data_1AKZ
# 
_entry.id   1AKZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AKZ         
WWPDB D_1000170946 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AKZ 
_pdbx_database_status.recvd_initial_deposition_date   1997-05-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tainer, J.A.' 1 
'Mol, C.D.'    2 
# 
_citation.id                        primary 
_citation.title                     
'Base excision repair initiation revealed by crystal structures and binding kinetics of human uracil-DNA glycosylase with DNA.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            17 
_citation.page_first                5214 
_citation.page_last                 5226 
_citation.year                      1998 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9724657 
_citation.pdbx_database_id_DOI      10.1093/emboj/17.17.5214 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Parikh, S.S.'  1 
primary 'Mol, C.D.'     2 
primary 'Slupphaug, G.' 3 
primary 'Bharati, S.'   4 
primary 'Krokan, H.E.'  5 
primary 'Tainer, J.A.'  6 
# 
_cell.entry_id           1AKZ 
_cell.length_a           47.760 
_cell.length_b           55.270 
_cell.length_c           84.970 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1AKZ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'URACIL-DNA GLYCOSYLASE' 25544.137 1   3.2.2.- 'P82M, V83E, G84F' ? 
;STRUCTURE IS THAT OF RECOMBINANT HUMAN URACIL-DNA GLYCOSYLASE IN WHICH THE 84 N-TERMINAL AMINO ACIDS CODED FOR BY THE UNG GENE HAVE BEEN REPLACED BY THREE RESIDUES FROM THE EXPRESSION VECTOR
;
2 water   nat water                    18.015    185 ?       ?                  ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'UDG, UNG' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQ
RPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLV
FLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQ
RPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLV
FLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   PHE n 
1 4   PHE n 
1 5   GLY n 
1 6   GLU n 
1 7   SER n 
1 8   TRP n 
1 9   LYS n 
1 10  LYS n 
1 11  HIS n 
1 12  LEU n 
1 13  SER n 
1 14  GLY n 
1 15  GLU n 
1 16  PHE n 
1 17  GLY n 
1 18  LYS n 
1 19  PRO n 
1 20  TYR n 
1 21  PHE n 
1 22  ILE n 
1 23  LYS n 
1 24  LEU n 
1 25  MET n 
1 26  GLY n 
1 27  PHE n 
1 28  VAL n 
1 29  ALA n 
1 30  GLU n 
1 31  GLU n 
1 32  ARG n 
1 33  LYS n 
1 34  HIS n 
1 35  TYR n 
1 36  THR n 
1 37  VAL n 
1 38  TYR n 
1 39  PRO n 
1 40  PRO n 
1 41  PRO n 
1 42  HIS n 
1 43  GLN n 
1 44  VAL n 
1 45  PHE n 
1 46  THR n 
1 47  TRP n 
1 48  THR n 
1 49  GLN n 
1 50  MET n 
1 51  CYS n 
1 52  ASP n 
1 53  ILE n 
1 54  LYS n 
1 55  ASP n 
1 56  VAL n 
1 57  LYS n 
1 58  VAL n 
1 59  VAL n 
1 60  ILE n 
1 61  LEU n 
1 62  GLY n 
1 63  GLN n 
1 64  ASP n 
1 65  PRO n 
1 66  TYR n 
1 67  HIS n 
1 68  GLY n 
1 69  PRO n 
1 70  ASN n 
1 71  GLN n 
1 72  ALA n 
1 73  HIS n 
1 74  GLY n 
1 75  LEU n 
1 76  CYS n 
1 77  PHE n 
1 78  SER n 
1 79  VAL n 
1 80  GLN n 
1 81  ARG n 
1 82  PRO n 
1 83  VAL n 
1 84  PRO n 
1 85  PRO n 
1 86  PRO n 
1 87  PRO n 
1 88  SER n 
1 89  LEU n 
1 90  GLU n 
1 91  ASN n 
1 92  ILE n 
1 93  TYR n 
1 94  LYS n 
1 95  GLU n 
1 96  LEU n 
1 97  SER n 
1 98  THR n 
1 99  ASP n 
1 100 ILE n 
1 101 GLU n 
1 102 ASP n 
1 103 PHE n 
1 104 VAL n 
1 105 HIS n 
1 106 PRO n 
1 107 GLY n 
1 108 HIS n 
1 109 GLY n 
1 110 ASP n 
1 111 LEU n 
1 112 SER n 
1 113 GLY n 
1 114 TRP n 
1 115 ALA n 
1 116 LYS n 
1 117 GLN n 
1 118 GLY n 
1 119 VAL n 
1 120 LEU n 
1 121 LEU n 
1 122 LEU n 
1 123 ASN n 
1 124 ALA n 
1 125 VAL n 
1 126 LEU n 
1 127 THR n 
1 128 VAL n 
1 129 ARG n 
1 130 ALA n 
1 131 HIS n 
1 132 GLN n 
1 133 ALA n 
1 134 ASN n 
1 135 SER n 
1 136 HIS n 
1 137 LYS n 
1 138 GLU n 
1 139 ARG n 
1 140 GLY n 
1 141 TRP n 
1 142 GLU n 
1 143 GLN n 
1 144 PHE n 
1 145 THR n 
1 146 ASP n 
1 147 ALA n 
1 148 VAL n 
1 149 VAL n 
1 150 SER n 
1 151 TRP n 
1 152 LEU n 
1 153 ASN n 
1 154 GLN n 
1 155 ASN n 
1 156 SER n 
1 157 ASN n 
1 158 GLY n 
1 159 LEU n 
1 160 VAL n 
1 161 PHE n 
1 162 LEU n 
1 163 LEU n 
1 164 TRP n 
1 165 GLY n 
1 166 SER n 
1 167 TYR n 
1 168 ALA n 
1 169 GLN n 
1 170 LYS n 
1 171 LYS n 
1 172 GLY n 
1 173 SER n 
1 174 ALA n 
1 175 ILE n 
1 176 ASP n 
1 177 ARG n 
1 178 LYS n 
1 179 ARG n 
1 180 HIS n 
1 181 HIS n 
1 182 VAL n 
1 183 LEU n 
1 184 GLN n 
1 185 THR n 
1 186 ALA n 
1 187 HIS n 
1 188 PRO n 
1 189 SER n 
1 190 PRO n 
1 191 LEU n 
1 192 SER n 
1 193 VAL n 
1 194 TYR n 
1 195 ARG n 
1 196 GLY n 
1 197 PHE n 
1 198 PHE n 
1 199 GLY n 
1 200 CYS n 
1 201 ARG n 
1 202 HIS n 
1 203 PHE n 
1 204 SER n 
1 205 LYS n 
1 206 THR n 
1 207 ASN n 
1 208 GLU n 
1 209 LEU n 
1 210 LEU n 
1 211 GLN n 
1 212 LYS n 
1 213 SER n 
1 214 GLY n 
1 215 LYS n 
1 216 LYS n 
1 217 PRO n 
1 218 ILE n 
1 219 ASP n 
1 220 TRP n 
1 221 LYS n 
1 222 GLU n 
1 223 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UNG_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P13051 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARN
VPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSV
QRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGL
VFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AKZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 223 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P13051 
_struct_ref_seq.db_align_beg                  85 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  304 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       85 
_struct_ref_seq.pdbx_auth_seq_align_end       304 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AKZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.25 
_exptl_crystal.density_percent_sol   54. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.9 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;100 MM IMIDAZOLE/MALEATE, PH 7.9, 1%-4% SATURATED NACL, 1%-4% SATURATED AMMONIUM SULFATE, 16%-20% PEG 4000, MIXED WITH EQUAL VOLUMES 30 MG/ML PROTEIN.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           275 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               ? 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   1995-02 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.08 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength             1.08 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AKZ 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.57 
_reflns.number_obs                   30433 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            0.0460000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.57 
_reflns_shell.d_res_low              1.61 
_reflns_shell.percent_possible_all   93.4 
_reflns_shell.Rmerge_I_obs           0.1060000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    11.0 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AKZ 
_refine.ls_number_reflns_obs                     30381 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               100000.00 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.57 
_refine.ls_percent_reflns_obs                    94.5 
_refine.ls_R_factor_obs                          0.1890000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1890000 
_refine.ls_R_factor_R_free                       0.2240000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.49 
_refine.ls_number_reflns_R_free                  3048 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            4.9022 
_refine.aniso_B[2][2]                            0.7885 
_refine.aniso_B[3][3]                            -5.6908 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'AN OVERALL BULK SOLVENT CORRECTION WAS APPLIED TO THE DATA.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MULTIPLE ISOMORPHOUS REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1808 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             185 
_refine_hist.number_atoms_total               1993 
_refine_hist.d_res_high                       1.57 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.154 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.96 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      0.949 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             0.958 1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            1.649 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             1.746 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.812 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.57 
_refine_ls_shell.d_res_low                        1.64 
_refine_ls_shell.number_reflns_R_work             3319 
_refine_ls_shell.R_factor_R_work                  0.3180000 
_refine_ls_shell.percent_reflns_obs               93.7 
_refine_ls_shell.R_factor_R_free                  0.2860000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            9.85 
_refine_ls_shell.number_reflns_R_free             390 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  TOPH19.SOL   'X-RAY DIFFRACTION' 
3 ?            TOPH19.PEP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1AKZ 
_struct.title                     'HUMAN URACIL-DNA GLYCOSYLASE' 
_struct.pdbx_descriptor           'URACIL-DNA GLYCOSYLASE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AKZ 
_struct_keywords.pdbx_keywords   GLYCOSIDASE 
_struct_keywords.text            'GLYCOSYLASE, DNA REPAIR, URACIL REMOVAL FROM DNA, ALPHA/ BETA PROTEIN, GLYCOSIDASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 6   ? GLY A 17  ? GLU A 87  GLY A 98  1 ? 12 
HELX_P HELX_P2  2  PRO A 19  ? HIS A 34  ? PRO A 100 HIS A 115 1 ? 16 
HELX_P HELX_P3  3  PRO A 41  ? GLN A 43  ? PRO A 122 GLN A 124 5 ? 3  
HELX_P HELX_P4  4  THR A 46  ? THR A 48  ? THR A 127 THR A 129 5 ? 3  
HELX_P HELX_P5  5  ILE A 53  ? ASP A 55  ? ILE A 134 ASP A 136 5 ? 3  
HELX_P HELX_P6  6  PRO A 87  ? ASP A 99  ? PRO A 168 ASP A 180 1 ? 13 
HELX_P HELX_P7  7  SER A 112 ? GLN A 117 ? SER A 193 GLN A 198 1 ? 6  
HELX_P HELX_P8  8  TRP A 141 ? ASN A 155 ? TRP A 222 ASN A 236 1 ? 15 
HELX_P HELX_P9  9  SER A 166 ? ALA A 174 ? SER A 247 ALA A 255 1 ? 9  
HELX_P HELX_P10 10 VAL A 193 ? ARG A 195 ? VAL A 274 ARG A 276 5 ? 3  
HELX_P HELX_P11 11 HIS A 202 ? SER A 213 ? HIS A 283 SER A 294 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 38 A . ? TYR 119 A PRO 39 A ? PRO 120 A 1 -1.36 
2 ARG 81 A . ? ARG 162 A PRO 82 A ? PRO 163 A 1 0.54  
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   4 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 119 ? ASN A 123 ? VAL A 200 ASN A 204 
A 2 VAL A 58  ? GLY A 62  ? VAL A 139 GLY A 143 
A 3 VAL A 160 ? TRP A 164 ? VAL A 241 TRP A 245 
A 4 HIS A 181 ? THR A 185 ? HIS A 262 THR A 266 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O LEU A 120 ? O LEU A 201 N VAL A 58  ? N VAL A 139 
A 2 3 O VAL A 59  ? O VAL A 140 N VAL A 160 ? N VAL A 241 
A 3 4 O PHE A 161 ? O PHE A 242 N HIS A 181 ? N HIS A 262 
# 
_database_PDB_matrix.entry_id          1AKZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AKZ 
_atom_sites.fract_transf_matrix[1][1]   0.020938 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018093 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011769 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 10.065  -25.604 -25.183 1.00 45.71 ? 82  MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 9.081   -25.845 -24.079 1.00 45.53 ? 82  MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 8.476   -27.260 -24.224 1.00 43.98 ? 82  MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 8.104   -27.664 -25.335 1.00 44.32 ? 82  MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 7.981   -24.765 -24.145 1.00 47.47 ? 82  MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 7.038   -24.712 -22.951 1.00 49.34 ? 82  MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 7.898   -24.432 -21.393 1.00 52.66 ? 82  MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 8.427   -22.742 -21.603 1.00 51.81 ? 82  MET A CE  1 
ATOM   9    N N   . GLU A 1 2   ? 8.404   -28.018 -23.118 1.00 41.48 ? 83  GLU A N   1 
ATOM   10   C CA  . GLU A 1 2   ? 7.885   -29.392 -23.181 1.00 38.76 ? 83  GLU A CA  1 
ATOM   11   C C   . GLU A 1 2   ? 6.382   -29.437 -22.990 1.00 35.50 ? 83  GLU A C   1 
ATOM   12   O O   . GLU A 1 2   ? 5.795   -28.529 -22.387 1.00 35.33 ? 83  GLU A O   1 
ATOM   13   C CB  . GLU A 1 2   ? 8.532   -30.291 -22.127 1.00 40.53 ? 83  GLU A CB  1 
ATOM   14   C CG  . GLU A 1 2   ? 10.037  -30.435 -22.255 1.00 43.52 ? 83  GLU A CG  1 
ATOM   15   C CD  . GLU A 1 2   ? 10.794  -29.374 -21.473 1.00 46.07 ? 83  GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 2   ? 10.134  -28.487 -20.859 1.00 47.42 ? 83  GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 2   ? 12.053  -29.427 -21.462 1.00 47.18 ? 83  GLU A OE2 1 
ATOM   18   N N   . PHE A 1 3   ? 5.768   -30.501 -23.496 1.00 31.18 ? 84  PHE A N   1 
ATOM   19   C CA  . PHE A 1 3   ? 4.322   -30.673 -23.373 1.00 28.33 ? 84  PHE A CA  1 
ATOM   20   C C   . PHE A 1 3   ? 3.591   -29.488 -23.995 1.00 26.90 ? 84  PHE A C   1 
ATOM   21   O O   . PHE A 1 3   ? 2.510   -29.124 -23.556 1.00 26.31 ? 84  PHE A O   1 
ATOM   22   C CB  . PHE A 1 3   ? 3.920   -30.787 -21.893 1.00 26.24 ? 84  PHE A CB  1 
ATOM   23   C CG  . PHE A 1 3   ? 4.684   -31.814 -21.120 1.00 23.90 ? 84  PHE A CG  1 
ATOM   24   C CD1 . PHE A 1 3   ? 4.542   -33.169 -21.406 1.00 24.08 ? 84  PHE A CD1 1 
ATOM   25   C CD2 . PHE A 1 3   ? 5.521   -31.430 -20.085 1.00 22.84 ? 84  PHE A CD2 1 
ATOM   26   C CE1 . PHE A 1 3   ? 5.226   -34.130 -20.663 1.00 23.34 ? 84  PHE A CE1 1 
ATOM   27   C CE2 . PHE A 1 3   ? 6.201   -32.379 -19.342 1.00 23.14 ? 84  PHE A CE2 1 
ATOM   28   C CZ  . PHE A 1 3   ? 6.053   -33.731 -19.632 1.00 22.59 ? 84  PHE A CZ  1 
ATOM   29   N N   . PHE A 1 4   ? 4.209   -28.896 -25.007 1.00 25.52 ? 85  PHE A N   1 
ATOM   30   C CA  . PHE A 1 4   ? 3.667   -27.724 -25.678 1.00 23.73 ? 85  PHE A CA  1 
ATOM   31   C C   . PHE A 1 4   ? 3.557   -28.060 -27.135 1.00 23.52 ? 85  PHE A C   1 
ATOM   32   O O   . PHE A 1 4   ? 4.547   -28.439 -27.742 1.00 24.58 ? 85  PHE A O   1 
ATOM   33   C CB  . PHE A 1 4   ? 4.633   -26.548 -25.485 1.00 22.91 ? 85  PHE A CB  1 
ATOM   34   C CG  . PHE A 1 4   ? 4.051   -25.184 -25.660 1.00 21.67 ? 85  PHE A CG  1 
ATOM   35   C CD1 . PHE A 1 4   ? 3.895   -24.629 -26.927 1.00 21.76 ? 85  PHE A CD1 1 
ATOM   36   C CD2 . PHE A 1 4   ? 3.695   -24.425 -24.551 1.00 21.40 ? 85  PHE A CD2 1 
ATOM   37   C CE1 . PHE A 1 4   ? 3.395   -23.337 -27.083 1.00 20.38 ? 85  PHE A CE1 1 
ATOM   38   C CE2 . PHE A 1 4   ? 3.195   -23.133 -24.701 1.00 20.88 ? 85  PHE A CE2 1 
ATOM   39   C CZ  . PHE A 1 4   ? 3.045   -22.589 -25.968 1.00 20.89 ? 85  PHE A CZ  1 
ATOM   40   N N   . GLY A 1 5   ? 2.356   -27.963 -27.671 1.00 22.65 ? 86  GLY A N   1 
ATOM   41   C CA  . GLY A 1 5   ? 2.109   -28.305 -29.066 1.00 23.81 ? 86  GLY A CA  1 
ATOM   42   C C   . GLY A 1 5   ? 3.058   -27.638 -30.044 1.00 24.24 ? 86  GLY A C   1 
ATOM   43   O O   . GLY A 1 5   ? 3.354   -26.447 -29.921 1.00 23.20 ? 86  GLY A O   1 
ATOM   44   N N   . GLU A 1 6   ? 3.497   -28.413 -31.040 1.00 25.60 ? 87  GLU A N   1 
ATOM   45   C CA  . GLU A 1 6   ? 4.488   -27.958 -32.017 1.00 26.94 ? 87  GLU A CA  1 
ATOM   46   C C   . GLU A 1 6   ? 4.078   -26.713 -32.779 1.00 25.37 ? 87  GLU A C   1 
ATOM   47   O O   . GLU A 1 6   ? 4.859   -25.777 -32.884 1.00 24.24 ? 87  GLU A O   1 
ATOM   48   C CB  . GLU A 1 6   ? 4.812   -29.079 -33.010 1.00 30.90 ? 87  GLU A CB  1 
ATOM   49   C CG  . GLU A 1 6   ? 5.697   -30.164 -32.426 1.00 38.03 ? 87  GLU A CG  1 
ATOM   50   C CD  . GLU A 1 6   ? 7.065   -29.631 -32.005 1.00 42.60 ? 87  GLU A CD  1 
ATOM   51   O OE1 . GLU A 1 6   ? 7.753   -29.011 -32.859 1.00 45.61 ? 87  GLU A OE1 1 
ATOM   52   O OE2 . GLU A 1 6   ? 7.458   -29.830 -30.824 1.00 44.92 ? 87  GLU A OE2 1 
ATOM   53   N N   . SER A 1 7   ? 2.873   -26.692 -33.316 1.00 24.30 ? 88  SER A N   1 
ATOM   54   C CA  . SER A 1 7   ? 2.447   -25.538 -34.089 1.00 24.64 ? 88  SER A CA  1 
ATOM   55   C C   . SER A 1 7   ? 2.382   -24.280 -33.221 1.00 24.11 ? 88  SER A C   1 
ATOM   56   O O   . SER A 1 7   ? 2.669   -23.169 -33.683 1.00 24.39 ? 88  SER A O   1 
ATOM   57   C CB  . SER A 1 7   ? 1.096   -25.812 -34.741 1.00 25.81 ? 88  SER A CB  1 
ATOM   58   O OG  . SER A 1 7   ? 0.102   -26.065 -33.762 1.00 27.72 ? 88  SER A OG  1 
ATOM   59   N N   . TRP A 1 8   ? 2.020   -24.447 -31.958 1.00 22.98 ? 89  TRP A N   1 
ATOM   60   C CA  . TRP A 1 8   ? 1.959   -23.306 -31.061 1.00 22.98 ? 89  TRP A CA  1 
ATOM   61   C C   . TRP A 1 8   ? 3.361   -22.843 -30.704 1.00 24.13 ? 89  TRP A C   1 
ATOM   62   O O   . TRP A 1 8   ? 3.628   -21.640 -30.652 1.00 24.52 ? 89  TRP A O   1 
ATOM   63   C CB  . TRP A 1 8   ? 1.204   -23.662 -29.791 1.00 21.10 ? 89  TRP A CB  1 
ATOM   64   C CG  . TRP A 1 8   ? -0.204  -24.026 -30.057 1.00 19.57 ? 89  TRP A CG  1 
ATOM   65   C CD1 . TRP A 1 8   ? -0.661  -25.228 -30.531 1.00 19.09 ? 89  TRP A CD1 1 
ATOM   66   C CD2 . TRP A 1 8   ? -1.352  -23.182 -29.873 1.00 19.22 ? 89  TRP A CD2 1 
ATOM   67   N NE1 . TRP A 1 8   ? -2.020  -25.170 -30.647 1.00 19.44 ? 89  TRP A NE1 1 
ATOM   68   C CE2 . TRP A 1 8   ? -2.493  -23.944 -30.257 1.00 19.59 ? 89  TRP A CE2 1 
ATOM   69   C CE3 . TRP A 1 8   ? -1.536  -21.858 -29.423 1.00 18.90 ? 89  TRP A CE3 1 
ATOM   70   C CZ2 . TRP A 1 8   ? -3.805  -23.432 -30.203 1.00 18.72 ? 89  TRP A CZ2 1 
ATOM   71   C CZ3 . TRP A 1 8   ? -2.837  -21.356 -29.372 1.00 18.85 ? 89  TRP A CZ3 1 
ATOM   72   C CH2 . TRP A 1 8   ? -3.950  -22.140 -29.757 1.00 18.05 ? 89  TRP A CH2 1 
ATOM   73   N N   . LYS A 1 9   ? 4.256   -23.813 -30.487 1.00 25.41 ? 90  LYS A N   1 
ATOM   74   C CA  . LYS A 1 9   ? 5.640   -23.527 -30.110 1.00 27.13 ? 90  LYS A CA  1 
ATOM   75   C C   . LYS A 1 9   ? 6.346   -22.704 -31.181 1.00 27.48 ? 90  LYS A C   1 
ATOM   76   O O   . LYS A 1 9   ? 7.116   -21.785 -30.872 1.00 26.27 ? 90  LYS A O   1 
ATOM   77   C CB  . LYS A 1 9   ? 6.381   -24.841 -29.891 1.00 29.06 ? 90  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 9   ? 7.719   -24.702 -29.202 1.00 32.59 ? 90  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 9   ? 8.369   -26.066 -29.056 1.00 35.72 ? 90  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 9   ? 9.777   -25.947 -28.505 1.00 38.37 ? 90  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 9   ? 10.516  -27.236 -28.628 1.00 41.19 ? 90  LYS A NZ  1 
ATOM   82   N N   . LYS A 1 10  ? 6.042   -23.021 -32.441 1.00 27.96 ? 91  LYS A N   1 
ATOM   83   C CA  . LYS A 1 10  ? 6.662   -22.350 -33.560 1.00 29.34 ? 91  LYS A CA  1 
ATOM   84   C C   . LYS A 1 10  ? 6.322   -20.873 -33.590 1.00 29.48 ? 91  LYS A C   1 
ATOM   85   O O   . LYS A 1 10  ? 7.174   -20.050 -33.905 1.00 30.52 ? 91  LYS A O   1 
ATOM   86   C CB  . LYS A 1 10  ? 6.244   -23.001 -34.883 1.00 30.72 ? 91  LYS A CB  1 
ATOM   87   C CG  . LYS A 1 10  ? 7.182   -22.663 -36.031 1.00 34.00 ? 91  LYS A CG  1 
ATOM   88   C CD  . LYS A 1 10  ? 6.793   -23.359 -37.327 1.00 36.21 ? 91  LYS A CD  1 
ATOM   89   C CE  . LYS A 1 10  ? 5.706   -22.594 -38.062 1.00 37.93 ? 91  LYS A CE  1 
ATOM   90   N NZ  . LYS A 1 10  ? 5.434   -23.171 -39.411 1.00 39.45 ? 91  LYS A NZ  1 
ATOM   91   N N   . HIS A 1 11  ? 5.098   -20.524 -33.231 1.00 29.10 ? 92  HIS A N   1 
ATOM   92   C CA  . HIS A 1 11  ? 4.676   -19.129 -33.306 1.00 29.35 ? 92  HIS A CA  1 
ATOM   93   C C   . HIS A 1 11  ? 4.850   -18.339 -32.003 1.00 29.09 ? 92  HIS A C   1 
ATOM   94   O O   . HIS A 1 11  ? 4.991   -17.122 -32.037 1.00 29.42 ? 92  HIS A O   1 
ATOM   95   C CB  . HIS A 1 11  ? 3.223   -19.063 -33.797 1.00 29.78 ? 92  HIS A CB  1 
ATOM   96   C CG  . HIS A 1 11  ? 3.065   -19.626 -35.175 1.00 30.58 ? 92  HIS A CG  1 
ATOM   97   N ND1 . HIS A 1 11  ? 3.531   -18.944 -36.293 1.00 31.22 ? 92  HIS A ND1 1 
ATOM   98   C CD2 . HIS A 1 11  ? 2.540   -20.823 -35.561 1.00 31.43 ? 92  HIS A CD2 1 
ATOM   99   C CE1 . HIS A 1 11  ? 3.284   -19.734 -37.328 1.00 31.11 ? 92  HIS A CE1 1 
ATOM   100  N NE2 . HIS A 1 11  ? 2.693   -20.861 -36.919 1.00 32.05 ? 92  HIS A NE2 1 
ATOM   101  N N   . LEU A 1 12  ? 4.863   -19.014 -30.864 1.00 28.49 ? 93  LEU A N   1 
ATOM   102  C CA  . LEU A 1 12  ? 4.947   -18.312 -29.578 1.00 29.00 ? 93  LEU A CA  1 
ATOM   103  C C   . LEU A 1 12  ? 6.292   -18.516 -28.882 1.00 29.31 ? 93  LEU A C   1 
ATOM   104  O O   . LEU A 1 12  ? 6.478   -18.067 -27.744 1.00 28.48 ? 93  LEU A O   1 
ATOM   105  C CB  . LEU A 1 12  ? 3.811   -18.783 -28.651 1.00 28.71 ? 93  LEU A CB  1 
ATOM   106  C CG  . LEU A 1 12  ? 2.385   -18.653 -29.195 1.00 28.24 ? 93  LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 12  ? 1.419   -19.424 -28.312 1.00 28.07 ? 93  LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 12  ? 1.994   -17.189 -29.287 1.00 27.69 ? 93  LEU A CD2 1 
ATOM   109  N N   . SER A 1 13  ? 7.233   -19.178 -29.565 1.00 30.09 ? 94  SER A N   1 
ATOM   110  C CA  . SER A 1 13  ? 8.543   -19.464 -28.964 1.00 31.23 ? 94  SER A CA  1 
ATOM   111  C C   . SER A 1 13  ? 9.242   -18.189 -28.472 1.00 29.92 ? 94  SER A C   1 
ATOM   112  O O   . SER A 1 13  ? 9.961   -18.225 -27.464 1.00 29.98 ? 94  SER A O   1 
ATOM   113  C CB  . SER A 1 13  ? 9.448   -20.238 -29.951 1.00 31.94 ? 94  SER A CB  1 
ATOM   114  O OG  . SER A 1 13  ? 9.607   -19.540 -31.182 1.00 35.08 ? 94  SER A OG  1 
ATOM   115  N N   . GLY A 1 14  ? 8.997   -17.073 -29.166 1.00 28.95 ? 95  GLY A N   1 
ATOM   116  C CA  . GLY A 1 14  ? 9.600   -15.801 -28.789 1.00 28.51 ? 95  GLY A CA  1 
ATOM   117  C C   . GLY A 1 14  ? 9.273   -15.377 -27.362 1.00 28.03 ? 95  GLY A C   1 
ATOM   118  O O   . GLY A 1 14  ? 10.068  -14.698 -26.702 1.00 28.59 ? 95  GLY A O   1 
ATOM   119  N N   . GLU A 1 15  ? 8.111   -15.786 -26.870 1.00 26.86 ? 96  GLU A N   1 
ATOM   120  C CA  . GLU A 1 15  ? 7.723   -15.447 -25.512 1.00 25.84 ? 96  GLU A CA  1 
ATOM   121  C C   . GLU A 1 15  ? 8.596   -16.164 -24.485 1.00 26.01 ? 96  GLU A C   1 
ATOM   122  O O   . GLU A 1 15  ? 8.838   -15.642 -23.387 1.00 24.86 ? 96  GLU A O   1 
ATOM   123  C CB  . GLU A 1 15  ? 6.244   -15.806 -25.266 1.00 25.55 ? 96  GLU A CB  1 
ATOM   124  C CG  . GLU A 1 15  ? 5.244   -14.949 -26.027 1.00 23.35 ? 96  GLU A CG  1 
ATOM   125  C CD  . GLU A 1 15  ? 5.507   -13.470 -25.832 1.00 23.14 ? 96  GLU A CD  1 
ATOM   126  O OE1 . GLU A 1 15  ? 5.439   -12.998 -24.677 1.00 22.05 ? 96  GLU A OE1 1 
ATOM   127  O OE2 . GLU A 1 15  ? 5.795   -12.782 -26.830 1.00 22.90 ? 96  GLU A OE2 1 
ATOM   128  N N   . PHE A 1 16  ? 9.101   -17.347 -24.862 1.00 26.39 ? 97  PHE A N   1 
ATOM   129  C CA  . PHE A 1 16  ? 9.850   -18.187 -23.931 1.00 27.32 ? 97  PHE A CA  1 
ATOM   130  C C   . PHE A 1 16  ? 11.154  -17.545 -23.434 1.00 26.94 ? 97  PHE A C   1 
ATOM   131  O O   . PHE A 1 16  ? 11.584  -17.806 -22.305 1.00 27.18 ? 97  PHE A O   1 
ATOM   132  C CB  . PHE A 1 16  ? 10.127  -19.557 -24.572 1.00 28.64 ? 97  PHE A CB  1 
ATOM   133  C CG  . PHE A 1 16  ? 8.887   -20.317 -24.991 1.00 29.90 ? 97  PHE A CG  1 
ATOM   134  C CD1 . PHE A 1 16  ? 7.670   -20.129 -24.336 1.00 30.18 ? 97  PHE A CD1 1 
ATOM   135  C CD2 . PHE A 1 16  ? 8.939   -21.232 -26.045 1.00 31.59 ? 97  PHE A CD2 1 
ATOM   136  C CE1 . PHE A 1 16  ? 6.538   -20.837 -24.724 1.00 31.15 ? 97  PHE A CE1 1 
ATOM   137  C CE2 . PHE A 1 16  ? 7.803   -21.943 -26.438 1.00 31.82 ? 97  PHE A CE2 1 
ATOM   138  C CZ  . PHE A 1 16  ? 6.604   -21.743 -25.775 1.00 31.22 ? 97  PHE A CZ  1 
ATOM   139  N N   . GLY A 1 17  ? 11.755  -16.683 -24.255 1.00 27.04 ? 98  GLY A N   1 
ATOM   140  C CA  . GLY A 1 17  ? 13.020  -16.057 -23.877 1.00 26.56 ? 98  GLY A CA  1 
ATOM   141  C C   . GLY A 1 17  ? 12.879  -14.701 -23.204 1.00 26.46 ? 98  GLY A C   1 
ATOM   142  O O   . GLY A 1 17  ? 13.881  -14.111 -22.784 1.00 26.70 ? 98  GLY A O   1 
ATOM   143  N N   . LYS A 1 18  ? 11.653  -14.188 -23.083 1.00 24.53 ? 99  LYS A N   1 
ATOM   144  C CA  . LYS A 1 18  ? 11.465  -12.887 -22.461 1.00 24.02 ? 99  LYS A CA  1 
ATOM   145  C C   . LYS A 1 18  ? 11.610  -12.956 -20.943 1.00 24.75 ? 99  LYS A C   1 
ATOM   146  O O   . LYS A 1 18  ? 11.231  -13.941 -20.308 1.00 25.02 ? 99  LYS A O   1 
ATOM   147  C CB  . LYS A 1 18  ? 10.116  -12.293 -22.860 1.00 22.17 ? 99  LYS A CB  1 
ATOM   148  C CG  . LYS A 1 18  ? 10.000  -12.124 -24.355 1.00 20.53 ? 99  LYS A CG  1 
ATOM   149  C CD  . LYS A 1 18  ? 8.710   -11.456 -24.755 1.00 18.86 ? 99  LYS A CD  1 
ATOM   150  C CE  . LYS A 1 18  ? 8.608   -11.393 -26.259 1.00 18.61 ? 99  LYS A CE  1 
ATOM   151  N NZ  . LYS A 1 18  ? 7.395   -10.660 -26.693 1.00 19.82 ? 99  LYS A NZ  1 
ATOM   152  N N   . PRO A 1 19  ? 12.178  -11.907 -20.329 1.00 25.56 ? 100 PRO A N   1 
ATOM   153  C CA  . PRO A 1 19  ? 12.381  -11.849 -18.884 1.00 25.99 ? 100 PRO A CA  1 
ATOM   154  C C   . PRO A 1 19  ? 11.162  -12.284 -18.057 1.00 26.01 ? 100 PRO A C   1 
ATOM   155  O O   . PRO A 1 19  ? 11.285  -13.150 -17.194 1.00 26.66 ? 100 PRO A O   1 
ATOM   156  C CB  . PRO A 1 19  ? 12.778  -10.392 -18.655 1.00 26.46 ? 100 PRO A CB  1 
ATOM   157  C CG  . PRO A 1 19  ? 13.564  -10.093 -19.886 1.00 26.46 ? 100 PRO A CG  1 
ATOM   158  C CD  . PRO A 1 19  ? 12.741  -10.695 -20.990 1.00 25.86 ? 100 PRO A CD  1 
ATOM   159  N N   . TYR A 1 20  ? 9.985   -11.714 -18.326 1.00 25.44 ? 101 TYR A N   1 
ATOM   160  C CA  . TYR A 1 20  ? 8.788   -12.045 -17.539 1.00 23.68 ? 101 TYR A CA  1 
ATOM   161  C C   . TYR A 1 20  ? 8.484   -13.553 -17.542 1.00 23.13 ? 101 TYR A C   1 
ATOM   162  O O   . TYR A 1 20  ? 8.093   -14.102 -16.508 1.00 22.63 ? 101 TYR A O   1 
ATOM   163  C CB  . TYR A 1 20  ? 7.554   -11.257 -18.053 1.00 22.77 ? 101 TYR A CB  1 
ATOM   164  C CG  . TYR A 1 20  ? 6.803   -11.908 -19.198 1.00 19.84 ? 101 TYR A CG  1 
ATOM   165  C CD1 . TYR A 1 20  ? 7.160   -11.677 -20.520 1.00 18.12 ? 101 TYR A CD1 1 
ATOM   166  C CD2 . TYR A 1 20  ? 5.766   -12.806 -18.943 1.00 19.28 ? 101 TYR A CD2 1 
ATOM   167  C CE1 . TYR A 1 20  ? 6.509   -12.327 -21.555 1.00 17.94 ? 101 TYR A CE1 1 
ATOM   168  C CE2 . TYR A 1 20  ? 5.115   -13.462 -19.976 1.00 17.67 ? 101 TYR A CE2 1 
ATOM   169  C CZ  . TYR A 1 20  ? 5.491   -13.221 -21.269 1.00 16.25 ? 101 TYR A CZ  1 
ATOM   170  O OH  . TYR A 1 20  ? 4.878   -13.890 -22.278 1.00 16.96 ? 101 TYR A OH  1 
ATOM   171  N N   . PHE A 1 21  ? 8.678   -14.213 -18.701 1.00 22.25 ? 102 PHE A N   1 
ATOM   172  C CA  . PHE A 1 21  ? 8.356   -15.629 -18.829 1.00 22.26 ? 102 PHE A CA  1 
ATOM   173  C C   . PHE A 1 21  ? 9.380   -16.509 -18.121 1.00 22.87 ? 102 PHE A C   1 
ATOM   174  O O   . PHE A 1 21  ? 9.017   -17.467 -17.433 1.00 22.75 ? 102 PHE A O   1 
ATOM   175  C CB  . PHE A 1 21  ? 8.252   -16.019 -20.292 1.00 22.28 ? 102 PHE A CB  1 
ATOM   176  C CG  . PHE A 1 21  ? 7.568   -17.327 -20.483 1.00 22.82 ? 102 PHE A CG  1 
ATOM   177  C CD1 . PHE A 1 21  ? 6.190   -17.385 -20.617 1.00 23.07 ? 102 PHE A CD1 1 
ATOM   178  C CD2 . PHE A 1 21  ? 8.297   -18.510 -20.506 1.00 23.24 ? 102 PHE A CD2 1 
ATOM   179  C CE1 . PHE A 1 21  ? 5.543   -18.603 -20.771 1.00 22.94 ? 102 PHE A CE1 1 
ATOM   180  C CE2 . PHE A 1 21  ? 7.654   -19.730 -20.659 1.00 23.46 ? 102 PHE A CE2 1 
ATOM   181  C CZ  . PHE A 1 21  ? 6.274   -19.776 -20.793 1.00 23.17 ? 102 PHE A CZ  1 
ATOM   182  N N   . ILE A 1 22  ? 10.655  -16.178 -18.284 1.00 23.19 ? 103 ILE A N   1 
ATOM   183  C CA  . ILE A 1 22  ? 11.714  -16.903 -17.601 1.00 23.78 ? 103 ILE A CA  1 
ATOM   184  C C   . ILE A 1 22  ? 11.534  -16.770 -16.077 1.00 24.24 ? 103 ILE A C   1 
ATOM   185  O O   . ILE A 1 22  ? 11.674  -17.751 -15.331 1.00 24.58 ? 103 ILE A O   1 
ATOM   186  C CB  . ILE A 1 22  ? 13.092  -16.370 -18.088 1.00 24.66 ? 103 ILE A CB  1 
ATOM   187  C CG1 . ILE A 1 22  ? 13.348  -16.922 -19.491 1.00 24.23 ? 103 ILE A CG1 1 
ATOM   188  C CG2 . ILE A 1 22  ? 14.220  -16.751 -17.143 1.00 24.80 ? 103 ILE A CG2 1 
ATOM   189  C CD1 . ILE A 1 22  ? 14.352  -16.127 -20.283 1.00 26.23 ? 103 ILE A CD1 1 
ATOM   190  N N   . LYS A 1 23  ? 11.171  -15.572 -15.614 1.00 24.52 ? 104 LYS A N   1 
ATOM   191  C CA  . LYS A 1 23  ? 10.897  -15.362 -14.192 1.00 25.83 ? 104 LYS A CA  1 
ATOM   192  C C   . LYS A 1 23  ? 9.696   -16.203 -13.750 1.00 25.16 ? 104 LYS A C   1 
ATOM   193  O O   . LYS A 1 23  ? 9.718   -16.851 -12.705 1.00 25.36 ? 104 LYS A O   1 
ATOM   194  C CB  . LYS A 1 23  ? 10.599  -13.885 -13.909 1.00 29.01 ? 104 LYS A CB  1 
ATOM   195  C CG  . LYS A 1 23  ? 11.793  -13.052 -13.453 1.00 34.15 ? 104 LYS A CG  1 
ATOM   196  C CD  . LYS A 1 23  ? 12.762  -12.733 -14.595 1.00 36.89 ? 104 LYS A CD  1 
ATOM   197  C CE  . LYS A 1 23  ? 13.870  -11.754 -14.160 1.00 38.76 ? 104 LYS A CE  1 
ATOM   198  N NZ  . LYS A 1 23  ? 14.759  -11.329 -15.298 1.00 38.50 ? 104 LYS A NZ  1 
ATOM   199  N N   . LEU A 1 24  ? 8.648   -16.175 -14.562 1.00 23.65 ? 105 LEU A N   1 
ATOM   200  C CA  . LEU A 1 24  ? 7.441   -16.935 -14.292 1.00 23.10 ? 105 LEU A CA  1 
ATOM   201  C C   . LEU A 1 24  ? 7.730   -18.432 -14.135 1.00 23.79 ? 105 LEU A C   1 
ATOM   202  O O   . LEU A 1 24  ? 7.274   -19.056 -13.166 1.00 23.43 ? 105 LEU A O   1 
ATOM   203  C CB  . LEU A 1 24  ? 6.453   -16.715 -15.437 1.00 22.62 ? 105 LEU A CB  1 
ATOM   204  C CG  . LEU A 1 24  ? 5.227   -17.624 -15.478 1.00 22.32 ? 105 LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 24  ? 4.354   -17.392 -14.244 1.00 22.28 ? 105 LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 24  ? 4.462   -17.382 -16.773 1.00 20.93 ? 105 LEU A CD2 1 
ATOM   207  N N   . MET A 1 25  ? 8.465   -19.015 -15.095 1.00 24.33 ? 106 MET A N   1 
ATOM   208  C CA  . MET A 1 25  ? 8.811   -20.439 -15.011 1.00 25.94 ? 106 MET A CA  1 
ATOM   209  C C   . MET A 1 25  ? 9.596   -20.726 -13.737 1.00 25.72 ? 106 MET A C   1 
ATOM   210  O O   . MET A 1 25  ? 9.382   -21.751 -13.087 1.00 25.56 ? 106 MET A O   1 
ATOM   211  C CB  . MET A 1 25  ? 9.601   -20.910 -16.243 1.00 27.71 ? 106 MET A CB  1 
ATOM   212  C CG  . MET A 1 25  ? 8.766   -21.030 -17.515 1.00 31.46 ? 106 MET A CG  1 
ATOM   213  S SD  . MET A 1 25  ? 7.308   -22.113 -17.336 1.00 37.60 ? 106 MET A SD  1 
ATOM   214  C CE  . MET A 1 25  ? 5.967   -20.943 -17.502 1.00 34.83 ? 106 MET A CE  1 
ATOM   215  N N   . GLY A 1 26  ? 10.483  -19.803 -13.364 1.00 26.01 ? 107 GLY A N   1 
ATOM   216  C CA  . GLY A 1 26  ? 11.230  -19.958 -12.130 1.00 25.81 ? 107 GLY A CA  1 
ATOM   217  C C   . GLY A 1 26  ? 10.312  -19.946 -10.917 1.00 25.85 ? 107 GLY A C   1 
ATOM   218  O O   . GLY A 1 26  ? 10.440  -20.788 -10.028 1.00 26.14 ? 107 GLY A O   1 
ATOM   219  N N   . PHE A 1 27  ? 9.375   -18.993 -10.894 1.00 25.26 ? 108 PHE A N   1 
ATOM   220  C CA  . PHE A 1 27  ? 8.402   -18.881 -9.808  1.00 24.61 ? 108 PHE A CA  1 
ATOM   221  C C   . PHE A 1 27  ? 7.568   -20.175 -9.653  1.00 24.31 ? 108 PHE A C   1 
ATOM   222  O O   . PHE A 1 27  ? 7.380   -20.687 -8.537  1.00 23.59 ? 108 PHE A O   1 
ATOM   223  C CB  . PHE A 1 27  ? 7.469   -17.689 -10.088 1.00 25.17 ? 108 PHE A CB  1 
ATOM   224  C CG  . PHE A 1 27  ? 6.249   -17.652 -9.210  1.00 25.01 ? 108 PHE A CG  1 
ATOM   225  C CD1 . PHE A 1 27  ? 6.352   -17.314 -7.862  1.00 25.40 ? 108 PHE A CD1 1 
ATOM   226  C CD2 . PHE A 1 27  ? 5.009   -18.017 -9.716  1.00 25.16 ? 108 PHE A CD2 1 
ATOM   227  C CE1 . PHE A 1 27  ? 5.244   -17.349 -7.035  1.00 26.11 ? 108 PHE A CE1 1 
ATOM   228  C CE2 . PHE A 1 27  ? 3.893   -18.056 -8.897  1.00 25.94 ? 108 PHE A CE2 1 
ATOM   229  C CZ  . PHE A 1 27  ? 4.009   -17.722 -7.553  1.00 27.46 ? 108 PHE A CZ  1 
ATOM   230  N N   . VAL A 1 28  ? 7.049   -20.686 -10.777 1.00 23.77 ? 109 VAL A N   1 
ATOM   231  C CA  . VAL A 1 28  ? 6.249   -21.901 -10.752 1.00 23.63 ? 109 VAL A CA  1 
ATOM   232  C C   . VAL A 1 28  ? 7.090   -23.097 -10.276 1.00 24.87 ? 109 VAL A C   1 
ATOM   233  O O   . VAL A 1 28  ? 6.612   -23.925 -9.491  1.00 24.28 ? 109 VAL A O   1 
ATOM   234  C CB  . VAL A 1 28  ? 5.638   -22.189 -12.148 1.00 23.41 ? 109 VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 28  ? 4.903   -23.529 -12.149 1.00 22.48 ? 109 VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 28  ? 4.691   -21.052 -12.536 1.00 21.28 ? 109 VAL A CG2 1 
ATOM   237  N N   . ALA A 1 29  ? 8.354   -23.171 -10.732 1.00 26.09 ? 110 ALA A N   1 
ATOM   238  C CA  . ALA A 1 29  ? 9.251   -24.253 -10.310 1.00 27.40 ? 110 ALA A CA  1 
ATOM   239  C C   . ALA A 1 29  ? 9.464   -24.206 -8.796  1.00 28.12 ? 110 ALA A C   1 
ATOM   240  O O   . ALA A 1 29  ? 9.401   -25.233 -8.121  1.00 28.58 ? 110 ALA A O   1 
ATOM   241  C CB  . ALA A 1 29  ? 10.582  -24.157 -11.035 1.00 26.73 ? 110 ALA A CB  1 
ATOM   242  N N   . GLU A 1 30  ? 9.684   -23.006 -8.271  1.00 29.00 ? 111 GLU A N   1 
ATOM   243  C CA  . GLU A 1 30  ? 9.873   -22.813 -6.831  1.00 30.46 ? 111 GLU A CA  1 
ATOM   244  C C   . GLU A 1 30  ? 8.623   -23.234 -6.055  1.00 29.86 ? 111 GLU A C   1 
ATOM   245  O O   . GLU A 1 30  ? 8.704   -23.904 -5.015  1.00 30.40 ? 111 GLU A O   1 
ATOM   246  C CB  . GLU A 1 30  ? 10.193  -21.338 -6.553  1.00 32.21 ? 111 GLU A CB  1 
ATOM   247  C CG  . GLU A 1 30  ? 10.649  -21.043 -5.136  1.00 36.32 ? 111 GLU A CG  1 
ATOM   248  C CD  . GLU A 1 30  ? 11.842  -21.892 -4.716  1.00 38.42 ? 111 GLU A CD  1 
ATOM   249  O OE1 . GLU A 1 30  ? 12.807  -22.041 -5.514  1.00 39.57 ? 111 GLU A OE1 1 
ATOM   250  O OE2 . GLU A 1 30  ? 11.814  -22.415 -3.588  1.00 40.34 ? 111 GLU A OE2 1 
ATOM   251  N N   . GLU A 1 31  ? 7.469   -22.830 -6.568  1.00 28.79 ? 112 GLU A N   1 
ATOM   252  C CA  . GLU A 1 31  ? 6.206   -23.180 -5.963  1.00 27.51 ? 112 GLU A CA  1 
ATOM   253  C C   . GLU A 1 31  ? 6.020   -24.698 -5.892  1.00 26.91 ? 112 GLU A C   1 
ATOM   254  O O   . GLU A 1 31  ? 5.572   -25.219 -4.882  1.00 27.16 ? 112 GLU A O   1 
ATOM   255  C CB  . GLU A 1 31  ? 5.073   -22.533 -6.757  1.00 27.42 ? 112 GLU A CB  1 
ATOM   256  C CG  . GLU A 1 31  ? 4.955   -21.034 -6.549  1.00 26.98 ? 112 GLU A CG  1 
ATOM   257  C CD  . GLU A 1 31  ? 4.171   -20.700 -5.299  1.00 27.72 ? 112 GLU A CD  1 
ATOM   258  O OE1 . GLU A 1 31  ? 3.006   -21.092 -5.219  1.00 27.37 ? 112 GLU A OE1 1 
ATOM   259  O OE2 . GLU A 1 31  ? 4.719   -20.053 -4.394  1.00 29.42 ? 112 GLU A OE2 1 
ATOM   260  N N   . ARG A 1 32  ? 6.385   -25.407 -6.948  1.00 26.27 ? 113 ARG A N   1 
ATOM   261  C CA  . ARG A 1 32  ? 6.227   -26.863 -6.968  1.00 26.66 ? 113 ARG A CA  1 
ATOM   262  C C   . ARG A 1 32  ? 7.176   -27.587 -5.981  1.00 28.03 ? 113 ARG A C   1 
ATOM   263  O O   . ARG A 1 32  ? 7.001   -28.763 -5.684  1.00 27.39 ? 113 ARG A O   1 
ATOM   264  C CB  . ARG A 1 32  ? 6.432   -27.401 -8.388  1.00 25.31 ? 113 ARG A CB  1 
ATOM   265  C CG  . ARG A 1 32  ? 5.346   -27.017 -9.392  1.00 23.01 ? 113 ARG A CG  1 
ATOM   266  C CD  . ARG A 1 32  ? 5.409   -27.913 -10.621 1.00 20.80 ? 113 ARG A CD  1 
ATOM   267  N NE  . ARG A 1 32  ? 4.568   -27.439 -11.710 1.00 20.41 ? 113 ARG A NE  1 
ATOM   268  C CZ  . ARG A 1 32  ? 3.266   -27.724 -11.813 1.00 21.22 ? 113 ARG A CZ  1 
ATOM   269  N NH1 . ARG A 1 32  ? 2.675   -28.482 -10.898 1.00 19.44 ? 113 ARG A NH1 1 
ATOM   270  N NH2 . ARG A 1 32  ? 2.558   -27.248 -12.842 1.00 19.94 ? 113 ARG A NH2 1 
ATOM   271  N N   . LYS A 1 33  ? 8.188   -26.889 -5.491  1.00 30.24 ? 114 LYS A N   1 
ATOM   272  C CA  . LYS A 1 33  ? 9.092   -27.476 -4.504  1.00 32.56 ? 114 LYS A CA  1 
ATOM   273  C C   . LYS A 1 33  ? 8.423   -27.498 -3.139  1.00 32.78 ? 114 LYS A C   1 
ATOM   274  O O   . LYS A 1 33  ? 8.622   -28.414 -2.342  1.00 33.56 ? 114 LYS A O   1 
ATOM   275  C CB  . LYS A 1 33  ? 10.385  -26.654 -4.404  1.00 34.11 ? 114 LYS A CB  1 
ATOM   276  C CG  . LYS A 1 33  ? 11.232  -26.651 -5.669  1.00 37.18 ? 114 LYS A CG  1 
ATOM   277  C CD  . LYS A 1 33  ? 12.431  -25.706 -5.543  1.00 39.45 ? 114 LYS A CD  1 
ATOM   278  C CE  . LYS A 1 33  ? 13.160  -25.535 -6.881  1.00 41.08 ? 114 LYS A CE  1 
ATOM   279  N NZ  . LYS A 1 33  ? 14.204  -24.466 -6.830  1.00 42.01 ? 114 LYS A NZ  1 
ATOM   280  N N   . HIS A 1 34  ? 7.609   -26.482 -2.891  1.00 32.95 ? 115 HIS A N   1 
ATOM   281  C CA  . HIS A 1 34  ? 6.997   -26.298 -1.586  1.00 32.81 ? 115 HIS A CA  1 
ATOM   282  C C   . HIS A 1 34  ? 5.498   -26.589 -1.541  1.00 32.09 ? 115 HIS A C   1 
ATOM   283  O O   . HIS A 1 34  ? 4.948   -26.746 -0.453  1.00 32.39 ? 115 HIS A O   1 
ATOM   284  C CB  . HIS A 1 34  ? 7.257   -24.862 -1.130  1.00 34.80 ? 115 HIS A CB  1 
ATOM   285  C CG  . HIS A 1 34  ? 8.713   -24.539 -1.115  1.00 36.92 ? 115 HIS A CG  1 
ATOM   286  N ND1 . HIS A 1 34  ? 9.539   -25.010 -0.109  1.00 37.73 ? 115 HIS A ND1 1 
ATOM   287  C CD2 . HIS A 1 34  ? 9.454   -23.886 -2.050  1.00 37.91 ? 115 HIS A CD2 1 
ATOM   288  C CE1 . HIS A 1 34  ? 10.761  -24.648 -0.449  1.00 38.27 ? 115 HIS A CE1 1 
ATOM   289  N NE2 . HIS A 1 34  ? 10.738  -23.978 -1.602  1.00 38.40 ? 115 HIS A NE2 1 
ATOM   290  N N   . TYR A 1 35  ? 4.828   -26.649 -2.699  1.00 30.99 ? 116 TYR A N   1 
ATOM   291  C CA  . TYR A 1 35  ? 3.372   -26.860 -2.720  1.00 30.34 ? 116 TYR A CA  1 
ATOM   292  C C   . TYR A 1 35  ? 2.943   -27.818 -3.809  1.00 28.35 ? 116 TYR A C   1 
ATOM   293  O O   . TYR A 1 35  ? 3.731   -28.210 -4.667  1.00 28.46 ? 116 TYR A O   1 
ATOM   294  C CB  . TYR A 1 35  ? 2.624   -25.541 -2.973  1.00 31.60 ? 116 TYR A CB  1 
ATOM   295  C CG  . TYR A 1 35  ? 2.899   -24.478 -1.970  1.00 34.47 ? 116 TYR A CG  1 
ATOM   296  C CD1 . TYR A 1 35  ? 3.988   -23.613 -2.125  1.00 35.83 ? 116 TYR A CD1 1 
ATOM   297  C CD2 . TYR A 1 35  ? 2.109   -24.363 -0.833  1.00 36.09 ? 116 TYR A CD2 1 
ATOM   298  C CE1 . TYR A 1 35  ? 4.289   -22.662 -1.163  1.00 37.87 ? 116 TYR A CE1 1 
ATOM   299  C CE2 . TYR A 1 35  ? 2.398   -23.415 0.139   1.00 38.58 ? 116 TYR A CE2 1 
ATOM   300  C CZ  . TYR A 1 35  ? 3.489   -22.570 -0.029  1.00 39.26 ? 116 TYR A CZ  1 
ATOM   301  O OH  . TYR A 1 35  ? 3.789   -21.646 0.947   1.00 42.36 ? 116 TYR A OH  1 
ATOM   302  N N   . THR A 1 36  ? 1.690   -28.213 -3.741  1.00 26.10 ? 117 THR A N   1 
ATOM   303  C CA  . THR A 1 36  ? 1.090   -28.926 -4.830  1.00 24.98 ? 117 THR A CA  1 
ATOM   304  C C   . THR A 1 36  ? 0.486   -27.855 -5.742  1.00 23.71 ? 117 THR A C   1 
ATOM   305  O O   . THR A 1 36  ? -0.299  -27.007 -5.279  1.00 23.97 ? 117 THR A O   1 
ATOM   306  C CB  . THR A 1 36  ? -0.006  -29.873 -4.335  1.00 26.12 ? 117 THR A CB  1 
ATOM   307  O OG1 . THR A 1 36  ? 0.589   -30.850 -3.473  1.00 28.07 ? 117 THR A OG1 1 
ATOM   308  C CG2 . THR A 1 36  ? -0.683  -30.580 -5.502  1.00 26.34 ? 117 THR A CG2 1 
ATOM   309  N N   . VAL A 1 37  ? 0.913   -27.845 -7.000  1.00 21.33 ? 118 VAL A N   1 
ATOM   310  C CA  . VAL A 1 37  ? 0.428   -26.871 -7.972  1.00 18.89 ? 118 VAL A CA  1 
ATOM   311  C C   . VAL A 1 37  ? -0.370  -27.582 -9.068  1.00 18.42 ? 118 VAL A C   1 
ATOM   312  O O   . VAL A 1 37  ? 0.017   -28.656 -9.539  1.00 18.71 ? 118 VAL A O   1 
ATOM   313  C CB  . VAL A 1 37  ? 1.621   -26.085 -8.587  1.00 18.40 ? 118 VAL A CB  1 
ATOM   314  C CG1 . VAL A 1 37  ? 1.172   -25.199 -9.733  1.00 17.21 ? 118 VAL A CG1 1 
ATOM   315  C CG2 . VAL A 1 37  ? 2.286   -25.238 -7.509  1.00 18.38 ? 118 VAL A CG2 1 
ATOM   316  N N   . TYR A 1 38  ? -1.522  -27.017 -9.424  1.00 17.50 ? 119 TYR A N   1 
ATOM   317  C CA  . TYR A 1 38  ? -2.331  -27.574 -10.489 1.00 16.27 ? 119 TYR A CA  1 
ATOM   318  C C   . TYR A 1 38  ? -2.345  -26.617 -11.682 1.00 15.45 ? 119 TYR A C   1 
ATOM   319  O O   . TYR A 1 38  ? -2.217  -25.404 -11.511 1.00 15.53 ? 119 TYR A O   1 
ATOM   320  C CB  . TYR A 1 38  ? -3.764  -27.780 -10.018 1.00 17.42 ? 119 TYR A CB  1 
ATOM   321  C CG  . TYR A 1 38  ? -3.918  -28.701 -8.831  1.00 19.40 ? 119 TYR A CG  1 
ATOM   322  C CD1 . TYR A 1 38  ? -3.258  -29.935 -8.768  1.00 19.41 ? 119 TYR A CD1 1 
ATOM   323  C CD2 . TYR A 1 38  ? -4.742  -28.327 -7.766  1.00 20.64 ? 119 TYR A CD2 1 
ATOM   324  C CE1 . TYR A 1 38  ? -3.420  -30.772 -7.665  1.00 20.84 ? 119 TYR A CE1 1 
ATOM   325  C CE2 . TYR A 1 38  ? -4.907  -29.149 -6.667  1.00 21.82 ? 119 TYR A CE2 1 
ATOM   326  C CZ  . TYR A 1 38  ? -4.246  -30.367 -6.616  1.00 22.12 ? 119 TYR A CZ  1 
ATOM   327  O OH  . TYR A 1 38  ? -4.394  -31.161 -5.503  1.00 23.87 ? 119 TYR A OH  1 
ATOM   328  N N   . PRO A 1 39  ? -2.439  -27.135 -12.906 1.00 14.23 ? 120 PRO A N   1 
ATOM   329  C CA  . PRO A 1 39  ? -2.502  -28.576 -13.190 1.00 14.77 ? 120 PRO A CA  1 
ATOM   330  C C   . PRO A 1 39  ? -1.106  -29.184 -13.062 1.00 16.19 ? 120 PRO A C   1 
ATOM   331  O O   . PRO A 1 39  ? -0.123  -28.457 -12.858 1.00 16.23 ? 120 PRO A O   1 
ATOM   332  C CB  . PRO A 1 39  ? -2.941  -28.634 -14.663 1.00 13.35 ? 120 PRO A CB  1 
ATOM   333  C CG  . PRO A 1 39  ? -3.399  -27.252 -14.970 1.00 14.46 ? 120 PRO A CG  1 
ATOM   334  C CD  . PRO A 1 39  ? -2.537  -26.357 -14.139 1.00 13.31 ? 120 PRO A CD  1 
ATOM   335  N N   . PRO A 1 40  ? -0.972  -30.519 -13.111 1.00 17.68 ? 121 PRO A N   1 
ATOM   336  C CA  . PRO A 1 40  ? 0.358   -31.137 -13.068 1.00 17.81 ? 121 PRO A CA  1 
ATOM   337  C C   . PRO A 1 40  ? 1.146   -30.611 -14.307 1.00 18.06 ? 121 PRO A C   1 
ATOM   338  O O   . PRO A 1 40  ? 0.535   -30.163 -15.291 1.00 17.37 ? 121 PRO A O   1 
ATOM   339  C CB  . PRO A 1 40  ? 0.057   -32.651 -13.115 1.00 17.15 ? 121 PRO A CB  1 
ATOM   340  C CG  . PRO A 1 40  ? -1.320  -32.730 -13.689 1.00 18.84 ? 121 PRO A CG  1 
ATOM   341  C CD  . PRO A 1 40  ? -2.051  -31.531 -13.135 1.00 17.53 ? 121 PRO A CD  1 
ATOM   342  N N   . PRO A 1 41  ? 2.493   -30.688 -14.314 1.00 19.24 ? 122 PRO A N   1 
ATOM   343  C CA  . PRO A 1 41  ? 3.321   -30.174 -15.423 1.00 18.19 ? 122 PRO A CA  1 
ATOM   344  C C   . PRO A 1 41  ? 2.852   -30.540 -16.826 1.00 17.77 ? 122 PRO A C   1 
ATOM   345  O O   . PRO A 1 41  ? 2.815   -29.675 -17.705 1.00 18.72 ? 122 PRO A O   1 
ATOM   346  C CB  . PRO A 1 41  ? 4.702   -30.740 -15.117 1.00 18.21 ? 122 PRO A CB  1 
ATOM   347  C CG  . PRO A 1 41  ? 4.706   -30.786 -13.633 1.00 18.95 ? 122 PRO A CG  1 
ATOM   348  C CD  . PRO A 1 41  ? 3.349   -31.322 -13.275 1.00 18.56 ? 122 PRO A CD  1 
ATOM   349  N N   . HIS A 1 42  ? 2.467   -31.798 -17.040 1.00 17.23 ? 123 HIS A N   1 
ATOM   350  C CA  . HIS A 1 42  ? 2.110   -32.248 -18.387 1.00 16.84 ? 123 HIS A CA  1 
ATOM   351  C C   . HIS A 1 42  ? 0.755   -31.720 -18.880 1.00 16.97 ? 123 HIS A C   1 
ATOM   352  O O   . HIS A 1 42  ? 0.398   -31.934 -20.044 1.00 16.82 ? 123 HIS A O   1 
ATOM   353  C CB  . HIS A 1 42  ? 2.132   -33.783 -18.467 1.00 17.12 ? 123 HIS A CB  1 
ATOM   354  C CG  . HIS A 1 42  ? 1.052   -34.470 -17.689 1.00 17.57 ? 123 HIS A CG  1 
ATOM   355  N ND1 . HIS A 1 42  ? 1.017   -34.431 -16.306 1.00 18.48 ? 123 HIS A ND1 1 
ATOM   356  C CD2 . HIS A 1 42  ? 0.039   -35.267 -18.147 1.00 18.62 ? 123 HIS A CD2 1 
ATOM   357  C CE1 . HIS A 1 42  ? 0.004   -35.208 -15.944 1.00 18.52 ? 123 HIS A CE1 1 
ATOM   358  N NE2 . HIS A 1 42  ? -0.595  -35.717 -17.026 1.00 18.47 ? 123 HIS A NE2 1 
ATOM   359  N N   . GLN A 1 43  ? 0.000   -31.041 -18.016 1.00 16.37 ? 124 GLN A N   1 
ATOM   360  C CA  . GLN A 1 43  ? -1.318  -30.542 -18.414 1.00 16.36 ? 124 GLN A CA  1 
ATOM   361  C C   . GLN A 1 43  ? -1.450  -29.023 -18.366 1.00 16.36 ? 124 GLN A C   1 
ATOM   362  O O   . GLN A 1 43  ? -2.536  -28.501 -18.622 1.00 16.06 ? 124 GLN A O   1 
ATOM   363  C CB  . GLN A 1 43  ? -2.398  -31.177 -17.552 1.00 16.46 ? 124 GLN A CB  1 
ATOM   364  C CG  . GLN A 1 43  ? -2.647  -32.634 -17.889 1.00 17.22 ? 124 GLN A CG  1 
ATOM   365  C CD  . GLN A 1 43  ? -3.674  -33.261 -16.982 1.00 18.46 ? 124 GLN A CD  1 
ATOM   366  O OE1 . GLN A 1 43  ? -3.787  -32.889 -15.807 1.00 20.77 ? 124 GLN A OE1 1 
ATOM   367  N NE2 . GLN A 1 43  ? -4.422  -34.216 -17.515 1.00 18.96 ? 124 GLN A NE2 1 
ATOM   368  N N   . VAL A 1 44  ? -0.364  -28.308 -18.071 1.00 15.59 ? 125 VAL A N   1 
ATOM   369  C CA  . VAL A 1 44  ? -0.434  -26.850 -18.042 1.00 15.23 ? 125 VAL A CA  1 
ATOM   370  C C   . VAL A 1 44  ? -0.774  -26.281 -19.431 1.00 15.14 ? 125 VAL A C   1 
ATOM   371  O O   . VAL A 1 44  ? -1.486  -25.274 -19.545 1.00 14.54 ? 125 VAL A O   1 
ATOM   372  C CB  . VAL A 1 44  ? 0.884   -26.243 -17.516 1.00 14.64 ? 125 VAL A CB  1 
ATOM   373  C CG1 . VAL A 1 44  ? 0.872   -24.719 -17.590 1.00 14.71 ? 125 VAL A CG1 1 
ATOM   374  C CG2 . VAL A 1 44  ? 1.076   -26.695 -16.077 1.00 14.81 ? 125 VAL A CG2 1 
ATOM   375  N N   . PHE A 1 45  ? -0.315  -26.944 -20.487 1.00 14.81 ? 126 PHE A N   1 
ATOM   376  C CA  . PHE A 1 45  ? -0.565  -26.436 -21.847 1.00 15.46 ? 126 PHE A CA  1 
ATOM   377  C C   . PHE A 1 45  ? -1.421  -27.384 -22.686 1.00 15.58 ? 126 PHE A C   1 
ATOM   378  O O   . PHE A 1 45  ? -1.249  -27.472 -23.898 1.00 15.50 ? 126 PHE A O   1 
ATOM   379  C CB  . PHE A 1 45  ? 0.769   -26.153 -22.569 1.00 15.61 ? 126 PHE A CB  1 
ATOM   380  C CG  . PHE A 1 45  ? 1.655   -25.193 -21.830 1.00 16.81 ? 126 PHE A CG  1 
ATOM   381  C CD1 . PHE A 1 45  ? 1.365   -23.831 -21.811 1.00 17.03 ? 126 PHE A CD1 1 
ATOM   382  C CD2 . PHE A 1 45  ? 2.767   -25.651 -21.135 1.00 16.97 ? 126 PHE A CD2 1 
ATOM   383  C CE1 . PHE A 1 45  ? 2.167   -22.943 -21.111 1.00 18.10 ? 126 PHE A CE1 1 
ATOM   384  C CE2 . PHE A 1 45  ? 3.572   -24.771 -20.435 1.00 17.70 ? 126 PHE A CE2 1 
ATOM   385  C CZ  . PHE A 1 45  ? 3.274   -23.413 -20.421 1.00 17.23 ? 126 PHE A CZ  1 
ATOM   386  N N   . THR A 1 46  ? -2.359  -28.076 -22.059 1.00 15.17 ? 127 THR A N   1 
ATOM   387  C CA  . THR A 1 46  ? -3.240  -28.980 -22.792 1.00 15.74 ? 127 THR A CA  1 
ATOM   388  C C   . THR A 1 46  ? -3.923  -28.276 -23.974 1.00 15.99 ? 127 THR A C   1 
ATOM   389  O O   . THR A 1 46  ? -4.153  -28.892 -25.024 1.00 16.83 ? 127 THR A O   1 
ATOM   390  C CB  . THR A 1 46  ? -4.310  -29.541 -21.853 1.00 15.49 ? 127 THR A CB  1 
ATOM   391  O OG1 . THR A 1 46  ? -3.648  -30.188 -20.765 1.00 17.00 ? 127 THR A OG1 1 
ATOM   392  C CG2 . THR A 1 46  ? -5.199  -30.530 -22.573 1.00 14.87 ? 127 THR A CG2 1 
ATOM   393  N N   . TRP A 1 47  ? -4.228  -26.980 -23.793 1.00 15.69 ? 128 TRP A N   1 
ATOM   394  C CA  . TRP A 1 47  ? -4.881  -26.173 -24.827 1.00 16.34 ? 128 TRP A CA  1 
ATOM   395  C C   . TRP A 1 47  ? -4.048  -26.011 -26.098 1.00 16.97 ? 128 TRP A C   1 
ATOM   396  O O   . TRP A 1 47  ? -4.570  -25.522 -27.098 1.00 19.41 ? 128 TRP A O   1 
ATOM   397  C CB  . TRP A 1 47  ? -5.250  -24.787 -24.272 1.00 15.78 ? 128 TRP A CB  1 
ATOM   398  C CG  . TRP A 1 47  ? -4.116  -24.072 -23.597 1.00 15.37 ? 128 TRP A CG  1 
ATOM   399  C CD1 . TRP A 1 47  ? -3.688  -24.246 -22.303 1.00 14.69 ? 128 TRP A CD1 1 
ATOM   400  C CD2 . TRP A 1 47  ? -3.245  -23.079 -24.186 1.00 14.61 ? 128 TRP A CD2 1 
ATOM   401  N NE1 . TRP A 1 47  ? -2.615  -23.424 -22.078 1.00 15.31 ? 128 TRP A NE1 1 
ATOM   402  C CE2 . TRP A 1 47  ? -2.314  -22.695 -23.194 1.00 15.48 ? 128 TRP A CE2 1 
ATOM   403  C CE3 . TRP A 1 47  ? -3.165  -22.476 -25.457 1.00 15.91 ? 128 TRP A CE3 1 
ATOM   404  C CZ2 . TRP A 1 47  ? -1.313  -21.732 -23.424 1.00 15.20 ? 128 TRP A CZ2 1 
ATOM   405  C CZ3 . TRP A 1 47  ? -2.171  -21.520 -25.689 1.00 15.64 ? 128 TRP A CZ3 1 
ATOM   406  C CH2 . TRP A 1 47  ? -1.259  -21.157 -24.676 1.00 14.97 ? 128 TRP A CH2 1 
ATOM   407  N N   . THR A 1 48  ? -2.755  -26.378 -26.046 1.00 16.86 ? 129 THR A N   1 
ATOM   408  C CA  . THR A 1 48  ? -1.867  -26.316 -27.235 1.00 17.05 ? 129 THR A CA  1 
ATOM   409  C C   . THR A 1 48  ? -1.708  -27.709 -27.867 1.00 17.15 ? 129 THR A C   1 
ATOM   410  O O   . THR A 1 48  ? -1.120  -27.856 -28.933 1.00 17.83 ? 129 THR A O   1 
ATOM   411  C CB  . THR A 1 48  ? -0.419  -25.829 -26.890 1.00 16.36 ? 129 THR A CB  1 
ATOM   412  O OG1 . THR A 1 48  ? 0.242   -26.836 -26.101 1.00 16.09 ? 129 THR A OG1 1 
ATOM   413  C CG2 . THR A 1 48  ? -0.408  -24.507 -26.137 1.00 15.45 ? 129 THR A CG2 1 
ATOM   414  N N   . GLN A 1 49  ? -2.206  -28.731 -27.203 1.00 18.42 ? 130 GLN A N   1 
ATOM   415  C CA  . GLN A 1 49  ? -2.002  -30.085 -27.684 1.00 20.28 ? 130 GLN A CA  1 
ATOM   416  C C   . GLN A 1 49  ? -3.186  -30.651 -28.424 1.00 20.96 ? 130 GLN A C   1 
ATOM   417  O O   . GLN A 1 49  ? -3.055  -31.673 -29.096 1.00 21.48 ? 130 GLN A O   1 
ATOM   418  C CB  . GLN A 1 49  ? -1.692  -31.000 -26.512 1.00 21.98 ? 130 GLN A CB  1 
ATOM   419  C CG  . GLN A 1 49  ? -0.423  -30.650 -25.779 1.00 25.02 ? 130 GLN A CG  1 
ATOM   420  C CD  . GLN A 1 49  ? -0.211  -31.565 -24.603 1.00 29.27 ? 130 GLN A CD  1 
ATOM   421  O OE1 . GLN A 1 49  ? 0.896   -32.087 -24.405 1.00 32.24 ? 130 GLN A OE1 1 
ATOM   422  N NE2 . GLN A 1 49  ? -1.272  -31.791 -23.826 1.00 28.79 ? 130 GLN A NE2 1 
ATOM   423  N N   . MET A 1 50  ? -4.319  -29.990 -28.320 1.00 21.06 ? 131 MET A N   1 
ATOM   424  C CA  . MET A 1 50  ? -5.560  -30.539 -28.840 1.00 22.60 ? 131 MET A CA  1 
ATOM   425  C C   . MET A 1 50  ? -5.821  -30.230 -30.312 1.00 22.68 ? 131 MET A C   1 
ATOM   426  O O   . MET A 1 50  ? -6.557  -30.959 -30.976 1.00 22.50 ? 131 MET A O   1 
ATOM   427  C CB  . MET A 1 50  ? -6.714  -30.034 -27.979 1.00 24.53 ? 131 MET A CB  1 
ATOM   428  C CG  . MET A 1 50  ? -6.636  -30.504 -26.537 1.00 27.29 ? 131 MET A CG  1 
ATOM   429  S SD  . MET A 1 50  ? -6.864  -32.278 -26.385 1.00 30.49 ? 131 MET A SD  1 
ATOM   430  C CE  . MET A 1 50  ? -7.316  -32.383 -24.658 1.00 31.27 ? 131 MET A CE  1 
ATOM   431  N N   . CYS A 1 51  ? -5.247  -29.150 -30.811 1.00 22.34 ? 132 CYS A N   1 
ATOM   432  C CA  . CYS A 1 51  ? -5.441  -28.772 -32.190 1.00 22.60 ? 132 CYS A CA  1 
ATOM   433  C C   . CYS A 1 51  ? -4.303  -27.888 -32.649 1.00 22.29 ? 132 CYS A C   1 
ATOM   434  O O   . CYS A 1 51  ? -3.585  -27.311 -31.844 1.00 21.68 ? 132 CYS A O   1 
ATOM   435  C CB  . CYS A 1 51  ? -6.799  -28.047 -32.400 1.00 23.18 ? 132 CYS A CB  1 
ATOM   436  S SG  . CYS A 1 51  ? -6.930  -26.360 -31.746 1.00 25.15 ? 132 CYS A SG  1 
ATOM   437  N N   . ASP A 1 52  ? -4.126  -27.823 -33.943 1.00 22.64 ? 133 ASP A N   1 
ATOM   438  C CA  . ASP A 1 52  ? -3.115  -26.983 -34.526 1.00 24.27 ? 133 ASP A CA  1 
ATOM   439  C C   . ASP A 1 52  ? -3.519  -25.525 -34.305 1.00 24.27 ? 133 ASP A C   1 
ATOM   440  O O   . ASP A 1 52  ? -4.707  -25.197 -34.362 1.00 24.07 ? 133 ASP A O   1 
ATOM   441  C CB  . ASP A 1 52  ? -3.039  -27.300 -36.024 1.00 26.80 ? 133 ASP A CB  1 
ATOM   442  C CG  . ASP A 1 52  ? -1.804  -26.760 -36.700 1.00 28.73 ? 133 ASP A CG  1 
ATOM   443  O OD1 . ASP A 1 52  ? -1.750  -25.542 -36.953 1.00 29.19 ? 133 ASP A OD1 1 
ATOM   444  O OD2 . ASP A 1 52  ? -0.884  -27.561 -36.978 1.00 31.72 ? 133 ASP A OD2 1 
ATOM   445  N N   . ILE A 1 53  ? -2.547  -24.651 -34.074 1.00 24.29 ? 134 ILE A N   1 
ATOM   446  C CA  . ILE A 1 53  ? -2.849  -23.236 -33.840 1.00 24.45 ? 134 ILE A CA  1 
ATOM   447  C C   . ILE A 1 53  ? -3.674  -22.617 -34.977 1.00 25.20 ? 134 ILE A C   1 
ATOM   448  O O   . ILE A 1 53  ? -4.511  -21.760 -34.732 1.00 25.78 ? 134 ILE A O   1 
ATOM   449  C CB  . ILE A 1 53  ? -1.551  -22.397 -33.613 1.00 23.78 ? 134 ILE A CB  1 
ATOM   450  C CG1 . ILE A 1 53  ? -1.907  -20.983 -33.138 1.00 22.70 ? 134 ILE A CG1 1 
ATOM   451  C CG2 . ILE A 1 53  ? -0.720  -22.341 -34.892 1.00 24.03 ? 134 ILE A CG2 1 
ATOM   452  C CD1 . ILE A 1 53  ? -0.723  -20.182 -32.650 1.00 21.83 ? 134 ILE A CD1 1 
ATOM   453  N N   . LYS A 1 54  ? -3.476  -23.058 -36.214 1.00 26.05 ? 135 LYS A N   1 
ATOM   454  C CA  . LYS A 1 54  ? -4.222  -22.442 -37.306 1.00 27.61 ? 135 LYS A CA  1 
ATOM   455  C C   . LYS A 1 54  ? -5.614  -23.020 -37.468 1.00 26.30 ? 135 LYS A C   1 
ATOM   456  O O   . LYS A 1 54  ? -6.377  -22.557 -38.307 1.00 26.36 ? 135 LYS A O   1 
ATOM   457  C CB  . LYS A 1 54  ? -3.437  -22.482 -38.629 1.00 30.63 ? 135 LYS A CB  1 
ATOM   458  C CG  . LYS A 1 54  ? -3.000  -23.854 -39.080 1.00 35.22 ? 135 LYS A CG  1 
ATOM   459  C CD  . LYS A 1 54  ? -3.898  -24.418 -40.174 1.00 39.06 ? 135 LYS A CD  1 
ATOM   460  C CE  . LYS A 1 54  ? -3.271  -25.671 -40.793 1.00 41.94 ? 135 LYS A CE  1 
ATOM   461  N NZ  . LYS A 1 54  ? -4.123  -26.270 -41.866 1.00 44.82 ? 135 LYS A NZ  1 
ATOM   462  N N   . ASP A 1 55  ? -5.951  -24.015 -36.653 1.00 24.50 ? 136 ASP A N   1 
ATOM   463  C CA  . ASP A 1 55  ? -7.290  -24.584 -36.687 1.00 23.32 ? 136 ASP A CA  1 
ATOM   464  C C   . ASP A 1 55  ? -8.204  -23.980 -35.627 1.00 21.18 ? 136 ASP A C   1 
ATOM   465  O O   . ASP A 1 55  ? -9.393  -24.303 -35.572 1.00 20.74 ? 136 ASP A O   1 
ATOM   466  C CB  . ASP A 1 55  ? -7.230  -26.093 -36.531 1.00 25.35 ? 136 ASP A CB  1 
ATOM   467  C CG  . ASP A 1 55  ? -6.695  -26.731 -37.782 1.00 27.60 ? 136 ASP A CG  1 
ATOM   468  O OD1 . ASP A 1 55  ? -7.023  -26.242 -38.881 1.00 29.64 ? 136 ASP A OD1 1 
ATOM   469  O OD2 . ASP A 1 55  ? -5.948  -27.706 -37.676 1.00 29.26 ? 136 ASP A OD2 1 
ATOM   470  N N   . VAL A 1 56  ? -7.648  -23.111 -34.786 1.00 20.14 ? 137 VAL A N   1 
ATOM   471  C CA  . VAL A 1 56  ? -8.442  -22.429 -33.774 1.00 18.69 ? 137 VAL A CA  1 
ATOM   472  C C   . VAL A 1 56  ? -9.508  -21.600 -34.482 1.00 18.99 ? 137 VAL A C   1 
ATOM   473  O O   . VAL A 1 56  ? -9.198  -20.869 -35.440 1.00 19.58 ? 137 VAL A O   1 
ATOM   474  C CB  . VAL A 1 56  ? -7.564  -21.514 -32.903 1.00 17.78 ? 137 VAL A CB  1 
ATOM   475  C CG1 . VAL A 1 56  ? -8.429  -20.698 -31.951 1.00 17.72 ? 137 VAL A CG1 1 
ATOM   476  C CG2 . VAL A 1 56  ? -6.575  -22.360 -32.123 1.00 17.88 ? 137 VAL A CG2 1 
ATOM   477  N N   . LYS A 1 57  ? -10.759 -21.745 -34.049 1.00 17.86 ? 138 LYS A N   1 
ATOM   478  C CA  . LYS A 1 57  ? -11.864 -21.035 -34.672 1.00 17.14 ? 138 LYS A CA  1 
ATOM   479  C C   . LYS A 1 57  ? -12.648 -20.219 -33.662 1.00 15.82 ? 138 LYS A C   1 
ATOM   480  O O   . LYS A 1 57  ? -13.247 -19.198 -33.997 1.00 16.46 ? 138 LYS A O   1 
ATOM   481  C CB  . LYS A 1 57  ? -12.805 -22.040 -35.335 1.00 18.05 ? 138 LYS A CB  1 
ATOM   482  C CG  . LYS A 1 57  ? -12.238 -22.692 -36.574 1.00 20.83 ? 138 LYS A CG  1 
ATOM   483  C CD  . LYS A 1 57  ? -13.288 -23.540 -37.263 1.00 22.60 ? 138 LYS A CD  1 
ATOM   484  C CE  . LYS A 1 57  ? -13.384 -24.920 -36.645 1.00 24.76 ? 138 LYS A CE  1 
ATOM   485  N NZ  . LYS A 1 57  ? -12.122 -25.706 -36.841 1.00 26.65 ? 138 LYS A NZ  1 
ATOM   486  N N   . VAL A 1 58  ? -12.658 -20.692 -32.436 1.00 14.86 ? 139 VAL A N   1 
ATOM   487  C CA  . VAL A 1 58  ? -13.435 -20.075 -31.382 1.00 13.90 ? 139 VAL A CA  1 
ATOM   488  C C   . VAL A 1 58  ? -12.561 -19.986 -30.144 1.00 13.46 ? 139 VAL A C   1 
ATOM   489  O O   . VAL A 1 58  ? -11.826 -20.930 -29.851 1.00 13.72 ? 139 VAL A O   1 
ATOM   490  C CB  . VAL A 1 58  ? -14.675 -20.952 -31.078 1.00 13.52 ? 139 VAL A CB  1 
ATOM   491  C CG1 . VAL A 1 58  ? -15.489 -20.380 -29.930 1.00 14.19 ? 139 VAL A CG1 1 
ATOM   492  C CG2 . VAL A 1 58  ? -15.529 -21.098 -32.335 1.00 13.79 ? 139 VAL A CG2 1 
ATOM   493  N N   . VAL A 1 59  ? -12.632 -18.868 -29.435 1.00 12.89 ? 140 VAL A N   1 
ATOM   494  C CA  . VAL A 1 59  ? -11.842 -18.687 -28.225 1.00 12.73 ? 140 VAL A CA  1 
ATOM   495  C C   . VAL A 1 59  ? -12.756 -18.372 -27.050 1.00 12.94 ? 140 VAL A C   1 
ATOM   496  O O   . VAL A 1 59  ? -13.567 -17.456 -27.123 1.00 13.76 ? 140 VAL A O   1 
ATOM   497  C CB  . VAL A 1 59  ? -10.823 -17.526 -28.380 1.00 12.43 ? 140 VAL A CB  1 
ATOM   498  C CG1 . VAL A 1 59  ? -9.945  -17.434 -27.130 1.00 11.63 ? 140 VAL A CG1 1 
ATOM   499  C CG2 . VAL A 1 59  ? -9.970  -17.724 -29.643 1.00 13.55 ? 140 VAL A CG2 1 
ATOM   500  N N   . ILE A 1 60  ? -12.647 -19.145 -25.985 1.00 12.36 ? 141 ILE A N   1 
ATOM   501  C CA  . ILE A 1 60  ? -13.404 -18.877 -24.764 1.00 13.02 ? 141 ILE A CA  1 
ATOM   502  C C   . ILE A 1 60  ? -12.386 -18.549 -23.687 1.00 12.79 ? 141 ILE A C   1 
ATOM   503  O O   . ILE A 1 60  ? -11.519 -19.367 -23.406 1.00 13.02 ? 141 ILE A O   1 
ATOM   504  C CB  . ILE A 1 60  ? -14.235 -20.105 -24.323 1.00 12.36 ? 141 ILE A CB  1 
ATOM   505  C CG1 . ILE A 1 60  ? -15.205 -20.523 -25.436 1.00 13.67 ? 141 ILE A CG1 1 
ATOM   506  C CG2 . ILE A 1 60  ? -14.996 -19.776 -23.049 1.00 13.95 ? 141 ILE A CG2 1 
ATOM   507  C CD1 . ILE A 1 60  ? -16.003 -21.774 -25.133 1.00 13.95 ? 141 ILE A CD1 1 
ATOM   508  N N   . LEU A 1 61  ? -12.457 -17.349 -23.126 1.00 13.68 ? 142 LEU A N   1 
ATOM   509  C CA  . LEU A 1 61  ? -11.474 -16.925 -22.145 1.00 14.61 ? 142 LEU A CA  1 
ATOM   510  C C   . LEU A 1 61  ? -11.950 -17.179 -20.731 1.00 15.41 ? 142 LEU A C   1 
ATOM   511  O O   . LEU A 1 61  ? -13.090 -16.841 -20.383 1.00 16.20 ? 142 LEU A O   1 
ATOM   512  C CB  . LEU A 1 61  ? -11.163 -15.440 -22.311 1.00 14.98 ? 142 LEU A CB  1 
ATOM   513  C CG  . LEU A 1 61  ? -10.531 -15.014 -23.634 1.00 16.57 ? 142 LEU A CG  1 
ATOM   514  C CD1 . LEU A 1 61  ? -10.291 -13.512 -23.625 1.00 18.51 ? 142 LEU A CD1 1 
ATOM   515  C CD2 . LEU A 1 61  ? -9.225  -15.763 -23.866 1.00 17.38 ? 142 LEU A CD2 1 
ATOM   516  N N   . GLY A 1 62  ? -11.070 -17.795 -19.938 1.00 15.64 ? 143 GLY A N   1 
ATOM   517  C CA  . GLY A 1 62  ? -11.334 -18.048 -18.537 1.00 15.34 ? 143 GLY A CA  1 
ATOM   518  C C   . GLY A 1 62  ? -10.374 -17.236 -17.686 1.00 16.28 ? 143 GLY A C   1 
ATOM   519  O O   . GLY A 1 62  ? -9.552  -16.480 -18.221 1.00 16.47 ? 143 GLY A O   1 
ATOM   520  N N   . GLN A 1 63  ? -10.455 -17.386 -16.372 1.00 17.21 ? 144 GLN A N   1 
ATOM   521  C CA  . GLN A 1 63  ? -9.597  -16.611 -15.471 1.00 19.20 ? 144 GLN A CA  1 
ATOM   522  C C   . GLN A 1 63  ? -8.514  -17.456 -14.782 1.00 19.43 ? 144 GLN A C   1 
ATOM   523  O O   . GLN A 1 63  ? -7.340  -17.363 -15.128 1.00 20.72 ? 144 GLN A O   1 
ATOM   524  C CB  . GLN A 1 63  ? -10.458 -15.900 -14.408 1.00 20.42 ? 144 GLN A CB  1 
ATOM   525  C CG  . GLN A 1 63  ? -9.675  -14.972 -13.475 1.00 23.47 ? 144 GLN A CG  1 
ATOM   526  C CD  . GLN A 1 63  ? -10.555 -14.145 -12.523 1.00 25.43 ? 144 GLN A CD  1 
ATOM   527  O OE1 . GLN A 1 63  ? -10.047 -13.395 -11.678 1.00 27.27 ? 144 GLN A OE1 1 
ATOM   528  N NE2 . GLN A 1 63  ? -11.869 -14.265 -12.652 1.00 24.07 ? 144 GLN A NE2 1 
ATOM   529  N N   . ASP A 1 64  ? -8.931  -18.286 -13.842 1.00 19.06 ? 145 ASP A N   1 
ATOM   530  C CA  . ASP A 1 64  ? -8.022  -19.046 -12.996 1.00 19.79 ? 145 ASP A CA  1 
ATOM   531  C C   . ASP A 1 64  ? -8.308  -20.553 -13.128 1.00 18.44 ? 145 ASP A C   1 
ATOM   532  O O   . ASP A 1 64  ? -9.435  -20.926 -13.379 1.00 18.87 ? 145 ASP A O   1 
ATOM   533  C CB  . ASP A 1 64  ? -8.322  -18.585 -11.559 1.00 22.44 ? 145 ASP A CB  1 
ATOM   534  C CG  . ASP A 1 64  ? -7.219  -18.815 -10.566 1.00 25.59 ? 145 ASP A CG  1 
ATOM   535  O OD1 . ASP A 1 64  ? -6.050  -18.526 -10.892 1.00 28.59 ? 145 ASP A OD1 1 
ATOM   536  O OD2 . ASP A 1 64  ? -7.523  -19.269 -9.442  1.00 27.77 ? 145 ASP A OD2 1 
ATOM   537  N N   . PRO A 1 65  ? -7.310  -21.454 -13.001 1.00 17.58 ? 146 PRO A N   1 
ATOM   538  C CA  . PRO A 1 65  ? -7.559  -22.907 -13.083 1.00 16.97 ? 146 PRO A CA  1 
ATOM   539  C C   . PRO A 1 65  ? -8.276  -23.381 -11.800 1.00 17.33 ? 146 PRO A C   1 
ATOM   540  O O   . PRO A 1 65  ? -8.204  -22.703 -10.768 1.00 16.88 ? 146 PRO A O   1 
ATOM   541  C CB  . PRO A 1 65  ? -6.157  -23.520 -13.165 1.00 17.04 ? 146 PRO A CB  1 
ATOM   542  C CG  . PRO A 1 65  ? -5.282  -22.367 -13.521 1.00 16.61 ? 146 PRO A CG  1 
ATOM   543  C CD  . PRO A 1 65  ? -5.881  -21.185 -12.818 1.00 16.56 ? 146 PRO A CD  1 
ATOM   544  N N   . TYR A 1 66  ? -8.977  -24.517 -11.867 1.00 17.60 ? 147 TYR A N   1 
ATOM   545  C CA  . TYR A 1 66  ? -9.614  -25.082 -10.667 1.00 18.73 ? 147 TYR A CA  1 
ATOM   546  C C   . TYR A 1 66  ? -8.522  -25.417 -9.660  1.00 19.73 ? 147 TYR A C   1 
ATOM   547  O O   . TYR A 1 66  ? -7.464  -25.894 -10.060 1.00 19.44 ? 147 TYR A O   1 
ATOM   548  C CB  . TYR A 1 66  ? -10.391 -26.349 -11.036 1.00 18.72 ? 147 TYR A CB  1 
ATOM   549  C CG  . TYR A 1 66  ? -11.588 -26.068 -11.902 1.00 18.54 ? 147 TYR A CG  1 
ATOM   550  C CD1 . TYR A 1 66  ? -12.617 -25.244 -11.439 1.00 19.33 ? 147 TYR A CD1 1 
ATOM   551  C CD2 . TYR A 1 66  ? -11.688 -26.583 -13.191 1.00 19.13 ? 147 TYR A CD2 1 
ATOM   552  C CE1 . TYR A 1 66  ? -13.716 -24.937 -12.233 1.00 20.16 ? 147 TYR A CE1 1 
ATOM   553  C CE2 . TYR A 1 66  ? -12.785 -26.280 -13.999 1.00 20.12 ? 147 TYR A CE2 1 
ATOM   554  C CZ  . TYR A 1 66  ? -13.792 -25.455 -13.513 1.00 20.23 ? 147 TYR A CZ  1 
ATOM   555  O OH  . TYR A 1 66  ? -14.847 -25.117 -14.313 1.00 21.03 ? 147 TYR A OH  1 
ATOM   556  N N   . HIS A 1 67  ? -8.772  -25.172 -8.372  1.00 20.79 ? 148 HIS A N   1 
ATOM   557  C CA  . HIS A 1 67  ? -7.734  -25.369 -7.349  1.00 22.22 ? 148 HIS A CA  1 
ATOM   558  C C   . HIS A 1 67  ? -7.936  -26.643 -6.507  1.00 23.55 ? 148 HIS A C   1 
ATOM   559  O O   . HIS A 1 67  ? -7.137  -26.929 -5.603  1.00 24.33 ? 148 HIS A O   1 
ATOM   560  C CB  . HIS A 1 67  ? -7.654  -24.129 -6.441  1.00 23.09 ? 148 HIS A CB  1 
ATOM   561  C CG  . HIS A 1 67  ? -8.974  -23.732 -5.820  1.00 25.10 ? 148 HIS A CG  1 
ATOM   562  N ND1 . HIS A 1 67  ? -9.656  -22.588 -6.227  1.00 25.04 ? 148 HIS A ND1 1 
ATOM   563  C CD2 . HIS A 1 67  ? -9.694  -24.366 -4.845  1.00 24.22 ? 148 HIS A CD2 1 
ATOM   564  C CE1 . HIS A 1 67  ? -10.763 -22.552 -5.499  1.00 25.31 ? 148 HIS A CE1 1 
ATOM   565  N NE2 . HIS A 1 67  ? -10.807 -23.598 -4.671  1.00 24.86 ? 148 HIS A NE2 1 
ATOM   566  N N   . GLY A 1 68  ? -9.002  -27.402 -6.787  1.00 24.03 ? 149 GLY A N   1 
ATOM   567  C CA  . GLY A 1 68  ? -9.234  -28.646 -6.068  1.00 24.58 ? 149 GLY A CA  1 
ATOM   568  C C   . GLY A 1 68  ? -8.537  -29.819 -6.736  1.00 25.28 ? 149 GLY A C   1 
ATOM   569  O O   . GLY A 1 68  ? -8.226  -29.761 -7.932  1.00 25.24 ? 149 GLY A O   1 
ATOM   570  N N   . PRO A 1 69  ? -8.269  -30.914 -6.004  1.00 25.69 ? 150 PRO A N   1 
ATOM   571  C CA  . PRO A 1 69  ? -7.594  -32.115 -6.553  1.00 25.84 ? 150 PRO A CA  1 
ATOM   572  C C   . PRO A 1 69  ? -8.260  -32.693 -7.822  1.00 25.80 ? 150 PRO A C   1 
ATOM   573  O O   . PRO A 1 69  ? -9.480  -32.882 -7.872  1.00 26.15 ? 150 PRO A O   1 
ATOM   574  C CB  . PRO A 1 69  ? -7.652  -33.112 -5.385  1.00 25.73 ? 150 PRO A CB  1 
ATOM   575  C CG  . PRO A 1 69  ? -7.652  -32.217 -4.189  1.00 26.15 ? 150 PRO A CG  1 
ATOM   576  C CD  . PRO A 1 69  ? -8.574  -31.090 -4.563  1.00 25.99 ? 150 PRO A CD  1 
ATOM   577  N N   . ASN A 1 70  ? -7.439  -32.938 -8.852  1.00 25.72 ? 151 ASN A N   1 
ATOM   578  C CA  . ASN A 1 70  ? -7.868  -33.612 -10.095 1.00 25.91 ? 151 ASN A CA  1 
ATOM   579  C C   . ASN A 1 70  ? -8.865  -32.850 -10.949 1.00 24.30 ? 151 ASN A C   1 
ATOM   580  O O   . ASN A 1 70  ? -9.415  -33.408 -11.891 1.00 24.90 ? 151 ASN A O   1 
ATOM   581  C CB  . ASN A 1 70  ? -8.429  -34.996 -9.773  1.00 29.13 ? 151 ASN A CB  1 
ATOM   582  C CG  . ASN A 1 70  ? -7.443  -35.794 -8.941  1.00 33.09 ? 151 ASN A CG  1 
ATOM   583  O OD1 . ASN A 1 70  ? -6.428  -36.296 -9.455  1.00 35.04 ? 151 ASN A OD1 1 
ATOM   584  N ND2 . ASN A 1 70  ? -7.716  -35.893 -7.637  1.00 34.49 ? 151 ASN A ND2 1 
ATOM   585  N N   . GLN A 1 71  ? -9.083  -31.587 -10.661 1.00 22.17 ? 152 GLN A N   1 
ATOM   586  C CA  . GLN A 1 71  ? -10.043 -30.829 -11.430 1.00 20.25 ? 152 GLN A CA  1 
ATOM   587  C C   . GLN A 1 71  ? -9.440  -30.194 -12.677 1.00 18.67 ? 152 GLN A C   1 
ATOM   588  O O   . GLN A 1 71  ? -9.859  -30.496 -13.788 1.00 18.93 ? 152 GLN A O   1 
ATOM   589  C CB  . GLN A 1 71  ? -10.668 -29.767 -10.560 1.00 20.67 ? 152 GLN A CB  1 
ATOM   590  C CG  . GLN A 1 71  ? -11.473 -30.332 -9.416  1.00 22.98 ? 152 GLN A CG  1 
ATOM   591  C CD  . GLN A 1 71  ? -12.110 -29.235 -8.622  1.00 24.56 ? 152 GLN A CD  1 
ATOM   592  O OE1 . GLN A 1 71  ? -11.474 -28.223 -8.333  1.00 26.43 ? 152 GLN A OE1 1 
ATOM   593  N NE2 . GLN A 1 71  ? -13.367 -29.413 -8.275  1.00 27.38 ? 152 GLN A NE2 1 
ATOM   594  N N   . ALA A 1 72  ? -8.477  -29.312 -12.501 1.00 17.11 ? 153 ALA A N   1 
ATOM   595  C CA  . ALA A 1 72  ? -7.883  -28.615 -13.645 1.00 16.24 ? 153 ALA A CA  1 
ATOM   596  C C   . ALA A 1 72  ? -7.032  -29.543 -14.487 1.00 16.29 ? 153 ALA A C   1 
ATOM   597  O O   . ALA A 1 72  ? -6.257  -30.337 -13.950 1.00 17.36 ? 153 ALA A O   1 
ATOM   598  C CB  . ALA A 1 72  ? -7.030  -27.452 -13.168 1.00 15.76 ? 153 ALA A CB  1 
ATOM   599  N N   . HIS A 1 73  ? -7.172  -29.448 -15.806 1.00 14.86 ? 154 HIS A N   1 
ATOM   600  C CA  . HIS A 1 73  ? -6.332  -30.233 -16.694 1.00 14.12 ? 154 HIS A CA  1 
ATOM   601  C C   . HIS A 1 73  ? -5.893  -29.446 -17.929 1.00 13.31 ? 154 HIS A C   1 
ATOM   602  O O   . HIS A 1 73  ? -5.627  -30.032 -18.978 1.00 13.96 ? 154 HIS A O   1 
ATOM   603  C CB  . HIS A 1 73  ? -7.013  -31.543 -17.105 1.00 14.29 ? 154 HIS A CB  1 
ATOM   604  C CG  . HIS A 1 73  ? -8.202  -31.405 -18.000 1.00 15.41 ? 154 HIS A CG  1 
ATOM   605  N ND1 . HIS A 1 73  ? -8.168  -31.845 -19.313 1.00 16.32 ? 154 HIS A ND1 1 
ATOM   606  C CD2 . HIS A 1 73  ? -9.452  -30.961 -17.703 1.00 15.62 ? 154 HIS A CD2 1 
ATOM   607  C CE1 . HIS A 1 73  ? -9.392  -31.672 -19.787 1.00 16.55 ? 154 HIS A CE1 1 
ATOM   608  N NE2 . HIS A 1 73  ? -10.174 -31.150 -18.846 1.00 16.14 ? 154 HIS A NE2 1 
ATOM   609  N N   . GLY A 1 74  ? -5.847  -28.120 -17.813 1.00 13.22 ? 155 GLY A N   1 
ATOM   610  C CA  . GLY A 1 74  ? -5.291  -27.296 -18.891 1.00 13.96 ? 155 GLY A CA  1 
ATOM   611  C C   . GLY A 1 74  ? -6.283  -26.614 -19.815 1.00 14.69 ? 155 GLY A C   1 
ATOM   612  O O   . GLY A 1 74  ? -5.867  -25.924 -20.751 1.00 15.95 ? 155 GLY A O   1 
ATOM   613  N N   . LEU A 1 75  ? -7.578  -26.794 -19.571 1.00 14.29 ? 156 LEU A N   1 
ATOM   614  C CA  . LEU A 1 75  ? -8.622  -26.169 -20.400 1.00 14.08 ? 156 LEU A CA  1 
ATOM   615  C C   . LEU A 1 75  ? -9.585  -25.453 -19.476 1.00 13.88 ? 156 LEU A C   1 
ATOM   616  O O   . LEU A 1 75  ? -9.960  -26.013 -18.455 1.00 14.55 ? 156 LEU A O   1 
ATOM   617  C CB  . LEU A 1 75  ? -9.419  -27.233 -21.179 1.00 13.88 ? 156 LEU A CB  1 
ATOM   618  C CG  . LEU A 1 75  ? -8.638  -28.171 -22.100 1.00 14.83 ? 156 LEU A CG  1 
ATOM   619  C CD1 . LEU A 1 75  ? -9.567  -29.236 -22.668 1.00 15.72 ? 156 LEU A CD1 1 
ATOM   620  C CD2 . LEU A 1 75  ? -7.977  -27.375 -23.213 1.00 14.87 ? 156 LEU A CD2 1 
ATOM   621  N N   . CYS A 1 76  ? -9.988  -24.235 -19.798 1.00 13.99 ? 157 CYS A N   1 
ATOM   622  C CA  . CYS A 1 76  ? -10.943 -23.550 -18.930 1.00 14.34 ? 157 CYS A CA  1 
ATOM   623  C C   . CYS A 1 76  ? -12.285 -24.277 -18.951 1.00 14.61 ? 157 CYS A C   1 
ATOM   624  O O   . CYS A 1 76  ? -12.634 -24.933 -19.956 1.00 14.04 ? 157 CYS A O   1 
ATOM   625  C CB  . CYS A 1 76  ? -11.140 -22.076 -19.322 1.00 15.35 ? 157 CYS A CB  1 
ATOM   626  S SG  . CYS A 1 76  ? -11.855 -21.794 -20.953 1.00 18.15 ? 157 CYS A SG  1 
ATOM   627  N N   . PHE A 1 77  ? -13.000 -24.181 -17.811 1.00 14.45 ? 158 PHE A N   1 
ATOM   628  C CA  . PHE A 1 77  ? -14.330 -24.789 -17.612 1.00 15.26 ? 158 PHE A CA  1 
ATOM   629  C C   . PHE A 1 77  ? -14.348 -26.322 -17.584 1.00 16.58 ? 158 PHE A C   1 
ATOM   630  O O   . PHE A 1 77  ? -15.287 -26.913 -17.081 1.00 20.99 ? 158 PHE A O   1 
ATOM   631  C CB  . PHE A 1 77  ? -15.343 -24.279 -18.649 1.00 14.75 ? 158 PHE A CB  1 
ATOM   632  C CG  . PHE A 1 77  ? -15.687 -22.835 -18.467 1.00 14.87 ? 158 PHE A CG  1 
ATOM   633  C CD1 . PHE A 1 77  ? -16.401 -22.411 -17.341 1.00 15.20 ? 158 PHE A CD1 1 
ATOM   634  C CD2 . PHE A 1 77  ? -15.260 -21.882 -19.393 1.00 15.84 ? 158 PHE A CD2 1 
ATOM   635  C CE1 . PHE A 1 77  ? -16.672 -21.056 -17.143 1.00 15.72 ? 158 PHE A CE1 1 
ATOM   636  C CE2 . PHE A 1 77  ? -15.525 -20.532 -19.204 1.00 15.87 ? 158 PHE A CE2 1 
ATOM   637  C CZ  . PHE A 1 77  ? -16.231 -20.117 -18.077 1.00 16.33 ? 158 PHE A CZ  1 
ATOM   638  N N   . SER A 1 78  ? -13.312 -26.955 -18.059 1.00 15.61 ? 159 SER A N   1 
ATOM   639  C CA  . SER A 1 78  ? -13.291 -28.404 -18.178 1.00 14.46 ? 159 SER A CA  1 
ATOM   640  C C   . SER A 1 78  ? -12.778 -29.116 -16.916 1.00 14.56 ? 159 SER A C   1 
ATOM   641  O O   . SER A 1 78  ? -11.873 -28.644 -16.248 1.00 15.58 ? 159 SER A O   1 
ATOM   642  C CB  . SER A 1 78  ? -12.395 -28.735 -19.382 1.00 13.61 ? 159 SER A CB  1 
ATOM   643  O OG  . SER A 1 78  ? -12.495 -30.075 -19.787 1.00 13.38 ? 159 SER A OG  1 
ATOM   644  N N   . VAL A 1 79  ? -13.378 -30.249 -16.591 1.00 14.70 ? 160 VAL A N   1 
ATOM   645  C CA  . VAL A 1 79  ? -12.856 -31.120 -15.539 1.00 16.08 ? 160 VAL A CA  1 
ATOM   646  C C   . VAL A 1 79  ? -12.822 -32.545 -16.095 1.00 17.57 ? 160 VAL A C   1 
ATOM   647  O O   . VAL A 1 79  ? -13.676 -32.910 -16.894 1.00 16.96 ? 160 VAL A O   1 
ATOM   648  C CB  . VAL A 1 79  ? -13.721 -31.093 -14.242 1.00 15.88 ? 160 VAL A CB  1 
ATOM   649  C CG1 . VAL A 1 79  ? -13.583 -29.752 -13.530 1.00 16.13 ? 160 VAL A CG1 1 
ATOM   650  C CG2 . VAL A 1 79  ? -15.184 -31.369 -14.567 1.00 16.79 ? 160 VAL A CG2 1 
ATOM   651  N N   . GLN A 1 80  ? -11.840 -33.354 -15.731 1.00 19.62 ? 161 GLN A N   1 
ATOM   652  C CA  . GLN A 1 80  ? -11.814 -34.725 -16.260 1.00 22.05 ? 161 GLN A CA  1 
ATOM   653  C C   . GLN A 1 80  ? -12.505 -35.691 -15.322 1.00 21.72 ? 161 GLN A C   1 
ATOM   654  O O   . GLN A 1 80  ? -12.656 -35.406 -14.132 1.00 21.90 ? 161 GLN A O   1 
ATOM   655  C CB  . GLN A 1 80  ? -10.383 -35.209 -16.551 1.00 24.39 ? 161 GLN A CB  1 
ATOM   656  C CG  . GLN A 1 80  ? -9.824  -34.649 -17.852 1.00 28.35 ? 161 GLN A CG  1 
ATOM   657  C CD  . GLN A 1 80  ? -8.663  -35.451 -18.432 1.00 29.87 ? 161 GLN A CD  1 
ATOM   658  O OE1 . GLN A 1 80  ? -7.709  -35.793 -17.726 1.00 31.72 ? 161 GLN A OE1 1 
ATOM   659  N NE2 . GLN A 1 80  ? -8.732  -35.740 -19.731 1.00 30.20 ? 161 GLN A NE2 1 
ATOM   660  N N   . ARG A 1 81  ? -12.967 -36.813 -15.865 1.00 22.60 ? 162 ARG A N   1 
ATOM   661  C CA  . ARG A 1 81  ? -13.593 -37.854 -15.043 1.00 24.15 ? 162 ARG A CA  1 
ATOM   662  C C   . ARG A 1 81  ? -12.631 -38.303 -13.957 1.00 25.51 ? 162 ARG A C   1 
ATOM   663  O O   . ARG A 1 81  ? -11.426 -38.330 -14.183 1.00 25.75 ? 162 ARG A O   1 
ATOM   664  C CB  . ARG A 1 81  ? -13.964 -39.051 -15.909 1.00 24.08 ? 162 ARG A CB  1 
ATOM   665  C CG  . ARG A 1 81  ? -15.325 -38.926 -16.537 1.00 23.94 ? 162 ARG A CG  1 
ATOM   666  C CD  . ARG A 1 81  ? -15.612 -40.093 -17.445 1.00 24.47 ? 162 ARG A CD  1 
ATOM   667  N NE  . ARG A 1 81  ? -17.026 -40.164 -17.770 1.00 23.84 ? 162 ARG A NE  1 
ATOM   668  C CZ  . ARG A 1 81  ? -17.491 -40.700 -18.892 1.00 23.96 ? 162 ARG A CZ  1 
ATOM   669  N NH1 . ARG A 1 81  ? -16.663 -41.197 -19.811 1.00 24.05 ? 162 ARG A NH1 1 
ATOM   670  N NH2 . ARG A 1 81  ? -18.785 -40.742 -19.095 1.00 22.77 ? 162 ARG A NH2 1 
ATOM   671  N N   . PRO A 1 82  ? -13.128 -38.701 -12.773 1.00 26.64 ? 163 PRO A N   1 
ATOM   672  C CA  . PRO A 1 82  ? -14.560 -38.751 -12.433 1.00 26.70 ? 163 PRO A CA  1 
ATOM   673  C C   . PRO A 1 82  ? -15.115 -37.478 -11.764 1.00 25.70 ? 163 PRO A C   1 
ATOM   674  O O   . PRO A 1 82  ? -16.123 -37.548 -11.068 1.00 26.46 ? 163 PRO A O   1 
ATOM   675  C CB  . PRO A 1 82  ? -14.580 -39.925 -11.472 1.00 27.96 ? 163 PRO A CB  1 
ATOM   676  C CG  . PRO A 1 82  ? -13.370 -39.639 -10.641 1.00 28.26 ? 163 PRO A CG  1 
ATOM   677  C CD  . PRO A 1 82  ? -12.311 -39.231 -11.652 1.00 28.08 ? 163 PRO A CD  1 
ATOM   678  N N   . VAL A 1 83  ? -14.473 -36.330 -11.940 1.00 23.74 ? 164 VAL A N   1 
ATOM   679  C CA  . VAL A 1 83  ? -14.977 -35.103 -11.309 1.00 22.33 ? 164 VAL A CA  1 
ATOM   680  C C   . VAL A 1 83  ? -16.273 -34.658 -12.001 1.00 21.85 ? 164 VAL A C   1 
ATOM   681  O O   . VAL A 1 83  ? -16.346 -34.601 -13.240 1.00 21.33 ? 164 VAL A O   1 
ATOM   682  C CB  . VAL A 1 83  ? -13.922 -33.959 -11.372 1.00 21.83 ? 164 VAL A CB  1 
ATOM   683  C CG1 . VAL A 1 83  ? -14.421 -32.711 -10.659 1.00 20.40 ? 164 VAL A CG1 1 
ATOM   684  C CG2 . VAL A 1 83  ? -12.621 -34.436 -10.749 1.00 22.30 ? 164 VAL A CG2 1 
ATOM   685  N N   . PRO A 1 84  ? -17.338 -34.395 -11.231 1.00 21.21 ? 165 PRO A N   1 
ATOM   686  C CA  . PRO A 1 84  ? -18.600 -33.957 -11.806 1.00 20.82 ? 165 PRO A CA  1 
ATOM   687  C C   . PRO A 1 84  ? -18.477 -32.525 -12.335 1.00 20.34 ? 165 PRO A C   1 
ATOM   688  O O   . PRO A 1 84  ? -17.640 -31.732 -11.855 1.00 20.09 ? 165 PRO A O   1 
ATOM   689  C CB  . PRO A 1 84  ? -19.575 -34.075 -10.642 1.00 21.44 ? 165 PRO A CB  1 
ATOM   690  C CG  . PRO A 1 84  ? -18.708 -33.793 -9.463  1.00 22.64 ? 165 PRO A CG  1 
ATOM   691  C CD  . PRO A 1 84  ? -17.429 -34.533 -9.762  1.00 21.17 ? 165 PRO A CD  1 
ATOM   692  N N   . PRO A 1 85  ? -19.260 -32.175 -13.362 1.00 20.04 ? 166 PRO A N   1 
ATOM   693  C CA  . PRO A 1 85  ? -19.227 -30.827 -13.927 1.00 19.74 ? 166 PRO A CA  1 
ATOM   694  C C   . PRO A 1 85  ? -19.539 -29.791 -12.845 1.00 20.01 ? 166 PRO A C   1 
ATOM   695  O O   . PRO A 1 85  ? -20.471 -29.975 -12.058 1.00 20.53 ? 166 PRO A O   1 
ATOM   696  C CB  . PRO A 1 85  ? -20.331 -30.864 -14.982 1.00 19.14 ? 166 PRO A CB  1 
ATOM   697  C CG  . PRO A 1 85  ? -20.380 -32.300 -15.375 1.00 18.60 ? 166 PRO A CG  1 
ATOM   698  C CD  . PRO A 1 85  ? -20.221 -33.043 -14.086 1.00 18.55 ? 166 PRO A CD  1 
ATOM   699  N N   . PRO A 1 86  ? -18.738 -28.728 -12.738 1.00 19.82 ? 167 PRO A N   1 
ATOM   700  C CA  . PRO A 1 86  ? -18.980 -27.658 -11.760 1.00 19.81 ? 167 PRO A CA  1 
ATOM   701  C C   . PRO A 1 86  ? -20.266 -26.889 -12.132 1.00 18.69 ? 167 PRO A C   1 
ATOM   702  O O   . PRO A 1 86  ? -20.736 -26.971 -13.282 1.00 18.37 ? 167 PRO A O   1 
ATOM   703  C CB  . PRO A 1 86  ? -17.727 -26.795 -11.877 1.00 20.89 ? 167 PRO A CB  1 
ATOM   704  C CG  . PRO A 1 86  ? -17.296 -27.027 -13.283 1.00 21.73 ? 167 PRO A CG  1 
ATOM   705  C CD  . PRO A 1 86  ? -17.502 -28.496 -13.501 1.00 20.67 ? 167 PRO A CD  1 
ATOM   706  N N   . PRO A 1 87  ? -20.869 -26.141 -11.187 1.00 18.19 ? 168 PRO A N   1 
ATOM   707  C CA  . PRO A 1 87  ? -22.099 -25.379 -11.439 1.00 17.76 ? 168 PRO A CA  1 
ATOM   708  C C   . PRO A 1 87  ? -22.063 -24.558 -12.740 1.00 17.41 ? 168 PRO A C   1 
ATOM   709  O O   . PRO A 1 87  ? -23.025 -24.568 -13.507 1.00 17.73 ? 168 PRO A O   1 
ATOM   710  C CB  . PRO A 1 87  ? -22.213 -24.505 -10.196 1.00 17.88 ? 168 PRO A CB  1 
ATOM   711  C CG  . PRO A 1 87  ? -21.661 -25.394 -9.141  1.00 18.84 ? 168 PRO A CG  1 
ATOM   712  C CD  . PRO A 1 87  ? -20.433 -25.981 -9.775  1.00 19.07 ? 168 PRO A CD  1 
ATOM   713  N N   . SER A 1 88  ? -20.952 -23.865 -12.999 1.00 17.03 ? 169 SER A N   1 
ATOM   714  C CA  . SER A 1 88  ? -20.824 -23.067 -14.225 1.00 17.18 ? 169 SER A CA  1 
ATOM   715  C C   . SER A 1 88  ? -20.974 -23.914 -15.468 1.00 16.49 ? 169 SER A C   1 
ATOM   716  O O   . SER A 1 88  ? -21.632 -23.500 -16.428 1.00 15.69 ? 169 SER A O   1 
ATOM   717  C CB  . SER A 1 88  ? -19.468 -22.368 -14.296 1.00 18.13 ? 169 SER A CB  1 
ATOM   718  O OG  . SER A 1 88  ? -19.374 -21.357 -13.313 1.00 22.84 ? 169 SER A OG  1 
ATOM   719  N N   . LEU A 1 89  ? -20.345 -25.100 -15.466 1.00 16.06 ? 170 LEU A N   1 
ATOM   720  C CA  . LEU A 1 89  ? -20.403 -25.964 -16.647 1.00 15.34 ? 170 LEU A CA  1 
ATOM   721  C C   . LEU A 1 89  ? -21.789 -26.563 -16.804 1.00 14.27 ? 170 LEU A C   1 
ATOM   722  O O   . LEU A 1 89  ? -22.267 -26.719 -17.923 1.00 14.54 ? 170 LEU A O   1 
ATOM   723  C CB  . LEU A 1 89  ? -19.332 -27.062 -16.602 1.00 15.02 ? 170 LEU A CB  1 
ATOM   724  C CG  . LEU A 1 89  ? -19.238 -27.967 -17.840 1.00 14.99 ? 170 LEU A CG  1 
ATOM   725  C CD1 . LEU A 1 89  ? -19.115 -27.138 -19.120 1.00 13.81 ? 170 LEU A CD1 1 
ATOM   726  C CD2 . LEU A 1 89  ? -18.058 -28.905 -17.684 1.00 15.77 ? 170 LEU A CD2 1 
ATOM   727  N N   . GLU A 1 90  ? -22.436 -26.892 -15.695 1.00 13.81 ? 171 GLU A N   1 
ATOM   728  C CA  . GLU A 1 90  ? -23.822 -27.348 -15.765 1.00 14.01 ? 171 GLU A CA  1 
ATOM   729  C C   . GLU A 1 90  ? -24.693 -26.271 -16.419 1.00 13.90 ? 171 GLU A C   1 
ATOM   730  O O   . GLU A 1 90  ? -25.582 -26.587 -17.208 1.00 14.92 ? 171 GLU A O   1 
ATOM   731  C CB  . GLU A 1 90  ? -24.373 -27.686 -14.370 1.00 15.72 ? 171 GLU A CB  1 
ATOM   732  C CG  . GLU A 1 90  ? -23.810 -28.960 -13.748 1.00 18.46 ? 171 GLU A CG  1 
ATOM   733  C CD  . GLU A 1 90  ? -24.229 -30.241 -14.464 1.00 20.04 ? 171 GLU A CD  1 
ATOM   734  O OE1 . GLU A 1 90  ? -25.166 -30.212 -15.279 1.00 21.46 ? 171 GLU A OE1 1 
ATOM   735  O OE2 . GLU A 1 90  ? -23.618 -31.288 -14.200 1.00 22.65 ? 171 GLU A OE2 1 
ATOM   736  N N   . ASN A 1 91  ? -24.427 -24.993 -16.121 1.00 14.07 ? 172 ASN A N   1 
ATOM   737  C CA  . ASN A 1 91  ? -25.194 -23.900 -16.742 1.00 14.17 ? 172 ASN A CA  1 
ATOM   738  C C   . ASN A 1 91  ? -24.896 -23.774 -18.234 1.00 14.19 ? 172 ASN A C   1 
ATOM   739  O O   . ASN A 1 91  ? -25.791 -23.467 -19.041 1.00 14.71 ? 172 ASN A O   1 
ATOM   740  C CB  . ASN A 1 91  ? -24.945 -22.579 -16.005 1.00 14.77 ? 172 ASN A CB  1 
ATOM   741  C CG  . ASN A 1 91  ? -25.698 -22.568 -14.685 1.00 15.02 ? 172 ASN A CG  1 
ATOM   742  O OD1 . ASN A 1 91  ? -26.645 -23.340 -14.515 1.00 16.27 ? 172 ASN A OD1 1 
ATOM   743  N ND2 . ASN A 1 91  ? -25.291 -21.713 -13.750 1.00 14.70 ? 172 ASN A ND2 1 
ATOM   744  N N   . ILE A 1 92  ? -23.643 -24.029 -18.607 1.00 13.51 ? 173 ILE A N   1 
ATOM   745  C CA  . ILE A 1 92  ? -23.267 -24.055 -20.025 1.00 13.28 ? 173 ILE A CA  1 
ATOM   746  C C   . ILE A 1 92  ? -24.059 -25.160 -20.758 1.00 13.05 ? 173 ILE A C   1 
ATOM   747  O O   . ILE A 1 92  ? -24.661 -24.918 -21.814 1.00 13.08 ? 173 ILE A O   1 
ATOM   748  C CB  . ILE A 1 92  ? -21.735 -24.263 -20.173 1.00 11.95 ? 173 ILE A CB  1 
ATOM   749  C CG1 . ILE A 1 92  ? -21.019 -22.977 -19.728 1.00 12.81 ? 173 ILE A CG1 1 
ATOM   750  C CG2 . ILE A 1 92  ? -21.360 -24.617 -21.610 1.00 11.80 ? 173 ILE A CG2 1 
ATOM   751  C CD1 . ILE A 1 92  ? -19.520 -23.124 -19.541 1.00 13.67 ? 173 ILE A CD1 1 
ATOM   752  N N   . TYR A 1 93  ? -24.088 -26.369 -20.183 1.00 13.47 ? 174 TYR A N   1 
ATOM   753  C CA  . TYR A 1 93  ? -24.847 -27.473 -20.785 1.00 13.89 ? 174 TYR A CA  1 
ATOM   754  C C   . TYR A 1 93  ? -26.335 -27.143 -20.868 1.00 14.57 ? 174 TYR A C   1 
ATOM   755  O O   . TYR A 1 93  ? -26.987 -27.528 -21.826 1.00 14.74 ? 174 TYR A O   1 
ATOM   756  C CB  . TYR A 1 93  ? -24.670 -28.774 -20.006 1.00 13.70 ? 174 TYR A CB  1 
ATOM   757  C CG  . TYR A 1 93  ? -23.302 -29.418 -20.134 1.00 14.42 ? 174 TYR A CG  1 
ATOM   758  C CD1 . TYR A 1 93  ? -22.448 -29.129 -21.209 1.00 14.77 ? 174 TYR A CD1 1 
ATOM   759  C CD2 . TYR A 1 93  ? -22.886 -30.369 -19.203 1.00 14.61 ? 174 TYR A CD2 1 
ATOM   760  C CE1 . TYR A 1 93  ? -21.227 -29.774 -21.349 1.00 14.64 ? 174 TYR A CE1 1 
ATOM   761  C CE2 . TYR A 1 93  ? -21.672 -31.022 -19.330 1.00 15.52 ? 174 TYR A CE2 1 
ATOM   762  C CZ  . TYR A 1 93  ? -20.842 -30.724 -20.402 1.00 15.79 ? 174 TYR A CZ  1 
ATOM   763  O OH  . TYR A 1 93  ? -19.631 -31.369 -20.523 1.00 15.34 ? 174 TYR A OH  1 
ATOM   764  N N   . LYS A 1 94  ? -26.865 -26.437 -19.854 1.00 15.95 ? 175 LYS A N   1 
ATOM   765  C CA  . LYS A 1 94  ? -28.268 -26.034 -19.871 1.00 16.59 ? 175 LYS A CA  1 
ATOM   766  C C   . LYS A 1 94  ? -28.550 -25.129 -21.044 1.00 15.64 ? 175 LYS A C   1 
ATOM   767  O O   . LYS A 1 94  ? -29.511 -25.359 -21.781 1.00 16.02 ? 175 LYS A O   1 
ATOM   768  C CB  . LYS A 1 94  ? -28.657 -25.340 -18.572 1.00 18.84 ? 175 LYS A CB  1 
ATOM   769  C CG  . LYS A 1 94  ? -29.062 -26.318 -17.493 1.00 25.47 ? 175 LYS A CG  1 
ATOM   770  C CD  . LYS A 1 94  ? -29.070 -25.675 -16.115 1.00 28.76 ? 175 LYS A CD  1 
ATOM   771  C CE  . LYS A 1 94  ? -29.238 -26.737 -15.038 1.00 31.10 ? 175 LYS A CE  1 
ATOM   772  N NZ  . LYS A 1 94  ? -28.896 -26.205 -13.694 1.00 32.38 ? 175 LYS A NZ  1 
ATOM   773  N N   . GLU A 1 95  ? -27.716 -24.100 -21.231 1.00 14.44 ? 176 GLU A N   1 
ATOM   774  C CA  . GLU A 1 95  ? -27.899 -23.206 -22.367 1.00 14.03 ? 176 GLU A CA  1 
ATOM   775  C C   . GLU A 1 95  ? -27.794 -23.981 -23.679 1.00 14.85 ? 176 GLU A C   1 
ATOM   776  O O   . GLU A 1 95  ? -28.599 -23.782 -24.604 1.00 15.11 ? 176 GLU A O   1 
ATOM   777  C CB  . GLU A 1 95  ? -26.871 -22.058 -22.339 1.00 13.49 ? 176 GLU A CB  1 
ATOM   778  C CG  . GLU A 1 95  ? -26.986 -21.071 -23.511 1.00 14.28 ? 176 GLU A CG  1 
ATOM   779  C CD  . GLU A 1 95  ? -28.318 -20.317 -23.552 1.00 14.11 ? 176 GLU A CD  1 
ATOM   780  O OE1 . GLU A 1 95  ? -29.052 -20.345 -22.565 1.00 15.69 ? 176 GLU A OE1 1 
ATOM   781  O OE2 . GLU A 1 95  ? -28.627 -19.701 -24.575 1.00 16.55 ? 176 GLU A OE2 1 
ATOM   782  N N   . LEU A 1 96  ? -26.813 -24.884 -23.758 1.00 14.73 ? 177 LEU A N   1 
ATOM   783  C CA  . LEU A 1 96  ? -26.645 -25.696 -24.951 1.00 15.23 ? 177 LEU A CA  1 
ATOM   784  C C   . LEU A 1 96  ? -27.876 -26.541 -25.256 1.00 16.31 ? 177 LEU A C   1 
ATOM   785  O O   . LEU A 1 96  ? -28.228 -26.685 -26.416 1.00 17.37 ? 177 LEU A O   1 
ATOM   786  C CB  . LEU A 1 96  ? -25.422 -26.604 -24.828 1.00 14.51 ? 177 LEU A CB  1 
ATOM   787  C CG  . LEU A 1 96  ? -24.096 -26.016 -25.299 1.00 13.97 ? 177 LEU A CG  1 
ATOM   788  C CD1 . LEU A 1 96  ? -22.945 -26.728 -24.628 1.00 14.53 ? 177 LEU A CD1 1 
ATOM   789  C CD2 . LEU A 1 96  ? -23.988 -26.118 -26.804 1.00 13.83 ? 177 LEU A CD2 1 
ATOM   790  N N   . SER A 1 97  ? -28.539 -27.082 -24.236 1.00 17.44 ? 178 SER A N   1 
ATOM   791  C CA  . SER A 1 97  ? -29.700 -27.946 -24.490 1.00 19.70 ? 178 SER A CA  1 
ATOM   792  C C   . SER A 1 97  ? -30.893 -27.177 -25.085 1.00 20.14 ? 178 SER A C   1 
ATOM   793  O O   . SER A 1 97  ? -31.705 -27.755 -25.790 1.00 21.12 ? 178 SER A O   1 
ATOM   794  C CB  . SER A 1 97  ? -30.118 -28.696 -23.220 1.00 20.34 ? 178 SER A CB  1 
ATOM   795  O OG  . SER A 1 97  ? -30.651 -27.827 -22.246 1.00 24.16 ? 178 SER A OG  1 
ATOM   796  N N   . THR A 1 98  ? -30.992 -25.870 -24.817 1.00 20.84 ? 179 THR A N   1 
ATOM   797  C CA  . THR A 1 98  ? -32.073 -25.064 -25.382 1.00 21.14 ? 179 THR A CA  1 
ATOM   798  C C   . THR A 1 98  ? -31.636 -24.375 -26.693 1.00 21.90 ? 179 THR A C   1 
ATOM   799  O O   . THR A 1 98  ? -32.467 -24.007 -27.530 1.00 23.44 ? 179 THR A O   1 
ATOM   800  C CB  . THR A 1 98  ? -32.546 -23.996 -24.367 1.00 21.61 ? 179 THR A CB  1 
ATOM   801  O OG1 . THR A 1 98  ? -31.447 -23.154 -24.003 1.00 22.96 ? 179 THR A OG1 1 
ATOM   802  C CG2 . THR A 1 98  ? -33.077 -24.650 -23.101 1.00 21.58 ? 179 THR A CG2 1 
ATOM   803  N N   . ASP A 1 99  ? -30.324 -24.237 -26.883 1.00 21.12 ? 180 ASP A N   1 
ATOM   804  C CA  . ASP A 1 99  ? -29.778 -23.518 -28.029 1.00 20.72 ? 180 ASP A CA  1 
ATOM   805  C C   . ASP A 1 99  ? -29.496 -24.422 -29.236 1.00 21.95 ? 180 ASP A C   1 
ATOM   806  O O   . ASP A 1 99  ? -29.828 -24.075 -30.372 1.00 22.31 ? 180 ASP A O   1 
ATOM   807  C CB  . ASP A 1 99  ? -28.487 -22.812 -27.579 1.00 19.73 ? 180 ASP A CB  1 
ATOM   808  C CG  . ASP A 1 99  ? -27.882 -21.892 -28.615 1.00 20.08 ? 180 ASP A CG  1 
ATOM   809  O OD1 . ASP A 1 99  ? -28.631 -21.409 -29.490 1.00 19.67 ? 180 ASP A OD1 1 
ATOM   810  O OD2 . ASP A 1 99  ? -26.654 -21.645 -28.549 1.00 17.97 ? 180 ASP A OD2 1 
ATOM   811  N N   . ILE A 1 100 ? -28.830 -25.549 -28.981 1.00 22.84 ? 181 ILE A N   1 
ATOM   812  C CA  . ILE A 1 100 ? -28.457 -26.499 -30.027 1.00 23.94 ? 181 ILE A CA  1 
ATOM   813  C C   . ILE A 1 100 ? -29.411 -27.687 -29.949 1.00 26.23 ? 181 ILE A C   1 
ATOM   814  O O   . ILE A 1 100 ? -29.406 -28.436 -28.965 1.00 25.40 ? 181 ILE A O   1 
ATOM   815  C CB  . ILE A 1 100 ? -26.978 -26.975 -29.829 1.00 23.54 ? 181 ILE A CB  1 
ATOM   816  C CG1 . ILE A 1 100 ? -26.010 -25.786 -29.972 1.00 22.48 ? 181 ILE A CG1 1 
ATOM   817  C CG2 . ILE A 1 100 ? -26.615 -28.072 -30.825 1.00 23.03 ? 181 ILE A CG2 1 
ATOM   818  C CD1 . ILE A 1 100 ? -25.978 -25.155 -31.352 1.00 20.90 ? 181 ILE A CD1 1 
ATOM   819  N N   . GLU A 1 101 ? -30.218 -27.861 -30.989 1.00 28.26 ? 182 GLU A N   1 
ATOM   820  C CA  . GLU A 1 101 ? -31.261 -28.884 -30.968 1.00 31.19 ? 182 GLU A CA  1 
ATOM   821  C C   . GLU A 1 101 ? -30.765 -30.320 -30.692 1.00 30.68 ? 182 GLU A C   1 
ATOM   822  O O   . GLU A 1 101 ? -31.427 -31.081 -29.995 1.00 31.06 ? 182 GLU A O   1 
ATOM   823  C CB  . GLU A 1 101 ? -32.086 -28.843 -32.269 1.00 34.69 ? 182 GLU A CB  1 
ATOM   824  C CG  . GLU A 1 101 ? -31.323 -29.228 -33.530 1.00 40.19 ? 182 GLU A CG  1 
ATOM   825  C CD  . GLU A 1 101 ? -32.208 -29.849 -34.627 1.00 44.00 ? 182 GLU A CD  1 
ATOM   826  O OE1 . GLU A 1 101 ? -33.443 -30.035 -34.394 1.00 45.30 ? 182 GLU A OE1 1 
ATOM   827  O OE2 . GLU A 1 101 ? -31.662 -30.164 -35.725 1.00 45.21 ? 182 GLU A OE2 1 
ATOM   828  N N   . ASP A 1 102 ? -29.619 -30.711 -31.201 1.00 30.40 ? 183 ASP A N   1 
ATOM   829  C CA  . ASP A 1 102 ? -29.203 -32.096 -30.994 1.00 31.26 ? 183 ASP A CA  1 
ATOM   830  C C   . ASP A 1 102 ? -28.316 -32.318 -29.748 1.00 29.98 ? 183 ASP A C   1 
ATOM   831  O O   . ASP A 1 102 ? -27.692 -33.374 -29.616 1.00 30.78 ? 183 ASP A O   1 
ATOM   832  C CB  . ASP A 1 102 ? -28.524 -32.646 -32.277 1.00 34.04 ? 183 ASP A CB  1 
ATOM   833  C CG  . ASP A 1 102 ? -27.288 -31.877 -32.776 1.00 36.94 ? 183 ASP A CG  1 
ATOM   834  O OD1 . ASP A 1 102 ? -26.983 -30.789 -32.248 1.00 37.57 ? 183 ASP A OD1 1 
ATOM   835  O OD2 . ASP A 1 102 ? -26.617 -32.378 -33.714 1.00 38.51 ? 183 ASP A OD2 1 
ATOM   836  N N   . PHE A 1 103 ? -28.281 -31.358 -28.809 1.00 27.57 ? 184 PHE A N   1 
ATOM   837  C CA  . PHE A 1 103 ? -27.362 -31.486 -27.663 1.00 23.73 ? 184 PHE A CA  1 
ATOM   838  C C   . PHE A 1 103 ? -27.804 -32.507 -26.620 1.00 21.70 ? 184 PHE A C   1 
ATOM   839  O O   . PHE A 1 103 ? -28.945 -32.501 -26.149 1.00 20.92 ? 184 PHE A O   1 
ATOM   840  C CB  . PHE A 1 103 ? -27.109 -30.145 -26.969 1.00 21.61 ? 184 PHE A CB  1 
ATOM   841  C CG  . PHE A 1 103 ? -25.997 -30.252 -25.976 1.00 19.37 ? 184 PHE A CG  1 
ATOM   842  C CD1 . PHE A 1 103 ? -24.682 -30.323 -26.406 1.00 19.16 ? 184 PHE A CD1 1 
ATOM   843  C CD2 . PHE A 1 103 ? -26.265 -30.350 -24.614 1.00 18.77 ? 184 PHE A CD2 1 
ATOM   844  C CE1 . PHE A 1 103 ? -23.649 -30.496 -25.501 1.00 19.34 ? 184 PHE A CE1 1 
ATOM   845  C CE2 . PHE A 1 103 ? -25.237 -30.522 -23.705 1.00 17.55 ? 184 PHE A CE2 1 
ATOM   846  C CZ  . PHE A 1 103 ? -23.928 -30.595 -24.148 1.00 17.99 ? 184 PHE A CZ  1 
ATOM   847  N N   . VAL A 1 104 ? -26.859 -33.373 -26.260 1.00 19.10 ? 185 VAL A N   1 
ATOM   848  C CA  . VAL A 1 104 ? -27.091 -34.375 -25.243 1.00 17.48 ? 185 VAL A CA  1 
ATOM   849  C C   . VAL A 1 104 ? -26.082 -34.153 -24.123 1.00 16.44 ? 185 VAL A C   1 
ATOM   850  O O   . VAL A 1 104 ? -24.888 -34.000 -24.397 1.00 16.63 ? 185 VAL A O   1 
ATOM   851  C CB  . VAL A 1 104 ? -26.914 -35.806 -25.826 1.00 16.89 ? 185 VAL A CB  1 
ATOM   852  C CG1 . VAL A 1 104 ? -27.093 -36.852 -24.739 1.00 17.40 ? 185 VAL A CG1 1 
ATOM   853  C CG2 . VAL A 1 104 ? -27.905 -36.041 -26.945 1.00 17.43 ? 185 VAL A CG2 1 
ATOM   854  N N   . HIS A 1 105 ? -26.558 -34.070 -22.877 1.00 15.85 ? 186 HIS A N   1 
ATOM   855  C CA  . HIS A 1 105 ? -25.653 -33.951 -21.729 1.00 15.63 ? 186 HIS A CA  1 
ATOM   856  C C   . HIS A 1 105 ? -24.842 -35.268 -21.638 1.00 16.17 ? 186 HIS A C   1 
ATOM   857  O O   . HIS A 1 105 ? -25.430 -36.343 -21.505 1.00 15.73 ? 186 HIS A O   1 
ATOM   858  C CB  . HIS A 1 105 ? -26.470 -33.721 -20.457 1.00 14.93 ? 186 HIS A CB  1 
ATOM   859  C CG  . HIS A 1 105 ? -25.680 -33.301 -19.242 1.00 15.69 ? 186 HIS A CG  1 
ATOM   860  N ND1 . HIS A 1 105 ? -24.531 -33.964 -18.843 1.00 16.01 ? 186 HIS A ND1 1 
ATOM   861  C CD2 . HIS A 1 105 ? -25.959 -32.315 -18.339 1.00 15.70 ? 186 HIS A CD2 1 
ATOM   862  C CE1 . HIS A 1 105 ? -24.143 -33.382 -17.716 1.00 16.34 ? 186 HIS A CE1 1 
ATOM   863  N NE2 . HIS A 1 105 ? -24.978 -32.397 -17.397 1.00 15.38 ? 186 HIS A NE2 1 
ATOM   864  N N   . PRO A 1 106 ? -23.485 -35.205 -21.728 1.00 16.32 ? 187 PRO A N   1 
ATOM   865  C CA  . PRO A 1 106 ? -22.625 -36.400 -21.689 1.00 15.74 ? 187 PRO A CA  1 
ATOM   866  C C   . PRO A 1 106 ? -22.394 -36.980 -20.292 1.00 15.67 ? 187 PRO A C   1 
ATOM   867  O O   . PRO A 1 106 ? -21.794 -38.042 -20.156 1.00 16.65 ? 187 PRO A O   1 
ATOM   868  C CB  . PRO A 1 106 ? -21.342 -35.886 -22.325 1.00 16.48 ? 187 PRO A CB  1 
ATOM   869  C CG  . PRO A 1 106 ? -21.261 -34.496 -21.788 1.00 16.09 ? 187 PRO A CG  1 
ATOM   870  C CD  . PRO A 1 106 ? -22.670 -33.973 -21.905 1.00 15.84 ? 187 PRO A CD  1 
ATOM   871  N N   . GLY A 1 107 ? -22.839 -36.275 -19.261 1.00 16.02 ? 188 GLY A N   1 
ATOM   872  C CA  . GLY A 1 107 ? -22.675 -36.769 -17.883 1.00 16.88 ? 188 GLY A CA  1 
ATOM   873  C C   . GLY A 1 107 ? -21.283 -36.548 -17.291 1.00 18.42 ? 188 GLY A C   1 
ATOM   874  O O   . GLY A 1 107 ? -20.993 -36.971 -16.157 1.00 20.07 ? 188 GLY A O   1 
ATOM   875  N N   . HIS A 1 108 ? -20.422 -35.906 -18.060 1.00 16.89 ? 189 HIS A N   1 
ATOM   876  C CA  . HIS A 1 108 ? -19.081 -35.576 -17.600 1.00 15.59 ? 189 HIS A CA  1 
ATOM   877  C C   . HIS A 1 108 ? -18.782 -34.134 -18.007 1.00 14.51 ? 189 HIS A C   1 
ATOM   878  O O   . HIS A 1 108 ? -19.554 -33.537 -18.769 1.00 14.68 ? 189 HIS A O   1 
ATOM   879  C CB  . HIS A 1 108 ? -18.036 -36.558 -18.198 1.00 15.36 ? 189 HIS A CB  1 
ATOM   880  C CG  . HIS A 1 108 ? -17.886 -36.516 -19.701 1.00 14.95 ? 189 HIS A CG  1 
ATOM   881  N ND1 . HIS A 1 108 ? -17.161 -35.515 -20.337 1.00 15.21 ? 189 HIS A ND1 1 
ATOM   882  C CD2 . HIS A 1 108 ? -18.348 -37.390 -20.633 1.00 15.03 ? 189 HIS A CD2 1 
ATOM   883  C CE1 . HIS A 1 108 ? -17.189 -35.796 -21.629 1.00 14.97 ? 189 HIS A CE1 1 
ATOM   884  N NE2 . HIS A 1 108 ? -17.890 -36.909 -21.833 1.00 16.10 ? 189 HIS A NE2 1 
ATOM   885  N N   . GLY A 1 109 ? -17.683 -33.574 -17.518 1.00 13.44 ? 190 GLY A N   1 
ATOM   886  C CA  . GLY A 1 109 ? -17.360 -32.193 -17.842 1.00 12.99 ? 190 GLY A CA  1 
ATOM   887  C C   . GLY A 1 109 ? -16.080 -32.014 -18.628 1.00 13.00 ? 190 GLY A C   1 
ATOM   888  O O   . GLY A 1 109 ? -15.483 -30.933 -18.586 1.00 13.44 ? 190 GLY A O   1 
ATOM   889  N N   . ASP A 1 110 ? -15.651 -33.056 -19.345 1.00 12.73 ? 191 ASP A N   1 
ATOM   890  C CA  . ASP A 1 110 ? -14.413 -32.991 -20.117 1.00 12.89 ? 191 ASP A CA  1 
ATOM   891  C C   . ASP A 1 110 ? -14.696 -32.387 -21.473 1.00 12.79 ? 191 ASP A C   1 
ATOM   892  O O   . ASP A 1 110 ? -15.377 -33.005 -22.283 1.00 13.89 ? 191 ASP A O   1 
ATOM   893  C CB  . ASP A 1 110 ? -13.824 -34.404 -20.261 1.00 13.89 ? 191 ASP A CB  1 
ATOM   894  C CG  . ASP A 1 110 ? -12.423 -34.461 -20.860 1.00 14.13 ? 191 ASP A CG  1 
ATOM   895  O OD1 . ASP A 1 110 ? -12.074 -33.588 -21.652 1.00 14.45 ? 191 ASP A OD1 1 
ATOM   896  O OD2 . ASP A 1 110 ? -11.671 -35.394 -20.532 1.00 16.07 ? 191 ASP A OD2 1 
ATOM   897  N N   . LEU A 1 111 ? -14.158 -31.200 -21.730 1.00 12.10 ? 192 LEU A N   1 
ATOM   898  C CA  . LEU A 1 111 ? -14.431 -30.489 -22.980 1.00 11.73 ? 192 LEU A CA  1 
ATOM   899  C C   . LEU A 1 111 ? -13.393 -30.728 -24.070 1.00 11.64 ? 192 LEU A C   1 
ATOM   900  O O   . LEU A 1 111 ? -13.311 -29.958 -25.021 1.00 11.96 ? 192 LEU A O   1 
ATOM   901  C CB  . LEU A 1 111 ? -14.548 -28.992 -22.684 1.00 12.35 ? 192 LEU A CB  1 
ATOM   902  C CG  . LEU A 1 111 ? -15.587 -28.608 -21.620 1.00 13.68 ? 192 LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 111 ? -15.604 -27.097 -21.405 1.00 12.04 ? 192 LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 111 ? -16.960 -29.117 -22.044 1.00 13.45 ? 192 LEU A CD2 1 
ATOM   905  N N   . SER A 1 112 ? -12.617 -31.808 -23.959 1.00 12.69 ? 193 SER A N   1 
ATOM   906  C CA  . SER A 1 112 ? -11.587 -32.135 -24.960 1.00 12.55 ? 193 SER A CA  1 
ATOM   907  C C   . SER A 1 112 ? -12.153 -32.184 -26.350 1.00 12.64 ? 193 SER A C   1 
ATOM   908  O O   . SER A 1 112 ? -11.476 -31.792 -27.294 1.00 13.55 ? 193 SER A O   1 
ATOM   909  C CB  . SER A 1 112 ? -10.949 -33.494 -24.672 1.00 12.68 ? 193 SER A CB  1 
ATOM   910  O OG  . SER A 1 112 ? -10.257 -33.475 -23.444 1.00 15.57 ? 193 SER A OG  1 
ATOM   911  N N   . GLY A 1 113 ? -13.387 -32.683 -26.474 1.00 12.94 ? 194 GLY A N   1 
ATOM   912  C CA  . GLY A 1 113 ? -14.018 -32.804 -27.781 1.00 13.74 ? 194 GLY A CA  1 
ATOM   913  C C   . GLY A 1 113 ? -14.183 -31.465 -28.483 1.00 14.61 ? 194 GLY A C   1 
ATOM   914  O O   . GLY A 1 113 ? -14.113 -31.387 -29.715 1.00 15.34 ? 194 GLY A O   1 
ATOM   915  N N   . TRP A 1 114 ? -14.418 -30.397 -27.703 1.00 14.00 ? 195 TRP A N   1 
ATOM   916  C CA  . TRP A 1 114 ? -14.523 -29.058 -28.275 1.00 13.49 ? 195 TRP A CA  1 
ATOM   917  C C   . TRP A 1 114 ? -13.145 -28.554 -28.662 1.00 13.44 ? 195 TRP A C   1 
ATOM   918  O O   . TRP A 1 114 ? -12.981 -27.983 -29.730 1.00 13.18 ? 195 TRP A O   1 
ATOM   919  C CB  . TRP A 1 114 ? -15.142 -28.073 -27.281 1.00 13.97 ? 195 TRP A CB  1 
ATOM   920  C CG  . TRP A 1 114 ? -16.600 -28.293 -26.996 1.00 14.46 ? 195 TRP A CG  1 
ATOM   921  C CD1 . TRP A 1 114 ? -17.437 -29.235 -27.543 1.00 14.44 ? 195 TRP A CD1 1 
ATOM   922  C CD2 . TRP A 1 114 ? -17.382 -27.559 -26.046 1.00 14.99 ? 195 TRP A CD2 1 
ATOM   923  N NE1 . TRP A 1 114 ? -18.673 -29.114 -26.972 1.00 13.91 ? 195 TRP A NE1 1 
ATOM   924  C CE2 . TRP A 1 114 ? -18.685 -28.111 -26.055 1.00 15.01 ? 195 TRP A CE2 1 
ATOM   925  C CE3 . TRP A 1 114 ? -17.102 -26.487 -25.188 1.00 15.86 ? 195 TRP A CE3 1 
ATOM   926  C CZ2 . TRP A 1 114 ? -19.702 -27.636 -25.236 1.00 15.13 ? 195 TRP A CZ2 1 
ATOM   927  C CZ3 . TRP A 1 114 ? -18.119 -26.011 -24.370 1.00 16.25 ? 195 TRP A CZ3 1 
ATOM   928  C CH2 . TRP A 1 114 ? -19.400 -26.586 -24.399 1.00 16.16 ? 195 TRP A CH2 1 
ATOM   929  N N   . ALA A 1 115 ? -12.153 -28.775 -27.776 1.00 13.14 ? 196 ALA A N   1 
ATOM   930  C CA  . ALA A 1 115 ? -10.777 -28.345 -28.036 1.00 13.59 ? 196 ALA A CA  1 
ATOM   931  C C   . ALA A 1 115 ? -10.228 -28.977 -29.322 1.00 14.18 ? 196 ALA A C   1 
ATOM   932  O O   . ALA A 1 115 ? -9.534  -28.308 -30.087 1.00 15.02 ? 196 ALA A O   1 
ATOM   933  C CB  . ALA A 1 115 ? -9.886  -28.687 -26.854 1.00 13.27 ? 196 ALA A CB  1 
ATOM   934  N N   . LYS A 1 116 ? -10.553 -30.251 -29.549 1.00 15.39 ? 197 LYS A N   1 
ATOM   935  C CA  . LYS A 1 116 ? -10.145 -30.963 -30.765 1.00 16.87 ? 197 LYS A CA  1 
ATOM   936  C C   . LYS A 1 116 ? -10.683 -30.283 -32.020 1.00 16.35 ? 197 LYS A C   1 
ATOM   937  O O   . LYS A 1 116 ? -10.087 -30.392 -33.077 1.00 17.31 ? 197 LYS A O   1 
ATOM   938  C CB  . LYS A 1 116 ? -10.669 -32.401 -30.738 1.00 19.89 ? 197 LYS A CB  1 
ATOM   939  C CG  . LYS A 1 116 ? -9.835  -33.362 -29.922 1.00 25.57 ? 197 LYS A CG  1 
ATOM   940  C CD  . LYS A 1 116 ? -8.502  -33.603 -30.602 1.00 29.82 ? 197 LYS A CD  1 
ATOM   941  C CE  . LYS A 1 116 ? -7.552  -34.413 -29.734 1.00 32.30 ? 197 LYS A CE  1 
ATOM   942  N NZ  . LYS A 1 116 ? -6.161  -34.388 -30.286 1.00 34.06 ? 197 LYS A NZ  1 
ATOM   943  N N   . GLN A 1 117 ? -11.814 -29.585 -31.905 1.00 15.42 ? 198 GLN A N   1 
ATOM   944  C CA  . GLN A 1 117 ? -12.439 -28.927 -33.069 1.00 15.67 ? 198 GLN A CA  1 
ATOM   945  C C   . GLN A 1 117 ? -12.013 -27.471 -33.264 1.00 15.63 ? 198 GLN A C   1 
ATOM   946  O O   . GLN A 1 117 ? -12.549 -26.790 -34.138 1.00 16.13 ? 198 GLN A O   1 
ATOM   947  C CB  . GLN A 1 117 ? -13.960 -28.958 -32.955 1.00 15.99 ? 198 GLN A CB  1 
ATOM   948  C CG  . GLN A 1 117 ? -14.572 -30.337 -32.863 1.00 16.08 ? 198 GLN A CG  1 
ATOM   949  C CD  . GLN A 1 117 ? -16.075 -30.264 -32.737 1.00 15.52 ? 198 GLN A CD  1 
ATOM   950  O OE1 . GLN A 1 117 ? -16.748 -29.840 -33.663 1.00 16.91 ? 198 GLN A OE1 1 
ATOM   951  N NE2 . GLN A 1 117 ? -16.603 -30.666 -31.594 1.00 14.70 ? 198 GLN A NE2 1 
ATOM   952  N N   . GLY A 1 118 ? -11.083 -26.978 -32.456 1.00 14.54 ? 199 GLY A N   1 
ATOM   953  C CA  . GLY A 1 118 ? -10.645 -25.615 -32.636 1.00 13.93 ? 199 GLY A CA  1 
ATOM   954  C C   . GLY A 1 118 ? -11.244 -24.630 -31.657 1.00 13.35 ? 199 GLY A C   1 
ATOM   955  O O   . GLY A 1 118 ? -11.189 -23.428 -31.874 1.00 14.40 ? 199 GLY A O   1 
ATOM   956  N N   . VAL A 1 119 ? -11.839 -25.115 -30.587 1.00 13.14 ? 200 VAL A N   1 
ATOM   957  C CA  . VAL A 1 119 ? -12.326 -24.208 -29.559 1.00 12.85 ? 200 VAL A CA  1 
ATOM   958  C C   . VAL A 1 119 ? -11.232 -24.073 -28.512 1.00 13.18 ? 200 VAL A C   1 
ATOM   959  O O   . VAL A 1 119 ? -10.947 -25.023 -27.762 1.00 13.47 ? 200 VAL A O   1 
ATOM   960  C CB  . VAL A 1 119 ? -13.635 -24.706 -28.880 1.00 12.82 ? 200 VAL A CB  1 
ATOM   961  C CG1 . VAL A 1 119 ? -14.120 -23.693 -27.843 1.00 12.23 ? 200 VAL A CG1 1 
ATOM   962  C CG2 . VAL A 1 119 ? -14.704 -24.952 -29.936 1.00 12.65 ? 200 VAL A CG2 1 
ATOM   963  N N   . LEU A 1 120 ? -10.579 -22.918 -28.514 1.00 13.14 ? 201 LEU A N   1 
ATOM   964  C CA  . LEU A 1 120 ? -9.507  -22.653 -27.581 1.00 12.58 ? 201 LEU A CA  1 
ATOM   965  C C   . LEU A 1 120 ? -10.097 -22.304 -26.220 1.00 13.15 ? 201 LEU A C   1 
ATOM   966  O O   . LEU A 1 120 ? -10.827 -21.320 -26.081 1.00 13.27 ? 201 LEU A O   1 
ATOM   967  C CB  . LEU A 1 120 ? -8.633  -21.510 -28.112 1.00 12.76 ? 201 LEU A CB  1 
ATOM   968  C CG  . LEU A 1 120 ? -7.475  -21.058 -27.215 1.00 13.47 ? 201 LEU A CG  1 
ATOM   969  C CD1 . LEU A 1 120 ? -6.540  -22.223 -26.932 1.00 13.18 ? 201 LEU A CD1 1 
ATOM   970  C CD2 . LEU A 1 120 ? -6.723  -19.913 -27.878 1.00 13.18 ? 201 LEU A CD2 1 
ATOM   971  N N   . LEU A 1 121 ? -9.820  -23.140 -25.237 1.00 12.30 ? 202 LEU A N   1 
ATOM   972  C CA  . LEU A 1 121 ? -10.348 -22.948 -23.904 1.00 12.41 ? 202 LEU A CA  1 
ATOM   973  C C   . LEU A 1 121 ? -9.210  -22.452 -23.044 1.00 12.18 ? 202 LEU A C   1 
ATOM   974  O O   . LEU A 1 121 ? -8.555  -23.228 -22.353 1.00 11.91 ? 202 LEU A O   1 
ATOM   975  C CB  . LEU A 1 121 ? -10.912 -24.281 -23.413 1.00 13.29 ? 202 LEU A CB  1 
ATOM   976  C CG  . LEU A 1 121 ? -12.051 -24.842 -24.274 1.00 14.12 ? 202 LEU A CG  1 
ATOM   977  C CD1 . LEU A 1 121 ? -12.141 -26.343 -24.119 1.00 14.87 ? 202 LEU A CD1 1 
ATOM   978  C CD2 . LEU A 1 121 ? -13.359 -24.166 -23.895 1.00 15.24 ? 202 LEU A CD2 1 
ATOM   979  N N   . LEU A 1 122 ? -8.998  -21.133 -23.107 1.00 12.31 ? 203 LEU A N   1 
ATOM   980  C CA  . LEU A 1 122 ? -7.814  -20.510 -22.531 1.00 11.82 ? 203 LEU A CA  1 
ATOM   981  C C   . LEU A 1 122 ? -8.038  -19.754 -21.236 1.00 11.98 ? 203 LEU A C   1 
ATOM   982  O O   . LEU A 1 122 ? -8.723  -18.725 -21.228 1.00 11.95 ? 203 LEU A O   1 
ATOM   983  C CB  . LEU A 1 122 ? -7.208  -19.548 -23.562 1.00 12.37 ? 203 LEU A CB  1 
ATOM   984  C CG  . LEU A 1 122 ? -5.905  -18.849 -23.153 1.00 13.36 ? 203 LEU A CG  1 
ATOM   985  C CD1 . LEU A 1 122 ? -4.806  -19.884 -22.957 1.00 13.43 ? 203 LEU A CD1 1 
ATOM   986  C CD2 . LEU A 1 122 ? -5.509  -17.823 -24.197 1.00 12.54 ? 203 LEU A CD2 1 
ATOM   987  N N   . ASN A 1 123 ? -7.437  -20.250 -20.146 1.00 11.37 ? 204 ASN A N   1 
ATOM   988  C CA  . ASN A 1 123 ? -7.438  -19.496 -18.883 1.00 12.59 ? 204 ASN A CA  1 
ATOM   989  C C   . ASN A 1 123 ? -6.393  -18.376 -18.968 1.00 12.80 ? 204 ASN A C   1 
ATOM   990  O O   . ASN A 1 123 ? -5.382  -18.536 -19.648 1.00 13.60 ? 204 ASN A O   1 
ATOM   991  C CB  . ASN A 1 123 ? -7.090  -20.388 -17.689 1.00 12.02 ? 204 ASN A CB  1 
ATOM   992  C CG  . ASN A 1 123 ? -8.263  -21.174 -17.157 1.00 14.29 ? 204 ASN A CG  1 
ATOM   993  O OD1 . ASN A 1 123 ? -9.405  -20.710 -17.161 1.00 16.73 ? 204 ASN A OD1 1 
ATOM   994  N ND2 . ASN A 1 123 ? -7.996  -22.364 -16.676 1.00 15.36 ? 204 ASN A ND2 1 
ATOM   995  N N   . ALA A 1 124 ? -6.634  -17.256 -18.293 1.00 12.77 ? 205 ALA A N   1 
ATOM   996  C CA  . ALA A 1 124 ? -5.658  -16.159 -18.265 1.00 13.22 ? 205 ALA A CA  1 
ATOM   997  C C   . ALA A 1 124 ? -4.437  -16.510 -17.393 1.00 14.33 ? 205 ALA A C   1 
ATOM   998  O O   . ALA A 1 124 ? -3.307  -16.125 -17.698 1.00 15.65 ? 205 ALA A O   1 
ATOM   999  C CB  . ALA A 1 124 ? -6.318  -14.904 -17.741 1.00 12.72 ? 205 ALA A CB  1 
ATOM   1000 N N   . VAL A 1 125 ? -4.691  -17.225 -16.298 1.00 14.42 ? 206 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 125 ? -3.649  -17.694 -15.367 1.00 14.39 ? 206 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 125 ? -3.630  -19.212 -15.479 1.00 14.57 ? 206 VAL A C   1 
ATOM   1003 O O   . VAL A 1 125 ? -4.682  -19.847 -15.368 1.00 14.78 ? 206 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 125 ? -3.985  -17.255 -13.907 1.00 14.63 ? 206 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 125 ? -2.947  -17.763 -12.919 1.00 14.26 ? 206 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 125 ? -4.070  -15.735 -13.846 1.00 15.36 ? 206 VAL A CG2 1 
ATOM   1007 N N   . LEU A 1 126 ? -2.455  -19.797 -15.713 1.00 14.43 ? 207 LEU A N   1 
ATOM   1008 C CA  . LEU A 1 126 ? -2.402  -21.214 -16.085 1.00 14.72 ? 207 LEU A CA  1 
ATOM   1009 C C   . LEU A 1 126 ? -2.034  -22.178 -14.972 1.00 15.17 ? 207 LEU A C   1 
ATOM   1010 O O   . LEU A 1 126 ? -2.095  -23.388 -15.174 1.00 15.95 ? 207 LEU A O   1 
ATOM   1011 C CB  . LEU A 1 126 ? -1.492  -21.399 -17.311 1.00 14.28 ? 207 LEU A CB  1 
ATOM   1012 C CG  . LEU A 1 126 ? -1.983  -20.704 -18.609 1.00 14.91 ? 207 LEU A CG  1 
ATOM   1013 C CD1 . LEU A 1 126 ? -1.038  -20.992 -19.759 1.00 14.62 ? 207 LEU A CD1 1 
ATOM   1014 C CD2 . LEU A 1 126 ? -3.386  -21.176 -18.967 1.00 15.22 ? 207 LEU A CD2 1 
ATOM   1015 N N   . THR A 1 127 ? -1.661  -21.664 -13.800 1.00 15.19 ? 208 THR A N   1 
ATOM   1016 C CA  . THR A 1 127 ? -1.380  -22.540 -12.654 1.00 15.04 ? 208 THR A CA  1 
ATOM   1017 C C   . THR A 1 127 ? -2.012  -21.962 -11.397 1.00 15.01 ? 208 THR A C   1 
ATOM   1018 O O   . THR A 1 127 ? -2.351  -20.765 -11.348 1.00 14.81 ? 208 THR A O   1 
ATOM   1019 C CB  . THR A 1 127 ? 0.146   -22.741 -12.383 1.00 15.03 ? 208 THR A CB  1 
ATOM   1020 O OG1 . THR A 1 127 ? 0.798   -21.464 -12.294 1.00 15.66 ? 208 THR A OG1 1 
ATOM   1021 C CG2 . THR A 1 127 ? 0.801   -23.587 -13.465 1.00 14.44 ? 208 THR A CG2 1 
ATOM   1022 N N   . VAL A 1 128 ? -2.167  -22.803 -10.394 1.00 15.34 ? 209 VAL A N   1 
ATOM   1023 C CA  . VAL A 1 128 ? -2.723  -22.365 -9.125  1.00 16.92 ? 209 VAL A CA  1 
ATOM   1024 C C   . VAL A 1 128 ? -2.202  -23.266 -8.008  1.00 18.48 ? 209 VAL A C   1 
ATOM   1025 O O   . VAL A 1 128 ? -1.951  -24.455 -8.236  1.00 18.55 ? 209 VAL A O   1 
ATOM   1026 C CB  . VAL A 1 128 ? -4.287  -22.413 -9.148  1.00 16.78 ? 209 VAL A CB  1 
ATOM   1027 C CG1 . VAL A 1 128 ? -4.787  -23.852 -9.284  1.00 15.99 ? 209 VAL A CG1 1 
ATOM   1028 C CG2 . VAL A 1 128 ? -4.861  -21.754 -7.901  1.00 15.95 ? 209 VAL A CG2 1 
ATOM   1029 N N   . ARG A 1 129 ? -1.982  -22.692 -6.821  1.00 19.84 ? 210 ARG A N   1 
ATOM   1030 C CA  . ARG A 1 129 ? -1.633  -23.503 -5.670  1.00 21.39 ? 210 ARG A CA  1 
ATOM   1031 C C   . ARG A 1 129 ? -2.860  -24.268 -5.256  1.00 20.88 ? 210 ARG A C   1 
ATOM   1032 O O   . ARG A 1 129 ? -3.963  -23.702 -5.239  1.00 20.53 ? 210 ARG A O   1 
ATOM   1033 C CB  . ARG A 1 129 ? -1.231  -22.643 -4.491  1.00 24.18 ? 210 ARG A CB  1 
ATOM   1034 C CG  . ARG A 1 129 ? 0.197   -22.199 -4.472  1.00 27.89 ? 210 ARG A CG  1 
ATOM   1035 C CD  . ARG A 1 129 ? 0.618   -22.002 -3.032  1.00 31.19 ? 210 ARG A CD  1 
ATOM   1036 N NE  . ARG A 1 129 ? 1.586   -20.933 -2.888  1.00 34.88 ? 210 ARG A NE  1 
ATOM   1037 C CZ  . ARG A 1 129 ? 1.478   -19.999 -1.963  1.00 36.80 ? 210 ARG A CZ  1 
ATOM   1038 N NH1 . ARG A 1 129 ? 0.475   -20.043 -1.099  1.00 38.82 ? 210 ARG A NH1 1 
ATOM   1039 N NH2 . ARG A 1 129 ? 2.377   -19.032 -1.887  1.00 37.81 ? 210 ARG A NH2 1 
ATOM   1040 N N   . ALA A 1 130 ? -2.683  -25.525 -4.911  1.00 20.58 ? 211 ALA A N   1 
ATOM   1041 C CA  . ALA A 1 130 ? -3.809  -26.341 -4.483  1.00 22.23 ? 211 ALA A CA  1 
ATOM   1042 C C   . ALA A 1 130 ? -4.598  -25.651 -3.362  1.00 22.89 ? 211 ALA A C   1 
ATOM   1043 O O   . ALA A 1 130 ? -4.012  -25.127 -2.408  1.00 22.42 ? 211 ALA A O   1 
ATOM   1044 C CB  . ALA A 1 130 ? -3.320  -27.709 -4.009  1.00 22.56 ? 211 ALA A CB  1 
ATOM   1045 N N   . HIS A 1 131 ? -5.918  -25.608 -3.534  1.00 23.35 ? 212 HIS A N   1 
ATOM   1046 C CA  . HIS A 1 131 ? -6.847  -25.084 -2.526  1.00 24.60 ? 212 HIS A CA  1 
ATOM   1047 C C   . HIS A 1 131 ? -6.787  -23.583 -2.329  1.00 25.97 ? 212 HIS A C   1 
ATOM   1048 O O   . HIS A 1 131 ? -7.492  -23.064 -1.470  1.00 26.44 ? 212 HIS A O   1 
ATOM   1049 C CB  . HIS A 1 131 ? -6.629  -25.782 -1.181  1.00 23.94 ? 212 HIS A CB  1 
ATOM   1050 C CG  . HIS A 1 131 ? -6.674  -27.276 -1.276  1.00 23.07 ? 212 HIS A CG  1 
ATOM   1051 N ND1 . HIS A 1 131 ? -7.838  -27.943 -1.621  1.00 22.96 ? 212 HIS A ND1 1 
ATOM   1052 C CD2 . HIS A 1 131 ? -5.665  -28.176 -1.092  1.00 23.55 ? 212 HIS A CD2 1 
ATOM   1053 C CE1 . HIS A 1 131 ? -7.524  -29.229 -1.645  1.00 23.23 ? 212 HIS A CE1 1 
ATOM   1054 N NE2 . HIS A 1 131 ? -6.236  -29.392 -1.332  1.00 23.32 ? 212 HIS A NE2 1 
ATOM   1055 N N   . GLN A 1 132 ? -5.985  -22.880 -3.124  1.00 27.55 ? 213 GLN A N   1 
ATOM   1056 C CA  . GLN A 1 132 ? -5.863  -21.429 -2.973  1.00 28.58 ? 213 GLN A CA  1 
ATOM   1057 C C   . GLN A 1 132 ? -6.200  -20.690 -4.250  1.00 28.56 ? 213 GLN A C   1 
ATOM   1058 O O   . GLN A 1 132 ? -5.331  -20.474 -5.098  1.00 28.52 ? 213 GLN A O   1 
ATOM   1059 C CB  . GLN A 1 132 ? -4.452  -21.041 -2.567  1.00 30.45 ? 213 GLN A CB  1 
ATOM   1060 C CG  . GLN A 1 132 ? -4.173  -21.060 -1.085  1.00 34.62 ? 213 GLN A CG  1 
ATOM   1061 C CD  . GLN A 1 132 ? -2.732  -20.666 -0.804  1.00 36.66 ? 213 GLN A CD  1 
ATOM   1062 O OE1 . GLN A 1 132 ? -2.346  -19.495 -0.942  1.00 37.03 ? 213 GLN A OE1 1 
ATOM   1063 N NE2 . GLN A 1 132 ? -1.921  -21.642 -0.425  1.00 37.56 ? 213 GLN A NE2 1 
ATOM   1064 N N   . ALA A 1 133 ? -7.450  -20.259 -4.366  1.00 28.22 ? 214 ALA A N   1 
ATOM   1065 C CA  . ALA A 1 133 ? -7.887  -19.522 -5.535  1.00 27.75 ? 214 ALA A CA  1 
ATOM   1066 C C   . ALA A 1 133 ? -7.025  -18.287 -5.775  1.00 27.45 ? 214 ALA A C   1 
ATOM   1067 O O   . ALA A 1 133 ? -6.673  -17.575 -4.843  1.00 27.63 ? 214 ALA A O   1 
ATOM   1068 C CB  . ALA A 1 133 ? -9.340  -19.105 -5.363  1.00 27.64 ? 214 ALA A CB  1 
ATOM   1069 N N   . ASN A 1 134 ? -6.658  -18.082 -7.034  1.00 27.28 ? 215 ASN A N   1 
ATOM   1070 C CA  . ASN A 1 134 ? -5.931  -16.885 -7.473  1.00 27.61 ? 215 ASN A CA  1 
ATOM   1071 C C   . ASN A 1 134 ? -4.533  -16.751 -6.886  1.00 26.88 ? 215 ASN A C   1 
ATOM   1072 O O   . ASN A 1 134 ? -3.913  -15.683 -7.020  1.00 27.54 ? 215 ASN A O   1 
ATOM   1073 C CB  . ASN A 1 134 ? -6.710  -15.594 -7.145  1.00 28.93 ? 215 ASN A CB  1 
ATOM   1074 C CG  . ASN A 1 134 ? -8.084  -15.527 -7.772  1.00 30.89 ? 215 ASN A CG  1 
ATOM   1075 O OD1 . ASN A 1 134 ? -9.089  -15.451 -7.069  1.00 33.16 ? 215 ASN A OD1 1 
ATOM   1076 N ND2 . ASN A 1 134 ? -8.144  -15.544 -9.089  1.00 31.86 ? 215 ASN A ND2 1 
ATOM   1077 N N   . SER A 1 135 ? -4.010  -17.801 -6.275  1.00 24.95 ? 216 SER A N   1 
ATOM   1078 C CA  . SER A 1 135 ? -2.689  -17.705 -5.661  1.00 23.85 ? 216 SER A CA  1 
ATOM   1079 C C   . SER A 1 135 ? -1.559  -17.422 -6.671  1.00 23.30 ? 216 SER A C   1 
ATOM   1080 O O   . SER A 1 135 ? -0.474  -16.991 -6.282  1.00 23.49 ? 216 SER A O   1 
ATOM   1081 C CB  . SER A 1 135 ? -2.392  -18.978 -4.877  1.00 23.37 ? 216 SER A CB  1 
ATOM   1082 O OG  . SER A 1 135 ? -2.676  -20.126 -5.660  1.00 23.05 ? 216 SER A OG  1 
ATOM   1083 N N   . HIS A 1 136 ? -1.788  -17.654 -7.976  1.00 22.34 ? 217 HIS A N   1 
ATOM   1084 C CA  . HIS A 1 136 ? -0.718  -17.424 -8.951  1.00 21.81 ? 217 HIS A CA  1 
ATOM   1085 C C   . HIS A 1 136 ? -0.994  -16.269 -9.902  1.00 22.28 ? 217 HIS A C   1 
ATOM   1086 O O   . HIS A 1 136 ? -0.351  -16.166 -10.942 1.00 21.27 ? 217 HIS A O   1 
ATOM   1087 C CB  . HIS A 1 136 ? -0.405  -18.699 -9.753  1.00 21.27 ? 217 HIS A CB  1 
ATOM   1088 C CG  . HIS A 1 136 ? 0.424   -19.708 -9.003  1.00 21.79 ? 217 HIS A CG  1 
ATOM   1089 N ND1 . HIS A 1 136 ? 1.022   -20.776 -9.653  1.00 21.18 ? 217 HIS A ND1 1 
ATOM   1090 C CD2 . HIS A 1 136 ? 0.703   -19.781 -7.661  1.00 21.48 ? 217 HIS A CD2 1 
ATOM   1091 C CE1 . HIS A 1 136 ? 1.645   -21.477 -8.715  1.00 21.72 ? 217 HIS A CE1 1 
ATOM   1092 N NE2 . HIS A 1 136 ? 1.465   -20.902 -7.520  1.00 21.59 ? 217 HIS A NE2 1 
ATOM   1093 N N   . LYS A 1 137 ? -1.928  -15.392 -9.551  1.00 23.65 ? 218 LYS A N   1 
ATOM   1094 C CA  . LYS A 1 137 ? -2.212  -14.257 -10.406 1.00 25.41 ? 218 LYS A CA  1 
ATOM   1095 C C   . LYS A 1 137 ? -1.114  -13.191 -10.316 1.00 25.56 ? 218 LYS A C   1 
ATOM   1096 O O   . LYS A 1 137 ? -0.441  -13.044 -9.294  1.00 24.63 ? 218 LYS A O   1 
ATOM   1097 C CB  . LYS A 1 137 ? -3.569  -13.644 -10.075 1.00 27.60 ? 218 LYS A CB  1 
ATOM   1098 C CG  . LYS A 1 137 ? -3.604  -12.845 -8.797  1.00 31.88 ? 218 LYS A CG  1 
ATOM   1099 C CD  . LYS A 1 137 ? -4.800  -11.904 -8.790  1.00 35.15 ? 218 LYS A CD  1 
ATOM   1100 C CE  . LYS A 1 137 ? -4.791  -11.018 -7.551  1.00 37.55 ? 218 LYS A CE  1 
ATOM   1101 N NZ  . LYS A 1 137 ? -5.943  -10.067 -7.543  1.00 39.49 ? 218 LYS A NZ  1 
ATOM   1102 N N   . GLU A 1 138 ? -0.907  -12.502 -11.430 1.00 26.13 ? 219 GLU A N   1 
ATOM   1103 C CA  . GLU A 1 138 ? 0.060   -11.424 -11.526 1.00 26.93 ? 219 GLU A CA  1 
ATOM   1104 C C   . GLU A 1 138 ? 1.490   -11.865 -11.291 1.00 26.52 ? 219 GLU A C   1 
ATOM   1105 O O   . GLU A 1 138 ? 2.267   -11.143 -10.676 1.00 27.30 ? 219 GLU A O   1 
ATOM   1106 C CB  . GLU A 1 138 ? -0.334  -10.283 -10.597 1.00 28.99 ? 219 GLU A CB  1 
ATOM   1107 C CG  . GLU A 1 138 ? -1.510  -9.500  -11.151 1.00 33.57 ? 219 GLU A CG  1 
ATOM   1108 C CD  . GLU A 1 138 ? -2.305  -8.761  -10.099 1.00 37.69 ? 219 GLU A CD  1 
ATOM   1109 O OE1 . GLU A 1 138 ? -1.779  -8.541  -8.977  1.00 39.81 ? 219 GLU A OE1 1 
ATOM   1110 O OE2 . GLU A 1 138 ? -3.468  -8.396  -10.392 1.00 40.20 ? 219 GLU A OE2 1 
ATOM   1111 N N   . ARG A 1 139 ? 1.837   -13.053 -11.800 1.00 25.32 ? 220 ARG A N   1 
ATOM   1112 C CA  . ARG A 1 139 ? 3.221   -13.548 -11.723 1.00 25.15 ? 220 ARG A CA  1 
ATOM   1113 C C   . ARG A 1 139 ? 3.805   -13.692 -13.129 1.00 23.52 ? 220 ARG A C   1 
ATOM   1114 O O   . ARG A 1 139 ? 4.921   -14.177 -13.292 1.00 23.18 ? 220 ARG A O   1 
ATOM   1115 C CB  . ARG A 1 139 ? 3.320   -14.920 -11.024 1.00 26.84 ? 220 ARG A CB  1 
ATOM   1116 C CG  . ARG A 1 139 ? 2.550   -15.068 -9.727  1.00 29.98 ? 220 ARG A CG  1 
ATOM   1117 C CD  . ARG A 1 139 ? 2.799   -13.914 -8.781  1.00 33.94 ? 220 ARG A CD  1 
ATOM   1118 N NE  . ARG A 1 139 ? 4.160   -13.881 -8.290  1.00 37.80 ? 220 ARG A NE  1 
ATOM   1119 C CZ  . ARG A 1 139 ? 4.458   -13.902 -6.986  1.00 40.85 ? 220 ARG A CZ  1 
ATOM   1120 N NH1 . ARG A 1 139 ? 3.484   -13.974 -6.062  1.00 41.19 ? 220 ARG A NH1 1 
ATOM   1121 N NH2 . ARG A 1 139 ? 5.735   -13.862 -6.603  1.00 41.27 ? 220 ARG A NH2 1 
ATOM   1122 N N   . GLY A 1 140 ? 3.031   -13.296 -14.147 1.00 21.61 ? 221 GLY A N   1 
ATOM   1123 C CA  . GLY A 1 140 ? 3.510   -13.396 -15.509 1.00 19.41 ? 221 GLY A CA  1 
ATOM   1124 C C   . GLY A 1 140 ? 2.549   -14.102 -16.452 1.00 17.92 ? 221 GLY A C   1 
ATOM   1125 O O   . GLY A 1 140 ? 2.636   -13.928 -17.669 1.00 17.82 ? 221 GLY A O   1 
ATOM   1126 N N   . TRP A 1 141 ? 1.623   -14.902 -15.922 1.00 16.94 ? 222 TRP A N   1 
ATOM   1127 C CA  . TRP A 1 141 ? 0.695   -15.645 -16.800 1.00 15.91 ? 222 TRP A CA  1 
ATOM   1128 C C   . TRP A 1 141 ? -0.160  -14.722 -17.651 1.00 15.70 ? 222 TRP A C   1 
ATOM   1129 O O   . TRP A 1 141 ? -0.337  -14.964 -18.846 1.00 15.20 ? 222 TRP A O   1 
ATOM   1130 C CB  . TRP A 1 141 ? -0.216  -16.577 -16.010 1.00 14.45 ? 222 TRP A CB  1 
ATOM   1131 C CG  . TRP A 1 141 ? 0.437   -17.870 -15.596 1.00 14.99 ? 222 TRP A CG  1 
ATOM   1132 C CD1 . TRP A 1 141 ? 0.527   -18.375 -14.317 1.00 14.56 ? 222 TRP A CD1 1 
ATOM   1133 C CD2 . TRP A 1 141 ? 1.112   -18.820 -16.458 1.00 14.54 ? 222 TRP A CD2 1 
ATOM   1134 N NE1 . TRP A 1 141 ? 1.216   -19.558 -14.357 1.00 15.07 ? 222 TRP A NE1 1 
ATOM   1135 C CE2 . TRP A 1 141 ? 1.590   -19.866 -15.631 1.00 15.03 ? 222 TRP A CE2 1 
ATOM   1136 C CE3 . TRP A 1 141 ? 1.369   -18.888 -17.848 1.00 15.17 ? 222 TRP A CE3 1 
ATOM   1137 C CZ2 . TRP A 1 141 ? 2.303   -20.961 -16.140 1.00 15.12 ? 222 TRP A CZ2 1 
ATOM   1138 C CZ3 . TRP A 1 141 ? 2.080   -19.972 -18.351 1.00 14.71 ? 222 TRP A CZ3 1 
ATOM   1139 C CH2 . TRP A 1 141 ? 2.537   -20.994 -17.499 1.00 15.49 ? 222 TRP A CH2 1 
ATOM   1140 N N   . GLU A 1 142 ? -0.668  -13.657 -17.045 1.00 16.03 ? 223 GLU A N   1 
ATOM   1141 C CA  . GLU A 1 142 ? -1.527  -12.711 -17.766 1.00 16.76 ? 223 GLU A CA  1 
ATOM   1142 C C   . GLU A 1 142 ? -0.811  -12.105 -18.981 1.00 17.51 ? 223 GLU A C   1 
ATOM   1143 O O   . GLU A 1 142 ? -1.420  -11.923 -20.036 1.00 17.28 ? 223 GLU A O   1 
ATOM   1144 C CB  . GLU A 1 142 ? -2.027  -11.594 -16.832 1.00 16.41 ? 223 GLU A CB  1 
ATOM   1145 C CG  . GLU A 1 142 ? -2.941  -12.068 -15.697 1.00 16.83 ? 223 GLU A CG  1 
ATOM   1146 C CD  . GLU A 1 142 ? -2.217  -12.503 -14.414 1.00 17.35 ? 223 GLU A CD  1 
ATOM   1147 O OE1 . GLU A 1 142 ? -1.019  -12.829 -14.453 1.00 18.19 ? 223 GLU A OE1 1 
ATOM   1148 O OE2 . GLU A 1 142 ? -2.858  -12.522 -13.359 1.00 18.22 ? 223 GLU A OE2 1 
ATOM   1149 N N   . GLN A 1 143 ? 0.487   -11.783 -18.843 1.00 18.01 ? 224 GLN A N   1 
ATOM   1150 C CA  . GLN A 1 143 ? 1.238   -11.243 -19.985 1.00 18.87 ? 224 GLN A CA  1 
ATOM   1151 C C   . GLN A 1 143 ? 1.379   -12.294 -21.067 1.00 17.28 ? 224 GLN A C   1 
ATOM   1152 O O   . GLN A 1 143 ? 1.302   -11.984 -22.247 1.00 17.86 ? 224 GLN A O   1 
ATOM   1153 C CB  . GLN A 1 143 ? 2.632   -10.745 -19.577 1.00 21.50 ? 224 GLN A CB  1 
ATOM   1154 C CG  . GLN A 1 143 ? 2.628   -9.419  -18.844 1.00 27.21 ? 224 GLN A CG  1 
ATOM   1155 C CD  . GLN A 1 143 ? 1.831   -9.469  -17.550 1.00 31.27 ? 224 GLN A CD  1 
ATOM   1156 O OE1 . GLN A 1 143 ? 2.036   -10.361 -16.707 1.00 33.66 ? 224 GLN A OE1 1 
ATOM   1157 N NE2 . GLN A 1 143 ? 0.895   -8.522  -17.385 1.00 32.94 ? 224 GLN A NE2 1 
ATOM   1158 N N   . PHE A 1 144 ? 1.556   -13.539 -20.657 1.00 15.87 ? 225 PHE A N   1 
ATOM   1159 C CA  . PHE A 1 144 ? 1.701   -14.613 -21.605 1.00 15.24 ? 225 PHE A CA  1 
ATOM   1160 C C   . PHE A 1 144 ? 0.413   -14.858 -22.363 1.00 14.53 ? 225 PHE A C   1 
ATOM   1161 O O   . PHE A 1 144 ? 0.430   -14.970 -23.583 1.00 15.18 ? 225 PHE A O   1 
ATOM   1162 C CB  . PHE A 1 144 ? 2.150   -15.906 -20.911 1.00 15.33 ? 225 PHE A CB  1 
ATOM   1163 C CG  . PHE A 1 144 ? 2.309   -17.030 -21.888 1.00 16.01 ? 225 PHE A CG  1 
ATOM   1164 C CD1 . PHE A 1 144 ? 3.215   -16.929 -22.935 1.00 16.96 ? 225 PHE A CD1 1 
ATOM   1165 C CD2 . PHE A 1 144 ? 1.497   -18.149 -21.814 1.00 16.97 ? 225 PHE A CD2 1 
ATOM   1166 C CE1 . PHE A 1 144 ? 3.307   -17.928 -23.904 1.00 19.27 ? 225 PHE A CE1 1 
ATOM   1167 C CE2 . PHE A 1 144 ? 1.577   -19.150 -22.772 1.00 18.06 ? 225 PHE A CE2 1 
ATOM   1168 C CZ  . PHE A 1 144 ? 2.482   -19.042 -23.823 1.00 18.70 ? 225 PHE A CZ  1 
ATOM   1169 N N   . THR A 1 145 ? -0.708  -14.954 -21.650 1.00 14.53 ? 226 THR A N   1 
ATOM   1170 C CA  . THR A 1 145 ? -1.982  -15.196 -22.324 1.00 14.04 ? 226 THR A CA  1 
ATOM   1171 C C   . THR A 1 145 ? -2.455  -13.963 -23.110 1.00 13.97 ? 226 THR A C   1 
ATOM   1172 O O   . THR A 1 145 ? -3.147  -14.109 -24.115 1.00 14.71 ? 226 THR A O   1 
ATOM   1173 C CB  . THR A 1 145 ? -3.067  -15.710 -21.347 1.00 13.49 ? 226 THR A CB  1 
ATOM   1174 O OG1 . THR A 1 145 ? -3.204  -14.817 -20.232 1.00 13.62 ? 226 THR A OG1 1 
ATOM   1175 C CG2 . THR A 1 145 ? -2.659  -17.085 -20.834 1.00 13.09 ? 226 THR A CG2 1 
ATOM   1176 N N   . ASP A 1 146 ? -2.054  -12.754 -22.687 1.00 14.07 ? 227 ASP A N   1 
ATOM   1177 C CA  . ASP A 1 146 ? -2.332  -11.553 -23.500 1.00 15.14 ? 227 ASP A CA  1 
ATOM   1178 C C   . ASP A 1 146 ? -1.569  -11.642 -24.816 1.00 15.36 ? 227 ASP A C   1 
ATOM   1179 O O   . ASP A 1 146 ? -2.073  -11.263 -25.872 1.00 15.46 ? 227 ASP A O   1 
ATOM   1180 C CB  . ASP A 1 146 ? -1.932  -10.257 -22.781 1.00 15.57 ? 227 ASP A CB  1 
ATOM   1181 C CG  . ASP A 1 146 ? -2.951  -9.779  -21.757 1.00 17.19 ? 227 ASP A CG  1 
ATOM   1182 O OD1 . ASP A 1 146 ? -4.120  -10.200 -21.822 1.00 18.20 ? 227 ASP A OD1 1 
ATOM   1183 O OD2 . ASP A 1 146 ? -2.583  -8.963  -20.890 1.00 18.36 ? 227 ASP A OD2 1 
ATOM   1184 N N   . ALA A 1 147 ? -0.339  -12.171 -24.750 1.00 16.42 ? 228 ALA A N   1 
ATOM   1185 C CA  . ALA A 1 147 ? 0.477   -12.367 -25.953 1.00 15.96 ? 228 ALA A CA  1 
ATOM   1186 C C   . ALA A 1 147 ? -0.173  -13.404 -26.879 1.00 15.82 ? 228 ALA A C   1 
ATOM   1187 O O   . ALA A 1 147 ? -0.151  -13.254 -28.111 1.00 16.42 ? 228 ALA A O   1 
ATOM   1188 C CB  . ALA A 1 147 ? 1.890   -12.802 -25.564 1.00 15.70 ? 228 ALA A CB  1 
ATOM   1189 N N   . VAL A 1 148 ? -0.760  -14.461 -26.298 1.00 16.00 ? 229 VAL A N   1 
ATOM   1190 C CA  . VAL A 1 148 ? -1.446  -15.463 -27.115 1.00 16.33 ? 229 VAL A CA  1 
ATOM   1191 C C   . VAL A 1 148 ? -2.681  -14.849 -27.788 1.00 16.59 ? 229 VAL A C   1 
ATOM   1192 O O   . VAL A 1 148 ? -2.892  -15.043 -28.991 1.00 16.57 ? 229 VAL A O   1 
ATOM   1193 C CB  . VAL A 1 148 ? -1.859  -16.718 -26.301 1.00 16.86 ? 229 VAL A CB  1 
ATOM   1194 C CG1 . VAL A 1 148 ? -2.631  -17.695 -27.188 1.00 16.16 ? 229 VAL A CG1 1 
ATOM   1195 C CG2 . VAL A 1 148 ? -0.619  -17.395 -25.736 1.00 16.20 ? 229 VAL A CG2 1 
ATOM   1196 N N   . VAL A 1 149 ? -3.484  -14.084 -27.025 1.00 16.92 ? 230 VAL A N   1 
ATOM   1197 C CA  . VAL A 1 149 ? -4.661  -13.408 -27.595 1.00 16.84 ? 230 VAL A CA  1 
ATOM   1198 C C   . VAL A 1 149 ? -4.233  -12.380 -28.662 1.00 17.64 ? 230 VAL A C   1 
ATOM   1199 O O   . VAL A 1 149 ? -4.846  -12.282 -29.718 1.00 16.59 ? 230 VAL A O   1 
ATOM   1200 C CB  . VAL A 1 149 ? -5.489  -12.716 -26.486 1.00 16.57 ? 230 VAL A CB  1 
ATOM   1201 C CG1 . VAL A 1 149 ? -6.618  -11.892 -27.085 1.00 16.76 ? 230 VAL A CG1 1 
ATOM   1202 C CG2 . VAL A 1 149 ? -6.060  -13.775 -25.553 1.00 16.52 ? 230 VAL A CG2 1 
ATOM   1203 N N   . SER A 1 150 ? -3.150  -11.646 -28.400 1.00 18.57 ? 231 SER A N   1 
ATOM   1204 C CA  . SER A 1 150 ? -2.642  -10.666 -29.373 1.00 19.25 ? 231 SER A CA  1 
ATOM   1205 C C   . SER A 1 150 ? -2.204  -11.356 -30.668 1.00 19.97 ? 231 SER A C   1 
ATOM   1206 O O   . SER A 1 150 ? -2.544  -10.881 -31.764 1.00 21.11 ? 231 SER A O   1 
ATOM   1207 C CB  . SER A 1 150 ? -1.474  -9.860  -28.787 1.00 18.93 ? 231 SER A CB  1 
ATOM   1208 O OG  . SER A 1 150 ? -1.071  -8.815  -29.668 1.00 19.85 ? 231 SER A OG  1 
ATOM   1209 N N   . TRP A 1 151 ? -1.486  -12.488 -30.549 1.00 19.29 ? 232 TRP A N   1 
ATOM   1210 C CA  . TRP A 1 151 ? -1.054  -13.232 -31.735 1.00 19.53 ? 232 TRP A CA  1 
ATOM   1211 C C   . TRP A 1 151 ? -2.261  -13.640 -32.584 1.00 19.98 ? 232 TRP A C   1 
ATOM   1212 O O   . TRP A 1 151 ? -2.289  -13.419 -33.790 1.00 20.50 ? 232 TRP A O   1 
ATOM   1213 C CB  . TRP A 1 151 ? -0.257  -14.491 -31.341 1.00 19.68 ? 232 TRP A CB  1 
ATOM   1214 C CG  . TRP A 1 151 ? 0.381   -15.164 -32.520 1.00 20.39 ? 232 TRP A CG  1 
ATOM   1215 C CD1 . TRP A 1 151 ? 1.649   -14.950 -32.990 1.00 21.28 ? 232 TRP A CD1 1 
ATOM   1216 C CD2 . TRP A 1 151 ? -0.247  -16.074 -33.451 1.00 20.67 ? 232 TRP A CD2 1 
ATOM   1217 N NE1 . TRP A 1 151 ? 1.824   -15.662 -34.148 1.00 21.97 ? 232 TRP A NE1 1 
ATOM   1218 C CE2 . TRP A 1 151 ? 0.699   -16.357 -34.466 1.00 21.79 ? 232 TRP A CE2 1 
ATOM   1219 C CE3 . TRP A 1 151 ? -1.516  -16.673 -33.529 1.00 21.26 ? 232 TRP A CE3 1 
ATOM   1220 C CZ2 . TRP A 1 151 ? 0.420   -17.204 -35.541 1.00 21.63 ? 232 TRP A CZ2 1 
ATOM   1221 C CZ3 . TRP A 1 151 ? -1.797  -17.513 -34.595 1.00 21.89 ? 232 TRP A CZ3 1 
ATOM   1222 C CH2 . TRP A 1 151 ? -0.833  -17.772 -35.588 1.00 22.51 ? 232 TRP A CH2 1 
ATOM   1223 N N   . LEU A 1 152 ? -3.265  -14.238 -31.944 1.00 19.83 ? 233 LEU A N   1 
ATOM   1224 C CA  . LEU A 1 152 ? -4.461  -14.676 -32.657 1.00 19.91 ? 233 LEU A CA  1 
ATOM   1225 C C   . LEU A 1 152 ? -5.176  -13.484 -33.270 1.00 20.21 ? 233 LEU A C   1 
ATOM   1226 O O   . LEU A 1 152 ? -5.642  -13.538 -34.406 1.00 20.13 ? 233 LEU A O   1 
ATOM   1227 C CB  . LEU A 1 152 ? -5.400  -15.426 -31.703 1.00 19.62 ? 233 LEU A CB  1 
ATOM   1228 C CG  . LEU A 1 152 ? -4.948  -16.828 -31.269 1.00 20.07 ? 233 LEU A CG  1 
ATOM   1229 C CD1 . LEU A 1 152 ? -5.746  -17.279 -30.057 1.00 20.87 ? 233 LEU A CD1 1 
ATOM   1230 C CD2 . LEU A 1 152 ? -5.090  -17.813 -32.426 1.00 20.02 ? 233 LEU A CD2 1 
ATOM   1231 N N   . ASN A 1 153 ? -5.227  -12.403 -32.522 1.00 20.94 ? 234 ASN A N   1 
ATOM   1232 C CA  . ASN A 1 153 ? -5.899  -11.208 -32.971 1.00 23.11 ? 234 ASN A CA  1 
ATOM   1233 C C   . ASN A 1 153 ? -5.297  -10.696 -34.293 1.00 24.44 ? 234 ASN A C   1 
ATOM   1234 O O   . ASN A 1 153 ? -6.038  -10.298 -35.202 1.00 24.38 ? 234 ASN A O   1 
ATOM   1235 C CB  . ASN A 1 153 ? -5.798  -10.147 -31.863 1.00 23.56 ? 234 ASN A CB  1 
ATOM   1236 C CG  . ASN A 1 153 ? -6.622  -8.899  -32.097 1.00 23.91 ? 234 ASN A CG  1 
ATOM   1237 O OD1 . ASN A 1 153 ? -7.760  -8.959  -32.556 1.00 25.07 ? 234 ASN A OD1 1 
ATOM   1238 N ND2 . ASN A 1 153 ? -6.049  -7.757  -31.767 1.00 24.72 ? 234 ASN A ND2 1 
ATOM   1239 N N   . GLN A 1 154 ? -3.966  -10.761 -34.418 1.00 25.88 ? 235 GLN A N   1 
ATOM   1240 C CA  . GLN A 1 154 ? -3.290  -10.206 -35.599 1.00 28.40 ? 235 GLN A CA  1 
ATOM   1241 C C   . GLN A 1 154 ? -3.009  -11.210 -36.718 1.00 28.63 ? 235 GLN A C   1 
ATOM   1242 O O   . GLN A 1 154 ? -2.885  -10.824 -37.874 1.00 29.65 ? 235 GLN A O   1 
ATOM   1243 C CB  . GLN A 1 154 ? -1.967  -9.585  -35.191 1.00 30.19 ? 235 GLN A CB  1 
ATOM   1244 C CG  . GLN A 1 154 ? -2.068  -8.594  -34.061 1.00 34.51 ? 235 GLN A CG  1 
ATOM   1245 C CD  . GLN A 1 154 ? -0.694  -8.160  -33.606 1.00 37.62 ? 235 GLN A CD  1 
ATOM   1246 O OE1 . GLN A 1 154 ? -0.378  -8.178  -32.408 1.00 39.10 ? 235 GLN A OE1 1 
ATOM   1247 N NE2 . GLN A 1 154 ? 0.141   -7.776  -34.568 1.00 39.29 ? 235 GLN A NE2 1 
ATOM   1248 N N   . ASN A 1 155 ? -2.880  -12.478 -36.395 1.00 28.17 ? 236 ASN A N   1 
ATOM   1249 C CA  . ASN A 1 155 ? -2.487  -13.446 -37.400 1.00 28.06 ? 236 ASN A CA  1 
ATOM   1250 C C   . ASN A 1 155 ? -3.611  -14.323 -37.883 1.00 28.58 ? 236 ASN A C   1 
ATOM   1251 O O   . ASN A 1 155 ? -3.401  -15.157 -38.760 1.00 30.12 ? 236 ASN A O   1 
ATOM   1252 C CB  . ASN A 1 155 ? -1.357  -14.309 -36.866 1.00 28.23 ? 236 ASN A CB  1 
ATOM   1253 C CG  . ASN A 1 155 ? -0.100  -13.499 -36.647 1.00 28.77 ? 236 ASN A CG  1 
ATOM   1254 O OD1 . ASN A 1 155 ? 0.243   -13.146 -35.513 1.00 27.75 ? 236 ASN A OD1 1 
ATOM   1255 N ND2 . ASN A 1 155 ? 0.591   -13.189 -37.740 1.00 28.72 ? 236 ASN A ND2 1 
ATOM   1256 N N   . SER A 1 156 ? -4.787  -14.163 -37.321 1.00 27.91 ? 237 SER A N   1 
ATOM   1257 C CA  . SER A 1 156 ? -5.931  -14.960 -37.745 1.00 27.55 ? 237 SER A CA  1 
ATOM   1258 C C   . SER A 1 156 ? -7.017  -14.042 -38.244 1.00 26.87 ? 237 SER A C   1 
ATOM   1259 O O   . SER A 1 156 ? -6.921  -12.827 -38.090 1.00 26.52 ? 237 SER A O   1 
ATOM   1260 C CB  . SER A 1 156 ? -6.461  -15.803 -36.583 1.00 27.79 ? 237 SER A CB  1 
ATOM   1261 O OG  . SER A 1 156 ? -5.469  -16.695 -36.113 1.00 31.01 ? 237 SER A OG  1 
ATOM   1262 N N   . ASN A 1 157 ? -8.054  -14.618 -38.821 1.00 26.84 ? 238 ASN A N   1 
ATOM   1263 C CA  . ASN A 1 157 ? -9.160  -13.833 -39.346 1.00 26.70 ? 238 ASN A CA  1 
ATOM   1264 C C   . ASN A 1 157 ? -10.464 -14.526 -39.083 1.00 24.54 ? 238 ASN A C   1 
ATOM   1265 O O   . ASN A 1 157 ? -10.551 -15.748 -39.225 1.00 25.21 ? 238 ASN A O   1 
ATOM   1266 C CB  . ASN A 1 157 ? -9.011  -13.633 -40.864 1.00 30.12 ? 238 ASN A CB  1 
ATOM   1267 C CG  . ASN A 1 157 ? -8.170  -12.429 -41.208 1.00 33.31 ? 238 ASN A CG  1 
ATOM   1268 O OD1 . ASN A 1 157 ? -8.649  -11.302 -41.135 1.00 36.64 ? 238 ASN A OD1 1 
ATOM   1269 N ND2 . ASN A 1 157 ? -6.910  -12.654 -41.584 1.00 35.14 ? 238 ASN A ND2 1 
ATOM   1270 N N   . GLY A 1 158 ? -11.453 -13.755 -38.680 1.00 22.21 ? 239 GLY A N   1 
ATOM   1271 C CA  . GLY A 1 158 ? -12.790 -14.291 -38.513 1.00 21.43 ? 239 GLY A CA  1 
ATOM   1272 C C   . GLY A 1 158 ? -12.982 -15.253 -37.349 1.00 20.57 ? 239 GLY A C   1 
ATOM   1273 O O   . GLY A 1 158 ? -13.869 -16.105 -37.393 1.00 19.59 ? 239 GLY A O   1 
ATOM   1274 N N   . LEU A 1 159 ? -12.163 -15.127 -36.310 1.00 19.67 ? 240 LEU A N   1 
ATOM   1275 C CA  . LEU A 1 159 ? -12.357 -15.946 -35.121 1.00 19.26 ? 240 LEU A CA  1 
ATOM   1276 C C   . LEU A 1 159 ? -13.565 -15.440 -34.348 1.00 18.07 ? 240 LEU A C   1 
ATOM   1277 O O   . LEU A 1 159 ? -13.942 -14.263 -34.459 1.00 18.78 ? 240 LEU A O   1 
ATOM   1278 C CB  . LEU A 1 159 ? -11.141 -15.877 -34.192 1.00 19.84 ? 240 LEU A CB  1 
ATOM   1279 C CG  . LEU A 1 159 ? -9.802  -16.367 -34.732 1.00 20.22 ? 240 LEU A CG  1 
ATOM   1280 C CD1 . LEU A 1 159 ? -8.732  -16.152 -33.683 1.00 20.96 ? 240 LEU A CD1 1 
ATOM   1281 C CD2 . LEU A 1 159 ? -9.888  -17.832 -35.089 1.00 21.29 ? 240 LEU A CD2 1 
ATOM   1282 N N   . VAL A 1 160 ? -14.171 -16.325 -33.585 1.00 16.63 ? 241 VAL A N   1 
ATOM   1283 C CA  . VAL A 1 160 ? -15.264 -15.939 -32.708 1.00 15.29 ? 241 VAL A CA  1 
ATOM   1284 C C   . VAL A 1 160 ? -14.748 -15.990 -31.267 1.00 14.79 ? 241 VAL A C   1 
ATOM   1285 O O   . VAL A 1 160 ? -14.263 -17.034 -30.807 1.00 14.11 ? 241 VAL A O   1 
ATOM   1286 C CB  . VAL A 1 160 ? -16.485 -16.891 -32.841 1.00 15.24 ? 241 VAL A CB  1 
ATOM   1287 C CG1 . VAL A 1 160 ? -17.622 -16.422 -31.942 1.00 14.63 ? 241 VAL A CG1 1 
ATOM   1288 C CG2 . VAL A 1 160 ? -16.945 -16.961 -34.288 1.00 15.19 ? 241 VAL A CG2 1 
ATOM   1289 N N   . PHE A 1 161 ? -14.795 -14.854 -30.590 1.00 14.31 ? 242 PHE A N   1 
ATOM   1290 C CA  . PHE A 1 161 ? -14.397 -14.783 -29.188 1.00 14.43 ? 242 PHE A CA  1 
ATOM   1291 C C   . PHE A 1 161 ? -15.646 -14.722 -28.300 1.00 14.68 ? 242 PHE A C   1 
ATOM   1292 O O   . PHE A 1 161 ? -16.520 -13.876 -28.503 1.00 14.20 ? 242 PHE A O   1 
ATOM   1293 C CB  . PHE A 1 161 ? -13.529 -13.535 -28.926 1.00 15.33 ? 242 PHE A CB  1 
ATOM   1294 C CG  . PHE A 1 161 ? -12.140 -13.585 -29.501 1.00 15.70 ? 242 PHE A CG  1 
ATOM   1295 C CD1 . PHE A 1 161 ? -11.912 -13.242 -30.834 1.00 16.34 ? 242 PHE A CD1 1 
ATOM   1296 C CD2 . PHE A 1 161 ? -11.052 -13.937 -28.694 1.00 17.24 ? 242 PHE A CD2 1 
ATOM   1297 C CE1 . PHE A 1 161 ? -10.625 -13.243 -31.356 1.00 17.58 ? 242 PHE A CE1 1 
ATOM   1298 C CE2 . PHE A 1 161 ? -9.750  -13.941 -29.211 1.00 17.85 ? 242 PHE A CE2 1 
ATOM   1299 C CZ  . PHE A 1 161 ? -9.542  -13.592 -30.542 1.00 18.12 ? 242 PHE A CZ  1 
ATOM   1300 N N   . LEU A 1 162 ? -15.743 -15.641 -27.348 1.00 13.75 ? 243 LEU A N   1 
ATOM   1301 C CA  . LEU A 1 162 ? -16.854 -15.653 -26.413 1.00 13.67 ? 243 LEU A CA  1 
ATOM   1302 C C   . LEU A 1 162 ? -16.339 -15.107 -25.089 1.00 13.57 ? 243 LEU A C   1 
ATOM   1303 O O   . LEU A 1 162 ? -15.485 -15.725 -24.452 1.00 14.24 ? 243 LEU A O   1 
ATOM   1304 C CB  . LEU A 1 162 ? -17.402 -17.088 -26.250 1.00 14.61 ? 243 LEU A CB  1 
ATOM   1305 C CG  . LEU A 1 162 ? -17.874 -17.782 -27.546 1.00 14.82 ? 243 LEU A CG  1 
ATOM   1306 C CD1 . LEU A 1 162 ? -18.328 -19.199 -27.253 1.00 15.27 ? 243 LEU A CD1 1 
ATOM   1307 C CD2 . LEU A 1 162 ? -18.997 -16.987 -28.179 1.00 15.49 ? 243 LEU A CD2 1 
ATOM   1308 N N   . LEU A 1 163 ? -16.818 -13.928 -24.719 1.00 12.71 ? 244 LEU A N   1 
ATOM   1309 C CA  . LEU A 1 163 ? -16.350 -13.244 -23.516 1.00 12.74 ? 244 LEU A CA  1 
ATOM   1310 C C   . LEU A 1 163 ? -17.452 -13.245 -22.447 1.00 12.96 ? 244 LEU A C   1 
ATOM   1311 O O   . LEU A 1 163 ? -18.416 -12.460 -22.514 1.00 11.95 ? 244 LEU A O   1 
ATOM   1312 C CB  . LEU A 1 163 ? -15.925 -11.807 -23.880 1.00 12.66 ? 244 LEU A CB  1 
ATOM   1313 C CG  . LEU A 1 163 ? -14.926 -11.663 -25.039 1.00 12.26 ? 244 LEU A CG  1 
ATOM   1314 C CD1 . LEU A 1 163 ? -14.588 -10.207 -25.254 1.00 12.97 ? 244 LEU A CD1 1 
ATOM   1315 C CD2 . LEU A 1 163 ? -13.665 -12.460 -24.740 1.00 13.86 ? 244 LEU A CD2 1 
ATOM   1316 N N   . TRP A 1 164 ? -17.303 -14.145 -21.472 1.00 12.66 ? 245 TRP A N   1 
ATOM   1317 C CA  . TRP A 1 164 ? -18.312 -14.330 -20.435 1.00 13.13 ? 245 TRP A CA  1 
ATOM   1318 C C   . TRP A 1 164 ? -17.827 -13.803 -19.099 1.00 13.55 ? 245 TRP A C   1 
ATOM   1319 O O   . TRP A 1 164 ? -16.889 -14.366 -18.511 1.00 14.04 ? 245 TRP A O   1 
ATOM   1320 C CB  . TRP A 1 164 ? -18.645 -15.815 -20.291 1.00 12.64 ? 245 TRP A CB  1 
ATOM   1321 C CG  . TRP A 1 164 ? -19.121 -16.467 -21.551 1.00 13.69 ? 245 TRP A CG  1 
ATOM   1322 C CD1 . TRP A 1 164 ? -19.739 -15.870 -22.623 1.00 12.18 ? 245 TRP A CD1 1 
ATOM   1323 C CD2 . TRP A 1 164 ? -19.057 -17.872 -21.845 1.00 13.53 ? 245 TRP A CD2 1 
ATOM   1324 N NE1 . TRP A 1 164 ? -20.047 -16.836 -23.535 1.00 12.85 ? 245 TRP A NE1 1 
ATOM   1325 C CE2 . TRP A 1 164 ? -19.652 -18.063 -23.101 1.00 13.32 ? 245 TRP A CE2 1 
ATOM   1326 C CE3 . TRP A 1 164 ? -18.553 -18.990 -21.151 1.00 14.31 ? 245 TRP A CE3 1 
ATOM   1327 C CZ2 . TRP A 1 164 ? -19.767 -19.328 -23.693 1.00 14.55 ? 245 TRP A CZ2 1 
ATOM   1328 C CZ3 . TRP A 1 164 ? -18.665 -20.245 -21.734 1.00 14.86 ? 245 TRP A CZ3 1 
ATOM   1329 C CH2 . TRP A 1 164 ? -19.268 -20.405 -22.994 1.00 14.43 ? 245 TRP A CH2 1 
ATOM   1330 N N   . GLY A 1 165 ? -18.451 -12.727 -18.615 1.00 13.19 ? 246 GLY A N   1 
ATOM   1331 C CA  . GLY A 1 165 ? -18.060 -12.176 -17.316 1.00 13.22 ? 246 GLY A CA  1 
ATOM   1332 C C   . GLY A 1 165 ? -17.128 -10.992 -17.448 1.00 13.30 ? 246 GLY A C   1 
ATOM   1333 O O   . GLY A 1 165 ? -16.598 -10.728 -18.531 1.00 13.48 ? 246 GLY A O   1 
ATOM   1334 N N   . SER A 1 166 ? -16.915 -10.302 -16.329 1.00 14.15 ? 247 SER A N   1 
ATOM   1335 C CA  . SER A 1 166 ? -16.128 -9.072  -16.288 1.00 15.33 ? 247 SER A CA  1 
ATOM   1336 C C   . SER A 1 166 ? -14.666 -9.270  -16.713 1.00 14.22 ? 247 SER A C   1 
ATOM   1337 O O   . SER A 1 166 ? -14.138 -8.533  -17.542 1.00 15.05 ? 247 SER A O   1 
ATOM   1338 C CB  . SER A 1 166 ? -16.170 -8.521  -14.865 1.00 16.32 ? 247 SER A CB  1 
ATOM   1339 O OG  . SER A 1 166 ? -15.516 -7.277  -14.801 1.00 23.13 ? 247 SER A OG  1 
ATOM   1340 N N   . TYR A 1 167 ? -14.021 -10.252 -16.123 1.00 14.82 ? 248 TYR A N   1 
ATOM   1341 C CA  . TYR A 1 167 ? -12.610 -10.498 -16.371 1.00 14.36 ? 248 TYR A CA  1 
ATOM   1342 C C   . TYR A 1 167 ? -12.342 -10.782 -17.861 1.00 14.14 ? 248 TYR A C   1 
ATOM   1343 O O   . TYR A 1 167 ? -11.441 -10.180 -18.469 1.00 14.09 ? 248 TYR A O   1 
ATOM   1344 C CB  . TYR A 1 167 ? -12.157 -11.674 -15.506 1.00 15.74 ? 248 TYR A CB  1 
ATOM   1345 C CG  . TYR A 1 167 ? -10.678 -11.857 -15.484 1.00 17.75 ? 248 TYR A CG  1 
ATOM   1346 C CD1 . TYR A 1 167 ? -10.045 -12.593 -16.476 1.00 18.22 ? 248 TYR A CD1 1 
ATOM   1347 C CD2 . TYR A 1 167 ? -9.896  -11.260 -14.492 1.00 18.89 ? 248 TYR A CD2 1 
ATOM   1348 C CE1 . TYR A 1 167 ? -8.664  -12.737 -16.500 1.00 19.52 ? 248 TYR A CE1 1 
ATOM   1349 C CE2 . TYR A 1 167 ? -8.504  -11.399 -14.504 1.00 20.62 ? 248 TYR A CE2 1 
ATOM   1350 C CZ  . TYR A 1 167 ? -7.892  -12.141 -15.518 1.00 20.45 ? 248 TYR A CZ  1 
ATOM   1351 O OH  . TYR A 1 167 ? -6.513  -12.258 -15.567 1.00 21.00 ? 248 TYR A OH  1 
ATOM   1352 N N   . ALA A 1 168 ? -13.140 -11.678 -18.443 1.00 13.02 ? 249 ALA A N   1 
ATOM   1353 C CA  . ALA A 1 168 ? -12.979 -12.039 -19.844 1.00 13.42 ? 249 ALA A CA  1 
ATOM   1354 C C   . ALA A 1 168 ? -13.249 -10.854 -20.753 1.00 13.36 ? 249 ALA A C   1 
ATOM   1355 O O   . ALA A 1 168 ? -12.570 -10.674 -21.769 1.00 13.32 ? 249 ALA A O   1 
ATOM   1356 C CB  . ALA A 1 168 ? -13.906 -13.200 -20.193 1.00 13.07 ? 249 ALA A CB  1 
ATOM   1357 N N   . GLN A 1 169 ? -14.243 -10.042 -20.392 1.00 13.57 ? 250 GLN A N   1 
ATOM   1358 C CA  . GLN A 1 169 ? -14.575 -8.887  -21.204 1.00 14.86 ? 250 GLN A CA  1 
ATOM   1359 C C   . GLN A 1 169 ? -13.461 -7.858  -21.205 1.00 15.48 ? 250 GLN A C   1 
ATOM   1360 O O   . GLN A 1 169 ? -13.190 -7.240  -22.245 1.00 16.65 ? 250 GLN A O   1 
ATOM   1361 C CB  . GLN A 1 169 ? -15.903 -8.279  -20.763 1.00 13.90 ? 250 GLN A CB  1 
ATOM   1362 C CG  . GLN A 1 169 ? -17.077 -9.146  -21.201 1.00 14.52 ? 250 GLN A CG  1 
ATOM   1363 C CD  . GLN A 1 169 ? -18.422 -8.607  -20.796 1.00 14.58 ? 250 GLN A CD  1 
ATOM   1364 O OE1 . GLN A 1 169 ? -18.551 -7.465  -20.359 1.00 15.46 ? 250 GLN A OE1 1 
ATOM   1365 N NE2 . GLN A 1 169 ? -19.438 -9.439  -20.946 1.00 15.48 ? 250 GLN A NE2 1 
ATOM   1366 N N   . LYS A 1 170 ? -12.798 -7.690  -20.061 1.00 16.21 ? 251 LYS A N   1 
ATOM   1367 C CA  . LYS A 1 170 ? -11.665 -6.770  -19.989 1.00 17.04 ? 251 LYS A CA  1 
ATOM   1368 C C   . LYS A 1 170 ? -10.487 -7.315  -20.775 1.00 16.73 ? 251 LYS A C   1 
ATOM   1369 O O   . LYS A 1 170 ? -9.907  -6.609  -21.586 1.00 17.35 ? 251 LYS A O   1 
ATOM   1370 C CB  . LYS A 1 170 ? -11.260 -6.525  -18.553 1.00 17.71 ? 251 LYS A CB  1 
ATOM   1371 C CG  . LYS A 1 170 ? -12.310 -5.759  -17.802 1.00 21.63 ? 251 LYS A CG  1 
ATOM   1372 C CD  . LYS A 1 170 ? -11.917 -5.572  -16.371 1.00 24.54 ? 251 LYS A CD  1 
ATOM   1373 C CE  . LYS A 1 170 ? -13.038 -4.898  -15.622 1.00 26.97 ? 251 LYS A CE  1 
ATOM   1374 N NZ  . LYS A 1 170 ? -12.826 -5.003  -14.159 1.00 30.86 ? 251 LYS A NZ  1 
ATOM   1375 N N   . LYS A 1 171 ? -10.160 -8.589  -20.572 1.00 16.57 ? 252 LYS A N   1 
ATOM   1376 C CA  . LYS A 1 171 ? -9.042  -9.185  -21.288 1.00 16.03 ? 252 LYS A CA  1 
ATOM   1377 C C   . LYS A 1 171 ? -9.287  -9.165  -22.799 1.00 15.62 ? 252 LYS A C   1 
ATOM   1378 O O   . LYS A 1 171 ? -8.357  -9.029  -23.584 1.00 15.75 ? 252 LYS A O   1 
ATOM   1379 C CB  . LYS A 1 171 ? -8.826  -10.622 -20.812 1.00 15.87 ? 252 LYS A CB  1 
ATOM   1380 C CG  . LYS A 1 171 ? -7.495  -11.222 -21.247 1.00 16.60 ? 252 LYS A CG  1 
ATOM   1381 C CD  . LYS A 1 171 ? -7.352  -12.668 -20.784 1.00 16.60 ? 252 LYS A CD  1 
ATOM   1382 C CE  . LYS A 1 171 ? -6.002  -13.263 -21.181 1.00 15.51 ? 252 LYS A CE  1 
ATOM   1383 N NZ  . LYS A 1 171 ? -4.884  -12.605 -20.457 1.00 13.98 ? 252 LYS A NZ  1 
ATOM   1384 N N   . GLY A 1 172 ? -10.538 -9.289  -23.204 1.00 15.24 ? 253 GLY A N   1 
ATOM   1385 C CA  . GLY A 1 172 ? -10.846 -9.313  -24.614 1.00 16.33 ? 253 GLY A CA  1 
ATOM   1386 C C   . GLY A 1 172 ? -11.152 -7.949  -25.204 1.00 17.44 ? 253 GLY A C   1 
ATOM   1387 O O   . GLY A 1 172 ? -11.557 -7.858  -26.357 1.00 18.02 ? 253 GLY A O   1 
ATOM   1388 N N   . SER A 1 173 ? -10.941 -6.886  -24.446 1.00 19.06 ? 254 SER A N   1 
ATOM   1389 C CA  . SER A 1 173 ? -11.263 -5.543  -24.934 1.00 21.10 ? 254 SER A CA  1 
ATOM   1390 C C   . SER A 1 173 ? -10.366 -5.081  -26.089 1.00 22.94 ? 254 SER A C   1 
ATOM   1391 O O   . SER A 1 173 ? -10.704 -4.145  -26.803 1.00 24.80 ? 254 SER A O   1 
ATOM   1392 C CB  . SER A 1 173 ? -11.194 -4.537  -23.784 1.00 20.66 ? 254 SER A CB  1 
ATOM   1393 O OG  . SER A 1 173 ? -9.890  -4.483  -23.226 1.00 20.55 ? 254 SER A OG  1 
ATOM   1394 N N   . ALA A 1 174 ? -9.234  -5.730  -26.278 1.00 25.33 ? 255 ALA A N   1 
ATOM   1395 C CA  . ALA A 1 174 ? -8.307  -5.327  -27.340 1.00 27.56 ? 255 ALA A CA  1 
ATOM   1396 C C   . ALA A 1 174 ? -8.559  -6.055  -28.671 1.00 27.77 ? 255 ALA A C   1 
ATOM   1397 O O   . ALA A 1 174 ? -7.880  -5.764  -29.663 1.00 28.43 ? 255 ALA A O   1 
ATOM   1398 C CB  . ALA A 1 174 ? -6.877  -5.580  -26.894 1.00 28.36 ? 255 ALA A CB  1 
ATOM   1399 N N   . ILE A 1 175 ? -9.505  -7.005  -28.699 1.00 26.46 ? 256 ILE A N   1 
ATOM   1400 C CA  . ILE A 1 175 ? -9.779  -7.748  -29.929 1.00 25.27 ? 256 ILE A CA  1 
ATOM   1401 C C   . ILE A 1 175 ? -10.315 -6.815  -31.011 1.00 25.82 ? 256 ILE A C   1 
ATOM   1402 O O   . ILE A 1 175 ? -11.130 -5.938  -30.751 1.00 25.42 ? 256 ILE A O   1 
ATOM   1403 C CB  . ILE A 1 175 ? -10.774 -8.909  -29.664 1.00 24.02 ? 256 ILE A CB  1 
ATOM   1404 C CG1 . ILE A 1 175 ? -10.116 -9.922  -28.727 1.00 23.12 ? 256 ILE A CG1 1 
ATOM   1405 C CG2 . ILE A 1 175 ? -11.192 -9.586  -30.961 1.00 22.27 ? 256 ILE A CG2 1 
ATOM   1406 C CD1 . ILE A 1 175 ? -11.106 -10.731 -27.924 1.00 24.07 ? 256 ILE A CD1 1 
ATOM   1407 N N   . ASP A 1 176 ? -9.816  -6.993  -32.212 1.00 27.27 ? 257 ASP A N   1 
ATOM   1408 C CA  . ASP A 1 176 ? -10.232 -6.181  -33.344 1.00 29.56 ? 257 ASP A CA  1 
ATOM   1409 C C   . ASP A 1 176 ? -11.581 -6.682  -33.855 1.00 30.45 ? 257 ASP A C   1 
ATOM   1410 O O   . ASP A 1 176 ? -11.650 -7.749  -34.470 1.00 31.01 ? 257 ASP A O   1 
ATOM   1411 C CB  . ASP A 1 176 ? -9.162  -6.301  -34.446 1.00 31.26 ? 257 ASP A CB  1 
ATOM   1412 C CG  . ASP A 1 176 ? -9.255  -5.261  -35.559 1.00 32.89 ? 257 ASP A CG  1 
ATOM   1413 O OD1 . ASP A 1 176 ? -10.375 -4.974  -36.043 1.00 33.04 ? 257 ASP A OD1 1 
ATOM   1414 O OD2 . ASP A 1 176 ? -8.190  -4.734  -35.956 1.00 35.07 ? 257 ASP A OD2 1 
ATOM   1415 N N   . ARG A 1 177 ? -12.645 -5.913  -33.624 1.00 32.14 ? 258 ARG A N   1 
ATOM   1416 C CA  . ARG A 1 177 ? -13.998 -6.321  -34.035 1.00 33.77 ? 258 ARG A CA  1 
ATOM   1417 C C   . ARG A 1 177 ? -14.257 -6.194  -35.535 1.00 34.23 ? 258 ARG A C   1 
ATOM   1418 O O   . ARG A 1 177 ? -15.312 -6.596  -36.027 1.00 34.47 ? 258 ARG A O   1 
ATOM   1419 C CB  . ARG A 1 177 ? -15.033 -5.544  -33.239 1.00 35.18 ? 258 ARG A CB  1 
ATOM   1420 C CG  . ARG A 1 177 ? -15.101 -6.029  -31.814 1.00 37.53 ? 258 ARG A CG  1 
ATOM   1421 C CD  . ARG A 1 177 ? -15.407 -4.913  -30.854 1.00 39.98 ? 258 ARG A CD  1 
ATOM   1422 N NE  . ARG A 1 177 ? -15.077 -5.329  -29.500 1.00 42.76 ? 258 ARG A NE  1 
ATOM   1423 C CZ  . ARG A 1 177 ? -15.990 -5.539  -28.540 1.00 44.10 ? 258 ARG A CZ  1 
ATOM   1424 N NH1 . ARG A 1 177 ? -17.296 -5.343  -28.769 1.00 43.08 ? 258 ARG A NH1 1 
ATOM   1425 N NH2 . ARG A 1 177 ? -15.581 -5.940  -27.338 1.00 44.54 ? 258 ARG A NH2 1 
ATOM   1426 N N   . LYS A 1 178 ? -13.297 -5.627  -36.251 1.00 35.16 ? 259 LYS A N   1 
ATOM   1427 C CA  . LYS A 1 178 ? -13.386 -5.533  -37.704 1.00 35.69 ? 259 LYS A CA  1 
ATOM   1428 C C   . LYS A 1 178 ? -12.887 -6.846  -38.339 1.00 34.27 ? 259 LYS A C   1 
ATOM   1429 O O   . LYS A 1 178 ? -13.347 -7.249  -39.406 1.00 34.61 ? 259 LYS A O   1 
ATOM   1430 C CB  . LYS A 1 178 ? -12.542 -4.342  -38.185 1.00 37.91 ? 259 LYS A CB  1 
ATOM   1431 C CG  . LYS A 1 178 ? -12.644 -4.038  -39.671 1.00 41.29 ? 259 LYS A CG  1 
ATOM   1432 C CD  . LYS A 1 178 ? -11.645 -2.961  -40.071 1.00 43.36 ? 259 LYS A CD  1 
ATOM   1433 C CE  . LYS A 1 178 ? -11.677 -2.705  -41.568 1.00 44.62 ? 259 LYS A CE  1 
ATOM   1434 N NZ  . LYS A 1 178 ? -10.609 -1.752  -41.984 1.00 46.10 ? 259 LYS A NZ  1 
ATOM   1435 N N   . ARG A 1 179 ? -11.953 -7.511  -37.652 1.00 32.44 ? 260 ARG A N   1 
ATOM   1436 C CA  . ARG A 1 179 ? -11.379 -8.766  -38.135 1.00 30.60 ? 260 ARG A CA  1 
ATOM   1437 C C   . ARG A 1 179 ? -12.011 -10.000 -37.481 1.00 28.15 ? 260 ARG A C   1 
ATOM   1438 O O   . ARG A 1 179 ? -12.004 -11.090 -38.066 1.00 27.46 ? 260 ARG A O   1 
ATOM   1439 C CB  . ARG A 1 179 ? -9.891  -8.803  -37.839 1.00 32.19 ? 260 ARG A CB  1 
ATOM   1440 C CG  . ARG A 1 179 ? -9.100  -7.685  -38.463 1.00 36.75 ? 260 ARG A CG  1 
ATOM   1441 C CD  . ARG A 1 179 ? -7.634  -7.879  -38.182 1.00 39.51 ? 260 ARG A CD  1 
ATOM   1442 N NE  . ARG A 1 179 ? -7.215  -9.226  -38.538 1.00 43.27 ? 260 ARG A NE  1 
ATOM   1443 C CZ  . ARG A 1 179 ? -5.964  -9.526  -38.855 1.00 46.58 ? 260 ARG A CZ  1 
ATOM   1444 N NH1 . ARG A 1 179 ? -5.018  -8.581  -38.846 1.00 48.27 ? 260 ARG A NH1 1 
ATOM   1445 N NH2 . ARG A 1 179 ? -5.647  -10.774 -39.182 1.00 48.05 ? 260 ARG A NH2 1 
ATOM   1446 N N   . HIS A 1 180 ? -12.505 -9.843  -36.247 1.00 25.48 ? 261 HIS A N   1 
ATOM   1447 C CA  . HIS A 1 180 ? -13.058 -10.975 -35.501 1.00 22.89 ? 261 HIS A CA  1 
ATOM   1448 C C   . HIS A 1 180 ? -14.438 -10.677 -34.967 1.00 22.08 ? 261 HIS A C   1 
ATOM   1449 O O   . HIS A 1 180 ? -14.857 -9.522  -34.891 1.00 21.11 ? 261 HIS A O   1 
ATOM   1450 C CB  . HIS A 1 180 ? -12.141 -11.341 -34.333 1.00 21.53 ? 261 HIS A CB  1 
ATOM   1451 C CG  . HIS A 1 180 ? -10.746 -11.612 -34.768 1.00 20.58 ? 261 HIS A CG  1 
ATOM   1452 N ND1 . HIS A 1 180 ? -10.428 -12.734 -35.503 1.00 20.70 ? 261 HIS A ND1 1 
ATOM   1453 C CD2 . HIS A 1 180 ? -9.631  -10.855 -34.589 1.00 21.66 ? 261 HIS A CD2 1 
ATOM   1454 C CE1 . HIS A 1 180 ? -9.133  -12.646 -35.764 1.00 20.75 ? 261 HIS A CE1 1 
ATOM   1455 N NE2 . HIS A 1 180 ? -8.635  -11.533 -35.231 1.00 21.00 ? 261 HIS A NE2 1 
ATOM   1456 N N   . HIS A 1 181 ? -15.132 -11.740 -34.592 1.00 21.09 ? 262 HIS A N   1 
ATOM   1457 C CA  . HIS A 1 181 ? -16.455 -11.622 -34.029 1.00 20.88 ? 262 HIS A CA  1 
ATOM   1458 C C   . HIS A 1 181 ? -16.365 -11.729 -32.520 1.00 20.09 ? 262 HIS A C   1 
ATOM   1459 O O   . HIS A 1 181 ? -15.734 -12.647 -32.006 1.00 20.13 ? 262 HIS A O   1 
ATOM   1460 C CB  . HIS A 1 181 ? -17.350 -12.733 -34.565 1.00 21.89 ? 262 HIS A CB  1 
ATOM   1461 C CG  . HIS A 1 181 ? -17.350 -12.823 -36.061 1.00 24.52 ? 262 HIS A CG  1 
ATOM   1462 N ND1 . HIS A 1 181 ? -18.192 -12.035 -36.842 1.00 26.21 ? 262 HIS A ND1 1 
ATOM   1463 C CD2 . HIS A 1 181 ? -16.590 -13.607 -36.867 1.00 25.00 ? 262 HIS A CD2 1 
ATOM   1464 C CE1 . HIS A 1 181 ? -17.928 -12.356 -38.097 1.00 25.54 ? 262 HIS A CE1 1 
ATOM   1465 N NE2 . HIS A 1 181 ? -16.977 -13.291 -38.136 1.00 26.00 ? 262 HIS A NE2 1 
ATOM   1466 N N   . VAL A 1 182 ? -16.980 -10.797 -31.820 1.00 18.59 ? 263 VAL A N   1 
ATOM   1467 C CA  . VAL A 1 182 ? -16.944 -10.816 -30.371 1.00 18.33 ? 263 VAL A CA  1 
ATOM   1468 C C   . VAL A 1 182 ? -18.353 -10.914 -29.816 1.00 18.56 ? 263 VAL A C   1 
ATOM   1469 O O   . VAL A 1 182 ? -19.172 -10.039 -30.088 1.00 20.14 ? 263 VAL A O   1 
ATOM   1470 C CB  . VAL A 1 182 ? -16.286 -9.537  -29.817 1.00 18.04 ? 263 VAL A CB  1 
ATOM   1471 C CG1 . VAL A 1 182 ? -16.379 -9.523  -28.294 1.00 19.00 ? 263 VAL A CG1 1 
ATOM   1472 C CG2 . VAL A 1 182 ? -14.839 -9.455  -30.272 1.00 17.85 ? 263 VAL A CG2 1 
ATOM   1473 N N   . LEU A 1 183 ? -18.638 -11.992 -29.069 1.00 17.06 ? 264 LEU A N   1 
ATOM   1474 C CA  . LEU A 1 183 ? -19.934 -12.163 -28.406 1.00 16.41 ? 264 LEU A CA  1 
ATOM   1475 C C   . LEU A 1 183 ? -19.712 -12.053 -26.906 1.00 16.08 ? 264 LEU A C   1 
ATOM   1476 O O   . LEU A 1 183 ? -18.827 -12.698 -26.375 1.00 16.10 ? 264 LEU A O   1 
ATOM   1477 C CB  . LEU A 1 183 ? -20.558 -13.533 -28.757 1.00 16.40 ? 264 LEU A CB  1 
ATOM   1478 C CG  . LEU A 1 183 ? -20.880 -13.783 -30.244 1.00 17.41 ? 264 LEU A CG  1 
ATOM   1479 C CD1 . LEU A 1 183 ? -21.433 -15.180 -30.443 1.00 17.89 ? 264 LEU A CD1 1 
ATOM   1480 C CD2 . LEU A 1 183 ? -21.871 -12.759 -30.753 1.00 18.18 ? 264 LEU A CD2 1 
ATOM   1481 N N   . GLN A 1 184 ? -20.494 -11.228 -26.227 1.00 15.76 ? 265 GLN A N   1 
ATOM   1482 C CA  . GLN A 1 184 ? -20.303 -11.007 -24.787 1.00 15.59 ? 265 GLN A CA  1 
ATOM   1483 C C   . GLN A 1 184 ? -21.582 -11.242 -24.014 1.00 15.50 ? 265 GLN A C   1 
ATOM   1484 O O   . GLN A 1 184 ? -22.663 -10.982 -24.520 1.00 15.26 ? 265 GLN A O   1 
ATOM   1485 C CB  . GLN A 1 184 ? -19.912 -9.566  -24.505 1.00 16.34 ? 265 GLN A CB  1 
ATOM   1486 C CG  . GLN A 1 184 ? -18.747 -9.046  -25.283 1.00 20.05 ? 265 GLN A CG  1 
ATOM   1487 C CD  . GLN A 1 184 ? -18.500 -7.607  -24.942 1.00 21.76 ? 265 GLN A CD  1 
ATOM   1488 O OE1 . GLN A 1 184 ? -19.220 -6.734  -25.405 1.00 24.12 ? 265 GLN A OE1 1 
ATOM   1489 N NE2 . GLN A 1 184 ? -17.491 -7.352  -24.127 1.00 22.56 ? 265 GLN A NE2 1 
ATOM   1490 N N   . THR A 1 185 ? -21.444 -11.706 -22.789 1.00 14.15 ? 266 THR A N   1 
ATOM   1491 C CA  . THR A 1 185 ? -22.571 -11.842 -21.896 1.00 13.75 ? 266 THR A CA  1 
ATOM   1492 C C   . THR A 1 185 ? -22.053 -12.122 -20.496 1.00 13.62 ? 266 THR A C   1 
ATOM   1493 O O   . THR A 1 185 ? -20.828 -12.083 -20.275 1.00 13.01 ? 266 THR A O   1 
ATOM   1494 C CB  . THR A 1 185 ? -23.564 -12.952 -22.335 1.00 13.56 ? 266 THR A CB  1 
ATOM   1495 O OG1 . THR A 1 185 ? -24.765 -12.835 -21.553 1.00 14.03 ? 266 THR A OG1 1 
ATOM   1496 C CG2 . THR A 1 185 ? -22.968 -14.334 -22.153 1.00 13.49 ? 266 THR A CG2 1 
ATOM   1497 N N   . ALA A 1 186 ? -22.965 -12.396 -19.561 1.00 13.33 ? 267 ALA A N   1 
ATOM   1498 C CA  . ALA A 1 186 ? -22.582 -12.664 -18.183 1.00 13.79 ? 267 ALA A CA  1 
ATOM   1499 C C   . ALA A 1 186 ? -21.899 -14.023 -18.033 1.00 13.65 ? 267 ALA A C   1 
ATOM   1500 O O   . ALA A 1 186 ? -22.042 -14.904 -18.878 1.00 13.46 ? 267 ALA A O   1 
ATOM   1501 C CB  . ALA A 1 186 ? -23.802 -12.594 -17.280 1.00 13.36 ? 267 ALA A CB  1 
ATOM   1502 N N   . HIS A 1 187 ? -21.142 -14.164 -16.950 1.00 13.77 ? 268 HIS A N   1 
ATOM   1503 C CA  . HIS A 1 187 ? -20.479 -15.419 -16.636 1.00 14.47 ? 268 HIS A CA  1 
ATOM   1504 C C   . HIS A 1 187 ? -21.531 -16.485 -16.271 1.00 14.05 ? 268 HIS A C   1 
ATOM   1505 O O   . HIS A 1 187 ? -22.473 -16.178 -15.546 1.00 15.02 ? 268 HIS A O   1 
ATOM   1506 C CB  . HIS A 1 187 ? -19.526 -15.193 -15.455 1.00 15.48 ? 268 HIS A CB  1 
ATOM   1507 C CG  . HIS A 1 187 ? -18.595 -16.341 -15.198 1.00 17.36 ? 268 HIS A CG  1 
ATOM   1508 N ND1 . HIS A 1 187 ? -18.995 -17.458 -14.476 1.00 18.01 ? 268 HIS A ND1 1 
ATOM   1509 C CD2 . HIS A 1 187 ? -17.311 -16.500 -15.602 1.00 17.23 ? 268 HIS A CD2 1 
ATOM   1510 C CE1 . HIS A 1 187 ? -17.960 -18.268 -14.454 1.00 18.13 ? 268 HIS A CE1 1 
ATOM   1511 N NE2 . HIS A 1 187 ? -16.945 -17.720 -15.119 1.00 18.72 ? 268 HIS A NE2 1 
ATOM   1512 N N   . PRO A 1 188 ? -21.371 -17.750 -16.743 1.00 14.07 ? 269 PRO A N   1 
ATOM   1513 C CA  . PRO A 1 188 ? -22.323 -18.852 -16.467 1.00 14.28 ? 269 PRO A CA  1 
ATOM   1514 C C   . PRO A 1 188 ? -22.427 -19.305 -14.993 1.00 15.17 ? 269 PRO A C   1 
ATOM   1515 O O   . PRO A 1 188 ? -23.229 -20.177 -14.670 1.00 15.45 ? 269 PRO A O   1 
ATOM   1516 C CB  . PRO A 1 188 ? -21.841 -19.971 -17.398 1.00 14.08 ? 269 PRO A CB  1 
ATOM   1517 C CG  . PRO A 1 188 ? -20.380 -19.709 -17.500 1.00 13.41 ? 269 PRO A CG  1 
ATOM   1518 C CD  . PRO A 1 188 ? -20.289 -18.214 -17.642 1.00 14.16 ? 269 PRO A CD  1 
ATOM   1519 N N   . SER A 1 189 ? -21.620 -18.725 -14.118 1.00 16.37 ? 270 SER A N   1 
ATOM   1520 C CA  . SER A 1 189 ? -21.705 -19.023 -12.682 1.00 18.00 ? 270 SER A CA  1 
ATOM   1521 C C   . SER A 1 189 ? -23.111 -18.775 -12.177 1.00 18.76 ? 270 SER A C   1 
ATOM   1522 O O   . SER A 1 189 ? -23.776 -17.832 -12.614 1.00 18.55 ? 270 SER A O   1 
ATOM   1523 C CB  . SER A 1 189 ? -20.750 -18.115 -11.875 1.00 17.70 ? 270 SER A CB  1 
ATOM   1524 O OG  . SER A 1 189 ? -21.089 -18.121 -10.490 1.00 19.85 ? 270 SER A OG  1 
ATOM   1525 N N   . PRO A 1 190 ? -23.590 -19.597 -11.238 1.00 19.75 ? 271 PRO A N   1 
ATOM   1526 C CA  . PRO A 1 190 ? -24.936 -19.428 -10.658 1.00 20.31 ? 271 PRO A CA  1 
ATOM   1527 C C   . PRO A 1 190 ? -25.170 -17.981 -10.193 1.00 20.33 ? 271 PRO A C   1 
ATOM   1528 O O   . PRO A 1 190 ? -26.262 -17.441 -10.332 1.00 21.05 ? 271 PRO A O   1 
ATOM   1529 C CB  . PRO A 1 190 ? -24.913 -20.410 -9.491  1.00 20.88 ? 271 PRO A CB  1 
ATOM   1530 C CG  . PRO A 1 190 ? -24.048 -21.504 -10.024 1.00 20.36 ? 271 PRO A CG  1 
ATOM   1531 C CD  . PRO A 1 190 ? -22.906 -20.786 -10.681 1.00 19.75 ? 271 PRO A CD  1 
ATOM   1532 N N   . LEU A 1 191 ? -24.113 -17.344 -9.690  1.00 21.09 ? 272 LEU A N   1 
ATOM   1533 C CA  . LEU A 1 191 ? -24.211 -15.966 -9.193  1.00 21.61 ? 272 LEU A CA  1 
ATOM   1534 C C   . LEU A 1 191 ? -24.604 -14.940 -10.251 1.00 20.79 ? 272 LEU A C   1 
ATOM   1535 O O   . LEU A 1 191 ? -25.201 -13.922 -9.926  1.00 21.03 ? 272 LEU A O   1 
ATOM   1536 C CB  . LEU A 1 191 ? -22.895 -15.540 -8.545  1.00 22.86 ? 272 LEU A CB  1 
ATOM   1537 C CG  . LEU A 1 191 ? -22.637 -16.104 -7.145  1.00 25.29 ? 272 LEU A CG  1 
ATOM   1538 C CD1 . LEU A 1 191 ? -21.359 -15.521 -6.581  1.00 26.28 ? 272 LEU A CD1 1 
ATOM   1539 C CD2 . LEU A 1 191 ? -23.803 -15.777 -6.231  1.00 25.16 ? 272 LEU A CD2 1 
ATOM   1540 N N   . SER A 1 192 ? -24.296 -15.202 -11.517 1.00 20.23 ? 273 SER A N   1 
ATOM   1541 C CA  . SER A 1 192 ? -24.557 -14.205 -12.556 1.00 19.01 ? 273 SER A CA  1 
ATOM   1542 C C   . SER A 1 192 ? -25.240 -14.767 -13.790 1.00 18.29 ? 273 SER A C   1 
ATOM   1543 O O   . SER A 1 192 ? -25.509 -14.012 -14.715 1.00 18.38 ? 273 SER A O   1 
ATOM   1544 C CB  . SER A 1 192 ? -23.234 -13.546 -12.971 1.00 18.08 ? 273 SER A CB  1 
ATOM   1545 O OG  . SER A 1 192 ? -22.283 -14.535 -13.321 1.00 19.96 ? 273 SER A OG  1 
ATOM   1546 N N   . VAL A 1 193 ? -25.551 -16.063 -13.804 1.00 18.35 ? 274 VAL A N   1 
ATOM   1547 C CA  . VAL A 1 193 ? -26.094 -16.689 -15.014 1.00 18.85 ? 274 VAL A CA  1 
ATOM   1548 C C   . VAL A 1 193 ? -27.387 -16.027 -15.515 1.00 19.90 ? 274 VAL A C   1 
ATOM   1549 O O   . VAL A 1 193 ? -27.653 -15.981 -16.735 1.00 19.89 ? 274 VAL A O   1 
ATOM   1550 C CB  . VAL A 1 193 ? -26.311 -18.224 -14.821 1.00 18.87 ? 274 VAL A CB  1 
ATOM   1551 C CG1 . VAL A 1 193 ? -27.456 -18.505 -13.855 1.00 17.12 ? 274 VAL A CG1 1 
ATOM   1552 C CG2 . VAL A 1 193 ? -26.543 -18.885 -16.178 1.00 17.74 ? 274 VAL A CG2 1 
ATOM   1553 N N   . TYR A 1 194 ? -28.159 -15.484 -14.588 1.00 19.76 ? 275 TYR A N   1 
ATOM   1554 C CA  . TYR A 1 194 ? -29.418 -14.862 -14.923 1.00 20.83 ? 275 TYR A CA  1 
ATOM   1555 C C   . TYR A 1 194 ? -29.260 -13.466 -15.474 1.00 20.98 ? 275 TYR A C   1 
ATOM   1556 O O   . TYR A 1 194 ? -30.229 -12.870 -15.931 1.00 21.33 ? 275 TYR A O   1 
ATOM   1557 C CB  . TYR A 1 194 ? -30.311 -14.857 -13.698 1.00 23.35 ? 275 TYR A CB  1 
ATOM   1558 C CG  . TYR A 1 194 ? -30.879 -16.228 -13.416 1.00 26.73 ? 275 TYR A CG  1 
ATOM   1559 C CD1 . TYR A 1 194 ? -31.818 -16.778 -14.278 1.00 28.94 ? 275 TYR A CD1 1 
ATOM   1560 C CD2 . TYR A 1 194 ? -30.498 -16.972 -12.298 1.00 27.71 ? 275 TYR A CD2 1 
ATOM   1561 C CE1 . TYR A 1 194 ? -32.375 -18.025 -14.042 1.00 30.49 ? 275 TYR A CE1 1 
ATOM   1562 C CE2 . TYR A 1 194 ? -31.051 -18.226 -12.053 1.00 28.87 ? 275 TYR A CE2 1 
ATOM   1563 C CZ  . TYR A 1 194 ? -31.993 -18.741 -12.930 1.00 30.06 ? 275 TYR A CZ  1 
ATOM   1564 O OH  . TYR A 1 194 ? -32.578 -19.958 -12.683 1.00 31.71 ? 275 TYR A OH  1 
ATOM   1565 N N   . ARG A 1 195 ? -28.049 -12.956 -15.459 1.00 20.29 ? 276 ARG A N   1 
ATOM   1566 C CA  . ARG A 1 195 ? -27.794 -11.628 -15.998 1.00 21.45 ? 276 ARG A CA  1 
ATOM   1567 C C   . ARG A 1 195 ? -27.483 -11.633 -17.500 1.00 21.10 ? 276 ARG A C   1 
ATOM   1568 O O   . ARG A 1 195 ? -26.792 -10.725 -17.988 1.00 22.43 ? 276 ARG A O   1 
ATOM   1569 C CB  . ARG A 1 195 ? -26.651 -10.963 -15.253 1.00 22.75 ? 276 ARG A CB  1 
ATOM   1570 C CG  . ARG A 1 195 ? -26.956 -10.715 -13.805 1.00 24.87 ? 276 ARG A CG  1 
ATOM   1571 C CD  . ARG A 1 195 ? -25.918 -9.822  -13.201 1.00 27.62 ? 276 ARG A CD  1 
ATOM   1572 N NE  . ARG A 1 195 ? -26.023 -9.843  -11.756 1.00 32.27 ? 276 ARG A NE  1 
ATOM   1573 C CZ  . ARG A 1 195 ? -25.023 -10.225 -10.969 1.00 34.28 ? 276 ARG A CZ  1 
ATOM   1574 N NH1 . ARG A 1 195 ? -23.837 -10.572 -11.482 1.00 35.15 ? 276 ARG A NH1 1 
ATOM   1575 N NH2 . ARG A 1 195 ? -25.200 -10.247 -9.665  1.00 35.61 ? 276 ARG A NH2 1 
ATOM   1576 N N   . GLY A 1 196 ? -27.945 -12.654 -18.234 1.00 19.05 ? 277 GLY A N   1 
ATOM   1577 C CA  . GLY A 1 196 ? -27.758 -12.637 -19.674 1.00 17.46 ? 277 GLY A CA  1 
ATOM   1578 C C   . GLY A 1 196 ? -27.256 -13.924 -20.267 1.00 16.39 ? 277 GLY A C   1 
ATOM   1579 O O   . GLY A 1 196 ? -27.490 -14.178 -21.437 1.00 16.38 ? 277 GLY A O   1 
ATOM   1580 N N   . PHE A 1 197 ? -26.539 -14.731 -19.494 1.00 15.72 ? 278 PHE A N   1 
ATOM   1581 C CA  . PHE A 1 197 ? -26.007 -15.968 -20.042 1.00 15.10 ? 278 PHE A CA  1 
ATOM   1582 C C   . PHE A 1 197 ? -27.139 -16.890 -20.495 1.00 14.85 ? 278 PHE A C   1 
ATOM   1583 O O   . PHE A 1 197 ? -27.122 -17.399 -21.621 1.00 13.70 ? 278 PHE A O   1 
ATOM   1584 C CB  . PHE A 1 197 ? -25.105 -16.688 -19.044 1.00 13.96 ? 278 PHE A CB  1 
ATOM   1585 C CG  . PHE A 1 197 ? -24.454 -17.887 -19.669 1.00 13.97 ? 278 PHE A CG  1 
ATOM   1586 C CD1 . PHE A 1 197 ? -23.308 -17.742 -20.448 1.00 13.64 ? 278 PHE A CD1 1 
ATOM   1587 C CD2 . PHE A 1 197 ? -25.033 -19.150 -19.551 1.00 14.34 ? 278 PHE A CD2 1 
ATOM   1588 C CE1 . PHE A 1 197 ? -22.756 -18.835 -21.108 1.00 14.05 ? 278 PHE A CE1 1 
ATOM   1589 C CE2 . PHE A 1 197 ? -24.483 -20.252 -20.208 1.00 14.75 ? 278 PHE A CE2 1 
ATOM   1590 C CZ  . PHE A 1 197 ? -23.343 -20.091 -20.991 1.00 13.72 ? 278 PHE A CZ  1 
ATOM   1591 N N   . PHE A 1 198 ? -28.124 -17.133 -19.629 1.00 14.68 ? 279 PHE A N   1 
ATOM   1592 C CA  . PHE A 1 198 ? -29.264 -17.899 -20.094 1.00 15.42 ? 279 PHE A CA  1 
ATOM   1593 C C   . PHE A 1 198 ? -29.961 -17.100 -21.203 1.00 15.62 ? 279 PHE A C   1 
ATOM   1594 O O   . PHE A 1 198 ? -30.258 -15.925 -21.023 1.00 16.01 ? 279 PHE A O   1 
ATOM   1595 C CB  . PHE A 1 198 ? -30.234 -18.233 -18.944 1.00 15.69 ? 279 PHE A CB  1 
ATOM   1596 C CG  . PHE A 1 198 ? -29.791 -19.395 -18.087 1.00 16.29 ? 279 PHE A CG  1 
ATOM   1597 C CD1 . PHE A 1 198 ? -29.002 -20.426 -18.621 1.00 17.09 ? 279 PHE A CD1 1 
ATOM   1598 C CD2 . PHE A 1 198 ? -30.168 -19.467 -16.743 1.00 17.25 ? 279 PHE A CD2 1 
ATOM   1599 C CE1 . PHE A 1 198 ? -28.604 -21.503 -17.830 1.00 17.63 ? 279 PHE A CE1 1 
ATOM   1600 C CE2 . PHE A 1 198 ? -29.775 -20.539 -15.947 1.00 17.06 ? 279 PHE A CE2 1 
ATOM   1601 C CZ  . PHE A 1 198 ? -28.994 -21.559 -16.490 1.00 17.50 ? 279 PHE A CZ  1 
ATOM   1602 N N   . GLY A 1 199 ? -30.145 -17.735 -22.361 1.00 14.99 ? 280 GLY A N   1 
ATOM   1603 C CA  . GLY A 1 199 ? -30.766 -17.080 -23.487 1.00 15.48 ? 280 GLY A CA  1 
ATOM   1604 C C   . GLY A 1 199 ? -29.780 -16.369 -24.415 1.00 15.78 ? 280 GLY A C   1 
ATOM   1605 O O   . GLY A 1 199 ? -30.193 -15.755 -25.406 1.00 16.47 ? 280 GLY A O   1 
ATOM   1606 N N   . CYS A 1 200 ? -28.474 -16.447 -24.134 1.00 15.45 ? 281 CYS A N   1 
ATOM   1607 C CA  . CYS A 1 200 ? -27.501 -15.749 -24.981 1.00 14.74 ? 281 CYS A CA  1 
ATOM   1608 C C   . CYS A 1 200 ? -27.369 -16.413 -26.348 1.00 14.73 ? 281 CYS A C   1 
ATOM   1609 O O   . CYS A 1 200 ? -27.038 -15.755 -27.337 1.00 14.84 ? 281 CYS A O   1 
ATOM   1610 C CB  . CYS A 1 200 ? -26.129 -15.639 -24.287 1.00 14.64 ? 281 CYS A CB  1 
ATOM   1611 S SG  . CYS A 1 200 ? -25.145 -17.162 -24.187 1.00 14.27 ? 281 CYS A SG  1 
ATOM   1612 N N   . ARG A 1 201 ? -27.620 -17.721 -26.395 1.00 14.67 ? 282 ARG A N   1 
ATOM   1613 C CA  . ARG A 1 201 ? -27.574 -18.473 -27.660 1.00 15.92 ? 282 ARG A CA  1 
ATOM   1614 C C   . ARG A 1 201 ? -26.223 -18.337 -28.355 1.00 15.00 ? 282 ARG A C   1 
ATOM   1615 O O   . ARG A 1 201 ? -26.126 -18.315 -29.587 1.00 14.77 ? 282 ARG A O   1 
ATOM   1616 C CB  . ARG A 1 201 ? -28.699 -18.009 -28.606 1.00 18.09 ? 282 ARG A CB  1 
ATOM   1617 C CG  . ARG A 1 201 ? -30.112 -18.135 -28.038 1.00 21.23 ? 282 ARG A CG  1 
ATOM   1618 C CD  . ARG A 1 201 ? -31.117 -18.457 -29.131 1.00 23.23 ? 282 ARG A CD  1 
ATOM   1619 N NE  . ARG A 1 201 ? -30.958 -19.843 -29.572 1.00 27.02 ? 282 ARG A NE  1 
ATOM   1620 C CZ  . ARG A 1 201 ? -31.436 -20.329 -30.719 1.00 28.54 ? 282 ARG A CZ  1 
ATOM   1621 N NH1 . ARG A 1 201 ? -32.121 -19.553 -31.555 1.00 30.38 ? 282 ARG A NH1 1 
ATOM   1622 N NH2 . ARG A 1 201 ? -31.221 -21.606 -31.026 1.00 28.24 ? 282 ARG A NH2 1 
ATOM   1623 N N   . HIS A 1 202 ? -25.169 -18.292 -27.563 1.00 14.67 ? 283 HIS A N   1 
ATOM   1624 C CA  . HIS A 1 202 ? -23.844 -18.077 -28.120 1.00 14.43 ? 283 HIS A CA  1 
ATOM   1625 C C   . HIS A 1 202 ? -23.366 -19.232 -28.977 1.00 14.25 ? 283 HIS A C   1 
ATOM   1626 O O   . HIS A 1 202 ? -22.582 -19.032 -29.896 1.00 15.05 ? 283 HIS A O   1 
ATOM   1627 C CB  . HIS A 1 202 ? -22.816 -17.787 -27.015 1.00 13.85 ? 283 HIS A CB  1 
ATOM   1628 C CG  . HIS A 1 202 ? -22.792 -16.350 -26.591 1.00 13.95 ? 283 HIS A CG  1 
ATOM   1629 N ND1 . HIS A 1 202 ? -21.789 -15.854 -25.781 1.00 14.84 ? 283 HIS A ND1 1 
ATOM   1630 C CD2 . HIS A 1 202 ? -23.682 -15.351 -26.869 1.00 14.10 ? 283 HIS A CD2 1 
ATOM   1631 C CE1 . HIS A 1 202 ? -22.081 -14.580 -25.577 1.00 14.74 ? 283 HIS A CE1 1 
ATOM   1632 N NE2 . HIS A 1 202 ? -23.204 -14.256 -26.213 1.00 13.55 ? 283 HIS A NE2 1 
ATOM   1633 N N   . PHE A 1 203 ? -23.867 -20.419 -28.718 1.00 13.98 ? 284 PHE A N   1 
ATOM   1634 C CA  . PHE A 1 203 ? -23.388 -21.590 -29.441 1.00 13.96 ? 284 PHE A CA  1 
ATOM   1635 C C   . PHE A 1 203 ? -23.920 -21.656 -30.879 1.00 14.09 ? 284 PHE A C   1 
ATOM   1636 O O   . PHE A 1 203 ? -23.150 -21.908 -31.813 1.00 14.05 ? 284 PHE A O   1 
ATOM   1637 C CB  . PHE A 1 203 ? -23.707 -22.830 -28.613 1.00 14.09 ? 284 PHE A CB  1 
ATOM   1638 C CG  . PHE A 1 203 ? -23.159 -22.684 -27.205 1.00 13.88 ? 284 PHE A CG  1 
ATOM   1639 C CD1 . PHE A 1 203 ? -21.791 -22.828 -26.955 1.00 14.68 ? 284 PHE A CD1 1 
ATOM   1640 C CD2 . PHE A 1 203 ? -24.002 -22.362 -26.142 1.00 14.17 ? 284 PHE A CD2 1 
ATOM   1641 C CE1 . PHE A 1 203 ? -21.278 -22.656 -25.669 1.00 15.89 ? 284 PHE A CE1 1 
ATOM   1642 C CE2 . PHE A 1 203 ? -23.494 -22.189 -24.857 1.00 15.63 ? 284 PHE A CE2 1 
ATOM   1643 C CZ  . PHE A 1 203 ? -22.133 -22.337 -24.622 1.00 16.00 ? 284 PHE A CZ  1 
ATOM   1644 N N   . SER A 1 204 ? -25.214 -21.399 -31.079 1.00 15.16 ? 285 SER A N   1 
ATOM   1645 C CA  . SER A 1 204 ? -25.750 -21.338 -32.450 1.00 15.40 ? 285 SER A CA  1 
ATOM   1646 C C   . SER A 1 204 ? -25.230 -20.086 -33.169 1.00 15.40 ? 285 SER A C   1 
ATOM   1647 O O   . SER A 1 204 ? -24.876 -20.148 -34.346 1.00 16.16 ? 285 SER A O   1 
ATOM   1648 C CB  . SER A 1 204 ? -27.279 -21.333 -32.450 1.00 16.13 ? 285 SER A CB  1 
ATOM   1649 O OG  . SER A 1 204 ? -27.789 -20.265 -31.673 1.00 17.00 ? 285 SER A OG  1 
ATOM   1650 N N   . LYS A 1 205 ? -25.170 -18.954 -32.465 1.00 15.29 ? 286 LYS A N   1 
ATOM   1651 C CA  . LYS A 1 205 ? -24.646 -17.724 -33.065 1.00 16.59 ? 286 LYS A CA  1 
ATOM   1652 C C   . LYS A 1 205 ? -23.231 -17.936 -33.565 1.00 16.48 ? 286 LYS A C   1 
ATOM   1653 O O   . LYS A 1 205 ? -22.880 -17.475 -34.648 1.00 17.54 ? 286 LYS A O   1 
ATOM   1654 C CB  . LYS A 1 205 ? -24.617 -16.576 -32.064 1.00 19.01 ? 286 LYS A CB  1 
ATOM   1655 C CG  . LYS A 1 205 ? -25.957 -15.978 -31.696 1.00 23.84 ? 286 LYS A CG  1 
ATOM   1656 C CD  . LYS A 1 205 ? -25.764 -14.909 -30.623 1.00 26.66 ? 286 LYS A CD  1 
ATOM   1657 C CE  . LYS A 1 205 ? -27.054 -14.171 -30.301 1.00 29.46 ? 286 LYS A CE  1 
ATOM   1658 N NZ  . LYS A 1 205 ? -26.806 -13.001 -29.410 1.00 31.08 ? 286 LYS A NZ  1 
ATOM   1659 N N   . THR A 1 206 ? -22.404 -18.619 -32.760 1.00 15.71 ? 287 THR A N   1 
ATOM   1660 C CA  . THR A 1 206 ? -21.019 -18.889 -33.147 1.00 15.30 ? 287 THR A CA  1 
ATOM   1661 C C   . THR A 1 206 ? -20.960 -19.670 -34.451 1.00 15.35 ? 287 THR A C   1 
ATOM   1662 O O   . THR A 1 206 ? -20.197 -19.325 -35.351 1.00 15.45 ? 287 THR A O   1 
ATOM   1663 C CB  . THR A 1 206 ? -20.279 -19.672 -32.045 1.00 14.62 ? 287 THR A CB  1 
ATOM   1664 O OG1 . THR A 1 206 ? -20.071 -18.799 -30.932 1.00 13.34 ? 287 THR A OG1 1 
ATOM   1665 C CG2 . THR A 1 206 ? -18.945 -20.203 -32.547 1.00 13.63 ? 287 THR A CG2 1 
ATOM   1666 N N   . ASN A 1 207 ? -21.792 -20.695 -34.563 1.00 16.25 ? 288 ASN A N   1 
ATOM   1667 C CA  . ASN A 1 207 ? -21.813 -21.506 -35.781 1.00 17.28 ? 288 ASN A CA  1 
ATOM   1668 C C   . ASN A 1 207 ? -22.322 -20.731 -36.996 1.00 19.14 ? 288 ASN A C   1 
ATOM   1669 O O   . ASN A 1 207 ? -21.831 -20.924 -38.107 1.00 19.37 ? 288 ASN A O   1 
ATOM   1670 C CB  . ASN A 1 207 ? -22.617 -22.776 -35.561 1.00 16.40 ? 288 ASN A CB  1 
ATOM   1671 C CG  . ASN A 1 207 ? -21.784 -23.807 -34.847 1.00 15.24 ? 288 ASN A CG  1 
ATOM   1672 O OD1 . ASN A 1 207 ? -20.563 -23.663 -34.740 1.00 17.07 ? 288 ASN A OD1 1 
ATOM   1673 N ND2 . ASN A 1 207 ? -22.417 -24.844 -34.359 1.00 15.29 ? 288 ASN A ND2 1 
ATOM   1674 N N   . GLU A 1 208 ? -23.271 -19.831 -36.776 1.00 20.61 ? 289 GLU A N   1 
ATOM   1675 C CA  . GLU A 1 208 ? -23.780 -19.008 -37.851 1.00 22.55 ? 289 GLU A CA  1 
ATOM   1676 C C   . GLU A 1 208 ? -22.671 -18.085 -38.354 1.00 22.14 ? 289 GLU A C   1 
ATOM   1677 O O   . GLU A 1 208 ? -22.467 -17.935 -39.563 1.00 22.01 ? 289 GLU A O   1 
ATOM   1678 C CB  . GLU A 1 208 ? -24.955 -18.201 -37.335 1.00 25.72 ? 289 GLU A CB  1 
ATOM   1679 C CG  . GLU A 1 208 ? -25.700 -17.448 -38.401 1.00 33.10 ? 289 GLU A CG  1 
ATOM   1680 C CD  . GLU A 1 208 ? -26.426 -16.238 -37.835 1.00 37.70 ? 289 GLU A CD  1 
ATOM   1681 O OE1 . GLU A 1 208 ? -27.013 -16.344 -36.715 1.00 39.81 ? 289 GLU A OE1 1 
ATOM   1682 O OE2 . GLU A 1 208 ? -26.403 -15.173 -38.505 1.00 40.60 ? 289 GLU A OE2 1 
ATOM   1683 N N   . LEU A 1 209 ? -21.929 -17.489 -37.415 1.00 21.34 ? 290 LEU A N   1 
ATOM   1684 C CA  . LEU A 1 209 ? -20.827 -16.605 -37.758 1.00 20.79 ? 290 LEU A CA  1 
ATOM   1685 C C   . LEU A 1 209 ? -19.685 -17.349 -38.446 1.00 21.77 ? 290 LEU A C   1 
ATOM   1686 O O   . LEU A 1 209 ? -19.122 -16.844 -39.427 1.00 22.17 ? 290 LEU A O   1 
ATOM   1687 C CB  . LEU A 1 209 ? -20.320 -15.905 -36.508 1.00 20.23 ? 290 LEU A CB  1 
ATOM   1688 C CG  . LEU A 1 209 ? -21.295 -14.921 -35.883 1.00 20.05 ? 290 LEU A CG  1 
ATOM   1689 C CD1 . LEU A 1 209 ? -20.728 -14.402 -34.567 1.00 20.57 ? 290 LEU A CD1 1 
ATOM   1690 C CD2 . LEU A 1 209 ? -21.574 -13.780 -36.855 1.00 19.70 ? 290 LEU A CD2 1 
ATOM   1691 N N   . LEU A 1 210 ? -19.340 -18.542 -37.947 1.00 21.70 ? 291 LEU A N   1 
ATOM   1692 C CA  . LEU A 1 210 ? -18.292 -19.342 -38.574 1.00 23.08 ? 291 LEU A CA  1 
ATOM   1693 C C   . LEU A 1 210 ? -18.621 -19.628 -40.045 1.00 25.04 ? 291 LEU A C   1 
ATOM   1694 O O   . LEU A 1 210 ? -17.770 -19.463 -40.916 1.00 25.25 ? 291 LEU A O   1 
ATOM   1695 C CB  . LEU A 1 210 ? -18.074 -20.663 -37.817 1.00 21.60 ? 291 LEU A CB  1 
ATOM   1696 C CG  . LEU A 1 210 ? -17.340 -20.550 -36.467 1.00 21.55 ? 291 LEU A CG  1 
ATOM   1697 C CD1 . LEU A 1 210 ? -17.261 -21.906 -35.780 1.00 20.75 ? 291 LEU A CD1 1 
ATOM   1698 C CD2 . LEU A 1 210 ? -15.949 -19.978 -36.681 1.00 21.51 ? 291 LEU A CD2 1 
ATOM   1699 N N   . GLN A 1 211 ? -19.848 -20.023 -40.329 1.00 27.28 ? 292 GLN A N   1 
ATOM   1700 C CA  . GLN A 1 211 ? -20.241 -20.299 -41.717 1.00 31.48 ? 292 GLN A CA  1 
ATOM   1701 C C   . GLN A 1 211 ? -20.083 -19.077 -42.631 1.00 32.59 ? 292 GLN A C   1 
ATOM   1702 O O   . GLN A 1 211 ? -19.595 -19.208 -43.758 1.00 32.99 ? 292 GLN A O   1 
ATOM   1703 C CB  . GLN A 1 211 ? -21.677 -20.802 -41.770 1.00 33.56 ? 292 GLN A CB  1 
ATOM   1704 C CG  . GLN A 1 211 ? -21.828 -22.243 -41.321 1.00 38.83 ? 292 GLN A CG  1 
ATOM   1705 C CD  . GLN A 1 211 ? -23.209 -22.545 -40.765 1.00 41.80 ? 292 GLN A CD  1 
ATOM   1706 O OE1 . GLN A 1 211 ? -23.335 -23.164 -39.710 1.00 43.51 ? 292 GLN A OE1 1 
ATOM   1707 N NE2 . GLN A 1 211 ? -24.255 -22.113 -41.468 1.00 44.12 ? 292 GLN A NE2 1 
ATOM   1708 N N   . LYS A 1 212 ? -20.476 -17.896 -42.142 1.00 33.51 ? 293 LYS A N   1 
ATOM   1709 C CA  . LYS A 1 212 ? -20.368 -16.669 -42.934 1.00 35.00 ? 293 LYS A CA  1 
ATOM   1710 C C   . LYS A 1 212 ? -18.926 -16.287 -43.261 1.00 35.11 ? 293 LYS A C   1 
ATOM   1711 O O   . LYS A 1 212 ? -18.693 -15.493 -44.169 1.00 35.71 ? 293 LYS A O   1 
ATOM   1712 C CB  . LYS A 1 212 ? -21.069 -15.509 -42.228 1.00 36.24 ? 293 LYS A CB  1 
ATOM   1713 C CG  . LYS A 1 212 ? -22.578 -15.639 -42.269 1.00 40.32 ? 293 LYS A CG  1 
ATOM   1714 C CD  . LYS A 1 212 ? -23.290 -14.471 -41.608 1.00 43.15 ? 293 LYS A CD  1 
ATOM   1715 C CE  . LYS A 1 212 ? -24.799 -14.620 -41.780 1.00 45.79 ? 293 LYS A CE  1 
ATOM   1716 N NZ  . LYS A 1 212 ? -25.563 -13.529 -41.108 1.00 48.13 ? 293 LYS A NZ  1 
ATOM   1717 N N   . SER A 1 213 ? -17.954 -16.810 -42.523 1.00 34.81 ? 294 SER A N   1 
ATOM   1718 C CA  . SER A 1 213 ? -16.566 -16.534 -42.865 1.00 34.46 ? 294 SER A CA  1 
ATOM   1719 C C   . SER A 1 213 ? -15.945 -17.739 -43.559 1.00 33.41 ? 294 SER A C   1 
ATOM   1720 O O   . SER A 1 213 ? -14.743 -17.774 -43.793 1.00 33.84 ? 294 SER A O   1 
ATOM   1721 C CB  . SER A 1 213 ? -15.737 -16.154 -41.631 1.00 35.77 ? 294 SER A CB  1 
ATOM   1722 O OG  . SER A 1 213 ? -15.515 -17.265 -40.781 1.00 37.01 ? 294 SER A OG  1 
ATOM   1723 N N   . GLY A 1 214 ? -16.775 -18.725 -43.879 1.00 31.99 ? 295 GLY A N   1 
ATOM   1724 C CA  . GLY A 1 214 ? -16.298 -19.902 -44.578 1.00 30.86 ? 295 GLY A CA  1 
ATOM   1725 C C   . GLY A 1 214 ? -15.537 -20.875 -43.700 1.00 29.39 ? 295 GLY A C   1 
ATOM   1726 O O   . GLY A 1 214 ? -14.585 -21.499 -44.153 1.00 29.53 ? 295 GLY A O   1 
ATOM   1727 N N   . LYS A 1 215 ? -15.942 -21.008 -42.450 1.00 27.78 ? 296 LYS A N   1 
ATOM   1728 C CA  . LYS A 1 215 ? -15.300 -21.954 -41.554 1.00 26.94 ? 296 LYS A CA  1 
ATOM   1729 C C   . LYS A 1 215 ? -16.252 -23.092 -41.226 1.00 25.76 ? 296 LYS A C   1 
ATOM   1730 O O   . LYS A 1 215 ? -17.469 -22.951 -41.302 1.00 25.63 ? 296 LYS A O   1 
ATOM   1731 C CB  . LYS A 1 215 ? -14.858 -21.288 -40.241 1.00 27.61 ? 296 LYS A CB  1 
ATOM   1732 C CG  . LYS A 1 215 ? -13.433 -20.789 -40.210 1.00 29.63 ? 296 LYS A CG  1 
ATOM   1733 C CD  . LYS A 1 215 ? -13.322 -19.436 -40.864 1.00 32.62 ? 296 LYS A CD  1 
ATOM   1734 C CE  . LYS A 1 215 ? -12.838 -18.381 -39.882 1.00 34.35 ? 296 LYS A CE  1 
ATOM   1735 N NZ  . LYS A 1 215 ? -11.391 -18.526 -39.563 1.00 35.86 ? 296 LYS A NZ  1 
ATOM   1736 N N   . LYS A 1 216 ? -15.694 -24.224 -40.871 1.00 25.02 ? 297 LYS A N   1 
ATOM   1737 C CA  . LYS A 1 216 ? -16.500 -25.351 -40.455 1.00 24.39 ? 297 LYS A CA  1 
ATOM   1738 C C   . LYS A 1 216 ? -17.071 -25.054 -39.065 1.00 23.14 ? 297 LYS A C   1 
ATOM   1739 O O   . LYS A 1 216 ? -16.319 -24.655 -38.173 1.00 23.22 ? 297 LYS A O   1 
ATOM   1740 C CB  . LYS A 1 216 ? -15.614 -26.605 -40.400 1.00 25.57 ? 297 LYS A CB  1 
ATOM   1741 C CG  . LYS A 1 216 ? -16.334 -27.892 -40.024 1.00 26.29 ? 297 LYS A CG  1 
ATOM   1742 C CD  . LYS A 1 216 ? -15.363 -29.056 -40.002 1.00 27.26 ? 297 LYS A CD  1 
ATOM   1743 C CE  . LYS A 1 216 ? -16.066 -30.336 -39.590 1.00 29.78 ? 297 LYS A CE  1 
ATOM   1744 N NZ  . LYS A 1 216 ? -15.113 -31.484 -39.445 1.00 32.19 ? 297 LYS A NZ  1 
ATOM   1745 N N   . PRO A 1 217 ? -18.397 -25.193 -38.862 1.00 22.20 ? 298 PRO A N   1 
ATOM   1746 C CA  . PRO A 1 217 ? -19.020 -24.941 -37.552 1.00 20.83 ? 298 PRO A CA  1 
ATOM   1747 C C   . PRO A 1 217 ? -18.566 -25.959 -36.511 1.00 19.68 ? 298 PRO A C   1 
ATOM   1748 O O   . PRO A 1 217 ? -18.031 -27.015 -36.847 1.00 19.62 ? 298 PRO A O   1 
ATOM   1749 C CB  . PRO A 1 217 ? -20.522 -25.038 -37.836 1.00 20.66 ? 298 PRO A CB  1 
ATOM   1750 C CG  . PRO A 1 217 ? -20.574 -25.973 -38.994 1.00 21.89 ? 298 PRO A CG  1 
ATOM   1751 C CD  . PRO A 1 217 ? -19.425 -25.543 -39.875 1.00 22.56 ? 298 PRO A CD  1 
ATOM   1752 N N   . ILE A 1 218 ? -18.758 -25.622 -35.250 1.00 18.32 ? 299 ILE A N   1 
ATOM   1753 C CA  . ILE A 1 218 ? -18.429 -26.531 -34.169 1.00 17.08 ? 299 ILE A CA  1 
ATOM   1754 C C   . ILE A 1 218 ? -19.570 -27.496 -33.931 1.00 17.19 ? 299 ILE A C   1 
ATOM   1755 O O   . ILE A 1 218 ? -20.735 -27.091 -33.814 1.00 17.84 ? 299 ILE A O   1 
ATOM   1756 C CB  . ILE A 1 218 ? -18.188 -25.767 -32.850 1.00 15.51 ? 299 ILE A CB  1 
ATOM   1757 C CG1 . ILE A 1 218 ? -17.100 -24.695 -33.045 1.00 14.89 ? 299 ILE A CG1 1 
ATOM   1758 C CG2 . ILE A 1 218 ? -17.823 -26.750 -31.737 1.00 14.50 ? 299 ILE A CG2 1 
ATOM   1759 C CD1 . ILE A 1 218 ? -15.768 -25.214 -33.558 1.00 14.80 ? 299 ILE A CD1 1 
ATOM   1760 N N   . ASP A 1 219 ? -19.261 -28.765 -33.877 1.00 17.54 ? 300 ASP A N   1 
ATOM   1761 C CA  . ASP A 1 219 ? -20.269 -29.739 -33.500 1.00 18.67 ? 300 ASP A CA  1 
ATOM   1762 C C   . ASP A 1 219 ? -20.235 -29.819 -31.981 1.00 18.67 ? 300 ASP A C   1 
ATOM   1763 O O   . ASP A 1 219 ? -19.444 -30.565 -31.400 1.00 17.63 ? 300 ASP A O   1 
ATOM   1764 C CB  . ASP A 1 219 ? -19.986 -31.114 -34.143 1.00 20.59 ? 300 ASP A CB  1 
ATOM   1765 C CG  . ASP A 1 219 ? -21.136 -32.099 -33.979 1.00 23.73 ? 300 ASP A CG  1 
ATOM   1766 O OD1 . ASP A 1 219 ? -22.076 -31.813 -33.203 1.00 26.18 ? 300 ASP A OD1 1 
ATOM   1767 O OD2 . ASP A 1 219 ? -21.100 -33.165 -34.623 1.00 26.05 ? 300 ASP A OD2 1 
ATOM   1768 N N   . TRP A 1 220 ? -21.075 -29.010 -31.348 1.00 18.21 ? 301 TRP A N   1 
ATOM   1769 C CA  . TRP A 1 220 ? -21.056 -28.881 -29.894 1.00 17.78 ? 301 TRP A CA  1 
ATOM   1770 C C   . TRP A 1 220 ? -21.416 -30.157 -29.161 1.00 18.33 ? 301 TRP A C   1 
ATOM   1771 O O   . TRP A 1 220 ? -21.031 -30.318 -28.010 1.00 18.57 ? 301 TRP A O   1 
ATOM   1772 C CB  . TRP A 1 220 ? -21.976 -27.742 -29.436 1.00 17.10 ? 301 TRP A CB  1 
ATOM   1773 C CG  . TRP A 1 220 ? -21.583 -26.391 -29.960 1.00 15.50 ? 301 TRP A CG  1 
ATOM   1774 C CD1 . TRP A 1 220 ? -22.158 -25.723 -31.003 1.00 15.48 ? 301 TRP A CD1 1 
ATOM   1775 C CD2 . TRP A 1 220 ? -20.530 -25.545 -29.468 1.00 14.85 ? 301 TRP A CD2 1 
ATOM   1776 N NE1 . TRP A 1 220 ? -21.521 -24.530 -31.170 1.00 15.72 ? 301 TRP A NE1 1 
ATOM   1777 C CE2 . TRP A 1 220 ? -20.526 -24.380 -30.264 1.00 15.18 ? 301 TRP A CE2 1 
ATOM   1778 C CE3 . TRP A 1 220 ? -19.590 -25.659 -28.436 1.00 15.17 ? 301 TRP A CE3 1 
ATOM   1779 C CZ2 . TRP A 1 220 ? -19.621 -23.335 -30.069 1.00 15.77 ? 301 TRP A CZ2 1 
ATOM   1780 C CZ3 . TRP A 1 220 ? -18.687 -24.620 -28.232 1.00 15.48 ? 301 TRP A CZ3 1 
ATOM   1781 C CH2 . TRP A 1 220 ? -18.707 -23.470 -29.046 1.00 15.52 ? 301 TRP A CH2 1 
ATOM   1782 N N   . LYS A 1 221 ? -22.139 -31.074 -29.806 1.00 18.96 ? 302 LYS A N   1 
ATOM   1783 C CA  . LYS A 1 221 ? -22.537 -32.299 -29.115 1.00 20.42 ? 302 LYS A CA  1 
ATOM   1784 C C   . LYS A 1 221 ? -21.406 -33.308 -29.076 1.00 20.96 ? 302 LYS A C   1 
ATOM   1785 O O   . LYS A 1 221 ? -21.472 -34.305 -28.334 1.00 20.12 ? 302 LYS A O   1 
ATOM   1786 C CB  . LYS A 1 221 ? -23.768 -32.927 -29.780 1.00 22.95 ? 302 LYS A CB  1 
ATOM   1787 C CG  . LYS A 1 221 ? -23.503 -33.624 -31.105 1.00 25.96 ? 302 LYS A CG  1 
ATOM   1788 C CD  . LYS A 1 221 ? -24.803 -34.178 -31.686 1.00 28.74 ? 302 LYS A CD  1 
ATOM   1789 C CE  . LYS A 1 221 ? -24.575 -34.922 -32.995 1.00 29.49 ? 302 LYS A CE  1 
ATOM   1790 N NZ  . LYS A 1 221 ? -23.981 -34.053 -34.043 1.00 30.06 ? 302 LYS A NZ  1 
ATOM   1791 N N   . GLU A 1 222 ? -20.372 -33.046 -29.874 1.00 20.78 ? 303 GLU A N   1 
ATOM   1792 C CA  . GLU A 1 222 ? -19.262 -33.967 -29.983 1.00 23.17 ? 303 GLU A CA  1 
ATOM   1793 C C   . GLU A 1 222 ? -18.297 -33.821 -28.808 1.00 22.44 ? 303 GLU A C   1 
ATOM   1794 O O   . GLU A 1 222 ? -17.278 -33.140 -28.902 1.00 22.59 ? 303 GLU A O   1 
ATOM   1795 C CB  . GLU A 1 222 ? -18.547 -33.758 -31.332 1.00 26.31 ? 303 GLU A CB  1 
ATOM   1796 C CG  . GLU A 1 222 ? -17.736 -34.959 -31.793 1.00 32.43 ? 303 GLU A CG  1 
ATOM   1797 C CD  . GLU A 1 222 ? -18.542 -36.255 -31.708 1.00 35.83 ? 303 GLU A CD  1 
ATOM   1798 O OE1 . GLU A 1 222 ? -19.476 -36.443 -32.530 1.00 37.64 ? 303 GLU A OE1 1 
ATOM   1799 O OE2 . GLU A 1 222 ? -18.251 -37.081 -30.806 1.00 38.19 ? 303 GLU A OE2 1 
ATOM   1800 N N   . LEU A 1 223 ? -18.652 -34.449 -27.697 1.00 21.74 ? 304 LEU A N   1 
ATOM   1801 C CA  . LEU A 1 223 ? -17.825 -34.427 -26.504 1.00 21.93 ? 304 LEU A CA  1 
ATOM   1802 C C   . LEU A 1 223 ? -17.308 -35.834 -26.163 1.00 22.01 ? 304 LEU A C   1 
ATOM   1803 O O   . LEU A 1 223 ? -17.580 -36.770 -26.931 1.00 23.68 ? 304 LEU A O   1 
ATOM   1804 C CB  . LEU A 1 223 ? -18.631 -33.831 -25.345 1.00 21.25 ? 304 LEU A CB  1 
ATOM   1805 C CG  . LEU A 1 223 ? -18.819 -32.314 -25.398 1.00 21.33 ? 304 LEU A CG  1 
ATOM   1806 C CD1 . LEU A 1 223 ? -19.800 -31.857 -24.335 1.00 21.84 ? 304 LEU A CD1 1 
ATOM   1807 C CD2 . LEU A 1 223 ? -17.479 -31.634 -25.209 1.00 20.99 ? 304 LEU A CD2 1 
ATOM   1808 O OXT . LEU A 1 223 ? -16.624 -35.982 -25.153 1.00 22.57 ? 304 LEU A OXT 1 
HETATM 1809 O O   . HOH B 2 .   ? -15.900 -35.005 -15.864 1.00 17.40 ? 305 HOH A O   1 
HETATM 1810 O O   . HOH B 2 .   ? 0.959   -11.224 -14.493 1.00 32.35 ? 306 HOH A O   1 
HETATM 1811 O O   . HOH B 2 .   ? 0.609   -14.348 -6.933  1.00 40.85 ? 307 HOH A O   1 
HETATM 1812 O O   . HOH B 2 .   ? -7.856  -17.369 -39.044 1.00 50.31 ? 308 HOH A O   1 
HETATM 1813 O O   . HOH B 2 .   ? -15.786 -9.311  -38.016 1.00 36.26 ? 309 HOH A O   1 
HETATM 1814 O O   . HOH B 2 .   ? -26.273 -21.950 -36.000 1.00 33.35 ? 310 HOH A O   1 
HETATM 1815 O O   . HOH B 2 .   ? -25.670 -23.127 -38.372 1.00 58.51 ? 311 HOH A O   1 
HETATM 1816 O O   . HOH B 2 .   ? -22.329 -28.199 -36.255 1.00 33.28 ? 312 HOH A O   1 
HETATM 1817 O O   . HOH B 2 .   ? -17.099 -38.511 -24.263 1.00 30.26 ? 313 HOH A O   1 
HETATM 1818 O O   . HOH B 2 .   ? -7.130  -28.707 -10.125 1.00 17.77 ? 314 HOH A O   1 
HETATM 1819 O O   . HOH B 2 .   ? -14.578 -34.247 -24.543 1.00 16.30 ? 315 HOH A O   1 
HETATM 1820 O O   . HOH B 2 .   ? -9.477  -27.750 -16.367 1.00 12.27 ? 316 HOH A O   1 
HETATM 1821 O O   . HOH B 2 .   ? -4.058  -8.977  -25.918 1.00 21.50 ? 317 HOH A O   1 
HETATM 1822 O O   . HOH B 2 .   ? 0.190   -14.945 -13.348 1.00 15.65 ? 318 HOH A O   1 
HETATM 1823 O O   . HOH B 2 .   ? -6.618  -25.912 -16.147 1.00 15.66 ? 319 HOH A O   1 
HETATM 1824 O O   . HOH B 2 .   ? -21.057 -11.807 -15.109 1.00 17.73 ? 320 HOH A O   1 
HETATM 1825 O O   . HOH B 2 .   ? 3.318   -34.378 -14.920 1.00 26.68 ? 321 HOH A O   1 
HETATM 1826 O O   . HOH B 2 .   ? -15.178 -16.006 -21.660 1.00 16.35 ? 322 HOH A O   1 
HETATM 1827 O O   . HOH B 2 .   ? -5.870  -23.712 -17.760 1.00 19.31 ? 323 HOH A O   1 
HETATM 1828 O O   . HOH B 2 .   ? -5.501  -11.865 -13.091 1.00 23.26 ? 324 HOH A O   1 
HETATM 1829 O O   . HOH B 2 .   ? -3.376  -24.468 -17.288 1.00 19.75 ? 325 HOH A O   1 
HETATM 1830 O O   . HOH B 2 .   ? -15.220 -16.704 -18.541 1.00 18.46 ? 326 HOH A O   1 
HETATM 1831 O O   . HOH B 2 .   ? -10.847 -23.059 -15.418 1.00 23.09 ? 327 HOH A O   1 
HETATM 1832 O O   . HOH B 2 .   ? -5.438  -11.537 -17.889 1.00 20.39 ? 328 HOH A O   1 
HETATM 1833 O O   . HOH B 2 .   ? -22.678 -10.054 -27.613 1.00 26.41 ? 329 HOH A O   1 
HETATM 1834 O O   . HOH B 2 .   ? -14.801 -13.453 -16.907 1.00 18.00 ? 330 HOH A O   1 
HETATM 1835 O O   . HOH B 2 .   ? -18.854 -39.198 -15.854 1.00 24.75 ? 331 HOH A O   1 
HETATM 1836 O O   . HOH B 2 .   ? -27.966 -14.730 -11.570 1.00 34.19 ? 332 HOH A O   1 
HETATM 1837 O O   . HOH B 2 .   ? -16.041 -22.288 -13.489 1.00 33.55 ? 333 HOH A O   1 
HETATM 1838 O O   . HOH B 2 .   ? 0.197   -31.275 -9.462  1.00 25.26 ? 334 HOH A O   1 
HETATM 1839 O O   . HOH B 2 .   ? -0.015  -27.502 -1.574  1.00 34.84 ? 335 HOH A O   1 
HETATM 1840 O O   . HOH B 2 .   ? 5.010   -10.218 -24.596 1.00 25.17 ? 336 HOH A O   1 
HETATM 1841 O O   . HOH B 2 .   ? -12.645 -37.322 -18.599 1.00 28.89 ? 337 HOH A O   1 
HETATM 1842 O O   . HOH B 2 .   ? -16.970 -8.464  -33.309 1.00 48.61 ? 338 HOH A O   1 
HETATM 1843 O O   . HOH B 2 .   ? -5.367  -30.610 -11.452 1.00 21.31 ? 339 HOH A O   1 
HETATM 1844 O O   . HOH B 2 .   ? -33.359 -19.051 -25.504 1.00 33.93 ? 340 HOH A O   1 
HETATM 1845 O O   . HOH B 2 .   ? -9.243  -25.209 -14.878 1.00 17.33 ? 341 HOH A O   1 
HETATM 1846 O O   . HOH B 2 .   ? -5.877  -29.170 -35.566 1.00 40.25 ? 342 HOH A O   1 
HETATM 1847 O O   . HOH B 2 .   ? 2.743   -9.838  -26.585 1.00 40.77 ? 343 HOH A O   1 
HETATM 1848 O O   . HOH B 2 .   ? -5.667  -9.721  -23.992 1.00 18.55 ? 344 HOH A O   1 
HETATM 1849 O O   . HOH B 2 .   ? -4.577  -8.877  -18.925 1.00 22.64 ? 345 HOH A O   1 
HETATM 1850 O O   . HOH B 2 .   ? -11.556 -25.184 -7.743  1.00 29.72 ? 346 HOH A O   1 
HETATM 1851 O O   . HOH B 2 .   ? -14.738 -6.496  -24.301 1.00 24.06 ? 347 HOH A O   1 
HETATM 1852 O O   . HOH B 2 .   ? -6.145  -33.270 -20.636 1.00 32.14 ? 348 HOH A O   1 
HETATM 1853 O O   . HOH B 2 .   ? 2.410   -9.647  -23.490 1.00 22.75 ? 349 HOH A O   1 
HETATM 1854 O O   . HOH B 2 .   ? -31.546 -21.295 -21.877 1.00 41.13 ? 350 HOH A O   1 
HETATM 1855 O O   . HOH B 2 .   ? -15.746 -39.665 -22.189 1.00 37.92 ? 351 HOH A O   1 
HETATM 1856 O O   . HOH B 2 .   ? -7.099  -7.743  -19.145 1.00 35.33 ? 352 HOH A O   1 
HETATM 1857 O O   . HOH B 2 .   ? -30.928 -20.690 -25.680 1.00 25.10 ? 353 HOH A O   1 
HETATM 1858 O O   . HOH B 2 .   ? 4.543   -26.396 -14.805 1.00 23.66 ? 354 HOH A O   1 
HETATM 1859 O O   . HOH B 2 .   ? -13.872 -17.440 -16.193 1.00 34.48 ? 355 HOH A O   1 
HETATM 1860 O O   . HOH B 2 .   ? -9.630  -28.344 -35.816 1.00 43.97 ? 356 HOH A O   1 
HETATM 1861 O O   . HOH B 2 .   ? -12.064 -19.888 -15.676 1.00 42.73 ? 357 HOH A O   1 
HETATM 1862 O O   . HOH B 2 .   ? -3.458  -7.267  -30.320 1.00 30.47 ? 358 HOH A O   1 
HETATM 1863 O O   . HOH B 2 .   ? -23.175 -39.619 -15.673 1.00 23.84 ? 359 HOH A O   1 
HETATM 1864 O O   . HOH B 2 .   ? -14.259 -34.023 -31.211 1.00 32.96 ? 360 HOH A O   1 
HETATM 1865 O O   . HOH B 2 .   ? -9.050  -8.992  -17.037 1.00 27.83 ? 361 HOH A O   1 
HETATM 1866 O O   . HOH B 2 .   ? -18.430 -23.381 -11.347 1.00 27.51 ? 362 HOH A O   1 
HETATM 1867 O O   . HOH B 2 .   ? 1.973   -11.852 -29.279 1.00 28.13 ? 363 HOH A O   1 
HETATM 1868 O O   . HOH B 2 .   ? -6.969  -13.406 -11.563 1.00 37.21 ? 364 HOH A O   1 
HETATM 1869 O O   . HOH B 2 .   ? -18.293 -11.255 -14.002 1.00 24.11 ? 365 HOH A O   1 
HETATM 1870 O O   . HOH B 2 .   ? 2.045   -28.246 -19.746 1.00 59.75 ? 366 HOH A O   1 
HETATM 1871 O O   . HOH B 2 .   ? -27.188 -21.449 -11.567 1.00 37.27 ? 367 HOH A O   1 
HETATM 1872 O O   . HOH B 2 .   ? -23.586 -28.014 -32.948 1.00 29.21 ? 368 HOH A O   1 
HETATM 1873 O O   . HOH B 2 .   ? -7.314  -34.871 -15.117 1.00 35.78 ? 369 HOH A O   1 
HETATM 1874 O O   . HOH B 2 .   ? -5.739  -19.425 -35.896 1.00 47.73 ? 370 HOH A O   1 
HETATM 1875 O O   . HOH B 2 .   ? -9.734  -20.248 -38.164 1.00 54.12 ? 371 HOH A O   1 
HETATM 1876 O O   . HOH B 2 .   ? -22.428 -9.372  -30.311 1.00 43.55 ? 372 HOH A O   1 
HETATM 1877 O O   . HOH B 2 .   ? 7.227   -12.505 -14.420 1.00 26.81 ? 373 HOH A O   1 
HETATM 1878 O O   . HOH B 2 .   ? -25.946 -24.534 -9.846  1.00 57.85 ? 374 HOH A O   1 
HETATM 1879 O O   . HOH B 2 .   ? -22.441 -31.828 -11.778 1.00 26.90 ? 375 HOH A O   1 
HETATM 1880 O O   . HOH B 2 .   ? 0.414   -24.174 -38.390 1.00 43.54 ? 376 HOH A O   1 
HETATM 1881 O O   . HOH B 2 .   ? -5.831  -4.674  -32.178 1.00 41.64 ? 377 HOH A O   1 
HETATM 1882 O O   . HOH B 2 .   ? -15.606 -28.588 -36.222 1.00 44.24 ? 378 HOH A O   1 
HETATM 1883 O O   . HOH B 2 .   ? -12.919 -24.373 -41.357 1.00 33.98 ? 379 HOH A O   1 
HETATM 1884 O O   . HOH B 2 .   ? -13.641 -24.251 -44.435 1.00 55.88 ? 380 HOH A O   1 
HETATM 1885 O O   . HOH B 2 .   ? 8.257   -24.008 -14.346 1.00 27.52 ? 381 HOH A O   1 
HETATM 1886 O O   . HOH B 2 .   ? -26.937 -29.019 -16.936 1.00 24.75 ? 382 HOH A O   1 
HETATM 1887 O O   . HOH B 2 .   ? 9.862   -25.585 -15.924 1.00 55.43 ? 383 HOH A O   1 
HETATM 1888 O O   . HOH B 2 .   ? 5.571   -23.924 -16.000 1.00 45.79 ? 384 HOH A O   1 
HETATM 1889 O O   . HOH B 2 .   ? -1.124  -29.390 -31.314 1.00 33.27 ? 385 HOH A O   1 
HETATM 1890 O O   . HOH B 2 .   ? 14.324  -31.562 -22.284 1.00 49.19 ? 386 HOH A O   1 
HETATM 1891 O O   . HOH B 2 .   ? -8.769  -25.641 -26.097 1.00 16.63 ? 387 HOH A O   1 
HETATM 1892 O O   . HOH B 2 .   ? -7.107  -26.332 -27.875 1.00 35.73 ? 388 HOH A O   1 
HETATM 1893 O O   . HOH B 2 .   ? -20.844 -39.473 -18.012 1.00 38.79 ? 389 HOH A O   1 
HETATM 1894 O O   . HOH B 2 .   ? -27.902 -30.608 -21.226 1.00 41.41 ? 390 HOH A O   1 
HETATM 1895 O O   . HOH B 2 .   ? -23.986 -34.448 -27.013 1.00 31.29 ? 391 HOH A O   1 
HETATM 1896 O O   . HOH B 2 .   ? -9.467  -32.789 -14.756 1.00 34.44 ? 392 HOH A O   1 
HETATM 1897 O O   . HOH B 2 .   ? -3.478  -35.011 -20.573 1.00 36.43 ? 393 HOH A O   1 
HETATM 1898 O O   . HOH B 2 .   ? -1.574  -33.371 -21.505 1.00 51.05 ? 394 HOH A O   1 
HETATM 1899 O O   . HOH B 2 .   ? -24.403 -9.032  -17.048 1.00 27.36 ? 395 HOH A O   1 
HETATM 1900 O O   . HOH B 2 .   ? 9.922   -9.287  -20.175 1.00 25.21 ? 396 HOH A O   1 
HETATM 1901 O O   . HOH B 2 .   ? 0.535   -29.608 -21.599 1.00 27.37 ? 397 HOH A O   1 
HETATM 1902 O O   . HOH B 2 .   ? -28.778 -18.037 -33.199 1.00 33.00 ? 398 HOH A O   1 
HETATM 1903 O O   . HOH B 2 .   ? -7.877  -8.182  -26.174 1.00 39.40 ? 399 HOH A O   1 
HETATM 1904 O O   . HOH B 2 .   ? -4.639  -32.742 -10.045 1.00 33.36 ? 400 HOH A O   1 
HETATM 1905 O O   . HOH B 2 .   ? 0.613   -28.374 -32.980 1.00 33.02 ? 401 HOH A O   1 
HETATM 1906 O O   . HOH B 2 .   ? -5.391  -32.822 -13.544 1.00 42.86 ? 402 HOH A O   1 
HETATM 1907 O O   . HOH B 2 .   ? -22.711 -9.695  -14.123 1.00 36.52 ? 403 HOH A O   1 
HETATM 1908 O O   . HOH B 2 .   ? -22.733 -11.203 -8.840  1.00 49.82 ? 404 HOH A O   1 
HETATM 1909 O O   . HOH B 2 .   ? -20.630 -12.434 -9.991  1.00 61.43 ? 405 HOH A O   1 
HETATM 1910 O O   . HOH B 2 .   ? -19.883 -14.473 -11.753 1.00 59.04 ? 406 HOH A O   1 
HETATM 1911 O O   . HOH B 2 .   ? -18.293 -39.264 -11.249 1.00 63.19 ? 407 HOH A O   1 
HETATM 1912 O O   . HOH B 2 .   ? -17.734 -37.045 -14.252 1.00 44.52 ? 408 HOH A O   1 
HETATM 1913 O O   . HOH B 2 .   ? -25.183 -24.948 -34.971 1.00 31.46 ? 409 HOH A O   1 
HETATM 1914 O O   . HOH B 2 .   ? -13.709 -15.363 -14.496 1.00 50.99 ? 410 HOH A O   1 
HETATM 1915 O O   . HOH B 2 .   ? -15.344 -12.359 -14.163 1.00 34.68 ? 411 HOH A O   1 
HETATM 1916 O O   . HOH B 2 .   ? -17.899 -5.051  -22.487 1.00 41.37 ? 412 HOH A O   1 
HETATM 1917 O O   . HOH B 2 .   ? -19.778 -9.885  -35.583 1.00 51.75 ? 413 HOH A O   1 
HETATM 1918 O O   . HOH B 2 .   ? -8.979  -21.242 -8.565  1.00 29.21 ? 414 HOH A O   1 
HETATM 1919 O O   . HOH B 2 .   ? -3.766  -18.788 -9.599  1.00 17.38 ? 415 HOH A O   1 
HETATM 1920 O O   . HOH B 2 .   ? -6.417  -23.027 -20.395 1.00 15.64 ? 416 HOH A O   1 
HETATM 1921 O O   . HOH B 2 .   ? 2.889   -29.662 -8.051  1.00 28.63 ? 417 HOH A O   1 
HETATM 1922 O O   . HOH B 2 .   ? -1.532  -25.358 -1.517  1.00 33.91 ? 418 HOH A O   1 
HETATM 1923 O O   . HOH B 2 .   ? -19.169 -29.428 -37.562 1.00 40.69 ? 419 HOH A O   1 
HETATM 1924 O O   . HOH B 2 .   ? -7.849  -3.286  -31.025 1.00 53.47 ? 420 HOH A O   1 
HETATM 1925 O O   . HOH B 2 .   ? -30.010 -14.153 -27.941 1.00 29.66 ? 421 HOH A O   1 
HETATM 1926 O O   . HOH B 2 .   ? -30.748 -14.909 -30.512 1.00 52.93 ? 422 HOH A O   1 
HETATM 1927 O O   . HOH B 2 .   ? -0.206  -8.038  -20.250 1.00 47.60 ? 423 HOH A O   1 
HETATM 1928 O O   . HOH B 2 .   ? -28.542 -19.007 -10.071 1.00 38.37 ? 424 HOH A O   1 
HETATM 1929 O O   . HOH B 2 .   ? -2.778  -5.634  -32.198 1.00 38.57 ? 425 HOH A O   1 
HETATM 1930 O O   . HOH B 2 .   ? -3.364  -33.633 -5.596  1.00 40.09 ? 426 HOH A O   1 
HETATM 1931 O O   . HOH B 2 .   ? -29.932 -14.659 -18.610 1.00 22.60 ? 427 HOH A O   1 
HETATM 1932 O O   . HOH B 2 .   ? 4.747   -30.489 -6.472  1.00 50.49 ? 428 HOH A O   1 
HETATM 1933 O O   . HOH B 2 .   ? 8.723   -31.333 -3.864  1.00 55.54 ? 429 HOH A O   1 
HETATM 1934 O O   . HOH B 2 .   ? -28.793 -29.800 -18.662 1.00 45.27 ? 430 HOH A O   1 
HETATM 1935 O O   . HOH B 2 .   ? -18.793 -23.357 -43.423 1.00 45.02 ? 431 HOH A O   1 
HETATM 1936 O O   . HOH B 2 .   ? -27.168 -36.295 -30.418 1.00 43.52 ? 432 HOH A O   1 
HETATM 1937 O O   . HOH B 2 .   ? 7.181   -26.485 -13.189 1.00 45.28 ? 433 HOH A O   1 
HETATM 1938 O O   . HOH B 2 .   ? -24.208 -30.471 -32.122 1.00 39.53 ? 434 HOH A O   1 
HETATM 1939 O O   . HOH B 2 .   ? 13.957  -19.323 -22.458 1.00 38.74 ? 435 HOH A O   1 
HETATM 1940 O O   . HOH B 2 .   ? 4.879   -9.457  -17.147 1.00 39.72 ? 436 HOH A O   1 
HETATM 1941 O O   . HOH B 2 .   ? -9.417  -20.886 -2.507  1.00 36.68 ? 437 HOH A O   1 
HETATM 1942 O O   . HOH B 2 .   ? -31.314 -28.524 -19.478 1.00 56.43 ? 438 HOH A O   1 
HETATM 1943 O O   . HOH B 2 .   ? 2.790   -31.235 -31.048 1.00 45.32 ? 439 HOH A O   1 
HETATM 1944 O O   . HOH B 2 .   ? 10.491  -27.849 -8.637  1.00 56.05 ? 440 HOH A O   1 
HETATM 1945 O O   . HOH B 2 .   ? -12.141 -32.725 -6.776  1.00 46.36 ? 441 HOH A O   1 
HETATM 1946 O O   . HOH B 2 .   ? -3.427  -33.591 -24.586 1.00 51.02 ? 442 HOH A O   1 
HETATM 1947 O O   . HOH B 2 .   ? 7.363   -14.226 -11.196 1.00 52.64 ? 443 HOH A O   1 
HETATM 1948 O O   . HOH B 2 .   ? -11.480 -21.935 -10.790 1.00 54.86 ? 444 HOH A O   1 
HETATM 1949 O O   . HOH B 2 .   ? -8.198  -15.816 -20.540 1.00 43.31 ? 445 HOH A O   1 
HETATM 1950 O O   . HOH B 2 .   ? 8.491   -17.737 -32.749 1.00 57.56 ? 446 HOH A O   1 
HETATM 1951 O O   . HOH B 2 .   ? 6.678   -15.449 -30.399 1.00 39.01 ? 447 HOH A O   1 
HETATM 1952 O O   . HOH B 2 .   ? 1.507   -8.790  -29.803 1.00 45.45 ? 448 HOH A O   1 
HETATM 1953 O O   . HOH B 2 .   ? 11.632  -17.914 -31.521 1.00 54.31 ? 449 HOH A O   1 
HETATM 1954 O O   . HOH B 2 .   ? -32.937 -15.961 -26.248 1.00 36.61 ? 450 HOH A O   1 
HETATM 1955 O O   . HOH B 2 .   ? 12.180  -20.408 -27.529 1.00 56.40 ? 451 HOH A O   1 
HETATM 1956 O O   . HOH B 2 .   ? 13.379  -17.909 -29.617 1.00 47.25 ? 452 HOH A O   1 
HETATM 1957 O O   . HOH B 2 .   ? 6.203   -27.182 -20.011 1.00 50.80 ? 453 HOH A O   1 
HETATM 1958 O O   . HOH B 2 .   ? 4.685   -27.477 -17.528 1.00 33.59 ? 454 HOH A O   1 
HETATM 1959 O O   . HOH B 2 .   ? -4.637  -27.265 -29.050 1.00 52.70 ? 455 HOH A O   1 
HETATM 1960 O O   . HOH B 2 .   ? -1.791  -33.170 -9.704  1.00 56.00 ? 456 HOH A O   1 
HETATM 1961 O O   . HOH B 2 .   ? -2.619  -30.735 -33.390 1.00 48.99 ? 457 HOH A O   1 
HETATM 1962 O O   . HOH B 2 .   ? -3.488  -18.620 -37.508 1.00 49.70 ? 458 HOH A O   1 
HETATM 1963 O O   . HOH B 2 .   ? -12.949 -19.120 -36.952 1.00 40.98 ? 459 HOH A O   1 
HETATM 1964 O O   . HOH B 2 .   ? -10.503 -18.649 -8.613  1.00 51.31 ? 460 HOH A O   1 
HETATM 1965 O O   . HOH B 2 .   ? -11.683 -18.692 -13.094 1.00 55.74 ? 461 HOH A O   1 
HETATM 1966 O O   . HOH B 2 .   ? -10.450 -26.049 -0.782  1.00 57.24 ? 462 HOH A O   1 
HETATM 1967 O O   . HOH B 2 .   ? -7.755  -35.510 -22.972 1.00 50.88 ? 463 HOH A O   1 
HETATM 1968 O O   . HOH B 2 .   ? -16.945 -30.087 -9.734  1.00 43.97 ? 464 HOH A O   1 
HETATM 1969 O O   . HOH B 2 .   ? -23.761 -34.118 -14.618 1.00 35.97 ? 465 HOH A O   1 
HETATM 1970 O O   . HOH B 2 .   ? -32.600 -22.565 -18.445 1.00 60.85 ? 466 HOH A O   1 
HETATM 1971 O O   . HOH B 2 .   ? -29.839 -24.469 -33.066 1.00 39.97 ? 467 HOH A O   1 
HETATM 1972 O O   . HOH B 2 .   ? -32.162 -33.946 -32.593 1.00 49.36 ? 468 HOH A O   1 
HETATM 1973 O O   . HOH B 2 .   ? -29.855 -32.400 -23.066 1.00 46.62 ? 469 HOH A O   1 
HETATM 1974 O O   . HOH B 2 .   ? -7.225  -31.667 -33.640 1.00 40.73 ? 470 HOH A O   1 
HETATM 1975 O O   . HOH B 2 .   ? 4.656   -9.845  -12.559 1.00 56.78 ? 471 HOH A O   1 
HETATM 1976 O O   . HOH B 2 .   ? -13.880 -11.904 -11.811 1.00 41.61 ? 472 HOH A O   1 
HETATM 1977 O O   . HOH B 2 .   ? -8.382  -2.122  -24.220 1.00 44.58 ? 473 HOH A O   1 
HETATM 1978 O O   . HOH B 2 .   ? -12.196 -3.307  -32.775 1.00 41.20 ? 474 HOH A O   1 
HETATM 1979 O O   . HOH B 2 .   ? -19.283 -7.443  -28.691 1.00 57.52 ? 475 HOH A O   1 
HETATM 1980 O O   . HOH B 2 .   ? -21.481 -7.451  -27.080 1.00 47.38 ? 476 HOH A O   1 
HETATM 1981 O O   . HOH B 2 .   ? -30.296 -22.206 -34.711 1.00 47.36 ? 477 HOH A O   1 
HETATM 1982 O O   . HOH B 2 .   ? -14.063 -31.551 -42.076 1.00 50.42 ? 478 HOH A O   1 
HETATM 1983 O O   . HOH B 2 .   ? -6.363  -15.868 -11.042 1.00 49.76 ? 479 HOH A O   1 
HETATM 1984 O O   . HOH B 2 .   ? 4.890   -13.332 -29.238 1.00 55.98 ? 480 HOH A O   1 
HETATM 1985 O O   . HOH B 2 .   ? -0.666  -23.749 0.520   1.00 62.78 ? 481 HOH A O   1 
HETATM 1986 O O   . HOH B 2 .   ? -5.951  -36.748 -20.683 1.00 55.96 ? 482 HOH A O   1 
HETATM 1987 O O   . HOH B 2 .   ? -31.305 -29.958 -27.256 1.00 57.56 ? 483 HOH A O   1 
HETATM 1988 O O   . HOH B 2 .   ? -33.775 -30.034 -29.003 1.00 54.00 ? 484 HOH A O   1 
HETATM 1989 O O   . HOH B 2 .   ? -5.738  -7.335  -36.049 1.00 60.81 ? 485 HOH A O   1 
HETATM 1990 O O   . HOH B 2 .   ? -16.225 -15.822 -38.775 1.00 64.00 ? 486 HOH A O   1 
HETATM 1991 O O   . HOH B 2 .   ? -28.851 -23.118 -12.833 1.00 54.21 ? 487 HOH A O   1 
HETATM 1992 O O   . HOH B 2 .   ? -32.260 -21.493 -10.480 1.00 66.81 ? 488 HOH A O   1 
HETATM 1993 O O   . HOH B 2 .   ? -31.488 -22.223 -13.087 1.00 61.82 ? 489 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   82  82  MET MET A . n 
A 1 2   GLU 2   83  83  GLU GLU A . n 
A 1 3   PHE 3   84  84  PHE PHE A . n 
A 1 4   PHE 4   85  85  PHE PHE A . n 
A 1 5   GLY 5   86  86  GLY GLY A . n 
A 1 6   GLU 6   87  87  GLU GLU A . n 
A 1 7   SER 7   88  88  SER SER A . n 
A 1 8   TRP 8   89  89  TRP TRP A . n 
A 1 9   LYS 9   90  90  LYS LYS A . n 
A 1 10  LYS 10  91  91  LYS LYS A . n 
A 1 11  HIS 11  92  92  HIS HIS A . n 
A 1 12  LEU 12  93  93  LEU LEU A . n 
A 1 13  SER 13  94  94  SER SER A . n 
A 1 14  GLY 14  95  95  GLY GLY A . n 
A 1 15  GLU 15  96  96  GLU GLU A . n 
A 1 16  PHE 16  97  97  PHE PHE A . n 
A 1 17  GLY 17  98  98  GLY GLY A . n 
A 1 18  LYS 18  99  99  LYS LYS A . n 
A 1 19  PRO 19  100 100 PRO PRO A . n 
A 1 20  TYR 20  101 101 TYR TYR A . n 
A 1 21  PHE 21  102 102 PHE PHE A . n 
A 1 22  ILE 22  103 103 ILE ILE A . n 
A 1 23  LYS 23  104 104 LYS LYS A . n 
A 1 24  LEU 24  105 105 LEU LEU A . n 
A 1 25  MET 25  106 106 MET MET A . n 
A 1 26  GLY 26  107 107 GLY GLY A . n 
A 1 27  PHE 27  108 108 PHE PHE A . n 
A 1 28  VAL 28  109 109 VAL VAL A . n 
A 1 29  ALA 29  110 110 ALA ALA A . n 
A 1 30  GLU 30  111 111 GLU GLU A . n 
A 1 31  GLU 31  112 112 GLU GLU A . n 
A 1 32  ARG 32  113 113 ARG ARG A . n 
A 1 33  LYS 33  114 114 LYS LYS A . n 
A 1 34  HIS 34  115 115 HIS HIS A . n 
A 1 35  TYR 35  116 116 TYR TYR A . n 
A 1 36  THR 36  117 117 THR THR A . n 
A 1 37  VAL 37  118 118 VAL VAL A . n 
A 1 38  TYR 38  119 119 TYR TYR A . n 
A 1 39  PRO 39  120 120 PRO PRO A . n 
A 1 40  PRO 40  121 121 PRO PRO A . n 
A 1 41  PRO 41  122 122 PRO PRO A . n 
A 1 42  HIS 42  123 123 HIS HIS A . n 
A 1 43  GLN 43  124 124 GLN GLN A . n 
A 1 44  VAL 44  125 125 VAL VAL A . n 
A 1 45  PHE 45  126 126 PHE PHE A . n 
A 1 46  THR 46  127 127 THR THR A . n 
A 1 47  TRP 47  128 128 TRP TRP A . n 
A 1 48  THR 48  129 129 THR THR A . n 
A 1 49  GLN 49  130 130 GLN GLN A . n 
A 1 50  MET 50  131 131 MET MET A . n 
A 1 51  CYS 51  132 132 CYS CYS A . n 
A 1 52  ASP 52  133 133 ASP ASP A . n 
A 1 53  ILE 53  134 134 ILE ILE A . n 
A 1 54  LYS 54  135 135 LYS LYS A . n 
A 1 55  ASP 55  136 136 ASP ASP A . n 
A 1 56  VAL 56  137 137 VAL VAL A . n 
A 1 57  LYS 57  138 138 LYS LYS A . n 
A 1 58  VAL 58  139 139 VAL VAL A . n 
A 1 59  VAL 59  140 140 VAL VAL A . n 
A 1 60  ILE 60  141 141 ILE ILE A . n 
A 1 61  LEU 61  142 142 LEU LEU A . n 
A 1 62  GLY 62  143 143 GLY GLY A . n 
A 1 63  GLN 63  144 144 GLN GLN A . n 
A 1 64  ASP 64  145 145 ASP ASP A . n 
A 1 65  PRO 65  146 146 PRO PRO A . n 
A 1 66  TYR 66  147 147 TYR TYR A . n 
A 1 67  HIS 67  148 148 HIS HIS A . n 
A 1 68  GLY 68  149 149 GLY GLY A . n 
A 1 69  PRO 69  150 150 PRO PRO A . n 
A 1 70  ASN 70  151 151 ASN ASN A . n 
A 1 71  GLN 71  152 152 GLN GLN A . n 
A 1 72  ALA 72  153 153 ALA ALA A . n 
A 1 73  HIS 73  154 154 HIS HIS A . n 
A 1 74  GLY 74  155 155 GLY GLY A . n 
A 1 75  LEU 75  156 156 LEU LEU A . n 
A 1 76  CYS 76  157 157 CYS CYS A . n 
A 1 77  PHE 77  158 158 PHE PHE A . n 
A 1 78  SER 78  159 159 SER SER A . n 
A 1 79  VAL 79  160 160 VAL VAL A . n 
A 1 80  GLN 80  161 161 GLN GLN A . n 
A 1 81  ARG 81  162 162 ARG ARG A . n 
A 1 82  PRO 82  163 163 PRO PRO A . n 
A 1 83  VAL 83  164 164 VAL VAL A . n 
A 1 84  PRO 84  165 165 PRO PRO A . n 
A 1 85  PRO 85  166 166 PRO PRO A . n 
A 1 86  PRO 86  167 167 PRO PRO A . n 
A 1 87  PRO 87  168 168 PRO PRO A . n 
A 1 88  SER 88  169 169 SER SER A . n 
A 1 89  LEU 89  170 170 LEU LEU A . n 
A 1 90  GLU 90  171 171 GLU GLU A . n 
A 1 91  ASN 91  172 172 ASN ASN A . n 
A 1 92  ILE 92  173 173 ILE ILE A . n 
A 1 93  TYR 93  174 174 TYR TYR A . n 
A 1 94  LYS 94  175 175 LYS LYS A . n 
A 1 95  GLU 95  176 176 GLU GLU A . n 
A 1 96  LEU 96  177 177 LEU LEU A . n 
A 1 97  SER 97  178 178 SER SER A . n 
A 1 98  THR 98  179 179 THR THR A . n 
A 1 99  ASP 99  180 180 ASP ASP A . n 
A 1 100 ILE 100 181 181 ILE ILE A . n 
A 1 101 GLU 101 182 182 GLU GLU A . n 
A 1 102 ASP 102 183 183 ASP ASP A . n 
A 1 103 PHE 103 184 184 PHE PHE A . n 
A 1 104 VAL 104 185 185 VAL VAL A . n 
A 1 105 HIS 105 186 186 HIS HIS A . n 
A 1 106 PRO 106 187 187 PRO PRO A . n 
A 1 107 GLY 107 188 188 GLY GLY A . n 
A 1 108 HIS 108 189 189 HIS HIS A . n 
A 1 109 GLY 109 190 190 GLY GLY A . n 
A 1 110 ASP 110 191 191 ASP ASP A . n 
A 1 111 LEU 111 192 192 LEU LEU A . n 
A 1 112 SER 112 193 193 SER SER A . n 
A 1 113 GLY 113 194 194 GLY GLY A . n 
A 1 114 TRP 114 195 195 TRP TRP A . n 
A 1 115 ALA 115 196 196 ALA ALA A . n 
A 1 116 LYS 116 197 197 LYS LYS A . n 
A 1 117 GLN 117 198 198 GLN GLN A . n 
A 1 118 GLY 118 199 199 GLY GLY A . n 
A 1 119 VAL 119 200 200 VAL VAL A . n 
A 1 120 LEU 120 201 201 LEU LEU A . n 
A 1 121 LEU 121 202 202 LEU LEU A . n 
A 1 122 LEU 122 203 203 LEU LEU A . n 
A 1 123 ASN 123 204 204 ASN ASN A . n 
A 1 124 ALA 124 205 205 ALA ALA A . n 
A 1 125 VAL 125 206 206 VAL VAL A . n 
A 1 126 LEU 126 207 207 LEU LEU A . n 
A 1 127 THR 127 208 208 THR THR A . n 
A 1 128 VAL 128 209 209 VAL VAL A . n 
A 1 129 ARG 129 210 210 ARG ARG A . n 
A 1 130 ALA 130 211 211 ALA ALA A . n 
A 1 131 HIS 131 212 212 HIS HIS A . n 
A 1 132 GLN 132 213 213 GLN GLN A . n 
A 1 133 ALA 133 214 214 ALA ALA A . n 
A 1 134 ASN 134 215 215 ASN ASN A . n 
A 1 135 SER 135 216 216 SER SER A . n 
A 1 136 HIS 136 217 217 HIS HIS A . n 
A 1 137 LYS 137 218 218 LYS LYS A . n 
A 1 138 GLU 138 219 219 GLU GLU A . n 
A 1 139 ARG 139 220 220 ARG ARG A . n 
A 1 140 GLY 140 221 221 GLY GLY A . n 
A 1 141 TRP 141 222 222 TRP TRP A . n 
A 1 142 GLU 142 223 223 GLU GLU A . n 
A 1 143 GLN 143 224 224 GLN GLN A . n 
A 1 144 PHE 144 225 225 PHE PHE A . n 
A 1 145 THR 145 226 226 THR THR A . n 
A 1 146 ASP 146 227 227 ASP ASP A . n 
A 1 147 ALA 147 228 228 ALA ALA A . n 
A 1 148 VAL 148 229 229 VAL VAL A . n 
A 1 149 VAL 149 230 230 VAL VAL A . n 
A 1 150 SER 150 231 231 SER SER A . n 
A 1 151 TRP 151 232 232 TRP TRP A . n 
A 1 152 LEU 152 233 233 LEU LEU A . n 
A 1 153 ASN 153 234 234 ASN ASN A . n 
A 1 154 GLN 154 235 235 GLN GLN A . n 
A 1 155 ASN 155 236 236 ASN ASN A . n 
A 1 156 SER 156 237 237 SER SER A . n 
A 1 157 ASN 157 238 238 ASN ASN A . n 
A 1 158 GLY 158 239 239 GLY GLY A . n 
A 1 159 LEU 159 240 240 LEU LEU A . n 
A 1 160 VAL 160 241 241 VAL VAL A . n 
A 1 161 PHE 161 242 242 PHE PHE A . n 
A 1 162 LEU 162 243 243 LEU LEU A . n 
A 1 163 LEU 163 244 244 LEU LEU A . n 
A 1 164 TRP 164 245 245 TRP TRP A . n 
A 1 165 GLY 165 246 246 GLY GLY A . n 
A 1 166 SER 166 247 247 SER SER A . n 
A 1 167 TYR 167 248 248 TYR TYR A . n 
A 1 168 ALA 168 249 249 ALA ALA A . n 
A 1 169 GLN 169 250 250 GLN GLN A . n 
A 1 170 LYS 170 251 251 LYS LYS A . n 
A 1 171 LYS 171 252 252 LYS LYS A . n 
A 1 172 GLY 172 253 253 GLY GLY A . n 
A 1 173 SER 173 254 254 SER SER A . n 
A 1 174 ALA 174 255 255 ALA ALA A . n 
A 1 175 ILE 175 256 256 ILE ILE A . n 
A 1 176 ASP 176 257 257 ASP ASP A . n 
A 1 177 ARG 177 258 258 ARG ARG A . n 
A 1 178 LYS 178 259 259 LYS LYS A . n 
A 1 179 ARG 179 260 260 ARG ARG A . n 
A 1 180 HIS 180 261 261 HIS HIS A . n 
A 1 181 HIS 181 262 262 HIS HIS A . n 
A 1 182 VAL 182 263 263 VAL VAL A . n 
A 1 183 LEU 183 264 264 LEU LEU A . n 
A 1 184 GLN 184 265 265 GLN GLN A . n 
A 1 185 THR 185 266 266 THR THR A . n 
A 1 186 ALA 186 267 267 ALA ALA A . n 
A 1 187 HIS 187 268 268 HIS HIS A . n 
A 1 188 PRO 188 269 269 PRO PRO A . n 
A 1 189 SER 189 270 270 SER SER A . n 
A 1 190 PRO 190 271 271 PRO PRO A . n 
A 1 191 LEU 191 272 272 LEU LEU A . n 
A 1 192 SER 192 273 273 SER SER A . n 
A 1 193 VAL 193 274 274 VAL VAL A . n 
A 1 194 TYR 194 275 275 TYR TYR A . n 
A 1 195 ARG 195 276 276 ARG ARG A . n 
A 1 196 GLY 196 277 277 GLY GLY A . n 
A 1 197 PHE 197 278 278 PHE PHE A . n 
A 1 198 PHE 198 279 279 PHE PHE A . n 
A 1 199 GLY 199 280 280 GLY GLY A . n 
A 1 200 CYS 200 281 281 CYS CYS A . n 
A 1 201 ARG 201 282 282 ARG ARG A . n 
A 1 202 HIS 202 283 283 HIS HIS A . n 
A 1 203 PHE 203 284 284 PHE PHE A . n 
A 1 204 SER 204 285 285 SER SER A . n 
A 1 205 LYS 205 286 286 LYS LYS A . n 
A 1 206 THR 206 287 287 THR THR A . n 
A 1 207 ASN 207 288 288 ASN ASN A . n 
A 1 208 GLU 208 289 289 GLU GLU A . n 
A 1 209 LEU 209 290 290 LEU LEU A . n 
A 1 210 LEU 210 291 291 LEU LEU A . n 
A 1 211 GLN 211 292 292 GLN GLN A . n 
A 1 212 LYS 212 293 293 LYS LYS A . n 
A 1 213 SER 213 294 294 SER SER A . n 
A 1 214 GLY 214 295 295 GLY GLY A . n 
A 1 215 LYS 215 296 296 LYS LYS A . n 
A 1 216 LYS 216 297 297 LYS LYS A . n 
A 1 217 PRO 217 298 298 PRO PRO A . n 
A 1 218 ILE 218 299 299 ILE ILE A . n 
A 1 219 ASP 219 300 300 ASP ASP A . n 
A 1 220 TRP 220 301 301 TRP TRP A . n 
A 1 221 LYS 221 302 302 LYS LYS A . n 
A 1 222 GLU 222 303 303 GLU GLU A . n 
A 1 223 LEU 223 304 304 LEU LEU A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1997-08-20 
2 'Structure model' 1 1 2008-03-04 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASES    phasing          .   ? 1 
SQUASH    phasing          .   ? 2 
XTALVIEW  refinement       .   ? 3 
X-PLOR    refinement       3.8 ? 4 
DENZO     'data reduction' .   ? 5 
SCALEPACK 'data scaling'   .   ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 144 ? ? -109.25 -71.94 
2 1 HIS A 154 ? ? -140.45 25.56  
3 1 PHE A 158 ? ? 67.34   -16.92 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   305 1   HOH HOH A . 
B 2 HOH 2   306 2   HOH HOH A . 
B 2 HOH 3   307 3   HOH HOH A . 
B 2 HOH 4   308 4   HOH HOH A . 
B 2 HOH 5   309 5   HOH HOH A . 
B 2 HOH 6   310 6   HOH HOH A . 
B 2 HOH 7   311 7   HOH HOH A . 
B 2 HOH 8   312 8   HOH HOH A . 
B 2 HOH 9   313 9   HOH HOH A . 
B 2 HOH 10  314 10  HOH HOH A . 
B 2 HOH 11  315 11  HOH HOH A . 
B 2 HOH 12  316 12  HOH HOH A . 
B 2 HOH 13  317 14  HOH HOH A . 
B 2 HOH 14  318 15  HOH HOH A . 
B 2 HOH 15  319 16  HOH HOH A . 
B 2 HOH 16  320 17  HOH HOH A . 
B 2 HOH 17  321 18  HOH HOH A . 
B 2 HOH 18  322 19  HOH HOH A . 
B 2 HOH 19  323 20  HOH HOH A . 
B 2 HOH 20  324 21  HOH HOH A . 
B 2 HOH 21  325 22  HOH HOH A . 
B 2 HOH 22  326 23  HOH HOH A . 
B 2 HOH 23  327 24  HOH HOH A . 
B 2 HOH 24  328 25  HOH HOH A . 
B 2 HOH 25  329 26  HOH HOH A . 
B 2 HOH 26  330 27  HOH HOH A . 
B 2 HOH 27  331 28  HOH HOH A . 
B 2 HOH 28  332 29  HOH HOH A . 
B 2 HOH 29  333 30  HOH HOH A . 
B 2 HOH 30  334 31  HOH HOH A . 
B 2 HOH 31  335 32  HOH HOH A . 
B 2 HOH 32  336 33  HOH HOH A . 
B 2 HOH 33  337 34  HOH HOH A . 
B 2 HOH 34  338 35  HOH HOH A . 
B 2 HOH 35  339 36  HOH HOH A . 
B 2 HOH 36  340 37  HOH HOH A . 
B 2 HOH 37  341 38  HOH HOH A . 
B 2 HOH 38  342 39  HOH HOH A . 
B 2 HOH 39  343 40  HOH HOH A . 
B 2 HOH 40  344 41  HOH HOH A . 
B 2 HOH 41  345 42  HOH HOH A . 
B 2 HOH 42  346 43  HOH HOH A . 
B 2 HOH 43  347 44  HOH HOH A . 
B 2 HOH 44  348 45  HOH HOH A . 
B 2 HOH 45  349 46  HOH HOH A . 
B 2 HOH 46  350 47  HOH HOH A . 
B 2 HOH 47  351 48  HOH HOH A . 
B 2 HOH 48  352 49  HOH HOH A . 
B 2 HOH 49  353 50  HOH HOH A . 
B 2 HOH 50  354 51  HOH HOH A . 
B 2 HOH 51  355 52  HOH HOH A . 
B 2 HOH 52  356 53  HOH HOH A . 
B 2 HOH 53  357 54  HOH HOH A . 
B 2 HOH 54  358 55  HOH HOH A . 
B 2 HOH 55  359 56  HOH HOH A . 
B 2 HOH 56  360 57  HOH HOH A . 
B 2 HOH 57  361 58  HOH HOH A . 
B 2 HOH 58  362 59  HOH HOH A . 
B 2 HOH 59  363 60  HOH HOH A . 
B 2 HOH 60  364 61  HOH HOH A . 
B 2 HOH 61  365 62  HOH HOH A . 
B 2 HOH 62  366 63  HOH HOH A . 
B 2 HOH 63  367 64  HOH HOH A . 
B 2 HOH 64  368 65  HOH HOH A . 
B 2 HOH 65  369 66  HOH HOH A . 
B 2 HOH 66  370 67  HOH HOH A . 
B 2 HOH 67  371 68  HOH HOH A . 
B 2 HOH 68  372 69  HOH HOH A . 
B 2 HOH 69  373 70  HOH HOH A . 
B 2 HOH 70  374 71  HOH HOH A . 
B 2 HOH 71  375 72  HOH HOH A . 
B 2 HOH 72  376 73  HOH HOH A . 
B 2 HOH 73  377 74  HOH HOH A . 
B 2 HOH 74  378 75  HOH HOH A . 
B 2 HOH 75  379 76  HOH HOH A . 
B 2 HOH 76  380 77  HOH HOH A . 
B 2 HOH 77  381 78  HOH HOH A . 
B 2 HOH 78  382 79  HOH HOH A . 
B 2 HOH 79  383 80  HOH HOH A . 
B 2 HOH 80  384 81  HOH HOH A . 
B 2 HOH 81  385 82  HOH HOH A . 
B 2 HOH 82  386 83  HOH HOH A . 
B 2 HOH 83  387 84  HOH HOH A . 
B 2 HOH 84  388 85  HOH HOH A . 
B 2 HOH 85  389 86  HOH HOH A . 
B 2 HOH 86  390 87  HOH HOH A . 
B 2 HOH 87  391 88  HOH HOH A . 
B 2 HOH 88  392 89  HOH HOH A . 
B 2 HOH 89  393 90  HOH HOH A . 
B 2 HOH 90  394 91  HOH HOH A . 
B 2 HOH 91  395 92  HOH HOH A . 
B 2 HOH 92  396 93  HOH HOH A . 
B 2 HOH 93  397 94  HOH HOH A . 
B 2 HOH 94  398 95  HOH HOH A . 
B 2 HOH 95  399 96  HOH HOH A . 
B 2 HOH 96  400 97  HOH HOH A . 
B 2 HOH 97  401 98  HOH HOH A . 
B 2 HOH 98  402 99  HOH HOH A . 
B 2 HOH 99  403 100 HOH HOH A . 
B 2 HOH 100 404 101 HOH HOH A . 
B 2 HOH 101 405 102 HOH HOH A . 
B 2 HOH 102 406 103 HOH HOH A . 
B 2 HOH 103 407 104 HOH HOH A . 
B 2 HOH 104 408 105 HOH HOH A . 
B 2 HOH 105 409 106 HOH HOH A . 
B 2 HOH 106 410 107 HOH HOH A . 
B 2 HOH 107 411 108 HOH HOH A . 
B 2 HOH 108 412 109 HOH HOH A . 
B 2 HOH 109 413 110 HOH HOH A . 
B 2 HOH 110 414 111 HOH HOH A . 
B 2 HOH 111 415 112 HOH HOH A . 
B 2 HOH 112 416 113 HOH HOH A . 
B 2 HOH 113 417 114 HOH HOH A . 
B 2 HOH 114 418 115 HOH HOH A . 
B 2 HOH 115 419 116 HOH HOH A . 
B 2 HOH 116 420 117 HOH HOH A . 
B 2 HOH 117 421 118 HOH HOH A . 
B 2 HOH 118 422 119 HOH HOH A . 
B 2 HOH 119 423 120 HOH HOH A . 
B 2 HOH 120 424 121 HOH HOH A . 
B 2 HOH 121 425 122 HOH HOH A . 
B 2 HOH 122 426 123 HOH HOH A . 
B 2 HOH 123 427 124 HOH HOH A . 
B 2 HOH 124 428 125 HOH HOH A . 
B 2 HOH 125 429 126 HOH HOH A . 
B 2 HOH 126 430 127 HOH HOH A . 
B 2 HOH 127 431 128 HOH HOH A . 
B 2 HOH 128 432 129 HOH HOH A . 
B 2 HOH 129 433 130 HOH HOH A . 
B 2 HOH 130 434 131 HOH HOH A . 
B 2 HOH 131 435 132 HOH HOH A . 
B 2 HOH 132 436 133 HOH HOH A . 
B 2 HOH 133 437 134 HOH HOH A . 
B 2 HOH 134 438 135 HOH HOH A . 
B 2 HOH 135 439 136 HOH HOH A . 
B 2 HOH 136 440 137 HOH HOH A . 
B 2 HOH 137 441 138 HOH HOH A . 
B 2 HOH 138 442 139 HOH HOH A . 
B 2 HOH 139 443 140 HOH HOH A . 
B 2 HOH 140 444 141 HOH HOH A . 
B 2 HOH 141 445 142 HOH HOH A . 
B 2 HOH 142 446 143 HOH HOH A . 
B 2 HOH 143 447 144 HOH HOH A . 
B 2 HOH 144 448 145 HOH HOH A . 
B 2 HOH 145 449 146 HOH HOH A . 
B 2 HOH 146 450 147 HOH HOH A . 
B 2 HOH 147 451 148 HOH HOH A . 
B 2 HOH 148 452 149 HOH HOH A . 
B 2 HOH 149 453 150 HOH HOH A . 
B 2 HOH 150 454 151 HOH HOH A . 
B 2 HOH 151 455 152 HOH HOH A . 
B 2 HOH 152 456 153 HOH HOH A . 
B 2 HOH 153 457 154 HOH HOH A . 
B 2 HOH 154 458 155 HOH HOH A . 
B 2 HOH 155 459 156 HOH HOH A . 
B 2 HOH 156 460 157 HOH HOH A . 
B 2 HOH 157 461 158 HOH HOH A . 
B 2 HOH 158 462 159 HOH HOH A . 
B 2 HOH 159 463 160 HOH HOH A . 
B 2 HOH 160 464 161 HOH HOH A . 
B 2 HOH 161 465 162 HOH HOH A . 
B 2 HOH 162 466 163 HOH HOH A . 
B 2 HOH 163 467 164 HOH HOH A . 
B 2 HOH 164 468 165 HOH HOH A . 
B 2 HOH 165 469 166 HOH HOH A . 
B 2 HOH 166 470 167 HOH HOH A . 
B 2 HOH 167 471 168 HOH HOH A . 
B 2 HOH 168 472 169 HOH HOH A . 
B 2 HOH 169 473 170 HOH HOH A . 
B 2 HOH 170 474 171 HOH HOH A . 
B 2 HOH 171 475 172 HOH HOH A . 
B 2 HOH 172 476 173 HOH HOH A . 
B 2 HOH 173 477 174 HOH HOH A . 
B 2 HOH 174 478 175 HOH HOH A . 
B 2 HOH 175 479 176 HOH HOH A . 
B 2 HOH 176 480 177 HOH HOH A . 
B 2 HOH 177 481 178 HOH HOH A . 
B 2 HOH 178 482 179 HOH HOH A . 
B 2 HOH 179 483 180 HOH HOH A . 
B 2 HOH 180 484 181 HOH HOH A . 
B 2 HOH 181 485 182 HOH HOH A . 
B 2 HOH 182 486 183 HOH HOH A . 
B 2 HOH 183 487 184 HOH HOH A . 
B 2 HOH 184 488 185 HOH HOH A . 
B 2 HOH 185 489 186 HOH HOH A . 
#