data_1AN7
# 
_entry.id   1AN7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AN7         
WWPDB D_1000171024 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AN7 
_pdbx_database_status.recvd_initial_deposition_date   1997-06-27 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nevskaya, N.'     1 
'Nikonov, S.'      2 
'Al-Karadaghi, S.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structure of ribosomal protein S8 from Thermus thermophilus reveals a high degree of structural conservation of a specific RNA binding site.
;
J.Mol.Biol. 279 233 244 1998 JMOBAK UK 0022-2836 0070 ? 9636713 10.1006/jmbi.1998.1758 
1       'Crystallization and Preliminary Crystallographic Analysis of Ribosomal Protein S8 from Thermus Thermophilus' Proteins    
27  309 ?   1997 PSFGEY US 0887-3585 0867 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nevskaya, N.'     1  
primary 'Tishchenko, S.'   2  
primary 'Nikulin, A.'      3  
primary 'al-Karadaghi, S.' 4  
primary 'Liljas, A.'       5  
primary 'Ehresmann, B.'    6  
primary 'Ehresmann, C.'    7  
primary 'Garber, M.'       8  
primary 'Nikonov, S.'      9  
1       'Tishchenko, S.V.' 10 
1       'Vysotskaya, V.S.' 11 
1       'Fomenkova, N.P.'  12 
1       'Nikonov, S.V.'    13 
1       'Ehresmann, B.'    14 
1       'Garber, M.B.'     15 
# 
_cell.entry_id           1AN7 
_cell.length_a           67.860 
_cell.length_b           67.860 
_cell.length_c           174.090 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AN7 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'RIBOSOMAL PROTEIN S8' 
_entity.formula_weight             15624.214 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHH
IRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHH
IRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   ASP n 
1 3   PRO n 
1 4   ILE n 
1 5   ALA n 
1 6   ASP n 
1 7   MET n 
1 8   LEU n 
1 9   THR n 
1 10  ARG n 
1 11  ILE n 
1 12  ARG n 
1 13  ASN n 
1 14  ALA n 
1 15  THR n 
1 16  ARG n 
1 17  VAL n 
1 18  TYR n 
1 19  LYS n 
1 20  GLU n 
1 21  SER n 
1 22  THR n 
1 23  ASP n 
1 24  VAL n 
1 25  PRO n 
1 26  ALA n 
1 27  SER n 
1 28  ARG n 
1 29  PHE n 
1 30  LYS n 
1 31  GLU n 
1 32  GLU n 
1 33  ILE n 
1 34  LEU n 
1 35  ARG n 
1 36  ILE n 
1 37  LEU n 
1 38  ALA n 
1 39  ARG n 
1 40  GLU n 
1 41  GLY n 
1 42  PHE n 
1 43  ILE n 
1 44  LYS n 
1 45  GLY n 
1 46  TYR n 
1 47  GLU n 
1 48  ARG n 
1 49  VAL n 
1 50  ASP n 
1 51  VAL n 
1 52  ASP n 
1 53  GLY n 
1 54  LYS n 
1 55  PRO n 
1 56  TYR n 
1 57  LEU n 
1 58  ARG n 
1 59  VAL n 
1 60  TYR n 
1 61  LEU n 
1 62  LYS n 
1 63  TYR n 
1 64  GLY n 
1 65  PRO n 
1 66  ARG n 
1 67  ARG n 
1 68  GLN n 
1 69  GLY n 
1 70  PRO n 
1 71  ASP n 
1 72  PRO n 
1 73  ARG n 
1 74  PRO n 
1 75  GLU n 
1 76  GLN n 
1 77  VAL n 
1 78  ILE n 
1 79  HIS n 
1 80  HIS n 
1 81  ILE n 
1 82  ARG n 
1 83  ARG n 
1 84  ILE n 
1 85  SER n 
1 86  LYS n 
1 87  PRO n 
1 88  GLY n 
1 89  ARG n 
1 90  ARG n 
1 91  VAL n 
1 92  TYR n 
1 93  VAL n 
1 94  GLY n 
1 95  VAL n 
1 96  LYS n 
1 97  GLU n 
1 98  ILE n 
1 99  PRO n 
1 100 ARG n 
1 101 VAL n 
1 102 ARG n 
1 103 ARG n 
1 104 GLY n 
1 105 LEU n 
1 106 GLY n 
1 107 ILE n 
1 108 ALA n 
1 109 ILE n 
1 110 LEU n 
1 111 SER n 
1 112 THR n 
1 113 SER n 
1 114 LYS n 
1 115 GLY n 
1 116 VAL n 
1 117 LEU n 
1 118 THR n 
1 119 ASP n 
1 120 ARG n 
1 121 GLU n 
1 122 ALA n 
1 123 ARG n 
1 124 LYS n 
1 125 LEU n 
1 126 GLY n 
1 127 VAL n 
1 128 GLY n 
1 129 GLY n 
1 130 GLU n 
1 131 LEU n 
1 132 ILE n 
1 133 CYS n 
1 134 GLU n 
1 135 VAL n 
1 136 TRP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermus 
_entity_src_gen.pdbx_gene_src_gene                 RPS8 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    VK1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermus thermophilus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 'ATCC 27634' 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET-TTHS8 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RS8_THETH 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P24319 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPDPRPEQVI
HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AN7 A 1 ? 136 ? P24319 3 ? 138 ? 3 138 
2 1 1AN7 B 1 ? 136 ? P24319 3 ? 138 ? 3 138 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AN7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.21 
_exptl_crystal.density_percent_sol   60. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   1996-02-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AN7 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   8932 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            0.0510000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        33.6 
_reflns.pdbx_redundancy              3.6 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   93.6 
_reflns_shell.Rmerge_I_obs           0.0190000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.2 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AN7 
_refine.ls_number_reflns_obs                     8932 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1620000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1620000 
_refine.ls_R_factor_R_free                       0.2750000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  871 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.0 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2200 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2200 
_refine_hist.d_res_high                       2.9 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.016 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             3.477 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.29 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.432 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM19X.PRO TOPH19X.PRO 'X-RAY DIFFRACTION' 
2 ?            ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   -0.892800 
_struct_ncs_oper.matrix[1][2]   0.084200 
_struct_ncs_oper.matrix[1][3]   -0.442500 
_struct_ncs_oper.matrix[2][1]   0.136800 
_struct_ncs_oper.matrix[2][2]   -0.885200 
_struct_ncs_oper.matrix[2][3]   -0.444600 
_struct_ncs_oper.matrix[3][1]   -0.429200 
_struct_ncs_oper.matrix[3][2]   -0.457500 
_struct_ncs_oper.matrix[3][3]   0.778800 
_struct_ncs_oper.vector[1]      84.16170 
_struct_ncs_oper.vector[2]      74.86390 
_struct_ncs_oper.vector[3]      39.39390 
# 
_struct.entry_id                  1AN7 
_struct.title                     'RIBOSOMAL PROTEIN S8 FROM THERMUS THERMOPHILUS' 
_struct.pdbx_descriptor           'RIBOSOMAL PROTEIN S8' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AN7 
_struct_keywords.pdbx_keywords   'RIBOSOMAL PROTEIN' 
_struct_keywords.text            'RIBOSOMAL PROTEIN, RRNA-PROTEIN BINDING, PROTEIN-PROTEIN BINDING, THERMUS THERMOPHILUS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 3   ? VAL A 17  ? PRO A 5   VAL A 19  1 ? 15 
HELX_P HELX_P2  2  ARG A 28  ? ARG A 39  ? ARG A 30  ARG A 41  1 ? 12 
HELX_P HELX_P3  3  VAL A 95  ? GLU A 97  ? VAL A 97  GLU A 99  5 ? 3  
HELX_P HELX_P4  4  VAL A 101 ? GLY A 104 ? VAL A 103 GLY A 106 5 ? 4  
HELX_P HELX_P5  5  ASP A 119 ? LEU A 125 ? ASP A 121 LEU A 127 1 ? 7  
HELX_P HELX_P6  6  PRO B 3   ? VAL B 17  ? PRO B 5   VAL B 19  1 ? 15 
HELX_P HELX_P7  7  ARG B 28  ? ARG B 39  ? ARG B 30  ARG B 41  1 ? 12 
HELX_P HELX_P8  8  VAL B 95  ? GLU B 97  ? VAL B 97  GLU B 99  5 ? 3  
HELX_P HELX_P9  9  ARG B 102 ? GLY B 104 ? ARG B 104 GLY B 106 5 ? 3  
HELX_P HELX_P10 10 ASP B 119 ? LYS B 124 ? ASP B 121 LYS B 126 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 21  ? PRO A 25  ? SER A 23  PRO A 27  
A 2 LYS A 54  ? LEU A 61  ? LYS A 56  LEU A 63  
A 3 ILE A 43  ? VAL A 51  ? ILE A 45  VAL A 53  
B 1 ILE A 81  ? ARG A 83  ? ILE A 83  ARG A 85  
B 2 GLY A 129 ? VAL A 135 ? GLY A 131 VAL A 137 
B 3 ILE A 107 ? THR A 112 ? ILE A 109 THR A 114 
B 4 GLY A 115 ? THR A 118 ? GLY A 117 THR A 120 
C 1 SER B 21  ? PRO B 25  ? SER B 23  PRO B 27  
C 2 PRO B 55  ? LEU B 61  ? PRO B 57  LEU B 63  
C 3 ILE B 43  ? ASP B 50  ? ILE B 45  ASP B 52  
D 1 ILE B 81  ? ARG B 83  ? ILE B 83  ARG B 85  
D 2 GLY B 129 ? VAL B 135 ? GLY B 131 VAL B 137 
D 3 ILE B 107 ? THR B 112 ? ILE B 109 THR B 114 
D 4 GLY B 115 ? THR B 118 ? GLY B 117 THR B 120 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 22  ? O THR A 24  N VAL A 59  ? N VAL A 61  
A 2 3 O LYS A 54  ? O LYS A 56  N VAL A 51  ? N VAL A 53  
B 1 2 O ARG A 82  ? O ARG A 84  N GLU A 134 ? N GLU A 136 
B 2 3 O GLU A 130 ? O GLU A 132 N SER A 111 ? N SER A 113 
B 3 4 O LEU A 110 ? O LEU A 112 N LEU A 117 ? N LEU A 119 
C 1 2 O THR B 22  ? O THR B 24  N VAL B 59  ? N VAL B 61  
C 2 3 O TYR B 56  ? O TYR B 58  N VAL B 49  ? N VAL B 51  
D 1 2 O ARG B 82  ? O ARG B 84  N GLU B 134 ? N GLU B 136 
D 2 3 O GLU B 130 ? O GLU B 132 N SER B 111 ? N SER B 113 
D 3 4 O LEU B 110 ? O LEU B 112 N LEU B 117 ? N LEU B 119 
# 
_database_PDB_matrix.entry_id          1AN7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AN7 
_atom_sites.fract_transf_matrix[1][1]   0.014736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014736 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . THR A 1 1   ? 21.199 55.716 57.876 1.00 97.33  ? 3   THR A N   1 
ATOM 2    C CA  . THR A 1 1   ? 22.502 55.123 57.701 1.00 90.68  ? 3   THR A CA  1 
ATOM 3    C C   . THR A 1 1   ? 22.528 54.043 58.763 1.00 79.29  ? 3   THR A C   1 
ATOM 4    O O   . THR A 1 1   ? 21.858 54.204 59.790 1.00 84.43  ? 3   THR A O   1 
ATOM 5    C CB  . THR A 1 1   ? 23.566 56.186 57.990 1.00 100.03 ? 3   THR A CB  1 
ATOM 6    O OG1 . THR A 1 1   ? 22.973 57.412 57.553 1.00 112.06 ? 3   THR A OG1 1 
ATOM 7    C CG2 . THR A 1 1   ? 24.926 55.885 57.348 1.00 105.19 ? 3   THR A CG2 1 
ATOM 8    N N   . ASP A 1 2   ? 23.243 52.961 58.541 1.00 53.05  ? 4   ASP A N   1 
ATOM 9    C CA  . ASP A 1 2   ? 23.410 52.022 59.601 1.00 35.73  ? 4   ASP A CA  1 
ATOM 10   C C   . ASP A 1 2   ? 24.907 51.835 59.563 1.00 36.87  ? 4   ASP A C   1 
ATOM 11   O O   . ASP A 1 2   ? 25.392 50.985 58.818 1.00 43.09  ? 4   ASP A O   1 
ATOM 12   C CB  . ASP A 1 2   ? 22.691 50.759 59.261 1.00 43.16  ? 4   ASP A CB  1 
ATOM 13   C CG  . ASP A 1 2   ? 22.770 49.620 60.262 1.00 43.38  ? 4   ASP A CG  1 
ATOM 14   O OD1 . ASP A 1 2   ? 23.589 49.634 61.182 1.00 38.47  ? 4   ASP A OD1 1 
ATOM 15   O OD2 . ASP A 1 2   ? 21.983 48.692 60.088 1.00 50.51  ? 4   ASP A OD2 1 
ATOM 16   N N   . PRO A 1 3   ? 25.681 52.596 60.336 1.00 31.34  ? 5   PRO A N   1 
ATOM 17   C CA  . PRO A 1 3   ? 27.118 52.399 60.565 1.00 32.27  ? 5   PRO A CA  1 
ATOM 18   C C   . PRO A 1 3   ? 27.620 50.972 60.780 1.00 27.84  ? 5   PRO A C   1 
ATOM 19   O O   . PRO A 1 3   ? 28.566 50.530 60.116 1.00 26.74  ? 5   PRO A O   1 
ATOM 20   C CB  . PRO A 1 3   ? 27.416 53.275 61.745 1.00 35.22  ? 5   PRO A CB  1 
ATOM 21   C CG  . PRO A 1 3   ? 26.081 53.376 62.449 1.00 43.37  ? 5   PRO A CG  1 
ATOM 22   C CD  . PRO A 1 3   ? 25.173 53.596 61.249 1.00 24.17  ? 5   PRO A CD  1 
ATOM 23   N N   . ILE A 1 4   ? 26.948 50.262 61.696 1.00 14.31  ? 6   ILE A N   1 
ATOM 24   C CA  . ILE A 1 4   ? 27.264 48.882 61.989 1.00 11.08  ? 6   ILE A CA  1 
ATOM 25   C C   . ILE A 1 4   ? 27.097 48.045 60.736 1.00 11.01  ? 6   ILE A C   1 
ATOM 26   O O   . ILE A 1 4   ? 28.011 47.311 60.410 1.00 24.78  ? 6   ILE A O   1 
ATOM 27   C CB  . ILE A 1 4   ? 26.356 48.410 63.118 1.00 16.25  ? 6   ILE A CB  1 
ATOM 28   C CG1 . ILE A 1 4   ? 26.459 49.403 64.258 1.00 4.27   ? 6   ILE A CG1 1 
ATOM 29   C CG2 . ILE A 1 4   ? 26.769 47.023 63.623 1.00 10.50  ? 6   ILE A CG2 1 
ATOM 30   C CD1 . ILE A 1 4   ? 27.881 49.552 64.810 1.00 22.84  ? 6   ILE A CD1 1 
ATOM 31   N N   . ALA A 1 5   ? 26.069 48.155 59.910 1.00 17.17  ? 7   ALA A N   1 
ATOM 32   C CA  . ALA A 1 5   ? 26.004 47.332 58.703 1.00 18.44  ? 7   ALA A CA  1 
ATOM 33   C C   . ALA A 1 5   ? 27.082 47.704 57.751 1.00 18.96  ? 7   ALA A C   1 
ATOM 34   O O   . ALA A 1 5   ? 27.615 46.836 57.060 1.00 30.14  ? 7   ALA A O   1 
ATOM 35   C CB  . ALA A 1 5   ? 24.766 47.494 57.860 1.00 20.23  ? 7   ALA A CB  1 
ATOM 36   N N   . ASP A 1 6   ? 27.377 49.001 57.735 1.00 25.46  ? 8   ASP A N   1 
ATOM 37   C CA  . ASP A 1 6   ? 28.397 49.493 56.859 1.00 22.87  ? 8   ASP A CA  1 
ATOM 38   C C   . ASP A 1 6   ? 29.770 49.009 57.303 1.00 21.42  ? 8   ASP A C   1 
ATOM 39   O O   . ASP A 1 6   ? 30.596 48.715 56.439 1.00 25.25  ? 8   ASP A O   1 
ATOM 40   C CB  . ASP A 1 6   ? 28.339 50.987 56.820 1.00 21.71  ? 8   ASP A CB  1 
ATOM 41   C CG  . ASP A 1 6   ? 29.522 51.470 56.009 1.00 56.51  ? 8   ASP A CG  1 
ATOM 42   O OD1 . ASP A 1 6   ? 29.490 51.345 54.778 1.00 68.34  ? 8   ASP A OD1 1 
ATOM 43   O OD2 . ASP A 1 6   ? 30.502 51.901 56.633 1.00 80.55  ? 8   ASP A OD2 1 
ATOM 44   N N   . MET A 1 7   ? 30.083 48.868 58.578 1.00 19.93  ? 9   MET A N   1 
ATOM 45   C CA  . MET A 1 7   ? 31.338 48.264 58.989 1.00 13.44  ? 9   MET A CA  1 
ATOM 46   C C   . MET A 1 7   ? 31.423 46.812 58.495 1.00 24.98  ? 9   MET A C   1 
ATOM 47   O O   . MET A 1 7   ? 32.410 46.469 57.824 1.00 27.44  ? 9   MET A O   1 
ATOM 48   C CB  . MET A 1 7   ? 31.424 48.288 60.498 1.00 11.92  ? 9   MET A CB  1 
ATOM 49   C CG  . MET A 1 7   ? 32.678 47.636 61.055 1.00 14.42  ? 9   MET A CG  1 
ATOM 50   S SD  . MET A 1 7   ? 32.795 47.754 62.844 1.00 22.46  ? 9   MET A SD  1 
ATOM 51   C CE  . MET A 1 7   ? 31.379 46.875 63.450 1.00 14.25  ? 9   MET A CE  1 
ATOM 52   N N   . LEU A 1 8   ? 30.386 45.976 58.791 1.00 20.81  ? 10  LEU A N   1 
ATOM 53   C CA  . LEU A 1 8   ? 30.334 44.542 58.485 1.00 2.00   ? 10  LEU A CA  1 
ATOM 54   C C   . LEU A 1 8   ? 30.414 44.239 57.015 1.00 6.90   ? 10  LEU A C   1 
ATOM 55   O O   . LEU A 1 8   ? 31.019 43.253 56.618 1.00 7.70   ? 10  LEU A O   1 
ATOM 56   C CB  . LEU A 1 8   ? 29.075 43.923 59.002 1.00 2.10   ? 10  LEU A CB  1 
ATOM 57   C CG  . LEU A 1 8   ? 28.701 44.161 60.497 1.00 17.08  ? 10  LEU A CG  1 
ATOM 58   C CD1 . LEU A 1 8   ? 27.399 43.383 60.819 1.00 2.07   ? 10  LEU A CD1 1 
ATOM 59   C CD2 . LEU A 1 8   ? 29.890 43.799 61.405 1.00 2.07   ? 10  LEU A CD2 1 
ATOM 60   N N   . THR A 1 9   ? 29.845 45.086 56.187 1.00 17.12  ? 11  THR A N   1 
ATOM 61   C CA  . THR A 1 9   ? 30.021 44.997 54.759 1.00 20.85  ? 11  THR A CA  1 
ATOM 62   C C   . THR A 1 9   ? 31.460 45.345 54.476 1.00 17.62  ? 11  THR A C   1 
ATOM 63   O O   . THR A 1 9   ? 32.081 44.560 53.766 1.00 34.00  ? 11  THR A O   1 
ATOM 64   C CB  . THR A 1 9   ? 29.077 45.989 54.055 1.00 31.49  ? 11  THR A CB  1 
ATOM 65   O OG1 . THR A 1 9   ? 27.765 45.447 54.236 1.00 37.71  ? 11  THR A OG1 1 
ATOM 66   C CG2 . THR A 1 9   ? 29.423 46.239 52.596 1.00 12.45  ? 11  THR A CG2 1 
ATOM 67   N N   . ARG A 1 10  ? 32.049 46.433 54.993 1.00 12.27  ? 12  ARG A N   1 
ATOM 68   C CA  . ARG A 1 10  ? 33.449 46.762 54.704 1.00 9.57   ? 12  ARG A CA  1 
ATOM 69   C C   . ARG A 1 10  ? 34.390 45.645 55.053 1.00 5.72   ? 12  ARG A C   1 
ATOM 70   O O   . ARG A 1 10  ? 35.256 45.368 54.238 1.00 14.69  ? 12  ARG A O   1 
ATOM 71   C CB  . ARG A 1 10  ? 33.934 47.964 55.455 1.00 18.40  ? 12  ARG A CB  1 
ATOM 72   C CG  . ARG A 1 10  ? 33.504 49.229 54.746 1.00 40.05  ? 12  ARG A CG  1 
ATOM 73   C CD  . ARG A 1 10  ? 34.040 50.432 55.469 1.00 53.22  ? 12  ARG A CD  1 
ATOM 74   N NE  . ARG A 1 10  ? 33.918 51.601 54.622 1.00 79.72  ? 12  ARG A NE  1 
ATOM 75   C CZ  . ARG A 1 10  ? 33.762 52.827 55.132 1.00 93.06  ? 12  ARG A CZ  1 
ATOM 76   N NH1 . ARG A 1 10  ? 33.698 53.054 56.439 1.00 94.20  ? 12  ARG A NH1 1 
ATOM 77   N NH2 . ARG A 1 10  ? 33.693 53.875 54.316 1.00 109.08 ? 12  ARG A NH2 1 
ATOM 78   N N   . ILE A 1 11  ? 34.188 44.983 56.187 1.00 4.52   ? 13  ILE A N   1 
ATOM 79   C CA  . ILE A 1 11  ? 34.933 43.811 56.587 1.00 3.12   ? 13  ILE A CA  1 
ATOM 80   C C   . ILE A 1 11  ? 34.709 42.657 55.601 1.00 12.31  ? 13  ILE A C   1 
ATOM 81   O O   . ILE A 1 11  ? 35.681 42.237 54.963 1.00 31.79  ? 13  ILE A O   1 
ATOM 82   C CB  . ILE A 1 11  ? 34.515 43.395 58.036 1.00 5.70   ? 13  ILE A CB  1 
ATOM 83   C CG1 . ILE A 1 11  ? 35.103 44.329 59.105 1.00 2.12   ? 13  ILE A CG1 1 
ATOM 84   C CG2 . ILE A 1 11  ? 35.003 41.986 58.294 1.00 2.04   ? 13  ILE A CG2 1 
ATOM 85   C CD1 . ILE A 1 11  ? 34.798 43.858 60.566 1.00 2.00   ? 13  ILE A CD1 1 
ATOM 86   N N   . ARG A 1 12  ? 33.509 42.093 55.418 1.00 16.41  ? 14  ARG A N   1 
ATOM 87   C CA  . ARG A 1 12  ? 33.226 40.984 54.494 1.00 3.43   ? 14  ARG A CA  1 
ATOM 88   C C   . ARG A 1 12  ? 33.812 41.286 53.122 1.00 10.86  ? 14  ARG A C   1 
ATOM 89   O O   . ARG A 1 12  ? 34.542 40.470 52.561 1.00 19.07  ? 14  ARG A O   1 
ATOM 90   C CB  . ARG A 1 12  ? 31.743 40.850 54.419 1.00 9.31   ? 14  ARG A CB  1 
ATOM 91   C CG  . ARG A 1 12  ? 31.075 39.775 53.586 1.00 32.71  ? 14  ARG A CG  1 
ATOM 92   C CD  . ARG A 1 12  ? 29.746 40.330 53.016 1.00 36.29  ? 14  ARG A CD  1 
ATOM 93   N NE  . ARG A 1 12  ? 28.772 40.641 54.057 1.00 58.14  ? 14  ARG A NE  1 
ATOM 94   C CZ  . ARG A 1 12  ? 27.964 41.712 54.034 1.00 53.45  ? 14  ARG A CZ  1 
ATOM 95   N NH1 . ARG A 1 12  ? 27.970 42.608 53.033 1.00 49.99  ? 14  ARG A NH1 1 
ATOM 96   N NH2 . ARG A 1 12  ? 27.163 41.893 55.085 1.00 44.12  ? 14  ARG A NH2 1 
ATOM 97   N N   . ASN A 1 13  ? 33.641 42.496 52.595 1.00 10.33  ? 15  ASN A N   1 
ATOM 98   C CA  . ASN A 1 13  ? 34.208 42.821 51.292 1.00 14.26  ? 15  ASN A CA  1 
ATOM 99   C C   . ASN A 1 13  ? 35.699 42.852 51.204 1.00 16.63  ? 15  ASN A C   1 
ATOM 100  O O   . ASN A 1 13  ? 36.235 42.509 50.156 1.00 20.65  ? 15  ASN A O   1 
ATOM 101  C CB  . ASN A 1 13  ? 33.797 44.138 50.795 1.00 19.44  ? 15  ASN A CB  1 
ATOM 102  C CG  . ASN A 1 13  ? 32.383 44.109 50.310 1.00 32.48  ? 15  ASN A CG  1 
ATOM 103  O OD1 . ASN A 1 13  ? 31.731 43.071 50.209 1.00 42.41  ? 15  ASN A OD1 1 
ATOM 104  N ND2 . ASN A 1 13  ? 31.872 45.288 49.987 1.00 53.02  ? 15  ASN A ND2 1 
ATOM 105  N N   . ALA A 1 14  ? 36.397 43.266 52.257 1.00 19.06  ? 16  ALA A N   1 
ATOM 106  C CA  . ALA A 1 14  ? 37.838 43.199 52.240 1.00 21.31  ? 16  ALA A CA  1 
ATOM 107  C C   . ALA A 1 14  ? 38.229 41.718 52.274 1.00 21.96  ? 16  ALA A C   1 
ATOM 108  O O   . ALA A 1 14  ? 39.126 41.356 51.493 1.00 19.63  ? 16  ALA A O   1 
ATOM 109  C CB  . ALA A 1 14  ? 38.453 43.893 53.454 1.00 19.64  ? 16  ALA A CB  1 
ATOM 110  N N   . THR A 1 15  ? 37.579 40.792 53.016 1.00 14.52  ? 17  THR A N   1 
ATOM 111  C CA  . THR A 1 15  ? 38.062 39.403 53.004 1.00 14.80  ? 17  THR A CA  1 
ATOM 112  C C   . THR A 1 15  ? 37.877 38.758 51.654 1.00 7.20   ? 17  THR A C   1 
ATOM 113  O O   . THR A 1 15  ? 38.754 38.047 51.160 1.00 9.51   ? 17  THR A O   1 
ATOM 114  C CB  . THR A 1 15  ? 37.378 38.482 54.042 1.00 8.52   ? 17  THR A CB  1 
ATOM 115  O OG1 . THR A 1 15  ? 36.016 38.403 53.704 1.00 18.72  ? 17  THR A OG1 1 
ATOM 116  C CG2 . THR A 1 15  ? 37.495 39.007 55.465 1.00 5.80   ? 17  THR A CG2 1 
ATOM 117  N N   . ARG A 1 16  ? 36.796 39.111 50.983 1.00 8.44   ? 18  ARG A N   1 
ATOM 118  C CA  . ARG A 1 16  ? 36.542 38.551 49.682 1.00 12.88  ? 18  ARG A CA  1 
ATOM 119  C C   . ARG A 1 16  ? 37.614 38.941 48.717 1.00 11.52  ? 18  ARG A C   1 
ATOM 120  O O   . ARG A 1 16  ? 37.721 38.319 47.678 1.00 25.59  ? 18  ARG A O   1 
ATOM 121  C CB  . ARG A 1 16  ? 35.159 38.986 49.147 1.00 18.04  ? 18  ARG A CB  1 
ATOM 122  C CG  . ARG A 1 16  ? 34.077 37.937 49.514 1.00 35.07  ? 18  ARG A CG  1 
ATOM 123  C CD  . ARG A 1 16  ? 34.149 37.508 51.000 1.00 63.14  ? 18  ARG A CD  1 
ATOM 124  N NE  . ARG A 1 16  ? 33.509 36.245 51.365 1.00 86.37  ? 18  ARG A NE  1 
ATOM 125  C CZ  . ARG A 1 16  ? 33.617 35.691 52.591 1.00 91.21  ? 18  ARG A CZ  1 
ATOM 126  N NH1 . ARG A 1 16  ? 34.320 36.243 53.574 1.00 83.05  ? 18  ARG A NH1 1 
ATOM 127  N NH2 . ARG A 1 16  ? 32.954 34.572 52.870 1.00 101.41 ? 18  ARG A NH2 1 
ATOM 128  N N   . VAL A 1 17  ? 38.463 39.907 48.972 1.00 6.97   ? 19  VAL A N   1 
ATOM 129  C CA  . VAL A 1 17  ? 39.501 40.164 48.000 1.00 12.84  ? 19  VAL A CA  1 
ATOM 130  C C   . VAL A 1 17  ? 40.855 40.076 48.676 1.00 19.01  ? 19  VAL A C   1 
ATOM 131  O O   . VAL A 1 17  ? 41.782 40.792 48.316 1.00 21.09  ? 19  VAL A O   1 
ATOM 132  C CB  . VAL A 1 17  ? 39.284 41.559 47.343 1.00 8.04   ? 19  VAL A CB  1 
ATOM 133  C CG1 . VAL A 1 17  ? 38.188 41.455 46.336 1.00 13.57  ? 19  VAL A CG1 1 
ATOM 134  C CG2 . VAL A 1 17  ? 38.817 42.598 48.312 1.00 18.55  ? 19  VAL A CG2 1 
ATOM 135  N N   . TYR A 1 18  ? 40.924 39.200 49.689 1.00 17.82  ? 20  TYR A N   1 
ATOM 136  C CA  . TYR A 1 18  ? 42.111 38.905 50.491 1.00 14.83  ? 20  TYR A CA  1 
ATOM 137  C C   . TYR A 1 18  ? 43.017 40.064 50.976 1.00 18.49  ? 20  TYR A C   1 
ATOM 138  O O   . TYR A 1 18  ? 44.254 39.955 50.995 1.00 34.28  ? 20  TYR A O   1 
ATOM 139  C CB  . TYR A 1 18  ? 42.941 37.863 49.705 1.00 3.52   ? 20  TYR A CB  1 
ATOM 140  C CG  . TYR A 1 18  ? 42.112 36.656 49.384 1.00 2.13   ? 20  TYR A CG  1 
ATOM 141  C CD1 . TYR A 1 18  ? 41.897 35.713 50.367 1.00 3.44   ? 20  TYR A CD1 1 
ATOM 142  C CD2 . TYR A 1 18  ? 41.494 36.541 48.149 1.00 2.07   ? 20  TYR A CD2 1 
ATOM 143  C CE1 . TYR A 1 18  ? 41.037 34.641 50.111 1.00 8.99   ? 20  TYR A CE1 1 
ATOM 144  C CE2 . TYR A 1 18  ? 40.638 35.470 47.887 1.00 5.98   ? 20  TYR A CE2 1 
ATOM 145  C CZ  . TYR A 1 18  ? 40.397 34.514 48.877 1.00 12.74  ? 20  TYR A CZ  1 
ATOM 146  O OH  . TYR A 1 18  ? 39.503 33.458 48.667 1.00 15.32  ? 20  TYR A OH  1 
ATOM 147  N N   . LYS A 1 19  ? 42.417 41.170 51.439 1.00 11.70  ? 21  LYS A N   1 
ATOM 148  C CA  . LYS A 1 19  ? 43.115 42.341 51.985 1.00 3.85   ? 21  LYS A CA  1 
ATOM 149  C C   . LYS A 1 19  ? 43.654 42.092 53.370 1.00 2.90   ? 21  LYS A C   1 
ATOM 150  O O   . LYS A 1 19  ? 43.108 41.316 54.141 1.00 7.03   ? 21  LYS A O   1 
ATOM 151  C CB  . LYS A 1 19  ? 42.216 43.566 52.126 1.00 9.70   ? 21  LYS A CB  1 
ATOM 152  C CG  . LYS A 1 19  ? 41.554 43.943 50.813 1.00 16.45  ? 21  LYS A CG  1 
ATOM 153  C CD  . LYS A 1 19  ? 41.901 45.323 50.326 1.00 10.03  ? 21  LYS A CD  1 
ATOM 154  C CE  . LYS A 1 19  ? 40.922 46.323 50.885 1.00 38.36  ? 21  LYS A CE  1 
ATOM 155  N NZ  . LYS A 1 19  ? 40.917 46.299 52.340 1.00 50.06  ? 21  LYS A NZ  1 
ATOM 156  N N   . GLU A 1 20  ? 44.755 42.767 53.705 1.00 19.35  ? 22  GLU A N   1 
ATOM 157  C CA  . GLU A 1 20  ? 45.352 42.638 55.025 1.00 16.98  ? 22  GLU A CA  1 
ATOM 158  C C   . GLU A 1 20  ? 44.521 43.436 56.023 1.00 21.39  ? 22  GLU A C   1 
ATOM 159  O O   . GLU A 1 20  ? 44.456 43.048 57.191 1.00 36.97  ? 22  GLU A O   1 
ATOM 160  C CB  . GLU A 1 20  ? 46.754 43.188 55.006 1.00 48.19  ? 22  GLU A CB  1 
ATOM 161  C CG  . GLU A 1 20  ? 47.938 42.260 55.315 1.00 87.89  ? 22  GLU A CG  1 
ATOM 162  C CD  . GLU A 1 20  ? 49.195 43.026 55.761 1.00 105.77 ? 22  GLU A CD  1 
ATOM 163  O OE1 . GLU A 1 20  ? 49.781 43.749 54.949 1.00 117.39 ? 22  GLU A OE1 1 
ATOM 164  O OE2 . GLU A 1 20  ? 49.582 42.906 56.931 1.00 117.71 ? 22  GLU A OE2 1 
ATOM 165  N N   . SER A 1 21  ? 43.858 44.544 55.654 1.00 16.37  ? 23  SER A N   1 
ATOM 166  C CA  . SER A 1 21  ? 43.149 45.346 56.635 1.00 17.88  ? 23  SER A CA  1 
ATOM 167  C C   . SER A 1 21  ? 42.165 46.241 55.950 1.00 18.01  ? 23  SER A C   1 
ATOM 168  O O   . SER A 1 21  ? 42.230 46.374 54.720 1.00 18.83  ? 23  SER A O   1 
ATOM 169  C CB  . SER A 1 21  ? 44.080 46.249 57.430 1.00 9.34   ? 23  SER A CB  1 
ATOM 170  O OG  . SER A 1 21  ? 44.679 47.211 56.580 1.00 21.74  ? 23  SER A OG  1 
ATOM 171  N N   . THR A 1 22  ? 41.340 46.852 56.821 1.00 15.19  ? 24  THR A N   1 
ATOM 172  C CA  . THR A 1 22  ? 40.316 47.783 56.425 1.00 3.53   ? 24  THR A CA  1 
ATOM 173  C C   . THR A 1 22  ? 40.021 48.699 57.603 1.00 11.97  ? 24  THR A C   1 
ATOM 174  O O   . THR A 1 22  ? 40.049 48.295 58.780 1.00 8.83   ? 24  THR A O   1 
ATOM 175  C CB  . THR A 1 22  ? 39.145 46.926 55.969 1.00 12.07  ? 24  THR A CB  1 
ATOM 176  O OG1 . THR A 1 22  ? 38.521 47.857 55.144 1.00 26.97  ? 24  THR A OG1 1 
ATOM 177  C CG2 . THR A 1 22  ? 38.134 46.393 56.967 1.00 20.47  ? 24  THR A CG2 1 
ATOM 178  N N   . ASP A 1 23  ? 39.809 49.972 57.244 1.00 19.75  ? 25  ASP A N   1 
ATOM 179  C CA  . ASP A 1 23  ? 39.602 51.072 58.180 1.00 18.02  ? 25  ASP A CA  1 
ATOM 180  C C   . ASP A 1 23  ? 38.158 51.505 58.154 1.00 22.51  ? 25  ASP A C   1 
ATOM 181  O O   . ASP A 1 23  ? 37.657 51.888 57.080 1.00 19.39  ? 25  ASP A O   1 
ATOM 182  C CB  . ASP A 1 23  ? 40.405 52.303 57.805 1.00 25.87  ? 25  ASP A CB  1 
ATOM 183  C CG  . ASP A 1 23  ? 41.923 52.216 57.922 1.00 45.88  ? 25  ASP A CG  1 
ATOM 184  O OD1 . ASP A 1 23  ? 42.425 51.233 58.459 1.00 44.93  ? 25  ASP A OD1 1 
ATOM 185  O OD2 . ASP A 1 23  ? 42.602 53.152 57.487 1.00 45.60  ? 25  ASP A OD2 1 
ATOM 186  N N   . VAL A 1 24  ? 37.489 51.415 59.303 1.00 11.56  ? 26  VAL A N   1 
ATOM 187  C CA  . VAL A 1 24  ? 36.149 51.924 59.384 1.00 3.04   ? 26  VAL A CA  1 
ATOM 188  C C   . VAL A 1 24  ? 36.199 53.057 60.362 1.00 10.90  ? 26  VAL A C   1 
ATOM 189  O O   . VAL A 1 24  ? 37.047 53.041 61.253 1.00 20.46  ? 26  VAL A O   1 
ATOM 190  C CB  . VAL A 1 24  ? 35.122 50.904 59.884 1.00 8.35   ? 26  VAL A CB  1 
ATOM 191  C CG1 . VAL A 1 24  ? 35.196 49.745 58.901 1.00 18.72  ? 26  VAL A CG1 1 
ATOM 192  C CG2 . VAL A 1 24  ? 35.322 50.511 61.322 1.00 4.26   ? 26  VAL A CG2 1 
ATOM 193  N N   . PRO A 1 25  ? 35.383 54.102 60.182 1.00 22.38  ? 27  PRO A N   1 
ATOM 194  C CA  . PRO A 1 25  ? 35.332 55.296 61.029 1.00 9.15   ? 27  PRO A CA  1 
ATOM 195  C C   . PRO A 1 25  ? 35.172 54.893 62.479 1.00 13.63  ? 27  PRO A C   1 
ATOM 196  O O   . PRO A 1 25  ? 34.380 54.001 62.768 1.00 31.38  ? 27  PRO A O   1 
ATOM 197  C CB  . PRO A 1 25  ? 34.186 56.034 60.415 1.00 13.99  ? 27  PRO A CB  1 
ATOM 198  C CG  . PRO A 1 25  ? 34.286 55.743 58.924 1.00 10.98  ? 27  PRO A CG  1 
ATOM 199  C CD  . PRO A 1 25  ? 34.489 54.260 59.031 1.00 23.65  ? 27  PRO A CD  1 
ATOM 200  N N   . ALA A 1 26  ? 35.905 55.494 63.400 1.00 11.07  ? 28  ALA A N   1 
ATOM 201  C CA  . ALA A 1 26  ? 35.980 55.001 64.756 1.00 7.28   ? 28  ALA A CA  1 
ATOM 202  C C   . ALA A 1 26  ? 34.736 55.252 65.535 1.00 13.45  ? 28  ALA A C   1 
ATOM 203  O O   . ALA A 1 26  ? 34.150 56.294 65.259 1.00 16.70  ? 28  ALA A O   1 
ATOM 204  C CB  . ALA A 1 26  ? 37.093 55.687 65.469 1.00 26.83  ? 28  ALA A CB  1 
ATOM 205  N N   . SER A 1 27  ? 34.347 54.407 66.507 1.00 17.06  ? 29  SER A N   1 
ATOM 206  C CA  . SER A 1 27  ? 33.176 54.631 67.376 1.00 2.00   ? 29  SER A CA  1 
ATOM 207  C C   . SER A 1 27  ? 33.324 53.698 68.543 1.00 12.77  ? 29  SER A C   1 
ATOM 208  O O   . SER A 1 27  ? 33.941 52.649 68.360 1.00 29.09  ? 29  SER A O   1 
ATOM 209  C CB  . SER A 1 27  ? 31.921 54.323 66.594 1.00 11.81  ? 29  SER A CB  1 
ATOM 210  O OG  . SER A 1 27  ? 30.926 53.464 67.121 1.00 21.86  ? 29  SER A OG  1 
ATOM 211  N N   . ARG A 1 28  ? 32.757 53.946 69.726 1.00 21.62  ? 30  ARG A N   1 
ATOM 212  C CA  . ARG A 1 28  ? 33.000 53.063 70.878 1.00 29.91  ? 30  ARG A CA  1 
ATOM 213  C C   . ARG A 1 28  ? 32.310 51.729 70.665 1.00 31.35  ? 30  ARG A C   1 
ATOM 214  O O   . ARG A 1 28  ? 32.861 50.652 70.901 1.00 33.77  ? 30  ARG A O   1 
ATOM 215  C CB  . ARG A 1 28  ? 32.479 53.614 72.229 1.00 40.60  ? 30  ARG A CB  1 
ATOM 216  C CG  . ARG A 1 28  ? 32.529 55.125 72.458 1.00 80.17  ? 30  ARG A CG  1 
ATOM 217  C CD  . ARG A 1 28  ? 31.215 55.708 71.892 1.00 115.48 ? 30  ARG A CD  1 
ATOM 218  N NE  . ARG A 1 28  ? 31.210 57.147 71.644 1.00 133.03 ? 30  ARG A NE  1 
ATOM 219  C CZ  . ARG A 1 28  ? 31.049 58.067 72.606 1.00 144.01 ? 30  ARG A CZ  1 
ATOM 220  N NH1 . ARG A 1 28  ? 30.883 57.755 73.900 1.00 146.38 ? 30  ARG A NH1 1 
ATOM 221  N NH2 . ARG A 1 28  ? 31.018 59.346 72.244 1.00 149.49 ? 30  ARG A NH2 1 
ATOM 222  N N   . PHE A 1 29  ? 31.105 51.830 70.104 1.00 36.72  ? 31  PHE A N   1 
ATOM 223  C CA  . PHE A 1 29  ? 30.254 50.688 69.845 1.00 26.46  ? 31  PHE A CA  1 
ATOM 224  C C   . PHE A 1 29  ? 30.846 49.804 68.747 1.00 27.12  ? 31  PHE A C   1 
ATOM 225  O O   . PHE A 1 29  ? 30.860 48.568 68.867 1.00 23.62  ? 31  PHE A O   1 
ATOM 226  C CB  . PHE A 1 29  ? 28.899 51.238 69.468 1.00 35.68  ? 31  PHE A CB  1 
ATOM 227  C CG  . PHE A 1 29  ? 27.883 50.136 69.388 1.00 36.13  ? 31  PHE A CG  1 
ATOM 228  C CD1 . PHE A 1 29  ? 27.721 49.265 70.467 1.00 38.88  ? 31  PHE A CD1 1 
ATOM 229  C CD2 . PHE A 1 29  ? 27.171 49.956 68.211 1.00 42.66  ? 31  PHE A CD2 1 
ATOM 230  C CE1 . PHE A 1 29  ? 26.838 48.194 70.352 1.00 36.84  ? 31  PHE A CE1 1 
ATOM 231  C CE2 . PHE A 1 29  ? 26.289 48.879 68.109 1.00 46.16  ? 31  PHE A CE2 1 
ATOM 232  C CZ  . PHE A 1 29  ? 26.123 47.998 69.176 1.00 44.65  ? 31  PHE A CZ  1 
ATOM 233  N N   . LYS A 1 30  ? 31.379 50.407 67.671 1.00 15.57  ? 32  LYS A N   1 
ATOM 234  C CA  . LYS A 1 30  ? 32.045 49.601 66.670 1.00 11.45  ? 32  LYS A CA  1 
ATOM 235  C C   . LYS A 1 30  ? 33.280 48.965 67.341 1.00 21.36  ? 32  LYS A C   1 
ATOM 236  O O   . LYS A 1 30  ? 33.513 47.765 67.176 1.00 28.90  ? 32  LYS A O   1 
ATOM 237  C CB  . LYS A 1 30  ? 32.461 50.458 65.500 1.00 3.46   ? 32  LYS A CB  1 
ATOM 238  C CG  . LYS A 1 30  ? 31.309 51.177 64.832 1.00 2.49   ? 32  LYS A CG  1 
ATOM 239  C CD  . LYS A 1 30  ? 31.677 51.490 63.404 1.00 2.00   ? 32  LYS A CD  1 
ATOM 240  C CE  . LYS A 1 30  ? 31.239 52.887 62.902 1.00 11.21  ? 32  LYS A CE  1 
ATOM 241  N NZ  . LYS A 1 30  ? 31.048 52.898 61.441 1.00 30.18  ? 32  LYS A NZ  1 
ATOM 242  N N   . GLU A 1 31  ? 34.018 49.659 68.227 1.00 23.94  ? 33  GLU A N   1 
ATOM 243  C CA  . GLU A 1 31  ? 35.226 49.134 68.864 1.00 20.61  ? 33  GLU A CA  1 
ATOM 244  C C   . GLU A 1 31  ? 34.983 47.922 69.725 1.00 19.56  ? 33  GLU A C   1 
ATOM 245  O O   . GLU A 1 31  ? 35.774 46.988 69.722 1.00 20.05  ? 33  GLU A O   1 
ATOM 246  C CB  . GLU A 1 31  ? 35.843 50.199 69.696 1.00 18.23  ? 33  GLU A CB  1 
ATOM 247  C CG  . GLU A 1 31  ? 37.226 49.791 70.092 1.00 30.47  ? 33  GLU A CG  1 
ATOM 248  C CD  . GLU A 1 31  ? 38.041 50.811 70.869 1.00 47.85  ? 33  GLU A CD  1 
ATOM 249  O OE1 . GLU A 1 31  ? 37.697 52.012 70.833 1.00 37.01  ? 33  GLU A OE1 1 
ATOM 250  O OE2 . GLU A 1 31  ? 39.027 50.366 71.490 1.00 44.00  ? 33  GLU A OE2 1 
ATOM 251  N N   . GLU A 1 32  ? 33.869 47.894 70.435 1.00 29.22  ? 34  GLU A N   1 
ATOM 252  C CA  . GLU A 1 32  ? 33.459 46.714 71.174 1.00 31.88  ? 34  GLU A CA  1 
ATOM 253  C C   . GLU A 1 32  ? 32.988 45.594 70.260 1.00 32.01  ? 34  GLU A C   1 
ATOM 254  O O   . GLU A 1 32  ? 33.149 44.444 70.660 1.00 37.73  ? 34  GLU A O   1 
ATOM 255  C CB  . GLU A 1 32  ? 32.314 46.987 72.115 1.00 31.66  ? 34  GLU A CB  1 
ATOM 256  C CG  . GLU A 1 32  ? 32.714 47.677 73.389 1.00 52.25  ? 34  GLU A CG  1 
ATOM 257  C CD  . GLU A 1 32  ? 31.836 47.183 74.526 1.00 74.85  ? 34  GLU A CD  1 
ATOM 258  O OE1 . GLU A 1 32  ? 32.161 46.125 75.077 1.00 93.02  ? 34  GLU A OE1 1 
ATOM 259  O OE2 . GLU A 1 32  ? 30.829 47.830 74.844 1.00 77.43  ? 34  GLU A OE2 1 
ATOM 260  N N   . ILE A 1 33  ? 32.395 45.786 69.064 1.00 29.95  ? 35  ILE A N   1 
ATOM 261  C CA  . ILE A 1 33  ? 32.002 44.635 68.241 1.00 18.47  ? 35  ILE A CA  1 
ATOM 262  C C   . ILE A 1 33  ? 33.319 44.038 67.732 1.00 20.33  ? 35  ILE A C   1 
ATOM 263  O O   . ILE A 1 33  ? 33.470 42.811 67.720 1.00 30.62  ? 35  ILE A O   1 
ATOM 264  C CB  . ILE A 1 33  ? 31.062 45.093 67.071 1.00 14.29  ? 35  ILE A CB  1 
ATOM 265  C CG1 . ILE A 1 33  ? 29.692 45.526 67.593 1.00 2.47   ? 35  ILE A CG1 1 
ATOM 266  C CG2 . ILE A 1 33  ? 30.883 43.946 66.087 1.00 7.07   ? 35  ILE A CG2 1 
ATOM 267  C CD1 . ILE A 1 33  ? 28.715 45.956 66.466 1.00 3.26   ? 35  ILE A CD1 1 
ATOM 268  N N   . LEU A 1 34  ? 34.314 44.878 67.393 1.00 17.37  ? 36  LEU A N   1 
ATOM 269  C CA  . LEU A 1 34  ? 35.633 44.449 66.962 1.00 8.71   ? 36  LEU A CA  1 
ATOM 270  C C   . LEU A 1 34  ? 36.378 43.755 68.059 1.00 11.41  ? 36  LEU A C   1 
ATOM 271  O O   . LEU A 1 34  ? 37.113 42.800 67.799 1.00 23.48  ? 36  LEU A O   1 
ATOM 272  C CB  . LEU A 1 34  ? 36.487 45.612 66.509 1.00 6.67   ? 36  LEU A CB  1 
ATOM 273  C CG  . LEU A 1 34  ? 36.042 46.200 65.210 1.00 6.95   ? 36  LEU A CG  1 
ATOM 274  C CD1 . LEU A 1 34  ? 37.038 47.201 64.699 1.00 10.88  ? 36  LEU A CD1 1 
ATOM 275  C CD2 . LEU A 1 34  ? 35.959 45.085 64.185 1.00 28.07  ? 36  LEU A CD2 1 
ATOM 276  N N   . ARG A 1 35  ? 36.186 44.221 69.280 1.00 3.74   ? 37  ARG A N   1 
ATOM 277  C CA  . ARG A 1 35  ? 36.771 43.572 70.435 1.00 15.46  ? 37  ARG A CA  1 
ATOM 278  C C   . ARG A 1 35  ? 36.268 42.125 70.529 1.00 16.24  ? 37  ARG A C   1 
ATOM 279  O O   . ARG A 1 35  ? 37.053 41.244 70.860 1.00 14.85  ? 37  ARG A O   1 
ATOM 280  C CB  . ARG A 1 35  ? 36.379 44.412 71.613 1.00 18.32  ? 37  ARG A CB  1 
ATOM 281  C CG  . ARG A 1 35  ? 37.316 44.501 72.775 1.00 48.45  ? 37  ARG A CG  1 
ATOM 282  C CD  . ARG A 1 35  ? 36.880 43.551 73.879 1.00 76.02  ? 37  ARG A CD  1 
ATOM 283  N NE  . ARG A 1 35  ? 35.528 43.841 74.344 1.00 89.92  ? 37  ARG A NE  1 
ATOM 284  C CZ  . ARG A 1 35  ? 34.902 43.076 75.244 1.00 91.24  ? 37  ARG A CZ  1 
ATOM 285  N NH1 . ARG A 1 35  ? 35.478 41.991 75.790 1.00 87.05  ? 37  ARG A NH1 1 
ATOM 286  N NH2 . ARG A 1 35  ? 33.644 43.391 75.550 1.00 94.80  ? 37  ARG A NH2 1 
ATOM 287  N N   . ILE A 1 36  ? 35.012 41.788 70.168 1.00 27.48  ? 38  ILE A N   1 
ATOM 288  C CA  . ILE A 1 36  ? 34.480 40.417 70.240 1.00 22.30  ? 38  ILE A CA  1 
ATOM 289  C C   . ILE A 1 36  ? 34.875 39.603 69.025 1.00 21.90  ? 38  ILE A C   1 
ATOM 290  O O   . ILE A 1 36  ? 35.224 38.432 69.167 1.00 16.69  ? 38  ILE A O   1 
ATOM 291  C CB  . ILE A 1 36  ? 32.934 40.400 70.365 1.00 9.24   ? 38  ILE A CB  1 
ATOM 292  C CG1 . ILE A 1 36  ? 32.521 41.070 71.666 1.00 19.50  ? 38  ILE A CG1 1 
ATOM 293  C CG2 . ILE A 1 36  ? 32.417 38.973 70.437 1.00 14.42  ? 38  ILE A CG2 1 
ATOM 294  C CD1 . ILE A 1 36  ? 31.009 41.082 72.003 1.00 31.13  ? 38  ILE A CD1 1 
ATOM 295  N N   . LEU A 1 37  ? 34.831 40.175 67.826 1.00 16.43  ? 39  LEU A N   1 
ATOM 296  C CA  . LEU A 1 37  ? 35.277 39.473 66.625 1.00 25.09  ? 39  LEU A CA  1 
ATOM 297  C C   . LEU A 1 37  ? 36.757 39.042 66.806 1.00 30.37  ? 39  LEU A C   1 
ATOM 298  O O   . LEU A 1 37  ? 37.140 37.902 66.484 1.00 30.76  ? 39  LEU A O   1 
ATOM 299  C CB  . LEU A 1 37  ? 35.076 40.425 65.399 1.00 12.94  ? 39  LEU A CB  1 
ATOM 300  C CG  . LEU A 1 37  ? 33.930 40.297 64.368 1.00 12.04  ? 39  LEU A CG  1 
ATOM 301  C CD1 . LEU A 1 37  ? 32.688 39.869 65.106 1.00 17.22  ? 39  LEU A CD1 1 
ATOM 302  C CD2 . LEU A 1 37  ? 33.663 41.616 63.621 1.00 6.82   ? 39  LEU A CD2 1 
ATOM 303  N N   . ALA A 1 38  ? 37.605 39.915 67.363 1.00 27.24  ? 40  ALA A N   1 
ATOM 304  C CA  . ALA A 1 38  ? 38.993 39.594 67.617 1.00 24.03  ? 40  ALA A CA  1 
ATOM 305  C C   . ALA A 1 38  ? 39.165 38.480 68.664 1.00 26.16  ? 40  ALA A C   1 
ATOM 306  O O   . ALA A 1 38  ? 39.786 37.454 68.379 1.00 29.72  ? 40  ALA A O   1 
ATOM 307  C CB  . ALA A 1 38  ? 39.651 40.857 68.054 1.00 19.54  ? 40  ALA A CB  1 
ATOM 308  N N   . ARG A 1 39  ? 38.607 38.588 69.877 1.00 31.32  ? 41  ARG A N   1 
ATOM 309  C CA  . ARG A 1 39  ? 38.625 37.503 70.867 1.00 27.04  ? 41  ARG A CA  1 
ATOM 310  C C   . ARG A 1 39  ? 38.069 36.172 70.343 1.00 25.28  ? 41  ARG A C   1 
ATOM 311  O O   . ARG A 1 39  ? 38.500 35.124 70.796 1.00 32.26  ? 41  ARG A O   1 
ATOM 312  C CB  . ARG A 1 39  ? 37.813 37.899 72.132 1.00 22.75  ? 41  ARG A CB  1 
ATOM 313  C CG  . ARG A 1 39  ? 37.157 36.723 72.894 1.00 17.47  ? 41  ARG A CG  1 
ATOM 314  C CD  . ARG A 1 39  ? 36.783 36.946 74.346 1.00 27.56  ? 41  ARG A CD  1 
ATOM 315  N NE  . ARG A 1 39  ? 35.720 37.917 74.546 1.00 37.12  ? 41  ARG A NE  1 
ATOM 316  C CZ  . ARG A 1 39  ? 34.427 37.638 74.360 1.00 39.25  ? 41  ARG A CZ  1 
ATOM 317  N NH1 . ARG A 1 39  ? 33.978 36.447 73.986 1.00 26.44  ? 41  ARG A NH1 1 
ATOM 318  N NH2 . ARG A 1 39  ? 33.552 38.620 74.529 1.00 53.84  ? 41  ARG A NH2 1 
ATOM 319  N N   . GLU A 1 40  ? 37.087 36.145 69.452 1.00 33.04  ? 42  GLU A N   1 
ATOM 320  C CA  . GLU A 1 40  ? 36.504 34.902 68.965 1.00 29.41  ? 42  GLU A CA  1 
ATOM 321  C C   . GLU A 1 40  ? 37.209 34.339 67.732 1.00 24.47  ? 42  GLU A C   1 
ATOM 322  O O   . GLU A 1 40  ? 36.758 33.336 67.171 1.00 33.63  ? 42  GLU A O   1 
ATOM 323  C CB  . GLU A 1 40  ? 34.997 35.125 68.646 1.00 39.06  ? 42  GLU A CB  1 
ATOM 324  C CG  . GLU A 1 40  ? 34.112 35.476 69.841 1.00 26.77  ? 42  GLU A CG  1 
ATOM 325  C CD  . GLU A 1 40  ? 34.069 34.400 70.914 1.00 32.12  ? 42  GLU A CD  1 
ATOM 326  O OE1 . GLU A 1 40  ? 33.871 33.215 70.606 1.00 39.01  ? 42  GLU A OE1 1 
ATOM 327  O OE2 . GLU A 1 40  ? 34.230 34.752 72.072 1.00 37.64  ? 42  GLU A OE2 1 
ATOM 328  N N   . GLY A 1 41  ? 38.238 35.010 67.221 1.00 13.59  ? 43  GLY A N   1 
ATOM 329  C CA  . GLY A 1 41  ? 39.012 34.488 66.127 1.00 2.75   ? 43  GLY A CA  1 
ATOM 330  C C   . GLY A 1 41  ? 38.566 34.923 64.760 1.00 17.90  ? 43  GLY A C   1 
ATOM 331  O O   . GLY A 1 41  ? 39.111 34.382 63.796 1.00 31.68  ? 43  GLY A O   1 
ATOM 332  N N   . PHE A 1 42  ? 37.646 35.867 64.558 1.00 10.94  ? 44  PHE A N   1 
ATOM 333  C CA  . PHE A 1 42  ? 37.257 36.209 63.187 1.00 6.35   ? 44  PHE A CA  1 
ATOM 334  C C   . PHE A 1 42  ? 38.138 37.240 62.502 1.00 13.22  ? 44  PHE A C   1 
ATOM 335  O O   . PHE A 1 42  ? 38.136 37.444 61.271 1.00 26.84  ? 44  PHE A O   1 
ATOM 336  C CB  . PHE A 1 42  ? 35.841 36.709 63.195 1.00 26.08  ? 44  PHE A CB  1 
ATOM 337  C CG  . PHE A 1 42  ? 34.903 35.579 63.553 1.00 12.16  ? 44  PHE A CG  1 
ATOM 338  C CD1 . PHE A 1 42  ? 34.633 34.618 62.590 1.00 15.19  ? 44  PHE A CD1 1 
ATOM 339  C CD2 . PHE A 1 42  ? 34.397 35.485 64.843 1.00 9.75   ? 44  PHE A CD2 1 
ATOM 340  C CE1 . PHE A 1 42  ? 33.851 33.521 62.929 1.00 20.53  ? 44  PHE A CE1 1 
ATOM 341  C CE2 . PHE A 1 42  ? 33.618 34.393 65.171 1.00 17.80  ? 44  PHE A CE2 1 
ATOM 342  C CZ  . PHE A 1 42  ? 33.349 33.409 64.210 1.00 10.92  ? 44  PHE A CZ  1 
ATOM 343  N N   . ILE A 1 43  ? 38.860 37.987 63.319 1.00 3.60   ? 45  ILE A N   1 
ATOM 344  C CA  . ILE A 1 43  ? 39.809 38.933 62.788 1.00 3.23   ? 45  ILE A CA  1 
ATOM 345  C C   . ILE A 1 43  ? 41.069 38.703 63.610 1.00 11.11  ? 45  ILE A C   1 
ATOM 346  O O   . ILE A 1 43  ? 41.010 37.961 64.601 1.00 20.96  ? 45  ILE A O   1 
ATOM 347  C CB  . ILE A 1 43  ? 39.296 40.421 62.923 1.00 2.84   ? 45  ILE A CB  1 
ATOM 348  C CG1 . ILE A 1 43  ? 38.719 40.747 64.282 1.00 5.66   ? 45  ILE A CG1 1 
ATOM 349  C CG2 . ILE A 1 43  ? 38.238 40.644 61.884 1.00 2.00   ? 45  ILE A CG2 1 
ATOM 350  C CD1 . ILE A 1 43  ? 38.531 42.269 64.436 1.00 11.17  ? 45  ILE A CD1 1 
ATOM 351  N N   . LYS A 1 44  ? 42.207 39.281 63.190 1.00 15.80  ? 46  LYS A N   1 
ATOM 352  C CA  . LYS A 1 44  ? 43.504 39.184 63.868 1.00 9.20   ? 46  LYS A CA  1 
ATOM 353  C C   . LYS A 1 44  ? 43.406 40.183 64.983 1.00 18.58  ? 46  LYS A C   1 
ATOM 354  O O   . LYS A 1 44  ? 43.646 39.862 66.135 1.00 19.58  ? 46  LYS A O   1 
ATOM 355  C CB  . LYS A 1 44  ? 44.581 39.569 62.894 1.00 26.14  ? 46  LYS A CB  1 
ATOM 356  C CG  . LYS A 1 44  ? 45.903 38.806 62.957 1.00 54.45  ? 46  LYS A CG  1 
ATOM 357  C CD  . LYS A 1 44  ? 46.511 38.591 61.541 1.00 64.68  ? 46  LYS A CD  1 
ATOM 358  C CE  . LYS A 1 44  ? 47.034 39.876 60.869 1.00 75.93  ? 46  LYS A CE  1 
ATOM 359  N NZ  . LYS A 1 44  ? 47.114 39.747 59.420 1.00 83.29  ? 46  LYS A NZ  1 
ATOM 360  N N   . GLY A 1 45  ? 43.022 41.431 64.693 1.00 32.80  ? 47  GLY A N   1 
ATOM 361  C CA  . GLY A 1 45  ? 42.814 42.441 65.740 1.00 21.74  ? 47  GLY A CA  1 
ATOM 362  C C   . GLY A 1 45  ? 42.507 43.768 65.087 1.00 17.07  ? 47  GLY A C   1 
ATOM 363  O O   . GLY A 1 45  ? 42.326 43.815 63.863 1.00 8.41   ? 47  GLY A O   1 
ATOM 364  N N   . TYR A 1 46  ? 42.497 44.846 65.860 1.00 14.11  ? 48  TYR A N   1 
ATOM 365  C CA  . TYR A 1 46  ? 42.254 46.176 65.318 1.00 6.46   ? 48  TYR A CA  1 
ATOM 366  C C   . TYR A 1 46  ? 43.143 47.175 66.009 1.00 6.32   ? 48  TYR A C   1 
ATOM 367  O O   . TYR A 1 46  ? 43.660 46.923 67.100 1.00 14.88  ? 48  TYR A O   1 
ATOM 368  C CB  . TYR A 1 46  ? 40.808 46.610 65.537 1.00 2.17   ? 48  TYR A CB  1 
ATOM 369  C CG  . TYR A 1 46  ? 40.433 46.734 67.000 1.00 2.00   ? 48  TYR A CG  1 
ATOM 370  C CD1 . TYR A 1 46  ? 40.186 45.583 67.782 1.00 12.22  ? 48  TYR A CD1 1 
ATOM 371  C CD2 . TYR A 1 46  ? 40.357 48.013 67.544 1.00 4.27   ? 48  TYR A CD2 1 
ATOM 372  C CE1 . TYR A 1 46  ? 39.855 45.722 69.134 1.00 14.01  ? 48  TYR A CE1 1 
ATOM 373  C CE2 . TYR A 1 46  ? 40.039 48.158 68.894 1.00 15.18  ? 48  TYR A CE2 1 
ATOM 374  C CZ  . TYR A 1 46  ? 39.791 47.023 69.681 1.00 23.42  ? 48  TYR A CZ  1 
ATOM 375  O OH  . TYR A 1 46  ? 39.511 47.221 71.024 1.00 38.25  ? 48  TYR A OH  1 
ATOM 376  N N   . GLU A 1 47  ? 43.193 48.386 65.514 1.00 16.51  ? 49  GLU A N   1 
ATOM 377  C CA  . GLU A 1 47  ? 44.075 49.361 66.112 1.00 23.71  ? 49  GLU A CA  1 
ATOM 378  C C   . GLU A 1 47  ? 43.504 50.703 65.789 1.00 19.55  ? 49  GLU A C   1 
ATOM 379  O O   . GLU A 1 47  ? 43.091 50.899 64.652 1.00 26.37  ? 49  GLU A O   1 
ATOM 380  C CB  . GLU A 1 47  ? 45.403 49.179 65.476 1.00 24.82  ? 49  GLU A CB  1 
ATOM 381  C CG  . GLU A 1 47  ? 46.570 49.972 65.963 1.00 22.59  ? 49  GLU A CG  1 
ATOM 382  C CD  . GLU A 1 47  ? 47.723 49.586 65.072 1.00 39.37  ? 49  GLU A CD  1 
ATOM 383  O OE1 . GLU A 1 47  ? 47.591 49.727 63.855 1.00 33.44  ? 49  GLU A OE1 1 
ATOM 384  O OE2 . GLU A 1 47  ? 48.742 49.133 65.595 1.00 49.98  ? 49  GLU A OE2 1 
ATOM 385  N N   . ARG A 1 48  ? 43.458 51.616 66.738 1.00 20.56  ? 50  ARG A N   1 
ATOM 386  C CA  . ARG A 1 48  ? 42.952 52.943 66.468 1.00 25.86  ? 50  ARG A CA  1 
ATOM 387  C C   . ARG A 1 48  ? 43.912 53.696 65.544 1.00 16.03  ? 50  ARG A C   1 
ATOM 388  O O   . ARG A 1 48  ? 45.116 53.510 65.621 1.00 20.77  ? 50  ARG A O   1 
ATOM 389  C CB  . ARG A 1 48  ? 42.750 53.620 67.829 1.00 33.88  ? 50  ARG A CB  1 
ATOM 390  C CG  . ARG A 1 48  ? 42.068 54.985 67.837 1.00 65.67  ? 50  ARG A CG  1 
ATOM 391  C CD  . ARG A 1 48  ? 40.679 54.990 67.252 1.00 85.46  ? 50  ARG A CD  1 
ATOM 392  N NE  . ARG A 1 48  ? 39.924 56.071 67.839 1.00 109.21 ? 50  ARG A NE  1 
ATOM 393  C CZ  . ARG A 1 48  ? 39.105 55.867 68.887 1.00 125.42 ? 50  ARG A CZ  1 
ATOM 394  N NH1 . ARG A 1 48  ? 38.920 54.667 69.462 1.00 126.21 ? 50  ARG A NH1 1 
ATOM 395  N NH2 . ARG A 1 48  ? 38.455 56.914 69.393 1.00 134.38 ? 50  ARG A NH2 1 
ATOM 396  N N   . VAL A 1 49  ? 43.461 54.549 64.634 1.00 16.53  ? 51  VAL A N   1 
ATOM 397  C CA  . VAL A 1 49  ? 44.313 55.192 63.654 1.00 14.55  ? 51  VAL A CA  1 
ATOM 398  C C   . VAL A 1 49  ? 43.719 56.564 63.382 1.00 23.96  ? 51  VAL A C   1 
ATOM 399  O O   . VAL A 1 49  ? 42.522 56.635 63.101 1.00 28.73  ? 51  VAL A O   1 
ATOM 400  C CB  . VAL A 1 49  ? 44.332 54.323 62.380 1.00 12.36  ? 51  VAL A CB  1 
ATOM 401  C CG1 . VAL A 1 49  ? 44.727 55.094 61.141 1.00 2.36   ? 51  VAL A CG1 1 
ATOM 402  C CG2 . VAL A 1 49  ? 45.357 53.247 62.583 1.00 2.02   ? 51  VAL A CG2 1 
ATOM 403  N N   . ASP A 1 50  ? 44.487 57.650 63.515 1.00 21.88  ? 52  ASP A N   1 
ATOM 404  C CA  . ASP A 1 50  ? 44.014 58.974 63.189 1.00 16.49  ? 52  ASP A CA  1 
ATOM 405  C C   . ASP A 1 50  ? 44.668 59.284 61.900 1.00 20.16  ? 52  ASP A C   1 
ATOM 406  O O   . ASP A 1 50  ? 45.878 59.165 61.723 1.00 30.50  ? 52  ASP A O   1 
ATOM 407  C CB  . ASP A 1 50  ? 44.439 60.030 64.150 1.00 32.12  ? 52  ASP A CB  1 
ATOM 408  C CG  . ASP A 1 50  ? 43.763 59.961 65.522 1.00 63.86  ? 52  ASP A CG  1 
ATOM 409  O OD1 . ASP A 1 50  ? 43.122 58.956 65.871 1.00 75.98  ? 52  ASP A OD1 1 
ATOM 410  O OD2 . ASP A 1 50  ? 43.891 60.944 66.259 1.00 80.66  ? 52  ASP A OD2 1 
ATOM 411  N N   . VAL A 1 51  ? 43.836 59.599 60.948 1.00 22.84  ? 53  VAL A N   1 
ATOM 412  C CA  . VAL A 1 51  ? 44.336 59.892 59.636 1.00 28.01  ? 53  VAL A CA  1 
ATOM 413  C C   . VAL A 1 51  ? 43.811 61.303 59.450 1.00 41.69  ? 53  VAL A C   1 
ATOM 414  O O   . VAL A 1 51  ? 42.594 61.518 59.495 1.00 55.79  ? 53  VAL A O   1 
ATOM 415  C CB  . VAL A 1 51  ? 43.730 58.969 58.597 1.00 16.35  ? 53  VAL A CB  1 
ATOM 416  C CG1 . VAL A 1 51  ? 44.675 58.968 57.430 1.00 21.94  ? 53  VAL A CG1 1 
ATOM 417  C CG2 . VAL A 1 51  ? 43.589 57.545 59.060 1.00 39.96  ? 53  VAL A CG2 1 
ATOM 418  N N   . ASP A 1 52  ? 44.735 62.268 59.338 1.00 38.09  ? 54  ASP A N   1 
ATOM 419  C CA  . ASP A 1 52  ? 44.465 63.689 59.195 1.00 23.07  ? 54  ASP A CA  1 
ATOM 420  C C   . ASP A 1 52  ? 43.397 64.229 60.135 1.00 26.75  ? 54  ASP A C   1 
ATOM 421  O O   . ASP A 1 52  ? 42.566 65.046 59.756 1.00 36.70  ? 54  ASP A O   1 
ATOM 422  C CB  . ASP A 1 52  ? 44.090 64.012 57.740 1.00 22.66  ? 54  ASP A CB  1 
ATOM 423  C CG  . ASP A 1 52  ? 45.213 64.024 56.699 1.00 39.55  ? 54  ASP A CG  1 
ATOM 424  O OD1 . ASP A 1 52  ? 46.367 63.894 57.094 1.00 47.33  ? 54  ASP A OD1 1 
ATOM 425  O OD2 . ASP A 1 52  ? 44.945 64.168 55.493 1.00 39.35  ? 54  ASP A OD2 1 
ATOM 426  N N   . GLY A 1 53  ? 43.400 63.804 61.400 1.00 26.24  ? 55  GLY A N   1 
ATOM 427  C CA  . GLY A 1 53  ? 42.463 64.330 62.382 1.00 28.10  ? 55  GLY A CA  1 
ATOM 428  C C   . GLY A 1 53  ? 41.260 63.436 62.628 1.00 33.22  ? 55  GLY A C   1 
ATOM 429  O O   . GLY A 1 53  ? 40.693 63.408 63.723 1.00 35.42  ? 55  GLY A O   1 
ATOM 430  N N   . LYS A 1 54  ? 40.879 62.658 61.626 1.00 31.07  ? 56  LYS A N   1 
ATOM 431  C CA  . LYS A 1 54  ? 39.723 61.820 61.749 1.00 20.92  ? 56  LYS A CA  1 
ATOM 432  C C   . LYS A 1 54  ? 40.199 60.547 62.390 1.00 22.15  ? 56  LYS A C   1 
ATOM 433  O O   . LYS A 1 54  ? 41.264 60.037 62.048 1.00 27.39  ? 56  LYS A O   1 
ATOM 434  C CB  . LYS A 1 54  ? 39.119 61.537 60.382 1.00 30.94  ? 56  LYS A CB  1 
ATOM 435  C CG  . LYS A 1 54  ? 38.803 62.753 59.485 1.00 44.58  ? 56  LYS A CG  1 
ATOM 436  C CD  . LYS A 1 54  ? 38.059 63.862 60.231 1.00 68.26  ? 56  LYS A CD  1 
ATOM 437  C CE  . LYS A 1 54  ? 36.698 63.442 60.770 1.00 77.64  ? 56  LYS A CE  1 
ATOM 438  N NZ  . LYS A 1 54  ? 36.361 64.269 61.915 1.00 87.90  ? 56  LYS A NZ  1 
ATOM 439  N N   . PRO A 1 55  ? 39.463 60.065 63.380 1.00 18.79  ? 57  PRO A N   1 
ATOM 440  C CA  . PRO A 1 55  ? 39.559 58.738 63.966 1.00 21.77  ? 57  PRO A CA  1 
ATOM 441  C C   . PRO A 1 55  ? 38.977 57.642 63.146 1.00 19.53  ? 57  PRO A C   1 
ATOM 442  O O   . PRO A 1 55  ? 37.809 57.702 62.757 1.00 35.47  ? 57  PRO A O   1 
ATOM 443  C CB  . PRO A 1 55  ? 38.844 58.777 65.272 1.00 13.66  ? 57  PRO A CB  1 
ATOM 444  C CG  . PRO A 1 55  ? 37.805 59.816 64.980 1.00 12.57  ? 57  PRO A CG  1 
ATOM 445  C CD  . PRO A 1 55  ? 38.512 60.853 64.126 1.00 13.22  ? 57  PRO A CD  1 
ATOM 446  N N   . TYR A 1 56  ? 39.796 56.631 62.974 1.00 20.75  ? 58  TYR A N   1 
ATOM 447  C CA  . TYR A 1 56  ? 39.444 55.407 62.294 1.00 12.66  ? 58  TYR A CA  1 
ATOM 448  C C   . TYR A 1 56  ? 39.838 54.299 63.237 1.00 16.43  ? 58  TYR A C   1 
ATOM 449  O O   . TYR A 1 56  ? 40.491 54.518 64.270 1.00 15.64  ? 58  TYR A O   1 
ATOM 450  C CB  . TYR A 1 56  ? 40.225 55.251 61.030 1.00 17.14  ? 58  TYR A CB  1 
ATOM 451  C CG  . TYR A 1 56  ? 39.814 56.242 59.976 1.00 9.73   ? 58  TYR A CG  1 
ATOM 452  C CD1 . TYR A 1 56  ? 40.169 57.572 60.109 1.00 15.95  ? 58  TYR A CD1 1 
ATOM 453  C CD2 . TYR A 1 56  ? 39.014 55.803 58.930 1.00 14.54  ? 58  TYR A CD2 1 
ATOM 454  C CE1 . TYR A 1 56  ? 39.704 58.491 59.184 1.00 36.40  ? 58  TYR A CE1 1 
ATOM 455  C CE2 . TYR A 1 56  ? 38.543 56.713 57.993 1.00 34.07  ? 58  TYR A CE2 1 
ATOM 456  C CZ  . TYR A 1 56  ? 38.889 58.059 58.137 1.00 42.35  ? 58  TYR A CZ  1 
ATOM 457  O OH  . TYR A 1 56  ? 38.403 58.985 57.237 1.00 49.19  ? 58  TYR A OH  1 
ATOM 458  N N   . LEU A 1 57  ? 39.371 53.123 62.851 1.00 20.54  ? 59  LEU A N   1 
ATOM 459  C CA  . LEU A 1 57  ? 39.661 51.845 63.489 1.00 21.40  ? 59  LEU A CA  1 
ATOM 460  C C   . LEU A 1 57  ? 40.108 50.961 62.306 1.00 24.21  ? 59  LEU A C   1 
ATOM 461  O O   . LEU A 1 57  ? 39.434 50.813 61.260 1.00 29.53  ? 59  LEU A O   1 
ATOM 462  C CB  . LEU A 1 57  ? 38.388 51.272 64.169 1.00 29.53  ? 59  LEU A CB  1 
ATOM 463  C CG  . LEU A 1 57  ? 37.712 51.899 65.417 1.00 24.04  ? 59  LEU A CG  1 
ATOM 464  C CD1 . LEU A 1 57  ? 36.276 51.413 65.497 1.00 24.39  ? 59  LEU A CD1 1 
ATOM 465  C CD2 . LEU A 1 57  ? 38.419 51.485 66.693 1.00 24.18  ? 59  LEU A CD2 1 
ATOM 466  N N   . ARG A 1 58  ? 41.346 50.473 62.412 1.00 18.52  ? 60  ARG A N   1 
ATOM 467  C CA  . ARG A 1 58  ? 41.942 49.643 61.386 1.00 10.28  ? 60  ARG A CA  1 
ATOM 468  C C   . ARG A 1 58  ? 41.898 48.238 61.906 1.00 12.69  ? 60  ARG A C   1 
ATOM 469  O O   . ARG A 1 58  ? 42.498 47.957 62.941 1.00 12.44  ? 60  ARG A O   1 
ATOM 470  C CB  . ARG A 1 58  ? 43.345 50.015 61.173 1.00 2.01   ? 60  ARG A CB  1 
ATOM 471  C CG  . ARG A 1 58  ? 44.027 48.965 60.354 1.00 9.98   ? 60  ARG A CG  1 
ATOM 472  C CD  . ARG A 1 58  ? 45.311 49.525 59.889 1.00 26.76  ? 60  ARG A CD  1 
ATOM 473  N NE  . ARG A 1 58  ? 45.141 50.735 59.122 1.00 14.36  ? 60  ARG A NE  1 
ATOM 474  C CZ  . ARG A 1 58  ? 46.183 51.514 58.934 1.00 22.38  ? 60  ARG A CZ  1 
ATOM 475  N NH1 . ARG A 1 58  ? 47.403 51.185 59.438 1.00 23.83  ? 60  ARG A NH1 1 
ATOM 476  N NH2 . ARG A 1 58  ? 45.935 52.646 58.278 1.00 10.06  ? 60  ARG A NH2 1 
ATOM 477  N N   . VAL A 1 59  ? 41.183 47.450 61.115 1.00 6.52   ? 61  VAL A N   1 
ATOM 478  C CA  . VAL A 1 59  ? 40.838 46.060 61.345 1.00 12.90  ? 61  VAL A CA  1 
ATOM 479  C C   . VAL A 1 59  ? 41.890 45.233 60.649 1.00 8.98   ? 61  VAL A C   1 
ATOM 480  O O   . VAL A 1 59  ? 42.151 45.528 59.480 1.00 15.46  ? 61  VAL A O   1 
ATOM 481  C CB  . VAL A 1 59  ? 39.443 45.784 60.734 1.00 22.41  ? 61  VAL A CB  1 
ATOM 482  C CG1 . VAL A 1 59  ? 39.024 44.364 61.076 1.00 13.76  ? 61  VAL A CG1 1 
ATOM 483  C CG2 . VAL A 1 59  ? 38.427 46.814 61.236 1.00 16.40  ? 61  VAL A CG2 1 
ATOM 484  N N   . TYR A 1 60  ? 42.478 44.222 61.258 1.00 2.00   ? 62  TYR A N   1 
ATOM 485  C CA  . TYR A 1 60  ? 43.508 43.431 60.612 1.00 2.10   ? 62  TYR A CA  1 
ATOM 486  C C   . TYR A 1 60  ? 42.806 42.107 60.412 1.00 17.22  ? 62  TYR A C   1 
ATOM 487  O O   . TYR A 1 60  ? 42.426 41.407 61.370 1.00 11.40  ? 62  TYR A O   1 
ATOM 488  C CB  . TYR A 1 60  ? 44.682 43.237 61.512 1.00 2.00   ? 62  TYR A CB  1 
ATOM 489  C CG  . TYR A 1 60  ? 45.467 44.536 61.659 1.00 14.05  ? 62  TYR A CG  1 
ATOM 490  C CD1 . TYR A 1 60  ? 46.285 44.961 60.610 1.00 5.63   ? 62  TYR A CD1 1 
ATOM 491  C CD2 . TYR A 1 60  ? 45.305 45.360 62.791 1.00 18.70  ? 62  TYR A CD2 1 
ATOM 492  C CE1 . TYR A 1 60  ? 46.920 46.203 60.672 1.00 14.25  ? 62  TYR A CE1 1 
ATOM 493  C CE2 . TYR A 1 60  ? 45.943 46.614 62.855 1.00 22.44  ? 62  TYR A CE2 1 
ATOM 494  C CZ  . TYR A 1 60  ? 46.749 47.030 61.792 1.00 22.30  ? 62  TYR A CZ  1 
ATOM 495  O OH  . TYR A 1 60  ? 47.374 48.272 61.820 1.00 20.05  ? 62  TYR A OH  1 
ATOM 496  N N   . LEU A 1 61  ? 42.603 41.822 59.128 1.00 14.09  ? 63  LEU A N   1 
ATOM 497  C CA  . LEU A 1 61  ? 41.891 40.666 58.668 1.00 3.43   ? 63  LEU A CA  1 
ATOM 498  C C   . LEU A 1 61  ? 42.685 39.388 58.832 1.00 7.50   ? 63  LEU A C   1 
ATOM 499  O O   . LEU A 1 61  ? 43.910 39.421 58.752 1.00 21.28  ? 63  LEU A O   1 
ATOM 500  C CB  . LEU A 1 61  ? 41.500 40.922 57.200 1.00 2.00   ? 63  LEU A CB  1 
ATOM 501  C CG  . LEU A 1 61  ? 40.127 41.531 56.896 1.00 2.00   ? 63  LEU A CG  1 
ATOM 502  C CD1 . LEU A 1 61  ? 39.413 41.946 58.182 1.00 2.60   ? 63  LEU A CD1 1 
ATOM 503  C CD2 . LEU A 1 61  ? 40.304 42.770 56.086 1.00 2.39   ? 63  LEU A CD2 1 
ATOM 504  N N   . LYS A 1 62  ? 41.996 38.264 59.083 1.00 11.72  ? 64  LYS A N   1 
ATOM 505  C CA  . LYS A 1 62  ? 42.610 36.964 59.344 1.00 15.34  ? 64  LYS A CA  1 
ATOM 506  C C   . LYS A 1 62  ? 42.268 35.952 58.271 1.00 16.48  ? 64  LYS A C   1 
ATOM 507  O O   . LYS A 1 62  ? 41.123 35.880 57.802 1.00 29.06  ? 64  LYS A O   1 
ATOM 508  C CB  . LYS A 1 62  ? 42.132 36.408 60.665 1.00 15.15  ? 64  LYS A CB  1 
ATOM 509  C CG  . LYS A 1 62  ? 42.755 35.112 61.132 1.00 9.94   ? 64  LYS A CG  1 
ATOM 510  C CD  . LYS A 1 62  ? 42.294 34.956 62.560 1.00 14.47  ? 64  LYS A CD  1 
ATOM 511  C CE  . LYS A 1 62  ? 42.926 33.757 63.195 1.00 19.10  ? 64  LYS A CE  1 
ATOM 512  N NZ  . LYS A 1 62  ? 42.257 33.466 64.448 1.00 53.88  ? 64  LYS A NZ  1 
ATOM 513  N N   . TYR A 1 63  ? 43.238 35.157 57.830 1.00 13.44  ? 65  TYR A N   1 
ATOM 514  C CA  . TYR A 1 63  ? 42.903 34.168 56.830 1.00 12.05  ? 65  TYR A CA  1 
ATOM 515  C C   . TYR A 1 63  ? 43.361 32.797 57.353 1.00 22.19  ? 65  TYR A C   1 
ATOM 516  O O   . TYR A 1 63  ? 44.212 32.674 58.240 1.00 11.28  ? 65  TYR A O   1 
ATOM 517  C CB  . TYR A 1 63  ? 43.559 34.621 55.536 1.00 4.57   ? 65  TYR A CB  1 
ATOM 518  C CG  . TYR A 1 63  ? 42.934 35.894 55.003 1.00 2.18   ? 65  TYR A CG  1 
ATOM 519  C CD1 . TYR A 1 63  ? 43.305 37.134 55.501 1.00 12.30  ? 65  TYR A CD1 1 
ATOM 520  C CD2 . TYR A 1 63  ? 41.939 35.836 54.045 1.00 23.34  ? 65  TYR A CD2 1 
ATOM 521  C CE1 . TYR A 1 63  ? 42.690 38.308 55.071 1.00 17.47  ? 65  TYR A CE1 1 
ATOM 522  C CE2 . TYR A 1 63  ? 41.307 36.998 53.594 1.00 19.13  ? 65  TYR A CE2 1 
ATOM 523  C CZ  . TYR A 1 63  ? 41.688 38.221 54.115 1.00 15.72  ? 65  TYR A CZ  1 
ATOM 524  O OH  . TYR A 1 63  ? 41.051 39.360 53.688 1.00 31.42  ? 65  TYR A OH  1 
ATOM 525  N N   . GLY A 1 64  ? 42.634 31.760 56.968 1.00 25.60  ? 66  GLY A N   1 
ATOM 526  C CA  . GLY A 1 64  ? 42.932 30.428 57.419 1.00 34.60  ? 66  GLY A CA  1 
ATOM 527  C C   . GLY A 1 64  ? 43.876 29.765 56.436 1.00 51.35  ? 66  GLY A C   1 
ATOM 528  O O   . GLY A 1 64  ? 44.427 30.407 55.534 1.00 55.96  ? 66  GLY A O   1 
ATOM 529  N N   . PRO A 1 65  ? 44.064 28.445 56.554 1.00 62.01  ? 67  PRO A N   1 
ATOM 530  C CA  . PRO A 1 65  ? 45.152 27.711 55.913 1.00 59.92  ? 67  PRO A CA  1 
ATOM 531  C C   . PRO A 1 65  ? 45.043 27.662 54.398 1.00 58.99  ? 67  PRO A C   1 
ATOM 532  O O   . PRO A 1 65  ? 43.974 27.875 53.822 1.00 60.48  ? 67  PRO A O   1 
ATOM 533  C CB  . PRO A 1 65  ? 45.088 26.347 56.552 1.00 62.06  ? 67  PRO A CB  1 
ATOM 534  C CG  . PRO A 1 65  ? 44.147 26.501 57.734 1.00 62.72  ? 67  PRO A CG  1 
ATOM 535  C CD  . PRO A 1 65  ? 43.148 27.520 57.223 1.00 60.00  ? 67  PRO A CD  1 
ATOM 536  N N   . ARG A 1 66  ? 46.164 27.375 53.739 1.00 67.68  ? 68  ARG A N   1 
ATOM 537  C CA  . ARG A 1 66  ? 46.203 27.231 52.292 1.00 77.96  ? 68  ARG A CA  1 
ATOM 538  C C   . ARG A 1 66  ? 45.278 26.104 51.913 1.00 74.72  ? 68  ARG A C   1 
ATOM 539  O O   . ARG A 1 66  ? 45.017 25.142 52.655 1.00 74.89  ? 68  ARG A O   1 
ATOM 540  C CB  . ARG A 1 66  ? 47.565 26.842 51.751 1.00 100.27 ? 68  ARG A CB  1 
ATOM 541  C CG  . ARG A 1 66  ? 48.663 27.874 51.874 1.00 132.30 ? 68  ARG A CG  1 
ATOM 542  C CD  . ARG A 1 66  ? 49.943 27.237 51.350 1.00 154.05 ? 68  ARG A CD  1 
ATOM 543  N NE  . ARG A 1 66  ? 51.076 28.132 51.511 1.00 172.78 ? 68  ARG A NE  1 
ATOM 544  C CZ  . ARG A 1 66  ? 51.971 28.336 50.539 1.00 181.90 ? 68  ARG A CZ  1 
ATOM 545  N NH1 . ARG A 1 66  ? 51.886 27.729 49.353 1.00 187.42 ? 68  ARG A NH1 1 
ATOM 546  N NH2 . ARG A 1 66  ? 52.973 29.182 50.764 1.00 188.26 ? 68  ARG A NH2 1 
ATOM 547  N N   . ARG A 1 67  ? 44.780 26.259 50.714 1.00 70.39  ? 69  ARG A N   1 
ATOM 548  C CA  . ARG A 1 67  ? 43.863 25.273 50.278 1.00 69.64  ? 69  ARG A CA  1 
ATOM 549  C C   . ARG A 1 67  ? 44.540 24.013 49.778 1.00 72.80  ? 69  ARG A C   1 
ATOM 550  O O   . ARG A 1 67  ? 45.678 23.936 49.307 1.00 68.50  ? 69  ARG A O   1 
ATOM 551  C CB  . ARG A 1 67  ? 42.980 25.949 49.260 1.00 61.55  ? 69  ARG A CB  1 
ATOM 552  C CG  . ARG A 1 67  ? 41.891 26.578 50.105 1.00 50.64  ? 69  ARG A CG  1 
ATOM 553  C CD  . ARG A 1 67  ? 40.746 27.015 49.242 1.00 52.15  ? 69  ARG A CD  1 
ATOM 554  N NE  . ARG A 1 67  ? 40.661 28.460 49.235 1.00 58.47  ? 69  ARG A NE  1 
ATOM 555  C CZ  . ARG A 1 67  ? 39.535 29.085 48.915 1.00 63.80  ? 69  ARG A CZ  1 
ATOM 556  N NH1 . ARG A 1 67  ? 38.441 28.395 48.575 1.00 66.06  ? 69  ARG A NH1 1 
ATOM 557  N NH2 . ARG A 1 67  ? 39.492 30.418 49.000 1.00 66.82  ? 69  ARG A NH2 1 
ATOM 558  N N   . GLN A 1 68  ? 43.759 23.012 50.161 1.00 82.10  ? 70  GLN A N   1 
ATOM 559  C CA  . GLN A 1 68  ? 43.955 21.591 49.923 1.00 93.34  ? 70  GLN A CA  1 
ATOM 560  C C   . GLN A 1 68  ? 44.235 21.252 48.432 1.00 96.78  ? 70  GLN A C   1 
ATOM 561  O O   . GLN A 1 68  ? 43.401 20.645 47.758 1.00 96.94  ? 70  GLN A O   1 
ATOM 562  C CB  . GLN A 1 68  ? 42.649 20.939 50.542 1.00 104.33 ? 70  GLN A CB  1 
ATOM 563  C CG  . GLN A 1 68  ? 42.360 21.215 52.082 1.00 116.18 ? 70  GLN A CG  1 
ATOM 564  C CD  . GLN A 1 68  ? 40.941 21.084 52.708 1.00 113.74 ? 70  GLN A CD  1 
ATOM 565  O OE1 . GLN A 1 68  ? 40.773 21.054 53.934 1.00 112.88 ? 70  GLN A OE1 1 
ATOM 566  N NE2 . GLN A 1 68  ? 39.818 21.090 52.003 1.00 112.61 ? 70  GLN A NE2 1 
ATOM 567  N N   . GLY A 1 69  ? 45.420 21.636 47.918 1.00 101.46 ? 71  GLY A N   1 
ATOM 568  C CA  . GLY A 1 69  ? 45.855 21.438 46.528 1.00 102.28 ? 71  GLY A CA  1 
ATOM 569  C C   . GLY A 1 69  ? 46.091 22.794 45.815 1.00 100.77 ? 71  GLY A C   1 
ATOM 570  O O   . GLY A 1 69  ? 45.337 23.712 46.138 1.00 105.52 ? 71  GLY A O   1 
ATOM 571  N N   . PRO A 1 70  ? 47.075 23.049 44.891 1.00 90.31  ? 72  PRO A N   1 
ATOM 572  C CA  . PRO A 1 70  ? 47.354 24.331 44.215 1.00 75.35  ? 72  PRO A CA  1 
ATOM 573  C C   . PRO A 1 70  ? 46.259 25.219 43.650 1.00 71.40  ? 72  PRO A C   1 
ATOM 574  O O   . PRO A 1 70  ? 45.938 25.327 42.461 1.00 75.32  ? 72  PRO A O   1 
ATOM 575  C CB  . PRO A 1 70  ? 48.366 23.989 43.154 1.00 66.57  ? 72  PRO A CB  1 
ATOM 576  C CG  . PRO A 1 70  ? 49.248 23.137 44.000 1.00 81.29  ? 72  PRO A CG  1 
ATOM 577  C CD  . PRO A 1 70  ? 48.222 22.185 44.638 1.00 93.06  ? 72  PRO A CD  1 
ATOM 578  N N   . ASP A 1 71  ? 45.786 25.878 44.694 1.00 58.67  ? 73  ASP A N   1 
ATOM 579  C CA  . ASP A 1 71  ? 44.819 26.927 44.699 1.00 41.81  ? 73  ASP A CA  1 
ATOM 580  C C   . ASP A 1 71  ? 45.475 27.850 45.740 1.00 42.19  ? 73  ASP A C   1 
ATOM 581  O O   . ASP A 1 71  ? 45.798 27.406 46.848 1.00 49.50  ? 73  ASP A O   1 
ATOM 582  C CB  . ASP A 1 71  ? 43.494 26.329 45.141 1.00 34.17  ? 73  ASP A CB  1 
ATOM 583  C CG  . ASP A 1 71  ? 42.490 27.421 45.396 1.00 40.52  ? 73  ASP A CG  1 
ATOM 584  O OD1 . ASP A 1 71  ? 42.260 28.256 44.537 1.00 46.51  ? 73  ASP A OD1 1 
ATOM 585  O OD2 . ASP A 1 71  ? 41.943 27.471 46.478 1.00 59.51  ? 73  ASP A OD2 1 
ATOM 586  N N   . PRO A 1 72  ? 45.816 29.117 45.425 1.00 38.79  ? 74  PRO A N   1 
ATOM 587  C CA  . PRO A 1 72  ? 46.664 29.997 46.244 1.00 27.31  ? 74  PRO A CA  1 
ATOM 588  C C   . PRO A 1 72  ? 45.890 30.587 47.390 1.00 29.36  ? 74  PRO A C   1 
ATOM 589  O O   . PRO A 1 72  ? 46.422 30.835 48.486 1.00 32.20  ? 74  PRO A O   1 
ATOM 590  C CB  . PRO A 1 72  ? 47.150 31.077 45.333 1.00 31.84  ? 74  PRO A CB  1 
ATOM 591  C CG  . PRO A 1 72  ? 46.913 30.494 43.961 1.00 30.14  ? 74  PRO A CG  1 
ATOM 592  C CD  . PRO A 1 72  ? 45.599 29.754 44.138 1.00 40.80  ? 74  PRO A CD  1 
ATOM 593  N N   . ARG A 1 73  ? 44.608 30.817 47.031 1.00 16.22  ? 75  ARG A N   1 
ATOM 594  C CA  . ARG A 1 73  ? 43.650 31.408 47.935 1.00 11.52  ? 75  ARG A CA  1 
ATOM 595  C C   . ARG A 1 73  ? 43.577 30.722 49.288 1.00 6.79   ? 75  ARG A C   1 
ATOM 596  O O   . ARG A 1 73  ? 43.435 29.509 49.336 1.00 18.10  ? 75  ARG A O   1 
ATOM 597  C CB  . ARG A 1 73  ? 42.337 31.373 47.271 1.00 7.62   ? 75  ARG A CB  1 
ATOM 598  C CG  . ARG A 1 73  ? 42.306 32.219 46.022 1.00 10.92  ? 75  ARG A CG  1 
ATOM 599  C CD  . ARG A 1 73  ? 40.884 32.111 45.581 1.00 21.95  ? 75  ARG A CD  1 
ATOM 600  N NE  . ARG A 1 73  ? 40.606 30.708 45.295 1.00 51.53  ? 75  ARG A NE  1 
ATOM 601  C CZ  . ARG A 1 73  ? 39.395 30.164 45.426 1.00 49.41  ? 75  ARG A CZ  1 
ATOM 602  N NH1 . ARG A 1 73  ? 38.359 30.899 45.831 1.00 61.12  ? 75  ARG A NH1 1 
ATOM 603  N NH2 . ARG A 1 73  ? 39.225 28.870 45.155 1.00 34.19  ? 75  ARG A NH2 1 
ATOM 604  N N   . PRO A 1 74  ? 43.750 31.399 50.415 1.00 14.62  ? 76  PRO A N   1 
ATOM 605  C CA  . PRO A 1 74  ? 43.565 30.810 51.720 1.00 6.09   ? 76  PRO A CA  1 
ATOM 606  C C   . PRO A 1 74  ? 42.097 30.529 51.888 1.00 15.27  ? 76  PRO A C   1 
ATOM 607  O O   . PRO A 1 74  ? 41.140 31.043 51.279 1.00 19.38  ? 76  PRO A O   1 
ATOM 608  C CB  . PRO A 1 74  ? 44.045 31.833 52.695 1.00 10.28  ? 76  PRO A CB  1 
ATOM 609  C CG  . PRO A 1 74  ? 44.920 32.749 51.868 1.00 23.34  ? 76  PRO A CG  1 
ATOM 610  C CD  . PRO A 1 74  ? 44.212 32.776 50.526 1.00 12.96  ? 76  PRO A CD  1 
ATOM 611  N N   . GLU A 1 75  ? 41.956 29.669 52.840 1.00 19.28  ? 77  GLU A N   1 
ATOM 612  C CA  . GLU A 1 75  ? 40.642 29.357 53.277 1.00 15.35  ? 77  GLU A CA  1 
ATOM 613  C C   . GLU A 1 75  ? 40.329 30.588 54.154 1.00 18.77  ? 77  GLU A C   1 
ATOM 614  O O   . GLU A 1 75  ? 41.178 31.116 54.889 1.00 12.69  ? 77  GLU A O   1 
ATOM 615  C CB  . GLU A 1 75  ? 40.773 28.047 54.027 1.00 19.60  ? 77  GLU A CB  1 
ATOM 616  C CG  . GLU A 1 75  ? 39.642 27.081 53.776 1.00 43.88  ? 77  GLU A CG  1 
ATOM 617  C CD  . GLU A 1 75  ? 39.417 26.169 54.971 1.00 60.28  ? 77  GLU A CD  1 
ATOM 618  O OE1 . GLU A 1 75  ? 40.052 25.113 55.001 1.00 68.53  ? 77  GLU A OE1 1 
ATOM 619  O OE2 . GLU A 1 75  ? 38.620 26.524 55.855 1.00 60.81  ? 77  GLU A OE2 1 
ATOM 620  N N   . GLN A 1 76  ? 39.127 31.123 53.973 1.00 15.95  ? 78  GLN A N   1 
ATOM 621  C CA  . GLN A 1 76  ? 38.557 32.195 54.785 1.00 14.53  ? 78  GLN A CA  1 
ATOM 622  C C   . GLN A 1 76  ? 38.341 31.889 56.264 1.00 16.70  ? 78  GLN A C   1 
ATOM 623  O O   . GLN A 1 76  ? 38.219 30.709 56.587 1.00 25.26  ? 78  GLN A O   1 
ATOM 624  C CB  . GLN A 1 76  ? 37.216 32.572 54.235 1.00 2.00   ? 78  GLN A CB  1 
ATOM 625  C CG  . GLN A 1 76  ? 37.278 33.322 52.917 1.00 5.67   ? 78  GLN A CG  1 
ATOM 626  C CD  . GLN A 1 76  ? 37.811 34.731 53.010 1.00 13.94  ? 78  GLN A CD  1 
ATOM 627  O OE1 . GLN A 1 76  ? 38.125 35.284 54.081 1.00 33.93  ? 78  GLN A OE1 1 
ATOM 628  N NE2 . GLN A 1 76  ? 37.904 35.281 51.817 1.00 2.00   ? 78  GLN A NE2 1 
ATOM 629  N N   . VAL A 1 77  ? 38.245 32.874 57.180 1.00 20.34  ? 79  VAL A N   1 
ATOM 630  C CA  . VAL A 1 77  ? 37.762 32.619 58.556 1.00 8.21   ? 79  VAL A CA  1 
ATOM 631  C C   . VAL A 1 77  ? 36.318 33.148 58.799 1.00 19.31  ? 79  VAL A C   1 
ATOM 632  O O   . VAL A 1 77  ? 35.492 32.504 59.469 1.00 19.53  ? 79  VAL A O   1 
ATOM 633  C CB  . VAL A 1 77  ? 38.742 33.257 59.510 1.00 2.06   ? 79  VAL A CB  1 
ATOM 634  C CG1 . VAL A 1 77  ? 38.298 33.336 60.938 1.00 11.32  ? 79  VAL A CG1 1 
ATOM 635  C CG2 . VAL A 1 77  ? 39.888 32.324 59.564 1.00 26.53  ? 79  VAL A CG2 1 
ATOM 636  N N   . ILE A 1 78  ? 35.945 34.309 58.231 1.00 12.35  ? 80  ILE A N   1 
ATOM 637  C CA  . ILE A 1 78  ? 34.620 34.868 58.384 1.00 5.91   ? 80  ILE A CA  1 
ATOM 638  C C   . ILE A 1 78  ? 33.917 34.300 57.210 1.00 6.95   ? 80  ILE A C   1 
ATOM 639  O O   . ILE A 1 78  ? 34.244 34.654 56.082 1.00 11.77  ? 80  ILE A O   1 
ATOM 640  C CB  . ILE A 1 78  ? 34.664 36.408 58.306 1.00 10.58  ? 80  ILE A CB  1 
ATOM 641  C CG1 . ILE A 1 78  ? 34.737 36.920 59.727 1.00 21.79  ? 80  ILE A CG1 1 
ATOM 642  C CG2 . ILE A 1 78  ? 33.421 37.028 57.675 1.00 11.43  ? 80  ILE A CG2 1 
ATOM 643  C CD1 . ILE A 1 78  ? 35.198 38.396 59.690 1.00 11.66  ? 80  ILE A CD1 1 
ATOM 644  N N   . HIS A 1 79  ? 33.020 33.369 57.419 1.00 19.66  ? 81  HIS A N   1 
ATOM 645  C CA  . HIS A 1 79  ? 32.291 32.846 56.277 1.00 19.89  ? 81  HIS A CA  1 
ATOM 646  C C   . HIS A 1 79  ? 31.023 33.660 56.018 1.00 18.71  ? 81  HIS A C   1 
ATOM 647  O O   . HIS A 1 79  ? 30.676 33.948 54.860 1.00 16.01  ? 81  HIS A O   1 
ATOM 648  C CB  . HIS A 1 79  ? 31.983 31.351 56.542 1.00 22.34  ? 81  HIS A CB  1 
ATOM 649  C CG  . HIS A 1 79  ? 33.255 30.551 56.773 1.00 19.87  ? 81  HIS A CG  1 
ATOM 650  N ND1 . HIS A 1 79  ? 33.762 30.222 57.959 1.00 28.67  ? 81  HIS A ND1 1 
ATOM 651  C CD2 . HIS A 1 79  ? 34.116 30.086 55.796 1.00 12.43  ? 81  HIS A CD2 1 
ATOM 652  C CE1 . HIS A 1 79  ? 34.898 29.577 57.754 1.00 28.51  ? 81  HIS A CE1 1 
ATOM 653  N NE2 . HIS A 1 79  ? 35.106 29.499 56.452 1.00 25.89  ? 81  HIS A NE2 1 
ATOM 654  N N   . HIS A 1 80  ? 30.327 34.087 57.084 1.00 21.11  ? 82  HIS A N   1 
ATOM 655  C CA  . HIS A 1 80  ? 29.040 34.779 56.997 1.00 22.14  ? 82  HIS A CA  1 
ATOM 656  C C   . HIS A 1 80  ? 29.017 35.816 58.091 1.00 19.68  ? 82  HIS A C   1 
ATOM 657  O O   . HIS A 1 80  ? 29.180 35.411 59.238 1.00 24.67  ? 82  HIS A O   1 
ATOM 658  C CB  . HIS A 1 80  ? 27.972 33.708 57.186 1.00 23.35  ? 82  HIS A CB  1 
ATOM 659  C CG  . HIS A 1 80  ? 26.521 34.020 57.549 1.00 19.45  ? 82  HIS A CG  1 
ATOM 660  N ND1 . HIS A 1 80  ? 25.450 34.040 56.763 1.00 20.98  ? 82  HIS A ND1 1 
ATOM 661  C CD2 . HIS A 1 80  ? 26.070 34.173 58.833 1.00 24.50  ? 82  HIS A CD2 1 
ATOM 662  C CE1 . HIS A 1 80  ? 24.391 34.174 57.503 1.00 17.09  ? 82  HIS A CE1 1 
ATOM 663  N NE2 . HIS A 1 80  ? 24.779 34.250 58.750 1.00 26.45  ? 82  HIS A NE2 1 
ATOM 664  N N   . ILE A 1 81  ? 28.800 37.099 57.809 1.00 14.96  ? 83  ILE A N   1 
ATOM 665  C CA  . ILE A 1 81  ? 28.745 38.131 58.841 1.00 12.20  ? 83  ILE A CA  1 
ATOM 666  C C   . ILE A 1 81  ? 27.471 38.901 58.449 1.00 14.74  ? 83  ILE A C   1 
ATOM 667  O O   . ILE A 1 81  ? 27.357 39.331 57.289 1.00 17.79  ? 83  ILE A O   1 
ATOM 668  C CB  . ILE A 1 81  ? 30.131 38.957 58.787 1.00 2.00   ? 83  ILE A CB  1 
ATOM 669  C CG1 . ILE A 1 81  ? 30.037 40.173 59.670 1.00 5.33   ? 83  ILE A CG1 1 
ATOM 670  C CG2 . ILE A 1 81  ? 30.463 39.507 57.415 1.00 2.18   ? 83  ILE A CG2 1 
ATOM 671  C CD1 . ILE A 1 81  ? 30.134 39.972 61.185 1.00 20.36  ? 83  ILE A CD1 1 
ATOM 672  N N   . ARG A 1 82  ? 26.412 38.995 59.275 1.00 17.67  ? 84  ARG A N   1 
ATOM 673  C CA  . ARG A 1 82  ? 25.222 39.740 58.843 1.00 20.32  ? 84  ARG A CA  1 
ATOM 674  C C   . ARG A 1 82  ? 24.351 40.392 59.887 1.00 20.07  ? 84  ARG A C   1 
ATOM 675  O O   . ARG A 1 82  ? 24.178 39.784 60.944 1.00 27.79  ? 84  ARG A O   1 
ATOM 676  C CB  . ARG A 1 82  ? 24.305 38.877 58.054 1.00 28.18  ? 84  ARG A CB  1 
ATOM 677  C CG  . ARG A 1 82  ? 23.640 37.770 58.802 1.00 32.51  ? 84  ARG A CG  1 
ATOM 678  C CD  . ARG A 1 82  ? 22.395 37.488 58.020 1.00 34.23  ? 84  ARG A CD  1 
ATOM 679  N NE  . ARG A 1 82  ? 21.293 37.389 58.944 1.00 49.50  ? 84  ARG A NE  1 
ATOM 680  C CZ  . ARG A 1 82  ? 20.119 36.908 58.552 1.00 59.74  ? 84  ARG A CZ  1 
ATOM 681  N NH1 . ARG A 1 82  ? 19.926 36.494 57.288 1.00 68.80  ? 84  ARG A NH1 1 
ATOM 682  N NH2 . ARG A 1 82  ? 19.129 36.864 59.448 1.00 58.97  ? 84  ARG A NH2 1 
ATOM 683  N N   . ARG A 1 83  ? 23.818 41.600 59.616 1.00 25.14  ? 85  ARG A N   1 
ATOM 684  C CA  . ARG A 1 83  ? 22.991 42.337 60.580 1.00 18.84  ? 85  ARG A CA  1 
ATOM 685  C C   . ARG A 1 83  ? 21.641 41.690 60.779 1.00 16.82  ? 85  ARG A C   1 
ATOM 686  O O   . ARG A 1 83  ? 21.083 41.049 59.884 1.00 16.54  ? 85  ARG A O   1 
ATOM 687  C CB  . ARG A 1 83  ? 22.669 43.732 60.141 1.00 6.11   ? 85  ARG A CB  1 
ATOM 688  C CG  . ARG A 1 83  ? 23.654 44.782 60.517 1.00 14.42  ? 85  ARG A CG  1 
ATOM 689  C CD  . ARG A 1 83  ? 22.983 45.996 61.148 1.00 11.61  ? 85  ARG A CD  1 
ATOM 690  N NE  . ARG A 1 83  ? 22.780 45.832 62.586 1.00 22.25  ? 85  ARG A NE  1 
ATOM 691  C CZ  . ARG A 1 83  ? 22.492 46.872 63.384 1.00 31.12  ? 85  ARG A CZ  1 
ATOM 692  N NH1 . ARG A 1 83  ? 22.366 48.085 62.897 1.00 13.17  ? 85  ARG A NH1 1 
ATOM 693  N NH2 . ARG A 1 83  ? 22.360 46.733 64.704 1.00 41.85  ? 85  ARG A NH2 1 
ATOM 694  N N   . ILE A 1 84  ? 21.109 41.853 61.957 1.00 6.53   ? 86  ILE A N   1 
ATOM 695  C CA  . ILE A 1 84  ? 19.776 41.353 62.207 1.00 11.42  ? 86  ILE A CA  1 
ATOM 696  C C   . ILE A 1 84  ? 18.888 42.547 62.594 1.00 14.46  ? 86  ILE A C   1 
ATOM 697  O O   . ILE A 1 84  ? 17.989 42.952 61.858 1.00 20.79  ? 86  ILE A O   1 
ATOM 698  C CB  . ILE A 1 84  ? 19.933 40.262 63.307 1.00 16.02  ? 86  ILE A CB  1 
ATOM 699  C CG1 . ILE A 1 84  ? 20.790 39.076 62.780 1.00 7.19   ? 86  ILE A CG1 1 
ATOM 700  C CG2 . ILE A 1 84  ? 18.550 39.836 63.765 1.00 12.77  ? 86  ILE A CG2 1 
ATOM 701  C CD1 . ILE A 1 84  ? 21.166 38.054 63.874 1.00 11.29  ? 86  ILE A CD1 1 
ATOM 702  N N   . SER A 1 85  ? 19.096 43.102 63.786 1.00 4.74   ? 87  SER A N   1 
ATOM 703  C CA  . SER A 1 85  ? 18.459 44.299 64.258 1.00 2.00   ? 87  SER A CA  1 
ATOM 704  C C   . SER A 1 85  ? 18.858 45.429 63.352 1.00 5.64   ? 87  SER A C   1 
ATOM 705  O O   . SER A 1 85  ? 19.948 45.324 62.788 1.00 7.08   ? 87  SER A O   1 
ATOM 706  C CB  . SER A 1 85  ? 18.983 44.577 65.544 1.00 2.00   ? 87  SER A CB  1 
ATOM 707  O OG  . SER A 1 85  ? 18.213 45.534 66.172 1.00 4.62   ? 87  SER A OG  1 
ATOM 708  N N   . LYS A 1 86  ? 18.037 46.478 63.157 1.00 15.40  ? 88  LYS A N   1 
ATOM 709  C CA  . LYS A 1 86  ? 18.451 47.677 62.414 1.00 15.09  ? 88  LYS A CA  1 
ATOM 710  C C   . LYS A 1 86  ? 17.494 48.853 62.362 1.00 17.24  ? 88  LYS A C   1 
ATOM 711  O O   . LYS A 1 86  ? 16.315 48.665 62.619 1.00 25.17  ? 88  LYS A O   1 
ATOM 712  C CB  . LYS A 1 86  ? 18.770 47.372 60.985 1.00 2.00   ? 88  LYS A CB  1 
ATOM 713  C CG  . LYS A 1 86  ? 17.695 46.726 60.211 1.00 18.28  ? 88  LYS A CG  1 
ATOM 714  C CD  . LYS A 1 86  ? 18.374 46.242 58.946 1.00 41.20  ? 88  LYS A CD  1 
ATOM 715  C CE  . LYS A 1 86  ? 17.676 44.985 58.430 1.00 62.93  ? 88  LYS A CE  1 
ATOM 716  N NZ  . LYS A 1 86  ? 17.607 43.942 59.446 1.00 84.51  ? 88  LYS A NZ  1 
ATOM 717  N N   . PRO A 1 87  ? 17.900 50.100 62.092 1.00 20.81  ? 89  PRO A N   1 
ATOM 718  C CA  . PRO A 1 87  ? 17.082 51.126 61.498 1.00 26.62  ? 89  PRO A CA  1 
ATOM 719  C C   . PRO A 1 87  ? 15.779 50.726 60.828 1.00 29.90  ? 89  PRO A C   1 
ATOM 720  O O   . PRO A 1 87  ? 15.666 50.273 59.685 1.00 24.86  ? 89  PRO A O   1 
ATOM 721  C CB  . PRO A 1 87  ? 18.042 51.847 60.541 1.00 21.33  ? 89  PRO A CB  1 
ATOM 722  C CG  . PRO A 1 87  ? 19.220 51.984 61.456 1.00 23.33  ? 89  PRO A CG  1 
ATOM 723  C CD  . PRO A 1 87  ? 19.265 50.603 62.128 1.00 24.48  ? 89  PRO A CD  1 
ATOM 724  N N   . GLY A 1 88  ? 14.762 50.795 61.658 1.00 32.18  ? 90  GLY A N   1 
ATOM 725  C CA  . GLY A 1 88  ? 13.457 50.716 61.052 1.00 36.62  ? 90  GLY A CA  1 
ATOM 726  C C   . GLY A 1 88  ? 12.810 49.419 61.347 1.00 37.44  ? 90  GLY A C   1 
ATOM 727  O O   . GLY A 1 88  ? 11.585 49.394 61.451 1.00 44.41  ? 90  GLY A O   1 
ATOM 728  N N   . ARG A 1 89  ? 13.644 48.402 61.507 1.00 30.15  ? 91  ARG A N   1 
ATOM 729  C CA  . ARG A 1 89  ? 13.152 47.113 61.817 1.00 23.28  ? 91  ARG A CA  1 
ATOM 730  C C   . ARG A 1 89  ? 14.160 46.571 62.854 1.00 10.96  ? 91  ARG A C   1 
ATOM 731  O O   . ARG A 1 89  ? 15.177 45.960 62.563 1.00 31.39  ? 91  ARG A O   1 
ATOM 732  C CB  . ARG A 1 89  ? 13.050 46.430 60.417 1.00 27.87  ? 91  ARG A CB  1 
ATOM 733  C CG  . ARG A 1 89  ? 11.654 45.808 60.030 1.00 51.35  ? 91  ARG A CG  1 
ATOM 734  C CD  . ARG A 1 89  ? 10.601 46.672 59.228 1.00 85.38  ? 91  ARG A CD  1 
ATOM 735  N NE  . ARG A 1 89  ? 9.233  46.077 59.154 1.00 115.74 ? 91  ARG A NE  1 
ATOM 736  C CZ  . ARG A 1 89  ? 8.058  46.704 58.819 1.00 117.49 ? 91  ARG A CZ  1 
ATOM 737  N NH1 . ARG A 1 89  ? 7.956  47.994 58.491 1.00 119.84 ? 91  ARG A NH1 1 
ATOM 738  N NH2 . ARG A 1 89  ? 6.900  46.033 58.857 1.00 110.07 ? 91  ARG A NH2 1 
ATOM 739  N N   . ARG A 1 90  ? 13.966 46.874 64.127 1.00 2.62   ? 92  ARG A N   1 
ATOM 740  C CA  . ARG A 1 90  ? 14.773 46.451 65.267 1.00 6.12   ? 92  ARG A CA  1 
ATOM 741  C C   . ARG A 1 90  ? 14.405 45.046 65.752 1.00 16.62  ? 92  ARG A C   1 
ATOM 742  O O   . ARG A 1 90  ? 13.230 44.699 65.665 1.00 26.80  ? 92  ARG A O   1 
ATOM 743  C CB  . ARG A 1 90  ? 14.545 47.340 66.475 1.00 5.78   ? 92  ARG A CB  1 
ATOM 744  C CG  . ARG A 1 90  ? 15.623 48.312 66.804 1.00 33.64  ? 92  ARG A CG  1 
ATOM 745  C CD  . ARG A 1 90  ? 15.724 49.303 65.698 1.00 44.14  ? 92  ARG A CD  1 
ATOM 746  N NE  . ARG A 1 90  ? 17.108 49.588 65.364 1.00 66.99  ? 92  ARG A NE  1 
ATOM 747  C CZ  . ARG A 1 90  ? 17.785 50.602 65.897 1.00 70.20  ? 92  ARG A CZ  1 
ATOM 748  N NH1 . ARG A 1 90  ? 17.240 51.425 66.795 1.00 79.68  ? 92  ARG A NH1 1 
ATOM 749  N NH2 . ARG A 1 90  ? 19.019 50.829 65.462 1.00 72.30  ? 92  ARG A NH2 1 
ATOM 750  N N   . VAL A 1 91  ? 15.309 44.251 66.365 1.00 20.35  ? 93  VAL A N   1 
ATOM 751  C CA  . VAL A 1 91  ? 15.056 42.925 66.948 1.00 13.20  ? 93  VAL A CA  1 
ATOM 752  C C   . VAL A 1 91  ? 15.692 42.789 68.332 1.00 20.04  ? 93  VAL A C   1 
ATOM 753  O O   . VAL A 1 91  ? 16.931 42.872 68.505 1.00 22.72  ? 93  VAL A O   1 
ATOM 754  C CB  . VAL A 1 91  ? 15.646 41.758 66.128 1.00 15.75  ? 93  VAL A CB  1 
ATOM 755  C CG1 . VAL A 1 91  ? 15.265 40.470 66.848 1.00 2.06   ? 93  VAL A CG1 1 
ATOM 756  C CG2 . VAL A 1 91  ? 15.176 41.755 64.684 1.00 2.00   ? 93  VAL A CG2 1 
ATOM 757  N N   . TYR A 1 92  ? 14.813 42.521 69.286 1.00 11.50  ? 94  TYR A N   1 
ATOM 758  C CA  . TYR A 1 92  ? 15.178 42.374 70.670 1.00 7.22   ? 94  TYR A CA  1 
ATOM 759  C C   . TYR A 1 92  ? 14.745 40.982 71.033 1.00 8.49   ? 94  TYR A C   1 
ATOM 760  O O   . TYR A 1 92  ? 13.815 40.424 70.453 1.00 24.33  ? 94  TYR A O   1 
ATOM 761  C CB  . TYR A 1 92  ? 14.431 43.373 71.523 1.00 2.92   ? 94  TYR A CB  1 
ATOM 762  C CG  . TYR A 1 92  ? 14.882 44.817 71.301 1.00 2.00   ? 94  TYR A CG  1 
ATOM 763  C CD1 . TYR A 1 92  ? 14.429 45.580 70.242 1.00 2.03   ? 94  TYR A CD1 1 
ATOM 764  C CD2 . TYR A 1 92  ? 15.826 45.349 72.134 1.00 6.16   ? 94  TYR A CD2 1 
ATOM 765  C CE1 . TYR A 1 92  ? 14.938 46.857 70.027 1.00 7.93   ? 94  TYR A CE1 1 
ATOM 766  C CE2 . TYR A 1 92  ? 16.352 46.610 71.932 1.00 5.08   ? 94  TYR A CE2 1 
ATOM 767  C CZ  . TYR A 1 92  ? 15.915 47.373 70.877 1.00 7.66   ? 94  TYR A CZ  1 
ATOM 768  O OH  . TYR A 1 92  ? 16.491 48.627 70.674 1.00 25.81  ? 94  TYR A OH  1 
ATOM 769  N N   . VAL A 1 93  ? 15.441 40.396 71.978 1.00 10.94  ? 95  VAL A N   1 
ATOM 770  C CA  . VAL A 1 93  ? 15.214 39.063 72.487 1.00 11.94  ? 95  VAL A CA  1 
ATOM 771  C C   . VAL A 1 93  ? 15.562 39.119 73.957 1.00 21.28  ? 95  VAL A C   1 
ATOM 772  O O   . VAL A 1 93  ? 16.446 39.891 74.336 1.00 19.98  ? 95  VAL A O   1 
ATOM 773  C CB  . VAL A 1 93  ? 16.124 37.963 71.914 1.00 22.97  ? 95  VAL A CB  1 
ATOM 774  C CG1 . VAL A 1 93  ? 15.627 37.593 70.515 1.00 11.96  ? 95  VAL A CG1 1 
ATOM 775  C CG2 . VAL A 1 93  ? 17.596 38.404 72.006 1.00 5.88   ? 95  VAL A CG2 1 
ATOM 776  N N   . GLY A 1 94  ? 14.914 38.296 74.781 1.00 16.00  ? 96  GLY A N   1 
ATOM 777  C CA  . GLY A 1 94  ? 15.147 38.289 76.210 1.00 18.29  ? 96  GLY A CA  1 
ATOM 778  C C   . GLY A 1 94  ? 16.035 37.099 76.511 1.00 22.63  ? 96  GLY A C   1 
ATOM 779  O O   . GLY A 1 94  ? 16.188 36.284 75.609 1.00 24.18  ? 96  GLY A O   1 
ATOM 780  N N   . VAL A 1 95  ? 16.556 36.914 77.734 1.00 29.39  ? 97  VAL A N   1 
ATOM 781  C CA  . VAL A 1 95  ? 17.466 35.811 78.077 1.00 36.50  ? 97  VAL A CA  1 
ATOM 782  C C   . VAL A 1 95  ? 17.004 34.423 77.665 1.00 39.86  ? 97  VAL A C   1 
ATOM 783  O O   . VAL A 1 95  ? 17.805 33.641 77.155 1.00 41.63  ? 97  VAL A O   1 
ATOM 784  C CB  . VAL A 1 95  ? 17.780 35.848 79.621 1.00 36.30  ? 97  VAL A CB  1 
ATOM 785  C CG1 . VAL A 1 95  ? 16.504 36.036 80.413 1.00 46.45  ? 97  VAL A CG1 1 
ATOM 786  C CG2 . VAL A 1 95  ? 18.447 34.550 80.088 1.00 36.21  ? 97  VAL A CG2 1 
ATOM 787  N N   . LYS A 1 96  ? 15.712 34.123 77.825 1.00 49.47  ? 98  LYS A N   1 
ATOM 788  C CA  . LYS A 1 96  ? 15.144 32.825 77.437 1.00 51.64  ? 98  LYS A CA  1 
ATOM 789  C C   . LYS A 1 96  ? 15.027 32.649 75.923 1.00 47.69  ? 98  LYS A C   1 
ATOM 790  O O   . LYS A 1 96  ? 15.021 31.536 75.401 1.00 54.27  ? 98  LYS A O   1 
ATOM 791  C CB  . LYS A 1 96  ? 13.735 32.636 78.046 1.00 58.34  ? 98  LYS A CB  1 
ATOM 792  C CG  . LYS A 1 96  ? 13.692 32.474 79.556 1.00 68.87  ? 98  LYS A CG  1 
ATOM 793  C CD  . LYS A 1 96  ? 14.414 31.181 79.938 1.00 80.08  ? 98  LYS A CD  1 
ATOM 794  C CE  . LYS A 1 96  ? 14.652 31.075 81.438 1.00 80.34  ? 98  LYS A CE  1 
ATOM 795  N NZ  . LYS A 1 96  ? 15.851 31.782 81.837 1.00 81.86  ? 98  LYS A NZ  1 
ATOM 796  N N   . GLU A 1 97  ? 14.952 33.757 75.193 1.00 33.64  ? 99  GLU A N   1 
ATOM 797  C CA  . GLU A 1 97  ? 14.723 33.712 73.773 1.00 25.86  ? 99  GLU A CA  1 
ATOM 798  C C   . GLU A 1 97  ? 16.006 33.775 72.915 1.00 29.43  ? 99  GLU A C   1 
ATOM 799  O O   . GLU A 1 97  ? 15.916 33.747 71.685 1.00 30.67  ? 99  GLU A O   1 
ATOM 800  C CB  . GLU A 1 97  ? 13.770 34.858 73.525 1.00 28.73  ? 99  GLU A CB  1 
ATOM 801  C CG  . GLU A 1 97  ? 12.799 34.666 72.378 1.00 34.59  ? 99  GLU A CG  1 
ATOM 802  C CD  . GLU A 1 97  ? 11.861 33.493 72.603 1.00 44.81  ? 99  GLU A CD  1 
ATOM 803  O OE1 . GLU A 1 97  ? 11.150 33.477 73.615 1.00 50.39  ? 99  GLU A OE1 1 
ATOM 804  O OE2 . GLU A 1 97  ? 11.857 32.599 71.756 1.00 39.90  ? 99  GLU A OE2 1 
ATOM 805  N N   . ILE A 1 98  ? 17.228 33.837 73.474 1.00 23.92  ? 100 ILE A N   1 
ATOM 806  C CA  . ILE A 1 98  ? 18.437 33.951 72.667 1.00 21.95  ? 100 ILE A CA  1 
ATOM 807  C C   . ILE A 1 98  ? 18.624 32.679 71.832 1.00 24.17  ? 100 ILE A C   1 
ATOM 808  O O   . ILE A 1 98  ? 18.804 31.576 72.335 1.00 30.41  ? 100 ILE A O   1 
ATOM 809  C CB  . ILE A 1 98  ? 19.717 34.148 73.533 1.00 21.54  ? 100 ILE A CB  1 
ATOM 810  C CG1 . ILE A 1 98  ? 19.599 35.231 74.547 1.00 18.76  ? 100 ILE A CG1 1 
ATOM 811  C CG2 . ILE A 1 98  ? 20.813 34.659 72.610 1.00 24.51  ? 100 ILE A CG2 1 
ATOM 812  C CD1 . ILE A 1 98  ? 20.817 35.116 75.417 1.00 3.92   ? 100 ILE A CD1 1 
ATOM 813  N N   . PRO A 1 99  ? 18.581 32.775 70.528 1.00 21.42  ? 101 PRO A N   1 
ATOM 814  C CA  . PRO A 1 99  ? 18.761 31.646 69.641 1.00 17.10  ? 101 PRO A CA  1 
ATOM 815  C C   . PRO A 1 99  ? 20.158 31.046 69.637 1.00 30.91  ? 101 PRO A C   1 
ATOM 816  O O   . PRO A 1 99  ? 21.179 31.708 69.886 1.00 32.19  ? 101 PRO A O   1 
ATOM 817  C CB  . PRO A 1 99  ? 18.370 32.219 68.339 1.00 12.12  ? 101 PRO A CB  1 
ATOM 818  C CG  . PRO A 1 99  ? 18.929 33.621 68.401 1.00 26.33  ? 101 PRO A CG  1 
ATOM 819  C CD  . PRO A 1 99  ? 18.523 34.037 69.800 1.00 19.81  ? 101 PRO A CD  1 
ATOM 820  N N   . ARG A 1 100 ? 20.222 29.763 69.318 1.00 36.23  ? 102 ARG A N   1 
ATOM 821  C CA  . ARG A 1 100 ? 21.520 29.174 69.115 1.00 45.81  ? 102 ARG A CA  1 
ATOM 822  C C   . ARG A 1 100 ? 21.672 29.420 67.631 1.00 45.92  ? 102 ARG A C   1 
ATOM 823  O O   . ARG A 1 100 ? 20.809 29.063 66.829 1.00 52.46  ? 102 ARG A O   1 
ATOM 824  C CB  . ARG A 1 100 ? 21.530 27.677 69.440 1.00 64.59  ? 102 ARG A CB  1 
ATOM 825  C CG  . ARG A 1 100 ? 21.383 27.442 70.950 1.00 99.91  ? 102 ARG A CG  1 
ATOM 826  C CD  . ARG A 1 100 ? 21.884 26.092 71.498 1.00 120.29 ? 102 ARG A CD  1 
ATOM 827  N NE  . ARG A 1 100 ? 21.840 26.098 72.966 1.00 134.84 ? 102 ARG A NE  1 
ATOM 828  C CZ  . ARG A 1 100 ? 22.575 25.284 73.742 1.00 137.68 ? 102 ARG A CZ  1 
ATOM 829  N NH1 . ARG A 1 100 ? 23.419 24.385 73.222 1.00 143.40 ? 102 ARG A NH1 1 
ATOM 830  N NH2 . ARG A 1 100 ? 22.477 25.388 75.068 1.00 130.30 ? 102 ARG A NH2 1 
ATOM 831  N N   . VAL A 1 101 ? 22.723 30.106 67.226 1.00 52.84  ? 103 VAL A N   1 
ATOM 832  C CA  . VAL A 1 101 ? 22.919 30.412 65.818 1.00 51.24  ? 103 VAL A CA  1 
ATOM 833  C C   . VAL A 1 101 ? 23.559 29.194 65.183 1.00 52.69  ? 103 VAL A C   1 
ATOM 834  O O   . VAL A 1 101 ? 24.353 28.530 65.850 1.00 61.70  ? 103 VAL A O   1 
ATOM 835  C CB  . VAL A 1 101 ? 23.817 31.644 65.706 1.00 45.58  ? 103 VAL A CB  1 
ATOM 836  C CG1 . VAL A 1 101 ? 24.154 31.955 64.266 1.00 45.54  ? 103 VAL A CG1 1 
ATOM 837  C CG2 . VAL A 1 101 ? 23.074 32.816 66.327 1.00 49.04  ? 103 VAL A CG2 1 
ATOM 838  N N   . ARG A 1 102 ? 23.175 28.879 63.939 1.00 50.06  ? 104 ARG A N   1 
ATOM 839  C CA  . ARG A 1 102 ? 23.682 27.758 63.141 1.00 47.48  ? 104 ARG A CA  1 
ATOM 840  C C   . ARG A 1 102 ? 24.013 26.523 63.971 1.00 49.52  ? 104 ARG A C   1 
ATOM 841  O O   . ARG A 1 102 ? 25.164 26.090 64.069 1.00 55.52  ? 104 ARG A O   1 
ATOM 842  C CB  . ARG A 1 102 ? 24.946 28.157 62.358 1.00 48.61  ? 104 ARG A CB  1 
ATOM 843  C CG  . ARG A 1 102 ? 25.218 27.258 61.150 1.00 40.57  ? 104 ARG A CG  1 
ATOM 844  C CD  . ARG A 1 102 ? 26.682 27.313 60.792 1.00 46.54  ? 104 ARG A CD  1 
ATOM 845  N NE  . ARG A 1 102 ? 26.972 26.577 59.570 1.00 51.66  ? 104 ARG A NE  1 
ATOM 846  C CZ  . ARG A 1 102 ? 28.228 26.189 59.264 1.00 55.82  ? 104 ARG A CZ  1 
ATOM 847  N NH1 . ARG A 1 102 ? 29.284 26.453 60.077 1.00 31.81  ? 104 ARG A NH1 1 
ATOM 848  N NH2 . ARG A 1 102 ? 28.428 25.559 58.094 1.00 42.90  ? 104 ARG A NH2 1 
ATOM 849  N N   . ARG A 1 103 ? 22.997 26.029 64.676 1.00 40.71  ? 105 ARG A N   1 
ATOM 850  C CA  . ARG A 1 103 ? 23.098 24.833 65.492 1.00 42.74  ? 105 ARG A CA  1 
ATOM 851  C C   . ARG A 1 103 ? 24.219 24.808 66.534 1.00 45.17  ? 105 ARG A C   1 
ATOM 852  O O   . ARG A 1 103 ? 24.614 23.737 66.998 1.00 54.36  ? 105 ARG A O   1 
ATOM 853  C CB  . ARG A 1 103 ? 23.228 23.621 64.560 1.00 46.77  ? 105 ARG A CB  1 
ATOM 854  C CG  . ARG A 1 103 ? 22.030 23.483 63.641 1.00 57.90  ? 105 ARG A CG  1 
ATOM 855  C CD  . ARG A 1 103 ? 22.069 22.186 62.863 1.00 75.61  ? 105 ARG A CD  1 
ATOM 856  N NE  . ARG A 1 103 ? 21.024 22.177 61.847 1.00 89.79  ? 105 ARG A NE  1 
ATOM 857  C CZ  . ARG A 1 103 ? 21.150 22.812 60.672 1.00 97.73  ? 105 ARG A CZ  1 
ATOM 858  N NH1 . ARG A 1 103 ? 22.249 23.507 60.351 1.00 102.41 ? 105 ARG A NH1 1 
ATOM 859  N NH2 . ARG A 1 103 ? 20.157 22.732 59.785 1.00 100.03 ? 105 ARG A NH2 1 
ATOM 860  N N   . GLY A 1 104 ? 24.723 25.964 66.977 1.00 40.72  ? 106 GLY A N   1 
ATOM 861  C CA  . GLY A 1 104 ? 25.826 26.017 67.927 1.00 33.92  ? 106 GLY A CA  1 
ATOM 862  C C   . GLY A 1 104 ? 27.148 26.306 67.218 1.00 33.65  ? 106 GLY A C   1 
ATOM 863  O O   . GLY A 1 104 ? 28.153 26.640 67.847 1.00 39.33  ? 106 GLY A O   1 
ATOM 864  N N   . LEU A 1 105 ? 27.167 26.249 65.896 1.00 19.88  ? 107 LEU A N   1 
ATOM 865  C CA  . LEU A 1 105 ? 28.356 26.478 65.121 1.00 28.83  ? 107 LEU A CA  1 
ATOM 866  C C   . LEU A 1 105 ? 28.524 27.893 64.573 1.00 33.49  ? 107 LEU A C   1 
ATOM 867  O O   . LEU A 1 105 ? 29.194 28.097 63.551 1.00 38.80  ? 107 LEU A O   1 
ATOM 868  C CB  . LEU A 1 105 ? 28.335 25.472 63.999 1.00 38.00  ? 107 LEU A CB  1 
ATOM 869  C CG  . LEU A 1 105 ? 28.072 24.056 64.448 1.00 42.59  ? 107 LEU A CG  1 
ATOM 870  C CD1 . LEU A 1 105 ? 27.646 23.276 63.234 1.00 54.03  ? 107 LEU A CD1 1 
ATOM 871  C CD2 . LEU A 1 105 ? 29.282 23.481 65.167 1.00 40.88  ? 107 LEU A CD2 1 
ATOM 872  N N   . GLY A 1 106 ? 27.954 28.882 65.256 1.00 29.73  ? 108 GLY A N   1 
ATOM 873  C CA  . GLY A 1 106 ? 27.992 30.284 64.858 1.00 21.76  ? 108 GLY A CA  1 
ATOM 874  C C   . GLY A 1 106 ? 27.792 31.134 66.106 1.00 22.54  ? 108 GLY A C   1 
ATOM 875  O O   . GLY A 1 106 ? 27.406 30.582 67.143 1.00 19.34  ? 108 GLY A O   1 
ATOM 876  N N   . ILE A 1 107 ? 28.100 32.434 66.110 1.00 14.25  ? 109 ILE A N   1 
ATOM 877  C CA  . ILE A 1 107 ? 27.875 33.291 67.256 1.00 6.59   ? 109 ILE A CA  1 
ATOM 878  C C   . ILE A 1 107 ? 27.004 34.470 66.834 1.00 12.32  ? 109 ILE A C   1 
ATOM 879  O O   . ILE A 1 107 ? 27.000 34.921 65.681 1.00 12.61  ? 109 ILE A O   1 
ATOM 880  C CB  . ILE A 1 107 ? 29.173 33.885 67.877 1.00 17.19  ? 109 ILE A CB  1 
ATOM 881  C CG1 . ILE A 1 107 ? 29.811 35.001 67.068 1.00 14.92  ? 109 ILE A CG1 1 
ATOM 882  C CG2 . ILE A 1 107 ? 30.150 32.742 67.990 1.00 11.61  ? 109 ILE A CG2 1 
ATOM 883  C CD1 . ILE A 1 107 ? 30.784 35.784 67.932 1.00 15.15  ? 109 ILE A CD1 1 
ATOM 884  N N   . ALA A 1 108 ? 26.250 34.974 67.793 1.00 11.08  ? 110 ALA A N   1 
ATOM 885  C CA  . ALA A 1 108 ? 25.397 36.117 67.577 1.00 14.76  ? 110 ALA A CA  1 
ATOM 886  C C   . ALA A 1 108 ? 25.874 37.123 68.604 1.00 11.91  ? 110 ALA A C   1 
ATOM 887  O O   . ALA A 1 108 ? 26.134 36.712 69.744 1.00 18.13  ? 110 ALA A O   1 
ATOM 888  C CB  . ALA A 1 108 ? 23.969 35.792 67.875 1.00 5.59   ? 110 ALA A CB  1 
ATOM 889  N N   . ILE A 1 109 ? 26.055 38.383 68.210 1.00 8.00   ? 111 ILE A N   1 
ATOM 890  C CA  . ILE A 1 109 ? 26.432 39.467 69.111 1.00 11.97  ? 111 ILE A CA  1 
ATOM 891  C C   . ILE A 1 109 ? 25.128 40.215 69.486 1.00 14.05  ? 111 ILE A C   1 
ATOM 892  O O   . ILE A 1 109 ? 24.285 40.577 68.646 1.00 12.55  ? 111 ILE A O   1 
ATOM 893  C CB  . ILE A 1 109 ? 27.462 40.393 68.382 1.00 3.89   ? 111 ILE A CB  1 
ATOM 894  C CG1 . ILE A 1 109 ? 28.696 39.652 68.054 1.00 9.47   ? 111 ILE A CG1 1 
ATOM 895  C CG2 . ILE A 1 109 ? 28.023 41.415 69.303 1.00 2.14   ? 111 ILE A CG2 1 
ATOM 896  C CD1 . ILE A 1 109 ? 29.301 40.140 66.777 1.00 20.22  ? 111 ILE A CD1 1 
ATOM 897  N N   . LEU A 1 110 ? 24.964 40.439 70.776 1.00 5.70   ? 112 LEU A N   1 
ATOM 898  C CA  . LEU A 1 110 ? 23.829 41.083 71.363 1.00 11.09  ? 112 LEU A CA  1 
ATOM 899  C C   . LEU A 1 110 ? 24.287 42.369 72.022 1.00 15.37  ? 112 LEU A C   1 
ATOM 900  O O   . LEU A 1 110 ? 25.367 42.354 72.607 1.00 15.11  ? 112 LEU A O   1 
ATOM 901  C CB  . LEU A 1 110 ? 23.237 40.225 72.441 1.00 2.02   ? 112 LEU A CB  1 
ATOM 902  C CG  . LEU A 1 110 ? 22.830 38.837 72.126 1.00 5.73   ? 112 LEU A CG  1 
ATOM 903  C CD1 . LEU A 1 110 ? 21.962 38.361 73.232 1.00 24.47  ? 112 LEU A CD1 1 
ATOM 904  C CD2 . LEU A 1 110 ? 21.896 38.769 70.973 1.00 26.71  ? 112 LEU A CD2 1 
ATOM 905  N N   . SER A 1 111 ? 23.572 43.488 71.975 1.00 16.09  ? 113 SER A N   1 
ATOM 906  C CA  . SER A 1 111 ? 23.906 44.681 72.757 1.00 15.65  ? 113 SER A CA  1 
ATOM 907  C C   . SER A 1 111 ? 23.063 44.583 74.042 1.00 12.44  ? 113 SER A C   1 
ATOM 908  O O   . SER A 1 111 ? 21.836 44.587 73.963 1.00 27.01  ? 113 SER A O   1 
ATOM 909  C CB  . SER A 1 111 ? 23.568 45.872 71.871 1.00 5.28   ? 113 SER A CB  1 
ATOM 910  O OG  . SER A 1 111 ? 23.558 47.132 72.512 1.00 21.87  ? 113 SER A OG  1 
ATOM 911  N N   . THR A 1 112 ? 23.574 44.433 75.248 1.00 9.59   ? 114 THR A N   1 
ATOM 912  C CA  . THR A 1 112 ? 22.724 44.146 76.375 1.00 4.49   ? 114 THR A CA  1 
ATOM 913  C C   . THR A 1 112 ? 23.066 45.177 77.395 1.00 17.27  ? 114 THR A C   1 
ATOM 914  O O   . THR A 1 112 ? 24.035 45.913 77.272 1.00 24.60  ? 114 THR A O   1 
ATOM 915  C CB  . THR A 1 112 ? 23.002 42.754 76.980 1.00 20.36  ? 114 THR A CB  1 
ATOM 916  O OG1 . THR A 1 112 ? 24.209 42.845 77.757 1.00 22.55  ? 114 THR A OG1 1 
ATOM 917  C CG2 . THR A 1 112 ? 23.145 41.670 75.903 1.00 16.36  ? 114 THR A CG2 1 
ATOM 918  N N   . SER A 1 113 ? 22.339 45.098 78.490 1.00 37.08  ? 115 SER A N   1 
ATOM 919  C CA  . SER A 1 113 ? 22.477 45.994 79.618 1.00 47.02  ? 115 SER A CA  1 
ATOM 920  C C   . SER A 1 113 ? 23.832 45.873 80.245 1.00 44.40  ? 115 SER A C   1 
ATOM 921  O O   . SER A 1 113 ? 24.306 46.824 80.852 1.00 54.59  ? 115 SER A O   1 
ATOM 922  C CB  . SER A 1 113 ? 21.432 45.666 80.661 1.00 54.44  ? 115 SER A CB  1 
ATOM 923  O OG  . SER A 1 113 ? 21.243 44.251 80.692 1.00 68.13  ? 115 SER A OG  1 
ATOM 924  N N   . LYS A 1 114 ? 24.416 44.685 80.136 1.00 42.37  ? 116 LYS A N   1 
ATOM 925  C CA  . LYS A 1 114 ? 25.741 44.471 80.673 1.00 41.45  ? 116 LYS A CA  1 
ATOM 926  C C   . LYS A 1 114 ? 26.772 44.612 79.547 1.00 36.38  ? 116 LYS A C   1 
ATOM 927  O O   . LYS A 1 114 ? 27.889 44.105 79.653 1.00 32.86  ? 116 LYS A O   1 
ATOM 928  C CB  . LYS A 1 114 ? 25.784 43.075 81.346 1.00 44.42  ? 116 LYS A CB  1 
ATOM 929  C CG  . LYS A 1 114 ? 25.073 43.089 82.701 1.00 54.92  ? 116 LYS A CG  1 
ATOM 930  C CD  . LYS A 1 114 ? 24.990 41.770 83.477 1.00 55.80  ? 116 LYS A CD  1 
ATOM 931  C CE  . LYS A 1 114 ? 24.023 41.956 84.670 1.00 64.46  ? 116 LYS A CE  1 
ATOM 932  N NZ  . LYS A 1 114 ? 23.702 40.720 85.371 1.00 54.39  ? 116 LYS A NZ  1 
ATOM 933  N N   . GLY A 1 115 ? 26.432 45.338 78.466 1.00 32.10  ? 117 GLY A N   1 
ATOM 934  C CA  . GLY A 1 115 ? 27.323 45.628 77.344 1.00 30.60  ? 117 GLY A CA  1 
ATOM 935  C C   . GLY A 1 115 ? 27.197 44.690 76.153 1.00 28.78  ? 117 GLY A C   1 
ATOM 936  O O   . GLY A 1 115 ? 26.252 43.898 76.108 1.00 32.22  ? 117 GLY A O   1 
ATOM 937  N N   . VAL A 1 116 ? 28.143 44.764 75.199 1.00 24.94  ? 118 VAL A N   1 
ATOM 938  C CA  . VAL A 1 116 ? 28.133 43.917 74.008 1.00 16.61  ? 118 VAL A CA  1 
ATOM 939  C C   . VAL A 1 116 ? 28.734 42.606 74.461 1.00 15.45  ? 118 VAL A C   1 
ATOM 940  O O   . VAL A 1 116 ? 29.824 42.566 75.015 1.00 25.27  ? 118 VAL A O   1 
ATOM 941  C CB  . VAL A 1 116 ? 28.965 44.549 72.870 1.00 17.88  ? 118 VAL A CB  1 
ATOM 942  C CG1 . VAL A 1 116 ? 28.779 43.761 71.606 1.00 5.39   ? 118 VAL A CG1 1 
ATOM 943  C CG2 . VAL A 1 116 ? 28.496 45.964 72.591 1.00 2.10   ? 118 VAL A CG2 1 
ATOM 944  N N   . LEU A 1 117 ? 27.962 41.552 74.271 1.00 16.45  ? 119 LEU A N   1 
ATOM 945  C CA  . LEU A 1 117 ? 28.224 40.215 74.764 1.00 18.51  ? 119 LEU A CA  1 
ATOM 946  C C   . LEU A 1 117 ? 27.915 39.257 73.640 1.00 13.00  ? 119 LEU A C   1 
ATOM 947  O O   . LEU A 1 117 ? 27.184 39.676 72.749 1.00 21.05  ? 119 LEU A O   1 
ATOM 948  C CB  . LEU A 1 117 ? 27.288 39.788 75.897 1.00 23.77  ? 119 LEU A CB  1 
ATOM 949  C CG  . LEU A 1 117 ? 27.023 40.648 77.109 1.00 28.06  ? 119 LEU A CG  1 
ATOM 950  C CD1 . LEU A 1 117 ? 26.141 39.893 78.095 1.00 19.62  ? 119 LEU A CD1 1 
ATOM 951  C CD2 . LEU A 1 117 ? 28.338 41.010 77.737 1.00 20.71  ? 119 LEU A CD2 1 
ATOM 952  N N   . THR A 1 118 ? 28.402 38.002 73.633 1.00 21.38  ? 120 THR A N   1 
ATOM 953  C CA  . THR A 1 118 ? 28.009 37.000 72.646 1.00 6.83   ? 120 THR A CA  1 
ATOM 954  C C   . THR A 1 118 ? 26.803 36.376 73.223 0.00 9.65   ? 120 THR A C   1 
ATOM 955  O O   . THR A 1 118 ? 26.625 36.486 74.422 1.00 2.00   ? 120 THR A O   1 
ATOM 956  C CB  . THR A 1 118 ? 29.044 35.860 72.424 1.00 18.32  ? 120 THR A CB  1 
ATOM 957  O OG1 . THR A 1 118 ? 29.469 35.410 73.711 1.00 21.72  ? 120 THR A OG1 1 
ATOM 958  C CG2 . THR A 1 118 ? 30.211 36.297 71.522 1.00 10.35  ? 120 THR A CG2 1 
ATOM 959  N N   . ASP A 1 119 ? 26.053 35.632 72.449 1.00 5.01   ? 121 ASP A N   1 
ATOM 960  C CA  . ASP A 1 119 ? 24.867 34.984 72.986 1.00 18.76  ? 121 ASP A CA  1 
ATOM 961  C C   . ASP A 1 119 ? 25.185 34.009 74.080 1.00 22.52  ? 121 ASP A C   1 
ATOM 962  O O   . ASP A 1 119 ? 24.405 33.861 75.012 1.00 33.82  ? 121 ASP A O   1 
ATOM 963  C CB  . ASP A 1 119 ? 24.081 34.216 71.939 1.00 16.75  ? 121 ASP A CB  1 
ATOM 964  C CG  . ASP A 1 119 ? 24.771 33.119 71.142 1.00 32.58  ? 121 ASP A CG  1 
ATOM 965  O OD1 . ASP A 1 119 ? 25.444 33.495 70.189 1.00 36.16  ? 121 ASP A OD1 1 
ATOM 966  O OD2 . ASP A 1 119 ? 24.605 31.921 71.423 1.00 23.98  ? 121 ASP A OD2 1 
ATOM 967  N N   . ARG A 1 120 ? 26.373 33.415 74.023 1.00 31.45  ? 122 ARG A N   1 
ATOM 968  C CA  . ARG A 1 120 ? 26.787 32.478 75.043 1.00 30.22  ? 122 ARG A CA  1 
ATOM 969  C C   . ARG A 1 120 ? 27.082 33.311 76.273 1.00 29.32  ? 122 ARG A C   1 
ATOM 970  O O   . ARG A 1 120 ? 26.684 32.927 77.371 1.00 48.37  ? 122 ARG A O   1 
ATOM 971  C CB  . ARG A 1 120 ? 28.017 31.702 74.591 1.00 37.71  ? 122 ARG A CB  1 
ATOM 972  C CG  . ARG A 1 120 ? 28.345 30.593 75.588 1.00 88.18  ? 122 ARG A CG  1 
ATOM 973  C CD  . ARG A 1 120 ? 29.623 29.803 75.269 1.00 120.27 ? 122 ARG A CD  1 
ATOM 974  N NE  . ARG A 1 120 ? 30.185 29.191 76.478 1.00 143.44 ? 122 ARG A NE  1 
ATOM 975  C CZ  . ARG A 1 120 ? 31.218 28.329 76.480 1.00 151.14 ? 122 ARG A CZ  1 
ATOM 976  N NH1 . ARG A 1 120 ? 31.835 27.934 75.361 1.00 159.98 ? 122 ARG A NH1 1 
ATOM 977  N NH2 . ARG A 1 120 ? 31.667 27.866 77.646 1.00 151.12 ? 122 ARG A NH2 1 
ATOM 978  N N   . GLU A 1 121 ? 27.690 34.489 76.174 1.00 30.86  ? 123 GLU A N   1 
ATOM 979  C CA  . GLU A 1 121 ? 27.931 35.282 77.376 1.00 27.02  ? 123 GLU A CA  1 
ATOM 980  C C   . GLU A 1 121 ? 26.621 35.810 77.972 1.00 29.85  ? 123 GLU A C   1 
ATOM 981  O O   . GLU A 1 121 ? 26.389 35.737 79.179 1.00 27.48  ? 123 GLU A O   1 
ATOM 982  C CB  . GLU A 1 121 ? 28.841 36.446 77.033 1.00 16.84  ? 123 GLU A CB  1 
ATOM 983  C CG  . GLU A 1 121 ? 30.308 36.180 77.156 1.00 32.02  ? 123 GLU A CG  1 
ATOM 984  C CD  . GLU A 1 121 ? 31.112 37.083 76.240 1.00 46.33  ? 123 GLU A CD  1 
ATOM 985  O OE1 . GLU A 1 121 ? 31.407 38.237 76.583 1.00 51.37  ? 123 GLU A OE1 1 
ATOM 986  O OE2 . GLU A 1 121 ? 31.436 36.601 75.159 1.00 57.78  ? 123 GLU A OE2 1 
ATOM 987  N N   . ALA A 1 122 ? 25.740 36.332 77.118 1.00 28.63  ? 124 ALA A N   1 
ATOM 988  C CA  . ALA A 1 122 ? 24.484 36.928 77.500 1.00 20.92  ? 124 ALA A CA  1 
ATOM 989  C C   . ALA A 1 122 ? 23.700 35.993 78.375 1.00 23.59  ? 124 ALA A C   1 
ATOM 990  O O   . ALA A 1 122 ? 23.418 36.329 79.530 1.00 24.93  ? 124 ALA A O   1 
ATOM 991  C CB  . ALA A 1 122 ? 23.705 37.218 76.266 1.00 19.45  ? 124 ALA A CB  1 
ATOM 992  N N   . ARG A 1 123 ? 23.516 34.776 77.851 1.00 23.07  ? 125 ARG A N   1 
ATOM 993  C CA  . ARG A 1 123 ? 22.804 33.702 78.533 1.00 30.21  ? 125 ARG A CA  1 
ATOM 994  C C   . ARG A 1 123 ? 23.337 33.404 79.907 1.00 32.29  ? 125 ARG A C   1 
ATOM 995  O O   . ARG A 1 123 ? 22.583 33.049 80.814 1.00 45.00  ? 125 ARG A O   1 
ATOM 996  C CB  . ARG A 1 123 ? 22.866 32.390 77.761 1.00 28.12  ? 125 ARG A CB  1 
ATOM 997  C CG  . ARG A 1 123 ? 21.596 32.083 76.982 1.00 52.41  ? 125 ARG A CG  1 
ATOM 998  C CD  . ARG A 1 123 ? 21.688 30.799 76.166 1.00 67.64  ? 125 ARG A CD  1 
ATOM 999  N NE  . ARG A 1 123 ? 22.169 30.969 74.798 1.00 75.49  ? 125 ARG A NE  1 
ATOM 1000 C CZ  . ARG A 1 123 ? 21.421 30.584 73.750 1.00 77.47  ? 125 ARG A CZ  1 
ATOM 1001 N NH1 . ARG A 1 123 ? 20.208 30.039 73.933 1.00 80.33  ? 125 ARG A NH1 1 
ATOM 1002 N NH2 . ARG A 1 123 ? 21.891 30.730 72.502 1.00 59.18  ? 125 ARG A NH2 1 
ATOM 1003 N N   . LYS A 1 124 ? 24.649 33.568 80.028 1.00 37.89  ? 126 LYS A N   1 
ATOM 1004 C CA  . LYS A 1 124 ? 25.354 33.292 81.258 1.00 40.29  ? 126 LYS A CA  1 
ATOM 1005 C C   . LYS A 1 124 ? 25.124 34.423 82.223 1.00 33.56  ? 126 LYS A C   1 
ATOM 1006 O O   . LYS A 1 124 ? 24.906 34.211 83.406 1.00 45.08  ? 126 LYS A O   1 
ATOM 1007 C CB  . LYS A 1 124 ? 26.831 33.144 80.977 1.00 37.92  ? 126 LYS A CB  1 
ATOM 1008 C CG  . LYS A 1 124 ? 27.461 32.505 82.161 1.00 63.86  ? 126 LYS A CG  1 
ATOM 1009 C CD  . LYS A 1 124 ? 28.960 32.576 82.132 1.00 87.41  ? 126 LYS A CD  1 
ATOM 1010 C CE  . LYS A 1 124 ? 29.266 32.275 83.592 1.00 103.54 ? 126 LYS A CE  1 
ATOM 1011 N NZ  . LYS A 1 124 ? 30.680 32.379 83.873 1.00 120.19 ? 126 LYS A NZ  1 
ATOM 1012 N N   . LEU A 1 125 ? 25.122 35.654 81.759 1.00 35.03  ? 127 LEU A N   1 
ATOM 1013 C CA  . LEU A 1 125 ? 24.913 36.758 82.662 1.00 24.39  ? 127 LEU A CA  1 
ATOM 1014 C C   . LEU A 1 125 ? 23.446 36.938 82.845 1.00 22.55  ? 127 LEU A C   1 
ATOM 1015 O O   . LEU A 1 125 ? 23.036 37.776 83.629 1.00 35.59  ? 127 LEU A O   1 
ATOM 1016 C CB  . LEU A 1 125 ? 25.562 38.001 82.091 1.00 28.81  ? 127 LEU A CB  1 
ATOM 1017 C CG  . LEU A 1 125 ? 27.099 37.905 81.995 1.00 32.96  ? 127 LEU A CG  1 
ATOM 1018 C CD1 . LEU A 1 125 ? 27.695 39.033 81.171 1.00 30.69  ? 127 LEU A CD1 1 
ATOM 1019 C CD2 . LEU A 1 125 ? 27.663 37.970 83.400 1.00 38.10  ? 127 LEU A CD2 1 
ATOM 1020 N N   . GLY A 1 126 ? 22.627 36.175 82.137 1.00 33.46  ? 128 GLY A N   1 
ATOM 1021 C CA  . GLY A 1 126 ? 21.180 36.213 82.314 1.00 40.52  ? 128 GLY A CA  1 
ATOM 1022 C C   . GLY A 1 126 ? 20.495 37.406 81.656 1.00 43.57  ? 128 GLY A C   1 
ATOM 1023 O O   . GLY A 1 126 ? 19.380 37.807 82.026 1.00 51.01  ? 128 GLY A O   1 
ATOM 1024 N N   . VAL A 1 127 ? 21.135 37.939 80.619 1.00 40.70  ? 129 VAL A N   1 
ATOM 1025 C CA  . VAL A 1 127 ? 20.622 39.099 79.915 1.00 36.96  ? 129 VAL A CA  1 
ATOM 1026 C C   . VAL A 1 127 ? 20.140 38.746 78.534 1.00 32.13  ? 129 VAL A C   1 
ATOM 1027 O O   . VAL A 1 127 ? 20.480 37.718 77.945 1.00 27.71  ? 129 VAL A O   1 
ATOM 1028 C CB  . VAL A 1 127 ? 21.666 40.216 79.728 1.00 42.06  ? 129 VAL A CB  1 
ATOM 1029 C CG1 . VAL A 1 127 ? 21.541 41.174 80.871 1.00 34.18  ? 129 VAL A CG1 1 
ATOM 1030 C CG2 . VAL A 1 127 ? 23.089 39.662 79.703 1.00 55.15  ? 129 VAL A CG2 1 
ATOM 1031 N N   . GLY A 1 128 ? 19.280 39.626 78.077 1.00 19.93  ? 130 GLY A N   1 
ATOM 1032 C CA  . GLY A 1 128 ? 18.842 39.552 76.720 1.00 12.26  ? 130 GLY A CA  1 
ATOM 1033 C C   . GLY A 1 128 ? 19.264 40.878 76.121 1.00 11.44  ? 130 GLY A C   1 
ATOM 1034 O O   . GLY A 1 128 ? 19.957 41.655 76.810 1.00 29.63  ? 130 GLY A O   1 
ATOM 1035 N N   . GLY A 1 129 ? 18.875 41.170 74.878 1.00 2.00   ? 131 GLY A N   1 
ATOM 1036 C CA  . GLY A 1 129 ? 19.108 42.481 74.331 1.00 2.18   ? 131 GLY A CA  1 
ATOM 1037 C C   . GLY A 1 129 ? 18.787 42.435 72.865 1.00 9.92   ? 131 GLY A C   1 
ATOM 1038 O O   . GLY A 1 129 ? 18.029 41.600 72.389 1.00 16.85  ? 131 GLY A O   1 
ATOM 1039 N N   . GLU A 1 130 ? 19.423 43.340 72.151 1.00 12.95  ? 132 GLU A N   1 
ATOM 1040 C CA  . GLU A 1 130 ? 19.273 43.495 70.731 1.00 10.52  ? 132 GLU A CA  1 
ATOM 1041 C C   . GLU A 1 130 ? 20.292 42.602 70.022 1.00 20.56  ? 132 GLU A C   1 
ATOM 1042 O O   . GLU A 1 130 ? 21.521 42.638 70.246 1.00 13.16  ? 132 GLU A O   1 
ATOM 1043 C CB  . GLU A 1 130 ? 19.499 44.973 70.439 1.00 2.05   ? 132 GLU A CB  1 
ATOM 1044 C CG  . GLU A 1 130 ? 19.295 45.398 68.985 1.00 3.18   ? 132 GLU A CG  1 
ATOM 1045 C CD  . GLU A 1 130 ? 19.389 46.902 68.701 1.00 13.07  ? 132 GLU A CD  1 
ATOM 1046 O OE1 . GLU A 1 130 ? 19.528 47.660 69.656 1.00 30.34  ? 132 GLU A OE1 1 
ATOM 1047 O OE2 . GLU A 1 130 ? 19.328 47.338 67.546 1.00 6.70   ? 132 GLU A OE2 1 
ATOM 1048 N N   . LEU A 1 131 ? 19.752 41.811 69.105 1.00 24.19  ? 133 LEU A N   1 
ATOM 1049 C CA  . LEU A 1 131 ? 20.546 40.932 68.270 1.00 11.17  ? 133 LEU A CA  1 
ATOM 1050 C C   . LEU A 1 131 ? 21.236 41.795 67.244 1.00 9.81   ? 133 LEU A C   1 
ATOM 1051 O O   . LEU A 1 131 ? 20.601 42.068 66.220 1.00 18.36  ? 133 LEU A O   1 
ATOM 1052 C CB  . LEU A 1 131 ? 19.656 39.949 67.569 1.00 3.87   ? 133 LEU A CB  1 
ATOM 1053 C CG  . LEU A 1 131 ? 19.443 38.631 68.201 1.00 16.14  ? 133 LEU A CG  1 
ATOM 1054 C CD1 . LEU A 1 131 ? 18.204 38.076 67.585 1.00 29.06  ? 133 LEU A CD1 1 
ATOM 1055 C CD2 . LEU A 1 131 ? 20.577 37.657 67.913 1.00 9.90   ? 133 LEU A CD2 1 
ATOM 1056 N N   . ILE A 1 132 ? 22.465 42.269 67.455 1.00 8.44   ? 134 ILE A N   1 
ATOM 1057 C CA  . ILE A 1 132 ? 23.174 43.081 66.450 1.00 7.58   ? 134 ILE A CA  1 
ATOM 1058 C C   . ILE A 1 132 ? 23.497 42.244 65.181 1.00 12.37  ? 134 ILE A C   1 
ATOM 1059 O O   . ILE A 1 132 ? 23.074 42.572 64.048 1.00 22.98  ? 134 ILE A O   1 
ATOM 1060 C CB  . ILE A 1 132 ? 24.475 43.642 67.103 1.00 16.90  ? 134 ILE A CB  1 
ATOM 1061 C CG1 . ILE A 1 132 ? 24.191 44.292 68.468 1.00 9.56   ? 134 ILE A CG1 1 
ATOM 1062 C CG2 . ILE A 1 132 ? 25.124 44.624 66.134 1.00 8.01   ? 134 ILE A CG2 1 
ATOM 1063 C CD1 . ILE A 1 132 ? 23.476 45.624 68.310 1.00 21.00  ? 134 ILE A CD1 1 
ATOM 1064 N N   . CYS A 1 133 ? 24.169 41.094 65.257 1.00 16.90  ? 135 CYS A N   1 
ATOM 1065 C CA  . CYS A 1 133 ? 24.539 40.369 64.030 1.00 19.07  ? 135 CYS A CA  1 
ATOM 1066 C C   . CYS A 1 133 ? 24.768 38.881 64.261 1.00 19.05  ? 135 CYS A C   1 
ATOM 1067 O O   . CYS A 1 133 ? 24.739 38.454 65.422 1.00 27.59  ? 135 CYS A O   1 
ATOM 1068 C CB  . CYS A 1 133 ? 25.809 40.992 63.426 1.00 2.00   ? 135 CYS A CB  1 
ATOM 1069 S SG  . CYS A 1 133 ? 27.271 41.074 64.493 1.00 18.12  ? 135 CYS A SG  1 
ATOM 1070 N N   . GLU A 1 134 ? 24.889 38.050 63.227 1.00 18.85  ? 136 GLU A N   1 
ATOM 1071 C CA  . GLU A 1 134 ? 25.312 36.675 63.416 1.00 18.72  ? 136 GLU A CA  1 
ATOM 1072 C C   . GLU A 1 134 ? 26.541 36.478 62.560 1.00 18.77  ? 136 GLU A C   1 
ATOM 1073 O O   . GLU A 1 134 ? 26.640 37.111 61.492 1.00 21.12  ? 136 GLU A O   1 
ATOM 1074 C CB  . GLU A 1 134 ? 24.262 35.714 62.982 1.00 13.75  ? 136 GLU A CB  1 
ATOM 1075 C CG  . GLU A 1 134 ? 23.826 35.841 61.556 1.00 13.39  ? 136 GLU A CG  1 
ATOM 1076 C CD  . GLU A 1 134 ? 22.539 35.102 61.249 1.00 28.61  ? 136 GLU A CD  1 
ATOM 1077 O OE1 . GLU A 1 134 ? 21.789 34.765 62.169 1.00 26.23  ? 136 GLU A OE1 1 
ATOM 1078 O OE2 . GLU A 1 134 ? 22.270 34.870 60.076 1.00 20.95  ? 136 GLU A OE2 1 
ATOM 1079 N N   . VAL A 1 135 ? 27.447 35.617 63.020 1.00 11.22  ? 137 VAL A N   1 
ATOM 1080 C CA  . VAL A 1 135 ? 28.703 35.347 62.328 1.00 19.26  ? 137 VAL A CA  1 
ATOM 1081 C C   . VAL A 1 135 ? 29.262 33.971 62.630 1.00 15.06  ? 137 VAL A C   1 
ATOM 1082 O O   . VAL A 1 135 ? 29.144 33.467 63.747 1.00 27.81  ? 137 VAL A O   1 
ATOM 1083 C CB  . VAL A 1 135 ? 29.750 36.447 62.694 1.00 21.51  ? 137 VAL A CB  1 
ATOM 1084 C CG1 . VAL A 1 135 ? 29.720 36.691 64.186 1.00 28.58  ? 137 VAL A CG1 1 
ATOM 1085 C CG2 . VAL A 1 135 ? 31.170 36.037 62.242 1.00 17.21  ? 137 VAL A CG2 1 
ATOM 1086 N N   . TRP A 1 136 ? 29.827 33.361 61.608 1.00 13.83  ? 138 TRP A N   1 
ATOM 1087 C CA  . TRP A 1 136 ? 30.450 32.042 61.615 1.00 12.52  ? 138 TRP A CA  1 
ATOM 1088 C C   . TRP A 1 136 ? 31.334 32.004 60.355 1.00 19.61  ? 138 TRP A C   1 
ATOM 1089 O O   . TRP A 1 136 ? 32.091 31.063 60.159 1.00 21.87  ? 138 TRP A O   1 
ATOM 1090 C CB  . TRP A 1 136 ? 29.359 30.892 61.605 1.00 11.34  ? 138 TRP A CB  1 
ATOM 1091 C CG  . TRP A 1 136 ? 27.915 31.082 61.090 1.00 33.57  ? 138 TRP A CG  1 
ATOM 1092 C CD1 . TRP A 1 136 ? 26.809 31.597 61.798 1.00 43.31  ? 138 TRP A CD1 1 
ATOM 1093 C CD2 . TRP A 1 136 ? 27.539 30.773 59.832 1.00 22.14  ? 138 TRP A CD2 1 
ATOM 1094 N NE1 . TRP A 1 136 ? 25.734 31.621 60.980 1.00 19.40  ? 138 TRP A NE1 1 
ATOM 1095 C CE2 . TRP A 1 136 ? 26.153 31.130 59.792 1.00 35.00  ? 138 TRP A CE2 1 
ATOM 1096 C CE3 . TRP A 1 136 ? 28.220 30.259 58.763 1.00 2.20   ? 138 TRP A CE3 1 
ATOM 1097 C CZ2 . TRP A 1 136 ? 25.437 30.958 58.619 1.00 28.05  ? 138 TRP A CZ2 1 
ATOM 1098 C CZ3 . TRP A 1 136 ? 27.495 30.090 57.571 1.00 37.73  ? 138 TRP A CZ3 1 
ATOM 1099 C CH2 . TRP A 1 136 ? 26.129 30.431 57.504 1.00 50.87  ? 138 TRP A CH2 1 
ATOM 1100 O OXT . TRP A 1 136 ? 31.321 32.952 59.555 1.00 12.07  ? 138 TRP A OXT 1 
ATOM 1101 N N   . THR B 1 1   ? 44.493 2.594  49.129 1.00 147.19 ? 3   THR B N   1 
ATOM 1102 C CA  . THR B 1 1   ? 43.322 3.392  48.813 1.00 145.26 ? 3   THR B CA  1 
ATOM 1103 C C   . THR B 1 1   ? 42.906 3.966  50.167 1.00 137.09 ? 3   THR B C   1 
ATOM 1104 O O   . THR B 1 1   ? 43.318 3.359  51.169 1.00 141.85 ? 3   THR B O   1 
ATOM 1105 C CB  . THR B 1 1   ? 42.246 2.414  48.220 1.00 151.01 ? 3   THR B CB  1 
ATOM 1106 O OG1 . THR B 1 1   ? 42.996 1.558  47.351 1.00 161.64 ? 3   THR B OG1 1 
ATOM 1107 C CG2 . THR B 1 1   ? 41.073 3.080  47.496 1.00 145.40 ? 3   THR B CG2 1 
ATOM 1108 N N   . ASP B 1 2   ? 42.229 5.120  50.255 1.00 114.95 ? 4   ASP B N   1 
ATOM 1109 C CA  . ASP B 1 2   ? 41.507 5.409  51.480 1.00 85.77  ? 4   ASP B CA  1 
ATOM 1110 C C   . ASP B 1 2   ? 40.159 5.761  50.925 1.00 64.71  ? 4   ASP B C   1 
ATOM 1111 O O   . ASP B 1 2   ? 39.953 6.818  50.358 1.00 65.22  ? 4   ASP B O   1 
ATOM 1112 C CB  . ASP B 1 2   ? 41.931 6.626  52.301 1.00 82.09  ? 4   ASP B CB  1 
ATOM 1113 C CG  . ASP B 1 2   ? 41.055 6.855  53.549 1.00 71.98  ? 4   ASP B CG  1 
ATOM 1114 O OD1 . ASP B 1 2   ? 40.235 6.002  53.930 1.00 65.38  ? 4   ASP B OD1 1 
ATOM 1115 O OD2 . ASP B 1 2   ? 41.208 7.916  54.150 1.00 58.28  ? 4   ASP B OD2 1 
ATOM 1116 N N   . PRO B 1 3   ? 39.254 4.829  51.021 1.00 51.34  ? 5   PRO B N   1 
ATOM 1117 C CA  . PRO B 1 3   ? 37.836 5.043  51.056 1.00 50.92  ? 5   PRO B CA  1 
ATOM 1118 C C   . PRO B 1 3   ? 37.208 6.332  51.582 1.00 46.49  ? 5   PRO B C   1 
ATOM 1119 O O   . PRO B 1 3   ? 36.726 7.185  50.827 1.00 41.15  ? 5   PRO B O   1 
ATOM 1120 C CB  . PRO B 1 3   ? 37.462 3.782  51.769 1.00 59.87  ? 5   PRO B CB  1 
ATOM 1121 C CG  . PRO B 1 3   ? 38.169 2.784  50.890 1.00 65.57  ? 5   PRO B CG  1 
ATOM 1122 C CD  . PRO B 1 3   ? 39.518 3.431  50.751 1.00 57.18  ? 5   PRO B CD  1 
ATOM 1123 N N   . ILE B 1 4   ? 37.203 6.481  52.902 1.00 43.26  ? 6   ILE B N   1 
ATOM 1124 C CA  . ILE B 1 4   ? 36.634 7.646  53.553 1.00 38.52  ? 6   ILE B CA  1 
ATOM 1125 C C   . ILE B 1 4   ? 37.130 8.949  52.941 1.00 34.52  ? 6   ILE B C   1 
ATOM 1126 O O   . ILE B 1 4   ? 36.304 9.782  52.567 1.00 46.88  ? 6   ILE B O   1 
ATOM 1127 C CB  . ILE B 1 4   ? 36.973 7.534  55.048 1.00 38.93  ? 6   ILE B CB  1 
ATOM 1128 C CG1 . ILE B 1 4   ? 36.234 6.320  55.620 1.00 28.89  ? 6   ILE B CG1 1 
ATOM 1129 C CG2 . ILE B 1 4   ? 36.635 8.816  55.786 1.00 33.70  ? 6   ILE B CG2 1 
ATOM 1130 C CD1 . ILE B 1 4   ? 34.713 6.346  55.412 1.00 33.20  ? 6   ILE B CD1 1 
ATOM 1131 N N   . ALA B 1 5   ? 38.421 9.135  52.716 1.00 23.38  ? 7   ALA B N   1 
ATOM 1132 C CA  . ALA B 1 5   ? 38.872 10.387 52.161 1.00 25.96  ? 7   ALA B CA  1 
ATOM 1133 C C   . ALA B 1 5   ? 38.497 10.579 50.712 1.00 27.06  ? 7   ALA B C   1 
ATOM 1134 O O   . ALA B 1 5   ? 38.601 11.685 50.189 1.00 40.95  ? 7   ALA B O   1 
ATOM 1135 C CB  . ALA B 1 5   ? 40.363 10.520 52.249 1.00 36.44  ? 7   ALA B CB  1 
ATOM 1136 N N   . ASP B 1 6   ? 38.056 9.554  50.021 1.00 26.53  ? 8   ASP B N   1 
ATOM 1137 C CA  . ASP B 1 6   ? 37.595 9.727  48.661 1.00 27.99  ? 8   ASP B CA  1 
ATOM 1138 C C   . ASP B 1 6   ? 36.239 10.376 48.825 1.00 26.41  ? 8   ASP B C   1 
ATOM 1139 O O   . ASP B 1 6   ? 35.984 11.430 48.252 1.00 28.62  ? 8   ASP B O   1 
ATOM 1140 C CB  . ASP B 1 6   ? 37.486 8.366  47.978 1.00 43.20  ? 8   ASP B CB  1 
ATOM 1141 C CG  . ASP B 1 6   ? 36.590 8.252  46.748 1.00 65.76  ? 8   ASP B CG  1 
ATOM 1142 O OD1 . ASP B 1 6   ? 36.983 8.760  45.684 1.00 63.90  ? 8   ASP B OD1 1 
ATOM 1143 O OD2 . ASP B 1 6   ? 35.515 7.638  46.876 1.00 65.33  ? 8   ASP B OD2 1 
ATOM 1144 N N   . MET B 1 7   ? 35.391 9.804  49.670 1.00 27.36  ? 9   MET B N   1 
ATOM 1145 C CA  . MET B 1 7   ? 34.056 10.317 49.891 1.00 22.85  ? 9   MET B CA  1 
ATOM 1146 C C   . MET B 1 7   ? 34.080 11.775 50.331 1.00 26.86  ? 9   MET B C   1 
ATOM 1147 O O   . MET B 1 7   ? 33.326 12.596 49.794 1.00 37.77  ? 9   MET B O   1 
ATOM 1148 C CB  . MET B 1 7   ? 33.366 9.480  50.940 1.00 4.29   ? 9   MET B CB  1 
ATOM 1149 C CG  . MET B 1 7   ? 31.974 9.988  51.114 1.00 24.89  ? 9   MET B CG  1 
ATOM 1150 S SD  . MET B 1 7   ? 31.114 9.129  52.440 1.00 40.09  ? 9   MET B SD  1 
ATOM 1151 C CE  . MET B 1 7   ? 32.220 9.464  53.789 1.00 30.18  ? 9   MET B CE  1 
ATOM 1152 N N   . LEU B 1 8   ? 34.954 12.135 51.267 1.00 29.65  ? 10  LEU B N   1 
ATOM 1153 C CA  . LEU B 1 8   ? 35.006 13.504 51.725 1.00 27.46  ? 10  LEU B CA  1 
ATOM 1154 C C   . LEU B 1 8   ? 35.470 14.404 50.590 1.00 31.53  ? 10  LEU B C   1 
ATOM 1155 O O   . LEU B 1 8   ? 34.823 15.412 50.275 1.00 37.29  ? 10  LEU B O   1 
ATOM 1156 C CB  . LEU B 1 8   ? 35.945 13.635 52.896 1.00 21.35  ? 10  LEU B CB  1 
ATOM 1157 C CG  . LEU B 1 8   ? 35.668 12.856 54.190 1.00 37.28  ? 10  LEU B CG  1 
ATOM 1158 C CD1 . LEU B 1 8   ? 36.581 13.468 55.270 1.00 38.60  ? 10  LEU B CD1 1 
ATOM 1159 C CD2 . LEU B 1 8   ? 34.205 12.944 54.644 1.00 38.22  ? 10  LEU B CD2 1 
ATOM 1160 N N   . THR B 1 9   ? 36.531 14.050 49.892 1.00 34.62  ? 11  THR B N   1 
ATOM 1161 C CA  . THR B 1 9   ? 36.969 14.865 48.774 1.00 35.54  ? 11  THR B CA  1 
ATOM 1162 C C   . THR B 1 9   ? 35.895 15.007 47.695 1.00 32.03  ? 11  THR B C   1 
ATOM 1163 O O   . THR B 1 9   ? 35.678 16.103 47.177 1.00 34.45  ? 11  THR B O   1 
ATOM 1164 C CB  . THR B 1 9   ? 38.244 14.211 48.293 1.00 33.28  ? 11  THR B CB  1 
ATOM 1165 O OG1 . THR B 1 9   ? 39.096 14.182 49.455 1.00 36.56  ? 11  THR B OG1 1 
ATOM 1166 C CG2 . THR B 1 9   ? 38.906 14.945 47.165 1.00 28.36  ? 11  THR B CG2 1 
ATOM 1167 N N   . ARG B 1 10  ? 35.116 13.971 47.421 1.00 29.59  ? 12  ARG B N   1 
ATOM 1168 C CA  . ARG B 1 10  ? 34.060 14.045 46.443 1.00 32.82  ? 12  ARG B CA  1 
ATOM 1169 C C   . ARG B 1 10  ? 32.867 14.888 46.891 1.00 37.31  ? 12  ARG B C   1 
ATOM 1170 O O   . ARG B 1 10  ? 32.111 15.424 46.059 1.00 41.42  ? 12  ARG B O   1 
ATOM 1171 C CB  . ARG B 1 10  ? 33.575 12.649 46.097 1.00 51.33  ? 12  ARG B CB  1 
ATOM 1172 C CG  . ARG B 1 10  ? 34.560 11.801 45.289 1.00 62.38  ? 12  ARG B CG  1 
ATOM 1173 C CD  . ARG B 1 10  ? 33.834 10.545 44.813 1.00 70.46  ? 12  ARG B CD  1 
ATOM 1174 N NE  . ARG B 1 10  ? 34.664 9.796  43.886 1.00 71.94  ? 12  ARG B NE  1 
ATOM 1175 C CZ  . ARG B 1 10  ? 34.196 8.772  43.172 1.00 71.20  ? 12  ARG B CZ  1 
ATOM 1176 N NH1 . ARG B 1 10  ? 32.932 8.355  43.257 1.00 77.40  ? 12  ARG B NH1 1 
ATOM 1177 N NH2 . ARG B 1 10  ? 35.029 8.152  42.347 1.00 72.04  ? 12  ARG B NH2 1 
ATOM 1178 N N   . ILE B 1 11  ? 32.633 15.027 48.191 1.00 30.68  ? 13  ILE B N   1 
ATOM 1179 C CA  . ILE B 1 11  ? 31.567 15.906 48.653 1.00 23.71  ? 13  ILE B CA  1 
ATOM 1180 C C   . ILE B 1 11  ? 32.110 17.340 48.527 1.00 20.93  ? 13  ILE B C   1 
ATOM 1181 O O   . ILE B 1 11  ? 31.463 18.168 47.897 1.00 30.45  ? 13  ILE B O   1 
ATOM 1182 C CB  . ILE B 1 11  ? 31.221 15.447 50.096 1.00 21.37  ? 13  ILE B CB  1 
ATOM 1183 C CG1 . ILE B 1 11  ? 30.532 14.082 50.003 1.00 19.12  ? 13  ILE B CG1 1 
ATOM 1184 C CG2 . ILE B 1 11  ? 30.372 16.493 50.820 1.00 14.81  ? 13  ILE B CG2 1 
ATOM 1185 C CD1 . ILE B 1 11  ? 30.198 13.558 51.400 1.00 14.39  ? 13  ILE B CD1 1 
ATOM 1186 N N   . ARG B 1 12  ? 33.317 17.636 49.009 1.00 16.48  ? 14  ARG B N   1 
ATOM 1187 C CA  . ARG B 1 12  ? 33.986 18.918 48.912 1.00 15.88  ? 14  ARG B CA  1 
ATOM 1188 C C   . ARG B 1 12  ? 33.968 19.395 47.473 1.00 17.22  ? 14  ARG B C   1 
ATOM 1189 O O   . ARG B 1 12  ? 33.354 20.398 47.122 1.00 26.86  ? 14  ARG B O   1 
ATOM 1190 C CB  . ARG B 1 12  ? 35.419 18.735 49.390 1.00 35.85  ? 14  ARG B CB  1 
ATOM 1191 C CG  . ARG B 1 12  ? 36.404 19.915 49.504 1.00 37.30  ? 14  ARG B CG  1 
ATOM 1192 C CD  . ARG B 1 12  ? 37.826 19.313 49.576 1.00 49.09  ? 14  ARG B CD  1 
ATOM 1193 N NE  . ARG B 1 12  ? 38.073 18.482 50.767 1.00 59.18  ? 14  ARG B NE  1 
ATOM 1194 C CZ  . ARG B 1 12  ? 38.957 17.461 50.825 1.00 58.96  ? 14  ARG B CZ  1 
ATOM 1195 N NH1 . ARG B 1 12  ? 39.698 17.100 49.763 1.00 50.15  ? 14  ARG B NH1 1 
ATOM 1196 N NH2 . ARG B 1 12  ? 39.133 16.819 51.992 1.00 52.01  ? 14  ARG B NH2 1 
ATOM 1197 N N   . ASN B 1 13  ? 34.601 18.674 46.578 1.00 13.62  ? 15  ASN B N   1 
ATOM 1198 C CA  . ASN B 1 13  ? 34.585 19.029 45.164 1.00 20.19  ? 15  ASN B CA  1 
ATOM 1199 C C   . ASN B 1 13  ? 33.239 19.166 44.466 1.00 25.72  ? 15  ASN B C   1 
ATOM 1200 O O   . ASN B 1 13  ? 33.182 19.893 43.468 1.00 33.10  ? 15  ASN B O   1 
ATOM 1201 C CB  . ASN B 1 13  ? 35.340 18.029 44.365 1.00 12.73  ? 15  ASN B CB  1 
ATOM 1202 C CG  . ASN B 1 13  ? 36.789 18.004 44.724 1.00 24.60  ? 15  ASN B CG  1 
ATOM 1203 O OD1 . ASN B 1 13  ? 37.296 18.666 45.635 1.00 40.10  ? 15  ASN B OD1 1 
ATOM 1204 N ND2 . ASN B 1 13  ? 37.478 17.209 43.940 1.00 27.32  ? 15  ASN B ND2 1 
ATOM 1205 N N   . ALA B 1 14  ? 32.159 18.478 44.895 1.00 20.12  ? 16  ALA B N   1 
ATOM 1206 C CA  . ALA B 1 14  ? 30.879 18.607 44.219 1.00 16.63  ? 16  ALA B CA  1 
ATOM 1207 C C   . ALA B 1 14  ? 30.364 19.969 44.566 1.00 21.70  ? 16  ALA B C   1 
ATOM 1208 O O   . ALA B 1 14  ? 29.955 20.698 43.658 1.00 24.08  ? 16  ALA B O   1 
ATOM 1209 C CB  . ALA B 1 14  ? 29.798 17.685 44.704 1.00 18.17  ? 16  ALA B CB  1 
ATOM 1210 N N   . THR B 1 15  ? 30.443 20.334 45.849 1.00 13.56  ? 17  THR B N   1 
ATOM 1211 C CA  . THR B 1 15  ? 29.924 21.617 46.250 1.00 16.39  ? 17  THR B CA  1 
ATOM 1212 C C   . THR B 1 15  ? 30.724 22.739 45.632 1.00 16.55  ? 17  THR B C   1 
ATOM 1213 O O   . THR B 1 15  ? 30.148 23.775 45.288 1.00 19.21  ? 17  THR B O   1 
ATOM 1214 C CB  . THR B 1 15  ? 29.957 21.845 47.746 1.00 6.63   ? 17  THR B CB  1 
ATOM 1215 O OG1 . THR B 1 15  ? 31.308 21.699 48.141 1.00 26.54  ? 17  THR B OG1 1 
ATOM 1216 C CG2 . THR B 1 15  ? 29.139 20.866 48.520 1.00 2.00   ? 17  THR B CG2 1 
ATOM 1217 N N   . ARG B 1 16  ? 32.026 22.578 45.424 1.00 15.24  ? 18  ARG B N   1 
ATOM 1218 C CA  . ARG B 1 16  ? 32.759 23.706 44.885 1.00 15.61  ? 18  ARG B CA  1 
ATOM 1219 C C   . ARG B 1 16  ? 32.331 23.961 43.457 1.00 11.69  ? 18  ARG B C   1 
ATOM 1220 O O   . ARG B 1 16  ? 32.613 25.043 42.944 1.00 13.90  ? 18  ARG B O   1 
ATOM 1221 C CB  . ARG B 1 16  ? 34.294 23.480 44.958 1.00 19.17  ? 18  ARG B CB  1 
ATOM 1222 C CG  . ARG B 1 16  ? 34.860 23.335 46.379 1.00 28.20  ? 18  ARG B CG  1 
ATOM 1223 C CD  . ARG B 1 16  ? 34.194 24.232 47.463 1.00 53.70  ? 18  ARG B CD  1 
ATOM 1224 N NE  . ARG B 1 16  ? 34.350 23.650 48.803 1.00 76.85  ? 18  ARG B NE  1 
ATOM 1225 C CZ  . ARG B 1 16  ? 33.403 23.615 49.765 1.00 74.74  ? 18  ARG B CZ  1 
ATOM 1226 N NH1 . ARG B 1 16  ? 32.188 24.133 49.589 1.00 67.48  ? 18  ARG B NH1 1 
ATOM 1227 N NH2 . ARG B 1 16  ? 33.675 22.998 50.922 1.00 76.81  ? 18  ARG B NH2 1 
ATOM 1228 N N   . VAL B 1 17  ? 31.653 23.026 42.785 1.00 3.30   ? 19  VAL B N   1 
ATOM 1229 C CA  . VAL B 1 17  ? 31.076 23.386 41.504 1.00 8.51   ? 19  VAL B CA  1 
ATOM 1230 C C   . VAL B 1 17  ? 29.534 23.347 41.520 1.00 14.71  ? 19  VAL B C   1 
ATOM 1231 O O   . VAL B 1 17  ? 28.871 23.096 40.498 1.00 18.24  ? 19  VAL B O   1 
ATOM 1232 C CB  . VAL B 1 17  ? 31.592 22.487 40.328 1.00 7.11   ? 19  VAL B CB  1 
ATOM 1233 C CG1 . VAL B 1 17  ? 33.001 22.906 39.989 1.00 14.88  ? 19  VAL B CG1 1 
ATOM 1234 C CG2 . VAL B 1 17  ? 31.539 21.024 40.672 1.00 15.93  ? 19  VAL B CG2 1 
ATOM 1235 N N   . TYR B 1 18  ? 28.970 23.621 42.714 1.00 7.25   ? 20  TYR B N   1 
ATOM 1236 C CA  . TYR B 1 18  ? 27.547 23.752 42.920 1.00 2.00   ? 20  TYR B CA  1 
ATOM 1237 C C   . TYR B 1 18  ? 26.743 22.613 42.309 1.00 18.16  ? 20  TYR B C   1 
ATOM 1238 O O   . TYR B 1 18  ? 25.772 22.880 41.575 1.00 25.66  ? 20  TYR B O   1 
ATOM 1239 C CB  . TYR B 1 18  ? 27.119 25.092 42.326 1.00 10.07  ? 20  TYR B CB  1 
ATOM 1240 C CG  . TYR B 1 18  ? 27.804 26.227 43.026 1.00 2.06   ? 20  TYR B CG  1 
ATOM 1241 C CD1 . TYR B 1 18  ? 27.401 26.479 44.312 1.00 2.50   ? 20  TYR B CD1 1 
ATOM 1242 C CD2 . TYR B 1 18  ? 28.854 26.927 42.442 1.00 2.00   ? 20  TYR B CD2 1 
ATOM 1243 C CE1 . TYR B 1 18  ? 28.070 27.436 45.044 1.00 4.78   ? 20  TYR B CE1 1 
ATOM 1244 C CE2 . TYR B 1 18  ? 29.519 27.897 43.192 1.00 2.02   ? 20  TYR B CE2 1 
ATOM 1245 C CZ  . TYR B 1 18  ? 29.117 28.134 44.495 1.00 2.16   ? 20  TYR B CZ  1 
ATOM 1246 O OH  . TYR B 1 18  ? 29.762 29.030 45.309 1.00 17.70  ? 20  TYR B OH  1 
ATOM 1247 N N   . LYS B 1 19  ? 27.169 21.347 42.555 1.00 17.48  ? 21  LYS B N   1 
ATOM 1248 C CA  . LYS B 1 19  ? 26.467 20.167 42.047 1.00 13.27  ? 21  LYS B CA  1 
ATOM 1249 C C   . LYS B 1 19  ? 25.243 19.872 42.916 1.00 20.01  ? 21  LYS B C   1 
ATOM 1250 O O   . LYS B 1 19  ? 25.282 20.133 44.117 1.00 24.82  ? 21  LYS B O   1 
ATOM 1251 C CB  . LYS B 1 19  ? 27.357 18.954 42.066 1.00 29.00  ? 21  LYS B CB  1 
ATOM 1252 C CG  . LYS B 1 19  ? 28.594 19.068 41.184 1.00 46.03  ? 21  LYS B CG  1 
ATOM 1253 C CD  . LYS B 1 19  ? 28.635 18.200 39.913 1.00 57.11  ? 21  LYS B CD  1 
ATOM 1254 C CE  . LYS B 1 19  ? 28.755 16.692 40.176 1.00 72.68  ? 21  LYS B CE  1 
ATOM 1255 N NZ  . LYS B 1 19  ? 28.986 15.965 38.940 1.00 81.04  ? 21  LYS B NZ  1 
ATOM 1256 N N   . GLU B 1 20  ? 24.134 19.356 42.363 1.00 24.82  ? 22  GLU B N   1 
ATOM 1257 C CA  . GLU B 1 20  ? 22.914 19.071 43.105 1.00 20.01  ? 22  GLU B CA  1 
ATOM 1258 C C   . GLU B 1 20  ? 23.155 17.782 43.898 1.00 24.68  ? 22  GLU B C   1 
ATOM 1259 O O   . GLU B 1 20  ? 22.675 17.672 45.023 1.00 33.24  ? 22  GLU B O   1 
ATOM 1260 C CB  . GLU B 1 20  ? 21.795 18.934 42.082 1.00 41.16  ? 22  GLU B CB  1 
ATOM 1261 C CG  . GLU B 1 20  ? 20.366 18.715 42.632 1.00 77.07  ? 22  GLU B CG  1 
ATOM 1262 C CD  . GLU B 1 20  ? 19.225 18.290 41.668 1.00 89.84  ? 22  GLU B CD  1 
ATOM 1263 O OE1 . GLU B 1 20  ? 19.502 17.751 40.589 1.00 95.61  ? 22  GLU B OE1 1 
ATOM 1264 O OE2 . GLU B 1 20  ? 18.044 18.480 42.013 1.00 94.52  ? 22  GLU B OE2 1 
ATOM 1265 N N   . SER B 1 21  ? 23.915 16.803 43.374 1.00 30.40  ? 23  SER B N   1 
ATOM 1266 C CA  . SER B 1 21  ? 24.237 15.540 44.038 1.00 37.37  ? 23  SER B CA  1 
ATOM 1267 C C   . SER B 1 21  ? 25.594 14.971 43.584 1.00 43.99  ? 23  SER B C   1 
ATOM 1268 O O   . SER B 1 21  ? 26.129 15.400 42.553 1.00 52.63  ? 23  SER B O   1 
ATOM 1269 C CB  . SER B 1 21  ? 23.162 14.485 43.750 1.00 33.58  ? 23  SER B CB  1 
ATOM 1270 O OG  . SER B 1 21  ? 23.105 13.970 42.421 1.00 42.60  ? 23  SER B OG  1 
ATOM 1271 N N   . THR B 1 22  ? 26.180 14.024 44.331 1.00 49.24  ? 24  THR B N   1 
ATOM 1272 C CA  . THR B 1 22  ? 27.434 13.346 43.992 1.00 48.64  ? 24  THR B CA  1 
ATOM 1273 C C   . THR B 1 22  ? 27.281 11.921 44.525 1.00 51.81  ? 24  THR B C   1 
ATOM 1274 O O   . THR B 1 22  ? 26.647 11.700 45.575 1.00 57.90  ? 24  THR B O   1 
ATOM 1275 C CB  . THR B 1 22  ? 28.647 14.030 44.663 1.00 43.92  ? 24  THR B CB  1 
ATOM 1276 O OG1 . THR B 1 22  ? 29.764 13.451 44.007 1.00 50.60  ? 24  THR B OG1 1 
ATOM 1277 C CG2 . THR B 1 22  ? 28.752 13.863 46.188 1.00 40.95  ? 24  THR B CG2 1 
ATOM 1278 N N   . ASP B 1 23  ? 27.817 10.925 43.823 1.00 52.36  ? 25  ASP B N   1 
ATOM 1279 C CA  . ASP B 1 23  ? 27.660 9.551  44.271 1.00 50.06  ? 25  ASP B CA  1 
ATOM 1280 C C   . ASP B 1 23  ? 28.960 8.931  44.736 1.00 46.56  ? 25  ASP B C   1 
ATOM 1281 O O   . ASP B 1 23  ? 30.015 9.047  44.098 1.00 44.64  ? 25  ASP B O   1 
ATOM 1282 C CB  . ASP B 1 23  ? 27.105 8.675  43.175 1.00 50.33  ? 25  ASP B CB  1 
ATOM 1283 C CG  . ASP B 1 23  ? 25.698 9.009  42.712 1.00 51.74  ? 25  ASP B CG  1 
ATOM 1284 O OD1 . ASP B 1 23  ? 24.870 9.423  43.528 1.00 34.78  ? 25  ASP B OD1 1 
ATOM 1285 O OD2 . ASP B 1 23  ? 25.448 8.820  41.518 1.00 42.95  ? 25  ASP B OD2 1 
ATOM 1286 N N   . VAL B 1 24  ? 28.829 8.277  45.881 1.00 39.48  ? 26  VAL B N   1 
ATOM 1287 C CA  . VAL B 1 24  ? 29.932 7.596  46.516 1.00 43.38  ? 26  VAL B CA  1 
ATOM 1288 C C   . VAL B 1 24  ? 29.519 6.112  46.628 1.00 49.91  ? 26  VAL B C   1 
ATOM 1289 O O   . VAL B 1 24  ? 28.371 5.853  47.029 1.00 53.48  ? 26  VAL B O   1 
ATOM 1290 C CB  . VAL B 1 24  ? 30.183 8.314  47.889 1.00 40.81  ? 26  VAL B CB  1 
ATOM 1291 C CG1 . VAL B 1 24  ? 28.917 8.394  48.721 1.00 32.68  ? 26  VAL B CG1 1 
ATOM 1292 C CG2 . VAL B 1 24  ? 31.196 7.535  48.702 1.00 39.12  ? 26  VAL B CG2 1 
ATOM 1293 N N   . PRO B 1 25  ? 30.341 5.112  46.205 1.00 40.80  ? 27  PRO B N   1 
ATOM 1294 C CA  . PRO B 1 25  ? 30.199 3.698  46.530 1.00 35.05  ? 27  PRO B CA  1 
ATOM 1295 C C   . PRO B 1 25  ? 29.761 3.446  47.968 1.00 41.92  ? 27  PRO B C   1 
ATOM 1296 O O   . PRO B 1 25  ? 30.433 3.851  48.916 1.00 51.28  ? 27  PRO B O   1 
ATOM 1297 C CB  . PRO B 1 25  ? 31.554 3.154  46.189 1.00 32.97  ? 27  PRO B CB  1 
ATOM 1298 C CG  . PRO B 1 25  ? 31.962 3.896  44.968 1.00 21.48  ? 27  PRO B CG  1 
ATOM 1299 C CD  . PRO B 1 25  ? 31.524 5.303  45.361 1.00 42.05  ? 27  PRO B CD  1 
ATOM 1300 N N   . ALA B 1 26  ? 28.621 2.789  48.117 1.00 44.85  ? 28  ALA B N   1 
ATOM 1301 C CA  . ALA B 1 26  ? 27.976 2.587  49.402 1.00 47.32  ? 28  ALA B CA  1 
ATOM 1302 C C   . ALA B 1 26  ? 28.773 1.791  50.437 1.00 44.79  ? 28  ALA B C   1 
ATOM 1303 O O   . ALA B 1 26  ? 29.752 1.145  50.066 1.00 38.92  ? 28  ALA B O   1 
ATOM 1304 C CB  . ALA B 1 26  ? 26.659 1.918  49.111 1.00 42.69  ? 28  ALA B CB  1 
ATOM 1305 N N   . SER B 1 27  ? 28.411 1.814  51.725 1.00 34.22  ? 29  SER B N   1 
ATOM 1306 C CA  . SER B 1 27  ? 29.138 1.116  52.775 1.00 39.27  ? 29  SER B CA  1 
ATOM 1307 C C   . SER B 1 27  ? 28.412 1.412  54.072 1.00 47.32  ? 29  SER B C   1 
ATOM 1308 O O   . SER B 1 27  ? 27.895 2.521  54.210 1.00 56.60  ? 29  SER B O   1 
ATOM 1309 C CB  . SER B 1 27  ? 30.589 1.622  52.850 1.00 31.35  ? 29  SER B CB  1 
ATOM 1310 O OG  . SER B 1 27  ? 31.138 2.040  54.110 1.00 49.45  ? 29  SER B OG  1 
ATOM 1311 N N   . ARG B 1 28  ? 28.354 0.495  55.041 1.00 54.46  ? 30  ARG B N   1 
ATOM 1312 C CA  . ARG B 1 28  ? 27.683 0.742  56.317 1.00 69.56  ? 30  ARG B CA  1 
ATOM 1313 C C   . ARG B 1 28  ? 28.208 2.008  57.001 1.00 70.22  ? 30  ARG B C   1 
ATOM 1314 O O   . ARG B 1 28  ? 27.468 2.875  57.473 1.00 73.06  ? 30  ARG B O   1 
ATOM 1315 C CB  . ARG B 1 28  ? 27.892 -0.426 57.291 1.00 85.63  ? 30  ARG B CB  1 
ATOM 1316 C CG  . ARG B 1 28  ? 27.450 -1.811 56.827 1.00 111.81 ? 30  ARG B CG  1 
ATOM 1317 C CD  . ARG B 1 28  ? 27.667 -2.801 57.976 1.00 131.04 ? 30  ARG B CD  1 
ATOM 1318 N NE  . ARG B 1 28  ? 27.463 -4.192 57.581 1.00 143.85 ? 30  ARG B NE  1 
ATOM 1319 C CZ  . ARG B 1 28  ? 27.369 -5.192 58.473 1.00 151.94 ? 30  ARG B CZ  1 
ATOM 1320 N NH1 . ARG B 1 28  ? 27.449 -4.990 59.790 1.00 155.68 ? 30  ARG B NH1 1 
ATOM 1321 N NH2 . ARG B 1 28  ? 27.208 -6.439 58.036 1.00 155.17 ? 30  ARG B NH2 1 
ATOM 1322 N N   . PHE B 1 29  ? 29.537 2.141  56.953 1.00 72.66  ? 31  PHE B N   1 
ATOM 1323 C CA  . PHE B 1 29  ? 30.273 3.213  57.606 1.00 59.45  ? 31  PHE B CA  1 
ATOM 1324 C C   . PHE B 1 29  ? 29.962 4.525  56.919 1.00 60.74  ? 31  PHE B C   1 
ATOM 1325 O O   . PHE B 1 29  ? 29.653 5.509  57.595 1.00 63.04  ? 31  PHE B O   1 
ATOM 1326 C CB  . PHE B 1 29  ? 31.775 2.934  57.529 1.00 45.77  ? 31  PHE B CB  1 
ATOM 1327 C CG  . PHE B 1 29  ? 32.589 3.609  58.622 1.00 43.46  ? 31  PHE B CG  1 
ATOM 1328 C CD1 . PHE B 1 29  ? 32.040 3.829  59.896 1.00 46.03  ? 31  PHE B CD1 1 
ATOM 1329 C CD2 . PHE B 1 29  ? 33.907 3.993  58.347 1.00 39.83  ? 31  PHE B CD2 1 
ATOM 1330 C CE1 . PHE B 1 29  ? 32.810 4.434  60.891 1.00 51.75  ? 31  PHE B CE1 1 
ATOM 1331 C CE2 . PHE B 1 29  ? 34.675 4.595  59.343 1.00 42.74  ? 31  PHE B CE2 1 
ATOM 1332 C CZ  . PHE B 1 29  ? 34.127 4.817  60.611 1.00 56.34  ? 31  PHE B CZ  1 
ATOM 1333 N N   . LYS B 1 30  ? 30.008 4.537  55.576 1.00 51.18  ? 32  LYS B N   1 
ATOM 1334 C CA  . LYS B 1 30  ? 29.703 5.731  54.809 1.00 33.31  ? 32  LYS B CA  1 
ATOM 1335 C C   . LYS B 1 30  ? 28.295 6.202  55.130 1.00 37.54  ? 32  LYS B C   1 
ATOM 1336 O O   . LYS B 1 30  ? 28.074 7.396  55.374 1.00 45.07  ? 32  LYS B O   1 
ATOM 1337 C CB  . LYS B 1 30  ? 29.859 5.405  53.368 1.00 26.42  ? 32  LYS B CB  1 
ATOM 1338 C CG  . LYS B 1 30  ? 31.367 5.291  53.151 1.00 28.40  ? 32  LYS B CG  1 
ATOM 1339 C CD  . LYS B 1 30  ? 31.542 5.039  51.672 1.00 23.96  ? 32  LYS B CD  1 
ATOM 1340 C CE  . LYS B 1 30  ? 32.987 4.921  51.264 1.00 20.39  ? 32  LYS B CE  1 
ATOM 1341 N NZ  . LYS B 1 30  ? 33.042 4.735  49.820 1.00 35.31  ? 32  LYS B NZ  1 
ATOM 1342 N N   . GLU B 1 31  ? 27.367 5.255  55.282 1.00 32.18  ? 33  GLU B N   1 
ATOM 1343 C CA  . GLU B 1 31  ? 26.039 5.592  55.716 1.00 30.89  ? 33  GLU B CA  1 
ATOM 1344 C C   . GLU B 1 31  ? 26.071 6.239  57.059 1.00 32.97  ? 33  GLU B C   1 
ATOM 1345 O O   . GLU B 1 31  ? 25.348 7.197  57.273 1.00 36.97  ? 33  GLU B O   1 
ATOM 1346 C CB  . GLU B 1 31  ? 25.170 4.414  55.843 1.00 35.42  ? 33  GLU B CB  1 
ATOM 1347 C CG  . GLU B 1 31  ? 24.536 4.303  54.483 1.00 63.65  ? 33  GLU B CG  1 
ATOM 1348 C CD  . GLU B 1 31  ? 23.373 3.346  54.507 1.00 76.23  ? 33  GLU B CD  1 
ATOM 1349 O OE1 . GLU B 1 31  ? 22.409 3.633  55.218 1.00 86.17  ? 33  GLU B OE1 1 
ATOM 1350 O OE2 . GLU B 1 31  ? 23.441 2.317  53.833 1.00 79.96  ? 33  GLU B OE2 1 
ATOM 1351 N N   . GLU B 1 32  ? 26.931 5.788  57.947 1.00 37.79  ? 34  GLU B N   1 
ATOM 1352 C CA  . GLU B 1 32  ? 27.021 6.374  59.260 1.00 42.50  ? 34  GLU B CA  1 
ATOM 1353 C C   . GLU B 1 32  ? 27.494 7.803  59.172 1.00 38.38  ? 34  GLU B C   1 
ATOM 1354 O O   . GLU B 1 32  ? 26.845 8.698  59.729 1.00 43.07  ? 34  GLU B O   1 
ATOM 1355 C CB  . GLU B 1 32  ? 27.991 5.605  60.134 1.00 56.90  ? 34  GLU B CB  1 
ATOM 1356 C CG  . GLU B 1 32  ? 27.672 4.131  60.343 1.00 86.34  ? 34  GLU B CG  1 
ATOM 1357 C CD  . GLU B 1 32  ? 26.266 3.887  60.864 1.00 99.43  ? 34  GLU B CD  1 
ATOM 1358 O OE1 . GLU B 1 32  ? 25.969 4.297  61.991 1.00 104.58 ? 34  GLU B OE1 1 
ATOM 1359 O OE2 . GLU B 1 32  ? 25.478 3.297  60.123 1.00 105.32 ? 34  GLU B OE2 1 
ATOM 1360 N N   . ILE B 1 33  ? 28.567 8.067  58.426 1.00 36.54  ? 35  ILE B N   1 
ATOM 1361 C CA  . ILE B 1 33  ? 29.116 9.413  58.414 1.00 34.71  ? 35  ILE B CA  1 
ATOM 1362 C C   . ILE B 1 33  ? 28.095 10.313 57.725 1.00 38.80  ? 35  ILE B C   1 
ATOM 1363 O O   . ILE B 1 33  ? 27.749 11.360 58.284 1.00 36.91  ? 35  ILE B O   1 
ATOM 1364 C CB  . ILE B 1 33  ? 30.514 9.368  57.722 1.00 32.05  ? 35  ILE B CB  1 
ATOM 1365 C CG1 . ILE B 1 33  ? 31.557 8.646  58.623 1.00 21.09  ? 35  ILE B CG1 1 
ATOM 1366 C CG2 . ILE B 1 33  ? 30.991 10.781 57.491 1.00 10.85  ? 35  ILE B CG2 1 
ATOM 1367 C CD1 . ILE B 1 33  ? 32.868 8.315  57.891 1.00 5.64   ? 35  ILE B CD1 1 
ATOM 1368 N N   . LEU B 1 34  ? 27.499 9.919  56.601 1.00 33.22  ? 36  LEU B N   1 
ATOM 1369 C CA  . LEU B 1 34  ? 26.439 10.720 56.027 1.00 32.13  ? 36  LEU B CA  1 
ATOM 1370 C C   . LEU B 1 34  ? 25.250 10.905 56.976 1.00 35.56  ? 36  LEU B C   1 
ATOM 1371 O O   . LEU B 1 34  ? 24.740 12.012 57.091 1.00 46.41  ? 36  LEU B O   1 
ATOM 1372 C CB  . LEU B 1 34  ? 25.999 10.072 54.744 1.00 25.03  ? 36  LEU B CB  1 
ATOM 1373 C CG  . LEU B 1 34  ? 27.019 10.101 53.639 1.00 26.50  ? 36  LEU B CG  1 
ATOM 1374 C CD1 . LEU B 1 34  ? 26.503 9.419  52.375 1.00 19.13  ? 36  LEU B CD1 1 
ATOM 1375 C CD2 . LEU B 1 34  ? 27.311 11.553 53.343 1.00 35.17  ? 36  LEU B CD2 1 
ATOM 1376 N N   . ARG B 1 35  ? 24.787 9.900  57.706 1.00 41.63  ? 37  ARG B N   1 
ATOM 1377 C CA  . ARG B 1 35  ? 23.705 9.983  58.692 1.00 43.00  ? 37  ARG B CA  1 
ATOM 1378 C C   . ARG B 1 35  ? 24.015 11.151 59.636 1.00 36.54  ? 37  ARG B C   1 
ATOM 1379 O O   . ARG B 1 35  ? 23.178 12.022 59.864 1.00 32.59  ? 37  ARG B O   1 
ATOM 1380 C CB  . ARG B 1 35  ? 23.671 8.582  59.384 1.00 57.86  ? 37  ARG B CB  1 
ATOM 1381 C CG  . ARG B 1 35  ? 22.746 8.052  60.488 1.00 62.19  ? 37  ARG B CG  1 
ATOM 1382 C CD  . ARG B 1 35  ? 23.101 8.497  61.908 1.00 73.10  ? 37  ARG B CD  1 
ATOM 1383 N NE  . ARG B 1 35  ? 24.293 7.873  62.470 1.00 81.19  ? 37  ARG B NE  1 
ATOM 1384 C CZ  . ARG B 1 35  ? 24.739 8.144  63.715 1.00 85.34  ? 37  ARG B CZ  1 
ATOM 1385 N NH1 . ARG B 1 35  ? 24.138 9.008  64.533 1.00 90.42  ? 37  ARG B NH1 1 
ATOM 1386 N NH2 . ARG B 1 35  ? 25.816 7.525  64.189 1.00 87.78  ? 37  ARG B NH2 1 
ATOM 1387 N N   . ILE B 1 36  ? 25.248 11.229 60.131 1.00 30.66  ? 38  ILE B N   1 
ATOM 1388 C CA  . ILE B 1 36  ? 25.684 12.315 60.996 1.00 21.54  ? 38  ILE B CA  1 
ATOM 1389 C C   . ILE B 1 36  ? 25.775 13.622 60.183 1.00 31.36  ? 38  ILE B C   1 
ATOM 1390 O O   . ILE B 1 36  ? 25.177 14.604 60.631 1.00 33.76  ? 38  ILE B O   1 
ATOM 1391 C CB  . ILE B 1 36  ? 27.043 11.888 61.585 1.00 14.38  ? 38  ILE B CB  1 
ATOM 1392 C CG1 . ILE B 1 36  ? 26.795 10.758 62.541 1.00 2.00   ? 38  ILE B CG1 1 
ATOM 1393 C CG2 . ILE B 1 36  ? 27.780 13.078 62.173 1.00 6.26   ? 38  ILE B CG2 1 
ATOM 1394 C CD1 . ILE B 1 36  ? 26.819 11.060 64.058 1.00 28.92  ? 38  ILE B CD1 1 
ATOM 1395 N N   . LEU B 1 37  ? 26.458 13.715 59.007 1.00 24.52  ? 39  LEU B N   1 
ATOM 1396 C CA  . LEU B 1 37  ? 26.623 14.952 58.236 1.00 14.96  ? 39  LEU B CA  1 
ATOM 1397 C C   . LEU B 1 37  ? 25.290 15.609 57.889 1.00 27.73  ? 39  LEU B C   1 
ATOM 1398 O O   . LEU B 1 37  ? 25.144 16.835 58.019 1.00 30.21  ? 39  LEU B O   1 
ATOM 1399 C CB  . LEU B 1 37  ? 27.386 14.728 56.906 1.00 2.08   ? 39  LEU B CB  1 
ATOM 1400 C CG  . LEU B 1 37  ? 28.885 14.428 56.979 1.00 9.70   ? 39  LEU B CG  1 
ATOM 1401 C CD1 . LEU B 1 37  ? 29.506 14.556 55.603 1.00 5.70   ? 39  LEU B CD1 1 
ATOM 1402 C CD2 . LEU B 1 37  ? 29.618 15.475 57.795 1.00 14.77  ? 39  LEU B CD2 1 
ATOM 1403 N N   . ALA B 1 38  ? 24.288 14.813 57.476 1.00 33.23  ? 40  ALA B N   1 
ATOM 1404 C CA  . ALA B 1 38  ? 22.962 15.308 57.130 1.00 37.89  ? 40  ALA B CA  1 
ATOM 1405 C C   . ALA B 1 38  ? 22.286 15.825 58.399 1.00 40.67  ? 40  ALA B C   1 
ATOM 1406 O O   . ALA B 1 38  ? 21.781 16.950 58.413 1.00 54.14  ? 40  ALA B O   1 
ATOM 1407 C CB  . ALA B 1 38  ? 22.089 14.189 56.506 1.00 11.63  ? 40  ALA B CB  1 
ATOM 1408 N N   . ARG B 1 39  ? 22.382 15.118 59.528 1.00 39.47  ? 41  ARG B N   1 
ATOM 1409 C CA  . ARG B 1 39  ? 21.656 15.544 60.704 1.00 43.95  ? 41  ARG B CA  1 
ATOM 1410 C C   . ARG B 1 39  ? 22.234 16.785 61.321 1.00 39.22  ? 41  ARG B C   1 
ATOM 1411 O O   . ARG B 1 39  ? 21.499 17.540 61.933 1.00 45.61  ? 41  ARG B O   1 
ATOM 1412 C CB  . ARG B 1 39  ? 21.601 14.431 61.756 1.00 50.46  ? 41  ARG B CB  1 
ATOM 1413 C CG  . ARG B 1 39  ? 22.802 14.146 62.619 1.00 61.87  ? 41  ARG B CG  1 
ATOM 1414 C CD  . ARG B 1 39  ? 22.320 14.235 64.057 1.00 71.23  ? 41  ARG B CD  1 
ATOM 1415 N NE  . ARG B 1 39  ? 22.480 12.962 64.742 1.00 67.80  ? 41  ARG B NE  1 
ATOM 1416 C CZ  . ARG B 1 39  ? 23.608 12.638 65.360 1.00 64.33  ? 41  ARG B CZ  1 
ATOM 1417 N NH1 . ARG B 1 39  ? 24.646 13.472 65.378 1.00 74.82  ? 41  ARG B NH1 1 
ATOM 1418 N NH2 . ARG B 1 39  ? 23.697 11.457 65.958 1.00 67.47  ? 41  ARG B NH2 1 
ATOM 1419 N N   . GLU B 1 40  ? 23.517 17.065 61.154 1.00 44.73  ? 42  GLU B N   1 
ATOM 1420 C CA  . GLU B 1 40  ? 24.058 18.293 61.702 1.00 40.97  ? 42  GLU B CA  1 
ATOM 1421 C C   . GLU B 1 40  ? 23.940 19.384 60.652 1.00 32.25  ? 42  GLU B C   1 
ATOM 1422 O O   . GLU B 1 40  ? 24.544 20.441 60.797 1.00 33.26  ? 42  GLU B O   1 
ATOM 1423 C CB  . GLU B 1 40  ? 25.498 18.033 62.113 1.00 52.74  ? 42  GLU B CB  1 
ATOM 1424 C CG  . GLU B 1 40  ? 25.660 16.956 63.213 1.00 66.02  ? 42  GLU B CG  1 
ATOM 1425 C CD  . GLU B 1 40  ? 25.458 17.382 64.673 1.00 80.45  ? 42  GLU B CD  1 
ATOM 1426 O OE1 . GLU B 1 40  ? 25.806 18.510 65.039 1.00 96.05  ? 42  GLU B OE1 1 
ATOM 1427 O OE2 . GLU B 1 40  ? 24.983 16.566 65.462 1.00 77.87  ? 42  GLU B OE2 1 
ATOM 1428 N N   . GLY B 1 41  ? 23.152 19.133 59.596 1.00 32.25  ? 43  GLY B N   1 
ATOM 1429 C CA  . GLY B 1 41  ? 22.828 20.071 58.536 1.00 36.45  ? 43  GLY B CA  1 
ATOM 1430 C C   . GLY B 1 41  ? 23.813 20.184 57.369 1.00 43.15  ? 43  GLY B C   1 
ATOM 1431 O O   . GLY B 1 41  ? 23.502 20.922 56.436 1.00 56.62  ? 43  GLY B O   1 
ATOM 1432 N N   . PHE B 1 42  ? 24.957 19.499 57.256 1.00 32.33  ? 44  PHE B N   1 
ATOM 1433 C CA  . PHE B 1 42  ? 25.896 19.758 56.166 1.00 13.50  ? 44  PHE B CA  1 
ATOM 1434 C C   . PHE B 1 42  ? 25.557 19.162 54.818 1.00 19.67  ? 44  PHE B C   1 
ATOM 1435 O O   . PHE B 1 42  ? 26.224 19.487 53.839 1.00 26.82  ? 44  PHE B O   1 
ATOM 1436 C CB  . PHE B 1 42  ? 27.276 19.287 56.586 1.00 16.41  ? 44  PHE B CB  1 
ATOM 1437 C CG  . PHE B 1 42  ? 27.817 19.989 57.843 1.00 12.57  ? 44  PHE B CG  1 
ATOM 1438 C CD1 . PHE B 1 42  ? 27.488 19.512 59.116 1.00 16.91  ? 44  PHE B CD1 1 
ATOM 1439 C CD2 . PHE B 1 42  ? 28.613 21.130 57.719 1.00 9.28   ? 44  PHE B CD2 1 
ATOM 1440 C CE1 . PHE B 1 42  ? 27.944 20.180 60.249 1.00 21.10  ? 44  PHE B CE1 1 
ATOM 1441 C CE2 . PHE B 1 42  ? 29.068 21.797 58.850 1.00 16.70  ? 44  PHE B CE2 1 
ATOM 1442 C CZ  . PHE B 1 42  ? 28.729 21.321 60.119 1.00 18.95  ? 44  PHE B CZ  1 
ATOM 1443 N N   . ILE B 1 43  ? 24.590 18.247 54.692 1.00 31.69  ? 45  ILE B N   1 
ATOM 1444 C CA  . ILE B 1 43  ? 24.115 17.735 53.391 1.00 30.97  ? 45  ILE B CA  1 
ATOM 1445 C C   . ILE B 1 43  ? 22.611 17.645 53.547 1.00 30.57  ? 45  ILE B C   1 
ATOM 1446 O O   . ILE B 1 43  ? 22.124 17.605 54.675 1.00 32.04  ? 45  ILE B O   1 
ATOM 1447 C CB  . ILE B 1 43  ? 24.560 16.265 52.906 1.00 16.50  ? 45  ILE B CB  1 
ATOM 1448 C CG1 . ILE B 1 43  ? 24.356 15.197 53.932 1.00 17.51  ? 45  ILE B CG1 1 
ATOM 1449 C CG2 . ILE B 1 43  ? 26.027 16.305 52.534 1.00 8.77   ? 45  ILE B CG2 1 
ATOM 1450 C CD1 . ILE B 1 43  ? 24.423 13.797 53.310 1.00 17.81  ? 45  ILE B CD1 1 
ATOM 1451 N N   . LYS B 1 44  ? 21.894 17.642 52.422 1.00 45.71  ? 46  LYS B N   1 
ATOM 1452 C CA  . LYS B 1 44  ? 20.438 17.513 52.373 1.00 52.27  ? 46  LYS B CA  1 
ATOM 1453 C C   . LYS B 1 44  ? 20.061 16.140 52.864 1.00 49.64  ? 46  LYS B C   1 
ATOM 1454 O O   . LYS B 1 44  ? 19.240 16.021 53.779 1.00 48.01  ? 46  LYS B O   1 
ATOM 1455 C CB  . LYS B 1 44  ? 19.862 17.652 50.951 1.00 57.52  ? 46  LYS B CB  1 
ATOM 1456 C CG  . LYS B 1 44  ? 19.839 19.084 50.426 1.00 84.67  ? 46  LYS B CG  1 
ATOM 1457 C CD  . LYS B 1 44  ? 19.431 19.207 48.957 1.00 104.49 ? 46  LYS B CD  1 
ATOM 1458 C CE  . LYS B 1 44  ? 18.024 18.704 48.643 1.00 118.34 ? 46  LYS B CE  1 
ATOM 1459 N NZ  . LYS B 1 44  ? 17.744 18.878 47.227 1.00 129.10 ? 46  LYS B NZ  1 
ATOM 1460 N N   . GLY B 1 45  ? 20.678 15.126 52.226 1.00 50.98  ? 47  GLY B N   1 
ATOM 1461 C CA  . GLY B 1 45  ? 20.455 13.733 52.570 1.00 38.72  ? 47  GLY B CA  1 
ATOM 1462 C C   . GLY B 1 45  ? 21.133 12.821 51.572 1.00 37.43  ? 47  GLY B C   1 
ATOM 1463 O O   . GLY B 1 45  ? 21.981 13.221 50.778 1.00 30.72  ? 47  GLY B O   1 
ATOM 1464 N N   . TYR B 1 46  ? 20.772 11.560 51.650 1.00 42.99  ? 48  TYR B N   1 
ATOM 1465 C CA  . TYR B 1 46  ? 21.311 10.570 50.761 1.00 42.11  ? 48  TYR B CA  1 
ATOM 1466 C C   . TYR B 1 46  ? 20.244 9.520  50.507 1.00 45.18  ? 48  TYR B C   1 
ATOM 1467 O O   . TYR B 1 46  ? 19.234 9.415  51.204 1.00 46.14  ? 48  TYR B O   1 
ATOM 1468 C CB  . TYR B 1 46  ? 22.592 9.910  51.357 1.00 41.05  ? 48  TYR B CB  1 
ATOM 1469 C CG  . TYR B 1 46  ? 22.456 9.068  52.621 1.00 45.91  ? 48  TYR B CG  1 
ATOM 1470 C CD1 . TYR B 1 46  ? 22.413 9.723  53.859 1.00 48.49  ? 48  TYR B CD1 1 
ATOM 1471 C CD2 . TYR B 1 46  ? 22.348 7.665  52.553 1.00 49.36  ? 48  TYR B CD2 1 
ATOM 1472 C CE1 . TYR B 1 46  ? 22.259 9.004  55.045 1.00 48.15  ? 48  TYR B CE1 1 
ATOM 1473 C CE2 . TYR B 1 46  ? 22.198 6.935  53.744 1.00 56.18  ? 48  TYR B CE2 1 
ATOM 1474 C CZ  . TYR B 1 46  ? 22.152 7.617  54.981 1.00 61.66  ? 48  TYR B CZ  1 
ATOM 1475 O OH  . TYR B 1 46  ? 22.013 6.937  56.178 1.00 75.93  ? 48  TYR B OH  1 
ATOM 1476 N N   . GLU B 1 47  ? 20.440 8.786  49.441 1.00 46.52  ? 49  GLU B N   1 
ATOM 1477 C CA  . GLU B 1 47  ? 19.620 7.664  49.110 1.00 47.23  ? 49  GLU B CA  1 
ATOM 1478 C C   . GLU B 1 47  ? 20.673 6.634  48.791 1.00 58.52  ? 49  GLU B C   1 
ATOM 1479 O O   . GLU B 1 47  ? 21.671 6.944  48.138 1.00 66.29  ? 49  GLU B O   1 
ATOM 1480 C CB  . GLU B 1 47  ? 18.807 7.875  47.854 1.00 46.78  ? 49  GLU B CB  1 
ATOM 1481 C CG  . GLU B 1 47  ? 17.532 8.717  47.935 1.00 64.23  ? 49  GLU B CG  1 
ATOM 1482 C CD  . GLU B 1 47  ? 16.786 8.954  46.603 1.00 80.09  ? 49  GLU B CD  1 
ATOM 1483 O OE1 . GLU B 1 47  ? 17.162 8.406  45.556 1.00 82.96  ? 49  GLU B OE1 1 
ATOM 1484 O OE2 . GLU B 1 47  ? 15.808 9.711  46.604 1.00 83.49  ? 49  GLU B OE2 1 
ATOM 1485 N N   . ARG B 1 48  ? 20.539 5.411  49.275 1.00 71.27  ? 50  ARG B N   1 
ATOM 1486 C CA  . ARG B 1 48  ? 21.373 4.322  48.777 1.00 81.90  ? 50  ARG B CA  1 
ATOM 1487 C C   . ARG B 1 48  ? 20.857 4.176  47.322 1.00 76.68  ? 50  ARG B C   1 
ATOM 1488 O O   . ARG B 1 48  ? 19.646 4.112  47.098 1.00 73.24  ? 50  ARG B O   1 
ATOM 1489 C CB  . ARG B 1 48  ? 21.114 3.033  49.616 1.00 93.55  ? 50  ARG B CB  1 
ATOM 1490 C CG  . ARG B 1 48  ? 22.050 1.805  49.440 1.00 116.59 ? 50  ARG B CG  1 
ATOM 1491 C CD  . ARG B 1 48  ? 23.246 1.758  50.423 1.00 133.03 ? 50  ARG B CD  1 
ATOM 1492 N NE  . ARG B 1 48  ? 24.038 0.525  50.343 1.00 143.12 ? 50  ARG B NE  1 
ATOM 1493 C CZ  . ARG B 1 48  ? 25.011 0.185  51.216 1.00 142.77 ? 50  ARG B CZ  1 
ATOM 1494 N NH1 . ARG B 1 48  ? 25.353 0.951  52.250 1.00 137.60 ? 50  ARG B NH1 1 
ATOM 1495 N NH2 . ARG B 1 48  ? 25.715 -0.930 51.011 1.00 144.15 ? 50  ARG B NH2 1 
ATOM 1496 N N   . VAL B 1 49  ? 21.659 4.237  46.278 1.00 69.81  ? 51  VAL B N   1 
ATOM 1497 C CA  . VAL B 1 49  ? 21.183 4.084  44.921 1.00 70.15  ? 51  VAL B CA  1 
ATOM 1498 C C   . VAL B 1 49  ? 22.019 2.955  44.396 1.00 76.66  ? 51  VAL B C   1 
ATOM 1499 O O   . VAL B 1 49  ? 23.239 3.059  44.450 1.00 79.26  ? 51  VAL B O   1 
ATOM 1500 C CB  . VAL B 1 49  ? 21.451 5.361  44.111 1.00 71.77  ? 51  VAL B CB  1 
ATOM 1501 C CG1 . VAL B 1 49  ? 21.094 5.199  42.643 1.00 54.84  ? 51  VAL B CG1 1 
ATOM 1502 C CG2 . VAL B 1 49  ? 20.621 6.470  44.726 1.00 80.48  ? 51  VAL B CG2 1 
ATOM 1503 N N   . ASP B 1 50  ? 21.477 1.845  43.936 1.00 85.04  ? 52  ASP B N   1 
ATOM 1504 C CA  . ASP B 1 50  ? 22.337 0.858  43.316 1.00 92.03  ? 52  ASP B CA  1 
ATOM 1505 C C   . ASP B 1 50  ? 22.411 1.304  41.874 1.00 89.23  ? 52  ASP B C   1 
ATOM 1506 O O   . ASP B 1 50  ? 21.355 1.525  41.270 1.00 91.82  ? 52  ASP B O   1 
ATOM 1507 C CB  . ASP B 1 50  ? 21.744 -0.553 43.360 1.00 105.67 ? 52  ASP B CB  1 
ATOM 1508 C CG  . ASP B 1 50  ? 22.049 -1.359 44.616 1.00 117.23 ? 52  ASP B CG  1 
ATOM 1509 O OD1 . ASP B 1 50  ? 21.956 -0.808 45.719 1.00 126.28 ? 52  ASP B OD1 1 
ATOM 1510 O OD2 . ASP B 1 50  ? 22.375 -2.543 44.472 1.00 115.91 ? 52  ASP B OD2 1 
ATOM 1511 N N   . VAL B 1 51  ? 23.578 1.543  41.289 1.00 86.12  ? 53  VAL B N   1 
ATOM 1512 C CA  . VAL B 1 51  ? 23.564 1.796  39.874 1.00 84.72  ? 53  VAL B CA  1 
ATOM 1513 C C   . VAL B 1 51  ? 24.580 0.804  39.363 1.00 90.88  ? 53  VAL B C   1 
ATOM 1514 O O   . VAL B 1 51  ? 25.771 0.754  39.666 1.00 82.64  ? 53  VAL B O   1 
ATOM 1515 C CB  . VAL B 1 51  ? 23.958 3.222  39.456 1.00 74.87  ? 53  VAL B CB  1 
ATOM 1516 C CG1 . VAL B 1 51  ? 22.961 3.514  38.337 1.00 69.12  ? 53  VAL B CG1 1 
ATOM 1517 C CG2 . VAL B 1 51  ? 23.806 4.314  40.507 1.00 77.85  ? 53  VAL B CG2 1 
ATOM 1518 N N   . ASP B 1 52  ? 23.827 -0.082 38.702 1.00 103.49 ? 54  ASP B N   1 
ATOM 1519 C CA  . ASP B 1 52  ? 24.249 -1.306 38.058 1.00 111.14 ? 54  ASP B CA  1 
ATOM 1520 C C   . ASP B 1 52  ? 24.857 -2.333 38.984 1.00 109.96 ? 54  ASP B C   1 
ATOM 1521 O O   . ASP B 1 52  ? 26.015 -2.737 38.901 1.00 104.34 ? 54  ASP B O   1 
ATOM 1522 C CB  . ASP B 1 52  ? 25.204 -0.975 36.910 1.00 124.48 ? 54  ASP B CB  1 
ATOM 1523 C CG  . ASP B 1 52  ? 24.372 -0.622 35.686 1.00 140.31 ? 54  ASP B CG  1 
ATOM 1524 O OD1 . ASP B 1 52  ? 24.019 -1.542 34.941 1.00 149.35 ? 54  ASP B OD1 1 
ATOM 1525 O OD2 . ASP B 1 52  ? 24.058 0.559  35.493 1.00 146.70 ? 54  ASP B OD2 1 
ATOM 1526 N N   . GLY B 1 53  ? 23.984 -2.755 39.903 1.00 109.21 ? 55  GLY B N   1 
ATOM 1527 C CA  . GLY B 1 53  ? 24.302 -3.806 40.852 1.00 110.12 ? 55  GLY B CA  1 
ATOM 1528 C C   . GLY B 1 53  ? 25.102 -3.268 42.021 1.00 110.62 ? 55  GLY B C   1 
ATOM 1529 O O   . GLY B 1 53  ? 24.733 -3.492 43.176 1.00 116.65 ? 55  GLY B O   1 
ATOM 1530 N N   . LYS B 1 54  ? 26.202 -2.578 41.697 1.00 104.02 ? 56  LYS B N   1 
ATOM 1531 C CA  . LYS B 1 54  ? 27.083 -1.903 42.644 1.00 93.15  ? 56  LYS B CA  1 
ATOM 1532 C C   . LYS B 1 54  ? 26.276 -0.857 43.404 1.00 91.05  ? 56  LYS B C   1 
ATOM 1533 O O   . LYS B 1 54  ? 25.604 -0.044 42.752 1.00 95.53  ? 56  LYS B O   1 
ATOM 1534 C CB  . LYS B 1 54  ? 28.265 -1.223 41.907 1.00 84.28  ? 56  LYS B CB  1 
ATOM 1535 C CG  . LYS B 1 54  ? 28.179 -1.071 40.375 1.00 74.23  ? 56  LYS B CG  1 
ATOM 1536 C CD  . LYS B 1 54  ? 29.469 -0.667 39.662 1.00 81.60  ? 56  LYS B CD  1 
ATOM 1537 C CE  . LYS B 1 54  ? 30.672 -1.566 40.043 1.00 75.31  ? 56  LYS B CE  1 
ATOM 1538 N NZ  . LYS B 1 54  ? 31.877 -1.229 39.298 1.00 65.23  ? 56  LYS B NZ  1 
ATOM 1539 N N   . PRO B 1 55  ? 26.215 -0.881 44.751 1.00 87.80  ? 57  PRO B N   1 
ATOM 1540 C CA  . PRO B 1 55  ? 25.552 0.140  45.562 1.00 88.43  ? 57  PRO B CA  1 
ATOM 1541 C C   . PRO B 1 55  ? 26.346 1.442  45.613 1.00 81.91  ? 57  PRO B C   1 
ATOM 1542 O O   . PRO B 1 55  ? 27.580 1.495  45.732 1.00 82.58  ? 57  PRO B O   1 
ATOM 1543 C CB  . PRO B 1 55  ? 25.373 -0.482 46.939 1.00 83.12  ? 57  PRO B CB  1 
ATOM 1544 C CG  . PRO B 1 55  ? 25.537 -1.953 46.665 1.00 87.08  ? 57  PRO B CG  1 
ATOM 1545 C CD  . PRO B 1 55  ? 26.636 -1.981 45.602 1.00 82.86  ? 57  PRO B CD  1 
ATOM 1546 N N   . TYR B 1 56  ? 25.582 2.508  45.546 1.00 65.29  ? 58  TYR B N   1 
ATOM 1547 C CA  . TYR B 1 56  ? 26.077 3.847  45.575 1.00 52.40  ? 58  TYR B CA  1 
ATOM 1548 C C   . TYR B 1 56  ? 25.242 4.564  46.606 1.00 56.49  ? 58  TYR B C   1 
ATOM 1549 O O   . TYR B 1 56  ? 24.248 4.032  47.105 1.00 63.11  ? 58  TYR B O   1 
ATOM 1550 C CB  . TYR B 1 56  ? 25.920 4.463  44.222 1.00 33.97  ? 58  TYR B CB  1 
ATOM 1551 C CG  . TYR B 1 56  ? 27.033 4.029  43.293 1.00 40.81  ? 58  TYR B CG  1 
ATOM 1552 C CD1 . TYR B 1 56  ? 28.341 4.061  43.732 1.00 44.24  ? 58  TYR B CD1 1 
ATOM 1553 C CD2 . TYR B 1 56  ? 26.770 3.631  41.986 1.00 58.54  ? 58  TYR B CD2 1 
ATOM 1554 C CE1 . TYR B 1 56  ? 29.382 3.710  42.884 1.00 50.72  ? 58  TYR B CE1 1 
ATOM 1555 C CE2 . TYR B 1 56  ? 27.806 3.272  41.116 1.00 56.80  ? 58  TYR B CE2 1 
ATOM 1556 C CZ  . TYR B 1 56  ? 29.118 3.318  41.583 1.00 56.25  ? 58  TYR B CZ  1 
ATOM 1557 O OH  . TYR B 1 56  ? 30.189 2.999  40.767 1.00 66.29  ? 58  TYR B OH  1 
ATOM 1558 N N   . LEU B 1 57  ? 25.707 5.728  47.016 1.00 53.62  ? 59  LEU B N   1 
ATOM 1559 C CA  . LEU B 1 57  ? 25.051 6.563  47.983 1.00 40.65  ? 59  LEU B CA  1 
ATOM 1560 C C   . LEU B 1 57  ? 25.017 7.869  47.228 1.00 49.55  ? 59  LEU B C   1 
ATOM 1561 O O   . LEU B 1 57  ? 26.035 8.334  46.687 1.00 52.46  ? 59  LEU B O   1 
ATOM 1562 C CB  . LEU B 1 57  ? 25.906 6.635  49.218 1.00 31.32  ? 59  LEU B CB  1 
ATOM 1563 C CG  . LEU B 1 57  ? 25.818 5.493  50.213 1.00 27.26  ? 59  LEU B CG  1 
ATOM 1564 C CD1 . LEU B 1 57  ? 26.724 5.746  51.396 1.00 23.68  ? 59  LEU B CD1 1 
ATOM 1565 C CD2 . LEU B 1 57  ? 24.420 5.421  50.768 1.00 26.85  ? 59  LEU B CD2 1 
ATOM 1566 N N   . ARG B 1 58  ? 23.798 8.376  47.091 1.00 51.60  ? 60  ARG B N   1 
ATOM 1567 C CA  . ARG B 1 58  ? 23.530 9.600  46.370 1.00 50.99  ? 60  ARG B CA  1 
ATOM 1568 C C   . ARG B 1 58  ? 23.319 10.647 47.428 1.00 54.32  ? 60  ARG B C   1 
ATOM 1569 O O   . ARG B 1 58  ? 22.251 10.721 48.045 1.00 51.25  ? 60  ARG B O   1 
ATOM 1570 C CB  . ARG B 1 58  ? 22.272 9.502  45.532 1.00 43.75  ? 60  ARG B CB  1 
ATOM 1571 C CG  . ARG B 1 58  ? 22.180 10.650 44.551 1.00 34.98  ? 60  ARG B CG  1 
ATOM 1572 C CD  . ARG B 1 58  ? 21.381 10.184 43.382 1.00 33.48  ? 60  ARG B CD  1 
ATOM 1573 N NE  . ARG B 1 58  ? 21.965 8.974  42.845 1.00 43.87  ? 60  ARG B NE  1 
ATOM 1574 C CZ  . ARG B 1 58  ? 22.458 8.876  41.615 1.00 44.10  ? 60  ARG B CZ  1 
ATOM 1575 N NH1 . ARG B 1 58  ? 22.457 9.897  40.795 1.00 47.21  ? 60  ARG B NH1 1 
ATOM 1576 N NH2 . ARG B 1 58  ? 22.971 7.724  41.186 1.00 52.97  ? 60  ARG B NH2 1 
ATOM 1577 N N   . VAL B 1 59  ? 24.404 11.395 47.630 1.00 56.15  ? 61  VAL B N   1 
ATOM 1578 C CA  . VAL B 1 59  ? 24.490 12.483 48.595 1.00 40.65  ? 61  VAL B CA  1 
ATOM 1579 C C   . VAL B 1 59  ? 23.775 13.649 47.929 1.00 34.62  ? 61  VAL B C   1 
ATOM 1580 O O   . VAL B 1 59  ? 23.998 13.914 46.743 1.00 43.82  ? 61  VAL B O   1 
ATOM 1581 C CB  . VAL B 1 59  ? 25.993 12.736 48.849 1.00 32.91  ? 61  VAL B CB  1 
ATOM 1582 C CG1 . VAL B 1 59  ? 26.169 13.792 49.895 1.00 34.00  ? 61  VAL B CG1 1 
ATOM 1583 C CG2 . VAL B 1 59  ? 26.654 11.453 49.347 1.00 12.77  ? 61  VAL B CG2 1 
ATOM 1584 N N   . TYR B 1 60  ? 22.897 14.350 48.607 1.00 22.82  ? 62  TYR B N   1 
ATOM 1585 C CA  . TYR B 1 60  ? 22.194 15.459 48.015 1.00 19.20  ? 62  TYR B CA  1 
ATOM 1586 C C   . TYR B 1 60  ? 22.764 16.629 48.743 1.00 24.92  ? 62  TYR B C   1 
ATOM 1587 O O   . TYR B 1 60  ? 22.522 16.788 49.942 1.00 23.92  ? 62  TYR B O   1 
ATOM 1588 C CB  . TYR B 1 60  ? 20.720 15.356 48.281 1.00 40.25  ? 62  TYR B CB  1 
ATOM 1589 C CG  . TYR B 1 60  ? 20.136 14.294 47.380 1.00 47.88  ? 62  TYR B CG  1 
ATOM 1590 C CD1 . TYR B 1 60  ? 20.267 14.444 45.988 1.00 40.43  ? 62  TYR B CD1 1 
ATOM 1591 C CD2 . TYR B 1 60  ? 19.527 13.169 47.937 1.00 38.60  ? 62  TYR B CD2 1 
ATOM 1592 C CE1 . TYR B 1 60  ? 19.796 13.457 45.128 1.00 38.82  ? 62  TYR B CE1 1 
ATOM 1593 C CE2 . TYR B 1 60  ? 19.056 12.184 47.067 1.00 53.00  ? 62  TYR B CE2 1 
ATOM 1594 C CZ  . TYR B 1 60  ? 19.194 12.330 45.679 1.00 45.69  ? 62  TYR B CZ  1 
ATOM 1595 O OH  . TYR B 1 60  ? 18.736 11.342 44.830 1.00 59.56  ? 62  TYR B OH  1 
ATOM 1596 N N   . LEU B 1 61  ? 23.552 17.421 48.040 1.00 20.97  ? 63  LEU B N   1 
ATOM 1597 C CA  . LEU B 1 61  ? 24.251 18.505 48.676 1.00 17.12  ? 63  LEU B CA  1 
ATOM 1598 C C   . LEU B 1 61  ? 23.354 19.690 49.032 1.00 21.94  ? 63  LEU B C   1 
ATOM 1599 O O   . LEU B 1 61  ? 22.369 19.994 48.343 1.00 21.10  ? 63  LEU B O   1 
ATOM 1600 C CB  . LEU B 1 61  ? 25.373 18.948 47.754 1.00 13.11  ? 63  LEU B CB  1 
ATOM 1601 C CG  . LEU B 1 61  ? 26.666 18.157 47.568 1.00 14.94  ? 63  LEU B CG  1 
ATOM 1602 C CD1 . LEU B 1 61  ? 26.909 17.316 48.807 1.00 12.98  ? 63  LEU B CD1 1 
ATOM 1603 C CD2 . LEU B 1 61  ? 26.592 17.320 46.311 1.00 16.14  ? 63  LEU B CD2 1 
ATOM 1604 N N   . LYS B 1 62  ? 23.745 20.343 50.132 1.00 17.74  ? 64  LYS B N   1 
ATOM 1605 C CA  . LYS B 1 62  ? 23.054 21.506 50.636 1.00 22.01  ? 64  LYS B CA  1 
ATOM 1606 C C   . LYS B 1 62  ? 23.902 22.765 50.473 1.00 34.76  ? 64  LYS B C   1 
ATOM 1607 O O   . LYS B 1 62  ? 25.121 22.813 50.746 1.00 38.48  ? 64  LYS B O   1 
ATOM 1608 C CB  . LYS B 1 62  ? 22.745 21.309 52.090 1.00 17.86  ? 64  LYS B CB  1 
ATOM 1609 C CG  . LYS B 1 62  ? 21.943 22.433 52.672 1.00 10.33  ? 64  LYS B CG  1 
ATOM 1610 C CD  . LYS B 1 62  ? 21.399 21.860 53.951 1.00 31.94  ? 64  LYS B CD  1 
ATOM 1611 C CE  . LYS B 1 62  ? 20.287 22.704 54.529 1.00 35.88  ? 64  LYS B CE  1 
ATOM 1612 N NZ  . LYS B 1 62  ? 20.023 22.232 55.874 1.00 53.45  ? 64  LYS B NZ  1 
ATOM 1613 N N   . TYR B 1 63  ? 23.185 23.805 50.028 1.00 41.37  ? 65  TYR B N   1 
ATOM 1614 C CA  . TYR B 1 63  ? 23.751 25.138 49.815 1.00 38.64  ? 65  TYR B CA  1 
ATOM 1615 C C   . TYR B 1 63  ? 22.844 26.177 50.438 1.00 37.23  ? 65  TYR B C   1 
ATOM 1616 O O   . TYR B 1 63  ? 21.625 26.008 50.452 1.00 53.90  ? 65  TYR B O   1 
ATOM 1617 C CB  . TYR B 1 63  ? 23.863 25.455 48.364 1.00 13.06  ? 65  TYR B CB  1 
ATOM 1618 C CG  . TYR B 1 63  ? 24.714 24.458 47.591 1.00 20.84  ? 65  TYR B CG  1 
ATOM 1619 C CD1 . TYR B 1 63  ? 26.107 24.548 47.620 1.00 22.73  ? 65  TYR B CD1 1 
ATOM 1620 C CD2 . TYR B 1 63  ? 24.091 23.489 46.803 1.00 12.73  ? 65  TYR B CD2 1 
ATOM 1621 C CE1 . TYR B 1 63  ? 26.876 23.675 46.856 1.00 24.73  ? 65  TYR B CE1 1 
ATOM 1622 C CE2 . TYR B 1 63  ? 24.864 22.613 46.040 1.00 20.07  ? 65  TYR B CE2 1 
ATOM 1623 C CZ  . TYR B 1 63  ? 26.252 22.712 46.072 1.00 23.61  ? 65  TYR B CZ  1 
ATOM 1624 O OH  . TYR B 1 63  ? 27.014 21.813 45.353 1.00 30.03  ? 65  TYR B OH  1 
ATOM 1625 N N   . GLY B 1 64  ? 23.396 27.231 50.995 1.00 34.54  ? 66  GLY B N   1 
ATOM 1626 C CA  . GLY B 1 64  ? 22.579 28.244 51.623 1.00 40.15  ? 66  GLY B CA  1 
ATOM 1627 C C   . GLY B 1 64  ? 22.132 29.351 50.663 1.00 45.18  ? 66  GLY B C   1 
ATOM 1628 O O   . GLY B 1 64  ? 22.022 29.174 49.437 1.00 39.67  ? 66  GLY B O   1 
ATOM 1629 N N   . PRO B 1 65  ? 21.876 30.542 51.248 1.00 50.67  ? 67  PRO B N   1 
ATOM 1630 C CA  . PRO B 1 65  ? 21.134 31.644 50.631 1.00 52.82  ? 67  PRO B CA  1 
ATOM 1631 C C   . PRO B 1 65  ? 22.003 32.310 49.595 1.00 51.76  ? 67  PRO B C   1 
ATOM 1632 O O   . PRO B 1 65  ? 23.230 32.234 49.722 1.00 60.88  ? 67  PRO B O   1 
ATOM 1633 C CB  . PRO B 1 65  ? 20.800 32.561 51.774 1.00 51.00  ? 67  PRO B CB  1 
ATOM 1634 C CG  . PRO B 1 65  ? 21.386 31.928 53.030 1.00 42.26  ? 67  PRO B CG  1 
ATOM 1635 C CD  . PRO B 1 65  ? 22.482 31.031 52.490 1.00 47.26  ? 67  PRO B CD  1 
ATOM 1636 N N   . ARG B 1 66  ? 21.459 32.950 48.565 1.00 54.81  ? 68  ARG B N   1 
ATOM 1637 C CA  . ARG B 1 66  ? 22.335 33.636 47.628 1.00 63.02  ? 68  ARG B CA  1 
ATOM 1638 C C   . ARG B 1 66  ? 22.938 34.775 48.400 1.00 65.70  ? 68  ARG B C   1 
ATOM 1639 O O   . ARG B 1 66  ? 22.507 35.111 49.514 1.00 62.64  ? 68  ARG B O   1 
ATOM 1640 C CB  . ARG B 1 66  ? 21.626 34.237 46.453 1.00 73.13  ? 68  ARG B CB  1 
ATOM 1641 C CG  . ARG B 1 66  ? 22.000 33.548 45.155 1.00 92.16  ? 68  ARG B CG  1 
ATOM 1642 C CD  . ARG B 1 66  ? 21.084 34.047 44.048 1.00 108.89 ? 68  ARG B CD  1 
ATOM 1643 N NE  . ARG B 1 66  ? 19.695 33.966 44.491 1.00 127.55 ? 68  ARG B NE  1 
ATOM 1644 C CZ  . ARG B 1 66  ? 18.707 34.705 43.972 1.00 135.76 ? 68  ARG B CZ  1 
ATOM 1645 N NH1 . ARG B 1 66  ? 18.925 35.569 42.977 1.00 139.11 ? 68  ARG B NH1 1 
ATOM 1646 N NH2 . ARG B 1 66  ? 17.490 34.638 44.523 1.00 137.96 ? 68  ARG B NH2 1 
ATOM 1647 N N   . ARG B 1 67  ? 23.966 35.321 47.783 1.00 75.39  ? 69  ARG B N   1 
ATOM 1648 C CA  . ARG B 1 67  ? 24.729 36.344 48.452 1.00 85.58  ? 69  ARG B CA  1 
ATOM 1649 C C   . ARG B 1 67  ? 24.086 37.718 48.236 1.00 92.74  ? 69  ARG B C   1 
ATOM 1650 O O   . ARG B 1 67  ? 23.136 37.863 47.453 1.00 97.08  ? 69  ARG B O   1 
ATOM 1651 C CB  . ARG B 1 67  ? 26.162 36.205 47.937 1.00 81.97  ? 69  ARG B CB  1 
ATOM 1652 C CG  . ARG B 1 67  ? 26.814 34.914 48.431 1.00 72.89  ? 69  ARG B CG  1 
ATOM 1653 C CD  . ARG B 1 67  ? 28.161 34.636 47.781 1.00 69.48  ? 69  ARG B CD  1 
ATOM 1654 N NE  . ARG B 1 67  ? 28.411 33.207 47.564 1.00 69.79  ? 69  ARG B NE  1 
ATOM 1655 C CZ  . ARG B 1 67  ? 29.632 32.666 47.531 1.00 66.05  ? 69  ARG B CZ  1 
ATOM 1656 N NH1 . ARG B 1 67  ? 30.724 33.424 47.705 1.00 69.50  ? 69  ARG B NH1 1 
ATOM 1657 N NH2 . ARG B 1 67  ? 29.869 31.365 47.327 1.00 56.16  ? 69  ARG B NH2 1 
ATOM 1658 N N   . GLN B 1 68  ? 24.634 38.674 48.962 1.00 96.97  ? 70  GLN B N   1 
ATOM 1659 C CA  . GLN B 1 68  ? 24.141 40.061 48.992 1.00 99.05  ? 70  GLN B CA  1 
ATOM 1660 C C   . GLN B 1 68  ? 24.716 40.867 47.823 1.00 101.23 ? 70  GLN B C   1 
ATOM 1661 O O   . GLN B 1 68  ? 25.891 41.261 47.830 1.00 92.64  ? 70  GLN B O   1 
ATOM 1662 C CB  . GLN B 1 68  ? 24.506 40.666 50.347 1.00 99.80  ? 70  GLN B CB  1 
ATOM 1663 C CG  . GLN B 1 68  ? 23.807 39.924 51.494 1.00 102.91 ? 70  GLN B CG  1 
ATOM 1664 C CD  . GLN B 1 68  ? 24.560 39.972 52.826 1.00 103.15 ? 70  GLN B CD  1 
ATOM 1665 O OE1 . GLN B 1 68  ? 24.258 40.819 53.665 1.00 93.12  ? 70  GLN B OE1 1 
ATOM 1666 N NE2 . GLN B 1 68  ? 25.522 39.105 53.080 1.00 97.51  ? 70  GLN B NE2 1 
ATOM 1667 N N   . GLY B 1 69  ? 23.830 41.085 46.866 1.00 105.65 ? 71  GLY B N   1 
ATOM 1668 C CA  . GLY B 1 69  ? 24.135 41.788 45.614 1.00 104.38 ? 71  GLY B CA  1 
ATOM 1669 C C   . GLY B 1 69  ? 24.185 40.752 44.490 1.00 99.66  ? 71  GLY B C   1 
ATOM 1670 O O   . GLY B 1 69  ? 24.432 39.564 44.734 1.00 107.72 ? 71  GLY B O   1 
ATOM 1671 N N   . PRO B 1 70  ? 23.954 41.113 43.222 1.00 81.34  ? 72  PRO B N   1 
ATOM 1672 C CA  . PRO B 1 70  ? 23.974 40.138 42.139 1.00 66.74  ? 72  PRO B CA  1 
ATOM 1673 C C   . PRO B 1 70  ? 25.303 39.382 41.995 1.00 61.31  ? 72  PRO B C   1 
ATOM 1674 O O   . PRO B 1 70  ? 26.122 39.752 41.098 1.00 72.22  ? 72  PRO B O   1 
ATOM 1675 C CB  . PRO B 1 70  ? 23.663 40.944 40.905 1.00 58.43  ? 72  PRO B CB  1 
ATOM 1676 C CG  . PRO B 1 70  ? 23.456 42.387 41.331 1.00 61.87  ? 72  PRO B CG  1 
ATOM 1677 C CD  . PRO B 1 70  ? 23.647 42.487 42.817 1.00 79.46  ? 72  PRO B CD  1 
ATOM 1678 N N   . ASP B 1 71  ? 25.434 38.388 42.867 1.00 51.61  ? 73  ASP B N   1 
ATOM 1679 C CA  . ASP B 1 71  ? 26.488 37.318 42.879 1.00 32.96  ? 73  ASP B CA  1 
ATOM 1680 C C   . ASP B 1 71  ? 25.599 36.092 42.880 1.00 35.63  ? 73  ASP B C   1 
ATOM 1681 O O   . ASP B 1 71  ? 24.759 35.890 43.778 1.00 42.34  ? 73  ASP B O   1 
ATOM 1682 C CB  . ASP B 1 71  ? 27.357 37.454 44.127 1.00 31.84  ? 73  ASP B CB  1 
ATOM 1683 C CG  . ASP B 1 71  ? 28.404 36.347 44.237 1.00 30.42  ? 73  ASP B CG  1 
ATOM 1684 O OD1 . ASP B 1 71  ? 29.310 36.228 43.326 1.00 39.57  ? 73  ASP B OD1 1 
ATOM 1685 O OD2 . ASP B 1 71  ? 28.380 35.533 45.236 1.00 50.04  ? 73  ASP B OD2 1 
ATOM 1686 N N   . PRO B 1 72  ? 25.656 35.305 41.807 1.00 29.94  ? 74  PRO B N   1 
ATOM 1687 C CA  . PRO B 1 72  ? 24.727 34.199 41.635 1.00 35.81  ? 74  PRO B CA  1 
ATOM 1688 C C   . PRO B 1 72  ? 25.063 32.999 42.524 1.00 37.81  ? 74  PRO B C   1 
ATOM 1689 O O   . PRO B 1 72  ? 24.200 32.125 42.695 1.00 39.93  ? 74  PRO B O   1 
ATOM 1690 C CB  . PRO B 1 72  ? 24.771 33.905 40.122 1.00 21.38  ? 74  PRO B CB  1 
ATOM 1691 C CG  . PRO B 1 72  ? 26.164 34.299 39.719 1.00 26.55  ? 74  PRO B CG  1 
ATOM 1692 C CD  . PRO B 1 72  ? 26.461 35.512 40.612 1.00 32.91  ? 74  PRO B CD  1 
ATOM 1693 N N   . ARG B 1 73  ? 26.294 32.940 43.087 1.00 29.61  ? 75  ARG B N   1 
ATOM 1694 C CA  . ARG B 1 73  ? 26.705 31.783 43.849 1.00 22.01  ? 75  ARG B CA  1 
ATOM 1695 C C   . ARG B 1 73  ? 26.000 31.768 45.174 1.00 18.58  ? 75  ARG B C   1 
ATOM 1696 O O   . ARG B 1 73  ? 25.931 32.798 45.830 1.00 19.34  ? 75  ARG B O   1 
ATOM 1697 C CB  . ARG B 1 73  ? 28.157 31.794 44.118 1.00 15.36  ? 75  ARG B CB  1 
ATOM 1698 C CG  . ARG B 1 73  ? 29.033 31.464 42.938 1.00 17.44  ? 75  ARG B CG  1 
ATOM 1699 C CD  . ARG B 1 73  ? 29.639 32.737 42.382 1.00 44.40  ? 75  ARG B CD  1 
ATOM 1700 N NE  . ARG B 1 73  ? 30.049 33.663 43.423 1.00 43.99  ? 75  ARG B NE  1 
ATOM 1701 C CZ  . ARG B 1 73  ? 31.168 33.570 44.142 1.00 38.37  ? 75  ARG B CZ  1 
ATOM 1702 N NH1 . ARG B 1 73  ? 32.046 32.595 43.978 1.00 41.41  ? 75  ARG B NH1 1 
ATOM 1703 N NH2 . ARG B 1 73  ? 31.401 34.482 45.069 1.00 44.06  ? 75  ARG B NH2 1 
ATOM 1704 N N   . PRO B 1 74  ? 25.401 30.658 45.586 1.00 19.81  ? 76  PRO B N   1 
ATOM 1705 C CA  . PRO B 1 74  ? 24.909 30.472 46.917 1.00 11.60  ? 76  PRO B CA  1 
ATOM 1706 C C   . PRO B 1 74  ? 26.142 30.436 47.749 1.00 12.20  ? 76  PRO B C   1 
ATOM 1707 O O   . PRO B 1 74  ? 27.284 30.208 47.348 1.00 22.00  ? 76  PRO B O   1 
ATOM 1708 C CB  . PRO B 1 74  ? 24.203 29.150 46.957 1.00 13.16  ? 76  PRO B CB  1 
ATOM 1709 C CG  . PRO B 1 74  ? 23.981 28.785 45.502 1.00 10.87  ? 76  PRO B CG  1 
ATOM 1710 C CD  . PRO B 1 74  ? 25.189 29.434 44.818 1.00 29.42  ? 76  PRO B CD  1 
ATOM 1711 N N   . GLU B 1 75  ? 25.791 30.702 48.962 1.00 13.42  ? 77  GLU B N   1 
ATOM 1712 C CA  . GLU B 1 75  ? 26.717 30.579 50.027 1.00 16.89  ? 77  GLU B CA  1 
ATOM 1713 C C   . GLU B 1 75  ? 26.708 29.067 50.293 1.00 18.43  ? 77  GLU B C   1 
ATOM 1714 O O   . GLU B 1 75  ? 25.737 28.334 50.081 1.00 29.69  ? 77  GLU B O   1 
ATOM 1715 C CB  . GLU B 1 75  ? 26.120 31.450 51.097 1.00 25.06  ? 77  GLU B CB  1 
ATOM 1716 C CG  . GLU B 1 75  ? 26.937 31.732 52.328 1.00 44.36  ? 77  GLU B CG  1 
ATOM 1717 C CD  . GLU B 1 75  ? 26.158 32.611 53.287 1.00 50.91  ? 77  GLU B CD  1 
ATOM 1718 O OE1 . GLU B 1 75  ? 25.288 32.099 54.000 1.00 66.75  ? 77  GLU B OE1 1 
ATOM 1719 O OE2 . GLU B 1 75  ? 26.416 33.816 53.299 1.00 64.47  ? 77  GLU B OE2 1 
ATOM 1720 N N   . GLN B 1 76  ? 27.842 28.559 50.699 1.00 18.70  ? 78  GLN B N   1 
ATOM 1721 C CA  . GLN B 1 76  ? 28.049 27.171 51.051 1.00 13.35  ? 78  GLN B CA  1 
ATOM 1722 C C   . GLN B 1 76  ? 27.674 26.782 52.455 1.00 18.22  ? 78  GLN B C   1 
ATOM 1723 O O   . GLN B 1 76  ? 27.760 27.593 53.387 1.00 29.27  ? 78  GLN B O   1 
ATOM 1724 C CB  . GLN B 1 76  ? 29.501 26.803 50.908 1.00 10.46  ? 78  GLN B CB  1 
ATOM 1725 C CG  . GLN B 1 76  ? 30.035 26.652 49.519 1.00 2.09   ? 78  GLN B CG  1 
ATOM 1726 C CD  . GLN B 1 76  ? 29.335 25.531 48.814 1.00 16.44  ? 78  GLN B CD  1 
ATOM 1727 O OE1 . GLN B 1 76  ? 28.588 24.669 49.348 1.00 27.09  ? 78  GLN B OE1 1 
ATOM 1728 N NE2 . GLN B 1 76  ? 29.669 25.685 47.553 1.00 7.65   ? 78  GLN B NE2 1 
ATOM 1729 N N   . VAL B 1 77  ? 27.390 25.499 52.642 1.00 29.94  ? 79  VAL B N   1 
ATOM 1730 C CA  . VAL B 1 77  ? 27.226 25.032 54.009 1.00 25.10  ? 79  VAL B CA  1 
ATOM 1731 C C   . VAL B 1 77  ? 28.472 24.282 54.449 1.00 28.64  ? 79  VAL B C   1 
ATOM 1732 O O   . VAL B 1 77  ? 28.849 24.434 55.614 1.00 33.37  ? 79  VAL B O   1 
ATOM 1733 C CB  . VAL B 1 77  ? 26.054 24.108 54.168 1.00 7.63   ? 79  VAL B CB  1 
ATOM 1734 C CG1 . VAL B 1 77  ? 25.881 23.852 55.646 1.00 26.73  ? 79  VAL B CG1 1 
ATOM 1735 C CG2 . VAL B 1 77  ? 24.796 24.728 53.625 1.00 12.89  ? 79  VAL B CG2 1 
ATOM 1736 N N   . ILE B 1 78  ? 29.136 23.515 53.561 1.00 24.57  ? 80  ILE B N   1 
ATOM 1737 C CA  . ILE B 1 78  ? 30.343 22.768 53.912 1.00 20.60  ? 80  ILE B CA  1 
ATOM 1738 C C   . ILE B 1 78  ? 31.411 23.759 53.571 1.00 20.70  ? 80  ILE B C   1 
ATOM 1739 O O   . ILE B 1 78  ? 31.536 24.135 52.404 1.00 21.96  ? 80  ILE B O   1 
ATOM 1740 C CB  . ILE B 1 78  ? 30.518 21.480 53.051 1.00 14.29  ? 80  ILE B CB  1 
ATOM 1741 C CG1 . ILE B 1 78  ? 29.519 20.497 53.581 1.00 25.10  ? 80  ILE B CG1 1 
ATOM 1742 C CG2 . ILE B 1 78  ? 31.882 20.840 53.146 1.00 2.00   ? 80  ILE B CG2 1 
ATOM 1743 C CD1 . ILE B 1 78  ? 29.441 19.194 52.779 1.00 36.73  ? 80  ILE B CD1 1 
ATOM 1744 N N   . HIS B 1 79  ? 32.092 24.262 54.581 1.00 18.11  ? 81  HIS B N   1 
ATOM 1745 C CA  . HIS B 1 79  ? 33.149 25.200 54.304 1.00 21.82  ? 81  HIS B CA  1 
ATOM 1746 C C   . HIS B 1 79  ? 34.468 24.480 54.523 1.00 31.35  ? 81  HIS B C   1 
ATOM 1747 O O   . HIS B 1 79  ? 35.480 24.852 53.919 1.00 33.59  ? 81  HIS B O   1 
ATOM 1748 C CB  . HIS B 1 79  ? 33.124 26.354 55.239 1.00 20.57  ? 81  HIS B CB  1 
ATOM 1749 C CG  . HIS B 1 79  ? 31.820 27.097 55.373 1.00 22.90  ? 81  HIS B CG  1 
ATOM 1750 N ND1 . HIS B 1 79  ? 30.948 26.901 56.360 1.00 17.66  ? 81  HIS B ND1 1 
ATOM 1751 C CD2 . HIS B 1 79  ? 31.370 28.101 54.534 1.00 13.66  ? 81  HIS B CD2 1 
ATOM 1752 C CE1 . HIS B 1 79  ? 29.979 27.765 56.145 1.00 32.81  ? 81  HIS B CE1 1 
ATOM 1753 N NE2 . HIS B 1 79  ? 30.227 28.483 55.051 1.00 17.00  ? 81  HIS B NE2 1 
ATOM 1754 N N   . HIS B 1 80  ? 34.550 23.475 55.399 1.00 32.94  ? 82  HIS B N   1 
ATOM 1755 C CA  . HIS B 1 80  ? 35.785 22.737 55.608 1.00 40.38  ? 82  HIS B CA  1 
ATOM 1756 C C   . HIS B 1 80  ? 35.505 21.288 55.953 1.00 40.13  ? 82  HIS B C   1 
ATOM 1757 O O   . HIS B 1 80  ? 34.710 21.087 56.861 1.00 43.47  ? 82  HIS B O   1 
ATOM 1758 C CB  . HIS B 1 80  ? 36.543 23.381 56.727 1.00 36.19  ? 82  HIS B CB  1 
ATOM 1759 C CG  . HIS B 1 80  ? 37.817 22.694 57.195 1.00 30.21  ? 82  HIS B CG  1 
ATOM 1760 N ND1 . HIS B 1 80  ? 39.044 22.767 56.700 1.00 28.93  ? 82  HIS B ND1 1 
ATOM 1761 C CD2 . HIS B 1 80  ? 37.883 21.907 58.316 1.00 31.57  ? 82  HIS B CD2 1 
ATOM 1762 C CE1 . HIS B 1 80  ? 39.834 22.073 57.474 1.00 32.09  ? 82  HIS B CE1 1 
ATOM 1763 N NE2 . HIS B 1 80  ? 39.120 21.558 58.441 1.00 25.48  ? 82  HIS B NE2 1 
ATOM 1764 N N   . ILE B 1 81  ? 36.119 20.284 55.309 1.00 36.65  ? 83  ILE B N   1 
ATOM 1765 C CA  . ILE B 1 81  ? 35.932 18.892 55.678 1.00 27.25  ? 83  ILE B CA  1 
ATOM 1766 C C   . ILE B 1 81  ? 37.267 18.216 55.397 1.00 27.20  ? 83  ILE B C   1 
ATOM 1767 O O   . ILE B 1 81  ? 37.807 18.340 54.297 1.00 29.68  ? 83  ILE B O   1 
ATOM 1768 C CB  . ILE B 1 81  ? 34.711 18.336 54.852 1.00 15.11  ? 83  ILE B CB  1 
ATOM 1769 C CG1 . ILE B 1 81  ? 34.501 16.902 55.210 1.00 26.17  ? 83  ILE B CG1 1 
ATOM 1770 C CG2 . ILE B 1 81  ? 34.908 18.413 53.369 1.00 23.59  ? 83  ILE B CG2 1 
ATOM 1771 C CD1 . ILE B 1 81  ? 33.161 16.390 54.615 1.00 44.16  ? 83  ILE B CD1 1 
ATOM 1772 N N   . ARG B 1 82  ? 37.903 17.646 56.425 1.00 26.78  ? 84  ARG B N   1 
ATOM 1773 C CA  . ARG B 1 82  ? 39.120 16.881 56.202 1.00 33.70  ? 84  ARG B CA  1 
ATOM 1774 C C   . ARG B 1 82  ? 39.351 15.780 57.229 1.00 39.23  ? 84  ARG B C   1 
ATOM 1775 O O   . ARG B 1 82  ? 39.111 15.926 58.433 1.00 37.52  ? 84  ARG B O   1 
ATOM 1776 C CB  . ARG B 1 82  ? 40.379 17.741 56.201 1.00 29.89  ? 84  ARG B CB  1 
ATOM 1777 C CG  . ARG B 1 82  ? 40.600 18.404 57.520 1.00 37.63  ? 84  ARG B CG  1 
ATOM 1778 C CD  . ARG B 1 82  ? 42.017 18.796 57.737 1.00 36.01  ? 84  ARG B CD  1 
ATOM 1779 N NE  . ARG B 1 82  ? 42.164 18.743 59.177 1.00 55.06  ? 84  ARG B NE  1 
ATOM 1780 C CZ  . ARG B 1 82  ? 43.289 18.391 59.813 1.00 62.28  ? 84  ARG B CZ  1 
ATOM 1781 N NH1 . ARG B 1 82  ? 44.385 18.051 59.120 1.00 55.04  ? 84  ARG B NH1 1 
ATOM 1782 N NH2 . ARG B 1 82  ? 43.296 18.375 61.163 1.00 52.94  ? 84  ARG B NH2 1 
ATOM 1783 N N   . ARG B 1 83  ? 39.740 14.659 56.602 1.00 47.08  ? 85  ARG B N   1 
ATOM 1784 C CA  . ARG B 1 83  ? 40.160 13.363 57.143 1.00 36.06  ? 85  ARG B CA  1 
ATOM 1785 C C   . ARG B 1 83  ? 41.286 13.665 58.108 1.00 35.91  ? 85  ARG B C   1 
ATOM 1786 O O   . ARG B 1 83  ? 42.196 14.402 57.747 1.00 38.41  ? 85  ARG B O   1 
ATOM 1787 C CB  . ARG B 1 83  ? 40.659 12.520 55.966 1.00 28.90  ? 85  ARG B CB  1 
ATOM 1788 C CG  . ARG B 1 83  ? 41.097 11.061 56.053 1.00 41.21  ? 85  ARG B CG  1 
ATOM 1789 C CD  . ARG B 1 83  ? 39.960 10.064 56.079 1.00 41.78  ? 85  ARG B CD  1 
ATOM 1790 N NE  . ARG B 1 83  ? 39.778 9.530  57.413 1.00 50.04  ? 85  ARG B NE  1 
ATOM 1791 C CZ  . ARG B 1 83  ? 39.748 8.220  57.658 1.00 57.73  ? 85  ARG B CZ  1 
ATOM 1792 N NH1 . ARG B 1 83  ? 39.878 7.326  56.680 1.00 63.89  ? 85  ARG B NH1 1 
ATOM 1793 N NH2 . ARG B 1 83  ? 39.625 7.790  58.918 1.00 60.10  ? 85  ARG B NH2 1 
ATOM 1794 N N   . ILE B 1 84  ? 41.261 13.205 59.338 1.00 35.40  ? 86  ILE B N   1 
ATOM 1795 C CA  . ILE B 1 84  ? 42.388 13.448 60.206 1.00 31.59  ? 86  ILE B CA  1 
ATOM 1796 C C   . ILE B 1 84  ? 43.149 12.112 60.309 1.00 37.66  ? 86  ILE B C   1 
ATOM 1797 O O   . ILE B 1 84  ? 44.311 11.968 59.898 1.00 34.88  ? 86  ILE B O   1 
ATOM 1798 C CB  . ILE B 1 84  ? 41.805 13.950 61.514 1.00 28.15  ? 86  ILE B CB  1 
ATOM 1799 C CG1 . ILE B 1 84  ? 40.908 15.158 61.299 1.00 35.11  ? 86  ILE B CG1 1 
ATOM 1800 C CG2 . ILE B 1 84  ? 42.948 14.380 62.402 1.00 41.04  ? 86  ILE B CG2 1 
ATOM 1801 C CD1 . ILE B 1 84  ? 40.238 15.665 62.592 1.00 38.03  ? 86  ILE B CD1 1 
ATOM 1802 N N   . SER B 1 85  ? 42.487 11.075 60.817 1.00 40.80  ? 87  SER B N   1 
ATOM 1803 C CA  . SER B 1 85  ? 43.083 9.763  60.932 1.00 41.57  ? 87  SER B CA  1 
ATOM 1804 C C   . SER B 1 85  ? 43.224 9.196  59.545 1.00 36.74  ? 87  SER B C   1 
ATOM 1805 O O   . SER B 1 85  ? 42.242 8.822  58.928 1.00 38.72  ? 87  SER B O   1 
ATOM 1806 C CB  . SER B 1 85  ? 42.196 8.858  61.755 1.00 41.58  ? 87  SER B CB  1 
ATOM 1807 O OG  . SER B 1 85  ? 42.826 7.631  62.075 1.00 40.77  ? 87  SER B OG  1 
ATOM 1808 N N   . LYS B 1 86  ? 44.422 9.197  59.007 1.00 39.75  ? 88  LYS B N   1 
ATOM 1809 C CA  . LYS B 1 86  ? 44.683 8.562  57.732 1.00 36.56  ? 88  LYS B CA  1 
ATOM 1810 C C   . LYS B 1 86  ? 44.892 7.079  58.033 1.00 37.19  ? 88  LYS B C   1 
ATOM 1811 O O   . LYS B 1 86  ? 45.023 6.700  59.200 1.00 40.27  ? 88  LYS B O   1 
ATOM 1812 C CB  . LYS B 1 86  ? 45.941 9.165  57.139 1.00 39.42  ? 88  LYS B CB  1 
ATOM 1813 C CG  . LYS B 1 86  ? 45.768 10.440 56.340 1.00 46.26  ? 88  LYS B CG  1 
ATOM 1814 C CD  . LYS B 1 86  ? 45.713 10.074 54.848 1.00 80.73  ? 88  LYS B CD  1 
ATOM 1815 C CE  . LYS B 1 86  ? 44.331 10.226 54.168 1.00 87.85  ? 88  LYS B CE  1 
ATOM 1816 N NZ  . LYS B 1 86  ? 43.861 8.989  53.560 1.00 84.84  ? 88  LYS B NZ  1 
ATOM 1817 N N   . PRO B 1 87  ? 44.965 6.161  57.077 1.00 34.67  ? 89  PRO B N   1 
ATOM 1818 C CA  . PRO B 1 87  ? 45.539 4.839  57.252 1.00 33.32  ? 89  PRO B CA  1 
ATOM 1819 C C   . PRO B 1 87  ? 47.061 4.845  57.361 1.00 31.04  ? 89  PRO B C   1 
ATOM 1820 O O   . PRO B 1 87  ? 47.697 5.564  56.609 1.00 36.63  ? 89  PRO B O   1 
ATOM 1821 C CB  . PRO B 1 87  ? 44.985 4.098  56.067 1.00 33.73  ? 89  PRO B CB  1 
ATOM 1822 C CG  . PRO B 1 87  ? 44.952 5.126  54.979 1.00 33.45  ? 89  PRO B CG  1 
ATOM 1823 C CD  . PRO B 1 87  ? 44.350 6.272  55.765 1.00 44.18  ? 89  PRO B CD  1 
ATOM 1824 N N   . GLY B 1 88  ? 47.694 4.097  58.273 1.00 34.91  ? 90  GLY B N   1 
ATOM 1825 C CA  . GLY B 1 88  ? 49.142 4.132  58.434 1.00 35.87  ? 90  GLY B CA  1 
ATOM 1826 C C   . GLY B 1 88  ? 49.567 5.363  59.238 1.00 44.96  ? 90  GLY B C   1 
ATOM 1827 O O   . GLY B 1 88  ? 50.758 5.599  59.465 1.00 40.97  ? 90  GLY B O   1 
ATOM 1828 N N   . ARG B 1 89  ? 48.570 6.134  59.725 1.00 52.34  ? 91  ARG B N   1 
ATOM 1829 C CA  . ARG B 1 89  ? 48.719 7.354  60.521 1.00 51.32  ? 91  ARG B CA  1 
ATOM 1830 C C   . ARG B 1 89  ? 47.321 7.607  61.124 1.00 49.02  ? 91  ARG B C   1 
ATOM 1831 O O   . ARG B 1 89  ? 46.576 8.525  60.771 1.00 56.82  ? 91  ARG B O   1 
ATOM 1832 C CB  . ARG B 1 89  ? 49.150 8.502  59.609 1.00 50.36  ? 91  ARG B CB  1 
ATOM 1833 C CG  . ARG B 1 89  ? 49.634 9.731  60.357 1.00 75.69  ? 91  ARG B CG  1 
ATOM 1834 C CD  . ARG B 1 89  ? 49.754 11.002 59.492 1.00 89.72  ? 91  ARG B CD  1 
ATOM 1835 N NE  . ARG B 1 89  ? 50.709 10.919 58.393 1.00 95.69  ? 91  ARG B NE  1 
ATOM 1836 C CZ  . ARG B 1 89  ? 52.029 10.819 58.574 1.00 100.87 ? 91  ARG B CZ  1 
ATOM 1837 N NH1 . ARG B 1 89  ? 52.593 10.784 59.786 1.00 98.17  ? 91  ARG B NH1 1 
ATOM 1838 N NH2 . ARG B 1 89  ? 52.803 10.743 57.497 1.00 107.27 ? 91  ARG B NH2 1 
ATOM 1839 N N   . ARG B 1 90  ? 46.969 6.668  62.009 1.00 44.44  ? 92  ARG B N   1 
ATOM 1840 C CA  . ARG B 1 90  ? 45.697 6.546  62.728 1.00 32.60  ? 92  ARG B CA  1 
ATOM 1841 C C   . ARG B 1 90  ? 45.619 7.379  63.976 1.00 26.38  ? 92  ARG B C   1 
ATOM 1842 O O   . ARG B 1 90  ? 46.573 7.380  64.753 1.00 26.01  ? 92  ARG B O   1 
ATOM 1843 C CB  . ARG B 1 90  ? 45.437 5.136  63.205 1.00 21.41  ? 92  ARG B CB  1 
ATOM 1844 C CG  . ARG B 1 90  ? 44.542 4.327  62.304 1.00 28.03  ? 92  ARG B CG  1 
ATOM 1845 C CD  . ARG B 1 90  ? 45.164 4.079  60.980 1.00 25.87  ? 92  ARG B CD  1 
ATOM 1846 N NE  . ARG B 1 90  ? 44.141 4.282  59.990 1.00 40.38  ? 92  ARG B NE  1 
ATOM 1847 C CZ  . ARG B 1 90  ? 43.312 3.331  59.619 1.00 43.56  ? 92  ARG B CZ  1 
ATOM 1848 N NH1 . ARG B 1 90  ? 43.352 2.108  60.157 1.00 59.42  ? 92  ARG B NH1 1 
ATOM 1849 N NH2 . ARG B 1 90  ? 42.509 3.614  58.610 1.00 37.11  ? 92  ARG B NH2 1 
ATOM 1850 N N   . VAL B 1 91  ? 44.529 8.072  64.242 1.00 23.36  ? 93  VAL B N   1 
ATOM 1851 C CA  . VAL B 1 91  ? 44.523 8.837  65.456 1.00 32.98  ? 93  VAL B CA  1 
ATOM 1852 C C   . VAL B 1 91  ? 43.335 8.400  66.265 1.00 35.46  ? 93  VAL B C   1 
ATOM 1853 O O   . VAL B 1 91  ? 42.211 8.275  65.775 1.00 23.57  ? 93  VAL B O   1 
ATOM 1854 C CB  . VAL B 1 91  ? 44.455 10.348 65.177 1.00 30.38  ? 93  VAL B CB  1 
ATOM 1855 C CG1 . VAL B 1 91  ? 44.551 11.056 66.534 1.00 43.10  ? 93  VAL B CG1 1 
ATOM 1856 C CG2 . VAL B 1 91  ? 45.622 10.845 64.315 1.00 13.17  ? 93  VAL B CG2 1 
ATOM 1857 N N   . TYR B 1 92  ? 43.649 8.131  67.523 1.00 38.23  ? 94  TYR B N   1 
ATOM 1858 C CA  . TYR B 1 92  ? 42.636 7.701  68.453 1.00 50.51  ? 94  TYR B CA  1 
ATOM 1859 C C   . TYR B 1 92  ? 42.698 8.704  69.584 1.00 55.85  ? 94  TYR B C   1 
ATOM 1860 O O   . TYR B 1 92  ? 43.812 9.101  69.930 1.00 70.57  ? 94  TYR B O   1 
ATOM 1861 C CB  . TYR B 1 92  ? 42.952 6.319  68.979 1.00 43.32  ? 94  TYR B CB  1 
ATOM 1862 C CG  . TYR B 1 92  ? 43.245 5.324  67.876 1.00 45.94  ? 94  TYR B CG  1 
ATOM 1863 C CD1 . TYR B 1 92  ? 44.570 5.212  67.440 1.00 56.94  ? 94  TYR B CD1 1 
ATOM 1864 C CD2 . TYR B 1 92  ? 42.228 4.546  67.306 1.00 44.35  ? 94  TYR B CD2 1 
ATOM 1865 C CE1 . TYR B 1 92  ? 44.894 4.318  66.428 1.00 56.89  ? 94  TYR B CE1 1 
ATOM 1866 C CE2 . TYR B 1 92  ? 42.546 3.647  66.284 1.00 45.52  ? 94  TYR B CE2 1 
ATOM 1867 C CZ  . TYR B 1 92  ? 43.881 3.546  65.864 1.00 55.29  ? 94  TYR B CZ  1 
ATOM 1868 O OH  . TYR B 1 92  ? 44.247 2.656  64.878 1.00 60.69  ? 94  TYR B OH  1 
ATOM 1869 N N   . VAL B 1 93  ? 41.576 9.187  70.126 1.00 52.73  ? 95  VAL B N   1 
ATOM 1870 C CA  . VAL B 1 93  ? 41.546 10.083 71.273 1.00 43.46  ? 95  VAL B CA  1 
ATOM 1871 C C   . VAL B 1 93  ? 40.677 9.432  72.346 1.00 53.62  ? 95  VAL B C   1 
ATOM 1872 O O   . VAL B 1 93  ? 39.586 8.890  72.091 1.00 55.42  ? 95  VAL B O   1 
ATOM 1873 C CB  . VAL B 1 93  ? 40.948 11.469 70.908 1.00 37.58  ? 95  VAL B CB  1 
ATOM 1874 C CG1 . VAL B 1 93  ? 41.978 12.214 70.077 1.00 43.73  ? 95  VAL B CG1 1 
ATOM 1875 C CG2 . VAL B 1 93  ? 39.647 11.356 70.114 1.00 26.96  ? 95  VAL B CG2 1 
ATOM 1876 N N   . GLY B 1 94  ? 41.154 9.417  73.580 1.00 51.76  ? 96  GLY B N   1 
ATOM 1877 C CA  . GLY B 1 94  ? 40.344 8.873  74.649 1.00 58.87  ? 96  GLY B CA  1 
ATOM 1878 C C   . GLY B 1 94  ? 39.606 10.016 75.307 1.00 61.91  ? 96  GLY B C   1 
ATOM 1879 O O   . GLY B 1 94  ? 40.262 10.914 75.830 1.00 68.52  ? 96  GLY B O   1 
ATOM 1880 N N   . VAL B 1 95  ? 38.274 10.004 75.286 1.00 68.87  ? 97  VAL B N   1 
ATOM 1881 C CA  . VAL B 1 95  ? 37.360 11.008 75.860 1.00 77.22  ? 97  VAL B CA  1 
ATOM 1882 C C   . VAL B 1 95  ? 37.802 12.405 76.329 1.00 79.35  ? 97  VAL B C   1 
ATOM 1883 O O   . VAL B 1 95  ? 37.305 13.409 75.812 1.00 78.87  ? 97  VAL B O   1 
ATOM 1884 C CB  . VAL B 1 95  ? 36.575 10.287 77.002 1.00 72.60  ? 97  VAL B CB  1 
ATOM 1885 C CG1 . VAL B 1 95  ? 37.516 9.860  78.122 1.00 79.46  ? 97  VAL B CG1 1 
ATOM 1886 C CG2 . VAL B 1 95  ? 35.463 11.203 77.503 1.00 73.33  ? 97  VAL B CG2 1 
ATOM 1887 N N   . LYS B 1 96  ? 38.741 12.546 77.257 1.00 79.15  ? 98  LYS B N   1 
ATOM 1888 C CA  . LYS B 1 96  ? 39.140 13.856 77.729 1.00 89.37  ? 98  LYS B CA  1 
ATOM 1889 C C   . LYS B 1 96  ? 40.055 14.528 76.705 1.00 88.57  ? 98  LYS B C   1 
ATOM 1890 O O   . LYS B 1 96  ? 40.242 15.744 76.715 1.00 89.63  ? 98  LYS B O   1 
ATOM 1891 C CB  . LYS B 1 96  ? 39.856 13.716 79.070 1.00 106.50 ? 98  LYS B CB  1 
ATOM 1892 C CG  . LYS B 1 96  ? 39.155 12.953 80.229 1.00 121.80 ? 98  LYS B CG  1 
ATOM 1893 C CD  . LYS B 1 96  ? 37.766 13.433 80.715 1.00 125.43 ? 98  LYS B CD  1 
ATOM 1894 C CE  . LYS B 1 96  ? 37.608 13.384 82.255 1.00 126.23 ? 98  LYS B CE  1 
ATOM 1895 N NZ  . LYS B 1 96  ? 37.979 12.115 82.864 1.00 119.34 ? 98  LYS B NZ  1 
ATOM 1896 N N   . GLU B 1 97  ? 40.657 13.725 75.821 1.00 87.63  ? 99  GLU B N   1 
ATOM 1897 C CA  . GLU B 1 97  ? 41.471 14.214 74.718 1.00 84.06  ? 99  GLU B CA  1 
ATOM 1898 C C   . GLU B 1 97  ? 40.642 14.409 73.444 1.00 79.87  ? 99  GLU B C   1 
ATOM 1899 O O   . GLU B 1 97  ? 41.231 14.580 72.366 1.00 78.58  ? 99  GLU B O   1 
ATOM 1900 C CB  . GLU B 1 97  ? 42.565 13.249 74.357 1.00 85.83  ? 99  GLU B CB  1 
ATOM 1901 C CG  . GLU B 1 97  ? 43.491 12.789 75.437 1.00 92.70  ? 99  GLU B CG  1 
ATOM 1902 C CD  . GLU B 1 97  ? 44.293 11.633 74.880 1.00 102.38 ? 99  GLU B CD  1 
ATOM 1903 O OE1 . GLU B 1 97  ? 45.344 11.882 74.280 1.00 104.94 ? 99  GLU B OE1 1 
ATOM 1904 O OE2 . GLU B 1 97  ? 43.844 10.493 75.028 1.00 107.97 ? 99  GLU B OE2 1 
ATOM 1905 N N   . ILE B 1 98  ? 39.301 14.298 73.471 1.00 70.49  ? 100 ILE B N   1 
ATOM 1906 C CA  . ILE B 1 98  ? 38.497 14.617 72.298 1.00 64.35  ? 100 ILE B CA  1 
ATOM 1907 C C   . ILE B 1 98  ? 38.676 16.138 72.135 1.00 67.36  ? 100 ILE B C   1 
ATOM 1908 O O   . ILE B 1 98  ? 38.392 16.906 73.072 1.00 75.02  ? 100 ILE B O   1 
ATOM 1909 C CB  . ILE B 1 98  ? 36.994 14.308 72.515 1.00 56.61  ? 100 ILE B CB  1 
ATOM 1910 C CG1 . ILE B 1 98  ? 36.742 12.831 72.538 1.00 54.94  ? 100 ILE B CG1 1 
ATOM 1911 C CG2 . ILE B 1 98  ? 36.182 14.915 71.374 1.00 56.37  ? 100 ILE B CG2 1 
ATOM 1912 C CD1 . ILE B 1 98  ? 35.311 12.511 73.001 1.00 45.85  ? 100 ILE B CD1 1 
ATOM 1913 N N   . PRO B 1 99  ? 39.186 16.620 70.999 1.00 54.85  ? 101 PRO B N   1 
ATOM 1914 C CA  . PRO B 1 99  ? 39.358 18.037 70.768 1.00 51.35  ? 101 PRO B CA  1 
ATOM 1915 C C   . PRO B 1 99  ? 38.062 18.755 70.421 1.00 54.59  ? 101 PRO B C   1 
ATOM 1916 O O   . PRO B 1 99  ? 37.041 18.188 70.005 1.00 52.99  ? 101 PRO B O   1 
ATOM 1917 C CB  . PRO B 1 99  ? 40.398 18.062 69.693 1.00 53.09  ? 101 PRO B CB  1 
ATOM 1918 C CG  . PRO B 1 99  ? 40.019 16.848 68.871 1.00 42.36  ? 101 PRO B CG  1 
ATOM 1919 C CD  . PRO B 1 99  ? 39.732 15.816 69.917 1.00 43.21  ? 101 PRO B CD  1 
ATOM 1920 N N   . ARG B 1 100 ? 38.175 20.064 70.588 1.00 58.52  ? 102 ARG B N   1 
ATOM 1921 C CA  . ARG B 1 100 ? 37.100 20.996 70.336 1.00 56.53  ? 102 ARG B CA  1 
ATOM 1922 C C   . ARG B 1 100 ? 37.512 21.514 68.982 1.00 52.38  ? 102 ARG B C   1 
ATOM 1923 O O   . ARG B 1 100 ? 38.627 22.042 68.839 1.00 50.96  ? 102 ARG B O   1 
ATOM 1924 C CB  . ARG B 1 100 ? 37.149 22.102 71.352 1.00 63.69  ? 102 ARG B CB  1 
ATOM 1925 C CG  . ARG B 1 100 ? 35.834 22.394 72.014 1.00 78.81  ? 102 ARG B CG  1 
ATOM 1926 C CD  . ARG B 1 100 ? 36.011 23.638 72.886 1.00 97.62  ? 102 ARG B CD  1 
ATOM 1927 N NE  . ARG B 1 100 ? 34.727 24.273 73.156 1.00 113.65 ? 102 ARG B NE  1 
ATOM 1928 C CZ  . ARG B 1 100 ? 33.891 23.878 74.129 1.00 122.33 ? 102 ARG B CZ  1 
ATOM 1929 N NH1 . ARG B 1 100 ? 34.172 22.856 74.955 1.00 124.68 ? 102 ARG B NH1 1 
ATOM 1930 N NH2 . ARG B 1 100 ? 32.718 24.506 74.247 1.00 126.09 ? 102 ARG B NH2 1 
ATOM 1931 N N   . VAL B 1 101 ? 36.669 21.359 67.973 1.00 52.44  ? 103 VAL B N   1 
ATOM 1932 C CA  . VAL B 1 101 ? 37.063 21.831 66.649 1.00 51.83  ? 103 VAL B CA  1 
ATOM 1933 C C   . VAL B 1 101 ? 36.561 23.259 66.409 1.00 57.05  ? 103 VAL B C   1 
ATOM 1934 O O   . VAL B 1 101 ? 35.401 23.597 66.683 1.00 58.01  ? 103 VAL B O   1 
ATOM 1935 C CB  . VAL B 1 101 ? 36.506 20.924 65.528 1.00 46.89  ? 103 VAL B CB  1 
ATOM 1936 C CG1 . VAL B 1 101 ? 37.212 21.315 64.243 1.00 39.35  ? 103 VAL B CG1 1 
ATOM 1937 C CG2 . VAL B 1 101 ? 36.700 19.440 65.833 1.00 39.70  ? 103 VAL B CG2 1 
ATOM 1938 N N   . ARG B 1 102 ? 37.502 24.084 65.919 1.00 54.91  ? 104 ARG B N   1 
ATOM 1939 C CA  . ARG B 1 102 ? 37.336 25.489 65.563 1.00 44.42  ? 104 ARG B CA  1 
ATOM 1940 C C   . ARG B 1 102 ? 36.660 26.185 66.728 1.00 43.51  ? 104 ARG B C   1 
ATOM 1941 O O   . ARG B 1 102 ? 35.498 26.568 66.647 1.00 50.21  ? 104 ARG B O   1 
ATOM 1942 C CB  . ARG B 1 102 ? 36.487 25.615 64.267 1.00 43.80  ? 104 ARG B CB  1 
ATOM 1943 C CG  . ARG B 1 102 ? 36.499 27.036 63.689 1.00 46.40  ? 104 ARG B CG  1 
ATOM 1944 C CD  . ARG B 1 102 ? 35.466 27.271 62.592 1.00 39.84  ? 104 ARG B CD  1 
ATOM 1945 N NE  . ARG B 1 102 ? 35.554 28.614 62.035 1.00 34.01  ? 104 ARG B NE  1 
ATOM 1946 C CZ  . ARG B 1 102 ? 34.484 29.280 61.563 1.00 42.17  ? 104 ARG B CZ  1 
ATOM 1947 N NH1 . ARG B 1 102 ? 33.255 28.748 61.563 1.00 27.24  ? 104 ARG B NH1 1 
ATOM 1948 N NH2 . ARG B 1 102 ? 34.636 30.540 61.131 1.00 39.79  ? 104 ARG B NH2 1 
ATOM 1949 N N   . ARG B 1 103 ? 37.312 26.210 67.892 1.00 38.78  ? 105 ARG B N   1 
ATOM 1950 C CA  . ARG B 1 103 ? 36.815 26.889 69.085 1.00 39.12  ? 105 ARG B CA  1 
ATOM 1951 C C   . ARG B 1 103 ? 35.492 26.375 69.626 1.00 33.86  ? 105 ARG B C   1 
ATOM 1952 O O   . ARG B 1 103 ? 35.099 26.768 70.721 1.00 43.20  ? 105 ARG B O   1 
ATOM 1953 C CB  . ARG B 1 103 ? 36.664 28.400 68.821 1.00 51.72  ? 105 ARG B CB  1 
ATOM 1954 C CG  . ARG B 1 103 ? 38.003 29.003 68.475 1.00 79.36  ? 105 ARG B CG  1 
ATOM 1955 C CD  . ARG B 1 103 ? 37.914 30.099 67.423 1.00 106.96 ? 105 ARG B CD  1 
ATOM 1956 N NE  . ARG B 1 103 ? 39.250 30.526 67.000 1.00 132.03 ? 105 ARG B NE  1 
ATOM 1957 C CZ  . ARG B 1 103 ? 40.051 31.320 67.739 1.00 140.67 ? 105 ARG B CZ  1 
ATOM 1958 N NH1 . ARG B 1 103 ? 39.682 31.788 68.937 1.00 143.49 ? 105 ARG B NH1 1 
ATOM 1959 N NH2 . ARG B 1 103 ? 41.254 31.663 67.267 1.00 142.87 ? 105 ARG B NH2 1 
ATOM 1960 N N   . GLY B 1 104 ? 34.812 25.458 68.946 1.00 25.05  ? 106 GLY B N   1 
ATOM 1961 C CA  . GLY B 1 104 ? 33.491 24.976 69.343 1.00 30.39  ? 106 GLY B CA  1 
ATOM 1962 C C   . GLY B 1 104 ? 32.439 25.261 68.260 1.00 33.13  ? 106 GLY B C   1 
ATOM 1963 O O   . GLY B 1 104 ? 31.247 25.020 68.451 1.00 28.86  ? 106 GLY B O   1 
ATOM 1964 N N   . LEU B 1 105 ? 32.902 25.706 67.084 1.00 25.72  ? 107 LEU B N   1 
ATOM 1965 C CA  . LEU B 1 105 ? 32.085 26.160 65.994 1.00 18.58  ? 107 LEU B CA  1 
ATOM 1966 C C   . LEU B 1 105 ? 32.385 25.282 64.794 1.00 30.32  ? 107 LEU B C   1 
ATOM 1967 O O   . LEU B 1 105 ? 32.415 25.763 63.667 1.00 41.52  ? 107 LEU B O   1 
ATOM 1968 C CB  . LEU B 1 105 ? 32.443 27.625 65.707 1.00 24.82  ? 107 LEU B CB  1 
ATOM 1969 C CG  . LEU B 1 105 ? 32.453 28.622 66.871 1.00 26.55  ? 107 LEU B CG  1 
ATOM 1970 C CD1 . LEU B 1 105 ? 33.314 29.812 66.545 1.00 31.32  ? 107 LEU B CD1 1 
ATOM 1971 C CD2 . LEU B 1 105 ? 31.036 29.013 67.182 1.00 34.71  ? 107 LEU B CD2 1 
ATOM 1972 N N   . GLY B 1 106 ? 32.619 23.993 64.999 1.00 36.30  ? 108 GLY B N   1 
ATOM 1973 C CA  . GLY B 1 106 ? 32.909 22.992 63.976 1.00 28.89  ? 108 GLY B CA  1 
ATOM 1974 C C   . GLY B 1 106 ? 32.674 21.647 64.657 1.00 32.64  ? 108 GLY B C   1 
ATOM 1975 O O   . GLY B 1 106 ? 32.586 21.618 65.904 1.00 36.32  ? 108 GLY B O   1 
ATOM 1976 N N   . ILE B 1 107 ? 32.468 20.529 63.961 1.00 12.47  ? 109 ILE B N   1 
ATOM 1977 C CA  . ILE B 1 107 ? 32.357 19.254 64.642 1.00 18.97  ? 109 ILE B CA  1 
ATOM 1978 C C   . ILE B 1 107 ? 33.496 18.319 64.280 1.00 15.42  ? 109 ILE B C   1 
ATOM 1979 O O   . ILE B 1 107 ? 34.073 18.418 63.199 1.00 9.36   ? 109 ILE B O   1 
ATOM 1980 C CB  . ILE B 1 107 ? 31.022 18.513 64.316 1.00 23.34  ? 109 ILE B CB  1 
ATOM 1981 C CG1 . ILE B 1 107 ? 30.976 18.109 62.854 1.00 41.01  ? 109 ILE B CG1 1 
ATOM 1982 C CG2 . ILE B 1 107 ? 29.833 19.416 64.626 1.00 30.87  ? 109 ILE B CG2 1 
ATOM 1983 C CD1 . ILE B 1 107 ? 29.704 17.371 62.384 1.00 47.79  ? 109 ILE B CD1 1 
ATOM 1984 N N   . ALA B 1 108 ? 33.883 17.434 65.185 1.00 17.07  ? 110 ALA B N   1 
ATOM 1985 C CA  . ALA B 1 108 ? 34.738 16.313 64.800 1.00 26.00  ? 110 ALA B CA  1 
ATOM 1986 C C   . ALA B 1 108 ? 33.805 15.104 64.735 1.00 32.31  ? 110 ALA B C   1 
ATOM 1987 O O   . ALA B 1 108 ? 32.769 15.097 65.440 1.00 35.22  ? 110 ALA B O   1 
ATOM 1988 C CB  . ALA B 1 108 ? 35.786 16.001 65.846 1.00 30.53  ? 110 ALA B CB  1 
ATOM 1989 N N   . ILE B 1 109 ? 34.091 14.089 63.912 1.00 35.21  ? 111 ILE B N   1 
ATOM 1990 C CA  . ILE B 1 109 ? 33.281 12.866 63.878 1.00 29.49  ? 111 ILE B CA  1 
ATOM 1991 C C   . ILE B 1 109 ? 34.180 11.688 64.261 1.00 33.75  ? 111 ILE B C   1 
ATOM 1992 O O   . ILE B 1 109 ? 35.162 11.429 63.555 1.00 33.49  ? 111 ILE B O   1 
ATOM 1993 C CB  . ILE B 1 109 ? 32.693 12.607 62.476 1.00 23.22  ? 111 ILE B CB  1 
ATOM 1994 C CG1 . ILE B 1 109 ? 31.926 13.836 62.010 1.00 20.19  ? 111 ILE B CG1 1 
ATOM 1995 C CG2 . ILE B 1 109 ? 31.791 11.360 62.527 1.00 20.98  ? 111 ILE B CG2 1 
ATOM 1996 C CD1 . ILE B 1 109 ? 31.243 13.782 60.640 1.00 29.14  ? 111 ILE B CD1 1 
ATOM 1997 N N   . LEU B 1 110 ? 33.886 11.033 65.395 1.00 32.08  ? 112 LEU B N   1 
ATOM 1998 C CA  . LEU B 1 110 ? 34.619 9.894  65.942 1.00 30.02  ? 112 LEU B CA  1 
ATOM 1999 C C   . LEU B 1 110 ? 34.023 8.563  65.530 1.00 30.61  ? 112 LEU B C   1 
ATOM 2000 O O   . LEU B 1 110 ? 32.829 8.444  65.239 1.00 37.71  ? 112 LEU B O   1 
ATOM 2001 C CB  . LEU B 1 110 ? 34.604 9.830  67.443 1.00 19.74  ? 112 LEU B CB  1 
ATOM 2002 C CG  . LEU B 1 110 ? 35.096 10.862 68.433 1.00 33.62  ? 112 LEU B CG  1 
ATOM 2003 C CD1 . LEU B 1 110 ? 36.601 11.008 68.264 1.00 34.89  ? 112 LEU B CD1 1 
ATOM 2004 C CD2 . LEU B 1 110 ? 34.300 12.149 68.275 1.00 31.64  ? 112 LEU B CD2 1 
ATOM 2005 N N   . SER B 1 111 ? 34.853 7.534  65.545 1.00 27.62  ? 113 SER B N   1 
ATOM 2006 C CA  . SER B 1 111 ? 34.370 6.179  65.373 1.00 31.89  ? 113 SER B CA  1 
ATOM 2007 C C   . SER B 1 111 ? 34.651 5.629  66.754 1.00 36.98  ? 113 SER B C   1 
ATOM 2008 O O   . SER B 1 111 ? 35.778 5.777  67.258 1.00 30.83  ? 113 SER B O   1 
ATOM 2009 C CB  . SER B 1 111 ? 35.181 5.413  64.372 1.00 35.51  ? 113 SER B CB  1 
ATOM 2010 O OG  . SER B 1 111 ? 34.596 4.134  64.203 1.00 48.24  ? 113 SER B OG  1 
ATOM 2011 N N   . THR B 1 112 ? 33.656 5.070  67.432 1.00 44.58  ? 114 THR B N   1 
ATOM 2012 C CA  . THR B 1 112 ? 33.860 4.540  68.767 1.00 47.97  ? 114 THR B CA  1 
ATOM 2013 C C   . THR B 1 112 ? 33.029 3.270  68.907 1.00 56.98  ? 114 THR B C   1 
ATOM 2014 O O   . THR B 1 112 ? 32.236 2.869  68.039 1.00 48.79  ? 114 THR B O   1 
ATOM 2015 C CB  . THR B 1 112 ? 33.414 5.523  69.874 1.00 30.36  ? 114 THR B CB  1 
ATOM 2016 O OG1 . THR B 1 112 ? 31.992 5.627  69.821 1.00 44.24  ? 114 THR B OG1 1 
ATOM 2017 C CG2 . THR B 1 112 ? 33.972 6.887  69.698 1.00 33.46  ? 114 THR B CG2 1 
ATOM 2018 N N   . SER B 1 113 ? 33.208 2.722  70.113 1.00 71.08  ? 115 SER B N   1 
ATOM 2019 C CA  . SER B 1 113 ? 32.534 1.540  70.619 1.00 75.95  ? 115 SER B CA  1 
ATOM 2020 C C   . SER B 1 113 ? 31.036 1.756  70.579 1.00 74.25  ? 115 SER B C   1 
ATOM 2021 O O   . SER B 1 113 ? 30.267 0.903  70.138 1.00 77.33  ? 115 SER B O   1 
ATOM 2022 C CB  . SER B 1 113 ? 33.024 1.307  72.048 1.00 81.80  ? 115 SER B CB  1 
ATOM 2023 O OG  . SER B 1 113 ? 33.298 2.557  72.697 1.00 99.01  ? 115 SER B OG  1 
ATOM 2024 N N   . LYS B 1 114 ? 30.667 2.966  71.000 1.00 73.35  ? 116 LYS B N   1 
ATOM 2025 C CA  . LYS B 1 114 ? 29.292 3.381  71.028 1.00 71.39  ? 116 LYS B CA  1 
ATOM 2026 C C   . LYS B 1 114 ? 28.800 3.883  69.682 1.00 73.27  ? 116 LYS B C   1 
ATOM 2027 O O   . LYS B 1 114 ? 27.829 4.638  69.616 1.00 85.28  ? 116 LYS B O   1 
ATOM 2028 C CB  . LYS B 1 114 ? 29.161 4.431  72.106 1.00 68.92  ? 116 LYS B CB  1 
ATOM 2029 C CG  . LYS B 1 114 ? 28.964 3.635  73.364 1.00 81.75  ? 116 LYS B CG  1 
ATOM 2030 C CD  . LYS B 1 114 ? 28.633 4.538  74.511 1.00 94.38  ? 116 LYS B CD  1 
ATOM 2031 C CE  . LYS B 1 114 ? 27.981 3.678  75.583 1.00 107.96 ? 116 LYS B CE  1 
ATOM 2032 N NZ  . LYS B 1 114 ? 27.669 4.472  76.758 1.00 116.20 ? 116 LYS B NZ  1 
ATOM 2033 N N   . GLY B 1 115 ? 29.402 3.460  68.574 1.00 69.41  ? 117 GLY B N   1 
ATOM 2034 C CA  . GLY B 1 115 ? 28.925 3.858  67.274 1.00 67.17  ? 117 GLY B CA  1 
ATOM 2035 C C   . GLY B 1 115 ? 29.728 5.024  66.740 1.00 67.99  ? 117 GLY B C   1 
ATOM 2036 O O   . GLY B 1 115 ? 30.841 5.339  67.190 1.00 66.86  ? 117 GLY B O   1 
ATOM 2037 N N   . VAL B 1 116 ? 29.105 5.686  65.770 1.00 62.70  ? 118 VAL B N   1 
ATOM 2038 C CA  . VAL B 1 116 ? 29.763 6.769  65.071 1.00 55.27  ? 118 VAL B CA  1 
ATOM 2039 C C   . VAL B 1 116 ? 29.146 8.017  65.713 1.00 57.10  ? 118 VAL B C   1 
ATOM 2040 O O   . VAL B 1 116 ? 27.919 8.205  65.798 1.00 56.34  ? 118 VAL B O   1 
ATOM 2041 C CB  . VAL B 1 116 ? 29.469 6.594  63.557 1.00 48.64  ? 118 VAL B CB  1 
ATOM 2042 C CG1 . VAL B 1 116 ? 30.602 7.235  62.801 1.00 51.75  ? 118 VAL B CG1 1 
ATOM 2043 C CG2 . VAL B 1 116 ? 29.461 5.138  63.112 1.00 45.04  ? 118 VAL B CG2 1 
ATOM 2044 N N   . LEU B 1 117 ? 30.002 8.875  66.250 1.00 52.84  ? 119 LEU B N   1 
ATOM 2045 C CA  . LEU B 1 117 ? 29.517 9.959  67.067 1.00 46.22  ? 119 LEU B CA  1 
ATOM 2046 C C   . LEU B 1 117 ? 30.170 11.261 66.773 1.00 42.08  ? 119 LEU B C   1 
ATOM 2047 O O   . LEU B 1 117 ? 31.378 11.265 66.545 1.00 46.33  ? 119 LEU B O   1 
ATOM 2048 C CB  . LEU B 1 117 ? 29.773 9.730  68.535 1.00 45.86  ? 119 LEU B CB  1 
ATOM 2049 C CG  . LEU B 1 117 ? 29.267 8.537  69.280 1.00 39.25  ? 119 LEU B CG  1 
ATOM 2050 C CD1 . LEU B 1 117 ? 29.247 8.962  70.722 1.00 24.46  ? 119 LEU B CD1 1 
ATOM 2051 C CD2 . LEU B 1 117 ? 27.845 8.134  68.899 1.00 42.08  ? 119 LEU B CD2 1 
ATOM 2052 N N   . THR B 1 118 ? 29.422 12.353 66.893 1.00 28.50  ? 120 THR B N   1 
ATOM 2053 C CA  . THR B 1 118 ? 30.028 13.661 66.722 1.00 22.11  ? 120 THR B CA  1 
ATOM 2054 C C   . THR B 1 118 ? 30.785 13.946 67.995 0.00 24.57  ? 120 THR B C   1 
ATOM 2055 O O   . THR B 1 118 ? 30.445 13.338 68.996 1.00 20.37  ? 120 THR B O   1 
ATOM 2056 C CB  . THR B 1 118 ? 28.905 14.634 66.463 1.00 31.38  ? 120 THR B CB  1 
ATOM 2057 O OG1 . THR B 1 118 ? 28.112 14.723 67.626 1.00 47.45  ? 120 THR B OG1 1 
ATOM 2058 C CG2 . THR B 1 118 ? 27.967 14.137 65.377 1.00 31.57  ? 120 THR B CG2 1 
ATOM 2059 N N   . ASP B 1 119 ? 31.755 14.829 68.084 1.00 19.16  ? 121 ASP B N   1 
ATOM 2060 C CA  . ASP B 1 119 ? 32.481 15.031 69.340 1.00 32.13  ? 121 ASP B CA  1 
ATOM 2061 C C   . ASP B 1 119 ? 31.669 15.264 70.623 1.00 45.88  ? 121 ASP B C   1 
ATOM 2062 O O   . ASP B 1 119 ? 32.004 14.682 71.661 1.00 54.05  ? 121 ASP B O   1 
ATOM 2063 C CB  . ASP B 1 119 ? 33.524 16.195 69.200 1.00 41.75  ? 121 ASP B CB  1 
ATOM 2064 C CG  . ASP B 1 119 ? 33.133 17.620 68.789 1.00 55.05  ? 121 ASP B CG  1 
ATOM 2065 O OD1 . ASP B 1 119 ? 32.219 17.786 67.979 1.00 63.93  ? 121 ASP B OD1 1 
ATOM 2066 O OD2 . ASP B 1 119 ? 33.767 18.574 69.263 1.00 67.46  ? 121 ASP B OD2 1 
ATOM 2067 N N   . ARG B 1 120 ? 30.542 15.996 70.638 1.00 55.09  ? 122 ARG B N   1 
ATOM 2068 C CA  . ARG B 1 120 ? 29.783 16.248 71.871 1.00 50.66  ? 122 ARG B CA  1 
ATOM 2069 C C   . ARG B 1 120 ? 29.014 15.011 72.283 1.00 47.29  ? 122 ARG B C   1 
ATOM 2070 O O   . ARG B 1 120 ? 28.815 14.737 73.459 1.00 53.46  ? 122 ARG B O   1 
ATOM 2071 C CB  . ARG B 1 120 ? 28.796 17.367 71.678 1.00 60.79  ? 122 ARG B CB  1 
ATOM 2072 C CG  . ARG B 1 120 ? 29.515 18.639 71.324 1.00 81.80  ? 122 ARG B CG  1 
ATOM 2073 C CD  . ARG B 1 120 ? 28.684 19.483 70.370 1.00 98.49  ? 122 ARG B CD  1 
ATOM 2074 N NE  . ARG B 1 120 ? 29.541 20.513 69.803 1.00 112.91 ? 122 ARG B NE  1 
ATOM 2075 C CZ  . ARG B 1 120 ? 29.144 21.350 68.845 1.00 114.91 ? 122 ARG B CZ  1 
ATOM 2076 N NH1 . ARG B 1 120 ? 27.906 21.302 68.337 1.00 116.03 ? 122 ARG B NH1 1 
ATOM 2077 N NH2 . ARG B 1 120 ? 30.037 22.224 68.376 1.00 116.04 ? 122 ARG B NH2 1 
ATOM 2078 N N   . GLU B 1 121 ? 28.603 14.227 71.302 1.00 39.74  ? 123 GLU B N   1 
ATOM 2079 C CA  . GLU B 1 121 ? 27.888 12.984 71.508 1.00 42.84  ? 123 GLU B CA  1 
ATOM 2080 C C   . GLU B 1 121 ? 28.947 12.104 72.181 1.00 47.70  ? 123 GLU B C   1 
ATOM 2081 O O   . GLU B 1 121 ? 28.654 11.569 73.243 1.00 52.13  ? 123 GLU B O   1 
ATOM 2082 C CB  . GLU B 1 121 ? 27.451 12.561 70.095 1.00 50.71  ? 123 GLU B CB  1 
ATOM 2083 C CG  . GLU B 1 121 ? 26.447 11.497 69.593 1.00 59.38  ? 123 GLU B CG  1 
ATOM 2084 C CD  . GLU B 1 121 ? 26.141 11.632 68.073 1.00 67.57  ? 123 GLU B CD  1 
ATOM 2085 O OE1 . GLU B 1 121 ? 25.683 12.709 67.708 1.00 64.06  ? 123 GLU B OE1 1 
ATOM 2086 O OE2 . GLU B 1 121 ? 26.338 10.716 67.252 1.00 56.55  ? 123 GLU B OE2 1 
ATOM 2087 N N   . ALA B 1 122 ? 30.201 11.993 71.698 1.00 49.49  ? 124 ALA B N   1 
ATOM 2088 C CA  . ALA B 1 122 ? 31.233 11.155 72.313 1.00 44.14  ? 124 ALA B CA  1 
ATOM 2089 C C   . ALA B 1 122 ? 31.559 11.603 73.703 1.00 43.78  ? 124 ALA B C   1 
ATOM 2090 O O   . ALA B 1 122 ? 31.675 10.760 74.577 1.00 44.49  ? 124 ALA B O   1 
ATOM 2091 C CB  . ALA B 1 122 ? 32.540 11.167 71.557 1.00 39.74  ? 124 ALA B CB  1 
ATOM 2092 N N   . ARG B 1 123 ? 31.630 12.898 73.958 1.00 49.21  ? 125 ARG B N   1 
ATOM 2093 C CA  . ARG B 1 123 ? 31.840 13.385 75.312 1.00 62.75  ? 125 ARG B CA  1 
ATOM 2094 C C   . ARG B 1 123 ? 30.660 13.072 76.224 1.00 61.93  ? 125 ARG B C   1 
ATOM 2095 O O   . ARG B 1 123 ? 30.865 12.674 77.373 1.00 56.21  ? 125 ARG B O   1 
ATOM 2096 C CB  . ARG B 1 123 ? 32.064 14.893 75.305 1.00 77.12  ? 125 ARG B CB  1 
ATOM 2097 C CG  . ARG B 1 123 ? 33.343 15.285 74.570 1.00 97.33  ? 125 ARG B CG  1 
ATOM 2098 C CD  . ARG B 1 123 ? 33.598 16.786 74.554 1.00 105.31 ? 125 ARG B CD  1 
ATOM 2099 N NE  . ARG B 1 123 ? 34.233 17.160 73.302 1.00 113.67 ? 125 ARG B NE  1 
ATOM 2100 C CZ  . ARG B 1 123 ? 34.587 18.410 73.018 1.00 114.71 ? 125 ARG B CZ  1 
ATOM 2101 N NH1 . ARG B 1 123 ? 34.392 19.412 73.874 1.00 119.60 ? 125 ARG B NH1 1 
ATOM 2102 N NH2 . ARG B 1 123 ? 35.115 18.661 71.829 1.00 112.38 ? 125 ARG B NH2 1 
ATOM 2103 N N   . LYS B 1 124 ? 29.423 13.176 75.720 1.00 66.71  ? 126 LYS B N   1 
ATOM 2104 C CA  . LYS B 1 124 ? 28.225 12.914 76.509 1.00 69.11  ? 126 LYS B CA  1 
ATOM 2105 C C   . LYS B 1 124 ? 28.147 11.430 76.803 1.00 64.76  ? 126 LYS B C   1 
ATOM 2106 O O   . LYS B 1 124 ? 27.947 11.032 77.948 1.00 66.28  ? 126 LYS B O   1 
ATOM 2107 C CB  . LYS B 1 124 ? 26.962 13.331 75.766 1.00 80.49  ? 126 LYS B CB  1 
ATOM 2108 C CG  . LYS B 1 124 ? 25.779 13.395 76.723 1.00 95.50  ? 126 LYS B CG  1 
ATOM 2109 C CD  . LYS B 1 124 ? 24.618 14.102 76.065 1.00 112.29 ? 126 LYS B CD  1 
ATOM 2110 C CE  . LYS B 1 124 ? 23.819 14.827 77.144 1.00 124.87 ? 126 LYS B CE  1 
ATOM 2111 N NZ  . LYS B 1 124 ? 22.924 15.794 76.529 1.00 134.11 ? 126 LYS B NZ  1 
ATOM 2112 N N   . LEU B 1 125 ? 28.329 10.566 75.809 1.00 57.75  ? 127 LEU B N   1 
ATOM 2113 C CA  . LEU B 1 125 ? 28.421 9.149  76.071 1.00 50.50  ? 127 LEU B CA  1 
ATOM 2114 C C   . LEU B 1 125 ? 29.746 8.852  76.744 1.00 55.05  ? 127 LEU B C   1 
ATOM 2115 O O   . LEU B 1 125 ? 30.010 7.685  77.011 1.00 67.40  ? 127 LEU B O   1 
ATOM 2116 C CB  . LEU B 1 125 ? 28.326 8.347  74.784 1.00 48.07  ? 127 LEU B CB  1 
ATOM 2117 C CG  . LEU B 1 125 ? 26.942 8.127  74.196 1.00 52.85  ? 127 LEU B CG  1 
ATOM 2118 C CD1 . LEU B 1 125 ? 27.006 7.283  72.948 1.00 56.26  ? 127 LEU B CD1 1 
ATOM 2119 C CD2 . LEU B 1 125 ? 26.106 7.343  75.175 1.00 68.45  ? 127 LEU B CD2 1 
ATOM 2120 N N   . GLY B 1 126 ? 30.610 9.837  77.024 1.00 56.38  ? 128 GLY B N   1 
ATOM 2121 C CA  . GLY B 1 126 ? 31.887 9.640  77.656 1.00 54.42  ? 128 GLY B CA  1 
ATOM 2122 C C   . GLY B 1 126 ? 32.777 8.744  76.813 1.00 66.65  ? 128 GLY B C   1 
ATOM 2123 O O   . GLY B 1 126 ? 33.780 8.283  77.340 1.00 77.44  ? 128 GLY B O   1 
ATOM 2124 N N   . VAL B 1 127 ? 32.520 8.444  75.531 1.00 71.85  ? 129 VAL B N   1 
ATOM 2125 C CA  . VAL B 1 127 ? 33.368 7.535  74.755 1.00 67.48  ? 129 VAL B CA  1 
ATOM 2126 C C   . VAL B 1 127 ? 34.585 8.196  74.151 1.00 63.55  ? 129 VAL B C   1 
ATOM 2127 O O   . VAL B 1 127 ? 34.723 9.412  74.050 1.00 70.16  ? 129 VAL B O   1 
ATOM 2128 C CB  . VAL B 1 127 ? 32.662 6.835  73.546 1.00 66.69  ? 129 VAL B CB  1 
ATOM 2129 C CG1 . VAL B 1 127 ? 32.305 5.417  73.948 1.00 63.87  ? 129 VAL B CG1 1 
ATOM 2130 C CG2 . VAL B 1 127 ? 31.430 7.582  73.105 1.00 65.85  ? 129 VAL B CG2 1 
ATOM 2131 N N   . GLY B 1 128 ? 35.505 7.328  73.782 1.00 62.09  ? 130 GLY B N   1 
ATOM 2132 C CA  . GLY B 1 128 ? 36.689 7.692  73.045 1.00 55.51  ? 130 GLY B CA  1 
ATOM 2133 C C   . GLY B 1 128 ? 36.600 6.848  71.776 1.00 56.24  ? 130 GLY B C   1 
ATOM 2134 O O   . GLY B 1 128 ? 35.811 5.872  71.716 1.00 51.55  ? 130 GLY B O   1 
ATOM 2135 N N   . GLY B 1 129 ? 37.414 7.220  70.782 1.00 49.70  ? 131 GLY B N   1 
ATOM 2136 C CA  . GLY B 1 129 ? 37.431 6.552  69.492 1.00 30.25  ? 131 GLY B CA  1 
ATOM 2137 C C   . GLY B 1 129 ? 38.526 7.103  68.600 1.00 33.15  ? 131 GLY B C   1 
ATOM 2138 O O   . GLY B 1 129 ? 39.453 7.769  69.064 1.00 33.66  ? 131 GLY B O   1 
ATOM 2139 N N   . GLU B 1 130 ? 38.445 6.820  67.310 1.00 36.08  ? 132 GLU B N   1 
ATOM 2140 C CA  . GLU B 1 130 ? 39.410 7.268  66.299 1.00 40.69  ? 132 GLU B CA  1 
ATOM 2141 C C   . GLU B 1 130 ? 38.966 8.598  65.667 1.00 40.10  ? 132 GLU B C   1 
ATOM 2142 O O   . GLU B 1 130 ? 37.765 8.757  65.373 1.00 40.08  ? 132 GLU B O   1 
ATOM 2143 C CB  . GLU B 1 130 ? 39.495 6.148  65.262 1.00 42.95  ? 132 GLU B CB  1 
ATOM 2144 C CG  . GLU B 1 130 ? 40.442 6.192  64.054 1.00 32.70  ? 132 GLU B CG  1 
ATOM 2145 C CD  . GLU B 1 130 ? 40.019 5.266  62.896 1.00 45.90  ? 132 GLU B CD  1 
ATOM 2146 O OE1 . GLU B 1 130 ? 39.024 4.518  63.001 1.00 33.81  ? 132 GLU B OE1 1 
ATOM 2147 O OE2 . GLU B 1 130 ? 40.683 5.325  61.853 1.00 44.80  ? 132 GLU B OE2 1 
ATOM 2148 N N   . LEU B 1 131 ? 39.821 9.583  65.404 1.00 34.00  ? 133 LEU B N   1 
ATOM 2149 C CA  . LEU B 1 131 ? 39.320 10.808 64.817 1.00 34.24  ? 133 LEU B CA  1 
ATOM 2150 C C   . LEU B 1 131 ? 39.219 10.778 63.292 1.00 39.78  ? 133 LEU B C   1 
ATOM 2151 O O   . LEU B 1 131 ? 40.199 11.104 62.612 1.00 46.87  ? 133 LEU B O   1 
ATOM 2152 C CB  . LEU B 1 131 ? 40.200 11.951 65.282 1.00 18.17  ? 133 LEU B CB  1 
ATOM 2153 C CG  . LEU B 1 131 ? 39.407 12.934 66.141 1.00 33.53  ? 133 LEU B CG  1 
ATOM 2154 C CD1 . LEU B 1 131 ? 40.334 13.922 66.797 1.00 33.63  ? 133 LEU B CD1 1 
ATOM 2155 C CD2 . LEU B 1 131 ? 38.425 13.694 65.270 1.00 38.29  ? 133 LEU B CD2 1 
ATOM 2156 N N   . ILE B 1 132 ? 38.035 10.424 62.740 1.00 32.97  ? 134 ILE B N   1 
ATOM 2157 C CA  . ILE B 1 132 ? 37.749 10.308 61.296 1.00 22.88  ? 134 ILE B CA  1 
ATOM 2158 C C   . ILE B 1 132 ? 37.995 11.623 60.526 1.00 28.35  ? 134 ILE B C   1 
ATOM 2159 O O   . ILE B 1 132 ? 38.810 11.717 59.606 1.00 34.55  ? 134 ILE B O   1 
ATOM 2160 C CB  . ILE B 1 132 ? 36.248 9.885  61.054 1.00 27.64  ? 134 ILE B CB  1 
ATOM 2161 C CG1 . ILE B 1 132 ? 35.847 8.690  61.907 1.00 39.54  ? 134 ILE B CG1 1 
ATOM 2162 C CG2 . ILE B 1 132 ? 36.039 9.543  59.582 1.00 14.39  ? 134 ILE B CG2 1 
ATOM 2163 C CD1 . ILE B 1 132 ? 36.523 7.336  61.611 1.00 59.44  ? 134 ILE B CD1 1 
ATOM 2164 N N   . CYS B 1 133 ? 37.305 12.701 60.846 1.00 34.01  ? 135 CYS B N   1 
ATOM 2165 C CA  . CYS B 1 133 ? 37.420 13.935 60.108 1.00 33.41  ? 135 CYS B CA  1 
ATOM 2166 C C   . CYS B 1 133 ? 36.854 15.062 60.952 1.00 39.45  ? 135 CYS B C   1 
ATOM 2167 O O   . CYS B 1 133 ? 36.244 14.832 62.016 1.00 44.04  ? 135 CYS B O   1 
ATOM 2168 C CB  . CYS B 1 133 ? 36.654 13.812 58.798 1.00 30.17  ? 135 CYS B CB  1 
ATOM 2169 S SG  . CYS B 1 133 ? 34.898 13.391 58.955 1.00 41.10  ? 135 CYS B SG  1 
ATOM 2170 N N   . GLU B 1 134 ? 37.143 16.287 60.515 1.00 43.72  ? 136 GLU B N   1 
ATOM 2171 C CA  . GLU B 1 134 ? 36.620 17.494 61.145 1.00 38.08  ? 136 GLU B CA  1 
ATOM 2172 C C   . GLU B 1 134 ? 35.804 18.288 60.114 1.00 28.45  ? 136 GLU B C   1 
ATOM 2173 O O   . GLU B 1 134 ? 36.197 18.280 58.929 1.00 27.82  ? 136 GLU B O   1 
ATOM 2174 C CB  . GLU B 1 134 ? 37.790 18.322 61.686 1.00 21.37  ? 136 GLU B CB  1 
ATOM 2175 C CG  . GLU B 1 134 ? 38.781 18.836 60.673 1.00 23.85  ? 136 GLU B CG  1 
ATOM 2176 C CD  . GLU B 1 134 ? 39.864 19.729 61.259 1.00 38.20  ? 136 GLU B CD  1 
ATOM 2177 O OE1 . GLU B 1 134 ? 40.204 19.629 62.440 1.00 45.73  ? 136 GLU B OE1 1 
ATOM 2178 O OE2 . GLU B 1 134 ? 40.411 20.519 60.504 1.00 29.45  ? 136 GLU B OE2 1 
ATOM 2179 N N   . VAL B 1 135 ? 34.687 18.935 60.481 1.00 17.96  ? 137 VAL B N   1 
ATOM 2180 C CA  . VAL B 1 135 ? 33.875 19.672 59.524 1.00 23.37  ? 137 VAL B CA  1 
ATOM 2181 C C   . VAL B 1 135 ? 33.138 20.815 60.197 1.00 26.03  ? 137 VAL B C   1 
ATOM 2182 O O   . VAL B 1 135 ? 32.609 20.731 61.310 1.00 21.31  ? 137 VAL B O   1 
ATOM 2183 C CB  . VAL B 1 135 ? 32.873 18.667 58.739 1.00 16.02  ? 137 VAL B CB  1 
ATOM 2184 C CG1 . VAL B 1 135 ? 32.103 17.790 59.679 1.00 23.93  ? 137 VAL B CG1 1 
ATOM 2185 C CG2 . VAL B 1 135 ? 31.828 19.422 57.953 1.00 5.96   ? 137 VAL B CG2 1 
ATOM 2186 N N   . TRP B 1 136 ? 33.260 21.923 59.474 1.00 31.98  ? 138 TRP B N   1 
ATOM 2187 C CA  . TRP B 1 136 ? 32.645 23.184 59.802 1.00 29.98  ? 138 TRP B CA  1 
ATOM 2188 C C   . TRP B 1 136 ? 32.314 23.975 58.517 1.00 25.86  ? 138 TRP B C   1 
ATOM 2189 O O   . TRP B 1 136 ? 31.702 25.035 58.552 1.00 30.83  ? 138 TRP B O   1 
ATOM 2190 C CB  . TRP B 1 136 ? 33.615 23.899 60.790 1.00 33.59  ? 138 TRP B CB  1 
ATOM 2191 C CG  . TRP B 1 136 ? 35.160 23.787 60.755 1.00 51.00  ? 138 TRP B CG  1 
ATOM 2192 C CD1 . TRP B 1 136 ? 35.965 22.924 61.501 1.00 51.77  ? 138 TRP B CD1 1 
ATOM 2193 C CD2 . TRP B 1 136 ? 35.929 24.600 60.010 1.00 29.74  ? 138 TRP B CD2 1 
ATOM 2194 N NE1 . TRP B 1 136 ? 37.242 23.202 61.224 1.00 23.08  ? 138 TRP B NE1 1 
ATOM 2195 C CE2 . TRP B 1 136 ? 37.246 24.207 60.325 1.00 35.37  ? 138 TRP B CE2 1 
ATOM 2196 C CE3 . TRP B 1 136 ? 35.608 25.593 59.121 1.00 6.82   ? 138 TRP B CE3 1 
ATOM 2197 C CZ2 . TRP B 1 136 ? 38.300 24.861 59.702 1.00 45.10  ? 138 TRP B CZ2 1 
ATOM 2198 C CZ3 . TRP B 1 136 ? 36.672 26.252 58.492 1.00 52.41  ? 138 TRP B CZ3 1 
ATOM 2199 C CH2 . TRP B 1 136 ? 38.000 25.886 58.781 1.00 55.62  ? 138 TRP B CH2 1 
ATOM 2200 O OXT . TRP B 1 136 ? 32.590 23.505 57.415 1.00 24.60  ? 138 TRP B OXT 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   3   3   THR THR A . n 
A 1 2   ASP 2   4   4   ASP ASP A . n 
A 1 3   PRO 3   5   5   PRO PRO A . n 
A 1 4   ILE 4   6   6   ILE ILE A . n 
A 1 5   ALA 5   7   7   ALA ALA A . n 
A 1 6   ASP 6   8   8   ASP ASP A . n 
A 1 7   MET 7   9   9   MET MET A . n 
A 1 8   LEU 8   10  10  LEU LEU A . n 
A 1 9   THR 9   11  11  THR THR A . n 
A 1 10  ARG 10  12  12  ARG ARG A . n 
A 1 11  ILE 11  13  13  ILE ILE A . n 
A 1 12  ARG 12  14  14  ARG ARG A . n 
A 1 13  ASN 13  15  15  ASN ASN A . n 
A 1 14  ALA 14  16  16  ALA ALA A . n 
A 1 15  THR 15  17  17  THR THR A . n 
A 1 16  ARG 16  18  18  ARG ARG A . n 
A 1 17  VAL 17  19  19  VAL VAL A . n 
A 1 18  TYR 18  20  20  TYR TYR A . n 
A 1 19  LYS 19  21  21  LYS LYS A . n 
A 1 20  GLU 20  22  22  GLU GLU A . n 
A 1 21  SER 21  23  23  SER SER A . n 
A 1 22  THR 22  24  24  THR THR A . n 
A 1 23  ASP 23  25  25  ASP ASP A . n 
A 1 24  VAL 24  26  26  VAL VAL A . n 
A 1 25  PRO 25  27  27  PRO PRO A . n 
A 1 26  ALA 26  28  28  ALA ALA A . n 
A 1 27  SER 27  29  29  SER SER A . n 
A 1 28  ARG 28  30  30  ARG ARG A . n 
A 1 29  PHE 29  31  31  PHE PHE A . n 
A 1 30  LYS 30  32  32  LYS LYS A . n 
A 1 31  GLU 31  33  33  GLU GLU A . n 
A 1 32  GLU 32  34  34  GLU GLU A . n 
A 1 33  ILE 33  35  35  ILE ILE A . n 
A 1 34  LEU 34  36  36  LEU LEU A . n 
A 1 35  ARG 35  37  37  ARG ARG A . n 
A 1 36  ILE 36  38  38  ILE ILE A . n 
A 1 37  LEU 37  39  39  LEU LEU A . n 
A 1 38  ALA 38  40  40  ALA ALA A . n 
A 1 39  ARG 39  41  41  ARG ARG A . n 
A 1 40  GLU 40  42  42  GLU GLU A . n 
A 1 41  GLY 41  43  43  GLY GLY A . n 
A 1 42  PHE 42  44  44  PHE PHE A . n 
A 1 43  ILE 43  45  45  ILE ILE A . n 
A 1 44  LYS 44  46  46  LYS LYS A . n 
A 1 45  GLY 45  47  47  GLY GLY A . n 
A 1 46  TYR 46  48  48  TYR TYR A . n 
A 1 47  GLU 47  49  49  GLU GLU A . n 
A 1 48  ARG 48  50  50  ARG ARG A . n 
A 1 49  VAL 49  51  51  VAL VAL A . n 
A 1 50  ASP 50  52  52  ASP ASP A . n 
A 1 51  VAL 51  53  53  VAL VAL A . n 
A 1 52  ASP 52  54  54  ASP ASP A . n 
A 1 53  GLY 53  55  55  GLY GLY A . n 
A 1 54  LYS 54  56  56  LYS LYS A . n 
A 1 55  PRO 55  57  57  PRO PRO A . n 
A 1 56  TYR 56  58  58  TYR TYR A . n 
A 1 57  LEU 57  59  59  LEU LEU A . n 
A 1 58  ARG 58  60  60  ARG ARG A . n 
A 1 59  VAL 59  61  61  VAL VAL A . n 
A 1 60  TYR 60  62  62  TYR TYR A . n 
A 1 61  LEU 61  63  63  LEU LEU A . n 
A 1 62  LYS 62  64  64  LYS LYS A . n 
A 1 63  TYR 63  65  65  TYR TYR A . n 
A 1 64  GLY 64  66  66  GLY GLY A . n 
A 1 65  PRO 65  67  67  PRO PRO A . n 
A 1 66  ARG 66  68  68  ARG ARG A . n 
A 1 67  ARG 67  69  69  ARG ARG A . n 
A 1 68  GLN 68  70  70  GLN GLN A . n 
A 1 69  GLY 69  71  71  GLY GLY A . n 
A 1 70  PRO 70  72  72  PRO PRO A . n 
A 1 71  ASP 71  73  73  ASP ASP A . n 
A 1 72  PRO 72  74  74  PRO PRO A . n 
A 1 73  ARG 73  75  75  ARG ARG A . n 
A 1 74  PRO 74  76  76  PRO PRO A . n 
A 1 75  GLU 75  77  77  GLU GLU A . n 
A 1 76  GLN 76  78  78  GLN GLN A . n 
A 1 77  VAL 77  79  79  VAL VAL A . n 
A 1 78  ILE 78  80  80  ILE ILE A . n 
A 1 79  HIS 79  81  81  HIS HIS A . n 
A 1 80  HIS 80  82  82  HIS HIS A . n 
A 1 81  ILE 81  83  83  ILE ILE A . n 
A 1 82  ARG 82  84  84  ARG ARG A . n 
A 1 83  ARG 83  85  85  ARG ARG A . n 
A 1 84  ILE 84  86  86  ILE ILE A . n 
A 1 85  SER 85  87  87  SER SER A . n 
A 1 86  LYS 86  88  88  LYS LYS A . n 
A 1 87  PRO 87  89  89  PRO PRO A . n 
A 1 88  GLY 88  90  90  GLY GLY A . n 
A 1 89  ARG 89  91  91  ARG ARG A . n 
A 1 90  ARG 90  92  92  ARG ARG A . n 
A 1 91  VAL 91  93  93  VAL VAL A . n 
A 1 92  TYR 92  94  94  TYR TYR A . n 
A 1 93  VAL 93  95  95  VAL VAL A . n 
A 1 94  GLY 94  96  96  GLY GLY A . n 
A 1 95  VAL 95  97  97  VAL VAL A . n 
A 1 96  LYS 96  98  98  LYS LYS A . n 
A 1 97  GLU 97  99  99  GLU GLU A . n 
A 1 98  ILE 98  100 100 ILE ILE A . n 
A 1 99  PRO 99  101 101 PRO PRO A . n 
A 1 100 ARG 100 102 102 ARG ARG A . n 
A 1 101 VAL 101 103 103 VAL VAL A . n 
A 1 102 ARG 102 104 104 ARG ARG A . n 
A 1 103 ARG 103 105 105 ARG ARG A . n 
A 1 104 GLY 104 106 106 GLY GLY A . n 
A 1 105 LEU 105 107 107 LEU LEU A . n 
A 1 106 GLY 106 108 108 GLY GLY A . n 
A 1 107 ILE 107 109 109 ILE ILE A . n 
A 1 108 ALA 108 110 110 ALA ALA A . n 
A 1 109 ILE 109 111 111 ILE ILE A . n 
A 1 110 LEU 110 112 112 LEU LEU A . n 
A 1 111 SER 111 113 113 SER SER A . n 
A 1 112 THR 112 114 114 THR THR A . n 
A 1 113 SER 113 115 115 SER SER A . n 
A 1 114 LYS 114 116 116 LYS LYS A . n 
A 1 115 GLY 115 117 117 GLY GLY A . n 
A 1 116 VAL 116 118 118 VAL VAL A . n 
A 1 117 LEU 117 119 119 LEU LEU A . n 
A 1 118 THR 118 120 120 THR THR A . n 
A 1 119 ASP 119 121 121 ASP ASP A . n 
A 1 120 ARG 120 122 122 ARG ARG A . n 
A 1 121 GLU 121 123 123 GLU GLU A . n 
A 1 122 ALA 122 124 124 ALA ALA A . n 
A 1 123 ARG 123 125 125 ARG ARG A . n 
A 1 124 LYS 124 126 126 LYS LYS A . n 
A 1 125 LEU 125 127 127 LEU LEU A . n 
A 1 126 GLY 126 128 128 GLY GLY A . n 
A 1 127 VAL 127 129 129 VAL VAL A . n 
A 1 128 GLY 128 130 130 GLY GLY A . n 
A 1 129 GLY 129 131 131 GLY GLY A . n 
A 1 130 GLU 130 132 132 GLU GLU A . n 
A 1 131 LEU 131 133 133 LEU LEU A . n 
A 1 132 ILE 132 134 134 ILE ILE A . n 
A 1 133 CYS 133 135 135 CYS CYS A . n 
A 1 134 GLU 134 136 136 GLU GLU A . n 
A 1 135 VAL 135 137 137 VAL VAL A . n 
A 1 136 TRP 136 138 138 TRP TRP A . n 
B 1 1   THR 1   3   3   THR THR B . n 
B 1 2   ASP 2   4   4   ASP ASP B . n 
B 1 3   PRO 3   5   5   PRO PRO B . n 
B 1 4   ILE 4   6   6   ILE ILE B . n 
B 1 5   ALA 5   7   7   ALA ALA B . n 
B 1 6   ASP 6   8   8   ASP ASP B . n 
B 1 7   MET 7   9   9   MET MET B . n 
B 1 8   LEU 8   10  10  LEU LEU B . n 
B 1 9   THR 9   11  11  THR THR B . n 
B 1 10  ARG 10  12  12  ARG ARG B . n 
B 1 11  ILE 11  13  13  ILE ILE B . n 
B 1 12  ARG 12  14  14  ARG ARG B . n 
B 1 13  ASN 13  15  15  ASN ASN B . n 
B 1 14  ALA 14  16  16  ALA ALA B . n 
B 1 15  THR 15  17  17  THR THR B . n 
B 1 16  ARG 16  18  18  ARG ARG B . n 
B 1 17  VAL 17  19  19  VAL VAL B . n 
B 1 18  TYR 18  20  20  TYR TYR B . n 
B 1 19  LYS 19  21  21  LYS LYS B . n 
B 1 20  GLU 20  22  22  GLU GLU B . n 
B 1 21  SER 21  23  23  SER SER B . n 
B 1 22  THR 22  24  24  THR THR B . n 
B 1 23  ASP 23  25  25  ASP ASP B . n 
B 1 24  VAL 24  26  26  VAL VAL B . n 
B 1 25  PRO 25  27  27  PRO PRO B . n 
B 1 26  ALA 26  28  28  ALA ALA B . n 
B 1 27  SER 27  29  29  SER SER B . n 
B 1 28  ARG 28  30  30  ARG ARG B . n 
B 1 29  PHE 29  31  31  PHE PHE B . n 
B 1 30  LYS 30  32  32  LYS LYS B . n 
B 1 31  GLU 31  33  33  GLU GLU B . n 
B 1 32  GLU 32  34  34  GLU GLU B . n 
B 1 33  ILE 33  35  35  ILE ILE B . n 
B 1 34  LEU 34  36  36  LEU LEU B . n 
B 1 35  ARG 35  37  37  ARG ARG B . n 
B 1 36  ILE 36  38  38  ILE ILE B . n 
B 1 37  LEU 37  39  39  LEU LEU B . n 
B 1 38  ALA 38  40  40  ALA ALA B . n 
B 1 39  ARG 39  41  41  ARG ARG B . n 
B 1 40  GLU 40  42  42  GLU GLU B . n 
B 1 41  GLY 41  43  43  GLY GLY B . n 
B 1 42  PHE 42  44  44  PHE PHE B . n 
B 1 43  ILE 43  45  45  ILE ILE B . n 
B 1 44  LYS 44  46  46  LYS LYS B . n 
B 1 45  GLY 45  47  47  GLY GLY B . n 
B 1 46  TYR 46  48  48  TYR TYR B . n 
B 1 47  GLU 47  49  49  GLU GLU B . n 
B 1 48  ARG 48  50  50  ARG ARG B . n 
B 1 49  VAL 49  51  51  VAL VAL B . n 
B 1 50  ASP 50  52  52  ASP ASP B . n 
B 1 51  VAL 51  53  53  VAL VAL B . n 
B 1 52  ASP 52  54  54  ASP ASP B . n 
B 1 53  GLY 53  55  55  GLY GLY B . n 
B 1 54  LYS 54  56  56  LYS LYS B . n 
B 1 55  PRO 55  57  57  PRO PRO B . n 
B 1 56  TYR 56  58  58  TYR TYR B . n 
B 1 57  LEU 57  59  59  LEU LEU B . n 
B 1 58  ARG 58  60  60  ARG ARG B . n 
B 1 59  VAL 59  61  61  VAL VAL B . n 
B 1 60  TYR 60  62  62  TYR TYR B . n 
B 1 61  LEU 61  63  63  LEU LEU B . n 
B 1 62  LYS 62  64  64  LYS LYS B . n 
B 1 63  TYR 63  65  65  TYR TYR B . n 
B 1 64  GLY 64  66  66  GLY GLY B . n 
B 1 65  PRO 65  67  67  PRO PRO B . n 
B 1 66  ARG 66  68  68  ARG ARG B . n 
B 1 67  ARG 67  69  69  ARG ARG B . n 
B 1 68  GLN 68  70  70  GLN GLN B . n 
B 1 69  GLY 69  71  71  GLY GLY B . n 
B 1 70  PRO 70  72  72  PRO PRO B . n 
B 1 71  ASP 71  73  73  ASP ASP B . n 
B 1 72  PRO 72  74  74  PRO PRO B . n 
B 1 73  ARG 73  75  75  ARG ARG B . n 
B 1 74  PRO 74  76  76  PRO PRO B . n 
B 1 75  GLU 75  77  77  GLU GLU B . n 
B 1 76  GLN 76  78  78  GLN GLN B . n 
B 1 77  VAL 77  79  79  VAL VAL B . n 
B 1 78  ILE 78  80  80  ILE ILE B . n 
B 1 79  HIS 79  81  81  HIS HIS B . n 
B 1 80  HIS 80  82  82  HIS HIS B . n 
B 1 81  ILE 81  83  83  ILE ILE B . n 
B 1 82  ARG 82  84  84  ARG ARG B . n 
B 1 83  ARG 83  85  85  ARG ARG B . n 
B 1 84  ILE 84  86  86  ILE ILE B . n 
B 1 85  SER 85  87  87  SER SER B . n 
B 1 86  LYS 86  88  88  LYS LYS B . n 
B 1 87  PRO 87  89  89  PRO PRO B . n 
B 1 88  GLY 88  90  90  GLY GLY B . n 
B 1 89  ARG 89  91  91  ARG ARG B . n 
B 1 90  ARG 90  92  92  ARG ARG B . n 
B 1 91  VAL 91  93  93  VAL VAL B . n 
B 1 92  TYR 92  94  94  TYR TYR B . n 
B 1 93  VAL 93  95  95  VAL VAL B . n 
B 1 94  GLY 94  96  96  GLY GLY B . n 
B 1 95  VAL 95  97  97  VAL VAL B . n 
B 1 96  LYS 96  98  98  LYS LYS B . n 
B 1 97  GLU 97  99  99  GLU GLU B . n 
B 1 98  ILE 98  100 100 ILE ILE B . n 
B 1 99  PRO 99  101 101 PRO PRO B . n 
B 1 100 ARG 100 102 102 ARG ARG B . n 
B 1 101 VAL 101 103 103 VAL VAL B . n 
B 1 102 ARG 102 104 104 ARG ARG B . n 
B 1 103 ARG 103 105 105 ARG ARG B . n 
B 1 104 GLY 104 106 106 GLY GLY B . n 
B 1 105 LEU 105 107 107 LEU LEU B . n 
B 1 106 GLY 106 108 108 GLY GLY B . n 
B 1 107 ILE 107 109 109 ILE ILE B . n 
B 1 108 ALA 108 110 110 ALA ALA B . n 
B 1 109 ILE 109 111 111 ILE ILE B . n 
B 1 110 LEU 110 112 112 LEU LEU B . n 
B 1 111 SER 111 113 113 SER SER B . n 
B 1 112 THR 112 114 114 THR THR B . n 
B 1 113 SER 113 115 115 SER SER B . n 
B 1 114 LYS 114 116 116 LYS LYS B . n 
B 1 115 GLY 115 117 117 GLY GLY B . n 
B 1 116 VAL 116 118 118 VAL VAL B . n 
B 1 117 LEU 117 119 119 LEU LEU B . n 
B 1 118 THR 118 120 120 THR THR B . n 
B 1 119 ASP 119 121 121 ASP ASP B . n 
B 1 120 ARG 120 122 122 ARG ARG B . n 
B 1 121 GLU 121 123 123 GLU GLU B . n 
B 1 122 ALA 122 124 124 ALA ALA B . n 
B 1 123 ARG 123 125 125 ARG ARG B . n 
B 1 124 LYS 124 126 126 LYS LYS B . n 
B 1 125 LEU 125 127 127 LEU LEU B . n 
B 1 126 GLY 126 128 128 GLY GLY B . n 
B 1 127 VAL 127 129 129 VAL VAL B . n 
B 1 128 GLY 128 130 130 GLY GLY B . n 
B 1 129 GLY 129 131 131 GLY GLY B . n 
B 1 130 GLU 130 132 132 GLU GLU B . n 
B 1 131 LEU 131 133 133 LEU LEU B . n 
B 1 132 ILE 132 134 134 ILE ILE B . n 
B 1 133 CYS 133 135 135 CYS CYS B . n 
B 1 134 GLU 134 136 136 GLU GLU B . n 
B 1 135 VAL 135 137 137 VAL VAL B . n 
B 1 136 TRP 136 138 138 TRP TRP B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 67.8600000000 -1.0000000000 
0.0000000000 0.0000000000 67.8600000000 0.0000000000 0.0000000000 -1.0000000000 87.0450000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-07-01 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' 3.1 ? 1 
X-PLOR    refinement       3.1 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 NE2 A HIS 82 ? ? CD2 A HIS 82 ? ? 1.296 1.373 -0.077 0.011 N 
2 1 CA  A SER 87 ? ? CB  A SER 87 ? ? 1.416 1.525 -0.109 0.015 N 
3 1 NE2 B HIS 82 ? ? CD2 B HIS 82 ? ? 1.291 1.373 -0.082 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 14  ? ? CZ A ARG 14  ? ? NH2 A ARG 14  ? ? 117.16 120.30 -3.14  0.50 N 
2  1 CA A THR 24  ? ? CB A THR 24  ? ? CG2 A THR 24  ? ? 120.91 112.40 8.51   1.40 N 
3  1 NE A ARG 41  ? ? CZ A ARG 41  ? ? NH1 A ARG 41  ? ? 123.67 120.30 3.37   0.50 N 
4  1 NE A ARG 50  ? ? CZ A ARG 50  ? ? NH1 A ARG 50  ? ? 123.54 120.30 3.24   0.50 N 
5  1 NE A ARG 60  ? ? CZ A ARG 60  ? ? NH2 A ARG 60  ? ? 115.25 120.30 -5.05  0.50 N 
6  1 NE A ARG 91  ? ? CZ A ARG 91  ? ? NH1 A ARG 91  ? ? 124.51 120.30 4.21   0.50 N 
7  1 CB B TYR 20  ? ? CG B TYR 20  ? ? CD1 B TYR 20  ? ? 116.28 121.00 -4.72  0.60 N 
8  1 CA B ARG 37  ? ? CB B ARG 37  ? ? CG  B ARG 37  ? ? 129.88 113.40 16.48  2.20 N 
9  1 CA B VAL 53  ? ? C  B VAL 53  ? ? N   B ASP 54  ? ? 102.93 117.20 -14.27 2.20 Y 
10 1 NE B ARG 69  ? ? CZ B ARG 69  ? ? NH2 B ARG 69  ? ? 124.02 120.30 3.72   0.50 N 
11 1 NE B ARG 92  ? ? CZ B ARG 92  ? ? NH2 B ARG 92  ? ? 116.36 120.30 -3.94  0.50 N 
12 1 CA B GLU 123 ? ? CB B GLU 123 ? ? CG  B GLU 123 ? ? 132.20 113.40 18.80  2.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 70  ? ? -50.83  69.92  
2  1 PRO A 72  ? ? -43.51  80.44  
3  1 ILE A 86  ? ? -119.62 -71.05 
4  1 PRO A 89  ? ? -14.98  92.64  
5  1 ARG A 104 ? ? 34.76   58.30  
6  1 PRO B 5   ? ? -27.39  -75.26 
7  1 PRO B 27  ? ? -39.05  120.30 
8  1 SER B 29  ? ? 179.38  146.25 
9  1 ASP B 54  ? ? 61.76   62.67  
10 1 PRO B 72  ? ? -58.42  79.91  
11 1 ILE B 86  ? ? -105.22 -60.76 
12 1 ARG B 91  ? ? -165.06 66.93  
13 1 VAL B 97  ? ? 13.63   -57.68 
14 1 ARG B 105 ? ? 61.34   -6.23  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A THR 120 ? C ? A THR 118 C 
2 1 Y 0 B THR 120 ? C ? B THR 118 C 
#