 46 ? -1.627  -3.431  -3.561  1.00 0.00 ? 46 HIS A CD2 8  
ATOM   5489  C  CE1 . HIS A 1 46 ? -1.416  -4.247  -5.519  1.00 0.00 ? 46 HIS A CE1 8  
ATOM   5490  N  NE2 . HIS A 1 46 ? -1.220  -3.093  -4.826  1.00 0.00 ? 46 HIS A NE2 8  
ATOM   5491  N  N   . ALA A 1 47 ? -5.258  -2.797  -2.155  1.00 0.00 ? 47 ALA A N   8  
ATOM   5492  C  CA  . ALA A 1 47 ? -6.195  -2.043  -2.983  1.00 0.00 ? 47 ALA A CA  8  
ATOM   5493  C  C   . ALA A 1 47 ? -5.520  -1.534  -4.235  1.00 0.00 ? 47 ALA A C   8  
ATOM   5494  O  O   . ALA A 1 47 ? -4.312  -1.710  -4.446  1.00 0.00 ? 47 ALA A O   8  
ATOM   5495  C  CB  . ALA A 1 47 ? -6.779  -0.913  -2.118  1.00 0.00 ? 47 ALA A CB  8  
ATOM   5496  N  N   . LEU A 1 48 ? -6.375  -0.781  -5.179  1.00 0.00 ? 48 LEU A N   8  
ATOM   5497  C  CA  . LEU A 1 48 ? -5.886  -0.355  -6.487  1.00 0.00 ? 48 LEU A CA  8  
ATOM   5498  C  C   . LEU A 1 48 ? -5.092  0.926   -6.371  1.00 0.00 ? 48 LEU A C   8  
ATOM   5499  O  O   . LEU A 1 48 ? -5.144  1.635   -5.356  1.00 0.00 ? 48 LEU A O   8  
ATOM   5500  C  CB  . LEU A 1 48 ? -7.061  -0.202  -7.493  1.00 0.00 ? 48 LEU A CB  8  
ATOM   5501  C  CG  . LEU A 1 48 ? -8.510  -0.406  -6.975  1.00 0.00 ? 48 LEU A CG  8  
ATOM   5502  C  CD1 . LEU A 1 48 ? -8.922  0.767   -6.076  1.00 0.00 ? 48 LEU A CD1 8  
ATOM   5503  C  CD2 . LEU A 1 48 ? -9.530  -0.567  -8.115  1.00 0.00 ? 48 LEU A CD2 8  
ATOM   5504  N  N   . ARG A 1 49 ? -4.280  1.303   -7.548  1.00 0.00 ? 49 ARG A N   8  
ATOM   5505  C  CA  . ARG A 1 49 ? -3.552  2.567   -7.625  1.00 0.00 ? 49 ARG A CA  8  
ATOM   5506  C  C   . ARG A 1 49 ? -4.442  3.690   -8.100  1.00 0.00 ? 49 ARG A C   8  
ATOM   5507  O  O   . ARG A 1 49 ? -3.974  4.800   -8.404  1.00 0.00 ? 49 ARG A O   8  
ATOM   5508  C  CB  . ARG A 1 49 ? -2.336  2.380   -8.578  1.00 0.00 ? 49 ARG A CB  8  
ATOM   5509  C  CG  . ARG A 1 49 ? -2.683  2.427   -10.089 1.00 0.00 ? 49 ARG A CG  8  
ATOM   5510  C  CD  . ARG A 1 49 ? -3.366  1.143   -10.579 1.00 0.00 ? 49 ARG A CD  8  
ATOM   5511  N  NE  . ARG A 1 49 ? -3.443  1.189   -12.061 1.00 0.00 ? 49 ARG A NE  8  
ATOM   5512  C  CZ  . ARG A 1 49 ? -4.286  0.490   -12.810 1.00 0.00 ? 49 ARG A CZ  8  
ATOM   5513  N  NH1 . ARG A 1 49 ? -5.173  -0.336  -12.340 1.00 0.00 ? 49 ARG A NH1 8  
ATOM   5514  N  NH2 . ARG A 1 49 ? -4.216  0.645   -14.085 1.00 0.00 ? 49 ARG A NH2 8  
ATOM   5515  N  N   . GLU A 1 50 ? -5.895  3.421   -8.161  1.00 0.00 ? 50 GLU A N   8  
ATOM   5516  C  CA  . GLU A 1 50 ? -6.836  4.347   -8.778  1.00 0.00 ? 50 GLU A CA  8  
ATOM   5517  C  C   . GLU A 1 50 ? -7.334  5.403   -7.822  1.00 0.00 ? 50 GLU A C   8  
ATOM   5518  O  O   . GLU A 1 50 ? -7.912  6.426   -8.254  1.00 0.00 ? 50 GLU A O   8  
ATOM   5519  C  CB  . GLU A 1 50 ? -8.021  3.526   -9.366  1.00 0.00 ? 50 GLU A CB  8  
ATOM   5520  C  CG  . GLU A 1 50 ? -8.802  2.588   -8.387  1.00 0.00 ? 50 GLU A CG  8  
ATOM   5521  C  CD  . GLU A 1 50 ? -10.324 2.729   -8.308  1.00 0.00 ? 50 GLU A CD  8  
ATOM   5522  O  OE1 . GLU A 1 50 ? -10.933 2.785   -9.525  1.00 0.00 ? 50 GLU A OE1 8  
ATOM   5523  O  OE2 . GLU A 1 50 ? -10.934 2.785   -7.249  1.00 0.00 ? 50 GLU A OE2 8  
ATOM   5524  N  N   . ASN A 1 51 ? -7.095  5.213   -6.386  1.00 0.00 ? 51 ASN A N   8  
ATOM   5525  C  CA  . ASN A 1 51 ? -7.639  6.125   -5.348  1.00 0.00 ? 51 ASN A CA  8  
ATOM   5526  C  C   . ASN A 1 51 ? -6.489  6.477   -4.422  1.00 0.00 ? 51 ASN A C   8  
ATOM   5527  O  O   . ASN A 1 51 ? -6.678  6.940   -3.288  1.00 0.00 ? 51 ASN A O   8  
ATOM   5528  C  CB  . ASN A 1 51 ? -8.637  5.259   -4.531  1.00 0.00 ? 51 ASN A CB  8  
ATOM   5529  C  CG  . ASN A 1 51 ? -7.992  4.254   -3.550  1.00 0.00 ? 51 ASN A CG  8  
ATOM   5530  O  OD1 . ASN A 1 51 ? -7.283  3.336   -3.928  1.00 0.00 ? 51 ASN A OD1 8  
ATOM   5531  N  ND2 . ASN A 1 51 ? -8.232  4.405   -2.277  1.00 0.00 ? 51 ASN A ND2 8  
ATOM   5532  N  N   . VAL A 1 52 ? -5.134  6.180   -4.932  1.00 0.00 ? 52 VAL A N   8  
ATOM   5533  C  CA  . VAL A 1 52 ? -3.970  6.104   -4.055  1.00 0.00 ? 52 VAL A CA  8  
ATOM   5534  C  C   . VAL A 1 52 ? -3.216  7.405   -4.052  1.00 0.00 ? 52 VAL A C   8  
ATOM   5535  O  O   . VAL A 1 52 ? -2.967  7.990   -5.134  1.00 0.00 ? 52 VAL A O   8  
ATOM   5536  C  CB  . VAL A 1 52 ? -3.052  4.883   -4.474  1.00 0.00 ? 52 VAL A CB  8  
ATOM   5537  C  CG1 . VAL A 1 52 ? -1.953  5.158   -5.534  1.00 0.00 ? 52 VAL A CG1 8  
ATOM   5538  C  CG2 . VAL A 1 52 ? -2.316  4.230   -3.273  1.00 0.00 ? 52 VAL A CG2 8  
ATOM   5539  N  N   . SER A 1 53 ? -2.808  8.003   -2.763  1.00 0.00 ? 53 SER A N   8  
ATOM   5540  C  CA  . SER A 1 53 ? -2.197  9.330   -2.680  1.00 0.00 ? 53 SER A CA  8  
ATOM   5541  C  C   . SER A 1 53 ? -0.765  9.233   -2.212  1.00 0.00 ? 53 SER A C   8  
ATOM   5542  O  O   . SER A 1 53 ? -0.460  8.643   -1.166  1.00 0.00 ? 53 SER A O   8  
ATOM   5543  C  CB  . SER A 1 53 ? -3.035  10.279  -1.789  1.00 0.00 ? 53 SER A CB  8  
ATOM   5544  O  OG  . SER A 1 53 ? -2.446  11.578  -1.653  1.00 0.00 ? 53 SER A OG  8  
ATOM   5545  N  N   . PHE A 1 54 ? 0.252   9.914   -3.045  1.00 0.00 ? 54 PHE A N   8  
ATOM   5546  C  CA  . PHE A 1 54 ? 1.681   9.747   -2.804  1.00 0.00 ? 54 PHE A CA  8  
ATOM   5547  C  C   . PHE A 1 54 ? 2.283   10.922  -2.069  1.00 0.00 ? 54 PHE A C   8  
ATOM   5548  O  O   . PHE A 1 54 ? 1.998   12.098  -2.331  1.00 0.00 ? 54 PHE A O   8  
ATOM   5549  C  CB  . PHE A 1 54 ? 2.435   9.559   -4.155  1.00 0.00 ? 54 PHE A CB  8  
ATOM   5550  C  CG  . PHE A 1 54 ? 1.940   8.436   -5.080  1.00 0.00 ? 54 PHE A CG  8  
ATOM   5551  C  CD1 . PHE A 1 54 ? 2.462   7.144   -4.979  1.00 0.00 ? 54 PHE A CD1 8  
ATOM   5552  C  CD2 . PHE A 1 54 ? 0.965   8.712   -6.045  1.00 0.00 ? 54 PHE A CD2 8  
ATOM   5553  C  CE1 . PHE A 1 54 ? 2.009   6.139   -5.830  1.00 0.00 ? 54 PHE A CE1 8  
ATOM   5554  C  CE2 . PHE A 1 54 ? 0.513   7.708   -6.894  1.00 0.00 ? 54 PHE A CE2 8  
ATOM   5555  C  CZ  . PHE A 1 54 ? 1.036   6.421   -6.787  1.00 0.00 ? 54 PHE A CZ  8  
ATOM   5556  N  N   . TYR A 1 55 ? 3.263   10.585  -1.014  1.00 0.00 ? 55 TYR A N   8  
ATOM   5557  C  CA  . TYR A 1 55 ? 4.055   11.565  -0.268  1.00 0.00 ? 55 TYR A CA  8  
ATOM   5558  C  C   . TYR A 1 55 ? 5.528   11.237  -0.363  1.00 0.00 ? 55 TYR A C   8  
ATOM   5559  O  O   . TYR A 1 55 ? 5.904   10.122  -0.811  1.00 0.00 ? 55 TYR A O   8  
ATOM   5560  C  CB  . TYR A 1 55 ? 3.659   11.504  1.239   1.00 0.00 ? 55 TYR A CB  8  
ATOM   5561  C  CG  . TYR A 1 55 ? 2.184   11.164  1.537   1.00 0.00 ? 55 TYR A CG  8  
ATOM   5562  C  CD1 . TYR A 1 55 ? 1.197   12.091  1.152   1.00 0.00 ? 55 TYR A CD1 8  
ATOM   5563  C  CD2 . TYR A 1 55 ? 1.806   9.990   2.186   1.00 0.00 ? 55 TYR A CD2 8  
ATOM   5564  C  CE1 . TYR A 1 55 ? -0.144  11.833  1.422   1.00 0.00 ? 55 TYR A CE1 8  
ATOM   5565  C  CE2 . TYR A 1 55 ? 0.463   9.738   2.453   1.00 0.00 ? 55 TYR A CE2 8  
ATOM   5566  C  CZ  . TYR A 1 55 ? -0.508  10.660  2.075   1.00 0.00 ? 55 TYR A CZ  8  
ATOM   5567  O  OH  . TYR A 1 55 ? -1.826  10.419  2.345   1.00 0.00 ? 55 TYR A OH  8  
ATOM   5568  N  N   . ALA A 1 56 ? 6.546   12.239  0.021   1.00 0.00 ? 56 ALA A N   8  
ATOM   5569  C  CA  . ALA A 1 56 ? 7.969   11.919  0.150   1.00 0.00 ? 56 ALA A CA  8  
ATOM   5570  C  C   . ALA A 1 56 ? 8.292   11.230  1.454   1.00 0.00 ? 56 ALA A C   8  
ATOM   5571  O  O   . ALA A 1 56 ? 9.258   10.441  1.536   1.00 0.00 ? 56 ALA A O   8  
ATOM   5572  C  CB  . ALA A 1 56 ? 8.760   13.228  -0.037  1.00 0.00 ? 56 ALA A CB  8  
ATOM   5573  N  N   . ASN A 1 57 ? 7.466   11.543  2.642   1.00 0.00 ? 57 ASN A N   8  
ATOM   5574  C  CA  . ASN A 1 57 ? 7.616   10.814  3.898   1.00 0.00 ? 57 ASN A CA  8  
ATOM   5575  C  C   . ASN A 1 57 ? 6.308   10.710  4.647   1.00 0.00 ? 57 ASN A C   8  
ATOM   5576  O  O   . ASN A 1 57 ? 5.387   11.520  4.475   1.00 0.00 ? 57 ASN A O   8  
ATOM   5577  C  CB  . ASN A 1 57 ? 8.700   11.496  4.783   1.00 0.00 ? 57 ASN A CB  8  
ATOM   5578  C  CG  . ASN A 1 57 ? 8.927   10.905  6.179   1.00 0.00 ? 57 ASN A CG  8  
ATOM   5579  O  OD1 . ASN A 1 57 ? 8.708   11.537  7.202   1.00 0.00 ? 57 ASN A OD1 8  
ATOM   5580  N  ND2 . ASN A 1 57 ? 9.358   9.677   6.278   1.00 0.00 ? 57 ASN A ND2 8  
ATOM   5581  N  N   . ALA A 1 58 ? 6.207   9.604   5.628   1.00 0.00 ? 58 ALA A N   8  
ATOM   5582  C  CA  . ALA A 1 58 ? 5.002   9.364   6.414   1.00 0.00 ? 58 ALA A CA  8  
ATOM   5583  C  C   . ALA A 1 58 ? 4.788   10.436  7.455   1.00 0.00 ? 58 ALA A C   8  
ATOM   5584  O  O   . ALA A 1 58 ? 3.827   10.384  8.244   1.00 0.00 ? 58 ALA A O   8  
ATOM   5585  C  CB  . ALA A 1 58 ? 5.117   7.956   7.029   1.00 0.00 ? 58 ALA A CB  8  
ATOM   5586  N  N   . SER A 1 59 ? 5.783   11.528  7.528   1.00 0.00 ? 59 SER A N   8  
ATOM   5587  C  CA  . SER A 1 59 ? 5.578   12.697  8.380   1.00 0.00 ? 59 SER A CA  8  
ATOM   5588  C  C   . SER A 1 59 ? 4.312   13.427  7.994   1.00 0.00 ? 59 SER A C   8  
ATOM   5589  O  O   . SER A 1 59 ? 3.463   13.758  8.832   1.00 0.00 ? 59 SER A O   8  
ATOM   5590  C  CB  . SER A 1 59 ? 6.807   13.638  8.348   1.00 0.00 ? 59 SER A CB  8  
ATOM   5591  O  OG  . SER A 1 59 ? 6.984   14.369  9.566   1.00 0.00 ? 59 SER A OG  8  
ATOM   5592  N  N   . GLU A 1 60 ? 4.168   13.760  6.557   1.00 0.00 ? 60 GLU A N   8  
ATOM   5593  C  CA  . GLU A 1 60 ? 2.979   14.402  6.013   1.00 0.00 ? 60 GLU A CA  8  
ATOM   5594  C  C   . GLU A 1 60 ? 1.767   13.504  5.951   1.00 0.00 ? 60 GLU A C   8  
ATOM   5595  O  O   . GLU A 1 60 ? 0.622   13.982  6.126   1.00 0.00 ? 60 GLU A O   8  
ATOM   5596  C  CB  . GLU A 1 60 ? 3.326   14.954  4.596   1.00 0.00 ? 60 GLU A CB  8  
ATOM   5597  C  CG  . GLU A 1 60 ? 3.970   13.947  3.591   1.00 0.00 ? 60 GLU A CG  8  
ATOM   5598  C  CD  . GLU A 1 60 ? 4.946   14.481  2.541   1.00 0.00 ? 60 GLU A CD  8  
ATOM   5599  O  OE1 . GLU A 1 60 ? 6.144   14.620  2.754   1.00 0.00 ? 60 GLU A OE1 8  
ATOM   5600  O  OE2 . GLU A 1 60 ? 4.359   14.787  1.351   1.00 0.00 ? 60 GLU A OE2 8  
ATOM   5601  N  N   . ALA A 1 61 ? 1.944   12.071  5.631   1.00 0.00 ? 61 ALA A N   8  
ATOM   5602  C  CA  . ALA A 1 61 ? 0.842   11.119  5.717   1.00 0.00 ? 61 ALA A CA  8  
ATOM   5603  C  C   . ALA A 1 61 ? 0.236   11.015  7.097   1.00 0.00 ? 61 ALA A C   8  
ATOM   5604  O  O   . ALA A 1 61 ? -0.999  10.889  7.237   1.00 0.00 ? 61 ALA A O   8  
ATOM   5605  C  CB  . ALA A 1 61 ? 1.342   9.764   5.189   1.00 0.00 ? 61 ALA A CB  8  
ATOM   5606  N  N   . LEU A 1 62 ? 1.142   11.010  8.264   1.00 0.00 ? 62 LEU A N   8  
ATOM   5607  C  CA  . LEU A 1 62 ? 0.630   10.959  9.638   1.00 0.00 ? 62 LEU A CA  8  
ATOM   5608  C  C   . LEU A 1 62 ? 0.036   12.293  10.023  1.00 0.00 ? 62 LEU A C   8  
ATOM   5609  O  O   . LEU A 1 62 ? -1.091  12.391  10.526  1.00 0.00 ? 62 LEU A O   8  
ATOM   5610  C  CB  . LEU A 1 62 ? 1.760   10.537  10.615  1.00 0.00 ? 62 LEU A CB  8  
ATOM   5611  C  CG  . LEU A 1 62 ? 1.425   9.655   11.849  1.00 0.00 ? 62 LEU A CG  8  
ATOM   5612  C  CD1 . LEU A 1 62 ? 0.006   9.080   11.737  1.00 0.00 ? 62 LEU A CD1 8  
ATOM   5613  C  CD2 . LEU A 1 62 ? 2.432   8.509   12.047  1.00 0.00 ? 62 LEU A CD2 8  
ATOM   5614  N  N   . ALA A 1 63 ? 0.900   13.474  9.802   1.00 0.00 ? 63 ALA A N   8  
ATOM   5615  C  CA  . ALA A 1 63 ? 0.412   14.842  9.950   1.00 0.00 ? 63 ALA A CA  8  
ATOM   5616  C  C   . ALA A 1 63 ? -0.830  15.066  9.120   1.00 0.00 ? 63 ALA A C   8  
ATOM   5617  O  O   . ALA A 1 63 ? -1.648  15.955  9.399   1.00 0.00 ? 63 ALA A O   8  
ATOM   5618  C  CB  . ALA A 1 63 ? 1.558   15.799  9.575   1.00 0.00 ? 63 ALA A CB  8  
ATOM   5619  N  N   . ALA A 1 64 ? -1.040  14.146  7.979   1.00 0.00 ? 64 ALA A N   8  
ATOM   5620  C  CA  . ALA A 1 64 ? -2.279  14.147  7.206   1.00 0.00 ? 64 ALA A CA  8  
ATOM   5621  C  C   . ALA A 1 64 ? -3.416  13.651  8.085   1.00 0.00 ? 64 ALA A C   8  
ATOM   5622  O  O   . ALA A 1 64 ? -4.545  14.155  8.068   1.00 0.00 ? 64 ALA A O   8  
ATOM   5623  C  CB  . ALA A 1 64 ? -2.068  13.265  5.967   1.00 0.00 ? 64 ALA A CB  8  
ATOM   5624  N  N   . GLY A 1 65 ? -3.051  12.526  8.983   1.00 0.00 ? 65 GLY A N   8  
ATOM   5625  C  CA  . GLY A 1 65 ? -3.970  12.018  9.997   1.00 0.00 ? 65 GLY A CA  8  
ATOM   5626  C  C   . GLY A 1 65 ? -4.504  10.662  9.560   1.00 0.00 ? 65 GLY A C   8  
ATOM   5627  O  O   . GLY A 1 65 ? -5.632  10.253  9.862   1.00 0.00 ? 65 GLY A O   8  
ATOM   5628  N  N   . PHE A 1 66 ? -3.581  9.882   8.708   1.00 0.00 ? 66 PHE A N   8  
ATOM   5629  C  CA  . PHE A 1 66 ? -3.966  8.641   8.043   1.00 0.00 ? 66 PHE A CA  8  
ATOM   5630  C  C   . PHE A 1 66 ? -3.440  7.429   8.768   1.00 0.00 ? 66 PHE A C   8  
ATOM   5631  O  O   . PHE A 1 66 ? -2.840  7.550   9.866   1.00 0.00 ? 66 PHE A O   8  
ATOM   5632  C  CB  . PHE A 1 66 ? -3.431  8.670   6.574   1.00 0.00 ? 66 PHE A CB  8  
ATOM   5633  C  CG  . PHE A 1 66 ? -4.192  7.790   5.573   1.00 0.00 ? 66 PHE A CG  8  
ATOM   5634  C  CD1 . PHE A 1 66 ? -5.502  7.391   5.877   1.00 0.00 ? 66 PHE A CD1 8  
ATOM   5635  C  CD2 . PHE A 1 66 ? -3.604  7.373   4.378   1.00 0.00 ? 66 PHE A CD2 8  
ATOM   5636  C  CE1 . PHE A 1 66 ? -6.209  6.581   4.996   1.00 0.00 ? 66 PHE A CE1 8  
ATOM   5637  C  CE2 . PHE A 1 66 ? -4.314  6.561   3.497   1.00 0.00 ? 66 PHE A CE2 8  
ATOM   5638  C  CZ  . PHE A 1 66 ? -5.613  6.164   3.808   1.00 0.00 ? 66 PHE A CZ  8  
ATOM   5639  N  N   . ARG A 1 67 ? -3.622  6.093   8.159   1.00 0.00 ? 67 ARG A N   8  
ATOM   5640  C  CA  . ARG A 1 67 ? -3.299  4.867   8.890   1.00 0.00 ? 67 ARG A CA  8  
ATOM   5641  C  C   . ARG A 1 67 ? -1.905  4.372   8.586   1.00 0.00 ? 67 ARG A C   8  
ATOM   5642  O  O   . ARG A 1 67 ? -1.645  3.702   7.579   1.00 0.00 ? 67 ARG A O   8  
ATOM   5643  C  CB  . ARG A 1 67 ? -4.385  3.788   8.647   1.00 0.00 ? 67 ARG A CB  8  
ATOM   5644  C  CG  . ARG A 1 67 ? -4.643  2.847   9.858   1.00 0.00 ? 67 ARG A CG  8  
ATOM   5645  C  CD  . ARG A 1 67 ? -3.351  2.212   10.387  1.00 0.00 ? 67 ARG A CD  8  
ATOM   5646  N  NE  . ARG A 1 67 ? -3.201  2.569   11.821  1.00 0.00 ? 67 ARG A NE  8  
ATOM   5647  C  CZ  . ARG A 1 67 ? -3.522  1.790   12.845  1.00 0.00 ? 67 ARG A CZ  8  
ATOM   5648  N  NH1 . ARG A 1 67 ? -4.024  0.596   12.730  1.00 0.00 ? 67 ARG A NH1 8  
ATOM   5649  N  NH2 . ARG A 1 67 ? -3.321  2.252   14.028  1.00 0.00 ? 67 ARG A NH2 8  
ATOM   5650  N  N   . PRO A 1 68 ? -0.862  4.721   9.580   1.00 0.00 ? 68 PRO A N   8  
ATOM   5651  C  CA  . PRO A 1 68 ? 0.625   4.387   9.527   1.00 0.00 ? 68 PRO A CA  8  
ATOM   5652  C  C   . PRO A 1 68 ? 1.044   2.939   9.404   1.00 0.00 ? 68 PRO A C   8  
ATOM   5653  O  O   . PRO A 1 68 ? 0.858   2.150   10.362  1.00 0.00 ? 68 PRO A O   8  
ATOM   5654  C  CB  . PRO A 1 68 ? 1.240   4.912   10.838  1.00 0.00 ? 68 PRO A CB  8  
ATOM   5655  C  CG  . PRO A 1 68 ? 0.292   6.068   11.182  1.00 0.00 ? 68 PRO A CG  8  
ATOM   5656  C  CD  . PRO A 1 68 ? -1.088  5.496   10.836  1.00 0.00 ? 68 PRO A CD  8  
ATOM   5657  N  N   . CYS A 1 69 ? 1.636   2.450   8.140   1.00 0.00 ? 69 CYS A N   8  
ATOM   5658  C  CA  . CYS A 1 69 ? 2.277   1.150   8.020   1.00 0.00 ? 69 CYS A CA  8  
ATOM   5659  C  C   . CYS A 1 69 ? 3.739   1.308   7.630   1.00 0.00 ? 69 CYS A C   8  
ATOM   5660  O  O   . CYS A 1 69 ? 4.110   1.820   6.566   1.00 0.00 ? 69 CYS A O   8  
ATOM   5661  C  CB  . CYS A 1 69 ? 1.527   0.244   7.025   1.00 0.00 ? 69 CYS A CB  8  
ATOM   5662  S  SG  . CYS A 1 69 ? 2.694   -0.893  6.245   1.00 0.00 ? 69 CYS A SG  8  
ATOM   5663  N  N   . LYS A 1 70 ? 4.718   0.840   8.649   1.00 0.00 ? 70 LYS A N   8  
ATOM   5664  C  CA  . LYS A 1 70 ? 6.147   0.729   8.395   1.00 0.00 ? 70 LYS A CA  8  
ATOM   5665  C  C   . LYS A 1 70 ? 6.601   -0.709  8.583   1.00 0.00 ? 70 LYS A C   8  
ATOM   5666  O  O   . LYS A 1 70 ? 7.758   -1.004  8.905   1.00 0.00 ? 70 LYS A O   8  
ATOM   5667  C  CB  . LYS A 1 70 ? 6.936   1.685   9.327   1.00 0.00 ? 70 LYS A CB  8  
ATOM   5668  C  CG  . LYS A 1 70 ? 6.925   3.159   8.848   1.00 0.00 ? 70 LYS A CG  8  
ATOM   5669  C  CD  . LYS A 1 70 ? 7.761   4.118   9.700   1.00 0.00 ? 70 LYS A CD  8  
ATOM   5670  C  CE  . LYS A 1 70 ? 9.251   3.853   9.445   1.00 0.00 ? 70 LYS A CE  8  
ATOM   5671  N  NZ  . LYS A 1 70 ? 9.832   3.164   10.611  1.00 0.00 ? 70 LYS A NZ  8  
ATOM   5672  N  N   . ARG A 1 71 ? 5.549   -1.734  8.390   1.00 0.00 ? 71 ARG A N   8  
ATOM   5673  C  CA  . ARG A 1 71 ? 5.757   -3.145  8.693   1.00 0.00 ? 71 ARG A CA  8  
ATOM   5674  C  C   . ARG A 1 71 ? 4.558   -3.969  8.272   1.00 0.00 ? 71 ARG A C   8  
ATOM   5675  O  O   . ARG A 1 71 ? 4.139   -4.889  8.986   1.00 0.00 ? 71 ARG A O   8  
ATOM   5676  C  CB  . ARG A 1 71 ? 6.037   -3.299  10.212  1.00 0.00 ? 71 ARG A CB  8  
ATOM   5677  C  CG  . ARG A 1 71 ? 6.561   -4.694  10.648  1.00 0.00 ? 71 ARG A CG  8  
ATOM   5678  C  CD  . ARG A 1 71 ? 7.344   -4.640  11.967  1.00 0.00 ? 71 ARG A CD  8  
ATOM   5679  N  NE  . ARG A 1 71 ? 8.641   -3.962  11.713  1.00 0.00 ? 71 ARG A NE  8  
ATOM   5680  C  CZ  . ARG A 1 71 ? 9.747   -4.122  12.426  1.00 0.00 ? 71 ARG A CZ  8  
ATOM   5681  N  NH1 . ARG A 1 71 ? 9.845   -4.902  13.463  1.00 0.00 ? 71 ARG A NH1 8  
ATOM   5682  N  NH2 . ARG A 1 71 ? 10.788  -3.461  12.064  1.00 0.00 ? 71 ARG A NH2 8  
ATOM   5683  N  N   . CYS A 1 72 ? 3.993   -3.707  6.927   1.00 0.00 ? 72 CYS A N   8  
ATOM   5684  C  CA  . CYS A 1 72 ? 2.723   -4.230  6.376   1.00 0.00 ? 72 CYS A CA  8  
ATOM   5685  C  C   . CYS A 1 72 ? 2.008   -4.955  7.498   1.00 0.00 ? 72 CYS A C   8  
ATOM   5686  O  O   . CYS A 1 72 ? 1.566   -6.100  7.568   1.00 0.00 ? 72 CYS A O   8  
ATOM   5687  C  CB  . CYS A 1 72 ? 3.060   -4.945  5.061   1.00 0.00 ? 72 CYS A CB  8  
ATOM   5688  S  SG  . CYS A 1 72 ? 3.679   -3.667  3.881   1.00 0.00 ? 72 CYS A SG  8  
ATOM   5689  N  N   . GLN A 1 73 ? 1.821   -4.002  8.673   1.00 0.00 ? 73 GLN A N   8  
ATOM   5690  C  CA  . GLN A 1 73 ? 1.064   -4.279  9.890   1.00 0.00 ? 73 GLN A CA  8  
ATOM   5691  C  C   . GLN A 1 73 ? -0.231  -5.013  9.719   1.00 0.00 ? 73 GLN A C   8  
ATOM   5692  O  O   . GLN A 1 73 ? -0.467  -6.076  10.334  1.00 0.00 ? 73 GLN A O   8  
ATOM   5693  C  CB  . GLN A 1 73 ? 0.783   -2.888  10.582  1.00 0.00 ? 73 GLN A CB  8  
ATOM   5694  C  CG  . GLN A 1 73 ? 0.267   -2.976  12.054  1.00 0.00 ? 73 GLN A CG  8  
ATOM   5695  C  CD  . GLN A 1 73 ? -1.224  -2.751  12.339  1.00 0.00 ? 73 GLN A CD  8  
ATOM   5696  O  OE1 . GLN A 1 73 ? -2.081  -3.146  11.566  1.00 0.00 ? 73 GLN A OE1 8  
ATOM   5697  N  NE2 . GLN A 1 73 ? -1.591  -2.102  13.415  1.00 0.00 ? 73 GLN A NE2 8  
ATOM   5698  N  N   . PRO A 1 74 ? -1.207  -4.443  8.774   1.00 0.00 ? 74 PRO A N   8  
ATOM   5699  C  CA  . PRO A 1 74 ? -2.607  -4.997  8.460   1.00 0.00 ? 74 PRO A CA  8  
ATOM   5700  C  C   . PRO A 1 74 ? -2.772  -6.488  8.627   1.00 0.00 ? 74 PRO A C   8  
ATOM   5701  O  O   . PRO A 1 74 ? -2.666  -7.273  7.675   1.00 0.00 ? 74 PRO A O   8  
ATOM   5702  C  CB  . PRO A 1 74 ? -2.852  -4.593  7.007   1.00 0.00 ? 74 PRO A CB  8  
ATOM   5703  C  CG  . PRO A 1 74 ? -2.271  -3.170  7.019   1.00 0.00 ? 74 PRO A CG  8  
ATOM   5704  C  CD  . PRO A 1 74 ? -1.046  -3.230  7.939   1.00 0.00 ? 74 PRO A CD  8  
ATOM   5705  N  N   . ASP A 1 75 ? -3.106  -6.961  9.992   1.00 0.00 ? 75 ASP A N   8  
ATOM   5706  C  CA  . ASP A 1 75 ? -3.266  -8.372  10.326  1.00 0.00 ? 75 ASP A CA  8  
ATOM   5707  C  C   . ASP A 1 75 ? -4.251  -8.554  11.458  1.00 0.00 ? 75 ASP A C   8  
ATOM   5708  O  O   . ASP A 1 75 ? -3.882  -8.882  12.598  1.00 0.00 ? 75 ASP A O   8  
ATOM   5709  C  CB  . ASP A 1 75 ? -1.889  -9.006  10.659  1.00 0.00 ? 75 ASP A CB  8  
ATOM   5710  C  CG  . ASP A 1 75 ? -1.423  -10.165 9.765   1.00 0.00 ? 75 ASP A CG  8  
ATOM   5711  O  OD1 . ASP A 1 75 ? -2.459  -10.931 9.307   1.00 0.00 ? 75 ASP A OD1 8  
ATOM   5712  O  OD2 . ASP A 1 75 ? -0.246  -10.383 9.516   1.00 0.00 ? 75 ASP A OD2 8  
ATOM   5713  N  N   . LYS A 1 76 ? -5.676  -8.297  11.153  1.00 0.00 ? 76 LYS A N   8  
ATOM   5714  C  CA  . LYS A 1 76 ? -6.697  -8.292  12.196  1.00 0.00 ? 76 LYS A CA  8  
ATOM   5715  C  C   . LYS A 1 76 ? -7.361  -9.645  12.320  1.00 0.00 ? 76 LYS A C   8  
ATOM   5716  O  O   . LYS A 1 76 ? -8.026  -9.951  13.318  1.00 0.00 ? 76 LYS A O   8  
ATOM   5717  C  CB  . LYS A 1 76 ? -7.746  -7.187  11.894  1.00 0.00 ? 76 LYS A CB  8  
ATOM   5718  C  CG  . LYS A 1 76 ? -7.559  -5.910  12.751  1.00 0.00 ? 76 LYS A CG  8  
ATOM   5719  C  CD  . LYS A 1 76 ? -8.303  -5.916  14.089  1.00 0.00 ? 76 LYS A CD  8  
ATOM   5720  C  CE  . LYS A 1 76 ? -8.734  -4.484  14.435  1.00 0.00 ? 76 LYS A CE  8  
ATOM   5721  N  NZ  . LYS A 1 76 ? -9.059  -4.403  15.870  1.00 0.00 ? 76 LYS A NZ  8  
ATOM   5722  N  N   . ALA A 1 77 ? -7.211  -10.557 11.168  1.00 0.00 ? 77 ALA A N   8  
ATOM   5723  C  CA  . ALA A 1 77 ? -7.631  -11.955 11.171  1.00 0.00 ? 77 ALA A CA  8  
ATOM   5724  C  C   . ALA A 1 77 ? -7.802  -12.537 12.551  1.00 0.00 ? 77 ALA A C   8  
ATOM   5725  O  O   . ALA A 1 77 ? -8.919  -12.828 13.004  1.00 0.00 ? 77 ALA A O   8  
ATOM   5726  C  CB  . ALA A 1 77 ? -6.601  -12.740 10.326  1.00 0.00 ? 77 ALA A CB  8  
ATOM   5727  N  N   . ASN A 1 78 ? -6.563  -12.781 13.323  1.00 0.00 ? 78 ASN A N   8  
ATOM   5728  C  CA  . ASN A 1 78 ? -6.590  -13.372 14.657  1.00 0.00 ? 78 ASN A CA  8  
ATOM   5729  C  C   . ASN A 1 78 ? -5.193  -13.656 15.154  1.00 0.00 ? 78 ASN A C   8  
ATOM   5730  O  O   . ASN A 1 78 ? -4.718  -14.799 15.178  1.00 0.00 ? 78 ASN A O   8  
ATOM   5731  C  CB  . ASN A 1 78 ? -7.454  -14.666 14.634  1.00 0.00 ? 78 ASN A CB  8  
ATOM   5732  C  CG  . ASN A 1 78 ? -8.793  -14.620 15.381  1.00 0.00 ? 78 ASN A CG  8  
ATOM   5733  O  OD1 . ASN A 1 78 ? -8.894  -14.173 16.513  1.00 0.00 ? 78 ASN A OD1 8  
ATOM   5734  N  ND2 . ASN A 1 78 ? -9.857  -15.090 14.789  1.00 0.00 ? 78 ASN A ND2 8  
ATOM   5735  N  N   . PRO A 1 79 ? -4.409  -12.478 15.586  1.00 0.00 ? 79 PRO A N   8  
ATOM   5736  C  CA  . PRO A 1 79 ? -2.984  -12.492 16.143  1.00 0.00 ? 79 PRO A CA  8  
ATOM   5737  C  C   . PRO A 1 79 ? -2.848  -13.119 17.517  1.00 0.00 ? 79 PRO A C   8  
ATOM   5738  O  O   . PRO A 1 79 ? -3.840  -13.395 18.205  1.00 0.00 ? 79 PRO A O   8  
ATOM   5739  C  CB  . PRO A 1 79 ? -2.537  -11.038 16.233  1.00 0.00 ? 79 PRO A CB  8  
ATOM   5740  C  CG  . PRO A 1 79 ? -3.876  -10.329 16.494  1.00 0.00 ? 79 PRO A CG  8  
ATOM   5741  C  CD  . PRO A 1 79 ? -4.852  -11.063 15.565  1.00 0.00 ? 79 PRO A CD  8  
ATOM   5742  N  N   . ARG A 1 80 ? -1.470  -13.412 17.966  1.00 0.00 ? 80 ARG A N   8  
ATOM   5743  C  CA  . ARG A 1 80 ? -1.180  -13.900 19.311  1.00 0.00 ? 80 ARG A CA  8  
ATOM   5744  C  C   . ARG A 1 80 ? -1.848  -15.232 19.558  1.00 0.00 ? 80 ARG A C   8  
ATOM   5745  O  O   . ARG A 1 80 ? -2.845  -15.337 20.286  1.00 0.00 ? 80 ARG A O   8  
ATOM   5746  C  CB  . ARG A 1 80 ? -1.638  -12.835 20.344  1.00 0.00 ? 80 ARG A CB  8  
ATOM   5747  C  CG  . ARG A 1 80 ? -0.924  -11.462 20.228  1.00 0.00 ? 80 ARG A CG  8  
ATOM   5748  C  CD  . ARG A 1 80 ? -1.557  -10.392 21.126  1.00 0.00 ? 80 ARG A CD  8  
ATOM   5749  N  NE  . ARG A 1 80 ? -0.945  -9.080  20.792  1.00 0.00 ? 80 ARG A NE  8  
ATOM   5750  C  CZ  . ARG A 1 80 ? -0.854  -8.042  21.612  1.00 0.00 ? 80 ARG A CZ  8  
ATOM   5751  N  NH1 . ARG A 1 80 ? -1.299  -8.031  22.834  1.00 0.00 ? 80 ARG A NH1 8  
ATOM   5752  N  NH2 . ARG A 1 80 ? -0.286  -6.979  21.163  1.00 0.00 ? 80 ARG A NH2 8  
ATOM   5753  N  N   . GLN A 1 81 ? -1.228  -16.407 18.908  1.00 0.00 ? 81 GLN A N   8  
ATOM   5754  C  CA  . GLN A 1 81 ? -1.748  -17.759 19.092  1.00 0.00 ? 81 GLN A CA  8  
ATOM   5755  C  C   . GLN A 1 81 ? -2.058  -18.026 20.546  1.00 0.00 ? 81 GLN A C   8  
ATOM   5756  O  O   . GLN A 1 81 ? -3.219  -18.193 20.945  1.00 0.00 ? 81 GLN A O   8  
ATOM   5757  C  CB  . GLN A 1 81 ? -0.710  -18.767 18.553  1.00 0.00 ? 81 GLN A CB  8  
ATOM   5758  C  CG  . GLN A 1 81 ? -0.650  -18.934 16.999  1.00 0.00 ? 81 GLN A CG  8  
ATOM   5759  C  CD  . GLN A 1 81 ? -0.629  -17.683 16.112  1.00 0.00 ? 81 GLN A CD  8  
ATOM   5760  O  OE1 . GLN A 1 81 ? 0.416   -17.258 15.644  1.00 0.00 ? 81 GLN A OE1 8  
ATOM   5761  N  NE2 . GLN A 1 81 ? -1.744  -17.054 15.844  1.00 0.00 ? 81 GLN A NE2 8  
ATOM   5762  N  N   . HIS A 1 82 ? -0.898  -18.115 21.458  1.00 0.00 ? 82 HIS A N   8  
ATOM   5763  C  CA  . HIS A 1 82 ? -1.049  -18.433 22.875  1.00 0.00 ? 82 HIS A CA  8  
ATOM   5764  C  C   . HIS A 1 82 ? 0.292   -18.446 23.572  1.00 0.00 ? 82 HIS A C   8  
ATOM   5765  O  O   . HIS A 1 82 ? 1.248   -17.776 23.159  1.00 0.00 ? 82 HIS A O   8  
ATOM   5766  C  CB  . HIS A 1 82 ? -1.699  -19.825 22.939  1.00 0.00 ? 82 HIS A CB  8  
ATOM   5767  C  CG  . HIS A 1 82 ? -2.782  -19.901 23.976  1.00 0.00 ? 82 HIS A CG  8  
ATOM   5768  N  ND1 . HIS A 1 82 ? -2.680  -20.525 25.216  1.00 0.00 ? 82 HIS A ND1 8  
ATOM   5769  C  CD2 . HIS A 1 82 ? -4.036  -19.336 23.793  1.00 0.00 ? 82 HIS A CD2 8  
ATOM   5770  C  CE1 . HIS A 1 82 ? -3.913  -20.282 25.698  1.00 0.00 ? 82 HIS A CE1 8  
ATOM   5771  N  NE2 . HIS A 1 82 ? -4.781  -19.583 24.917  1.00 0.00 ? 82 HIS A NE2 8  
ATOM   5772  N  N   . ARG A 1 83 ? 0.398   -19.305 24.771  1.00 0.00 ? 83 ARG A N   8  
ATOM   5773  C  CA  . ARG A 1 83 ? 1.636   -19.415 25.537  1.00 0.00 ? 83 ARG A CA  8  
ATOM   5774  C  C   . ARG A 1 83 ? 2.703   -20.130 24.740  1.00 0.00 ? 83 ARG A C   8  
ATOM   5775  O  O   . ARG A 1 83 ? 2.591   -21.323 24.426  1.00 0.00 ? 83 ARG A O   8  
ATOM   5776  C  CB  . ARG A 1 83 ? 1.339   -20.149 26.873  1.00 0.00 ? 83 ARG A CB  8  
ATOM   5777  C  CG  . ARG A 1 83 ? 0.461   -21.421 26.740  1.00 0.00 ? 83 ARG A CG  8  
ATOM   5778  C  CD  . ARG A 1 83 ? 0.867   -22.522 27.728  1.00 0.00 ? 83 ARG A CD  8  
ATOM   5779  N  NE  . ARG A 1 83 ? -0.355  -23.266 28.127  1.00 0.00 ? 83 ARG A NE  8  
ATOM   5780  C  CZ  . ARG A 1 83 ? -0.377  -24.468 28.686  1.00 0.00 ? 83 ARG A CZ  8  
ATOM   5781  N  NH1 . ARG A 1 83 ? 0.684   -25.167 28.965  1.00 0.00 ? 83 ARG A NH1 8  
ATOM   5782  N  NH2 . ARG A 1 83 ? -1.526  -24.971 28.967  1.00 0.00 ? 83 ARG A NH2 8  
ATOM   5783  N  N   . LEU A 1 84 ? 3.891   -19.331 24.370  1.00 0.00 ? 84 LEU A N   8  
ATOM   5784  C  CA  . LEU A 1 84 ? 4.988   -19.892 23.587  1.00 0.00 ? 84 LEU A CA  8  
ATOM   5785  C  C   . LEU A 1 84 ? 6.324   -19.443 24.129  1.00 0.00 ? 84 LEU A C   8  
ATOM   5786  O  O   . LEU A 1 84 ? 7.319   -19.326 23.401  1.00 0.00 ? 84 LEU A O   8  
ATOM   5787  C  CB  . LEU A 1 84 ? 4.840   -19.510 22.087  1.00 0.00 ? 84 LEU A CB  8  
ATOM   5788  C  CG  . LEU A 1 84 ? 5.214   -18.065 21.660  1.00 0.00 ? 84 LEU A CG  8  
ATOM   5789  C  CD1 . LEU A 1 84 ? 5.946   -18.087 20.310  1.00 0.00 ? 84 LEU A CD1 8  
ATOM   5790  C  CD2 . LEU A 1 84 ? 3.991   -17.137 21.571  1.00 0.00 ? 84 LEU A CD2 8  
ATOM   5791  N  N   . ASP A 1 85 ? 6.372   -19.129 25.576  1.00 0.00 ? 85 ASP A N   8  
ATOM   5792  C  CA  . ASP A 1 85 ? 7.584   -18.622 26.212  1.00 0.00 ? 85 ASP A CA  8  
ATOM   5793  C  C   . ASP A 1 85 ? 7.936   -17.250 25.688  1.00 0.00 ? 85 ASP A C   8  
ATOM   5794  O  O   . ASP A 1 85 ? 8.655   -17.097 24.691  1.00 0.00 ? 85 ASP A O   8  
ATOM   5795  C  CB  . ASP A 1 85 ? 8.750   -19.627 26.024  1.00 0.00 ? 85 ASP A CB  8  
ATOM   5796  C  CG  . ASP A 1 85 ? 9.885   -19.568 27.056  1.00 0.00 ? 85 ASP A CG  8  
ATOM   5797  O  OD1 . ASP A 1 85 ? 9.469   -19.111 28.276  1.00 0.00 ? 85 ASP A OD1 8  
ATOM   5798  O  OD2 . ASP A 1 85 ? 11.036  -19.891 26.801  1.00 0.00 ? 85 ASP A OD2 8  
ATOM   5799  N  N   . LYS A 1 86 ? 7.383   -16.101 26.437  1.00 0.00 ? 86 LYS A N   8  
ATOM   5800  C  CA  . LYS A 1 86 ? 7.693   -14.720 26.077  1.00 0.00 ? 86 LYS A CA  8  
ATOM   5801  C  C   . LYS A 1 86 ? 8.995   -14.278 26.704  1.00 0.00 ? 86 LYS A C   8  
ATOM   5802  O  O   . LYS A 1 86 ? 10.048  -14.229 26.054  1.00 0.00 ? 86 LYS A O   8  
ATOM   5803  C  CB  . LYS A 1 86 ? 6.524   -13.796 26.514  1.00 0.00 ? 86 LYS A CB  8  
ATOM   5804  C  CG  . LYS A 1 86 ? 5.279   -13.902 25.597  1.00 0.00 ? 86 LYS A CG  8  
ATOM   5805  C  CD  . LYS A 1 86 ? 5.585   -14.208 24.129  1.00 0.00 ? 86 LYS A CD  8  
ATOM   5806  C  CE  . LYS A 1 86 ? 6.406   -13.058 23.532  1.00 0.00 ? 86 LYS A CE  8  
ATOM   5807  N  NZ  . LYS A 1 86 ? 5.525   -12.193 22.728  1.00 0.00 ? 86 LYS A NZ  8  
ATOM   5808  N  N   . ILE A 1 87 ? 8.935   -13.883 28.128  1.00 0.00 ? 87 ILE A N   8  
ATOM   5809  C  CA  . ILE A 1 87 ? 10.130  -13.506 28.877  1.00 0.00 ? 87 ILE A CA  8  
ATOM   5810  C  C   . ILE A 1 87 ? 10.230  -14.285 30.168  1.00 0.00 ? 87 ILE A C   8  
ATOM   5811  O  O   . ILE A 1 87 ? 9.372   -15.116 30.499  1.00 0.00 ? 87 ILE A O   8  
ATOM   5812  C  CB  . ILE A 1 87 ? 10.185  -11.944 29.128  1.00 0.00 ? 87 ILE A CB  8  
ATOM   5813  C  CG1 . ILE A 1 87 ? 8.818   -11.299 29.524  1.00 0.00 ? 87 ILE A CG1 8  
ATOM   5814  C  CG2 . ILE A 1 87 ? 10.757  -11.156 27.909  1.00 0.00 ? 87 ILE A CG2 8  
ATOM   5815  C  CD1 . ILE A 1 87 ? 8.885   -9.852  30.055  1.00 0.00 ? 87 ILE A CD1 8  
ATOM   5816  N  N   . THR A 1 88 ? 11.406  -13.996 31.017  1.00 0.00 ? 88 THR A N   8  
ATOM   5817  C  CA  . THR A 1 88 ? 11.611  -14.654 32.304  1.00 0.00 ? 88 THR A CA  8  
ATOM   5818  C  C   . THR A 1 88 ? 11.971  -13.650 33.374  1.00 0.00 ? 88 THR A C   8  
ATOM   5819  O  O   . THR A 1 88 ? 12.755  -13.927 34.292  1.00 0.00 ? 88 THR A O   8  
ATOM   5820  C  CB  . THR A 1 88 ? 12.713  -15.761 32.187  1.00 0.00 ? 88 THR A CB  8  
ATOM   5821  O  OG1 . THR A 1 88 ? 12.566  -16.721 33.225  1.00 0.00 ? 88 THR A OG1 8  
ATOM   5822  C  CG2 . THR A 1 88 ? 14.178  -15.286 32.304  1.00 0.00 ? 88 THR A CG2 8  
ATOM   5823  N  N   . HIS A 1 89 ? 11.307  -12.332 33.284  1.00 0.00 ? 89 HIS A N   8  
ATOM   5824  C  CA  . HIS A 1 89 ? 11.528  -11.282 34.277  1.00 0.00 ? 89 HIS A CA  8  
ATOM   5825  C  C   . HIS A 1 89 ? 10.214  -10.729 34.777  1.00 0.00 ? 89 HIS A C   8  
ATOM   5826  O  O   . HIS A 1 89 ? 9.131   -11.248 34.477  1.00 0.00 ? 89 HIS A O   8  
ATOM   5827  C  CB  . HIS A 1 89 ? 12.340  -10.183 33.572  1.00 0.00 ? 89 HIS A CB  8  
ATOM   5828  C  CG  . HIS A 1 89 ? 13.535  -9.754  34.372  1.00 0.00 ? 89 HIS A CG  8  
ATOM   5829  N  ND1 . HIS A 1 89 ? 14.213  -10.534 35.306  1.00 0.00 ? 89 HIS A ND1 8  
ATOM   5830  C  CD2 . HIS A 1 89 ? 14.104  -8.493  34.254  1.00 0.00 ? 89 HIS A CD2 8  
ATOM   5831  C  CE1 . HIS A 1 89 ? 15.165  -9.660  35.687  1.00 0.00 ? 89 HIS A CE1 8  
ATOM   5832  N  NE2 . HIS A 1 89 ? 15.171  -8.427  35.111  1.00 0.00 ? 89 HIS A NE2 8  
ATOM   5833  N  N   . ALA A 1 90 ? 10.297  -9.556  35.675  1.00 0.00 ? 90 ALA A N   8  
ATOM   5834  C  CA  . ALA A 1 90 ? 9.102   -8.893  36.191  1.00 0.00 ? 90 ALA A CA  8  
ATOM   5835  C  C   . ALA A 1 90 ? 8.272   -8.322  35.065  1.00 0.00 ? 90 ALA A C   8  
ATOM   5836  O  O   . ALA A 1 90 ? 8.619   -8.421  33.880  1.00 0.00 ? 90 ALA A O   8  
ATOM   5837  C  CB  . ALA A 1 90 ? 9.557   -7.823  37.198  1.00 0.00 ? 90 ALA A CB  8  
ATOM   5838  N  N   . CYS A 1 91 ? 7.003   -7.670  35.455  1.00 0.00 ? 91 CYS A N   8  
ATOM   5839  C  CA  . CYS A 1 91 ? 6.062   -7.154  34.465  1.00 0.00 ? 91 CYS A CA  8  
ATOM   5840  C  C   . CYS A 1 91 ? 5.568   -5.780  34.852  1.00 0.00 ? 91 CYS A C   8  
ATOM   5841  O  O   . CYS A 1 91 ? 4.469   -5.612  35.397  1.00 0.00 ? 91 CYS A O   8  
ATOM   5842  C  CB  . CYS A 1 91 ? 4.913   -8.169  34.303  1.00 0.00 ? 91 CYS A CB  8  
ATOM   5843  S  SG  . CYS A 1 91 ? 4.444   -8.864  35.903  1.00 0.00 ? 91 CYS A SG  8  
ATOM   5844  N  N   . ARG A 1 92 ? 6.475   -4.650  34.555  1.00 0.00 ? 92 ARG A N   8  
ATOM   5845  C  CA  . ARG A 1 92 ? 6.188   -3.289  35.001  1.00 0.00 ? 92 ARG A CA  8  
ATOM   5846  C  C   . ARG A 1 92 ? 6.946   -2.278  34.176  1.00 0.00 ? 92 ARG A C   8  
ATOM   5847  O  O   . ARG A 1 92 ? 6.434   -1.225  33.804  1.00 0.00 ? 92 ARG A O   8  
ATOM   5848  C  CB  . ARG A 1 92 ? 6.540   -3.169  36.509  1.00 0.00 ? 92 ARG A CB  8  
ATOM   5849  C  CG  . ARG A 1 92 ? 5.323   -3.216  37.471  1.00 0.00 ? 92 ARG A CG  8  
ATOM   5850  C  CD  . ARG A 1 92 ? 5.709   -2.910  38.924  1.00 0.00 ? 92 ARG A CD  8  
ATOM   5851  N  NE  . ARG A 1 92 ? 5.253   -1.534  39.248  1.00 0.00 ? 92 ARG A NE  8  
ATOM   5852  C  CZ  . ARG A 1 92 ? 5.093   -1.044  40.470  1.00 0.00 ? 92 ARG A CZ  8  
ATOM   5853  N  NH1 . ARG A 1 92 ? 5.319   -1.711  41.563  1.00 0.00 ? 92 ARG A NH1 8  
ATOM   5854  N  NH2 . ARG A 1 92 ? 4.689   0.172   40.573  1.00 0.00 ? 92 ARG A NH2 8  
ATOM   5855  O  OXT . ARG A 1 92 ? 8.299   -2.615  33.859  1.00 0.00 ? 92 ARG A OXT 8  
HETATM 5856  ZN ZN  . ZN  B 2 .  ? 2.266   -1.804  4.237   1.00 0.00 ? 93 ZN  A ZN  8  
ATOM   5857  N  N   . MET A 1 1  ? 17.929  23.245  -9.936  1.00 0.00 ? 1  MET A N   9  
ATOM   5858  C  CA  . MET A 1 1  ? 18.772  22.293  -9.217  1.00 0.00 ? 1  MET A CA  9  
ATOM   5859  C  C   . MET A 1 1  ? 18.971  21.031  -10.022 1.00 0.00 ? 1  MET A C   9  
ATOM   5860  O  O   . MET A 1 1  ? 18.729  19.911  -9.552  1.00 0.00 ? 1  MET A O   9  
ATOM   5861  C  CB  . MET A 1 1  ? 20.137  22.951  -8.873  1.00 0.00 ? 1  MET A CB  9  
ATOM   5862  C  CG  . MET A 1 1  ? 21.195  22.018  -8.248  1.00 0.00 ? 1  MET A CG  9  
ATOM   5863  S  SD  . MET A 1 1  ? 22.434  22.996  -7.381  1.00 0.00 ? 1  MET A SD  9  
ATOM   5864  C  CE  . MET A 1 1  ? 22.084  22.445  -5.706  1.00 0.00 ? 1  MET A CE  9  
ATOM   5865  N  N   . LYS A 1 2  ? 19.473  21.207  -11.404 1.00 0.00 ? 2  LYS A N   9  
ATOM   5866  C  CA  . LYS A 1 2  ? 19.716  20.070  -12.286 1.00 0.00 ? 2  LYS A CA  9  
ATOM   5867  C  C   . LYS A 1 2  ? 18.420  19.395  -12.669 1.00 0.00 ? 2  LYS A C   9  
ATOM   5868  O  O   . LYS A 1 2  ? 17.322  19.816  -12.281 1.00 0.00 ? 2  LYS A O   9  
ATOM   5869  C  CB  . LYS A 1 2  ? 20.676  19.069  -11.586 1.00 0.00 ? 2  LYS A CB  9  
ATOM   5870  C  CG  . LYS A 1 2  ? 21.670  18.386  -12.558 1.00 0.00 ? 2  LYS A CG  9  
ATOM   5871  C  CD  . LYS A 1 2  ? 23.148  18.570  -12.203 1.00 0.00 ? 2  LYS A CD  9  
ATOM   5872  C  CE  . LYS A 1 2  ? 23.968  18.689  -13.495 1.00 0.00 ? 2  LYS A CE  9  
ATOM   5873  N  NZ  . LYS A 1 2  ? 25.102  19.603  -13.273 1.00 0.00 ? 2  LYS A NZ  9  
ATOM   5874  N  N   . LYS A 1 3  ? 18.535  18.203  -13.539 1.00 0.00 ? 3  LYS A N   9  
ATOM   5875  C  CA  . LYS A 1 3  ? 17.362  17.507  -14.057 1.00 0.00 ? 3  LYS A CA  9  
ATOM   5876  C  C   . LYS A 1 3  ? 17.456  16.022  -13.799 1.00 0.00 ? 3  LYS A C   9  
ATOM   5877  O  O   . LYS A 1 3  ? 18.125  15.274  -14.525 1.00 0.00 ? 3  LYS A O   9  
ATOM   5878  C  CB  . LYS A 1 3  ? 17.216  17.799  -15.576 1.00 0.00 ? 3  LYS A CB  9  
ATOM   5879  C  CG  . LYS A 1 3  ? 16.220  18.942  -15.891 1.00 0.00 ? 3  LYS A CG  9  
ATOM   5880  C  CD  . LYS A 1 3  ? 16.869  20.264  -16.312 1.00 0.00 ? 3  LYS A CD  9  
ATOM   5881  C  CE  . LYS A 1 3  ? 17.914  19.989  -17.401 1.00 0.00 ? 3  LYS A CE  9  
ATOM   5882  N  NZ  . LYS A 1 3  ? 18.004  21.154  -18.299 1.00 0.00 ? 3  LYS A NZ  9  
ATOM   5883  N  N   . ALA A 1 4  ? 16.718  15.514  -12.622 1.00 0.00 ? 4  ALA A N   9  
ATOM   5884  C  CA  . ALA A 1 4  ? 16.717  14.100  -12.260 1.00 0.00 ? 4  ALA A CA  9  
ATOM   5885  C  C   . ALA A 1 4  ? 15.826  13.305  -13.186 1.00 0.00 ? 4  ALA A C   9  
ATOM   5886  O  O   . ALA A 1 4  ? 16.104  12.144  -13.518 1.00 0.00 ? 4  ALA A O   9  
ATOM   5887  C  CB  . ALA A 1 4  ? 16.288  13.995  -10.786 1.00 0.00 ? 4  ALA A CB  9  
ATOM   5888  N  N   . THR A 1 5  ? 14.589  13.978  -13.639 1.00 0.00 ? 5  THR A N   9  
ATOM   5889  C  CA  . THR A 1 5  ? 13.602  13.319  -14.487 1.00 0.00 ? 5  THR A CA  9  
ATOM   5890  C  C   . THR A 1 5  ? 12.674  12.443  -13.679 1.00 0.00 ? 5  THR A C   9  
ATOM   5891  O  O   . THR A 1 5  ? 11.598  12.038  -14.151 1.00 0.00 ? 5  THR A O   9  
ATOM   5892  C  CB  . THR A 1 5  ? 14.302  12.492  -15.617 1.00 0.00 ? 5  THR A CB  9  
ATOM   5893  O  OG1 . THR A 1 5  ? 13.636  12.682  -16.859 1.00 0.00 ? 5  THR A OG1 9  
ATOM   5894  C  CG2 . THR A 1 5  ? 14.333  10.960  -15.426 1.00 0.00 ? 5  THR A CG2 9  
ATOM   5895  N  N   . CYS A 1 6  ? 13.080  12.119  -12.295 1.00 0.00 ? 6  CYS A N   9  
ATOM   5896  C  CA  . CYS A 1 6  ? 12.325  11.177  -11.472 1.00 0.00 ? 6  CYS A CA  9  
ATOM   5897  C  C   . CYS A 1 6  ? 11.112  11.828  -10.853 1.00 0.00 ? 6  CYS A C   9  
ATOM   5898  O  O   . CYS A 1 6  ? 10.462  11.262  -9.956  1.00 0.00 ? 6  CYS A O   9  
ATOM   5899  C  CB  . CYS A 1 6  ? 13.276  10.583  -10.414 1.00 0.00 ? 6  CYS A CB  9  
ATOM   5900  S  SG  . CYS A 1 6  ? 14.685  9.771   -11.202 1.00 0.00 ? 6  CYS A SG  9  
ATOM   5901  N  N   . LEU A 1 7  ? 10.724  13.163  -11.359 1.00 0.00 ? 7  LEU A N   9  
ATOM   5902  C  CA  . LEU A 1 7  ? 9.478   13.809  -10.953 1.00 0.00 ? 7  LEU A CA  9  
ATOM   5903  C  C   . LEU A 1 7  ? 8.332   13.369  -11.834 1.00 0.00 ? 7  LEU A C   9  
ATOM   5904  O  O   . LEU A 1 7  ? 7.776   14.150  -12.619 1.00 0.00 ? 7  LEU A O   9  
ATOM   5905  C  CB  . LEU A 1 7  ? 9.634   15.355  -10.967 1.00 0.00 ? 7  LEU A CB  9  
ATOM   5906  C  CG  . LEU A 1 7  ? 10.405  16.023  -9.796  1.00 0.00 ? 7  LEU A CG  9  
ATOM   5907  C  CD1 . LEU A 1 7  ? 11.838  15.476  -9.729  1.00 0.00 ? 7  LEU A CD1 9  
ATOM   5908  C  CD2 . LEU A 1 7  ? 10.441  17.556  -9.905  1.00 0.00 ? 7  LEU A CD2 9  
ATOM   5909  N  N   . THR A 1 8  ? 7.938   11.947  -11.734 1.00 0.00 ? 8  THR A N   9  
ATOM   5910  C  CA  . THR A 1 8  ? 6.918   11.362  -12.599 1.00 0.00 ? 8  THR A CA  9  
ATOM   5911  C  C   . THR A 1 8  ? 5.994   10.462  -11.812 1.00 0.00 ? 8  THR A C   9  
ATOM   5912  O  O   . THR A 1 8  ? 6.424   9.659   -10.973 1.00 0.00 ? 8  THR A O   9  
ATOM   5913  C  CB  . THR A 1 8  ? 7.579   10.577  -13.782 1.00 0.00 ? 8  THR A CB  9  
ATOM   5914  O  OG1 . THR A 1 8  ? 8.834   10.040  -13.386 1.00 0.00 ? 8  THR A OG1 9  
ATOM   5915  C  CG2 . THR A 1 8  ? 7.893   11.396  -15.054 1.00 0.00 ? 8  THR A CG2 9  
ATOM   5916  N  N   . ASP A 1 9  ? 4.547   10.623  -12.074 1.00 0.00 ? 9  ASP A N   9  
ATOM   5917  C  CA  . ASP A 1 9  ? 3.549   9.754   -11.457 1.00 0.00 ? 9  ASP A CA  9  
ATOM   5918  C  C   . ASP A 1 9  ? 3.762   8.315   -11.865 1.00 0.00 ? 9  ASP A C   9  
ATOM   5919  O  O   . ASP A 1 9  ? 3.403   7.372   -11.147 1.00 0.00 ? 9  ASP A O   9  
ATOM   5920  C  CB  . ASP A 1 9  ? 2.118   10.246  -11.798 1.00 0.00 ? 9  ASP A CB  9  
ATOM   5921  C  CG  . ASP A 1 9  ? 0.998   9.197   -11.747 1.00 0.00 ? 9  ASP A CG  9  
ATOM   5922  O  OD1 . ASP A 1 9  ? 0.982   8.204   -12.460 1.00 0.00 ? 9  ASP A OD1 9  
ATOM   5923  O  OD2 . ASP A 1 9  ? 0.030   9.499   -10.830 1.00 0.00 ? 9  ASP A OD2 9  
ATOM   5924  N  N   . ASP A 1 10 ? 4.459   8.098   -13.153 1.00 0.00 ? 10 ASP A N   9  
ATOM   5925  C  CA  . ASP A 1 10 ? 4.585   6.771   -13.748 1.00 0.00 ? 10 ASP A CA  9  
ATOM   5926  C  C   . ASP A 1 10 ? 5.693   5.985   -13.087 1.00 0.00 ? 10 ASP A C   9  
ATOM   5927  O  O   . ASP A 1 10 ? 5.526   4.815   -12.711 1.00 0.00 ? 10 ASP A O   9  
ATOM   5928  C  CB  . ASP A 1 10 ? 4.786   6.884   -15.281 1.00 0.00 ? 10 ASP A CB  9  
ATOM   5929  C  CG  . ASP A 1 10 ? 4.256   5.721   -16.133 1.00 0.00 ? 10 ASP A CG  9  
ATOM   5930  O  OD1 . ASP A 1 10 ? 3.086   5.623   -16.474 1.00 0.00 ? 10 ASP A OD1 9  
ATOM   5931  O  OD2 . ASP A 1 10 ? 5.224   4.806   -16.441 1.00 0.00 ? 10 ASP A OD2 9  
ATOM   5932  N  N   . GLN A 1 11 ? 6.974   6.693   -12.875 1.00 0.00 ? 11 GLN A N   9  
ATOM   5933  C  CA  . GLN A 1 11 ? 8.142   6.027   -12.303 1.00 0.00 ? 11 GLN A CA  9  
ATOM   5934  C  C   . GLN A 1 11 ? 7.959   5.803   -10.819 1.00 0.00 ? 11 GLN A C   9  
ATOM   5935  O  O   . GLN A 1 11 ? 8.230   4.727   -10.271 1.00 0.00 ? 11 GLN A O   9  
ATOM   5936  C  CB  . GLN A 1 11 ? 9.389   6.893   -12.581 1.00 0.00 ? 11 GLN A CB  9  
ATOM   5937  C  CG  . GLN A 1 11 ? 10.523  6.839   -11.504 1.00 0.00 ? 11 GLN A CG  9  
ATOM   5938  C  CD  . GLN A 1 11 ? 11.877  6.223   -11.875 1.00 0.00 ? 11 GLN A CD  9  
ATOM   5939  O  OE1 . GLN A 1 11 ? 12.546  5.623   -11.049 1.00 0.00 ? 11 GLN A OE1 9  
ATOM   5940  N  NE2 . GLN A 1 11 ? 12.322  6.314   -13.103 1.00 0.00 ? 11 GLN A NE2 9  
ATOM   5941  N  N   . ARG A 1 12 ? 7.397   6.944   -10.061 1.00 0.00 ? 12 ARG A N   9  
ATOM   5942  C  CA  . ARG A 1 12 ? 6.996   6.858   -8.663  1.00 0.00 ? 12 ARG A CA  9  
ATOM   5943  C  C   . ARG A 1 12 ? 6.292   5.555   -8.360  1.00 0.00 ? 12 ARG A C   9  
ATOM   5944  O  O   . ARG A 1 12 ? 6.756   4.640   -7.652  1.00 0.00 ? 12 ARG A O   9  
ATOM   5945  C  CB  . ARG A 1 12 ? 6.024   8.052   -8.378  1.00 0.00 ? 12 ARG A CB  9  
ATOM   5946  C  CG  . ARG A 1 12 ? 6.679   9.326   -7.792  1.00 0.00 ? 12 ARG A CG  9  
ATOM   5947  C  CD  . ARG A 1 12 ? 5.689   10.184  -6.991  1.00 0.00 ? 12 ARG A CD  9  
ATOM   5948  N  NE  . ARG A 1 12 ? 4.680   10.733  -7.933  1.00 0.00 ? 12 ARG A NE  9  
ATOM   5949  C  CZ  . ARG A 1 12 ? 4.803   11.858  -8.623  1.00 0.00 ? 12 ARG A CZ  9  
ATOM   5950  N  NH1 . ARG A 1 12 ? 5.836   12.645  -8.565  1.00 0.00 ? 12 ARG A NH1 9  
ATOM   5951  N  NH2 . ARG A 1 12 ? 3.833   12.187  -9.400  1.00 0.00 ? 12 ARG A NH2 9  
ATOM   5952  N  N   . TRP A 1 13 ? 4.930   5.436   -8.951  1.00 0.00 ? 13 TRP A N   9  
ATOM   5953  C  CA  . TRP A 1 13 ? 4.042   4.346   -8.591  1.00 0.00 ? 13 TRP A CA  9  
ATOM   5954  C  C   . TRP A 1 13 ? 4.504   3.040   -9.191  1.00 0.00 ? 13 TRP A C   9  
ATOM   5955  O  O   . TRP A 1 13 ? 4.217   1.950   -8.678  1.00 0.00 ? 13 TRP A O   9  
ATOM   5956  C  CB  . TRP A 1 13 ? 2.601   4.655   -9.138  1.00 0.00 ? 13 TRP A CB  9  
ATOM   5957  C  CG  . TRP A 1 13 ? 1.788   3.344   -9.120  1.00 0.00 ? 13 TRP A CG  9  
ATOM   5958  C  CD1 . TRP A 1 13 ? 1.581   2.484   -10.215 1.00 0.00 ? 13 TRP A CD1 9  
ATOM   5959  C  CD2 . TRP A 1 13 ? 1.232   2.726   -8.023  1.00 0.00 ? 13 TRP A CD2 9  
ATOM   5960  N  NE1 . TRP A 1 13 ? 0.885   1.322   -9.825  1.00 0.00 ? 13 TRP A NE1 9  
ATOM   5961  C  CE2 . TRP A 1 13 ? 0.681   1.495   -8.461  1.00 0.00 ? 13 TRP A CE2 9  
ATOM   5962  C  CE3 . TRP A 1 13 ? 1.174   3.105   -6.656  1.00 0.00 ? 13 TRP A CE3 9  
ATOM   5963  C  CZ2 . TRP A 1 13 ? 0.050   0.643   -7.529  1.00 0.00 ? 13 TRP A CZ2 9  
ATOM   5964  C  CZ3 . TRP A 1 13 ? 0.529   2.253   -5.761  1.00 0.00 ? 13 TRP A CZ3 9  
ATOM   5965  C  CH2 . TRP A 1 13 ? -0.031  1.041   -6.192  1.00 0.00 ? 13 TRP A CH2 9  
ATOM   5966  N  N   . GLN A 1 14 ? 5.269   3.125   -10.459 1.00 0.00 ? 14 GLN A N   9  
ATOM   5967  C  CA  . GLN A 1 14 ? 5.921   1.945   -11.027 1.00 0.00 ? 14 GLN A CA  9  
ATOM   5968  C  C   . GLN A 1 14 ? 6.833   1.324   -9.983  1.00 0.00 ? 14 GLN A C   9  
ATOM   5969  O  O   . GLN A 1 14 ? 6.968   0.100   -9.870  1.00 0.00 ? 14 GLN A O   9  
ATOM   5970  C  CB  . GLN A 1 14 ? 6.719   2.345   -12.282 1.00 0.00 ? 14 GLN A CB  9  
ATOM   5971  C  CG  . GLN A 1 14 ? 7.803   1.325   -12.769 1.00 0.00 ? 14 GLN A CG  9  
ATOM   5972  C  CD  . GLN A 1 14 ? 8.294   1.390   -14.220 1.00 0.00 ? 14 GLN A CD  9  
ATOM   5973  O  OE1 . GLN A 1 14 ? 8.709   0.395   -14.792 1.00 0.00 ? 14 GLN A OE1 9  
ATOM   5974  N  NE2 . GLN A 1 14 ? 8.276   2.528   -14.866 1.00 0.00 ? 14 GLN A NE2 9  
ATOM   5975  N  N   . SER A 1 15 ? 7.514   2.291   -9.089  1.00 0.00 ? 15 SER A N   9  
ATOM   5976  C  CA  . SER A 1 15 ? 8.276   1.858   -7.923  1.00 0.00 ? 15 SER A CA  9  
ATOM   5977  C  C   . SER A 1 15 ? 7.398   1.058   -6.985  1.00 0.00 ? 15 SER A C   9  
ATOM   5978  O  O   . SER A 1 15 ? 7.824   0.017   -6.454  1.00 0.00 ? 15 SER A O   9  
ATOM   5979  C  CB  . SER A 1 15 ? 8.951   3.053   -7.207  1.00 0.00 ? 15 SER A CB  9  
ATOM   5980  O  OG  . SER A 1 15 ? 10.164  2.693   -6.536  1.00 0.00 ? 15 SER A OG  9  
ATOM   5981  N  N   . VAL A 1 16 ? 6.007   1.551   -6.763  1.00 0.00 ? 16 VAL A N   9  
ATOM   5982  C  CA  . VAL A 1 16 ? 5.058   0.743   -6.006  1.00 0.00 ? 16 VAL A CA  9  
ATOM   5983  C  C   . VAL A 1 16 ? 4.780   -0.627  -6.580  1.00 0.00 ? 16 VAL A C   9  
ATOM   5984  O  O   . VAL A 1 16 ? 4.774   -1.650  -5.850  1.00 0.00 ? 16 VAL A O   9  
ATOM   5985  C  CB  . VAL A 1 16 ? 3.698   1.474   -5.685  1.00 0.00 ? 16 VAL A CB  9  
ATOM   5986  C  CG1 . VAL A 1 16 ? 2.841   0.815   -4.553  1.00 0.00 ? 16 VAL A CG1 9  
ATOM   5987  C  CG2 . VAL A 1 16 ? 3.840   2.956   -5.275  1.00 0.00 ? 16 VAL A CG2 9  
ATOM   5988  N  N   . LEU A 1 17 ? 4.437   -0.728  -8.010  1.00 0.00 ? 17 LEU A N   9  
ATOM   5989  C  CA  . LEU A 1 17 ? 4.187   -2.033  -8.658  1.00 0.00 ? 17 LEU A CA  9  
ATOM   5990  C  C   . LEU A 1 17 ? 5.313   -2.982  -8.340  1.00 0.00 ? 17 LEU A C   9  
ATOM   5991  O  O   . LEU A 1 17 ? 5.147   -4.117  -7.878  1.00 0.00 ? 17 LEU A O   9  
ATOM   5992  C  CB  . LEU A 1 17 ? 4.011   -1.865  -10.193 1.00 0.00 ? 17 LEU A CB  9  
ATOM   5993  C  CG  . LEU A 1 17 ? 2.681   -1.239  -10.700 1.00 0.00 ? 17 LEU A CG  9  
ATOM   5994  C  CD1 . LEU A 1 17 ? 2.450   -1.616  -12.169 1.00 0.00 ? 17 LEU A CD1 9  
ATOM   5995  C  CD2 . LEU A 1 17 ? 1.468   -1.666  -9.857  1.00 0.00 ? 17 LEU A CD2 9  
ATOM   5996  N  N   . ALA A 1 18 ? 6.671   -2.471  -8.662  1.00 0.00 ? 18 ALA A N   9  
ATOM   5997  C  CA  . ALA A 1 18 ? 7.881   -3.279  -8.612  1.00 0.00 ? 18 ALA A CA  9  
ATOM   5998  C  C   . ALA A 1 18 ? 8.523   -3.240  -7.246  1.00 0.00 ? 18 ALA A C   9  
ATOM   5999  O  O   . ALA A 1 18 ? 9.681   -3.640  -7.065  1.00 0.00 ? 18 ALA A O   9  
ATOM   6000  C  CB  . ALA A 1 18 ? 8.838   -2.729  -9.699  1.00 0.00 ? 18 ALA A CB  9  
ATOM   6001  N  N   . ARG A 1 19 ? 7.681   -2.786  -6.122  1.00 0.00 ? 19 ARG A N   9  
ATOM   6002  C  CA  . ARG A 1 19 ? 8.130   -2.415  -4.788  1.00 0.00 ? 19 ARG A CA  9  
ATOM   6003  C  C   . ARG A 1 19 ? 9.617   -2.432  -4.583  1.00 0.00 ? 19 ARG A C   9  
ATOM   6004  O  O   . ARG A 1 19 ? 10.157  -2.962  -3.598  1.00 0.00 ? 19 ARG A O   9  
ATOM   6005  C  CB  . ARG A 1 19 ? 7.383   -3.301  -3.748  1.00 0.00 ? 19 ARG A CB  9  
ATOM   6006  C  CG  . ARG A 1 19 ? 7.858   -4.766  -3.585  1.00 0.00 ? 19 ARG A CG  9  
ATOM   6007  C  CD  . ARG A 1 19 ? 7.668   -5.632  -4.835  1.00 0.00 ? 19 ARG A CD  9  
ATOM   6008  N  NE  . ARG A 1 19 ? 8.920   -6.403  -5.059  1.00 0.00 ? 19 ARG A NE  9  
ATOM   6009  C  CZ  . ARG A 1 19 ? 9.330   -7.430  -4.327  1.00 0.00 ? 19 ARG A CZ  9  
ATOM   6010  N  NH1 . ARG A 1 19 ? 8.682   -7.911  -3.308  1.00 0.00 ? 19 ARG A NH1 9  
ATOM   6011  N  NH2 . ARG A 1 19 ? 10.445  -7.982  -4.652  1.00 0.00 ? 19 ARG A NH2 9  
ATOM   6012  N  N   . ASP A 1 20 ? 10.431  -1.725  -5.604  1.00 0.00 ? 20 ASP A N   9  
ATOM   6013  C  CA  . ASP A 1 20 ? 11.861  -1.482  -5.476  1.00 0.00 ? 20 ASP A CA  9  
ATOM   6014  C  C   . ASP A 1 20 ? 12.138  -0.169  -4.788  1.00 0.00 ? 20 ASP A C   9  
ATOM   6015  O  O   . ASP A 1 20 ? 11.601  0.887   -5.161  1.00 0.00 ? 20 ASP A O   9  
ATOM   6016  C  CB  . ASP A 1 20 ? 12.524  -1.506  -6.887  1.00 0.00 ? 20 ASP A CB  9  
ATOM   6017  C  CG  . ASP A 1 20 ? 13.981  -1.980  -6.955  1.00 0.00 ? 20 ASP A CG  9  
ATOM   6018  O  OD1 . ASP A 1 20 ? 14.189  -3.156  -6.288  1.00 0.00 ? 20 ASP A OD1 9  
ATOM   6019  O  OD2 . ASP A 1 20 ? 14.861  -1.357  -7.532  1.00 0.00 ? 20 ASP A OD2 9  
ATOM   6020  N  N   . PRO A 1 21 ? 13.068  -0.210  -3.644  1.00 0.00 ? 21 PRO A N   9  
ATOM   6021  C  CA  . PRO A 1 21 ? 13.535  1.001   -2.817  1.00 0.00 ? 21 PRO A CA  9  
ATOM   6022  C  C   . PRO A 1 21 ? 14.704  1.746   -3.431  1.00 0.00 ? 21 PRO A C   9  
ATOM   6023  O  O   . PRO A 1 21 ? 15.571  2.305   -2.745  1.00 0.00 ? 21 PRO A O   9  
ATOM   6024  C  CB  . PRO A 1 21 ? 13.963  0.419   -1.477  1.00 0.00 ? 21 PRO A CB  9  
ATOM   6025  C  CG  . PRO A 1 21 ? 14.627  -0.890  -1.937  1.00 0.00 ? 21 PRO A CG  9  
ATOM   6026  C  CD  . PRO A 1 21 ? 13.741  -1.401  -3.077  1.00 0.00 ? 21 PRO A CD  9  
ATOM   6027  N  N   . ASN A 1 22 ? 14.736  1.806   -4.914  1.00 0.00 ? 22 ASN A N   9  
ATOM   6028  C  CA  . ASN A 1 22 ? 15.877  2.316   -5.666  1.00 0.00 ? 22 ASN A CA  9  
ATOM   6029  C  C   . ASN A 1 22 ? 15.754  3.806   -5.880  1.00 0.00 ? 22 ASN A C   9  
ATOM   6030  O  O   . ASN A 1 22 ? 16.678  4.592   -5.632  1.00 0.00 ? 22 ASN A O   9  
ATOM   6031  C  CB  . ASN A 1 22 ? 15.955  1.582   -7.039  1.00 0.00 ? 22 ASN A CB  9  
ATOM   6032  C  CG  . ASN A 1 22 ? 16.596  2.345   -8.202  1.00 0.00 ? 22 ASN A CG  9  
ATOM   6033  O  OD1 . ASN A 1 22 ? 17.760  2.176   -8.533  1.00 0.00 ? 22 ASN A OD1 9  
ATOM   6034  N  ND2 . ASN A 1 22 ? 15.866  3.194   -8.875  1.00 0.00 ? 22 ASN A ND2 9  
ATOM   6035  N  N   . ALA A 1 23 ? 14.462  4.262   -6.447  1.00 0.00 ? 23 ALA A N   9  
ATOM   6036  C  CA  . ALA A 1 23 ? 14.221  5.646   -6.838  1.00 0.00 ? 23 ALA A CA  9  
ATOM   6037  C  C   . ALA A 1 23 ? 13.976  6.507   -5.615  1.00 0.00 ? 23 ALA A C   9  
ATOM   6038  O  O   . ALA A 1 23 ? 14.848  7.248   -5.144  1.00 0.00 ? 23 ALA A O   9  
ATOM   6039  C  CB  . ALA A 1 23 ? 13.033  5.656   -7.814  1.00 0.00 ? 23 ALA A CB  9  
ATOM   6040  N  N   . ASP A 1 24 ? 12.632  6.385   -5.011  1.00 0.00 ? 24 ASP A N   9  
ATOM   6041  C  CA  . ASP A 1 24 ? 12.172  7.262   -3.939  1.00 0.00 ? 24 ASP A CA  9  
ATOM   6042  C  C   . ASP A 1 24 ? 12.583  6.727   -2.587  1.00 0.00 ? 24 ASP A C   9  
ATOM   6043  O  O   . ASP A 1 24 ? 11.927  5.847   -2.013  1.00 0.00 ? 24 ASP A O   9  
ATOM   6044  C  CB  . ASP A 1 24 ? 10.636  7.460   -4.033  1.00 0.00 ? 24 ASP A CB  9  
ATOM   6045  C  CG  . ASP A 1 24 ? 10.147  8.620   -4.912  1.00 0.00 ? 24 ASP A CG  9  
ATOM   6046  O  OD1 . ASP A 1 24 ? 10.007  9.762   -4.499  1.00 0.00 ? 24 ASP A OD1 9  
ATOM   6047  O  OD2 . ASP A 1 24 ? 9.913   8.241   -6.206  1.00 0.00 ? 24 ASP A OD2 9  
ATOM   6048  N  N   . GLY A 1 25 ? 13.776  7.346   -1.972  1.00 0.00 ? 25 GLY A N   9  
ATOM   6049  C  CA  . GLY A 1 25 ? 14.428  6.846   -0.769  1.00 0.00 ? 25 GLY A CA  9  
ATOM   6050  C  C   . GLY A 1 25 ? 13.529  6.039   0.136   1.00 0.00 ? 25 GLY A C   9  
ATOM   6051  O  O   . GLY A 1 25 ? 13.812  4.874   0.461   1.00 0.00 ? 25 GLY A O   9  
ATOM   6052  N  N   . GLU A 1 26 ? 12.278  6.686   0.586   1.00 0.00 ? 26 GLU A N   9  
ATOM   6053  C  CA  . GLU A 1 26 ? 11.303  5.982   1.416   1.00 0.00 ? 26 GLU A CA  9  
ATOM   6054  C  C   . GLU A 1 26 ? 9.934   6.604   1.287   1.00 0.00 ? 26 GLU A C   9  
ATOM   6055  O  O   . GLU A 1 26 ? 9.195   6.755   2.274   1.00 0.00 ? 26 GLU A O   9  
ATOM   6056  C  CB  . GLU A 1 26 ? 11.802  6.011   2.888   1.00 0.00 ? 26 GLU A CB  9  
ATOM   6057  C  CG  . GLU A 1 26 ? 10.898  5.338   3.973   1.00 0.00 ? 26 GLU A CG  9  
ATOM   6058  C  CD  . GLU A 1 26 ? 11.575  4.605   5.134   1.00 0.00 ? 26 GLU A CD  9  
ATOM   6059  O  OE1 . GLU A 1 26 ? 12.054  5.436   6.101   1.00 0.00 ? 26 GLU A OE1 9  
ATOM   6060  O  OE2 . GLU A 1 26 ? 11.676  3.386   5.185   1.00 0.00 ? 26 GLU A OE2 9  
ATOM   6061  N  N   . PHE A 1 27 ? 9.504   7.003   -0.072  1.00 0.00 ? 27 PHE A N   9  
ATOM   6062  C  CA  . PHE A 1 27 ? 8.270   7.769   -0.283  1.00 0.00 ? 27 PHE A CA  9  
ATOM   6063  C  C   . PHE A 1 27 ? 7.058   6.980   0.147   1.00 0.00 ? 27 PHE A C   9  
ATOM   6064  O  O   . PHE A 1 27 ? 7.086   5.732   0.185   1.00 0.00 ? 27 PHE A O   9  
ATOM   6065  C  CB  . PHE A 1 27 ? 8.140   8.173   -1.780  1.00 0.00 ? 27 PHE A CB  9  
ATOM   6066  C  CG  . PHE A 1 27 ? 7.909   7.058   -2.814  1.00 0.00 ? 27 PHE A CG  9  
ATOM   6067  C  CD1 . PHE A 1 27 ? 8.179   5.727   -2.486  1.00 0.00 ? 27 PHE A CD1 9  
ATOM   6068  C  CD2 . PHE A 1 27 ? 7.435   7.370   -4.093  1.00 0.00 ? 27 PHE A CD2 9  
ATOM   6069  C  CE1 . PHE A 1 27 ? 7.980   4.718   -3.422  1.00 0.00 ? 27 PHE A CE1 9  
ATOM   6070  C  CE2 . PHE A 1 27 ? 7.235   6.359   -5.029  1.00 0.00 ? 27 PHE A CE2 9  
ATOM   6071  C  CZ  . PHE A 1 27 ? 7.508   5.034   -4.694  1.00 0.00 ? 27 PHE A CZ  9  
ATOM   6072  N  N   . VAL A 1 28 ? 5.844   7.721   0.563   1.00 0.00 ? 28 VAL A N   9  
ATOM   6073  C  CA  . VAL A 1 28 ? 4.646   7.054   1.071   1.00 0.00 ? 28 VAL A CA  9  
ATOM   6074  C  C   . VAL A 1 28 ? 3.537   7.052   0.042   1.00 0.00 ? 28 VAL A C   9  
ATOM   6075  O  O   . VAL A 1 28 ? 3.518   7.837   -0.915  1.00 0.00 ? 28 VAL A O   9  
ATOM   6076  C  CB  . VAL A 1 28 ? 4.163   7.740   2.409   1.00 0.00 ? 28 VAL A CB  9  
ATOM   6077  C  CG1 . VAL A 1 28 ? 4.240   6.867   3.695   1.00 0.00 ? 28 VAL A CG1 9  
ATOM   6078  C  CG2 . VAL A 1 28 ? 4.935   9.031   2.771   1.00 0.00 ? 28 VAL A CG2 9  
ATOM   6079  N  N   . PHE A 1 29 ? 2.455   6.062   0.265   1.00 0.00 ? 29 PHE A N   9  
ATOM   6080  C  CA  . PHE A 1 29 ? 1.279   5.967   -0.594  1.00 0.00 ? 29 PHE A CA  9  
ATOM   6081  C  C   . PHE A 1 29 ? 0.042   5.703   0.235   1.00 0.00 ? 29 PHE A C   9  
ATOM   6082  O  O   . PHE A 1 29 ? 0.048   4.856   1.147   1.00 0.00 ? 29 PHE A O   9  
ATOM   6083  C  CB  . PHE A 1 29 ? 1.459   4.811   -1.626  1.00 0.00 ? 29 PHE A CB  9  
ATOM   6084  C  CG  . PHE A 1 29 ? 0.920   3.424   -1.244  1.00 0.00 ? 29 PHE A CG  9  
ATOM   6085  C  CD1 . PHE A 1 29 ? -0.414  3.085   -1.482  1.00 0.00 ? 29 PHE A CD1 9  
ATOM   6086  C  CD2 . PHE A 1 29 ? 1.790   2.468   -0.710  1.00 0.00 ? 29 PHE A CD2 9  
ATOM   6087  C  CE1 . PHE A 1 29 ? -0.872  1.803   -1.185  1.00 0.00 ? 29 PHE A CE1 9  
ATOM   6088  C  CE2 . PHE A 1 29 ? 1.330   1.191   -0.408  1.00 0.00 ? 29 PHE A CE2 9  
ATOM   6089  C  CZ  . PHE A 1 29 ? -0.001  0.859   -0.645  1.00 0.00 ? 29 PHE A CZ  9  
ATOM   6090  N  N   . ALA A 1 30 ? -1.159  6.515   -0.053  1.00 0.00 ? 30 ALA A N   9  
ATOM   6091  C  CA  . ALA A 1 30 ? -2.346  6.461   0.797   1.00 0.00 ? 30 ALA A CA  9  
ATOM   6092  C  C   . ALA A 1 30 ? -3.574  6.115   -0.012  1.00 0.00 ? 30 ALA A C   9  
ATOM   6093  O  O   . ALA A 1 30 ? -4.156  6.959   -0.707  1.00 0.00 ? 30 ALA A O   9  
ATOM   6094  C  CB  . ALA A 1 30 ? -2.467  7.814   1.518   1.00 0.00 ? 30 ALA A CB  9  
ATOM   6095  N  N   . VAL A 1 31 ? -4.060  4.723   0.097   1.00 0.00 ? 31 VAL A N   9  
ATOM   6096  C  CA  . VAL A 1 31 ? -5.298  4.285   -0.541  1.00 0.00 ? 31 VAL A CA  9  
ATOM   6097  C  C   . VAL A 1 31 ? -6.475  4.497   0.384   1.00 0.00 ? 31 VAL A C   9  
ATOM   6098  O  O   . VAL A 1 31 ? -6.696  3.726   1.331   1.00 0.00 ? 31 VAL A O   9  
ATOM   6099  C  CB  . VAL A 1 31 ? -5.175  2.769   -0.966  1.00 0.00 ? 31 VAL A CB  9  
ATOM   6100  C  CG1 . VAL A 1 31 ? -4.776  1.767   0.155   1.00 0.00 ? 31 VAL A CG1 9  
ATOM   6101  C  CG2 . VAL A 1 31 ? -6.462  2.179   -1.592  1.00 0.00 ? 31 VAL A CG2 9  
ATOM   6102  N  N   . ARG A 1 32 ? -7.303  5.695   0.132   1.00 0.00 ? 32 ARG A N   9  
ATOM   6103  C  CA  . ARG A 1 32 ? -8.386  6.102   1.024   1.00 0.00 ? 32 ARG A CA  9  
ATOM   6104  C  C   . ARG A 1 32 ? -9.701  5.453   0.664   1.00 0.00 ? 32 ARG A C   9  
ATOM   6105  O  O   . ARG A 1 32 ? -10.698 6.135   0.336   1.00 0.00 ? 32 ARG A O   9  
ATOM   6106  C  CB  . ARG A 1 32 ? -8.500  7.653   0.984   1.00 0.00 ? 32 ARG A CB  9  
ATOM   6107  C  CG  . ARG A 1 32 ? -9.440  8.265   2.056   1.00 0.00 ? 32 ARG A CG  9  
ATOM   6108  C  CD  . ARG A 1 32 ? -9.322  9.792   2.141   1.00 0.00 ? 32 ARG A CD  9  
ATOM   6109  N  NE  . ARG A 1 32 ? -10.046 10.383  0.986   1.00 0.00 ? 32 ARG A NE  9  
ATOM   6110  C  CZ  . ARG A 1 32 ? -9.717  11.507  0.365   1.00 0.00 ? 32 ARG A CZ  9  
ATOM   6111  N  NH1 . ARG A 1 32 ? -8.704  12.255  0.689   1.00 0.00 ? 32 ARG A NH1 9  
ATOM   6112  N  NH2 . ARG A 1 32 ? -10.454 11.877  -0.622  1.00 0.00 ? 32 ARG A NH2 9  
ATOM   6113  N  N   . THR A 1 33 ? -9.774  3.976   0.671   1.00 0.00 ? 33 THR A N   9  
ATOM   6114  C  CA  . THR A 1 33 ? -11.040 3.260   0.509   1.00 0.00 ? 33 THR A CA  9  
ATOM   6115  C  C   . THR A 1 33 ? -11.306 2.372   1.702   1.00 0.00 ? 33 THR A C   9  
ATOM   6116  O  O   . THR A 1 33 ? -12.425 2.301   2.228   1.00 0.00 ? 33 THR A O   9  
ATOM   6117  C  CB  . THR A 1 33 ? -11.044 2.430   -0.818  1.00 0.00 ? 33 THR A CB  9  
ATOM   6118  O  OG1 . THR A 1 33 ? -12.351 2.395   -1.380  1.00 0.00 ? 33 THR A OG1 9  
ATOM   6119  C  CG2 . THR A 1 33 ? -10.634 0.946   -0.701  1.00 0.00 ? 33 THR A CG2 9  
ATOM   6120  N  N   . THR A 1 34 ? -10.163 1.565   2.182   1.00 0.00 ? 34 THR A N   9  
ATOM   6121  C  CA  . THR A 1 34 ? -10.212 0.796   3.422   1.00 0.00 ? 34 THR A CA  9  
ATOM   6122  C  C   . THR A 1 34 ? -9.511  1.532   4.541   1.00 0.00 ? 34 THR A C   9  
ATOM   6123  O  O   . THR A 1 34 ? -9.740  1.277   5.731   1.00 0.00 ? 34 THR A O   9  
ATOM   6124  C  CB  . THR A 1 34 ? -9.584  -0.624  3.216   1.00 0.00 ? 34 THR A CB  9  
ATOM   6125  O  OG1 . THR A 1 34 ? -10.168 -1.269  2.091   1.00 0.00 ? 34 THR A OG1 9  
ATOM   6126  C  CG2 . THR A 1 34 ? -9.766  -1.628  4.374   1.00 0.00 ? 34 THR A CG2 9  
ATOM   6127  N  N   . GLY A 1 35 ? -8.567  2.597   4.136   1.00 0.00 ? 35 GLY A N   9  
ATOM   6128  C  CA  . GLY A 1 35 ? -7.950  3.502   5.100   1.00 0.00 ? 35 GLY A CA  9  
ATOM   6129  C  C   . GLY A 1 35 ? -6.607  3.013   5.584   1.00 0.00 ? 35 GLY A C   9  
ATOM   6130  O  O   . GLY A 1 35 ? -6.411  2.738   6.783   1.00 0.00 ? 35 GLY A O   9  
ATOM   6131  N  N   . ILE A 1 36 ? -5.537  2.850   4.577   1.00 0.00 ? 36 ILE A N   9  
ATOM   6132  C  CA  . ILE A 1 36 ? -4.155  2.562   4.959   1.00 0.00 ? 36 ILE A CA  9  
ATOM   6133  C  C   . ILE A 1 36 ? -3.194  3.428   4.180   1.00 0.00 ? 36 ILE A C   9  
ATOM   6134  O  O   . ILE A 1 36 ? -3.316  3.604   2.956   1.00 0.00 ? 36 ILE A O   9  
ATOM   6135  C  CB  . ILE A 1 36 ? -3.813  1.021   4.860   1.00 0.00 ? 36 ILE A CB  9  
ATOM   6136  C  CG1 . ILE A 1 36 ? -3.150  0.536   3.531   1.00 0.00 ? 36 ILE A CG1 9  
ATOM   6137  C  CG2 . ILE A 1 36 ? -5.050  0.109   5.140   1.00 0.00 ? 36 ILE A CG2 9  
ATOM   6138  C  CD1 . ILE A 1 36 ? -2.000  -0.482  3.685   1.00 0.00 ? 36 ILE A CD1 9  
ATOM   6139  N  N   . PHE A 1 37 ? -2.127  4.093   4.956   1.00 0.00 ? 37 PHE A N   9  
ATOM   6140  C  CA  . PHE A 1 37 ? -1.015  4.818   4.315   1.00 0.00 ? 37 PHE A CA  9  
ATOM   6141  C  C   . PHE A 1 37 ? 0.274   4.082   4.587   1.00 0.00 ? 37 PHE A C   9  
ATOM   6142  O  O   . PHE A 1 37 ? 0.684   3.954   5.771   1.00 0.00 ? 37 PHE A O   9  
ATOM   6143  C  CB  . PHE A 1 37 ? -0.938  6.276   4.855   1.00 0.00 ? 37 PHE A CB  9  
ATOM   6144  C  CG  . PHE A 1 37 ? -0.067  6.584   6.082   1.00 0.00 ? 37 PHE A CG  9  
ATOM   6145  C  CD1 . PHE A 1 37 ? 1.310   6.780   5.951   1.00 0.00 ? 37 PHE A CD1 9  
ATOM   6146  C  CD2 . PHE A 1 37 ? -0.659  6.674   7.347   1.00 0.00 ? 37 PHE A CD2 9  
ATOM   6147  C  CE1 . PHE A 1 37 ? 2.085   7.065   7.072   1.00 0.00 ? 37 PHE A CE1 9  
ATOM   6148  C  CE2 . PHE A 1 37 ? 0.116   6.964   8.465   1.00 0.00 ? 37 PHE A CE2 9  
ATOM   6149  C  CZ  . PHE A 1 37 ? 1.488   7.160   8.328   1.00 0.00 ? 37 PHE A CZ  9  
ATOM   6150  N  N   . CYS A 1 38 ? 1.026   3.474   3.470   1.00 0.00 ? 38 CYS A N   9  
ATOM   6151  C  CA  . CYS A 1 38 ? 2.157   2.577   3.692   1.00 0.00 ? 38 CYS A CA  9  
ATOM   6152  C  C   . CYS A 1 38 ? 3.320   2.906   2.794   1.00 0.00 ? 38 CYS A C   9  
ATOM   6153  O  O   . CYS A 1 38 ? 3.176   3.609   1.777   1.00 0.00 ? 38 CYS A O   9  
ATOM   6154  C  CB  . CYS A 1 38 ? 1.659   1.127   3.437   1.00 0.00 ? 38 CYS A CB  9  
ATOM   6155  S  SG  . CYS A 1 38 ? 2.985   -0.073  3.718   1.00 0.00 ? 38 CYS A SG  9  
ATOM   6156  N  N   . ARG A 1 39 ? 4.642   2.391   3.198   1.00 0.00 ? 39 ARG A N   9  
ATOM   6157  C  CA  . ARG A 1 39 ? 5.779   2.419   2.260   1.00 0.00 ? 39 ARG A CA  9  
ATOM   6158  C  C   . ARG A 1 39 ? 5.548   1.309   1.252   1.00 0.00 ? 39 ARG A C   9  
ATOM   6159  O  O   . ARG A 1 39 ? 5.700   0.120   1.562   1.00 0.00 ? 39 ARG A O   9  
ATOM   6160  C  CB  . ARG A 1 39 ? 7.105   2.284   3.043   1.00 0.00 ? 39 ARG A CB  9  
ATOM   6161  C  CG  . ARG A 1 39 ? 8.390   2.584   2.225   1.00 0.00 ? 39 ARG A CG  9  
ATOM   6162  C  CD  . ARG A 1 39 ? 8.869   1.375   1.411   1.00 0.00 ? 39 ARG A CD  9  
ATOM   6163  N  NE  . ARG A 1 39 ? 9.378   0.346   2.353   1.00 0.00 ? 39 ARG A NE  9  
ATOM   6164  C  CZ  . ARG A 1 39 ? 10.593  0.322   2.885   1.00 0.00 ? 39 ARG A CZ  9  
ATOM   6165  N  NH1 . ARG A 1 39 ? 11.514  1.210   2.652   1.00 0.00 ? 39 ARG A NH1 9  
ATOM   6166  N  NH2 . ARG A 1 39 ? 10.873  -0.647  3.682   1.00 0.00 ? 39 ARG A NH2 9  
ATOM   6167  N  N   . PRO A 1 40 ? 5.165   1.724   -0.108  1.00 0.00 ? 40 PRO A N   9  
ATOM   6168  C  CA  . PRO A 1 40 ? 4.807   0.804   -1.291  1.00 0.00 ? 40 PRO A CA  9  
ATOM   6169  C  C   . PRO A 1 40 ? 5.232   -0.636  -1.199  1.00 0.00 ? 40 PRO A C   9  
ATOM   6170  O  O   . PRO A 1 40 ? 6.374   -0.995  -1.550  1.00 0.00 ? 40 PRO A O   9  
ATOM   6171  C  CB  . PRO A 1 40 ? 5.443   1.513   -2.492  1.00 0.00 ? 40 PRO A CB  9  
ATOM   6172  C  CG  . PRO A 1 40 ? 5.077   2.972   -2.166  1.00 0.00 ? 40 PRO A CG  9  
ATOM   6173  C  CD  . PRO A 1 40 ? 5.036   3.105   -0.639  1.00 0.00 ? 40 PRO A CD  9  
ATOM   6174  N  N   . SER A 1 41 ? 4.258   -1.615  -0.640  1.00 0.00 ? 41 SER A N   9  
ATOM   6175  C  CA  . SER A 1 41 ? 4.577   -3.035  -0.548  1.00 0.00 ? 41 SER A CA  9  
ATOM   6176  C  C   . SER A 1 41 ? 3.414   -3.938  -0.225  1.00 0.00 ? 41 SER A C   9  
ATOM   6177  O  O   . SER A 1 41 ? 3.075   -4.862  -0.992  1.00 0.00 ? 41 SER A O   9  
ATOM   6178  C  CB  . SER A 1 41 ? 5.747   -3.258  0.456   1.00 0.00 ? 41 SER A CB  9  
ATOM   6179  O  OG  . SER A 1 41 ? 5.561   -2.565  1.692   1.00 0.00 ? 41 SER A OG  9  
ATOM   6180  N  N   . CYS A 1 42 ? 2.645   -3.675  1.016   1.00 0.00 ? 42 CYS A N   9  
ATOM   6181  C  CA  . CYS A 1 42 ? 1.655   -4.562  1.606   1.00 0.00 ? 42 CYS A CA  9  
ATOM   6182  C  C   . CYS A 1 42 ? 1.452   -5.853  0.837   1.00 0.00 ? 42 CYS A C   9  
ATOM   6183  O  O   . CYS A 1 42 ? 0.549   -6.030  0.013   1.00 0.00 ? 42 CYS A O   9  
ATOM   6184  C  CB  . CYS A 1 42 ? 0.345   -3.833  1.958   1.00 0.00 ? 42 CYS A CB  9  
ATOM   6185  S  SG  . CYS A 1 42 ? 0.523   -2.106  2.452   1.00 0.00 ? 42 CYS A SG  9  
ATOM   6186  N  N   . ARG A 1 43 ? 2.443   -6.917  1.138   1.00 0.00 ? 43 ARG A N   9  
ATOM   6187  C  CA  . ARG A 1 43 ? 2.398   -8.299  0.679   1.00 0.00 ? 43 ARG A CA  9  
ATOM   6188  C  C   . ARG A 1 43 ? 1.222   -8.643  -0.189  1.00 0.00 ? 43 ARG A C   9  
ATOM   6189  O  O   . ARG A 1 43 ? 1.329   -8.708  -1.432  1.00 0.00 ? 43 ARG A O   9  
ATOM   6190  C  CB  . ARG A 1 43 ? 2.459   -9.230  1.933   1.00 0.00 ? 43 ARG A CB  9  
ATOM   6191  C  CG  . ARG A 1 43 ? 2.753   -8.507  3.271   1.00 0.00 ? 43 ARG A CG  9  
ATOM   6192  C  CD  . ARG A 1 43 ? 2.330   -9.327  4.496   1.00 0.00 ? 43 ARG A CD  9  
ATOM   6193  N  NE  . ARG A 1 43 ? 3.483   -10.158 4.926   1.00 0.00 ? 43 ARG A NE  9  
ATOM   6194  C  CZ  . ARG A 1 43 ? 4.354   -9.836  5.873   1.00 0.00 ? 43 ARG A CZ  9  
ATOM   6195  N  NH1 . ARG A 1 43 ? 4.318   -8.732  6.559   1.00 0.00 ? 43 ARG A NH1 9  
ATOM   6196  N  NH2 . ARG A 1 43 ? 5.294   -10.677 6.125   1.00 0.00 ? 43 ARG A NH2 9  
ATOM   6197  N  N   . ALA A 1 44 ? -0.059  -8.944  0.483   1.00 0.00 ? 44 ALA A N   9  
ATOM   6198  C  CA  . ALA A 1 44 ? -1.207  -9.478  -0.234  1.00 0.00 ? 44 ALA A CA  9  
ATOM   6199  C  C   . ALA A 1 44 ? -1.637  -8.537  -1.345  1.00 0.00 ? 44 ALA A C   9  
ATOM   6200  O  O   . ALA A 1 44 ? -1.045  -7.481  -1.591  1.00 0.00 ? 44 ALA A O   9  
ATOM   6201  C  CB  . ALA A 1 44 ? -2.340  -9.733  0.778   1.00 0.00 ? 44 ALA A CB  9  
ATOM   6202  N  N   . ARG A 1 45 ? -2.803  -9.012  -2.137  1.00 0.00 ? 45 ARG A N   9  
ATOM   6203  C  CA  . ARG A 1 45 ? -3.392  -8.202  -3.198  1.00 0.00 ? 45 ARG A CA  9  
ATOM   6204  C  C   . ARG A 1 45 ? -3.709  -6.811  -2.690  1.00 0.00 ? 45 ARG A C   9  
ATOM   6205  O  O   . ARG A 1 45 ? -4.779  -6.551  -2.126  1.00 0.00 ? 45 ARG A O   9  
ATOM   6206  C  CB  . ARG A 1 45 ? -4.655  -8.919  -3.746  1.00 0.00 ? 45 ARG A CB  9  
ATOM   6207  C  CG  . ARG A 1 45 ? -5.681  -9.361  -2.670  1.00 0.00 ? 45 ARG A CG  9  
ATOM   6208  C  CD  . ARG A 1 45 ? -7.129  -9.070  -3.085  1.00 0.00 ? 45 ARG A CD  9  
ATOM   6209  N  NE  . ARG A 1 45 ? -7.901  -10.337 -3.014  1.00 0.00 ? 45 ARG A NE  9  
ATOM   6210  C  CZ  . ARG A 1 45 ? -7.835  -11.328 -3.892  1.00 0.00 ? 45 ARG A CZ  9  
ATOM   6211  N  NH1 . ARG A 1 45 ? -7.071  -11.328 -4.944  1.00 0.00 ? 45 ARG A NH1 9  
ATOM   6212  N  NH2 . ARG A 1 45 ? -8.580  -12.356 -3.683  1.00 0.00 ? 45 ARG A NH2 9  
ATOM   6213  N  N   . HIS A 1 46 ? -2.649  -5.797  -2.875  1.00 0.00 ? 46 HIS A N   9  
ATOM   6214  C  CA  . HIS A 1 46 ? -2.724  -4.467  -2.281  1.00 0.00 ? 46 HIS A CA  9  
ATOM   6215  C  C   . HIS A 1 46 ? -3.799  -3.628  -2.932  1.00 0.00 ? 46 HIS A C   9  
ATOM   6216  O  O   . HIS A 1 46 ? -4.726  -4.136  -3.576  1.00 0.00 ? 46 HIS A O   9  
ATOM   6217  C  CB  . HIS A 1 46 ? -1.343  -3.821  -2.493  1.00 0.00 ? 46 HIS A CB  9  
ATOM   6218  C  CG  . HIS A 1 46 ? -1.023  -3.627  -3.946  1.00 0.00 ? 46 HIS A CG  9  
ATOM   6219  N  ND1 . HIS A 1 46 ? -1.523  -4.389  -4.999  1.00 0.00 ? 46 HIS A ND1 9  
ATOM   6220  C  CD2 . HIS A 1 46 ? -0.167  -2.634  -4.400  1.00 0.00 ? 46 HIS A CD2 9  
ATOM   6221  C  CE1 . HIS A 1 46 ? -0.914  -3.779  -6.034  1.00 0.00 ? 46 HIS A CE1 9  
ATOM   6222  N  NE2 . HIS A 1 46 ? -0.091  -2.730  -5.765  1.00 0.00 ? 46 HIS A NE2 9  
ATOM   6223  N  N   . ALA A 1 47 ? -3.697  -2.167  -2.720  1.00 0.00 ? 47 ALA A N   9  
ATOM   6224  C  CA  . ALA A 1 47 ? -4.745  -1.247  -3.152  1.00 0.00 ? 47 ALA A CA  9  
ATOM   6225  C  C   . ALA A 1 47 ? -4.580  -0.891  -4.610  1.00 0.00 ? 47 ALA A C   9  
ATOM   6226  O  O   . ALA A 1 47 ? -3.553  -1.178  -5.241  1.00 0.00 ? 47 ALA A O   9  
ATOM   6227  C  CB  . ALA A 1 47 ? -4.695  -0.018  -2.228  1.00 0.00 ? 47 ALA A CB  9  
ATOM   6228  N  N   . LEU A 1 48 ? -5.729  -0.213  -5.251  1.00 0.00 ? 48 LEU A N   9  
ATOM   6229  C  CA  . LEU A 1 48 ? -5.641  0.334   -6.603  1.00 0.00 ? 48 LEU A CA  9  
ATOM   6230  C  C   . LEU A 1 48 ? -5.003  1.703   -6.583  1.00 0.00 ? 48 LEU A C   9  
ATOM   6231  O  O   . LEU A 1 48 ? -5.024  2.418   -5.571  1.00 0.00 ? 48 LEU A O   9  
ATOM   6232  C  CB  . LEU A 1 48 ? -7.042  0.365   -7.276  1.00 0.00 ? 48 LEU A CB  9  
ATOM   6233  C  CG  . LEU A 1 48 ? -8.297  0.116   -6.396  1.00 0.00 ? 48 LEU A CG  9  
ATOM   6234  C  CD1 . LEU A 1 48 ? -8.446  1.235   -5.356  1.00 0.00 ? 48 LEU A CD1 9  
ATOM   6235  C  CD2 . LEU A 1 48 ? -9.589  0.007   -7.224  1.00 0.00 ? 48 LEU A CD2 9  
ATOM   6236  N  N   . ARG A 1 49 ? -4.382  2.163   -7.848  1.00 0.00 ? 49 ARG A N   9  
ATOM   6237  C  CA  . ARG A 1 49 ? -3.812  3.498   -7.985  1.00 0.00 ? 49 ARG A CA  9  
ATOM   6238  C  C   . ARG A 1 49 ? -4.891  4.546   -8.134  1.00 0.00 ? 49 ARG A C   9  
ATOM   6239  O  O   . ARG A 1 49 ? -4.606  5.755   -8.198  1.00 0.00 ? 49 ARG A O   9  
ATOM   6240  C  CB  . ARG A 1 49 ? -2.860  3.535   -9.218  1.00 0.00 ? 49 ARG A CB  9  
ATOM   6241  C  CG  . ARG A 1 49 ? -2.311  2.182   -9.734  1.00 0.00 ? 49 ARG A CG  9  
ATOM   6242  C  CD  . ARG A 1 49 ? -2.750  1.865   -11.170 1.00 0.00 ? 49 ARG A CD  9  
ATOM   6243  N  NE  . ARG A 1 49 ? -4.229  1.951   -11.255 1.00 0.00 ? 49 ARG A NE  9  
ATOM   6244  C  CZ  . ARG A 1 49 ? -4.947  1.780   -12.358 1.00 0.00 ? 49 ARG A CZ  9  
ATOM   6245  N  NH1 . ARG A 1 49 ? -4.445  1.519   -13.529 1.00 0.00 ? 49 ARG A NH1 9  
ATOM   6246  N  NH2 . ARG A 1 49 ? -6.226  1.880   -12.255 1.00 0.00 ? 49 ARG A NH2 9  
ATOM   6247  N  N   . GLU A 1 50 ? -6.295  4.084   -8.162  1.00 0.00 ? 50 GLU A N   9  
ATOM   6248  C  CA  . GLU A 1 50 ? -7.409  4.948   -8.527  1.00 0.00 ? 50 GLU A CA  9  
ATOM   6249  C  C   . GLU A 1 50 ? -7.828  5.940   -7.475  1.00 0.00 ? 50 GLU A C   9  
ATOM   6250  O  O   . GLU A 1 50 ? -8.386  7.016   -7.808  1.00 0.00 ? 50 GLU A O   9  
ATOM   6251  C  CB  . GLU A 1 50 ? -8.605  4.041   -8.952  1.00 0.00 ? 50 GLU A CB  9  
ATOM   6252  C  CG  . GLU A 1 50 ? -9.858  4.017   -8.017  1.00 0.00 ? 50 GLU A CG  9  
ATOM   6253  C  CD  . GLU A 1 50 ? -11.095 4.814   -8.440  1.00 0.00 ? 50 GLU A CD  9  
ATOM   6254  O  OE1 . GLU A 1 50 ? -11.320 5.127   -9.601  1.00 0.00 ? 50 GLU A OE1 9  
ATOM   6255  O  OE2 . GLU A 1 50 ? -11.917 5.138   -7.404  1.00 0.00 ? 50 GLU A OE2 9  
ATOM   6256  N  N   . ASN A 1 51 ? -7.540  5.644   -6.067  1.00 0.00 ? 51 ASN A N   9  
ATOM   6257  C  CA  . ASN A 1 51 ? -8.066  6.471   -4.953  1.00 0.00 ? 51 ASN A CA  9  
ATOM   6258  C  C   . ASN A 1 51 ? -6.894  6.775   -4.037  1.00 0.00 ? 51 ASN A C   9  
ATOM   6259  O  O   . ASN A 1 51 ? -7.050  7.118   -2.856  1.00 0.00 ? 51 ASN A O   9  
ATOM   6260  C  CB  . ASN A 1 51 ? -9.038  5.546   -4.174  1.00 0.00 ? 51 ASN A CB  9  
ATOM   6261  C  CG  . ASN A 1 51 ? -8.372  4.509   -3.240  1.00 0.00 ? 51 ASN A CG  9  
ATOM   6262  O  OD1 . ASN A 1 51 ? -7.699  3.581   -3.658  1.00 0.00 ? 51 ASN A OD1 9  
ATOM   6263  N  ND2 . ASN A 1 51 ? -8.564  4.641   -1.956  1.00 0.00 ? 51 ASN A ND2 9  
ATOM   6264  N  N   . VAL A 1 52 ? -5.553  6.578   -4.627  1.00 0.00 ? 52 VAL A N   9  
ATOM   6265  C  CA  . VAL A 1 52 ? -4.347  6.474   -3.808  1.00 0.00 ? 52 VAL A CA  9  
ATOM   6266  C  C   . VAL A 1 52 ? -3.640  7.802   -3.753  1.00 0.00 ? 52 VAL A C   9  
ATOM   6267  O  O   . VAL A 1 52 ? -3.724  8.583   -4.746  1.00 0.00 ? 52 VAL A O   9  
ATOM   6268  C  CB  . VAL A 1 52 ? -3.416  5.331   -4.384  1.00 0.00 ? 52 VAL A CB  9  
ATOM   6269  C  CG1 . VAL A 1 52 ? -2.326  5.760   -5.402  1.00 0.00 ? 52 VAL A CG1 9  
ATOM   6270  C  CG2 . VAL A 1 52 ? -2.664  4.535   -3.284  1.00 0.00 ? 52 VAL A CG2 9  
ATOM   6271  N  N   . SER A 1 53 ? -2.844  8.190   -2.572  1.00 0.00 ? 53 SER A N   9  
ATOM   6272  C  CA  . SER A 1 53 ? -2.170  9.487   -2.481  1.00 0.00 ? 53 SER A CA  9  
ATOM   6273  C  C   . SER A 1 53 ? -0.721  9.344   -2.083  1.00 0.00 ? 53 SER A C   9  
ATOM   6274  O  O   . SER A 1 53 ? -0.379  8.723   -1.067  1.00 0.00 ? 53 SER A O   9  
ATOM   6275  C  CB  . SER A 1 53 ? -2.939  10.449  -1.543  1.00 0.00 ? 53 SER A CB  9  
ATOM   6276  O  OG  . SER A 1 53 ? -2.322  11.738  -1.441  1.00 0.00 ? 53 SER A OG  9  
ATOM   6277  N  N   . PHE A 1 54 ? 0.271   10.022  -2.952  1.00 0.00 ? 54 PHE A N   9  
ATOM   6278  C  CA  . PHE A 1 54 ? 1.706   9.825   -2.781  1.00 0.00 ? 54 PHE A CA  9  
ATOM   6279  C  C   . PHE A 1 54 ? 2.359   11.002  -2.090  1.00 0.00 ? 54 PHE A C   9  
ATOM   6280  O  O   . PHE A 1 54 ? 2.161   12.174  -2.437  1.00 0.00 ? 54 PHE A O   9  
ATOM   6281  C  CB  . PHE A 1 54 ? 2.399   9.612   -4.161  1.00 0.00 ? 54 PHE A CB  9  
ATOM   6282  C  CG  . PHE A 1 54 ? 1.821   8.511   -5.063  1.00 0.00 ? 54 PHE A CG  9  
ATOM   6283  C  CD1 . PHE A 1 54 ? 0.445   8.411   -5.282  1.00 0.00 ? 54 PHE A CD1 9  
ATOM   6284  C  CD2 . PHE A 1 54 ? 2.685   7.599   -5.681  1.00 0.00 ? 54 PHE A CD2 9  
ATOM   6285  C  CE1 . PHE A 1 54 ? -0.060  7.410   -6.108  1.00 0.00 ? 54 PHE A CE1 9  
ATOM   6286  C  CE2 . PHE A 1 54 ? 2.179   6.600   -6.504  1.00 0.00 ? 54 PHE A CE2 9  
ATOM   6287  C  CZ  . PHE A 1 54 ? 0.807   6.505   -6.719  1.00 0.00 ? 54 PHE A CZ  9  
ATOM   6288  N  N   . TYR A 1 55 ? 3.276   10.669  -0.980  1.00 0.00 ? 55 TYR A N   9  
ATOM   6289  C  CA  . TYR A 1 55 ? 4.121   11.642  -0.286  1.00 0.00 ? 55 TYR A CA  9  
ATOM   6290  C  C   . TYR A 1 55 ? 5.572   11.231  -0.355  1.00 0.00 ? 55 TYR A C   9  
ATOM   6291  O  O   . TYR A 1 55 ? 5.884   10.071  -0.717  1.00 0.00 ? 55 TYR A O   9  
ATOM   6292  C  CB  . TYR A 1 55 ? 3.721   11.672  1.225   1.00 0.00 ? 55 TYR A CB  9  
ATOM   6293  C  CG  . TYR A 1 55 ? 2.242   11.359  1.520   1.00 0.00 ? 55 TYR A CG  9  
ATOM   6294  C  CD1 . TYR A 1 55 ? 1.777   10.050  1.648   1.00 0.00 ? 55 TYR A CD1 9  
ATOM   6295  C  CD2 . TYR A 1 55 ? 1.340   12.431  1.655   1.00 0.00 ? 55 TYR A CD2 9  
ATOM   6296  C  CE1 . TYR A 1 55 ? 0.431   9.808   1.909   1.00 0.00 ? 55 TYR A CE1 9  
ATOM   6297  C  CE2 . TYR A 1 55 ? -0.004  12.182  1.916   1.00 0.00 ? 55 TYR A CE2 9  
ATOM   6298  C  CZ  . TYR A 1 55 ? -0.457  10.872  2.042   1.00 0.00 ? 55 TYR A CZ  9  
ATOM   6299  O  OH  . TYR A 1 55 ? -1.779  10.633  2.294   1.00 0.00 ? 55 TYR A OH  9  
ATOM   6300  N  N   . ALA A 1 56 ? 6.638   12.206  -0.033  1.00 0.00 ? 56 ALA A N   9  
ATOM   6301  C  CA  . ALA A 1 56 ? 8.043   11.822  0.109   1.00 0.00 ? 56 ALA A CA  9  
ATOM   6302  C  C   . ALA A 1 56 ? 8.336   11.181  1.445   1.00 0.00 ? 56 ALA A C   9  
ATOM   6303  O  O   . ALA A 1 56 ? 9.278   10.370  1.570   1.00 0.00 ? 56 ALA A O   9  
ATOM   6304  C  CB  . ALA A 1 56 ? 8.895   13.080  -0.142  1.00 0.00 ? 56 ALA A CB  9  
ATOM   6305  N  N   . ASN A 1 57 ? 7.506   11.571  2.605   1.00 0.00 ? 57 ASN A N   9  
ATOM   6306  C  CA  . ASN A 1 57 ? 7.709   10.986  3.930   1.00 0.00 ? 57 ASN A CA  9  
ATOM   6307  C  C   . ASN A 1 57 ? 6.406   10.836  4.679   1.00 0.00 ? 57 ASN A C   9  
ATOM   6308  O  O   . ASN A 1 57 ? 5.466   11.627  4.519   1.00 0.00 ? 57 ASN A O   9  
ATOM   6309  C  CB  . ASN A 1 57 ? 8.710   11.862  4.738   1.00 0.00 ? 57 ASN A CB  9  
ATOM   6310  C  CG  . ASN A 1 57 ? 8.907   11.509  6.217   1.00 0.00 ? 57 ASN A CG  9  
ATOM   6311  O  OD1 . ASN A 1 57 ? 8.655   12.297  7.117   1.00 0.00 ? 57 ASN A OD1 9  
ATOM   6312  N  ND2 . ASN A 1 57 ? 9.375   10.330  6.523   1.00 0.00 ? 57 ASN A ND2 9  
ATOM   6313  N  N   . ALA A 1 58 ? 6.302   9.678   5.595   1.00 0.00 ? 58 ALA A N   9  
ATOM   6314  C  CA  . ALA A 1 58 ? 5.106   9.412   6.389   1.00 0.00 ? 58 ALA A CA  9  
ATOM   6315  C  C   . ALA A 1 58 ? 4.636   10.643  7.127   1.00 0.00 ? 58 ALA A C   9  
ATOM   6316  O  O   . ALA A 1 58 ? 3.429   10.857  7.316   1.00 0.00 ? 58 ALA A O   9  
ATOM   6317  C  CB  . ALA A 1 58 ? 5.420   8.239   7.337   1.00 0.00 ? 58 ALA A CB  9  
ATOM   6318  N  N   . SER A 1 59 ? 5.679   11.555  7.644   1.00 0.00 ? 59 SER A N   9  
ATOM   6319  C  CA  . SER A 1 59 ? 5.374   12.684  8.518   1.00 0.00 ? 59 SER A CA  9  
ATOM   6320  C  C   . SER A 1 59 ? 4.142   13.427  8.058   1.00 0.00 ? 59 SER A C   9  
ATOM   6321  O  O   . SER A 1 59 ? 3.255   13.782  8.847   1.00 0.00 ? 59 SER A O   9  
ATOM   6322  C  CB  . SER A 1 59 ? 6.594   13.635  8.634   1.00 0.00 ? 59 SER A CB  9  
ATOM   6323  O  OG  . SER A 1 59 ? 7.463   13.299  9.721   1.00 0.00 ? 59 SER A OG  9  
ATOM   6324  N  N   . GLU A 1 60 ? 4.074   13.745  6.614   1.00 0.00 ? 60 GLU A N   9  
ATOM   6325  C  CA  . GLU A 1 60 ? 2.930   14.425  6.020   1.00 0.00 ? 60 GLU A CA  9  
ATOM   6326  C  C   . GLU A 1 60 ? 1.683   13.575  5.955   1.00 0.00 ? 60 GLU A C   9  
ATOM   6327  O  O   . GLU A 1 60 ? 0.561   14.089  6.162   1.00 0.00 ? 60 GLU A O   9  
ATOM   6328  C  CB  . GLU A 1 60 ? 3.336   14.924  4.602   1.00 0.00 ? 60 GLU A CB  9  
ATOM   6329  C  CG  . GLU A 1 60 ? 4.113   13.917  3.692   1.00 0.00 ? 60 GLU A CG  9  
ATOM   6330  C  CD  . GLU A 1 60 ? 5.228   14.457  2.795   1.00 0.00 ? 60 GLU A CD  9  
ATOM   6331  O  OE1 . GLU A 1 60 ? 4.795   14.874  1.572   1.00 0.00 ? 60 GLU A OE1 9  
ATOM   6332  O  OE2 . GLU A 1 60 ? 6.399   14.509  3.145   1.00 0.00 ? 60 GLU A OE2 9  
ATOM   6333  N  N   . ALA A 1 61 ? 1.806   12.146  5.596   1.00 0.00 ? 61 ALA A N   9  
ATOM   6334  C  CA  . ALA A 1 61 ? 0.654   11.251  5.570   1.00 0.00 ? 61 ALA A CA  9  
ATOM   6335  C  C   . ALA A 1 61 ? -0.037  11.109  6.904   1.00 0.00 ? 61 ALA A C   9  
ATOM   6336  O  O   . ALA A 1 61 ? -1.270  10.886  6.950   1.00 0.00 ? 61 ALA A O   9  
ATOM   6337  C  CB  . ALA A 1 61 ? 1.110   9.902   4.990   1.00 0.00 ? 61 ALA A CB  9  
ATOM   6338  N  N   . LEU A 1 62 ? 0.763   11.187  8.145   1.00 0.00 ? 62 LEU A N   9  
ATOM   6339  C  CA  . LEU A 1 62 ? 0.132   11.235  9.465   1.00 0.00 ? 62 LEU A CA  9  
ATOM   6340  C  C   . LEU A 1 62 ? -0.422  12.613  9.736   1.00 0.00 ? 62 LEU A C   9  
ATOM   6341  O  O   . LEU A 1 62 ? -1.521  12.770  10.295  1.00 0.00 ? 62 LEU A O   9  
ATOM   6342  C  CB  . LEU A 1 62 ? 1.093   10.766  10.590  1.00 0.00 ? 62 LEU A CB  9  
ATOM   6343  C  CG  . LEU A 1 62 ? 2.603   11.116  10.517  1.00 0.00 ? 62 LEU A CG  9  
ATOM   6344  C  CD1 . LEU A 1 62 ? 2.986   12.045  11.677  1.00 0.00 ? 62 LEU A CD1 9  
ATOM   6345  C  CD2 . LEU A 1 62 ? 3.503   9.868   10.538  1.00 0.00 ? 62 LEU A CD2 9  
ATOM   6346  N  N   . ALA A 1 63 ? 0.420   13.764  9.348   1.00 0.00 ? 63 ALA A N   9  
ATOM   6347  C  CA  . ALA A 1 63 ? -0.091  15.136  9.386   1.00 0.00 ? 63 ALA A CA  9  
ATOM   6348  C  C   . ALA A 1 63 ? -1.370  15.244  8.590   1.00 0.00 ? 63 ALA A C   9  
ATOM   6349  O  O   . ALA A 1 63 ? -2.236  16.090  8.850   1.00 0.00 ? 63 ALA A O   9  
ATOM   6350  C  CB  . ALA A 1 63 ? 1.016   16.074  8.876   1.00 0.00 ? 63 ALA A CB  9  
ATOM   6351  N  N   . ALA A 1 64 ? -1.541  14.257  7.498   1.00 0.00 ? 64 ALA A N   9  
ATOM   6352  C  CA  . ALA A 1 64 ? -2.792  14.119  6.759   1.00 0.00 ? 64 ALA A CA  9  
ATOM   6353  C  C   . ALA A 1 64 ? -3.863  13.566  7.686   1.00 0.00 ? 64 ALA A C   9  
ATOM   6354  O  O   . ALA A 1 64 ? -5.033  13.963  7.671   1.00 0.00 ? 64 ALA A O   9  
ATOM   6355  C  CB  . ALA A 1 64 ? -2.527  13.209  5.550   1.00 0.00 ? 64 ALA A CB  9  
ATOM   6356  N  N   . GLY A 1 65 ? -3.377  12.537  8.639   1.00 0.00 ? 65 GLY A N   9  
ATOM   6357  C  CA  . GLY A 1 65 ? -4.220  12.012  9.710   1.00 0.00 ? 65 GLY A CA  9  
ATOM   6358  C  C   . GLY A 1 65 ? -4.678  10.607  9.349   1.00 0.00 ? 65 GLY A C   9  
ATOM   6359  O  O   . GLY A 1 65 ? -5.802  10.180  9.638   1.00 0.00 ? 65 GLY A O   9  
ATOM   6360  N  N   . PHE A 1 66 ? -3.691  9.807   8.589   1.00 0.00 ? 66 PHE A N   9  
ATOM   6361  C  CA  . PHE A 1 66 ? -4.018  8.514   8.001   1.00 0.00 ? 66 PHE A CA  9  
ATOM   6362  C  C   . PHE A 1 66 ? -3.449  7.367   8.796   1.00 0.00 ? 66 PHE A C   9  
ATOM   6363  O  O   . PHE A 1 66 ? -2.838  7.569   9.867   1.00 0.00 ? 66 PHE A O   9  
ATOM   6364  C  CB  . PHE A 1 66 ? -3.478  8.456   6.536   1.00 0.00 ? 66 PHE A CB  9  
ATOM   6365  C  CG  . PHE A 1 66 ? -4.252  7.530   5.587   1.00 0.00 ? 66 PHE A CG  9  
ATOM   6366  C  CD1 . PHE A 1 66 ? -5.562  7.156   5.925   1.00 0.00 ? 66 PHE A CD1 9  
ATOM   6367  C  CD2 . PHE A 1 66 ? -3.678  7.041   4.414   1.00 0.00 ? 66 PHE A CD2 9  
ATOM   6368  C  CE1 . PHE A 1 66 ? -6.282  6.303   5.098   1.00 0.00 ? 66 PHE A CE1 9  
ATOM   6369  C  CE2 . PHE A 1 66 ? -4.401  6.185   3.586   1.00 0.00 ? 66 PHE A CE2 9  
ATOM   6370  C  CZ  . PHE A 1 66 ? -5.699  5.816   3.931   1.00 0.00 ? 66 PHE A CZ  9  
ATOM   6371  N  N   . ARG A 1 67 ? -3.607  5.999   8.254   1.00 0.00 ? 67 ARG A N   9  
ATOM   6372  C  CA  . ARG A 1 67 ? -3.243  4.822   9.044   1.00 0.00 ? 67 ARG A CA  9  
ATOM   6373  C  C   . ARG A 1 67 ? -1.860  4.310   8.724   1.00 0.00 ? 67 ARG A C   9  
ATOM   6374  O  O   . ARG A 1 67 ? -1.612  3.678   7.690   1.00 0.00 ? 67 ARG A O   9  
ATOM   6375  C  CB  . ARG A 1 67 ? -4.321  3.720   8.858   1.00 0.00 ? 67 ARG A CB  9  
ATOM   6376  C  CG  . ARG A 1 67 ? -4.077  2.429   9.686   1.00 0.00 ? 67 ARG A CG  9  
ATOM   6377  C  CD  . ARG A 1 67 ? -3.022  2.628   10.781  1.00 0.00 ? 67 ARG A CD  9  
ATOM   6378  N  NE  . ARG A 1 67 ? -3.161  1.533   11.774  1.00 0.00 ? 67 ARG A NE  9  
ATOM   6379  C  CZ  . ARG A 1 67 ? -3.682  1.656   12.988  1.00 0.00 ? 67 ARG A CZ  9  
ATOM   6380  N  NH1 . ARG A 1 67 ? -4.152  2.765   13.476  1.00 0.00 ? 67 ARG A NH1 9  
ATOM   6381  N  NH2 . ARG A 1 67 ? -3.722  0.603   13.726  1.00 0.00 ? 67 ARG A NH2 9  
ATOM   6382  N  N   . PRO A 1 68 ? -0.815  4.586   9.740   1.00 0.00 ? 68 PRO A N   9  
ATOM   6383  C  CA  . PRO A 1 68 ? 0.658   4.175   9.678   1.00 0.00 ? 68 PRO A CA  9  
ATOM   6384  C  C   . PRO A 1 68 ? 0.900   2.714   9.356   1.00 0.00 ? 68 PRO A C   9  
ATOM   6385  O  O   . PRO A 1 68 ? 0.568   1.826   10.167  1.00 0.00 ? 68 PRO A O   9  
ATOM   6386  C  CB  . PRO A 1 68 ? 1.230   4.439   11.074  1.00 0.00 ? 68 PRO A CB  9  
ATOM   6387  C  CG  . PRO A 1 68 ? 0.406   5.665   11.495  1.00 0.00 ? 68 PRO A CG  9  
ATOM   6388  C  CD  . PRO A 1 68 ? -1.009  5.323   11.015  1.00 0.00 ? 68 PRO A CD  9  
ATOM   6389  N  N   . CYS A 1 69 ? 1.568   2.369   8.084   1.00 0.00 ? 69 CYS A N   9  
ATOM   6390  C  CA  . CYS A 1 69 ? 2.014   1.013   7.741   1.00 0.00 ? 69 CYS A CA  9  
ATOM   6391  C  C   . CYS A 1 69 ? 3.484   1.047   7.372   1.00 0.00 ? 69 CYS A C   9  
ATOM   6392  O  O   . CYS A 1 69 ? 3.920   1.397   6.268   1.00 0.00 ? 69 CYS A O   9  
ATOM   6393  C  CB  . CYS A 1 69 ? 1.065   0.473   6.659   1.00 0.00 ? 69 CYS A CB  9  
ATOM   6394  S  SG  . CYS A 1 69 ? 1.184   -1.304  6.386   1.00 0.00 ? 69 CYS A SG  9  
ATOM   6395  N  N   . LYS A 1 70 ? 4.409   0.663   8.483   1.00 0.00 ? 70 LYS A N   9  
ATOM   6396  C  CA  . LYS A 1 70 ? 5.857   0.795   8.402   1.00 0.00 ? 70 LYS A CA  9  
ATOM   6397  C  C   . LYS A 1 70 ? 6.452   -0.305  7.554   1.00 0.00 ? 70 LYS A C   9  
ATOM   6398  O  O   . LYS A 1 70 ? 6.585   -0.165  6.324   1.00 0.00 ? 70 LYS A O   9  
ATOM   6399  C  CB  . LYS A 1 70 ? 6.467   0.783   9.831   1.00 0.00 ? 70 LYS A CB  9  
ATOM   6400  C  CG  . LYS A 1 70 ? 8.016   0.786   9.838   1.00 0.00 ? 70 LYS A CG  9  
ATOM   6401  C  CD  . LYS A 1 70 ? 8.655   1.089   11.196  1.00 0.00 ? 70 LYS A CD  9  
ATOM   6402  C  CE  . LYS A 1 70 ? 10.139  1.425   10.993  1.00 0.00 ? 70 LYS A CE  9  
ATOM   6403  N  NZ  . LYS A 1 70 ? 10.836  1.365   12.290  1.00 0.00 ? 70 LYS A NZ  9  
ATOM   6404  N  N   . ARG A 1 71 ? 6.901   -1.528  8.251   1.00 0.00 ? 71 ARG A N   9  
ATOM   6405  C  CA  . ARG A 1 71 ? 7.308   -2.720  7.489   1.00 0.00 ? 71 ARG A CA  9  
ATOM   6406  C  C   . ARG A 1 71 ? 6.139   -3.128  6.612   1.00 0.00 ? 71 ARG A C   9  
ATOM   6407  O  O   . ARG A 1 71 ? 6.190   -3.030  5.382   1.00 0.00 ? 71 ARG A O   9  
ATOM   6408  C  CB  . ARG A 1 71 ? 7.714   -3.841  8.474   1.00 0.00 ? 71 ARG A CB  9  
ATOM   6409  C  CG  . ARG A 1 71 ? 9.221   -4.217  8.476   1.00 0.00 ? 71 ARG A CG  9  
ATOM   6410  C  CD  . ARG A 1 71 ? 9.924   -3.837  9.786   1.00 0.00 ? 71 ARG A CD  9  
ATOM   6411  N  NE  . ARG A 1 71 ? 9.098   -4.311  10.925  1.00 0.00 ? 71 ARG A NE  9  
ATOM   6412  C  CZ  . ARG A 1 71 ? 9.563   -4.670  12.115  1.00 0.00 ? 71 ARG A CZ  9  
ATOM   6413  N  NH1 . ARG A 1 71 ? 10.820  -4.659  12.446  1.00 0.00 ? 71 ARG A NH1 9  
ATOM   6414  N  NH2 . ARG A 1 71 ? 8.706   -5.053  12.995  1.00 0.00 ? 71 ARG A NH2 9  
ATOM   6415  N  N   . CYS A 1 72 ? 4.970   -3.685  7.327   1.00 0.00 ? 72 CYS A N   9  
ATOM   6416  C  CA  . CYS A 1 72 ? 3.671   -3.923  6.717   1.00 0.00 ? 72 CYS A CA  9  
ATOM   6417  C  C   . CYS A 1 72 ? 2.718   -4.531  7.751   1.00 0.00 ? 72 CYS A C   9  
ATOM   6418  O  O   . CYS A 1 72 ? 2.308   -5.696  7.720   1.00 0.00 ? 72 CYS A O   9  
ATOM   6419  C  CB  . CYS A 1 72 ? 3.814   -4.698  5.398   1.00 0.00 ? 72 CYS A CB  9  
ATOM   6420  S  SG  . CYS A 1 72 ? 3.654   -3.538  3.989   1.00 0.00 ? 72 CYS A SG  9  
ATOM   6421  N  N   . GLN A 1 73 ? 2.351   -3.603  8.839   1.00 0.00 ? 73 GLN A N   9  
ATOM   6422  C  CA  . GLN A 1 73 ? 1.637   -3.979  10.072  1.00 0.00 ? 73 GLN A CA  9  
ATOM   6423  C  C   . GLN A 1 73 ? 0.508   -4.948  9.909   1.00 0.00 ? 73 GLN A C   9  
ATOM   6424  O  O   . GLN A 1 73 ? 0.732   -6.187  9.838   1.00 0.00 ? 73 GLN A O   9  
ATOM   6425  C  CB  . GLN A 1 73 ? 1.188   -2.657  10.785  1.00 0.00 ? 73 GLN A CB  9  
ATOM   6426  C  CG  . GLN A 1 73 ? 0.886   -2.795  12.311  1.00 0.00 ? 73 GLN A CG  9  
ATOM   6427  C  CD  . GLN A 1 73 ? 2.026   -3.170  13.268  1.00 0.00 ? 73 GLN A CD  9  
ATOM   6428  O  OE1 . GLN A 1 73 ? 1.808   -3.787  14.299  1.00 0.00 ? 73 GLN A OE1 9  
ATOM   6429  N  NE2 . GLN A 1 73 ? 3.260   -2.851  12.970  1.00 0.00 ? 73 GLN A NE2 9  
ATOM   6430  N  N   . PRO A 1 74 ? -0.880  -4.446  9.862   1.00 0.00 ? 74 PRO A N   9  
ATOM   6431  C  CA  . PRO A 1 74 ? -2.165  -5.269  9.770   1.00 0.00 ? 74 PRO A CA  9  
ATOM   6432  C  C   . PRO A 1 74 ? -2.512  -5.908  8.437   1.00 0.00 ? 74 PRO A C   9  
ATOM   6433  O  O   . PRO A 1 74 ? -1.872  -5.706  7.398   1.00 0.00 ? 74 PRO A O   9  
ATOM   6434  C  CB  . PRO A 1 74 ? -3.319  -4.355  10.158  1.00 0.00 ? 74 PRO A CB  9  
ATOM   6435  C  CG  . PRO A 1 74 ? -2.646  -3.078  10.679  1.00 0.00 ? 74 PRO A CG  9  
ATOM   6436  C  CD  . PRO A 1 74 ? -1.312  -3.025  9.921   1.00 0.00 ? 74 PRO A CD  9  
ATOM   6437  N  N   . ASP A 1 75 ? -3.717  -6.776  8.461   1.00 0.00 ? 75 ASP A N   9  
ATOM   6438  C  CA  . ASP A 1 75 ? -4.316  -7.343  7.259   1.00 0.00 ? 75 ASP A CA  9  
ATOM   6439  C  C   . ASP A 1 75 ? -5.827  -7.315  7.349   1.00 0.00 ? 75 ASP A C   9  
ATOM   6440  O  O   . ASP A 1 75 ? -6.517  -6.562  6.647   1.00 0.00 ? 75 ASP A O   9  
ATOM   6441  C  CB  . ASP A 1 75 ? -3.785  -8.779  7.015   1.00 0.00 ? 75 ASP A CB  9  
ATOM   6442  C  CG  . ASP A 1 75 ? -3.227  -9.528  8.234   1.00 0.00 ? 75 ASP A CG  9  
ATOM   6443  O  OD1 . ASP A 1 75 ? -1.969  -9.118  8.577   1.00 0.00 ? 75 ASP A OD1 9  
ATOM   6444  O  OD2 . ASP A 1 75 ? -3.844  -10.410 8.813   1.00 0.00 ? 75 ASP A OD2 9  
ATOM   6445  N  N   . LYS A 1 76 ? -6.437  -8.215  8.355   1.00 0.00 ? 76 LYS A N   9  
ATOM   6446  C  CA  . LYS A 1 76 ? -7.883  -8.359  8.488   1.00 0.00 ? 76 LYS A CA  9  
ATOM   6447  C  C   . LYS A 1 76 ? -8.420  -7.529  9.631   1.00 0.00 ? 76 LYS A C   9  
ATOM   6448  O  O   . LYS A 1 76 ? -9.450  -6.843  9.500   1.00 0.00 ? 76 LYS A O   9  
ATOM   6449  C  CB  . LYS A 1 76 ? -8.243  -9.859  8.675   1.00 0.00 ? 76 LYS A CB  9  
ATOM   6450  C  CG  . LYS A 1 76 ? -8.192  -10.334 10.148  1.00 0.00 ? 76 LYS A CG  9  
ATOM   6451  C  CD  . LYS A 1 76 ? -8.130  -11.853 10.333  1.00 0.00 ? 76 LYS A CD  9  
ATOM   6452  C  CE  . LYS A 1 76 ? -9.556  -12.420 10.361  1.00 0.00 ? 76 LYS A CE  9  
ATOM   6453  N  NZ  . LYS A 1 76 ? -9.934  -12.729 11.751  1.00 0.00 ? 76 LYS A NZ  9  
ATOM   6454  N  N   . ALA A 1 77 ? -7.693  -7.599  10.912  1.00 0.00 ? 77 ALA A N   9  
ATOM   6455  C  CA  . ALA A 1 77 ? -8.192  -6.981  12.144  1.00 0.00 ? 77 ALA A CA  9  
ATOM   6456  C  C   . ALA A 1 77 ? -7.246  -7.172  13.312  1.00 0.00 ? 77 ALA A C   9  
ATOM   6457  O  O   . ALA A 1 77 ? -7.528  -7.917  14.260  1.00 0.00 ? 77 ALA A O   9  
ATOM   6458  C  CB  . ALA A 1 77 ? -9.606  -7.518  12.411  1.00 0.00 ? 77 ALA A CB  9  
ATOM   6459  N  N   . ASN A 1 78 ? -5.993  -6.389  13.268  1.00 0.00 ? 78 ASN A N   9  
ATOM   6460  C  CA  . ASN A 1 78 ? -5.062  -6.337  14.392  1.00 0.00 ? 78 ASN A CA  9  
ATOM   6461  C  C   . ASN A 1 78 ? -4.842  -7.707  14.988  1.00 0.00 ? 78 ASN A C   9  
ATOM   6462  O  O   . ASN A 1 78 ? -4.932  -7.909  16.207  1.00 0.00 ? 78 ASN A O   9  
ATOM   6463  C  CB  . ASN A 1 78 ? -5.600  -5.348  15.467  1.00 0.00 ? 78 ASN A CB  9  
ATOM   6464  C  CG  . ASN A 1 78 ? -5.421  -3.853  15.187  1.00 0.00 ? 78 ASN A CG  9  
ATOM   6465  O  OD1 . ASN A 1 78 ? -4.373  -3.266  15.412  1.00 0.00 ? 78 ASN A OD1 9  
ATOM   6466  N  ND2 . ASN A 1 78 ? -6.421  -3.185  14.679  1.00 0.00 ? 78 ASN A ND2 9  
ATOM   6467  N  N   . PRO A 1 79 ? -4.546  -8.792  14.029  1.00 0.00 ? 79 PRO A N   9  
ATOM   6468  C  CA  . PRO A 1 79 ? -4.268  -10.260 14.362  1.00 0.00 ? 79 PRO A CA  9  
ATOM   6469  C  C   . PRO A 1 79 ? -3.141  -10.479 15.354  1.00 0.00 ? 79 PRO A C   9  
ATOM   6470  O  O   . PRO A 1 79 ? -2.891  -9.641  16.236  1.00 0.00 ? 79 PRO A O   9  
ATOM   6471  C  CB  . PRO A 1 79 ? -3.901  -10.948 13.056  1.00 0.00 ? 79 PRO A CB  9  
ATOM   6472  C  CG  . PRO A 1 79 ? -4.652  -10.091 12.025  1.00 0.00 ? 79 PRO A CG  9  
ATOM   6473  C  CD  . PRO A 1 79 ? -4.464  -8.662  12.552  1.00 0.00 ? 79 PRO A CD  9  
ATOM   6474  N  N   . ARG A 1 80 ? -2.334  -11.707 15.203  1.00 0.00 ? 80 ARG A N   9  
ATOM   6475  C  CA  . ARG A 1 80 ? -1.149  -11.958 16.030  1.00 0.00 ? 80 ARG A CA  9  
ATOM   6476  C  C   . ARG A 1 80 ? -0.238  -12.962 15.361  1.00 0.00 ? 80 ARG A C   9  
ATOM   6477  O  O   . ARG A 1 80 ? -0.687  -13.904 14.694  1.00 0.00 ? 80 ARG A O   9  
ATOM   6478  C  CB  . ARG A 1 80 ? -1.600  -12.436 17.435  1.00 0.00 ? 80 ARG A CB  9  
ATOM   6479  C  CG  . ARG A 1 80 ? -1.185  -13.887 17.799  1.00 0.00 ? 80 ARG A CG  9  
ATOM   6480  C  CD  . ARG A 1 80 ? -1.327  -14.183 19.297  1.00 0.00 ? 80 ARG A CD  9  
ATOM   6481  N  NE  . ARG A 1 80 ? -2.536  -15.022 19.496  1.00 0.00 ? 80 ARG A NE  9  
ATOM   6482  C  CZ  . ARG A 1 80 ? -2.576  -16.345 19.424  1.00 0.00 ? 80 ARG A CZ  9  
ATOM   6483  N  NH1 . ARG A 1 80 ? -1.549  -17.097 19.160  1.00 0.00 ? 80 ARG A NH1 9  
ATOM   6484  N  NH2 . ARG A 1 80 ? -3.709  -16.917 19.631  1.00 0.00 ? 80 ARG A NH2 9  
ATOM   6485  N  N   . GLN A 1 81 ? 1.212   -12.779 15.582  1.00 0.00 ? 81 GLN A N   9  
ATOM   6486  C  CA  . GLN A 1 81 ? 2.220   -13.558 14.866  1.00 0.00 ? 81 GLN A CA  9  
ATOM   6487  C  C   . GLN A 1 81 ? 3.613   -13.114 15.252  1.00 0.00 ? 81 GLN A C   9  
ATOM   6488  O  O   . GLN A 1 81 ? 4.059   -12.008 14.919  1.00 0.00 ? 81 GLN A O   9  
ATOM   6489  C  CB  . GLN A 1 81 ? 1.992   -13.399 13.348  1.00 0.00 ? 81 GLN A CB  9  
ATOM   6490  C  CG  . GLN A 1 81 ? 2.942   -14.222 12.416  1.00 0.00 ? 81 GLN A CG  9  
ATOM   6491  C  CD  . GLN A 1 81 ? 2.508   -14.507 10.973  1.00 0.00 ? 81 GLN A CD  9  
ATOM   6492  O  OE1 . GLN A 1 81 ? 2.895   -13.811 10.047  1.00 0.00 ? 81 GLN A OE1 9  
ATOM   6493  N  NE2 . GLN A 1 81 ? 1.702   -15.506 10.718  1.00 0.00 ? 81 GLN A NE2 9  
ATOM   6494  N  N   . HIS A 1 82 ? 4.398   -14.062 16.071  1.00 0.00 ? 82 HIS A N   9  
ATOM   6495  C  CA  . HIS A 1 82 ? 5.732   -13.736 16.568  1.00 0.00 ? 82 HIS A CA  9  
ATOM   6496  C  C   . HIS A 1 82 ? 6.790   -14.080 15.546  1.00 0.00 ? 82 HIS A C   9  
ATOM   6497  O  O   . HIS A 1 82 ? 7.206   -13.245 14.732  1.00 0.00 ? 82 HIS A O   9  
ATOM   6498  C  CB  . HIS A 1 82 ? 5.932   -14.567 17.846  1.00 0.00 ? 82 HIS A CB  9  
ATOM   6499  C  CG  . HIS A 1 82 ? 5.187   -14.000 19.019  1.00 0.00 ? 82 HIS A CG  9  
ATOM   6500  N  ND1 . HIS A 1 82 ? 5.284   -14.440 20.336  1.00 0.00 ? 82 HIS A ND1 9  
ATOM   6501  C  CD2 . HIS A 1 82 ? 4.293   -12.945 18.900  1.00 0.00 ? 82 HIS A CD2 9  
ATOM   6502  C  CE1 . HIS A 1 82 ? 4.421   -13.592 20.926  1.00 0.00 ? 82 HIS A CE1 9  
ATOM   6503  N  NE2 . HIS A 1 82 ? 3.790   -12.673 20.145  1.00 0.00 ? 82 HIS A NE2 9  
ATOM   6504  N  N   . ARG A 1 83 ? 7.316   -15.462 15.588  1.00 0.00 ? 83 ARG A N   9  
ATOM   6505  C  CA  . ARG A 1 83 ? 8.441   -15.887 14.760  1.00 0.00 ? 83 ARG A CA  9  
ATOM   6506  C  C   . ARG A 1 83 ? 8.673   -17.375 14.887  1.00 0.00 ? 83 ARG A C   9  
ATOM   6507  O  O   . ARG A 1 83 ? 8.391   -17.993 15.923  1.00 0.00 ? 83 ARG A O   9  
ATOM   6508  C  CB  . ARG A 1 83 ? 9.702   -15.080 15.171  1.00 0.00 ? 83 ARG A CB  9  
ATOM   6509  C  CG  . ARG A 1 83 ? 10.476  -15.651 16.389  1.00 0.00 ? 83 ARG A CG  9  
ATOM   6510  C  CD  . ARG A 1 83 ? 11.301  -14.581 17.116  1.00 0.00 ? 83 ARG A CD  9  
ATOM   6511  N  NE  . ARG A 1 83 ? 12.580  -14.400 16.384  1.00 0.00 ? 83 ARG A NE  9  
ATOM   6512  C  CZ  . ARG A 1 83 ? 12.793  -13.525 15.410  1.00 0.00 ? 83 ARG A CZ  9  
ATOM   6513  N  NH1 . ARG A 1 83 ? 11.896  -12.699 14.958  1.00 0.00 ? 83 ARG A NH1 9  
ATOM   6514  N  NH2 . ARG A 1 83 ? 13.965  -13.496 14.883  1.00 0.00 ? 83 ARG A NH2 9  
ATOM   6515  N  N   . LEU A 1 84 ? 9.256   -18.050 13.708  1.00 0.00 ? 84 LEU A N   9  
ATOM   6516  C  CA  . LEU A 1 84 ? 9.471   -19.494 13.671  1.00 0.00 ? 84 LEU A CA  9  
ATOM   6517  C  C   . LEU A 1 84 ? 10.854  -19.848 14.164  1.00 0.00 ? 84 LEU A C   9  
ATOM   6518  O  O   . LEU A 1 84 ? 11.851  -19.189 13.839  1.00 0.00 ? 84 LEU A O   9  
ATOM   6519  C  CB  . LEU A 1 84 ? 9.236   -20.045 12.236  1.00 0.00 ? 84 LEU A CB  9  
ATOM   6520  C  CG  . LEU A 1 84 ? 9.265   -21.584 12.030  1.00 0.00 ? 84 LEU A CG  9  
ATOM   6521  C  CD1 . LEU A 1 84 ? 7.836   -22.145 12.047  1.00 0.00 ? 84 LEU A CD1 9  
ATOM   6522  C  CD2 . LEU A 1 84 ? 9.967   -21.995 10.726  1.00 0.00 ? 84 LEU A CD2 9  
ATOM   6523  N  N   . ASP A 1 85 ? 10.955  -21.041 15.032  1.00 0.00 ? 85 ASP A N   9  
ATOM   6524  C  CA  . ASP A 1 85 ? 12.238  -21.546 15.510  1.00 0.00 ? 85 ASP A CA  9  
ATOM   6525  C  C   . ASP A 1 85 ? 12.454  -22.981 15.090  1.00 0.00 ? 85 ASP A C   9  
ATOM   6526  O  O   . ASP A 1 85 ? 11.569  -23.643 14.529  1.00 0.00 ? 85 ASP A O   9  
ATOM   6527  C  CB  . ASP A 1 85 ? 12.344  -21.373 17.048  1.00 0.00 ? 85 ASP A CB  9  
ATOM   6528  C  CG  . ASP A 1 85 ? 13.758  -21.232 17.630  1.00 0.00 ? 85 ASP A CG  9  
ATOM   6529  O  OD1 . ASP A 1 85 ? 14.654  -20.729 16.729  1.00 0.00 ? 85 ASP A OD1 9  
ATOM   6530  O  OD2 . ASP A 1 85 ? 14.040  -21.539 18.779  1.00 0.00 ? 85 ASP A OD2 9  
ATOM   6531  N  N   . LYS A 1 86 ? 13.772  -23.566 15.422  1.00 0.00 ? 86 LYS A N   9  
ATOM   6532  C  CA  . LYS A 1 86 ? 14.157  -24.903 14.980  1.00 0.00 ? 86 LYS A CA  9  
ATOM   6533  C  C   . LYS A 1 86 ? 14.027  -25.904 16.105  1.00 0.00 ? 86 LYS A C   9  
ATOM   6534  O  O   . LYS A 1 86 ? 14.731  -26.921 16.158  1.00 0.00 ? 86 LYS A O   9  
ATOM   6535  C  CB  . LYS A 1 86 ? 15.611  -24.869 14.434  1.00 0.00 ? 86 LYS A CB  9  
ATOM   6536  C  CG  . LYS A 1 86 ? 15.713  -24.322 12.988  1.00 0.00 ? 86 LYS A CG  9  
ATOM   6537  C  CD  . LYS A 1 86 ? 17.075  -23.726 12.620  1.00 0.00 ? 86 LYS A CD  9  
ATOM   6538  C  CE  . LYS A 1 86 ? 18.187  -24.633 13.164  1.00 0.00 ? 86 LYS A CE  9  
ATOM   6539  N  NZ  . LYS A 1 86 ? 18.928  -23.920 14.220  1.00 0.00 ? 86 LYS A NZ  9  
ATOM   6540  N  N   . ILE A 1 87 ? 13.021  -25.593 17.144  1.00 0.00 ? 87 ILE A N   9  
ATOM   6541  C  CA  . ILE A 1 87 ? 12.798  -26.468 18.291  1.00 0.00 ? 87 ILE A CA  9  
ATOM   6542  C  C   . ILE A 1 87 ? 11.388  -26.325 18.815  1.00 0.00 ? 87 ILE A C   9  
ATOM   6543  O  O   . ILE A 1 87 ? 11.148  -26.249 20.028  1.00 0.00 ? 87 ILE A O   9  
ATOM   6544  C  CB  . ILE A 1 87 ? 13.875  -26.221 19.424  1.00 0.00 ? 87 ILE A CB  9  
ATOM   6545  C  CG1 . ILE A 1 87 ? 13.896  -27.302 20.552  1.00 0.00 ? 87 ILE A CG1 9  
ATOM   6546  C  CG2 . ILE A 1 87 ? 13.734  -24.821 20.098  1.00 0.00 ? 87 ILE A CG2 9  
ATOM   6547  C  CD1 . ILE A 1 87 ? 14.901  -28.456 20.359  1.00 0.00 ? 87 ILE A CD1 9  
ATOM   6548  N  N   . THR A 1 88 ? 10.315  -26.264 17.799  1.00 0.00 ? 88 THR A N   9  
ATOM   6549  C  CA  . THR A 1 88 ? 8.911   -26.110 18.166  1.00 0.00 ? 88 THR A CA  9  
ATOM   6550  C  C   . THR A 1 88 ? 8.063   -27.200 17.554  1.00 0.00 ? 88 THR A C   9  
ATOM   6551  O  O   . THR A 1 88 ? 6.837   -27.072 17.419  1.00 0.00 ? 88 THR A O   9  
ATOM   6552  C  CB  . THR A 1 88 ? 8.384   -24.697 17.742  1.00 0.00 ? 88 THR A CB  9  
ATOM   6553  O  OG1 . THR A 1 88 ? 7.805   -24.750 16.445  1.00 0.00 ? 88 THR A OG1 9  
ATOM   6554  C  CG2 . THR A 1 88 ? 9.438   -23.573 17.650  1.00 0.00 ? 88 THR A CG2 9  
ATOM   6555  N  N   . HIS A 1 89 ? 8.763   -28.441 17.159  1.00 0.00 ? 89 HIS A N   9  
ATOM   6556  C  CA  . HIS A 1 89 ? 8.042   -29.611 16.660  1.00 0.00 ? 89 HIS A CA  9  
ATOM   6557  C  C   . HIS A 1 89 ? 7.918   -30.665 17.734  1.00 0.00 ? 89 HIS A C   9  
ATOM   6558  O  O   . HIS A 1 89 ? 7.681   -30.362 18.915  1.00 0.00 ? 89 HIS A O   9  
ATOM   6559  C  CB  . HIS A 1 89 ? 8.853   -30.139 15.465  1.00 0.00 ? 89 HIS A CB  9  
ATOM   6560  C  CG  . HIS A 1 89 ? 7.979   -30.747 14.408  1.00 0.00 ? 89 HIS A CG  9  
ATOM   6561  N  ND1 . HIS A 1 89 ? 6.744   -31.354 14.623  1.00 0.00 ? 89 HIS A ND1 9  
ATOM   6562  C  CD2 . HIS A 1 89 ? 8.328   -30.767 13.065  1.00 0.00 ? 89 HIS A CD2 9  
ATOM   6563  C  CE1 . HIS A 1 89 ? 6.437   -31.705 13.359  1.00 0.00 ? 89 HIS A CE1 9  
ATOM   6564  N  NE2 . HIS A 1 89 ? 7.323   -31.393 12.375  1.00 0.00 ? 89 HIS A NE2 9  
ATOM   6565  N  N   . ALA A 1 90 ? 8.053   -32.075 17.308  1.00 0.00 ? 90 ALA A N   9  
ATOM   6566  C  CA  . ALA A 1 90 ? 8.083   -33.173 18.271  1.00 0.00 ? 90 ALA A CA  9  
ATOM   6567  C  C   . ALA A 1 90 ? 6.689   -33.509 18.748  1.00 0.00 ? 90 ALA A C   9  
ATOM   6568  O  O   . ALA A 1 90 ? 5.683   -33.007 18.226  1.00 0.00 ? 90 ALA A O   9  
ATOM   6569  C  CB  . ALA A 1 90 ? 9.025   -32.765 19.416  1.00 0.00 ? 90 ALA A CB  9  
ATOM   6570  N  N   . CYS A 1 91 ? 6.590   -34.497 19.844  1.00 0.00 ? 91 CYS A N   9  
ATOM   6571  C  CA  . CYS A 1 91 ? 5.308   -34.865 20.439  1.00 0.00 ? 91 CYS A CA  9  
ATOM   6572  C  C   . CYS A 1 91 ? 4.477   -33.637 20.732  1.00 0.00 ? 91 CYS A C   9  
ATOM   6573  O  O   . CYS A 1 91 ? 3.239   -33.673 20.732  1.00 0.00 ? 91 CYS A O   9  
ATOM   6574  C  CB  . CYS A 1 91 ? 5.575   -35.710 21.700  1.00 0.00 ? 91 CYS A CB  9  
ATOM   6575  S  SG  . CYS A 1 91 ? 5.838   -34.648 23.138  1.00 0.00 ? 91 CYS A SG  9  
ATOM   6576  N  N   . ARG A 1 92 ? 5.223   -32.385 20.981  1.00 0.00 ? 92 ARG A N   9  
ATOM   6577  C  CA  . ARG A 1 92 ? 4.546   -31.112 21.206  1.00 0.00 ? 92 ARG A CA  9  
ATOM   6578  C  C   . ARG A 1 92 ? 3.608   -30.788 20.068  1.00 0.00 ? 92 ARG A C   9  
ATOM   6579  O  O   . ARG A 1 92 ? 3.907   -31.005 18.896  1.00 0.00 ? 92 ARG A O   9  
ATOM   6580  C  CB  . ARG A 1 92 ? 5.614   -29.999 21.394  1.00 0.00 ? 92 ARG A CB  9  
ATOM   6581  C  CG  . ARG A 1 92 ? 5.239   -28.899 22.422  1.00 0.00 ? 92 ARG A CG  9  
ATOM   6582  C  CD  . ARG A 1 92 ? 5.430   -29.359 23.873  1.00 0.00 ? 92 ARG A CD  9  
ATOM   6583  N  NE  . ARG A 1 92 ? 5.675   -28.161 24.715  1.00 0.00 ? 92 ARG A NE  9  
ATOM   6584  C  CZ  . ARG A 1 92 ? 6.860   -27.612 24.947  1.00 0.00 ? 92 ARG A CZ  9  
ATOM   6585  N  NH1 . ARG A 1 92 ? 7.982   -28.056 24.463  1.00 0.00 ? 92 ARG A NH1 9  
ATOM   6586  N  NH2 . ARG A 1 92 ? 6.894   -26.573 25.703  1.00 0.00 ? 92 ARG A NH2 9  
ATOM   6587  O  OXT . ARG A 1 92 ? 2.362   -30.188 20.433  1.00 0.00 ? 92 ARG A OXT 9  
HETATM 6588  ZN ZN  . ZN  B 2 .  ? 1.885   -2.026  4.375   1.00 0.00 ? 93 ZN  A ZN  9  
ATOM   6589  N  N   . MET A 1 1  ? 5.357   23.140  -24.051 1.00 0.00 ? 1  MET A N   10 
ATOM   6590  C  CA  . MET A 1 1  ? 5.034   22.363  -25.244 1.00 0.00 ? 1  MET A CA  10 
ATOM   6591  C  C   . MET A 1 1  ? 5.554   20.950  -25.126 1.00 0.00 ? 1  MET A C   10 
ATOM   6592  O  O   . MET A 1 1  ? 4.867   20.040  -24.642 1.00 0.00 ? 1  MET A O   10 
ATOM   6593  C  CB  . MET A 1 1  ? 3.498   22.370  -25.479 1.00 0.00 ? 1  MET A CB  10 
ATOM   6594  C  CG  . MET A 1 1  ? 3.026   22.946  -26.831 1.00 0.00 ? 1  MET A CG  10 
ATOM   6595  S  SD  . MET A 1 1  ? 1.323   22.451  -27.143 1.00 0.00 ? 1  MET A SD  10 
ATOM   6596  C  CE  . MET A 1 1  ? 0.512   23.514  -25.942 1.00 0.00 ? 1  MET A CE  10 
ATOM   6597  N  N   . LYS A 1 2  ? 6.935   20.718  -25.603 1.00 0.00 ? 2  LYS A N   10 
ATOM   6598  C  CA  . LYS A 1 2  ? 7.511   19.380  -25.685 1.00 0.00 ? 2  LYS A CA  10 
ATOM   6599  C  C   . LYS A 1 2  ? 8.818   19.305  -24.931 1.00 0.00 ? 2  LYS A C   10 
ATOM   6600  O  O   . LYS A 1 2  ? 9.800   18.702  -25.386 1.00 0.00 ? 2  LYS A O   10 
ATOM   6601  C  CB  . LYS A 1 2  ? 7.708   18.992  -27.177 1.00 0.00 ? 2  LYS A CB  10 
ATOM   6602  C  CG  . LYS A 1 2  ? 7.783   17.462  -27.411 1.00 0.00 ? 2  LYS A CG  10 
ATOM   6603  C  CD  . LYS A 1 2  ? 8.938   17.004  -28.306 1.00 0.00 ? 2  LYS A CD  10 
ATOM   6604  C  CE  . LYS A 1 2  ? 8.852   17.733  -29.654 1.00 0.00 ? 2  LYS A CE  10 
ATOM   6605  N  NZ  . LYS A 1 2  ? 10.204  18.141  -30.077 1.00 0.00 ? 2  LYS A NZ  10 
ATOM   6606  N  N   . LYS A 1 3  ? 8.854   19.977  -23.614 1.00 0.00 ? 3  LYS A N   10 
ATOM   6607  C  CA  . LYS A 1 3  ? 10.026  19.918  -22.747 1.00 0.00 ? 3  LYS A CA  10 
ATOM   6608  C  C   . LYS A 1 3  ? 10.068  18.617  -21.979 1.00 0.00 ? 3  LYS A C   10 
ATOM   6609  O  O   . LYS A 1 3  ? 9.239   17.718  -22.173 1.00 0.00 ? 3  LYS A O   10 
ATOM   6610  C  CB  . LYS A 1 3  ? 10.016  21.133  -21.779 1.00 0.00 ? 3  LYS A CB  10 
ATOM   6611  C  CG  . LYS A 1 3  ? 10.151  22.497  -22.501 1.00 0.00 ? 3  LYS A CG  10 
ATOM   6612  C  CD  . LYS A 1 3  ? 9.356   23.642  -21.868 1.00 0.00 ? 3  LYS A CD  10 
ATOM   6613  C  CE  . LYS A 1 3  ? 9.925   23.944  -20.475 1.00 0.00 ? 3  LYS A CE  10 
ATOM   6614  N  NZ  . LYS A 1 3  ? 9.112   23.259  -19.455 1.00 0.00 ? 3  LYS A NZ  10 
ATOM   6615  N  N   . ALA A 1 4  ? 11.148  18.482  -20.978 1.00 0.00 ? 4  ALA A N   10 
ATOM   6616  C  CA  . ALA A 1 4  ? 11.320  17.270  -20.183 1.00 0.00 ? 4  ALA A CA  10 
ATOM   6617  C  C   . ALA A 1 4  ? 10.338  17.231  -19.036 1.00 0.00 ? 4  ALA A C   10 
ATOM   6618  O  O   . ALA A 1 4  ? 10.404  18.030  -18.093 1.00 0.00 ? 4  ALA A O   10 
ATOM   6619  C  CB  . ALA A 1 4  ? 12.785  17.223  -19.715 1.00 0.00 ? 4  ALA A CB  10 
ATOM   6620  N  N   . THR A 1 5  ? 9.297   16.181  -19.100 1.00 0.00 ? 5  THR A N   10 
ATOM   6621  C  CA  . THR A 1 5  ? 8.240   16.079  -18.098 1.00 0.00 ? 5  THR A CA  10 
ATOM   6622  C  C   . THR A 1 5  ? 8.815   16.116  -16.701 1.00 0.00 ? 5  THR A C   10 
ATOM   6623  O  O   . THR A 1 5  ? 9.969   15.736  -16.461 1.00 0.00 ? 5  THR A O   10 
ATOM   6624  C  CB  . THR A 1 5  ? 7.398   14.777  -18.314 1.00 0.00 ? 5  THR A CB  10 
ATOM   6625  O  OG1 . THR A 1 5  ? 7.317   14.459  -19.698 1.00 0.00 ? 5  THR A OG1 10 
ATOM   6626  C  CG2 . THR A 1 5  ? 5.928   14.826  -17.842 1.00 0.00 ? 5  THR A CG2 10 
ATOM   6627  N  N   . CYS A 1 6  ? 7.920   16.622  -15.638 1.00 0.00 ? 6  CYS A N   10 
ATOM   6628  C  CA  . CYS A 1 6  ? 8.315   16.630  -14.233 1.00 0.00 ? 6  CYS A CA  10 
ATOM   6629  C  C   . CYS A 1 6  ? 8.126   15.267  -13.609 1.00 0.00 ? 6  CYS A C   10 
ATOM   6630  O  O   . CYS A 1 6  ? 7.843   14.272  -14.290 1.00 0.00 ? 6  CYS A O   10 
ATOM   6631  C  CB  . CYS A 1 6  ? 7.515   17.727  -13.504 1.00 0.00 ? 6  CYS A CB  10 
ATOM   6632  S  SG  . CYS A 1 6  ? 8.563   19.156  -13.149 1.00 0.00 ? 6  CYS A SG  10 
ATOM   6633  N  N   . LEU A 1 7  ? 8.284   15.193  -12.140 1.00 0.00 ? 7  LEU A N   10 
ATOM   6634  C  CA  . LEU A 1 7  ? 8.102   13.948  -11.400 1.00 0.00 ? 7  LEU A CA  10 
ATOM   6635  C  C   . LEU A 1 7  ? 6.826   13.253  -11.817 1.00 0.00 ? 7  LEU A C   10 
ATOM   6636  O  O   . LEU A 1 7  ? 5.714   13.646  -11.441 1.00 0.00 ? 7  LEU A O   10 
ATOM   6637  C  CB  . LEU A 1 7  ? 8.116   14.215  -9.869  1.00 0.00 ? 7  LEU A CB  10 
ATOM   6638  C  CG  . LEU A 1 7  ? 9.475   14.554  -9.198  1.00 0.00 ? 7  LEU A CG  10 
ATOM   6639  C  CD1 . LEU A 1 7  ? 10.188  15.665  -9.982  1.00 0.00 ? 7  LEU A CD1 10 
ATOM   6640  C  CD2 . LEU A 1 7  ? 9.325   14.972  -7.727  1.00 0.00 ? 7  LEU A CD2 10 
ATOM   6641  N  N   . THR A 1 8  ? 6.982   12.099  -12.732 1.00 0.00 ? 8  THR A N   10 
ATOM   6642  C  CA  . THR A 1 8  ? 5.833   11.427  -13.329 1.00 0.00 ? 8  THR A CA  10 
ATOM   6643  C  C   . THR A 1 8  ? 5.155   10.515  -12.329 1.00 0.00 ? 8  THR A C   10 
ATOM   6644  O  O   . THR A 1 8  ? 5.802   9.778   -11.573 1.00 0.00 ? 8  THR A O   10 
ATOM   6645  C  CB  . THR A 1 8  ? 6.253   10.626  -14.607 1.00 0.00 ? 8  THR A CB  10 
ATOM   6646  O  OG1 . THR A 1 8  ? 7.589   10.156  -14.489 1.00 0.00 ? 8  THR A OG1 10 
ATOM   6647  C  CG2 . THR A 1 8  ? 6.234   11.406  -15.940 1.00 0.00 ? 8  THR A CG2 10 
ATOM   6648  N  N   . ASP A 1 9  ? 3.677   10.587  -12.285 1.00 0.00 ? 9  ASP A N   10 
ATOM   6649  C  CA  . ASP A 1 9  ? 2.883   9.653   -11.492 1.00 0.00 ? 9  ASP A CA  10 
ATOM   6650  C  C   . ASP A 1 9  ? 3.221   8.223   -11.849 1.00 0.00 ? 9  ASP A C   10 
ATOM   6651  O  O   . ASP A 1 9  ? 3.040   7.291   -11.054 1.00 0.00 ? 9  ASP A O   10 
ATOM   6652  C  CB  . ASP A 1 9  ? 1.370   9.946   -11.662 1.00 0.00 ? 9  ASP A CB  10 
ATOM   6653  C  CG  . ASP A 1 9  ? 0.689   10.733  -10.532 1.00 0.00 ? 9  ASP A CG  10 
ATOM   6654  O  OD1 . ASP A 1 9  ? 0.838   12.086  -10.664 1.00 0.00 ? 9  ASP A OD1 10 
ATOM   6655  O  OD2 . ASP A 1 9  ? 0.066   10.197  -9.628  1.00 0.00 ? 9  ASP A OD2 10 
ATOM   6656  N  N   . ASP A 1 10 ? 3.759   8.001   -13.209 1.00 0.00 ? 10 ASP A N   10 
ATOM   6657  C  CA  . ASP A 1 10 ? 4.057   6.662   -13.711 1.00 0.00 ? 10 ASP A CA  10 
ATOM   6658  C  C   . ASP A 1 10 ? 5.221   6.054   -12.965 1.00 0.00 ? 10 ASP A C   10 
ATOM   6659  O  O   . ASP A 1 10 ? 5.157   4.924   -12.460 1.00 0.00 ? 10 ASP A O   10 
ATOM   6660  C  CB  . ASP A 1 10 ? 4.301   6.704   -15.242 1.00 0.00 ? 10 ASP A CB  10 
ATOM   6661  C  CG  . ASP A 1 10 ? 5.022   5.497   -15.860 1.00 0.00 ? 10 ASP A CG  10 
ATOM   6662  O  OD1 . ASP A 1 10 ? 6.226   5.313   -15.753 1.00 0.00 ? 10 ASP A OD1 10 
ATOM   6663  O  OD2 . ASP A 1 10 ? 4.178   4.671   -16.548 1.00 0.00 ? 10 ASP A OD2 10 
ATOM   6664  N  N   . GLN A 1 11 ? 6.434   6.895   -12.829 1.00 0.00 ? 11 GLN A N   10 
ATOM   6665  C  CA  . GLN A 1 11 ? 7.632   6.408   -12.150 1.00 0.00 ? 11 GLN A CA  10 
ATOM   6666  C  C   . GLN A 1 11 ? 7.343   6.124   -10.692 1.00 0.00 ? 11 GLN A C   10 
ATOM   6667  O  O   . GLN A 1 11 ? 7.770   5.116   -10.113 1.00 0.00 ? 11 GLN A O   10 
ATOM   6668  C  CB  . GLN A 1 11 ? 8.748   7.465   -12.292 1.00 0.00 ? 11 GLN A CB  10 
ATOM   6669  C  CG  . GLN A 1 11 ? 9.115   7.896   -13.751 1.00 0.00 ? 11 GLN A CG  10 
ATOM   6670  C  CD  . GLN A 1 11 ? 10.585  7.873   -14.189 1.00 0.00 ? 11 GLN A CD  10 
ATOM   6671  O  OE1 . GLN A 1 11 ? 11.034  6.947   -14.846 1.00 0.00 ? 11 GLN A OE1 10 
ATOM   6672  N  NE2 . GLN A 1 11 ? 11.378  8.864   -13.870 1.00 0.00 ? 11 GLN A NE2 10 
ATOM   6673  N  N   . ARG A 1 12 ? 6.545   7.148   -9.984  1.00 0.00 ? 12 ARG A N   10 
ATOM   6674  C  CA  . ARG A 1 12 ? 6.061   6.995   -8.618  1.00 0.00 ? 12 ARG A CA  10 
ATOM   6675  C  C   . ARG A 1 12 ? 5.526   5.607   -8.339  1.00 0.00 ? 12 ARG A C   10 
ATOM   6676  O  O   . ARG A 1 12 ? 6.093   4.755   -7.617  1.00 0.00 ? 12 ARG A O   10 
ATOM   6677  C  CB  . ARG A 1 12 ? 4.924   8.040   -8.392  1.00 0.00 ? 12 ARG A CB  10 
ATOM   6678  C  CG  . ARG A 1 12 ? 5.319   9.426   -7.829  1.00 0.00 ? 12 ARG A CG  10 
ATOM   6679  C  CD  . ARG A 1 12 ? 6.824   9.712   -7.783  1.00 0.00 ? 12 ARG A CD  10 
ATOM   6680  N  NE  . ARG A 1 12 ? 7.039   10.958  -6.997  1.00 0.00 ? 12 ARG A NE  10 
ATOM   6681  C  CZ  . ARG A 1 12 ? 6.516   12.144  -7.276  1.00 0.00 ? 12 ARG A CZ  10 
ATOM   6682  N  NH1 . ARG A 1 12 ? 5.740   12.384  -8.292  1.00 0.00 ? 12 ARG A NH1 10 
ATOM   6683  N  NH2 . ARG A 1 12 ? 6.797   13.118  -6.485  1.00 0.00 ? 12 ARG A NH2 10 
ATOM   6684  N  N   . TRP A 1 13 ? 4.208   5.308   -8.961  1.00 0.00 ? 13 TRP A N   10 
ATOM   6685  C  CA  . TRP A 1 13 ? 3.469   4.110   -8.590  1.00 0.00 ? 13 TRP A CA  10 
ATOM   6686  C  C   . TRP A 1 13 ? 4.070   2.879   -9.217  1.00 0.00 ? 13 TRP A C   10 
ATOM   6687  O  O   . TRP A 1 13 ? 3.925   1.757   -8.693  1.00 0.00 ? 13 TRP A O   10 
ATOM   6688  C  CB  . TRP A 1 13 ? 1.967   4.271   -8.974  1.00 0.00 ? 13 TRP A CB  10 
ATOM   6689  C  CG  . TRP A 1 13 ? 1.269   2.903   -8.819  1.00 0.00 ? 13 TRP A CG  10 
ATOM   6690  C  CD1 . TRP A 1 13 ? 0.996   1.998   -9.862  1.00 0.00 ? 13 TRP A CD1 10 
ATOM   6691  C  CD2 . TRP A 1 13 ? 0.908   2.280   -7.648  1.00 0.00 ? 13 TRP A CD2 10 
ATOM   6692  N  NE1 . TRP A 1 13 ? 0.452   0.798   -9.360  1.00 0.00 ? 13 TRP A NE1 10 
ATOM   6693  C  CE2 . TRP A 1 13 ? 0.416   0.993   -7.985  1.00 0.00 ? 13 TRP A CE2 10 
ATOM   6694  C  CE3 . TRP A 1 13 ? 0.987   2.699   -6.293  1.00 0.00 ? 13 TRP A CE3 10 
ATOM   6695  C  CZ2 . TRP A 1 13 ? -0.011  0.121   -6.960  1.00 0.00 ? 13 TRP A CZ2 10 
ATOM   6696  C  CZ3 . TRP A 1 13 ? 0.535   1.827   -5.304  1.00 0.00 ? 13 TRP A CZ3 10 
ATOM   6697  C  CH2 . TRP A 1 13 ? 0.038   0.558   -5.633  1.00 0.00 ? 13 TRP A CH2 10 
ATOM   6698  N  N   . GLN A 1 14 ? 4.801   3.048   -10.495 1.00 0.00 ? 14 GLN A N   10 
ATOM   6699  C  CA  . GLN A 1 14 ? 5.590   1.950   -11.058 1.00 0.00 ? 14 GLN A CA  10 
ATOM   6700  C  C   . GLN A 1 14 ? 6.725   1.622   -10.106 1.00 0.00 ? 14 GLN A C   10 
ATOM   6701  O  O   . GLN A 1 14 ? 7.211   0.486   -10.025 1.00 0.00 ? 14 GLN A O   10 
ATOM   6702  C  CB  . GLN A 1 14 ? 6.118   2.320   -12.455 1.00 0.00 ? 14 GLN A CB  10 
ATOM   6703  C  CG  . GLN A 1 14 ? 6.811   1.162   -13.254 1.00 0.00 ? 14 GLN A CG  10 
ATOM   6704  C  CD  . GLN A 1 14 ? 7.787   1.502   -14.386 1.00 0.00 ? 14 GLN A CD  10 
ATOM   6705  O  OE1 . GLN A 1 14 ? 8.469   2.514   -14.352 1.00 0.00 ? 14 GLN A OE1 10 
ATOM   6706  N  NE2 . GLN A 1 14 ? 7.907   0.694   -15.409 1.00 0.00 ? 14 GLN A NE2 10 
ATOM   6707  N  N   . SER A 1 15 ? 7.185   2.748   -9.253  1.00 0.00 ? 15 SER A N   10 
ATOM   6708  C  CA  . SER A 1 15 ? 8.130   2.523   -8.161  1.00 0.00 ? 15 SER A CA  10 
ATOM   6709  C  C   . SER A 1 15 ? 7.555   1.500   -7.200  1.00 0.00 ? 15 SER A C   10 
ATOM   6710  O  O   . SER A 1 15 ? 8.297   0.686   -6.626  1.00 0.00 ? 15 SER A O   10 
ATOM   6711  C  CB  . SER A 1 15 ? 8.577   3.822   -7.450  1.00 0.00 ? 15 SER A CB  10 
ATOM   6712  O  OG  . SER A 1 15 ? 9.948   3.791   -7.037  1.00 0.00 ? 15 SER A OG  10 
ATOM   6713  N  N   . VAL A 1 16 ? 6.076   1.552   -6.955  1.00 0.00 ? 16 VAL A N   10 
ATOM   6714  C  CA  . VAL A 1 16 ? 5.446   0.478   -6.189  1.00 0.00 ? 16 VAL A CA  10 
ATOM   6715  C  C   . VAL A 1 16 ? 5.278   -0.852  -6.884  1.00 0.00 ? 16 VAL A C   10 
ATOM   6716  O  O   . VAL A 1 16 ? 5.781   -1.917  -6.417  1.00 0.00 ? 16 VAL A O   10 
ATOM   6717  C  CB  . VAL A 1 16 ? 4.097   0.896   -5.491  1.00 0.00 ? 16 VAL A CB  10 
ATOM   6718  C  CG1 . VAL A 1 16 ? 3.717   0.079   -4.214  1.00 0.00 ? 16 VAL A CG1 10 
ATOM   6719  C  CG2 . VAL A 1 16 ? 4.021   2.376   -5.058  1.00 0.00 ? 16 VAL A CG2 10 
ATOM   6720  N  N   . LEU A 1 17 ? 4.456   -0.918  -8.109  1.00 0.00 ? 17 LEU A N   10 
ATOM   6721  C  CA  . LEU A 1 17 ? 4.066   -2.197  -8.742  1.00 0.00 ? 17 LEU A CA  10 
ATOM   6722  C  C   . LEU A 1 17 ? 5.228   -3.155  -8.665  1.00 0.00 ? 17 LEU A C   10 
ATOM   6723  O  O   . LEU A 1 17 ? 5.132   -4.347  -8.350  1.00 0.00 ? 17 LEU A O   10 
ATOM   6724  C  CB  . LEU A 1 17 ? 3.652   -1.967  -10.221 1.00 0.00 ? 17 LEU A CB  10 
ATOM   6725  C  CG  . LEU A 1 17 ? 2.202   -1.465  -10.485 1.00 0.00 ? 17 LEU A CG  10 
ATOM   6726  C  CD1 . LEU A 1 17 ? 1.832   -1.665  -11.959 1.00 0.00 ? 17 LEU A CD1 10 
ATOM   6727  C  CD2 . LEU A 1 17 ? 1.170   -2.170  -9.590  1.00 0.00 ? 17 LEU A CD2 10 
ATOM   6728  N  N   . ALA A 1 18 ? 6.544   -2.535  -8.965  1.00 0.00 ? 18 ALA A N   10 
ATOM   6729  C  CA  . ALA A 1 18 ? 7.821   -3.206  -8.781  1.00 0.00 ? 18 ALA A CA  10 
ATOM   6730  C  C   . ALA A 1 18 ? 8.377   -3.035  -7.386  1.00 0.00 ? 18 ALA A C   10 
ATOM   6731  O  O   . ALA A 1 18 ? 7.958   -3.671  -6.410  1.00 0.00 ? 18 ALA A O   10 
ATOM   6732  C  CB  . ALA A 1 18 ? 8.782   -2.672  -9.868  1.00 0.00 ? 18 ALA A CB  10 
ATOM   6733  N  N   . ARG A 1 19 ? 9.503   -2.075  -7.254  1.00 0.00 ? 19 ARG A N   10 
ATOM   6734  C  CA  . ARG A 1 19 ? 10.329  -1.952  -6.060  1.00 0.00 ? 19 ARG A CA  10 
ATOM   6735  C  C   . ARG A 1 19 ? 11.424  -0.933  -6.257  1.00 0.00 ? 19 ARG A C   10 
ATOM   6736  O  O   . ARG A 1 19 ? 12.423  -0.938  -5.483  1.00 0.00 ? 19 ARG A O   10 
ATOM   6737  C  CB  . ARG A 1 19 ? 10.928  -3.356  -5.737  1.00 0.00 ? 19 ARG A CB  10 
ATOM   6738  C  CG  . ARG A 1 19 ? 11.730  -3.458  -4.414  1.00 0.00 ? 19 ARG A CG  10 
ATOM   6739  C  CD  . ARG A 1 19 ? 11.003  -2.810  -3.228  1.00 0.00 ? 19 ARG A CD  10 
ATOM   6740  N  NE  . ARG A 1 19 ? 9.915   -3.723  -2.794  1.00 0.00 ? 19 ARG A NE  10 
ATOM   6741  C  CZ  . ARG A 1 19 ? 10.075  -4.824  -2.072  1.00 0.00 ? 19 ARG A CZ  10 
ATOM   6742  N  NH1 . ARG A 1 19 ? 11.221  -5.256  -1.637  1.00 0.00 ? 19 ARG A NH1 10 
ATOM   6743  N  NH2 . ARG A 1 19 ? 9.022   -5.505  -1.789  1.00 0.00 ? 19 ARG A NH2 10 
ATOM   6744  N  N   . ASP A 1 20 ? 11.331  0.092   -7.316  1.00 0.00 ? 20 ASP A N   10 
ATOM   6745  C  CA  . ASP A 1 20 ? 12.469  0.906   -7.725  1.00 0.00 ? 20 ASP A CA  10 
ATOM   6746  C  C   . ASP A 1 20 ? 13.168  1.625   -6.600  1.00 0.00 ? 20 ASP A C   10 
ATOM   6747  O  O   . ASP A 1 20 ? 12.596  2.487   -5.918  1.00 0.00 ? 20 ASP A O   10 
ATOM   6748  C  CB  . ASP A 1 20 ? 12.067  1.886   -8.864  1.00 0.00 ? 20 ASP A CB  10 
ATOM   6749  C  CG  . ASP A 1 20 ? 13.202  2.382   -9.770  1.00 0.00 ? 20 ASP A CG  10 
ATOM   6750  O  OD1 . ASP A 1 20 ? 14.182  1.703   -10.044 1.00 0.00 ? 20 ASP A OD1 10 
ATOM   6751  O  OD2 . ASP A 1 20 ? 13.010  3.662   -10.212 1.00 0.00 ? 20 ASP A OD2 10 
ATOM   6752  N  N   . PRO A 1 21 ? 14.588  1.273   -6.373  1.00 0.00 ? 21 PRO A N   10 
ATOM   6753  C  CA  . PRO A 1 21 ? 15.519  1.873   -5.319  1.00 0.00 ? 21 PRO A CA  10 
ATOM   6754  C  C   . PRO A 1 21 ? 15.679  3.385   -5.425  1.00 0.00 ? 21 PRO A C   10 
ATOM   6755  O  O   . PRO A 1 21 ? 15.688  4.111   -4.424  1.00 0.00 ? 21 PRO A O   10 
ATOM   6756  C  CB  . PRO A 1 21 ? 16.890  1.244   -5.521  1.00 0.00 ? 21 PRO A CB  10 
ATOM   6757  C  CG  . PRO A 1 21 ? 16.543  -0.091  -6.198  1.00 0.00 ? 21 PRO A CG  10 
ATOM   6758  C  CD  . PRO A 1 21 ? 15.379  0.273   -7.129  1.00 0.00 ? 21 PRO A CD  10 
ATOM   6759  N  N   . ASN A 1 22 ? 15.861  3.912   -6.795  1.00 0.00 ? 22 ASN A N   10 
ATOM   6760  C  CA  . ASN A 1 22 ? 16.168  5.315   -7.055  1.00 0.00 ? 22 ASN A CA  10 
ATOM   6761  C  C   . ASN A 1 22 ? 14.983  6.195   -6.732  1.00 0.00 ? 22 ASN A C   10 
ATOM   6762  O  O   . ASN A 1 22 ? 15.092  7.202   -6.019  1.00 0.00 ? 22 ASN A O   10 
ATOM   6763  C  CB  . ASN A 1 22 ? 16.588  5.487   -8.544  1.00 0.00 ? 22 ASN A CB  10 
ATOM   6764  C  CG  . ASN A 1 22 ? 16.194  6.799   -9.229  1.00 0.00 ? 22 ASN A CG  10 
ATOM   6765  O  OD1 . ASN A 1 22 ? 16.955  7.752   -9.306  1.00 0.00 ? 22 ASN A OD1 10 
ATOM   6766  N  ND2 . ASN A 1 22 ? 15.006  6.896   -9.763  1.00 0.00 ? 22 ASN A ND2 10 
ATOM   6767  N  N   . ALA A 1 23 ? 13.689  5.790   -7.323  1.00 0.00 ? 23 ALA A N   10 
ATOM   6768  C  CA  . ALA A 1 23 ? 12.475  6.580   -7.144  1.00 0.00 ? 23 ALA A CA  10 
ATOM   6769  C  C   . ALA A 1 23 ? 11.879  6.366   -5.772  1.00 0.00 ? 23 ALA A C   10 
ATOM   6770  O  O   . ALA A 1 23 ? 10.972  7.101   -5.343  1.00 0.00 ? 23 ALA A O   10 
ATOM   6771  C  CB  . ALA A 1 23 ? 11.506  6.210   -8.280  1.00 0.00 ? 23 ALA A CB  10 
ATOM   6772  N  N   . ASP A 1 24 ? 12.398  5.233   -4.977  1.00 0.00 ? 24 ASP A N   10 
ATOM   6773  C  CA  . ASP A 1 24 ? 11.840  4.898   -3.665  1.00 0.00 ? 24 ASP A CA  10 
ATOM   6774  C  C   . ASP A 1 24 ? 12.351  5.851   -2.610  1.00 0.00 ? 24 ASP A C   10 
ATOM   6775  O  O   . ASP A 1 24 ? 11.775  6.927   -2.362  1.00 0.00 ? 24 ASP A O   10 
ATOM   6776  C  CB  . ASP A 1 24 ? 12.105  3.416   -3.297  1.00 0.00 ? 24 ASP A CB  10 
ATOM   6777  C  CG  . ASP A 1 24 ? 11.010  2.400   -3.669  1.00 0.00 ? 24 ASP A CG  10 
ATOM   6778  O  OD1 . ASP A 1 24 ? 9.754   2.936   -3.639  1.00 0.00 ? 24 ASP A OD1 10 
ATOM   6779  O  OD2 . ASP A 1 24 ? 11.254  1.233   -3.939  1.00 0.00 ? 24 ASP A OD2 10 
ATOM   6780  N  N   . GLY A 1 25 ? 13.527  5.410   -1.838  1.00 0.00 ? 25 GLY A N   10 
ATOM   6781  C  CA  . GLY A 1 25 ? 14.251  6.306   -0.903  1.00 0.00 ? 25 GLY A CA  10 
ATOM   6782  C  C   . GLY A 1 25 ? 13.617  6.045   0.466   1.00 0.00 ? 25 GLY A C   10 
ATOM   6783  O  O   . GLY A 1 25 ? 14.127  5.265   1.277   1.00 0.00 ? 25 GLY A O   10 
ATOM   6784  N  N   . GLU A 1 26 ? 12.338  6.749   0.683   1.00 0.00 ? 26 GLU A N   10 
ATOM   6785  C  CA  . GLU A 1 26 ? 11.473  6.441   1.813   1.00 0.00 ? 26 GLU A CA  10 
ATOM   6786  C  C   . GLU A 1 26 ? 10.066  6.930   1.566   1.00 0.00 ? 26 GLU A C   10 
ATOM   6787  O  O   . GLU A 1 26 ? 9.299   7.158   2.528   1.00 0.00 ? 26 GLU A O   10 
ATOM   6788  C  CB  . GLU A 1 26 ? 12.097  7.145   3.060   1.00 0.00 ? 26 GLU A CB  10 
ATOM   6789  C  CG  . GLU A 1 26 ? 13.586  6.838   3.422   1.00 0.00 ? 26 GLU A CG  10 
ATOM   6790  C  CD  . GLU A 1 26 ? 14.166  7.441   4.703   1.00 0.00 ? 26 GLU A CD  10 
ATOM   6791  O  OE1 . GLU A 1 26 ? 14.672  8.555   4.746   1.00 0.00 ? 26 GLU A OE1 10 
ATOM   6792  O  OE2 . GLU A 1 26 ? 14.068  6.623   5.788   1.00 0.00 ? 26 GLU A OE2 10 
ATOM   6793  N  N   . PHE A 1 27 ? 9.634   7.159   0.167   1.00 0.00 ? 27 PHE A N   10 
ATOM   6794  C  CA  . PHE A 1 27 ? 8.354   7.818   -0.128  1.00 0.00 ? 27 PHE A CA  10 
ATOM   6795  C  C   . PHE A 1 27 ? 7.177   6.966   0.269   1.00 0.00 ? 27 PHE A C   10 
ATOM   6796  O  O   . PHE A 1 27 ? 7.245   5.721   0.253   1.00 0.00 ? 27 PHE A O   10 
ATOM   6797  C  CB  . PHE A 1 27 ? 8.264   8.238   -1.621  1.00 0.00 ? 27 PHE A CB  10 
ATOM   6798  C  CG  . PHE A 1 27 ? 7.862   7.207   -2.688  1.00 0.00 ? 27 PHE A CG  10 
ATOM   6799  C  CD1 . PHE A 1 27 ? 8.792   6.266   -3.135  1.00 0.00 ? 27 PHE A CD1 10 
ATOM   6800  C  CD2 . PHE A 1 27 ? 6.576   7.217   -3.245  1.00 0.00 ? 27 PHE A CD2 10 
ATOM   6801  C  CE1 . PHE A 1 27 ? 8.443   5.345   -4.118  1.00 0.00 ? 27 PHE A CE1 10 
ATOM   6802  C  CE2 . PHE A 1 27 ? 6.228   6.295   -4.228  1.00 0.00 ? 27 PHE A CE2 10 
ATOM   6803  C  CZ  . PHE A 1 27 ? 7.162   5.360   -4.667  1.00 0.00 ? 27 PHE A CZ  10 
ATOM   6804  N  N   . VAL A 1 28 ? 5.941   7.648   0.703   1.00 0.00 ? 28 VAL A N   10 
ATOM   6805  C  CA  . VAL A 1 28 ? 4.777   6.962   1.298   1.00 0.00 ? 28 VAL A CA  10 
ATOM   6806  C  C   . VAL A 1 28 ? 3.584   7.086   0.384   1.00 0.00 ? 28 VAL A C   10 
ATOM   6807  O  O   . VAL A 1 28 ? 3.542   7.993   -0.486  1.00 0.00 ? 28 VAL A O   10 
ATOM   6808  C  CB  . VAL A 1 28 ? 4.510   7.618   2.710   1.00 0.00 ? 28 VAL A CB  10 
ATOM   6809  C  CG1 . VAL A 1 28 ? 5.764   7.788   3.623   1.00 0.00 ? 28 VAL A CG1 10 
ATOM   6810  C  CG2 . VAL A 1 28 ? 3.877   9.028   2.632   1.00 0.00 ? 28 VAL A CG2 10 
ATOM   6811  N  N   . PHE A 1 29 ? 2.476   6.112   0.491   1.00 0.00 ? 29 PHE A N   10 
ATOM   6812  C  CA  . PHE A 1 29 ? 1.323   6.133   -0.414  1.00 0.00 ? 29 PHE A CA  10 
ATOM   6813  C  C   . PHE A 1 29 ? 0.047   5.896   0.358   1.00 0.00 ? 29 PHE A C   10 
ATOM   6814  O  O   . PHE A 1 29 ? -0.035  4.972   1.191   1.00 0.00 ? 29 PHE A O   10 
ATOM   6815  C  CB  . PHE A 1 29 ? 1.473   5.013   -1.485  1.00 0.00 ? 29 PHE A CB  10 
ATOM   6816  C  CG  . PHE A 1 29 ? 1.144   3.582   -1.031  1.00 0.00 ? 29 PHE A CG  10 
ATOM   6817  C  CD1 . PHE A 1 29 ? -0.184  3.141   -1.041  1.00 0.00 ? 29 PHE A CD1 10 
ATOM   6818  C  CD2 . PHE A 1 29 ? 2.155   2.710   -0.619  1.00 0.00 ? 29 PHE A CD2 10 
ATOM   6819  C  CE1 . PHE A 1 29 ? -0.499  1.851   -0.627  1.00 0.00 ? 29 PHE A CE1 10 
ATOM   6820  C  CE2 . PHE A 1 29 ? 1.840   1.415   -0.215  1.00 0.00 ? 29 PHE A CE2 10 
ATOM   6821  C  CZ  . PHE A 1 29 ? 0.513   0.987   -0.216  1.00 0.00 ? 29 PHE A CZ  10 
ATOM   6822  N  N   . ALA A 1 30 ? -1.096  6.800   0.104   1.00 0.00 ? 30 ALA A N   10 
ATOM   6823  C  CA  . ALA A 1 30 ? -2.313  6.748   0.912   1.00 0.00 ? 30 ALA A CA  10 
ATOM   6824  C  C   . ALA A 1 30 ? -3.502  6.312   0.088   1.00 0.00 ? 30 ALA A C   10 
ATOM   6825  O  O   . ALA A 1 30 ? -4.196  7.130   -0.535  1.00 0.00 ? 30 ALA A O   10 
ATOM   6826  C  CB  . ALA A 1 30 ? -2.507  8.136   1.547   1.00 0.00 ? 30 ALA A CB  10 
ATOM   6827  N  N   . VAL A 1 31 ? -3.807  4.865   0.076   1.00 0.00 ? 31 VAL A N   10 
ATOM   6828  C  CA  . VAL A 1 31 ? -5.011  4.330   -0.556  1.00 0.00 ? 31 VAL A CA  10 
ATOM   6829  C  C   . VAL A 1 31 ? -6.226  4.582   0.305   1.00 0.00 ? 31 VAL A C   10 
ATOM   6830  O  O   . VAL A 1 31 ? -6.448  3.905   1.322   1.00 0.00 ? 31 VAL A O   10 
ATOM   6831  C  CB  . VAL A 1 31 ? -4.827  2.785   -0.828  1.00 0.00 ? 31 VAL A CB  10 
ATOM   6832  C  CG1 . VAL A 1 31 ? -4.524  1.899   0.414   1.00 0.00 ? 31 VAL A CG1 10 
ATOM   6833  C  CG2 . VAL A 1 31 ? -6.040  2.114   -1.516  1.00 0.00 ? 31 VAL A CG2 10 
ATOM   6834  N  N   . ARG A 1 32 ? -7.108  5.700   -0.092  1.00 0.00 ? 32 ARG A N   10 
ATOM   6835  C  CA  . ARG A 1 32 ? -8.234  6.130   0.732   1.00 0.00 ? 32 ARG A CA  10 
ATOM   6836  C  C   . ARG A 1 32 ? -9.502  5.368   0.426   1.00 0.00 ? 32 ARG A C   10 
ATOM   6837  O  O   . ARG A 1 32 ? -10.600 5.959   0.339   1.00 0.00 ? 32 ARG A O   10 
ATOM   6838  C  CB  . ARG A 1 32 ? -8.442  7.659   0.526   1.00 0.00 ? 32 ARG A CB  10 
ATOM   6839  C  CG  . ARG A 1 32 ? -7.330  8.552   1.135   1.00 0.00 ? 32 ARG A CG  10 
ATOM   6840  C  CD  . ARG A 1 32 ? -7.473  10.027  0.736   1.00 0.00 ? 32 ARG A CD  10 
ATOM   6841  N  NE  . ARG A 1 32 ? -6.347  10.784  1.337   1.00 0.00 ? 32 ARG A NE  10 
ATOM   6842  C  CZ  . ARG A 1 32 ? -6.373  11.399  2.512   1.00 0.00 ? 32 ARG A CZ  10 
ATOM   6843  N  NH1 . ARG A 1 32 ? -7.403  11.423  3.305   1.00 0.00 ? 32 ARG A NH1 10 
ATOM   6844  N  NH2 . ARG A 1 32 ? -5.304  12.010  2.886   1.00 0.00 ? 32 ARG A NH2 10 
ATOM   6845  N  N   . THR A 1 33 ? -9.418  3.900   0.268   1.00 0.00 ? 33 THR A N   10 
ATOM   6846  C  CA  . THR A 1 33 ? -10.592 3.085   -0.049  1.00 0.00 ? 33 THR A CA  10 
ATOM   6847  C  C   . THR A 1 33 ? -11.005 2.263   1.149   1.00 0.00 ? 33 THR A C   10 
ATOM   6848  O  O   . THR A 1 33 ? -12.186 2.186   1.515   1.00 0.00 ? 33 THR A O   10 
ATOM   6849  C  CB  . THR A 1 33 ? -10.311 2.169   -1.286  1.00 0.00 ? 33 THR A CB  10 
ATOM   6850  O  OG1 . THR A 1 33 ? -10.519 2.887   -2.496  1.00 0.00 ? 33 THR A OG1 10 
ATOM   6851  C  CG2 . THR A 1 33 ? -11.200 0.913   -1.426  1.00 0.00 ? 33 THR A CG2 10 
ATOM   6852  N  N   . THR A 1 34 ? -9.922  1.526   1.837   1.00 0.00 ? 34 THR A N   10 
ATOM   6853  C  CA  . THR A 1 34 ? -10.130 0.834   3.105   1.00 0.00 ? 34 THR A CA  10 
ATOM   6854  C  C   . THR A 1 34 ? -9.477  1.591   4.240   1.00 0.00 ? 34 THR A C   10 
ATOM   6855  O  O   . THR A 1 34 ? -9.761  1.360   5.423   1.00 0.00 ? 34 THR A O   10 
ATOM   6856  C  CB  . THR A 1 34 ? -9.611  -0.640  3.034   1.00 0.00 ? 34 THR A CB  10 
ATOM   6857  O  OG1 . THR A 1 34 ? -10.411 -1.405  2.139   1.00 0.00 ? 34 THR A OG1 10 
ATOM   6858  C  CG2 . THR A 1 34 ? -9.631  -1.438  4.356   1.00 0.00 ? 34 THR A CG2 10 
ATOM   6859  N  N   . GLY A 1 35 ? -8.455  2.592   3.862   1.00 0.00 ? 35 GLY A N   10 
ATOM   6860  C  CA  . GLY A 1 35 ? -7.875  3.520   4.827   1.00 0.00 ? 35 GLY A CA  10 
ATOM   6861  C  C   . GLY A 1 35 ? -6.522  3.083   5.332   1.00 0.00 ? 35 GLY A C   10 
ATOM   6862  O  O   . GLY A 1 35 ? -6.353  2.748   6.521   1.00 0.00 ? 35 GLY A O   10 
ATOM   6863  N  N   . ILE A 1 36 ? -5.410  3.027   4.357   1.00 0.00 ? 36 ILE A N   10 
ATOM   6864  C  CA  . ILE A 1 36 ? -4.032  2.799   4.780   1.00 0.00 ? 36 ILE A CA  10 
ATOM   6865  C  C   . ILE A 1 36 ? -3.057  3.723   4.095   1.00 0.00 ? 36 ILE A C   10 
ATOM   6866  O  O   . ILE A 1 36 ? -3.029  3.855   2.859   1.00 0.00 ? 36 ILE A O   10 
ATOM   6867  C  CB  . ILE A 1 36 ? -3.610  1.276   4.669   1.00 0.00 ? 36 ILE A CB  10 
ATOM   6868  C  CG1 . ILE A 1 36 ? -3.069  0.766   3.297   1.00 0.00 ? 36 ILE A CG1 10 
ATOM   6869  C  CG2 . ILE A 1 36 ? -4.756  0.309   5.119   1.00 0.00 ? 36 ILE A CG2 10 
ATOM   6870  C  CD1 . ILE A 1 36 ? -1.751  -0.039  3.350   1.00 0.00 ? 36 ILE A CD1 10 
ATOM   6871  N  N   . PHE A 1 37 ? -2.170  4.512   4.973   1.00 0.00 ? 37 PHE A N   10 
ATOM   6872  C  CA  . PHE A 1 37 ? -1.024  5.276   4.450   1.00 0.00 ? 37 PHE A CA  10 
ATOM   6873  C  C   . PHE A 1 37 ? 0.231   4.475   4.688   1.00 0.00 ? 37 PHE A C   10 
ATOM   6874  O  O   . PHE A 1 37 ? 0.694   4.359   5.854   1.00 0.00 ? 37 PHE A O   10 
ATOM   6875  C  CB  . PHE A 1 37 ? -0.940  6.679   5.115   1.00 0.00 ? 37 PHE A CB  10 
ATOM   6876  C  CG  . PHE A 1 37 ? 0.006   6.912   6.302   1.00 0.00 ? 37 PHE A CG  10 
ATOM   6877  C  CD1 . PHE A 1 37 ? 1.384   7.042   6.106   1.00 0.00 ? 37 PHE A CD1 10 
ATOM   6878  C  CD2 . PHE A 1 37 ? -0.522  7.038   7.592   1.00 0.00 ? 37 PHE A CD2 10 
ATOM   6879  C  CE1 . PHE A 1 37 ? 2.222   7.296   7.189   1.00 0.00 ? 37 PHE A CE1 10 
ATOM   6880  C  CE2 . PHE A 1 37 ? 0.317   7.284   8.673   1.00 0.00 ? 37 PHE A CE2 10 
ATOM   6881  C  CZ  . PHE A 1 37 ? 1.689   7.415   8.472   1.00 0.00 ? 37 PHE A CZ  10 
ATOM   6882  N  N   . CYS A 1 38 ? 0.886   3.781   3.561   1.00 0.00 ? 38 CYS A N   10 
ATOM   6883  C  CA  . CYS A 1 38 ? 1.940   2.789   3.771   1.00 0.00 ? 38 CYS A CA  10 
ATOM   6884  C  C   . CYS A 1 38 ? 3.226   3.077   3.050   1.00 0.00 ? 38 CYS A C   10 
ATOM   6885  O  O   . CYS A 1 38 ? 3.231   3.767   2.005   1.00 0.00 ? 38 CYS A O   10 
ATOM   6886  C  CB  . CYS A 1 38 ? 1.346   1.422   3.304   1.00 0.00 ? 38 CYS A CB  10 
ATOM   6887  S  SG  . CYS A 1 38 ? 2.649   0.300   2.748   1.00 0.00 ? 38 CYS A SG  10 
ATOM   6888  N  N   . ARG A 1 39 ? 4.479   2.560   3.634   1.00 0.00 ? 39 ARG A N   10 
ATOM   6889  C  CA  . ARG A 1 39 ? 5.725   2.558   2.848   1.00 0.00 ? 39 ARG A CA  10 
ATOM   6890  C  C   . ARG A 1 39 ? 5.646   1.403   1.869   1.00 0.00 ? 39 ARG A C   10 
ATOM   6891  O  O   . ARG A 1 39 ? 5.771   0.229   2.255   1.00 0.00 ? 39 ARG A O   10 
ATOM   6892  C  CB  . ARG A 1 39 ? 6.940   2.445   3.797   1.00 0.00 ? 39 ARG A CB  10 
ATOM   6893  C  CG  . ARG A 1 39 ? 7.407   3.770   4.457   1.00 0.00 ? 39 ARG A CG  10 
ATOM   6894  C  CD  . ARG A 1 39 ? 8.402   3.534   5.602   1.00 0.00 ? 39 ARG A CD  10 
ATOM   6895  N  NE  . ARG A 1 39 ? 9.647   2.965   5.028   1.00 0.00 ? 39 ARG A NE  10 
ATOM   6896  C  CZ  . ARG A 1 39 ? 10.432  2.071   5.615   1.00 0.00 ? 39 ARG A CZ  10 
ATOM   6897  N  NH1 . ARG A 1 39 ? 10.214  1.564   6.792   1.00 0.00 ? 39 ARG A NH1 10 
ATOM   6898  N  NH2 . ARG A 1 39 ? 11.477  1.685   4.972   1.00 0.00 ? 39 ARG A NH2 10 
ATOM   6899  N  N   . PRO A 1 40 ? 5.438   1.734   0.449   1.00 0.00 ? 40 PRO A N   10 
ATOM   6900  C  CA  . PRO A 1 40 ? 5.269   0.762   -0.728  1.00 0.00 ? 40 PRO A CA  10 
ATOM   6901  C  C   . PRO A 1 40 ? 5.779   -0.647  -0.565  1.00 0.00 ? 40 PRO A C   10 
ATOM   6902  O  O   . PRO A 1 40 ? 6.937   -0.950  -0.930  1.00 0.00 ? 40 PRO A O   10 
ATOM   6903  C  CB  . PRO A 1 40 ? 6.015   1.457   -1.876  1.00 0.00 ? 40 PRO A CB  10 
ATOM   6904  C  CG  . PRO A 1 40 ? 5.561   2.907   -1.654  1.00 0.00 ? 40 PRO A CG  10 
ATOM   6905  C  CD  . PRO A 1 40 ? 5.345   3.092   -0.148  1.00 0.00 ? 40 PRO A CD  10 
ATOM   6906  N  N   . SER A 1 41 ? 4.862   -1.667  0.002   1.00 0.00 ? 41 SER A N   10 
ATOM   6907  C  CA  . SER A 1 41 ? 5.219   -3.079  0.022   1.00 0.00 ? 41 SER A CA  10 
ATOM   6908  C  C   . SER A 1 41 ? 4.193   -4.004  0.629   1.00 0.00 ? 41 SER A C   10 
ATOM   6909  O  O   . SER A 1 41 ? 4.568   -5.172  0.955   1.00 0.00 ? 41 SER A O   10 
ATOM   6910  C  CB  . SER A 1 41 ? 6.602   -3.260  0.727   1.00 0.00 ? 41 SER A CB  10 
ATOM   6911  O  OG  . SER A 1 41 ? 6.973   -2.115  1.500   1.00 0.00 ? 41 SER A OG  10 
ATOM   6912  N  N   . CYS A 1 42 ? 2.781   -3.596  0.819   1.00 0.00 ? 42 CYS A N   10 
ATOM   6913  C  CA  . CYS A 1 42 ? 1.816   -4.481  1.467   1.00 0.00 ? 42 CYS A CA  10 
ATOM   6914  C  C   . CYS A 1 42 ? 1.832   -5.840  0.788   1.00 0.00 ? 42 CYS A C   10 
ATOM   6915  O  O   . CYS A 1 42 ? 1.311   -6.025  -0.320  1.00 0.00 ? 42 CYS A O   10 
ATOM   6916  C  CB  . CYS A 1 42 ? 0.401   -3.892  1.558   1.00 0.00 ? 42 CYS A CB  10 
ATOM   6917  S  SG  . CYS A 1 42 ? 0.377   -2.133  1.950   1.00 0.00 ? 42 CYS A SG  10 
ATOM   6918  N  N   . ARG A 1 43 ? 2.540   -6.918  1.509   1.00 0.00 ? 43 ARG A N   10 
ATOM   6919  C  CA  . ARG A 1 43 ? 2.817   -8.225  0.922   1.00 0.00 ? 43 ARG A CA  10 
ATOM   6920  C  C   . ARG A 1 43 ? 1.580   -9.077  0.793   1.00 0.00 ? 43 ARG A C   10 
ATOM   6921  O  O   . ARG A 1 43 ? 1.543   -10.052 0.020   1.00 0.00 ? 43 ARG A O   10 
ATOM   6922  C  CB  . ARG A 1 43 ? 3.921   -8.914  1.778   1.00 0.00 ? 43 ARG A CB  10 
ATOM   6923  C  CG  . ARG A 1 43 ? 4.911   -7.929  2.454   1.00 0.00 ? 43 ARG A CG  10 
ATOM   6924  C  CD  . ARG A 1 43 ? 6.176   -8.624  2.973   1.00 0.00 ? 43 ARG A CD  10 
ATOM   6925  N  NE  . ARG A 1 43 ? 7.193   -8.610  1.891   1.00 0.00 ? 43 ARG A NE  10 
ATOM   6926  C  CZ  . ARG A 1 43 ? 8.121   -9.537  1.694   1.00 0.00 ? 43 ARG A CZ  10 
ATOM   6927  N  NH1 . ARG A 1 43 ? 8.271   -10.594 2.436   1.00 0.00 ? 43 ARG A NH1 10 
ATOM   6928  N  NH2 . ARG A 1 43 ? 8.923   -9.372  0.703   1.00 0.00 ? 43 ARG A NH2 10 
ATOM   6929  N  N   . ALA A 1 44 ? 0.401   -8.685  1.593   1.00 0.00 ? 44 ALA A N   10 
ATOM   6930  C  CA  . ALA A 1 44 ? -0.901  -9.312  1.418   1.00 0.00 ? 44 ALA A CA  10 
ATOM   6931  C  C   . ALA A 1 44 ? -1.627  -8.687  0.238   1.00 0.00 ? 44 ALA A C   10 
ATOM   6932  O  O   . ALA A 1 44 ? -1.089  -7.861  -0.509  1.00 0.00 ? 44 ALA A O   10 
ATOM   6933  C  CB  . ALA A 1 44 ? -1.682  -9.144  2.733   1.00 0.00 ? 44 ALA A CB  10 
ATOM   6934  N  N   . ARG A 1 45 ? -3.013  -9.181  0.030   1.00 0.00 ? 45 ARG A N   10 
ATOM   6935  C  CA  . ARG A 1 45 ? -3.905  -8.566  -0.948  1.00 0.00 ? 45 ARG A CA  10 
ATOM   6936  C  C   . ARG A 1 45 ? -3.994  -7.072  -0.714  1.00 0.00 ? 45 ARG A C   10 
ATOM   6937  O  O   . ARG A 1 45 ? -4.873  -6.577  0.003   1.00 0.00 ? 45 ARG A O   10 
ATOM   6938  C  CB  . ARG A 1 45 ? -5.300  -9.241  -0.866  1.00 0.00 ? 45 ARG A CB  10 
ATOM   6939  C  CG  . ARG A 1 45 ? -6.117  -9.214  -2.186  1.00 0.00 ? 45 ARG A CG  10 
ATOM   6940  C  CD  . ARG A 1 45 ? -7.606  -9.508  -1.965  1.00 0.00 ? 45 ARG A CD  10 
ATOM   6941  N  NE  . ARG A 1 45 ? -7.782  -10.979 -1.863  1.00 0.00 ? 45 ARG A NE  10 
ATOM   6942  C  CZ  . ARG A 1 45 ? -8.842  -11.659 -2.279  1.00 0.00 ? 45 ARG A CZ  10 
ATOM   6943  N  NH1 . ARG A 1 45 ? -9.883  -11.123 -2.844  1.00 0.00 ? 45 ARG A NH1 10 
ATOM   6944  N  NH2 . ARG A 1 45 ? -8.833  -12.934 -2.110  1.00 0.00 ? 45 ARG A NH2 10 
ATOM   6945  N  N   . HIS A 1 46 ? -2.996  -6.242  -1.421  1.00 0.00 ? 46 HIS A N   10 
ATOM   6946  C  CA  . HIS A 1 46 ? -2.836  -4.816  -1.155  1.00 0.00 ? 46 HIS A CA  10 
ATOM   6947  C  C   . HIS A 1 46 ? -3.838  -3.983  -1.917  1.00 0.00 ? 46 HIS A C   10 
ATOM   6948  O  O   . HIS A 1 46 ? -4.865  -4.474  -2.404  1.00 0.00 ? 46 HIS A O   10 
ATOM   6949  C  CB  . HIS A 1 46 ? -1.402  -4.455  -1.580  1.00 0.00 ? 46 HIS A CB  10 
ATOM   6950  C  CG  . HIS A 1 46 ? -1.281  -4.205  -3.054  1.00 0.00 ? 46 HIS A CG  10 
ATOM   6951  N  ND1 . HIS A 1 46 ? -1.608  -5.106  -4.064  1.00 0.00 ? 46 HIS A ND1 10 
ATOM   6952  C  CD2 . HIS A 1 46 ? -0.814  -3.006  -3.575  1.00 0.00 ? 46 HIS A CD2 10 
ATOM   6953  C  CE1 . HIS A 1 46 ? -1.301  -4.363  -5.144  1.00 0.00 ? 46 HIS A CE1 10 
ATOM   6954  N  NE2 . HIS A 1 46 ? -0.826  -3.104  -4.942  1.00 0.00 ? 46 HIS A NE2 10 
ATOM   6955  N  N   . ALA A 1 47 ? -3.539  -2.536  -2.015  1.00 0.00 ? 47 ALA A N   10 
ATOM   6956  C  CA  . ALA A 1 47 ? -4.492  -1.580  -2.569  1.00 0.00 ? 47 ALA A CA  10 
ATOM   6957  C  C   . ALA A 1 47 ? -4.126  -1.198  -3.984  1.00 0.00 ? 47 ALA A C   10 
ATOM   6958  O  O   . ALA A 1 47 ? -2.979  -1.347  -4.427  1.00 0.00 ? 47 ALA A O   10 
ATOM   6959  C  CB  . ALA A 1 47 ? -4.544  -0.370  -1.620  1.00 0.00 ? 47 ALA A CB  10 
ATOM   6960  N  N   . LEU A 1 48 ? -5.210  -0.600  -4.795  1.00 0.00 ? 48 LEU A N   10 
ATOM   6961  C  CA  . LEU A 1 48 ? -5.001  -0.169  -6.174  1.00 0.00 ? 48 LEU A CA  10 
ATOM   6962  C  C   . LEU A 1 48 ? -4.459  1.241   -6.220  1.00 0.00 ? 48 LEU A C   10 
ATOM   6963  O  O   . LEU A 1 48 ? -4.566  2.010   -5.253  1.00 0.00 ? 48 LEU A O   10 
ATOM   6964  C  CB  . LEU A 1 48 ? -6.319  -0.297  -6.991  1.00 0.00 ? 48 LEU A CB  10 
ATOM   6965  C  CG  . LEU A 1 48 ? -7.604  -0.763  -6.253  1.00 0.00 ? 48 LEU A CG  10 
ATOM   6966  C  CD1 . LEU A 1 48 ? -8.125  0.354   -5.340  1.00 0.00 ? 48 LEU A CD1 10 
ATOM   6967  C  CD2 . LEU A 1 48 ? -8.716  -1.201  -7.221  1.00 0.00 ? 48 LEU A CD2 10 
ATOM   6968  N  N   . ARG A 1 49 ? -3.763  1.640   -7.462  1.00 0.00 ? 49 ARG A N   10 
ATOM   6969  C  CA  . ARG A 1 49 ? -3.258  2.992   -7.683  1.00 0.00 ? 49 ARG A CA  10 
ATOM   6970  C  C   . ARG A 1 49 ? -4.375  3.964   -7.972  1.00 0.00 ? 49 ARG A C   10 
ATOM   6971  O  O   . ARG A 1 49 ? -4.169  5.187   -8.055  1.00 0.00 ? 49 ARG A O   10 
ATOM   6972  C  CB  . ARG A 1 49 ? -2.263  2.945   -8.885  1.00 0.00 ? 49 ARG A CB  10 
ATOM   6973  C  CG  . ARG A 1 49 ? -1.821  4.320   -9.449  1.00 0.00 ? 49 ARG A CG  10 
ATOM   6974  C  CD  . ARG A 1 49 ? -2.819  4.903   -10.457 1.00 0.00 ? 49 ARG A CD  10 
ATOM   6975  N  NE  . ARG A 1 49 ? -2.342  4.613   -11.833 1.00 0.00 ? 49 ARG A NE  10 
ATOM   6976  C  CZ  . ARG A 1 49 ? -3.070  4.718   -12.937 1.00 0.00 ? 49 ARG A CZ  10 
ATOM   6977  N  NH1 . ARG A 1 49 ? -4.317  5.086   -12.962 1.00 0.00 ? 49 ARG A NH1 10 
ATOM   6978  N  NH2 . ARG A 1 49 ? -2.499  4.434   -14.054 1.00 0.00 ? 49 ARG A NH2 10 
ATOM   6979  N  N   . GLU A 1 50 ? -5.739  3.409   -8.108  1.00 0.00 ? 50 GLU A N   10 
ATOM   6980  C  CA  . GLU A 1 50 ? -6.873  4.166   -8.617  1.00 0.00 ? 50 GLU A CA  10 
ATOM   6981  C  C   . GLU A 1 50 ? -7.418  5.218   -7.688  1.00 0.00 ? 50 GLU A C   10 
ATOM   6982  O  O   . GLU A 1 50 ? -8.023  6.217   -8.149  1.00 0.00 ? 50 GLU A O   10 
ATOM   6983  C  CB  . GLU A 1 50 ? -7.989  3.149   -9.021  1.00 0.00 ? 50 GLU A CB  10 
ATOM   6984  C  CG  . GLU A 1 50 ? -7.520  1.807   -9.673  1.00 0.00 ? 50 GLU A CG  10 
ATOM   6985  C  CD  . GLU A 1 50 ? -6.996  1.840   -11.111 1.00 0.00 ? 50 GLU A CD  10 
ATOM   6986  O  OE1 . GLU A 1 50 ? -5.875  2.236   -11.403 1.00 0.00 ? 50 GLU A OE1 10 
ATOM   6987  O  OE2 . GLU A 1 50 ? -7.892  1.387   -12.031 1.00 0.00 ? 50 GLU A OE2 10 
ATOM   6988  N  N   . ASN A 1 51 ? -7.195  5.071   -6.246  1.00 0.00 ? 51 ASN A N   10 
ATOM   6989  C  CA  . ASN A 1 51 ? -7.769  5.994   -5.234  1.00 0.00 ? 51 ASN A CA  10 
ATOM   6990  C  C   . ASN A 1 51 ? -6.627  6.410   -4.323  1.00 0.00 ? 51 ASN A C   10 
ATOM   6991  O  O   . ASN A 1 51 ? -6.818  6.871   -3.189  1.00 0.00 ? 51 ASN A O   10 
ATOM   6992  C  CB  . ASN A 1 51 ? -8.739  5.126   -4.391  1.00 0.00 ? 51 ASN A CB  10 
ATOM   6993  C  CG  . ASN A 1 51 ? -8.065  4.182   -3.367  1.00 0.00 ? 51 ASN A CG  10 
ATOM   6994  O  OD1 . ASN A 1 51 ? -7.358  3.245   -3.702  1.00 0.00 ? 51 ASN A OD1 10 
ATOM   6995  N  ND2 . ASN A 1 51 ? -8.287  4.404   -2.102  1.00 0.00 ? 51 ASN A ND2 10 
ATOM   6996  N  N   . VAL A 1 52 ? -5.267  6.171   -4.853  1.00 0.00 ? 52 VAL A N   10 
ATOM   6997  C  CA  . VAL A 1 52 ? -4.084  6.159   -3.998  1.00 0.00 ? 52 VAL A CA  10 
ATOM   6998  C  C   . VAL A 1 52 ? -3.386  7.491   -4.041  1.00 0.00 ? 52 VAL A C   10 
ATOM   6999  O  O   . VAL A 1 52 ? -3.293  8.122   -5.119  1.00 0.00 ? 52 VAL A O   10 
ATOM   7000  C  CB  . VAL A 1 52 ? -3.134  4.966   -4.424  1.00 0.00 ? 52 VAL A CB  10 
ATOM   7001  C  CG1 . VAL A 1 52 ? -1.892  5.329   -5.279  1.00 0.00 ? 52 VAL A CG1 10 
ATOM   7002  C  CG2 . VAL A 1 52 ? -2.587  4.157   -3.219  1.00 0.00 ? 52 VAL A CG2 10 
ATOM   7003  N  N   . SER A 1 53 ? -2.850  8.054   -2.784  1.00 0.00 ? 53 SER A N   10 
ATOM   7004  C  CA  . SER A 1 53 ? -2.081  9.298   -2.763  1.00 0.00 ? 53 SER A CA  10 
ATOM   7005  C  C   . SER A 1 53 ? -0.602  9.012   -2.669  1.00 0.00 ? 53 SER A C   10 
ATOM   7006  O  O   . SER A 1 53 ? -0.171  7.857   -2.518  1.00 0.00 ? 53 SER A O   10 
ATOM   7007  C  CB  . SER A 1 53 ? -2.573  10.242  -1.641  1.00 0.00 ? 53 SER A CB  10 
ATOM   7008  O  OG  . SER A 1 53 ? -2.285  11.621  -1.905  1.00 0.00 ? 53 SER A OG  10 
ATOM   7009  N  N   . PHE A 1 54 ? 0.316   10.167  -2.806  1.00 0.00 ? 54 PHE A N   10 
ATOM   7010  C  CA  . PHE A 1 54 ? 1.761   10.014  -2.670  1.00 0.00 ? 54 PHE A CA  10 
ATOM   7011  C  C   . PHE A 1 54 ? 2.391   11.168  -1.924  1.00 0.00 ? 54 PHE A C   10 
ATOM   7012  O  O   . PHE A 1 54 ? 2.092   12.350  -2.139  1.00 0.00 ? 54 PHE A O   10 
ATOM   7013  C  CB  . PHE A 1 54 ? 2.435   9.905   -4.071  1.00 0.00 ? 54 PHE A CB  10 
ATOM   7014  C  CG  . PHE A 1 54 ? 2.000   8.745   -4.978  1.00 0.00 ? 54 PHE A CG  10 
ATOM   7015  C  CD1 . PHE A 1 54 ? 0.917   8.885   -5.850  1.00 0.00 ? 54 PHE A CD1 10 
ATOM   7016  C  CD2 . PHE A 1 54 ? 2.704   7.536   -4.942  1.00 0.00 ? 54 PHE A CD2 10 
ATOM   7017  C  CE1 . PHE A 1 54 ? 0.542   7.827   -6.673  1.00 0.00 ? 54 PHE A CE1 10 
ATOM   7018  C  CE2 . PHE A 1 54 ? 2.327   6.479   -5.764  1.00 0.00 ? 54 PHE A CE2 10 
ATOM   7019  C  CZ  . PHE A 1 54 ? 1.246   6.625   -6.630  1.00 0.00 ? 54 PHE A CZ  10 
ATOM   7020  N  N   . TYR A 1 55 ? 3.432   10.801  -0.941  1.00 0.00 ? 55 TYR A N   10 
ATOM   7021  C  CA  . TYR A 1 55 ? 4.251   11.768  -0.199  1.00 0.00 ? 55 TYR A CA  10 
ATOM   7022  C  C   . TYR A 1 55 ? 5.694   11.322  -0.188  1.00 0.00 ? 55 TYR A C   10 
ATOM   7023  O  O   . TYR A 1 55 ? 6.001   10.144  -0.507  1.00 0.00 ? 55 TYR A O   10 
ATOM   7024  C  CB  . TYR A 1 55 ? 3.742   11.854  1.269   1.00 0.00 ? 55 TYR A CB  10 
ATOM   7025  C  CG  . TYR A 1 55 ? 2.231   11.615  1.468   1.00 0.00 ? 55 TYR A CG  10 
ATOM   7026  C  CD1 . TYR A 1 55 ? 1.347   12.196  0.545   1.00 0.00 ? 55 TYR A CD1 10 
ATOM   7027  C  CD2 . TYR A 1 55 ? 1.721   10.871  2.531   1.00 0.00 ? 55 TYR A CD2 10 
ATOM   7028  C  CE1 . TYR A 1 55 ? -0.027  12.029  0.690   1.00 0.00 ? 55 TYR A CE1 10 
ATOM   7029  C  CE2 . TYR A 1 55 ? 0.345   10.705  2.672   1.00 0.00 ? 55 TYR A CE2 10 
ATOM   7030  C  CZ  . TYR A 1 55 ? -0.527  11.285  1.756   1.00 0.00 ? 55 TYR A CZ  10 
ATOM   7031  O  OH  . TYR A 1 55 ? -1.876  11.129  1.904   1.00 0.00 ? 55 TYR A OH  10 
ATOM   7032  N  N   . ALA A 1 56 ? 6.766   12.282  0.158   1.00 0.00 ? 56 ALA A N   10 
ATOM   7033  C  CA  . ALA A 1 56 ? 8.162   11.878  0.342   1.00 0.00 ? 56 ALA A CA  10 
ATOM   7034  C  C   . ALA A 1 56 ? 8.402   11.205  1.671   1.00 0.00 ? 56 ALA A C   10 
ATOM   7035  O  O   . ALA A 1 56 ? 9.307   10.357  1.805   1.00 0.00 ? 56 ALA A O   10 
ATOM   7036  C  CB  . ALA A 1 56 ? 9.036   13.130  0.142   1.00 0.00 ? 56 ALA A CB  10 
ATOM   7037  N  N   . ASN A 1 57 ? 7.559   11.615  2.815   1.00 0.00 ? 57 ASN A N   10 
ATOM   7038  C  CA  . ASN A 1 57 ? 7.768   11.077  4.157   1.00 0.00 ? 57 ASN A CA  10 
ATOM   7039  C  C   . ASN A 1 57 ? 6.459   10.846  4.874   1.00 0.00 ? 57 ASN A C   10 
ATOM   7040  O  O   . ASN A 1 57 ? 5.448   11.516  4.626   1.00 0.00 ? 57 ASN A O   10 
ATOM   7041  C  CB  . ASN A 1 57 ? 8.682   12.036  4.973   1.00 0.00 ? 57 ASN A CB  10 
ATOM   7042  C  CG  . ASN A 1 57 ? 9.056   11.593  6.392   1.00 0.00 ? 57 ASN A CG  10 
ATOM   7043  O  OD1 . ASN A 1 57 ? 8.609   12.141  7.389   1.00 0.00 ? 57 ASN A OD1 10 
ATOM   7044  N  ND2 . ASN A 1 57 ? 9.870   10.583  6.540   1.00 0.00 ? 57 ASN A ND2 10 
ATOM   7045  N  N   . ALA A 1 58 ? 6.447   9.745   5.866   1.00 0.00 ? 58 ALA A N   10 
ATOM   7046  C  CA  . ALA A 1 58 ? 5.248   9.376   6.609   1.00 0.00 ? 58 ALA A CA  10 
ATOM   7047  C  C   . ALA A 1 58 ? 4.803   10.457  7.565   1.00 0.00 ? 58 ALA A C   10 
ATOM   7048  O  O   . ALA A 1 58 ? 3.647   10.460  8.032   1.00 0.00 ? 58 ALA A O   10 
ATOM   7049  C  CB  . ALA A 1 58 ? 5.529   8.038   7.319   1.00 0.00 ? 58 ALA A CB  10 
ATOM   7050  N  N   . SER A 1 59 ? 5.790   11.485  7.955   1.00 0.00 ? 59 SER A N   10 
ATOM   7051  C  CA  . SER A 1 59 ? 5.437   12.595  8.841   1.00 0.00 ? 59 SER A CA  10 
ATOM   7052  C  C   . SER A 1 59 ? 4.354   13.447  8.222   1.00 0.00 ? 59 SER A C   10 
ATOM   7053  O  O   . SER A 1 59 ? 3.490   14.009  8.909   1.00 0.00 ? 59 SER A O   10 
ATOM   7054  C  CB  . SER A 1 59 ? 6.684   13.434  9.212   1.00 0.00 ? 59 SER A CB  10 
ATOM   7055  O  OG  . SER A 1 59 ? 6.634   13.946  10.549  1.00 0.00 ? 59 SER A OG  10 
ATOM   7056  N  N   . GLU A 1 60 ? 4.364   13.541  6.744   1.00 0.00 ? 60 GLU A N   10 
ATOM   7057  C  CA  . GLU A 1 60 ? 3.300   14.213  6.006   1.00 0.00 ? 60 GLU A CA  10 
ATOM   7058  C  C   . GLU A 1 60 ? 1.996   13.459  6.119   1.00 0.00 ? 60 GLU A C   10 
ATOM   7059  O  O   . GLU A 1 60 ? 0.968   13.999  6.552   1.00 0.00 ? 60 GLU A O   10 
ATOM   7060  C  CB  . GLU A 1 60 ? 3.741   14.362  4.523   1.00 0.00 ? 60 GLU A CB  10 
ATOM   7061  C  CG  . GLU A 1 60 ? 2.630   14.251  3.427   1.00 0.00 ? 60 GLU A CG  10 
ATOM   7062  C  CD  . GLU A 1 60 ? 2.394   15.453  2.508   1.00 0.00 ? 60 GLU A CD  10 
ATOM   7063  O  OE1 . GLU A 1 60 ? 1.909   16.506  2.901   1.00 0.00 ? 60 GLU A OE1 10 
ATOM   7064  O  OE2 . GLU A 1 60 ? 2.774   15.240  1.218   1.00 0.00 ? 60 GLU A OE2 10 
ATOM   7065  N  N   . ALA A 1 61 ? 1.997   12.055  5.649   1.00 0.00 ? 61 ALA A N   10 
ATOM   7066  C  CA  . ALA A 1 61 ? 0.809   11.213  5.728   1.00 0.00 ? 61 ALA A CA  10 
ATOM   7067  C  C   . ALA A 1 61 ? 0.191   11.209  7.107   1.00 0.00 ? 61 ALA A C   10 
ATOM   7068  O  O   . ALA A 1 61 ? -1.014  10.928  7.265   1.00 0.00 ? 61 ALA A O   10 
ATOM   7069  C  CB  . ALA A 1 61 ? 1.201   9.803   5.253   1.00 0.00 ? 61 ALA A CB  10 
ATOM   7070  N  N   . LEU A 1 62 ? 1.067   11.501  8.261   1.00 0.00 ? 62 LEU A N   10 
ATOM   7071  C  CA  . LEU A 1 62 ? 0.529   11.666  9.611   1.00 0.00 ? 62 LEU A CA  10 
ATOM   7072  C  C   . LEU A 1 62 ? -0.105  13.027  9.774   1.00 0.00 ? 62 LEU A C   10 
ATOM   7073  O  O   . LEU A 1 62 ? -1.180  13.179  10.371  1.00 0.00 ? 62 LEU A O   10 
ATOM   7074  C  CB  . LEU A 1 62 ? 1.640   11.432  10.673  1.00 0.00 ? 62 LEU A CB  10 
ATOM   7075  C  CG  . LEU A 1 62 ? 1.276   10.628  11.951  1.00 0.00 ? 62 LEU A CG  10 
ATOM   7076  C  CD1 . LEU A 1 62 ? 1.797   11.356  13.198  1.00 0.00 ? 62 LEU A CD1 10 
ATOM   7077  C  CD2 . LEU A 1 62 ? -0.235  10.381  12.089  1.00 0.00 ? 62 LEU A CD2 10 
ATOM   7078  N  N   . ALA A 1 63 ? 0.650   14.172  9.220   1.00 0.00 ? 63 ALA A N   10 
ATOM   7079  C  CA  . ALA A 1 63 ? 0.086   15.518  9.149   1.00 0.00 ? 63 ALA A CA  10 
ATOM   7080  C  C   . ALA A 1 63 ? -1.295  15.507  8.539   1.00 0.00 ? 63 ALA A C   10 
ATOM   7081  O  O   . ALA A 1 63 ? -2.189  16.270  8.940   1.00 0.00 ? 63 ALA A O   10 
ATOM   7082  C  CB  . ALA A 1 63 ? 1.073   16.404  8.368   1.00 0.00 ? 63 ALA A CB  10 
ATOM   7083  N  N   . ALA A 1 64 ? -1.544  14.517  7.468   1.00 0.00 ? 64 ALA A N   10 
ATOM   7084  C  CA  . ALA A 1 64 ? -2.881  14.300  6.918   1.00 0.00 ? 64 ALA A CA  10 
ATOM   7085  C  C   . ALA A 1 64 ? -3.773  13.670  7.969   1.00 0.00 ? 64 ALA A C   10 
ATOM   7086  O  O   . ALA A 1 64 ? -4.964  13.979  8.100   1.00 0.00 ? 64 ALA A O   10 
ATOM   7087  C  CB  . ALA A 1 64 ? -2.736  13.430  5.660   1.00 0.00 ? 64 ALA A CB  10 
ATOM   7088  N  N   . GLY A 1 65 ? -3.102  12.685  8.853   1.00 0.00 ? 65 GLY A N   10 
ATOM   7089  C  CA  . GLY A 1 65 ? -3.790  12.060  9.978   1.00 0.00 ? 65 GLY A CA  10 
ATOM   7090  C  C   . GLY A 1 65 ? -4.302  10.688  9.580   1.00 0.00 ? 65 GLY A C   10 
ATOM   7091  O  O   . GLY A 1 65 ? -5.395  10.254  9.963   1.00 0.00 ? 65 GLY A O   10 
ATOM   7092  N  N   . PHE A 1 66 ? -3.421  9.922   8.671   1.00 0.00 ? 66 PHE A N   10 
ATOM   7093  C  CA  . PHE A 1 66 ? -3.831  8.666   8.052   1.00 0.00 ? 66 PHE A CA  10 
ATOM   7094  C  C   . PHE A 1 66 ? -3.246  7.472   8.762   1.00 0.00 ? 66 PHE A C   10 
ATOM   7095  O  O   . PHE A 1 66 ? -2.615  7.612   9.837   1.00 0.00 ? 66 PHE A O   10 
ATOM   7096  C  CB  . PHE A 1 66 ? -3.393  8.666   6.552   1.00 0.00 ? 66 PHE A CB  10 
ATOM   7097  C  CG  . PHE A 1 66 ? -4.219  7.767   5.620   1.00 0.00 ? 66 PHE A CG  10 
ATOM   7098  C  CD1 . PHE A 1 66 ? -5.536  7.444   5.979   1.00 0.00 ? 66 PHE A CD1 10 
ATOM   7099  C  CD2 . PHE A 1 66 ? -3.678  7.243   4.444   1.00 0.00 ? 66 PHE A CD2 10 
ATOM   7100  C  CE1 . PHE A 1 66 ? -6.300  6.614   5.167   1.00 0.00 ? 66 PHE A CE1 10 
ATOM   7101  C  CE2 . PHE A 1 66 ? -4.444  6.411   3.633   1.00 0.00 ? 66 PHE A CE2 10 
ATOM   7102  C  CZ  . PHE A 1 66 ? -5.752  6.095   3.996   1.00 0.00 ? 66 PHE A CZ  10 
ATOM   7103  N  N   . ARG A 1 67 ? -3.419  6.134   8.158   1.00 0.00 ? 67 ARG A N   10 
ATOM   7104  C  CA  . ARG A 1 67 ? -3.036  4.914   8.872   1.00 0.00 ? 67 ARG A CA  10 
ATOM   7105  C  C   . ARG A 1 67 ? -1.656  4.442   8.483   1.00 0.00 ? 67 ARG A C   10 
ATOM   7106  O  O   . ARG A 1 67 ? -1.433  3.860   7.414   1.00 0.00 ? 67 ARG A O   10 
ATOM   7107  C  CB  . ARG A 1 67 ? -4.121  3.831   8.634   1.00 0.00 ? 67 ARG A CB  10 
ATOM   7108  C  CG  . ARG A 1 67 ? -3.734  2.401   9.097   1.00 0.00 ? 67 ARG A CG  10 
ATOM   7109  C  CD  . ARG A 1 67 ? -2.808  2.406   10.320  1.00 0.00 ? 67 ARG A CD  10 
ATOM   7110  N  NE  . ARG A 1 67 ? -2.911  1.084   10.989  1.00 0.00 ? 67 ARG A NE  10 
ATOM   7111  C  CZ  . ARG A 1 67 ? -3.857  0.727   11.847  1.00 0.00 ? 67 ARG A CZ  10 
ATOM   7112  N  NH1 . ARG A 1 67 ? -4.837  1.496   12.221  1.00 0.00 ? 67 ARG A NH1 10 
ATOM   7113  N  NH2 . ARG A 1 67 ? -3.796  -0.460  12.337  1.00 0.00 ? 67 ARG A NH2 10 
ATOM   7114  N  N   . PRO A 1 68 ? -0.584  4.684   9.476   1.00 0.00 ? 68 PRO A N   10 
ATOM   7115  C  CA  . PRO A 1 68 ? 0.896   4.336   9.337   1.00 0.00 ? 68 PRO A CA  10 
ATOM   7116  C  C   . PRO A 1 68 ? 1.235   2.877   9.140   1.00 0.00 ? 68 PRO A C   10 
ATOM   7117  O  O   . PRO A 1 68 ? 1.278   2.093   10.110  1.00 0.00 ? 68 PRO A O   10 
ATOM   7118  C  CB  . PRO A 1 68 ? 1.591   4.811   10.615  1.00 0.00 ? 68 PRO A CB  10 
ATOM   7119  C  CG  . PRO A 1 68 ? 0.439   4.816   11.630  1.00 0.00 ? 68 PRO A CG  10 
ATOM   7120  C  CD  . PRO A 1 68 ? -0.753  5.323   10.808  1.00 0.00 ? 68 PRO A CD  10 
ATOM   7121  N  N   . CYS A 1 69 ? 1.491   2.394   7.764   1.00 0.00 ? 69 CYS A N   10 
ATOM   7122  C  CA  . CYS A 1 69 ? 2.007   1.066   7.458   1.00 0.00 ? 69 CYS A CA  10 
ATOM   7123  C  C   . CYS A 1 69 ? 3.520   1.033   7.660   1.00 0.00 ? 69 CYS A C   10 
ATOM   7124  O  O   . CYS A 1 69 ? 4.303   1.473   6.808   1.00 0.00 ? 69 CYS A O   10 
ATOM   7125  C  CB  . CYS A 1 69 ? 1.632   0.721   6.008   1.00 0.00 ? 69 CYS A CB  10 
ATOM   7126  S  SG  . CYS A 1 69 ? 1.097   -0.977  5.727   1.00 0.00 ? 69 CYS A SG  10 
ATOM   7127  N  N   . LYS A 1 70 ? 3.961   0.393   8.926   1.00 0.00 ? 70 LYS A N   10 
ATOM   7128  C  CA  . LYS A 1 70 ? 5.361   0.295   9.316   1.00 0.00 ? 70 LYS A CA  10 
ATOM   7129  C  C   . LYS A 1 70 ? 6.070   -0.759  8.496   1.00 0.00 ? 70 LYS A C   10 
ATOM   7130  O  O   . LYS A 1 70 ? 6.660   -0.461  7.442   1.00 0.00 ? 70 LYS A O   10 
ATOM   7131  C  CB  . LYS A 1 70 ? 5.459   -0.033  10.832  1.00 0.00 ? 70 LYS A CB  10 
ATOM   7132  C  CG  . LYS A 1 70 ? 5.670   1.217   11.722  1.00 0.00 ? 70 LYS A CG  10 
ATOM   7133  C  CD  . LYS A 1 70 ? 4.752   2.399   11.399  1.00 0.00 ? 70 LYS A CD  10 
ATOM   7134  C  CE  . LYS A 1 70 ? 4.899   3.466   12.492  1.00 0.00 ? 70 LYS A CE  10 
ATOM   7135  N  NZ  . LYS A 1 70 ? 6.106   4.270   12.230  1.00 0.00 ? 70 LYS A NZ  10 
ATOM   7136  N  N   . ARG A 1 71 ? 6.062   -2.140  9.021   1.00 0.00 ? 71 ARG A N   10 
ATOM   7137  C  CA  . ARG A 1 71 ? 6.550   -3.260  8.197   1.00 0.00 ? 71 ARG A CA  10 
ATOM   7138  C  C   . ARG A 1 71 ? 5.662   -3.361  6.973   1.00 0.00 ? 71 ARG A C   10 
ATOM   7139  O  O   . ARG A 1 71 ? 6.060   -3.041  5.848   1.00 0.00 ? 71 ARG A O   10 
ATOM   7140  C  CB  . ARG A 1 71 ? 6.542   -4.557  9.041   1.00 0.00 ? 71 ARG A CB  10 
ATOM   7141  C  CG  . ARG A 1 71 ? 6.251   -5.860  8.248   1.00 0.00 ? 71 ARG A CG  10 
ATOM   7142  C  CD  . ARG A 1 71 ? 5.116   -6.686  8.867   1.00 0.00 ? 71 ARG A CD  10 
ATOM   7143  N  NE  . ARG A 1 71 ? 5.702   -7.616  9.866   1.00 0.00 ? 71 ARG A NE  10 
ATOM   7144  C  CZ  . ARG A 1 71 ? 5.904   -7.341  11.148  1.00 0.00 ? 71 ARG A CZ  10 
ATOM   7145  N  NH1 . ARG A 1 71 ? 5.617   -6.204  11.708  1.00 0.00 ? 71 ARG A NH1 10 
ATOM   7146  N  NH2 . ARG A 1 71 ? 6.418   -8.266  11.879  1.00 0.00 ? 71 ARG A NH2 10 
ATOM   7147  N  N   . CYS A 1 72 ? 4.307   -3.904  7.215   1.00 0.00 ? 72 CYS A N   10 
ATOM   7148  C  CA  . CYS A 1 72 ? 3.244   -3.870  6.224   1.00 0.00 ? 72 CYS A CA  10 
ATOM   7149  C  C   . CYS A 1 72 ? 1.983   -4.528  6.766   1.00 0.00 ? 72 CYS A C   10 
ATOM   7150  O  O   . CYS A 1 72 ? 1.623   -5.664  6.432   1.00 0.00 ? 72 CYS A O   10 
ATOM   7151  C  CB  . CYS A 1 72 ? 3.737   -4.430  4.877   1.00 0.00 ? 72 CYS A CB  10 
ATOM   7152  S  SG  . CYS A 1 72 ? 3.937   -3.076  3.666   1.00 0.00 ? 72 CYS A SG  10 
ATOM   7153  N  N   . GLN A 1 73 ? 1.231   -3.725  7.749   1.00 0.00 ? 73 GLN A N   10 
ATOM   7154  C  CA  . GLN A 1 73 ? -0.016  -4.187  8.400   1.00 0.00 ? 73 GLN A CA  10 
ATOM   7155  C  C   . GLN A 1 73 ? -0.894  -4.937  7.440   1.00 0.00 ? 73 GLN A C   10 
ATOM   7156  O  O   . GLN A 1 73 ? -1.133  -4.519  6.300   1.00 0.00 ? 73 GLN A O   10 
ATOM   7157  C  CB  . GLN A 1 73 ? -0.738  -2.944  8.986   1.00 0.00 ? 73 GLN A CB  10 
ATOM   7158  C  CG  . GLN A 1 73 ? -1.359  -3.113  10.411  1.00 0.00 ? 73 GLN A CG  10 
ATOM   7159  C  CD  . GLN A 1 73 ? -0.479  -2.869  11.644  1.00 0.00 ? 73 GLN A CD  10 
ATOM   7160  O  OE1 . GLN A 1 73 ? -0.407  -3.694  12.540  1.00 0.00 ? 73 GLN A OE1 10 
ATOM   7161  N  NE2 . GLN A 1 73 ? 0.194   -1.753  11.756  1.00 0.00 ? 73 GLN A NE2 10 
ATOM   7162  N  N   . PRO A 1 74 ? -1.437  -6.228  7.925   1.00 0.00 ? 74 PRO A N   10 
ATOM   7163  C  CA  . PRO A 1 74 ? -2.332  -7.191  7.147   1.00 0.00 ? 74 PRO A CA  10 
ATOM   7164  C  C   . PRO A 1 74 ? -3.480  -6.561  6.389   1.00 0.00 ? 74 PRO A C   10 
ATOM   7165  O  O   . PRO A 1 74 ? -3.405  -6.381  5.162   1.00 0.00 ? 74 PRO A O   10 
ATOM   7166  C  CB  . PRO A 1 74 ? -2.873  -8.188  8.162   1.00 0.00 ? 74 PRO A CB  10 
ATOM   7167  C  CG  . PRO A 1 74 ? -1.680  -8.284  9.131   1.00 0.00 ? 74 PRO A CG  10 
ATOM   7168  C  CD  . PRO A 1 74 ? -1.206  -6.833  9.259   1.00 0.00 ? 74 PRO A CD  10 
ATOM   7169  N  N   . ASP A 1 75 ? -4.660  -6.123  7.184   1.00 0.00 ? 75 ASP A N   10 
ATOM   7170  C  CA  . ASP A 1 75 ? -5.896  -5.680  6.550   1.00 0.00 ? 75 ASP A CA  10 
ATOM   7171  C  C   . ASP A 1 75 ? -6.093  -6.387  5.220   1.00 0.00 ? 75 ASP A C   10 
ATOM   7172  O  O   . ASP A 1 75 ? -6.415  -5.781  4.190   1.00 0.00 ? 75 ASP A O   10 
ATOM   7173  C  CB  . ASP A 1 75 ? -5.885  -4.139  6.374   1.00 0.00 ? 75 ASP A CB  10 
ATOM   7174  C  CG  . ASP A 1 75 ? -5.990  -3.299  7.655   1.00 0.00 ? 75 ASP A CG  10 
ATOM   7175  O  OD1 . ASP A 1 75 ? -4.819  -3.254  8.358   1.00 0.00 ? 75 ASP A OD1 10 
ATOM   7176  O  OD2 . ASP A 1 75 ? -7.023  -2.749  8.008   1.00 0.00 ? 75 ASP A OD2 10 
ATOM   7177  N  N   . LYS A 1 76 ? -5.865  -7.847  5.233   1.00 0.00 ? 76 LYS A N   10 
ATOM   7178  C  CA  . LYS A 1 76 ? -5.828  -8.654  4.017   1.00 0.00 ? 76 LYS A CA  10 
ATOM   7179  C  C   . LYS A 1 76 ? -7.208  -9.132  3.632   1.00 0.00 ? 76 LYS A C   10 
ATOM   7180  O  O   . LYS A 1 76 ? -8.234  -8.687  4.160   1.00 0.00 ? 76 LYS A O   10 
ATOM   7181  C  CB  . LYS A 1 76 ? -4.859  -9.852  4.244   1.00 0.00 ? 76 LYS A CB  10 
ATOM   7182  C  CG  . LYS A 1 76 ? -5.140  -10.618 5.562   1.00 0.00 ? 76 LYS A CG  10 
ATOM   7183  C  CD  . LYS A 1 76 ? -4.484  -11.997 5.664   1.00 0.00 ? 76 LYS A CD  10 
ATOM   7184  C  CE  . LYS A 1 76 ? -5.369  -12.914 6.520   1.00 0.00 ? 76 LYS A CE  10 
ATOM   7185  N  NZ  . LYS A 1 76 ? -5.559  -12.310 7.851   1.00 0.00 ? 76 LYS A NZ  10 
ATOM   7186  N  N   . ALA A 1 77 ? -7.258  -10.138 2.549   1.00 0.00 ? 77 ALA A N   10 
ATOM   7187  C  CA  . ALA A 1 77 ? -8.479  -10.689 1.976   1.00 0.00 ? 77 ALA A CA  10 
ATOM   7188  C  C   . ALA A 1 77 ? -9.708  -10.540 2.837   1.00 0.00 ? 77 ALA A C   10 
ATOM   7189  O  O   . ALA A 1 77 ? -10.078 -11.441 3.605   1.00 0.00 ? 77 ALA A O   10 
ATOM   7190  C  CB  . ALA A 1 77 ? -8.187  -12.171 1.630   1.00 0.00 ? 77 ALA A CB  10 
ATOM   7191  N  N   . ASN A 1 78 ? -10.467 -9.280  2.688   1.00 0.00 ? 78 ASN A N   10 
ATOM   7192  C  CA  . ASN A 1 78 ? -11.766 -9.059  3.316   1.00 0.00 ? 78 ASN A CA  10 
ATOM   7193  C  C   . ASN A 1 78 ? -11.800 -9.563  4.738   1.00 0.00 ? 78 ASN A C   10 
ATOM   7194  O  O   . ASN A 1 78 ? -12.228 -10.689 5.026   1.00 0.00 ? 78 ASN A O   10 
ATOM   7195  C  CB  . ASN A 1 78 ? -12.874 -9.749  2.463   1.00 0.00 ? 78 ASN A CB  10 
ATOM   7196  C  CG  . ASN A 1 78 ? -13.385 -8.984  1.238   1.00 0.00 ? 78 ASN A CG  10 
ATOM   7197  O  OD1 . ASN A 1 78 ? -12.721 -8.121  0.683   1.00 0.00 ? 78 ASN A OD1 10 
ATOM   7198  N  ND2 . ASN A 1 78 ? -14.565 -9.276  0.762   1.00 0.00 ? 78 ASN A ND2 10 
ATOM   7199  N  N   . PRO A 1 79 ? -11.322 -8.621  5.772   1.00 0.00 ? 79 PRO A N   10 
ATOM   7200  C  CA  . PRO A 1 79 ? -11.247 -8.888  7.277   1.00 0.00 ? 79 PRO A CA  10 
ATOM   7201  C  C   . PRO A 1 79 ? -12.434 -9.630  7.852   1.00 0.00 ? 79 PRO A C   10 
ATOM   7202  O  O   . PRO A 1 79 ? -12.297 -10.495 8.728   1.00 0.00 ? 79 PRO A O   10 
ATOM   7203  C  CB  . PRO A 1 79 ? -11.169 -7.513  7.934   1.00 0.00 ? 79 PRO A CB  10 
ATOM   7204  C  CG  . PRO A 1 79 ? -10.305 -6.760  6.909   1.00 0.00 ? 79 PRO A CG  10 
ATOM   7205  C  CD  . PRO A 1 79 ? -10.829 -7.240  5.552   1.00 0.00 ? 79 PRO A CD  10 
ATOM   7206  N  N   . ARG A 1 80 ? -13.757 -9.293  7.283   1.00 0.00 ? 80 ARG A N   10 
ATOM   7207  C  CA  . ARG A 1 80 ? -14.977 -9.975  7.704   1.00 0.00 ? 80 ARG A CA  10 
ATOM   7208  C  C   . ARG A 1 80 ? -14.871 -11.466 7.479   1.00 0.00 ? 80 ARG A C   10 
ATOM   7209  O  O   . ARG A 1 80 ? -14.044 -11.948 6.694   1.00 0.00 ? 80 ARG A O   10 
ATOM   7210  C  CB  . ARG A 1 80 ? -16.184 -9.370  6.936   1.00 0.00 ? 80 ARG A CB  10 
ATOM   7211  C  CG  . ARG A 1 80 ? -16.655 -7.983  7.446   1.00 0.00 ? 80 ARG A CG  10 
ATOM   7212  C  CD  . ARG A 1 80 ? -15.961 -6.823  6.721   1.00 0.00 ? 80 ARG A CD  10 
ATOM   7213  N  NE  . ARG A 1 80 ? -16.604 -5.554  7.147   1.00 0.00 ? 80 ARG A NE  10 
ATOM   7214  C  CZ  . ARG A 1 80 ? -16.346 -4.899  8.271   1.00 0.00 ? 80 ARG A CZ  10 
ATOM   7215  N  NH1 . ARG A 1 80 ? -15.487 -5.287  9.166   1.00 0.00 ? 80 ARG A NH1 10 
ATOM   7216  N  NH2 . ARG A 1 80 ? -16.992 -3.807  8.483   1.00 0.00 ? 80 ARG A NH2 10 
ATOM   7217  N  N   . GLN A 1 81 ? -15.784 -12.313 8.277   1.00 0.00 ? 81 GLN A N   10 
ATOM   7218  C  CA  . GLN A 1 81 ? -15.833 -13.765 8.128   1.00 0.00 ? 81 GLN A CA  10 
ATOM   7219  C  C   . GLN A 1 81 ? -15.937 -14.168 6.676   1.00 0.00 ? 81 GLN A C   10 
ATOM   7220  O  O   . GLN A 1 81 ? -16.164 -13.342 5.782   1.00 0.00 ? 81 GLN A O   10 
ATOM   7221  C  CB  . GLN A 1 81 ? -17.034 -14.304 8.937   1.00 0.00 ? 81 GLN A CB  10 
ATOM   7222  C  CG  . GLN A 1 81 ? -18.408 -13.598 8.687   1.00 0.00 ? 81 GLN A CG  10 
ATOM   7223  C  CD  . GLN A 1 81 ? -18.789 -12.380 9.537   1.00 0.00 ? 81 GLN A CD  10 
ATOM   7224  O  OE1 . GLN A 1 81 ? -19.454 -11.468 9.072   1.00 0.00 ? 81 GLN A OE1 10 
ATOM   7225  N  NE2 . GLN A 1 81 ? -18.393 -12.302 10.782  1.00 0.00 ? 81 GLN A NE2 10 
ATOM   7226  N  N   . HIS A 1 82 ? -15.791 -15.612 6.388   1.00 0.00 ? 82 HIS A N   10 
ATOM   7227  C  CA  . HIS A 1 82 ? -15.704 -16.129 5.025   1.00 0.00 ? 82 HIS A CA  10 
ATOM   7228  C  C   . HIS A 1 82 ? -17.057 -16.586 4.531   1.00 0.00 ? 82 HIS A C   10 
ATOM   7229  O  O   . HIS A 1 82 ? -17.302 -17.781 4.313   1.00 0.00 ? 82 HIS A O   10 
ATOM   7230  C  CB  . HIS A 1 82 ? -14.723 -17.312 5.073   1.00 0.00 ? 82 HIS A CB  10 
ATOM   7231  C  CG  . HIS A 1 82 ? -14.250 -17.720 3.709   1.00 0.00 ? 82 HIS A CG  10 
ATOM   7232  N  ND1 . HIS A 1 82 ? -13.148 -18.528 3.436   1.00 0.00 ? 82 HIS A ND1 10 
ATOM   7233  C  CD2 . HIS A 1 82 ? -14.887 -17.320 2.543   1.00 0.00 ? 82 HIS A CD2 10 
ATOM   7234  C  CE1 . HIS A 1 82 ? -13.210 -18.555 2.092   1.00 0.00 ? 82 HIS A CE1 10 
ATOM   7235  N  NE2 . HIS A 1 82 ? -14.210 -17.863 1.482   1.00 0.00 ? 82 HIS A NE2 10 
ATOM   7236  N  N   . ARG A 1 83 ? -18.069 -15.529 4.318   1.00 0.00 ? 83 ARG A N   10 
ATOM   7237  C  CA  . ARG A 1 83 ? -19.361 -15.809 3.697   1.00 0.00 ? 83 ARG A CA  10 
ATOM   7238  C  C   . ARG A 1 83 ? -20.000 -17.035 4.305   1.00 0.00 ? 83 ARG A C   10 
ATOM   7239  O  O   . ARG A 1 83 ? -20.300 -18.022 3.619   1.00 0.00 ? 83 ARG A O   10 
ATOM   7240  C  CB  . ARG A 1 83 ? -19.159 -15.975 2.166   1.00 0.00 ? 83 ARG A CB  10 
ATOM   7241  C  CG  . ARG A 1 83 ? -18.900 -14.656 1.393   1.00 0.00 ? 83 ARG A CG  10 
ATOM   7242  C  CD  . ARG A 1 83 ? -19.311 -13.413 2.193   1.00 0.00 ? 83 ARG A CD  10 
ATOM   7243  N  NE  . ARG A 1 83 ? -19.196 -12.227 1.307   1.00 0.00 ? 83 ARG A NE  10 
ATOM   7244  C  CZ  . ARG A 1 83 ? -19.457 -10.975 1.659   1.00 0.00 ? 83 ARG A CZ  10 
ATOM   7245  N  NH1 . ARG A 1 83 ? -19.858 -10.614 2.841   1.00 0.00 ? 83 ARG A NH1 10 
ATOM   7246  N  NH2 . ARG A 1 83 ? -19.300 -10.063 0.766   1.00 0.00 ? 83 ARG A NH2 10 
ATOM   7247  N  N   . LEU A 1 84 ? -20.277 -16.979 5.757   1.00 0.00 ? 84 LEU A N   10 
ATOM   7248  C  CA  . LEU A 1 84 ? -20.956 -18.065 6.458   1.00 0.00 ? 84 LEU A CA  10 
ATOM   7249  C  C   . LEU A 1 84 ? -20.029 -19.241 6.659   1.00 0.00 ? 84 LEU A C   10 
ATOM   7250  O  O   . LEU A 1 84 ? -19.584 -19.892 5.704   1.00 0.00 ? 84 LEU A O   10 
ATOM   7251  C  CB  . LEU A 1 84 ? -22.238 -18.494 5.690   1.00 0.00 ? 84 LEU A CB  10 
ATOM   7252  C  CG  . LEU A 1 84 ? -23.342 -17.427 5.457   1.00 0.00 ? 84 LEU A CG  10 
ATOM   7253  C  CD1 . LEU A 1 84 ? -24.681 -18.112 5.150   1.00 0.00 ? 84 LEU A CD1 10 
ATOM   7254  C  CD2 . LEU A 1 84 ? -23.510 -16.475 6.652   1.00 0.00 ? 84 LEU A CD2 10 
ATOM   7255  N  N   . ASP A 1 85 ? -19.702 -19.585 8.060   1.00 0.00 ? 85 ASP A N   10 
ATOM   7256  C  CA  . ASP A 1 85 ? -18.801 -20.683 8.397   1.00 0.00 ? 85 ASP A CA  10 
ATOM   7257  C  C   . ASP A 1 85 ? -19.351 -21.503 9.541   1.00 0.00 ? 85 ASP A C   10 
ATOM   7258  O  O   . ASP A 1 85 ? -19.322 -22.741 9.529   1.00 0.00 ? 85 ASP A O   10 
ATOM   7259  C  CB  . ASP A 1 85 ? -17.382 -20.140 8.705   1.00 0.00 ? 85 ASP A CB  10 
ATOM   7260  C  CG  . ASP A 1 85 ? -16.213 -21.117 8.516   1.00 0.00 ? 85 ASP A CG  10 
ATOM   7261  O  OD1 . ASP A 1 85 ? -16.330 -22.328 8.639   1.00 0.00 ? 85 ASP A OD1 10 
ATOM   7262  O  OD2 . ASP A 1 85 ? -15.042 -20.489 8.196   1.00 0.00 ? 85 ASP A OD2 10 
ATOM   7263  N  N   . LYS A 1 86 ? -19.943 -20.745 10.665  1.00 0.00 ? 86 LYS A N   10 
ATOM   7264  C  CA  . LYS A 1 86 ? -20.563 -21.412 11.806  1.00 0.00 ? 86 LYS A CA  10 
ATOM   7265  C  C   . LYS A 1 86 ? -21.973 -21.844 11.479  1.00 0.00 ? 86 LYS A C   10 
ATOM   7266  O  O   . LYS A 1 86 ? -22.873 -21.022 11.261  1.00 0.00 ? 86 LYS A O   10 
ATOM   7267  C  CB  . LYS A 1 86 ? -20.544 -20.460 13.034  1.00 0.00 ? 86 LYS A CB  10 
ATOM   7268  C  CG  . LYS A 1 86 ? -19.663 -20.976 14.199  1.00 0.00 ? 86 LYS A CG  10 
ATOM   7269  C  CD  . LYS A 1 86 ? -18.226 -20.448 14.202  1.00 0.00 ? 86 LYS A CD  10 
ATOM   7270  C  CE  . LYS A 1 86 ? -17.262 -21.603 13.897  1.00 0.00 ? 86 LYS A CE  10 
ATOM   7271  N  NZ  . LYS A 1 86 ? -15.920 -21.268 14.405  1.00 0.00 ? 86 LYS A NZ  10 
ATOM   7272  N  N   . ILE A 1 87 ? -22.217 -23.302 11.433  1.00 0.00 ? 87 ILE A N   10 
ATOM   7273  C  CA  . ILE A 1 87 ? -23.556 -23.857 11.256  1.00 0.00 ? 87 ILE A CA  10 
ATOM   7274  C  C   . ILE A 1 87 ? -23.799 -25.000 12.215  1.00 0.00 ? 87 ILE A C   10 
ATOM   7275  O  O   . ILE A 1 87 ? -23.409 -26.150 11.971  1.00 0.00 ? 87 ILE A O   10 
ATOM   7276  C  CB  . ILE A 1 87 ? -23.810 -24.285 9.754   1.00 0.00 ? 87 ILE A CB  10 
ATOM   7277  C  CG1 . ILE A 1 87 ? -22.677 -23.875 8.759   1.00 0.00 ? 87 ILE A CG1 10 
ATOM   7278  C  CG2 . ILE A 1 87 ? -25.164 -23.750 9.193   1.00 0.00 ? 87 ILE A CG2 10 
ATOM   7279  C  CD1 . ILE A 1 87 ? -22.999 -24.053 7.261   1.00 0.00 ? 87 ILE A CD1 10 
ATOM   7280  N  N   . THR A 1 88 ? -24.518 -24.665 13.463  1.00 0.00 ? 88 THR A N   10 
ATOM   7281  C  CA  . THR A 1 88 ? -24.872 -25.679 14.451  1.00 0.00 ? 88 THR A CA  10 
ATOM   7282  C  C   . THR A 1 88 ? -26.327 -26.069 14.343  1.00 0.00 ? 88 THR A C   10 
ATOM   7283  O  O   . THR A 1 88 ? -26.761 -27.095 14.895  1.00 0.00 ? 88 THR A O   10 
ATOM   7284  C  CB  . THR A 1 88 ? -24.539 -25.179 15.897  1.00 0.00 ? 88 THR A CB  10 
ATOM   7285  O  OG1 . THR A 1 88 ? -25.540 -24.280 16.357  1.00 0.00 ? 88 THR A OG1 10 
ATOM   7286  C  CG2 . THR A 1 88 ? -23.215 -24.402 16.065  1.00 0.00 ? 88 THR A CG2 10 
ATOM   7287  N  N   . HIS A 1 89 ? -27.203 -25.204 13.524  1.00 0.00 ? 89 HIS A N   10 
ATOM   7288  C  CA  . HIS A 1 89 ? -28.648 -25.415 13.455  1.00 0.00 ? 89 HIS A CA  10 
ATOM   7289  C  C   . HIS A 1 89 ? -29.030 -26.160 12.199  1.00 0.00 ? 89 HIS A C   10 
ATOM   7290  O  O   . HIS A 1 89 ? -29.168 -25.581 11.112  1.00 0.00 ? 89 HIS A O   10 
ATOM   7291  C  CB  . HIS A 1 89 ? -29.288 -24.017 13.466  1.00 0.00 ? 89 HIS A CB  10 
ATOM   7292  C  CG  . HIS A 1 89 ? -30.586 -23.989 14.220  1.00 0.00 ? 89 HIS A CG  10 
ATOM   7293  N  ND1 . HIS A 1 89 ? -31.692 -23.202 13.909  1.00 0.00 ? 89 HIS A ND1 10 
ATOM   7294  C  CD2 . HIS A 1 89 ? -30.819 -24.773 15.341  1.00 0.00 ? 89 HIS A CD2 10 
ATOM   7295  C  CE1 . HIS A 1 89 ? -32.527 -23.580 14.895  1.00 0.00 ? 89 HIS A CE1 10 
ATOM   7296  N  NE2 . HIS A 1 89 ? -32.088 -24.509 15.787  1.00 0.00 ? 89 HIS A NE2 10 
ATOM   7297  N  N   . ALA A 1 90 ? -29.195 -27.625 12.330  1.00 0.00 ? 90 ALA A N   10 
ATOM   7298  C  CA  . ALA A 1 90 ? -29.560 -28.468 11.195  1.00 0.00 ? 90 ALA A CA  10 
ATOM   7299  C  C   . ALA A 1 90 ? -30.234 -29.737 11.659  1.00 0.00 ? 90 ALA A C   10 
ATOM   7300  O  O   . ALA A 1 90 ? -30.061 -30.818 11.078  1.00 0.00 ? 90 ALA A O   10 
ATOM   7301  C  CB  . ALA A 1 90 ? -28.281 -28.735 10.382  1.00 0.00 ? 90 ALA A CB  10 
ATOM   7302  N  N   . CYS A 1 91 ? -31.098 -29.622 12.854  1.00 0.00 ? 91 CYS A N   10 
ATOM   7303  C  CA  . CYS A 1 91 ? -31.898 -30.741 13.342  1.00 0.00 ? 91 CYS A CA  10 
ATOM   7304  C  C   . CYS A 1 91 ? -33.374 -30.443 13.225  1.00 0.00 ? 91 CYS A C   10 
ATOM   7305  O  O   . CYS A 1 91 ? -33.800 -29.283 13.139  1.00 0.00 ? 91 CYS A O   10 
ATOM   7306  C  CB  . CYS A 1 91 ? -31.474 -31.054 14.791  1.00 0.00 ? 91 CYS A CB  10 
ATOM   7307  S  SG  . CYS A 1 91 ? -29.893 -31.929 14.820  1.00 0.00 ? 91 CYS A SG  10 
ATOM   7308  N  N   . ARG A 1 92 ? -34.279 -31.612 13.201  1.00 0.00 ? 92 ARG A N   10 
ATOM   7309  C  CA  . ARG A 1 92 ? -35.732 -31.466 13.175  1.00 0.00 ? 92 ARG A CA  10 
ATOM   7310  C  C   . ARG A 1 92 ? -36.193 -30.874 11.865  1.00 0.00 ? 92 ARG A C   10 
ATOM   7311  O  O   . ARG A 1 92 ? -36.091 -29.674 11.621  1.00 0.00 ? 92 ARG A O   10 
ATOM   7312  C  CB  . ARG A 1 92 ? -36.171 -30.589 14.380  1.00 0.00 ? 92 ARG A CB  10 
ATOM   7313  C  CG  . ARG A 1 92 ? -37.616 -30.847 14.883  1.00 0.00 ? 92 ARG A CG  10 
ATOM   7314  C  CD  . ARG A 1 92 ? -37.729 -32.133 15.712  1.00 0.00 ? 92 ARG A CD  10 
ATOM   7315  N  NE  . ARG A 1 92 ? -39.060 -32.148 16.372  1.00 0.00 ? 92 ARG A NE  10 
ATOM   7316  C  CZ  . ARG A 1 92 ? -39.347 -31.587 17.539  1.00 0.00 ? 92 ARG A CZ  10 
ATOM   7317  N  NH1 . ARG A 1 92 ? -38.490 -30.940 18.272  1.00 0.00 ? 92 ARG A NH1 10 
ATOM   7318  N  NH2 . ARG A 1 92 ? -40.554 -31.695 17.968  1.00 0.00 ? 92 ARG A NH2 10 
ATOM   7319  O  OXT . ARG A 1 92 ? -36.757 -31.793 10.926  1.00 0.00 ? 92 ARG A OXT 10 
HETATM 7320  ZN ZN  . ZN  B 2 .  ? 1.965   -1.783  3.671   1.00 0.00 ? 93 ZN  A ZN  10 
ATOM   7321  N  N   . MET A 1 1  ? 11.340  24.791  -11.003 1.00 0.00 ? 1  MET A N   11 
ATOM   7322  C  CA  . MET A 1 1  ? 10.874  25.942  -11.771 1.00 0.00 ? 1  MET A CA  11 
ATOM   7323  C  C   . MET A 1 1  ? 11.535  25.990  -13.129 1.00 0.00 ? 1  MET A C   11 
ATOM   7324  O  O   . MET A 1 1  ? 10.884  26.180  -14.165 1.00 0.00 ? 1  MET A O   11 
ATOM   7325  C  CB  . MET A 1 1  ? 11.142  27.250  -10.977 1.00 0.00 ? 1  MET A CB  11 
ATOM   7326  C  CG  . MET A 1 1  ? 10.185  28.425  -11.272 1.00 0.00 ? 1  MET A CG  11 
ATOM   7327  S  SD  . MET A 1 1  ? 11.034  29.987  -10.992 1.00 0.00 ? 1  MET A SD  11 
ATOM   7328  C  CE  . MET A 1 1  ? 9.792   31.092  -11.678 1.00 0.00 ? 1  MET A CE  11 
ATOM   7329  N  N   . LYS A 1 2  ? 13.003  25.805  -13.150 1.00 0.00 ? 2  LYS A N   11 
ATOM   7330  C  CA  . LYS A 1 2  ? 13.760  25.764  -14.397 1.00 0.00 ? 2  LYS A CA  11 
ATOM   7331  C  C   . LYS A 1 2  ? 13.775  24.369  -14.976 1.00 0.00 ? 2  LYS A C   11 
ATOM   7332  O  O   . LYS A 1 2  ? 14.323  23.425  -14.390 1.00 0.00 ? 2  LYS A O   11 
ATOM   7333  C  CB  . LYS A 1 2  ? 15.204  26.276  -14.143 1.00 0.00 ? 2  LYS A CB  11 
ATOM   7334  C  CG  . LYS A 1 2  ? 15.260  27.566  -13.288 1.00 0.00 ? 2  LYS A CG  11 
ATOM   7335  C  CD  . LYS A 1 2  ? 16.292  28.600  -13.748 1.00 0.00 ? 2  LYS A CD  11 
ATOM   7336  C  CE  . LYS A 1 2  ? 15.563  29.813  -14.341 1.00 0.00 ? 2  LYS A CE  11 
ATOM   7337  N  NZ  . LYS A 1 2  ? 16.532  30.895  -14.585 1.00 0.00 ? 2  LYS A NZ  11 
ATOM   7338  N  N   . LYS A 1 3  ? 13.066  24.185  -16.262 1.00 0.00 ? 3  LYS A N   11 
ATOM   7339  C  CA  . LYS A 1 3  ? 12.927  22.872  -16.885 1.00 0.00 ? 3  LYS A CA  11 
ATOM   7340  C  C   . LYS A 1 3  ? 11.989  21.994  -16.090 1.00 0.00 ? 3  LYS A C   11 
ATOM   7341  O  O   . LYS A 1 3  ? 11.700  22.247  -14.912 1.00 0.00 ? 3  LYS A O   11 
ATOM   7342  C  CB  . LYS A 1 3  ? 14.327  22.212  -17.017 1.00 0.00 ? 3  LYS A CB  11 
ATOM   7343  C  CG  . LYS A 1 3  ? 14.435  21.231  -18.211 1.00 0.00 ? 3  LYS A CG  11 
ATOM   7344  C  CD  . LYS A 1 3  ? 14.757  19.784  -17.830 1.00 0.00 ? 3  LYS A CD  11 
ATOM   7345  C  CE  . LYS A 1 3  ? 16.262  19.538  -18.001 1.00 0.00 ? 3  LYS A CE  11 
ATOM   7346  N  NZ  . LYS A 1 3  ? 16.549  19.226  -19.412 1.00 0.00 ? 3  LYS A NZ  11 
ATOM   7347  N  N   . ALA A 1 4  ? 11.422  20.828  -16.801 1.00 0.00 ? 4  ALA A N   11 
ATOM   7348  C  CA  . ALA A 1 4  ? 10.543  19.869  -16.137 1.00 0.00 ? 4  ALA A CA  11 
ATOM   7349  C  C   . ALA A 1 4  ? 11.342  18.872  -15.332 1.00 0.00 ? 4  ALA A C   11 
ATOM   7350  O  O   . ALA A 1 4  ? 12.471  18.504  -15.684 1.00 0.00 ? 4  ALA A O   11 
ATOM   7351  C  CB  . ALA A 1 4  ? 9.676   19.204  -17.220 1.00 0.00 ? 4  ALA A CB  11 
ATOM   7352  N  N   . THR A 1 5  ? 10.707  18.371  -14.094 1.00 0.00 ? 5  THR A N   11 
ATOM   7353  C  CA  . THR A 1 5  ? 11.351  17.375  -13.242 1.00 0.00 ? 5  THR A CA  11 
ATOM   7354  C  C   . THR A 1 5  ? 11.035  15.974  -13.714 1.00 0.00 ? 5  THR A C   11 
ATOM   7355  O  O   . THR A 1 5  ? 9.879   15.626  -13.989 1.00 0.00 ? 5  THR A O   11 
ATOM   7356  C  CB  . THR A 1 5  ? 10.921  17.565  -11.749 1.00 0.00 ? 5  THR A CB  11 
ATOM   7357  O  OG1 . THR A 1 5  ? 10.610  18.928  -11.490 1.00 0.00 ? 5  THR A OG1 11 
ATOM   7358  C  CG2 . THR A 1 5  ? 11.975  17.200  -10.681 1.00 0.00 ? 5  THR A CG2 11 
ATOM   7359  N  N   . CYS A 1 6  ? 12.186  15.058  -13.866 1.00 0.00 ? 6  CYS A N   11 
ATOM   7360  C  CA  . CYS A 1 6  ? 12.042  13.722  -14.436 1.00 0.00 ? 6  CYS A CA  11 
ATOM   7361  C  C   . CYS A 1 6  ? 11.373  12.785  -13.459 1.00 0.00 ? 6  CYS A C   11 
ATOM   7362  O  O   . CYS A 1 6  ? 10.802  11.751  -13.833 1.00 0.00 ? 6  CYS A O   11 
ATOM   7363  C  CB  . CYS A 1 6  ? 13.433  13.222  -14.873 1.00 0.00 ? 6  CYS A CB  11 
ATOM   7364  S  SG  . CYS A 1 6  ? 14.390  12.667  -13.444 1.00 0.00 ? 6  CYS A SG  11 
ATOM   7365  N  N   . LEU A 1 7  ? 11.450  13.162  -12.031 1.00 0.00 ? 7  LEU A N   11 
ATOM   7366  C  CA  . LEU A 1 7  ? 10.736  12.418  -10.996 1.00 0.00 ? 7  LEU A CA  11 
ATOM   7367  C  C   . LEU A 1 7  ? 9.243   12.495  -11.210 1.00 0.00 ? 7  LEU A C   11 
ATOM   7368  O  O   . LEU A 1 7  ? 8.576   13.462  -10.816 1.00 0.00 ? 7  LEU A O   11 
ATOM   7369  C  CB  . LEU A 1 7  ? 11.125  12.937  -9.583  1.00 0.00 ? 7  LEU A CB  11 
ATOM   7370  C  CG  . LEU A 1 7  ? 12.325  12.263  -8.862  1.00 0.00 ? 7  LEU A CG  11 
ATOM   7371  C  CD1 . LEU A 1 7  ? 13.274  11.635  -9.893  1.00 0.00 ? 7  LEU A CD1 11 
ATOM   7372  C  CD2 . LEU A 1 7  ? 13.105  13.238  -7.966  1.00 0.00 ? 7  LEU A CD2 11 
ATOM   7373  N  N   . THR A 1 8  ? 8.617   11.335  -11.881 1.00 0.00 ? 8  THR A N   11 
ATOM   7374  C  CA  . THR A 1 8  ? 7.219   11.345  -12.302 1.00 0.00 ? 8  THR A CA  11 
ATOM   7375  C  C   . THR A 1 8  ? 6.377   10.441  -11.433 1.00 0.00 ? 8  THR A C   11 
ATOM   7376  O  O   . THR A 1 8  ? 6.832   9.399   -10.941 1.00 0.00 ? 8  THR A O   11 
ATOM   7377  C  CB  . THR A 1 8  ? 7.095   10.933  -13.808 1.00 0.00 ? 8  THR A CB  11 
ATOM   7378  O  OG1 . THR A 1 8  ? 8.049   9.929   -14.129 1.00 0.00 ? 8  THR A OG1 11 
ATOM   7379  C  CG2 . THR A 1 8  ? 7.344   12.049  -14.846 1.00 0.00 ? 8  THR A CG2 11 
ATOM   7380  N  N   . ASP A 1 9  ? 4.991   10.889  -11.172 1.00 0.00 ? 9  ASP A N   11 
ATOM   7381  C  CA  . ASP A 1 9  ? 4.019   10.035  -10.497 1.00 0.00 ? 9  ASP A CA  11 
ATOM   7382  C  C   . ASP A 1 9  ? 4.015   8.649   -11.100 1.00 0.00 ? 9  ASP A C   11 
ATOM   7383  O  O   . ASP A 1 9  ? 3.574   7.669   -10.484 1.00 0.00 ? 9  ASP A O   11 
ATOM   7384  C  CB  . ASP A 1 9  ? 2.611   10.684  -10.535 1.00 0.00 ? 9  ASP A CB  11 
ATOM   7385  C  CG  . ASP A 1 9  ? 2.316   11.759  -9.479  1.00 0.00 ? 9  ASP A CG  11 
ATOM   7386  O  OD1 . ASP A 1 9  ? 2.895   12.835  -9.443  1.00 0.00 ? 9  ASP A OD1 11 
ATOM   7387  O  OD2 . ASP A 1 9  ? 1.326   11.391  -8.610  1.00 0.00 ? 9  ASP A OD2 11 
ATOM   7388  N  N   . ASP A 1 10 ? 4.533   8.539   -12.482 1.00 0.00 ? 10 ASP A N   11 
ATOM   7389  C  CA  . ASP A 1 10 ? 4.590   7.262   -13.187 1.00 0.00 ? 10 ASP A CA  11 
ATOM   7390  C  C   . ASP A 1 10 ? 5.613   6.343   -12.563 1.00 0.00 ? 10 ASP A C   11 
ATOM   7391  O  O   . ASP A 1 10 ? 5.317   5.207   -12.162 1.00 0.00 ? 10 ASP A O   11 
ATOM   7392  C  CB  . ASP A 1 10 ? 4.862   7.489   -14.697 1.00 0.00 ? 10 ASP A CB  11 
ATOM   7393  C  CG  . ASP A 1 10 ? 5.071   6.233   -15.556 1.00 0.00 ? 10 ASP A CG  11 
ATOM   7394  O  OD1 . ASP A 1 10 ? 3.897   5.616   -15.887 1.00 0.00 ? 10 ASP A OD1 11 
ATOM   7395  O  OD2 . ASP A 1 10 ? 6.175   5.833   -15.895 1.00 0.00 ? 10 ASP A OD2 11 
ATOM   7396  N  N   . GLN A 1 11 ? 6.987   6.878   -12.422 1.00 0.00 ? 11 GLN A N   11 
ATOM   7397  C  CA  . GLN A 1 11 ? 8.079   6.060   -11.898 1.00 0.00 ? 11 GLN A CA  11 
ATOM   7398  C  C   . GLN A 1 11 ? 7.835   5.714   -10.446 1.00 0.00 ? 11 GLN A C   11 
ATOM   7399  O  O   . GLN A 1 11 ? 8.169   4.630   -9.951  1.00 0.00 ? 11 GLN A O   11 
ATOM   7400  C  CB  . GLN A 1 11 ? 9.403   6.834   -12.065 1.00 0.00 ? 11 GLN A CB  11 
ATOM   7401  C  CG  . GLN A 1 11 ? 9.751   7.308   -13.515 1.00 0.00 ? 11 GLN A CG  11 
ATOM   7402  C  CD  . GLN A 1 11 ? 11.207  7.242   -13.993 1.00 0.00 ? 11 GLN A CD  11 
ATOM   7403  O  OE1 . GLN A 1 11 ? 11.484  7.287   -15.181 1.00 0.00 ? 11 GLN A OE1 11 
ATOM   7404  N  NE2 . GLN A 1 11 ? 12.177  7.142   -13.121 1.00 0.00 ? 11 GLN A NE2 11 
ATOM   7405  N  N   . ARG A 1 12 ? 7.205   6.777   -9.633  1.00 0.00 ? 12 ARG A N   11 
ATOM   7406  C  CA  . ARG A 1 12 ? 6.727   6.587   -8.271  1.00 0.00 ? 12 ARG A CA  11 
ATOM   7407  C  C   . ARG A 1 12 ? 5.924   5.318   -8.114  1.00 0.00 ? 12 ARG A C   11 
ATOM   7408  O  O   . ARG A 1 12 ? 6.288   4.306   -7.469  1.00 0.00 ? 12 ARG A O   11 
ATOM   7409  C  CB  . ARG A 1 12 ? 5.816   7.817   -7.925  1.00 0.00 ? 12 ARG A CB  11 
ATOM   7410  C  CG  . ARG A 1 12 ? 6.548   9.067   -7.385  1.00 0.00 ? 12 ARG A CG  11 
ATOM   7411  C  CD  . ARG A 1 12 ? 7.107   8.896   -5.967  1.00 0.00 ? 12 ARG A CD  11 
ATOM   7412  N  NE  . ARG A 1 12 ? 6.849   10.153  -5.217  1.00 0.00 ? 12 ARG A NE  11 
ATOM   7413  C  CZ  . ARG A 1 12 ? 7.599   11.246  -5.266  1.00 0.00 ? 12 ARG A CZ  11 
ATOM   7414  N  NH1 . ARG A 1 12 ? 8.678   11.364  -5.981  1.00 0.00 ? 12 ARG A NH1 11 
ATOM   7415  N  NH2 . ARG A 1 12 ? 7.226   12.253  -4.558  1.00 0.00 ? 12 ARG A NH2 11 
ATOM   7416  N  N   . TRP A 1 13 ? 4.581   5.354   -8.768  1.00 0.00 ? 13 TRP A N   11 
ATOM   7417  C  CA  . TRP A 1 13 ? 3.622   4.281   -8.541  1.00 0.00 ? 13 TRP A CA  11 
ATOM   7418  C  C   . TRP A 1 13 ? 4.083   3.024   -9.250  1.00 0.00 ? 13 TRP A C   11 
ATOM   7419  O  O   . TRP A 1 13 ? 3.673   1.903   -8.923  1.00 0.00 ? 13 TRP A O   11 
ATOM   7420  C  CB  . TRP A 1 13 ? 2.206   4.695   -9.044  1.00 0.00 ? 13 TRP A CB  11 
ATOM   7421  C  CG  . TRP A 1 13 ? 1.332   3.429   -9.180  1.00 0.00 ? 13 TRP A CG  11 
ATOM   7422  C  CD1 . TRP A 1 13 ? 1.057   2.744   -10.379 1.00 0.00 ? 13 TRP A CD1 11 
ATOM   7423  C  CD2 . TRP A 1 13 ? 0.779   2.684   -8.164  1.00 0.00 ? 13 TRP A CD2 11 
ATOM   7424  N  NE1 . TRP A 1 13 ? 0.325   1.565   -10.134 1.00 0.00 ? 13 TRP A NE1 11 
ATOM   7425  C  CE2 . TRP A 1 13 ? 0.173   1.546   -8.754  1.00 0.00 ? 13 TRP A CE2 11 
ATOM   7426  C  CE3 . TRP A 1 13 ? 0.770   2.869   -6.757  1.00 0.00 ? 13 TRP A CE3 11 
ATOM   7427  C  CZ2 . TRP A 1 13 ? -0.451  0.584   -7.929  1.00 0.00 ? 13 TRP A CZ2 11 
ATOM   7428  C  CZ3 . TRP A 1 13 ? 0.130   1.914   -5.968  1.00 0.00 ? 13 TRP A CZ3 11 
ATOM   7429  C  CH2 . TRP A 1 13 ? -0.474  0.788   -6.546  1.00 0.00 ? 13 TRP A CH2 11 
ATOM   7430  N  N   . GLN A 1 14 ? 5.022   3.225   -10.380 1.00 0.00 ? 14 GLN A N   11 
ATOM   7431  C  CA  . GLN A 1 14 ? 5.697   2.090   -11.013 1.00 0.00 ? 14 GLN A CA  11 
ATOM   7432  C  C   . GLN A 1 14 ? 6.515   1.359   -9.966  1.00 0.00 ? 14 GLN A C   11 
ATOM   7433  O  O   . GLN A 1 14 ? 6.608   0.125   -9.955  1.00 0.00 ? 14 GLN A O   11 
ATOM   7434  C  CB  . GLN A 1 14 ? 6.576   2.577   -12.178 1.00 0.00 ? 14 GLN A CB  11 
ATOM   7435  C  CG  . GLN A 1 14 ? 7.346   1.466   -12.972 1.00 0.00 ? 14 GLN A CG  11 
ATOM   7436  C  CD  . GLN A 1 14 ? 6.738   0.918   -14.269 1.00 0.00 ? 14 GLN A CD  11 
ATOM   7437  O  OE1 . GLN A 1 14 ? 6.411   -0.254  -14.367 1.00 0.00 ? 14 GLN A OE1 11 
ATOM   7438  N  NE2 . GLN A 1 14 ? 6.555   1.713   -15.292 1.00 0.00 ? 14 GLN A NE2 11 
ATOM   7439  N  N   . SER A 1 15 ? 7.226   2.223   -8.987  1.00 0.00 ? 15 SER A N   11 
ATOM   7440  C  CA  . SER A 1 15 ? 7.862   1.635   -7.807  1.00 0.00 ? 15 SER A CA  11 
ATOM   7441  C  C   . SER A 1 15 ? 6.913   0.596   -7.228  1.00 0.00 ? 15 SER A C   11 
ATOM   7442  O  O   . SER A 1 15 ? 7.241   -0.587  -7.092  1.00 0.00 ? 15 SER A O   11 
ATOM   7443  C  CB  . SER A 1 15 ? 8.289   2.670   -6.743  1.00 0.00 ? 15 SER A CB  11 
ATOM   7444  O  OG  . SER A 1 15 ? 8.959   3.806   -7.305  1.00 0.00 ? 15 SER A OG  11 
ATOM   7445  N  N   . VAL A 1 16 ? 5.546   1.106   -6.902  1.00 0.00 ? 16 VAL A N   11 
ATOM   7446  C  CA  . VAL A 1 16 ? 4.584   0.209   -6.258  1.00 0.00 ? 16 VAL A CA  11 
ATOM   7447  C  C   . VAL A 1 16 ? 4.243   -1.025  -7.053  1.00 0.00 ? 16 VAL A C   11 
ATOM   7448  O  O   . VAL A 1 16 ? 4.308   -2.175  -6.541  1.00 0.00 ? 16 VAL A O   11 
ATOM   7449  C  CB  . VAL A 1 16 ? 3.285   0.970   -5.797  1.00 0.00 ? 16 VAL A CB  11 
ATOM   7450  C  CG1 . VAL A 1 16 ? 2.520   0.342   -4.589  1.00 0.00 ? 16 VAL A CG1 11 
ATOM   7451  C  CG2 . VAL A 1 16 ? 3.521   2.445   -5.394  1.00 0.00 ? 16 VAL A CG2 11 
ATOM   7452  N  N   . LEU A 1 17 ? 3.774   -0.864  -8.444  1.00 0.00 ? 17 LEU A N   11 
ATOM   7453  C  CA  . LEU A 1 17 ? 3.367   -2.011  -9.280  1.00 0.00 ? 17 LEU A CA  11 
ATOM   7454  C  C   . LEU A 1 17 ? 4.338   -3.147  -9.087  1.00 0.00 ? 17 LEU A C   11 
ATOM   7455  O  O   . LEU A 1 17 ? 3.999   -4.330  -8.959  1.00 0.00 ? 17 LEU A O   11 
ATOM   7456  C  CB  . LEU A 1 17 ? 3.312   -1.590  -10.775 1.00 0.00 ? 17 LEU A CB  11 
ATOM   7457  C  CG  . LEU A 1 17 ? 2.062   -0.783  -11.235 1.00 0.00 ? 17 LEU A CG  11 
ATOM   7458  C  CD1 . LEU A 1 17 ? 2.019   -0.697  -12.765 1.00 0.00 ? 17 LEU A CD1 11 
ATOM   7459  C  CD2 . LEU A 1 17 ? 0.751   -1.393  -10.713 1.00 0.00 ? 17 LEU A CD2 11 
ATOM   7460  N  N   . ALA A 1 18 ? 5.770   -2.741  -9.101  1.00 0.00 ? 18 ALA A N   11 
ATOM   7461  C  CA  . ALA A 1 18 ? 6.870   -3.689  -8.999  1.00 0.00 ? 18 ALA A CA  11 
ATOM   7462  C  C   . ALA A 1 18 ? 7.067   -4.227  -7.602  1.00 0.00 ? 18 ALA A C   11 
ATOM   7463  O  O   . ALA A 1 18 ? 6.401   -5.174  -7.162  1.00 0.00 ? 18 ALA A O   11 
ATOM   7464  C  CB  . ALA A 1 18 ? 8.136   -2.986  -9.540  1.00 0.00 ? 18 ALA A CB  11 
ATOM   7465  N  N   . ARG A 1 19 ? 8.131   -3.583  -6.799  1.00 0.00 ? 19 ARG A N   11 
ATOM   7466  C  CA  . ARG A 1 19 ? 8.599   -4.121  -5.528  1.00 0.00 ? 19 ARG A CA  11 
ATOM   7467  C  C   . ARG A 1 19 ? 9.704   -3.259  -4.958  1.00 0.00 ? 19 ARG A C   11 
ATOM   7468  O  O   . ARG A 1 19 ? 10.631  -3.753  -4.300  1.00 0.00 ? 19 ARG A O   11 
ATOM   7469  C  CB  . ARG A 1 19 ? 9.088   -5.581  -5.748  1.00 0.00 ? 19 ARG A CB  11 
ATOM   7470  C  CG  . ARG A 1 19 ? 9.753   -5.853  -7.123  1.00 0.00 ? 19 ARG A CG  11 
ATOM   7471  C  CD  . ARG A 1 19 ? 10.822  -6.951  -7.055  1.00 0.00 ? 19 ARG A CD  11 
ATOM   7472  N  NE  . ARG A 1 19 ? 10.236  -8.209  -7.582  1.00 0.00 ? 19 ARG A NE  11 
ATOM   7473  C  CZ  . ARG A 1 19 ? 10.923  -9.269  -7.986  1.00 0.00 ? 19 ARG A CZ  11 
ATOM   7474  N  NH1 . ARG A 1 19 ? 12.221  -9.349  -7.977  1.00 0.00 ? 19 ARG A NH1 11 
ATOM   7475  N  NH2 . ARG A 1 19 ? 10.255  -10.282 -8.413  1.00 0.00 ? 19 ARG A NH2 11 
ATOM   7476  N  N   . ASP A 1 20 ? 9.639   -1.815  -5.265  1.00 0.00 ? 20 ASP A N   11 
ATOM   7477  C  CA  . ASP A 1 20 ? 10.729  -0.892  -4.966  1.00 0.00 ? 20 ASP A CA  11 
ATOM   7478  C  C   . ASP A 1 20 ? 11.363  -1.187  -3.627  1.00 0.00 ? 20 ASP A C   11 
ATOM   7479  O  O   . ASP A 1 20 ? 10.693  -1.531  -2.646  1.00 0.00 ? 20 ASP A O   11 
ATOM   7480  C  CB  . ASP A 1 20 ? 10.245  0.578   -5.063  1.00 0.00 ? 20 ASP A CB  11 
ATOM   7481  C  CG  . ASP A 1 20 ? 11.117  1.635   -4.370  1.00 0.00 ? 20 ASP A CG  11 
ATOM   7482  O  OD1 . ASP A 1 20 ? 11.399  1.589   -3.181  1.00 0.00 ? 20 ASP A OD1 11 
ATOM   7483  O  OD2 . ASP A 1 20 ? 11.558  2.605   -5.227  1.00 0.00 ? 20 ASP A OD2 11 
ATOM   7484  N  N   . PRO A 1 21 ? 12.833  -1.050  -3.575  1.00 0.00 ? 21 PRO A N   11 
ATOM   7485  C  CA  . PRO A 1 21 ? 13.731  -1.303  -2.350  1.00 0.00 ? 21 PRO A CA  11 
ATOM   7486  C  C   . PRO A 1 21 ? 13.063  -1.062  -1.020  1.00 0.00 ? 21 PRO A C   11 
ATOM   7487  O  O   . PRO A 1 21 ? 12.307  -1.944  -0.535  1.00 0.00 ? 21 PRO A O   11 
ATOM   7488  C  CB  . PRO A 1 21 ? 14.931  -0.393  -2.568  1.00 0.00 ? 21 PRO A CB  11 
ATOM   7489  C  CG  . PRO A 1 21 ? 15.154  -0.620  -4.083  1.00 0.00 ? 21 PRO A CG  11 
ATOM   7490  C  CD  . PRO A 1 21 ? 13.742  -0.646  -4.675  1.00 0.00 ? 21 PRO A CD  11 
ATOM   7491  N  N   . ASN A 1 22 ? 13.331  0.182   -0.276  1.00 0.00 ? 22 ASN A N   11 
ATOM   7492  C  CA  . ASN A 1 22 ? 12.578  0.541   0.932   1.00 0.00 ? 22 ASN A CA  11 
ATOM   7493  C  C   . ASN A 1 22 ? 11.387  1.374   0.511   1.00 0.00 ? 22 ASN A C   11 
ATOM   7494  O  O   . ASN A 1 22 ? 10.232  0.942   0.420   1.00 0.00 ? 22 ASN A O   11 
ATOM   7495  C  CB  . ASN A 1 22 ? 13.504  1.372   1.865   1.00 0.00 ? 22 ASN A CB  11 
ATOM   7496  C  CG  . ASN A 1 22 ? 12.875  2.155   3.022   1.00 0.00 ? 22 ASN A CG  11 
ATOM   7497  O  OD1 . ASN A 1 22 ? 12.373  1.603   3.990   1.00 0.00 ? 22 ASN A OD1 11 
ATOM   7498  N  ND2 . ASN A 1 22 ? 12.900  3.460   2.983   1.00 0.00 ? 22 ASN A ND2 11 
ATOM   7499  N  N   . ALA A 1 23 ? 11.713  2.779   0.164   1.00 0.00 ? 23 ALA A N   11 
ATOM   7500  C  CA  . ALA A 1 23 ? 10.806  3.706   -0.494  1.00 0.00 ? 23 ALA A CA  11 
ATOM   7501  C  C   . ALA A 1 23 ? 11.611  4.838   -1.123  1.00 0.00 ? 23 ALA A C   11 
ATOM   7502  O  O   . ALA A 1 23 ? 12.024  5.774   -0.429  1.00 0.00 ? 23 ALA A O   11 
ATOM   7503  C  CB  . ALA A 1 23 ? 9.778   4.202   0.531   1.00 0.00 ? 23 ALA A CB  11 
ATOM   7504  N  N   . ASP A 1 24 ? 11.884  4.690   -2.568  1.00 0.00 ? 24 ASP A N   11 
ATOM   7505  C  CA  . ASP A 1 24 ? 12.794  5.593   -3.274  1.00 0.00 ? 24 ASP A CA  11 
ATOM   7506  C  C   . ASP A 1 24 ? 12.674  7.001   -2.706  1.00 0.00 ? 24 ASP A C   11 
ATOM   7507  O  O   . ASP A 1 24 ? 11.636  7.677   -2.703  1.00 0.00 ? 24 ASP A O   11 
ATOM   7508  C  CB  . ASP A 1 24 ? 12.528  5.555   -4.798  1.00 0.00 ? 24 ASP A CB  11 
ATOM   7509  C  CG  . ASP A 1 24 ? 13.677  5.059   -5.690  1.00 0.00 ? 24 ASP A CG  11 
ATOM   7510  O  OD1 . ASP A 1 24 ? 14.776  4.753   -5.252  1.00 0.00 ? 24 ASP A OD1 11 
ATOM   7511  O  OD2 . ASP A 1 24 ? 13.342  5.025   -7.015  1.00 0.00 ? 24 ASP A OD2 11 
ATOM   7512  N  N   . GLY A 1 25 ? 13.901  7.487   -2.030  1.00 0.00 ? 25 GLY A N   11 
ATOM   7513  C  CA  . GLY A 1 25 ? 14.041  8.801   -1.359  1.00 0.00 ? 25 GLY A CA  11 
ATOM   7514  C  C   . GLY A 1 25 ? 13.644  8.503   0.096   1.00 0.00 ? 25 GLY A C   11 
ATOM   7515  O  O   . GLY A 1 25 ? 14.452  8.118   0.947   1.00 0.00 ? 25 GLY A O   11 
ATOM   7516  N  N   . GLU A 1 26 ? 12.208  8.678   0.362   1.00 0.00 ? 26 GLU A N   11 
ATOM   7517  C  CA  . GLU A 1 26 ? 11.563  8.155   1.559   1.00 0.00 ? 26 GLU A CA  11 
ATOM   7518  C  C   . GLU A 1 26 ? 10.066  8.115   1.352   1.00 0.00 ? 26 GLU A C   11 
ATOM   7519  O  O   . GLU A 1 26 ? 9.272   8.134   2.302   1.00 0.00 ? 26 GLU A O   11 
ATOM   7520  C  CB  . GLU A 1 26 ? 12.042  9.021   2.764   1.00 0.00 ? 26 GLU A CB  11 
ATOM   7521  C  CG  . GLU A 1 26 ? 13.205  8.441   3.635   1.00 0.00 ? 26 GLU A CG  11 
ATOM   7522  C  CD  . GLU A 1 26 ? 14.577  9.114   3.568   1.00 0.00 ? 26 GLU A CD  11 
ATOM   7523  O  OE1 . GLU A 1 26 ? 14.528  10.428  3.213   1.00 0.00 ? 26 GLU A OE1 11 
ATOM   7524  O  OE2 . GLU A 1 26 ? 15.621  8.523   3.812   1.00 0.00 ? 26 GLU A OE2 11 
ATOM   7525  N  N   . PHE A 1 27 ? 9.600   8.030   -0.063  1.00 0.00 ? 27 PHE A N   11 
ATOM   7526  C  CA  . PHE A 1 27 ? 8.193   8.229   -0.390  1.00 0.00 ? 27 PHE A CA  11 
ATOM   7527  C  C   . PHE A 1 27 ? 7.235   7.217   0.184   1.00 0.00 ? 27 PHE A C   11 
ATOM   7528  O  O   . PHE A 1 27 ? 7.583   6.112   0.618   1.00 0.00 ? 27 PHE A O   11 
ATOM   7529  C  CB  . PHE A 1 27 ? 7.972   8.361   -1.923  1.00 0.00 ? 27 PHE A CB  11 
ATOM   7530  C  CG  . PHE A 1 27 ? 7.699   7.087   -2.740  1.00 0.00 ? 27 PHE A CG  11 
ATOM   7531  C  CD1 . PHE A 1 27 ? 6.504   6.373   -2.609  1.00 0.00 ? 27 PHE A CD1 11 
ATOM   7532  C  CD2 . PHE A 1 27 ? 8.665   6.645   -3.654  1.00 0.00 ? 27 PHE A CD2 11 
ATOM   7533  C  CE1 . PHE A 1 27 ? 6.283   5.232   -3.377  1.00 0.00 ? 27 PHE A CE1 11 
ATOM   7534  C  CE2 . PHE A 1 27 ? 8.443   5.507   -4.419  1.00 0.00 ? 27 PHE A CE2 11 
ATOM   7535  C  CZ  . PHE A 1 27 ? 7.251   4.799   -4.282  1.00 0.00 ? 27 PHE A CZ  11 
ATOM   7536  N  N   . VAL A 1 28 ? 5.811   7.647   0.234   1.00 0.00 ? 28 VAL A N   11 
ATOM   7537  C  CA  . VAL A 1 28 ? 4.751   6.897   0.904   1.00 0.00 ? 28 VAL A CA  11 
ATOM   7538  C  C   . VAL A 1 28 ? 3.446   7.068   0.148   1.00 0.00 ? 28 VAL A C   11 
ATOM   7539  O  O   . VAL A 1 28 ? 3.246   8.111   -0.518  1.00 0.00 ? 28 VAL A O   11 
ATOM   7540  C  CB  . VAL A 1 28 ? 4.608   7.399   2.393   1.00 0.00 ? 28 VAL A CB  11 
ATOM   7541  C  CG1 . VAL A 1 28 ? 5.929   7.502   3.213   1.00 0.00 ? 28 VAL A CG1 11 
ATOM   7542  C  CG2 . VAL A 1 28 ? 3.942   8.792   2.528   1.00 0.00 ? 28 VAL A CG2 11 
ATOM   7543  N  N   . PHE A 1 29 ? 2.423   6.006   0.209   1.00 0.00 ? 29 PHE A N   11 
ATOM   7544  C  CA  . PHE A 1 29 ? 1.219   6.030   -0.633  1.00 0.00 ? 29 PHE A CA  11 
ATOM   7545  C  C   . PHE A 1 29 ? -0.001  5.752   0.214   1.00 0.00 ? 29 PHE A C   11 
ATOM   7546  O  O   . PHE A 1 29 ? 0.054   4.990   1.194   1.00 0.00 ? 29 PHE A O   11 
ATOM   7547  C  CB  . PHE A 1 29 ? 1.311   4.974   -1.772  1.00 0.00 ? 29 PHE A CB  11 
ATOM   7548  C  CG  . PHE A 1 29 ? 1.157   3.496   -1.380  1.00 0.00 ? 29 PHE A CG  11 
ATOM   7549  C  CD1 . PHE A 1 29 ? 1.557   3.048   -0.119  1.00 0.00 ? 29 PHE A CD1 11 
ATOM   7550  C  CD2 . PHE A 1 29 ? 0.652   2.578   -2.308  1.00 0.00 ? 29 PHE A CD2 11 
ATOM   7551  C  CE1 . PHE A 1 29 ? 1.455   1.699   0.211   1.00 0.00 ? 29 PHE A CE1 11 
ATOM   7552  C  CE2 . PHE A 1 29 ? 0.540   1.232   -1.975  1.00 0.00 ? 29 PHE A CE2 11 
ATOM   7553  C  CZ  . PHE A 1 29 ? 0.944   0.792   -0.717  1.00 0.00 ? 29 PHE A CZ  11 
ATOM   7554  N  N   . ALA A 1 30 ? -1.248  6.455   -0.150  1.00 0.00 ? 30 ALA A N   11 
ATOM   7555  C  CA  . ALA A 1 30 ? -2.436  6.408   0.698   1.00 0.00 ? 30 ALA A CA  11 
ATOM   7556  C  C   . ALA A 1 30 ? -3.645  5.972   -0.096  1.00 0.00 ? 30 ALA A C   11 
ATOM   7557  O  O   . ALA A 1 30 ? -4.276  6.761   -0.811  1.00 0.00 ? 30 ALA A O   11 
ATOM   7558  C  CB  . ALA A 1 30 ? -2.610  7.796   1.337   1.00 0.00 ? 30 ALA A CB  11 
ATOM   7559  N  N   . VAL A 1 31 ? -4.050  4.558   0.058   1.00 0.00 ? 31 VAL A N   11 
ATOM   7560  C  CA  . VAL A 1 31 ? -5.262  4.034   -0.572  1.00 0.00 ? 31 VAL A CA  11 
ATOM   7561  C  C   . VAL A 1 31 ? -6.457  4.260   0.321   1.00 0.00 ? 31 VAL A C   11 
ATOM   7562  O  O   . VAL A 1 31 ? -6.657  3.573   1.334   1.00 0.00 ? 31 VAL A O   11 
ATOM   7563  C  CB  . VAL A 1 31 ? -5.057  2.512   -0.935  1.00 0.00 ? 31 VAL A CB  11 
ATOM   7564  C  CG1 . VAL A 1 31 ? -5.216  1.480   0.215   1.00 0.00 ? 31 VAL A CG1 11 
ATOM   7565  C  CG2 . VAL A 1 31 ? -5.979  2.001   -2.070  1.00 0.00 ? 31 VAL A CG2 11 
ATOM   7566  N  N   . ARG A 1 32 ? -7.365  5.372   -0.051  1.00 0.00 ? 32 ARG A N   11 
ATOM   7567  C  CA  . ARG A 1 32 ? -8.446  5.802   0.829   1.00 0.00 ? 32 ARG A CA  11 
ATOM   7568  C  C   . ARG A 1 32 ? -9.675  4.930   0.742   1.00 0.00 ? 32 ARG A C   11 
ATOM   7569  O  O   . ARG A 1 32 ? -10.792 5.370   1.094   1.00 0.00 ? 32 ARG A O   11 
ATOM   7570  C  CB  . ARG A 1 32 ? -8.789  7.286   0.508   1.00 0.00 ? 32 ARG A CB  11 
ATOM   7571  C  CG  . ARG A 1 32 ? -9.475  7.518   -0.863  1.00 0.00 ? 32 ARG A CG  11 
ATOM   7572  C  CD  . ARG A 1 32 ? -11.007 7.423   -0.776  1.00 0.00 ? 32 ARG A CD  11 
ATOM   7573  N  NE  . ARG A 1 32 ? -11.585 8.273   -1.847  1.00 0.00 ? 32 ARG A NE  11 
ATOM   7574  C  CZ  . ARG A 1 32 ? -12.563 9.157   -1.714  1.00 0.00 ? 32 ARG A CZ  11 
ATOM   7575  N  NH1 . ARG A 1 32 ? -13.171 9.419   -0.596  1.00 0.00 ? 32 ARG A NH1 11 
ATOM   7576  N  NH2 . ARG A 1 32 ? -12.933 9.798   -2.768  1.00 0.00 ? 32 ARG A NH2 11 
ATOM   7577  N  N   . THR A 1 33 ? -9.525  3.537   0.271   1.00 0.00 ? 33 THR A N   11 
ATOM   7578  C  CA  . THR A 1 33 ? -10.654 2.606   0.226   1.00 0.00 ? 33 THR A CA  11 
ATOM   7579  C  C   . THR A 1 33 ? -10.536 1.568   1.317   1.00 0.00 ? 33 THR A C   11 
ATOM   7580  O  O   . THR A 1 33 ? -11.532 1.110   1.893   1.00 0.00 ? 33 THR A O   11 
ATOM   7581  C  CB  . THR A 1 33 ? -10.750 1.926   -1.180  1.00 0.00 ? 33 THR A CB  11 
ATOM   7582  O  OG1 . THR A 1 33 ? -12.080 1.488   -1.432  1.00 0.00 ? 33 THR A OG1 11 
ATOM   7583  C  CG2 . THR A 1 33 ? -9.883  0.665   -1.393  1.00 0.00 ? 33 THR A CG2 11 
ATOM   7584  N  N   . THR A 1 34 ? -9.166  1.120   1.648   1.00 0.00 ? 34 THR A N   11 
ATOM   7585  C  CA  . THR A 1 34 ? -8.883  0.252   2.786   1.00 0.00 ? 34 THR A CA  11 
ATOM   7586  C  C   . THR A 1 34 ? -8.428  1.052   3.984   1.00 0.00 ? 34 THR A C   11 
ATOM   7587  O  O   . THR A 1 34 ? -8.180  0.499   5.069   1.00 0.00 ? 34 THR A O   11 
ATOM   7588  C  CB  . THR A 1 34 ? -7.812  -0.826  2.404   1.00 0.00 ? 34 THR A CB  11 
ATOM   7589  O  OG1 . THR A 1 34 ? -8.065  -1.341  1.103   1.00 0.00 ? 34 THR A OG1 11 
ATOM   7590  C  CG2 . THR A 1 34 ? -7.745  -2.075  3.309   1.00 0.00 ? 34 THR A CG2 11 
ATOM   7591  N  N   . GLY A 1 35 ? -8.279  2.514   3.812   1.00 0.00 ? 35 GLY A N   11 
ATOM   7592  C  CA  . GLY A 1 35 ? -8.003  3.395   4.944   1.00 0.00 ? 35 GLY A CA  11 
ATOM   7593  C  C   . GLY A 1 35 ? -6.651  3.097   5.546   1.00 0.00 ? 35 GLY A C   11 
ATOM   7594  O  O   . GLY A 1 35 ? -6.494  3.008   6.774   1.00 0.00 ? 35 GLY A O   11 
ATOM   7595  N  N   . ILE A 1 36 ? -5.531  2.879   4.603   1.00 0.00 ? 36 ILE A N   11 
ATOM   7596  C  CA  . ILE A 1 36 ? -4.152  2.749   5.062   1.00 0.00 ? 36 ILE A CA  11 
ATOM   7597  C  C   . ILE A 1 36 ? -3.199  3.541   4.200   1.00 0.00 ? 36 ILE A C   11 
ATOM   7598  O  O   . ILE A 1 36 ? -3.346  3.624   2.969   1.00 0.00 ? 36 ILE A O   11 
ATOM   7599  C  CB  . ILE A 1 36 ? -3.721  1.227   5.179   1.00 0.00 ? 36 ILE A CB  11 
ATOM   7600  C  CG1 . ILE A 1 36 ? -3.345  0.527   3.835   1.00 0.00 ? 36 ILE A CG1 11 
ATOM   7601  C  CG2 . ILE A 1 36 ? -4.803  0.353   5.891   1.00 0.00 ? 36 ILE A CG2 11 
ATOM   7602  C  CD1 . ILE A 1 36 ? -2.140  -0.436  3.887   1.00 0.00 ? 36 ILE A CD1 11 
ATOM   7603  N  N   . PHE A 1 37 ? -2.091  4.227   4.897   1.00 0.00 ? 37 PHE A N   11 
ATOM   7604  C  CA  . PHE A 1 37 ? -0.984  4.880   4.173   1.00 0.00 ? 37 PHE A CA  11 
ATOM   7605  C  C   . PHE A 1 37 ? 0.296   4.142   4.490   1.00 0.00 ? 37 PHE A C   11 
ATOM   7606  O  O   . PHE A 1 37 ? 0.634   3.962   5.688   1.00 0.00 ? 37 PHE A O   11 
ATOM   7607  C  CB  . PHE A 1 37 ? -0.828  6.368   4.598   1.00 0.00 ? 37 PHE A CB  11 
ATOM   7608  C  CG  . PHE A 1 37 ? 0.001   6.660   5.861   1.00 0.00 ? 37 PHE A CG  11 
ATOM   7609  C  CD1 . PHE A 1 37 ? -0.604  6.614   7.120   1.00 0.00 ? 37 PHE A CD1 11 
ATOM   7610  C  CD2 . PHE A 1 37 ? 1.347   7.034   5.754   1.00 0.00 ? 37 PHE A CD2 11 
ATOM   7611  C  CE1 . PHE A 1 37 ? 0.130   6.931   8.260   1.00 0.00 ? 37 PHE A CE1 11 
ATOM   7612  C  CE2 . PHE A 1 37 ? 2.080   7.339   6.896   1.00 0.00 ? 37 PHE A CE2 11 
ATOM   7613  C  CZ  . PHE A 1 37 ? 1.472   7.290   8.148   1.00 0.00 ? 37 PHE A CZ  11 
ATOM   7614  N  N   . CYS A 1 38 ? 1.118   3.602   3.390   1.00 0.00 ? 38 CYS A N   11 
ATOM   7615  C  CA  . CYS A 1 38 ? 2.241   2.704   3.631   1.00 0.00 ? 38 CYS A CA  11 
ATOM   7616  C  C   . CYS A 1 38 ? 3.440   3.027   2.780   1.00 0.00 ? 38 CYS A C   11 
ATOM   7617  O  O   . CYS A 1 38 ? 3.357   3.772   1.788   1.00 0.00 ? 38 CYS A O   11 
ATOM   7618  C  CB  . CYS A 1 38 ? 1.749   1.254   3.336   1.00 0.00 ? 38 CYS A CB  11 
ATOM   7619  S  SG  . CYS A 1 38 ? 3.044   0.046   3.705   1.00 0.00 ? 38 CYS A SG  11 
ATOM   7620  N  N   . ARG A 1 39 ? 4.731   2.453   3.204   1.00 0.00 ? 39 ARG A N   11 
ATOM   7621  C  CA  . ARG A 1 39 ? 5.891   2.436   2.307   1.00 0.00 ? 39 ARG A CA  11 
ATOM   7622  C  C   . ARG A 1 39 ? 5.738   1.231   1.395   1.00 0.00 ? 39 ARG A C   11 
ATOM   7623  O  O   . ARG A 1 39 ? 5.630   0.088   1.871   1.00 0.00 ? 39 ARG A O   11 
ATOM   7624  C  CB  . ARG A 1 39 ? 7.199   2.387   3.132   1.00 0.00 ? 39 ARG A CB  11 
ATOM   7625  C  CG  . ARG A 1 39 ? 8.395   1.696   2.421   1.00 0.00 ? 39 ARG A CG  11 
ATOM   7626  C  CD  . ARG A 1 39 ? 9.673   1.720   3.269   1.00 0.00 ? 39 ARG A CD  11 
ATOM   7627  N  NE  . ARG A 1 39 ? 9.399   1.015   4.547   1.00 0.00 ? 39 ARG A NE  11 
ATOM   7628  C  CZ  . ARG A 1 39 ? 9.708   -0.246  4.817   1.00 0.00 ? 39 ARG A CZ  11 
ATOM   7629  N  NH1 . ARG A 1 39 ? 10.296  -1.053  3.984   1.00 0.00 ? 39 ARG A NH1 11 
ATOM   7630  N  NH2 . ARG A 1 39 ? 9.402   -0.695  5.983   1.00 0.00 ? 39 ARG A NH2 11 
ATOM   7631  N  N   . PRO A 1 40 ? 5.705   1.476   -0.054  1.00 0.00 ? 40 PRO A N   11 
ATOM   7632  C  CA  . PRO A 1 40 ? 5.508   0.437   -1.174  1.00 0.00 ? 40 PRO A CA  11 
ATOM   7633  C  C   . PRO A 1 40 ? 5.762   -1.004  -0.813  1.00 0.00 ? 40 PRO A C   11 
ATOM   7634  O  O   . PRO A 1 40 ? 6.933   -1.443  -0.738  1.00 0.00 ? 40 PRO A O   11 
ATOM   7635  C  CB  . PRO A 1 40 ? 6.487   0.901   -2.258  1.00 0.00 ? 40 PRO A CB  11 
ATOM   7636  C  CG  . PRO A 1 40 ? 6.296   2.424   -2.176  1.00 0.00 ? 40 PRO A CG  11 
ATOM   7637  C  CD  . PRO A 1 40 ? 5.855   2.776   -0.752  1.00 0.00 ? 40 PRO A CD  11 
ATOM   7638  N  N   . SER A 1 41 ? 4.600   -1.881  -0.512  1.00 0.00 ? 41 SER A N   11 
ATOM   7639  C  CA  . SER A 1 41 ? 4.765   -3.318  -0.324  1.00 0.00 ? 41 SER A CA  11 
ATOM   7640  C  C   . SER A 1 41 ? 3.505   -4.102  -0.067  1.00 0.00 ? 41 SER A C   11 
ATOM   7641  O  O   . SER A 1 41 ? 3.139   -5.017  -0.831  1.00 0.00 ? 41 SER A O   11 
ATOM   7642  C  CB  . SER A 1 41 ? 5.809   -3.580  0.811   1.00 0.00 ? 41 SER A CB  11 
ATOM   7643  O  OG  . SER A 1 41 ? 5.746   -2.608  1.856   1.00 0.00 ? 41 SER A OG  11 
ATOM   7644  N  N   . CYS A 1 42 ? 2.679   -3.729  1.105   1.00 0.00 ? 42 CYS A N   11 
ATOM   7645  C  CA  . CYS A 1 42 ? 1.581   -4.505  1.659   1.00 0.00 ? 42 CYS A CA  11 
ATOM   7646  C  C   . CYS A 1 42 ? 1.309   -5.807  0.943   1.00 0.00 ? 42 CYS A C   11 
ATOM   7647  O  O   . CYS A 1 42 ? 0.561   -5.914  -0.036  1.00 0.00 ? 42 CYS A O   11 
ATOM   7648  C  CB  . CYS A 1 42 ? 0.318   -3.652  1.890   1.00 0.00 ? 42 CYS A CB  11 
ATOM   7649  S  SG  . CYS A 1 42 ? 0.603   -1.921  2.310   1.00 0.00 ? 42 CYS A SG  11 
ATOM   7650  N  N   . ARG A 1 43 ? 2.052   -6.985  1.463   1.00 0.00 ? 43 ARG A N   11 
ATOM   7651  C  CA  . ARG A 1 43 ? 1.845   -8.377  1.086   1.00 0.00 ? 43 ARG A CA  11 
ATOM   7652  C  C   . ARG A 1 43 ? 0.526   -8.639  0.410   1.00 0.00 ? 43 ARG A C   11 
ATOM   7653  O  O   . ARG A 1 43 ? 0.461   -9.390  -0.591  1.00 0.00 ? 43 ARG A O   11 
ATOM   7654  C  CB  . ARG A 1 43 ? 1.979   -9.242  2.386   1.00 0.00 ? 43 ARG A CB  11 
ATOM   7655  C  CG  . ARG A 1 43 ? 1.949   -8.431  3.707   1.00 0.00 ? 43 ARG A CG  11 
ATOM   7656  C  CD  . ARG A 1 43 ? 2.253   -9.274  4.950   1.00 0.00 ? 43 ARG A CD  11 
ATOM   7657  N  NE  . ARG A 1 43 ? 1.520   -10.561 4.853   1.00 0.00 ? 43 ARG A NE  11 
ATOM   7658  C  CZ  . ARG A 1 43 ? 0.213   -10.718 5.013   1.00 0.00 ? 43 ARG A CZ  11 
ATOM   7659  N  NH1 . ARG A 1 43 ? -0.616  -9.750  5.273   1.00 0.00 ? 43 ARG A NH1 11 
ATOM   7660  N  NH2 . ARG A 1 43 ? -0.260  -11.909 4.902   1.00 0.00 ? 43 ARG A NH2 11 
ATOM   7661  N  N   . ALA A 1 44 ? -0.693  -8.031  0.981   1.00 0.00 ? 44 ALA A N   11 
ATOM   7662  C  CA  . ALA A 1 44 ? -2.025  -8.366  0.506   1.00 0.00 ? 44 ALA A CA  11 
ATOM   7663  C  C   . ALA A 1 44 ? -2.159  -8.093  -0.984  1.00 0.00 ? 44 ALA A C   11 
ATOM   7664  O  O   . ALA A 1 44 ? -1.237  -7.657  -1.681  1.00 0.00 ? 44 ALA A O   11 
ATOM   7665  C  CB  . ALA A 1 44 ? -3.052  -7.561  1.328   1.00 0.00 ? 44 ALA A CB  11 
ATOM   7666  N  N   . ARG A 1 45 ? -3.512  -8.372  -1.537  1.00 0.00 ? 45 ARG A N   11 
ATOM   7667  C  CA  . ARG A 1 45 ? -3.815  -8.260  -2.958  1.00 0.00 ? 45 ARG A CA  11 
ATOM   7668  C  C   . ARG A 1 45 ? -3.387  -6.924  -3.519  1.00 0.00 ? 45 ARG A C   11 
ATOM   7669  O  O   . ARG A 1 45 ? -3.387  -6.710  -4.742  1.00 0.00 ? 45 ARG A O   11 
ATOM   7670  C  CB  . ARG A 1 45 ? -5.332  -8.507  -3.177  1.00 0.00 ? 45 ARG A CB  11 
ATOM   7671  C  CG  . ARG A 1 45 ? -5.751  -8.719  -4.656  1.00 0.00 ? 45 ARG A CG  11 
ATOM   7672  C  CD  . ARG A 1 45 ? -5.995  -10.194 -4.997  1.00 0.00 ? 45 ARG A CD  11 
ATOM   7673  N  NE  . ARG A 1 45 ? -4.712  -10.790 -5.448  1.00 0.00 ? 45 ARG A NE  11 
ATOM   7674  C  CZ  . ARG A 1 45 ? -4.513  -12.073 -5.722  1.00 0.00 ? 45 ARG A CZ  11 
ATOM   7675  N  NH1 . ARG A 1 45 ? -5.429  -12.992 -5.637  1.00 0.00 ? 45 ARG A NH1 11 
ATOM   7676  N  NH2 . ARG A 1 45 ? -3.334  -12.424 -6.097  1.00 0.00 ? 45 ARG A NH2 11 
ATOM   7677  N  N   . HIS A 1 46 ? -3.018  -5.876  -2.545  1.00 0.00 ? 46 HIS A N   11 
ATOM   7678  C  CA  . HIS A 1 46 ? -2.408  -4.606  -2.923  1.00 0.00 ? 46 HIS A CA  11 
ATOM   7679  C  C   . HIS A 1 46 ? -3.456  -3.583  -3.292  1.00 0.00 ? 46 HIS A C   11 
ATOM   7680  O  O   . HIS A 1 46 ? -4.566  -3.911  -3.735  1.00 0.00 ? 46 HIS A O   11 
ATOM   7681  C  CB  . HIS A 1 46 ? -1.472  -4.873  -4.111  1.00 0.00 ? 46 HIS A CB  11 
ATOM   7682  C  CG  . HIS A 1 46 ? -0.040  -4.537  -3.814  1.00 0.00 ? 46 HIS A CG  11 
ATOM   7683  N  ND1 . HIS A 1 46 ? 1.072   -5.240  -4.273  1.00 0.00 ? 46 HIS A ND1 11 
ATOM   7684  C  CD2 . HIS A 1 46 ? 0.331   -3.456  -3.028  1.00 0.00 ? 46 HIS A CD2 11 
ATOM   7685  C  CE1 . HIS A 1 46 ? 2.053   -4.507  -3.715  1.00 0.00 ? 46 HIS A CE1 11 
ATOM   7686  N  NE2 . HIS A 1 46 ? 1.700   -3.432  -2.959  1.00 0.00 ? 46 HIS A NE2 11 
ATOM   7687  N  N   . ALA A 1 47 ? -3.092  -2.168  -3.057  1.00 0.00 ? 47 ALA A N   11 
ATOM   7688  C  CA  . ALA A 1 47 ? -4.056  -1.083  -3.215  1.00 0.00 ? 47 ALA A CA  11 
ATOM   7689  C  C   . ALA A 1 47 ? -4.109  -0.615  -4.651  1.00 0.00 ? 47 ALA A C   11 
ATOM   7690  O  O   . ALA A 1 47 ? -3.095  -0.584  -5.363  1.00 0.00 ? 47 ALA A O   11 
ATOM   7691  C  CB  . ALA A 1 47 ? -3.659  0.038   -2.239  1.00 0.00 ? 47 ALA A CB  11 
ATOM   7692  N  N   . LEU A 1 48 ? -5.440  -0.236  -5.171  1.00 0.00 ? 48 LEU A N   11 
ATOM   7693  C  CA  . LEU A 1 48 ? -5.600  0.391   -6.481  1.00 0.00 ? 48 LEU A CA  11 
ATOM   7694  C  C   . LEU A 1 48 ? -4.976  1.768   -6.490  1.00 0.00 ? 48 LEU A C   11 
ATOM   7695  O  O   . LEU A 1 48 ? -5.062  2.525   -5.512  1.00 0.00 ? 48 LEU A O   11 
ATOM   7696  C  CB  . LEU A 1 48 ? -7.102  0.450   -6.878  1.00 0.00 ? 48 LEU A CB  11 
ATOM   7697  C  CG  . LEU A 1 48 ? -8.091  -0.489  -6.136  1.00 0.00 ? 48 LEU A CG  11 
ATOM   7698  C  CD1 . LEU A 1 48 ? -8.595  0.184   -4.852  1.00 0.00 ? 48 LEU A CD1 11 
ATOM   7699  C  CD2 . LEU A 1 48 ? -9.288  -0.903  -7.008  1.00 0.00 ? 48 LEU A CD2 11 
ATOM   7700  N  N   . ARG A 1 49 ? -4.294  2.175   -7.737  1.00 0.00 ? 49 ARG A N   11 
ATOM   7701  C  CA  . ARG A 1 49 ? -3.729  3.508   -7.920  1.00 0.00 ? 49 ARG A CA  11 
ATOM   7702  C  C   . ARG A 1 49 ? -4.796  4.528   -8.241  1.00 0.00 ? 49 ARG A C   11 
ATOM   7703  O  O   . ARG A 1 49 ? -4.500  5.704   -8.512  1.00 0.00 ? 49 ARG A O   11 
ATOM   7704  C  CB  . ARG A 1 49 ? -2.664  3.444   -9.055  1.00 0.00 ? 49 ARG A CB  11 
ATOM   7705  C  CG  . ARG A 1 49 ? -3.128  2.706   -10.338 1.00 0.00 ? 49 ARG A CG  11 
ATOM   7706  C  CD  . ARG A 1 49 ? -2.554  3.322   -11.619 1.00 0.00 ? 49 ARG A CD  11 
ATOM   7707  N  NE  . ARG A 1 49 ? -3.675  3.893   -12.408 1.00 0.00 ? 49 ARG A NE  11 
ATOM   7708  C  CZ  . ARG A 1 49 ? -3.548  4.697   -13.456 1.00 0.00 ? 49 ARG A CZ  11 
ATOM   7709  N  NH1 . ARG A 1 49 ? -2.410  5.093   -13.943 1.00 0.00 ? 49 ARG A NH1 11 
ATOM   7710  N  NH2 . ARG A 1 49 ? -4.627  5.107   -14.022 1.00 0.00 ? 49 ARG A NH2 11 
ATOM   7711  N  N   . GLU A 1 50 ? -6.201  4.068   -8.234  1.00 0.00 ? 50 GLU A N   11 
ATOM   7712  C  CA  . GLU A 1 50 ? -7.297  4.904   -8.708  1.00 0.00 ? 50 GLU A CA  11 
ATOM   7713  C  C   . GLU A 1 50 ? -7.851  5.801   -7.627  1.00 0.00 ? 50 GLU A C   11 
ATOM   7714  O  O   . GLU A 1 50 ? -8.552  6.794   -7.924  1.00 0.00 ? 50 GLU A O   11 
ATOM   7715  C  CB  . GLU A 1 50 ? -8.406  3.975   -9.285  1.00 0.00 ? 50 GLU A CB  11 
ATOM   7716  C  CG  . GLU A 1 50 ? -7.937  2.661   -9.992  1.00 0.00 ? 50 GLU A CG  11 
ATOM   7717  C  CD  . GLU A 1 50 ? -8.146  2.530   -11.502 1.00 0.00 ? 50 GLU A CD  11 
ATOM   7718  O  OE1 . GLU A 1 50 ? -7.335  3.338   -12.240 1.00 0.00 ? 50 GLU A OE1 11 
ATOM   7719  O  OE2 . GLU A 1 50 ? -8.966  1.769   -11.998 1.00 0.00 ? 50 GLU A OE2 11 
ATOM   7720  N  N   . ASN A 1 51 ? -7.514  5.495   -6.231  1.00 0.00 ? 51 ASN A N   11 
ATOM   7721  C  CA  . ASN A 1 51 ? -8.054  6.263   -5.080  1.00 0.00 ? 51 ASN A CA  11 
ATOM   7722  C  C   . ASN A 1 51 ? -6.882  6.593   -4.175  1.00 0.00 ? 51 ASN A C   11 
ATOM   7723  O  O   . ASN A 1 51 ? -7.033  6.928   -2.991  1.00 0.00 ? 51 ASN A O   11 
ATOM   7724  C  CB  . ASN A 1 51 ? -8.957  5.256   -4.317  1.00 0.00 ? 51 ASN A CB  11 
ATOM   7725  C  CG  . ASN A 1 51 ? -8.205  4.189   -3.488  1.00 0.00 ? 51 ASN A CG  11 
ATOM   7726  O  OD1 . ASN A 1 51 ? -7.475  3.356   -3.999  1.00 0.00 ? 51 ASN A OD1 11 
ATOM   7727  N  ND2 . ASN A 1 51 ? -8.383  4.186   -2.196  1.00 0.00 ? 51 ASN A ND2 11 
ATOM   7728  N  N   . VAL A 1 52 ? -5.540  6.426   -4.776  1.00 0.00 ? 52 VAL A N   11 
ATOM   7729  C  CA  . VAL A 1 52 ? -4.322  6.346   -3.969  1.00 0.00 ? 52 VAL A CA  11 
ATOM   7730  C  C   . VAL A 1 52 ? -3.619  7.675   -3.946  1.00 0.00 ? 52 VAL A C   11 
ATOM   7731  O  O   . VAL A 1 52 ? -3.635  8.399   -4.981  1.00 0.00 ? 52 VAL A O   11 
ATOM   7732  C  CB  . VAL A 1 52 ? -3.399  5.188   -4.540  1.00 0.00 ? 52 VAL A CB  11 
ATOM   7733  C  CG1 . VAL A 1 52 ? -2.193  5.615   -5.416  1.00 0.00 ? 52 VAL A CG1 11 
ATOM   7734  C  CG2 . VAL A 1 52 ? -2.811  4.273   -3.434  1.00 0.00 ? 52 VAL A CG2 11 
ATOM   7735  N  N   . SER A 1 53 ? -2.948  8.150   -2.719  1.00 0.00 ? 53 SER A N   11 
ATOM   7736  C  CA  . SER A 1 53 ? -2.302  9.465   -2.644  1.00 0.00 ? 53 SER A CA  11 
ATOM   7737  C  C   . SER A 1 53 ? -0.877  9.354   -2.163  1.00 0.00 ? 53 SER A C   11 
ATOM   7738  O  O   . SER A 1 53 ? -0.561  8.599   -1.230  1.00 0.00 ? 53 SER A O   11 
ATOM   7739  C  CB  . SER A 1 53 ? -3.136  10.447  -1.787  1.00 0.00 ? 53 SER A CB  11 
ATOM   7740  O  OG  . SER A 1 53 ? -2.753  11.815  -1.978  1.00 0.00 ? 53 SER A OG  11 
ATOM   7741  N  N   . PHE A 1 54 ? 0.140   10.221  -2.817  1.00 0.00 ? 54 PHE A N   11 
ATOM   7742  C  CA  . PHE A 1 54 ? 1.565   10.056  -2.565  1.00 0.00 ? 54 PHE A CA  11 
ATOM   7743  C  C   . PHE A 1 54 ? 2.170   11.187  -1.760  1.00 0.00 ? 54 PHE A C   11 
ATOM   7744  O  O   . PHE A 1 54 ? 1.678   12.320  -1.707  1.00 0.00 ? 54 PHE A O   11 
ATOM   7745  C  CB  . PHE A 1 54 ? 2.359   9.923   -3.900  1.00 0.00 ? 54 PHE A CB  11 
ATOM   7746  C  CG  . PHE A 1 54 ? 2.477   8.501   -4.475  1.00 0.00 ? 54 PHE A CG  11 
ATOM   7747  C  CD1 . PHE A 1 54 ? 2.664   7.420   -3.607  1.00 0.00 ? 54 PHE A CD1 11 
ATOM   7748  C  CD2 . PHE A 1 54 ? 2.404   8.276   -5.851  1.00 0.00 ? 54 PHE A CD2 11 
ATOM   7749  C  CE1 . PHE A 1 54 ? 2.774   6.128   -4.109  1.00 0.00 ? 54 PHE A CE1 11 
ATOM   7750  C  CE2 . PHE A 1 54 ? 2.515   6.982   -6.353  1.00 0.00 ? 54 PHE A CE2 11 
ATOM   7751  C  CZ  . PHE A 1 54 ? 2.699   5.909   -5.483  1.00 0.00 ? 54 PHE A CZ  11 
ATOM   7752  N  N   . TYR A 1 55 ? 3.399   10.837  -1.009  1.00 0.00 ? 55 TYR A N   11 
ATOM   7753  C  CA  . TYR A 1 55 ? 4.137   11.775  -0.169  1.00 0.00 ? 55 TYR A CA  11 
ATOM   7754  C  C   . TYR A 1 55 ? 5.612   11.422  -0.172  1.00 0.00 ? 55 TYR A C   11 
ATOM   7755  O  O   . TYR A 1 55 ? 5.986   10.274  -0.506  1.00 0.00 ? 55 TYR A O   11 
ATOM   7756  C  CB  . TYR A 1 55 ? 3.634   11.675  1.302   1.00 0.00 ? 55 TYR A CB  11 
ATOM   7757  C  CG  . TYR A 1 55 ? 2.145   11.326  1.481   1.00 0.00 ? 55 TYR A CG  11 
ATOM   7758  C  CD1 . TYR A 1 55 ? 1.662   10.018  1.484   1.00 0.00 ? 55 TYR A CD1 11 
ATOM   7759  C  CD2 . TYR A 1 55 ? 1.234   12.392  1.648   1.00 0.00 ? 55 TYR A CD2 11 
ATOM   7760  C  CE1 . TYR A 1 55 ? 0.304   9.767   1.656   1.00 0.00 ? 55 TYR A CE1 11 
ATOM   7761  C  CE2 . TYR A 1 55 ? -0.122  12.137  1.817   1.00 0.00 ? 55 TYR A CE2 11 
ATOM   7762  C  CZ  . TYR A 1 55 ? -0.585  10.824  1.823   1.00 0.00 ? 55 TYR A CZ  11 
ATOM   7763  O  OH  . TYR A 1 55 ? -1.918  10.573  1.996   1.00 0.00 ? 55 TYR A OH  11 
ATOM   7764  N  N   . ALA A 1 56 ? 6.610   12.453  0.186   1.00 0.00 ? 56 ALA A N   11 
ATOM   7765  C  CA  . ALA A 1 56 ? 8.043   12.175  0.265   1.00 0.00 ? 56 ALA A CA  11 
ATOM   7766  C  C   . ALA A 1 56 ? 8.407   11.413  1.516   1.00 0.00 ? 56 ALA A C   11 
ATOM   7767  O  O   . ALA A 1 56 ? 9.495   10.813  1.609   1.00 0.00 ? 56 ALA A O   11 
ATOM   7768  C  CB  . ALA A 1 56 ? 8.786   13.522  0.157   1.00 0.00 ? 56 ALA A CB  11 
ATOM   7769  N  N   . ASN A 1 57 ? 7.451   11.441  2.645   1.00 0.00 ? 57 ASN A N   11 
ATOM   7770  C  CA  . ASN A 1 57 ? 7.628   10.596  3.821   1.00 0.00 ? 57 ASN A CA  11 
ATOM   7771  C  C   . ASN A 1 57 ? 6.331   10.424  4.579   1.00 0.00 ? 57 ASN A C   11 
ATOM   7772  O  O   . ASN A 1 57 ? 5.306   11.052  4.283   1.00 0.00 ? 57 ASN A O   11 
ATOM   7773  C  CB  . ASN A 1 57 ? 8.731   11.182  4.749   1.00 0.00 ? 57 ASN A CB  11 
ATOM   7774  C  CG  . ASN A 1 57 ? 8.288   11.714  6.116   1.00 0.00 ? 57 ASN A CG  11 
ATOM   7775  O  OD1 . ASN A 1 57 ? 8.861   11.421  7.156   1.00 0.00 ? 57 ASN A OD1 11 
ATOM   7776  N  ND2 . ASN A 1 57 ? 7.253   12.508  6.174   1.00 0.00 ? 57 ASN A ND2 11 
ATOM   7777  N  N   . ALA A 1 58 ? 6.376   9.485   5.723   1.00 0.00 ? 58 ALA A N   11 
ATOM   7778  C  CA  . ALA A 1 58 ? 5.199   9.165   6.524   1.00 0.00 ? 58 ALA A CA  11 
ATOM   7779  C  C   . ALA A 1 58 ? 4.676   10.382  7.251   1.00 0.00 ? 58 ALA A C   11 
ATOM   7780  O  O   . ALA A 1 58 ? 3.467   10.656  7.265   1.00 0.00 ? 58 ALA A O   11 
ATOM   7781  C  CB  . ALA A 1 58 ? 5.575   8.021   7.485   1.00 0.00 ? 58 ALA A CB  11 
ATOM   7782  N  N   . SER A 1 59 ? 5.670   11.200  7.978   1.00 0.00 ? 59 SER A N   11 
ATOM   7783  C  CA  . SER A 1 59 ? 5.269   12.295  8.857   1.00 0.00 ? 59 SER A CA  11 
ATOM   7784  C  C   . SER A 1 59 ? 4.338   13.254  8.153   1.00 0.00 ? 59 SER A C   11 
ATOM   7785  O  O   . SER A 1 59 ? 3.660   14.080  8.787   1.00 0.00 ? 59 SER A O   11 
ATOM   7786  C  CB  . SER A 1 59 ? 6.503   13.024  9.445   1.00 0.00 ? 59 SER A CB  11 
ATOM   7787  O  OG  . SER A 1 59 ? 6.241   13.622  10.720  1.00 0.00 ? 59 SER A OG  11 
ATOM   7788  N  N   . GLU A 1 60 ? 4.259   13.154  6.680   1.00 0.00 ? 60 GLU A N   11 
ATOM   7789  C  CA  . GLU A 1 60 ? 3.286   13.919  5.905   1.00 0.00 ? 60 GLU A CA  11 
ATOM   7790  C  C   . GLU A 1 60 ? 1.925   13.265  5.926   1.00 0.00 ? 60 GLU A C   11 
ATOM   7791  O  O   . GLU A 1 60 ? 0.936   13.842  6.399   1.00 0.00 ? 60 GLU A O   11 
ATOM   7792  C  CB  . GLU A 1 60 ? 3.807   14.074  4.448   1.00 0.00 ? 60 GLU A CB  11 
ATOM   7793  C  CG  . GLU A 1 60 ? 2.728   14.196  3.321   1.00 0.00 ? 60 GLU A CG  11 
ATOM   7794  C  CD  . GLU A 1 60 ? 2.557   15.541  2.613   1.00 0.00 ? 60 GLU A CD  11 
ATOM   7795  O  OE1 . GLU A 1 60 ? 2.538   16.609  3.459   1.00 0.00 ? 60 GLU A OE1 11 
ATOM   7796  O  OE2 . GLU A 1 60 ? 2.447   15.646  1.398   1.00 0.00 ? 60 GLU A OE2 11 
ATOM   7797  N  N   . ALA A 1 61 ? 1.823   11.920  5.317   1.00 0.00 ? 61 ALA A N   11 
ATOM   7798  C  CA  . ALA A 1 61 ? 0.608   11.118  5.419   1.00 0.00 ? 61 ALA A CA  11 
ATOM   7799  C  C   . ALA A 1 61 ? 0.099   11.033  6.838   1.00 0.00 ? 61 ALA A C   11 
ATOM   7800  O  O   . ALA A 1 61 ? -1.048  10.609  7.083   1.00 0.00 ? 61 ALA A O   11 
ATOM   7801  C  CB  . ALA A 1 61 ? 0.900   9.741   4.801   1.00 0.00 ? 61 ALA A CB  11 
ATOM   7802  N  N   . LEU A 1 62 ? 1.003   11.461  7.926   1.00 0.00 ? 62 LEU A N   11 
ATOM   7803  C  CA  . LEU A 1 62 ? 0.543   11.583  9.310   1.00 0.00 ? 62 LEU A CA  11 
ATOM   7804  C  C   . LEU A 1 62 ? -0.108  12.928  9.534   1.00 0.00 ? 62 LEU A C   11 
ATOM   7805  O  O   . LEU A 1 62 ? -1.198  13.039  10.112  1.00 0.00 ? 62 LEU A O   11 
ATOM   7806  C  CB  . LEU A 1 62 ? 1.724   11.361  10.296  1.00 0.00 ? 62 LEU A CB  11 
ATOM   7807  C  CG  . LEU A 1 62 ? 1.414   10.796  11.708  1.00 0.00 ? 62 LEU A CG  11 
ATOM   7808  C  CD1 . LEU A 1 62 ? 2.153   11.614  12.777  1.00 0.00 ? 62 LEU A CD1 11 
ATOM   7809  C  CD2 . LEU A 1 62 ? -0.090  10.770  12.023  1.00 0.00 ? 62 LEU A CD2 11 
ATOM   7810  N  N   . ALA A 1 63 ? 0.652   14.106  9.064   1.00 0.00 ? 63 ALA A N   11 
ATOM   7811  C  CA  . ALA A 1 63 ? 0.081   15.451  9.047   1.00 0.00 ? 63 ALA A CA  11 
ATOM   7812  C  C   . ALA A 1 63 ? -1.263  15.468  8.359   1.00 0.00 ? 63 ALA A C   11 
ATOM   7813  O  O   . ALA A 1 63 ? -2.130  16.309  8.648   1.00 0.00 ? 63 ALA A O   11 
ATOM   7814  C  CB  . ALA A 1 63 ? 1.102   16.392  8.383   1.00 0.00 ? 63 ALA A CB  11 
ATOM   7815  N  N   . ALA A 1 64 ? -1.509  14.418  7.346   1.00 0.00 ? 64 ALA A N   11 
ATOM   7816  C  CA  . ALA A 1 64 ? -2.824  14.226  6.739   1.00 0.00 ? 64 ALA A CA  11 
ATOM   7817  C  C   . ALA A 1 64 ? -3.781  13.662  7.774   1.00 0.00 ? 64 ALA A C   11 
ATOM   7818  O  O   . ALA A 1 64 ? -4.965  14.011  7.853   1.00 0.00 ? 64 ALA A O   11 
ATOM   7819  C  CB  . ALA A 1 64 ? -2.651  13.305  5.523   1.00 0.00 ? 64 ALA A CB  11 
ATOM   7820  N  N   . GLY A 1 65 ? -3.193  12.630  8.663   1.00 0.00 ? 65 GLY A N   11 
ATOM   7821  C  CA  . GLY A 1 65 ? -3.913  12.097  9.816   1.00 0.00 ? 65 GLY A CA  11 
ATOM   7822  C  C   . GLY A 1 65 ? -4.371  10.679  9.521   1.00 0.00 ? 65 GLY A C   11 
ATOM   7823  O  O   . GLY A 1 65 ? -5.362  10.172  10.061  1.00 0.00 ? 65 GLY A O   11 
ATOM   7824  N  N   . PHE A 1 66 ? -3.564  9.961   8.509   1.00 0.00 ? 66 PHE A N   11 
ATOM   7825  C  CA  . PHE A 1 66 ? -3.951  8.663   7.970   1.00 0.00 ? 66 PHE A CA  11 
ATOM   7826  C  C   . PHE A 1 66 ? -3.401  7.523   8.790   1.00 0.00 ? 66 PHE A C   11 
ATOM   7827  O  O   . PHE A 1 66 ? -2.789  7.738   9.859   1.00 0.00 ? 66 PHE A O   11 
ATOM   7828  C  CB  . PHE A 1 66 ? -3.430  8.533   6.502   1.00 0.00 ? 66 PHE A CB  11 
ATOM   7829  C  CG  . PHE A 1 66 ? -4.263  7.610   5.599   1.00 0.00 ? 66 PHE A CG  11 
ATOM   7830  C  CD1 . PHE A 1 66 ? -5.618  7.408   5.916   1.00 0.00 ? 66 PHE A CD1 11 
ATOM   7831  C  CD2 . PHE A 1 66 ? -3.704  6.949   4.505   1.00 0.00 ? 66 PHE A CD2 11 
ATOM   7832  C  CE1 . PHE A 1 66 ? -6.398  6.560   5.139   1.00 0.00 ? 66 PHE A CE1 11 
ATOM   7833  C  CE2 . PHE A 1 66 ? -4.489  6.099   3.730   1.00 0.00 ? 66 PHE A CE2 11 
ATOM   7834  C  CZ  . PHE A 1 66 ? -5.832  5.904   4.048   1.00 0.00 ? 66 PHE A CZ  11 
ATOM   7835  N  N   . ARG A 1 67 ? -3.578  6.148   8.276   1.00 0.00 ? 67 ARG A N   11 
ATOM   7836  C  CA  . ARG A 1 67 ? -3.225  4.980   9.088   1.00 0.00 ? 67 ARG A CA  11 
ATOM   7837  C  C   . ARG A 1 67 ? -1.842  4.472   8.765   1.00 0.00 ? 67 ARG A C   11 
ATOM   7838  O  O   . ARG A 1 67 ? -1.566  3.964   7.671   1.00 0.00 ? 67 ARG A O   11 
ATOM   7839  C  CB  . ARG A 1 67 ? -4.325  3.900   8.915   1.00 0.00 ? 67 ARG A CB  11 
ATOM   7840  C  CG  . ARG A 1 67 ? -3.823  2.437   8.806   1.00 0.00 ? 67 ARG A CG  11 
ATOM   7841  C  CD  . ARG A 1 67 ? -3.112  1.957   10.078  1.00 0.00 ? 67 ARG A CD  11 
ATOM   7842  N  NE  . ARG A 1 67 ? -3.638  0.612   10.426  1.00 0.00 ? 67 ARG A NE  11 
ATOM   7843  C  CZ  . ARG A 1 67 ? -4.233  0.289   11.567  1.00 0.00 ? 67 ARG A CZ  11 
ATOM   7844  N  NH1 . ARG A 1 67 ? -4.434  1.116   12.550  1.00 0.00 ? 67 ARG A NH1 11 
ATOM   7845  N  NH2 . ARG A 1 67 ? -4.636  -0.925  11.703  1.00 0.00 ? 67 ARG A NH2 11 
ATOM   7846  N  N   . PRO A 1 68 ? -0.818  4.645   9.823   1.00 0.00 ? 68 PRO A N   11 
ATOM   7847  C  CA  . PRO A 1 68 ? 0.654   4.245   9.755   1.00 0.00 ? 68 PRO A CA  11 
ATOM   7848  C  C   . PRO A 1 68 ? 0.916   2.798   9.393   1.00 0.00 ? 68 PRO A C   11 
ATOM   7849  O  O   . PRO A 1 68 ? 0.688   1.890   10.219  1.00 0.00 ? 68 PRO A O   11 
ATOM   7850  C  CB  . PRO A 1 68 ? 1.237   4.482   11.151  1.00 0.00 ? 68 PRO A CB  11 
ATOM   7851  C  CG  . PRO A 1 68 ? 0.358   5.635   11.657  1.00 0.00 ? 68 PRO A CG  11 
ATOM   7852  C  CD  . PRO A 1 68 ? -1.042  5.256   11.160  1.00 0.00 ? 68 PRO A CD  11 
ATOM   7853  N  N   . CYS A 1 69 ? 1.444   2.489   8.048   1.00 0.00 ? 69 CYS A N   11 
ATOM   7854  C  CA  . CYS A 1 69 ? 1.905   1.156   7.657   1.00 0.00 ? 69 CYS A CA  11 
ATOM   7855  C  C   . CYS A 1 69 ? 3.390   1.193   7.355   1.00 0.00 ? 69 CYS A C   11 
ATOM   7856  O  O   . CYS A 1 69 ? 3.879   1.553   6.276   1.00 0.00 ? 69 CYS A O   11 
ATOM   7857  C  CB  . CYS A 1 69 ? 1.003   0.655   6.518   1.00 0.00 ? 69 CYS A CB  11 
ATOM   7858  S  SG  . CYS A 1 69 ? 1.066   -1.129  6.267   1.00 0.00 ? 69 CYS A SG  11 
ATOM   7859  N  N   . LYS A 1 70 ? 4.262   0.796   8.506   1.00 0.00 ? 70 LYS A N   11 
ATOM   7860  C  CA  . LYS A 1 70 ? 5.714   0.917   8.493   1.00 0.00 ? 70 LYS A CA  11 
ATOM   7861  C  C   . LYS A 1 70 ? 6.328   -0.195  7.673   1.00 0.00 ? 70 LYS A C   11 
ATOM   7862  O  O   . LYS A 1 70 ? 6.526   -0.060  6.453   1.00 0.00 ? 70 LYS A O   11 
ATOM   7863  C  CB  . LYS A 1 70 ? 6.251   0.885   9.950   1.00 0.00 ? 70 LYS A CB  11 
ATOM   7864  C  CG  . LYS A 1 70 ? 5.867   2.136   10.779  1.00 0.00 ? 70 LYS A CG  11 
ATOM   7865  C  CD  . LYS A 1 70 ? 6.572   3.429   10.358  1.00 0.00 ? 70 LYS A CD  11 
ATOM   7866  C  CE  . LYS A 1 70 ? 6.127   4.570   11.282  1.00 0.00 ? 70 LYS A CE  11 
ATOM   7867  N  NZ  . LYS A 1 70 ? 5.996   5.811   10.497  1.00 0.00 ? 70 LYS A NZ  11 
ATOM   7868  N  N   . ARG A 1 71 ? 6.712   -1.426  8.397   1.00 0.00 ? 71 ARG A N   11 
ATOM   7869  C  CA  . ARG A 1 71 ? 7.122   -2.630  7.659   1.00 0.00 ? 71 ARG A CA  11 
ATOM   7870  C  C   . ARG A 1 71 ? 5.972   -3.032  6.751   1.00 0.00 ? 71 ARG A C   11 
ATOM   7871  O  O   . ARG A 1 71 ? 6.064   -2.941  5.523   1.00 0.00 ? 71 ARG A O   11 
ATOM   7872  C  CB  . ARG A 1 71 ? 7.497   -3.755  8.651   1.00 0.00 ? 71 ARG A CB  11 
ATOM   7873  C  CG  . ARG A 1 71 ? 8.044   -3.276  10.023  1.00 0.00 ? 71 ARG A CG  11 
ATOM   7874  C  CD  . ARG A 1 71 ? 9.523   -2.875  9.958   1.00 0.00 ? 71 ARG A CD  11 
ATOM   7875  N  NE  . ARG A 1 71 ? 10.083  -2.930  11.332  1.00 0.00 ? 71 ARG A NE  11 
ATOM   7876  C  CZ  . ARG A 1 71 ? 10.648  -3.992  11.892  1.00 0.00 ? 71 ARG A CZ  11 
ATOM   7877  N  NH1 . ARG A 1 71 ? 10.794  -5.141  11.302  1.00 0.00 ? 71 ARG A NH1 11 
ATOM   7878  N  NH2 . ARG A 1 71 ? 11.077  -3.869  13.098  1.00 0.00 ? 71 ARG A NH2 11 
ATOM   7879  N  N   . CYS A 1 72 ? 4.777   -3.570  7.434   1.00 0.00 ? 72 CYS A N   11 
ATOM   7880  C  CA  . CYS A 1 72 ? 3.499   -3.805  6.782   1.00 0.00 ? 72 CYS A CA  11 
ATOM   7881  C  C   . CYS A 1 72 ? 2.500   -4.394  7.777   1.00 0.00 ? 72 CYS A C   11 
ATOM   7882  O  O   . CYS A 1 72 ? 2.158   -5.581  7.788   1.00 0.00 ? 72 CYS A O   11 
ATOM   7883  C  CB  . CYS A 1 72 ? 3.683   -4.606  5.482   1.00 0.00 ? 72 CYS A CB  11 
ATOM   7884  S  SG  . CYS A 1 72 ? 3.594   -3.479  4.048   1.00 0.00 ? 72 CYS A SG  11 
ATOM   7885  N  N   . GLN A 1 73 ? 1.995   -3.428  8.774   1.00 0.00 ? 73 GLN A N   11 
ATOM   7886  C  CA  . GLN A 1 73 ? 1.181   -3.784  9.947   1.00 0.00 ? 73 GLN A CA  11 
ATOM   7887  C  C   . GLN A 1 73 ? 0.127   -4.820  9.704   1.00 0.00 ? 73 GLN A C   11 
ATOM   7888  O  O   . GLN A 1 73 ? -0.161  -5.673  10.574  1.00 0.00 ? 73 GLN A O   11 
ATOM   7889  C  CB  . GLN A 1 73 ? 0.522   -2.464  10.482  1.00 0.00 ? 73 GLN A CB  11 
ATOM   7890  C  CG  . GLN A 1 73 ? 0.538   -2.296  12.035  1.00 0.00 ? 73 GLN A CG  11 
ATOM   7891  C  CD  . GLN A 1 73 ? 1.854   -2.508  12.797  1.00 0.00 ? 73 GLN A CD  11 
ATOM   7892  O  OE1 . GLN A 1 73 ? 2.604   -1.574  13.031  1.00 0.00 ? 73 GLN A OE1 11 
ATOM   7893  N  NE2 . GLN A 1 73 ? 2.198   -3.709  13.185  1.00 0.00 ? 73 GLN A NE2 11 
ATOM   7894  N  N   . PRO A 1 74 ? -0.561  -4.802  8.399   1.00 0.00 ? 74 PRO A N   11 
ATOM   7895  C  CA  . PRO A 1 74 ? -1.680  -5.747  7.942   1.00 0.00 ? 74 PRO A CA  11 
ATOM   7896  C  C   . PRO A 1 74 ? -1.556  -7.167  8.445   1.00 0.00 ? 74 PRO A C   11 
ATOM   7897  O  O   . PRO A 1 74 ? -2.528  -7.785  8.898   1.00 0.00 ? 74 PRO A O   11 
ATOM   7898  C  CB  . PRO A 1 74 ? -1.612  -5.737  6.419   1.00 0.00 ? 74 PRO A CB  11 
ATOM   7899  C  CG  . PRO A 1 74 ? -1.289  -4.255  6.165   1.00 0.00 ? 74 PRO A CG  11 
ATOM   7900  C  CD  . PRO A 1 74 ? -0.307  -3.869  7.276   1.00 0.00 ? 74 PRO A CD  11 
ATOM   7901  N  N   . ASP A 1 75 ? -0.201  -7.760  8.399   1.00 0.00 ? 75 ASP A N   11 
ATOM   7902  C  CA  . ASP A 1 75 ? 0.114   -9.051  9.003   1.00 0.00 ? 75 ASP A CA  11 
ATOM   7903  C  C   . ASP A 1 75 ? 1.488   -9.524  8.581   1.00 0.00 ? 75 ASP A C   11 
ATOM   7904  O  O   . ASP A 1 75 ? 1.642   -10.411 7.731   1.00 0.00 ? 75 ASP A O   11 
ATOM   7905  C  CB  . ASP A 1 75 ? -0.981  -10.098 8.677   1.00 0.00 ? 75 ASP A CB  11 
ATOM   7906  C  CG  . ASP A 1 75 ? -1.199  -11.212 9.713   1.00 0.00 ? 75 ASP A CG  11 
ATOM   7907  O  OD1 . ASP A 1 75 ? -0.048  -11.881 10.022  1.00 0.00 ? 75 ASP A OD1 11 
ATOM   7908  O  OD2 . ASP A 1 75 ? -2.289  -11.455 10.211  1.00 0.00 ? 75 ASP A OD2 11 
ATOM   7909  N  N   . LYS A 1 76 ? 2.633   -8.838  9.217   1.00 0.00 ? 76 LYS A N   11 
ATOM   7910  C  CA  . LYS A 1 76 ? 4.013   -9.053  8.792   1.00 0.00 ? 76 LYS A CA  11 
ATOM   7911  C  C   . LYS A 1 76 ? 4.577   -10.330 9.366   1.00 0.00 ? 76 LYS A C   11 
ATOM   7912  O  O   . LYS A 1 76 ? 5.662   -10.793 8.964   1.00 0.00 ? 76 LYS A O   11 
ATOM   7913  C  CB  . LYS A 1 76 ? 4.866   -7.814  9.180   1.00 0.00 ? 76 LYS A CB  11 
ATOM   7914  C  CG  . LYS A 1 76 ? 6.284   -8.129  9.711   1.00 0.00 ? 76 LYS A CG  11 
ATOM   7915  C  CD  . LYS A 1 76 ? 7.349   -8.347  8.633   1.00 0.00 ? 76 LYS A CD  11 
ATOM   7916  C  CE  . LYS A 1 76 ? 8.733   -8.402  9.295   1.00 0.00 ? 76 LYS A CE  11 
ATOM   7917  N  NZ  . LYS A 1 76 ? 9.754   -8.690  8.272   1.00 0.00 ? 76 LYS A NZ  11 
ATOM   7918  N  N   . ALA A 1 77 ? 3.777   -11.025 10.390  1.00 0.00 ? 77 ALA A N   11 
ATOM   7919  C  CA  . ALA A 1 77 ? 4.131   -12.355 10.902  1.00 0.00 ? 77 ALA A CA  11 
ATOM   7920  C  C   . ALA A 1 77 ? 3.139   -12.866 11.924  1.00 0.00 ? 77 ALA A C   11 
ATOM   7921  O  O   . ALA A 1 77 ? 1.999   -13.228 11.592  1.00 0.00 ? 77 ALA A O   11 
ATOM   7922  C  CB  . ALA A 1 77 ? 5.578   -12.296 11.413  1.00 0.00 ? 77 ALA A CB  11 
ATOM   7923  N  N   . ASN A 1 78 ? 3.603   -12.949 13.325  1.00 0.00 ? 78 ASN A N   11 
ATOM   7924  C  CA  . ASN A 1 78 ? 2.803   -13.584 14.369  1.00 0.00 ? 78 ASN A CA  11 
ATOM   7925  C  C   . ASN A 1 78 ? 2.389   -12.587 15.424  1.00 0.00 ? 78 ASN A C   11 
ATOM   7926  O  O   . ASN A 1 78 ? 2.961   -12.518 16.520  1.00 0.00 ? 78 ASN A O   11 
ATOM   7927  C  CB  . ASN A 1 78 ? 3.615   -14.752 15.003  1.00 0.00 ? 78 ASN A CB  11 
ATOM   7928  C  CG  . ASN A 1 78 ? 5.127   -14.551 15.141  1.00 0.00 ? 78 ASN A CG  11 
ATOM   7929  O  OD1 . ASN A 1 78 ? 5.893   -14.680 14.197  1.00 0.00 ? 78 ASN A OD1 11 
ATOM   7930  N  ND2 . ASN A 1 78 ? 5.615   -14.230 16.309  1.00 0.00 ? 78 ASN A ND2 11 
ATOM   7931  N  N   . PRO A 1 79 ? 1.244   -11.718 15.081  1.00 0.00 ? 79 PRO A N   11 
ATOM   7932  C  CA  . PRO A 1 79 ? 0.623   -10.642 15.977  1.00 0.00 ? 79 PRO A CA  11 
ATOM   7933  C  C   . PRO A 1 79 ? 0.442   -11.050 17.424  1.00 0.00 ? 79 PRO A C   11 
ATOM   7934  O  O   . PRO A 1 79 ? -0.619  -11.543 17.832  1.00 0.00 ? 79 PRO A O   11 
ATOM   7935  C  CB  . PRO A 1 79 ? -0.751  -10.352 15.381  1.00 0.00 ? 79 PRO A CB  11 
ATOM   7936  C  CG  . PRO A 1 79 ? -0.446  -10.500 13.882  1.00 0.00 ? 79 PRO A CG  11 
ATOM   7937  C  CD  . PRO A 1 79 ? 0.479   -11.720 13.811  1.00 0.00 ? 79 PRO A CD  11 
ATOM   7938  N  N   . ARG A 1 80 ? 1.610   -10.857 18.309  1.00 0.00 ? 80 ARG A N   11 
ATOM   7939  C  CA  . ARG A 1 80 ? 1.625   -11.335 19.688  1.00 0.00 ? 80 ARG A CA  11 
ATOM   7940  C  C   . ARG A 1 80 ? 0.377   -10.905 20.424  1.00 0.00 ? 80 ARG A C   11 
ATOM   7941  O  O   . ARG A 1 80 ? 0.061   -9.712  20.528  1.00 0.00 ? 80 ARG A O   11 
ATOM   7942  C  CB  . ARG A 1 80 ? 2.906   -10.808 20.391  1.00 0.00 ? 80 ARG A CB  11 
ATOM   7943  C  CG  . ARG A 1 80 ? 3.093   -9.268  20.341  1.00 0.00 ? 80 ARG A CG  11 
ATOM   7944  C  CD  . ARG A 1 80 ? 4.514   -8.861  19.932  1.00 0.00 ? 80 ARG A CD  11 
ATOM   7945  N  NE  . ARG A 1 80 ? 5.477   -9.615  20.773  1.00 0.00 ? 80 ARG A NE  11 
ATOM   7946  C  CZ  . ARG A 1 80 ? 6.797   -9.484  20.739  1.00 0.00 ? 80 ARG A CZ  11 
ATOM   7947  N  NH1 . ARG A 1 80 ? 7.432   -8.660  19.959  1.00 0.00 ? 80 ARG A NH1 11 
ATOM   7948  N  NH2 . ARG A 1 80 ? 7.487   -10.222 21.534  1.00 0.00 ? 80 ARG A NH2 11 
ATOM   7949  N  N   . GLN A 1 81 ? -0.464  -11.988 20.978  1.00 0.00 ? 81 GLN A N   11 
ATOM   7950  C  CA  . GLN A 1 81 ? -1.748  -11.720 21.617  1.00 0.00 ? 81 GLN A CA  11 
ATOM   7951  C  C   . GLN A 1 81 ? -1.643  -10.561 22.580  1.00 0.00 ? 81 GLN A C   11 
ATOM   7952  O  O   . GLN A 1 81 ? -0.732  -10.489 23.417  1.00 0.00 ? 81 GLN A O   11 
ATOM   7953  C  CB  . GLN A 1 81 ? -2.218  -13.000 22.343  1.00 0.00 ? 81 GLN A CB  11 
ATOM   7954  C  CG  . GLN A 1 81 ? -3.727  -13.047 22.754  1.00 0.00 ? 81 GLN A CG  11 
ATOM   7955  C  CD  . GLN A 1 81 ? -4.125  -13.738 24.065  1.00 0.00 ? 81 GLN A CD  11 
ATOM   7956  O  OE1 . GLN A 1 81 ? -5.198  -13.507 24.600  1.00 0.00 ? 81 GLN A OE1 11 
ATOM   7957  N  NE2 . GLN A 1 81 ? -3.310  -14.595 24.625  1.00 0.00 ? 81 GLN A NE2 11 
ATOM   7958  N  N   . HIS A 1 82 ? -2.690  -9.523  22.473  1.00 0.00 ? 82 HIS A N   11 
ATOM   7959  C  CA  . HIS A 1 82 ? -2.697  -8.338  23.326  1.00 0.00 ? 82 HIS A CA  11 
ATOM   7960  C  C   . HIS A 1 82 ? -3.022  -8.703  24.756  1.00 0.00 ? 82 HIS A C   11 
ATOM   7961  O  O   . HIS A 1 82 ? -4.157  -9.065  25.094  1.00 0.00 ? 82 HIS A O   11 
ATOM   7962  C  CB  . HIS A 1 82 ? -3.772  -7.399  22.756  1.00 0.00 ? 82 HIS A CB  11 
ATOM   7963  C  CG  . HIS A 1 82 ? -3.417  -5.952  22.931  1.00 0.00 ? 82 HIS A CG  11 
ATOM   7964  N  ND1 . HIS A 1 82 ? -4.290  -4.939  23.322  1.00 0.00 ? 82 HIS A ND1 11 
ATOM   7965  C  CD2 . HIS A 1 82 ? -2.137  -5.462  22.711  1.00 0.00 ? 82 HIS A CD2 11 
ATOM   7966  C  CE1 . HIS A 1 82 ? -3.446  -3.890  23.308  1.00 0.00 ? 82 HIS A CE1 11 
ATOM   7967  N  NE2 . HIS A 1 82 ? -2.151  -4.113  22.955  1.00 0.00 ? 82 HIS A NE2 11 
ATOM   7968  N  N   . ARG A 1 83 ? -1.911  -8.601  25.727  1.00 0.00 ? 83 ARG A N   11 
ATOM   7969  C  CA  . ARG A 1 83 ? -2.106  -8.844  27.154  1.00 0.00 ? 83 ARG A CA  11 
ATOM   7970  C  C   . ARG A 1 83 ? -0.975  -8.253  27.962  1.00 0.00 ? 83 ARG A C   11 
ATOM   7971  O  O   . ARG A 1 83 ? -0.594  -8.767  29.023  1.00 0.00 ? 83 ARG A O   11 
ATOM   7972  C  CB  . ARG A 1 83 ? -2.234  -10.373 27.392  1.00 0.00 ? 83 ARG A CB  11 
ATOM   7973  C  CG  . ARG A 1 83 ? -2.998  -10.772 28.683  1.00 0.00 ? 83 ARG A CG  11 
ATOM   7974  C  CD  . ARG A 1 83 ? -2.557  -12.136 29.230  1.00 0.00 ? 83 ARG A CD  11 
ATOM   7975  N  NE  . ARG A 1 83 ? -2.727  -12.125 30.705  1.00 0.00 ? 83 ARG A NE  11 
ATOM   7976  C  CZ  . ARG A 1 83 ? -2.311  -13.072 31.535  1.00 0.00 ? 83 ARG A CZ  11 
ATOM   7977  N  NH1 . ARG A 1 83 ? -1.690  -14.152 31.164  1.00 0.00 ? 83 ARG A NH1 11 
ATOM   7978  N  NH2 . ARG A 1 83 ? -2.539  -12.903 32.790  1.00 0.00 ? 83 ARG A NH2 11 
ATOM   7979  N  N   . LEU A 1 84 ? -0.363  -7.017  27.428  1.00 0.00 ? 84 LEU A N   11 
ATOM   7980  C  CA  . LEU A 1 84 ? 0.743   -6.346  28.105  1.00 0.00 ? 84 LEU A CA  11 
ATOM   7981  C  C   . LEU A 1 84 ? 0.232   -5.384  29.152  1.00 0.00 ? 84 LEU A C   11 
ATOM   7982  O  O   . LEU A 1 84 ? -0.913  -5.472  29.616  1.00 0.00 ? 84 LEU A O   11 
ATOM   7983  C  CB  . LEU A 1 84 ? 1.651   -5.616  27.076  1.00 0.00 ? 84 LEU A CB  11 
ATOM   7984  C  CG  . LEU A 1 84 ? 1.879   -6.288  25.695  1.00 0.00 ? 84 LEU A CG  11 
ATOM   7985  C  CD1 . LEU A 1 84 ? 2.396   -5.255  24.684  1.00 0.00 ? 84 LEU A CD1 11 
ATOM   7986  C  CD2 . LEU A 1 84 ? 2.853   -7.476  25.766  1.00 0.00 ? 84 LEU A CD2 11 
ATOM   7987  N  N   . ASP A 1 85 ? 1.174   -4.332  29.590  1.00 0.00 ? 85 ASP A N   11 
ATOM   7988  C  CA  . ASP A 1 85 ? 0.793   -3.303  30.553  1.00 0.00 ? 85 ASP A CA  11 
ATOM   7989  C  C   . ASP A 1 85 ? 0.681   -1.952  29.886  1.00 0.00 ? 85 ASP A C   11 
ATOM   7990  O  O   . ASP A 1 85 ? 1.376   -1.649  28.907  1.00 0.00 ? 85 ASP A O   11 
ATOM   7991  C  CB  . ASP A 1 85 ? 1.791   -3.281  31.740  1.00 0.00 ? 85 ASP A CB  11 
ATOM   7992  C  CG  . ASP A 1 85 ? 1.186   -3.186  33.148  1.00 0.00 ? 85 ASP A CG  11 
ATOM   7993  O  OD1 . ASP A 1 85 ? 0.020   -3.460  33.392  1.00 0.00 ? 85 ASP A OD1 11 
ATOM   7994  O  OD2 . ASP A 1 85 ? 2.087   -2.762  34.085  1.00 0.00 ? 85 ASP A OD2 11 
ATOM   7995  N  N   . LYS A 1 86 ? -0.291  -1.007  30.478  1.00 0.00 ? 86 LYS A N   11 
ATOM   7996  C  CA  . LYS A 1 86 ? -0.498  0.332   29.935  1.00 0.00 ? 86 LYS A CA  11 
ATOM   7997  C  C   . LYS A 1 86 ? -0.745  1.331   31.041  1.00 0.00 ? 86 LYS A C   11 
ATOM   7998  O  O   . LYS A 1 86 ? -1.856  1.853   31.212  1.00 0.00 ? 86 LYS A O   11 
ATOM   7999  C  CB  . LYS A 1 86 ? -1.685  0.307   28.934  1.00 0.00 ? 86 LYS A CB  11 
ATOM   8000  C  CG  . LYS A 1 86 ? -1.646  1.462   27.903  1.00 0.00 ? 86 LYS A CG  11 
ATOM   8001  C  CD  . LYS A 1 86 ? -2.464  2.698   28.290  1.00 0.00 ? 86 LYS A CD  11 
ATOM   8002  C  CE  . LYS A 1 86 ? -3.190  3.233   27.048  1.00 0.00 ? 86 LYS A CE  11 
ATOM   8003  N  NZ  . LYS A 1 86 ? -3.152  4.706   27.055  1.00 0.00 ? 86 LYS A NZ  11 
ATOM   8004  N  N   . ILE A 1 87 ? 0.408   1.643   31.913  1.00 0.00 ? 87 ILE A N   11 
ATOM   8005  C  CA  . ILE A 1 87 ? 0.345   2.683   32.936  1.00 0.00 ? 87 ILE A CA  11 
ATOM   8006  C  C   . ILE A 1 87 ? 1.321   3.799   32.643  1.00 0.00 ? 87 ILE A C   11 
ATOM   8007  O  O   . ILE A 1 87 ? 1.646   4.622   33.512  1.00 0.00 ? 87 ILE A O   11 
ATOM   8008  C  CB  . ILE A 1 87 ? 0.562   2.080   34.384  1.00 0.00 ? 87 ILE A CB  11 
ATOM   8009  C  CG1 . ILE A 1 87 ? 1.686   0.998   34.476  1.00 0.00 ? 87 ILE A CG1 11 
ATOM   8010  C  CG2 . ILE A 1 87 ? -0.743  1.478   34.990  1.00 0.00 ? 87 ILE A CG2 11 
ATOM   8011  C  CD1 . ILE A 1 87 ? 3.125   1.501   34.246  1.00 0.00 ? 87 ILE A CD1 11 
ATOM   8012  N  N   . THR A 1 88 ? 1.838   3.882   31.260  1.00 0.00 ? 88 THR A N   11 
ATOM   8013  C  CA  . THR A 1 88 ? 2.789   4.913   30.852  1.00 0.00 ? 88 THR A CA  11 
ATOM   8014  C  C   . THR A 1 88 ? 2.356   5.565   29.560  1.00 0.00 ? 88 THR A C   11 
ATOM   8015  O  O   . THR A 1 88 ? 1.925   4.901   28.607  1.00 0.00 ? 88 THR A O   11 
ATOM   8016  C  CB  . THR A 1 88 ? 4.229   4.314   30.717  1.00 0.00 ? 88 THR A CB  11 
ATOM   8017  O  OG1 . THR A 1 88 ? 4.681   3.816   31.969  1.00 0.00 ? 88 THR A OG1 11 
ATOM   8018  C  CG2 . THR A 1 88 ? 5.337   5.290   30.266  1.00 0.00 ? 88 THR A CG2 11 
ATOM   8019  N  N   . HIS A 1 89 ? 2.440   7.041   29.510  1.00 0.00 ? 89 HIS A N   11 
ATOM   8020  C  CA  . HIS A 1 89 ? 2.146   7.795   28.293  1.00 0.00 ? 89 HIS A CA  11 
ATOM   8021  C  C   . HIS A 1 89 ? 3.309   8.683   27.917  1.00 0.00 ? 89 HIS A C   11 
ATOM   8022  O  O   . HIS A 1 89 ? 3.139   9.804   27.419  1.00 0.00 ? 89 HIS A O   11 
ATOM   8023  C  CB  . HIS A 1 89 ? 0.899   8.640   28.598  1.00 0.00 ? 89 HIS A CB  11 
ATOM   8024  C  CG  . HIS A 1 89 ? 0.348   9.306   27.371  1.00 0.00 ? 89 HIS A CG  11 
ATOM   8025  N  ND1 . HIS A 1 89 ? 0.219   10.680  27.177  1.00 0.00 ? 89 HIS A ND1 11 
ATOM   8026  C  CD2 . HIS A 1 89 ? -0.106  8.593   26.270  1.00 0.00 ? 89 HIS A CD2 11 
ATOM   8027  C  CE1 . HIS A 1 89 ? -0.318  10.688  25.943  1.00 0.00 ? 89 HIS A CE1 11 
ATOM   8028  N  NE2 . HIS A 1 89 ? -0.542  9.493   25.332  1.00 0.00 ? 89 HIS A NE2 11 
ATOM   8029  N  N   . ALA A 1 90 ? 4.658   8.153   28.212  1.00 0.00 ? 90 ALA A N   11 
ATOM   8030  C  CA  . ALA A 1 90 ? 5.866   8.944   27.995  1.00 0.00 ? 90 ALA A CA  11 
ATOM   8031  C  C   . ALA A 1 90 ? 6.900   8.152   27.230  1.00 0.00 ? 90 ALA A C   11 
ATOM   8032  O  O   . ALA A 1 90 ? 7.476   7.176   27.730  1.00 0.00 ? 90 ALA A O   11 
ATOM   8033  C  CB  . ALA A 1 90 ? 6.372   9.410   29.372  1.00 0.00 ? 90 ALA A CB  11 
ATOM   8034  N  N   . CYS A 1 91 ? 7.159   8.584   25.839  1.00 0.00 ? 91 CYS A N   11 
ATOM   8035  C  CA  . CYS A 1 91 ? 8.070   7.858   24.960  1.00 0.00 ? 91 CYS A CA  11 
ATOM   8036  C  C   . CYS A 1 91 ? 9.457   8.454   25.007  1.00 0.00 ? 91 CYS A C   11 
ATOM   8037  O  O   . CYS A 1 91 ? 10.458  7.760   25.234  1.00 0.00 ? 91 CYS A O   11 
ATOM   8038  C  CB  . CYS A 1 91 ? 7.480   7.854   23.536  1.00 0.00 ? 91 CYS A CB  11 
ATOM   8039  S  SG  . CYS A 1 91 ? 6.016   6.798   23.453  1.00 0.00 ? 91 CYS A SG  11 
ATOM   8040  N  N   . ARG A 1 92 ? 9.549   9.916   24.806  1.00 0.00 ? 92 ARG A N   11 
ATOM   8041  C  CA  . ARG A 1 92 ? 10.823  10.627  24.864  1.00 0.00 ? 92 ARG A CA  11 
ATOM   8042  C  C   . ARG A 1 92 ? 11.342  10.693  26.281  1.00 0.00 ? 92 ARG A C   11 
ATOM   8043  O  O   . ARG A 1 92 ? 11.185  9.768   27.075  1.00 0.00 ? 92 ARG A O   11 
ATOM   8044  C  CB  . ARG A 1 92 ? 10.635  12.047  24.263  1.00 0.00 ? 92 ARG A CB  11 
ATOM   8045  C  CG  . ARG A 1 92 ? 9.726   12.110  23.007  1.00 0.00 ? 92 ARG A CG  11 
ATOM   8046  C  CD  . ARG A 1 92 ? 9.753   13.486  22.329  1.00 0.00 ? 92 ARG A CD  11 
ATOM   8047  N  NE  . ARG A 1 92 ? 11.147  13.997  22.364  1.00 0.00 ? 92 ARG A NE  11 
ATOM   8048  C  CZ  . ARG A 1 92 ? 11.647  14.808  23.286  1.00 0.00 ? 92 ARG A CZ  11 
ATOM   8049  N  NH1 . ARG A 1 92 ? 10.975  15.271  24.298  1.00 0.00 ? 92 ARG A NH1 11 
ATOM   8050  N  NH2 . ARG A 1 92 ? 12.879  15.156  23.165  1.00 0.00 ? 92 ARG A NH2 11 
ATOM   8051  O  OXT . ARG A 1 92 ? 12.042  11.888  26.637  1.00 0.00 ? 92 ARG A OXT 11 
HETATM 8052  ZN ZN  . ZN  B 2 .  ? 1.865   -1.897  4.309   1.00 0.00 ? 93 ZN  A ZN  11 
ATOM   8053  N  N   . MET A 1 1  ? 14.620  12.167  -29.237 1.00 0.00 ? 1  MET A N   12 
ATOM   8054  C  CA  . MET A 1 1  ? 13.786  11.864  -28.077 1.00 0.00 ? 1  MET A CA  12 
ATOM   8055  C  C   . MET A 1 1  ? 14.635  11.597  -26.856 1.00 0.00 ? 1  MET A C   12 
ATOM   8056  O  O   . MET A 1 1  ? 14.478  10.582  -26.163 1.00 0.00 ? 1  MET A O   12 
ATOM   8057  C  CB  . MET A 1 1  ? 12.797  13.034  -27.819 1.00 0.00 ? 1  MET A CB  12 
ATOM   8058  C  CG  . MET A 1 1  ? 11.387  12.870  -28.425 1.00 0.00 ? 1  MET A CG  12 
ATOM   8059  S  SD  . MET A 1 1  ? 11.433  13.245  -30.185 1.00 0.00 ? 1  MET A SD  12 
ATOM   8060  C  CE  . MET A 1 1  ? 10.432  14.738  -30.166 1.00 0.00 ? 1  MET A CE  12 
ATOM   8061  N  N   . LYS A 1 2  ? 15.659  12.614  -26.534 1.00 0.00 ? 2  LYS A N   12 
ATOM   8062  C  CA  . LYS A 1 2  ? 16.536  12.489  -25.374 1.00 0.00 ? 2  LYS A CA  12 
ATOM   8063  C  C   . LYS A 1 2  ? 16.427  13.701  -24.479 1.00 0.00 ? 2  LYS A C   12 
ATOM   8064  O  O   . LYS A 1 2  ? 17.374  14.081  -23.777 1.00 0.00 ? 2  LYS A O   12 
ATOM   8065  C  CB  . LYS A 1 2  ? 18.000  12.282  -25.852 1.00 0.00 ? 2  LYS A CB  12 
ATOM   8066  C  CG  . LYS A 1 2  ? 18.345  10.803  -26.159 1.00 0.00 ? 2  LYS A CG  12 
ATOM   8067  C  CD  . LYS A 1 2  ? 19.255  10.594  -27.373 1.00 0.00 ? 2  LYS A CD  12 
ATOM   8068  C  CE  . LYS A 1 2  ? 19.698  9.126   -27.425 1.00 0.00 ? 2  LYS A CE  12 
ATOM   8069  N  NZ  . LYS A 1 2  ? 21.010  8.986   -26.770 1.00 0.00 ? 2  LYS A NZ  12 
ATOM   8070  N  N   . LYS A 1 3  ? 15.134  14.420  -24.504 1.00 0.00 ? 3  LYS A N   12 
ATOM   8071  C  CA  . LYS A 1 3  ? 14.872  15.569  -23.643 1.00 0.00 ? 3  LYS A CA  12 
ATOM   8072  C  C   . LYS A 1 3  ? 14.309  15.129  -22.312 1.00 0.00 ? 3  LYS A C   12 
ATOM   8073  O  O   . LYS A 1 3  ? 14.872  15.397  -21.241 1.00 0.00 ? 3  LYS A O   12 
ATOM   8074  C  CB  . LYS A 1 3  ? 13.900  16.544  -24.362 1.00 0.00 ? 3  LYS A CB  12 
ATOM   8075  C  CG  . LYS A 1 3  ? 14.140  18.031  -24.002 1.00 0.00 ? 3  LYS A CG  12 
ATOM   8076  C  CD  . LYS A 1 3  ? 12.898  18.923  -24.080 1.00 0.00 ? 3  LYS A CD  12 
ATOM   8077  C  CE  . LYS A 1 3  ? 13.326  20.395  -24.011 1.00 0.00 ? 3  LYS A CE  12 
ATOM   8078  N  NZ  . LYS A 1 3  ? 12.129  21.251  -23.958 1.00 0.00 ? 3  LYS A NZ  12 
ATOM   8079  N  N   . ALA A 1 4  ? 13.033  14.381  -22.356 1.00 0.00 ? 4  ALA A N   12 
ATOM   8080  C  CA  . ALA A 1 4  ? 12.389  13.877  -21.147 1.00 0.00 ? 4  ALA A CA  12 
ATOM   8081  C  C   . ALA A 1 4  ? 13.146  12.698  -20.581 1.00 0.00 ? 4  ALA A C   12 
ATOM   8082  O  O   . ALA A 1 4  ? 12.954  11.544  -20.989 1.00 0.00 ? 4  ALA A O   12 
ATOM   8083  C  CB  . ALA A 1 4  ? 10.932  13.534  -21.503 1.00 0.00 ? 4  ALA A CB  12 
ATOM   8084  N  N   . THR A 1 5  ? 14.112  12.996  -19.502 1.00 0.00 ? 5  THR A N   12 
ATOM   8085  C  CA  . THR A 1 5  ? 14.969  11.965  -18.925 1.00 0.00 ? 5  THR A CA  12 
ATOM   8086  C  C   . THR A 1 5  ? 14.476  11.551  -17.559 1.00 0.00 ? 5  THR A C   12 
ATOM   8087  O  O   . THR A 1 5  ? 14.080  10.401  -17.327 1.00 0.00 ? 5  THR A O   12 
ATOM   8088  C  CB  . THR A 1 5  ? 16.454  12.458  -18.853 1.00 0.00 ? 5  THR A CB  12 
ATOM   8089  O  OG1 . THR A 1 5  ? 16.503  13.858  -18.612 1.00 0.00 ? 5  THR A OG1 12 
ATOM   8090  C  CG2 . THR A 1 5  ? 17.305  12.254  -20.125 1.00 0.00 ? 5  THR A CG2 12 
ATOM   8091  N  N   . CYS A 1 6  ? 14.493  12.598  -16.510 1.00 0.00 ? 6  CYS A N   12 
ATOM   8092  C  CA  . CYS A 1 6  ? 13.919  12.367  -15.188 1.00 0.00 ? 6  CYS A CA  12 
ATOM   8093  C  C   . CYS A 1 6  ? 12.424  12.585  -15.198 1.00 0.00 ? 6  CYS A C   12 
ATOM   8094  O  O   . CYS A 1 6  ? 11.912  13.635  -15.608 1.00 0.00 ? 6  CYS A O   12 
ATOM   8095  C  CB  . CYS A 1 6  ? 14.654  13.243  -14.156 1.00 0.00 ? 6  CYS A CB  12 
ATOM   8096  S  SG  . CYS A 1 6  ? 14.501  15.001  -14.540 1.00 0.00 ? 6  CYS A SG  12 
ATOM   8097  N  N   . LEU A 1 7  ? 11.597  11.450  -14.726 1.00 0.00 ? 7  LEU A N   12 
ATOM   8098  C  CA  . LEU A 1 7  ? 10.139  11.514  -14.694 1.00 0.00 ? 7  LEU A CA  12 
ATOM   8099  C  C   . LEU A 1 7  ? 9.651   12.122  -13.400 1.00 0.00 ? 7  LEU A C   12 
ATOM   8100  O  O   . LEU A 1 7  ? 10.340  12.926  -12.756 1.00 0.00 ? 7  LEU A O   12 
ATOM   8101  C  CB  . LEU A 1 7  ? 9.527   10.099  -14.905 1.00 0.00 ? 7  LEU A CB  12 
ATOM   8102  C  CG  . LEU A 1 7  ? 10.175  9.176   -15.972 1.00 0.00 ? 7  LEU A CG  12 
ATOM   8103  C  CD1 . LEU A 1 7  ? 9.602   7.756   -15.860 1.00 0.00 ? 7  LEU A CD1 12 
ATOM   8104  C  CD2 . LEU A 1 7  ? 9.987   9.700   -17.405 1.00 0.00 ? 7  LEU A CD2 12 
ATOM   8105  N  N   . THR A 1 8  ? 8.323   11.676  -12.926 1.00 0.00 ? 8  THR A N   12 
ATOM   8106  C  CA  . THR A 1 8  ? 7.805   12.054  -11.614 1.00 0.00 ? 8  THR A CA  12 
ATOM   8107  C  C   . THR A 1 8  ? 6.763   11.070  -11.136 1.00 0.00 ? 8  THR A C   12 
ATOM   8108  O  O   . THR A 1 8  ? 7.004   10.251  -10.237 1.00 0.00 ? 8  THR A O   12 
ATOM   8109  C  CB  . THR A 1 8  ? 7.221   13.506  -11.650 1.00 0.00 ? 8  THR A CB  12 
ATOM   8110  O  OG1 . THR A 1 8  ? 8.162   14.436  -11.128 1.00 0.00 ? 8  THR A OG1 12 
ATOM   8111  C  CG2 . THR A 1 8  ? 5.939   13.751  -10.824 1.00 0.00 ? 8  THR A CG2 12 
ATOM   8112  N  N   . ASP A 1 9  ? 5.432   11.152  -11.779 1.00 0.00 ? 9  ASP A N   12 
ATOM   8113  C  CA  . ASP A 1 9  ? 4.297   10.371  -11.297 1.00 0.00 ? 9  ASP A CA  12 
ATOM   8114  C  C   . ASP A 1 9  ? 4.396   8.936   -11.764 1.00 0.00 ? 9  ASP A C   12 
ATOM   8115  O  O   . ASP A 1 9  ? 3.867   8.009   -11.136 1.00 0.00 ? 9  ASP A O   12 
ATOM   8116  C  CB  . ASP A 1 9  ? 2.958   11.026  -11.724 1.00 0.00 ? 9  ASP A CB  12 
ATOM   8117  C  CG  . ASP A 1 9  ? 3.040   12.288  -12.594 1.00 0.00 ? 9  ASP A CG  12 
ATOM   8118  O  OD1 . ASP A 1 9  ? 3.160   12.252  -13.810 1.00 0.00 ? 9  ASP A OD1 12 
ATOM   8119  O  OD2 . ASP A 1 9  ? 2.967   13.441  -11.864 1.00 0.00 ? 9  ASP A OD2 12 
ATOM   8120  N  N   . ASP A 1 10 ? 5.190   8.701   -12.989 1.00 0.00 ? 10 ASP A N   12 
ATOM   8121  C  CA  . ASP A 1 10 ? 5.439   7.357   -13.503 1.00 0.00 ? 10 ASP A CA  12 
ATOM   8122  C  C   . ASP A 1 10 ? 6.386   6.601   -12.601 1.00 0.00 ? 10 ASP A C   12 
ATOM   8123  O  O   . ASP A 1 10 ? 6.039   5.585   -11.980 1.00 0.00 ? 10 ASP A O   12 
ATOM   8124  C  CB  . ASP A 1 10 ? 5.964   7.430   -14.960 1.00 0.00 ? 10 ASP A CB  12 
ATOM   8125  C  CG  . ASP A 1 10 ? 4.908   7.556   -16.068 1.00 0.00 ? 10 ASP A CG  12 
ATOM   8126  O  OD1 . ASP A 1 10 ? 3.858   6.696   -15.899 1.00 0.00 ? 10 ASP A OD1 12 
ATOM   8127  O  OD2 . ASP A 1 10 ? 5.006   8.344   -16.997 1.00 0.00 ? 10 ASP A OD2 12 
ATOM   8128  N  N   . GLN A 1 11 ? 7.749   7.163   -12.463 1.00 0.00 ? 11 GLN A N   12 
ATOM   8129  C  CA  . GLN A 1 11 ? 8.760   6.527   -11.621 1.00 0.00 ? 11 GLN A CA  12 
ATOM   8130  C  C   . GLN A 1 11 ? 8.189   6.213   -10.255 1.00 0.00 ? 11 GLN A C   12 
ATOM   8131  O  O   . GLN A 1 11 ? 8.416   5.148   -9.666  1.00 0.00 ? 11 GLN A O   12 
ATOM   8132  C  CB  . GLN A 1 11 ? 9.973   7.474   -11.504 1.00 0.00 ? 11 GLN A CB  12 
ATOM   8133  C  CG  . GLN A 1 11 ? 9.706   8.853   -10.813 1.00 0.00 ? 11 GLN A CG  12 
ATOM   8134  C  CD  . GLN A 1 11 ? 10.652  9.331   -9.704  1.00 0.00 ? 11 GLN A CD  12 
ATOM   8135  O  OE1 . GLN A 1 11 ? 10.232  9.957   -8.743  1.00 0.00 ? 11 GLN A OE1 12 
ATOM   8136  N  NE2 . GLN A 1 11 ? 11.935  9.091   -9.790  1.00 0.00 ? 11 GLN A NE2 12 
ATOM   8137  N  N   . ARG A 1 12 ? 7.303   7.250   -9.681  1.00 0.00 ? 12 ARG A N   12 
ATOM   8138  C  CA  . ARG A 1 12 ? 6.635   7.114   -8.395  1.00 0.00 ? 12 ARG A CA  12 
ATOM   8139  C  C   . ARG A 1 12 ? 5.928   5.791   -8.233  1.00 0.00 ? 12 ARG A C   12 
ATOM   8140  O  O   . ARG A 1 12 ? 6.400   4.832   -7.585  1.00 0.00 ? 12 ARG A O   12 
ATOM   8141  C  CB  . ARG A 1 12 ? 5.607   8.287   -8.260  1.00 0.00 ? 12 ARG A CB  12 
ATOM   8142  C  CG  . ARG A 1 12 ? 6.170   9.585   -7.633  1.00 0.00 ? 12 ARG A CG  12 
ATOM   8143  C  CD  . ARG A 1 12 ? 5.550   9.907   -6.266  1.00 0.00 ? 12 ARG A CD  12 
ATOM   8144  N  NE  . ARG A 1 12 ? 6.429   10.885  -5.576  1.00 0.00 ? 12 ARG A NE  12 
ATOM   8145  C  CZ  . ARG A 1 12 ? 6.724   12.100  -6.017  1.00 0.00 ? 12 ARG A CZ  12 
ATOM   8146  N  NH1 . ARG A 1 12 ? 6.273   12.608  -7.126  1.00 0.00 ? 12 ARG A NH1 12 
ATOM   8147  N  NH2 . ARG A 1 12 ? 7.510   12.819  -5.296  1.00 0.00 ? 12 ARG A NH2 12 
ATOM   8148  N  N   . TRP A 1 13 ? 4.624   5.666   -8.935  1.00 0.00 ? 13 TRP A N   12 
ATOM   8149  C  CA  . TRP A 1 13 ? 3.753   4.525   -8.695  1.00 0.00 ? 13 TRP A CA  12 
ATOM   8150  C  C   . TRP A 1 13 ? 4.307   3.277   -9.340  1.00 0.00 ? 13 TRP A C   12 
ATOM   8151  O  O   . TRP A 1 13 ? 4.077   2.149   -8.884  1.00 0.00 ? 13 TRP A O   12 
ATOM   8152  C  CB  . TRP A 1 13 ? 2.322   4.799   -9.268  1.00 0.00 ? 13 TRP A CB  12 
ATOM   8153  C  CG  . TRP A 1 13 ? 1.558   3.466   -9.402  1.00 0.00 ? 13 TRP A CG  12 
ATOM   8154  C  CD1 . TRP A 1 13 ? 1.390   2.728   -10.590 1.00 0.00 ? 13 TRP A CD1 12 
ATOM   8155  C  CD2 . TRP A 1 13 ? 1.015   2.708   -8.390  1.00 0.00 ? 13 TRP A CD2 12 
ATOM   8156  N  NE1 . TRP A 1 13 ? 0.736   1.504   -10.340 1.00 0.00 ? 13 TRP A NE1 12 
ATOM   8157  C  CE2 . TRP A 1 13 ? 0.519   1.513   -8.969  1.00 0.00 ? 13 TRP A CE2 12 
ATOM   8158  C  CE3 . TRP A 1 13 ? 0.930   2.928   -6.990  1.00 0.00 ? 13 TRP A CE3 12 
ATOM   8159  C  CZ2 . TRP A 1 13 ? -0.073  0.531   -8.144  1.00 0.00 ? 13 TRP A CZ2 12 
ATOM   8160  C  CZ3 . TRP A 1 13 ? 0.328   1.948   -6.201  1.00 0.00 ? 13 TRP A CZ3 12 
ATOM   8161  C  CH2 . TRP A 1 13 ? -0.168  0.766   -6.769  1.00 0.00 ? 13 TRP A CH2 12 
ATOM   8162  N  N   . GLN A 1 14 ? 5.100   3.468   -10.578 1.00 0.00 ? 14 GLN A N   12 
ATOM   8163  C  CA  . GLN A 1 14 ? 5.837   2.364   -11.187 1.00 0.00 ? 14 GLN A CA  12 
ATOM   8164  C  C   . GLN A 1 14 ? 6.748   1.722   -10.160 1.00 0.00 ? 14 GLN A C   12 
ATOM   8165  O  O   . GLN A 1 14 ? 6.954   0.501   -10.138 1.00 0.00 ? 14 GLN A O   12 
ATOM   8166  C  CB  . GLN A 1 14 ? 6.650   2.891   -12.386 1.00 0.00 ? 14 GLN A CB  12 
ATOM   8167  C  CG  . GLN A 1 14 ? 7.489   1.828   -13.173 1.00 0.00 ? 14 GLN A CG  12 
ATOM   8168  C  CD  . GLN A 1 14 ? 7.975   2.154   -14.590 1.00 0.00 ? 14 GLN A CD  12 
ATOM   8169  O  OE1 . GLN A 1 14 ? 7.519   1.575   -15.563 1.00 0.00 ? 14 GLN A OE1 12 
ATOM   8170  N  NE2 . GLN A 1 14 ? 8.900   3.062   -14.771 1.00 0.00 ? 14 GLN A NE2 12 
ATOM   8171  N  N   . SER A 1 15 ? 7.354   2.648   -9.176  1.00 0.00 ? 15 SER A N   12 
ATOM   8172  C  CA  . SER A 1 15 ? 8.108   2.164   -8.025  1.00 0.00 ? 15 SER A CA  12 
ATOM   8173  C  C   . SER A 1 15 ? 7.260   1.238   -7.182  1.00 0.00 ? 15 SER A C   12 
ATOM   8174  O  O   . SER A 1 15 ? 7.728   0.185   -6.719  1.00 0.00 ? 15 SER A O   12 
ATOM   8175  C  CB  . SER A 1 15 ? 8.684   3.333   -7.187  1.00 0.00 ? 15 SER A CB  12 
ATOM   8176  O  OG  . SER A 1 15 ? 10.088  3.526   -7.391  1.00 0.00 ? 15 SER A OG  12 
ATOM   8177  N  N   . VAL A 1 16 ? 5.849   1.650   -6.944  1.00 0.00 ? 16 VAL A N   12 
ATOM   8178  C  CA  . VAL A 1 16 ? 4.921   0.743   -6.273  1.00 0.00 ? 16 VAL A CA  12 
ATOM   8179  C  C   . VAL A 1 16 ? 4.836   -0.605  -6.945  1.00 0.00 ? 16 VAL A C   12 
ATOM   8180  O  O   . VAL A 1 16 ? 4.955   -1.671  -6.292  1.00 0.00 ? 16 VAL A O   12 
ATOM   8181  C  CB  . VAL A 1 16 ? 3.493   1.369   -6.047  1.00 0.00 ? 16 VAL A CB  12 
ATOM   8182  C  CG1 . VAL A 1 16 ? 2.663   0.752   -4.873  1.00 0.00 ? 16 VAL A CG1 12 
ATOM   8183  C  CG2 . VAL A 1 16 ? 3.514   2.887   -5.749  1.00 0.00 ? 16 VAL A CG2 12 
ATOM   8184  N  N   . LEU A 1 17 ? 4.553   -0.645  -8.393  1.00 0.00 ? 17 LEU A N   12 
ATOM   8185  C  CA  . LEU A 1 17 ? 4.446   -1.917  -9.135  1.00 0.00 ? 17 LEU A CA  12 
ATOM   8186  C  C   . LEU A 1 17 ? 5.649   -2.787  -8.884  1.00 0.00 ? 17 LEU A C   12 
ATOM   8187  O  O   . LEU A 1 17 ? 5.575   -3.983  -8.573  1.00 0.00 ? 17 LEU A O   12 
ATOM   8188  C  CB  . LEU A 1 17 ? 4.263   -1.660  -10.660 1.00 0.00 ? 17 LEU A CB  12 
ATOM   8189  C  CG  . LEU A 1 17 ? 3.039   -0.816  -11.109 1.00 0.00 ? 17 LEU A CG  12 
ATOM   8190  C  CD1 . LEU A 1 17 ? 2.845   -0.934  -12.627 1.00 0.00 ? 17 LEU A CD1 12 
ATOM   8191  C  CD2 . LEU A 1 17 ? 1.742   -1.220  -10.389 1.00 0.00 ? 17 LEU A CD2 12 
ATOM   8192  N  N   . ALA A 1 18 ? 6.963   -2.121  -9.073  1.00 0.00 ? 18 ALA A N   12 
ATOM   8193  C  CA  . ALA A 1 18 ? 8.238   -2.821  -9.090  1.00 0.00 ? 18 ALA A CA  12 
ATOM   8194  C  C   . ALA A 1 18 ? 8.848   -2.986  -7.717  1.00 0.00 ? 18 ALA A C   12 
ATOM   8195  O  O   . ALA A 1 18 ? 10.023  -3.357  -7.583  1.00 0.00 ? 18 ALA A O   12 
ATOM   8196  C  CB  . ALA A 1 18 ? 9.177   -2.034  -10.037 1.00 0.00 ? 18 ALA A CB  12 
ATOM   8197  N  N   . ARG A 1 19 ? 7.970   -2.740  -6.555  1.00 0.00 ? 19 ARG A N   12 
ATOM   8198  C  CA  . ARG A 1 19 ? 8.410   -2.650  -5.168  1.00 0.00 ? 19 ARG A CA  12 
ATOM   8199  C  C   . ARG A 1 19 ? 9.894   -2.814  -4.993  1.00 0.00 ? 19 ARG A C   12 
ATOM   8200  O  O   . ARG A 1 19 ? 10.390  -3.756  -4.357  1.00 0.00 ? 19 ARG A O   12 
ATOM   8201  C  CB  . ARG A 1 19 ? 7.611   -3.682  -4.321  1.00 0.00 ? 19 ARG A CB  12 
ATOM   8202  C  CG  . ARG A 1 19 ? 7.834   -5.174  -4.679  1.00 0.00 ? 19 ARG A CG  12 
ATOM   8203  C  CD  . ARG A 1 19 ? 7.418   -5.521  -6.114  1.00 0.00 ? 19 ARG A CD  12 
ATOM   8204  N  NE  . ARG A 1 19 ? 8.649   -5.734  -6.917  1.00 0.00 ? 19 ARG A NE  12 
ATOM   8205  C  CZ  . ARG A 1 19 ? 8.714   -6.382  -8.072  1.00 0.00 ? 19 ARG A CZ  12 
ATOM   8206  N  NH1 . ARG A 1 19 ? 7.692   -6.920  -8.669  1.00 0.00 ? 19 ARG A NH1 12 
ATOM   8207  N  NH2 . ARG A 1 19 ? 9.866   -6.480  -8.634  1.00 0.00 ? 19 ARG A NH2 12 
ATOM   8208  N  N   . ASP A 1 20 ? 10.746  -1.757  -5.593  1.00 0.00 ? 20 ASP A N   12 
ATOM   8209  C  CA  . ASP A 1 20 ? 12.203  -1.796  -5.531  1.00 0.00 ? 20 ASP A CA  12 
ATOM   8210  C  C   . ASP A 1 20 ? 12.711  -1.179  -4.249  1.00 0.00 ? 20 ASP A C   12 
ATOM   8211  O  O   . ASP A 1 20 ? 12.227  -0.139  -3.787  1.00 0.00 ? 20 ASP A O   12 
ATOM   8212  C  CB  . ASP A 1 20 ? 12.812  -1.105  -6.779  1.00 0.00 ? 20 ASP A CB  12 
ATOM   8213  C  CG  . ASP A 1 20 ? 14.241  -1.515  -7.166  1.00 0.00 ? 20 ASP A CG  12 
ATOM   8214  O  OD1 . ASP A 1 20 ? 14.449  -2.863  -7.072  1.00 0.00 ? 20 ASP A OD1 12 
ATOM   8215  O  OD2 . ASP A 1 20 ? 15.087  -0.715  -7.537  1.00 0.00 ? 20 ASP A OD2 12 
ATOM   8216  N  N   . PRO A 1 21 ? 13.815  -1.897  -3.577  1.00 0.00 ? 21 PRO A N   12 
ATOM   8217  C  CA  . PRO A 1 21 ? 14.515  -1.478  -2.285  1.00 0.00 ? 21 PRO A CA  12 
ATOM   8218  C  C   . PRO A 1 21 ? 15.047  -0.057  -2.252  1.00 0.00 ? 21 PRO A C   12 
ATOM   8219  O  O   . PRO A 1 21 ? 15.245  0.524   -1.172  1.00 0.00 ? 21 PRO A O   12 
ATOM   8220  C  CB  . PRO A 1 21 ? 15.698  -2.426  -2.102  1.00 0.00 ? 21 PRO A CB  12 
ATOM   8221  C  CG  . PRO A 1 21 ? 15.183  -3.697  -2.795  1.00 0.00 ? 21 PRO A CG  12 
ATOM   8222  C  CD  . PRO A 1 21 ? 14.451  -3.158  -4.030  1.00 0.00 ? 21 PRO A CD  12 
ATOM   8223  N  N   . ASN A 1 22 ? 15.314  0.601   -3.548  1.00 0.00 ? 22 ASN A N   12 
ATOM   8224  C  CA  . ASN A 1 22 ? 15.991  1.888   -3.652  1.00 0.00 ? 22 ASN A CA  12 
ATOM   8225  C  C   . ASN A 1 22 ? 15.127  3.039   -3.198  1.00 0.00 ? 22 ASN A C   12 
ATOM   8226  O  O   . ASN A 1 22 ? 15.577  3.930   -2.454  1.00 0.00 ? 22 ASN A O   12 
ATOM   8227  C  CB  . ASN A 1 22 ? 16.460  2.106   -5.124  1.00 0.00 ? 22 ASN A CB  12 
ATOM   8228  C  CG  . ASN A 1 22 ? 16.310  3.517   -5.700  1.00 0.00 ? 22 ASN A CG  12 
ATOM   8229  O  OD1 . ASN A 1 22 ? 17.232  4.319   -5.715  1.00 0.00 ? 22 ASN A OD1 12 
ATOM   8230  N  ND2 . ASN A 1 22 ? 15.155  3.876   -6.193  1.00 0.00 ? 22 ASN A ND2 12 
ATOM   8231  N  N   . ALA A 1 23 ? 13.731  3.081   -3.688  1.00 0.00 ? 23 ALA A N   12 
ATOM   8232  C  CA  . ALA A 1 23 ? 12.870  4.237   -3.464  1.00 0.00 ? 23 ALA A CA  12 
ATOM   8233  C  C   . ALA A 1 23 ? 11.765  3.952   -2.476  1.00 0.00 ? 23 ALA A C   12 
ATOM   8234  O  O   . ALA A 1 23 ? 10.846  4.771   -2.289  1.00 0.00 ? 23 ALA A O   12 
ATOM   8235  C  CB  . ALA A 1 23 ? 12.333  4.685   -4.838  1.00 0.00 ? 23 ALA A CB  12 
ATOM   8236  N  N   . ASP A 1 24 ? 11.836  2.687   -1.714  1.00 0.00 ? 24 ASP A N   12 
ATOM   8237  C  CA  . ASP A 1 24 ? 10.833  2.337   -0.709  1.00 0.00 ? 24 ASP A CA  12 
ATOM   8238  C  C   . ASP A 1 24 ? 10.579  3.498   0.223   1.00 0.00 ? 24 ASP A C   12 
ATOM   8239  O  O   . ASP A 1 24 ? 9.580   4.223   0.118   1.00 0.00 ? 24 ASP A O   12 
ATOM   8240  C  CB  . ASP A 1 24 ? 11.257  1.059   0.058   1.00 0.00 ? 24 ASP A CB  12 
ATOM   8241  C  CG  . ASP A 1 24 ? 10.962  -0.285  -0.626  1.00 0.00 ? 24 ASP A CG  12 
ATOM   8242  O  OD1 . ASP A 1 24 ? 10.119  -0.416  -1.501  1.00 0.00 ? 24 ASP A OD1 12 
ATOM   8243  O  OD2 . ASP A 1 24 ? 11.749  -1.301  -0.160  1.00 0.00 ? 24 ASP A OD2 12 
ATOM   8244  N  N   . GLY A 1 25 ? 11.617  3.749   1.249   1.00 0.00 ? 25 GLY A N   12 
ATOM   8245  C  CA  . GLY A 1 25 ? 11.435  4.729   2.315   1.00 0.00 ? 25 GLY A CA  12 
ATOM   8246  C  C   . GLY A 1 25 ? 11.635  6.137   1.805   1.00 0.00 ? 25 GLY A C   12 
ATOM   8247  O  O   . GLY A 1 25 ? 11.607  7.113   2.575   1.00 0.00 ? 25 GLY A O   12 
ATOM   8248  N  N   . GLU A 1 26 ? 11.869  6.304   0.355   1.00 0.00 ? 26 GLU A N   12 
ATOM   8249  C  CA  . GLU A 1 26 ? 12.066  7.623   -0.245  1.00 0.00 ? 26 GLU A CA  12 
ATOM   8250  C  C   . GLU A 1 26 ? 10.744  8.302   -0.517  1.00 0.00 ? 26 GLU A C   12 
ATOM   8251  O  O   . GLU A 1 26 ? 10.702  9.511   -0.821  1.00 0.00 ? 26 GLU A O   12 
ATOM   8252  C  CB  . GLU A 1 26 ? 12.893  7.450   -1.549  1.00 0.00 ? 26 GLU A CB  12 
ATOM   8253  C  CG  . GLU A 1 26 ? 13.647  8.708   -2.096  1.00 0.00 ? 26 GLU A CG  12 
ATOM   8254  C  CD  . GLU A 1 26 ? 13.135  9.359   -3.383  1.00 0.00 ? 26 GLU A CD  12 
ATOM   8255  O  OE1 . GLU A 1 26 ? 12.710  8.714   -4.332  1.00 0.00 ? 26 GLU A OE1 12 
ATOM   8256  O  OE2 . GLU A 1 26 ? 13.198  10.719  -3.372  1.00 0.00 ? 26 GLU A OE2 12 
ATOM   8257  N  N   . PHE A 1 27 ? 9.514   7.490   -0.381  1.00 0.00 ? 27 PHE A N   12 
ATOM   8258  C  CA  . PHE A 1 27 ? 8.186   8.093   -0.597  1.00 0.00 ? 27 PHE A CA  12 
ATOM   8259  C  C   . PHE A 1 27 ? 7.075   7.193   -0.120  1.00 0.00 ? 27 PHE A C   12 
ATOM   8260  O  O   . PHE A 1 27 ? 7.226   5.952   -0.086  1.00 0.00 ? 27 PHE A O   12 
ATOM   8261  C  CB  . PHE A 1 27 ? 8.011   8.402   -2.113  1.00 0.00 ? 27 PHE A CB  12 
ATOM   8262  C  CG  . PHE A 1 27 ? 7.665   7.223   -3.037  1.00 0.00 ? 27 PHE A CG  12 
ATOM   8263  C  CD1 . PHE A 1 27 ? 8.440   6.059   -2.982  1.00 0.00 ? 27 PHE A CD1 12 
ATOM   8264  C  CD2 . PHE A 1 27 ? 6.605   7.301   -3.942  1.00 0.00 ? 27 PHE A CD2 12 
ATOM   8265  C  CE1 . PHE A 1 27 ? 8.155   4.985   -3.817  1.00 0.00 ? 27 PHE A CE1 12 
ATOM   8266  C  CE2 . PHE A 1 27 ? 6.320   6.224   -4.779  1.00 0.00 ? 27 PHE A CE2 12 
ATOM   8267  C  CZ  . PHE A 1 27 ? 7.096   5.068   -4.717  1.00 0.00 ? 27 PHE A CZ  12 
ATOM   8268  N  N   . VAL A 1 28 ? 5.796   7.806   0.312   1.00 0.00 ? 28 VAL A N   12 
ATOM   8269  C  CA  . VAL A 1 28 ? 4.665   7.032   0.831   1.00 0.00 ? 28 VAL A CA  12 
ATOM   8270  C  C   . VAL A 1 28 ? 3.573   6.906   -0.205  1.00 0.00 ? 28 VAL A C   12 
ATOM   8271  O  O   . VAL A 1 28 ? 3.568   7.598   -1.233  1.00 0.00 ? 28 VAL A O   12 
ATOM   8272  C  CB  . VAL A 1 28 ? 4.118   7.709   2.149   1.00 0.00 ? 28 VAL A CB  12 
ATOM   8273  C  CG1 . VAL A 1 28 ? 4.097   6.815   3.422   1.00 0.00 ? 28 VAL A CG1 12 
ATOM   8274  C  CG2 . VAL A 1 28 ? 4.898   8.974   2.578   1.00 0.00 ? 28 VAL A CG2 12 
ATOM   8275  N  N   . PHE A 1 29 ? 2.489   5.941   0.090   1.00 0.00 ? 29 PHE A N   12 
ATOM   8276  C  CA  . PHE A 1 29 ? 1.291   5.816   -0.737  1.00 0.00 ? 29 PHE A CA  12 
ATOM   8277  C  C   . PHE A 1 29 ? 0.072   5.618   0.135   1.00 0.00 ? 29 PHE A C   12 
ATOM   8278  O  O   . PHE A 1 29 ? 0.128   4.922   1.167   1.00 0.00 ? 29 PHE A O   12 
ATOM   8279  C  CB  . PHE A 1 29 ? 1.425   4.594   -1.695  1.00 0.00 ? 29 PHE A CB  12 
ATOM   8280  C  CG  . PHE A 1 29 ? 0.826   3.256   -1.232  1.00 0.00 ? 29 PHE A CG  12 
ATOM   8281  C  CD1 . PHE A 1 29 ? -0.558  3.061   -1.282  1.00 0.00 ? 29 PHE A CD1 12 
ATOM   8282  C  CD2 . PHE A 1 29 ? 1.654   2.217   -0.800  1.00 0.00 ? 29 PHE A CD2 12 
ATOM   8283  C  CE1 . PHE A 1 29 ? -1.109  1.845   -0.893  1.00 0.00 ? 29 PHE A CE1 12 
ATOM   8284  C  CE2 . PHE A 1 29 ? 1.101   1.000   -0.413  1.00 0.00 ? 29 PHE A CE2 12 
ATOM   8285  C  CZ  . PHE A 1 29 ? -0.279  0.813   -0.461  1.00 0.00 ? 29 PHE A CZ  12 
ATOM   8286  N  N   . ALA A 1 30 ? -1.174  6.307   -0.262  1.00 0.00 ? 30 ALA A N   12 
ATOM   8287  C  CA  . ALA A 1 30 ? -2.351  6.322   0.602   1.00 0.00 ? 30 ALA A CA  12 
ATOM   8288  C  C   . ALA A 1 30 ? -3.592  5.898   -0.147  1.00 0.00 ? 30 ALA A C   12 
ATOM   8289  O  O   . ALA A 1 30 ? -4.244  6.688   -0.842  1.00 0.00 ? 30 ALA A O   12 
ATOM   8290  C  CB  . ALA A 1 30 ? -2.469  7.730   1.209   1.00 0.00 ? 30 ALA A CB  12 
ATOM   8291  N  N   . VAL A 1 31 ? -4.003  4.486   0.031   1.00 0.00 ? 31 VAL A N   12 
ATOM   8292  C  CA  . VAL A 1 31 ? -5.205  3.931   -0.582  1.00 0.00 ? 31 VAL A CA  12 
ATOM   8293  C  C   . VAL A 1 31 ? -6.403  4.120   0.319   1.00 0.00 ? 31 VAL A C   12 
ATOM   8294  O  O   . VAL A 1 31 ? -6.614  3.346   1.271   1.00 0.00 ? 31 VAL A O   12 
ATOM   8295  C  CB  . VAL A 1 31 ? -4.978  2.396   -0.888  1.00 0.00 ? 31 VAL A CB  12 
ATOM   8296  C  CG1 . VAL A 1 31 ? -4.727  1.486   0.349   1.00 0.00 ? 31 VAL A CG1 12 
ATOM   8297  C  CG2 . VAL A 1 31 ? -6.134  1.716   -1.658  1.00 0.00 ? 31 VAL A CG2 12 
ATOM   8298  N  N   . ARG A 1 32 ? -7.286  5.276   0.052   1.00 0.00 ? 32 ARG A N   12 
ATOM   8299  C  CA  . ARG A 1 32 ? -8.373  5.634   0.964   1.00 0.00 ? 32 ARG A CA  12 
ATOM   8300  C  C   . ARG A 1 32 ? -9.635  4.868   0.645   1.00 0.00 ? 32 ARG A C   12 
ATOM   8301  O  O   . ARG A 1 32 ? -10.562 5.379   -0.004  1.00 0.00 ? 32 ARG A O   12 
ATOM   8302  C  CB  . ARG A 1 32 ? -8.606  7.167   0.897   1.00 0.00 ? 32 ARG A CB  12 
ATOM   8303  C  CG  . ARG A 1 32 ? -9.103  7.705   -0.471  1.00 0.00 ? 32 ARG A CG  12 
ATOM   8304  C  CD  . ARG A 1 32 ? -10.568 8.159   -0.424  1.00 0.00 ? 32 ARG A CD  12 
ATOM   8305  N  NE  . ARG A 1 32 ? -10.660 9.507   -1.037  1.00 0.00 ? 32 ARG A NE  12 
ATOM   8306  C  CZ  . ARG A 1 32 ? -11.192 9.805   -2.214  1.00 0.00 ? 32 ARG A CZ  12 
ATOM   8307  N  NH1 . ARG A 1 32 ? -11.717 8.934   -3.024  1.00 0.00 ? 32 ARG A NH1 12 
ATOM   8308  N  NH2 . ARG A 1 32 ? -11.186 11.041  -2.574  1.00 0.00 ? 32 ARG A NH2 12 
ATOM   8309  N  N   . THR A 1 33 ? -9.714  3.478   1.142   1.00 0.00 ? 33 THR A N   12 
ATOM   8310  C  CA  . THR A 1 33 ? -10.926 2.665   1.040   1.00 0.00 ? 33 THR A CA  12 
ATOM   8311  C  C   . THR A 1 33 ? -11.190 1.962   2.354   1.00 0.00 ? 33 THR A C   12 
ATOM   8312  O  O   . THR A 1 33 ? -12.286 2.015   2.927   1.00 0.00 ? 33 THR A O   12 
ATOM   8313  C  CB  . THR A 1 33 ? -10.801 1.634   -0.129  1.00 0.00 ? 33 THR A CB  12 
ATOM   8314  O  OG1 . THR A 1 33 ? -11.040 2.264   -1.381  1.00 0.00 ? 33 THR A OG1 12 
ATOM   8315  C  CG2 . THR A 1 33 ? -11.784 0.441   -0.106  1.00 0.00 ? 33 THR A CG2 12 
ATOM   8316  N  N   . THR A 1 34 ? -10.062 1.170   2.895   1.00 0.00 ? 34 THR A N   12 
ATOM   8317  C  CA  . THR A 1 34 ? -10.074 0.591   4.233   1.00 0.00 ? 34 THR A CA  12 
ATOM   8318  C  C   . THR A 1 34 ? -9.323  1.481   5.201   1.00 0.00 ? 34 THR A C   12 
ATOM   8319  O  O   . THR A 1 34 ? -9.419  1.340   6.428   1.00 0.00 ? 34 THR A O   12 
ATOM   8320  C  CB  . THR A 1 34 ? -9.459  -0.848  4.220   1.00 0.00 ? 34 THR A CB  12 
ATOM   8321  O  OG1 . THR A 1 34 ? -10.074 -1.646  3.218   1.00 0.00 ? 34 THR A OG1 12 
ATOM   8322  C  CG2 . THR A 1 34 ? -9.612  -1.671  5.518   1.00 0.00 ? 34 THR A CG2 12 
ATOM   8323  N  N   . GLY A 1 35 ? -8.456  2.516   4.595   1.00 0.00 ? 35 GLY A N   12 
ATOM   8324  C  CA  . GLY A 1 35 ? -7.802  3.553   5.387   1.00 0.00 ? 35 GLY A CA  12 
ATOM   8325  C  C   . GLY A 1 35 ? -6.412  3.131   5.802   1.00 0.00 ? 35 GLY A C   12 
ATOM   8326  O  O   . GLY A 1 35 ? -6.119  2.950   6.995   1.00 0.00 ? 35 GLY A O   12 
ATOM   8327  N  N   . ILE A 1 36 ? -5.411  2.966   4.725   1.00 0.00 ? 36 ILE A N   12 
ATOM   8328  C  CA  . ILE A 1 36 ? -4.011  2.673   5.017   1.00 0.00 ? 36 ILE A CA  12 
ATOM   8329  C  C   . ILE A 1 36 ? -3.082  3.516   4.179   1.00 0.00 ? 36 ILE A C   12 
ATOM   8330  O  O   . ILE A 1 36 ? -3.261  3.683   2.962   1.00 0.00 ? 36 ILE A O   12 
ATOM   8331  C  CB  . ILE A 1 36 ? -3.705  1.124   4.900   1.00 0.00 ? 36 ILE A CB  12 
ATOM   8332  C  CG1 . ILE A 1 36 ? -3.394  0.578   3.472   1.00 0.00 ? 36 ILE A CG1 12 
ATOM   8333  C  CG2 . ILE A 1 36 ? -4.848  0.244   5.509   1.00 0.00 ? 36 ILE A CG2 12 
ATOM   8334  C  CD1 . ILE A 1 36 ? -2.210  -0.408  3.370   1.00 0.00 ? 36 ILE A CD1 12 
ATOM   8335  N  N   . PHE A 1 37 ? -1.969  4.175   4.895   1.00 0.00 ? 37 PHE A N   12 
ATOM   8336  C  CA  . PHE A 1 37 ? -0.879  4.870   4.190   1.00 0.00 ? 37 PHE A CA  12 
ATOM   8337  C  C   . PHE A 1 37 ? 0.417   4.133   4.427   1.00 0.00 ? 37 PHE A C   12 
ATOM   8338  O  O   . PHE A 1 37 ? 0.923   4.111   5.581   1.00 0.00 ? 37 PHE A O   12 
ATOM   8339  C  CB  . PHE A 1 37 ? -0.788  6.343   4.685   1.00 0.00 ? 37 PHE A CB  12 
ATOM   8340  C  CG  . PHE A 1 37 ? 0.016   6.656   5.955   1.00 0.00 ? 37 PHE A CG  12 
ATOM   8341  C  CD1 . PHE A 1 37 ? 1.383   6.940   5.855   1.00 0.00 ? 37 PHE A CD1 12 
ATOM   8342  C  CD2 . PHE A 1 37 ? -0.611  6.724   7.202   1.00 0.00 ? 37 PHE A CD2 12 
ATOM   8343  C  CE1 . PHE A 1 37 ? 2.114   7.284   6.987   1.00 0.00 ? 37 PHE A CE1 12 
ATOM   8344  C  CE2 . PHE A 1 37 ? 0.120   7.077   8.333   1.00 0.00 ? 37 PHE A CE2 12 
ATOM   8345  C  CZ  . PHE A 1 37 ? 1.482   7.355   8.226   1.00 0.00 ? 37 PHE A CZ  12 
ATOM   8346  N  N   . CYS A 1 38 ? 1.066   3.399   3.322   1.00 0.00 ? 38 CYS A N   12 
ATOM   8347  C  CA  . CYS A 1 38 ? 2.198   2.503   3.537   1.00 0.00 ? 38 CYS A CA  12 
ATOM   8348  C  C   . CYS A 1 38 ? 3.381   2.860   2.675   1.00 0.00 ? 38 CYS A C   12 
ATOM   8349  O  O   . CYS A 1 38 ? 3.259   3.611   1.689   1.00 0.00 ? 38 CYS A O   12 
ATOM   8350  C  CB  . CYS A 1 38 ? 1.721   1.058   3.219   1.00 0.00 ? 38 CYS A CB  12 
ATOM   8351  S  SG  . CYS A 1 38 ? 2.914   -0.169  3.822   1.00 0.00 ? 38 CYS A SG  12 
ATOM   8352  N  N   . ARG A 1 39 ? 4.687   2.305   3.077   1.00 0.00 ? 39 ARG A N   12 
ATOM   8353  C  CA  . ARG A 1 39 ? 5.838   2.364   2.148   1.00 0.00 ? 39 ARG A CA  12 
ATOM   8354  C  C   . ARG A 1 39 ? 5.553   1.337   1.062   1.00 0.00 ? 39 ARG A C   12 
ATOM   8355  O  O   . ARG A 1 39 ? 5.541   0.127   1.318   1.00 0.00 ? 39 ARG A O   12 
ATOM   8356  C  CB  . ARG A 1 39 ? 7.167   2.189   2.911   1.00 0.00 ? 39 ARG A CB  12 
ATOM   8357  C  CG  . ARG A 1 39 ? 7.789   0.768   2.945   1.00 0.00 ? 39 ARG A CG  12 
ATOM   8358  C  CD  . ARG A 1 39 ? 7.146   -0.129  4.009   1.00 0.00 ? 39 ARG A CD  12 
ATOM   8359  N  NE  . ARG A 1 39 ? 6.727   -1.405  3.379   1.00 0.00 ? 39 ARG A NE  12 
ATOM   8360  C  CZ  . ARG A 1 39 ? 7.543   -2.339  2.909   1.00 0.00 ? 39 ARG A CZ  12 
ATOM   8361  N  NH1 . ARG A 1 39 ? 8.841   -2.257  2.931   1.00 0.00 ? 39 ARG A NH1 12 
ATOM   8362  N  NH2 . ARG A 1 39 ? 7.010   -3.393  2.401   1.00 0.00 ? 39 ARG A NH2 12 
ATOM   8363  N  N   . PRO A 1 40 ? 5.329   1.861   -0.294  1.00 0.00 ? 40 PRO A N   12 
ATOM   8364  C  CA  . PRO A 1 40 ? 4.939   1.072   -1.558  1.00 0.00 ? 40 PRO A CA  12 
ATOM   8365  C  C   . PRO A 1 40 ? 5.043   -0.428  -1.572  1.00 0.00 ? 40 PRO A C   12 
ATOM   8366  O  O   . PRO A 1 40 ? 5.753   -1.033  -2.387  1.00 0.00 ? 40 PRO A O   12 
ATOM   8367  C  CB  . PRO A 1 40 ? 5.774   1.729   -2.656  1.00 0.00 ? 40 PRO A CB  12 
ATOM   8368  C  CG  . PRO A 1 40 ? 5.595   3.211   -2.271  1.00 0.00 ? 40 PRO A CG  12 
ATOM   8369  C  CD  . PRO A 1 40 ? 5.419   3.276   -0.749  1.00 0.00 ? 40 PRO A CD  12 
ATOM   8370  N  N   . SER A 1 41 ? 4.205   -1.150  -0.582  1.00 0.00 ? 41 SER A N   12 
ATOM   8371  C  CA  . SER A 1 41 ? 4.050   -2.598  -0.573  1.00 0.00 ? 41 SER A CA  12 
ATOM   8372  C  C   . SER A 1 41 ? 3.161   -3.073  0.552   1.00 0.00 ? 41 SER A C   12 
ATOM   8373  O  O   . SER A 1 41 ? 3.470   -2.836  1.743   1.00 0.00 ? 41 SER A O   12 
ATOM   8374  C  CB  . SER A 1 41 ? 5.435   -3.305  -0.508  1.00 0.00 ? 41 SER A CB  12 
ATOM   8375  O  OG  . SER A 1 41 ? 5.495   -4.473  -1.333  1.00 0.00 ? 41 SER A OG  12 
ATOM   8376  N  N   . CYS A 1 42 ? 1.926   -3.818  0.229   1.00 0.00 ? 42 CYS A N   12 
ATOM   8377  C  CA  . CYS A 1 42 ? 1.148   -4.507  1.252   1.00 0.00 ? 42 CYS A CA  12 
ATOM   8378  C  C   . CYS A 1 42 ? 0.695   -5.862  0.729   1.00 0.00 ? 42 CYS A C   12 
ATOM   8379  O  O   . CYS A 1 42 ? 0.137   -5.986  -0.369  1.00 0.00 ? 42 CYS A O   12 
ATOM   8380  C  CB  . CYS A 1 42 ? -0.021  -3.682  1.810   1.00 0.00 ? 42 CYS A CB  12 
ATOM   8381  S  SG  . CYS A 1 42 ? 0.461   -2.024  2.326   1.00 0.00 ? 42 CYS A SG  12 
ATOM   8382  N  N   . ARG A 1 43 ? 0.992   -7.024  1.592   1.00 0.00 ? 43 ARG A N   12 
ATOM   8383  C  CA  . ARG A 1 43 ? 0.807   -8.406  1.164   1.00 0.00 ? 43 ARG A CA  12 
ATOM   8384  C  C   . ARG A 1 43 ? -0.645  -8.800  1.075   1.00 0.00 ? 43 ARG A C   12 
ATOM   8385  O  O   . ARG A 1 43 ? -0.998  -9.817  0.445   1.00 0.00 ? 43 ARG A O   12 
ATOM   8386  C  CB  . ARG A 1 43 ? 1.620   -9.325  2.122   1.00 0.00 ? 43 ARG A CB  12 
ATOM   8387  C  CG  . ARG A 1 43 ? 2.907   -8.669  2.691   1.00 0.00 ? 43 ARG A CG  12 
ATOM   8388  C  CD  . ARG A 1 43 ? 3.460   -9.407  3.916   1.00 0.00 ? 43 ARG A CD  12 
ATOM   8389  N  NE  . ARG A 1 43 ? 4.896   -9.059  4.061   1.00 0.00 ? 43 ARG A NE  12 
ATOM   8390  C  CZ  . ARG A 1 43 ? 5.868   -9.445  3.245   1.00 0.00 ? 43 ARG A CZ  12 
ATOM   8391  N  NH1 . ARG A 1 43 ? 5.691   -10.195 2.197   1.00 0.00 ? 43 ARG A NH1 12 
ATOM   8392  N  NH2 . ARG A 1 43 ? 7.061   -9.049  3.513   1.00 0.00 ? 43 ARG A NH2 12 
ATOM   8393  N  N   . ALA A 1 44 ? -1.637  -7.921  1.727   1.00 0.00 ? 44 ALA A N   12 
ATOM   8394  C  CA  . ALA A 1 44 ? -3.070  -8.100  1.536   1.00 0.00 ? 44 ALA A CA  12 
ATOM   8395  C  C   . ALA A 1 44 ? -3.442  -7.749  0.101   1.00 0.00 ? 44 ALA A C   12 
ATOM   8396  O  O   . ALA A 1 44 ? -2.593  -7.514  -0.767  1.00 0.00 ? 44 ALA A O   12 
ATOM   8397  C  CB  . ALA A 1 44 ? -3.803  -7.211  2.554   1.00 0.00 ? 44 ALA A CB  12 
ATOM   8398  N  N   . ARG A 1 45 ? -4.903  -7.760  -0.177  1.00 0.00 ? 45 ARG A N   12 
ATOM   8399  C  CA  . ARG A 1 45 ? -5.436  -7.279  -1.448  1.00 0.00 ? 45 ARG A CA  12 
ATOM   8400  C  C   . ARG A 1 45 ? -4.784  -5.961  -1.818  1.00 0.00 ? 45 ARG A C   12 
ATOM   8401  O  O   . ARG A 1 45 ? -5.203  -4.888  -1.361  1.00 0.00 ? 45 ARG A O   12 
ATOM   8402  C  CB  . ARG A 1 45 ? -6.977  -7.142  -1.347  1.00 0.00 ? 45 ARG A CB  12 
ATOM   8403  C  CG  . ARG A 1 45 ? -7.685  -8.242  -0.513  1.00 0.00 ? 45 ARG A CG  12 
ATOM   8404  C  CD  . ARG A 1 45 ? -7.350  -9.658  -0.997  1.00 0.00 ? 45 ARG A CD  12 
ATOM   8405  N  NE  . ARG A 1 45 ? -8.570  -10.495 -0.873  1.00 0.00 ? 45 ARG A NE  12 
ATOM   8406  C  CZ  . ARG A 1 45 ? -8.622  -11.810 -1.043  1.00 0.00 ? 45 ARG A CZ  12 
ATOM   8407  N  NH1 . ARG A 1 45 ? -7.599  -12.551 -1.351  1.00 0.00 ? 45 ARG A NH1 12 
ATOM   8408  N  NH2 . ARG A 1 45 ? -9.764  -12.382 -0.892  1.00 0.00 ? 45 ARG A NH2 12 
ATOM   8409  N  N   . HIS A 1 46 ? -3.609  -6.032  -2.713  1.00 0.00 ? 46 HIS A N   12 
ATOM   8410  C  CA  . HIS A 1 46 ? -2.772  -4.871  -2.993  1.00 0.00 ? 46 HIS A CA  12 
ATOM   8411  C  C   . HIS A 1 46 ? -3.599  -3.636  -3.253  1.00 0.00 ? 46 HIS A C   12 
ATOM   8412  O  O   . HIS A 1 46 ? -4.331  -3.535  -4.247  1.00 0.00 ? 46 HIS A O   12 
ATOM   8413  C  CB  . HIS A 1 46 ? -1.905  -5.219  -4.214  1.00 0.00 ? 46 HIS A CB  12 
ATOM   8414  C  CG  . HIS A 1 46 ? -0.525  -4.632  -4.106  1.00 0.00 ? 46 HIS A CG  12 
ATOM   8415  N  ND1 . HIS A 1 46 ? 0.654   -5.222  -4.554  1.00 0.00 ? 46 HIS A ND1 12 
ATOM   8416  C  CD2 . HIS A 1 46 ? -0.285  -3.395  -3.522  1.00 0.00 ? 46 HIS A CD2 12 
ATOM   8417  C  CE1 . HIS A 1 46 ? 1.537   -4.271  -4.194  1.00 0.00 ? 46 HIS A CE1 12 
ATOM   8418  N  NE2 . HIS A 1 46 ? 1.063   -3.154  -3.579  1.00 0.00 ? 46 HIS A NE2 12 
ATOM   8419  N  N   . ALA A 1 47 ? -3.517  -2.568  -2.230  1.00 0.00 ? 47 ALA A N   12 
ATOM   8420  C  CA  . ALA A 1 47 ? -4.131  -1.256  -2.395  1.00 0.00 ? 47 ALA A CA  12 
ATOM   8421  C  C   . ALA A 1 47 ? -4.142  -0.812  -3.838  1.00 0.00 ? 47 ALA A C   12 
ATOM   8422  O  O   . ALA A 1 47 ? -3.105  -0.476  -4.427  1.00 0.00 ? 47 ALA A O   12 
ATOM   8423  C  CB  . ALA A 1 47 ? -3.368  -0.274  -1.483  1.00 0.00 ? 47 ALA A CB  12 
ATOM   8424  N  N   . LEU A 1 48 ? -5.463  -0.793  -4.504  1.00 0.00 ? 48 LEU A N   12 
ATOM   8425  C  CA  . LEU A 1 48 ? -5.653  -0.232  -5.838  1.00 0.00 ? 48 LEU A CA  12 
ATOM   8426  C  C   . LEU A 1 48 ? -5.079  1.163   -5.924  1.00 0.00 ? 48 LEU A C   12 
ATOM   8427  O  O   . LEU A 1 48 ? -5.206  1.979   -5.001  1.00 0.00 ? 48 LEU A O   12 
ATOM   8428  C  CB  . LEU A 1 48 ? -7.160  -0.241  -6.223  1.00 0.00 ? 48 LEU A CB  12 
ATOM   8429  C  CG  . LEU A 1 48 ? -8.202  0.028   -5.103  1.00 0.00 ? 48 LEU A CG  12 
ATOM   8430  C  CD1 . LEU A 1 48 ? -9.147  1.161   -5.523  1.00 0.00 ? 48 LEU A CD1 12 
ATOM   8431  C  CD2 . LEU A 1 48 ? -9.021  -1.222  -4.738  1.00 0.00 ? 48 LEU A CD2 12 
ATOM   8432  N  N   . ARG A 1 49 ? -4.325  1.485   -7.155  1.00 0.00 ? 49 ARG A N   12 
ATOM   8433  C  CA  . ARG A 1 49 ? -3.776  2.811   -7.419  1.00 0.00 ? 49 ARG A CA  12 
ATOM   8434  C  C   . ARG A 1 49 ? -4.855  3.795   -7.804  1.00 0.00 ? 49 ARG A C   12 
ATOM   8435  O  O   . ARG A 1 49 ? -4.602  5.003   -7.953  1.00 0.00 ? 49 ARG A O   12 
ATOM   8436  C  CB  . ARG A 1 49 ? -2.708  2.689   -8.546  1.00 0.00 ? 49 ARG A CB  12 
ATOM   8437  C  CG  . ARG A 1 49 ? -2.842  3.734   -9.684  1.00 0.00 ? 49 ARG A CG  12 
ATOM   8438  C  CD  . ARG A 1 49 ? -1.837  3.513   -10.821 1.00 0.00 ? 49 ARG A CD  12 
ATOM   8439  N  NE  . ARG A 1 49 ? -2.125  4.498   -11.896 1.00 0.00 ? 49 ARG A NE  12 
ATOM   8440  C  CZ  . ARG A 1 49 ? -2.913  4.288   -12.942 1.00 0.00 ? 49 ARG A CZ  12 
ATOM   8441  N  NH1 . ARG A 1 49 ? -3.553  3.179   -13.168 1.00 0.00 ? 49 ARG A NH1 12 
ATOM   8442  N  NH2 . ARG A 1 49 ? -3.049  5.250   -13.784 1.00 0.00 ? 49 ARG A NH2 12 
ATOM   8443  N  N   . GLU A 1 50 ? -6.230  3.273   -7.951  1.00 0.00 ? 50 GLU A N   12 
ATOM   8444  C  CA  . GLU A 1 50 ? -7.311  4.071   -8.517  1.00 0.00 ? 50 GLU A CA  12 
ATOM   8445  C  C   . GLU A 1 50 ? -7.951  5.002   -7.517  1.00 0.00 ? 50 GLU A C   12 
ATOM   8446  O  O   . GLU A 1 50 ? -8.736  5.897   -7.900  1.00 0.00 ? 50 GLU A O   12 
ATOM   8447  C  CB  . GLU A 1 50 ? -8.364  3.103   -9.134  1.00 0.00 ? 50 GLU A CB  12 
ATOM   8448  C  CG  . GLU A 1 50 ? -9.348  2.389   -8.150  1.00 0.00 ? 50 GLU A CG  12 
ATOM   8449  C  CD  . GLU A 1 50 ? -9.959  1.052   -8.576  1.00 0.00 ? 50 GLU A CD  12 
ATOM   8450  O  OE1 . GLU A 1 50 ? -10.914 1.168   -9.540  1.00 0.00 ? 50 GLU A OE1 12 
ATOM   8451  O  OE2 . GLU A 1 50 ? -9.617  -0.020  -8.094  1.00 0.00 ? 50 GLU A OE2 12 
ATOM   8452  N  N   . ASN A 1 51 ? -7.597  4.851   -6.100  1.00 0.00 ? 51 ASN A N   12 
ATOM   8453  C  CA  . ASN A 1 51 ? -8.146  5.732   -5.034  1.00 0.00 ? 51 ASN A CA  12 
ATOM   8454  C  C   . ASN A 1 51 ? -6.976  6.159   -4.166  1.00 0.00 ? 51 ASN A C   12 
ATOM   8455  O  O   . ASN A 1 51 ? -7.123  6.559   -3.003  1.00 0.00 ? 51 ASN A O   12 
ATOM   8456  C  CB  . ASN A 1 51 ? -9.050  4.806   -4.179  1.00 0.00 ? 51 ASN A CB  12 
ATOM   8457  C  CG  . ASN A 1 51 ? -8.300  3.827   -3.245  1.00 0.00 ? 51 ASN A CG  12 
ATOM   8458  O  OD1 . ASN A 1 51 ? -7.609  2.917   -3.671  1.00 0.00 ? 51 ASN A OD1 12 
ATOM   8459  N  ND2 . ASN A 1 51 ? -8.446  3.984   -1.959  1.00 0.00 ? 51 ASN A ND2 12 
ATOM   8460  N  N   . VAL A 1 52 ? -5.640  6.005   -4.782  1.00 0.00 ? 52 VAL A N   12 
ATOM   8461  C  CA  . VAL A 1 52 ? -4.410  6.022   -3.995  1.00 0.00 ? 52 VAL A CA  12 
ATOM   8462  C  C   . VAL A 1 52 ? -3.786  7.392   -4.025  1.00 0.00 ? 52 VAL A C   12 
ATOM   8463  O  O   . VAL A 1 52 ? -3.934  8.117   -5.049  1.00 0.00 ? 52 VAL A O   12 
ATOM   8464  C  CB  . VAL A 1 52 ? -3.419  4.913   -4.537  1.00 0.00 ? 52 VAL A CB  12 
ATOM   8465  C  CG1 . VAL A 1 52 ? -2.344  5.375   -5.556  1.00 0.00 ? 52 VAL A CG1 12 
ATOM   8466  C  CG2 . VAL A 1 52 ? -2.641  4.178   -3.417  1.00 0.00 ? 52 VAL A CG2 12 
ATOM   8467  N  N   . SER A 1 53 ? -2.980  7.872   -2.884  1.00 0.00 ? 53 SER A N   12 
ATOM   8468  C  CA  . SER A 1 53 ? -2.310  9.175   -2.902  1.00 0.00 ? 53 SER A CA  12 
ATOM   8469  C  C   . SER A 1 53 ? -0.874  9.077   -2.450  1.00 0.00 ? 53 SER A C   12 
ATOM   8470  O  O   . SER A 1 53 ? -0.545  8.409   -1.459  1.00 0.00 ? 53 SER A O   12 
ATOM   8471  C  CB  . SER A 1 53 ? -3.107  10.211  -2.072  1.00 0.00 ? 53 SER A CB  12 
ATOM   8472  O  OG  . SER A 1 53 ? -2.540  11.526  -2.128  1.00 0.00 ? 53 SER A OG  12 
ATOM   8473  N  N   . PHE A 1 54 ? 0.124   9.851   -3.228  1.00 0.00 ? 54 PHE A N   12 
ATOM   8474  C  CA  . PHE A 1 54 ? 1.556   9.713   -2.990  1.00 0.00 ? 54 PHE A CA  12 
ATOM   8475  C  C   . PHE A 1 54 ? 2.125   10.916  -2.265  1.00 0.00 ? 54 PHE A C   12 
ATOM   8476  O  O   . PHE A 1 54 ? 1.862   12.085  -2.579  1.00 0.00 ? 54 PHE A O   12 
ATOM   8477  C  CB  . PHE A 1 54 ? 2.336   9.521   -4.323  1.00 0.00 ? 54 PHE A CB  12 
ATOM   8478  C  CG  . PHE A 1 54 ? 1.723   8.617   -5.404  1.00 0.00 ? 54 PHE A CG  12 
ATOM   8479  C  CD1 . PHE A 1 54 ? 1.044   7.450   -5.037  1.00 0.00 ? 54 PHE A CD1 12 
ATOM   8480  C  CD2 . PHE A 1 54 ? 1.853   8.940   -6.758  1.00 0.00 ? 54 PHE A CD2 12 
ATOM   8481  C  CE1 . PHE A 1 54 ? 0.497   6.620   -6.010  1.00 0.00 ? 54 PHE A CE1 12 
ATOM   8482  C  CE2 . PHE A 1 54 ? 1.305   8.108   -7.731  1.00 0.00 ? 54 PHE A CE2 12 
ATOM   8483  C  CZ  . PHE A 1 54 ? 0.628   6.949   -7.357  1.00 0.00 ? 54 PHE A CZ  12 
ATOM   8484  N  N   . TYR A 1 55 ? 3.059   10.611  -1.162  1.00 0.00 ? 55 TYR A N   12 
ATOM   8485  C  CA  . TYR A 1 55 ? 3.845   11.602  -0.415  1.00 0.00 ? 55 TYR A CA  12 
ATOM   8486  C  C   . TYR A 1 55 ? 5.315   11.260  -0.485  1.00 0.00 ? 55 TYR A C   12 
ATOM   8487  O  O   . TYR A 1 55 ? 5.692   10.152  -0.967  1.00 0.00 ? 55 TYR A O   12 
ATOM   8488  C  CB  . TYR A 1 55 ? 3.399   11.570  1.077   1.00 0.00 ? 55 TYR A CB  12 
ATOM   8489  C  CG  . TYR A 1 55 ? 1.900   11.277  1.315   1.00 0.00 ? 55 TYR A CG  12 
ATOM   8490  C  CD1 . TYR A 1 55 ? 1.409   9.979   1.461   1.00 0.00 ? 55 TYR A CD1 12 
ATOM   8491  C  CD2 . TYR A 1 55 ? 1.012   12.368  1.392   1.00 0.00 ? 55 TYR A CD2 12 
ATOM   8492  C  CE1 . TYR A 1 55 ? 0.051   9.767   1.680   1.00 0.00 ? 55 TYR A CE1 12 
ATOM   8493  C  CE2 . TYR A 1 55 ? -0.345  12.145  1.610   1.00 0.00 ? 55 TYR A CE2 12 
ATOM   8494  C  CZ  . TYR A 1 55 ? -0.823  10.847  1.756   1.00 0.00 ? 55 TYR A CZ  12 
ATOM   8495  O  OH  . TYR A 1 55 ? -2.155  10.635  1.972   1.00 0.00 ? 55 TYR A OH  12 
ATOM   8496  N  N   . ALA A 1 56 ? 6.349   12.225  -0.050  1.00 0.00 ? 56 ALA A N   12 
ATOM   8497  C  CA  . ALA A 1 56 ? 7.764   11.872  0.096   1.00 0.00 ? 56 ALA A CA  12 
ATOM   8498  C  C   . ALA A 1 56 ? 8.070   11.208  1.417   1.00 0.00 ? 56 ALA A C   12 
ATOM   8499  O  O   . ALA A 1 56 ? 9.064   10.455  1.531   1.00 0.00 ? 56 ALA A O   12 
ATOM   8500  C  CB  . ALA A 1 56 ? 8.582   13.158  -0.123  1.00 0.00 ? 56 ALA A CB  12 
ATOM   8501  N  N   . ASN A 1 57 ? 7.200   11.498  2.578   1.00 0.00 ? 57 ASN A N   12 
ATOM   8502  C  CA  . ASN A 1 57 ? 7.435   10.895  3.887   1.00 0.00 ? 57 ASN A CA  12 
ATOM   8503  C  C   . ASN A 1 57 ? 6.152   10.611  4.631   1.00 0.00 ? 57 ASN A C   12 
ATOM   8504  O  O   . ASN A 1 57 ? 5.097   11.212  4.387   1.00 0.00 ? 57 ASN A O   12 
ATOM   8505  C  CB  . ASN A 1 57 ? 8.369   11.807  4.735   1.00 0.00 ? 57 ASN A CB  12 
ATOM   8506  C  CG  . ASN A 1 57 ? 8.865   11.235  6.069   1.00 0.00 ? 57 ASN A CG  12 
ATOM   8507  O  OD1 . ASN A 1 57 ? 8.821   11.870  7.112   1.00 0.00 ? 57 ASN A OD1 12 
ATOM   8508  N  ND2 . ASN A 1 57 ? 9.335   10.017  6.092   1.00 0.00 ? 57 ASN A ND2 12 
ATOM   8509  N  N   . ALA A 1 58 ? 6.237   9.576   5.690   1.00 0.00 ? 58 ALA A N   12 
ATOM   8510  C  CA  . ALA A 1 58 ? 5.128   9.273   6.587   1.00 0.00 ? 58 ALA A CA  12 
ATOM   8511  C  C   . ALA A 1 58 ? 4.813   10.414  7.524   1.00 0.00 ? 58 ALA A C   12 
ATOM   8512  O  O   . ALA A 1 58 ? 3.741   10.440  8.161   1.00 0.00 ? 58 ALA A O   12 
ATOM   8513  C  CB  . ALA A 1 58 ? 5.474   7.973   7.337   1.00 0.00 ? 58 ALA A CB  12 
ATOM   8514  N  N   . SER A 1 59 ? 5.828   11.476  7.690   1.00 0.00 ? 59 SER A N   12 
ATOM   8515  C  CA  . SER A 1 59 ? 5.551   12.690  8.457   1.00 0.00 ? 59 SER A CA  12 
ATOM   8516  C  C   . SER A 1 59 ? 4.401   13.456  7.847   1.00 0.00 ? 59 SER A C   12 
ATOM   8517  O  O   . SER A 1 59 ? 3.593   14.085  8.544   1.00 0.00 ? 59 SER A O   12 
ATOM   8518  C  CB  . SER A 1 59 ? 6.817   13.571  8.592   1.00 0.00 ? 59 SER A CB  12 
ATOM   8519  O  OG  . SER A 1 59 ? 6.840   14.332  9.805   1.00 0.00 ? 59 SER A OG  12 
ATOM   8520  N  N   . GLU A 1 60 ? 4.319   13.442  6.369   1.00 0.00 ? 60 GLU A N   12 
ATOM   8521  C  CA  . GLU A 1 60 ? 3.243   14.109  5.642   1.00 0.00 ? 60 GLU A CA  12 
ATOM   8522  C  C   . GLU A 1 60 ? 1.934   13.368  5.777   1.00 0.00 ? 60 GLU A C   12 
ATOM   8523  O  O   . GLU A 1 60 ? 0.914   13.926  6.209   1.00 0.00 ? 60 GLU A O   12 
ATOM   8524  C  CB  . GLU A 1 60 ? 3.664   14.246  4.151   1.00 0.00 ? 60 GLU A CB  12 
ATOM   8525  C  CG  . GLU A 1 60 ? 2.523   14.218  3.081   1.00 0.00 ? 60 GLU A CG  12 
ATOM   8526  C  CD  . GLU A 1 60 ? 2.282   15.479  2.246   1.00 0.00 ? 60 GLU A CD  12 
ATOM   8527  O  OE1 . GLU A 1 60 ? 3.397   15.935  1.610   1.00 0.00 ? 60 GLU A OE1 12 
ATOM   8528  O  OE2 . GLU A 1 60 ? 1.190   16.024  2.161   1.00 0.00 ? 60 GLU A OE2 12 
ATOM   8529  N  N   . ALA A 1 61 ? 1.913   11.957  5.328   1.00 0.00 ? 61 ALA A N   12 
ATOM   8530  C  CA  . ALA A 1 61 ? 0.720   11.128  5.453   1.00 0.00 ? 61 ALA A CA  12 
ATOM   8531  C  C   . ALA A 1 61 ? 0.200   11.040  6.868   1.00 0.00 ? 61 ALA A C   12 
ATOM   8532  O  O   . ALA A 1 61 ? -1.009  10.793  7.082   1.00 0.00 ? 61 ALA A O   12 
ATOM   8533  C  CB  . ALA A 1 61 ? 1.039   9.750   4.849   1.00 0.00 ? 61 ALA A CB  12 
ATOM   8534  N  N   . LEU A 1 62 ? 1.150   11.206  7.987   1.00 0.00 ? 62 LEU A N   12 
ATOM   8535  C  CA  . LEU A 1 62 ? 0.692   11.303  9.376   1.00 0.00 ? 62 LEU A CA  12 
ATOM   8536  C  C   . LEU A 1 62 ? 0.098   12.666  9.641   1.00 0.00 ? 62 LEU A C   12 
ATOM   8537  O  O   . LEU A 1 62 ? -0.985  12.802  10.228  1.00 0.00 ? 62 LEU A O   12 
ATOM   8538  C  CB  . LEU A 1 62 ? 1.849   10.986  10.363  1.00 0.00 ? 62 LEU A CB  12 
ATOM   8539  C  CG  . LEU A 1 62 ? 1.480   10.469  11.781  1.00 0.00 ? 62 LEU A CG  12 
ATOM   8540  C  CD1 . LEU A 1 62 ? 1.662   11.590  12.814  1.00 0.00 ? 62 LEU A CD1 12 
ATOM   8541  C  CD2 . LEU A 1 62 ? 0.045   9.922   11.859  1.00 0.00 ? 62 LEU A CD2 12 
ATOM   8542  N  N   . ALA A 1 63 ? 0.901   13.826  9.199   1.00 0.00 ? 63 ALA A N   12 
ATOM   8543  C  CA  . ALA A 1 63 ? 0.379   15.190  9.231   1.00 0.00 ? 63 ALA A CA  12 
ATOM   8544  C  C   . ALA A 1 63 ? -0.956  15.277  8.531   1.00 0.00 ? 63 ALA A C   12 
ATOM   8545  O  O   . ALA A 1 63 ? -1.787  16.151  8.820   1.00 0.00 ? 63 ALA A O   12 
ATOM   8546  C  CB  . ALA A 1 63 ? 1.438   16.119  8.611   1.00 0.00 ? 63 ALA A CB  12 
ATOM   8547  N  N   . ALA A 1 64 ? -1.240  14.242  7.511   1.00 0.00 ? 64 ALA A N   12 
ATOM   8548  C  CA  . ALA A 1 64 ? -2.555  14.118  6.889   1.00 0.00 ? 64 ALA A CA  12 
ATOM   8549  C  C   . ALA A 1 64 ? -3.556  13.615  7.914   1.00 0.00 ? 64 ALA A C   12 
ATOM   8550  O  O   . ALA A 1 64 ? -4.703  14.068  8.005   1.00 0.00 ? 64 ALA A O   12 
ATOM   8551  C  CB  . ALA A 1 64 ? -2.420  13.179  5.680   1.00 0.00 ? 64 ALA A CB  12 
ATOM   8552  N  N   . GLY A 1 65 ? -3.036  12.560  8.820   1.00 0.00 ? 65 GLY A N   12 
ATOM   8553  C  CA  . GLY A 1 65 ? -3.816  12.059  9.949   1.00 0.00 ? 65 GLY A CA  12 
ATOM   8554  C  C   . GLY A 1 65 ? -4.361  10.679  9.621   1.00 0.00 ? 65 GLY A C   12 
ATOM   8555  O  O   . GLY A 1 65 ? -5.446  10.269  10.051  1.00 0.00 ? 65 GLY A O   12 
ATOM   8556  N  N   . PHE A 1 66 ? -3.515  9.875   8.713   1.00 0.00 ? 66 PHE A N   12 
ATOM   8557  C  CA  . PHE A 1 66 ? -3.946  8.600   8.147   1.00 0.00 ? 66 PHE A CA  12 
ATOM   8558  C  C   . PHE A 1 66 ? -3.406  7.433   8.938   1.00 0.00 ? 66 PHE A C   12 
ATOM   8559  O  O   . PHE A 1 66 ? -2.891  7.616   10.070  1.00 0.00 ? 66 PHE A O   12 
ATOM   8560  C  CB  . PHE A 1 66 ? -3.455  8.513   6.666   1.00 0.00 ? 66 PHE A CB  12 
ATOM   8561  C  CG  . PHE A 1 66 ? -4.254  7.576   5.750   1.00 0.00 ? 66 PHE A CG  12 
ATOM   8562  C  CD1 . PHE A 1 66 ? -5.580  7.265   6.086   1.00 0.00 ? 66 PHE A CD1 12 
ATOM   8563  C  CD2 . PHE A 1 66 ? -3.680  7.011   4.609   1.00 0.00 ? 66 PHE A CD2 12 
ATOM   8564  C  CE1 . PHE A 1 66 ? -6.321  6.404   5.286   1.00 0.00 ? 66 PHE A CE1 12 
ATOM   8565  C  CE2 . PHE A 1 66 ? -4.425  6.148   3.809   1.00 0.00 ? 66 PHE A CE2 12 
ATOM   8566  C  CZ  . PHE A 1 66 ? -5.742  5.844   4.149   1.00 0.00 ? 66 PHE A CZ  12 
ATOM   8567  N  N   . ARG A 1 67 ? -3.527  6.070   8.378   1.00 0.00 ? 67 ARG A N   12 
ATOM   8568  C  CA  . ARG A 1 67 ? -3.089  4.891   9.128   1.00 0.00 ? 67 ARG A CA  12 
ATOM   8569  C  C   . ARG A 1 67 ? -1.690  4.475   8.747   1.00 0.00 ? 67 ARG A C   12 
ATOM   8570  O  O   . ARG A 1 67 ? -1.440  3.928   7.665   1.00 0.00 ? 67 ARG A O   12 
ATOM   8571  C  CB  . ARG A 1 67 ? -4.112  3.737   8.957   1.00 0.00 ? 67 ARG A CB  12 
ATOM   8572  C  CG  . ARG A 1 67 ? -4.175  2.749   10.155  1.00 0.00 ? 67 ARG A CG  12 
ATOM   8573  C  CD  . ARG A 1 67 ? -2.901  2.786   11.009  1.00 0.00 ? 67 ARG A CD  12 
ATOM   8574  N  NE  . ARG A 1 67 ? -3.284  2.966   12.433  1.00 0.00 ? 67 ARG A NE  12 
ATOM   8575  C  CZ  . ARG A 1 67 ? -3.841  2.042   13.203  1.00 0.00 ? 67 ARG A CZ  12 
ATOM   8576  N  NH1 . ARG A 1 67 ? -4.138  0.839   12.809  1.00 0.00 ? 67 ARG A NH1 12 
ATOM   8577  N  NH2 . ARG A 1 67 ? -4.102  2.363   14.421  1.00 0.00 ? 67 ARG A NH2 12 
ATOM   8578  N  N   . PRO A 1 68 ? -0.636  4.733   9.753   1.00 0.00 ? 68 PRO A N   12 
ATOM   8579  C  CA  . PRO A 1 68 ? 0.857   4.433   9.632   1.00 0.00 ? 68 PRO A CA  12 
ATOM   8580  C  C   . PRO A 1 68 ? 1.190   2.983   9.342   1.00 0.00 ? 68 PRO A C   12 
ATOM   8581  O  O   . PRO A 1 68 ? 1.117   2.124   10.243  1.00 0.00 ? 68 PRO A O   12 
ATOM   8582  C  CB  . PRO A 1 68 ? 1.506   4.807   10.963  1.00 0.00 ? 68 PRO A CB  12 
ATOM   8583  C  CG  . PRO A 1 68 ? 0.320   4.800   11.938  1.00 0.00 ? 68 PRO A CG  12 
ATOM   8584  C  CD  . PRO A 1 68 ? -0.838  5.346   11.094  1.00 0.00 ? 68 PRO A CD  12 
ATOM   8585  N  N   . CYS A 1 69 ? 1.613   2.619   7.974   1.00 0.00 ? 69 CYS A N   12 
ATOM   8586  C  CA  . CYS A 1 69 ? 1.909   1.245   7.558   1.00 0.00 ? 69 CYS A CA  12 
ATOM   8587  C  C   . CYS A 1 69 ? 3.384   1.117   7.229   1.00 0.00 ? 69 CYS A C   12 
ATOM   8588  O  O   . CYS A 1 69 ? 3.898   1.521   6.177   1.00 0.00 ? 69 CYS A O   12 
ATOM   8589  C  CB  . CYS A 1 69 ? 0.941   0.885   6.418   1.00 0.00 ? 69 CYS A CB  12 
ATOM   8590  S  SG  . CYS A 1 69 ? 0.576   -0.870  6.250   1.00 0.00 ? 69 CYS A SG  12 
ATOM   8591  N  N   . LYS A 1 70 ? 4.213   0.499   8.309   1.00 0.00 ? 70 LYS A N   12 
ATOM   8592  C  CA  . LYS A 1 70 ? 5.655   0.313   8.203   1.00 0.00 ? 70 LYS A CA  12 
ATOM   8593  C  C   . LYS A 1 70 ? 5.965   -1.041  7.603   1.00 0.00 ? 70 LYS A C   12 
ATOM   8594  O  O   . LYS A 1 70 ? 6.118   -1.168  6.372   1.00 0.00 ? 70 LYS A O   12 
ATOM   8595  C  CB  . LYS A 1 70 ? 6.325   0.479   9.593   1.00 0.00 ? 70 LYS A CB  12 
ATOM   8596  C  CG  . LYS A 1 70 ? 5.464   -0.037  10.772  1.00 0.00 ? 70 LYS A CG  12 
ATOM   8597  C  CD  . LYS A 1 70 ? 4.689   1.046   11.528  1.00 0.00 ? 70 LYS A CD  12 
ATOM   8598  C  CE  . LYS A 1 70 ? 4.724   0.736   13.031  1.00 0.00 ? 70 LYS A CE  12 
ATOM   8599  N  NZ  . LYS A 1 70 ? 3.754   -0.331  13.334  1.00 0.00 ? 70 LYS A NZ  12 
ATOM   8600  N  N   . ARG A 1 71 ? 6.049   -2.197  8.519   1.00 0.00 ? 71 ARG A N   12 
ATOM   8601  C  CA  . ARG A 1 71 ? 6.132   -3.571  7.988   1.00 0.00 ? 71 ARG A CA  12 
ATOM   8602  C  C   . ARG A 1 71 ? 4.893   -3.805  7.143   1.00 0.00 ? 71 ARG A C   12 
ATOM   8603  O  O   . ARG A 1 71 ? 4.934   -3.854  5.909   1.00 0.00 ? 71 ARG A O   12 
ATOM   8604  C  CB  . ARG A 1 71 ? 6.238   -4.560  9.171   1.00 0.00 ? 71 ARG A CB  12 
ATOM   8605  C  CG  . ARG A 1 71 ? 7.022   -5.870  8.884   1.00 0.00 ? 71 ARG A CG  12 
ATOM   8606  C  CD  . ARG A 1 71 ? 7.587   -6.507  10.160  1.00 0.00 ? 71 ARG A CD  12 
ATOM   8607  N  NE  . ARG A 1 71 ? 6.488   -7.224  10.855  1.00 0.00 ? 71 ARG A NE  12 
ATOM   8608  C  CZ  . ARG A 1 71 ? 6.629   -8.313  11.601  1.00 0.00 ? 71 ARG A CZ  12 
ATOM   8609  N  NH1 . ARG A 1 71 ? 7.763   -8.908  11.822  1.00 0.00 ? 71 ARG A NH1 12 
ATOM   8610  N  NH2 . ARG A 1 71 ? 5.570   -8.805  12.137  1.00 0.00 ? 71 ARG A NH2 12 
ATOM   8611  N  N   . CYS A 1 72 ? 3.629   -3.932  7.902   1.00 0.00 ? 72 CYS A N   12 
ATOM   8612  C  CA  . CYS A 1 72 ? 2.316   -3.926  7.278   1.00 0.00 ? 72 CYS A CA  12 
ATOM   8613  C  C   . CYS A 1 72 ? 1.223   -4.103  8.314   1.00 0.00 ? 72 CYS A C   12 
ATOM   8614  O  O   . CYS A 1 72 ? 0.480   -5.094  8.320   1.00 0.00 ? 72 CYS A O   12 
ATOM   8615  C  CB  . CYS A 1 72 ? 2.256   -4.959  6.136   1.00 0.00 ? 72 CYS A CB  12 
ATOM   8616  S  SG  . CYS A 1 72 ? 2.190   -4.129  4.530   1.00 0.00 ? 72 CYS A SG  12 
ATOM   8617  N  N   . GLN A 1 73 ? 1.122   -3.046  9.335   1.00 0.00 ? 73 GLN A N   12 
ATOM   8618  C  CA  . GLN A 1 73 ? 0.239   -3.139  10.517  1.00 0.00 ? 73 GLN A CA  12 
ATOM   8619  C  C   . GLN A 1 73 ? -1.091  -3.754  10.194  1.00 0.00 ? 73 GLN A C   12 
ATOM   8620  O  O   . GLN A 1 73 ? -1.700  -3.502  9.147   1.00 0.00 ? 73 GLN A O   12 
ATOM   8621  C  CB  . GLN A 1 73 ? 0.062   -1.708  11.100  1.00 0.00 ? 73 GLN A CB  12 
ATOM   8622  C  CG  . GLN A 1 73 ? -0.956  -1.573  12.279  1.00 0.00 ? 73 GLN A CG  12 
ATOM   8623  C  CD  . GLN A 1 73 ? -0.434  -1.554  13.721  1.00 0.00 ? 73 GLN A CD  12 
ATOM   8624  O  OE1 . GLN A 1 73 ? -0.597  -2.508  14.464  1.00 0.00 ? 73 GLN A OE1 12 
ATOM   8625  N  NE2 . GLN A 1 73 ? 0.207   -0.505  14.170  1.00 0.00 ? 73 GLN A NE2 12 
ATOM   8626  N  N   . PRO A 1 74 ? -1.626  -4.711  11.193  1.00 0.00 ? 74 PRO A N   12 
ATOM   8627  C  CA  . PRO A 1 74 ? -2.960  -5.459  11.117  1.00 0.00 ? 74 PRO A CA  12 
ATOM   8628  C  C   . PRO A 1 74 ? -4.174  -4.615  11.449  1.00 0.00 ? 74 PRO A C   12 
ATOM   8629  O  O   . PRO A 1 74 ? -4.096  -3.381  11.538  1.00 0.00 ? 74 PRO A O   12 
ATOM   8630  C  CB  . PRO A 1 74 ? -2.861  -6.588  12.137  1.00 0.00 ? 74 PRO A CB  12 
ATOM   8631  C  CG  . PRO A 1 74 ? -2.029  -5.907  13.236  1.00 0.00 ? 74 PRO A CG  12 
ATOM   8632  C  CD  . PRO A 1 74 ? -0.969  -5.122  12.457  1.00 0.00 ? 74 PRO A CD  12 
ATOM   8633  N  N   . ASP A 1 75 ? -5.440  -5.337  11.697  1.00 0.00 ? 75 ASP A N   12 
ATOM   8634  C  CA  . ASP A 1 75 ? -6.659  -4.642  12.103  1.00 0.00 ? 75 ASP A CA  12 
ATOM   8635  C  C   . ASP A 1 75 ? -6.589  -4.234  13.557  1.00 0.00 ? 75 ASP A C   12 
ATOM   8636  O  O   . ASP A 1 75 ? -6.135  -3.136  13.906  1.00 0.00 ? 75 ASP A O   12 
ATOM   8637  C  CB  . ASP A 1 75 ? -7.901  -5.523  11.811  1.00 0.00 ? 75 ASP A CB  12 
ATOM   8638  C  CG  . ASP A 1 75 ? -9.200  -4.786  11.452  1.00 0.00 ? 75 ASP A CG  12 
ATOM   8639  O  OD1 . ASP A 1 75 ? -9.950  -4.311  12.291  1.00 0.00 ? 75 ASP A OD1 12 
ATOM   8640  O  OD2 . ASP A 1 75 ? -9.406  -4.703  10.103  1.00 0.00 ? 75 ASP A OD2 12 
ATOM   8641  N  N   . LYS A 1 76 ? -7.069  -5.232  14.537  1.00 0.00 ? 76 LYS A N   12 
ATOM   8642  C  CA  . LYS A 1 76 ? -7.005  -5.003  15.982  1.00 0.00 ? 76 LYS A CA  12 
ATOM   8643  C  C   . LYS A 1 76 ? -5.938  -5.871  16.607  1.00 0.00 ? 76 LYS A C   12 
ATOM   8644  O  O   . LYS A 1 76 ? -4.744  -5.511  16.607  1.00 0.00 ? 76 LYS A O   12 
ATOM   8645  C  CB  . LYS A 1 76 ? -8.405  -5.261  16.600  1.00 0.00 ? 76 LYS A CB  12 
ATOM   8646  C  CG  . LYS A 1 76 ? -8.505  -4.892  18.101  1.00 0.00 ? 76 LYS A CG  12 
ATOM   8647  C  CD  . LYS A 1 76 ? -9.890  -4.425  18.557  1.00 0.00 ? 76 LYS A CD  12 
ATOM   8648  C  CE  . LYS A 1 76 ? -9.759  -3.682  19.894  1.00 0.00 ? 76 LYS A CE  12 
ATOM   8649  N  NZ  . LYS A 1 76 ? -9.164  -2.354  19.660  1.00 0.00 ? 76 LYS A NZ  12 
ATOM   8650  N  N   . ALA A 1 77 ? -6.363  -7.116  17.277  1.00 0.00 ? 77 ALA A N   12 
ATOM   8651  C  CA  . ALA A 1 77 ? -5.432  -8.149  17.733  1.00 0.00 ? 77 ALA A CA  12 
ATOM   8652  C  C   . ALA A 1 77 ? -4.389  -8.498  16.704  1.00 0.00 ? 77 ALA A C   12 
ATOM   8653  O  O   . ALA A 1 77 ? -4.231  -7.869  15.649  1.00 0.00 ? 77 ALA A O   12 
ATOM   8654  C  CB  . ALA A 1 77 ? -6.269  -9.391  18.141  1.00 0.00 ? 77 ALA A CB  12 
ATOM   8655  N  N   . ASN A 1 78 ? -3.574  -9.710  16.997  1.00 0.00 ? 78 ASN A N   12 
ATOM   8656  C  CA  . ASN A 1 78 ? -2.646  -10.269 16.020  1.00 0.00 ? 78 ASN A CA  12 
ATOM   8657  C  C   . ASN A 1 78 ? -3.105  -11.599 15.476  1.00 0.00 ? 78 ASN A C   12 
ATOM   8658  O  O   . ASN A 1 78 ? -2.309  -12.530 15.273  1.00 0.00 ? 78 ASN A O   12 
ATOM   8659  C  CB  . ASN A 1 78 ? -1.235  -10.402 16.669  1.00 0.00 ? 78 ASN A CB  12 
ATOM   8660  C  CG  . ASN A 1 78 ? -1.039  -11.537 17.679  1.00 0.00 ? 78 ASN A CG  12 
ATOM   8661  O  OD1 . ASN A 1 78 ? -0.588  -12.627 17.359  1.00 0.00 ? 78 ASN A OD1 12 
ATOM   8662  N  ND2 . ASN A 1 78 ? -1.365  -11.331 18.927  1.00 0.00 ? 78 ASN A ND2 12 
ATOM   8663  N  N   . PRO A 1 79 ? -4.549  -11.739 15.202  1.00 0.00 ? 79 PRO A N   12 
ATOM   8664  C  CA  . PRO A 1 79 ? -5.261  -12.977 14.635  1.00 0.00 ? 79 PRO A CA  12 
ATOM   8665  C  C   . PRO A 1 79 ? -5.401  -12.987 13.130  1.00 0.00 ? 79 PRO A C   12 
ATOM   8666  O  O   . PRO A 1 79 ? -6.074  -12.105 12.553  1.00 0.00 ? 79 PRO A O   12 
ATOM   8667  C  CB  . PRO A 1 79 ? -6.663  -12.924 15.246  1.00 0.00 ? 79 PRO A CB  12 
ATOM   8668  C  CG  . PRO A 1 79 ? -6.951  -11.418 15.213  1.00 0.00 ? 79 PRO A CG  12 
ATOM   8669  C  CD  . PRO A 1 79 ? -5.604  -10.721 15.416  1.00 0.00 ? 79 PRO A CD  12 
ATOM   8670  N  N   . ARG A 1 80 ? -4.694  -14.025 12.352  1.00 0.00 ? 80 ARG A N   12 
ATOM   8671  C  CA  . ARG A 1 80 ? -4.919  -14.212 10.916  1.00 0.00 ? 80 ARG A CA  12 
ATOM   8672  C  C   . ARG A 1 80 ? -6.104  -15.109 10.655  1.00 0.00 ? 80 ARG A C   12 
ATOM   8673  O  O   . ARG A 1 80 ? -6.001  -16.140 9.970   1.00 0.00 ? 80 ARG A O   12 
ATOM   8674  C  CB  . ARG A 1 80 ? -3.621  -14.784 10.281  1.00 0.00 ? 80 ARG A CB  12 
ATOM   8675  C  CG  . ARG A 1 80 ? -3.256  -14.187 8.896   1.00 0.00 ? 80 ARG A CG  12 
ATOM   8676  C  CD  . ARG A 1 80 ? -1.820  -13.651 8.844   1.00 0.00 ? 80 ARG A CD  12 
ATOM   8677  N  NE  . ARG A 1 80 ? -1.768  -12.547 7.852   1.00 0.00 ? 80 ARG A NE  12 
ATOM   8678  C  CZ  . ARG A 1 80 ? -0.838  -11.603 7.798   1.00 0.00 ? 80 ARG A CZ  12 
ATOM   8679  N  NH1 . ARG A 1 80 ? 0.166   -11.515 8.619   1.00 0.00 ? 80 ARG A NH1 12 
ATOM   8680  N  NH2 . ARG A 1 80 ? -0.943  -10.719 6.870   1.00 0.00 ? 80 ARG A NH2 12 
ATOM   8681  N  N   . GLN A 1 81 ? -7.384  -14.723 11.286  1.00 0.00 ? 81 GLN A N   12 
ATOM   8682  C  CA  . GLN A 1 81 ? -8.611  -15.491 11.090  1.00 0.00 ? 81 GLN A CA  12 
ATOM   8683  C  C   . GLN A 1 81 ? -8.766  -15.905 9.645   1.00 0.00 ? 81 GLN A C   12 
ATOM   8684  O  O   . GLN A 1 81 ? -9.116  -15.101 8.771   1.00 0.00 ? 81 GLN A O   12 
ATOM   8685  C  CB  . GLN A 1 81 ? -9.810  -14.636 11.552  1.00 0.00 ? 81 GLN A CB  12 
ATOM   8686  C  CG  . GLN A 1 81 ? -9.828  -14.226 13.062  1.00 0.00 ? 81 GLN A CG  12 
ATOM   8687  C  CD  . GLN A 1 81 ? -10.329 -15.234 14.104  1.00 0.00 ? 81 GLN A CD  12 
ATOM   8688  O  OE1 . GLN A 1 81 ? -10.951 -16.230 13.771  1.00 0.00 ? 81 GLN A OE1 12 
ATOM   8689  N  NE2 . GLN A 1 81 ? -10.089 -15.033 15.375  1.00 0.00 ? 81 GLN A NE2 12 
ATOM   8690  N  N   . HIS A 1 82 ? -8.509  -17.329 9.341   1.00 0.00 ? 82 HIS A N   12 
ATOM   8691  C  CA  . HIS A 1 82 ? -8.707  -17.884 8.006   1.00 0.00 ? 82 HIS A CA  12 
ATOM   8692  C  C   . HIS A 1 82 ? -8.434  -19.370 7.991   1.00 0.00 ? 82 HIS A C   12 
ATOM   8693  O  O   . HIS A 1 82 ? -9.352  -20.201 7.977   1.00 0.00 ? 82 HIS A O   12 
ATOM   8694  C  CB  . HIS A 1 82 ? -7.721  -17.150 7.081   1.00 0.00 ? 82 HIS A CB  12 
ATOM   8695  C  CG  . HIS A 1 82 ? -8.421  -16.284 6.075   1.00 0.00 ? 82 HIS A CG  12 
ATOM   8696  N  ND1 . HIS A 1 82 ? -7.981  -15.042 5.622   1.00 0.00 ? 82 HIS A ND1 12 
ATOM   8697  C  CD2 . HIS A 1 82 ? -9.620  -16.647 5.477   1.00 0.00 ? 82 HIS A CD2 12 
ATOM   8698  C  CE1 . HIS A 1 82 ? -8.976  -14.745 4.765   1.00 0.00 ? 82 HIS A CE1 12 
ATOM   8699  N  NE2 . HIS A 1 82 ? -9.987  -15.643 4.619   1.00 0.00 ? 82 HIS A NE2 12 
ATOM   8700  N  N   . ARG A 1 83 ? -7.012  -19.775 8.035   1.00 0.00 ? 83 ARG A N   12 
ATOM   8701  C  CA  . ARG A 1 83 ? -6.606  -21.177 7.996   1.00 0.00 ? 83 ARG A CA  12 
ATOM   8702  C  C   . ARG A 1 83 ? -5.121  -21.317 8.237   1.00 0.00 ? 83 ARG A C   12 
ATOM   8703  O  O   . ARG A 1 83 ? -4.287  -20.876 7.435   1.00 0.00 ? 83 ARG A O   12 
ATOM   8704  C  CB  . ARG A 1 83 ? -7.018  -21.783 6.627   1.00 0.00 ? 83 ARG A CB  12 
ATOM   8705  C  CG  . ARG A 1 83 ? -6.107  -22.933 6.120   1.00 0.00 ? 83 ARG A CG  12 
ATOM   8706  C  CD  . ARG A 1 83 ? -6.559  -23.488 4.763   1.00 0.00 ? 83 ARG A CD  12 
ATOM   8707  N  NE  . ARG A 1 83 ? -6.124  -24.904 4.669   1.00 0.00 ? 83 ARG A NE  12 
ATOM   8708  C  CZ  . ARG A 1 83 ? -6.514  -25.769 3.742   1.00 0.00 ? 83 ARG A CZ  12 
ATOM   8709  N  NH1 . ARG A 1 83 ? -7.343  -25.490 2.780   1.00 0.00 ? 83 ARG A NH1 12 
ATOM   8710  N  NH2 . ARG A 1 83 ? -6.036  -26.961 3.805   1.00 0.00 ? 83 ARG A NH2 12 
ATOM   8711  N  N   . LEU A 1 84 ? -4.722  -22.008 9.482   1.00 0.00 ? 84 LEU A N   12 
ATOM   8712  C  CA  . LEU A 1 84 ? -3.331  -22.070 9.921   1.00 0.00 ? 84 LEU A CA  12 
ATOM   8713  C  C   . LEU A 1 84 ? -2.984  -23.449 10.430  1.00 0.00 ? 84 LEU A C   12 
ATOM   8714  O  O   . LEU A 1 84 ? -3.831  -24.179 10.964  1.00 0.00 ? 84 LEU A O   12 
ATOM   8715  C  CB  . LEU A 1 84 ? -3.050  -20.991 11.006  1.00 0.00 ? 84 LEU A CB  12 
ATOM   8716  C  CG  . LEU A 1 84 ? -4.253  -20.428 11.810  1.00 0.00 ? 84 LEU A CG  12 
ATOM   8717  C  CD1 . LEU A 1 84 ? -4.065  -20.709 13.307  1.00 0.00 ? 84 LEU A CD1 12 
ATOM   8718  C  CD2 . LEU A 1 84 ? -4.462  -18.921 11.588  1.00 0.00 ? 84 LEU A CD2 12 
ATOM   8719  N  N   . ASP A 1 85 ? -1.584  -23.885 10.239  1.00 0.00 ? 85 ASP A N   12 
ATOM   8720  C  CA  . ASP A 1 85 ? -1.070  -25.120 10.825  1.00 0.00 ? 85 ASP A CA  12 
ATOM   8721  C  C   . ASP A 1 85 ? 0.412   -25.013 11.096  1.00 0.00 ? 85 ASP A C   12 
ATOM   8722  O  O   . ASP A 1 85 ? 1.173   -24.404 10.330  1.00 0.00 ? 85 ASP A O   12 
ATOM   8723  C  CB  . ASP A 1 85 ? -1.405  -26.328 9.914   1.00 0.00 ? 85 ASP A CB  12 
ATOM   8724  C  CG  . ASP A 1 85 ? -1.591  -27.685 10.608  1.00 0.00 ? 85 ASP A CG  12 
ATOM   8725  O  OD1 . ASP A 1 85 ? -0.654  -28.385 10.966  1.00 0.00 ? 85 ASP A OD1 12 
ATOM   8726  O  OD2 . ASP A 1 85 ? -2.906  -28.024 10.768  1.00 0.00 ? 85 ASP A OD2 12 
ATOM   8727  N  N   . LYS A 1 86 ? 0.903   -25.666 12.328  1.00 0.00 ? 86 LYS A N   12 
ATOM   8728  C  CA  . LYS A 1 86 ? 2.276   -25.504 12.796  1.00 0.00 ? 86 LYS A CA  12 
ATOM   8729  C  C   . LYS A 1 86 ? 2.933   -26.845 13.023  1.00 0.00 ? 86 LYS A C   12 
ATOM   8730  O  O   . LYS A 1 86 ? 2.726   -27.508 14.048  1.00 0.00 ? 86 LYS A O   12 
ATOM   8731  C  CB  . LYS A 1 86 ? 2.283   -24.655 14.097  1.00 0.00 ? 86 LYS A CB  12 
ATOM   8732  C  CG  . LYS A 1 86 ? 2.714   -23.184 13.871  1.00 0.00 ? 86 LYS A CG  12 
ATOM   8733  C  CD  . LYS A 1 86 ? 2.906   -22.364 15.150  1.00 0.00 ? 86 LYS A CD  12 
ATOM   8734  C  CE  . LYS A 1 86 ? 3.642   -23.217 16.191  1.00 0.00 ? 86 LYS A CE  12 
ATOM   8735  N  NZ  . LYS A 1 86 ? 2.659   -23.854 17.086  1.00 0.00 ? 86 LYS A NZ  12 
ATOM   8736  N  N   . ILE A 1 87 ? 3.847   -27.315 11.959  1.00 0.00 ? 87 ILE A N   12 
ATOM   8737  C  CA  . ILE A 1 87 ? 4.667   -28.513 12.115  1.00 0.00 ? 87 ILE A CA  12 
ATOM   8738  C  C   . ILE A 1 87 ? 6.133   -28.189 11.949  1.00 0.00 ? 87 ILE A C   12 
ATOM   8739  O  O   . ILE A 1 87 ? 6.994   -28.659 12.706  1.00 0.00 ? 87 ILE A O   12 
ATOM   8740  C  CB  . ILE A 1 87 ? 4.203   -29.662 11.130  1.00 0.00 ? 87 ILE A CB  12 
ATOM   8741  C  CG1 . ILE A 1 87 ? 2.735   -29.524 10.613  1.00 0.00 ? 87 ILE A CG1 12 
ATOM   8742  C  CG2 . ILE A 1 87 ? 4.369   -31.087 11.742  1.00 0.00 ? 87 ILE A CG2 12 
ATOM   8743  C  CD1 . ILE A 1 87 ? 2.396   -30.310 9.330   1.00 0.00 ? 87 ILE A CD1 12 
ATOM   8744  N  N   . THR A 1 88 ? 6.485   -27.300 10.821  1.00 0.00 ? 88 THR A N   12 
ATOM   8745  C  CA  . THR A 1 88 ? 7.843   -26.804 10.620  1.00 0.00 ? 88 THR A CA  12 
ATOM   8746  C  C   . THR A 1 88 ? 7.913   -25.312 10.847  1.00 0.00 ? 88 THR A C   12 
ATOM   8747  O  O   . THR A 1 88 ? 6.893   -24.628 11.004  1.00 0.00 ? 88 THR A O   12 
ATOM   8748  C  CB  . THR A 1 88 ? 8.356   -27.169 9.187   1.00 0.00 ? 88 THR A CB  12 
ATOM   8749  O  OG1 . THR A 1 88 ? 8.193   -26.068 8.303   1.00 0.00 ? 88 THR A OG1 12 
ATOM   8750  C  CG2 . THR A 1 88 ? 7.640   -28.341 8.481   1.00 0.00 ? 88 THR A CG2 12 
ATOM   8751  N  N   . HIS A 1 89 ? 9.265   -24.711 10.844  1.00 0.00 ? 89 HIS A N   12 
ATOM   8752  C  CA  . HIS A 1 89 ? 9.494   -23.316 11.212  1.00 0.00 ? 89 HIS A CA  12 
ATOM   8753  C  C   . HIS A 1 89 ? 9.690   -22.456 9.986   1.00 0.00 ? 89 HIS A C   12 
ATOM   8754  O  O   . HIS A 1 89 ? 9.563   -21.224 10.027  1.00 0.00 ? 89 HIS A O   12 
ATOM   8755  C  CB  . HIS A 1 89 ? 10.760  -23.302 12.085  1.00 0.00 ? 89 HIS A CB  12 
ATOM   8756  C  CG  . HIS A 1 89 ? 11.205  -21.909 12.422  1.00 0.00 ? 89 HIS A CG  12 
ATOM   8757  N  ND1 . HIS A 1 89 ? 10.367  -20.823 12.666  1.00 0.00 ? 89 HIS A ND1 12 
ATOM   8758  C  CD2 . HIS A 1 89 ? 12.542  -21.553 12.526  1.00 0.00 ? 89 HIS A CD2 12 
ATOM   8759  C  CE1 . HIS A 1 89 ? 11.289  -19.872 12.906  1.00 0.00 ? 89 HIS A CE1 12 
ATOM   8760  N  NE2 . HIS A 1 89 ? 12.603  -20.221 12.842  1.00 0.00 ? 89 HIS A NE2 12 
ATOM   8761  N  N   . ALA A 1 90 ? 10.062  -23.163 8.741   1.00 0.00 ? 90 ALA A N   12 
ATOM   8762  C  CA  . ALA A 1 90 ? 10.206  -22.463 7.468   1.00 0.00 ? 90 ALA A CA  12 
ATOM   8763  C  C   . ALA A 1 90 ? 8.857   -22.079 6.906   1.00 0.00 ? 90 ALA A C   12 
ATOM   8764  O  O   . ALA A 1 90 ? 7.924   -22.892 6.836   1.00 0.00 ? 90 ALA A O   12 
ATOM   8765  C  CB  . ALA A 1 90 ? 11.008  -23.373 6.522   1.00 0.00 ? 90 ALA A CB  12 
ATOM   8766  N  N   . CYS A 1 91 ? 8.712   -20.681 6.445   1.00 0.00 ? 91 CYS A N   12 
ATOM   8767  C  CA  . CYS A 1 91 ? 7.484   -20.194 5.824   1.00 0.00 ? 91 CYS A CA  12 
ATOM   8768  C  C   . CYS A 1 91 ? 7.787   -19.161 4.764   1.00 0.00 ? 91 CYS A C   12 
ATOM   8769  O  O   . CYS A 1 91 ? 7.978   -17.971 5.050   1.00 0.00 ? 91 CYS A O   12 
ATOM   8770  C  CB  . CYS A 1 91 ? 6.557   -19.649 6.929   1.00 0.00 ? 91 CYS A CB  12 
ATOM   8771  S  SG  . CYS A 1 91 ? 5.158   -18.761 6.210   1.00 0.00 ? 91 CYS A SG  12 
ATOM   8772  N  N   . ARG A 1 92 ? 7.809   -19.643 3.367   1.00 0.00 ? 92 ARG A N   12 
ATOM   8773  C  CA  . ARG A 1 92 ? 8.113   -18.757 2.247   1.00 0.00 ? 92 ARG A CA  12 
ATOM   8774  C  C   . ARG A 1 92 ? 7.118   -17.625 2.168   1.00 0.00 ? 92 ARG A C   12 
ATOM   8775  O  O   . ARG A 1 92 ? 7.428   -16.514 1.743   1.00 0.00 ? 92 ARG A O   12 
ATOM   8776  C  CB  . ARG A 1 92 ? 8.129   -19.590 0.936   1.00 0.00 ? 92 ARG A CB  12 
ATOM   8777  C  CG  . ARG A 1 92 ? 8.039   -18.756 -0.370  1.00 0.00 ? 92 ARG A CG  12 
ATOM   8778  C  CD  . ARG A 1 92 ? 6.608   -18.672 -0.917  1.00 0.00 ? 92 ARG A CD  12 
ATOM   8779  N  NE  . ARG A 1 92 ? 6.505   -17.463 -1.773  1.00 0.00 ? 92 ARG A NE  12 
ATOM   8780  C  CZ  . ARG A 1 92 ? 5.375   -16.903 -2.182  1.00 0.00 ? 92 ARG A CZ  12 
ATOM   8781  N  NH1 . ARG A 1 92 ? 4.188   -17.343 -1.883  1.00 0.00 ? 92 ARG A NH1 12 
ATOM   8782  N  NH2 . ARG A 1 92 ? 5.465   -15.856 -2.922  1.00 0.00 ? 92 ARG A NH2 12 
ATOM   8783  O  OXT . ARG A 1 92 ? 5.791   -17.924 2.610   1.00 0.00 ? 92 ARG A OXT 12 
HETATM 8784  ZN ZN  . ZN  B 2 .  ? 1.501   -1.981  4.454   1.00 0.00 ? 93 ZN  A ZN  12 
ATOM   8785  N  N   . MET A 1 1  ? 7.020   12.706  -20.251 1.00 0.00 ? 1  MET A N   13 
ATOM   8786  C  CA  . MET A 1 1  ? 5.868   12.907  -21.124 1.00 0.00 ? 1  MET A CA  13 
ATOM   8787  C  C   . MET A 1 1  ? 5.785   14.343  -21.587 1.00 0.00 ? 1  MET A C   13 
ATOM   8788  O  O   . MET A 1 1  ? 6.798   14.996  -21.869 1.00 0.00 ? 1  MET A O   13 
ATOM   8789  C  CB  . MET A 1 1  ? 5.947   11.938  -22.335 1.00 0.00 ? 1  MET A CB  13 
ATOM   8790  C  CG  . MET A 1 1  ? 6.707   10.616  -22.092 1.00 0.00 ? 1  MET A CG  13 
ATOM   8791  S  SD  . MET A 1 1  ? 6.666   9.606   -23.582 1.00 0.00 ? 1  MET A SD  13 
ATOM   8792  C  CE  . MET A 1 1  ? 6.032   8.088   -22.857 1.00 0.00 ? 1  MET A CE  13 
ATOM   8793  N  N   . LYS A 1 2  ? 4.427   14.920  -21.695 1.00 0.00 ? 2  LYS A N   13 
ATOM   8794  C  CA  . LYS A 1 2  ? 4.192   16.244  -22.263 1.00 0.00 ? 2  LYS A CA  13 
ATOM   8795  C  C   . LYS A 1 2  ? 3.845   17.242  -21.183 1.00 0.00 ? 2  LYS A C   13 
ATOM   8796  O  O   . LYS A 1 2  ? 3.957   16.967  -19.981 1.00 0.00 ? 2  LYS A O   13 
ATOM   8797  C  CB  . LYS A 1 2  ? 3.062   16.159  -23.325 1.00 0.00 ? 2  LYS A CB  13 
ATOM   8798  C  CG  . LYS A 1 2  ? 2.121   14.944  -23.129 1.00 0.00 ? 2  LYS A CG  13 
ATOM   8799  C  CD  . LYS A 1 2  ? 0.859   14.961  -23.996 1.00 0.00 ? 2  LYS A CD  13 
ATOM   8800  C  CE  . LYS A 1 2  ? 1.256   14.816  -25.471 1.00 0.00 ? 2  LYS A CE  13 
ATOM   8801  N  NZ  . LYS A 1 2  ? 0.142   14.209  -26.221 1.00 0.00 ? 2  LYS A NZ  13 
ATOM   8802  N  N   . LYS A 1 3  ? 3.369   18.565  -21.643 1.00 0.00 ? 3  LYS A N   13 
ATOM   8803  C  CA  . LYS A 1 3  ? 2.958   19.608  -20.708 1.00 0.00 ? 3  LYS A CA  13 
ATOM   8804  C  C   . LYS A 1 3  ? 2.109   19.035  -19.597 1.00 0.00 ? 3  LYS A C   13 
ATOM   8805  O  O   . LYS A 1 3  ? 2.039   19.576  -18.485 1.00 0.00 ? 3  LYS A O   13 
ATOM   8806  C  CB  . LYS A 1 3  ? 2.191   20.718  -21.477 1.00 0.00 ? 3  LYS A CB  13 
ATOM   8807  C  CG  . LYS A 1 3  ? 1.108   20.167  -22.438 1.00 0.00 ? 3  LYS A CG  13 
ATOM   8808  C  CD  . LYS A 1 3  ? -0.255  20.858  -22.337 1.00 0.00 ? 3  LYS A CD  13 
ATOM   8809  C  CE  . LYS A 1 3  ? -0.171  22.241  -22.995 1.00 0.00 ? 3  LYS A CE  13 
ATOM   8810  N  NZ  . LYS A 1 3  ? -1.219  23.114  -22.436 1.00 0.00 ? 3  LYS A NZ  13 
ATOM   8811  N  N   . ALA A 1 4  ? 1.343   17.813  -19.922 1.00 0.00 ? 4  ALA A N   13 
ATOM   8812  C  CA  . ALA A 1 4  ? 0.431   17.194  -18.964 1.00 0.00 ? 4  ALA A CA  13 
ATOM   8813  C  C   . ALA A 1 4  ? 1.071   17.085  -17.600 1.00 0.00 ? 4  ALA A C   13 
ATOM   8814  O  O   . ALA A 1 4  ? 0.729   17.814  -16.659 1.00 0.00 ? 4  ALA A O   13 
ATOM   8815  C  CB  . ALA A 1 4  ? 0.009   15.829  -19.535 1.00 0.00 ? 4  ALA A CB  13 
ATOM   8816  N  N   . THR A 1 5  ? 2.143   16.076  -17.458 1.00 0.00 ? 5  THR A N   13 
ATOM   8817  C  CA  . THR A 1 5  ? 2.906   15.925  -16.222 1.00 0.00 ? 5  THR A CA  13 
ATOM   8818  C  C   . THR A 1 5  ? 4.307   15.438  -16.507 1.00 0.00 ? 5  THR A C   13 
ATOM   8819  O  O   . THR A 1 5  ? 4.536   14.577  -17.369 1.00 0.00 ? 5  THR A O   13 
ATOM   8820  C  CB  . THR A 1 5  ? 2.172   14.955  -15.237 1.00 0.00 ? 5  THR A CB  13 
ATOM   8821  O  OG1 . THR A 1 5  ? 1.583   13.874  -15.949 1.00 0.00 ? 5  THR A OG1 13 
ATOM   8822  C  CG2 . THR A 1 5  ? 1.010   15.559  -14.419 1.00 0.00 ? 5  THR A CG2 13 
ATOM   8823  N  N   . CYS A 1 6  ? 5.385   16.022  -15.681 1.00 0.00 ? 6  CYS A N   13 
ATOM   8824  C  CA  . CYS A 1 6  ? 6.762   15.543  -15.752 1.00 0.00 ? 6  CYS A CA  13 
ATOM   8825  C  C   . CYS A 1 6  ? 6.900   14.191  -15.091 1.00 0.00 ? 6  CYS A C   13 
ATOM   8826  O  O   . CYS A 1 6  ? 5.912   13.497  -14.816 1.00 0.00 ? 6  CYS A O   13 
ATOM   8827  C  CB  . CYS A 1 6  ? 7.685   16.604  -15.121 1.00 0.00 ? 6  CYS A CB  13 
ATOM   8828  S  SG  . CYS A 1 6  ? 9.105   16.934  -16.188 1.00 0.00 ? 6  CYS A SG  13 
ATOM   8829  N  N   . LEU A 1 7  ? 8.277   13.748  -14.788 1.00 0.00 ? 7  LEU A N   13 
ATOM   8830  C  CA  . LEU A 1 7  ? 8.552   12.482  -14.115 1.00 0.00 ? 7  LEU A CA  13 
ATOM   8831  C  C   . LEU A 1 7  ? 8.339   12.604  -12.624 1.00 0.00 ? 7  LEU A C   13 
ATOM   8832  O  O   . LEU A 1 7  ? 9.228   13.028  -11.872 1.00 0.00 ? 7  LEU A O   13 
ATOM   8833  C  CB  . LEU A 1 7  ? 9.995   11.996  -14.431 1.00 0.00 ? 7  LEU A CB  13 
ATOM   8834  C  CG  . LEU A 1 7  ? 10.520  12.156  -15.883 1.00 0.00 ? 7  LEU A CG  13 
ATOM   8835  C  CD1 . LEU A 1 7  ? 9.344   12.183  -16.870 1.00 0.00 ? 7  LEU A CD1 13 
ATOM   8836  C  CD2 . LEU A 1 7  ? 11.380  13.417  -16.069 1.00 0.00 ? 7  LEU A CD2 13 
ATOM   8837  N  N   . THR A 1 8  ? 7.011   12.200  -12.115 1.00 0.00 ? 8  THR A N   13 
ATOM   8838  C  CA  . THR A 1 8  ? 6.640   12.358  -10.712 1.00 0.00 ? 8  THR A CA  13 
ATOM   8839  C  C   . THR A 1 8  ? 5.697   11.261  -10.274 1.00 0.00 ? 8  THR A C   13 
ATOM   8840  O  O   . THR A 1 8  ? 6.071   10.333  -9.545  1.00 0.00 ? 8  THR A O   13 
ATOM   8841  C  CB  . THR A 1 8  ? 6.004   13.767  -10.466 1.00 0.00 ? 8  THR A CB  13 
ATOM   8842  O  OG1 . THR A 1 8  ? 5.234   14.170  -11.592 1.00 0.00 ? 8  THR A OG1 13 
ATOM   8843  C  CG2 . THR A 1 8  ? 6.990   14.933  -10.235 1.00 0.00 ? 8  THR A CG2 13 
ATOM   8844  N  N   . ASP A 1 9  ? 4.296   11.377  -10.734 1.00 0.00 ? 9  ASP A N   13 
ATOM   8845  C  CA  . ASP A 1 9  ? 3.282   10.387  -10.381 1.00 0.00 ? 9  ASP A CA  13 
ATOM   8846  C  C   . ASP A 1 9  ? 3.633   9.031   -10.946 1.00 0.00 ? 9  ASP A C   13 
ATOM   8847  O  O   . ASP A 1 9  ? 3.318   7.982   -10.367 1.00 0.00 ? 9  ASP A O   13 
ATOM   8848  C  CB  . ASP A 1 9  ? 1.880   10.861  -10.844 1.00 0.00 ? 9  ASP A CB  13 
ATOM   8849  C  CG  . ASP A 1 9  ? 1.514   10.600  -12.312 1.00 0.00 ? 9  ASP A CG  13 
ATOM   8850  O  OD1 . ASP A 1 9  ? 2.311   11.285  -13.187 1.00 0.00 ? 9  ASP A OD1 13 
ATOM   8851  O  OD2 . ASP A 1 9  ? 0.596   9.867   -12.650 1.00 0.00 ? 9  ASP A OD2 13 
ATOM   8852  N  N   . ASP A 1 10 ? 4.405   9.025   -12.208 1.00 0.00 ? 10 ASP A N   13 
ATOM   8853  C  CA  . ASP A 1 10 ? 4.742   7.785   -12.901 1.00 0.00 ? 10 ASP A CA  13 
ATOM   8854  C  C   . ASP A 1 10 ? 5.755   6.986   -12.115 1.00 0.00 ? 10 ASP A C   13 
ATOM   8855  O  O   . ASP A 1 10 ? 5.553   5.809   -11.789 1.00 0.00 ? 10 ASP A O   13 
ATOM   8856  C  CB  . ASP A 1 10 ? 5.238   8.091   -14.338 1.00 0.00 ? 10 ASP A CB  13 
ATOM   8857  C  CG  . ASP A 1 10 ? 5.557   6.882   -15.230 1.00 0.00 ? 10 ASP A CG  13 
ATOM   8858  O  OD1 . ASP A 1 10 ? 5.083   5.772   -15.041 1.00 0.00 ? 10 ASP A OD1 13 
ATOM   8859  O  OD2 . ASP A 1 10 ? 6.419   7.186   -16.246 1.00 0.00 ? 10 ASP A OD2 13 
ATOM   8860  N  N   . GLN A 1 11 ? 7.022   7.678   -11.787 1.00 0.00 ? 11 GLN A N   13 
ATOM   8861  C  CA  . GLN A 1 11 ? 8.119   7.018   -11.086 1.00 0.00 ? 11 GLN A CA  13 
ATOM   8862  C  C   . GLN A 1 11 ? 7.663   6.479   -9.749  1.00 0.00 ? 11 GLN A C   13 
ATOM   8863  O  O   . GLN A 1 11 ? 7.940   5.335   -9.364  1.00 0.00 ? 11 GLN A O   13 
ATOM   8864  C  CB  . GLN A 1 11 ? 9.266   8.037   -10.902 1.00 0.00 ? 11 GLN A CB  13 
ATOM   8865  C  CG  . GLN A 1 11 ? 8.979   9.227   -9.927  1.00 0.00 ? 11 GLN A CG  13 
ATOM   8866  C  CD  . GLN A 1 11 ? 10.151  10.044  -9.369  1.00 0.00 ? 11 GLN A CD  13 
ATOM   8867  O  OE1 . GLN A 1 11 ? 10.106  10.529  -8.250  1.00 0.00 ? 11 GLN A OE1 13 
ATOM   8868  N  NE2 . GLN A 1 11 ? 11.213  10.252  -10.106 1.00 0.00 ? 11 GLN A NE2 13 
ATOM   8869  N  N   . ARG A 1 12 ? 6.889   7.418   -8.907  1.00 0.00 ? 12 ARG A N   13 
ATOM   8870  C  CA  . ARG A 1 12 ? 6.291   7.049   -7.631  1.00 0.00 ? 12 ARG A CA  13 
ATOM   8871  C  C   . ARG A 1 12 ? 5.666   5.672   -7.665  1.00 0.00 ? 12 ARG A C   13 
ATOM   8872  O  O   . ARG A 1 12 ? 6.155   4.670   -7.100  1.00 0.00 ? 12 ARG A O   13 
ATOM   8873  C  CB  . ARG A 1 12 ? 5.189   8.104   -7.297  1.00 0.00 ? 12 ARG A CB  13 
ATOM   8874  C  CG  . ARG A 1 12 ? 5.629   9.381   -6.543  1.00 0.00 ? 12 ARG A CG  13 
ATOM   8875  C  CD  . ARG A 1 12 ? 7.024   9.309   -5.912  1.00 0.00 ? 12 ARG A CD  13 
ATOM   8876  N  NE  . ARG A 1 12 ? 7.113   10.364  -4.866  1.00 0.00 ? 12 ARG A NE  13 
ATOM   8877  C  CZ  . ARG A 1 12 ? 7.151   11.671  -5.088  1.00 0.00 ? 12 ARG A CZ  13 
ATOM   8878  N  NH1 . ARG A 1 12 ? 7.122   12.216  -6.267  1.00 0.00 ? 12 ARG A NH1 13 
ATOM   8879  N  NH2 . ARG A 1 12 ? 7.220   12.444  -4.063  1.00 0.00 ? 12 ARG A NH2 13 
ATOM   8880  N  N   . TRP A 1 13 ? 4.400   5.568   -8.428  1.00 0.00 ? 13 TRP A N   13 
ATOM   8881  C  CA  . TRP A 1 13 ? 3.572   4.371   -8.354  1.00 0.00 ? 13 TRP A CA  13 
ATOM   8882  C  C   . TRP A 1 13 ? 4.154   3.245   -9.167  1.00 0.00 ? 13 TRP A C   13 
ATOM   8883  O  O   . TRP A 1 13 ? 3.855   2.059   -8.940  1.00 0.00 ? 13 TRP A O   13 
ATOM   8884  C  CB  . TRP A 1 13 ? 2.128   4.740   -8.828  1.00 0.00 ? 13 TRP A CB  13 
ATOM   8885  C  CG  . TRP A 1 13 ? 1.291   3.459   -8.991  1.00 0.00 ? 13 TRP A CG  13 
ATOM   8886  C  CD1 . TRP A 1 13 ? 1.034   2.796   -10.207 1.00 0.00 ? 13 TRP A CD1 13 
ATOM   8887  C  CD2 . TRP A 1 13 ? 0.751   2.677   -7.996  1.00 0.00 ? 13 TRP A CD2 13 
ATOM   8888  N  NE1 . TRP A 1 13 ? 0.326   1.597   -9.993  1.00 0.00 ? 13 TRP A NE1 13 
ATOM   8889  C  CE2 . TRP A 1 13 ? 0.168   1.541   -8.615  1.00 0.00 ? 13 TRP A CE2 13 
ATOM   8890  C  CE3 . TRP A 1 13 ? 0.737   2.826   -6.584  1.00 0.00 ? 13 TRP A CE3 13 
ATOM   8891  C  CZ2 . TRP A 1 13 ? -0.443  0.550   -7.815  1.00 0.00 ? 13 TRP A CZ2 13 
ATOM   8892  C  CZ3 . TRP A 1 13 ? 0.113   1.840   -5.821  1.00 0.00 ? 13 TRP A CZ3 13 
ATOM   8893  C  CH2 . TRP A 1 13 ? -0.472  0.719   -6.427  1.00 0.00 ? 13 TRP A CH2 13 
ATOM   8894  N  N   . GLN A 1 14 ? 5.067   3.610   -10.275 1.00 0.00 ? 14 GLN A N   13 
ATOM   8895  C  CA  . GLN A 1 14 ? 5.842   2.594   -10.985 1.00 0.00 ? 14 GLN A CA  13 
ATOM   8896  C  C   . GLN A 1 14 ? 6.761   1.897   -9.991  1.00 0.00 ? 14 GLN A C   13 
ATOM   8897  O  O   . GLN A 1 14 ? 7.061   0.701   -10.090 1.00 0.00 ? 14 GLN A O   13 
ATOM   8898  C  CB  . GLN A 1 14 ? 6.662   3.240   -12.116 1.00 0.00 ? 14 GLN A CB  13 
ATOM   8899  C  CG  . GLN A 1 14 ? 7.778   2.344   -12.756 1.00 0.00 ? 14 GLN A CG  13 
ATOM   8900  C  CD  . GLN A 1 14 ? 9.193   2.385   -12.168 1.00 0.00 ? 14 GLN A CD  13 
ATOM   8901  O  OE1 . GLN A 1 14 ? 9.398   2.830   -11.049 1.00 0.00 ? 14 GLN A OE1 13 
ATOM   8902  N  NE2 . GLN A 1 14 ? 10.207  1.940   -12.865 1.00 0.00 ? 14 GLN A NE2 13 
ATOM   8903  N  N   . SER A 1 15 ? 7.252   2.761   -8.890  1.00 0.00 ? 15 SER A N   13 
ATOM   8904  C  CA  . SER A 1 15 ? 7.986   2.215   -7.754  1.00 0.00 ? 15 SER A CA  13 
ATOM   8905  C  C   . SER A 1 15 ? 7.123   1.227   -7.000  1.00 0.00 ? 15 SER A C   13 
ATOM   8906  O  O   . SER A 1 15 ? 7.638   0.256   -6.415  1.00 0.00 ? 15 SER A O   13 
ATOM   8907  C  CB  . SER A 1 15 ? 8.544   3.328   -6.835  1.00 0.00 ? 15 SER A CB  13 
ATOM   8908  O  OG  . SER A 1 15 ? 9.584   4.094   -7.455  1.00 0.00 ? 15 SER A OG  13 
ATOM   8909  N  N   . VAL A 1 16 ? 5.656   1.492   -6.952  1.00 0.00 ? 16 VAL A N   13 
ATOM   8910  C  CA  . VAL A 1 16 ? 4.755   0.469   -6.402  1.00 0.00 ? 16 VAL A CA  13 
ATOM   8911  C  C   . VAL A 1 16 ? 4.704   -0.764  -7.268  1.00 0.00 ? 16 VAL A C   13 
ATOM   8912  O  O   . VAL A 1 16 ? 5.155   -1.883  -6.866  1.00 0.00 ? 16 VAL A O   13 
ATOM   8913  C  CB  . VAL A 1 16 ? 3.355   1.034   -5.961  1.00 0.00 ? 16 VAL A CB  13 
ATOM   8914  C  CG1 . VAL A 1 16 ? 2.659   0.268   -4.784  1.00 0.00 ? 16 VAL A CG1 13 
ATOM   8915  C  CG2 . VAL A 1 16 ? 3.397   2.507   -5.483  1.00 0.00 ? 16 VAL A CG2 13 
ATOM   8916  N  N   . LEU A 1 17 ? 4.135   -0.668  -8.626  1.00 0.00 ? 17 LEU A N   13 
ATOM   8917  C  CA  . LEU A 1 17 ? 3.893   -1.866  -9.463  1.00 0.00 ? 17 LEU A CA  13 
ATOM   8918  C  C   . LEU A 1 17 ? 5.142   -2.704  -9.536  1.00 0.00 ? 17 LEU A C   13 
ATOM   8919  O  O   . LEU A 1 17 ? 5.160   -3.929  -9.362  1.00 0.00 ? 17 LEU A O   13 
ATOM   8920  C  CB  . LEU A 1 17 ? 3.417   -1.471  -10.890 1.00 0.00 ? 17 LEU A CB  13 
ATOM   8921  C  CG  . LEU A 1 17 ? 2.098   -0.658  -11.014 1.00 0.00 ? 17 LEU A CG  13 
ATOM   8922  C  CD1 . LEU A 1 17 ? 1.657   -0.589  -12.482 1.00 0.00 ? 17 LEU A CD1 13 
ATOM   8923  C  CD2 . LEU A 1 17 ? 0.962   -1.243  -10.160 1.00 0.00 ? 17 LEU A CD2 13 
ATOM   8924  N  N   . ALA A 1 18 ? 6.383   -1.956  -9.877  1.00 0.00 ? 18 ALA A N   13 
ATOM   8925  C  CA  . ALA A 1 18 ? 7.643   -2.589  -10.227 1.00 0.00 ? 18 ALA A CA  13 
ATOM   8926  C  C   . ALA A 1 18 ? 8.534   -2.886  -9.042  1.00 0.00 ? 18 ALA A C   13 
ATOM   8927  O  O   . ALA A 1 18 ? 9.386   -3.787  -9.096  1.00 0.00 ? 18 ALA A O   13 
ATOM   8928  C  CB  . ALA A 1 18 ? 8.360   -1.642  -11.227 1.00 0.00 ? 18 ALA A CB  13 
ATOM   8929  N  N   . ARG A 1 19 ? 8.306   -2.104  -7.812  1.00 0.00 ? 19 ARG A N   13 
ATOM   8930  C  CA  . ARG A 1 19 ? 9.202   -2.062  -6.663  1.00 0.00 ? 19 ARG A CA  13 
ATOM   8931  C  C   . ARG A 1 19 ? 10.456  -2.871  -6.844  1.00 0.00 ? 19 ARG A C   13 
ATOM   8932  O  O   . ARG A 1 19 ? 10.776  -3.826  -6.124  1.00 0.00 ? 19 ARG A O   13 
ATOM   8933  C  CB  . ARG A 1 19 ? 8.406   -2.419  -5.380  1.00 0.00 ? 19 ARG A CB  13 
ATOM   8934  C  CG  . ARG A 1 19 ? 8.291   -3.916  -4.995  1.00 0.00 ? 19 ARG A CG  13 
ATOM   8935  C  CD  . ARG A 1 19 ? 8.046   -4.842  -6.192  1.00 0.00 ? 19 ARG A CD  13 
ATOM   8936  N  NE  . ARG A 1 19 ? 8.083   -6.246  -5.707  1.00 0.00 ? 19 ARG A NE  13 
ATOM   8937  C  CZ  . ARG A 1 19 ? 7.992   -7.328  -6.470  1.00 0.00 ? 19 ARG A CZ  13 
ATOM   8938  N  NH1 . ARG A 1 19 ? 7.851   -7.305  -7.762  1.00 0.00 ? 19 ARG A NH1 13 
ATOM   8939  N  NH2 . ARG A 1 19 ? 8.048   -8.472  -5.885  1.00 0.00 ? 19 ARG A NH2 13 
ATOM   8940  N  N   . ASP A 1 20 ? 11.352  -2.419  -7.949  1.00 0.00 ? 20 ASP A N   13 
ATOM   8941  C  CA  . ASP A 1 20 ? 12.693  -2.965  -8.136  1.00 0.00 ? 20 ASP A CA  13 
ATOM   8942  C  C   . ASP A 1 20 ? 13.503  -2.779  -6.868  1.00 0.00 ? 20 ASP A C   13 
ATOM   8943  O  O   . ASP A 1 20 ? 14.081  -3.719  -6.311  1.00 0.00 ? 20 ASP A O   13 
ATOM   8944  C  CB  . ASP A 1 20 ? 13.377  -2.313  -9.362  1.00 0.00 ? 20 ASP A CB  13 
ATOM   8945  C  CG  . ASP A 1 20 ? 14.906  -2.442  -9.450  1.00 0.00 ? 20 ASP A CG  13 
ATOM   8946  O  OD1 . ASP A 1 20 ? 15.364  -3.639  -8.974  1.00 0.00 ? 20 ASP A OD1 13 
ATOM   8947  O  OD2 . ASP A 1 20 ? 15.626  -1.553  -9.881  1.00 0.00 ? 20 ASP A OD2 13 
ATOM   8948  N  N   . PRO A 1 21 ? 13.572  -1.390  -6.364  1.00 0.00 ? 21 PRO A N   13 
ATOM   8949  C  CA  . PRO A 1 21 ? 14.293  -0.939  -5.080  1.00 0.00 ? 21 PRO A CA  13 
ATOM   8950  C  C   . PRO A 1 21 ? 13.527  -1.308  -3.824  1.00 0.00 ? 21 PRO A C   13 
ATOM   8951  O  O   . PRO A 1 21 ? 12.687  -2.243  -3.871  1.00 0.00 ? 21 PRO A O   13 
ATOM   8952  C  CB  . PRO A 1 21 ? 14.422  0.570   -5.187  1.00 0.00 ? 21 PRO A CB  13 
ATOM   8953  C  CG  . PRO A 1 21 ? 13.125  0.931   -5.929  1.00 0.00 ? 21 PRO A CG  13 
ATOM   8954  C  CD  . PRO A 1 21 ? 12.964  -0.183  -6.969  1.00 0.00 ? 21 PRO A CD  13 
ATOM   8955  N  N   . ASN A 1 22 ? 13.797  -0.599  -2.559  1.00 0.00 ? 22 ASN A N   13 
ATOM   8956  C  CA  . ASN A 1 22 ? 12.961  -0.801  -1.375  1.00 0.00 ? 22 ASN A CA  13 
ATOM   8957  C  C   . ASN A 1 22 ? 11.828  0.203   -1.400  1.00 0.00 ? 22 ASN A C   13 
ATOM   8958  O  O   . ASN A 1 22 ? 10.693  -0.071  -1.805  1.00 0.00 ? 22 ASN A O   13 
ATOM   8959  C  CB  . ASN A 1 22 ? 13.816  -0.600  -0.092  1.00 0.00 ? 22 ASN A CB  13 
ATOM   8960  C  CG  . ASN A 1 22 ? 13.055  -0.295  1.204   1.00 0.00 ? 22 ASN A CG  13 
ATOM   8961  O  OD1 . ASN A 1 22 ? 12.240  -1.070  1.682   1.00 0.00 ? 22 ASN A OD1 13 
ATOM   8962  N  ND2 . ASN A 1 22 ? 13.274  0.843   1.807   1.00 0.00 ? 22 ASN A ND2 13 
ATOM   8963  N  N   . ALA A 1 23 ? 12.201  1.567   -0.952  1.00 0.00 ? 23 ALA A N   13 
ATOM   8964  C  CA  . ALA A 1 23 ? 11.325  2.725   -1.076  1.00 0.00 ? 23 ALA A CA  13 
ATOM   8965  C  C   . ALA A 1 23 ? 12.160  3.995   -1.086  1.00 0.00 ? 23 ALA A C   13 
ATOM   8966  O  O   . ALA A 1 23 ? 12.488  4.554   -0.032  1.00 0.00 ? 23 ALA A O   13 
ATOM   8967  C  CB  . ALA A 1 23 ? 10.305  2.687   0.071   1.00 0.00 ? 23 ALA A CB  13 
ATOM   8968  N  N   . ASP A 1 24 ? 12.575  4.474   -2.422  1.00 0.00 ? 24 ASP A N   13 
ATOM   8969  C  CA  . ASP A 1 24 ? 13.532  5.562   -2.598  1.00 0.00 ? 24 ASP A CA  13 
ATOM   8970  C  C   . ASP A 1 24 ? 13.344  6.650   -1.555  1.00 0.00 ? 24 ASP A C   13 
ATOM   8971  O  O   . ASP A 1 24 ? 12.363  7.408   -1.506  1.00 0.00 ? 24 ASP A O   13 
ATOM   8972  C  CB  . ASP A 1 24 ? 13.429  6.138   -4.035  1.00 0.00 ? 24 ASP A CB  13 
ATOM   8973  C  CG  . ASP A 1 24 ? 13.813  5.202   -5.190  1.00 0.00 ? 24 ASP A CG  13 
ATOM   8974  O  OD1 . ASP A 1 24 ? 14.034  3.917   -4.782  1.00 0.00 ? 24 ASP A OD1 13 
ATOM   8975  O  OD2 . ASP A 1 24 ? 13.916  5.581   -6.348  1.00 0.00 ? 24 ASP A OD2 13 
ATOM   8976  N  N   . GLY A 1 25 ? 14.391  6.695   -0.510  1.00 0.00 ? 25 GLY A N   13 
ATOM   8977  C  CA  . GLY A 1 25 ? 14.536  7.779   0.482   1.00 0.00 ? 25 GLY A CA  13 
ATOM   8978  C  C   . GLY A 1 25 ? 13.800  7.277   1.730   1.00 0.00 ? 25 GLY A C   13 
ATOM   8979  O  O   . GLY A 1 25 ? 14.370  6.646   2.626   1.00 0.00 ? 25 GLY A O   13 
ATOM   8980  N  N   . GLU A 1 26 ? 12.356  7.571   1.725   1.00 0.00 ? 26 GLU A N   13 
ATOM   8981  C  CA  . GLU A 1 26 ? 11.434  6.960   2.673   1.00 0.00 ? 26 GLU A CA  13 
ATOM   8982  C  C   . GLU A 1 26 ? 10.016  7.075   2.156   1.00 0.00 ? 26 GLU A C   13 
ATOM   8983  O  O   . GLU A 1 26 ? 9.041   7.075   2.919   1.00 0.00 ? 26 GLU A O   13 
ATOM   8984  C  CB  . GLU A 1 26 ? 11.627  7.677   4.041   1.00 0.00 ? 26 GLU A CB  13 
ATOM   8985  C  CG  . GLU A 1 26 ? 12.827  7.262   4.954   1.00 0.00 ? 26 GLU A CG  13 
ATOM   8986  C  CD  . GLU A 1 26 ? 13.075  5.776   5.223   1.00 0.00 ? 26 GLU A CD  13 
ATOM   8987  O  OE1 . GLU A 1 26 ? 11.950  5.086   5.562   1.00 0.00 ? 26 GLU A OE1 13 
ATOM   8988  O  OE2 . GLU A 1 26 ? 14.181  5.259   5.144   1.00 0.00 ? 26 GLU A OE2 13 
ATOM   8989  N  N   . PHE A 1 27 ? 9.863   7.229   0.687   1.00 0.00 ? 27 PHE A N   13 
ATOM   8990  C  CA  . PHE A 1 27 ? 8.566   7.558   0.094   1.00 0.00 ? 27 PHE A CA  13 
ATOM   8991  C  C   . PHE A 1 27 ? 7.462   6.645   0.558   1.00 0.00 ? 27 PHE A C   13 
ATOM   8992  O  O   . PHE A 1 27 ? 7.661   5.504   0.996   1.00 0.00 ? 27 PHE A O   13 
ATOM   8993  C  CB  . PHE A 1 27 ? 8.682   7.655   -1.449  1.00 0.00 ? 27 PHE A CB  13 
ATOM   8994  C  CG  . PHE A 1 27 ? 8.151   6.538   -2.358  1.00 0.00 ? 27 PHE A CG  13 
ATOM   8995  C  CD1 . PHE A 1 27 ? 8.934   5.418   -2.649  1.00 0.00 ? 27 PHE A CD1 13 
ATOM   8996  C  CD2 . PHE A 1 27 ? 6.880   6.659   -2.933  1.00 0.00 ? 27 PHE A CD2 13 
ATOM   8997  C  CE1 . PHE A 1 27 ? 8.448   4.428   -3.500  1.00 0.00 ? 27 PHE A CE1 13 
ATOM   8998  C  CE2 . PHE A 1 27 ? 6.396   5.670   -3.782  1.00 0.00 ? 27 PHE A CE2 13 
ATOM   8999  C  CZ  . PHE A 1 27 ? 7.182   4.556   -4.068  1.00 0.00 ? 27 PHE A CZ  13 
ATOM   9000  N  N   . VAL A 1 28 ? 6.084   7.194   0.449   1.00 0.00 ? 28 VAL A N   13 
ATOM   9001  C  CA  . VAL A 1 28 ? 4.907   6.563   1.043   1.00 0.00 ? 28 VAL A CA  13 
ATOM   9002  C  C   . VAL A 1 28 ? 3.718   6.684   0.116   1.00 0.00 ? 28 VAL A C   13 
ATOM   9003  O  O   . VAL A 1 28 ? 3.676   7.585   -0.748  1.00 0.00 ? 28 VAL A O   13 
ATOM   9004  C  CB  . VAL A 1 28 ? 4.607   7.266   2.428   1.00 0.00 ? 28 VAL A CB  13 
ATOM   9005  C  CG1 . VAL A 1 28 ? 5.853   7.588   3.307   1.00 0.00 ? 28 VAL A CG1 13 
ATOM   9006  C  CG2 . VAL A 1 28 ? 3.851   8.610   2.296   1.00 0.00 ? 28 VAL A CG2 13 
ATOM   9007  N  N   . PHE A 1 29 ? 2.606   5.720   0.261   1.00 0.00 ? 29 PHE A N   13 
ATOM   9008  C  CA  . PHE A 1 29 ? 1.424   5.726   -0.603  1.00 0.00 ? 29 PHE A CA  13 
ATOM   9009  C  C   . PHE A 1 29 ? 0.181   5.451   0.211   1.00 0.00 ? 29 PHE A C   13 
ATOM   9010  O  O   . PHE A 1 29 ? 0.173   4.575   1.097   1.00 0.00 ? 29 PHE A O   13 
ATOM   9011  C  CB  . PHE A 1 29 ? 1.559   4.627   -1.699  1.00 0.00 ? 29 PHE A CB  13 
ATOM   9012  C  CG  . PHE A 1 29 ? 1.040   3.226   -1.337  1.00 0.00 ? 29 PHE A CG  13 
ATOM   9013  C  CD1 . PHE A 1 29 ? 1.829   2.377   -0.555  1.00 0.00 ? 29 PHE A CD1 13 
ATOM   9014  C  CD2 . PHE A 1 29 ? -0.189  2.773   -1.823  1.00 0.00 ? 29 PHE A CD2 13 
ATOM   9015  C  CE1 . PHE A 1 29 ? 1.390   1.092   -0.253  1.00 0.00 ? 29 PHE A CE1 13 
ATOM   9016  C  CE2 . PHE A 1 29 ? -0.626  1.486   -1.522  1.00 0.00 ? 29 PHE A CE2 13 
ATOM   9017  C  CZ  . PHE A 1 29 ? 0.161   0.648   -0.735  1.00 0.00 ? 29 PHE A CZ  13 
ATOM   9018  N  N   . ALA A 1 30 ? -1.018  6.272   -0.065  1.00 0.00 ? 30 ALA A N   13 
ATOM   9019  C  CA  . ALA A 1 30 ? -2.213  6.198   0.771   1.00 0.00 ? 30 ALA A CA  13 
ATOM   9020  C  C   . ALA A 1 30 ? -3.428  5.829   -0.048  1.00 0.00 ? 30 ALA A C   13 
ATOM   9021  O  O   . ALA A 1 30 ? -3.932  6.616   -0.862  1.00 0.00 ? 30 ALA A O   13 
ATOM   9022  C  CB  . ALA A 1 30 ? -2.368  7.546   1.494   1.00 0.00 ? 30 ALA A CB  13 
ATOM   9023  N  N   . VAL A 1 31 ? -4.004  4.491   0.207   1.00 0.00 ? 31 VAL A N   13 
ATOM   9024  C  CA  . VAL A 1 31 ? -5.234  4.043   -0.445  1.00 0.00 ? 31 VAL A CA  13 
ATOM   9025  C  C   . VAL A 1 31 ? -6.425  4.284   0.451   1.00 0.00 ? 31 VAL A C   13 
ATOM   9026  O  O   . VAL A 1 31 ? -6.589  3.632   1.497   1.00 0.00 ? 31 VAL A O   13 
ATOM   9027  C  CB  . VAL A 1 31 ? -5.105  2.517   -0.830  1.00 0.00 ? 31 VAL A CB  13 
ATOM   9028  C  CG1 . VAL A 1 31 ? -5.208  1.496   0.338   1.00 0.00 ? 31 VAL A CG1 13 
ATOM   9029  C  CG2 . VAL A 1 31 ? -6.136  2.038   -1.880  1.00 0.00 ? 31 VAL A CG2 13 
ATOM   9030  N  N   . ARG A 1 32 ? -7.379  5.339   0.040   1.00 0.00 ? 32 ARG A N   13 
ATOM   9031  C  CA  . ARG A 1 32 ? -8.460  5.775   0.921   1.00 0.00 ? 32 ARG A CA  13 
ATOM   9032  C  C   . ARG A 1 32 ? -9.688  4.903   0.817   1.00 0.00 ? 32 ARG A C   13 
ATOM   9033  O  O   . ARG A 1 32 ? -10.818 5.350   1.101   1.00 0.00 ? 32 ARG A O   13 
ATOM   9034  C  CB  . ARG A 1 32 ? -8.798  7.258   0.600   1.00 0.00 ? 32 ARG A CB  13 
ATOM   9035  C  CG  . ARG A 1 32 ? -9.885  7.454   -0.491  1.00 0.00 ? 32 ARG A CG  13 
ATOM   9036  C  CD  . ARG A 1 32 ? -9.769  8.806   -1.205  1.00 0.00 ? 32 ARG A CD  13 
ATOM   9037  N  NE  . ARG A 1 32 ? -10.933 8.957   -2.115  1.00 0.00 ? 32 ARG A NE  13 
ATOM   9038  C  CZ  . ARG A 1 32 ? -10.955 9.685   -3.222  1.00 0.00 ? 32 ARG A CZ  13 
ATOM   9039  N  NH1 . ARG A 1 32 ? -9.945  10.370  -3.671  1.00 0.00 ? 32 ARG A NH1 13 
ATOM   9040  N  NH2 . ARG A 1 32 ? -12.052 9.712   -3.893  1.00 0.00 ? 32 ARG A NH2 13 
ATOM   9041  N  N   . THR A 1 33 ? -9.505  3.496   0.405   1.00 0.00 ? 33 THR A N   13 
ATOM   9042  C  CA  . THR A 1 33 ? -10.637 2.581   0.248   1.00 0.00 ? 33 THR A CA  13 
ATOM   9043  C  C   . THR A 1 33 ? -10.668 1.586   1.385   1.00 0.00 ? 33 THR A C   13 
ATOM   9044  O  O   . THR A 1 33 ? -11.729 1.217   1.908   1.00 0.00 ? 33 THR A O   13 
ATOM   9045  C  CB  . THR A 1 33 ? -10.572 1.853   -1.135  1.00 0.00 ? 33 THR A CB  13 
ATOM   9046  O  OG1 . THR A 1 33 ? -11.061 2.700   -2.169  1.00 0.00 ? 33 THR A OG1 13 
ATOM   9047  C  CG2 . THR A 1 33 ? -11.408 0.560   -1.270  1.00 0.00 ? 33 THR A CG2 13 
ATOM   9048  N  N   . THR A 1 34 ? -9.352  1.085   1.841   1.00 0.00 ? 34 THR A N   13 
ATOM   9049  C  CA  . THR A 1 34 ? -9.195  0.262   3.034   1.00 0.00 ? 34 THR A CA  13 
ATOM   9050  C  C   . THR A 1 34 ? -8.692  1.088   4.196   1.00 0.00 ? 34 THR A C   13 
ATOM   9051  O  O   . THR A 1 34 ? -8.625  0.615   5.342   1.00 0.00 ? 34 THR A O   13 
ATOM   9052  C  CB  . THR A 1 34 ? -8.240  -0.946  2.751   1.00 0.00 ? 34 THR A CB  13 
ATOM   9053  O  OG1 . THR A 1 34 ? -8.774  -1.770  1.722   1.00 0.00 ? 34 THR A OG1 13 
ATOM   9054  C  CG2 . THR A 1 34 ? -7.989  -1.912  3.929   1.00 0.00 ? 34 THR A CG2 13 
ATOM   9055  N  N   . GLY A 1 35 ? -8.248  2.468   3.901   1.00 0.00 ? 35 GLY A N   13 
ATOM   9056  C  CA  . GLY A 1 35 ? -7.911  3.414   4.960   1.00 0.00 ? 35 GLY A CA  13 
ATOM   9057  C  C   . GLY A 1 35 ? -6.596  3.085   5.624   1.00 0.00 ? 35 GLY A C   13 
ATOM   9058  O  O   . GLY A 1 35 ? -6.493  3.025   6.862   1.00 0.00 ? 35 GLY A O   13 
ATOM   9059  N  N   . ILE A 1 36 ? -5.429  2.871   4.742   1.00 0.00 ? 36 ILE A N   13 
ATOM   9060  C  CA  . ILE A 1 36 ? -4.069  2.723   5.262   1.00 0.00 ? 36 ILE A CA  13 
ATOM   9061  C  C   . ILE A 1 36 ? -3.096  3.534   4.441   1.00 0.00 ? 36 ILE A C   13 
ATOM   9062  O  O   . ILE A 1 36 ? -3.233  3.628   3.199   1.00 0.00 ? 36 ILE A O   13 
ATOM   9063  C  CB  . ILE A 1 36 ? -3.633  1.204   5.360   1.00 0.00 ? 36 ILE A CB  13 
ATOM   9064  C  CG1 . ILE A 1 36 ? -3.130  0.565   4.027   1.00 0.00 ? 36 ILE A CG1 13 
ATOM   9065  C  CG2 . ILE A 1 36 ? -4.760  0.291   5.939   1.00 0.00 ? 36 ILE A CG2 13 
ATOM   9066  C  CD1 . ILE A 1 36 ? -1.955  -0.426  4.157   1.00 0.00 ? 36 ILE A CD1 13 
ATOM   9067  N  N   . PHE A 1 37 ? -1.999  4.242   5.134   1.00 0.00 ? 37 PHE A N   13 
ATOM   9068  C  CA  . PHE A 1 37 ? -0.907  4.912   4.395   1.00 0.00 ? 37 PHE A CA  13 
ATOM   9069  C  C   . PHE A 1 37 ? 0.380   4.160   4.616   1.00 0.00 ? 37 PHE A C   13 
ATOM   9070  O  O   . PHE A 1 37 ? 0.972   4.228   5.724   1.00 0.00 ? 37 PHE A O   13 
ATOM   9071  C  CB  . PHE A 1 37 ? -0.827  6.402   4.826   1.00 0.00 ? 37 PHE A CB  13 
ATOM   9072  C  CG  . PHE A 1 37 ? -0.074  6.888   6.073   1.00 0.00 ? 37 PHE A CG  13 
ATOM   9073  C  CD1 . PHE A 1 37 ? -0.102  6.200   7.285   1.00 0.00 ? 37 PHE A CD1 13 
ATOM   9074  C  CD2 . PHE A 1 37 ? 0.603   8.120   6.003   1.00 0.00 ? 37 PHE A CD2 13 
ATOM   9075  C  CE1 . PHE A 1 37 ? 0.529   6.727   8.408   1.00 0.00 ? 37 PHE A CE1 13 
ATOM   9076  C  CE2 . PHE A 1 37 ? 1.224   8.651   7.127   1.00 0.00 ? 37 PHE A CE2 13 
ATOM   9077  C  CZ  . PHE A 1 37 ? 1.188   7.952   8.331   1.00 0.00 ? 37 PHE A CZ  13 
ATOM   9078  N  N   . CYS A 1 38 ? 0.929   3.304   3.544   1.00 0.00 ? 38 CYS A N   13 
ATOM   9079  C  CA  . CYS A 1 38 ? 2.046   2.380   3.763   1.00 0.00 ? 38 CYS A CA  13 
ATOM   9080  C  C   . CYS A 1 38 ? 3.183   2.684   2.823   1.00 0.00 ? 38 CYS A C   13 
ATOM   9081  O  O   . CYS A 1 38 ? 3.026   3.438   1.842   1.00 0.00 ? 38 CYS A O   13 
ATOM   9082  C  CB  . CYS A 1 38 ? 1.510   0.943   3.526   1.00 0.00 ? 38 CYS A CB  13 
ATOM   9083  S  SG  . CYS A 1 38 ? 2.723   -0.321  3.992   1.00 0.00 ? 38 CYS A SG  13 
ATOM   9084  N  N   . ARG A 1 39 ? 4.476   2.025   3.096   1.00 0.00 ? 39 ARG A N   13 
ATOM   9085  C  CA  . ARG A 1 39 ? 5.545   2.032   2.082   1.00 0.00 ? 39 ARG A CA  13 
ATOM   9086  C  C   . ARG A 1 39 ? 5.135   1.091   0.957   1.00 0.00 ? 39 ARG A C   13 
ATOM   9087  O  O   . ARG A 1 39 ? 4.084   0.410   0.992   1.00 0.00 ? 39 ARG A O   13 
ATOM   9088  C  CB  . ARG A 1 39 ? 6.903   1.728   2.751   1.00 0.00 ? 39 ARG A CB  13 
ATOM   9089  C  CG  . ARG A 1 39 ? 7.525   0.337   2.445   1.00 0.00 ? 39 ARG A CG  13 
ATOM   9090  C  CD  . ARG A 1 39 ? 8.969   0.209   2.946   1.00 0.00 ? 39 ARG A CD  13 
ATOM   9091  N  NE  . ARG A 1 39 ? 8.961   -0.524  4.237   1.00 0.00 ? 39 ARG A NE  13 
ATOM   9092  C  CZ  . ARG A 1 39 ? 10.017  -0.736  5.010   1.00 0.00 ? 39 ARG A CZ  13 
ATOM   9093  N  NH1 . ARG A 1 39 ? 11.221  -0.326  4.739   1.00 0.00 ? 39 ARG A NH1 13 
ATOM   9094  N  NH2 . ARG A 1 39 ? 9.832   -1.392  6.101   1.00 0.00 ? 39 ARG A NH2 13 
ATOM   9095  N  N   . PRO A 1 40 ? 6.019   1.029   -0.221  1.00 0.00 ? 40 PRO A N   13 
ATOM   9096  C  CA  . PRO A 1 40 ? 5.852   0.217   -1.505  1.00 0.00 ? 40 PRO A CA  13 
ATOM   9097  C  C   . PRO A 1 40 ? 4.866   -0.916  -1.626  1.00 0.00 ? 40 PRO A C   13 
ATOM   9098  O  O   . PRO A 1 40 ? 4.315   -1.116  -2.754  1.00 0.00 ? 40 PRO A O   13 
ATOM   9099  C  CB  . PRO A 1 40 ? 7.266   -0.279  -1.826  1.00 0.00 ? 40 PRO A CB  13 
ATOM   9100  C  CG  . PRO A 1 40 ? 8.142   0.869   -1.309  1.00 0.00 ? 40 PRO A CG  13 
ATOM   9101  C  CD  . PRO A 1 40 ? 7.296   1.775   -0.410  1.00 0.00 ? 40 PRO A CD  13 
ATOM   9102  N  N   . SER A 1 41 ? 4.503   -1.765  -0.472  1.00 0.00 ? 41 SER A N   13 
ATOM   9103  C  CA  . SER A 1 41 ? 3.510   -2.833  -0.576  1.00 0.00 ? 41 SER A CA  13 
ATOM   9104  C  C   . SER A 1 41 ? 3.010   -3.337  0.756   1.00 0.00 ? 41 SER A C   13 
ATOM   9105  O  O   . SER A 1 41 ? 3.630   -3.200  1.817   1.00 0.00 ? 41 SER A O   13 
ATOM   9106  C  CB  . SER A 1 41 ? 4.063   -3.999  -1.441  1.00 0.00 ? 41 SER A CB  13 
ATOM   9107  O  OG  . SER A 1 41 ? 3.152   -5.099  -1.539  1.00 0.00 ? 41 SER A OG  13 
ATOM   9108  N  N   . CYS A 1 42 ? 1.711   -4.065  0.713   1.00 0.00 ? 42 CYS A N   13 
ATOM   9109  C  CA  . CYS A 1 42 ? 1.154   -4.799  1.839   1.00 0.00 ? 42 CYS A CA  13 
ATOM   9110  C  C   . CYS A 1 42 ? 0.797   -6.216  1.390   1.00 0.00 ? 42 CYS A C   13 
ATOM   9111  O  O   . CYS A 1 42 ? 0.185   -6.426  0.335   1.00 0.00 ? 42 CYS A O   13 
ATOM   9112  C  CB  . CYS A 1 42 ? -0.056  -4.105  2.489   1.00 0.00 ? 42 CYS A CB  13 
ATOM   9113  S  SG  . CYS A 1 42 ? 0.245   -2.360  2.820   1.00 0.00 ? 42 CYS A SG  13 
ATOM   9114  N  N   . ARG A 1 43 ? 1.264   -7.299  2.276   1.00 0.00 ? 43 ARG A N   13 
ATOM   9115  C  CA  . ARG A 1 43 ? 1.155   -8.709  1.901   1.00 0.00 ? 43 ARG A CA  13 
ATOM   9116  C  C   . ARG A 1 43 ? -0.262  -9.209  2.024   1.00 0.00 ? 43 ARG A C   13 
ATOM   9117  O  O   . ARG A 1 43 ? -0.543  -10.408 1.852   1.00 0.00 ? 43 ARG A O   13 
ATOM   9118  C  CB  . ARG A 1 43 ? 2.183   -9.508  2.749   1.00 0.00 ? 43 ARG A CB  13 
ATOM   9119  C  CG  . ARG A 1 43 ? 3.460   -8.700  3.123   1.00 0.00 ? 43 ARG A CG  13 
ATOM   9120  C  CD  . ARG A 1 43 ? 4.285   -9.385  4.219   1.00 0.00 ? 43 ARG A CD  13 
ATOM   9121  N  NE  . ARG A 1 43 ? 5.705   -9.427  3.788   1.00 0.00 ? 43 ARG A NE  13 
ATOM   9122  C  CZ  . ARG A 1 43 ? 6.738   -9.715  4.569   1.00 0.00 ? 43 ARG A CZ  13 
ATOM   9123  N  NH1 . ARG A 1 43 ? 6.645   -10.002 5.834   1.00 0.00 ? 43 ARG A NH1 13 
ATOM   9124  N  NH2 . ARG A 1 43 ? 7.907   -9.706  4.034   1.00 0.00 ? 43 ARG A NH2 13 
ATOM   9125  N  N   . ALA A 1 44 ? -1.302  -8.213  2.358   1.00 0.00 ? 44 ALA A N   13 
ATOM   9126  C  CA  . ALA A 1 44 ? -2.726  -8.517  2.314   1.00 0.00 ? 44 ALA A CA  13 
ATOM   9127  C  C   . ALA A 1 44 ? -3.268  -8.282  0.915   1.00 0.00 ? 44 ALA A C   13 
ATOM   9128  O  O   . ALA A 1 44 ? -2.542  -7.982  -0.040  1.00 0.00 ? 44 ALA A O   13 
ATOM   9129  C  CB  . ALA A 1 44 ? -3.423  -7.627  3.360   1.00 0.00 ? 44 ALA A CB  13 
ATOM   9130  N  N   . ARG A 1 45 ? -4.734  -8.481  0.778   1.00 0.00 ? 45 ARG A N   13 
ATOM   9131  C  CA  . ARG A 1 45 ? -5.439  -8.192  -0.465  1.00 0.00 ? 45 ARG A CA  13 
ATOM   9132  C  C   . ARG A 1 45 ? -4.900  -6.935  -1.110  1.00 0.00 ? 45 ARG A C   13 
ATOM   9133  O  O   . ARG A 1 45 ? -4.678  -6.875  -2.328  1.00 0.00 ? 45 ARG A O   13 
ATOM   9134  C  CB  . ARG A 1 45 ? -6.959  -8.069  -0.174  1.00 0.00 ? 45 ARG A CB  13 
ATOM   9135  C  CG  . ARG A 1 45 ? -7.322  -7.174  1.040   1.00 0.00 ? 45 ARG A CG  13 
ATOM   9136  C  CD  . ARG A 1 45 ? -8.701  -6.517  0.900   1.00 0.00 ? 45 ARG A CD  13 
ATOM   9137  N  NE  . ARG A 1 45 ? -9.706  -7.583  0.658   1.00 0.00 ? 45 ARG A NE  13 
ATOM   9138  C  CZ  . ARG A 1 45 ? -10.211 -7.923  -0.520  1.00 0.00 ? 45 ARG A CZ  13 
ATOM   9139  N  NH1 . ARG A 1 45 ? -9.884  -7.364  -1.647  1.00 0.00 ? 45 ARG A NH1 13 
ATOM   9140  N  NH2 . ARG A 1 45 ? -11.082 -8.869  -0.542  1.00 0.00 ? 45 ARG A NH2 13 
ATOM   9141  N  N   . HIS A 1 46 ? -4.615  -5.798  -0.208  1.00 0.00 ? 46 HIS A N   13 
ATOM   9142  C  CA  . HIS A 1 46 ? -4.144  -4.508  -0.707  1.00 0.00 ? 46 HIS A CA  13 
ATOM   9143  C  C   . HIS A 1 46 ? -5.093  -3.945  -1.737  1.00 0.00 ? 46 HIS A C   13 
ATOM   9144  O  O   . HIS A 1 46 ? -6.079  -4.584  -2.136  1.00 0.00 ? 46 HIS A O   13 
ATOM   9145  C  CB  . HIS A 1 46 ? -2.757  -4.762  -1.318  1.00 0.00 ? 46 HIS A CB  13 
ATOM   9146  C  CG  . HIS A 1 46 ? -2.655  -4.320  -2.748  1.00 0.00 ? 46 HIS A CG  13 
ATOM   9147  N  ND1 . HIS A 1 46 ? -3.404  -4.817  -3.812  1.00 0.00 ? 46 HIS A ND1 13 
ATOM   9148  C  CD2 . HIS A 1 46 ? -1.769  -3.336  -3.167  1.00 0.00 ? 46 HIS A CD2 13 
ATOM   9149  C  CE1 . HIS A 1 46 ? -2.897  -4.078  -4.816  1.00 0.00 ? 46 HIS A CE1 13 
ATOM   9150  N  NE2 . HIS A 1 46 ? -1.925  -3.173  -4.519  1.00 0.00 ? 46 HIS A NE2 13 
ATOM   9151  N  N   . ALA A 1 47 ? -4.812  -2.574  -2.222  1.00 0.00 ? 47 ALA A N   13 
ATOM   9152  C  CA  . ALA A 1 47 ? -5.748  -1.858  -3.083  1.00 0.00 ? 47 ALA A CA  13 
ATOM   9153  C  C   . ALA A 1 47 ? -5.052  -1.242  -4.274  1.00 0.00 ? 47 ALA A C   13 
ATOM   9154  O  O   . ALA A 1 47 ? -3.820  -1.253  -4.395  1.00 0.00 ? 47 ALA A O   13 
ATOM   9155  C  CB  . ALA A 1 47 ? -6.477  -0.818  -2.215  1.00 0.00 ? 47 ALA A CB  13 
ATOM   9156  N  N   . LEU A 1 48 ? -5.930  -0.588  -5.271  1.00 0.00 ? 48 LEU A N   13 
ATOM   9157  C  CA  . LEU A 1 48 ? -5.434  -0.098  -6.553  1.00 0.00 ? 48 LEU A CA  13 
ATOM   9158  C  C   . LEU A 1 48 ? -4.900  1.311   -6.445  1.00 0.00 ? 48 LEU A C   13 
ATOM   9159  O  O   . LEU A 1 48 ? -4.953  1.958   -5.390  1.00 0.00 ? 48 LEU A O   13 
ATOM   9160  C  CB  . LEU A 1 48 ? -6.551  -0.181  -7.635  1.00 0.00 ? 48 LEU A CB  13 
ATOM   9161  C  CG  . LEU A 1 48 ? -8.031  -0.140  -7.167  1.00 0.00 ? 48 LEU A CG  13 
ATOM   9162  C  CD1 . LEU A 1 48 ? -8.260  1.061   -6.239  1.00 0.00 ? 48 LEU A CD1 13 
ATOM   9163  C  CD2 . LEU A 1 48 ? -9.023  -0.084  -8.341  1.00 0.00 ? 48 LEU A CD2 13 
ATOM   9164  N  N   . ARG A 1 49 ? -4.342  1.889   -7.688  1.00 0.00 ? 49 ARG A N   13 
ATOM   9165  C  CA  . ARG A 1 49 ? -3.877  3.270   -7.785  1.00 0.00 ? 49 ARG A CA  13 
ATOM   9166  C  C   . ARG A 1 49 ? -4.999  4.207   -8.164  1.00 0.00 ? 49 ARG A C   13 
ATOM   9167  O  O   . ARG A 1 49 ? -4.779  5.365   -8.546  1.00 0.00 ? 49 ARG A O   13 
ATOM   9168  C  CB  . ARG A 1 49 ? -2.729  3.329   -8.837  1.00 0.00 ? 49 ARG A CB  13 
ATOM   9169  C  CG  . ARG A 1 49 ? -3.088  2.717   -10.215 1.00 0.00 ? 49 ARG A CG  13 
ATOM   9170  C  CD  . ARG A 1 49 ? -2.191  3.229   -11.352 1.00 0.00 ? 49 ARG A CD  13 
ATOM   9171  N  NE  . ARG A 1 49 ? -2.810  4.455   -11.915 1.00 0.00 ? 49 ARG A NE  13 
ATOM   9172  C  CZ  . ARG A 1 49 ? -2.819  4.803   -13.195 1.00 0.00 ? 49 ARG A CZ  13 
ATOM   9173  N  NH1 . ARG A 1 49 ? -2.272  4.110   -14.148 1.00 0.00 ? 49 ARG A NH1 13 
ATOM   9174  N  NH2 . ARG A 1 49 ? -3.411  5.902   -13.507 1.00 0.00 ? 49 ARG A NH2 13 
ATOM   9175  N  N   . GLU A 1 50 ? -6.374  3.680   -8.025  1.00 0.00 ? 50 GLU A N   13 
ATOM   9176  C  CA  . GLU A 1 50 ? -7.538  4.402   -8.528  1.00 0.00 ? 50 GLU A CA  13 
ATOM   9177  C  C   . GLU A 1 50 ? -8.067  5.404   -7.531  1.00 0.00 ? 50 GLU A C   13 
ATOM   9178  O  O   . GLU A 1 50 ? -8.784  6.359   -7.901  1.00 0.00 ? 50 GLU A O   13 
ATOM   9179  C  CB  . GLU A 1 50 ? -8.630  3.363   -8.913  1.00 0.00 ? 50 GLU A CB  13 
ATOM   9180  C  CG  . GLU A 1 50 ? -8.210  2.217   -9.893  1.00 0.00 ? 50 GLU A CG  13 
ATOM   9181  C  CD  . GLU A 1 50 ? -8.379  2.445   -11.397 1.00 0.00 ? 50 GLU A CD  13 
ATOM   9182  O  OE1 . GLU A 1 50 ? -8.140  3.516   -11.940 1.00 0.00 ? 50 GLU A OE1 13 
ATOM   9183  O  OE2 . GLU A 1 50 ? -8.818  1.346   -12.072 1.00 0.00 ? 50 GLU A OE2 13 
ATOM   9184  N  N   . ASN A 1 51 ? -7.744  5.198   -6.113  1.00 0.00 ? 51 ASN A N   13 
ATOM   9185  C  CA  . ASN A 1 51 ? -8.261  6.060   -5.018  1.00 0.00 ? 51 ASN A CA  13 
ATOM   9186  C  C   . ASN A 1 51 ? -7.076  6.407   -4.133  1.00 0.00 ? 51 ASN A C   13 
ATOM   9187  O  O   . ASN A 1 51 ? -7.212  6.782   -2.960  1.00 0.00 ? 51 ASN A O   13 
ATOM   9188  C  CB  . ASN A 1 51 ? -9.190  5.130   -4.191  1.00 0.00 ? 51 ASN A CB  13 
ATOM   9189  C  CG  . ASN A 1 51 ? -8.454  4.077   -3.328  1.00 0.00 ? 51 ASN A CG  13 
ATOM   9190  O  OD1 . ASN A 1 51 ? -7.763  3.199   -3.818  1.00 0.00 ? 51 ASN A OD1 13 
ATOM   9191  N  ND2 . ASN A 1 51 ? -8.601  4.140   -2.034  1.00 0.00 ? 51 ASN A ND2 13 
ATOM   9192  N  N   . VAL A 1 52 ? -5.744  6.209   -4.743  1.00 0.00 ? 52 VAL A N   13 
ATOM   9193  C  CA  . VAL A 1 52 ? -4.521  6.127   -3.953  1.00 0.00 ? 52 VAL A CA  13 
ATOM   9194  C  C   . VAL A 1 52 ? -3.845  7.467   -3.862  1.00 0.00 ? 52 VAL A C   13 
ATOM   9195  O  O   . VAL A 1 52 ? -4.150  8.391   -4.659  1.00 0.00 ? 52 VAL A O   13 
ATOM   9196  C  CB  . VAL A 1 52 ? -3.587  4.994   -4.535  1.00 0.00 ? 52 VAL A CB  13 
ATOM   9197  C  CG1 . VAL A 1 52 ? -2.318  5.453   -5.301  1.00 0.00 ? 52 VAL A CG1 13 
ATOM   9198  C  CG2 . VAL A 1 52 ? -3.085  3.983   -3.470  1.00 0.00 ? 52 VAL A CG2 13 
ATOM   9199  N  N   . SER A 1 53 ? -2.788  7.671   -2.848  1.00 0.00 ? 53 SER A N   13 
ATOM   9200  C  CA  . SER A 1 53 ? -1.972  8.885   -2.814  1.00 0.00 ? 53 SER A CA  13 
ATOM   9201  C  C   . SER A 1 53 ? -0.500  8.553   -2.832  1.00 0.00 ? 53 SER A C   13 
ATOM   9202  O  O   . SER A 1 53 ? -0.093  7.385   -2.758  1.00 0.00 ? 53 SER A O   13 
ATOM   9203  C  CB  . SER A 1 53 ? -2.349  9.778   -1.608  1.00 0.00 ? 53 SER A CB  13 
ATOM   9204  O  OG  . SER A 1 53 ? -1.660  11.035  -1.610  1.00 0.00 ? 53 SER A OG  13 
ATOM   9205  N  N   . PHE A 1 54 ? 0.434   9.694   -2.983  1.00 0.00 ? 54 PHE A N   13 
ATOM   9206  C  CA  . PHE A 1 54 ? 1.879   9.518   -2.888  1.00 0.00 ? 54 PHE A CA  13 
ATOM   9207  C  C   . PHE A 1 54 ? 2.545   10.664  -2.162  1.00 0.00 ? 54 PHE A C   13 
ATOM   9208  O  O   . PHE A 1 54 ? 2.100   11.820  -2.185  1.00 0.00 ? 54 PHE A O   13 
ATOM   9209  C  CB  . PHE A 1 54 ? 2.508   9.393   -4.308  1.00 0.00 ? 54 PHE A CB  13 
ATOM   9210  C  CG  . PHE A 1 54 ? 1.862   8.377   -5.263  1.00 0.00 ? 54 PHE A CG  13 
ATOM   9211  C  CD1 . PHE A 1 54 ? 1.844   7.020   -4.923  1.00 0.00 ? 54 PHE A CD1 13 
ATOM   9212  C  CD2 . PHE A 1 54 ? 1.302   8.791   -6.475  1.00 0.00 ? 54 PHE A CD2 13 
ATOM   9213  C  CE1 . PHE A 1 54 ? 1.268   6.089   -5.781  1.00 0.00 ? 54 PHE A CE1 13 
ATOM   9214  C  CE2 . PHE A 1 54 ? 0.727   7.857   -7.333  1.00 0.00 ? 54 PHE A CE2 13 
ATOM   9215  C  CZ  . PHE A 1 54 ? 0.710   6.507   -6.986  1.00 0.00 ? 54 PHE A CZ  13 
ATOM   9216  N  N   . TYR A 1 55 ? 3.767   10.317  -1.401  1.00 0.00 ? 55 TYR A N   13 
ATOM   9217  C  CA  . TYR A 1 55 ? 4.528   11.278  -0.605  1.00 0.00 ? 55 TYR A CA  13 
ATOM   9218  C  C   . TYR A 1 55 ? 5.984   10.861  -0.545  1.00 0.00 ? 55 TYR A C   13 
ATOM   9219  O  O   . TYR A 1 55 ? 6.322   9.685   -0.837  1.00 0.00 ? 55 TYR A O   13 
ATOM   9220  C  CB  . TYR A 1 55 ? 3.964   11.345  0.844   1.00 0.00 ? 55 TYR A CB  13 
ATOM   9221  C  CG  . TYR A 1 55 ? 2.473   11.018  1.018   1.00 0.00 ? 55 TYR A CG  13 
ATOM   9222  C  CD1 . TYR A 1 55 ? 1.935   9.798   0.601   1.00 0.00 ? 55 TYR A CD1 13 
ATOM   9223  C  CD2 . TYR A 1 55 ? 1.617   11.973  1.601   1.00 0.00 ? 55 TYR A CD2 13 
ATOM   9224  C  CE1 . TYR A 1 55 ? 0.579   9.529   0.766   1.00 0.00 ? 55 TYR A CE1 13 
ATOM   9225  C  CE2 . TYR A 1 55 ? 0.264   11.704  1.762   1.00 0.00 ? 55 TYR A CE2 13 
ATOM   9226  C  CZ  . TYR A 1 55 ? -0.254  10.480  1.346   1.00 0.00 ? 55 TYR A CZ  13 
ATOM   9227  O  OH  . TYR A 1 55 ? -1.584  10.213  1.507   1.00 0.00 ? 55 TYR A OH  13 
ATOM   9228  N  N   . ALA A 1 56 ? 7.021   11.853  -0.189  1.00 0.00 ? 56 ALA A N   13 
ATOM   9229  C  CA  . ALA A 1 56 ? 8.428   11.488  0.007   1.00 0.00 ? 56 ALA A CA  13 
ATOM   9230  C  C   . ALA A 1 56 ? 8.673   10.894  1.372   1.00 0.00 ? 56 ALA A C   13 
ATOM   9231  O  O   . ALA A 1 56 ? 9.643   10.142  1.583   1.00 0.00 ? 56 ALA A O   13 
ATOM   9232  C  CB  . ALA A 1 56 ? 9.268   12.750  -0.254  1.00 0.00 ? 56 ALA A CB  13 
ATOM   9233  N  N   . ASN A 1 57 ? 7.742   11.270  2.458   1.00 0.00 ? 57 ASN A N   13 
ATOM   9234  C  CA  . ASN A 1 57 ? 7.820   10.656  3.784   1.00 0.00 ? 57 ASN A CA  13 
ATOM   9235  C  C   . ASN A 1 57 ? 6.444   10.455  4.373   1.00 0.00 ? 57 ASN A C   13 
ATOM   9236  O  O   . ASN A 1 57 ? 5.458   11.075  3.947   1.00 0.00 ? 57 ASN A O   13 
ATOM   9237  C  CB  . ASN A 1 57 ? 8.702   11.541  4.711   1.00 0.00 ? 57 ASN A CB  13 
ATOM   9238  C  CG  . ASN A 1 57 ? 8.814   11.117  6.179   1.00 0.00 ? 57 ASN A CG  13 
ATOM   9239  O  OD1 . ASN A 1 57 ? 8.499   11.857  7.099   1.00 0.00 ? 57 ASN A OD1 13 
ATOM   9240  N  ND2 . ASN A 1 57 ? 9.267   9.924   6.455   1.00 0.00 ? 57 ASN A ND2 13 
ATOM   9241  N  N   . ALA A 1 58 ? 6.318   9.453   5.457   1.00 0.00 ? 58 ALA A N   13 
ATOM   9242  C  CA  . ALA A 1 58 ? 5.059   9.218   6.156   1.00 0.00 ? 58 ALA A CA  13 
ATOM   9243  C  C   . ALA A 1 58 ? 4.623   10.417  6.963   1.00 0.00 ? 58 ALA A C   13 
ATOM   9244  O  O   . ALA A 1 58 ? 3.417   10.643  7.177   1.00 0.00 ? 58 ALA A O   13 
ATOM   9245  C  CB  . ALA A 1 58 ? 5.224   7.952   7.018   1.00 0.00 ? 58 ALA A CB  13 
ATOM   9246  N  N   . SER A 1 59 ? 5.678   11.289  7.523   1.00 0.00 ? 59 SER A N   13 
ATOM   9247  C  CA  . SER A 1 59 ? 5.358   12.516  8.249   1.00 0.00 ? 59 SER A CA  13 
ATOM   9248  C  C   . SER A 1 59 ? 4.362   13.358  7.486   1.00 0.00 ? 59 SER A C   13 
ATOM   9249  O  O   . SER A 1 59 ? 3.553   14.093  8.072   1.00 0.00 ? 59 SER A O   13 
ATOM   9250  C  CB  . SER A 1 59 ? 6.640   13.317  8.586   1.00 0.00 ? 59 SER A CB  13 
ATOM   9251  O  OG  . SER A 1 59 ? 6.445   14.735  8.517   1.00 0.00 ? 59 SER A OG  13 
ATOM   9252  N  N   . GLU A 1 60 ? 4.427   13.294  6.010   1.00 0.00 ? 60 GLU A N   13 
ATOM   9253  C  CA  . GLU A 1 60 ? 3.528   14.068  5.157   1.00 0.00 ? 60 GLU A CA  13 
ATOM   9254  C  C   . GLU A 1 60 ? 2.132   13.493  5.161   1.00 0.00 ? 60 GLU A C   13 
ATOM   9255  O  O   . GLU A 1 60 ? 1.162   14.138  5.588   1.00 0.00 ? 60 GLU A O   13 
ATOM   9256  C  CB  . GLU A 1 60 ? 4.120   14.114  3.720   1.00 0.00 ? 60 GLU A CB  13 
ATOM   9257  C  CG  . GLU A 1 60 ? 3.109   14.254  2.535   1.00 0.00 ? 60 GLU A CG  13 
ATOM   9258  C  CD  . GLU A 1 60 ? 2.905   15.637  1.912   1.00 0.00 ? 60 GLU A CD  13 
ATOM   9259  O  OE1 . GLU A 1 60 ? 3.722   16.159  1.165   1.00 0.00 ? 60 GLU A OE1 13 
ATOM   9260  O  OE2 . GLU A 1 60 ? 1.732   16.231  2.269   1.00 0.00 ? 60 GLU A OE2 13 
ATOM   9261  N  N   . ALA A 1 61 ? 1.969   12.139  4.587   1.00 0.00 ? 61 ALA A N   13 
ATOM   9262  C  CA  . ALA A 1 61 ? 0.707   11.413  4.690   1.00 0.00 ? 61 ALA A CA  13 
ATOM   9263  C  C   . ALA A 1 61 ? 0.204   11.340  6.112   1.00 0.00 ? 61 ALA A C   13 
ATOM   9264  O  O   . ALA A 1 61 ? -0.977  11.002  6.350   1.00 0.00 ? 61 ALA A O   13 
ATOM   9265  C  CB  . ALA A 1 61 ? 0.902   10.045  4.015   1.00 0.00 ? 61 ALA A CB  13 
ATOM   9266  N  N   . LEU A 1 62 ? 1.121   11.712  7.211   1.00 0.00 ? 62 LEU A N   13 
ATOM   9267  C  CA  . LEU A 1 62 ? 0.659   11.843  8.595   1.00 0.00 ? 62 LEU A CA  13 
ATOM   9268  C  C   . LEU A 1 62 ? 0.060   13.211  8.824   1.00 0.00 ? 62 LEU A C   13 
ATOM   9269  O  O   . LEU A 1 62 ? -0.963  13.370  9.503   1.00 0.00 ? 62 LEU A O   13 
ATOM   9270  C  CB  . LEU A 1 62 ? 1.810   11.563  9.600   1.00 0.00 ? 62 LEU A CB  13 
ATOM   9271  C  CG  . LEU A 1 62 ? 1.436   11.025  11.009  1.00 0.00 ? 62 LEU A CG  13 
ATOM   9272  C  CD1 . LEU A 1 62 ? 2.178   9.710   11.286  1.00 0.00 ? 62 LEU A CD1 13 
ATOM   9273  C  CD2 . LEU A 1 62 ? 1.735   12.034  12.129  1.00 0.00 ? 62 LEU A CD2 13 
ATOM   9274  N  N   . ALA A 1 63 ? 0.791   14.352  8.233   1.00 0.00 ? 63 ALA A N   13 
ATOM   9275  C  CA  . ALA A 1 63 ? 0.232   15.704  8.209   1.00 0.00 ? 63 ALA A CA  13 
ATOM   9276  C  C   . ALA A 1 63 ? -1.162  15.683  7.625   1.00 0.00 ? 63 ALA A C   13 
ATOM   9277  O  O   . ALA A 1 63 ? -2.005  16.546  7.901   1.00 0.00 ? 63 ALA A O   13 
ATOM   9278  C  CB  . ALA A 1 63 ? 1.197   16.605  7.423   1.00 0.00 ? 63 ALA A CB  13 
ATOM   9279  N  N   . ALA A 1 64 ? -1.453  14.571  6.688   1.00 0.00 ? 64 ALA A N   13 
ATOM   9280  C  CA  . ALA A 1 64 ? -2.796  14.311  6.180   1.00 0.00 ? 64 ALA A CA  13 
ATOM   9281  C  C   . ALA A 1 64 ? -3.666  13.754  7.293   1.00 0.00 ? 64 ALA A C   13 
ATOM   9282  O  O   . ALA A 1 64 ? -4.837  14.110  7.467   1.00 0.00 ? 64 ALA A O   13 
ATOM   9283  C  CB  . ALA A 1 64 ? -2.671  13.348  4.990   1.00 0.00 ? 64 ALA A CB  13 
ATOM   9284  N  N   . GLY A 1 65 ? -2.992  12.772  8.176   1.00 0.00 ? 65 GLY A N   13 
ATOM   9285  C  CA  . GLY A 1 65 ? -3.619  12.253  9.388   1.00 0.00 ? 65 GLY A CA  13 
ATOM   9286  C  C   . GLY A 1 65 ? -4.145  10.851  9.133   1.00 0.00 ? 65 GLY A C   13 
ATOM   9287  O  O   . GLY A 1 65 ? -5.236  10.466  9.574   1.00 0.00 ? 65 GLY A O   13 
ATOM   9288  N  N   . PHE A 1 66 ? -3.266  9.986   8.315   1.00 0.00 ? 66 PHE A N   13 
ATOM   9289  C  CA  . PHE A 1 66 ? -3.699  8.685   7.822   1.00 0.00 ? 66 PHE A CA  13 
ATOM   9290  C  C   . PHE A 1 66 ? -3.218  7.552   8.692   1.00 0.00 ? 66 PHE A C   13 
ATOM   9291  O  O   . PHE A 1 66 ? -2.633  7.782   9.773   1.00 0.00 ? 66 PHE A O   13 
ATOM   9292  C  CB  . PHE A 1 66 ? -3.214  8.486   6.353   1.00 0.00 ? 66 PHE A CB  13 
ATOM   9293  C  CG  . PHE A 1 66 ? -4.087  7.563   5.489   1.00 0.00 ? 66 PHE A CG  13 
ATOM   9294  C  CD1 . PHE A 1 66 ? -5.395  7.275   5.912   1.00 0.00 ? 66 PHE A CD1 13 
ATOM   9295  C  CD2 . PHE A 1 66 ? -3.605  6.994   4.310   1.00 0.00 ? 66 PHE A CD2 13 
ATOM   9296  C  CE1 . PHE A 1 66 ? -6.203  6.427   5.164   1.00 0.00 ? 66 PHE A CE1 13 
ATOM   9297  C  CE2 . PHE A 1 66 ? -4.416  6.144   3.562   1.00 0.00 ? 66 PHE A CE2 13 
ATOM   9298  C  CZ  . PHE A 1 66 ? -5.711  5.860   3.991   1.00 0.00 ? 66 PHE A CZ  13 
ATOM   9299  N  N   . ARG A 1 67 ? -3.450  6.167   8.230   1.00 0.00 ? 67 ARG A N   13 
ATOM   9300  C  CA  . ARG A 1 67 ? -3.189  5.017   9.106   1.00 0.00 ? 67 ARG A CA  13 
ATOM   9301  C  C   . ARG A 1 67 ? -1.845  4.375   8.869   1.00 0.00 ? 67 ARG A C   13 
ATOM   9302  O  O   . ARG A 1 67 ? -1.605  3.687   7.869   1.00 0.00 ? 67 ARG A O   13 
ATOM   9303  C  CB  . ARG A 1 67 ? -4.358  4.008   8.941   1.00 0.00 ? 67 ARG A CB  13 
ATOM   9304  C  CG  . ARG A 1 67 ? -4.044  2.531   9.290   1.00 0.00 ? 67 ARG A CG  13 
ATOM   9305  C  CD  . ARG A 1 67 ? -3.137  2.373   10.516  1.00 0.00 ? 67 ARG A CD  13 
ATOM   9306  N  NE  . ARG A 1 67 ? -3.305  0.994   11.043  1.00 0.00 ? 67 ARG A NE  13 
ATOM   9307  C  CZ  . ARG A 1 67 ? -3.378  0.661   12.325  1.00 0.00 ? 67 ARG A CZ  13 
ATOM   9308  N  NH1 . ARG A 1 67 ? -3.307  1.509   13.308  1.00 0.00 ? 67 ARG A NH1 13 
ATOM   9309  N  NH2 . ARG A 1 67 ? -3.532  -0.584  12.606  1.00 0.00 ? 67 ARG A NH2 13 
ATOM   9310  N  N   . PRO A 1 68 ? -0.826  4.588   9.928   1.00 0.00 ? 68 PRO A N   13 
ATOM   9311  C  CA  . PRO A 1 68 ? 0.606   4.053   9.962   1.00 0.00 ? 68 PRO A CA  13 
ATOM   9312  C  C   . PRO A 1 68 ? 0.817   2.623   9.523   1.00 0.00 ? 68 PRO A C   13 
ATOM   9313  O  O   . PRO A 1 68 ? 0.433   1.675   10.240  1.00 0.00 ? 68 PRO A O   13 
ATOM   9314  C  CB  . PRO A 1 68 ? 1.035   4.150   11.437  1.00 0.00 ? 68 PRO A CB  13 
ATOM   9315  C  CG  . PRO A 1 68 ? 0.369   5.479   11.819  1.00 0.00 ? 68 PRO A CG  13 
ATOM   9316  C  CD  . PRO A 1 68 ? -1.017  5.382   11.173  1.00 0.00 ? 68 PRO A CD  13 
ATOM   9317  N  N   . CYS A 1 69 ? 1.522   2.373   8.248   1.00 0.00 ? 69 CYS A N   13 
ATOM   9318  C  CA  . CYS A 1 69 ? 1.949   1.042   7.813   1.00 0.00 ? 69 CYS A CA  13 
ATOM   9319  C  C   . CYS A 1 69 ? 3.400   1.094   7.372   1.00 0.00 ? 69 CYS A C   13 
ATOM   9320  O  O   . CYS A 1 69 ? 3.790   1.395   6.237   1.00 0.00 ? 69 CYS A O   13 
ATOM   9321  C  CB  . CYS A 1 69 ? 0.929   0.527   6.788   1.00 0.00 ? 69 CYS A CB  13 
ATOM   9322  S  SG  . CYS A 1 69 ? 0.805   -1.268  6.694   1.00 0.00 ? 69 CYS A SG  13 
ATOM   9323  N  N   . LYS A 1 70 ? 4.383   0.794   8.463   1.00 0.00 ? 70 LYS A N   13 
ATOM   9324  C  CA  . LYS A 1 70 ? 5.826   0.905   8.283   1.00 0.00 ? 70 LYS A CA  13 
ATOM   9325  C  C   . LYS A 1 70 ? 6.372   -0.378  7.702   1.00 0.00 ? 70 LYS A C   13 
ATOM   9326  O  O   . LYS A 1 70 ? 6.618   -0.472  6.480   1.00 0.00 ? 70 LYS A O   13 
ATOM   9327  C  CB  . LYS A 1 70 ? 6.504   1.301   9.621   1.00 0.00 ? 70 LYS A CB  13 
ATOM   9328  C  CG  . LYS A 1 70 ? 7.722   2.244   9.435   1.00 0.00 ? 70 LYS A CG  13 
ATOM   9329  C  CD  . LYS A 1 70 ? 8.653   2.347   10.646  1.00 0.00 ? 70 LYS A CD  13 
ATOM   9330  C  CE  . LYS A 1 70 ? 9.994   2.948   10.201  1.00 0.00 ? 70 LYS A CE  13 
ATOM   9331  N  NZ  . LYS A 1 70 ? 11.063  1.951   10.388  1.00 0.00 ? 70 LYS A NZ  13 
ATOM   9332  N  N   . ARG A 1 71 ? 6.576   -1.519  8.617   1.00 0.00 ? 71 ARG A N   13 
ATOM   9333  C  CA  . ARG A 1 71 ? 6.875   -2.864  8.092   1.00 0.00 ? 71 ARG A CA  13 
ATOM   9334  C  C   . ARG A 1 71 ? 5.663   -3.328  7.308   1.00 0.00 ? 71 ARG A C   13 
ATOM   9335  O  O   . ARG A 1 71 ? 5.666   -3.403  6.074   1.00 0.00 ? 71 ARG A O   13 
ATOM   9336  C  CB  . ARG A 1 71 ? 7.223   -3.805  9.269   1.00 0.00 ? 71 ARG A CB  13 
ATOM   9337  C  CG  . ARG A 1 71 ? 7.375   -5.304  8.893   1.00 0.00 ? 71 ARG A CG  13 
ATOM   9338  C  CD  . ARG A 1 71 ? 8.821   -5.799  9.019   1.00 0.00 ? 71 ARG A CD  13 
ATOM   9339  N  NE  . ARG A 1 71 ? 8.966   -6.495  10.323  1.00 0.00 ? 71 ARG A NE  13 
ATOM   9340  C  CZ  . ARG A 1 71 ? 10.086  -6.588  11.027  1.00 0.00 ? 71 ARG A CZ  13 
ATOM   9341  N  NH1 . ARG A 1 71 ? 11.224  -6.074  10.665  1.00 0.00 ? 71 ARG A NH1 13 
ATOM   9342  N  NH2 . ARG A 1 71 ? 10.036  -7.230  12.140  1.00 0.00 ? 71 ARG A NH2 13 
ATOM   9343  N  N   . CYS A 1 72 ? 4.479   -3.682  8.121   1.00 0.00 ? 72 CYS A N   13 
ATOM   9344  C  CA  . CYS A 1 72 ? 3.156   -3.920  7.568   1.00 0.00 ? 72 CYS A CA  13 
ATOM   9345  C  C   . CYS A 1 72 ? 2.171   -4.286  8.667   1.00 0.00 ? 72 CYS A C   13 
ATOM   9346  O  O   . CYS A 1 72 ? 1.824   -5.455  8.878   1.00 0.00 ? 72 CYS A O   13 
ATOM   9347  C  CB  . CYS A 1 72 ? 3.204   -4.946  6.421   1.00 0.00 ? 72 CYS A CB  13 
ATOM   9348  S  SG  . CYS A 1 72 ? 2.991   -4.132  4.822   1.00 0.00 ? 72 CYS A SG  13 
ATOM   9349  N  N   . GLN A 1 73 ? 1.707   -3.167  9.507   1.00 0.00 ? 73 GLN A N   13 
ATOM   9350  C  CA  . GLN A 1 73 ? 0.730   -3.292  10.600  1.00 0.00 ? 73 GLN A CA  13 
ATOM   9351  C  C   . GLN A 1 73 ? -0.435  -4.184  10.285  1.00 0.00 ? 73 GLN A C   13 
ATOM   9352  O  O   . GLN A 1 73 ? -0.646  -4.641  9.154   1.00 0.00 ? 73 GLN A O   13 
ATOM   9353  C  CB  . GLN A 1 73 ? 0.222   -1.857  10.957  1.00 0.00 ? 73 GLN A CB  13 
ATOM   9354  C  CG  . GLN A 1 73 ? 0.903   -1.155  12.176  1.00 0.00 ? 73 GLN A CG  13 
ATOM   9355  C  CD  . GLN A 1 73 ? 2.421   -1.278  12.360  1.00 0.00 ? 73 GLN A CD  13 
ATOM   9356  O  OE1 . GLN A 1 73 ? 3.170   -0.365  12.051  1.00 0.00 ? 73 GLN A OE1 13 
ATOM   9357  N  NE2 . GLN A 1 73 ? 2.930   -2.365  12.881  1.00 0.00 ? 73 GLN A NE2 13 
ATOM   9358  N  N   . PRO A 1 74 ? -1.359  -4.460  11.413  1.00 0.00 ? 74 PRO A N   13 
ATOM   9359  C  CA  . PRO A 1 74 ? -2.608  -5.342  11.402  1.00 0.00 ? 74 PRO A CA  13 
ATOM   9360  C  C   . PRO A 1 74 ? -3.433  -5.399  10.139  1.00 0.00 ? 74 PRO A C   13 
ATOM   9361  O  O   . PRO A 1 74 ? -3.294  -4.601  9.203   1.00 0.00 ? 74 PRO A O   13 
ATOM   9362  C  CB  . PRO A 1 74 ? -3.492  -4.792  12.528  1.00 0.00 ? 74 PRO A CB  13 
ATOM   9363  C  CG  . PRO A 1 74 ? -2.421  -4.492  13.588  1.00 0.00 ? 74 PRO A CG  13 
ATOM   9364  C  CD  . PRO A 1 74 ? -1.241  -3.922  12.798  1.00 0.00 ? 74 PRO A CD  13 
ATOM   9365  N  N   . ASP A 1 75 ? -4.476  -6.454  10.103  1.00 0.00 ? 75 ASP A N   13 
ATOM   9366  C  CA  . ASP A 1 75 ? -5.238  -6.778  8.902   1.00 0.00 ? 75 ASP A CA  13 
ATOM   9367  C  C   . ASP A 1 75 ? -6.588  -7.355  9.273   1.00 0.00 ? 75 ASP A C   13 
ATOM   9368  O  O   . ASP A 1 75 ? -6.813  -8.572  9.250   1.00 0.00 ? 75 ASP A O   13 
ATOM   9369  C  CB  . ASP A 1 75 ? -4.431  -7.737  7.990   1.00 0.00 ? 75 ASP A CB  13 
ATOM   9370  C  CG  . ASP A 1 75 ? -5.168  -8.318  6.775   1.00 0.00 ? 75 ASP A CG  13 
ATOM   9371  O  OD1 . ASP A 1 75 ? -5.226  -7.446  5.724   1.00 0.00 ? 75 ASP A OD1 13 
ATOM   9372  O  OD2 . ASP A 1 75 ? -5.633  -9.448  6.755   1.00 0.00 ? 75 ASP A OD2 13 
ATOM   9373  N  N   . LYS A 1 76 ? -7.616  -6.367  9.675   1.00 0.00 ? 76 LYS A N   13 
ATOM   9374  C  CA  . LYS A 1 76 ? -8.991  -6.754  9.975   1.00 0.00 ? 76 LYS A CA  13 
ATOM   9375  C  C   . LYS A 1 76 ? -9.754  -7.043  8.699   1.00 0.00 ? 76 LYS A C   13 
ATOM   9376  O  O   . LYS A 1 76 ? -10.403 -6.170  8.107   1.00 0.00 ? 76 LYS A O   13 
ATOM   9377  C  CB  . LYS A 1 76 ? -9.673  -5.643  10.818  1.00 0.00 ? 76 LYS A CB  13 
ATOM   9378  C  CG  . LYS A 1 76 ? -9.286  -4.209  10.375  1.00 0.00 ? 76 LYS A CG  13 
ATOM   9379  C  CD  . LYS A 1 76 ? -10.289 -3.118  10.760  1.00 0.00 ? 76 LYS A CD  13 
ATOM   9380  C  CE  . LYS A 1 76 ? -9.567  -2.028  11.564  1.00 0.00 ? 76 LYS A CE  13 
ATOM   9381  N  NZ  . LYS A 1 76 ? -9.050  -1.001  10.643  1.00 0.00 ? 76 LYS A NZ  13 
ATOM   9382  N  N   . ALA A 1 77 ? -9.643  -8.421  8.182   1.00 0.00 ? 77 ALA A N   13 
ATOM   9383  C  CA  . ALA A 1 77 ? -10.165 -8.833  6.880   1.00 0.00 ? 77 ALA A CA  13 
ATOM   9384  C  C   . ALA A 1 77 ? -9.917  -10.304 6.598   1.00 0.00 ? 77 ALA A C   13 
ATOM   9385  O  O   . ALA A 1 77 ? -10.642 -10.940 5.822   1.00 0.00 ? 77 ALA A O   13 
ATOM   9386  C  CB  . ALA A 1 77 ? -9.579  -7.904  5.806   1.00 0.00 ? 77 ALA A CB  13 
ATOM   9387  N  N   . ASN A 1 78 ? -8.746  -10.914 7.261   1.00 0.00 ? 78 ASN A N   13 
ATOM   9388  C  CA  . ASN A 1 78 ? -8.412  -12.331 7.157   1.00 0.00 ? 78 ASN A CA  13 
ATOM   9389  C  C   . ASN A 1 78 ? -7.495  -12.579 5.981   1.00 0.00 ? 78 ASN A C   13 
ATOM   9390  O  O   . ASN A 1 78 ? -7.913  -12.610 4.817   1.00 0.00 ? 78 ASN A O   13 
ATOM   9391  C  CB  . ASN A 1 78 ? -9.696  -13.202 7.061   1.00 0.00 ? 78 ASN A CB  13 
ATOM   9392  C  CG  . ASN A 1 78 ? -10.882 -12.796 7.944   1.00 0.00 ? 78 ASN A CG  13 
ATOM   9393  O  OD1 . ASN A 1 78 ? -10.733 -12.305 9.053   1.00 0.00 ? 78 ASN A OD1 13 
ATOM   9394  N  ND2 . ASN A 1 78 ? -12.093 -12.998 7.500   1.00 0.00 ? 78 ASN A ND2 13 
ATOM   9395  N  N   . PRO A 1 79 ? -6.072  -12.811 6.313   1.00 0.00 ? 79 PRO A N   13 
ATOM   9396  C  CA  . PRO A 1 79 ? -4.939  -13.065 5.319   1.00 0.00 ? 79 PRO A CA  13 
ATOM   9397  C  C   . PRO A 1 79 ? -4.983  -14.400 4.609   1.00 0.00 ? 79 PRO A C   13 
ATOM   9398  O  O   . PRO A 1 79 ? -4.726  -14.496 3.399   1.00 0.00 ? 79 PRO A O   13 
ATOM   9399  C  CB  . PRO A 1 79 ? -3.639  -12.981 6.112   1.00 0.00 ? 79 PRO A CB  13 
ATOM   9400  C  CG  . PRO A 1 79 ? -4.097  -13.483 7.491   1.00 0.00 ? 79 PRO A CG  13 
ATOM   9401  C  CD  . PRO A 1 79 ? -5.474  -12.836 7.670   1.00 0.00 ? 79 PRO A CD  13 
ATOM   9402  N  N   . ARG A 1 80 ? -5.316  -15.585 5.428   1.00 0.00 ? 80 ARG A N   13 
ATOM   9403  C  CA  . ARG A 1 80 ? -5.223  -16.940 4.891   1.00 0.00 ? 80 ARG A CA  13 
ATOM   9404  C  C   . ARG A 1 80 ? -5.717  -17.964 5.885   1.00 0.00 ? 80 ARG A C   13 
ATOM   9405  O  O   . ARG A 1 80 ? -4.962  -18.474 6.725   1.00 0.00 ? 80 ARG A O   13 
ATOM   9406  C  CB  . ARG A 1 80 ? -3.749  -17.215 4.483   1.00 0.00 ? 80 ARG A CB  13 
ATOM   9407  C  CG  . ARG A 1 80 ? -2.691  -16.791 5.535   1.00 0.00 ? 80 ARG A CG  13 
ATOM   9408  C  CD  . ARG A 1 80 ? -1.308  -16.551 4.916   1.00 0.00 ? 80 ARG A CD  13 
ATOM   9409  N  NE  . ARG A 1 80 ? -0.859  -17.811 4.271   1.00 0.00 ? 80 ARG A NE  13 
ATOM   9410  C  CZ  . ARG A 1 80 ? 0.402   -18.156 4.051   1.00 0.00 ? 80 ARG A CZ  13 
ATOM   9411  N  NH1 . ARG A 1 80 ? 1.430   -17.426 4.369   1.00 0.00 ? 80 ARG A NH1 13 
ATOM   9412  N  NH2 . ARG A 1 80 ? 0.617   -19.290 3.483   1.00 0.00 ? 80 ARG A NH2 13 
ATOM   9413  N  N   . GLN A 1 81 ? -7.157  -18.296 5.825   1.00 0.00 ? 81 GLN A N   13 
ATOM   9414  C  CA  . GLN A 1 81 ? -7.737  -19.387 6.605   1.00 0.00 ? 81 GLN A CA  13 
ATOM   9415  C  C   . GLN A 1 81 ? -6.945  -20.661 6.429   1.00 0.00 ? 81 GLN A C   13 
ATOM   9416  O  O   . GLN A 1 81 ? -5.984  -20.731 5.649   1.00 0.00 ? 81 GLN A O   13 
ATOM   9417  C  CB  . GLN A 1 81 ? -9.204  -19.584 6.164   1.00 0.00 ? 81 GLN A CB  13 
ATOM   9418  C  CG  . GLN A 1 81 ? -10.128 -18.325 6.257   1.00 0.00 ? 81 GLN A CG  13 
ATOM   9419  C  CD  . GLN A 1 81 ? -11.478 -18.441 6.975   1.00 0.00 ? 81 GLN A CD  13 
ATOM   9420  O  OE1 . GLN A 1 81 ? -11.681 -19.316 7.802   1.00 0.00 ? 81 GLN A OE1 13 
ATOM   9421  N  NE2 . GLN A 1 81 ? -12.438 -17.593 6.704   1.00 0.00 ? 81 GLN A NE2 13 
ATOM   9422  N  N   . HIS A 1 82 ? -7.402  -21.831 7.210   1.00 0.00 ? 82 HIS A N   13 
ATOM   9423  C  CA  . HIS A 1 82 ? -6.835  -23.162 7.011   1.00 0.00 ? 82 HIS A CA  13 
ATOM   9424  C  C   . HIS A 1 82 ? -5.381  -23.197 7.420   1.00 0.00 ? 82 HIS A C   13 
ATOM   9425  O  O   . HIS A 1 82 ? -4.587  -24.013 6.931   1.00 0.00 ? 82 HIS A O   13 
ATOM   9426  C  CB  . HIS A 1 82 ? -6.977  -23.473 5.512   1.00 0.00 ? 82 HIS A CB  13 
ATOM   9427  C  CG  . HIS A 1 82 ? -7.158  -24.939 5.248   1.00 0.00 ? 82 HIS A CG  13 
ATOM   9428  N  ND1 . HIS A 1 82 ? -7.714  -25.498 4.099   1.00 0.00 ? 82 HIS A ND1 13 
ATOM   9429  C  CD2 . HIS A 1 82 ? -6.775  -25.918 6.155   1.00 0.00 ? 82 HIS A CD2 13 
ATOM   9430  C  CE1 . HIS A 1 82 ? -7.622  -26.804 4.412   1.00 0.00 ? 82 HIS A CE1 13 
ATOM   9431  N  NE2 . HIS A 1 82 ? -7.077  -27.140 5.612   1.00 0.00 ? 82 HIS A NE2 13 
ATOM   9432  N  N   . ARG A 1 83 ? -4.953  -22.186 8.411   1.00 0.00 ? 83 ARG A N   13 
ATOM   9433  C  CA  . ARG A 1 83 ? -3.606  -22.173 8.971   1.00 0.00 ? 83 ARG A CA  13 
ATOM   9434  C  C   . ARG A 1 83 ? -3.552  -21.341 10.231  1.00 0.00 ? 83 ARG A C   13 
ATOM   9435  O  O   . ARG A 1 83 ? -4.060  -20.213 10.289  1.00 0.00 ? 83 ARG A O   13 
ATOM   9436  C  CB  . ARG A 1 83 ? -2.618  -21.639 7.897   1.00 0.00 ? 83 ARG A CB  13 
ATOM   9437  C  CG  . ARG A 1 83 ? -1.136  -22.044 8.114   1.00 0.00 ? 83 ARG A CG  13 
ATOM   9438  C  CD  . ARG A 1 83 ? -0.346  -22.107 6.800   1.00 0.00 ? 83 ARG A CD  13 
ATOM   9439  N  NE  . ARG A 1 83 ? -0.590  -23.429 6.171   1.00 0.00 ? 83 ARG A NE  13 
ATOM   9440  C  CZ  . ARG A 1 83 ? -0.427  -23.712 4.885   1.00 0.00 ? 83 ARG A CZ  13 
ATOM   9441  N  NH1 . ARG A 1 83 ? -0.029  -22.857 3.990   1.00 0.00 ? 83 ARG A NH1 13 
ATOM   9442  N  NH2 . ARG A 1 83 ? -0.681  -24.914 4.506   1.00 0.00 ? 83 ARG A NH2 13 
ATOM   9443  N  N   . LEU A 1 84 ? -2.893  -21.963 11.400  1.00 0.00 ? 84 LEU A N   13 
ATOM   9444  C  CA  . LEU A 1 84 ? -2.867  -21.315 12.708  1.00 0.00 ? 84 LEU A CA  13 
ATOM   9445  C  C   . LEU A 1 84 ? -4.197  -21.459 13.410  1.00 0.00 ? 84 LEU A C   13 
ATOM   9446  O  O   . LEU A 1 84 ? -5.104  -20.628 13.264  1.00 0.00 ? 84 LEU A O   13 
ATOM   9447  C  CB  . LEU A 1 84 ? -2.472  -19.818 12.569  1.00 0.00 ? 84 LEU A CB  13 
ATOM   9448  C  CG  . LEU A 1 84 ? -1.184  -19.331 13.286  1.00 0.00 ? 84 LEU A CG  13 
ATOM   9449  C  CD1 . LEU A 1 84 ? -0.509  -18.223 12.465  1.00 0.00 ? 84 LEU A CD1 13 
ATOM   9450  C  CD2 . LEU A 1 84 ? -1.452  -18.827 14.713  1.00 0.00 ? 84 LEU A CD2 13 
ATOM   9451  N  N   . ASP A 1 85 ? -4.356  -22.646 14.277  1.00 0.00 ? 85 ASP A N   13 
ATOM   9452  C  CA  . ASP A 1 85 ? -5.586  -22.902 15.022  1.00 0.00 ? 85 ASP A CA  13 
ATOM   9453  C  C   . ASP A 1 85 ? -5.297  -23.644 16.305  1.00 0.00 ? 85 ASP A C   13 
ATOM   9454  O  O   . ASP A 1 85 ? -6.161  -24.326 16.873  1.00 0.00 ? 85 ASP A O   13 
ATOM   9455  C  CB  . ASP A 1 85 ? -6.605  -23.660 14.133  1.00 0.00 ? 85 ASP A CB  13 
ATOM   9456  C  CG  . ASP A 1 85 ? -8.068  -23.651 14.600  1.00 0.00 ? 85 ASP A CG  13 
ATOM   9457  O  OD1 . ASP A 1 85 ? -8.446  -23.051 15.596  1.00 0.00 ? 85 ASP A OD1 13 
ATOM   9458  O  OD2 . ASP A 1 85 ? -8.888  -24.385 13.789  1.00 0.00 ? 85 ASP A OD2 13 
ATOM   9459  N  N   . LYS A 1 86 ? -3.930  -23.501 16.852  1.00 0.00 ? 86 LYS A N   13 
ATOM   9460  C  CA  . LYS A 1 86 ? -3.478  -24.258 18.016  1.00 0.00 ? 86 LYS A CA  13 
ATOM   9461  C  C   . LYS A 1 86 ? -3.323  -23.358 19.219  1.00 0.00 ? 86 LYS A C   13 
ATOM   9462  O  O   . LYS A 1 86 ? -2.208  -23.014 19.636  1.00 0.00 ? 86 LYS A O   13 
ATOM   9463  C  CB  . LYS A 1 86 ? -2.141  -24.973 17.681  1.00 0.00 ? 86 LYS A CB  13 
ATOM   9464  C  CG  . LYS A 1 86 ? -2.329  -26.309 16.920  1.00 0.00 ? 86 LYS A CG  13 
ATOM   9465  C  CD  . LYS A 1 86 ? -1.041  -27.102 16.683  1.00 0.00 ? 86 LYS A CD  13 
ATOM   9466  C  CE  . LYS A 1 86 ? -1.387  -28.586 16.496  1.00 0.00 ? 86 LYS A CE  13 
ATOM   9467  N  NZ  . LYS A 1 86 ? -0.203  -29.407 16.803  1.00 0.00 ? 86 LYS A NZ  13 
ATOM   9468  N  N   . ILE A 1 87 ? -4.573  -22.905 19.866  1.00 0.00 ? 87 ILE A N   13 
ATOM   9469  C  CA  . ILE A 1 87 ? -4.567  -22.008 21.017  1.00 0.00 ? 87 ILE A CA  13 
ATOM   9470  C  C   . ILE A 1 87 ? -4.895  -22.756 22.288  1.00 0.00 ? 87 ILE A C   13 
ATOM   9471  O  O   . ILE A 1 87 ? -4.531  -22.345 23.399  1.00 0.00 ? 87 ILE A O   13 
ATOM   9472  C  CB  . ILE A 1 87 ? -5.533  -20.774 20.794  1.00 0.00 ? 87 ILE A CB  13 
ATOM   9473  C  CG1 . ILE A 1 87 ? -7.039  -21.062 21.098  1.00 0.00 ? 87 ILE A CG1 13 
ATOM   9474  C  CG2 . ILE A 1 87 ? -5.435  -20.180 19.355  1.00 0.00 ? 87 ILE A CG2 13 
ATOM   9475  C  CD1 . ILE A 1 87 ? -8.059  -20.284 20.242  1.00 0.00 ? 87 ILE A CD1 13 
ATOM   9476  N  N   . THR A 1 88 ? -5.645  -24.020 22.130  1.00 0.00 ? 88 THR A N   13 
ATOM   9477  C  CA  . THR A 1 88 ? -5.973  -24.874 23.268  1.00 0.00 ? 88 THR A CA  13 
ATOM   9478  C  C   . THR A 1 88 ? -5.616  -26.315 22.985  1.00 0.00 ? 88 THR A C   13 
ATOM   9479  O  O   . THR A 1 88 ? -6.348  -27.044 22.303  1.00 0.00 ? 88 THR A O   13 
ATOM   9480  C  CB  . THR A 1 88 ? -7.489  -24.742 23.638  1.00 0.00 ? 88 THR A CB  13 
ATOM   9481  O  OG1 . THR A 1 88 ? -7.746  -23.481 24.241  1.00 0.00 ? 88 THR A OG1 13 
ATOM   9482  C  CG2 . THR A 1 88 ? -8.039  -25.773 24.647  1.00 0.00 ? 88 THR A CG2 13 
ATOM   9483  N  N   . HIS A 1 89 ? -4.367  -26.813 23.598  1.00 0.00 ? 89 HIS A N   13 
ATOM   9484  C  CA  . HIS A 1 89 ? -3.954  -28.210 23.493  1.00 0.00 ? 89 HIS A CA  13 
ATOM   9485  C  C   . HIS A 1 89 ? -4.293  -28.973 24.752  1.00 0.00 ? 89 HIS A C   13 
ATOM   9486  O  O   . HIS A 1 89 ? -3.416  -29.351 25.541  1.00 0.00 ? 89 HIS A O   13 
ATOM   9487  C  CB  . HIS A 1 89 ? -2.433  -28.196 23.267  1.00 0.00 ? 89 HIS A CB  13 
ATOM   9488  C  CG  . HIS A 1 89 ? -1.865  -29.578 23.121  1.00 0.00 ? 89 HIS A CG  13 
ATOM   9489  N  ND1 . HIS A 1 89 ? -2.603  -30.754 23.010  1.00 0.00 ? 89 HIS A ND1 13 
ATOM   9490  C  CD2 . HIS A 1 89 ? -0.501  -29.827 23.082  1.00 0.00 ? 89 HIS A CD2 13 
ATOM   9491  C  CE1 . HIS A 1 89 ? -1.599  -31.645 22.907  1.00 0.00 ? 89 HIS A CE1 13 
ATOM   9492  N  NE2 . HIS A 1 89 ? -0.321  -31.179 22.941  1.00 0.00 ? 89 HIS A NE2 13 
ATOM   9493  N  N   . ALA A 1 90 ? -5.727  -29.254 24.982  1.00 0.00 ? 90 ALA A N   13 
ATOM   9494  C  CA  . ALA A 1 90 ? -6.187  -30.053 26.114  1.00 0.00 ? 90 ALA A CA  13 
ATOM   9495  C  C   . ALA A 1 90 ? -7.584  -30.576 25.875  1.00 0.00 ? 90 ALA A C   13 
ATOM   9496  O  O   . ALA A 1 90 ? -8.587  -29.901 26.143  1.00 0.00 ? 90 ALA A O   13 
ATOM   9497  C  CB  . ALA A 1 90 ? -6.086  -29.178 27.375  1.00 0.00 ? 90 ALA A CB  13 
ATOM   9498  N  N   . CYS A 1 91 ? -7.685  -31.922 25.271  1.00 0.00 ? 91 CYS A N   13 
ATOM   9499  C  CA  . CYS A 1 91 ? -8.973  -32.539 24.966  1.00 0.00 ? 91 CYS A CA  13 
ATOM   9500  C  C   . CYS A 1 91 ? -8.900  -34.041 25.106  1.00 0.00 ? 91 CYS A C   13 
ATOM   9501  O  O   . CYS A 1 91 ? -9.252  -34.617 26.144  1.00 0.00 ? 91 CYS A O   13 
ATOM   9502  C  CB  . CYS A 1 91 ? -9.407  -32.099 23.554  1.00 0.00 ? 91 CYS A CB  13 
ATOM   9503  S  SG  . CYS A 1 91 ? -8.042  -31.290 22.689  1.00 0.00 ? 91 CYS A SG  13 
ATOM   9504  N  N   . ARG A 1 92 ? -8.401  -34.785 23.929  1.00 0.00 ? 92 ARG A N   13 
ATOM   9505  C  CA  . ARG A 1 92 ? -8.344  -36.244 23.903  1.00 0.00 ? 92 ARG A CA  13 
ATOM   9506  C  C   . ARG A 1 92 ? -7.673  -36.737 22.643  1.00 0.00 ? 92 ARG A C   13 
ATOM   9507  O  O   . ARG A 1 92 ? -7.582  -36.036 21.637  1.00 0.00 ? 92 ARG A O   13 
ATOM   9508  C  CB  . ARG A 1 92 ? -9.786  -36.806 24.034  1.00 0.00 ? 92 ARG A CB  13 
ATOM   9509  C  CG  . ARG A 1 92 ? -9.871  -38.290 24.479  1.00 0.00 ? 92 ARG A CG  13 
ATOM   9510  C  CD  . ARG A 1 92 ? -11.219 -38.933 24.127  1.00 0.00 ? 92 ARG A CD  13 
ATOM   9511  N  NE  . ARG A 1 92 ? -12.148 -38.726 25.266  1.00 0.00 ? 92 ARG A NE  13 
ATOM   9512  C  CZ  . ARG A 1 92 ? -13.328 -39.313 25.415  1.00 0.00 ? 92 ARG A CZ  13 
ATOM   9513  N  NH1 . ARG A 1 92 ? -13.837 -40.161 24.570  1.00 0.00 ? 92 ARG A NH1 13 
ATOM   9514  N  NH2 . ARG A 1 92 ? -14.008 -39.020 26.466  1.00 0.00 ? 92 ARG A NH2 13 
ATOM   9515  O  OXT . ARG A 1 92 ? -7.161  -38.071 22.687  1.00 0.00 ? 92 ARG A OXT 13 
HETATM 9516  ZN ZN  . ZN  B 2 .  ? 1.612   -2.258  4.776   1.00 0.00 ? 93 ZN  A ZN  13 
ATOM   9517  N  N   . MET A 1 1  ? -0.737  25.308  -18.314 1.00 0.00 ? 1  MET A N   14 
ATOM   9518  C  CA  . MET A 1 1  ? -1.373  25.769  -17.084 1.00 0.00 ? 1  MET A CA  14 
ATOM   9519  C  C   . MET A 1 1  ? -2.180  24.663  -16.445 1.00 0.00 ? 1  MET A C   14 
ATOM   9520  O  O   . MET A 1 1  ? -1.786  24.071  -15.431 1.00 0.00 ? 1  MET A O   14 
ATOM   9521  C  CB  . MET A 1 1  ? -2.267  27.004  -17.382 1.00 0.00 ? 1  MET A CB  14 
ATOM   9522  C  CG  . MET A 1 1  ? -1.575  28.380  -17.271 1.00 0.00 ? 1  MET A CG  14 
ATOM   9523  S  SD  . MET A 1 1  ? -2.672  29.666  -17.889 1.00 0.00 ? 1  MET A SD  14 
ATOM   9524  C  CE  . MET A 1 1  ? -1.432  30.903  -18.294 1.00 0.00 ? 1  MET A CE  14 
ATOM   9525  N  N   . LYS A 1 2  ? -3.459  24.320  -17.105 1.00 0.00 ? 2  LYS A N   14 
ATOM   9526  C  CA  . LYS A 1 2  ? -4.292  23.211  -16.651 1.00 0.00 ? 2  LYS A CA  14 
ATOM   9527  C  C   . LYS A 1 2  ? -3.696  21.884  -17.057 1.00 0.00 ? 2  LYS A C   14 
ATOM   9528  O  O   . LYS A 1 2  ? -3.662  20.919  -16.282 1.00 0.00 ? 2  LYS A O   14 
ATOM   9529  C  CB  . LYS A 1 2  ? -5.727  23.374  -17.224 1.00 0.00 ? 2  LYS A CB  14 
ATOM   9530  C  CG  . LYS A 1 2  ? -6.640  22.152  -16.956 1.00 0.00 ? 2  LYS A CG  14 
ATOM   9531  C  CD  . LYS A 1 2  ? -8.049  22.259  -17.545 1.00 0.00 ? 2  LYS A CD  14 
ATOM   9532  C  CE  . LYS A 1 2  ? -8.063  21.626  -18.942 1.00 0.00 ? 2  LYS A CE  14 
ATOM   9533  N  NZ  . LYS A 1 2  ? -9.064  22.310  -19.780 1.00 0.00 ? 2  LYS A NZ  14 
ATOM   9534  N  N   . LYS A 1 3  ? -3.137  21.809  -18.425 1.00 0.00 ? 3  LYS A N   14 
ATOM   9535  C  CA  . LYS A 1 3  ? -2.635  20.558  -18.987 1.00 0.00 ? 3  LYS A CA  14 
ATOM   9536  C  C   . LYS A 1 3  ? -1.671  19.888  -18.035 1.00 0.00 ? 3  LYS A C   14 
ATOM   9537  O  O   . LYS A 1 3  ? -0.764  20.518  -17.474 1.00 0.00 ? 3  LYS A O   14 
ATOM   9538  C  CB  . LYS A 1 3  ? -1.958  20.838  -20.356 1.00 0.00 ? 3  LYS A CB  14 
ATOM   9539  C  CG  . LYS A 1 3  ? -2.968  21.097  -21.502 1.00 0.00 ? 3  LYS A CG  14 
ATOM   9540  C  CD  . LYS A 1 3  ? -2.948  20.058  -22.626 1.00 0.00 ? 3  LYS A CD  14 
ATOM   9541  C  CE  . LYS A 1 3  ? -4.263  20.139  -23.413 1.00 0.00 ? 3  LYS A CE  14 
ATOM   9542  N  NZ  . LYS A 1 3  ? -4.551  21.546  -23.742 1.00 0.00 ? 3  LYS A NZ  14 
ATOM   9543  N  N   . ALA A 1 4  ? -1.867  18.438  -17.818 1.00 0.00 ? 4  ALA A N   14 
ATOM   9544  C  CA  . ALA A 1 4  ? -0.968  17.654  -16.976 1.00 0.00 ? 4  ALA A CA  14 
ATOM   9545  C  C   . ALA A 1 4  ? 0.357   17.426  -17.666 1.00 0.00 ? 4  ALA A C   14 
ATOM   9546  O  O   . ALA A 1 4  ? 0.429   16.885  -18.777 1.00 0.00 ? 4  ALA A O   14 
ATOM   9547  C  CB  . ALA A 1 4  ? -1.688  16.342  -16.619 1.00 0.00 ? 4  ALA A CB  14 
ATOM   9548  N  N   . THR A 1 5  ? 1.561   17.875  -16.934 1.00 0.00 ? 5  THR A N   14 
ATOM   9549  C  CA  . THR A 1 5  ? 2.899   17.776  -17.506 1.00 0.00 ? 5  THR A CA  14 
ATOM   9550  C  C   . THR A 1 5  ? 3.896   17.271  -16.489 1.00 0.00 ? 5  THR A C   14 
ATOM   9551  O  O   . THR A 1 5  ? 5.114   17.254  -16.737 1.00 0.00 ? 5  THR A O   14 
ATOM   9552  C  CB  . THR A 1 5  ? 3.354   19.163  -18.078 1.00 0.00 ? 5  THR A CB  14 
ATOM   9553  O  OG1 . THR A 1 5  ? 4.382   18.993  -19.043 1.00 0.00 ? 5  THR A OG1 14 
ATOM   9554  C  CG2 . THR A 1 5  ? 3.940   20.162  -17.057 1.00 0.00 ? 5  THR A CG2 14 
ATOM   9555  N  N   . CYS A 1 6  ? 3.368   16.837  -15.178 1.00 0.00 ? 6  CYS A N   14 
ATOM   9556  C  CA  . CYS A 1 6  ? 4.250   16.496  -14.065 1.00 0.00 ? 6  CYS A CA  14 
ATOM   9557  C  C   . CYS A 1 6  ? 4.691   15.053  -14.126 1.00 0.00 ? 6  CYS A C   14 
ATOM   9558  O  O   . CYS A 1 6  ? 4.033   14.151  -13.584 1.00 0.00 ? 6  CYS A O   14 
ATOM   9559  C  CB  . CYS A 1 6  ? 3.518   16.826  -12.747 1.00 0.00 ? 6  CYS A CB  14 
ATOM   9560  S  SG  . CYS A 1 6  ? 3.588   18.598  -12.403 1.00 0.00 ? 6  CYS A SG  14 
ATOM   9561  N  N   . LEU A 1 7  ? 5.945   14.766  -14.856 1.00 0.00 ? 7  LEU A N   14 
ATOM   9562  C  CA  . LEU A 1 7  ? 6.562   13.440  -14.829 1.00 0.00 ? 7  LEU A CA  14 
ATOM   9563  C  C   . LEU A 1 7  ? 6.955   13.073  -13.417 1.00 0.00 ? 7  LEU A C   14 
ATOM   9564  O  O   . LEU A 1 7  ? 8.032   13.442  -12.925 1.00 0.00 ? 7  LEU A O   14 
ATOM   9565  C  CB  . LEU A 1 7  ? 7.785   13.384  -15.785 1.00 0.00 ? 7  LEU A CB  14 
ATOM   9566  C  CG  . LEU A 1 7  ? 7.549   12.936  -17.254 1.00 0.00 ? 7  LEU A CG  14 
ATOM   9567  C  CD1 . LEU A 1 7  ? 6.643   13.944  -17.975 1.00 0.00 ? 7  LEU A CD1 14 
ATOM   9568  C  CD2 . LEU A 1 7  ? 8.860   12.763  -18.039 1.00 0.00 ? 7  LEU A CD2 14 
ATOM   9569  N  N   . THR A 1 8  ? 5.987   12.256  -12.654 1.00 0.00 ? 8  THR A N   14 
ATOM   9570  C  CA  . THR A 1 8  ? 6.154   11.990  -11.229 1.00 0.00 ? 8  THR A CA  14 
ATOM   9571  C  C   . THR A 1 8  ? 5.402   10.750  -10.809 1.00 0.00 ? 8  THR A C   14 
ATOM   9572  O  O   . THR A 1 8  ? 5.945   9.846   -10.159 1.00 0.00 ? 8  THR A O   14 
ATOM   9573  C  CB  . THR A 1 8  ? 5.680   13.228  -10.388 1.00 0.00 ? 8  THR A CB  14 
ATOM   9574  O  OG1 . THR A 1 8  ? 6.795   14.021  -10.001 1.00 0.00 ? 8  THR A OG1 14 
ATOM   9575  C  CG2 . THR A 1 8  ? 4.943   12.919  -9.068  1.00 0.00 ? 8  THR A CG2 14 
ATOM   9576  N  N   . ASP A 1 9  ? 3.971   10.690  -11.182 1.00 0.00 ? 9  ASP A N   14 
ATOM   9577  C  CA  . ASP A 1 9  ? 3.088   9.635   -10.694 1.00 0.00 ? 9  ASP A CA  14 
ATOM   9578  C  C   . ASP A 1 9  ? 3.517   8.278   -11.198 1.00 0.00 ? 9  ASP A C   14 
ATOM   9579  O  O   . ASP A 1 9  ? 3.436   7.265   -10.485 1.00 0.00 ? 9  ASP A O   14 
ATOM   9580  C  CB  . ASP A 1 9  ? 1.616   9.951   -11.068 1.00 0.00 ? 9  ASP A CB  14 
ATOM   9581  C  CG  . ASP A 1 9  ? 1.201   11.429  -11.041 1.00 0.00 ? 9  ASP A CG  14 
ATOM   9582  O  OD1 . ASP A 1 9  ? 1.531   12.051  -9.870  1.00 0.00 ? 9  ASP A OD1 14 
ATOM   9583  O  OD2 . ASP A 1 9  ? 0.620   11.975  -11.968 1.00 0.00 ? 9  ASP A OD2 14 
ATOM   9584  N  N   . ASP A 1 10 ? 4.010   8.211   -12.590 1.00 0.00 ? 10 ASP A N   14 
ATOM   9585  C  CA  . ASP A 1 10 ? 4.292   6.939   -13.249 1.00 0.00 ? 10 ASP A CA  14 
ATOM   9586  C  C   . ASP A 1 10 ? 5.604   6.354   -12.783 1.00 0.00 ? 10 ASP A C   14 
ATOM   9587  O  O   . ASP A 1 10 ? 5.736   5.137   -12.586 1.00 0.00 ? 10 ASP A O   14 
ATOM   9588  C  CB  . ASP A 1 10 ? 4.241   7.107   -14.790 1.00 0.00 ? 10 ASP A CB  14 
ATOM   9589  C  CG  . ASP A 1 10 ? 3.298   6.165   -15.554 1.00 0.00 ? 10 ASP A CG  14 
ATOM   9590  O  OD1 . ASP A 1 10 ? 2.208   5.794   -14.818 1.00 0.00 ? 10 ASP A OD1 14 
ATOM   9591  O  OD2 . ASP A 1 10 ? 3.504   5.805   -16.704 1.00 0.00 ? 10 ASP A OD2 14 
ATOM   9592  N  N   . GLN A 1 11 ? 6.711   7.305   -12.548 1.00 0.00 ? 11 GLN A N   14 
ATOM   9593  C  CA  . GLN A 1 11 ? 7.981   6.907   -11.940 1.00 0.00 ? 11 GLN A CA  14 
ATOM   9594  C  C   . GLN A 1 11 ? 7.765   6.397   -10.534 1.00 0.00 ? 11 GLN A C   14 
ATOM   9595  O  O   . GLN A 1 11 ? 8.180   5.299   -10.141 1.00 0.00 ? 11 GLN A O   14 
ATOM   9596  C  CB  . GLN A 1 11 ? 8.926   8.128   -11.955 1.00 0.00 ? 11 GLN A CB  14 
ATOM   9597  C  CG  . GLN A 1 11 ? 8.863   9.077   -10.712 1.00 0.00 ? 11 GLN A CG  14 
ATOM   9598  C  CD  . GLN A 1 11 ? 10.155  9.708   -10.181 1.00 0.00 ? 11 GLN A CD  14 
ATOM   9599  O  OE1 . GLN A 1 11 ? 10.696  9.285   -9.172  1.00 0.00 ? 11 GLN A OE1 14 
ATOM   9600  N  NE2 . GLN A 1 11 ? 10.682  10.736  -10.796 1.00 0.00 ? 11 GLN A NE2 14 
ATOM   9601  N  N   . ARG A 1 12 ? 6.976   7.286   -9.649  1.00 0.00 ? 12 ARG A N   14 
ATOM   9602  C  CA  . ARG A 1 12 ? 6.507   6.916   -8.322  1.00 0.00 ? 12 ARG A CA  14 
ATOM   9603  C  C   . ARG A 1 12 ? 5.997   5.490   -8.279  1.00 0.00 ? 12 ARG A C   14 
ATOM   9604  O  O   . ARG A 1 12 ? 6.420   4.598   -7.519  1.00 0.00 ? 12 ARG A O   14 
ATOM   9605  C  CB  . ARG A 1 12 ? 5.320   7.878   -7.969  1.00 0.00 ? 12 ARG A CB  14 
ATOM   9606  C  CG  . ARG A 1 12 ? 5.659   9.128   -7.127  1.00 0.00 ? 12 ARG A CG  14 
ATOM   9607  C  CD  . ARG A 1 12 ? 7.083   9.662   -7.328  1.00 0.00 ? 12 ARG A CD  14 
ATOM   9608  N  NE  . ARG A 1 12 ? 7.438   10.487  -6.142  1.00 0.00 ? 12 ARG A NE  14 
ATOM   9609  C  CZ  . ARG A 1 12 ? 6.799   11.580  -5.748  1.00 0.00 ? 12 ARG A CZ  14 
ATOM   9610  N  NH1 . ARG A 1 12 ? 5.766   12.086  -6.355  1.00 0.00 ? 12 ARG A NH1 14 
ATOM   9611  N  NH2 . ARG A 1 12 ? 7.236   12.175  -4.695  1.00 0.00 ? 12 ARG A NH2 14 
ATOM   9612  N  N   . TRP A 1 13 ? 4.873   5.222   -9.206  1.00 0.00 ? 13 TRP A N   14 
ATOM   9613  C  CA  . TRP A 1 13 ? 4.084   4.004   -9.123  1.00 0.00 ? 13 TRP A CA  14 
ATOM   9614  C  C   . TRP A 1 13 ? 4.769   2.810   -9.726  1.00 0.00 ? 13 TRP A C   14 
ATOM   9615  O  O   . TRP A 1 13 ? 4.492   1.650   -9.345  1.00 0.00 ? 13 TRP A O   14 
ATOM   9616  C  CB  . TRP A 1 13 ? 2.695   4.309   -9.799  1.00 0.00 ? 13 TRP A CB  14 
ATOM   9617  C  CG  . TRP A 1 13 ? 1.882   3.011   -9.892  1.00 0.00 ? 13 TRP A CG  14 
ATOM   9618  C  CD1 . TRP A 1 13 ? 1.782   2.186   -11.029 1.00 0.00 ? 13 TRP A CD1 14 
ATOM   9619  C  CD2 . TRP A 1 13 ? 1.217   2.362   -8.876  1.00 0.00 ? 13 TRP A CD2 14 
ATOM   9620  N  NE1 . TRP A 1 13 ? 1.050   1.015   -10.745 1.00 0.00 ? 13 TRP A NE1 14 
ATOM   9621  C  CE2 . TRP A 1 13 ? 0.716   1.145   -9.403  1.00 0.00 ? 13 TRP A CE2 14 
ATOM   9622  C  CE3 . TRP A 1 13 ? 1.023   2.703   -7.511  1.00 0.00 ? 13 TRP A CE3 14 
ATOM   9623  C  CZ2 . TRP A 1 13 ? 0.007   0.262   -8.558  1.00 0.00 ? 13 TRP A CZ2 14 
ATOM   9624  C  CZ3 . TRP A 1 13 ? 0.305   1.821   -6.705  1.00 0.00 ? 13 TRP A CZ3 14 
ATOM   9625  C  CH2 . TRP A 1 13 ? -0.199  0.618   -7.222  1.00 0.00 ? 13 TRP A CH2 14 
ATOM   9626  N  N   . GLN A 1 14 ? 5.752   3.040   -10.808 1.00 0.00 ? 14 GLN A N   14 
ATOM   9627  C  CA  . GLN A 1 14 ? 6.609   1.959   -11.299 1.00 0.00 ? 14 GLN A CA  14 
ATOM   9628  C  C   . GLN A 1 14 ? 7.434   1.416   -10.144 1.00 0.00 ? 14 GLN A C   14 
ATOM   9629  O  O   . GLN A 1 14 ? 7.883   0.264   -10.132 1.00 0.00 ? 14 GLN A O   14 
ATOM   9630  C  CB  . GLN A 1 14 ? 7.513   2.468   -12.436 1.00 0.00 ? 14 GLN A CB  14 
ATOM   9631  C  CG  . GLN A 1 14 ? 7.989   1.396   -13.477 1.00 0.00 ? 14 GLN A CG  14 
ATOM   9632  C  CD  . GLN A 1 14 ? 9.398   1.496   -14.072 1.00 0.00 ? 14 GLN A CD  14 
ATOM   9633  O  OE1 . GLN A 1 14 ? 9.652   2.288   -14.966 1.00 0.00 ? 14 GLN A OE1 14 
ATOM   9634  N  NE2 . GLN A 1 14 ? 10.352  0.717   -13.629 1.00 0.00 ? 14 GLN A NE2 14 
ATOM   9635  N  N   . SER A 1 15 ? 7.636   2.360   -9.018  1.00 0.00 ? 15 SER A N   14 
ATOM   9636  C  CA  . SER A 1 15 ? 8.243   1.952   -7.757  1.00 0.00 ? 15 SER A CA  14 
ATOM   9637  C  C   . SER A 1 15 ? 7.316   1.041   -6.984  1.00 0.00 ? 15 SER A C   14 
ATOM   9638  O  O   . SER A 1 15 ? 7.759   0.039   -6.391  1.00 0.00 ? 15 SER A O   14 
ATOM   9639  C  CB  . SER A 1 15 ? 8.685   3.171   -6.909  1.00 0.00 ? 15 SER A CB  14 
ATOM   9640  O  OG  . SER A 1 15 ? 9.664   3.982   -7.569  1.00 0.00 ? 15 SER A OG  14 
ATOM   9641  N  N   . VAL A 1 16 ? 5.875   1.412   -6.933  1.00 0.00 ? 16 VAL A N   14 
ATOM   9642  C  CA  . VAL A 1 16 ? 4.901   0.496   -6.336  1.00 0.00 ? 16 VAL A CA  14 
ATOM   9643  C  C   . VAL A 1 16 ? 4.913   -0.868  -6.974  1.00 0.00 ? 16 VAL A C   14 
ATOM   9644  O  O   . VAL A 1 16 ? 5.041   -1.918  -6.283  1.00 0.00 ? 16 VAL A O   14 
ATOM   9645  C  CB  . VAL A 1 16 ? 3.461   1.124   -6.233  1.00 0.00 ? 16 VAL A CB  14 
ATOM   9646  C  CG1 . VAL A 1 16 ? 2.555   0.551   -5.091  1.00 0.00 ? 16 VAL A CG1 14 
ATOM   9647  C  CG2 . VAL A 1 16 ? 3.459   2.653   -5.994  1.00 0.00 ? 16 VAL A CG2 14 
ATOM   9648  N  N   . LEU A 1 17 ? 4.726   -0.970  -8.434  1.00 0.00 ? 17 LEU A N   14 
ATOM   9649  C  CA  . LEU A 1 17 ? 4.829   -2.268  -9.145  1.00 0.00 ? 17 LEU A CA  14 
ATOM   9650  C  C   . LEU A 1 17 ? 6.105   -2.958  -8.744  1.00 0.00 ? 17 LEU A C   14 
ATOM   9651  O  O   . LEU A 1 17 ? 6.164   -4.157  -8.439  1.00 0.00 ? 17 LEU A O   14 
ATOM   9652  C  CB  . LEU A 1 17 ? 4.741   -2.072  -10.683 1.00 0.00 ? 17 LEU A CB  14 
ATOM   9653  C  CG  . LEU A 1 17 ? 3.466   -1.374  -11.242 1.00 0.00 ? 17 LEU A CG  14 
ATOM   9654  C  CD1 . LEU A 1 17 ? 3.324   -1.663  -12.741 1.00 0.00 ? 17 LEU A CD1 14 
ATOM   9655  C  CD2 . LEU A 1 17 ? 2.189   -1.803  -10.502 1.00 0.00 ? 17 LEU A CD2 14 
ATOM   9656  N  N   . ALA A 1 18 ? 7.321   -2.109  -8.781  1.00 0.00 ? 18 ALA A N   14 
ATOM   9657  C  CA  . ALA A 1 18 ? 8.663   -2.587  -8.474  1.00 0.00 ? 18 ALA A CA  14 
ATOM   9658  C  C   . ALA A 1 18 ? 8.985   -2.491  -7.001  1.00 0.00 ? 18 ALA A C   14 
ATOM   9659  O  O   . ALA A 1 18 ? 9.924   -1.792  -6.579  1.00 0.00 ? 18 ALA A O   14 
ATOM   9660  C  CB  . ALA A 1 18 ? 9.646   -1.769  -9.343  1.00 0.00 ? 18 ALA A CB  14 
ATOM   9661  N  N   . ARG A 1 19 ? 8.102   -3.231  -6.072  1.00 0.00 ? 19 ARG A N   14 
ATOM   9662  C  CA  . ARG A 1 19 ? 8.387   -3.388  -4.649  1.00 0.00 ? 19 ARG A CA  14 
ATOM   9663  C  C   . ARG A 1 19 ? 9.871   -3.414  -4.376  1.00 0.00 ? 19 ARG A C   14 
ATOM   9664  O  O   . ARG A 1 19 ? 10.345  -2.910  -3.341  1.00 0.00 ? 19 ARG A O   14 
ATOM   9665  C  CB  . ARG A 1 19 ? 7.707   -4.696  -4.147  1.00 0.00 ? 19 ARG A CB  14 
ATOM   9666  C  CG  . ARG A 1 19 ? 8.430   -6.005  -4.556  1.00 0.00 ? 19 ARG A CG  14 
ATOM   9667  C  CD  . ARG A 1 19 ? 9.573   -6.379  -3.604  1.00 0.00 ? 19 ARG A CD  14 
ATOM   9668  N  NE  . ARG A 1 19 ? 9.037   -6.425  -2.221  1.00 0.00 ? 19 ARG A NE  14 
ATOM   9669  C  CZ  . ARG A 1 19 ? 8.240   -7.367  -1.734  1.00 0.00 ? 19 ARG A CZ  14 
ATOM   9670  N  NH1 . ARG A 1 19 ? 7.813   -8.389  -2.414  1.00 0.00 ? 19 ARG A NH1 14 
ATOM   9671  N  NH2 . ARG A 1 19 ? 7.869   -7.255  -0.508  1.00 0.00 ? 19 ARG A NH2 14 
ATOM   9672  N  N   . ASP A 1 20 ? 10.733  -4.094  -5.367  1.00 0.00 ? 20 ASP A N   14 
ATOM   9673  C  CA  . ASP A 1 20 ? 12.186  -4.145  -5.216  1.00 0.00 ? 20 ASP A CA  14 
ATOM   9674  C  C   . ASP A 1 20 ? 12.725  -2.803  -4.778  1.00 0.00 ? 20 ASP A C   14 
ATOM   9675  O  O   . ASP A 1 20 ? 12.843  -1.859  -5.569  1.00 0.00 ? 20 ASP A O   14 
ATOM   9676  C  CB  . ASP A 1 20 ? 12.851  -4.641  -6.526  1.00 0.00 ? 20 ASP A CB  14 
ATOM   9677  C  CG  . ASP A 1 20 ? 14.386  -4.596  -6.580  1.00 0.00 ? 20 ASP A CG  14 
ATOM   9678  O  OD1 . ASP A 1 20 ? 15.096  -4.973  -5.659  1.00 0.00 ? 20 ASP A OD1 14 
ATOM   9679  O  OD2 . ASP A 1 20 ? 14.860  -4.106  -7.764  1.00 0.00 ? 20 ASP A OD2 14 
ATOM   9680  N  N   . PRO A 1 21 ? 13.131  -2.699  -3.361  1.00 0.00 ? 21 PRO A N   14 
ATOM   9681  C  CA  . PRO A 1 21 ? 13.684  -1.466  -2.644  1.00 0.00 ? 21 PRO A CA  14 
ATOM   9682  C  C   . PRO A 1 21 ? 14.550  -0.531  -3.453  1.00 0.00 ? 21 PRO A C   14 
ATOM   9683  O  O   . PRO A 1 21 ? 15.781  -0.489  -3.304  1.00 0.00 ? 21 PRO A O   14 
ATOM   9684  C  CB  . PRO A 1 21 ? 14.520  -2.022  -1.488  1.00 0.00 ? 21 PRO A CB  14 
ATOM   9685  C  CG  . PRO A 1 21 ? 13.632  -3.197  -1.050  1.00 0.00 ? 21 PRO A CG  14 
ATOM   9686  C  CD  . PRO A 1 21 ? 13.077  -3.786  -2.349  1.00 0.00 ? 21 PRO A CD  14 
ATOM   9687  N  N   . ASN A 1 22 ? 13.851  0.358   -4.407  1.00 0.00 ? 22 ASN A N   14 
ATOM   9688  C  CA  . ASN A 1 22 ? 14.541  1.428   -5.120  1.00 0.00 ? 22 ASN A CA  14 
ATOM   9689  C  C   . ASN A 1 22 ? 14.526  2.705   -4.311  1.00 0.00 ? 22 ASN A C   14 
ATOM   9690  O  O   . ASN A 1 22 ? 15.564  3.220   -3.874  1.00 0.00 ? 22 ASN A O   14 
ATOM   9691  C  CB  . ASN A 1 22 ? 13.862  1.654   -6.502  1.00 0.00 ? 22 ASN A CB  14 
ATOM   9692  C  CG  . ASN A 1 22 ? 14.096  3.011   -7.175  1.00 0.00 ? 22 ASN A CG  14 
ATOM   9693  O  OD1 . ASN A 1 22 ? 15.192  3.353   -7.594  1.00 0.00 ? 22 ASN A OD1 14 
ATOM   9694  N  ND2 . ASN A 1 22 ? 13.090  3.836   -7.291  1.00 0.00 ? 22 ASN A ND2 14 
ATOM   9695  N  N   . ALA A 1 23 ? 13.189  3.282   -4.042  1.00 0.00 ? 23 ALA A N   14 
ATOM   9696  C  CA  . ALA A 1 23 ? 13.000  4.502   -3.265  1.00 0.00 ? 23 ALA A CA  14 
ATOM   9697  C  C   . ALA A 1 23 ? 11.922  4.317   -2.222  1.00 0.00 ? 23 ALA A C   14 
ATOM   9698  O  O   . ALA A 1 23 ? 10.992  5.125   -2.094  1.00 0.00 ? 23 ALA A O   14 
ATOM   9699  C  CB  . ALA A 1 23 ? 12.683  5.639   -4.252  1.00 0.00 ? 23 ALA A CB  14 
ATOM   9700  N  N   . ASP A 1 24 ? 12.020  3.097   -1.391  1.00 0.00 ? 24 ASP A N   14 
ATOM   9701  C  CA  . ASP A 1 24 ? 10.979  2.724   -0.437  1.00 0.00 ? 24 ASP A CA  14 
ATOM   9702  C  C   . ASP A 1 24 ? 10.900  3.724   0.693   1.00 0.00 ? 24 ASP A C   14 
ATOM   9703  O  O   . ASP A 1 24 ? 9.858   4.336   0.964   1.00 0.00 ? 24 ASP A O   14 
ATOM   9704  C  CB  . ASP A 1 24 ? 11.219  1.284   0.086   1.00 0.00 ? 24 ASP A CB  14 
ATOM   9705  C  CG  . ASP A 1 24 ? 10.666  0.137   -0.772  1.00 0.00 ? 24 ASP A CG  14 
ATOM   9706  O  OD1 . ASP A 1 24 ? 10.182  0.308   -1.882  1.00 0.00 ? 24 ASP A OD1 14 
ATOM   9707  O  OD2 . ASP A 1 24 ? 10.765  -1.080  -0.158  1.00 0.00 ? 24 ASP A OD2 14 
ATOM   9708  N  N   . GLY A 1 25 ? 12.142  3.920   1.477   1.00 0.00 ? 25 GLY A N   14 
ATOM   9709  C  CA  . GLY A 1 25 ? 12.184  4.786   2.650   1.00 0.00 ? 25 GLY A CA  14 
ATOM   9710  C  C   . GLY A 1 25 ? 12.265  6.244   2.264   1.00 0.00 ? 25 GLY A C   14 
ATOM   9711  O  O   . GLY A 1 25 ? 12.398  7.132   3.125   1.00 0.00 ? 25 GLY A O   14 
ATOM   9712  N  N   . GLU A 1 26 ? 12.150  6.575   0.827   1.00 0.00 ? 26 GLU A N   14 
ATOM   9713  C  CA  . GLU A 1 26 ? 12.182  7.954   0.350   1.00 0.00 ? 26 GLU A CA  14 
ATOM   9714  C  C   . GLU A 1 26 ? 10.818  8.415   -0.104  1.00 0.00 ? 26 GLU A C   14 
ATOM   9715  O  O   . GLU A 1 26 ? 10.655  9.550   -0.589  1.00 0.00 ? 26 GLU A O   14 
ATOM   9716  C  CB  . GLU A 1 26 ? 13.227  8.068   -0.794  1.00 0.00 ? 26 GLU A CB  14 
ATOM   9717  C  CG  . GLU A 1 26 ? 13.646  9.508   -1.240  1.00 0.00 ? 26 GLU A CG  14 
ATOM   9718  C  CD  . GLU A 1 26 ? 15.076  9.973   -0.956  1.00 0.00 ? 26 GLU A CD  14 
ATOM   9719  O  OE1 . GLU A 1 26 ? 15.977  8.955   -0.870  1.00 0.00 ? 26 GLU A OE1 14 
ATOM   9720  O  OE2 . GLU A 1 26 ? 15.379  11.151  -0.820  1.00 0.00 ? 26 GLU A OE2 14 
ATOM   9721  N  N   . PHE A 1 27 ? 9.690   7.461   0.009   1.00 0.00 ? 27 PHE A N   14 
ATOM   9722  C  CA  . PHE A 1 27 ? 8.312   7.878   -0.230  1.00 0.00 ? 27 PHE A CA  14 
ATOM   9723  C  C   . PHE A 1 27 ? 7.310   6.944   0.398   1.00 0.00 ? 27 PHE A C   14 
ATOM   9724  O  O   . PHE A 1 27 ? 7.617   5.856   0.905   1.00 0.00 ? 27 PHE A O   14 
ATOM   9725  C  CB  . PHE A 1 27 ? 8.045   8.128   -1.739  1.00 0.00 ? 27 PHE A CB  14 
ATOM   9726  C  CG  . PHE A 1 27 ? 7.703   6.971   -2.687  1.00 0.00 ? 27 PHE A CG  14 
ATOM   9727  C  CD1 . PHE A 1 27 ? 8.728   6.283   -3.352  1.00 0.00 ? 27 PHE A CD1 14 
ATOM   9728  C  CD2 . PHE A 1 27 ? 6.371   6.609   -2.925  1.00 0.00 ? 27 PHE A CD2 14 
ATOM   9729  C  CE1 . PHE A 1 27 ? 8.422   5.248   -4.231  1.00 0.00 ? 27 PHE A CE1 14 
ATOM   9730  C  CE2 . PHE A 1 27 ? 6.069   5.574   -3.803  1.00 0.00 ? 27 PHE A CE2 14 
ATOM   9731  C  CZ  . PHE A 1 27 ? 7.093   4.893   -4.457  1.00 0.00 ? 27 PHE A CZ  14 
ATOM   9732  N  N   . VAL A 1 28 ? 5.902   7.402   0.372   1.00 0.00 ? 28 VAL A N   14 
ATOM   9733  C  CA  . VAL A 1 28 ? 4.802   6.778   1.111   1.00 0.00 ? 28 VAL A CA  14 
ATOM   9734  C  C   . VAL A 1 28 ? 3.552   6.784   0.254   1.00 0.00 ? 28 VAL A C   14 
ATOM   9735  O  O   . VAL A 1 28 ? 3.433   7.627   -0.671  1.00 0.00 ? 28 VAL A O   14 
ATOM   9736  C  CB  . VAL A 1 28 ? 4.572   7.595   2.443   1.00 0.00 ? 28 VAL A CB  14 
ATOM   9737  C  CG1 . VAL A 1 28 ? 5.831   7.812   3.336   1.00 0.00 ? 28 VAL A CG1 14 
ATOM   9738  C  CG2 . VAL A 1 28 ? 4.006   9.020   2.204   1.00 0.00 ? 28 VAL A CG2 14 
ATOM   9739  N  N   . PHE A 1 29 ? 2.484   5.789   0.480   1.00 0.00 ? 29 PHE A N   14 
ATOM   9740  C  CA  . PHE A 1 29 ? 1.336   5.635   -0.429  1.00 0.00 ? 29 PHE A CA  14 
ATOM   9741  C  C   . PHE A 1 29 ? 0.075   5.500   0.388   1.00 0.00 ? 29 PHE A C   14 
ATOM   9742  O  O   . PHE A 1 29 ? 0.053   4.794   1.419   1.00 0.00 ? 29 PHE A O   14 
ATOM   9743  C  CB  . PHE A 1 29 ? 1.549   4.376   -1.316  1.00 0.00 ? 29 PHE A CB  14 
ATOM   9744  C  CG  . PHE A 1 29 ? 0.601   3.174   -1.193  1.00 0.00 ? 29 PHE A CG  14 
ATOM   9745  C  CD1 . PHE A 1 29 ? 0.506   2.466   0.009   1.00 0.00 ? 29 PHE A CD1 14 
ATOM   9746  C  CD2 . PHE A 1 29 ? -0.120  2.731   -2.308  1.00 0.00 ? 29 PHE A CD2 14 
ATOM   9747  C  CE1 . PHE A 1 29 ? -0.308  1.343   0.103   1.00 0.00 ? 29 PHE A CE1 14 
ATOM   9748  C  CE2 . PHE A 1 29 ? -0.929  1.602   -2.216  1.00 0.00 ? 29 PHE A CE2 14 
ATOM   9749  C  CZ  . PHE A 1 29 ? -1.025  0.910   -1.009  1.00 0.00 ? 29 PHE A CZ  14 
ATOM   9750  N  N   . ALA A 1 30 ? -1.117  6.263   -0.038  1.00 0.00 ? 30 ALA A N   14 
ATOM   9751  C  CA  . ALA A 1 30 ? -2.315  6.346   0.792   1.00 0.00 ? 30 ALA A CA  14 
ATOM   9752  C  C   . ALA A 1 30 ? -3.550  5.948   0.021   1.00 0.00 ? 30 ALA A C   14 
ATOM   9753  O  O   . ALA A 1 30 ? -4.111  6.726   -0.763  1.00 0.00 ? 30 ALA A O   14 
ATOM   9754  C  CB  . ALA A 1 30 ? -2.395  7.776   1.354   1.00 0.00 ? 30 ALA A CB  14 
ATOM   9755  N  N   . VAL A 1 31 ? -4.074  4.591   0.287   1.00 0.00 ? 31 VAL A N   14 
ATOM   9756  C  CA  . VAL A 1 31 ? -5.323  4.118   -0.314  1.00 0.00 ? 31 VAL A CA  14 
ATOM   9757  C  C   . VAL A 1 31 ? -6.472  4.300   0.648   1.00 0.00 ? 31 VAL A C   14 
ATOM   9758  O  O   . VAL A 1 31 ? -6.621  3.561   1.631   1.00 0.00 ? 31 VAL A O   14 
ATOM   9759  C  CB  . VAL A 1 31 ? -5.160  2.610   -0.748  1.00 0.00 ? 31 VAL A CB  14 
ATOM   9760  C  CG1 . VAL A 1 31 ? -3.986  1.821   -0.090  1.00 0.00 ? 31 VAL A CG1 14 
ATOM   9761  C  CG2 . VAL A 1 31 ? -6.407  1.729   -0.494  1.00 0.00 ? 31 VAL A CG2 14 
ATOM   9762  N  N   . ARG A 1 32 ? -7.395  5.425   0.373   1.00 0.00 ? 32 ARG A N   14 
ATOM   9763  C  CA  . ARG A 1 32 ? -8.425  5.818   1.329   1.00 0.00 ? 32 ARG A CA  14 
ATOM   9764  C  C   . ARG A 1 32 ? -9.701  5.029   1.175   1.00 0.00 ? 32 ARG A C   14 
ATOM   9765  O  O   . ARG A 1 32 ? -10.806 5.535   1.460   1.00 0.00 ? 32 ARG A O   14 
ATOM   9766  C  CB  . ARG A 1 32 ? -8.686  7.344   1.186   1.00 0.00 ? 32 ARG A CB  14 
ATOM   9767  C  CG  . ARG A 1 32 ? -9.157  7.804   -0.220  1.00 0.00 ? 32 ARG A CG  14 
ATOM   9768  C  CD  . ARG A 1 32 ? -9.434  9.312   -0.280  1.00 0.00 ? 32 ARG A CD  14 
ATOM   9769  N  NE  . ARG A 1 32 ? -10.681 9.587   0.480   1.00 0.00 ? 32 ARG A NE  14 
ATOM   9770  C  CZ  . ARG A 1 32 ? -11.289 10.762  0.564   1.00 0.00 ? 32 ARG A CZ  14 
ATOM   9771  N  NH1 . ARG A 1 32 ? -10.869 11.848  -0.014  1.00 0.00 ? 32 ARG A NH1 14 
ATOM   9772  N  NH2 . ARG A 1 32 ? -12.366 10.824  1.264   1.00 0.00 ? 32 ARG A NH2 14 
ATOM   9773  N  N   . THR A 1 33 ? -9.598  3.629   0.713   1.00 0.00 ? 33 THR A N   14 
ATOM   9774  C  CA  . THR A 1 33 ? -10.771 2.767   0.590   1.00 0.00 ? 33 THR A CA  14 
ATOM   9775  C  C   . THR A 1 33 ? -10.865 1.804   1.750   1.00 0.00 ? 33 THR A C   14 
ATOM   9776  O  O   . THR A 1 33 ? -11.952 1.533   2.283   1.00 0.00 ? 33 THR A O   14 
ATOM   9777  C  CB  . THR A 1 33 ? -10.757 1.997   -0.773  1.00 0.00 ? 33 THR A CB  14 
ATOM   9778  O  OG1 . THR A 1 33 ? -11.963 1.261   -0.940  1.00 0.00 ? 33 THR A OG1 14 
ATOM   9779  C  CG2 . THR A 1 33 ? -9.636  0.952   -0.958  1.00 0.00 ? 33 THR A CG2 14 
ATOM   9780  N  N   . THR A 1 34 ? -9.602  1.175   2.192   1.00 0.00 ? 34 THR A N   14 
ATOM   9781  C  CA  . THR A 1 34 ? -9.526  0.359   3.402   1.00 0.00 ? 34 THR A CA  14 
ATOM   9782  C  C   . THR A 1 34 ? -8.945  1.155   4.547   1.00 0.00 ? 34 THR A C   14 
ATOM   9783  O  O   . THR A 1 34 ? -9.133  0.841   5.730   1.00 0.00 ? 34 THR A O   14 
ATOM   9784  C  CB  . THR A 1 34 ? -8.705  -0.947  3.137   1.00 0.00 ? 34 THR A CB  14 
ATOM   9785  O  OG1 . THR A 1 34 ? -9.097  -1.538  1.903   1.00 0.00 ? 34 THR A OG1 14 
ATOM   9786  C  CG2 . THR A 1 34 ? -8.867  -2.080  4.173   1.00 0.00 ? 34 THR A CG2 14 
ATOM   9787  N  N   . GLY A 1 35 ? -8.104  2.315   4.169   1.00 0.00 ? 35 GLY A N   14 
ATOM   9788  C  CA  . GLY A 1 35 ? -7.625  3.287   5.144   1.00 0.00 ? 35 GLY A CA  14 
ATOM   9789  C  C   . GLY A 1 35 ? -6.257  2.994   5.702   1.00 0.00 ? 35 GLY A C   14 
ATOM   9790  O  O   . GLY A 1 35 ? -6.080  2.839   6.932   1.00 0.00 ? 35 GLY A O   14 
ATOM   9791  N  N   . ILE A 1 36 ? -5.128  2.856   4.754   1.00 0.00 ? 36 ILE A N   14 
ATOM   9792  C  CA  . ILE A 1 36 ? -3.745  2.773   5.221   1.00 0.00 ? 36 ILE A CA  14 
ATOM   9793  C  C   . ILE A 1 36 ? -2.818  3.648   4.410   1.00 0.00 ? 36 ILE A C   14 
ATOM   9794  O  O   . ILE A 1 36 ? -2.870  3.714   3.172   1.00 0.00 ? 36 ILE A O   14 
ATOM   9795  C  CB  . ILE A 1 36 ? -3.215  1.288   5.321   1.00 0.00 ? 36 ILE A CB  14 
ATOM   9796  C  CG1 . ILE A 1 36 ? -2.009  0.909   4.405   1.00 0.00 ? 36 ILE A CG1 14 
ATOM   9797  C  CG2 . ILE A 1 36 ? -4.342  0.225   5.134   1.00 0.00 ? 36 ILE A CG2 14 
ATOM   9798  C  CD1 . ILE A 1 36 ? -2.366  0.198   3.086   1.00 0.00 ? 36 ILE A CD1 14 
ATOM   9799  N  N   . PHE A 1 37 ? -1.859  4.460   5.191   1.00 0.00 ? 37 PHE A N   14 
ATOM   9800  C  CA  . PHE A 1 37 ? -0.756  5.213   4.574   1.00 0.00 ? 37 PHE A CA  14 
ATOM   9801  C  C   . PHE A 1 37 ? 0.527   4.445   4.782   1.00 0.00 ? 37 PHE A C   14 
ATOM   9802  O  O   . PHE A 1 37 ? 1.171   4.538   5.854   1.00 0.00 ? 37 PHE A O   14 
ATOM   9803  C  CB  . PHE A 1 37 ? -0.677  6.651   5.163   1.00 0.00 ? 37 PHE A CB  14 
ATOM   9804  C  CG  . PHE A 1 37 ? 0.205   6.968   6.378   1.00 0.00 ? 37 PHE A CG  14 
ATOM   9805  C  CD1 . PHE A 1 37 ? 1.568   7.246   6.228   1.00 0.00 ? 37 PHE A CD1 14 
ATOM   9806  C  CD2 . PHE A 1 37 ? -0.364  6.990   7.656   1.00 0.00 ? 37 PHE A CD2 14 
ATOM   9807  C  CE1 . PHE A 1 37 ? 2.348   7.540   7.343   1.00 0.00 ? 37 PHE A CE1 14 
ATOM   9808  C  CE2 . PHE A 1 37 ? 0.414   7.292   8.768   1.00 0.00 ? 37 PHE A CE2 14 
ATOM   9809  C  CZ  . PHE A 1 37 ? 1.771   7.566   8.612   1.00 0.00 ? 37 PHE A CZ  14 
ATOM   9810  N  N   . CYS A 1 38 ? 0.982   3.522   3.721   1.00 0.00 ? 38 CYS A N   14 
ATOM   9811  C  CA  . CYS A 1 38 ? 2.087   2.588   3.920   1.00 0.00 ? 38 CYS A CA  14 
ATOM   9812  C  C   . CYS A 1 38 ? 3.244   2.904   3.010   1.00 0.00 ? 38 CYS A C   14 
ATOM   9813  O  O   . CYS A 1 38 ? 3.085   3.634   2.011   1.00 0.00 ? 38 CYS A O   14 
ATOM   9814  C  CB  . CYS A 1 38 ? 1.545   1.166   3.595   1.00 0.00 ? 38 CYS A CB  14 
ATOM   9815  S  SG  . CYS A 1 38 ? 2.724   -0.126  4.086   1.00 0.00 ? 38 CYS A SG  14 
ATOM   9816  N  N   . ARG A 1 39 ? 4.540   2.275   3.326   1.00 0.00 ? 39 ARG A N   14 
ATOM   9817  C  CA  . ARG A 1 39 ? 5.616   2.276   2.308   1.00 0.00 ? 39 ARG A CA  14 
ATOM   9818  C  C   . ARG A 1 39 ? 5.167   1.308   1.220   1.00 0.00 ? 39 ARG A C   14 
ATOM   9819  O  O   . ARG A 1 39 ? 4.406   0.344   1.476   1.00 0.00 ? 39 ARG A O   14 
ATOM   9820  C  CB  . ARG A 1 39 ? 6.999   2.008   2.926   1.00 0.00 ? 39 ARG A CB  14 
ATOM   9821  C  CG  . ARG A 1 39 ? 7.107   2.106   4.473   1.00 0.00 ? 39 ARG A CG  14 
ATOM   9822  C  CD  . ARG A 1 39 ? 8.515   1.771   4.982   1.00 0.00 ? 39 ARG A CD  14 
ATOM   9823  N  NE  . ARG A 1 39 ? 8.830   2.658   6.131   1.00 0.00 ? 39 ARG A NE  14 
ATOM   9824  C  CZ  . ARG A 1 39 ? 9.374   3.864   6.047   1.00 0.00 ? 39 ARG A CZ  14 
ATOM   9825  N  NH1 . ARG A 1 39 ? 9.714   4.440   4.932   1.00 0.00 ? 39 ARG A NH1 14 
ATOM   9826  N  NH2 . ARG A 1 39 ? 9.576   4.502   7.146   1.00 0.00 ? 39 ARG A NH2 14 
ATOM   9827  N  N   . PRO A 1 40 ? 5.680   1.517   -0.141  1.00 0.00 ? 40 PRO A N   14 
ATOM   9828  C  CA  . PRO A 1 40 ? 5.318   0.713   -1.413  1.00 0.00 ? 40 PRO A CA  14 
ATOM   9829  C  C   . PRO A 1 40 ? 4.613   -0.605  -1.262  1.00 0.00 ? 40 PRO A C   14 
ATOM   9830  O  O   . PRO A 1 40 ? 4.873   -1.411  -0.345  1.00 0.00 ? 40 PRO A O   14 
ATOM   9831  C  CB  . PRO A 1 40 ? 6.652   0.601   -2.144  1.00 0.00 ? 40 PRO A CB  14 
ATOM   9832  C  CG  . PRO A 1 40 ? 7.192   2.031   -1.936  1.00 0.00 ? 40 PRO A CG  14 
ATOM   9833  C  CD  . PRO A 1 40 ? 6.645   2.544   -0.597  1.00 0.00 ? 40 PRO A CD  14 
ATOM   9834  N  N   . SER A 1 41 ? 3.614   -0.991  -2.294  1.00 0.00 ? 41 SER A N   14 
ATOM   9835  C  CA  . SER A 1 41 ? 2.655   -2.082  -2.234  1.00 0.00 ? 41 SER A CA  14 
ATOM   9836  C  C   . SER A 1 41 ? 2.588   -2.912  -0.981  1.00 0.00 ? 41 SER A C   14 
ATOM   9837  O  O   . SER A 1 41 ? 3.504   -3.664  -0.624  1.00 0.00 ? 41 SER A O   14 
ATOM   9838  C  CB  . SER A 1 41 ? 2.857   -3.015  -3.480  1.00 0.00 ? 41 SER A CB  14 
ATOM   9839  O  OG  . SER A 1 41 ? 2.580   -2.357  -4.716  1.00 0.00 ? 41 SER A OG  14 
ATOM   9840  N  N   . CYS A 1 42 ? 1.317   -2.829  -0.205  1.00 0.00 ? 42 CYS A N   14 
ATOM   9841  C  CA  . CYS A 1 42 ? 1.000   -3.717  0.903   1.00 0.00 ? 42 CYS A CA  14 
ATOM   9842  C  C   . CYS A 1 42 ? 0.775   -5.129  0.368   1.00 0.00 ? 42 CYS A C   14 
ATOM   9843  O  O   . CYS A 1 42 ? 0.434   -5.354  -0.799  1.00 0.00 ? 42 CYS A O   14 
ATOM   9844  C  CB  . CYS A 1 42 ? -0.222  -3.224  1.698   1.00 0.00 ? 42 CYS A CB  14 
ATOM   9845  S  SG  . CYS A 1 42 ? 0.090   -1.671  2.556   1.00 0.00 ? 42 CYS A SG  14 
ATOM   9846  N  N   . ARG A 1 43 ? 0.992   -6.202  1.359   1.00 0.00 ? 43 ARG A N   14 
ATOM   9847  C  CA  . ARG A 1 43 ? 1.004   -7.620  0.993   1.00 0.00 ? 43 ARG A CA  14 
ATOM   9848  C  C   . ARG A 1 43 ? -0.272  -8.319  1.374   1.00 0.00 ? 43 ARG A C   14 
ATOM   9849  O  O   . ARG A 1 43 ? -0.540  -9.459  0.950   1.00 0.00 ? 43 ARG A O   14 
ATOM   9850  C  CB  . ARG A 1 43 ? 2.309   -8.228  1.597   1.00 0.00 ? 43 ARG A CB  14 
ATOM   9851  C  CG  . ARG A 1 43 ? 3.502   -7.236  1.629   1.00 0.00 ? 43 ARG A CG  14 
ATOM   9852  C  CD  . ARG A 1 43 ? 4.705   -7.699  2.455   1.00 0.00 ? 43 ARG A CD  14 
ATOM   9853  N  NE  . ARG A 1 43 ? 4.641   -9.162  2.689   1.00 0.00 ? 43 ARG A NE  14 
ATOM   9854  C  CZ  . ARG A 1 43 ? 5.278   -9.811  3.661   1.00 0.00 ? 43 ARG A CZ  14 
ATOM   9855  N  NH1 . ARG A 1 43 ? 6.055   -9.246  4.536   1.00 0.00 ? 43 ARG A NH1 14 
ATOM   9856  N  NH2 . ARG A 1 43 ? 5.111   -11.085 3.732   1.00 0.00 ? 43 ARG A NH2 14 
ATOM   9857  N  N   . ALA A 1 44 ? -1.216  -7.581  2.239   1.00 0.00 ? 44 ALA A N   14 
ATOM   9858  C  CA  . ALA A 1 44 ? -2.569  -8.054  2.499   1.00 0.00 ? 44 ALA A CA  14 
ATOM   9859  C  C   . ALA A 1 44 ? -3.474  -7.678  1.335   1.00 0.00 ? 44 ALA A C   14 
ATOM   9860  O  O   . ALA A 1 44 ? -3.041  -7.183  0.287   1.00 0.00 ? 44 ALA A O   14 
ATOM   9861  C  CB  . ALA A 1 44 ? -3.038  -7.428  3.822   1.00 0.00 ? 44 ALA A CB  14 
ATOM   9862  N  N   . ARG A 1 45 ? -4.913  -7.996  1.539   1.00 0.00 ? 45 ARG A N   14 
ATOM   9863  C  CA  . ARG A 1 45 ? -5.927  -7.544  0.590   1.00 0.00 ? 45 ARG A CA  14 
ATOM   9864  C  C   . ARG A 1 45 ? -5.683  -6.095  0.217   1.00 0.00 ? 45 ARG A C   14 
ATOM   9865  O  O   . ARG A 1 45 ? -6.075  -5.167  0.936   1.00 0.00 ? 45 ARG A O   14 
ATOM   9866  C  CB  . ARG A 1 45 ? -7.342  -7.742  1.192   1.00 0.00 ? 45 ARG A CB  14 
ATOM   9867  C  CG  . ARG A 1 45 ? -7.499  -8.967  2.130   1.00 0.00 ? 45 ARG A CG  14 
ATOM   9868  C  CD  . ARG A 1 45 ? -7.645  -8.560  3.605   1.00 0.00 ? 45 ARG A CD  14 
ATOM   9869  N  NE  . ARG A 1 45 ? -9.085  -8.330  3.880   1.00 0.00 ? 45 ARG A NE  14 
ATOM   9870  C  CZ  . ARG A 1 45 ? -9.642  -7.220  4.341   1.00 0.00 ? 45 ARG A CZ  14 
ATOM   9871  N  NH1 . ARG A 1 45 ? -8.990  -6.132  4.622   1.00 0.00 ? 45 ARG A NH1 14 
ATOM   9872  N  NH2 . ARG A 1 45 ? -10.918 -7.224  4.521   1.00 0.00 ? 45 ARG A NH2 14 
ATOM   9873  N  N   . HIS A 1 46 ? -4.923  -5.858  -1.029  1.00 0.00 ? 46 HIS A N   14 
ATOM   9874  C  CA  . HIS A 1 46 ? -4.453  -4.530  -1.411  1.00 0.00 ? 46 HIS A CA  14 
ATOM   9875  C  C   . HIS A 1 46 ? -5.375  -3.867  -2.405  1.00 0.00 ? 46 HIS A C   14 
ATOM   9876  O  O   . HIS A 1 46 ? -6.074  -4.520  -3.191  1.00 0.00 ? 46 HIS A O   14 
ATOM   9877  C  CB  . HIS A 1 46 ? -3.053  -4.729  -2.018  1.00 0.00 ? 46 HIS A CB  14 
ATOM   9878  C  CG  . HIS A 1 46 ? -2.913  -4.115  -3.380  1.00 0.00 ? 46 HIS A CG  14 
ATOM   9879  N  ND1 . HIS A 1 46 ? -3.641  -4.468  -4.514  1.00 0.00 ? 46 HIS A ND1 14 
ATOM   9880  C  CD2 . HIS A 1 46 ? -2.007  -3.099  -3.654  1.00 0.00 ? 46 HIS A CD2 14 
ATOM   9881  C  CE1 . HIS A 1 46 ? -3.103  -3.617  -5.407  1.00 0.00 ? 46 HIS A CE1 14 
ATOM   9882  N  NE2 . HIS A 1 46 ? -2.129  -2.769  -4.979  1.00 0.00 ? 46 HIS A NE2 14 
ATOM   9883  N  N   . ALA A 1 47 ? -5.401  -2.386  -2.377  1.00 0.00 ? 47 ALA A N   14 
ATOM   9884  C  CA  . ALA A 1 47 ? -6.243  -1.607  -3.279  1.00 0.00 ? 47 ALA A CA  14 
ATOM   9885  C  C   . ALA A 1 47 ? -5.438  -1.070  -4.439  1.00 0.00 ? 47 ALA A C   14 
ATOM   9886  O  O   . ALA A 1 47 ? -4.199  -1.076  -4.433  1.00 0.00 ? 47 ALA A O   14 
ATOM   9887  C  CB  . ALA A 1 47 ? -6.910  -0.495  -2.451  1.00 0.00 ? 47 ALA A CB  14 
ATOM   9888  N  N   . LEU A 1 48 ? -6.214  -0.551  -5.586  1.00 0.00 ? 48 LEU A N   14 
ATOM   9889  C  CA  . LEU A 1 48 ? -5.574  -0.123  -6.828  1.00 0.00 ? 48 LEU A CA  14 
ATOM   9890  C  C   . LEU A 1 48 ? -4.845  1.185   -6.634  1.00 0.00 ? 48 LEU A C   14 
ATOM   9891  O  O   . LEU A 1 48 ? -4.921  1.828   -5.578  1.00 0.00 ? 48 LEU A O   14 
ATOM   9892  C  CB  . LEU A 1 48 ? -6.627  -0.023  -7.969  1.00 0.00 ? 48 LEU A CB  14 
ATOM   9893  C  CG  . LEU A 1 48 ? -7.897  -0.911  -7.864  1.00 0.00 ? 48 LEU A CG  14 
ATOM   9894  C  CD1 . LEU A 1 48 ? -9.064  -0.097  -7.287  1.00 0.00 ? 48 LEU A CD1 14 
ATOM   9895  C  CD2 . LEU A 1 48 ? -8.310  -1.528  -9.209  1.00 0.00 ? 48 LEU A CD2 14 
ATOM   9896  N  N   . ARG A 1 49 ? -3.999  1.639   -7.763  1.00 0.00 ? 49 ARG A N   14 
ATOM   9897  C  CA  . ARG A 1 49 ? -3.375  2.958   -7.775  1.00 0.00 ? 49 ARG A CA  14 
ATOM   9898  C  C   . ARG A 1 49 ? -4.393  4.063   -7.925  1.00 0.00 ? 49 ARG A C   14 
ATOM   9899  O  O   . ARG A 1 49 ? -4.091  5.252   -7.736  1.00 0.00 ? 49 ARG A O   14 
ATOM   9900  C  CB  . ARG A 1 49 ? -2.320  3.009   -8.918  1.00 0.00 ? 49 ARG A CB  14 
ATOM   9901  C  CG  . ARG A 1 49 ? -2.663  2.188   -10.189 1.00 0.00 ? 49 ARG A CG  14 
ATOM   9902  C  CD  . ARG A 1 49 ? -1.692  2.457   -11.346 1.00 0.00 ? 49 ARG A CD  14 
ATOM   9903  N  NE  . ARG A 1 49 ? -2.476  2.901   -12.526 1.00 0.00 ? 49 ARG A NE  14 
ATOM   9904  C  CZ  . ARG A 1 49 ? -2.735  4.161   -12.849 1.00 0.00 ? 49 ARG A CZ  14 
ATOM   9905  N  NH1 . ARG A 1 49 ? -2.328  5.191   -12.168 1.00 0.00 ? 49 ARG A NH1 14 
ATOM   9906  N  NH2 . ARG A 1 49 ? -3.435  4.370   -13.907 1.00 0.00 ? 49 ARG A NH2 14 
ATOM   9907  N  N   . GLU A 1 50 ? -5.762  3.669   -8.333  1.00 0.00 ? 50 GLU A N   14 
ATOM   9908  C  CA  . GLU A 1 50 ? -6.788  4.630   -8.704  1.00 0.00 ? 50 GLU A CA  14 
ATOM   9909  C  C   . GLU A 1 50 ? -7.603  5.144   -7.542  1.00 0.00 ? 50 GLU A C   14 
ATOM   9910  O  O   . GLU A 1 50 ? -8.658  5.791   -7.759  1.00 0.00 ? 50 GLU A O   14 
ATOM   9911  C  CB  . GLU A 1 50 ? -7.725  3.983   -9.772  1.00 0.00 ? 50 GLU A CB  14 
ATOM   9912  C  CG  . GLU A 1 50 ? -7.601  2.449   -10.045 1.00 0.00 ? 50 GLU A CG  14 
ATOM   9913  C  CD  . GLU A 1 50 ? -7.652  1.964   -11.498 1.00 0.00 ? 50 GLU A CD  14 
ATOM   9914  O  OE1 . GLU A 1 50 ? -8.619  2.143   -12.226 1.00 0.00 ? 50 GLU A OE1 14 
ATOM   9915  O  OE2 . GLU A 1 50 ? -6.522  1.319   -11.899 1.00 0.00 ? 50 GLU A OE2 14 
ATOM   9916  N  N   . ASN A 1 51 ? -7.169  4.854   -6.169  1.00 0.00 ? 51 ASN A N   14 
ATOM   9917  C  CA  . ASN A 1 51 ? -7.813  5.475   -4.984  1.00 0.00 ? 51 ASN A CA  14 
ATOM   9918  C  C   . ASN A 1 51 ? -6.710  5.888   -4.031  1.00 0.00 ? 51 ASN A C   14 
ATOM   9919  O  O   . ASN A 1 51 ? -6.875  6.107   -2.824  1.00 0.00 ? 51 ASN A O   14 
ATOM   9920  C  CB  . ASN A 1 51 ? -8.690  4.379   -4.330  1.00 0.00 ? 51 ASN A CB  14 
ATOM   9921  C  CG  . ASN A 1 51 ? -8.042  3.500   -3.257  1.00 0.00 ? 51 ASN A CG  14 
ATOM   9922  O  OD1 . ASN A 1 51 ? -8.532  3.328   -2.151  1.00 0.00 ? 51 ASN A OD1 14 
ATOM   9923  N  ND2 . ASN A 1 51 ? -6.925  2.887   -3.553  1.00 0.00 ? 51 ASN A ND2 14 
ATOM   9924  N  N   . VAL A 1 52 ? -5.353  5.961   -4.657  1.00 0.00 ? 52 VAL A N   14 
ATOM   9925  C  CA  . VAL A 1 52 ? -4.117  6.020   -3.879  1.00 0.00 ? 52 VAL A CA  14 
ATOM   9926  C  C   . VAL A 1 52 ? -3.555  7.412   -3.875  1.00 0.00 ? 52 VAL A C   14 
ATOM   9927  O  O   . VAL A 1 52 ? -3.798  8.185   -4.845  1.00 0.00 ? 52 VAL A O   14 
ATOM   9928  C  CB  . VAL A 1 52 ? -3.099  4.948   -4.479  1.00 0.00 ? 52 VAL A CB  14 
ATOM   9929  C  CG1 . VAL A 1 52 ? -2.060  5.452   -5.510  1.00 0.00 ? 52 VAL A CG1 14 
ATOM   9930  C  CG2 . VAL A 1 52 ? -2.292  4.214   -3.380  1.00 0.00 ? 52 VAL A CG2 14 
ATOM   9931  N  N   . SER A 1 53 ? -2.755  7.895   -2.732  1.00 0.00 ? 53 SER A N   14 
ATOM   9932  C  CA  . SER A 1 53 ? -2.043  9.179   -2.767  1.00 0.00 ? 53 SER A CA  14 
ATOM   9933  C  C   . SER A 1 53 ? -0.638  9.020   -2.245  1.00 0.00 ? 53 SER A C   14 
ATOM   9934  O  O   . SER A 1 53 ? -0.402  8.348   -1.221  1.00 0.00 ? 53 SER A O   14 
ATOM   9935  C  CB  . SER A 1 53 ? -2.833  10.272  -2.008  1.00 0.00 ? 53 SER A CB  14 
ATOM   9936  O  OG  . SER A 1 53 ? -2.225  11.566  -2.104  1.00 0.00 ? 53 SER A OG  14 
ATOM   9937  N  N   . PHE A 1 54 ? 0.463   9.718   -2.955  1.00 0.00 ? 54 PHE A N   14 
ATOM   9938  C  CA  . PHE A 1 54 ? 1.867   9.465   -2.646  1.00 0.00 ? 54 PHE A CA  14 
ATOM   9939  C  C   . PHE A 1 54 ? 2.636   10.676  -2.186  1.00 0.00 ? 54 PHE A C   14 
ATOM   9940  O  O   . PHE A 1 54 ? 2.470   11.805  -2.666  1.00 0.00 ? 54 PHE A O   14 
ATOM   9941  C  CB  . PHE A 1 54 ? 2.565   8.846   -3.904  1.00 0.00 ? 54 PHE A CB  14 
ATOM   9942  C  CG  . PHE A 1 54 ? 1.959   7.521   -4.395  1.00 0.00 ? 54 PHE A CG  14 
ATOM   9943  C  CD1 . PHE A 1 54 ? 1.373   6.640   -3.476  1.00 0.00 ? 54 PHE A CD1 14 
ATOM   9944  C  CD2 . PHE A 1 54 ? 1.970   7.190   -5.753  1.00 0.00 ? 54 PHE A CD2 14 
ATOM   9945  C  CE1 . PHE A 1 54 ? 0.811   5.444   -3.915  1.00 0.00 ? 54 PHE A CE1 14 
ATOM   9946  C  CE2 . PHE A 1 54 ? 1.409   5.995   -6.189  1.00 0.00 ? 54 PHE A CE2 14 
ATOM   9947  C  CZ  . PHE A 1 54 ? 0.829   5.122   -5.272  1.00 0.00 ? 54 PHE A CZ  14 
ATOM   9948  N  N   . TYR A 1 55 ? 3.609   10.447  -1.084  1.00 0.00 ? 55 TYR A N   14 
ATOM   9949  C  CA  . TYR A 1 55 ? 4.318   11.521  -0.390  1.00 0.00 ? 55 TYR A CA  14 
ATOM   9950  C  C   . TYR A 1 55 ? 5.767   11.143  -0.165  1.00 0.00 ? 55 TYR A C   14 
ATOM   9951  O  O   . TYR A 1 55 ? 6.107   9.942   -0.117  1.00 0.00 ? 55 TYR A O   14 
ATOM   9952  C  CB  . TYR A 1 55 ? 3.678   11.787  1.003   1.00 0.00 ? 55 TYR A CB  14 
ATOM   9953  C  CG  . TYR A 1 55 ? 2.180   11.490  1.202   1.00 0.00 ? 55 TYR A CG  14 
ATOM   9954  C  CD1 . TYR A 1 55 ? 1.305   11.662  0.125   1.00 0.00 ? 55 TYR A CD1 14 
ATOM   9955  C  CD2 . TYR A 1 55 ? 1.678   11.082  2.440   1.00 0.00 ? 55 TYR A CD2 14 
ATOM   9956  C  CE1 . TYR A 1 55 ? -0.057  11.429  0.284   1.00 0.00 ? 55 TYR A CE1 14 
ATOM   9957  C  CE2 . TYR A 1 55 ? 0.313   10.851  2.596   1.00 0.00 ? 55 TYR A CE2 14 
ATOM   9958  C  CZ  . TYR A 1 55 ? -0.552  11.027  1.521   1.00 0.00 ? 55 TYR A CZ  14 
ATOM   9959  O  OH  . TYR A 1 55 ? -1.892  10.809  1.682   1.00 0.00 ? 55 TYR A OH  14 
ATOM   9960  N  N   . ALA A 1 56 ? 6.782   12.208  0.027   1.00 0.00 ? 56 ALA A N   14 
ATOM   9961  C  CA  . ALA A 1 56 ? 8.187   11.924  0.298   1.00 0.00 ? 56 ALA A CA  14 
ATOM   9962  C  C   . ALA A 1 56 ? 8.420   11.142  1.568   1.00 0.00 ? 56 ALA A C   14 
ATOM   9963  O  O   . ALA A 1 56 ? 9.351   10.309  1.637   1.00 0.00 ? 56 ALA A O   14 
ATOM   9964  C  CB  . ALA A 1 56 ? 8.957   13.262  0.286   1.00 0.00 ? 56 ALA A CB  14 
ATOM   9965  N  N   . ASN A 1 57 ? 7.559   11.419  2.737   1.00 0.00 ? 57 ASN A N   14 
ATOM   9966  C  CA  . ASN A 1 57 ? 7.803   10.797  4.037   1.00 0.00 ? 57 ASN A CA  14 
ATOM   9967  C  C   . ASN A 1 57 ? 6.538   10.656  4.849   1.00 0.00 ? 57 ASN A C   14 
ATOM   9968  O  O   . ASN A 1 57 ? 5.531   11.341  4.625   1.00 0.00 ? 57 ASN A O   14 
ATOM   9969  C  CB  . ASN A 1 57 ? 8.870   11.619  4.815   1.00 0.00 ? 57 ASN A CB  14 
ATOM   9970  C  CG  . ASN A 1 57 ? 8.881   11.478  6.341   1.00 0.00 ? 57 ASN A CG  14 
ATOM   9971  O  OD1 . ASN A 1 57 ? 8.524   12.382  7.083   1.00 0.00 ? 57 ASN A OD1 14 
ATOM   9972  N  ND2 . ASN A 1 57 ? 9.299   10.359  6.866   1.00 0.00 ? 57 ASN A ND2 14 
ATOM   9973  N  N   . ALA A 1 58 ? 6.568   9.634   5.923   1.00 0.00 ? 58 ALA A N   14 
ATOM   9974  C  CA  . ALA A 1 58 ? 5.382   9.277   6.693   1.00 0.00 ? 58 ALA A CA  14 
ATOM   9975  C  C   . ALA A 1 58 ? 4.827   10.465  7.443   1.00 0.00 ? 58 ALA A C   14 
ATOM   9976  O  O   . ALA A 1 58 ? 3.624   10.537  7.741   1.00 0.00 ? 58 ALA A O   14 
ATOM   9977  C  CB  . ALA A 1 58 ? 5.756   8.110   7.624   1.00 0.00 ? 58 ALA A CB  14 
ATOM   9978  N  N   . SER A 1 59 ? 5.788   11.517  7.840   1.00 0.00 ? 59 SER A N   14 
ATOM   9979  C  CA  . SER A 1 59 ? 5.389   12.653  8.666   1.00 0.00 ? 59 SER A CA  14 
ATOM   9980  C  C   . SER A 1 59 ? 4.297   13.452  7.991   1.00 0.00 ? 59 SER A C   14 
ATOM   9981  O  O   . SER A 1 59 ? 3.413   14.027  8.641   1.00 0.00 ? 59 SER A O   14 
ATOM   9982  C  CB  . SER A 1 59 ? 6.607   13.541  9.020   1.00 0.00 ? 59 SER A CB  14 
ATOM   9983  O  OG  . SER A 1 59 ? 7.357   13.041  10.133  1.00 0.00 ? 59 SER A OG  14 
ATOM   9984  N  N   . GLU A 1 60 ? 4.364   13.529  6.515   1.00 0.00 ? 60 GLU A N   14 
ATOM   9985  C  CA  . GLU A 1 60 ? 3.345   14.210  5.723   1.00 0.00 ? 60 GLU A CA  14 
ATOM   9986  C  C   . GLU A 1 60 ? 2.012   13.504  5.820   1.00 0.00 ? 60 GLU A C   14 
ATOM   9987  O  O   . GLU A 1 60 ? 0.982   14.106  6.151   1.00 0.00 ? 60 GLU A O   14 
ATOM   9988  C  CB  . GLU A 1 60 ? 3.829   14.291  4.247   1.00 0.00 ? 60 GLU A CB  14 
ATOM   9989  C  CG  . GLU A 1 60 ? 2.730   14.236  3.133   1.00 0.00 ? 60 GLU A CG  14 
ATOM   9990  C  CD  . GLU A 1 60 ? 2.580   15.445  2.207   1.00 0.00 ? 60 GLU A CD  14 
ATOM   9991  O  OE1 . GLU A 1 60 ? 3.473   15.826  1.460   1.00 0.00 ? 60 GLU A OE1 14 
ATOM   9992  O  OE2 . GLU A 1 60 ? 1.367   16.058  2.294   1.00 0.00 ? 60 GLU A OE2 14 
ATOM   9993  N  N   . ALA A 1 61 ? 2.000   12.070  5.456   1.00 0.00 ? 61 ALA A N   14 
ATOM   9994  C  CA  . ALA A 1 61 ? 0.794   11.256  5.551   1.00 0.00 ? 61 ALA A CA  14 
ATOM   9995  C  C   . ALA A 1 61 ? 0.175   11.267  6.929   1.00 0.00 ? 61 ALA A C   14 
ATOM   9996  O  O   . ALA A 1 61 ? -1.050  11.060  7.072   1.00 0.00 ? 61 ALA A O   14 
ATOM   9997  C  CB  . ALA A 1 61 ? 1.150   9.835   5.083   1.00 0.00 ? 61 ALA A CB  14 
ATOM   9998  N  N   . LEU A 1 62 ? 1.055   11.477  8.096   1.00 0.00 ? 62 LEU A N   14 
ATOM   9999  C  CA  . LEU A 1 62 ? 0.508   11.679  9.442   1.00 0.00 ? 62 LEU A CA  14 
ATOM   10000 C  C   . LEU A 1 62 ? -0.114  13.054  9.543   1.00 0.00 ? 62 LEU A C   14 
ATOM   10001 O  O   . LEU A 1 62 ? -1.165  13.254  10.166  1.00 0.00 ? 62 LEU A O   14 
ATOM   10002 C  CB  . LEU A 1 62 ? 1.605   11.462  10.518  1.00 0.00 ? 62 LEU A CB  14 
ATOM   10003 C  CG  . LEU A 1 62 ? 1.452   10.315  11.553  1.00 0.00 ? 62 LEU A CG  14 
ATOM   10004 C  CD1 . LEU A 1 62 ? 0.455   9.259   11.057  1.00 0.00 ? 62 LEU A CD1 14 
ATOM   10005 C  CD2 . LEU A 1 62 ? 2.794   9.638   11.887  1.00 0.00 ? 62 LEU A CD2 14 
ATOM   10006 N  N   . ALA A 1 63 ? 0.631   14.149  8.887   1.00 0.00 ? 63 ALA A N   14 
ATOM   10007 C  CA  . ALA A 1 63 ? 0.078   15.493  8.737   1.00 0.00 ? 63 ALA A CA  14 
ATOM   10008 C  C   . ALA A 1 63 ? -1.242  15.456  8.003   1.00 0.00 ? 63 ALA A C   14 
ATOM   10009 O  O   . ALA A 1 63 ? -2.122  16.305  8.201   1.00 0.00 ? 63 ALA A O   14 
ATOM   10010 C  CB  . ALA A 1 63 ? 1.126   16.368  8.026   1.00 0.00 ? 63 ALA A CB  14 
ATOM   10011 N  N   . ALA A 1 64 ? -1.426  14.353  7.034   1.00 0.00 ? 64 ALA A N   14 
ATOM   10012 C  CA  . ALA A 1 64 ? -2.703  14.116  6.366   1.00 0.00 ? 64 ALA A CA  14 
ATOM   10013 C  C   . ALA A 1 64 ? -3.730  13.627  7.367   1.00 0.00 ? 64 ALA A C   14 
ATOM   10014 O  O   . ALA A 1 64 ? -4.928  13.926  7.285   1.00 0.00 ? 64 ALA A O   14 
ATOM   10015 C  CB  . ALA A 1 64 ? -2.457  13.116  5.225   1.00 0.00 ? 64 ALA A CB  14 
ATOM   10016 N  N   . GLY A 1 65 ? -3.190  12.792  8.467   1.00 0.00 ? 65 GLY A N   14 
ATOM   10017 C  CA  . GLY A 1 65 ? -4.032  12.306  9.556   1.00 0.00 ? 65 GLY A CA  14 
ATOM   10018 C  C   . GLY A 1 65 ? -4.474  10.882  9.281   1.00 0.00 ? 65 GLY A C   14 
ATOM   10019 O  O   . GLY A 1 65 ? -5.579  10.455  9.638   1.00 0.00 ? 65 GLY A O   14 
ATOM   10020 N  N   . PHE A 1 66 ? -3.504  10.045  8.539   1.00 0.00 ? 66 PHE A N   14 
ATOM   10021 C  CA  . PHE A 1 66 ? -3.841  8.714   8.046   1.00 0.00 ? 66 PHE A CA  14 
ATOM   10022 C  C   . PHE A 1 66 ? -3.244  7.627   8.904   1.00 0.00 ? 66 PHE A C   14 
ATOM   10023 O  O   . PHE A 1 66 ? -2.685  7.906   9.990   1.00 0.00 ? 66 PHE A O   14 
ATOM   10024 C  CB  . PHE A 1 66 ? -3.335  8.558   6.577   1.00 0.00 ? 66 PHE A CB  14 
ATOM   10025 C  CG  . PHE A 1 66 ? -4.125  7.562   5.714   1.00 0.00 ? 66 PHE A CG  14 
ATOM   10026 C  CD1 . PHE A 1 66 ? -5.439  7.236   6.091   1.00 0.00 ? 66 PHE A CD1 14 
ATOM   10027 C  CD2 . PHE A 1 66 ? -3.563  6.962   4.587   1.00 0.00 ? 66 PHE A CD2 14 
ATOM   10028 C  CE1 . PHE A 1 66 ? -6.176  6.325   5.344   1.00 0.00 ? 66 PHE A CE1 14 
ATOM   10029 C  CE2 . PHE A 1 66 ? -4.304  6.049   3.840   1.00 0.00 ? 66 PHE A CE2 14 
ATOM   10030 C  CZ  . PHE A 1 66 ? -5.607  5.731   4.220   1.00 0.00 ? 66 PHE A CZ  14 
ATOM   10031 N  N   . ARG A 1 67 ? -3.367  6.224   8.451   1.00 0.00 ? 67 ARG A N   14 
ATOM   10032 C  CA  . ARG A 1 67 ? -2.947  5.108   9.302   1.00 0.00 ? 67 ARG A CA  14 
ATOM   10033 C  C   . ARG A 1 67 ? -1.551  4.638   8.974   1.00 0.00 ? 67 ARG A C   14 
ATOM   10034 O  O   . ARG A 1 67 ? -1.255  4.173   7.866   1.00 0.00 ? 67 ARG A O   14 
ATOM   10035 C  CB  . ARG A 1 67 ? -3.978  3.952   9.212   1.00 0.00 ? 67 ARG A CB  14 
ATOM   10036 C  CG  . ARG A 1 67 ? -3.876  2.903   10.354  1.00 0.00 ? 67 ARG A CG  14 
ATOM   10037 C  CD  . ARG A 1 67 ? -2.651  1.992   10.209  1.00 0.00 ? 67 ARG A CD  14 
ATOM   10038 N  NE  . ARG A 1 67 ? -1.966  1.904   11.524  1.00 0.00 ? 67 ARG A NE  14 
ATOM   10039 C  CZ  . ARG A 1 67 ? -2.391  1.206   12.569  1.00 0.00 ? 67 ARG A CZ  14 
ATOM   10040 N  NH1 . ARG A 1 67 ? -3.482  0.500   12.584  1.00 0.00 ? 67 ARG A NH1 14 
ATOM   10041 N  NH2 . ARG A 1 67 ? -1.670  1.234   13.633  1.00 0.00 ? 67 ARG A NH2 14 
ATOM   10042 N  N   . PRO A 1 68 ? -0.555  4.732   10.066  1.00 0.00 ? 68 PRO A N   14 
ATOM   10043 C  CA  . PRO A 1 68 ? 0.922   4.347   9.995   1.00 0.00 ? 68 PRO A CA  14 
ATOM   10044 C  C   . PRO A 1 68 ? 1.193   2.890   9.691   1.00 0.00 ? 68 PRO A C   14 
ATOM   10045 O  O   . PRO A 1 68 ? 1.128   2.027   10.588  1.00 0.00 ? 68 PRO A O   14 
ATOM   10046 C  CB  . PRO A 1 68 ? 1.534   4.673   11.353  1.00 0.00 ? 68 PRO A CB  14 
ATOM   10047 C  CG  . PRO A 1 68 ? 0.316   4.610   12.287  1.00 0.00 ? 68 PRO A CG  14 
ATOM   10048 C  CD  . PRO A 1 68 ? -0.809  5.224   11.443  1.00 0.00 ? 68 PRO A CD  14 
ATOM   10049 N  N   . CYS A 1 69 ? 1.499   2.518   8.294   1.00 0.00 ? 69 CYS A N   14 
ATOM   10050 C  CA  . CYS A 1 69 ? 1.820   1.148   7.872   1.00 0.00 ? 69 CYS A CA  14 
ATOM   10051 C  C   . CYS A 1 69 ? 3.283   1.057   7.494   1.00 0.00 ? 69 CYS A C   14 
ATOM   10052 O  O   . CYS A 1 69 ? 3.768   1.479   6.434   1.00 0.00 ? 69 CYS A O   14 
ATOM   10053 C  CB  . CYS A 1 69 ? 0.805   0.753   6.785   1.00 0.00 ? 69 CYS A CB  14 
ATOM   10054 S  SG  . CYS A 1 69 ? 0.525   -1.014  6.578   1.00 0.00 ? 69 CYS A SG  14 
ATOM   10055 N  N   . LYS A 1 70 ? 4.161   0.448   8.543   1.00 0.00 ? 70 LYS A N   14 
ATOM   10056 C  CA  . LYS A 1 70 ? 5.612   0.361   8.437   1.00 0.00 ? 70 LYS A CA  14 
ATOM   10057 C  C   . LYS A 1 70 ? 6.017   -0.952  7.803   1.00 0.00 ? 70 LYS A C   14 
ATOM   10058 O  O   . LYS A 1 70 ? 6.396   -1.002  6.620   1.00 0.00 ? 70 LYS A O   14 
ATOM   10059 C  CB  . LYS A 1 70 ? 6.254   0.518   9.843   1.00 0.00 ? 70 LYS A CB  14 
ATOM   10060 C  CG  . LYS A 1 70 ? 6.320   1.984   10.339  1.00 0.00 ? 70 LYS A CG  14 
ATOM   10061 C  CD  . LYS A 1 70 ? 6.774   3.003   9.290   1.00 0.00 ? 70 LYS A CD  14 
ATOM   10062 C  CE  . LYS A 1 70 ? 5.542   3.590   8.589   1.00 0.00 ? 70 LYS A CE  14 
ATOM   10063 N  NZ  . LYS A 1 70 ? 5.144   4.839   9.262   1.00 0.00 ? 70 LYS A NZ  14 
ATOM   10064 N  N   . ARG A 1 71 ? 5.980   -2.156  8.657   1.00 0.00 ? 71 ARG A N   14 
ATOM   10065 C  CA  . ARG A 1 71 ? 6.152   -3.499  8.077   1.00 0.00 ? 71 ARG A CA  14 
ATOM   10066 C  C   . ARG A 1 71 ? 5.023   -3.726  7.090   1.00 0.00 ? 71 ARG A C   14 
ATOM   10067 O  O   . ARG A 1 71 ? 5.191   -3.706  5.864   1.00 0.00 ? 71 ARG A O   14 
ATOM   10068 C  CB  . ARG A 1 71 ? 6.147   -4.545  9.216   1.00 0.00 ? 71 ARG A CB  14 
ATOM   10069 C  CG  . ARG A 1 71 ? 7.468   -5.342  9.399   1.00 0.00 ? 71 ARG A CG  14 
ATOM   10070 C  CD  . ARG A 1 71 ? 7.270   -6.853  9.229   1.00 0.00 ? 71 ARG A CD  14 
ATOM   10071 N  NE  . ARG A 1 71 ? 6.221   -7.075  8.202   1.00 0.00 ? 71 ARG A NE  14 
ATOM   10072 C  CZ  . ARG A 1 71 ? 4.940   -7.322  8.442   1.00 0.00 ? 71 ARG A CZ  14 
ATOM   10073 N  NH1 . ARG A 1 71 ? 4.419   -7.406  9.630   1.00 0.00 ? 71 ARG A NH1 14 
ATOM   10074 N  NH2 . ARG A 1 71 ? 4.168   -7.490  7.427   1.00 0.00 ? 71 ARG A NH2 14 
ATOM   10075 N  N   . CYS A 1 72 ? 3.691   -3.935  7.698   1.00 0.00 ? 72 CYS A N   14 
ATOM   10076 C  CA  . CYS A 1 72 ? 2.457   -3.935  6.928   1.00 0.00 ? 72 CYS A CA  14 
ATOM   10077 C  C   . CYS A 1 72 ? 1.254   -4.186  7.808   1.00 0.00 ? 72 CYS A C   14 
ATOM   10078 O  O   . CYS A 1 72 ? 0.413   -5.057  7.534   1.00 0.00 ? 72 CYS A O   14 
ATOM   10079 C  CB  . CYS A 1 72 ? 2.548   -4.910  5.738   1.00 0.00 ? 72 CYS A CB  14 
ATOM   10080 S  SG  . CYS A 1 72 ? 1.853   -4.118  4.252   1.00 0.00 ? 72 CYS A SG  14 
ATOM   10081 N  N   . GLN A 1 73 ? 1.113   -3.317  8.990   1.00 0.00 ? 73 GLN A N   14 
ATOM   10082 C  CA  . GLN A 1 73 ? -0.005  -3.423  9.952   1.00 0.00 ? 73 GLN A CA  14 
ATOM   10083 C  C   . GLN A 1 73 ? -1.325  -3.682  9.287   1.00 0.00 ? 73 GLN A C   14 
ATOM   10084 O  O   . GLN A 1 73 ? -1.882  -2.832  8.580   1.00 0.00 ? 73 GLN A O   14 
ATOM   10085 C  CB  . GLN A 1 73 ? -0.052  -2.106  10.781  1.00 0.00 ? 73 GLN A CB  14 
ATOM   10086 C  CG  . GLN A 1 73 ? 0.837   -2.087  12.067  1.00 0.00 ? 73 GLN A CG  14 
ATOM   10087 C  CD  . GLN A 1 73 ? 0.171   -2.218  13.442  1.00 0.00 ? 73 GLN A CD  14 
ATOM   10088 O  OE1 . GLN A 1 73 ? -0.897  -1.676  13.680  1.00 0.00 ? 73 GLN A OE1 14 
ATOM   10089 N  NE2 . GLN A 1 73 ? 0.746   -2.924  14.382  1.00 0.00 ? 73 GLN A NE2 14 
ATOM   10090 N  N   . PRO A 1 74 ? -1.930  -5.013  9.524   1.00 0.00 ? 74 PRO A N   14 
ATOM   10091 C  CA  . PRO A 1 74 ? -3.271  -5.515  8.977   1.00 0.00 ? 74 PRO A CA  14 
ATOM   10092 C  C   . PRO A 1 74 ? -4.494  -4.950  9.665   1.00 0.00 ? 74 PRO A C   14 
ATOM   10093 O  O   . PRO A 1 74 ? -4.888  -3.796  9.375   1.00 0.00 ? 74 PRO A O   14 
ATOM   10094 C  CB  . PRO A 1 74 ? -3.216  -7.029  9.074   1.00 0.00 ? 74 PRO A CB  14 
ATOM   10095 C  CG  . PRO A 1 74 ? -2.408  -7.220  10.366  1.00 0.00 ? 74 PRO A CG  14 
ATOM   10096 C  CD  . PRO A 1 74 ? -1.352  -6.111  10.334  1.00 0.00 ? 74 PRO A CD  14 
ATOM   10097 N  N   . ASP A 1 75 ? -5.207  -5.780  10.684  1.00 0.00 ? 75 ASP A N   14 
ATOM   10098 C  CA  . ASP A 1 75 ? -6.416  -5.278  11.326  1.00 0.00 ? 75 ASP A CA  14 
ATOM   10099 C  C   . ASP A 1 75 ? -7.512  -5.078  10.295  1.00 0.00 ? 75 ASP A C   14 
ATOM   10100 O  O   . ASP A 1 75 ? -7.754  -3.964  9.812   1.00 0.00 ? 75 ASP A O   14 
ATOM   10101 C  CB  . ASP A 1 75 ? -6.099  -3.939  12.056  1.00 0.00 ? 75 ASP A CB  14 
ATOM   10102 C  CG  . ASP A 1 75 ? -6.809  -3.710  13.398  1.00 0.00 ? 75 ASP A CG  14 
ATOM   10103 O  OD1 . ASP A 1 75 ? -6.653  -4.755  14.266  1.00 0.00 ? 75 ASP A OD1 14 
ATOM   10104 O  OD2 . ASP A 1 75 ? -7.461  -2.706  13.645  1.00 0.00 ? 75 ASP A OD2 14 
ATOM   10105 N  N   . LYS A 1 76 ? -8.289  -6.284  9.934   1.00 0.00 ? 76 LYS A N   14 
ATOM   10106 C  CA  . LYS A 1 76 ? -9.414  -6.230  9.007   1.00 0.00 ? 76 LYS A CA  14 
ATOM   10107 C  C   . LYS A 1 76 ? -10.710 -5.928  9.722   1.00 0.00 ? 76 LYS A C   14 
ATOM   10108 O  O   . LYS A 1 76 ? -11.634 -5.320  9.151   1.00 0.00 ? 76 LYS A O   14 
ATOM   10109 C  CB  . LYS A 1 76 ? -9.508  -7.567  8.223   1.00 0.00 ? 76 LYS A CB  14 
ATOM   10110 C  CG  . LYS A 1 76 ? -10.399 -8.631  8.912   1.00 0.00 ? 76 LYS A CG  14 
ATOM   10111 C  CD  . LYS A 1 76 ? -11.843 -8.688  8.407   1.00 0.00 ? 76 LYS A CD  14 
ATOM   10112 C  CE  . LYS A 1 76 ? -12.423 -10.081 8.686   1.00 0.00 ? 76 LYS A CE  14 
ATOM   10113 N  NZ  . LYS A 1 76 ? -13.855 -9.959  9.012   1.00 0.00 ? 76 LYS A NZ  14 
ATOM   10114 N  N   . ALA A 1 77 ? -10.841 -6.409  11.110  1.00 0.00 ? 77 ALA A N   14 
ATOM   10115 C  CA  . ALA A 1 77 ? -12.069 -6.247  11.894  1.00 0.00 ? 77 ALA A CA  14 
ATOM   10116 C  C   . ALA A 1 77 ? -11.938 -6.805  13.297  1.00 0.00 ? 77 ALA A C   14 
ATOM   10117 O  O   . ALA A 1 77 ? -12.646 -7.744  13.686  1.00 0.00 ? 77 ALA A O   14 
ATOM   10118 C  CB  . ALA A 1 77 ? -13.230 -6.863  11.101  1.00 0.00 ? 77 ALA A CB  14 
ATOM   10119 N  N   . ASN A 1 78 ? -10.954 -6.138  14.176  1.00 0.00 ? 78 ASN A N   14 
ATOM   10120 C  CA  . ASN A 1 78 ? -10.712 -6.566  15.550  1.00 0.00 ? 78 ASN A CA  14 
ATOM   10121 C  C   . ASN A 1 78 ? -10.728 -8.072  15.665  1.00 0.00 ? 78 ASN A C   14 
ATOM   10122 O  O   . ASN A 1 78 ? -11.648 -8.676  16.229  1.00 0.00 ? 78 ASN A O   14 
ATOM   10123 C  CB  . ASN A 1 78 ? -11.773 -5.929  16.493  1.00 0.00 ? 78 ASN A CB  14 
ATOM   10124 C  CG  . ASN A 1 78 ? -13.207 -5.824  15.964  1.00 0.00 ? 78 ASN A CG  14 
ATOM   10125 O  OD1 . ASN A 1 78 ? -13.490 -5.180  14.964  1.00 0.00 ? 78 ASN A OD1 14 
ATOM   10126 N  ND2 . ASN A 1 78 ? -14.163 -6.429  16.615  1.00 0.00 ? 78 ASN A ND2 14 
ATOM   10127 N  N   . PRO A 1 79 ? -9.564  -8.777  15.087  1.00 0.00 ? 79 PRO A N   14 
ATOM   10128 C  CA  . PRO A 1 79 ? -9.346  -10.295 15.057  1.00 0.00 ? 79 PRO A CA  14 
ATOM   10129 C  C   . PRO A 1 79 ? -9.701  -11.007 16.343  1.00 0.00 ? 79 PRO A C   14 
ATOM   10130 O  O   . PRO A 1 79 ? -9.509  -10.469 17.449  1.00 0.00 ? 79 PRO A O   14 
ATOM   10131 C  CB  . PRO A 1 79 ? -7.853  -10.484 14.798  1.00 0.00 ? 79 PRO A CB  14 
ATOM   10132 C  CG  . PRO A 1 79 ? -7.587  -9.318  13.832  1.00 0.00 ? 79 PRO A CG  14 
ATOM   10133 C  CD  . PRO A 1 79 ? -8.391  -8.157  14.426  1.00 0.00 ? 79 PRO A CD  14 
ATOM   10134 N  N   . ARG A 1 80 ? -10.248 -12.378 16.240  1.00 0.00 ? 80 ARG A N   14 
ATOM   10135 C  CA  . ARG A 1 80 ? -10.487 -13.216 17.410  1.00 0.00 ? 80 ARG A CA  14 
ATOM   10136 C  C   . ARG A 1 80 ? -11.466 -12.566 18.360  1.00 0.00 ? 80 ARG A C   14 
ATOM   10137 O  O   . ARG A 1 80 ? -11.924 -11.435 18.152  1.00 0.00 ? 80 ARG A O   14 
ATOM   10138 C  CB  . ARG A 1 80 ? -9.130  -13.515 18.104  1.00 0.00 ? 80 ARG A CB  14 
ATOM   10139 C  CG  . ARG A 1 80 ? -8.467  -14.856 17.689  1.00 0.00 ? 80 ARG A CG  14 
ATOM   10140 C  CD  . ARG A 1 80 ? -8.586  -15.131 16.184  1.00 0.00 ? 80 ARG A CD  14 
ATOM   10141 N  NE  . ARG A 1 80 ? -9.805  -15.946 15.951  1.00 0.00 ? 80 ARG A NE  14 
ATOM   10142 C  CZ  . ARG A 1 80 ? -9.880  -17.267 16.053  1.00 0.00 ? 80 ARG A CZ  14 
ATOM   10143 N  NH1 . ARG A 1 80 ? -8.880  -18.036 16.370  1.00 0.00 ? 80 ARG A NH1 14 
ATOM   10144 N  NH2 . ARG A 1 80 ? -11.019 -17.816 15.821  1.00 0.00 ? 80 ARG A NH2 14 
ATOM   10145 N  N   . GLN A 1 81 ? -11.876 -13.374 19.528  1.00 0.00 ? 81 GLN A N   14 
ATOM   10146 C  CA  . GLN A 1 81 ? -12.681 -12.828 20.618  1.00 0.00 ? 81 GLN A CA  14 
ATOM   10147 C  C   . GLN A 1 81 ? -12.084 -11.554 21.165  1.00 0.00 ? 81 GLN A C   14 
ATOM   10148 O  O   . GLN A 1 81 ? -11.073 -11.037 20.672  1.00 0.00 ? 81 GLN A O   14 
ATOM   10149 C  CB  . GLN A 1 81 ? -12.799 -13.900 21.726  1.00 0.00 ? 81 GLN A CB  14 
ATOM   10150 C  CG  . GLN A 1 81 ? -13.232 -15.330 21.261  1.00 0.00 ? 81 GLN A CG  14 
ATOM   10151 C  CD  . GLN A 1 81 ? -14.576 -15.896 21.736  1.00 0.00 ? 81 GLN A CD  14 
ATOM   10152 O  OE1 . GLN A 1 81 ? -15.466 -15.161 22.132  1.00 0.00 ? 81 GLN A OE1 14 
ATOM   10153 N  NE2 . GLN A 1 81 ? -14.780 -17.188 21.725  1.00 0.00 ? 81 GLN A NE2 14 
ATOM   10154 N  N   . HIS A 1 82 ? -12.755 -10.978 22.352  1.00 0.00 ? 82 HIS A N   14 
ATOM   10155 C  CA  . HIS A 1 82 ? -12.373 -9.685  22.911  1.00 0.00 ? 82 HIS A CA  14 
ATOM   10156 C  C   . HIS A 1 82 ? -11.136 -9.809  23.770  1.00 0.00 ? 82 HIS A C   14 
ATOM   10157 O  O   . HIS A 1 82 ? -10.188 -9.019  23.663  1.00 0.00 ? 82 HIS A O   14 
ATOM   10158 C  CB  . HIS A 1 82 ? -13.566 -9.209  23.757  1.00 0.00 ? 82 HIS A CB  14 
ATOM   10159 C  CG  . HIS A 1 82 ? -13.862 -10.137 24.899  1.00 0.00 ? 82 HIS A CG  14 
ATOM   10160 N  ND1 . HIS A 1 82 ? -13.282 -10.083 26.164  1.00 0.00 ? 82 HIS A ND1 14 
ATOM   10161 C  CD2 . HIS A 1 82 ? -14.777 -11.176 24.804  1.00 0.00 ? 82 HIS A CD2 14 
ATOM   10162 C  CE1 . HIS A 1 82 ? -13.911 -11.119 26.750  1.00 0.00 ? 82 HIS A CE1 14 
ATOM   10163 N  NE2 . HIS A 1 82 ? -14.814 -11.821 26.013  1.00 0.00 ? 82 HIS A NE2 14 
ATOM   10164 N  N   . ARG A 1 83 ? -11.117 -10.928 24.736  1.00 0.00 ? 83 ARG A N   14 
ATOM   10165 C  CA  . ARG A 1 83 ? -10.060 -11.073 25.732  1.00 0.00 ? 83 ARG A CA  14 
ATOM   10166 C  C   . ARG A 1 83 ? -10.060 -9.909  26.696  1.00 0.00 ? 83 ARG A C   14 
ATOM   10167 O  O   . ARG A 1 83 ? -9.802  -8.756  26.323  1.00 0.00 ? 83 ARG A O   14 
ATOM   10168 C  CB  . ARG A 1 83 ? -8.695  -11.207 25.005  1.00 0.00 ? 83 ARG A CB  14 
ATOM   10169 C  CG  . ARG A 1 83 ? -7.667  -12.133 25.709  1.00 0.00 ? 83 ARG A CG  14 
ATOM   10170 C  CD  . ARG A 1 83 ? -6.242  -11.565 25.672  1.00 0.00 ? 83 ARG A CD  14 
ATOM   10171 N  NE  . ARG A 1 83 ? -5.396  -12.476 24.860  1.00 0.00 ? 83 ARG A NE  14 
ATOM   10172 C  CZ  . ARG A 1 83 ? -4.717  -13.515 25.325  1.00 0.00 ? 83 ARG A CZ  14 
ATOM   10173 N  NH1 . ARG A 1 83 ? -4.696  -13.879 26.573  1.00 0.00 ? 83 ARG A NH1 14 
ATOM   10174 N  NH2 . ARG A 1 83 ? -4.035  -14.204 24.480  1.00 0.00 ? 83 ARG A NH2 14 
ATOM   10175 N  N   . LEU A 1 84 ? -10.411 -10.220 28.098  1.00 0.00 ? 84 LEU A N   14 
ATOM   10176 C  CA  . LEU A 1 84 ? -10.321 -9.223  29.161  1.00 0.00 ? 84 LEU A CA  14 
ATOM   10177 C  C   . LEU A 1 84 ? -11.566 -8.367  29.206  1.00 0.00 ? 84 LEU A C   14 
ATOM   10178 O  O   . LEU A 1 84 ? -11.529 -7.150  28.978  1.00 0.00 ? 84 LEU A O   14 
ATOM   10179 C  CB  . LEU A 1 84 ? -9.049  -8.346  28.985  1.00 0.00 ? 84 LEU A CB  14 
ATOM   10180 C  CG  . LEU A 1 84 ? -7.766  -8.757  29.757  1.00 0.00 ? 84 LEU A CG  14 
ATOM   10181 C  CD1 . LEU A 1 84 ? -7.739  -10.278 29.963  1.00 0.00 ? 84 LEU A CD1 14 
ATOM   10182 C  CD2 . LEU A 1 84 ? -6.477  -8.307  29.049  1.00 0.00 ? 84 LEU A CD2 14 
ATOM   10183 N  N   . ASP A 1 85 ? -12.823 -9.059  29.563  1.00 0.00 ? 85 ASP A N   14 
ATOM   10184 C  CA  . ASP A 1 85 ? -14.066 -8.331  29.805  1.00 0.00 ? 85 ASP A CA  14 
ATOM   10185 C  C   . ASP A 1 85 ? -15.114 -9.238  30.407  1.00 0.00 ? 85 ASP A C   14 
ATOM   10186 O  O   . ASP A 1 85 ? -16.144 -9.547  29.792  1.00 0.00 ? 85 ASP A O   14 
ATOM   10187 C  CB  . ASP A 1 85 ? -14.559 -7.659  28.498  1.00 0.00 ? 85 ASP A CB  14 
ATOM   10188 C  CG  . ASP A 1 85 ? -15.331 -6.340  28.650  1.00 0.00 ? 85 ASP A CG  14 
ATOM   10189 O  OD1 . ASP A 1 85 ? -16.112 -6.310  29.771  1.00 0.00 ? 85 ASP A OD1 14 
ATOM   10190 O  OD2 . ASP A 1 85 ? -15.235 -5.416  27.856  1.00 0.00 ? 85 ASP A OD2 14 
ATOM   10191 N  N   . LYS A 1 86 ? -14.824 -9.766  31.759  1.00 0.00 ? 86 LYS A N   14 
ATOM   10192 C  CA  . LYS A 1 86 ? -15.706 -10.719 32.424  1.00 0.00 ? 86 LYS A CA  14 
ATOM   10193 C  C   . LYS A 1 86 ? -15.644 -10.557 33.925  1.00 0.00 ? 86 LYS A C   14 
ATOM   10194 O  O   . LYS A 1 86 ? -14.829 -9.798  34.466  1.00 0.00 ? 86 LYS A O   14 
ATOM   10195 C  CB  . LYS A 1 86 ? -15.319 -12.164 32.005  1.00 0.00 ? 86 LYS A CB  14 
ATOM   10196 C  CG  . LYS A 1 86 ? -13.789 -12.403 31.960  1.00 0.00 ? 86 LYS A CG  14 
ATOM   10197 C  CD  . LYS A 1 86 ? -13.015 -11.847 33.160  1.00 0.00 ? 86 LYS A CD  14 
ATOM   10198 C  CE  . LYS A 1 86 ? -11.704 -12.628 33.321  1.00 0.00 ? 86 LYS A CE  14 
ATOM   10199 N  NZ  . LYS A 1 86 ? -10.658 -11.727 33.838  1.00 0.00 ? 86 LYS A NZ  14 
ATOM   10200 N  N   . ILE A 1 87 ? -16.625 -11.338 34.711  1.00 0.00 ? 87 ILE A N   14 
ATOM   10201 C  CA  . ILE A 1 87 ? -16.760 -11.178 36.157  1.00 0.00 ? 87 ILE A CA  14 
ATOM   10202 C  C   . ILE A 1 87 ? -16.899 -12.520 36.836  1.00 0.00 ? 87 ILE A C   14 
ATOM   10203 O  O   . ILE A 1 87 ? -15.960 -13.030 37.467  1.00 0.00 ? 87 ILE A O   14 
ATOM   10204 C  CB  . ILE A 1 87 ? -17.943 -10.191 36.517  1.00 0.00 ? 87 ILE A CB  14 
ATOM   10205 C  CG1 . ILE A 1 87 ? -18.594 -10.403 37.920  1.00 0.00 ? 87 ILE A CG1 14 
ATOM   10206 C  CG2 . ILE A 1 87 ? -19.082 -10.195 35.449  1.00 0.00 ? 87 ILE A CG2 14 
ATOM   10207 C  CD1 . ILE A 1 87 ? -17.936 -9.643  39.090  1.00 0.00 ? 87 ILE A CD1 14 
ATOM   10208 N  N   . THR A 1 88 ? -18.208 -13.195 36.708  1.00 0.00 ? 88 THR A N   14 
ATOM   10209 C  CA  . THR A 1 88 ? -18.501 -14.452 37.389  1.00 0.00 ? 88 THR A CA  14 
ATOM   10210 C  C   . THR A 1 88 ? -19.243 -15.402 36.478  1.00 0.00 ? 88 THR A C   14 
ATOM   10211 O  O   . THR A 1 88 ? -20.475 -15.361 36.357  1.00 0.00 ? 88 THR A O   14 
ATOM   10212 C  CB  . THR A 1 88 ? -19.319 -14.193 38.699  1.00 0.00 ? 88 THR A CB  14 
ATOM   10213 O  OG1 . THR A 1 88 ? -20.307 -13.194 38.481  1.00 0.00 ? 88 THR A OG1 14 
ATOM   10214 C  CG2 . THR A 1 88 ? -18.518 -13.685 39.918  1.00 0.00 ? 88 THR A CG2 14 
ATOM   10215 N  N   . HIS A 1 89 ? -18.415 -16.369 35.725  1.00 0.00 ? 89 HIS A N   14 
ATOM   10216 C  CA  . HIS A 1 89 ? -19.003 -17.369 34.836  1.00 0.00 ? 89 HIS A CA  14 
ATOM   10217 C  C   . HIS A 1 89 ? -18.811 -18.763 35.385  1.00 0.00 ? 89 HIS A C   14 
ATOM   10218 O  O   . HIS A 1 89 ? -18.764 -19.755 34.644  1.00 0.00 ? 89 HIS A O   14 
ATOM   10219 C  CB  . HIS A 1 89 ? -18.285 -17.221 33.484  1.00 0.00 ? 89 HIS A CB  14 
ATOM   10220 C  CG  . HIS A 1 89 ? -19.246 -17.052 32.344  1.00 0.00 ? 89 HIS A CG  14 
ATOM   10221 N  ND1 . HIS A 1 89 ? -19.076 -16.203 31.253  1.00 0.00 ? 89 HIS A ND1 14 
ATOM   10222 C  CD2 . HIS A 1 89 ? -20.442 -17.752 32.261  1.00 0.00 ? 89 HIS A CD2 14 
ATOM   10223 C  CE1 . HIS A 1 89 ? -20.213 -16.462 30.581  1.00 0.00 ? 89 HIS A CE1 14 
ATOM   10224 N  NE2 . HIS A 1 89 ? -21.078 -17.369 31.109  1.00 0.00 ? 89 HIS A NE2 14 
ATOM   10225 N  N   . ALA A 1 90 ? -18.708 -18.881 36.856  1.00 0.00 ? 90 ALA A N   14 
ATOM   10226 C  CA  . ALA A 1 90 ? -18.626 -20.177 37.524  1.00 0.00 ? 90 ALA A CA  14 
ATOM   10227 C  C   . ALA A 1 90 ? -17.631 -21.080 36.834  1.00 0.00 ? 90 ALA A C   14 
ATOM   10228 O  O   . ALA A 1 90 ? -17.930 -22.230 36.482  1.00 0.00 ? 90 ALA A O   14 
ATOM   10229 C  CB  . ALA A 1 90 ? -20.044 -20.772 37.563  1.00 0.00 ? 90 ALA A CB  14 
ATOM   10230 N  N   . CYS A 1 91 ? -16.280 -20.521 36.614  1.00 0.00 ? 91 CYS A N   14 
ATOM   10231 C  CA  . CYS A 1 91 ? -15.268 -21.227 35.834  1.00 0.00 ? 91 CYS A CA  14 
ATOM   10232 C  C   . CYS A 1 91 ? -13.877 -20.862 36.297  1.00 0.00 ? 91 CYS A C   14 
ATOM   10233 O  O   . CYS A 1 91 ? -13.073 -21.718 36.694  1.00 0.00 ? 91 CYS A O   14 
ATOM   10234 C  CB  . CYS A 1 91 ? -15.492 -20.914 34.342  1.00 0.00 ? 91 CYS A CB  14 
ATOM   10235 S  SG  . CYS A 1 91 ? -13.935 -20.996 33.429  1.00 0.00 ? 91 CYS A SG  14 
ATOM   10236 N  N   . ARG A 1 92 ? -13.522 -19.428 36.234  1.00 0.00 ? 92 ARG A N   14 
ATOM   10237 C  CA  . ARG A 1 92 ? -12.229 -18.930 36.696  1.00 0.00 ? 92 ARG A CA  14 
ATOM   10238 C  C   . ARG A 1 92 ? -11.933 -19.409 38.096  1.00 0.00 ? 92 ARG A C   14 
ATOM   10239 O  O   . ARG A 1 92 ? -12.544 -18.983 39.074  1.00 0.00 ? 92 ARG A O   14 
ATOM   10240 C  CB  . ARG A 1 92 ? -12.229 -17.378 36.616  1.00 0.00 ? 92 ARG A CB  14 
ATOM   10241 C  CG  . ARG A 1 92 ? -13.480 -16.693 37.226  1.00 0.00 ? 92 ARG A CG  14 
ATOM   10242 C  CD  . ARG A 1 92 ? -13.172 -15.299 37.789  1.00 0.00 ? 92 ARG A CD  14 
ATOM   10243 N  NE  . ARG A 1 92 ? -12.968 -15.422 39.255  1.00 0.00 ? 92 ARG A NE  14 
ATOM   10244 C  CZ  . ARG A 1 92 ? -13.202 -14.469 40.147  1.00 0.00 ? 92 ARG A CZ  14 
ATOM   10245 N  NH1 . ARG A 1 92 ? -13.646 -13.282 39.854  1.00 0.00 ? 92 ARG A NH1 14 
ATOM   10246 N  NH2 . ARG A 1 92 ? -12.971 -14.743 41.382  1.00 0.00 ? 92 ARG A NH2 14 
ATOM   10247 O  OXT . ARG A 1 92 ? -10.895 -20.385 38.219  1.00 0.00 ? 92 ARG A OXT 14 
HETATM 10248 ZN ZN  . ZN  B 2 .  ? 1.260   -1.941  4.586   1.00 0.00 ? 93 ZN  A ZN  14 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  ALA 4  4  4  ALA ALA A . n 
A 1 5  THR 5  5  5  THR THR A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  THR 8  8  8  THR THR A . n 
A 1 9  ASP 9  9  9  ASP ASP A . n 
A 1 10 ASP 10 10 10 ASP ASP A . n 
A 1 11 GLN 11 11 11 GLN GLN A . n 
A 1 12 ARG 12 12 12 ARG ARG A . n 
A 1 13 TRP 13 13 13 TRP TRP A . n 
A 1 14 GLN 14 14 14 GLN GLN A . n 
A 1 15 SER 15 15 15 SER SER A . n 
A 1 16 VAL 16 16 16 VAL VAL A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 ARG 19 19 19 ARG ARG A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 PRO 21 21 21 PRO PRO A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 ALA 23 23 23 ALA ALA A . n 
A 1 24 ASP 24 24 24 ASP ASP A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 GLU 26 26 26 GLU GLU A . n 
A 1 27 PHE 27 27 27 PHE PHE A . n 
A 1 28 VAL 28 28 28 VAL VAL A . n 
A 1 29 PHE 29 29 29 PHE PHE A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 VAL 31 31 31 VAL VAL A . n 
A 1 32 ARG 32 32 32 ARG ARG A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 THR 34 34 34 THR THR A . n 
A 1 35 GLY 35 35 35 GLY GLY A . n 
A 1 36 ILE 36 36 36 ILE ILE A . n 
A 1 37 PHE 37 37 37 PHE PHE A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 ARG 39 39 39 ARG ARG A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 SER 41 41 41 SER SER A . n 
A 1 42 CYS 42 42 42 CYS CYS A . n 
A 1 43 ARG 43 43 43 ARG ARG A . n 
A 1 44 ALA 44 44 44 ALA ALA A . n 
A 1 45 ARG 45 45 45 ARG ARG A . n 
A 1 46 HIS 46 46 46 HIS HIS A . n 
A 1 47 ALA 47 47 47 ALA ALA A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 ASN 51 51 51 ASN ASN A . n 
A 1 52 VAL 52 52 52 VAL VAL A . n 
A 1 53 SER 53 53 53 SER SER A . n 
A 1 54 PHE 54 54 54 PHE PHE A . n 
A 1 55 TYR 55 55 55 TYR TYR A . n 
A 1 56 ALA 56 56 56 ALA ALA A . n 
A 1 57 ASN 57 57 57 ASN ASN A . n 
A 1 58 ALA 58 58 58 ALA ALA A . n 
A 1 59 SER 59 59 59 SER SER A . n 
A 1 60 GLU 60 60 60 GLU GLU A . n 
A 1 61 ALA 61 61 61 ALA ALA A . n 
A 1 62 LEU 62 62 62 LEU LEU A . n 
A 1 63 ALA 63 63 63 ALA ALA A . n 
A 1 64 ALA 64 64 64 ALA ALA A . n 
A 1 65 GLY 65 65 65 GLY GLY A . n 
A 1 66 PHE 66 66 66 PHE PHE A . n 
A 1 67 ARG 67 67 67 ARG ARG A . n 
A 1 68 PRO 68 68 68 PRO PRO A . n 
A 1 69 CYS 69 69 69 CYS CYS A . n 
A 1 70 LYS 70 70 70 LYS LYS A . n 
A 1 71 ARG 71 71 71 ARG ARG A . n 
A 1 72 CYS 72 72 72 CYS CYS A . n 
A 1 73 GLN 73 73 73 GLN GLN A . n 
A 1 74 PRO 74 74 74 PRO PRO A . n 
A 1 75 ASP 75 75 75 ASP ASP A . n 
A 1 76 LYS 76 76 76 LYS LYS A . n 
A 1 77 ALA 77 77 77 ALA ALA A . n 
A 1 78 ASN 78 78 78 ASN ASN A . n 
A 1 79 PRO 79 79 79 PRO PRO A . n 
A 1 80 ARG 80 80 80 ARG ARG A . n 
A 1 81 GLN 81 81 81 GLN GLN A . n 
A 1 82 HIS 82 82 82 HIS HIS A . n 
A 1 83 ARG 83 83 83 ARG ARG A . n 
A 1 84 LEU 84 84 84 LEU LEU A . n 
A 1 85 ASP 85 85 85 ASP ASP A . n 
A 1 86 LYS 86 86 86 LYS LYS A . n 
A 1 87 ILE 87 87 87 ILE ILE A . n 
A 1 88 THR 88 88 88 THR THR A . n 
A 1 89 HIS 89 89 89 HIS HIS A . n 
A 1 90 ALA 90 90 90 ALA ALA A . n 
A 1 91 CYS 91 91 91 CYS CYS A . n 
A 1 92 ARG 92 92 92 ARG ARG A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     93 
_pdbx_nonpoly_scheme.auth_seq_num    93 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 93 ? 1_555 SG ? A CYS 69 ? A CYS 69 ? 1_555 118.4 ? 
2 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 93 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 98.7  ? 
3 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? B ZN . ? A ZN 93 ? 1_555 SG ? A CYS 72 ? A CYS 72 ? 1_555 118.3 ? 
4 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 93 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 96.1  ? 
5 SG ? A CYS 69 ? A CYS 69 ? 1_555 ZN ? B ZN . ? A ZN 93 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 102.5 ? 
6 SG ? A CYS 72 ? A CYS 72 ? 1_555 ZN ? B ZN . ? A ZN 93 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 121.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1    1  C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
2    1  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
3    1  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.480 1.336 0.144 0.023 Y 
4    1  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
5    1  C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
6    1  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.478 1.336 0.142 0.023 Y 
7    1  C  A LEU 7  ? ? N   A THR 8  ? ? 1.480 1.336 0.144 0.023 Y 
8    1  C  A THR 8  ? ? N   A ASP 9  ? ? 1.481 1.336 0.145 0.023 Y 
9    1  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
10   1  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.480 1.336 0.144 0.023 Y 
11   1  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.479 1.336 0.143 0.023 Y 
12   1  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.489 1.336 0.153 0.023 Y 
13   1  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.482 1.336 0.146 0.023 Y 
14   1  C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
15   1  C  A SER 15 ? ? N   A VAL 16 ? ? 1.492 1.336 0.156 0.023 Y 
16   1  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.477 1.336 0.141 0.023 Y 
17   1  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.488 1.336 0.152 0.023 Y 
18   1  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.479 1.336 0.143 0.023 Y 
19   1  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.484 1.336 0.148 0.023 Y 
20   1  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.477 1.338 0.139 0.019 Y 
21   1  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.478 1.336 0.142 0.023 Y 
22   1  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.482 1.336 0.146 0.023 Y 
23   1  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.480 1.336 0.144 0.023 Y 
24   1  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.479 1.336 0.143 0.023 Y 
25   1  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.480 1.336 0.144 0.023 Y 
26   1  CD A GLU 26 ? ? OE2 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
27   1  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.478 1.336 0.142 0.023 Y 
28   1  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.477 1.336 0.141 0.023 Y 
29   1  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.478 1.336 0.142 0.023 Y 
30   1  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.479 1.336 0.143 0.023 Y 
31   1  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.478 1.336 0.142 0.023 Y 
32   1  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.480 1.336 0.144 0.023 Y 
33   1  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
34   1  C  A THR 33 ? ? N   A THR 34 ? ? 1.479 1.336 0.143 0.023 Y 
35   1  C  A THR 34 ? ? N   A GLY 35 ? ? 1.479 1.336 0.143 0.023 Y 
36   1  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.483 1.336 0.147 0.023 Y 
37   1  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.479 1.336 0.143 0.023 Y 
38   1  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.477 1.336 0.141 0.023 Y 
39   1  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.479 1.336 0.143 0.023 Y 
40   1  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.475 1.338 0.137 0.019 Y 
41   1  C  A PRO 40 ? ? N   A SER 41 ? ? 1.477 1.336 0.141 0.023 Y 
42   1  C  A SER 41 ? ? N   A CYS 42 ? ? 1.492 1.336 0.156 0.023 Y 
43   1  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.481 1.336 0.145 0.023 Y 
44   1  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
45   1  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.484 1.336 0.148 0.023 Y 
46   1  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.482 1.336 0.146 0.023 Y 
47   1  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.480 1.336 0.144 0.023 Y 
48   1  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.479 1.336 0.143 0.023 Y 
49   1  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.481 1.336 0.145 0.023 Y 
50   1  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.481 1.336 0.145 0.023 Y 
51   1  CD A GLU 50 ? ? OE1 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
52   1  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.498 1.336 0.162 0.023 Y 
53   1  C  A VAL 52 ? ? N   A SER 53 ? ? 1.477 1.336 0.141 0.023 Y 
54   1  C  A SER 53 ? ? N   A PHE 54 ? ? 1.482 1.336 0.146 0.023 Y 
55   1  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.478 1.336 0.142 0.023 Y 
56   1  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.482 1.336 0.146 0.023 Y 
57   1  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.479 1.336 0.143 0.023 Y 
58   1  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.480 1.336 0.144 0.023 Y 
59   1  C  A ALA 58 ? ? N   A SER 59 ? ? 1.478 1.336 0.142 0.023 Y 
60   1  C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
61   1  CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
62   1  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.481 1.336 0.145 0.023 Y 
63   1  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.477 1.336 0.141 0.023 Y 
64   1  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
65   1  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.481 1.336 0.145 0.023 Y 
66   1  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.483 1.336 0.147 0.023 Y 
67   1  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.479 1.336 0.143 0.023 Y 
68   1  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
69   1  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.479 1.338 0.141 0.019 Y 
70   1  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.483 1.336 0.147 0.023 Y 
71   1  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.491 1.336 0.155 0.023 Y 
72   1  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.481 1.336 0.145 0.023 Y 
73   1  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.484 1.336 0.148 0.023 Y 
74   1  C  A CYS 72 ? ? N   A GLN 73 ? ? 1.521 1.336 0.185 0.023 Y 
75   1  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.479 1.338 0.141 0.019 Y 
76   1  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.478 1.336 0.142 0.023 Y 
77   1  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.478 1.336 0.142 0.023 Y 
78   1  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.477 1.336 0.141 0.023 Y 
79   1  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.481 1.336 0.145 0.023 Y 
80   1  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.478 1.338 0.140 0.019 Y 
81   1  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.478 1.336 0.142 0.023 Y 
82   1  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
83   1  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.479 1.336 0.143 0.023 Y 
84   1  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
85   1  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
86   1  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
87   1  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
88   1  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.478 1.336 0.142 0.023 Y 
89   1  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
90   1  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
91   1  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
92   1  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
93   1  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
94   1  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
95   2  C  A MET 1  ? ? N   A LYS 2  ? ? 1.481 1.336 0.145 0.023 Y 
96   2  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.479 1.336 0.143 0.023 Y 
97   2  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.480 1.336 0.144 0.023 Y 
98   2  C  A ALA 4  ? ? N   A THR 5  ? ? 1.478 1.336 0.142 0.023 Y 
99   2  C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
100  2  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
101  2  C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
102  2  C  A THR 8  ? ? N   A ASP 9  ? ? 1.479 1.336 0.143 0.023 Y 
103  2  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
104  2  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.482 1.336 0.146 0.023 Y 
105  2  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.479 1.336 0.143 0.023 Y 
106  2  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.487 1.336 0.151 0.023 Y 
107  2  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.481 1.336 0.145 0.023 Y 
108  2  C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
109  2  C  A SER 15 ? ? N   A VAL 16 ? ? 1.494 1.336 0.158 0.023 Y 
110  2  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
111  2  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.486 1.336 0.150 0.023 Y 
112  2  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.479 1.336 0.143 0.023 Y 
113  2  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.477 1.336 0.141 0.023 Y 
114  2  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.485 1.338 0.147 0.019 Y 
115  2  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.483 1.336 0.147 0.023 Y 
116  2  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.485 1.336 0.149 0.023 Y 
117  2  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.478 1.336 0.142 0.023 Y 
118  2  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.484 1.336 0.148 0.023 Y 
119  2  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.478 1.336 0.142 0.023 Y 
120  2  CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.363 1.252 0.111 0.011 N 
121  2  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.483 1.336 0.147 0.023 Y 
122  2  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.478 1.336 0.142 0.023 Y 
123  2  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.476 1.336 0.140 0.023 Y 
124  2  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.479 1.336 0.143 0.023 Y 
125  2  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
126  2  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.481 1.336 0.145 0.023 Y 
127  2  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
128  2  C  A THR 33 ? ? N   A THR 34 ? ? 1.480 1.336 0.144 0.023 Y 
129  2  C  A THR 34 ? ? N   A GLY 35 ? ? 1.479 1.336 0.143 0.023 Y 
130  2  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.482 1.336 0.146 0.023 Y 
131  2  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.478 1.336 0.142 0.023 Y 
132  2  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.477 1.336 0.141 0.023 Y 
133  2  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.477 1.336 0.141 0.023 Y 
134  2  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.471 1.338 0.133 0.019 Y 
135  2  C  A PRO 40 ? ? N   A SER 41 ? ? 1.491 1.336 0.155 0.023 Y 
136  2  C  A SER 41 ? ? N   A CYS 42 ? ? 1.487 1.336 0.151 0.023 Y 
137  2  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.480 1.336 0.144 0.023 Y 
138  2  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
139  2  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.487 1.336 0.151 0.023 Y 
140  2  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.478 1.336 0.142 0.023 Y 
141  2  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.479 1.336 0.143 0.023 Y 
142  2  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.479 1.336 0.143 0.023 Y 
143  2  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
144  2  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.481 1.336 0.145 0.023 Y 
145  2  CD A GLU 50 ? ? OE1 A GLU 50 ? ? 1.361 1.252 0.109 0.011 N 
146  2  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.502 1.336 0.166 0.023 Y 
147  2  C  A VAL 52 ? ? N   A SER 53 ? ? 1.478 1.336 0.142 0.023 Y 
148  2  C  A SER 53 ? ? N   A PHE 54 ? ? 1.482 1.336 0.146 0.023 Y 
149  2  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.481 1.336 0.145 0.023 Y 
150  2  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.481 1.336 0.145 0.023 Y 
151  2  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.480 1.336 0.144 0.023 Y 
152  2  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.480 1.336 0.144 0.023 Y 
153  2  C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
154  2  C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
155  2  CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
156  2  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.481 1.336 0.145 0.023 Y 
157  2  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.478 1.336 0.142 0.023 Y 
158  2  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
159  2  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.482 1.336 0.146 0.023 Y 
160  2  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.484 1.336 0.148 0.023 Y 
161  2  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
162  2  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.480 1.336 0.144 0.023 Y 
163  2  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.482 1.338 0.144 0.019 Y 
164  2  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.477 1.336 0.141 0.023 Y 
165  2  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.496 1.336 0.160 0.023 Y 
166  2  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
167  2  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.478 1.336 0.142 0.023 Y 
168  2  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.482 1.338 0.144 0.019 Y 
169  2  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.479 1.336 0.143 0.023 Y 
170  2  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.481 1.336 0.145 0.023 Y 
171  2  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.479 1.336 0.143 0.023 Y 
172  2  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.479 1.336 0.143 0.023 Y 
173  2  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.479 1.338 0.141 0.019 Y 
174  2  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.477 1.336 0.141 0.023 Y 
175  2  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
176  2  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.479 1.336 0.143 0.023 Y 
177  2  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.480 1.336 0.144 0.023 Y 
178  2  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
179  2  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.478 1.336 0.142 0.023 Y 
180  2  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.480 1.336 0.144 0.023 Y 
181  2  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
182  2  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
183  2  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
184  2  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
185  2  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.480 1.336 0.144 0.023 Y 
186  2  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.480 1.336 0.144 0.023 Y 
187  2  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
188  3  C  A MET 1  ? ? N   A LYS 2  ? ? 1.478 1.336 0.142 0.023 Y 
189  3  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
190  3  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
191  3  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
192  3  C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
193  3  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
194  3  C  A LEU 7  ? ? N   A THR 8  ? ? 1.480 1.336 0.144 0.023 Y 
195  3  C  A THR 8  ? ? N   A ASP 9  ? ? 1.478 1.336 0.142 0.023 Y 
196  3  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.479 1.336 0.143 0.023 Y 
197  3  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.480 1.336 0.144 0.023 Y 
198  3  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.478 1.336 0.142 0.023 Y 
199  3  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.490 1.336 0.154 0.023 Y 
200  3  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.481 1.336 0.145 0.023 Y 
201  3  C  A GLN 14 ? ? N   A SER 15 ? ? 1.484 1.336 0.148 0.023 Y 
202  3  C  A SER 15 ? ? N   A VAL 16 ? ? 1.494 1.336 0.158 0.023 Y 
203  3  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.477 1.336 0.141 0.023 Y 
204  3  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.488 1.336 0.152 0.023 Y 
205  3  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.480 1.336 0.144 0.023 Y 
206  3  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.481 1.336 0.145 0.023 Y 
207  3  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.477 1.338 0.139 0.019 Y 
208  3  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.480 1.336 0.144 0.023 Y 
209  3  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.480 1.336 0.144 0.023 Y 
210  3  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.479 1.336 0.143 0.023 Y 
211  3  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.479 1.336 0.143 0.023 Y 
212  3  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.479 1.336 0.143 0.023 Y 
213  3  CD A GLU 26 ? ? OE2 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
214  3  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.481 1.336 0.145 0.023 Y 
215  3  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.478 1.336 0.142 0.023 Y 
216  3  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.478 1.336 0.142 0.023 Y 
217  3  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.479 1.336 0.143 0.023 Y 
218  3  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.476 1.336 0.140 0.023 Y 
219  3  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.482 1.336 0.146 0.023 Y 
220  3  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
221  3  C  A THR 33 ? ? N   A THR 34 ? ? 1.480 1.336 0.144 0.023 Y 
222  3  C  A THR 34 ? ? N   A GLY 35 ? ? 1.481 1.336 0.145 0.023 Y 
223  3  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.478 1.336 0.142 0.023 Y 
224  3  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.477 1.336 0.141 0.023 Y 
225  3  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.479 1.336 0.143 0.023 Y 
226  3  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.476 1.336 0.140 0.023 Y 
227  3  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.471 1.338 0.133 0.019 Y 
228  3  C  A PRO 40 ? ? N   A SER 41 ? ? 1.488 1.336 0.152 0.023 Y 
229  3  C  A SER 41 ? ? N   A CYS 42 ? ? 1.482 1.336 0.146 0.023 Y 
230  3  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.487 1.336 0.151 0.023 Y 
231  3  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
232  3  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.488 1.336 0.152 0.023 Y 
233  3  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.478 1.336 0.142 0.023 Y 
234  3  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.483 1.336 0.147 0.023 Y 
235  3  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
236  3  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
237  3  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.479 1.336 0.143 0.023 Y 
238  3  CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
239  3  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.479 1.336 0.143 0.023 Y 
240  3  C  A VAL 52 ? ? N   A SER 53 ? ? 1.477 1.336 0.141 0.023 Y 
241  3  C  A SER 53 ? ? N   A PHE 54 ? ? 1.483 1.336 0.147 0.023 Y 
242  3  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.482 1.336 0.146 0.023 Y 
243  3  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.479 1.336 0.143 0.023 Y 
244  3  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.480 1.336 0.144 0.023 Y 
245  3  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.482 1.336 0.146 0.023 Y 
246  3  C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
247  3  C  A SER 59 ? ? N   A GLU 60 ? ? 1.481 1.336 0.145 0.023 Y 
248  3  CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
249  3  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.480 1.336 0.144 0.023 Y 
250  3  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.478 1.336 0.142 0.023 Y 
251  3  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
252  3  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.480 1.336 0.144 0.023 Y 
253  3  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.482 1.336 0.146 0.023 Y 
254  3  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
255  3  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.484 1.336 0.148 0.023 Y 
256  3  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.477 1.338 0.139 0.019 Y 
257  3  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.482 1.336 0.146 0.023 Y 
258  3  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.496 1.336 0.160 0.023 Y 
259  3  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
260  3  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.478 1.336 0.142 0.023 Y 
261  3  C  A CYS 72 ? ? N   A GLN 73 ? ? 1.475 1.336 0.139 0.023 Y 
262  3  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.479 1.338 0.141 0.019 Y 
263  3  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.491 1.336 0.155 0.023 Y 
264  3  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
265  3  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.477 1.336 0.141 0.023 Y 
266  3  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.480 1.336 0.144 0.023 Y 
267  3  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.479 1.338 0.141 0.019 Y 
268  3  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.478 1.336 0.142 0.023 Y 
269  3  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
270  3  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.478 1.336 0.142 0.023 Y 
271  3  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.478 1.336 0.142 0.023 Y 
272  3  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
273  3  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
274  3  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.482 1.336 0.146 0.023 Y 
275  3  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
276  3  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
277  3  C  A THR 88 ? ? N   A HIS 89 ? ? 1.478 1.336 0.142 0.023 Y 
278  3  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
279  3  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.480 1.336 0.144 0.023 Y 
280  3  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.478 1.336 0.142 0.023 Y 
281  3  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
282  4  C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
283  4  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.479 1.336 0.143 0.023 Y 
284  4  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
285  4  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
286  4  C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
287  4  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
288  4  C  A LEU 7  ? ? N   A THR 8  ? ? 1.481 1.336 0.145 0.023 Y 
289  4  C  A THR 8  ? ? N   A ASP 9  ? ? 1.482 1.336 0.146 0.023 Y 
290  4  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.479 1.336 0.143 0.023 Y 
291  4  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.481 1.336 0.145 0.023 Y 
292  4  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.478 1.336 0.142 0.023 Y 
293  4  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.493 1.336 0.157 0.023 Y 
294  4  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.482 1.336 0.146 0.023 Y 
295  4  C  A GLN 14 ? ? N   A SER 15 ? ? 1.487 1.336 0.151 0.023 Y 
296  4  C  A SER 15 ? ? N   A VAL 16 ? ? 1.493 1.336 0.157 0.023 Y 
297  4  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
298  4  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.488 1.336 0.152 0.023 Y 
299  4  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.479 1.336 0.143 0.023 Y 
300  4  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.481 1.336 0.145 0.023 Y 
301  4  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.478 1.338 0.140 0.019 Y 
302  4  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.477 1.336 0.141 0.023 Y 
303  4  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.484 1.336 0.148 0.023 Y 
304  4  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.477 1.336 0.141 0.023 Y 
305  4  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.491 1.336 0.155 0.023 Y 
306  4  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.474 1.336 0.138 0.023 Y 
307  4  CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.363 1.252 0.111 0.011 N 
308  4  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.504 1.336 0.168 0.023 Y 
309  4  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.486 1.336 0.150 0.023 Y 
310  4  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.477 1.336 0.141 0.023 Y 
311  4  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.478 1.336 0.142 0.023 Y 
312  4  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.478 1.336 0.142 0.023 Y 
313  4  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.480 1.336 0.144 0.023 Y 
314  4  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
315  4  C  A THR 33 ? ? N   A THR 34 ? ? 1.481 1.336 0.145 0.023 Y 
316  4  C  A THR 34 ? ? N   A GLY 35 ? ? 1.478 1.336 0.142 0.023 Y 
317  4  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.482 1.336 0.146 0.023 Y 
318  4  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.480 1.336 0.144 0.023 Y 
319  4  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.477 1.336 0.141 0.023 Y 
320  4  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.476 1.338 0.138 0.019 Y 
321  4  C  A PRO 40 ? ? N   A SER 41 ? ? 1.484 1.336 0.148 0.023 Y 
322  4  C  A SER 41 ? ? N   A CYS 42 ? ? 1.490 1.336 0.154 0.023 Y 
323  4  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.479 1.336 0.143 0.023 Y 
324  4  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.477 1.336 0.141 0.023 Y 
325  4  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.489 1.336 0.153 0.023 Y 
326  4  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.478 1.336 0.142 0.023 Y 
327  4  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.483 1.336 0.147 0.023 Y 
328  4  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
329  4  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
330  4  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.479 1.336 0.143 0.023 Y 
331  4  CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
332  4  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.496 1.336 0.160 0.023 Y 
333  4  C  A VAL 52 ? ? N   A SER 53 ? ? 1.477 1.336 0.141 0.023 Y 
334  4  C  A SER 53 ? ? N   A PHE 54 ? ? 1.482 1.336 0.146 0.023 Y 
335  4  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.479 1.336 0.143 0.023 Y 
336  4  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.479 1.336 0.143 0.023 Y 
337  4  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.478 1.336 0.142 0.023 Y 
338  4  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.479 1.336 0.143 0.023 Y 
339  4  C  A ALA 58 ? ? N   A SER 59 ? ? 1.480 1.336 0.144 0.023 Y 
340  4  C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
341  4  CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
342  4  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.480 1.336 0.144 0.023 Y 
343  4  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.478 1.336 0.142 0.023 Y 
344  4  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
345  4  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.481 1.336 0.145 0.023 Y 
346  4  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.483 1.336 0.147 0.023 Y 
347  4  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.481 1.336 0.145 0.023 Y 
348  4  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
349  4  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.485 1.338 0.147 0.019 Y 
350  4  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.476 1.336 0.140 0.023 Y 
351  4  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.506 1.336 0.170 0.023 Y 
352  4  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.482 1.336 0.146 0.023 Y 
353  4  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.478 1.336 0.142 0.023 Y 
354  4  C  A CYS 72 ? ? N   A GLN 73 ? ? 1.478 1.336 0.142 0.023 Y 
355  4  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.478 1.338 0.140 0.019 Y 
356  4  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.477 1.336 0.141 0.023 Y 
357  4  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
358  4  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.477 1.336 0.141 0.023 Y 
359  4  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.480 1.336 0.144 0.023 Y 
360  4  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.477 1.338 0.139 0.019 Y 
361  4  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.479 1.336 0.143 0.023 Y 
362  4  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
363  4  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.480 1.336 0.144 0.023 Y 
364  4  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
365  4  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
366  4  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.478 1.336 0.142 0.023 Y 
367  4  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
368  4  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
369  4  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
370  4  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
371  4  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
372  4  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
373  4  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
374  4  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.431 1.229 0.202 0.019 N 
375  5  C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
376  5  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.479 1.336 0.143 0.023 Y 
377  5  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.480 1.336 0.144 0.023 Y 
378  5  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
379  5  C  A THR 5  ? ? N   A CYS 6  ? ? 1.480 1.336 0.144 0.023 Y 
380  5  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
381  5  C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
382  5  C  A THR 8  ? ? N   A ASP 9  ? ? 1.481 1.336 0.145 0.023 Y 
383  5  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
384  5  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.481 1.336 0.145 0.023 Y 
385  5  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.480 1.336 0.144 0.023 Y 
386  5  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.489 1.336 0.153 0.023 Y 
387  5  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.483 1.336 0.147 0.023 Y 
388  5  C  A GLN 14 ? ? N   A SER 15 ? ? 1.482 1.336 0.146 0.023 Y 
389  5  C  A SER 15 ? ? N   A VAL 16 ? ? 1.494 1.336 0.158 0.023 Y 
390  5  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
391  5  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.486 1.336 0.150 0.023 Y 
392  5  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.480 1.336 0.144 0.023 Y 
393  5  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.479 1.336 0.143 0.023 Y 
394  5  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.478 1.338 0.140 0.019 Y 
395  5  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.480 1.336 0.144 0.023 Y 
396  5  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.480 1.336 0.144 0.023 Y 
397  5  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.480 1.336 0.144 0.023 Y 
398  5  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.478 1.336 0.142 0.023 Y 
399  5  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.478 1.336 0.142 0.023 Y 
400  5  CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.361 1.252 0.109 0.011 N 
401  5  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.481 1.336 0.145 0.023 Y 
402  5  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.483 1.336 0.147 0.023 Y 
403  5  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.478 1.336 0.142 0.023 Y 
404  5  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.479 1.336 0.143 0.023 Y 
405  5  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
406  5  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.478 1.336 0.142 0.023 Y 
407  5  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
408  5  C  A THR 33 ? ? N   A THR 34 ? ? 1.481 1.336 0.145 0.023 Y 
409  5  C  A THR 34 ? ? N   A GLY 35 ? ? 1.486 1.336 0.150 0.023 Y 
410  5  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.479 1.336 0.143 0.023 Y 
411  5  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.478 1.336 0.142 0.023 Y 
412  5  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.478 1.336 0.142 0.023 Y 
413  5  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.475 1.336 0.139 0.023 Y 
414  5  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.469 1.338 0.131 0.019 Y 
415  5  C  A PRO 40 ? ? N   A SER 41 ? ? 1.480 1.336 0.144 0.023 Y 
416  5  C  A SER 41 ? ? N   A CYS 42 ? ? 1.478 1.336 0.142 0.023 Y 
417  5  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.477 1.336 0.141 0.023 Y 
418  5  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.483 1.336 0.147 0.023 Y 
419  5  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.481 1.336 0.145 0.023 Y 
420  5  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.484 1.336 0.148 0.023 Y 
421  5  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.483 1.336 0.147 0.023 Y 
422  5  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.478 1.336 0.142 0.023 Y 
423  5  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.480 1.336 0.144 0.023 Y 
424  5  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.483 1.336 0.147 0.023 Y 
425  5  CD A GLU 50 ? ? OE1 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
426  5  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.500 1.336 0.164 0.023 Y 
427  5  C  A VAL 52 ? ? N   A SER 53 ? ? 1.476 1.336 0.140 0.023 Y 
428  5  C  A SER 53 ? ? N   A PHE 54 ? ? 1.481 1.336 0.145 0.023 Y 
429  5  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.481 1.336 0.145 0.023 Y 
430  5  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.480 1.336 0.144 0.023 Y 
431  5  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.479 1.336 0.143 0.023 Y 
432  5  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.482 1.336 0.146 0.023 Y 
433  5  C  A ALA 58 ? ? N   A SER 59 ? ? 1.478 1.336 0.142 0.023 Y 
434  5  C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
435  5  CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
436  5  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.479 1.336 0.143 0.023 Y 
437  5  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.476 1.336 0.140 0.023 Y 
438  5  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.480 1.336 0.144 0.023 Y 
439  5  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.480 1.336 0.144 0.023 Y 
440  5  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.483 1.336 0.147 0.023 Y 
441  5  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.479 1.336 0.143 0.023 Y 
442  5  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
443  5  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.480 1.338 0.142 0.019 Y 
444  5  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.478 1.336 0.142 0.023 Y 
445  5  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.495 1.336 0.159 0.023 Y 
446  5  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
447  5  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.479 1.336 0.143 0.023 Y 
448  5  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.478 1.338 0.140 0.019 Y 
449  5  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.478 1.336 0.142 0.023 Y 
450  5  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
451  5  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.477 1.336 0.141 0.023 Y 
452  5  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.481 1.336 0.145 0.023 Y 
453  5  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.483 1.338 0.145 0.019 Y 
454  5  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.478 1.336 0.142 0.023 Y 
455  5  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
456  5  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.480 1.336 0.144 0.023 Y 
457  5  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.480 1.336 0.144 0.023 Y 
458  5  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
459  5  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
460  5  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
461  5  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
462  5  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
463  5  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
464  5  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
465  5  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
466  5  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
467  5  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.431 1.229 0.202 0.019 N 
468  6  C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
469  6  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.482 1.336 0.146 0.023 Y 
470  6  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.484 1.336 0.148 0.023 Y 
471  6  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
472  6  C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
473  6  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.480 1.336 0.144 0.023 Y 
474  6  C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
475  6  C  A THR 8  ? ? N   A ASP 9  ? ? 1.478 1.336 0.142 0.023 Y 
476  6  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.481 1.336 0.145 0.023 Y 
477  6  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.479 1.336 0.143 0.023 Y 
478  6  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.479 1.336 0.143 0.023 Y 
479  6  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.484 1.336 0.148 0.023 Y 
480  6  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.481 1.336 0.145 0.023 Y 
481  6  C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
482  6  C  A SER 15 ? ? N   A VAL 16 ? ? 1.496 1.336 0.160 0.023 Y 
483  6  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
484  6  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.486 1.336 0.150 0.023 Y 
485  6  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.479 1.336 0.143 0.023 Y 
486  6  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.479 1.336 0.143 0.023 Y 
487  6  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.476 1.338 0.138 0.019 Y 
488  6  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.482 1.336 0.146 0.023 Y 
489  6  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.483 1.336 0.147 0.023 Y 
490  6  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.480 1.336 0.144 0.023 Y 
491  6  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.479 1.336 0.143 0.023 Y 
492  6  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.482 1.336 0.146 0.023 Y 
493  6  CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
494  6  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.480 1.336 0.144 0.023 Y 
495  6  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.486 1.336 0.150 0.023 Y 
496  6  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.477 1.336 0.141 0.023 Y 
497  6  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.478 1.336 0.142 0.023 Y 
498  6  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
499  6  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.480 1.336 0.144 0.023 Y 
500  6  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
501  6  C  A THR 33 ? ? N   A THR 34 ? ? 1.479 1.336 0.143 0.023 Y 
502  6  C  A THR 34 ? ? N   A GLY 35 ? ? 1.480 1.336 0.144 0.023 Y 
503  6  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.481 1.336 0.145 0.023 Y 
504  6  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.479 1.336 0.143 0.023 Y 
505  6  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.475 1.336 0.139 0.023 Y 
506  6  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.477 1.336 0.141 0.023 Y 
507  6  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.473 1.338 0.135 0.019 Y 
508  6  C  A PRO 40 ? ? N   A SER 41 ? ? 1.489 1.336 0.153 0.023 Y 
509  6  C  A SER 41 ? ? N   A CYS 42 ? ? 1.478 1.336 0.142 0.023 Y 
510  6  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.479 1.336 0.143 0.023 Y 
511  6  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.477 1.336 0.141 0.023 Y 
512  6  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.489 1.336 0.153 0.023 Y 
513  6  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.477 1.336 0.141 0.023 Y 
514  6  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.482 1.336 0.146 0.023 Y 
515  6  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
516  6  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.478 1.336 0.142 0.023 Y 
517  6  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.480 1.336 0.144 0.023 Y 
518  6  CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
519  6  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.497 1.336 0.161 0.023 Y 
520  6  C  A VAL 52 ? ? N   A SER 53 ? ? 1.478 1.336 0.142 0.023 Y 
521  6  C  A SER 53 ? ? N   A PHE 54 ? ? 1.483 1.336 0.147 0.023 Y 
522  6  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.482 1.336 0.146 0.023 Y 
523  6  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.480 1.336 0.144 0.023 Y 
524  6  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.480 1.336 0.144 0.023 Y 
525  6  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.482 1.336 0.146 0.023 Y 
526  6  C  A ALA 58 ? ? N   A SER 59 ? ? 1.480 1.336 0.144 0.023 Y 
527  6  C  A SER 59 ? ? N   A GLU 60 ? ? 1.482 1.336 0.146 0.023 Y 
528  6  CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.365 1.252 0.113 0.011 N 
529  6  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.478 1.336 0.142 0.023 Y 
530  6  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.477 1.336 0.141 0.023 Y 
531  6  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.479 1.336 0.143 0.023 Y 
532  6  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.479 1.336 0.143 0.023 Y 
533  6  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.486 1.336 0.150 0.023 Y 
534  6  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
535  6  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
536  6  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.486 1.338 0.148 0.019 Y 
537  6  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.479 1.336 0.143 0.023 Y 
538  6  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.500 1.336 0.164 0.023 Y 
539  6  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.482 1.336 0.146 0.023 Y 
540  6  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.477 1.336 0.141 0.023 Y 
541  6  C  A CYS 72 ? ? N   A GLN 73 ? ? 1.530 1.336 0.194 0.023 Y 
542  6  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.479 1.338 0.141 0.019 Y 
543  6  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.480 1.336 0.144 0.023 Y 
544  6  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
545  6  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.477 1.336 0.141 0.023 Y 
546  6  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.481 1.336 0.145 0.023 Y 
547  6  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.480 1.338 0.142 0.019 Y 
548  6  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.478 1.336 0.142 0.023 Y 
549  6  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
550  6  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.479 1.336 0.143 0.023 Y 
551  6  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.482 1.336 0.146 0.023 Y 
552  6  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.480 1.336 0.144 0.023 Y 
553  6  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
554  6  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.480 1.336 0.144 0.023 Y 
555  6  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.478 1.336 0.142 0.023 Y 
556  6  C  A ILE 87 ? ? N   A THR 88 ? ? 1.480 1.336 0.144 0.023 Y 
557  6  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
558  6  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
559  6  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
560  6  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
561  6  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
562  7  C  A MET 1  ? ? N   A LYS 2  ? ? 1.478 1.336 0.142 0.023 Y 
563  7  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
564  7  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
565  7  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
566  7  C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
567  7  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.480 1.336 0.144 0.023 Y 
568  7  C  A LEU 7  ? ? N   A THR 8  ? ? 1.481 1.336 0.145 0.023 Y 
569  7  C  A THR 8  ? ? N   A ASP 9  ? ? 1.481 1.336 0.145 0.023 Y 
570  7  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
571  7  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.480 1.336 0.144 0.023 Y 
572  7  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.479 1.336 0.143 0.023 Y 
573  7  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.491 1.336 0.155 0.023 Y 
574  7  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.482 1.336 0.146 0.023 Y 
575  7  C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
576  7  C  A SER 15 ? ? N   A VAL 16 ? ? 1.499 1.336 0.163 0.023 Y 
577  7  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.477 1.336 0.141 0.023 Y 
578  7  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.487 1.336 0.151 0.023 Y 
579  7  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.476 1.336 0.140 0.023 Y 
580  7  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.478 1.336 0.142 0.023 Y 
581  7  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.477 1.338 0.139 0.019 Y 
582  7  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.476 1.336 0.140 0.023 Y 
583  7  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.481 1.336 0.145 0.023 Y 
584  7  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.478 1.336 0.142 0.023 Y 
585  7  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.478 1.336 0.142 0.023 Y 
586  7  CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
587  7  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.487 1.336 0.151 0.023 Y 
588  7  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.480 1.336 0.144 0.023 Y 
589  7  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.479 1.336 0.143 0.023 Y 
590  7  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.481 1.336 0.145 0.023 Y 
591  7  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.478 1.336 0.142 0.023 Y 
592  7  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.480 1.336 0.144 0.023 Y 
593  7  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
594  7  C  A THR 33 ? ? N   A THR 34 ? ? 1.480 1.336 0.144 0.023 Y 
595  7  C  A THR 34 ? ? N   A GLY 35 ? ? 1.479 1.336 0.143 0.023 Y 
596  7  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.479 1.336 0.143 0.023 Y 
597  7  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.477 1.336 0.141 0.023 Y 
598  7  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.478 1.336 0.142 0.023 Y 
599  7  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.475 1.336 0.139 0.023 Y 
600  7  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.471 1.338 0.133 0.019 Y 
601  7  C  A PRO 40 ? ? N   A SER 41 ? ? 1.489 1.336 0.153 0.023 Y 
602  7  C  A SER 41 ? ? N   A CYS 42 ? ? 1.480 1.336 0.144 0.023 Y 
603  7  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.479 1.336 0.143 0.023 Y 
604  7  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.479 1.336 0.143 0.023 Y 
605  7  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.488 1.336 0.152 0.023 Y 
606  7  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.479 1.336 0.143 0.023 Y 
607  7  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.485 1.336 0.149 0.023 Y 
608  7  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.479 1.336 0.143 0.023 Y 
609  7  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
610  7  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.479 1.336 0.143 0.023 Y 
611  7  CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.361 1.252 0.109 0.011 N 
612  7  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.481 1.336 0.145 0.023 Y 
613  7  C  A VAL 52 ? ? N   A SER 53 ? ? 1.477 1.336 0.141 0.023 Y 
614  7  C  A SER 53 ? ? N   A PHE 54 ? ? 1.481 1.336 0.145 0.023 Y 
615  7  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.479 1.336 0.143 0.023 Y 
616  7  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.479 1.336 0.143 0.023 Y 
617  7  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.481 1.336 0.145 0.023 Y 
618  7  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.483 1.336 0.147 0.023 Y 
619  7  C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
620  7  C  A SER 59 ? ? N   A GLU 60 ? ? 1.477 1.336 0.141 0.023 Y 
621  7  CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
622  7  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.480 1.336 0.144 0.023 Y 
623  7  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.479 1.336 0.143 0.023 Y 
624  7  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.479 1.336 0.143 0.023 Y 
625  7  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.482 1.336 0.146 0.023 Y 
626  7  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.485 1.336 0.149 0.023 Y 
627  7  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.479 1.336 0.143 0.023 Y 
628  7  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.478 1.336 0.142 0.023 Y 
629  7  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.483 1.338 0.145 0.019 Y 
630  7  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.478 1.336 0.142 0.023 Y 
631  7  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.496 1.336 0.160 0.023 Y 
632  7  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
633  7  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.478 1.336 0.142 0.023 Y 
634  7  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.478 1.338 0.140 0.019 Y 
635  7  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.480 1.336 0.144 0.023 Y 
636  7  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.478 1.336 0.142 0.023 Y 
637  7  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.475 1.336 0.139 0.023 Y 
638  7  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.478 1.336 0.142 0.023 Y 
639  7  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.479 1.338 0.141 0.019 Y 
640  7  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.479 1.336 0.143 0.023 Y 
641  7  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
642  7  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.479 1.336 0.143 0.023 Y 
643  7  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.480 1.336 0.144 0.023 Y 
644  7  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
645  7  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.480 1.336 0.144 0.023 Y 
646  7  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
647  7  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.478 1.336 0.142 0.023 Y 
648  7  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
649  7  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
650  7  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.480 1.336 0.144 0.023 Y 
651  7  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
652  7  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
653  7  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
654  8  C  A MET 1  ? ? N   A LYS 2  ? ? 1.480 1.336 0.144 0.023 Y 
655  8  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.479 1.336 0.143 0.023 Y 
656  8  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
657  8  C  A ALA 4  ? ? N   A THR 5  ? ? 1.478 1.336 0.142 0.023 Y 
658  8  C  A THR 5  ? ? N   A CYS 6  ? ? 1.478 1.336 0.142 0.023 Y 
659  8  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.481 1.336 0.145 0.023 Y 
660  8  C  A LEU 7  ? ? N   A THR 8  ? ? 1.482 1.336 0.146 0.023 Y 
661  8  C  A THR 8  ? ? N   A ASP 9  ? ? 1.481 1.336 0.145 0.023 Y 
662  8  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
663  8  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.481 1.336 0.145 0.023 Y 
664  8  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.480 1.336 0.144 0.023 Y 
665  8  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.485 1.336 0.149 0.023 Y 
666  8  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.481 1.336 0.145 0.023 Y 
667  8  C  A GLN 14 ? ? N   A SER 15 ? ? 1.485 1.336 0.149 0.023 Y 
668  8  C  A SER 15 ? ? N   A VAL 16 ? ? 1.494 1.336 0.158 0.023 Y 
669  8  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
670  8  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.488 1.336 0.152 0.023 Y 
671  8  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.479 1.336 0.143 0.023 Y 
672  8  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.478 1.336 0.142 0.023 Y 
673  8  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.478 1.338 0.140 0.019 Y 
674  8  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.482 1.336 0.146 0.023 Y 
675  8  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.480 1.336 0.144 0.023 Y 
676  8  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.479 1.336 0.143 0.023 Y 
677  8  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.481 1.336 0.145 0.023 Y 
678  8  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.479 1.336 0.143 0.023 Y 
679  8  CD A GLU 26 ? ? OE2 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
680  8  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.479 1.336 0.143 0.023 Y 
681  8  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.481 1.336 0.145 0.023 Y 
682  8  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.479 1.336 0.143 0.023 Y 
683  8  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.478 1.336 0.142 0.023 Y 
684  8  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.478 1.336 0.142 0.023 Y 
685  8  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.481 1.336 0.145 0.023 Y 
686  8  C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
687  8  C  A THR 33 ? ? N   A THR 34 ? ? 1.480 1.336 0.144 0.023 Y 
688  8  C  A THR 34 ? ? N   A GLY 35 ? ? 1.481 1.336 0.145 0.023 Y 
689  8  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.481 1.336 0.145 0.023 Y 
690  8  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.480 1.336 0.144 0.023 Y 
691  8  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.476 1.336 0.140 0.023 Y 
692  8  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.477 1.336 0.141 0.023 Y 
693  8  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.475 1.338 0.137 0.019 Y 
694  8  C  A PRO 40 ? ? N   A SER 41 ? ? 1.489 1.336 0.153 0.023 Y 
695  8  C  A SER 41 ? ? N   A CYS 42 ? ? 1.479 1.336 0.143 0.023 Y 
696  8  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.482 1.336 0.146 0.023 Y 
697  8  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.479 1.336 0.143 0.023 Y 
698  8  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.489 1.336 0.153 0.023 Y 
699  8  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.478 1.336 0.142 0.023 Y 
700  8  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.483 1.336 0.147 0.023 Y 
701  8  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
702  8  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
703  8  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.479 1.336 0.143 0.023 Y 
704  8  CD A GLU 50 ? ? OE1 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
705  8  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.478 1.336 0.142 0.023 Y 
706  8  C  A VAL 52 ? ? N   A SER 53 ? ? 1.478 1.336 0.142 0.023 Y 
707  8  C  A SER 53 ? ? N   A PHE 54 ? ? 1.481 1.336 0.145 0.023 Y 
708  8  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.479 1.336 0.143 0.023 Y 
709  8  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.479 1.336 0.143 0.023 Y 
710  8  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.480 1.336 0.144 0.023 Y 
711  8  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.482 1.336 0.146 0.023 Y 
712  8  C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
713  8  C  A SER 59 ? ? N   A GLU 60 ? ? 1.482 1.336 0.146 0.023 Y 
714  8  CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
715  8  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.479 1.336 0.143 0.023 Y 
716  8  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.477 1.336 0.141 0.023 Y 
717  8  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.480 1.336 0.144 0.023 Y 
718  8  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.481 1.336 0.145 0.023 Y 
719  8  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.485 1.336 0.149 0.023 Y 
720  8  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.479 1.336 0.143 0.023 Y 
721  8  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
722  8  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.482 1.338 0.144 0.019 Y 
723  8  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.479 1.336 0.143 0.023 Y 
724  8  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.489 1.336 0.153 0.023 Y 
725  8  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.481 1.336 0.145 0.023 Y 
726  8  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.482 1.336 0.146 0.023 Y 
727  8  C  A CYS 72 ? ? N   A GLN 73 ? ? 1.524 1.336 0.188 0.023 Y 
728  8  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.473 1.338 0.135 0.019 Y 
729  8  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.483 1.336 0.147 0.023 Y 
730  8  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.480 1.336 0.144 0.023 Y 
731  8  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.477 1.336 0.141 0.023 Y 
732  8  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.480 1.336 0.144 0.023 Y 
733  8  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.480 1.338 0.142 0.019 Y 
734  8  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.479 1.336 0.143 0.023 Y 
735  8  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
736  8  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.478 1.336 0.142 0.023 Y 
737  8  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
738  8  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
739  8  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.481 1.336 0.145 0.023 Y 
740  8  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
741  8  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
742  8  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
743  8  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
744  8  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.480 1.336 0.144 0.023 Y 
745  8  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
746  8  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
747  8  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
748  9  C  A MET 1  ? ? N   A LYS 2  ? ? 1.481 1.336 0.145 0.023 Y 
749  9  C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
750  9  C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
751  9  C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
752  9  C  A THR 5  ? ? N   A CYS 6  ? ? 1.478 1.336 0.142 0.023 Y 
753  9  C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
754  9  C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
755  9  C  A THR 8  ? ? N   A ASP 9  ? ? 1.479 1.336 0.143 0.023 Y 
756  9  C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
757  9  C  A ASP 10 ? ? N   A GLN 11 ? ? 1.479 1.336 0.143 0.023 Y 
758  9  C  A GLN 11 ? ? N   A ARG 12 ? ? 1.481 1.336 0.145 0.023 Y 
759  9  C  A ARG 12 ? ? N   A TRP 13 ? ? 1.489 1.336 0.153 0.023 Y 
760  9  C  A TRP 13 ? ? N   A GLN 14 ? ? 1.483 1.336 0.147 0.023 Y 
761  9  C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
762  9  C  A SER 15 ? ? N   A VAL 16 ? ? 1.492 1.336 0.156 0.023 Y 
763  9  C  A VAL 16 ? ? N   A LEU 17 ? ? 1.474 1.336 0.138 0.023 Y 
764  9  C  A LEU 17 ? ? N   A ALA 18 ? ? 1.486 1.336 0.150 0.023 Y 
765  9  C  A ALA 18 ? ? N   A ARG 19 ? ? 1.476 1.336 0.140 0.023 Y 
766  9  C  A ARG 19 ? ? N   A ASP 20 ? ? 1.485 1.336 0.149 0.023 Y 
767  9  C  A ASP 20 ? ? N   A PRO 21 ? ? 1.475 1.338 0.137 0.019 Y 
768  9  C  A PRO 21 ? ? N   A ASN 22 ? ? 1.485 1.336 0.149 0.023 Y 
769  9  C  A ASN 22 ? ? N   A ALA 23 ? ? 1.483 1.336 0.147 0.023 Y 
770  9  C  A ALA 23 ? ? N   A ASP 24 ? ? 1.479 1.336 0.143 0.023 Y 
771  9  C  A ASP 24 ? ? N   A GLY 25 ? ? 1.478 1.336 0.142 0.023 Y 
772  9  C  A GLY 25 ? ? N   A GLU 26 ? ? 1.479 1.336 0.143 0.023 Y 
773  9  CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
774  9  C  A GLU 26 ? ? N   A PHE 27 ? ? 1.480 1.336 0.144 0.023 Y 
775  9  C  A PHE 27 ? ? N   A VAL 28 ? ? 1.482 1.336 0.146 0.023 Y 
776  9  C  A VAL 28 ? ? N   A PHE 29 ? ? 1.483 1.336 0.147 0.023 Y 
777  9  C  A PHE 29 ? ? N   A ALA 30 ? ? 1.478 1.336 0.142 0.023 Y 
778  9  C  A ALA 30 ? ? N   A VAL 31 ? ? 1.478 1.336 0.142 0.023 Y 
779  9  C  A VAL 31 ? ? N   A ARG 32 ? ? 1.478 1.336 0.142 0.023 Y 
780  9  C  A ARG 32 ? ? N   A THR 33 ? ? 1.479 1.336 0.143 0.023 Y 
781  9  C  A THR 33 ? ? N   A THR 34 ? ? 1.479 1.336 0.143 0.023 Y 
782  9  C  A THR 34 ? ? N   A GLY 35 ? ? 1.480 1.336 0.144 0.023 Y 
783  9  C  A GLY 35 ? ? N   A ILE 36 ? ? 1.478 1.336 0.142 0.023 Y 
784  9  C  A ILE 36 ? ? N   A PHE 37 ? ? 1.477 1.336 0.141 0.023 Y 
785  9  C  A PHE 37 ? ? N   A CYS 38 ? ? 1.477 1.336 0.141 0.023 Y 
786  9  C  A CYS 38 ? ? N   A ARG 39 ? ? 1.475 1.336 0.139 0.023 Y 
787  9  C  A ARG 39 ? ? N   A PRO 40 ? ? 1.473 1.338 0.135 0.019 Y 
788  9  C  A PRO 40 ? ? N   A SER 41 ? ? 1.490 1.336 0.154 0.023 Y 
789  9  C  A SER 41 ? ? N   A CYS 42 ? ? 1.483 1.336 0.147 0.023 Y 
790  9  C  A CYS 42 ? ? N   A ARG 43 ? ? 1.485 1.336 0.149 0.023 Y 
791  9  C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
792  9  C  A ALA 44 ? ? N   A ARG 45 ? ? 1.487 1.336 0.151 0.023 Y 
793  9  C  A ARG 45 ? ? N   A HIS 46 ? ? 1.479 1.336 0.143 0.023 Y 
794  9  C  A HIS 46 ? ? N   A ALA 47 ? ? 1.480 1.336 0.144 0.023 Y 
795  9  C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
796  9  C  A LEU 48 ? ? N   A ARG 49 ? ? 1.482 1.336 0.146 0.023 Y 
797  9  C  A ARG 49 ? ? N   A GLU 50 ? ? 1.478 1.336 0.142 0.023 Y 
798  9  CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
799  9  C  A ASN 51 ? ? N   A VAL 52 ? ? 1.478 1.336 0.142 0.023 Y 
800  9  C  A VAL 52 ? ? N   A SER 53 ? ? 1.476 1.336 0.140 0.023 Y 
801  9  C  A SER 53 ? ? N   A PHE 54 ? ? 1.483 1.336 0.147 0.023 Y 
802  9  C  A PHE 54 ? ? N   A TYR 55 ? ? 1.478 1.336 0.142 0.023 Y 
803  9  C  A TYR 55 ? ? N   A ALA 56 ? ? 1.480 1.336 0.144 0.023 Y 
804  9  C  A ALA 56 ? ? N   A ASN 57 ? ? 1.479 1.336 0.143 0.023 Y 
805  9  C  A ASN 57 ? ? N   A ALA 58 ? ? 1.480 1.336 0.144 0.023 Y 
806  9  C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
807  9  C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
808  9  CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.363 1.252 0.111 0.011 N 
809  9  C  A GLU 60 ? ? N   A ALA 61 ? ? 1.479 1.336 0.143 0.023 Y 
810  9  C  A ALA 61 ? ? N   A LEU 62 ? ? 1.479 1.336 0.143 0.023 Y 
811  9  C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
812  9  C  A ALA 63 ? ? N   A ALA 64 ? ? 1.482 1.336 0.146 0.023 Y 
813  9  C  A ALA 64 ? ? N   A GLY 65 ? ? 1.484 1.336 0.148 0.023 Y 
814  9  C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
815  9  C  A PHE 66 ? ? N   A ARG 67 ? ? 1.480 1.336 0.144 0.023 Y 
816  9  C  A ARG 67 ? ? N   A PRO 68 ? ? 1.483 1.338 0.145 0.019 Y 
817  9  C  A PRO 68 ? ? N   A CYS 69 ? ? 1.478 1.336 0.142 0.023 Y 
818  9  C  A CYS 69 ? ? N   A LYS 70 ? ? 1.496 1.336 0.160 0.023 Y 
819  9  C  A LYS 70 ? ? N   A ARG 71 ? ? 1.478 1.336 0.142 0.023 Y 
820  9  C  A ARG 71 ? ? N   A CYS 72 ? ? 1.479 1.336 0.143 0.023 Y 
821  9  C  A CYS 72 ? ? N   A GLN 73 ? ? 1.476 1.336 0.140 0.023 Y 
822  9  C  A GLN 73 ? ? N   A PRO 74 ? ? 1.477 1.338 0.139 0.019 Y 
823  9  C  A PRO 74 ? ? N   A ASP 75 ? ? 1.485 1.336 0.149 0.023 Y 
824  9  C  A ASP 75 ? ? N   A LYS 76 ? ? 1.481 1.336 0.145 0.023 Y 
825  9  C  A LYS 76 ? ? N   A ALA 77 ? ? 1.475 1.336 0.139 0.023 Y 
826  9  C  A ALA 77 ? ? N   A ASN 78 ? ? 1.478 1.336 0.142 0.023 Y 
827  9  C  A ASN 78 ? ? N   A PRO 79 ? ? 1.478 1.338 0.140 0.019 Y 
828  9  C  A PRO 79 ? ? N   A ARG 80 ? ? 1.477 1.336 0.141 0.023 Y 
829  9  C  A ARG 80 ? ? N   A GLN 81 ? ? 1.478 1.336 0.142 0.023 Y 
830  9  C  A GLN 81 ? ? N   A HIS 82 ? ? 1.478 1.336 0.142 0.023 Y 
831  9  C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
832  9  C  A ARG 83 ? ? N   A LEU 84 ? ? 1.478 1.336 0.142 0.023 Y 
833  9  C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
834  9  C  A ASP 85 ? ? N   A LYS 86 ? ? 1.480 1.336 0.144 0.023 Y 
835  9  C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
836  9  C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
837  9  C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
838  9  C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
839  9  C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
840  9  C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
841  9  C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
842  10 C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
843  10 C  A LYS 2  ? ? N   A LYS 3  ? ? 1.479 1.336 0.143 0.023 Y 
844  10 C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
845  10 C  A ALA 4  ? ? N   A THR 5  ? ? 1.480 1.336 0.144 0.023 Y 
846  10 C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
847  10 C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
848  10 C  A LEU 7  ? ? N   A THR 8  ? ? 1.481 1.336 0.145 0.023 Y 
849  10 C  A THR 8  ? ? N   A ASP 9  ? ? 1.480 1.336 0.144 0.023 Y 
850  10 C  A ASP 9  ? ? N   A ASP 10 ? ? 1.479 1.336 0.143 0.023 Y 
851  10 C  A ASP 10 ? ? N   A GLN 11 ? ? 1.482 1.336 0.146 0.023 Y 
852  10 C  A GLN 11 ? ? N   A ARG 12 ? ? 1.479 1.336 0.143 0.023 Y 
853  10 C  A ARG 12 ? ? N   A TRP 13 ? ? 1.488 1.336 0.152 0.023 Y 
854  10 C  A TRP 13 ? ? N   A GLN 14 ? ? 1.482 1.336 0.146 0.023 Y 
855  10 C  A GLN 14 ? ? N   A SER 15 ? ? 1.486 1.336 0.150 0.023 Y 
856  10 C  A SER 15 ? ? N   A VAL 16 ? ? 1.500 1.336 0.164 0.023 Y 
857  10 C  A VAL 16 ? ? N   A LEU 17 ? ? 1.477 1.336 0.141 0.023 Y 
858  10 C  A LEU 17 ? ? N   A ALA 18 ? ? 1.485 1.336 0.149 0.023 Y 
859  10 C  A ALA 18 ? ? N   A ARG 19 ? ? 1.486 1.336 0.150 0.023 Y 
860  10 C  A ARG 19 ? ? N   A ASP 20 ? ? 1.477 1.336 0.141 0.023 Y 
861  10 C  A ASP 20 ? ? N   A PRO 21 ? ? 1.480 1.338 0.142 0.019 Y 
862  10 C  A PRO 21 ? ? N   A ASN 22 ? ? 1.479 1.336 0.143 0.023 Y 
863  10 C  A ASN 22 ? ? N   A ALA 23 ? ? 1.479 1.336 0.143 0.023 Y 
864  10 C  A ALA 23 ? ? N   A ASP 24 ? ? 1.478 1.336 0.142 0.023 Y 
865  10 C  A ASP 24 ? ? N   A GLY 25 ? ? 1.474 1.336 0.138 0.023 Y 
866  10 C  A GLY 25 ? ? N   A GLU 26 ? ? 1.476 1.336 0.140 0.023 Y 
867  10 CD A GLU 26 ? ? OE2 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
868  10 C  A GLU 26 ? ? N   A PHE 27 ? ? 1.482 1.336 0.146 0.023 Y 
869  10 C  A PHE 27 ? ? N   A VAL 28 ? ? 1.477 1.336 0.141 0.023 Y 
870  10 C  A VAL 28 ? ? N   A PHE 29 ? ? 1.479 1.336 0.143 0.023 Y 
871  10 C  A PHE 29 ? ? N   A ALA 30 ? ? 1.479 1.336 0.143 0.023 Y 
872  10 C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
873  10 C  A VAL 31 ? ? N   A ARG 32 ? ? 1.478 1.336 0.142 0.023 Y 
874  10 C  A ARG 32 ? ? N   A THR 33 ? ? 1.479 1.336 0.143 0.023 Y 
875  10 C  A THR 33 ? ? N   A THR 34 ? ? 1.480 1.336 0.144 0.023 Y 
876  10 C  A THR 34 ? ? N   A GLY 35 ? ? 1.480 1.336 0.144 0.023 Y 
877  10 C  A GLY 35 ? ? N   A ILE 36 ? ? 1.480 1.336 0.144 0.023 Y 
878  10 C  A ILE 36 ? ? N   A PHE 37 ? ? 1.477 1.336 0.141 0.023 Y 
879  10 C  A PHE 37 ? ? N   A CYS 38 ? ? 1.477 1.336 0.141 0.023 Y 
880  10 C  A CYS 38 ? ? N   A ARG 39 ? ? 1.476 1.336 0.140 0.023 Y 
881  10 C  A ARG 39 ? ? N   A PRO 40 ? ? 1.473 1.338 0.135 0.019 Y 
882  10 C  A PRO 40 ? ? N   A SER 41 ? ? 1.484 1.336 0.148 0.023 Y 
883  10 C  A SER 41 ? ? N   A CYS 42 ? ? 1.482 1.336 0.146 0.023 Y 
884  10 C  A CYS 42 ? ? N   A ARG 43 ? ? 1.478 1.336 0.142 0.023 Y 
885  10 C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
886  10 C  A ALA 44 ? ? N   A ARG 45 ? ? 1.486 1.336 0.150 0.023 Y 
887  10 C  A ARG 45 ? ? N   A HIS 46 ? ? 1.478 1.336 0.142 0.023 Y 
888  10 C  A HIS 46 ? ? N   A ALA 47 ? ? 1.481 1.336 0.145 0.023 Y 
889  10 C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
890  10 C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
891  10 C  A ARG 49 ? ? N   A GLU 50 ? ? 1.479 1.336 0.143 0.023 Y 
892  10 CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
893  10 C  A ASN 51 ? ? N   A VAL 52 ? ? 1.479 1.336 0.143 0.023 Y 
894  10 C  A VAL 52 ? ? N   A SER 53 ? ? 1.478 1.336 0.142 0.023 Y 
895  10 C  A SER 53 ? ? N   A PHE 54 ? ? 1.482 1.336 0.146 0.023 Y 
896  10 C  A PHE 54 ? ? N   A TYR 55 ? ? 1.478 1.336 0.142 0.023 Y 
897  10 C  A TYR 55 ? ? N   A ALA 56 ? ? 1.480 1.336 0.144 0.023 Y 
898  10 C  A ALA 56 ? ? N   A ASN 57 ? ? 1.479 1.336 0.143 0.023 Y 
899  10 C  A ASN 57 ? ? N   A ALA 58 ? ? 1.482 1.336 0.146 0.023 Y 
900  10 C  A ALA 58 ? ? N   A SER 59 ? ? 1.478 1.336 0.142 0.023 Y 
901  10 C  A SER 59 ? ? N   A GLU 60 ? ? 1.481 1.336 0.145 0.023 Y 
902  10 CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
903  10 C  A GLU 60 ? ? N   A ALA 61 ? ? 1.481 1.336 0.145 0.023 Y 
904  10 C  A ALA 61 ? ? N   A LEU 62 ? ? 1.478 1.336 0.142 0.023 Y 
905  10 C  A LEU 62 ? ? N   A ALA 63 ? ? 1.479 1.336 0.143 0.023 Y 
906  10 C  A ALA 63 ? ? N   A ALA 64 ? ? 1.480 1.336 0.144 0.023 Y 
907  10 C  A ALA 64 ? ? N   A GLY 65 ? ? 1.484 1.336 0.148 0.023 Y 
908  10 C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
909  10 C  A PHE 66 ? ? N   A ARG 67 ? ? 1.478 1.336 0.142 0.023 Y 
910  10 C  A ARG 67 ? ? N   A PRO 68 ? ? 1.481 1.338 0.143 0.019 Y 
911  10 C  A PRO 68 ? ? N   A CYS 69 ? ? 1.481 1.336 0.145 0.023 Y 
912  10 C  A CYS 69 ? ? N   A LYS 70 ? ? 1.486 1.336 0.150 0.023 Y 
913  10 C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
914  10 C  A ARG 71 ? ? N   A CYS 72 ? ? 1.480 1.336 0.144 0.023 Y 
915  10 C  A CYS 72 ? ? N   A GLN 73 ? ? 1.475 1.336 0.139 0.023 Y 
916  10 C  A GLN 73 ? ? N   A PRO 74 ? ? 1.482 1.338 0.144 0.019 Y 
917  10 C  A PRO 74 ? ? N   A ASP 75 ? ? 1.489 1.336 0.153 0.023 Y 
918  10 C  A ASP 75 ? ? N   A LYS 76 ? ? 1.478 1.336 0.142 0.023 Y 
919  10 C  A LYS 76 ? ? N   A ALA 77 ? ? 1.479 1.336 0.143 0.023 Y 
920  10 C  A ALA 77 ? ? N   A ASN 78 ? ? 1.478 1.336 0.142 0.023 Y 
921  10 C  A ASN 78 ? ? N   A PRO 79 ? ? 1.478 1.338 0.140 0.019 Y 
922  10 C  A PRO 79 ? ? N   A ARG 80 ? ? 1.479 1.336 0.143 0.023 Y 
923  10 C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
924  10 C  A GLN 81 ? ? N   A HIS 82 ? ? 1.480 1.336 0.144 0.023 Y 
925  10 C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
926  10 C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
927  10 C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
928  10 C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
929  10 C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
930  10 C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
931  10 C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
932  10 C  A HIS 89 ? ? N   A ALA 90 ? ? 1.480 1.336 0.144 0.023 Y 
933  10 C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
934  10 C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
935  10 C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
936  11 C  A MET 1  ? ? N   A LYS 2  ? ? 1.480 1.336 0.144 0.023 Y 
937  11 C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
938  11 C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
939  11 C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
940  11 C  A THR 5  ? ? N   A CYS 6  ? ? 1.479 1.336 0.143 0.023 Y 
941  11 C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
942  11 C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
943  11 C  A THR 8  ? ? N   A ASP 9  ? ? 1.480 1.336 0.144 0.023 Y 
944  11 C  A ASP 9  ? ? N   A ASP 10 ? ? 1.480 1.336 0.144 0.023 Y 
945  11 C  A ASP 10 ? ? N   A GLN 11 ? ? 1.481 1.336 0.145 0.023 Y 
946  11 C  A GLN 11 ? ? N   A ARG 12 ? ? 1.479 1.336 0.143 0.023 Y 
947  11 C  A ARG 12 ? ? N   A TRP 13 ? ? 1.494 1.336 0.158 0.023 Y 
948  11 C  A TRP 13 ? ? N   A GLN 14 ? ? 1.483 1.336 0.147 0.023 Y 
949  11 C  A GLN 14 ? ? N   A SER 15 ? ? 1.487 1.336 0.151 0.023 Y 
950  11 C  A SER 15 ? ? N   A VAL 16 ? ? 1.495 1.336 0.159 0.023 Y 
951  11 C  A VAL 16 ? ? N   A LEU 17 ? ? 1.477 1.336 0.141 0.023 Y 
952  11 C  A LEU 17 ? ? N   A ALA 18 ? ? 1.489 1.336 0.153 0.023 Y 
953  11 C  A ALA 18 ? ? N   A ARG 19 ? ? 1.480 1.336 0.144 0.023 Y 
954  11 C  A ARG 19 ? ? N   A ASP 20 ? ? 1.478 1.336 0.142 0.023 Y 
955  11 C  A ASP 20 ? ? N   A PRO 21 ? ? 1.477 1.338 0.139 0.019 Y 
956  11 C  A PRO 21 ? ? N   A ASN 22 ? ? 1.474 1.336 0.138 0.023 Y 
957  11 C  A ASN 22 ? ? N   A ALA 23 ? ? 1.483 1.336 0.147 0.023 Y 
958  11 C  A ALA 23 ? ? N   A ASP 24 ? ? 1.478 1.336 0.142 0.023 Y 
959  11 C  A ASP 24 ? ? N   A GLY 25 ? ? 1.483 1.336 0.147 0.023 Y 
960  11 CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
961  11 C  A GLU 26 ? ? N   A PHE 27 ? ? 1.492 1.336 0.156 0.023 Y 
962  11 C  A PHE 27 ? ? N   A VAL 28 ? ? 1.488 1.336 0.152 0.023 Y 
963  11 C  A VAL 28 ? ? N   A PHE 29 ? ? 1.476 1.336 0.140 0.023 Y 
964  11 C  A PHE 29 ? ? N   A ALA 30 ? ? 1.477 1.336 0.141 0.023 Y 
965  11 C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
966  11 C  A VAL 31 ? ? N   A ARG 32 ? ? 1.483 1.336 0.147 0.023 Y 
967  11 C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
968  11 C  A THR 33 ? ? N   A THR 34 ? ? 1.479 1.336 0.143 0.023 Y 
969  11 C  A THR 34 ? ? N   A GLY 35 ? ? 1.480 1.336 0.144 0.023 Y 
970  11 C  A GLY 35 ? ? N   A ILE 36 ? ? 1.480 1.336 0.144 0.023 Y 
971  11 C  A ILE 36 ? ? N   A PHE 37 ? ? 1.478 1.336 0.142 0.023 Y 
972  11 C  A PHE 37 ? ? N   A CYS 38 ? ? 1.476 1.336 0.140 0.023 Y 
973  11 C  A CYS 38 ? ? N   A ARG 39 ? ? 1.475 1.336 0.139 0.023 Y 
974  11 C  A ARG 39 ? ? N   A PRO 40 ? ? 1.470 1.338 0.132 0.019 Y 
975  11 C  A PRO 40 ? ? N   A SER 41 ? ? 1.487 1.336 0.151 0.023 Y 
976  11 C  A SER 41 ? ? N   A CYS 42 ? ? 1.482 1.336 0.146 0.023 Y 
977  11 C  A CYS 42 ? ? N   A ARG 43 ? ? 1.487 1.336 0.151 0.023 Y 
978  11 C  A ARG 43 ? ? N   A ALA 44 ? ? 1.477 1.336 0.141 0.023 Y 
979  11 C  A ALA 44 ? ? N   A ARG 45 ? ? 1.488 1.336 0.152 0.023 Y 
980  11 C  A ARG 45 ? ? N   A HIS 46 ? ? 1.478 1.336 0.142 0.023 Y 
981  11 C  A HIS 46 ? ? N   A ALA 47 ? ? 1.480 1.336 0.144 0.023 Y 
982  11 C  A ALA 47 ? ? N   A LEU 48 ? ? 1.478 1.336 0.142 0.023 Y 
983  11 C  A LEU 48 ? ? N   A ARG 49 ? ? 1.478 1.336 0.142 0.023 Y 
984  11 C  A ARG 49 ? ? N   A GLU 50 ? ? 1.478 1.336 0.142 0.023 Y 
985  11 CD A GLU 50 ? ? OE1 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
986  11 C  A ASN 51 ? ? N   A VAL 52 ? ? 1.480 1.336 0.144 0.023 Y 
987  11 C  A VAL 52 ? ? N   A SER 53 ? ? 1.477 1.336 0.141 0.023 Y 
988  11 C  A SER 53 ? ? N   A PHE 54 ? ? 1.488 1.336 0.152 0.023 Y 
989  11 C  A PHE 54 ? ? N   A TYR 55 ? ? 1.482 1.336 0.146 0.023 Y 
990  11 C  A TYR 55 ? ? N   A ALA 56 ? ? 1.479 1.336 0.143 0.023 Y 
991  11 C  A ALA 56 ? ? N   A ASN 57 ? ? 1.480 1.336 0.144 0.023 Y 
992  11 C  A ASN 57 ? ? N   A ALA 58 ? ? 1.481 1.336 0.145 0.023 Y 
993  11 C  A ALA 58 ? ? N   A SER 59 ? ? 1.478 1.336 0.142 0.023 Y 
994  11 C  A SER 59 ? ? N   A GLU 60 ? ? 1.479 1.336 0.143 0.023 Y 
995  11 CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.363 1.252 0.111 0.011 N 
996  11 C  A GLU 60 ? ? N   A ALA 61 ? ? 1.480 1.336 0.144 0.023 Y 
997  11 C  A ALA 61 ? ? N   A LEU 62 ? ? 1.478 1.336 0.142 0.023 Y 
998  11 C  A LEU 62 ? ? N   A ALA 63 ? ? 1.479 1.336 0.143 0.023 Y 
999  11 C  A ALA 63 ? ? N   A ALA 64 ? ? 1.480 1.336 0.144 0.023 Y 
1000 11 C  A ALA 64 ? ? N   A GLY 65 ? ? 1.484 1.336 0.148 0.023 Y 
1001 11 C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
1002 11 C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
1003 11 C  A ARG 67 ? ? N   A PRO 68 ? ? 1.483 1.338 0.145 0.019 Y 
1004 11 C  A PRO 68 ? ? N   A CYS 69 ? ? 1.478 1.336 0.142 0.023 Y 
1005 11 C  A CYS 69 ? ? N   A LYS 70 ? ? 1.498 1.336 0.162 0.023 Y 
1006 11 C  A LYS 70 ? ? N   A ARG 71 ? ? 1.479 1.336 0.143 0.023 Y 
1007 11 C  A ARG 71 ? ? N   A CYS 72 ? ? 1.478 1.336 0.142 0.023 Y 
1008 11 C  A CYS 72 ? ? N   A GLN 73 ? ? 1.477 1.336 0.141 0.023 Y 
1009 11 C  A GLN 73 ? ? N   A PRO 74 ? ? 1.475 1.338 0.137 0.019 Y 
1010 11 C  A PRO 74 ? ? N   A ASP 75 ? ? 1.480 1.336 0.144 0.023 Y 
1011 11 C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
1012 11 C  A ALA 77 ? ? N   A ASN 78 ? ? 1.478 1.336 0.142 0.023 Y 
1013 11 C  A ASN 78 ? ? N   A PRO 79 ? ? 1.478 1.338 0.140 0.019 Y 
1014 11 C  A PRO 79 ? ? N   A ARG 80 ? ? 1.478 1.336 0.142 0.023 Y 
1015 11 C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
1016 11 C  A GLN 81 ? ? N   A HIS 82 ? ? 1.478 1.336 0.142 0.023 Y 
1017 11 C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
1018 11 C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
1019 11 C  A LEU 84 ? ? N   A ASP 85 ? ? 1.478 1.336 0.142 0.023 Y 
1020 11 C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
1021 11 C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
1022 11 C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
1023 11 C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
1024 11 C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
1025 11 C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
1026 11 C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
1027 11 C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
1028 12 C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
1029 12 C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
1030 12 C  A LYS 3  ? ? N   A ALA 4  ? ? 1.480 1.336 0.144 0.023 Y 
1031 12 C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
1032 12 C  A THR 5  ? ? N   A CYS 6  ? ? 1.482 1.336 0.146 0.023 Y 
1033 12 C  A CYS 6  ? ? N   A LEU 7  ? ? 1.482 1.336 0.146 0.023 Y 
1034 12 C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
1035 12 C  A THR 8  ? ? N   A ASP 9  ? ? 1.480 1.336 0.144 0.023 Y 
1036 12 C  A ASP 9  ? ? N   A ASP 10 ? ? 1.479 1.336 0.143 0.023 Y 
1037 12 C  A ASP 10 ? ? N   A GLN 11 ? ? 1.481 1.336 0.145 0.023 Y 
1038 12 C  A GLN 11 ? ? N   A ARG 12 ? ? 1.480 1.336 0.144 0.023 Y 
1039 12 C  A ARG 12 ? ? N   A TRP 13 ? ? 1.486 1.336 0.150 0.023 Y 
1040 12 C  A TRP 13 ? ? N   A GLN 14 ? ? 1.483 1.336 0.147 0.023 Y 
1041 12 C  A GLN 14 ? ? N   A SER 15 ? ? 1.481 1.336 0.145 0.023 Y 
1042 12 C  A SER 15 ? ? N   A VAL 16 ? ? 1.489 1.336 0.153 0.023 Y 
1043 12 C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
1044 12 C  A LEU 17 ? ? N   A ALA 18 ? ? 1.485 1.336 0.149 0.023 Y 
1045 12 C  A ALA 18 ? ? N   A ARG 19 ? ? 1.477 1.336 0.141 0.023 Y 
1046 12 C  A ARG 19 ? ? N   A ASP 20 ? ? 1.484 1.336 0.148 0.023 Y 
1047 12 C  A ASP 20 ? ? N   A PRO 21 ? ? 1.478 1.338 0.140 0.019 Y 
1048 12 C  A PRO 21 ? ? N   A ASN 22 ? ? 1.478 1.336 0.142 0.023 Y 
1049 12 C  A ASN 22 ? ? N   A ALA 23 ? ? 1.480 1.336 0.144 0.023 Y 
1050 12 C  A ALA 23 ? ? N   A ASP 24 ? ? 1.478 1.336 0.142 0.023 Y 
1051 12 C  A ASP 24 ? ? N   A GLY 25 ? ? 1.481 1.336 0.145 0.023 Y 
1052 12 C  A GLY 25 ? ? N   A GLU 26 ? ? 1.478 1.336 0.142 0.023 Y 
1053 12 CD A GLU 26 ? ? OE2 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
1054 12 C  A GLU 26 ? ? N   A PHE 27 ? ? 1.480 1.336 0.144 0.023 Y 
1055 12 C  A PHE 27 ? ? N   A VAL 28 ? ? 1.483 1.336 0.147 0.023 Y 
1056 12 C  A VAL 28 ? ? N   A PHE 29 ? ? 1.481 1.336 0.145 0.023 Y 
1057 12 C  A PHE 29 ? ? N   A ALA 30 ? ? 1.478 1.336 0.142 0.023 Y 
1058 12 C  A ALA 30 ? ? N   A VAL 31 ? ? 1.481 1.336 0.145 0.023 Y 
1059 12 C  A VAL 31 ? ? N   A ARG 32 ? ? 1.479 1.336 0.143 0.023 Y 
1060 12 C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
1061 12 C  A THR 33 ? ? N   A THR 34 ? ? 1.481 1.336 0.145 0.023 Y 
1062 12 C  A THR 34 ? ? N   A GLY 35 ? ? 1.480 1.336 0.144 0.023 Y 
1063 12 C  A GLY 35 ? ? N   A ILE 36 ? ? 1.480 1.336 0.144 0.023 Y 
1064 12 C  A ILE 36 ? ? N   A PHE 37 ? ? 1.478 1.336 0.142 0.023 Y 
1065 12 C  A PHE 37 ? ? N   A CYS 38 ? ? 1.477 1.336 0.141 0.023 Y 
1066 12 C  A CYS 38 ? ? N   A ARG 39 ? ? 1.475 1.336 0.139 0.023 Y 
1067 12 C  A ARG 39 ? ? N   A PRO 40 ? ? 1.471 1.338 0.133 0.019 Y 
1068 12 C  A PRO 40 ? ? N   A SER 41 ? ? 1.484 1.336 0.148 0.023 Y 
1069 12 C  A SER 41 ? ? N   A CYS 42 ? ? 1.478 1.336 0.142 0.023 Y 
1070 12 C  A CYS 42 ? ? N   A ARG 43 ? ? 1.478 1.336 0.142 0.023 Y 
1071 12 C  A ARG 43 ? ? N   A ALA 44 ? ? 1.477 1.336 0.141 0.023 Y 
1072 12 C  A ALA 44 ? ? N   A ARG 45 ? ? 1.487 1.336 0.151 0.023 Y 
1073 12 C  A ARG 45 ? ? N   A HIS 46 ? ? 1.479 1.336 0.143 0.023 Y 
1074 12 C  A HIS 46 ? ? N   A ALA 47 ? ? 1.481 1.336 0.145 0.023 Y 
1075 12 C  A ALA 47 ? ? N   A LEU 48 ? ? 1.480 1.336 0.144 0.023 Y 
1076 12 C  A LEU 48 ? ? N   A ARG 49 ? ? 1.479 1.336 0.143 0.023 Y 
1077 12 C  A ARG 49 ? ? N   A GLU 50 ? ? 1.478 1.336 0.142 0.023 Y 
1078 12 CD A GLU 50 ? ? OE1 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
1079 12 C  A ASN 51 ? ? N   A VAL 52 ? ? 1.479 1.336 0.143 0.023 Y 
1080 12 C  A VAL 52 ? ? N   A SER 53 ? ? 1.477 1.336 0.141 0.023 Y 
1081 12 C  A SER 53 ? ? N   A PHE 54 ? ? 1.483 1.336 0.147 0.023 Y 
1082 12 C  A PHE 54 ? ? N   A TYR 55 ? ? 1.477 1.336 0.141 0.023 Y 
1083 12 C  A TYR 55 ? ? N   A ALA 56 ? ? 1.480 1.336 0.144 0.023 Y 
1084 12 C  A ALA 56 ? ? N   A ASN 57 ? ? 1.480 1.336 0.144 0.023 Y 
1085 12 C  A ASN 57 ? ? N   A ALA 58 ? ? 1.483 1.336 0.147 0.023 Y 
1086 12 C  A ALA 58 ? ? N   A SER 59 ? ? 1.478 1.336 0.142 0.023 Y 
1087 12 C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
1088 12 CD A GLU 60 ? ? OE1 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
1089 12 C  A GLU 60 ? ? N   A ALA 61 ? ? 1.481 1.336 0.145 0.023 Y 
1090 12 C  A ALA 61 ? ? N   A LEU 62 ? ? 1.477 1.336 0.141 0.023 Y 
1091 12 C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
1092 12 C  A ALA 63 ? ? N   A ALA 64 ? ? 1.481 1.336 0.145 0.023 Y 
1093 12 C  A ALA 64 ? ? N   A GLY 65 ? ? 1.485 1.336 0.149 0.023 Y 
1094 12 C  A GLY 65 ? ? N   A PHE 66 ? ? 1.479 1.336 0.143 0.023 Y 
1095 12 C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
1096 12 C  A ARG 67 ? ? N   A PRO 68 ? ? 1.480 1.338 0.142 0.019 Y 
1097 12 C  A PRO 68 ? ? N   A CYS 69 ? ? 1.477 1.336 0.141 0.023 Y 
1098 12 C  A CYS 69 ? ? N   A LYS 70 ? ? 1.495 1.336 0.159 0.023 Y 
1099 12 C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
1100 12 C  A ARG 71 ? ? N   A CYS 72 ? ? 1.480 1.336 0.144 0.023 Y 
1101 12 C  A GLN 73 ? ? N   A PRO 74 ? ? 1.483 1.338 0.145 0.019 Y 
1102 12 C  A PRO 74 ? ? N   A ASP 75 ? ? 1.478 1.336 0.142 0.023 Y 
1103 12 C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
1104 12 C  A LYS 76 ? ? N   A ALA 77 ? ? 1.476 1.336 0.140 0.023 Y 
1105 12 C  A ALA 77 ? ? N   A ASN 78 ? ? 1.490 1.336 0.154 0.023 Y 
1106 12 C  A ASN 78 ? ? N   A PRO 79 ? ? 1.476 1.338 0.138 0.019 Y 
1107 12 C  A PRO 79 ? ? N   A ARG 80 ? ? 1.477 1.336 0.141 0.023 Y 
1108 12 C  A ARG 80 ? ? N   A GLN 81 ? ? 1.478 1.336 0.142 0.023 Y 
1109 12 C  A GLN 81 ? ? N   A HIS 82 ? ? 1.479 1.336 0.143 0.023 Y 
1110 12 C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
1111 12 C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
1112 12 C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
1113 12 C  A ASP 85 ? ? N   A LYS 86 ? ? 1.478 1.336 0.142 0.023 Y 
1114 12 C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
1115 12 C  A ILE 87 ? ? N   A THR 88 ? ? 1.479 1.336 0.143 0.023 Y 
1116 12 C  A THR 88 ? ? N   A HIS 89 ? ? 1.480 1.336 0.144 0.023 Y 
1117 12 C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
1118 12 C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
1119 12 C  A CYS 91 ? ? N   A ARG 92 ? ? 1.478 1.336 0.142 0.023 Y 
1120 12 C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
1121 13 C  A MET 1  ? ? N   A LYS 2  ? ? 1.479 1.336 0.143 0.023 Y 
1122 13 C  A LYS 2  ? ? N   A LYS 3  ? ? 1.479 1.336 0.143 0.023 Y 
1123 13 C  A LYS 3  ? ? N   A ALA 4  ? ? 1.478 1.336 0.142 0.023 Y 
1124 13 C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
1125 13 C  A THR 5  ? ? N   A CYS 6  ? ? 1.478 1.336 0.142 0.023 Y 
1126 13 C  A CYS 6  ? ? N   A LEU 7  ? ? 1.478 1.336 0.142 0.023 Y 
1127 13 C  A LEU 7  ? ? N   A THR 8  ? ? 1.478 1.336 0.142 0.023 Y 
1128 13 C  A THR 8  ? ? N   A ASP 9  ? ? 1.479 1.336 0.143 0.023 Y 
1129 13 C  A ASP 9  ? ? N   A ASP 10 ? ? 1.479 1.336 0.143 0.023 Y 
1130 13 C  A ASP 10 ? ? N   A GLN 11 ? ? 1.480 1.336 0.144 0.023 Y 
1131 13 C  A GLN 11 ? ? N   A ARG 12 ? ? 1.480 1.336 0.144 0.023 Y 
1132 13 C  A ARG 12 ? ? N   A TRP 13 ? ? 1.482 1.336 0.146 0.023 Y 
1133 13 C  A TRP 13 ? ? N   A GLN 14 ? ? 1.481 1.336 0.145 0.023 Y 
1134 13 C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
1135 13 C  A SER 15 ? ? N   A VAL 16 ? ? 1.492 1.336 0.156 0.023 Y 
1136 13 C  A VAL 16 ? ? N   A LEU 17 ? ? 1.476 1.336 0.140 0.023 Y 
1137 13 C  A LEU 17 ? ? N   A ALA 18 ? ? 1.489 1.336 0.153 0.023 Y 
1138 13 C  A ALA 18 ? ? N   A ARG 19 ? ? 1.475 1.336 0.139 0.023 Y 
1139 13 C  A ARG 19 ? ? N   A ASP 20 ? ? 1.493 1.336 0.157 0.023 Y 
1140 13 C  A ASP 20 ? ? N   A PRO 21 ? ? 1.479 1.338 0.141 0.019 Y 
1141 13 C  A PRO 21 ? ? N   A ASN 22 ? ? 1.475 1.336 0.139 0.023 Y 
1142 13 C  A ASN 22 ? ? N   A ALA 23 ? ? 1.483 1.336 0.147 0.023 Y 
1143 13 C  A ALA 23 ? ? N   A ASP 24 ? ? 1.479 1.336 0.143 0.023 Y 
1144 13 C  A ASP 24 ? ? N   A GLY 25 ? ? 1.480 1.336 0.144 0.023 Y 
1145 13 CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.363 1.252 0.111 0.011 N 
1146 13 C  A GLU 26 ? ? N   A PHE 27 ? ? 1.485 1.336 0.149 0.023 Y 
1147 13 C  A PHE 27 ? ? N   A VAL 28 ? ? 1.487 1.336 0.151 0.023 Y 
1148 13 C  A VAL 28 ? ? N   A PHE 29 ? ? 1.479 1.336 0.143 0.023 Y 
1149 13 C  A PHE 29 ? ? N   A ALA 30 ? ? 1.479 1.336 0.143 0.023 Y 
1150 13 C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
1151 13 C  A VAL 31 ? ? N   A ARG 32 ? ? 1.481 1.336 0.145 0.023 Y 
1152 13 C  A ARG 32 ? ? N   A THR 33 ? ? 1.477 1.336 0.141 0.023 Y 
1153 13 C  A THR 33 ? ? N   A THR 34 ? ? 1.480 1.336 0.144 0.023 Y 
1154 13 C  A THR 34 ? ? N   A GLY 35 ? ? 1.479 1.336 0.143 0.023 Y 
1155 13 C  A GLY 35 ? ? N   A ILE 36 ? ? 1.478 1.336 0.142 0.023 Y 
1156 13 C  A ILE 36 ? ? N   A PHE 37 ? ? 1.478 1.336 0.142 0.023 Y 
1157 13 C  A PHE 37 ? ? N   A CYS 38 ? ? 1.478 1.336 0.142 0.023 Y 
1158 13 C  A CYS 38 ? ? N   A ARG 39 ? ? 1.477 1.336 0.141 0.023 Y 
1159 13 C  A ARG 39 ? ? N   A PRO 40 ? ? 1.474 1.338 0.136 0.019 Y 
1160 13 C  A PRO 40 ? ? N   A SER 41 ? ? 1.478 1.336 0.142 0.023 Y 
1161 13 C  A SER 41 ? ? N   A CYS 42 ? ? 1.490 1.336 0.154 0.023 Y 
1162 13 C  A CYS 42 ? ? N   A ARG 43 ? ? 1.475 1.336 0.139 0.023 Y 
1163 13 C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
1164 13 C  A ALA 44 ? ? N   A ARG 45 ? ? 1.486 1.336 0.150 0.023 Y 
1165 13 C  A ARG 45 ? ? N   A HIS 46 ? ? 1.479 1.336 0.143 0.023 Y 
1166 13 C  A HIS 46 ? ? N   A ALA 47 ? ? 1.481 1.336 0.145 0.023 Y 
1167 13 C  A ALA 47 ? ? N   A LEU 48 ? ? 1.481 1.336 0.145 0.023 Y 
1168 13 C  A LEU 48 ? ? N   A ARG 49 ? ? 1.480 1.336 0.144 0.023 Y 
1169 13 C  A ARG 49 ? ? N   A GLU 50 ? ? 1.479 1.336 0.143 0.023 Y 
1170 13 CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
1171 13 C  A ASN 51 ? ? N   A VAL 52 ? ? 1.478 1.336 0.142 0.023 Y 
1172 13 C  A VAL 52 ? ? N   A SER 53 ? ? 1.479 1.336 0.143 0.023 Y 
1173 13 C  A SER 53 ? ? N   A PHE 54 ? ? 1.482 1.336 0.146 0.023 Y 
1174 13 C  A PHE 54 ? ? N   A TYR 55 ? ? 1.481 1.336 0.145 0.023 Y 
1175 13 C  A TYR 55 ? ? N   A ALA 56 ? ? 1.479 1.336 0.143 0.023 Y 
1176 13 C  A ALA 56 ? ? N   A ASN 57 ? ? 1.479 1.336 0.143 0.023 Y 
1177 13 C  A ASN 57 ? ? N   A ALA 58 ? ? 1.482 1.336 0.146 0.023 Y 
1178 13 C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
1179 13 C  A SER 59 ? ? N   A GLU 60 ? ? 1.479 1.336 0.143 0.023 Y 
1180 13 CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
1181 13 C  A GLU 60 ? ? N   A ALA 61 ? ? 1.480 1.336 0.144 0.023 Y 
1182 13 C  A ALA 61 ? ? N   A LEU 62 ? ? 1.479 1.336 0.143 0.023 Y 
1183 13 C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
1184 13 C  A ALA 63 ? ? N   A ALA 64 ? ? 1.483 1.336 0.147 0.023 Y 
1185 13 C  A ALA 64 ? ? N   A GLY 65 ? ? 1.483 1.336 0.147 0.023 Y 
1186 13 C  A GLY 65 ? ? N   A PHE 66 ? ? 1.480 1.336 0.144 0.023 Y 
1187 13 C  A PHE 66 ? ? N   A ARG 67 ? ? 1.478 1.336 0.142 0.023 Y 
1188 13 C  A ARG 67 ? ? N   A PRO 68 ? ? 1.485 1.338 0.147 0.019 Y 
1189 13 C  A PRO 68 ? ? N   A CYS 69 ? ? 1.478 1.336 0.142 0.023 Y 
1190 13 C  A CYS 69 ? ? N   A LYS 70 ? ? 1.499 1.336 0.163 0.023 Y 
1191 13 C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
1192 13 C  A ARG 71 ? ? N   A CYS 72 ? ? 1.479 1.336 0.143 0.023 Y 
1193 13 C  A CYS 72 ? ? N   A GLN 73 ? ? 1.474 1.336 0.138 0.023 Y 
1194 13 C  A GLN 73 ? ? N   A PRO 74 ? ? 1.484 1.338 0.146 0.019 Y 
1195 13 C  A PRO 74 ? ? N   A ASP 75 ? ? 1.484 1.336 0.148 0.023 Y 
1196 13 C  A ASP 75 ? ? N   A LYS 76 ? ? 1.481 1.336 0.145 0.023 Y 
1197 13 C  A LYS 76 ? ? N   A ALA 77 ? ? 1.476 1.336 0.140 0.023 Y 
1198 13 C  A ALA 77 ? ? N   A ASN 78 ? ? 1.477 1.336 0.141 0.023 Y 
1199 13 C  A ASN 78 ? ? N   A PRO 79 ? ? 1.480 1.338 0.142 0.019 Y 
1200 13 C  A PRO 79 ? ? N   A ARG 80 ? ? 1.478 1.336 0.142 0.023 Y 
1201 13 C  A ARG 80 ? ? N   A GLN 81 ? ? 1.479 1.336 0.143 0.023 Y 
1202 13 C  A GLN 81 ? ? N   A HIS 82 ? ? 1.479 1.336 0.143 0.023 Y 
1203 13 C  A HIS 82 ? ? N   A ARG 83 ? ? 1.479 1.336 0.143 0.023 Y 
1204 13 C  A ARG 83 ? ? N   A LEU 84 ? ? 1.479 1.336 0.143 0.023 Y 
1205 13 C  A LEU 84 ? ? N   A ASP 85 ? ? 1.478 1.336 0.142 0.023 Y 
1206 13 C  A ASP 85 ? ? N   A LYS 86 ? ? 1.479 1.336 0.143 0.023 Y 
1207 13 C  A LYS 86 ? ? N   A ILE 87 ? ? 1.479 1.336 0.143 0.023 Y 
1208 13 C  A ILE 87 ? ? N   A THR 88 ? ? 1.478 1.336 0.142 0.023 Y 
1209 13 C  A THR 88 ? ? N   A HIS 89 ? ? 1.478 1.336 0.142 0.023 Y 
1210 13 C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
1211 13 C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
1212 13 C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
1213 13 C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
1214 14 C  A MET 1  ? ? N   A LYS 2  ? ? 1.480 1.336 0.144 0.023 Y 
1215 14 C  A LYS 2  ? ? N   A LYS 3  ? ? 1.480 1.336 0.144 0.023 Y 
1216 14 C  A LYS 3  ? ? N   A ALA 4  ? ? 1.479 1.336 0.143 0.023 Y 
1217 14 C  A ALA 4  ? ? N   A THR 5  ? ? 1.479 1.336 0.143 0.023 Y 
1218 14 C  A THR 5  ? ? N   A CYS 6  ? ? 1.478 1.336 0.142 0.023 Y 
1219 14 C  A CYS 6  ? ? N   A LEU 7  ? ? 1.479 1.336 0.143 0.023 Y 
1220 14 C  A LEU 7  ? ? N   A THR 8  ? ? 1.479 1.336 0.143 0.023 Y 
1221 14 C  A THR 8  ? ? N   A ASP 9  ? ? 1.480 1.336 0.144 0.023 Y 
1222 14 C  A ASP 9  ? ? N   A ASP 10 ? ? 1.478 1.336 0.142 0.023 Y 
1223 14 C  A ASP 10 ? ? N   A GLN 11 ? ? 1.478 1.336 0.142 0.023 Y 
1224 14 C  A GLN 11 ? ? N   A ARG 12 ? ? 1.482 1.336 0.146 0.023 Y 
1225 14 C  A ARG 12 ? ? N   A TRP 13 ? ? 1.481 1.336 0.145 0.023 Y 
1226 14 C  A TRP 13 ? ? N   A GLN 14 ? ? 1.480 1.336 0.144 0.023 Y 
1227 14 C  A GLN 14 ? ? N   A SER 15 ? ? 1.483 1.336 0.147 0.023 Y 
1228 14 C  A SER 15 ? ? N   A VAL 16 ? ? 1.489 1.336 0.153 0.023 Y 
1229 14 C  A VAL 16 ? ? N   A LEU 17 ? ? 1.475 1.336 0.139 0.023 Y 
1230 14 C  A LEU 17 ? ? N   A ALA 18 ? ? 1.484 1.336 0.148 0.023 Y 
1231 14 C  A ALA 18 ? ? N   A ARG 19 ? ? 1.480 1.336 0.144 0.023 Y 
1232 14 C  A ARG 19 ? ? N   A ASP 20 ? ? 1.479 1.336 0.143 0.023 Y 
1233 14 C  A ASP 20 ? ? N   A PRO 21 ? ? 1.478 1.338 0.140 0.019 Y 
1234 14 C  A PRO 21 ? ? N   A ASN 22 ? ? 1.480 1.336 0.144 0.023 Y 
1235 14 C  A ASN 22 ? ? N   A ALA 23 ? ? 1.481 1.336 0.145 0.023 Y 
1236 14 C  A ALA 23 ? ? N   A ASP 24 ? ? 1.479 1.336 0.143 0.023 Y 
1237 14 C  A ASP 24 ? ? N   A GLY 25 ? ? 1.482 1.336 0.146 0.023 Y 
1238 14 C  A GLY 25 ? ? N   A GLU 26 ? ? 1.479 1.336 0.143 0.023 Y 
1239 14 CD A GLU 26 ? ? OE1 A GLU 26 ? ? 1.362 1.252 0.110 0.011 N 
1240 14 C  A GLU 26 ? ? N   A PHE 27 ? ? 1.482 1.336 0.146 0.023 Y 
1241 14 C  A PHE 27 ? ? N   A VAL 28 ? ? 1.481 1.336 0.145 0.023 Y 
1242 14 C  A VAL 28 ? ? N   A PHE 29 ? ? 1.477 1.336 0.141 0.023 Y 
1243 14 C  A PHE 29 ? ? N   A ALA 30 ? ? 1.478 1.336 0.142 0.023 Y 
1244 14 C  A ALA 30 ? ? N   A VAL 31 ? ? 1.479 1.336 0.143 0.023 Y 
1245 14 C  A VAL 31 ? ? N   A ARG 32 ? ? 1.481 1.336 0.145 0.023 Y 
1246 14 C  A ARG 32 ? ? N   A THR 33 ? ? 1.478 1.336 0.142 0.023 Y 
1247 14 C  A THR 33 ? ? N   A THR 34 ? ? 1.479 1.336 0.143 0.023 Y 
1248 14 C  A THR 34 ? ? N   A GLY 35 ? ? 1.482 1.336 0.146 0.023 Y 
1249 14 C  A GLY 35 ? ? N   A ILE 36 ? ? 1.481 1.336 0.145 0.023 Y 
1250 14 C  A ILE 36 ? ? N   A PHE 37 ? ? 1.480 1.336 0.144 0.023 Y 
1251 14 C  A PHE 37 ? ? N   A CYS 38 ? ? 1.478 1.336 0.142 0.023 Y 
1252 14 C  A CYS 38 ? ? N   A ARG 39 ? ? 1.475 1.336 0.139 0.023 Y 
1253 14 C  A ARG 39 ? ? N   A PRO 40 ? ? 1.469 1.338 0.131 0.019 Y 
1254 14 C  A PRO 40 ? ? N   A SER 41 ? ? 1.487 1.336 0.151 0.023 Y 
1255 14 C  A SER 41 ? ? N   A CYS 42 ? ? 1.491 1.336 0.155 0.023 Y 
1256 14 C  A CYS 42 ? ? N   A ARG 43 ? ? 1.477 1.336 0.141 0.023 Y 
1257 14 C  A ARG 43 ? ? N   A ALA 44 ? ? 1.478 1.336 0.142 0.023 Y 
1258 14 C  A ALA 44 ? ? N   A ARG 45 ? ? 1.488 1.336 0.152 0.023 Y 
1259 14 C  A ARG 45 ? ? N   A HIS 46 ? ? 1.479 1.336 0.143 0.023 Y 
1260 14 C  A HIS 46 ? ? N   A ALA 47 ? ? 1.481 1.336 0.145 0.023 Y 
1261 14 C  A ALA 47 ? ? N   A LEU 48 ? ? 1.479 1.336 0.143 0.023 Y 
1262 14 C  A LEU 48 ? ? N   A ARG 49 ? ? 1.482 1.336 0.146 0.023 Y 
1263 14 C  A ARG 49 ? ? N   A GLU 50 ? ? 1.482 1.336 0.146 0.023 Y 
1264 14 CD A GLU 50 ? ? OE2 A GLU 50 ? ? 1.362 1.252 0.110 0.011 N 
1265 14 C  A ASN 51 ? ? N   A VAL 52 ? ? 1.496 1.336 0.160 0.023 Y 
1266 14 C  A VAL 52 ? ? N   A SER 53 ? ? 1.476 1.336 0.140 0.023 Y 
1267 14 C  A SER 53 ? ? N   A PHE 54 ? ? 1.484 1.336 0.148 0.023 Y 
1268 14 C  A PHE 54 ? ? N   A TYR 55 ? ? 1.488 1.336 0.152 0.023 Y 
1269 14 C  A TYR 55 ? ? N   A ALA 56 ? ? 1.484 1.336 0.148 0.023 Y 
1270 14 C  A ALA 56 ? ? N   A ASN 57 ? ? 1.478 1.336 0.142 0.023 Y 
1271 14 C  A ASN 57 ? ? N   A ALA 58 ? ? 1.483 1.336 0.147 0.023 Y 
1272 14 C  A ALA 58 ? ? N   A SER 59 ? ? 1.479 1.336 0.143 0.023 Y 
1273 14 C  A SER 59 ? ? N   A GLU 60 ? ? 1.480 1.336 0.144 0.023 Y 
1274 14 CD A GLU 60 ? ? OE2 A GLU 60 ? ? 1.362 1.252 0.110 0.011 N 
1275 14 C  A GLU 60 ? ? N   A ALA 61 ? ? 1.480 1.336 0.144 0.023 Y 
1276 14 C  A ALA 61 ? ? N   A LEU 62 ? ? 1.477 1.336 0.141 0.023 Y 
1277 14 C  A LEU 62 ? ? N   A ALA 63 ? ? 1.478 1.336 0.142 0.023 Y 
1278 14 C  A ALA 63 ? ? N   A ALA 64 ? ? 1.480 1.336 0.144 0.023 Y 
1279 14 C  A ALA 64 ? ? N   A GLY 65 ? ? 1.483 1.336 0.147 0.023 Y 
1280 14 C  A GLY 65 ? ? N   A PHE 66 ? ? 1.481 1.336 0.145 0.023 Y 
1281 14 C  A PHE 66 ? ? N   A ARG 67 ? ? 1.479 1.336 0.143 0.023 Y 
1282 14 C  A ARG 67 ? ? N   A PRO 68 ? ? 1.481 1.338 0.143 0.019 Y 
1283 14 C  A PRO 68 ? ? N   A CYS 69 ? ? 1.478 1.336 0.142 0.023 Y 
1284 14 C  A CYS 69 ? ? N   A LYS 70 ? ? 1.497 1.336 0.161 0.023 Y 
1285 14 C  A LYS 70 ? ? N   A ARG 71 ? ? 1.477 1.336 0.141 0.023 Y 
1286 14 C  A ARG 71 ? ? N   A CYS 72 ? ? 1.479 1.336 0.143 0.023 Y 
1287 14 C  A GLN 73 ? ? N   A PRO 74 ? ? 1.481 1.338 0.143 0.019 Y 
1288 14 C  A PRO 74 ? ? N   A ASP 75 ? ? 1.495 1.336 0.159 0.023 Y 
1289 14 C  A ASP 75 ? ? N   A LYS 76 ? ? 1.479 1.336 0.143 0.023 Y 
1290 14 C  A LYS 76 ? ? N   A ALA 77 ? ? 1.475 1.336 0.139 0.023 Y 
1291 14 C  A ALA 77 ? ? N   A ASN 78 ? ? 1.478 1.336 0.142 0.023 Y 
1292 14 C  A ASN 78 ? ? N   A PRO 79 ? ? 1.479 1.338 0.141 0.019 Y 
1293 14 C  A PRO 79 ? ? N   A ARG 80 ? ? 1.480 1.336 0.144 0.023 Y 
1294 14 C  A ARG 80 ? ? N   A GLN 81 ? ? 1.478 1.336 0.142 0.023 Y 
1295 14 C  A GLN 81 ? ? N   A HIS 82 ? ? 1.480 1.336 0.144 0.023 Y 
1296 14 C  A HIS 82 ? ? N   A ARG 83 ? ? 1.478 1.336 0.142 0.023 Y 
1297 14 C  A ARG 83 ? ? N   A LEU 84 ? ? 1.478 1.336 0.142 0.023 Y 
1298 14 C  A LEU 84 ? ? N   A ASP 85 ? ? 1.479 1.336 0.143 0.023 Y 
1299 14 C  A ASP 85 ? ? N   A LYS 86 ? ? 1.480 1.336 0.144 0.023 Y 
1300 14 C  A LYS 86 ? ? N   A ILE 87 ? ? 1.480 1.336 0.144 0.023 Y 
1301 14 C  A ILE 87 ? ? N   A THR 88 ? ? 1.478 1.336 0.142 0.023 Y 
1302 14 C  A THR 88 ? ? N   A HIS 89 ? ? 1.479 1.336 0.143 0.023 Y 
1303 14 C  A HIS 89 ? ? N   A ALA 90 ? ? 1.479 1.336 0.143 0.023 Y 
1304 14 C  A ALA 90 ? ? N   A CYS 91 ? ? 1.479 1.336 0.143 0.023 Y 
1305 14 C  A CYS 91 ? ? N   A ARG 92 ? ? 1.479 1.336 0.143 0.023 Y 
1306 14 C  A ARG 92 ? ? OXT A ARG 92 ? ? 1.430 1.229 0.201 0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.86 118.30 -5.44 0.90 N 
2   1  CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.76 118.30 -5.54 0.90 N 
3   1  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.34 120.30 4.04  0.50 N 
4   1  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.28 120.30 3.98  0.50 N 
5   1  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.86 118.30 -5.44 0.90 N 
6   1  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.35 120.30 4.05  0.50 N 
7   1  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.38 120.30 4.08  0.50 N 
8   1  C  A ARG 39 ? ? N  A PRO 40 ? ? CA  A PRO 40 ? ? 129.50 119.30 10.20 1.50 Y 
9   1  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.34 120.30 4.04  0.50 N 
10  1  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.34 120.30 4.04  0.50 N 
11  1  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.37 120.30 4.07  0.50 N 
12  1  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.33 120.30 4.03  0.50 N 
13  1  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.39 120.30 4.09  0.50 N 
14  1  CB A CYS 72 ? ? CA A CYS 72 ? ? C   A CYS 72 ? ? 123.50 111.50 12.00 1.20 N 
15  1  CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.88 118.30 -5.42 0.90 N 
16  1  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.34 120.30 4.04  0.50 N 
17  1  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.36 120.30 4.06  0.50 N 
18  1  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.81 118.30 -5.49 0.90 N 
19  1  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.38 120.30 4.08  0.50 N 
20  2  CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 112.79 118.30 -5.51 0.90 N 
21  2  CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 112.79 118.30 -5.51 0.90 N 
22  2  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.31 120.30 4.01  0.50 N 
23  2  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.31 120.30 4.01  0.50 N 
24  2  N  A ASN 22 ? ? CA A ASN 22 ? ? CB  A ASN 22 ? ? 126.07 110.60 15.47 1.80 N 
25  2  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.87 118.30 -5.43 0.90 N 
26  2  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.38 120.30 4.08  0.50 N 
27  2  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.29 120.30 3.99  0.50 N 
28  2  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.37 120.30 4.07  0.50 N 
29  2  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.38 120.30 4.08  0.50 N 
30  2  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.35 120.30 4.05  0.50 N 
31  2  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.33 120.30 4.03  0.50 N 
32  2  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.33 120.30 4.03  0.50 N 
33  2  CB A ASP 75 ? ? CG A ASP 75 ? ? OD2 A ASP 75 ? ? 112.83 118.30 -5.47 0.90 N 
34  2  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.35 120.30 4.05  0.50 N 
35  2  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.36 120.30 4.06  0.50 N 
36  2  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.79 118.30 -5.51 0.90 N 
37  2  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.31 120.30 4.01  0.50 N 
38  3  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.87 118.30 -5.43 0.90 N 
39  3  CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.77 118.30 -5.53 0.90 N 
40  3  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.35 120.30 4.05  0.50 N 
41  3  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.33 120.30 4.03  0.50 N 
42  3  CB A ASP 20 ? ? CG A ASP 20 ? ? OD2 A ASP 20 ? ? 112.86 118.30 -5.44 0.90 N 
43  3  CB A ASP 24 ? ? CG A ASP 24 ? ? OD1 A ASP 24 ? ? 112.77 118.30 -5.53 0.90 N 
44  3  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.32 120.30 4.02  0.50 N 
45  3  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.35 120.30 4.05  0.50 N 
46  3  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.42 120.30 4.12  0.50 N 
47  3  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.35 120.30 4.05  0.50 N 
48  3  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.41 120.30 4.11  0.50 N 
49  3  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.34 120.30 4.04  0.50 N 
50  3  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.35 120.30 4.05  0.50 N 
51  3  CB A ASP 75 ? ? CG A ASP 75 ? ? OD2 A ASP 75 ? ? 112.83 118.30 -5.47 0.90 N 
52  3  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.35 120.30 4.05  0.50 N 
53  3  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.34 120.30 4.04  0.50 N 
54  3  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.80 118.30 -5.50 0.90 N 
55  3  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.33 120.30 4.03  0.50 N 
56  4  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.80 118.30 -5.50 0.90 N 
57  4  CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 112.84 118.30 -5.46 0.90 N 
58  4  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.47 120.30 4.17  0.50 N 
59  4  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.33 120.30 4.03  0.50 N 
60  4  CB A ASP 20 ? ? CG A ASP 20 ? ? OD2 A ASP 20 ? ? 112.41 118.30 -5.89 0.90 N 
61  4  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.85 118.30 -5.45 0.90 N 
62  4  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.39 120.30 4.09  0.50 N 
63  4  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.41 120.30 4.11  0.50 N 
64  4  C  A ARG 39 ? ? N  A PRO 40 ? ? CA  A PRO 40 ? ? 128.39 119.30 9.09  1.50 Y 
65  4  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.34 120.30 4.04  0.50 N 
66  4  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.35 120.30 4.05  0.50 N 
67  4  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.36 120.30 4.06  0.50 N 
68  4  CB A TYR 55 ? ? CG A TYR 55 ? ? CD1 A TYR 55 ? ? 116.78 121.00 -4.22 0.60 N 
69  4  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.32 120.30 4.02  0.50 N 
70  4  CB A CYS 69 ? ? CA A CYS 69 ? ? C   A CYS 69 ? ? 123.94 111.50 12.44 1.20 N 
71  4  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.34 120.30 4.04  0.50 N 
72  4  CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.80 118.30 -5.50 0.90 N 
73  4  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.38 120.30 4.08  0.50 N 
74  4  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.41 120.30 4.11  0.50 N 
75  4  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.83 118.30 -5.47 0.90 N 
76  4  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.27 120.30 3.97  0.50 N 
77  5  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.79 118.30 -5.51 0.90 N 
78  5  CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.81 118.30 -5.49 0.90 N 
79  5  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.38 120.30 4.08  0.50 N 
80  5  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.37 120.30 4.07  0.50 N 
81  5  CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.76 118.30 -5.54 0.90 N 
82  5  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.82 118.30 -5.48 0.90 N 
83  5  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.33 120.30 4.03  0.50 N 
84  5  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.37 120.30 4.07  0.50 N 
85  5  C  A ARG 39 ? ? N  A PRO 40 ? ? CA  A PRO 40 ? ? 128.58 119.30 9.28  1.50 Y 
86  5  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.32 120.30 4.02  0.50 N 
87  5  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.39 120.30 4.09  0.50 N 
88  5  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.42 120.30 4.12  0.50 N 
89  5  CB A TYR 55 ? ? CG A TYR 55 ? ? CD2 A TYR 55 ? ? 117.33 121.00 -3.67 0.60 N 
90  5  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.37 120.30 4.07  0.50 N 
91  5  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.33 120.30 4.03  0.50 N 
92  5  CB A ASP 75 ? ? CG A ASP 75 ? ? OD2 A ASP 75 ? ? 112.83 118.30 -5.47 0.90 N 
93  5  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.36 120.30 4.06  0.50 N 
94  5  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.40 120.30 4.10  0.50 N 
95  5  CB A ASP 85 ? ? CG A ASP 85 ? ? OD2 A ASP 85 ? ? 112.79 118.30 -5.51 0.90 N 
96  5  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.38 120.30 4.08  0.50 N 
97  6  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.79 118.30 -5.51 0.90 N 
98  6  CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.80 118.30 -5.50 0.90 N 
99  6  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.39 120.30 4.09  0.50 N 
100 6  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.34 120.30 4.04  0.50 N 
101 6  CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.78 118.30 -5.52 0.90 N 
102 6  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.76 118.30 -5.54 0.90 N 
103 6  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.37 120.30 4.07  0.50 N 
104 6  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.38 120.30 4.08  0.50 N 
105 6  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.33 120.30 4.03  0.50 N 
106 6  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.33 120.30 4.03  0.50 N 
107 6  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.41 120.30 4.11  0.50 N 
108 6  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.38 120.30 4.08  0.50 N 
109 6  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.33 120.30 4.03  0.50 N 
110 6  CB A CYS 72 ? ? CA A CYS 72 ? ? C   A CYS 72 ? ? 125.35 111.50 13.85 1.20 N 
111 6  CB A ASP 75 ? ? CG A ASP 75 ? ? OD2 A ASP 75 ? ? 112.81 118.30 -5.49 0.90 N 
112 6  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.32 120.30 4.02  0.50 N 
113 6  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.35 120.30 4.05  0.50 N 
114 6  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.77 118.30 -5.53 0.90 N 
115 6  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.39 120.30 4.09  0.50 N 
116 7  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.78 118.30 -5.52 0.90 N 
117 7  CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.79 118.30 -5.51 0.90 N 
118 7  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.36 120.30 4.06  0.50 N 
119 7  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.36 120.30 4.06  0.50 N 
120 7  CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.79 118.30 -5.51 0.90 N 
121 7  CB A ASP 24 ? ? CG A ASP 24 ? ? OD1 A ASP 24 ? ? 112.85 118.30 -5.45 0.90 N 
122 7  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.35 120.30 4.05  0.50 N 
123 7  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.45 120.30 4.15  0.50 N 
124 7  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.36 120.30 4.06  0.50 N 
125 7  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.34 120.30 4.04  0.50 N 
126 7  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.41 120.30 4.11  0.50 N 
127 7  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.32 120.30 4.02  0.50 N 
128 7  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.33 120.30 4.03  0.50 N 
129 7  CB A ASP 75 ? ? CG A ASP 75 ? ? OD2 A ASP 75 ? ? 112.85 118.30 -5.45 0.90 N 
130 7  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.33 120.30 4.03  0.50 N 
131 7  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.41 120.30 4.11  0.50 N 
132 7  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.80 118.30 -5.50 0.90 N 
133 7  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.41 120.30 4.11  0.50 N 
134 8  CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 112.76 118.30 -5.54 0.90 N 
135 8  CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 112.84 118.30 -5.46 0.90 N 
136 8  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.35 120.30 4.05  0.50 N 
137 8  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.37 120.30 4.07  0.50 N 
138 8  CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.82 118.30 -5.48 0.90 N 
139 8  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.82 118.30 -5.48 0.90 N 
140 8  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.35 120.30 4.05  0.50 N 
141 8  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.34 120.30 4.04  0.50 N 
142 8  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.37 120.30 4.07  0.50 N 
143 8  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.41 120.30 4.11  0.50 N 
144 8  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.35 120.30 4.05  0.50 N 
145 8  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.37 120.30 4.07  0.50 N 
146 8  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.32 120.30 4.02  0.50 N 
147 8  CB A CYS 72 ? ? CA A CYS 72 ? ? C   A CYS 72 ? ? 121.02 111.50 9.52  1.20 N 
148 8  CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.81 118.30 -5.49 0.90 N 
149 8  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.35 120.30 4.05  0.50 N 
150 8  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.34 120.30 4.04  0.50 N 
151 8  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.81 118.30 -5.49 0.90 N 
152 8  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.34 120.30 4.04  0.50 N 
153 9  CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.82 118.30 -5.48 0.90 N 
154 9  CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.79 118.30 -5.51 0.90 N 
155 9  NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.36 120.30 4.06  0.50 N 
156 9  NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.41 120.30 4.11  0.50 N 
157 9  CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.86 118.30 -5.44 0.90 N 
158 9  CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.74 118.30 -5.56 0.90 N 
159 9  NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.36 120.30 4.06  0.50 N 
160 9  NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.36 120.30 4.06  0.50 N 
161 9  NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.38 120.30 4.08  0.50 N 
162 9  NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.41 120.30 4.11  0.50 N 
163 9  NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.43 120.30 4.13  0.50 N 
164 9  NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.38 120.30 4.08  0.50 N 
165 9  NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.39 120.30 4.09  0.50 N 
166 9  CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.79 118.30 -5.51 0.90 N 
167 9  NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.37 120.30 4.07  0.50 N 
168 9  NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.29 120.30 3.99  0.50 N 
169 9  CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.81 118.30 -5.49 0.90 N 
170 9  NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.37 120.30 4.07  0.50 N 
171 10 CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 112.80 118.30 -5.50 0.90 N 
172 10 CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.81 118.30 -5.49 0.90 N 
173 10 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.38 120.30 4.08  0.50 N 
174 10 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.37 120.30 4.07  0.50 N 
175 10 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.36 120.30 4.06  0.50 N 
176 10 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.35 120.30 4.05  0.50 N 
177 10 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.34 120.30 4.04  0.50 N 
178 10 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.39 120.30 4.09  0.50 N 
179 10 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.38 120.30 4.08  0.50 N 
180 10 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.36 120.30 4.06  0.50 N 
181 10 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.34 120.30 4.04  0.50 N 
182 10 CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.87 118.30 -5.43 0.90 N 
183 10 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.38 120.30 4.08  0.50 N 
184 10 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.36 120.30 4.06  0.50 N 
185 10 CB A ASP 85 ? ? CG A ASP 85 ? ? OD2 A ASP 85 ? ? 112.88 118.30 -5.42 0.90 N 
186 10 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.33 120.30 4.03  0.50 N 
187 11 CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.81 118.30 -5.49 0.90 N 
188 11 CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 112.81 118.30 -5.49 0.90 N 
189 11 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.37 120.30 4.07  0.50 N 
190 11 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.34 120.30 4.04  0.50 N 
191 11 CB A ASP 20 ? ? CG A ASP 20 ? ? OD2 A ASP 20 ? ? 112.87 118.30 -5.43 0.90 N 
192 11 CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.79 118.30 -5.51 0.90 N 
193 11 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.49 120.30 4.19  0.50 N 
194 11 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.41 120.30 4.11  0.50 N 
195 11 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.35 120.30 4.05  0.50 N 
196 11 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.35 120.30 4.05  0.50 N 
197 11 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.36 120.30 4.06  0.50 N 
198 11 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.38 120.30 4.08  0.50 N 
199 11 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.31 120.30 4.01  0.50 N 
200 11 CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.82 118.30 -5.48 0.90 N 
201 11 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.32 120.30 4.02  0.50 N 
202 11 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.37 120.30 4.07  0.50 N 
203 11 CB A ASP 85 ? ? CG A ASP 85 ? ? OD2 A ASP 85 ? ? 112.83 118.30 -5.47 0.90 N 
204 11 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.35 120.30 4.05  0.50 N 
205 12 CB A ASP 9  ? ? CG A ASP 9  ? ? OD2 A ASP 9  ? ? 112.83 118.30 -5.47 0.90 N 
206 12 CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 112.78 118.30 -5.52 0.90 N 
207 12 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.36 120.30 4.06  0.50 N 
208 12 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.31 120.30 4.01  0.50 N 
209 12 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.79 118.30 -5.51 0.90 N 
210 12 CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.82 118.30 -5.48 0.90 N 
211 12 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.38 120.30 4.08  0.50 N 
212 12 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.30 120.30 4.00  0.50 N 
213 12 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.31 120.30 4.01  0.50 N 
214 12 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.35 120.30 4.05  0.50 N 
215 12 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.37 120.30 4.07  0.50 N 
216 12 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.40 120.30 4.10  0.50 N 
217 12 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.32 120.30 4.02  0.50 N 
218 12 CB A ASP 75 ? ? CG A ASP 75 ? ? OD2 A ASP 75 ? ? 112.78 118.30 -5.52 0.90 N 
219 12 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.34 120.30 4.04  0.50 N 
220 12 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.37 120.30 4.07  0.50 N 
221 12 CB A ASP 85 ? ? CG A ASP 85 ? ? OD2 A ASP 85 ? ? 112.86 118.30 -5.44 0.90 N 
222 12 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.33 120.30 4.03  0.50 N 
223 13 CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 112.81 118.30 -5.49 0.90 N 
224 13 CB A ASP 10 ? ? CG A ASP 10 ? ? OD2 A ASP 10 ? ? 112.81 118.30 -5.49 0.90 N 
225 13 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.38 120.30 4.08  0.50 N 
226 13 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.37 120.30 4.07  0.50 N 
227 13 CB A ASP 20 ? ? CG A ASP 20 ? ? OD1 A ASP 20 ? ? 112.76 118.30 -5.54 0.90 N 
228 13 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.40 120.30 4.10  0.50 N 
229 13 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.44 120.30 4.14  0.50 N 
230 13 C  A ARG 39 ? ? N  A PRO 40 ? ? CA  A PRO 40 ? ? 128.92 119.30 9.62  1.50 Y 
231 13 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.39 120.30 4.09  0.50 N 
232 13 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.35 120.30 4.05  0.50 N 
233 13 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.41 120.30 4.11  0.50 N 
234 13 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.33 120.30 4.03  0.50 N 
235 13 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.31 120.30 4.01  0.50 N 
236 13 CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.80 118.30 -5.50 0.90 N 
237 13 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.42 120.30 4.12  0.50 N 
238 13 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.37 120.30 4.07  0.50 N 
239 13 CB A ASP 85 ? ? CG A ASP 85 ? ? OD2 A ASP 85 ? ? 112.82 118.30 -5.48 0.90 N 
240 13 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.31 120.30 4.01  0.50 N 
241 14 CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 112.83 118.30 -5.47 0.90 N 
242 14 CB A ASP 10 ? ? CG A ASP 10 ? ? OD1 A ASP 10 ? ? 112.84 118.30 -5.46 0.90 N 
243 14 NE A ARG 12 ? ? CZ A ARG 12 ? ? NH1 A ARG 12 ? ? 124.39 120.30 4.09  0.50 N 
244 14 NE A ARG 19 ? ? CZ A ARG 19 ? ? NH1 A ARG 19 ? ? 124.31 120.30 4.01  0.50 N 
245 14 CB A ASP 20 ? ? CG A ASP 20 ? ? OD2 A ASP 20 ? ? 112.80 118.30 -5.50 0.90 N 
246 14 CB A ASP 24 ? ? CG A ASP 24 ? ? OD2 A ASP 24 ? ? 112.83 118.30 -5.47 0.90 N 
247 14 NE A ARG 32 ? ? CZ A ARG 32 ? ? NH1 A ARG 32 ? ? 124.34 120.30 4.04  0.50 N 
248 14 NE A ARG 39 ? ? CZ A ARG 39 ? ? NH1 A ARG 39 ? ? 124.38 120.30 4.08  0.50 N 
249 14 NE A ARG 43 ? ? CZ A ARG 43 ? ? NH1 A ARG 43 ? ? 124.46 120.30 4.16  0.50 N 
250 14 NE A ARG 45 ? ? CZ A ARG 45 ? ? NH1 A ARG 45 ? ? 124.47 120.30 4.17  0.50 N 
251 14 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH1 A ARG 49 ? ? 124.33 120.30 4.03  0.50 N 
252 14 NE A ARG 67 ? ? CZ A ARG 67 ? ? NH1 A ARG 67 ? ? 124.32 120.30 4.02  0.50 N 
253 14 NE A ARG 71 ? ? CZ A ARG 71 ? ? NH1 A ARG 71 ? ? 124.36 120.30 4.06  0.50 N 
254 14 CB A ASP 75 ? ? CG A ASP 75 ? ? OD1 A ASP 75 ? ? 112.84 118.30 -5.46 0.90 N 
255 14 NE A ARG 80 ? ? CZ A ARG 80 ? ? NH1 A ARG 80 ? ? 124.32 120.30 4.02  0.50 N 
256 14 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH1 A ARG 83 ? ? 124.37 120.30 4.07  0.50 N 
257 14 CB A ASP 85 ? ? CG A ASP 85 ? ? OD1 A ASP 85 ? ? 112.79 118.30 -5.51 0.90 N 
258 14 NE A ARG 92 ? ? CZ A ARG 92 ? ? NH1 A ARG 92 ? ? 124.37 120.30 4.07  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  LYS A 2  ? ? -107.74 -64.88  
2   1  ALA A 4  ? ? -59.24  -90.90  
3   1  CYS A 6  ? ? -41.12  154.25  
4   1  LEU A 7  ? ? -75.76  -79.40  
5   1  ARG A 12 ? ? -41.34  -73.45  
6   1  ALA A 18 ? ? -56.68  -96.14  
7   1  ARG A 19 ? ? 179.53  -85.57  
8   1  PRO A 21 ? ? -48.75  104.18  
9   1  ALA A 23 ? ? -91.17  -85.16  
10  1  PRO A 40 ? ? -11.50  -37.33  
11  1  SER A 41 ? ? -98.89  43.39   
12  1  ALA A 44 ? ? -39.06  143.69  
13  1  ARG A 45 ? ? -39.59  95.98   
14  1  ALA A 47 ? ? -48.82  172.48  
15  1  PRO A 68 ? ? -63.05  95.73   
16  1  ARG A 71 ? ? -158.77 40.80   
17  1  CYS A 72 ? ? 6.42    55.29   
18  1  GLN A 73 ? ? -41.33  99.14   
19  1  ASP A 75 ? ? 167.94  95.37   
20  1  ALA A 77 ? ? 0.35    75.36   
21  1  ASN A 78 ? ? 52.61   85.21   
22  1  GLN A 81 ? ? -46.93  -86.05  
23  1  ARG A 83 ? ? -175.49 -96.76  
24  1  LEU A 84 ? ? 50.21   91.90   
25  1  LYS A 86 ? ? -117.88 -165.53 
26  1  THR A 88 ? ? -112.36 69.07   
27  1  ALA A 90 ? ? -142.25 -42.86  
28  1  CYS A 91 ? ? -124.45 -168.88 
29  2  LYS A 2  ? ? 59.89   175.13  
30  2  LYS A 3  ? ? -102.31 73.38   
31  2  THR A 5  ? ? -138.68 -149.36 
32  2  THR A 8  ? ? -138.92 -66.70  
33  2  ARG A 12 ? ? -41.60  -76.72  
34  2  PRO A 21 ? ? -81.58  -95.41  
35  2  ALA A 23 ? ? -153.82 -38.97  
36  2  ASP A 24 ? ? -42.93  -100.65 
37  2  PRO A 40 ? ? -15.97  82.48   
38  2  SER A 41 ? ? -152.48 -34.33  
39  2  CYS A 42 ? ? -56.14  100.03  
40  2  HIS A 46 ? ? 40.48   -96.67  
41  2  PRO A 68 ? ? -59.21  104.16  
42  2  LYS A 70 ? ? -90.46  -80.23  
43  2  ARG A 71 ? ? -62.12  -74.29  
44  2  CYS A 72 ? ? 178.68  76.47   
45  2  GLN A 73 ? ? -39.58  144.76  
46  2  PRO A 74 ? ? -52.04  -72.67  
47  2  ASP A 75 ? ? 178.63  -73.55  
48  2  ALA A 77 ? ? -13.45  81.75   
49  2  ASN A 78 ? ? 39.15   87.86   
50  2  PRO A 79 ? ? -66.87  -169.64 
51  2  GLN A 81 ? ? 171.04  155.04  
52  2  LEU A 84 ? ? 77.53   170.23  
53  2  ASP A 85 ? ? 82.23   98.22   
54  2  ALA A 90 ? ? -168.93 -39.66  
55  2  CYS A 91 ? ? 66.78   -90.62  
56  3  LYS A 3  ? ? -58.86  101.12  
57  3  CYS A 6  ? ? -75.55  -113.55 
58  3  THR A 8  ? ? -146.66 -79.13  
59  3  ASP A 10 ? ? -47.57  -75.09  
60  3  ARG A 12 ? ? -54.64  -78.69  
61  3  ALA A 18 ? ? -48.81  -99.81  
62  3  ARG A 19 ? ? 179.52  -93.74  
63  3  PRO A 21 ? ? -28.49  80.71   
64  3  ALA A 23 ? ? -148.41 21.59   
65  3  ASP A 24 ? ? -48.49  -82.