data_1AOI
# 
_entry.id   1AOI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AOI         
RCSB  PD0001       
WWPDB D_1000171063 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AOI 
_pdbx_database_status.recvd_initial_deposition_date   1997-07-03 
_pdbx_database_status.deposit_site                    NDB 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Luger, K.'      1 
'Maeder, A.W.'   2 
'Richmond, R.K.' 3 
'Sargent, D.F.'  4 
'Richmond, T.J.' 5 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the nucleosome core particle at 2.8 A resolution.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            389 
_citation.page_first                251 
_citation.page_last                 260 
_citation.year                      1997 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9305837 
_citation.pdbx_database_id_DOI      10.1038/38444 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Luger, K.'      1 
primary 'Mader, A.W.'    2 
primary 'Richmond, R.K.' 3 
primary 'Sargent, D.F.'  4 
primary 'Richmond, T.J.' 5 
# 
_cell.entry_id           1AOI 
_cell.length_a           106.040 
_cell.length_b           181.780 
_cell.length_c           110.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AOI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     orthorhombic 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'PALINDROMIC 146 BP DNA REPEAT 8/9 FROM HUMAN X-CHROMOSOME ALPHA SATELLITE DNA' 45053.855 2  ? ?   ?             
? 
2 polymer     man 'HISTONE H3'                                                                    13244.528 2  ? ?   'HISTONE H3'  
? 
3 polymer     man 'HISTONE H4'                                                                    9990.770  2  ? ?   'HISTONE H4'  
? 
4 polymer     man 'HISTONE H2A'                                                                   12639.772 2  ? ?   'HISTONE H2A' 
? 
5 polymer     man 'HISTONE H2B'                                                                   11179.959 2  ? A7P 'HISTONE H2B' 
? 
6 non-polymer syn 'MANGANESE (II) ION'                                                            54.938    6  ? ?   ?             
? 
7 water       nat water                                                                           18.015    13 ? ?   ?             
? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATTCAGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTGAT
;
I,J ? 
2 'polypeptide(L)'        no no 
;LATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAY
LVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;LATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAY
LVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
3 'polypeptide(L)'        no no 
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
;KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGR
TLYGFGG
;
B,F ? 
4 'polypeptide(L)'        no no 
;GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHL
QLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
;GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHL
QLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKK
;
C,G ? 
5 'polypeptide(L)'        no no 
;KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL
AKHAVSEGTKAVTKYTSAK
;
;KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL
AKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DA  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DC  n 
1 17  DA  n 
1 18  DG  n 
1 19  DA  n 
1 20  DT  n 
1 21  DT  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DA  n 
1 73  DA  n 
1 74  DT  n 
1 75  DT  n 
1 76  DC  n 
1 77  DA  n 
1 78  DG  n 
1 79  DC  n 
1 80  DT  n 
1 81  DG  n 
1 82  DA  n 
1 83  DA  n 
1 84  DC  n 
1 85  DA  n 
1 86  DT  n 
1 87  DG  n 
1 88  DC  n 
1 89  DC  n 
1 90  DT  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DG  n 
1 95  DA  n 
1 96  DT  n 
1 97  DG  n 
1 98  DG  n 
1 99  DA  n 
1 100 DG  n 
1 101 DC  n 
1 102 DA  n 
1 103 DG  n 
1 104 DT  n 
1 105 DT  n 
1 106 DT  n 
1 107 DC  n 
1 108 DC  n 
1 109 DA  n 
1 110 DA  n 
1 111 DA  n 
1 112 DT  n 
1 113 DA  n 
1 114 DC  n 
1 115 DA  n 
1 116 DC  n 
1 117 DT  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DG  n 
1 122 DG  n 
1 123 DT  n 
1 124 DA  n 
1 125 DG  n 
1 126 DA  n 
1 127 DA  n 
1 128 DT  n 
1 129 DC  n 
1 130 DT  n 
1 131 DG  n 
1 132 DC  n 
1 133 DA  n 
1 134 DG  n 
1 135 DG  n 
1 136 DT  n 
1 137 DG  n 
1 138 DG  n 
1 139 DA  n 
1 140 DT  n 
1 141 DA  n 
1 142 DT  n 
1 143 DT  n 
1 144 DG  n 
1 145 DA  n 
1 146 DT  n 
2 1   LEU n 
2 2   ALA n 
2 3   THR n 
2 4   LYS n 
2 5   ALA n 
2 6   ALA n 
2 7   ARG n 
2 8   LYS n 
2 9   SER n 
2 10  ALA n 
2 11  PRO n 
2 12  ALA n 
2 13  THR n 
2 14  GLY n 
2 15  GLY n 
2 16  VAL n 
2 17  LYS n 
2 18  LYS n 
2 19  PRO n 
2 20  HIS n 
2 21  ARG n 
2 22  TYR n 
2 23  ARG n 
2 24  PRO n 
2 25  GLY n 
2 26  THR n 
2 27  VAL n 
2 28  ALA n 
2 29  LEU n 
2 30  ARG n 
2 31  GLU n 
2 32  ILE n 
2 33  ARG n 
2 34  ARG n 
2 35  TYR n 
2 36  GLN n 
2 37  LYS n 
2 38  SER n 
2 39  THR n 
2 40  GLU n 
2 41  LEU n 
2 42  LEU n 
2 43  ILE n 
2 44  ARG n 
2 45  LYS n 
2 46  LEU n 
2 47  PRO n 
2 48  PHE n 
2 49  GLN n 
2 50  ARG n 
2 51  LEU n 
2 52  VAL n 
2 53  ARG n 
2 54  GLU n 
2 55  ILE n 
2 56  ALA n 
2 57  GLN n 
2 58  ASP n 
2 59  PHE n 
2 60  LYS n 
2 61  THR n 
2 62  ASP n 
2 63  LEU n 
2 64  ARG n 
2 65  PHE n 
2 66  GLN n 
2 67  SER n 
2 68  SER n 
2 69  ALA n 
2 70  VAL n 
2 71  MET n 
2 72  ALA n 
2 73  LEU n 
2 74  GLN n 
2 75  GLU n 
2 76  ALA n 
2 77  SER n 
2 78  GLU n 
2 79  ALA n 
2 80  TYR n 
2 81  LEU n 
2 82  VAL n 
2 83  ALA n 
2 84  LEU n 
2 85  PHE n 
2 86  GLU n 
2 87  ASP n 
2 88  THR n 
2 89  ASN n 
2 90  LEU n 
2 91  CYS n 
2 92  ALA n 
2 93  ILE n 
2 94  HIS n 
2 95  ALA n 
2 96  LYS n 
2 97  ARG n 
2 98  VAL n 
2 99  THR n 
2 100 ILE n 
2 101 MET n 
2 102 PRO n 
2 103 LYS n 
2 104 ASP n 
2 105 ILE n 
2 106 GLN n 
2 107 LEU n 
2 108 ALA n 
2 109 ARG n 
2 110 ARG n 
2 111 ILE n 
2 112 ARG n 
2 113 GLY n 
2 114 GLU n 
2 115 ARG n 
2 116 ALA n 
3 1   LYS n 
3 2   ARG n 
3 3   HIS n 
3 4   ARG n 
3 5   LYS n 
3 6   VAL n 
3 7   LEU n 
3 8   ARG n 
3 9   ASP n 
3 10  ASN n 
3 11  ILE n 
3 12  GLN n 
3 13  GLY n 
3 14  ILE n 
3 15  THR n 
3 16  LYS n 
3 17  PRO n 
3 18  ALA n 
3 19  ILE n 
3 20  ARG n 
3 21  ARG n 
3 22  LEU n 
3 23  ALA n 
3 24  ARG n 
3 25  ARG n 
3 26  GLY n 
3 27  GLY n 
3 28  VAL n 
3 29  LYS n 
3 30  ARG n 
3 31  ILE n 
3 32  SER n 
3 33  GLY n 
3 34  LEU n 
3 35  ILE n 
3 36  TYR n 
3 37  GLU n 
3 38  GLU n 
3 39  THR n 
3 40  ARG n 
3 41  GLY n 
3 42  VAL n 
3 43  LEU n 
3 44  LYS n 
3 45  VAL n 
3 46  PHE n 
3 47  LEU n 
3 48  GLU n 
3 49  ASN n 
3 50  VAL n 
3 51  ILE n 
3 52  ARG n 
3 53  ASP n 
3 54  ALA n 
3 55  VAL n 
3 56  THR n 
3 57  TYR n 
3 58  THR n 
3 59  GLU n 
3 60  HIS n 
3 61  ALA n 
3 62  LYS n 
3 63  ARG n 
3 64  LYS n 
3 65  THR n 
3 66  VAL n 
3 67  THR n 
3 68  ALA n 
3 69  MET n 
3 70  ASP n 
3 71  VAL n 
3 72  VAL n 
3 73  TYR n 
3 74  ALA n 
3 75  LEU n 
3 76  LYS n 
3 77  ARG n 
3 78  GLN n 
3 79  GLY n 
3 80  ARG n 
3 81  THR n 
3 82  LEU n 
3 83  TYR n 
3 84  GLY n 
3 85  PHE n 
3 86  GLY n 
3 87  GLY n 
4 1   GLY n 
4 2   LYS n 
4 3   GLN n 
4 4   GLY n 
4 5   GLY n 
4 6   LYS n 
4 7   THR n 
4 8   ARG n 
4 9   ALA n 
4 10  LYS n 
4 11  ALA n 
4 12  LYS n 
4 13  THR n 
4 14  ARG n 
4 15  SER n 
4 16  SER n 
4 17  ARG n 
4 18  ALA n 
4 19  GLY n 
4 20  LEU n 
4 21  GLN n 
4 22  PHE n 
4 23  PRO n 
4 24  VAL n 
4 25  GLY n 
4 26  ARG n 
4 27  VAL n 
4 28  HIS n 
4 29  ARG n 
4 30  LEU n 
4 31  LEU n 
4 32  ARG n 
4 33  LYS n 
4 34  GLY n 
4 35  ASN n 
4 36  TYR n 
4 37  ALA n 
4 38  GLU n 
4 39  ARG n 
4 40  VAL n 
4 41  GLY n 
4 42  ALA n 
4 43  GLY n 
4 44  ALA n 
4 45  PRO n 
4 46  VAL n 
4 47  TYR n 
4 48  LEU n 
4 49  ALA n 
4 50  ALA n 
4 51  VAL n 
4 52  LEU n 
4 53  GLU n 
4 54  TYR n 
4 55  LEU n 
4 56  THR n 
4 57  ALA n 
4 58  GLU n 
4 59  ILE n 
4 60  LEU n 
4 61  GLU n 
4 62  LEU n 
4 63  ALA n 
4 64  GLY n 
4 65  ASN n 
4 66  ALA n 
4 67  ALA n 
4 68  ARG n 
4 69  ASP n 
4 70  ASN n 
4 71  LYS n 
4 72  LYS n 
4 73  THR n 
4 74  ARG n 
4 75  ILE n 
4 76  ILE n 
4 77  PRO n 
4 78  ARG n 
4 79  HIS n 
4 80  LEU n 
4 81  GLN n 
4 82  LEU n 
4 83  ALA n 
4 84  VAL n 
4 85  ARG n 
4 86  ASN n 
4 87  ASP n 
4 88  GLU n 
4 89  GLU n 
4 90  LEU n 
4 91  ASN n 
4 92  LYS n 
4 93  LEU n 
4 94  LEU n 
4 95  GLY n 
4 96  ARG n 
4 97  VAL n 
4 98  THR n 
4 99  ILE n 
4 100 ALA n 
4 101 GLN n 
4 102 GLY n 
4 103 GLY n 
4 104 VAL n 
4 105 LEU n 
4 106 PRO n 
4 107 ASN n 
4 108 ILE n 
4 109 GLN n 
4 110 SER n 
4 111 VAL n 
4 112 LEU n 
4 113 LEU n 
4 114 PRO n 
4 115 LYS n 
4 116 LYS n 
5 1   LYS n 
5 2   LYS n 
5 3   ARG n 
5 4   ARG n 
5 5   LYS n 
5 6   THR n 
5 7   ARG n 
5 8   LYS n 
5 9   GLU n 
5 10  SER n 
5 11  TYR n 
5 12  ALA n 
5 13  ILE n 
5 14  TYR n 
5 15  VAL n 
5 16  TYR n 
5 17  LYS n 
5 18  VAL n 
5 19  LEU n 
5 20  LYS n 
5 21  GLN n 
5 22  VAL n 
5 23  HIS n 
5 24  PRO n 
5 25  ASP n 
5 26  THR n 
5 27  GLY n 
5 28  ILE n 
5 29  SER n 
5 30  SER n 
5 31  LYS n 
5 32  ALA n 
5 33  MET n 
5 34  SER n 
5 35  ILE n 
5 36  MET n 
5 37  ASN n 
5 38  SER n 
5 39  PHE n 
5 40  VAL n 
5 41  ASN n 
5 42  ASP n 
5 43  VAL n 
5 44  PHE n 
5 45  GLU n 
5 46  ARG n 
5 47  ILE n 
5 48  ALA n 
5 49  GLY n 
5 50  GLU n 
5 51  ALA n 
5 52  SER n 
5 53  ARG n 
5 54  LEU n 
5 55  ALA n 
5 56  HIS n 
5 57  TYR n 
5 58  ASN n 
5 59  LYS n 
5 60  ARG n 
5 61  SER n 
5 62  THR n 
5 63  ILE n 
5 64  THR n 
5 65  SER n 
5 66  ARG n 
5 67  GLU n 
5 68  ILE n 
5 69  GLN n 
5 70  THR n 
5 71  ALA n 
5 72  VAL n 
5 73  ARG n 
5 74  LEU n 
5 75  LEU n 
5 76  LEU n 
5 77  PRO n 
5 78  GLY n 
5 79  GLU n 
5 80  LEU n 
5 81  ALA n 
5 82  LYS n 
5 83  HIS n 
5 84  ALA n 
5 85  VAL n 
5 86  SER n 
5 87  GLU n 
5 88  GLY n 
5 89  THR n 
5 90  LYS n 
5 91  ALA n 
5 92  VAL n 
5 93  THR n 
5 94  LYS n 
5 95  TYR n 
5 96  THR n 
5 97  SER n 
5 98  ALA n 
5 99  LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
2 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                             
3 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'SYNTHETIC GENE, OPTIMIZED CODON USAGE FOR ESCHERICHIA COLI;' 
4 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                             
5 1 sample ? ? ? 'African clawed frog' Xenopus ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                                                             
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 H32_XENLA  UNP 2 P02302 ? ? ? 
2 H4_XENLA   UNP 3 P62799 ? ? ? 
3 H2A1_XENLA UNP 4 P06897 ? ? ? 
4 H2B1_XENLA UNP 5 P02281 ? ? ? 
5 1AOI       PDB 1 1AOI   ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1AOI A 1 ? 116 ? P02302 20  ? 135 ? 20  135 
2  2 1AOI B 1 ? 87  ? P62799 17  ? 103 ? 16  102 
3  3 1AOI C 1 ? 116 ? P06897 4   ? 119 ? 4   119 
4  4 1AOI D 1 ? 99  ? P02281 27  ? 125 ? 24  122 
5  1 1AOI E 1 ? 116 ? P02302 21  ? 136 ? 20  135 
6  2 1AOI F 1 ? 87  ? P62799 17  ? 103 ? 16  102 
7  3 1AOI G 1 ? 116 ? P06897 4   ? 119 ? 4   119 
8  4 1AOI H 1 ? 99  ? P02281 27  ? 125 ? 24  122 
9  5 1AOI I 1 ? 146 ? 1AOI   1   ? 146 ? 1   146 
10 5 1AOI J 1 ? 146 ? 1AOI   147 ? 292 ? 147 292 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1AOI ALA A 2  ? UNP P02302 VAL 21 CONFLICT 21 1  
1 1AOI ARG A 7  ? UNP P02302 LYS 26 CONFLICT 26 2  
1 1AOI SER A 9  ? UNP P02302 CYS 28 CONFLICT 28 3  
1 1AOI SER A 67 ? UNP P02302 ARG 86 CONFLICT 86 4  
3 1AOI ARG C 96 ? UNP P06897 GLY 99 CONFLICT 99 5  
4 1AOI THR D 6  ? UNP P02281 SER 32 CONFLICT 29 6  
5 1AOI ALA E 2  ? UNP P02302 VAL 21 CONFLICT 21 7  
5 1AOI ARG E 7  ? UNP P02302 LYS 26 CONFLICT 26 8  
5 1AOI SER E 9  ? UNP P02302 CYS 28 CONFLICT 28 9  
5 1AOI SER E 67 ? UNP P02302 ARG 86 CONFLICT 86 10 
7 1AOI ARG G 96 ? UNP P06897 GLY 99 CONFLICT 99 11 
8 1AOI THR H 6  ? UNP P02281 SER 32 CONFLICT 29 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1AOI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.83 
_exptl_crystal.density_percent_sol   56.54 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           110.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-08-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID13' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID13 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AOI 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.0 
_reflns.d_resolution_high            2.8 
_reflns.number_obs                   52487 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            0.0560000 
_reflns.pdbx_Rsym_value              3.6000000 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.7 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.8 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   95.0 
_reflns_shell.Rmerge_I_obs           0.1320000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        6.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AOI 
_refine.ls_number_reflns_obs                     51237 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2240000 
_refine.ls_R_factor_R_free                       0.3020000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'BULK SOLVENT MODEL USED' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6387 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               12386 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        25.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1AOI 
_struct.title                     'COMPLEX BETWEEN NUCLEOSOME CORE PARTICLE (H3,H4,H2A,H2B) AND 146 BP LONG DNA FRAGMENT' 
_struct.pdbx_descriptor           'COMPLEX BETWEEN NUCLEOSOME CORE PARTICLE (H3,H4,H2A,H2B) AND 146 BP LONG DNA FRAGMENT' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AOI 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
_struct_keywords.text            
'NUCLEOSOME, CHROMATIN, HISTONE, PROTEIN DNA INTERACTION, NUCLEOPROTEIN, SUPERCOILED DNA, DNA BINDING PROTEIN-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 7 ? 
R N N 7 ? 
S N N 7 ? 
T N N 7 ? 
U N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR C 26  ? LYS C 37  ? THR A 45  LYS A 56  1 ? 12 
HELX_P HELX_P2  2  LYS C 45  ? PHE C 59  ? LYS A 64  PHE A 78  1 ? 15 
HELX_P HELX_P3  3  SER C 67  ? HIS C 94  ? SER A 86  HIS A 113 1 ? 28 
HELX_P HELX_P4  4  PRO C 102 ? ARG C 112 ? PRO A 121 ARG A 131 1 ? 11 
HELX_P HELX_P5  5  ILE D 11  ? GLY D 13  ? ILE B 26  GLY B 28  5 ? 3  
HELX_P HELX_P6  6  LYS D 16  ? ARG D 25  ? LYS B 31  ARG B 40  1 ? 10 
HELX_P HELX_P7  7  GLY D 33  ? HIS D 60  ? GLY B 48  HIS B 75  5 ? 28 
HELX_P HELX_P8  8  ALA D 68  ? GLN D 78  ? ALA B 83  GLN B 93  1 ? 11 
HELX_P HELX_P9  9  LYS E 2   ? GLY E 4   ? LYS C 5   GLY C 7   5 ? 3  
HELX_P HELX_P10 10 ARG E 14  ? ALA E 18  ? ARG C 17  ALA C 21  1 ? 5  
HELX_P HELX_P11 11 VAL E 24  ? ARG E 32  ? VAL C 27  ARG C 35  1 ? 9  
HELX_P HELX_P12 12 ALA E 42  ? ASP E 69  ? ALA C 45  ASP C 72  1 ? 28 
HELX_P HELX_P13 13 PRO E 77  ? ARG E 85  ? PRO C 80  ARG C 88  1 ? 9  
HELX_P HELX_P14 14 GLU E 88  ? LEU E 93  ? GLU C 91  LEU C 96  1 ? 6  
HELX_P HELX_P15 15 SER E 110 ? LEU E 112 ? SER C 113 LEU C 115 5 ? 3  
HELX_P HELX_P16 16 ALA F 12  ? VAL F 22  ? ALA D 35  VAL D 45  1 ? 11 
HELX_P HELX_P17 17 SER F 30  ? ASN F 58  ? SER D 53  ASN D 81  1 ? 29 
HELX_P HELX_P18 18 SER F 65  ? LEU F 75  ? SER D 88  LEU D 98  1 ? 11 
HELX_P HELX_P19 19 GLY F 78  ? THR F 96  ? GLY D 101 THR D 119 1 ? 19 
HELX_P HELX_P20 20 THR G 26  ? LYS G 37  ? THR E 45  LYS E 56  1 ? 12 
HELX_P HELX_P21 21 LYS G 45  ? ASP G 58  ? LYS E 64  ASP E 77  1 ? 14 
HELX_P HELX_P22 22 SER G 67  ? ALA G 95  ? SER E 86  ALA E 114 1 ? 29 
HELX_P HELX_P23 23 PRO G 102 ? ARG G 112 ? PRO E 121 ARG E 131 1 ? 11 
HELX_P HELX_P24 24 ASN H 10  ? GLY H 13  ? ASN F 25  GLY F 28  5 ? 4  
HELX_P HELX_P25 25 LYS H 16  ? ARG H 25  ? LYS F 31  ARG F 40  1 ? 10 
HELX_P HELX_P26 26 ILE H 35  ? ALA H 61  ? ILE F 50  ALA F 76  1 ? 27 
HELX_P HELX_P27 27 ALA H 68  ? ARG H 77  ? ALA F 83  ARG F 92  1 ? 10 
HELX_P HELX_P28 28 ARG I 14  ? ALA I 18  ? ARG G 17  ALA G 21  1 ? 5  
HELX_P HELX_P29 29 VAL I 24  ? GLY I 34  ? VAL G 27  GLY G 37  1 ? 11 
HELX_P HELX_P30 30 ALA I 44  ? ASN I 70  ? ALA G 47  ASN G 73  1 ? 27 
HELX_P HELX_P31 31 PRO I 77  ? ARG I 85  ? PRO G 80  ARG G 88  1 ? 9  
HELX_P HELX_P32 32 GLU I 88  ? LEU I 93  ? GLU G 91  LEU G 96  1 ? 6  
HELX_P HELX_P33 33 SER I 110 ? LEU I 112 ? SER G 113 LEU G 115 5 ? 3  
HELX_P HELX_P34 34 TYR J 11  ? VAL J 22  ? TYR H 34  VAL H 45  5 ? 12 
HELX_P HELX_P35 35 SER J 30  ? TYR J 57  ? SER H 53  TYR H 80  1 ? 28 
HELX_P HELX_P36 36 SER J 65  ? LEU J 75  ? SER H 88  LEU H 98  1 ? 11 
HELX_P HELX_P37 37 GLY J 78  ? THR J 96  ? GLY H 101 THR H 119 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DA 1   N1 ? ? ? 1_555 B DT 146 N3 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? A DA 1   N6 ? ? ? 1_555 B DT 146 O4 ? ? I DA 1   J DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? A DT 2   N3 ? ? ? 1_555 B DA 145 N1 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? A DT 2   O4 ? ? ? 1_555 B DA 145 N6 ? ? I DT 2   J DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? A DC 3   N3 ? ? ? 1_555 B DG 144 N1 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? A DC 3   N4 ? ? ? 1_555 B DG 144 O6 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7   hydrog ? ? A DC 3   O2 ? ? ? 1_555 B DG 144 N2 ? ? I DC 3   J DG 290 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8   hydrog ? ? A DA 4   N1 ? ? ? 1_555 B DT 143 N3 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9   hydrog ? ? A DA 4   N6 ? ? ? 1_555 B DT 143 O4 ? ? I DA 4   J DT 289 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? A DA 5   N1 ? ? ? 1_555 B DT 142 N3 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? A DA 5   N6 ? ? ? 1_555 B DT 142 O4 ? ? I DA 5   J DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? A DT 6   N3 ? ? ? 1_555 B DA 141 N1 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? A DT 6   O4 ? ? ? 1_555 B DA 141 N6 ? ? I DT 6   J DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14  hydrog ? ? A DA 7   N1 ? ? ? 1_555 B DT 140 N3 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15  hydrog ? ? A DA 7   N6 ? ? ? 1_555 B DT 140 O4 ? ? I DA 7   J DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16  hydrog ? ? A DT 8   N3 ? ? ? 1_555 B DA 139 N1 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17  hydrog ? ? A DT 8   O4 ? ? ? 1_555 B DA 139 N6 ? ? I DT 8   J DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18  hydrog ? ? A DC 9   N3 ? ? ? 1_555 B DG 138 N1 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19  hydrog ? ? A DC 9   N4 ? ? ? 1_555 B DG 138 O6 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? A DC 9   O2 ? ? ? 1_555 B DG 138 N2 ? ? I DC 9   J DG 284 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? A DC 10  O2 ? ? ? 1_555 B DG 137 N2 ? ? I DC 10  J DG 283 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog22  hydrog ? ? A DA 11  N1 ? ? ? 1_555 B DT 136 N3 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? A DA 11  N6 ? ? ? 1_555 B DT 136 O4 ? ? I DA 11  J DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? A DC 12  N3 ? ? ? 1_555 B DG 135 N1 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25  hydrog ? ? A DC 12  N4 ? ? ? 1_555 B DG 135 O6 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26  hydrog ? ? A DC 12  O2 ? ? ? 1_555 B DG 135 N2 ? ? I DC 12  J DG 281 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? A DC 13  O2 ? ? ? 1_555 B DG 134 N2 ? ? I DC 13  J DG 280 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog28  hydrog ? ? A DT 14  N3 ? ? ? 1_555 B DA 133 N1 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29  hydrog ? ? A DT 14  O4 ? ? ? 1_555 B DA 133 N6 ? ? I DT 14  J DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? A DG 15  N1 ? ? ? 1_555 B DC 132 O2 ? ? I DG 15  J DC 278 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog31  hydrog ? ? A DC 16  N4 ? ? ? 1_555 B DG 131 O6 ? ? I DC 16  J DG 277 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog32  hydrog ? ? A DA 17  N1 ? ? ? 1_555 B DT 130 N3 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? A DA 17  N6 ? ? ? 1_555 B DT 130 O4 ? ? I DA 17  J DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? A DG 18  N1 ? ? ? 1_555 B DC 129 N3 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? A DG 18  N2 ? ? ? 1_555 B DC 129 O2 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? A DG 18  O6 ? ? ? 1_555 B DC 129 N4 ? ? I DG 18  J DC 275 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? A DA 19  N1 ? ? ? 1_555 B DT 128 N3 ? ? I DA 19  J DT 274 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog38  hydrog ? ? A DT 21  N3 ? ? ? 1_555 B DA 126 N1 ? ? I DT 21  J DA 272 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog39  hydrog ? ? A DC 22  N4 ? ? ? 1_555 B DG 125 O6 ? ? I DC 22  J DG 271 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog40  hydrog ? ? A DT 23  N3 ? ? ? 1_555 B DA 124 N1 ? ? I DT 23  J DA 270 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? A DT 23  O4 ? ? ? 1_555 B DA 124 N6 ? ? I DT 23  J DA 270 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? A DA 24  N1 ? ? ? 1_555 B DT 123 N3 ? ? I DA 24  J DT 269 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog43  hydrog ? ? A DC 25  N3 ? ? ? 1_555 B DG 122 N2 ? ? I DC 25  J DG 268 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog44  hydrog ? ? A DC 26  O2 ? ? ? 1_555 B DG 121 N2 ? ? I DC 26  J DG 267 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog45  hydrog ? ? A DA 27  N6 ? ? ? 1_555 B DT 119 O4 ? ? I DA 27  J DT 265 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog46  hydrog ? ? A DA 27  N1 ? ? ? 1_555 B DT 120 N3 ? ? I DA 27  J DT 266 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog47  hydrog ? ? A DA 29  N1 ? ? ? 1_555 B DT 118 N3 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? A DA 29  N6 ? ? ? 1_555 B DT 118 O4 ? ? I DA 29  J DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? A DA 30  N1 ? ? ? 1_555 B DT 117 N3 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? A DA 30  N6 ? ? ? 1_555 B DT 117 O4 ? ? I DA 30  J DT 263 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? A DG 31  N1 ? ? ? 1_555 B DC 116 N3 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? A DG 31  N2 ? ? ? 1_555 B DC 116 O2 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? A DG 31  O6 ? ? ? 1_555 B DC 116 N4 ? ? I DG 31  J DC 262 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54  hydrog ? ? A DG 33  N1 ? ? ? 1_555 B DC 114 N3 ? ? I DG 33  J DC 260 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog55  hydrog ? ? A DT 34  O4 ? ? ? 1_555 B DA 113 N6 ? ? I DT 34  J DA 259 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog56  hydrog ? ? A DA 35  N1 ? ? ? 1_555 B DT 112 N3 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? A DA 35  N6 ? ? ? 1_555 B DT 112 O4 ? ? I DA 35  J DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? A DT 36  N3 ? ? ? 1_555 B DA 111 N1 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? A DT 36  O4 ? ? ? 1_555 B DA 111 N6 ? ? I DT 36  J DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? A DT 37  N3 ? ? ? 1_555 B DA 110 N1 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? A DT 37  O4 ? ? ? 1_555 B DA 110 N6 ? ? I DT 37  J DA 256 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? A DT 38  N3 ? ? ? 1_555 B DA 109 N1 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? A DT 38  O4 ? ? ? 1_555 B DA 109 N6 ? ? I DT 38  J DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? A DG 39  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 39  J DC 253 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog65  hydrog ? ? A DG 39  N2 ? ? ? 1_555 B DC 108 O2 ? ? I DG 39  J DC 254 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog66  hydrog ? ? A DG 40  N1 ? ? ? 1_555 B DC 107 N3 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? A DG 40  N2 ? ? ? 1_555 B DC 107 O2 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? A DG 40  O6 ? ? ? 1_555 B DC 107 N4 ? ? I DG 40  J DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? A DA 41  N1 ? ? ? 1_555 B DT 106 N3 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? A DA 41  N6 ? ? ? 1_555 B DT 106 O4 ? ? I DA 41  J DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog71  hydrog ? ? A DA 42  N1 ? ? ? 1_555 B DT 105 N3 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog72  hydrog ? ? A DA 42  N6 ? ? ? 1_555 B DT 105 O4 ? ? I DA 42  J DT 251 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? A DA 43  N1 ? ? ? 1_555 B DT 104 N3 ? ? I DA 43  J DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? A DA 43  N6 ? ? ? 1_555 B DT 104 O4 ? ? I DA 43  J DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? A DC 44  O2 ? ? ? 1_555 B DG 103 N2 ? ? I DC 44  J DG 249 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog76  hydrog ? ? A DT 45  N3 ? ? ? 1_555 B DA 102 N1 ? ? I DT 45  J DA 248 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog77  hydrog ? ? A DG 46  N1 ? ? ? 1_555 B DC 101 N3 ? ? I DG 46  J DC 247 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog78  hydrog ? ? A DC 47  N3 ? ? ? 1_555 B DA 99  N6 ? ? I DC 47  J DA 245 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ? ? 
hydrog79  hydrog ? ? A DC 47  O2 ? ? ? 1_555 B DG 100 N2 ? ? I DC 47  J DG 246 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog80  hydrog ? ? A DT 48  N3 ? ? ? 1_555 B DA 99  N1 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? A DT 48  O4 ? ? ? 1_555 B DA 99  N6 ? ? I DT 48  J DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog82  hydrog ? ? A DC 49  O2 ? ? ? 1_555 B DG 98  N2 ? ? I DC 49  J DG 244 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog83  hydrog ? ? A DC 50  N3 ? ? ? 1_555 B DG 97  N1 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? A DC 50  N4 ? ? ? 1_555 B DG 97  O6 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? A DC 50  O2 ? ? ? 1_555 B DG 97  N2 ? ? I DC 50  J DG 243 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? A DA 51  N1 ? ? ? 1_555 B DT 96  N3 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog87  hydrog ? ? A DA 51  N6 ? ? ? 1_555 B DT 96  O4 ? ? I DA 51  J DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog88  hydrog ? ? A DT 52  N3 ? ? ? 1_555 B DA 95  N1 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? A DT 52  O4 ? ? ? 1_555 B DA 95  N6 ? ? I DT 52  J DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? A DC 53  N3 ? ? ? 1_555 B DG 94  N1 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog91  hydrog ? ? A DC 53  N4 ? ? ? 1_555 B DG 94  O6 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? A DC 53  O2 ? ? ? 1_555 B DG 94  N2 ? ? I DC 53  J DG 240 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? A DA 54  N1 ? ? ? 1_555 B DT 93  N3 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog94  hydrog ? ? A DA 54  N6 ? ? ? 1_555 B DT 93  O4 ? ? I DA 54  J DT 239 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog95  hydrog ? ? A DA 55  N1 ? ? ? 1_555 B DT 92  N3 ? ? I DA 55  J DT 238 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog96  hydrog ? ? A DA 57  N1 ? ? ? 1_555 B DT 90  N3 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? A DA 57  N6 ? ? ? 1_555 B DT 90  O4 ? ? I DA 57  J DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? A DG 58  N2 ? ? ? 1_555 B DT 90  O2 ? ? I DG 58  J DT 236 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
hydrog99  hydrog ? ? A DG 59  N1 ? ? ? 1_555 B DC 88  N3 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 88  O2 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog101 hydrog ? ? A DG 59  O6 ? ? ? 1_555 B DC 88  N4 ? ? I DG 59  J DC 234 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog102 hydrog ? ? A DG 59  N2 ? ? ? 1_555 B DC 89  O2 ? ? I DG 59  J DC 235 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog103 hydrog ? ? A DC 60  N3 ? ? ? 1_555 B DG 87  N1 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? A DC 60  N4 ? ? ? 1_555 B DG 87  O6 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? A DC 60  O2 ? ? ? 1_555 B DG 87  N2 ? ? I DC 60  J DG 233 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog106 hydrog ? ? A DA 61  N1 ? ? ? 1_555 B DT 86  N3 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? A DA 61  N6 ? ? ? 1_555 B DT 86  O4 ? ? I DA 61  J DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? A DT 62  N3 ? ? ? 1_555 B DA 85  N1 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog109 hydrog ? ? A DT 62  O4 ? ? ? 1_555 B DA 85  N6 ? ? I DT 62  J DA 231 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog110 hydrog ? ? A DG 63  N1 ? ? ? 1_555 B DC 84  N3 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? A DG 63  N2 ? ? ? 1_555 B DC 84  O2 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? A DG 63  O6 ? ? ? 1_555 B DC 84  N4 ? ? I DG 63  J DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? A DT 64  N3 ? ? ? 1_555 B DA 83  N1 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? A DT 64  O4 ? ? ? 1_555 B DA 83  N6 ? ? I DT 64  J DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? A DT 65  N3 ? ? ? 1_555 B DA 82  N1 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? A DT 65  O4 ? ? ? 1_555 B DA 82  N6 ? ? I DT 65  J DA 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? A DC 66  N3 ? ? ? 1_555 B DG 81  N1 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? A DC 66  N4 ? ? ? 1_555 B DG 81  O6 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? A DC 66  O2 ? ? ? 1_555 B DG 81  N2 ? ? I DC 66  J DG 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? A DA 67  N1 ? ? ? 1_555 B DT 80  N3 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? A DA 67  N6 ? ? ? 1_555 B DT 80  O4 ? ? I DA 67  J DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? A DG 68  N1 ? ? ? 1_555 B DC 79  N3 ? ? I DG 68  J DC 225 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog123 hydrog ? ? A DC 69  O2 ? ? ? 1_555 B DG 78  N2 ? ? I DC 69  J DG 224 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog124 hydrog ? ? A DT 70  N3 ? ? ? 1_555 B DA 77  N1 ? ? I DT 70  J DA 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? A DT 70  O4 ? ? ? 1_555 B DA 77  N6 ? ? I DT 70  J DA 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? A DG 71  N1 ? ? ? 1_555 B DC 76  N3 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? A DG 71  N2 ? ? ? 1_555 B DC 76  O2 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? A DG 71  O6 ? ? ? 1_555 B DC 76  N4 ? ? I DG 71  J DC 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? A DA 72  N1 ? ? ? 1_555 B DT 75  N3 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? A DA 72  N6 ? ? ? 1_555 B DT 75  O4 ? ? I DA 72  J DT 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? A DA 73  N1 ? ? ? 1_555 B DT 74  N3 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? A DA 73  N6 ? ? ? 1_555 B DT 74  O4 ? ? I DA 73  J DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? A DT 74  N3 ? ? ? 1_555 B DA 73  N1 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? A DT 74  O4 ? ? ? 1_555 B DA 73  N6 ? ? I DT 74  J DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? A DT 75  N3 ? ? ? 1_555 B DA 72  N1 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog136 hydrog ? ? A DT 75  O4 ? ? ? 1_555 B DA 72  N6 ? ? I DT 75  J DA 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? A DC 76  N3 ? ? ? 1_555 B DG 71  N1 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? A DC 76  N4 ? ? ? 1_555 B DG 71  O6 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? A DC 76  O2 ? ? ? 1_555 B DG 71  N2 ? ? I DC 76  J DG 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? A DA 77  N1 ? ? ? 1_555 B DT 70  N3 ? ? I DA 77  J DT 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? A DA 77  N6 ? ? ? 1_555 B DT 70  O4 ? ? I DA 77  J DT 216 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog142 hydrog ? ? A DG 78  N1 ? ? ? 1_555 B DC 69  N3 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog143 hydrog ? ? A DG 78  N2 ? ? ? 1_555 B DC 69  O2 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? A DG 78  O6 ? ? ? 1_555 B DC 69  N4 ? ? I DG 78  J DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? A DC 79  N3 ? ? ? 1_555 B DG 68  N1 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? A DC 79  N4 ? ? ? 1_555 B DG 68  O6 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? A DC 79  O2 ? ? ? 1_555 B DG 68  N2 ? ? I DC 79  J DG 214 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? A DT 80  N3 ? ? ? 1_555 B DA 67  N1 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? A DT 80  O4 ? ? ? 1_555 B DA 67  N6 ? ? I DT 80  J DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? A DG 81  N1 ? ? ? 1_555 B DC 66  N3 ? ? I DG 81  J DC 212 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog151 hydrog ? ? A DA 82  N1 ? ? ? 1_555 B DT 65  N3 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog152 hydrog ? ? A DA 82  N6 ? ? ? 1_555 B DT 65  O4 ? ? I DA 82  J DT 211 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? A DA 83  N1 ? ? ? 1_555 B DT 64  N3 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? A DA 83  N6 ? ? ? 1_555 B DT 64  O4 ? ? I DA 83  J DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? A DC 84  N3 ? ? ? 1_555 B DG 63  N1 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? A DC 84  N4 ? ? ? 1_555 B DG 63  O6 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? A DC 84  O2 ? ? ? 1_555 B DG 63  N2 ? ? I DC 84  J DG 209 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? A DA 85  N1 ? ? ? 1_555 B DT 62  N3 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? A DA 85  N6 ? ? ? 1_555 B DT 62  O4 ? ? I DA 85  J DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? A DT 86  N3 ? ? ? 1_555 B DA 61  N1 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? A DT 86  O4 ? ? ? 1_555 B DA 61  N6 ? ? I DT 86  J DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog162 hydrog ? ? A DG 87  N1 ? ? ? 1_555 B DC 60  N3 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog163 hydrog ? ? A DG 87  N2 ? ? ? 1_555 B DC 60  O2 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? A DG 87  O6 ? ? ? 1_555 B DC 60  N4 ? ? I DG 87  J DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? A DC 88  N3 ? ? ? 1_555 B DG 59  N1 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? A DC 88  N4 ? ? ? 1_555 B DG 59  O6 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? A DC 88  O2 ? ? ? 1_555 B DG 59  N2 ? ? I DC 88  J DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? A DC 89  O2 ? ? ? 1_555 B DG 58  N2 ? ? I DC 89  J DG 204 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog169 hydrog ? ? A DT 90  N3 ? ? ? 1_555 B DA 57  N1 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? A DT 90  O4 ? ? ? 1_555 B DA 57  N6 ? ? I DT 90  J DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? A DT 92  N3 ? ? ? 1_555 B DA 55  N1 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? A DT 92  O4 ? ? ? 1_555 B DA 55  N6 ? ? I DT 92  J DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? A DT 93  N3 ? ? ? 1_555 B DA 54  N1 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? A DT 93  O4 ? ? ? 1_555 B DA 54  N6 ? ? I DT 93  J DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? A DG 94  N1 ? ? ? 1_555 B DC 53  N3 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? A DG 94  N2 ? ? ? 1_555 B DC 53  O2 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? A DG 94  O6 ? ? ? 1_555 B DC 53  N4 ? ? I DG 94  J DC 199 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? A DA 95  N1 ? ? ? 1_555 B DT 52  N3 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog179 hydrog ? ? A DA 95  N6 ? ? ? 1_555 B DT 52  O4 ? ? I DA 95  J DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? A DT 96  N3 ? ? ? 1_555 B DA 51  N1 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? A DT 96  O4 ? ? ? 1_555 B DA 51  N6 ? ? I DT 96  J DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? A DG 97  N1 ? ? ? 1_555 B DC 50  N3 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? A DG 97  N2 ? ? ? 1_555 B DC 50  O2 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? A DG 97  O6 ? ? ? 1_555 B DC 50  N4 ? ? I DG 97  J DC 196 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? A DG 98  N1 ? ? ? 1_555 B DC 49  N3 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? A DG 98  N2 ? ? ? 1_555 B DC 49  O2 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? A DG 98  O6 ? ? ? 1_555 B DC 49  N4 ? ? I DG 98  J DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DC 47  N3 ? ? I DA 99  J DC 193 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ? ? 
hydrog189 hydrog ? ? A DA 99  N1 ? ? ? 1_555 B DT 48  N3 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? A DA 99  N6 ? ? ? 1_555 B DT 48  O4 ? ? I DA 99  J DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? A DG 100 N1 ? ? ? 1_555 B DC 47  N3 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? A DG 100 N2 ? ? ? 1_555 B DC 47  O2 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? A DG 100 O6 ? ? ? 1_555 B DC 47  N4 ? ? I DG 100 J DC 193 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? A DC 101 N3 ? ? ? 1_555 B DG 46  N1 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? A DC 101 N4 ? ? ? 1_555 B DG 46  O6 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? A DC 101 O2 ? ? ? 1_555 B DG 46  N2 ? ? I DC 101 J DG 192 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? A DA 102 N1 ? ? ? 1_555 B DT 45  N3 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? A DA 102 N6 ? ? ? 1_555 B DT 45  O4 ? ? I DA 102 J DT 191 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? A DG 103 N1 ? ? ? 1_555 B DC 44  N3 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? A DG 103 N2 ? ? ? 1_555 B DC 44  O2 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? A DG 103 O6 ? ? ? 1_555 B DC 44  N4 ? ? I DG 103 J DC 190 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? A DT 104 N3 ? ? ? 1_555 B DA 43  N1 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? A DT 104 O4 ? ? ? 1_555 B DA 43  N6 ? ? I DT 104 J DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? A DT 105 N3 ? ? ? 1_555 B DA 42  N1 ? ? I DT 105 J DA 188 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog205 hydrog ? ? A DT 106 N3 ? ? ? 1_555 B DA 41  N1 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? A DT 106 O4 ? ? ? 1_555 B DA 41  N6 ? ? I DT 106 J DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? A DC 107 O2 ? ? ? 1_555 B DG 40  N2 ? ? I DC 107 J DG 186 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog208 hydrog ? ? A DC 108 N3 ? ? ? 1_555 B DG 39  N1 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? A DC 108 N4 ? ? ? 1_555 B DG 39  O6 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? A DC 108 O2 ? ? ? 1_555 B DG 39  N2 ? ? I DC 108 J DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? A DA 109 N1 ? ? ? 1_555 B DT 38  N3 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? A DA 109 N6 ? ? ? 1_555 B DT 38  O4 ? ? I DA 109 J DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? A DA 110 N1 ? ? ? 1_555 B DT 37  N3 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? A DA 110 N6 ? ? ? 1_555 B DT 37  O4 ? ? I DA 110 J DT 183 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? A DA 111 N1 ? ? ? 1_555 B DT 36  N3 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? A DA 111 N6 ? ? ? 1_555 B DT 36  O4 ? ? I DA 111 J DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? A DT 112 N3 ? ? ? 1_555 B DA 35  N1 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? A DT 112 O4 ? ? ? 1_555 B DA 35  N6 ? ? I DT 112 J DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? A DA 113 N1 ? ? ? 1_555 B DT 34  N3 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? A DA 113 N6 ? ? ? 1_555 B DT 34  O4 ? ? I DA 113 J DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? A DC 114 N3 ? ? ? 1_555 B DG 33  N1 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? A DC 114 N4 ? ? ? 1_555 B DG 33  O6 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? A DC 114 O2 ? ? ? 1_555 B DG 33  N2 ? ? I DC 114 J DG 179 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog224 hydrog ? ? A DA 115 N1 ? ? ? 1_555 B DT 32  N3 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? A DA 115 N6 ? ? ? 1_555 B DT 32  O4 ? ? I DA 115 J DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? A DC 116 N3 ? ? ? 1_555 B DG 31  N1 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? A DC 116 N4 ? ? ? 1_555 B DG 31  O6 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? A DC 116 O2 ? ? ? 1_555 B DG 31  N2 ? ? I DC 116 J DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? A DT 117 N3 ? ? ? 1_555 B DA 30  N1 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? A DT 117 O4 ? ? ? 1_555 B DA 30  N6 ? ? I DT 117 J DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? A DT 118 N3 ? ? ? 1_555 B DA 29  N1 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? A DT 118 O4 ? ? ? 1_555 B DA 29  N6 ? ? I DT 118 J DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? A DT 119 N3 ? ? ? 1_555 B DA 28  N1 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? A DT 119 O4 ? ? ? 1_555 B DA 28  N6 ? ? I DT 119 J DA 174 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog235 hydrog ? ? A DT 120 N3 ? ? ? 1_555 B DA 27  N1 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog236 hydrog ? ? A DT 120 O4 ? ? ? 1_555 B DA 27  N6 ? ? I DT 120 J DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog237 hydrog ? ? A DG 122 N1 ? ? ? 1_555 B DC 25  N3 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog238 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 25  O2 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog239 hydrog ? ? A DG 122 O6 ? ? ? 1_555 B DC 25  N4 ? ? I DG 122 J DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog240 hydrog ? ? A DG 122 N2 ? ? ? 1_555 B DC 26  O2 ? ? I DG 122 J DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog241 hydrog ? ? A DT 123 N3 ? ? ? 1_555 B DA 24  N1 ? ? I DT 123 J DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog242 hydrog ? ? A DT 123 O4 ? ? ? 1_555 B DA 24  N6 ? ? I DT 123 J DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog243 hydrog ? ? A DA 124 N1 ? ? ? 1_555 B DT 23  N3 ? ? I DA 124 J DT 169 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog244 hydrog ? ? A DG 125 N1 ? ? ? 1_555 B DC 22  N3 ? ? I DG 125 J DC 168 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? A DG 125 N2 ? ? ? 1_555 B DC 22  O2 ? ? I DG 125 J DC 168 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? A DG 125 O6 ? ? ? 1_555 B DC 22  N4 ? ? I DG 125 J DC 168 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? A DA 126 N6 ? ? ? 1_555 B DT 21  O4 ? ? I DA 126 J DT 167 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog248 hydrog ? ? A DA 127 N1 ? ? ? 1_555 B DT 20  N3 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? A DA 127 N6 ? ? ? 1_555 B DT 20  O4 ? ? I DA 127 J DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? A DT 128 N3 ? ? ? 1_555 B DA 19  N1 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? A DT 128 O4 ? ? ? 1_555 B DA 19  N6 ? ? I DT 128 J DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? A DC 129 N3 ? ? ? 1_555 B DG 18  N1 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? A DC 129 N4 ? ? ? 1_555 B DG 18  O6 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog254 hydrog ? ? A DC 129 O2 ? ? ? 1_555 B DG 18  N2 ? ? I DC 129 J DG 164 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? A DT 130 N3 ? ? ? 1_555 B DA 17  N1 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? A DT 130 O4 ? ? ? 1_555 B DA 17  N6 ? ? I DT 130 J DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? A DG 131 N1 ? ? ? 1_555 B DC 16  N3 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? A DG 131 N2 ? ? ? 1_555 B DC 16  O2 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? A DG 131 O6 ? ? ? 1_555 B DC 16  N4 ? ? I DG 131 J DC 162 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? A DC 132 N3 ? ? ? 1_555 B DG 15  N1 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog261 hydrog ? ? A DC 132 N4 ? ? ? 1_555 B DG 15  O6 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog262 hydrog ? ? A DC 132 O2 ? ? ? 1_555 B DG 15  N2 ? ? I DC 132 J DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? A DA 133 N1 ? ? ? 1_555 B DT 14  N3 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? A DA 133 N6 ? ? ? 1_555 B DT 14  O4 ? ? I DA 133 J DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog265 hydrog ? ? A DG 134 N1 ? ? ? 1_555 B DC 13  N3 ? ? I DG 134 J DC 159 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog266 hydrog ? ? A DG 135 N1 ? ? ? 1_555 B DC 12  N3 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? A DG 135 N2 ? ? ? 1_555 B DC 12  O2 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? A DG 135 O6 ? ? ? 1_555 B DC 12  N4 ? ? I DG 135 J DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog269 hydrog ? ? A DT 136 N3 ? ? ? 1_555 B DA 11  N1 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog270 hydrog ? ? A DT 136 O4 ? ? ? 1_555 B DA 11  N6 ? ? I DT 136 J DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog271 hydrog ? ? A DG 137 N1 ? ? ? 1_555 B DC 10  N3 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? A DG 137 N2 ? ? ? 1_555 B DC 10  O2 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? A DG 137 O6 ? ? ? 1_555 B DC 10  N4 ? ? I DG 137 J DC 156 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog274 hydrog ? ? A DG 138 N1 ? ? ? 1_555 B DC 9   N3 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog275 hydrog ? ? A DG 138 N2 ? ? ? 1_555 B DC 9   O2 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog276 hydrog ? ? A DG 138 O6 ? ? ? 1_555 B DC 9   N4 ? ? I DG 138 J DC 155 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? A DA 139 N1 ? ? ? 1_555 B DT 8   N3 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? A DA 139 N6 ? ? ? 1_555 B DT 8   O4 ? ? I DA 139 J DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? A DT 140 N3 ? ? ? 1_555 B DA 7   N1 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? A DT 140 O4 ? ? ? 1_555 B DA 7   N6 ? ? I DT 140 J DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? A DA 141 N1 ? ? ? 1_555 B DT 6   N3 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog282 hydrog ? ? A DA 141 N6 ? ? ? 1_555 B DT 6   O4 ? ? I DA 141 J DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog283 hydrog ? ? A DT 142 N3 ? ? ? 1_555 B DA 5   N1 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? A DT 142 O4 ? ? ? 1_555 B DA 5   N6 ? ? I DT 142 J DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog285 hydrog ? ? A DT 143 N3 ? ? ? 1_555 B DA 4   N1 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? A DT 143 O4 ? ? ? 1_555 B DA 4   N6 ? ? I DT 143 J DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? A DG 144 N1 ? ? ? 1_555 B DC 3   N3 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? A DG 144 N2 ? ? ? 1_555 B DC 3   O2 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog289 hydrog ? ? A DG 144 O6 ? ? ? 1_555 B DC 3   N4 ? ? I DG 144 J DC 149 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? A DA 145 N1 ? ? ? 1_555 B DT 2   N3 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog291 hydrog ? ? A DA 145 N6 ? ? ? 1_555 B DT 2   O4 ? ? I DA 145 J DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog292 hydrog ? ? A DT 146 N3 ? ? ? 1_555 B DA 1   N1 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog293 hydrog ? ? A DT 146 O4 ? ? ? 1_555 B DA 1   N6 ? ? I DT 146 J DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG C 64 ? PHE C 65  ? ARG A 83  PHE A 84  
A 2 THR D 65 ? VAL D 66  ? THR B 80  VAL B 81  
B 1 THR C 99 ? ILE C 100 ? THR A 118 ILE A 119 
B 2 ARG D 30 ? ILE D 31  ? ARG B 45  ILE B 46  
C 1 LEU D 82 ? TYR D 83  ? LEU B 97  TYR B 98  
C 2 THR I 98 ? ILE I 99  ? THR G 101 ILE G 102 
D 1 ARG E 39 ? VAL E 40  ? ARG C 42  VAL C 43  
D 2 THR F 62 ? ILE F 63  ? THR D 85  ILE D 86  
E 1 ARG E 74 ? ILE E 75  ? ARG C 77  ILE C 78  
E 2 GLY F 27 ? ILE F 28  ? GLY D 50  ILE D 51  
F 1 THR E 98 ? ILE E 99  ? THR C 101 ILE C 102 
F 2 LEU H 82 ? TYR H 83  ? LEU F 97  TYR F 98  
G 1 ARG G 64 ? PHE G 65  ? ARG E 83  PHE E 84  
G 2 THR H 65 ? VAL H 66  ? THR F 80  VAL F 81  
H 1 THR G 99 ? ILE G 100 ? THR E 118 ILE E 119 
H 2 ARG H 30 ? ILE H 31  ? ARG F 45  ILE F 46  
I 1 ARG I 39 ? VAL I 40  ? ARG G 42  VAL G 43  
I 2 THR J 62 ? ILE J 63  ? THR H 85  ILE H 86  
J 1 ARG I 74 ? ILE I 75  ? ARG G 77  ILE G 78  
J 2 GLY J 27 ? ILE J 28  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG C 64  ? O ARG A 83  N VAL D 66 ? N VAL B 81  
B 1 2 N ILE C 100 ? N ILE A 119 O ARG D 30 ? O ARG B 45  
C 1 2 N TYR D 83  ? N TYR B 98  O THR I 98 ? O THR G 101 
D 1 2 O ARG E 39  ? O ARG C 42  N ILE F 63 ? N ILE D 86  
E 1 2 N ILE E 75  ? N ILE C 78  O GLY F 27 ? O GLY D 50  
F 1 2 O THR E 98  ? O THR C 101 N TYR H 83 ? N TYR F 98  
G 1 2 O ARG G 64  ? O ARG E 83  N VAL H 66 ? N VAL F 81  
H 1 2 N ILE G 100 ? N ILE E 119 O ARG H 30 ? O ARG F 45  
I 1 2 O ARG I 39  ? O ARG G 42  N ILE J 63 ? N ILE H 86  
J 1 2 N ILE I 75  ? N ILE G 78  O GLY J 27 ? O GLY H 50  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE MN J 400' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        DT 
_struct_site_gen.label_asym_id        B 
_struct_site_gen.label_seq_id         21 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         DT 
_struct_site_gen.auth_asym_id         J 
_struct_site_gen.auth_seq_id          167 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          1AOI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AOI 
_atom_sites.fract_transf_matrix[1][1]   0.009430 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005501 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009081 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A 1 1   ? 25.537  137.838 26.891  1.00 170.35 ? 1   DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A 1 1   ? 25.358  139.192 27.309  1.00 170.35 ? 1   DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A 1 1   ? 24.106  139.813 26.732  1.00 170.35 ? 1   DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A 1 1   ? 24.251  139.999 25.303  1.00 170.35 ? 1   DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A 1 1   ? 22.837  138.982 26.918  1.00 170.35 ? 1   DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A 1 1   ? 21.723  139.844 27.145  1.00 170.35 ? 1   DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A 1 1   ? 22.671  138.294 25.577  1.00 170.35 ? 1   DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A 1 1   ? 23.178  139.357 24.621  1.00 170.35 ? 1   DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A 1 1   ? 23.690  138.834 23.351  1.00 66.50  ? 1   DA  I N9    1 
ATOM   10    C  C8    . DA  A 1 1   ? 24.833  138.084 23.152  1.00 66.50  ? 1   DA  I C8    1 
ATOM   11    N  N7    . DA  A 1 1   ? 25.045  137.760 21.893  1.00 66.50  ? 1   DA  I N7    1 
ATOM   12    C  C5    . DA  A 1 1   ? 23.973  138.331 21.217  1.00 66.50  ? 1   DA  I C5    1 
ATOM   13    C  C6    . DA  A 1 1   ? 23.622  138.348 19.863  1.00 66.50  ? 1   DA  I C6    1 
ATOM   14    N  N6    . DA  A 1 1   ? 24.335  137.759 18.911  1.00 66.50  ? 1   DA  I N6    1 
ATOM   15    N  N1    . DA  A 1 1   ? 22.498  139.000 19.515  1.00 66.50  ? 1   DA  I N1    1 
ATOM   16    C  C2    . DA  A 1 1   ? 21.776  139.597 20.476  1.00 66.50  ? 1   DA  I C2    1 
ATOM   17    N  N3    . DA  A 1 1   ? 21.999  139.653 21.789  1.00 66.50  ? 1   DA  I N3    1 
ATOM   18    C  C4    . DA  A 1 1   ? 23.128  138.993 22.101  1.00 66.50  ? 1   DA  I C4    1 
ATOM   19    P  P     . DT  A 1 2   ? 20.372  139.246 27.770  1.00 153.90 ? 2   DT  I P     1 
ATOM   20    O  OP1   . DT  A 1 2   ? 19.269  140.187 27.450  1.00 153.90 ? 2   DT  I OP1   1 
ATOM   21    O  OP2   . DT  A 1 2   ? 20.642  138.887 29.184  1.00 153.90 ? 2   DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A 1 2   ? 20.132  137.896 26.960  1.00 143.36 ? 2   DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A 1 2   ? 18.812  137.465 26.669  1.00 143.36 ? 2   DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A 1 2   ? 18.134  138.494 25.799  1.00 143.36 ? 2   DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A 1 2   ? 18.881  138.676 24.575  1.00 143.36 ? 2   DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A 1 2   ? 16.716  138.152 25.378  1.00 143.36 ? 2   DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A 1 2   ? 15.970  139.359 25.318  1.00 143.36 ? 2   DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A 1 2   ? 16.894  137.543 24.000  1.00 143.36 ? 2   DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A 1 2   ? 18.110  138.274 23.447  1.00 143.36 ? 2   DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A 1 2   ? 18.984  137.435 22.594  1.00 111.90 ? 2   DT  I N1    1 
ATOM   31    C  C2    . DT  A 1 2   ? 18.877  137.512 21.215  1.00 111.90 ? 2   DT  I C2    1 
ATOM   32    O  O2    . DT  A 1 2   ? 18.051  138.207 20.637  1.00 111.90 ? 2   DT  I O2    1 
ATOM   33    N  N3    . DT  A 1 2   ? 19.783  136.727 20.535  1.00 111.90 ? 2   DT  I N3    1 
ATOM   34    C  C4    . DT  A 1 2   ? 20.742  135.888 21.077  1.00 111.90 ? 2   DT  I C4    1 
ATOM   35    O  O4    . DT  A 1 2   ? 21.507  135.270 20.340  1.00 111.90 ? 2   DT  I O4    1 
ATOM   36    C  C5    . DT  A 1 2   ? 20.764  135.827 22.514  1.00 111.90 ? 2   DT  I C5    1 
ATOM   37    C  C7    . DT  A 1 2   ? 21.733  134.908 23.184  1.00 111.90 ? 2   DT  I C7    1 
ATOM   38    C  C6    . DT  A 1 2   ? 19.904  136.597 23.192  1.00 111.90 ? 2   DT  I C6    1 
ATOM   39    P  P     . DC  A 1 3   ? 14.379  139.291 25.262  1.00 107.76 ? 3   DC  I P     1 
ATOM   40    O  OP1   . DC  A 1 3   ? 13.828  140.650 25.481  1.00 107.76 ? 3   DC  I OP1   1 
ATOM   41    O  OP2   . DC  A 1 3   ? 13.978  138.173 26.157  1.00 107.76 ? 3   DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A 1 3   ? 14.089  138.888 23.754  1.00 118.45 ? 3   DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A 1 3   ? 12.936  138.141 23.418  1.00 118.45 ? 3   DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A 1 3   ? 12.930  137.834 21.940  1.00 118.45 ? 3   DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A 1 3   ? 14.256  137.451 21.485  1.00 118.45 ? 3   DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A 1 3   ? 12.012  136.668 21.591  1.00 118.45 ? 3   DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A 1 3   ? 11.331  136.941 20.374  1.00 118.45 ? 3   DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A 1 3   ? 12.968  135.505 21.409  1.00 118.45 ? 3   DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A 1 3   ? 14.174  136.202 20.809  1.00 118.45 ? 3   DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A 1 3   ? 15.460  135.479 20.962  1.00 75.97  ? 3   DC  I N1    1 
ATOM   51    C  C2    . DC  A 1 3   ? 16.324  135.391 19.854  1.00 75.97  ? 3   DC  I C2    1 
ATOM   52    O  O2    . DC  A 1 3   ? 15.992  135.941 18.786  1.00 75.97  ? 3   DC  I O2    1 
ATOM   53    N  N3    . DC  A 1 3   ? 17.488  134.707 19.977  1.00 75.97  ? 3   DC  I N3    1 
ATOM   54    C  C4    . DC  A 1 3   ? 17.803  134.126 21.137  1.00 75.97  ? 3   DC  I C4    1 
ATOM   55    N  N4    . DC  A 1 3   ? 18.956  133.459 21.209  1.00 75.97  ? 3   DC  I N4    1 
ATOM   56    C  C5    . DC  A 1 3   ? 16.951  134.203 22.277  1.00 75.97  ? 3   DC  I C5    1 
ATOM   57    C  C6    . DC  A 1 3   ? 15.803  134.887 22.149  1.00 75.97  ? 3   DC  I C6    1 
ATOM   58    P  P     . DA  A 1 4   ? 10.135  135.984 19.919  1.00 160.30 ? 4   DA  I P     1 
ATOM   59    O  OP1   . DA  A 1 4   ? 8.961   136.812 19.543  1.00 160.30 ? 4   DA  I OP1   1 
ATOM   60    O  OP2   . DA  A 1 4   ? 9.995   134.924 20.951  1.00 160.30 ? 4   DA  I OP2   1 
ATOM   61    O  "O5'" . DA  A 1 4   ? 10.695  135.303 18.605  1.00 81.02  ? 4   DA  I "O5'" 1 
ATOM   62    C  "C5'" . DA  A 1 4   ? 11.008  136.087 17.464  1.00 81.02  ? 4   DA  I "C5'" 1 
ATOM   63    C  "C4'" . DA  A 1 4   ? 11.360  135.178 16.314  1.00 81.02  ? 4   DA  I "C4'" 1 
ATOM   64    O  "O4'" . DA  A 1 4   ? 12.608  134.502 16.617  1.00 81.02  ? 4   DA  I "O4'" 1 
ATOM   65    C  "C3'" . DA  A 1 4   ? 10.325  134.082 16.068  1.00 81.02  ? 4   DA  I "C3'" 1 
ATOM   66    O  "O3'" . DA  A 1 4   ? 10.124  133.930 14.655  1.00 81.02  ? 4   DA  I "O3'" 1 
ATOM   67    C  "C2'" . DA  A 1 4   ? 10.911  132.865 16.771  1.00 81.02  ? 4   DA  I "C2'" 1 
ATOM   68    C  "C1'" . DA  A 1 4   ? 12.418  133.096 16.719  1.00 81.02  ? 4   DA  I "C1'" 1 
ATOM   69    N  N9    . DA  A 1 4   ? 13.169  132.630 17.896  1.00 51.15  ? 4   DA  I N9    1 
ATOM   70    C  C8    . DA  A 1 4   ? 12.795  132.662 19.227  1.00 51.15  ? 4   DA  I C8    1 
ATOM   71    N  N7    . DA  A 1 4   ? 13.706  132.185 20.050  1.00 51.15  ? 4   DA  I N7    1 
ATOM   72    C  C5    . DA  A 1 4   ? 14.750  131.810 19.209  1.00 51.15  ? 4   DA  I C5    1 
ATOM   73    C  C6    . DA  A 1 4   ? 16.022  131.230 19.461  1.00 51.15  ? 4   DA  I C6    1 
ATOM   74    N  N6    . DA  A 1 4   ? 16.481  130.921 20.684  1.00 51.15  ? 4   DA  I N6    1 
ATOM   75    N  N1    . DA  A 1 4   ? 16.813  130.977 18.393  1.00 51.15  ? 4   DA  I N1    1 
ATOM   76    C  C2    . DA  A 1 4   ? 16.358  131.279 17.163  1.00 51.15  ? 4   DA  I C2    1 
ATOM   77    N  N3    . DA  A 1 4   ? 15.195  131.822 16.799  1.00 51.15  ? 4   DA  I N3    1 
ATOM   78    C  C4    . DA  A 1 4   ? 14.429  132.070 17.878  1.00 51.15  ? 4   DA  I C4    1 
ATOM   79    P  P     . DA  A 1 5   ? 9.609   132.531 14.056  1.00 87.05  ? 5   DA  I P     1 
ATOM   80    O  OP1   . DA  A 1 5   ? 9.312   132.719 12.606  1.00 87.05  ? 5   DA  I OP1   1 
ATOM   81    O  OP2   . DA  A 1 5   ? 8.566   131.973 14.959  1.00 87.05  ? 5   DA  I OP2   1 
ATOM   82    O  "O5'" . DA  A 1 5   ? 10.915  131.637 14.161  1.00 98.96  ? 5   DA  I "O5'" 1 
ATOM   83    C  "C5'" . DA  A 1 5   ? 12.078  132.005 13.433  1.00 98.96  ? 5   DA  I "C5'" 1 
ATOM   84    C  "C4'" . DA  A 1 5   ? 12.698  130.776 12.830  1.00 98.96  ? 5   DA  I "C4'" 1 
ATOM   85    O  "O4'" . DA  A 1 5   ? 13.515  130.138 13.830  1.00 98.96  ? 5   DA  I "O4'" 1 
ATOM   86    C  "C3'" . DA  A 1 5   ? 11.646  129.755 12.416  1.00 98.96  ? 5   DA  I "C3'" 1 
ATOM   87    O  "O3'" . DA  A 1 5   ? 12.047  129.134 11.192  1.00 98.96  ? 5   DA  I "O3'" 1 
ATOM   88    C  "C2'" . DA  A 1 5   ? 11.567  128.817 13.610  1.00 98.96  ? 5   DA  I "C2'" 1 
ATOM   89    C  "C1'" . DA  A 1 5   ? 12.949  128.909 14.244  1.00 98.96  ? 5   DA  I "C1'" 1 
ATOM   90    N  N9    . DA  A 1 5   ? 12.939  128.919 15.704  1.00 67.55  ? 5   DA  I N9    1 
ATOM   91    C  C8    . DA  A 1 5   ? 12.001  129.467 16.539  1.00 67.55  ? 5   DA  I C8    1 
ATOM   92    N  N7    . DA  A 1 5   ? 12.272  129.310 17.816  1.00 67.55  ? 5   DA  I N7    1 
ATOM   93    C  C5    . DA  A 1 5   ? 13.473  128.613 17.820  1.00 67.55  ? 5   DA  I C5    1 
ATOM   94    C  C6    . DA  A 1 5   ? 14.305  128.132 18.868  1.00 67.55  ? 5   DA  I C6    1 
ATOM   95    N  N6    . DA  A 1 5   ? 14.047  128.275 20.168  1.00 67.55  ? 5   DA  I N6    1 
ATOM   96    N  N1    . DA  A 1 5   ? 15.430  127.486 18.520  1.00 67.55  ? 5   DA  I N1    1 
ATOM   97    C  C2    . DA  A 1 5   ? 15.706  127.331 17.220  1.00 67.55  ? 5   DA  I C2    1 
ATOM   98    N  N3    . DA  A 1 5   ? 15.013  127.731 16.151  1.00 67.55  ? 5   DA  I N3    1 
ATOM   99    C  C4    . DA  A 1 5   ? 13.896  128.371 16.524  1.00 67.55  ? 5   DA  I C4    1 
ATOM   100   P  P     . DT  A 1 6   ? 11.383  127.747 10.728  1.00 83.50  ? 6   DT  I P     1 
ATOM   101   O  OP1   . DT  A 1 6   ? 11.100  127.761 9.264   1.00 83.50  ? 6   DT  I OP1   1 
ATOM   102   O  OP2   . DT  A 1 6   ? 10.304  127.367 11.690  1.00 83.50  ? 6   DT  I OP2   1 
ATOM   103   O  "O5'" . DT  A 1 6   ? 12.580  126.733 10.927  1.00 51.12  ? 6   DT  I "O5'" 1 
ATOM   104   C  "C5'" . DT  A 1 6   ? 12.298  125.377 11.121  1.00 51.12  ? 6   DT  I "C5'" 1 
ATOM   105   C  "C4'" . DT  A 1 6   ? 13.441  124.704 11.824  1.00 51.12  ? 6   DT  I "C4'" 1 
ATOM   106   O  "O4'" . DT  A 1 6   ? 13.678  125.269 13.139  1.00 51.12  ? 6   DT  I "O4'" 1 
ATOM   107   C  "C3'" . DT  A 1 6   ? 13.085  123.244 12.038  1.00 51.12  ? 6   DT  I "C3'" 1 
ATOM   108   O  "O3'" . DT  A 1 6   ? 14.152  122.451 11.602  1.00 51.12  ? 6   DT  I "O3'" 1 
ATOM   109   C  "C2'" . DT  A 1 6   ? 12.874  123.121 13.531  1.00 51.12  ? 6   DT  I "C2'" 1 
ATOM   110   C  "C1'" . DT  A 1 6   ? 13.764  124.211 14.071  1.00 51.12  ? 6   DT  I "C1'" 1 
ATOM   111   N  N1    . DT  A 1 6   ? 13.310  124.691 15.377  1.00 45.37  ? 6   DT  I N1    1 
ATOM   112   C  C2    . DT  A 1 6   ? 14.170  124.552 16.448  1.00 45.37  ? 6   DT  I C2    1 
ATOM   113   O  O2    . DT  A 1 6   ? 15.308  124.125 16.342  1.00 45.37  ? 6   DT  I O2    1 
ATOM   114   N  N3    . DT  A 1 6   ? 13.654  124.944 17.650  1.00 45.37  ? 6   DT  I N3    1 
ATOM   115   C  C4    . DT  A 1 6   ? 12.414  125.476 17.893  1.00 45.37  ? 6   DT  I C4    1 
ATOM   116   O  O4    . DT  A 1 6   ? 12.106  125.793 19.036  1.00 45.37  ? 6   DT  I O4    1 
ATOM   117   C  C5    . DT  A 1 6   ? 11.566  125.618 16.724  1.00 45.37  ? 6   DT  I C5    1 
ATOM   118   C  C7    . DT  A 1 6   ? 10.190  126.179 16.893  1.00 45.37  ? 6   DT  I C7    1 
ATOM   119   C  C6    . DT  A 1 6   ? 12.055  125.230 15.534  1.00 45.37  ? 6   DT  I C6    1 
ATOM   120   P  P     . DA  A 1 7   ? 13.889  120.932 11.248  1.00 74.79  ? 7   DA  I P     1 
ATOM   121   O  OP1   . DA  A 1 7   ? 14.268  120.761 9.825   1.00 74.79  ? 7   DA  I OP1   1 
ATOM   122   O  OP2   . DA  A 1 7   ? 12.521  120.577 11.702  1.00 74.79  ? 7   DA  I OP2   1 
ATOM   123   O  "O5'" . DA  A 1 7   ? 14.950  120.232 12.187  1.00 52.17  ? 7   DA  I "O5'" 1 
ATOM   124   C  "C5'" . DA  A 1 7   ? 16.221  120.840 12.345  1.00 52.17  ? 7   DA  I "C5'" 1 
ATOM   125   C  "C4'" . DA  A 1 7   ? 16.803  120.492 13.688  1.00 52.17  ? 7   DA  I "C4'" 1 
ATOM   126   O  "O4'" . DA  A 1 7   ? 16.096  121.186 14.740  1.00 52.17  ? 7   DA  I "O4'" 1 
ATOM   127   C  "C3'" . DA  A 1 7   ? 16.673  119.009 13.986  1.00 52.17  ? 7   DA  I "C3'" 1 
ATOM   128   O  "O3'" . DA  A 1 7   ? 17.892  118.529 14.549  1.00 52.17  ? 7   DA  I "O3'" 1 
ATOM   129   C  "C2'" . DA  A 1 7   ? 15.503  118.950 14.952  1.00 52.17  ? 7   DA  I "C2'" 1 
ATOM   130   C  "C1'" . DA  A 1 7   ? 15.645  120.260 15.699  1.00 52.17  ? 7   DA  I "C1'" 1 
ATOM   131   N  N9    . DA  A 1 7   ? 14.398  120.769 16.264  1.00 49.10  ? 7   DA  I N9    1 
ATOM   132   C  C8    . DA  A 1 7   ? 13.226  121.025 15.607  1.00 49.10  ? 7   DA  I C8    1 
ATOM   133   N  N7    . DA  A 1 7   ? 12.265  121.456 16.392  1.00 49.10  ? 7   DA  I N7    1 
ATOM   134   C  C5    . DA  A 1 7   ? 12.849  121.493 17.653  1.00 49.10  ? 7   DA  I C5    1 
ATOM   135   C  C6    . DA  A 1 7   ? 12.353  121.853 18.926  1.00 49.10  ? 7   DA  I C6    1 
ATOM   136   N  N6    . DA  A 1 7   ? 11.110  122.277 19.150  1.00 49.10  ? 7   DA  I N6    1 
ATOM   137   N  N1    . DA  A 1 7   ? 13.195  121.760 19.977  1.00 49.10  ? 7   DA  I N1    1 
ATOM   138   C  C2    . DA  A 1 7   ? 14.441  121.340 19.761  1.00 49.10  ? 7   DA  I C2    1 
ATOM   139   N  N3    . DA  A 1 7   ? 15.024  120.980 18.621  1.00 49.10  ? 7   DA  I N3    1 
ATOM   140   C  C4    . DA  A 1 7   ? 14.164  121.077 17.589  1.00 49.10  ? 7   DA  I C4    1 
ATOM   141   P  P     . DT  A 1 8   ? 18.069  116.959 14.813  1.00 86.12  ? 8   DT  I P     1 
ATOM   142   O  OP1   . DT  A 1 8   ? 19.483  116.581 14.578  1.00 86.12  ? 8   DT  I OP1   1 
ATOM   143   O  OP2   . DT  A 1 8   ? 16.993  116.242 14.077  1.00 86.12  ? 8   DT  I OP2   1 
ATOM   144   O  "O5'" . DT  A 1 8   ? 17.791  116.882 16.375  1.00 113.81 ? 8   DT  I "O5'" 1 
ATOM   145   C  "C5'" . DT  A 1 8   ? 18.502  117.743 17.265  1.00 113.81 ? 8   DT  I "C5'" 1 
ATOM   146   C  "C4'" . DT  A 1 8   ? 18.194  117.379 18.696  1.00 113.81 ? 8   DT  I "C4'" 1 
ATOM   147   O  "O4'" . DT  A 1 8   ? 16.965  118.008 19.130  1.00 113.81 ? 8   DT  I "O4'" 1 
ATOM   148   C  "C3'" . DT  A 1 8   ? 18.007  115.876 18.910  1.00 113.81 ? 8   DT  I "C3'" 1 
ATOM   149   O  "O3'" . DT  A 1 8   ? 18.613  115.463 20.139  1.00 113.81 ? 8   DT  I "O3'" 1 
ATOM   150   C  "C2'" . DT  A 1 8   ? 16.498  115.724 18.965  1.00 113.81 ? 8   DT  I "C2'" 1 
ATOM   151   C  "C1'" . DT  A 1 8   ? 16.090  117.019 19.633  1.00 113.81 ? 8   DT  I "C1'" 1 
ATOM   152   N  N1    . DT  A 1 8   ? 14.722  117.444 19.349  1.00 39.29  ? 8   DT  I N1    1 
ATOM   153   C  C2    . DT  A 1 8   ? 13.987  117.959 20.396  1.00 39.29  ? 8   DT  I C2    1 
ATOM   154   O  O2    . DT  A 1 8   ? 14.443  118.105 21.524  1.00 39.29  ? 8   DT  I O2    1 
ATOM   155   N  N3    . DT  A 1 8   ? 12.696  118.307 20.079  1.00 39.29  ? 8   DT  I N3    1 
ATOM   156   C  C4    . DT  A 1 8   ? 12.089  118.215 18.837  1.00 39.29  ? 8   DT  I C4    1 
ATOM   157   O  O4    . DT  A 1 8   ? 10.910  118.574 18.694  1.00 39.29  ? 8   DT  I O4    1 
ATOM   158   C  C5    . DT  A 1 8   ? 12.935  117.680 17.778  1.00 39.29  ? 8   DT  I C5    1 
ATOM   159   C  C7    . DT  A 1 8   ? 12.373  117.552 16.396  1.00 39.29  ? 8   DT  I C7    1 
ATOM   160   C  C6    . DT  A 1 8   ? 14.191  117.324 18.087  1.00 39.29  ? 8   DT  I C6    1 
ATOM   161   P  P     . DC  A 1 9   ? 19.367  114.043 20.220  1.00 106.25 ? 9   DC  I P     1 
ATOM   162   O  OP1   . DC  A 1 9   ? 20.794  114.287 20.554  1.00 106.25 ? 9   DC  I OP1   1 
ATOM   163   O  OP2   . DC  A 1 9   ? 19.014  113.254 19.011  1.00 106.25 ? 9   DC  I OP2   1 
ATOM   164   O  "O5'" . DC  A 1 9   ? 18.681  113.342 21.464  1.00 79.01  ? 9   DC  I "O5'" 1 
ATOM   165   C  "C5'" . DC  A 1 9   ? 17.286  113.478 21.675  1.00 79.01  ? 9   DC  I "C5'" 1 
ATOM   166   C  "C4'" . DC  A 1 9   ? 17.032  114.198 22.977  1.00 79.01  ? 9   DC  I "C4'" 1 
ATOM   167   O  "O4'" . DC  A 1 9   ? 16.057  115.243 22.765  1.00 79.01  ? 9   DC  I "O4'" 1 
ATOM   168   C  "C3'" . DC  A 1 9   ? 16.463  113.299 24.064  1.00 79.01  ? 9   DC  I "C3'" 1 
ATOM   169   O  "O3'" . DC  A 1 9   ? 17.019  113.654 25.331  1.00 79.01  ? 9   DC  I "O3'" 1 
ATOM   170   C  "C2'" . DC  A 1 9   ? 14.962  113.520 23.966  1.00 79.01  ? 9   DC  I "C2'" 1 
ATOM   171   C  "C1'" . DC  A 1 9   ? 14.808  114.903 23.339  1.00 79.01  ? 9   DC  I "C1'" 1 
ATOM   172   N  N1    . DC  A 1 9   ? 13.819  114.932 22.252  1.00 51.82  ? 9   DC  I N1    1 
ATOM   173   C  C2    . DC  A 1 9   ? 12.506  115.293 22.536  1.00 51.82  ? 9   DC  I C2    1 
ATOM   174   O  O2    . DC  A 1 9   ? 12.212  115.609 23.702  1.00 51.82  ? 9   DC  I O2    1 
ATOM   175   N  N3    . DC  A 1 9   ? 11.586  115.294 21.536  1.00 51.82  ? 9   DC  I N3    1 
ATOM   176   C  C4    . DC  A 1 9   ? 11.951  114.957 20.294  1.00 51.82  ? 9   DC  I C4    1 
ATOM   177   N  N4    . DC  A 1 9   ? 11.014  114.969 19.327  1.00 51.82  ? 9   DC  I N4    1 
ATOM   178   C  C5    . DC  A 1 9   ? 13.291  114.595 19.980  1.00 51.82  ? 9   DC  I C5    1 
ATOM   179   C  C6    . DC  A 1 9   ? 14.181  114.600 20.978  1.00 51.82  ? 9   DC  I C6    1 
ATOM   180   P  P     . DC  A 1 10  ? 17.479  112.498 26.348  1.00 106.94 ? 10  DC  I P     1 
ATOM   181   O  OP1   . DC  A 1 10  ? 18.638  112.983 27.145  1.00 106.94 ? 10  DC  I OP1   1 
ATOM   182   O  OP2   . DC  A 1 10  ? 17.596  111.231 25.571  1.00 106.94 ? 10  DC  I OP2   1 
ATOM   183   O  "O5'" . DC  A 1 10  ? 16.231  112.375 27.320  1.00 121.81 ? 10  DC  I "O5'" 1 
ATOM   184   C  "C5'" . DC  A 1 10  ? 15.124  113.264 27.187  1.00 121.81 ? 10  DC  I "C5'" 1 
ATOM   185   C  "C4'" . DC  A 1 10  ? 13.852  112.568 27.603  1.00 121.81 ? 10  DC  I "C4'" 1 
ATOM   186   O  "O4'" . DC  A 1 10  ? 12.791  112.874 26.663  1.00 121.81 ? 10  DC  I "O4'" 1 
ATOM   187   C  "C3'" . DC  A 1 10  ? 13.959  111.041 27.646  1.00 121.81 ? 10  DC  I "C3'" 1 
ATOM   188   O  "O3'" . DC  A 1 10  ? 13.202  110.551 28.757  1.00 121.81 ? 10  DC  I "O3'" 1 
ATOM   189   C  "C2'" . DC  A 1 10  ? 13.313  110.618 26.340  1.00 121.81 ? 10  DC  I "C2'" 1 
ATOM   190   C  "C1'" . DC  A 1 10  ? 12.227  111.666 26.184  1.00 121.81 ? 10  DC  I "C1'" 1 
ATOM   191   N  N1    . DC  A 1 10  ? 11.794  111.878 24.797  1.00 76.30  ? 10  DC  I N1    1 
ATOM   192   C  C2    . DC  A 1 10  ? 10.484  112.317 24.549  1.00 76.30  ? 10  DC  I C2    1 
ATOM   193   O  O2    . DC  A 1 10  ? 9.740   112.574 25.510  1.00 76.30  ? 10  DC  I O2    1 
ATOM   194   N  N3    . DC  A 1 10  ? 10.065  112.458 23.267  1.00 76.30  ? 10  DC  I N3    1 
ATOM   195   C  C4    . DC  A 1 10  ? 10.905  112.199 22.259  1.00 76.30  ? 10  DC  I C4    1 
ATOM   196   N  N4    . DC  A 1 10  ? 10.451  112.339 21.009  1.00 76.30  ? 10  DC  I N4    1 
ATOM   197   C  C5    . DC  A 1 10  ? 12.249  111.782 22.487  1.00 76.30  ? 10  DC  I C5    1 
ATOM   198   C  C6    . DC  A 1 10  ? 12.647  111.635 23.759  1.00 76.30  ? 10  DC  I C6    1 
ATOM   199   P  P     . DA  A 1 11  ? 13.541  109.119 29.408  1.00 115.40 ? 11  DA  I P     1 
ATOM   200   O  OP1   . DA  A 1 11  ? 14.519  109.334 30.509  1.00 115.40 ? 11  DA  I OP1   1 
ATOM   201   O  OP2   . DA  A 1 11  ? 13.866  108.156 28.322  1.00 115.40 ? 11  DA  I OP2   1 
ATOM   202   O  "O5'" . DA  A 1 11  ? 12.134  108.719 30.046  1.00 77.48  ? 11  DA  I "O5'" 1 
ATOM   203   C  "C5'" . DA  A 1 11  ? 11.439  109.648 30.876  1.00 77.48  ? 11  DA  I "C5'" 1 
ATOM   204   C  "C4'" . DA  A 1 11  ? 9.959   109.658 30.564  1.00 77.48  ? 11  DA  I "C4'" 1 
ATOM   205   O  "O4'" . DA  A 1 11  ? 9.708   110.198 29.243  1.00 77.48  ? 11  DA  I "O4'" 1 
ATOM   206   C  "C3'" . DA  A 1 11  ? 9.225   108.311 30.619  1.00 77.48  ? 11  DA  I "C3'" 1 
ATOM   207   O  "O3'" . DA  A 1 11  ? 7.947   108.503 31.257  1.00 77.48  ? 11  DA  I "O3'" 1 
ATOM   208   C  "C2'" . DA  A 1 11  ? 9.011   107.983 29.154  1.00 77.48  ? 11  DA  I "C2'" 1 
ATOM   209   C  "C1'" . DA  A 1 11  ? 8.757   109.367 28.595  1.00 77.48  ? 11  DA  I "C1'" 1 
ATOM   210   N  N9    . DA  A 1 11  ? 8.933   109.483 27.147  1.00 78.90  ? 11  DA  I N9    1 
ATOM   211   C  C8    . DA  A 1 11  ? 10.079  109.297 26.409  1.00 78.90  ? 11  DA  I C8    1 
ATOM   212   N  N7    . DA  A 1 11  ? 9.909   109.455 25.117  1.00 78.90  ? 11  DA  I N7    1 
ATOM   213   C  C5    . DA  A 1 11  ? 8.562   109.769 24.993  1.00 78.90  ? 11  DA  I C5    1 
ATOM   214   C  C6    . DA  A 1 11  ? 7.758   110.054 23.874  1.00 78.90  ? 11  DA  I C6    1 
ATOM   215   N  N6    . DA  A 1 11  ? 8.217   110.064 22.624  1.00 78.90  ? 11  DA  I N6    1 
ATOM   216   N  N1    . DA  A 1 11  ? 6.453   110.333 24.089  1.00 78.90  ? 11  DA  I N1    1 
ATOM   217   C  C2    . DA  A 1 11  ? 5.999   110.325 25.350  1.00 78.90  ? 11  DA  I C2    1 
ATOM   218   N  N3    . DA  A 1 11  ? 6.655   110.070 26.486  1.00 78.90  ? 11  DA  I N3    1 
ATOM   219   C  C4    . DA  A 1 11  ? 7.948   109.796 26.235  1.00 78.90  ? 11  DA  I C4    1 
ATOM   220   P  P     . DC  A 1 12  ? 6.964   107.249 31.520  1.00 121.14 ? 12  DC  I P     1 
ATOM   221   O  OP1   . DC  A 1 12  ? 6.367   107.434 32.865  1.00 121.14 ? 12  DC  I OP1   1 
ATOM   222   O  OP2   . DC  A 1 12  ? 7.724   106.007 31.224  1.00 121.14 ? 12  DC  I OP2   1 
ATOM   223   O  "O5'" . DC  A 1 12  ? 5.801   107.415 30.430  1.00 119.74 ? 12  DC  I "O5'" 1 
ATOM   224   C  "C5'" . DC  A 1 12  ? 4.968   108.587 30.391  1.00 119.74 ? 12  DC  I "C5'" 1 
ATOM   225   C  "C4'" . DC  A 1 12  ? 3.790   108.372 29.464  1.00 119.74 ? 12  DC  I "C4'" 1 
ATOM   226   O  "O4'" . DC  A 1 12  ? 4.219   108.494 28.081  1.00 119.74 ? 12  DC  I "O4'" 1 
ATOM   227   C  "C3'" . DC  A 1 12  ? 3.131   106.992 29.571  1.00 119.74 ? 12  DC  I "C3'" 1 
ATOM   228   O  "O3'" . DC  A 1 12  ? 1.714   107.081 29.357  1.00 119.74 ? 12  DC  I "O3'" 1 
ATOM   229   C  "C2'" . DC  A 1 12  ? 3.748   106.229 28.417  1.00 119.74 ? 12  DC  I "C2'" 1 
ATOM   230   C  "C1'" . DC  A 1 12  ? 3.849   107.316 27.369  1.00 119.74 ? 12  DC  I "C1'" 1 
ATOM   231   N  N1    . DC  A 1 12  ? 4.860   107.046 26.328  1.00 64.88  ? 12  DC  I N1    1 
ATOM   232   C  C2    . DC  A 1 12  ? 4.544   107.322 24.985  1.00 64.88  ? 12  DC  I C2    1 
ATOM   233   O  O2    . DC  A 1 12  ? 3.423   107.801 24.716  1.00 64.88  ? 12  DC  I O2    1 
ATOM   234   N  N3    . DC  A 1 12  ? 5.466   107.056 24.017  1.00 64.88  ? 12  DC  I N3    1 
ATOM   235   C  C4    . DC  A 1 12  ? 6.655   106.538 24.348  1.00 64.88  ? 12  DC  I C4    1 
ATOM   236   N  N4    . DC  A 1 12  ? 7.527   106.286 23.366  1.00 64.88  ? 12  DC  I N4    1 
ATOM   237   C  C5    . DC  A 1 12  ? 7.001   106.254 25.705  1.00 64.88  ? 12  DC  I C5    1 
ATOM   238   C  C6    . DC  A 1 12  ? 6.084   106.522 26.653  1.00 64.88  ? 12  DC  I C6    1 
ATOM   239   P  P     . DC  A 1 13  ? 0.814   105.740 29.365  1.00 104.25 ? 13  DC  I P     1 
ATOM   240   O  OP1   . DC  A 1 13  ? -0.177  105.851 30.464  1.00 104.25 ? 13  DC  I OP1   1 
ATOM   241   O  OP2   . DC  A 1 13  ? 1.729   104.573 29.329  1.00 104.25 ? 13  DC  I OP2   1 
ATOM   242   O  "O5'" . DC  A 1 13  ? 0.016   105.787 27.984  1.00 111.59 ? 13  DC  I "O5'" 1 
ATOM   243   C  "C5'" . DC  A 1 13  ? 0.679   106.078 26.757  1.00 111.59 ? 13  DC  I "C5'" 1 
ATOM   244   C  "C4'" . DC  A 1 13  ? -0.001  105.370 25.607  1.00 111.59 ? 13  DC  I "C4'" 1 
ATOM   245   O  "O4'" . DC  A 1 13  ? 0.961   105.230 24.532  1.00 111.59 ? 13  DC  I "O4'" 1 
ATOM   246   C  "C3'" . DC  A 1 13  ? -0.482  103.951 25.927  1.00 111.59 ? 13  DC  I "C3'" 1 
ATOM   247   O  "O3'" . DC  A 1 13  ? -1.689  103.625 25.212  1.00 111.59 ? 13  DC  I "O3'" 1 
ATOM   248   C  "C2'" . DC  A 1 13  ? 0.669   103.084 25.461  1.00 111.59 ? 13  DC  I "C2'" 1 
ATOM   249   C  "C1'" . DC  A 1 13  ? 1.222   103.856 24.274  1.00 111.59 ? 13  DC  I "C1'" 1 
ATOM   250   N  N1    . DC  A 1 13  ? 2.676   103.686 24.123  1.00 54.47  ? 13  DC  I N1    1 
ATOM   251   C  C2    . DC  A 1 13  ? 3.256   103.833 22.853  1.00 54.47  ? 13  DC  I C2    1 
ATOM   252   O  O2    . DC  A 1 13  ? 2.529   104.135 21.889  1.00 54.47  ? 13  DC  I O2    1 
ATOM   253   N  N3    . DC  A 1 13  ? 4.596   103.644 22.713  1.00 54.47  ? 13  DC  I N3    1 
ATOM   254   C  C4    . DC  A 1 13  ? 5.343   103.327 23.779  1.00 54.47  ? 13  DC  I C4    1 
ATOM   255   N  N4    . DC  A 1 13  ? 6.655   103.140 23.597  1.00 54.47  ? 13  DC  I N4    1 
ATOM   256   C  C5    . DC  A 1 13  ? 4.778   103.187 25.078  1.00 54.47  ? 13  DC  I C5    1 
ATOM   257   C  C6    . DC  A 1 13  ? 3.454   103.375 25.204  1.00 54.47  ? 13  DC  I C6    1 
ATOM   258   P  P     . DT  A 1 14  ? -2.344  102.153 25.363  1.00 125.22 ? 14  DT  I P     1 
ATOM   259   O  OP1   . DT  A 1 14  ? -3.808  102.262 25.143  1.00 125.22 ? 14  DT  I OP1   1 
ATOM   260   O  OP2   . DT  A 1 14  ? -1.833  101.511 26.605  1.00 125.22 ? 14  DT  I OP2   1 
ATOM   261   O  "O5'" . DT  A 1 14  ? -1.753  101.346 24.130  1.00 124.34 ? 14  DT  I "O5'" 1 
ATOM   262   C  "C5'" . DT  A 1 14  ? -2.111  101.693 22.799  1.00 124.34 ? 14  DT  I "C5'" 1 
ATOM   263   C  "C4'" . DT  A 1 14  ? -1.647  100.615 21.851  1.00 124.34 ? 14  DT  I "C4'" 1 
ATOM   264   O  "O4'" . DT  A 1 14  ? -0.201  100.585 21.823  1.00 124.34 ? 14  DT  I "O4'" 1 
ATOM   265   C  "C3'" . DT  A 1 14  ? -2.085  99.207  22.256  1.00 124.34 ? 14  DT  I "C3'" 1 
ATOM   266   O  "O3'" . DT  A 1 14  ? -2.267  98.432  21.071  1.00 124.34 ? 14  DT  I "O3'" 1 
ATOM   267   C  "C2'" . DT  A 1 14  ? -0.875  98.680  23.002  1.00 124.34 ? 14  DT  I "C2'" 1 
ATOM   268   C  "C1'" . DT  A 1 14  ? 0.239   99.280  22.165  1.00 124.34 ? 14  DT  I "C1'" 1 
ATOM   269   N  N1    . DT  A 1 14  ? 1.549   99.397  22.826  1.00 91.68  ? 14  DT  I N1    1 
ATOM   270   C  C2    . DT  A 1 14  ? 2.660   99.581  22.028  1.00 91.68  ? 14  DT  I C2    1 
ATOM   271   O  O2    . DT  A 1 14  ? 2.610   99.666  20.807  1.00 91.68  ? 14  DT  I O2    1 
ATOM   272   N  N3    . DT  A 1 14  ? 3.840   99.664  22.713  1.00 91.68  ? 14  DT  I N3    1 
ATOM   273   C  C4    . DT  A 1 14  ? 4.021   99.595  24.083  1.00 91.68  ? 14  DT  I C4    1 
ATOM   274   O  O4    . DT  A 1 14  ? 5.147   99.693  24.558  1.00 91.68  ? 14  DT  I O4    1 
ATOM   275   C  C5    . DT  A 1 14  ? 2.813   99.408  24.856  1.00 91.68  ? 14  DT  I C5    1 
ATOM   276   C  C7    . DT  A 1 14  ? 2.903   99.325  26.346  1.00 91.68  ? 14  DT  I C7    1 
ATOM   277   C  C6    . DT  A 1 14  ? 1.654   99.318  24.196  1.00 91.68  ? 14  DT  I C6    1 
ATOM   278   P  P     . DG  A 1 15  ? -3.569  98.662  20.165  1.00 141.01 ? 15  DG  I P     1 
ATOM   279   O  OP1   . DG  A 1 15  ? -3.788  100.123 20.002  1.00 141.01 ? 15  DG  I OP1   1 
ATOM   280   O  OP2   . DG  A 1 15  ? -4.639  97.809  20.745  1.00 141.01 ? 15  DG  I OP2   1 
ATOM   281   O  "O5'" . DG  A 1 15  ? -3.156  98.075  18.745  1.00 150.37 ? 15  DG  I "O5'" 1 
ATOM   282   C  "C5'" . DG  A 1 15  ? -2.439  98.869  17.800  1.00 150.37 ? 15  DG  I "C5'" 1 
ATOM   283   C  "C4'" . DG  A 1 15  ? -1.445  98.011  17.052  1.00 150.37 ? 15  DG  I "C4'" 1 
ATOM   284   O  "O4'" . DG  A 1 15  ? -0.303  97.721  17.897  1.00 150.37 ? 15  DG  I "O4'" 1 
ATOM   285   C  "C3'" . DG  A 1 15  ? -1.998  96.657  16.610  1.00 150.37 ? 15  DG  I "C3'" 1 
ATOM   286   O  "O3'" . DG  A 1 15  ? -1.475  96.314  15.327  1.00 150.37 ? 15  DG  I "O3'" 1 
ATOM   287   C  "C2'" . DG  A 1 15  ? -1.489  95.705  17.680  1.00 150.37 ? 15  DG  I "C2'" 1 
ATOM   288   C  "C1'" . DG  A 1 15  ? -0.143  96.313  18.041  1.00 150.37 ? 15  DG  I "C1'" 1 
ATOM   289   N  N9    . DG  A 1 15  ? 0.325   96.053  19.402  1.00 92.86  ? 15  DG  I N9    1 
ATOM   290   C  C8    . DG  A 1 15  ? -0.424  95.682  20.498  1.00 92.86  ? 15  DG  I C8    1 
ATOM   291   N  N7    . DG  A 1 15  ? 0.285   95.578  21.591  1.00 92.86  ? 15  DG  I N7    1 
ATOM   292   C  C5    . DG  A 1 15  ? 1.578   95.895  21.191  1.00 92.86  ? 15  DG  I C5    1 
ATOM   293   C  C6    . DG  A 1 15  ? 2.782   95.989  21.943  1.00 92.86  ? 15  DG  I C6    1 
ATOM   294   O  O6    . DG  A 1 15  ? 2.949   95.842  23.163  1.00 92.86  ? 15  DG  I O6    1 
ATOM   295   N  N1    . DG  A 1 15  ? 3.866   96.313  21.133  1.00 92.86  ? 15  DG  I N1    1 
ATOM   296   C  C2    . DG  A 1 15  ? 3.800   96.534  19.780  1.00 92.86  ? 15  DG  I C2    1 
ATOM   297   N  N2    . DG  A 1 15  ? 4.957   96.799  19.162  1.00 92.86  ? 15  DG  I N2    1 
ATOM   298   N  N3    . DG  A 1 15  ? 2.685   96.490  19.078  1.00 92.86  ? 15  DG  I N3    1 
ATOM   299   C  C4    . DG  A 1 15  ? 1.621   96.164  19.839  1.00 92.86  ? 15  DG  I C4    1 
ATOM   300   P  P     . DC  A 1 16  ? -1.837  94.895  14.667  1.00 126.38 ? 16  DC  I P     1 
ATOM   301   O  OP1   . DC  A 1 16  ? -2.490  95.151  13.359  1.00 126.38 ? 16  DC  I OP1   1 
ATOM   302   O  OP2   . DC  A 1 16  ? -2.521  94.042  15.680  1.00 126.38 ? 16  DC  I OP2   1 
ATOM   303   O  "O5'" . DC  A 1 16  ? -0.406  94.265  14.377  1.00 137.65 ? 16  DC  I "O5'" 1 
ATOM   304   C  "C5'" . DC  A 1 16  ? 0.746   95.101  14.296  1.00 137.65 ? 16  DC  I "C5'" 1 
ATOM   305   C  "C4'" . DC  A 1 16  ? 1.968   94.281  13.962  1.00 137.65 ? 16  DC  I "C4'" 1 
ATOM   306   O  "O4'" . DC  A 1 16  ? 2.794   94.142  15.141  1.00 137.65 ? 16  DC  I "O4'" 1 
ATOM   307   C  "C3'" . DC  A 1 16  ? 1.681   92.864  13.475  1.00 137.65 ? 16  DC  I "C3'" 1 
ATOM   308   O  "O3'" . DC  A 1 16  ? 2.576   92.569  12.396  1.00 137.65 ? 16  DC  I "O3'" 1 
ATOM   309   C  "C2'" . DC  A 1 16  ? 1.866   92.009  14.719  1.00 137.65 ? 16  DC  I "C2'" 1 
ATOM   310   C  "C1'" . DC  A 1 16  ? 2.875   92.783  15.552  1.00 137.65 ? 16  DC  I "C1'" 1 
ATOM   311   N  N1    . DC  A 1 16  ? 2.614   92.747  17.003  1.00 78.10  ? 16  DC  I N1    1 
ATOM   312   C  C2    . DC  A 1 16  ? 3.575   93.276  17.865  1.00 78.10  ? 16  DC  I C2    1 
ATOM   313   O  O2    . DC  A 1 16  ? 4.611   93.760  17.378  1.00 78.10  ? 16  DC  I O2    1 
ATOM   314   N  N3    . DC  A 1 16  ? 3.354   93.256  19.207  1.00 78.10  ? 16  DC  I N3    1 
ATOM   315   C  C4    . DC  A 1 16  ? 2.218   92.742  19.689  1.00 78.10  ? 16  DC  I C4    1 
ATOM   316   N  N4    . DC  A 1 16  ? 2.035   92.756  21.014  1.00 78.10  ? 16  DC  I N4    1 
ATOM   317   C  C5    . DC  A 1 16  ? 1.220   92.194  18.830  1.00 78.10  ? 16  DC  I C5    1 
ATOM   318   C  C6    . DC  A 1 16  ? 1.459   92.214  17.506  1.00 78.10  ? 16  DC  I C6    1 
ATOM   319   P  P     . DA  A 1 17  ? 3.113   91.076  12.163  1.00 99.08  ? 17  DA  I P     1 
ATOM   320   O  OP1   . DA  A 1 17  ? 3.084   90.769  10.712  1.00 99.08  ? 17  DA  I OP1   1 
ATOM   321   O  OP2   . DA  A 1 17  ? 2.490   90.135  13.130  1.00 99.08  ? 17  DA  I OP2   1 
ATOM   322   O  "O5'" . DA  A 1 17  ? 4.639   91.204  12.561  1.00 122.04 ? 17  DA  I "O5'" 1 
ATOM   323   C  "C5'" . DA  A 1 17  ? 5.341   92.430  12.396  1.00 122.04 ? 17  DA  I "C5'" 1 
ATOM   324   C  "C4'" . DA  A 1 17  ? 6.693   92.290  13.041  1.00 122.04 ? 17  DA  I "C4'" 1 
ATOM   325   O  "O4'" . DA  A 1 17  ? 6.451   91.923  14.419  1.00 122.04 ? 17  DA  I "O4'" 1 
ATOM   326   C  "C3'" . DA  A 1 17  ? 7.467   91.120  12.445  1.00 122.04 ? 17  DA  I "C3'" 1 
ATOM   327   O  "O3'" . DA  A 1 17  ? 8.868   91.320  12.611  1.00 122.04 ? 17  DA  I "O3'" 1 
ATOM   328   C  "C2'" . DA  A 1 17  ? 6.984   89.934  13.258  1.00 122.04 ? 17  DA  I "C2'" 1 
ATOM   329   C  "C1'" . DA  A 1 17  ? 6.751   90.546  14.628  1.00 122.04 ? 17  DA  I "C1'" 1 
ATOM   330   N  N9    . DA  A 1 17  ? 5.629   89.962  15.358  1.00 88.59  ? 17  DA  I N9    1 
ATOM   331   C  C8    . DA  A 1 17  ? 4.535   89.291  14.865  1.00 88.59  ? 17  DA  I C8    1 
ATOM   332   N  N7    . DA  A 1 17  ? 3.684   88.921  15.791  1.00 88.59  ? 17  DA  I N7    1 
ATOM   333   C  C5    . DA  A 1 17  ? 4.263   89.370  16.972  1.00 88.59  ? 17  DA  I C5    1 
ATOM   334   C  C6    . DA  A 1 17  ? 3.855   89.298  18.313  1.00 88.59  ? 17  DA  I C6    1 
ATOM   335   N  N6    . DA  A 1 17  ? 2.713   88.748  18.705  1.00 88.59  ? 17  DA  I N6    1 
ATOM   336   N  N1    . DA  A 1 17  ? 4.667   89.830  19.248  1.00 88.59  ? 17  DA  I N1    1 
ATOM   337   C  C2    . DA  A 1 17  ? 5.803   90.411  18.851  1.00 88.59  ? 17  DA  I C2    1 
ATOM   338   N  N3    . DA  A 1 17  ? 6.290   90.555  17.623  1.00 88.59  ? 17  DA  I N3    1 
ATOM   339   C  C4    . DA  A 1 17  ? 5.463   90.004  16.719  1.00 88.59  ? 17  DA  I C4    1 
ATOM   340   P  P     . DG  A 1 18  ? 9.888   90.166  12.173  1.00 81.03  ? 18  DG  I P     1 
ATOM   341   O  OP1   . DG  A 1 18  ? 11.066  90.842  11.585  1.00 81.03  ? 18  DG  I OP1   1 
ATOM   342   O  OP2   . DG  A 1 18  ? 9.142   89.158  11.372  1.00 81.03  ? 18  DG  I OP2   1 
ATOM   343   O  "O5'" . DG  A 1 18  ? 10.288  89.457  13.540  1.00 78.56  ? 18  DG  I "O5'" 1 
ATOM   344   C  "C5'" . DG  A 1 18  ? 10.697  90.206  14.667  1.00 78.56  ? 18  DG  I "C5'" 1 
ATOM   345   C  "C4'" . DG  A 1 18  ? 10.813  89.303  15.872  1.00 78.56  ? 18  DG  I "C4'" 1 
ATOM   346   O  "O4'" . DG  A 1 18  ? 9.508   88.917  16.371  1.00 78.56  ? 18  DG  I "O4'" 1 
ATOM   347   C  "C3'" . DG  A 1 18  ? 11.583  87.996  15.654  1.00 78.56  ? 18  DG  I "C3'" 1 
ATOM   348   O  "O3'" . DG  A 1 18  ? 12.331  87.704  16.842  1.00 78.56  ? 18  DG  I "O3'" 1 
ATOM   349   C  "C2'" . DG  A 1 18  ? 10.469  86.968  15.540  1.00 78.56  ? 18  DG  I "C2'" 1 
ATOM   350   C  "C1'" . DG  A 1 18  ? 9.516   87.516  16.580  1.00 78.56  ? 18  DG  I "C1'" 1 
ATOM   351   N  N9    . DG  A 1 18  ? 8.140   87.029  16.563  1.00 76.83  ? 18  DG  I N9    1 
ATOM   352   C  C8    . DG  A 1 18  ? 7.433   86.494  15.512  1.00 76.83  ? 18  DG  I C8    1 
ATOM   353   N  N7    . DG  A 1 18  ? 6.227   86.121  15.848  1.00 76.83  ? 18  DG  I N7    1 
ATOM   354   C  C5    . DG  A 1 18  ? 6.136   86.437  17.198  1.00 76.83  ? 18  DG  I C5    1 
ATOM   355   C  C6    . DG  A 1 18  ? 5.069   86.260  18.121  1.00 76.83  ? 18  DG  I C6    1 
ATOM   356   O  O6    . DG  A 1 18  ? 3.950   85.759  17.927  1.00 76.83  ? 18  DG  I O6    1 
ATOM   357   N  N1    . DG  A 1 18  ? 5.410   86.733  19.386  1.00 76.83  ? 18  DG  I N1    1 
ATOM   358   C  C2    . DG  A 1 18  ? 6.615   87.302  19.722  1.00 76.83  ? 18  DG  I C2    1 
ATOM   359   N  N2    . DG  A 1 18  ? 6.738   87.716  20.989  1.00 76.83  ? 18  DG  I N2    1 
ATOM   360   N  N3    . DG  A 1 18  ? 7.614   87.457  18.880  1.00 76.83  ? 18  DG  I N3    1 
ATOM   361   C  C4    . DG  A 1 18  ? 7.306   87.008  17.645  1.00 76.83  ? 18  DG  I C4    1 
ATOM   362   P  P     . DA  A 1 19  ? 13.927  87.540  16.780  1.00 58.59  ? 19  DA  I P     1 
ATOM   363   O  OP1   . DA  A 1 19  ? 14.588  88.759  16.222  1.00 58.59  ? 19  DA  I OP1   1 
ATOM   364   O  OP2   . DA  A 1 19  ? 14.200  86.205  16.169  1.00 58.59  ? 19  DA  I OP2   1 
ATOM   365   O  "O5'" . DA  A 1 19  ? 14.297  87.474  18.320  1.00 68.39  ? 19  DA  I "O5'" 1 
ATOM   366   C  "C5'" . DA  A 1 19  ? 14.018  86.309  19.075  1.00 68.39  ? 19  DA  I "C5'" 1 
ATOM   367   C  "C4'" . DA  A 1 19  ? 13.206  86.660  20.297  1.00 68.39  ? 19  DA  I "C4'" 1 
ATOM   368   O  "O4'" . DA  A 1 19  ? 11.799  86.633  19.949  1.00 68.39  ? 19  DA  I "O4'" 1 
ATOM   369   C  "C3'" . DA  A 1 19  ? 13.398  85.616  21.391  1.00 68.39  ? 19  DA  I "C3'" 1 
ATOM   370   O  "O3'" . DA  A 1 19  ? 13.546  86.218  22.672  1.00 68.39  ? 19  DA  I "O3'" 1 
ATOM   371   C  "C2'" . DA  A 1 19  ? 12.183  84.717  21.275  1.00 68.39  ? 19  DA  I "C2'" 1 
ATOM   372   C  "C1'" . DA  A 1 19  ? 11.118  85.608  20.663  1.00 68.39  ? 19  DA  I "C1'" 1 
ATOM   373   N  N9    . DA  A 1 19  ? 10.253  84.889  19.723  1.00 77.32  ? 19  DA  I N9    1 
ATOM   374   C  C8    . DA  A 1 19  ? 10.555  84.463  18.455  1.00 77.32  ? 19  DA  I C8    1 
ATOM   375   N  N7    . DA  A 1 19  ? 9.565   83.847  17.852  1.00 77.32  ? 19  DA  I N7    1 
ATOM   376   C  C5    . DA  A 1 19  ? 8.539   83.865  18.790  1.00 77.32  ? 19  DA  I C5    1 
ATOM   377   C  C6    . DA  A 1 19  ? 7.205   83.374  18.766  1.00 77.32  ? 19  DA  I C6    1 
ATOM   378   N  N6    . DA  A 1 19  ? 6.652   82.751  17.722  1.00 77.32  ? 19  DA  I N6    1 
ATOM   379   N  N1    . DA  A 1 19  ? 6.451   83.555  19.871  1.00 77.32  ? 19  DA  I N1    1 
ATOM   380   C  C2    . DA  A 1 19  ? 6.994   84.188  20.917  1.00 77.32  ? 19  DA  I C2    1 
ATOM   381   N  N3    . DA  A 1 19  ? 8.219   84.696  21.058  1.00 77.32  ? 19  DA  I N3    1 
ATOM   382   C  C4    . DA  A 1 19  ? 8.951   84.499  19.948  1.00 77.32  ? 19  DA  I C4    1 
ATOM   383   P  P     . DT  A 1 20  ? 14.460  85.492  23.778  1.00 105.51 ? 20  DT  I P     1 
ATOM   384   O  OP1   . DT  A 1 20  ? 14.871  86.502  24.789  1.00 105.51 ? 20  DT  I OP1   1 
ATOM   385   O  OP2   . DT  A 1 20  ? 15.501  84.729  23.049  1.00 105.51 ? 20  DT  I OP2   1 
ATOM   386   O  "O5'" . DT  A 1 20  ? 13.447  84.464  24.452  1.00 114.59 ? 20  DT  I "O5'" 1 
ATOM   387   C  "C5'" . DT  A 1 20  ? 12.263  84.947  25.080  1.00 114.59 ? 20  DT  I "C5'" 1 
ATOM   388   C  "C4'" . DT  A 1 20  ? 11.269  83.832  25.314  1.00 114.59 ? 20  DT  I "C4'" 1 
ATOM   389   O  "O4'" . DT  A 1 20  ? 10.515  83.500  24.118  1.00 114.59 ? 20  DT  I "O4'" 1 
ATOM   390   C  "C3'" . DT  A 1 20  ? 11.805  82.511  25.878  1.00 114.59 ? 20  DT  I "C3'" 1 
ATOM   391   O  "O3'" . DT  A 1 20  ? 11.043  82.163  27.051  1.00 114.59 ? 20  DT  I "O3'" 1 
ATOM   392   C  "C2'" . DT  A 1 20  ? 11.567  81.524  24.742  1.00 114.59 ? 20  DT  I "C2'" 1 
ATOM   393   C  "C1'" . DT  A 1 20  ? 10.316  82.098  24.103  1.00 114.59 ? 20  DT  I "C1'" 1 
ATOM   394   N  N1    . DT  A 1 20  ? 10.002  81.663  22.715  1.00 90.06  ? 20  DT  I N1    1 
ATOM   395   C  C2    . DT  A 1 20  ? 8.671   81.422  22.414  1.00 90.06  ? 20  DT  I C2    1 
ATOM   396   O  O2    . DT  A 1 20  ? 7.769   81.578  23.220  1.00 90.06  ? 20  DT  I O2    1 
ATOM   397   N  N3    . DT  A 1 20  ? 8.435   80.985  21.128  1.00 90.06  ? 20  DT  I N3    1 
ATOM   398   C  C4    . DT  A 1 20  ? 9.370   80.777  20.131  1.00 90.06  ? 20  DT  I C4    1 
ATOM   399   O  O4    . DT  A 1 20  ? 9.002   80.376  19.025  1.00 90.06  ? 20  DT  I O4    1 
ATOM   400   C  C5    . DT  A 1 20  ? 10.748  81.059  20.508  1.00 90.06  ? 20  DT  I C5    1 
ATOM   401   C  C7    . DT  A 1 20  ? 11.832  80.861  19.493  1.00 90.06  ? 20  DT  I C7    1 
ATOM   402   C  C6    . DT  A 1 20  ? 10.989  81.485  21.763  1.00 90.06  ? 20  DT  I C6    1 
ATOM   403   P  P     . DT  A 1 21  ? 11.154  80.688  27.691  1.00 126.32 ? 21  DT  I P     1 
ATOM   404   O  OP1   . DT  A 1 21  ? 10.943  80.800  29.162  1.00 126.32 ? 21  DT  I OP1   1 
ATOM   405   O  OP2   . DT  A 1 21  ? 12.389  80.041  27.181  1.00 126.32 ? 21  DT  I OP2   1 
ATOM   406   O  "O5'" . DT  A 1 21  ? 9.899   79.947  27.051  1.00 163.70 ? 21  DT  I "O5'" 1 
ATOM   407   C  "C5'" . DT  A 1 21  ? 8.621   80.585  27.034  1.00 163.70 ? 21  DT  I "C5'" 1 
ATOM   408   C  "C4'" . DT  A 1 21  ? 7.527   79.570  26.804  1.00 163.70 ? 21  DT  I "C4'" 1 
ATOM   409   O  "O4'" . DT  A 1 21  ? 7.376   79.291  25.393  1.00 163.70 ? 21  DT  I "O4'" 1 
ATOM   410   C  "C3'" . DT  A 1 21  ? 7.773   78.226  27.486  1.00 163.70 ? 21  DT  I "C3'" 1 
ATOM   411   O  "O3'" . DT  A 1 21  ? 6.562   77.732  28.072  1.00 163.70 ? 21  DT  I "O3'" 1 
ATOM   412   C  "C2'" . DT  A 1 21  ? 8.257   77.339  26.350  1.00 163.70 ? 21  DT  I "C2'" 1 
ATOM   413   C  "C1'" . DT  A 1 21  ? 7.510   77.898  25.152  1.00 163.70 ? 21  DT  I "C1'" 1 
ATOM   414   N  N1    . DT  A 1 21  ? 8.201   77.739  23.859  1.00 99.19  ? 21  DT  I N1    1 
ATOM   415   C  C2    . DT  A 1 21  ? 7.427   77.570  22.728  1.00 99.19  ? 21  DT  I C2    1 
ATOM   416   O  O2    . DT  A 1 21  ? 6.206   77.504  22.755  1.00 99.19  ? 21  DT  I O2    1 
ATOM   417   N  N3    . DT  A 1 21  ? 8.136   77.477  21.555  1.00 99.19  ? 21  DT  I N3    1 
ATOM   418   C  C4    . DT  A 1 21  ? 9.515   77.536  21.403  1.00 99.19  ? 21  DT  I C4    1 
ATOM   419   O  O4    . DT  A 1 21  ? 10.013  77.467  20.276  1.00 99.19  ? 21  DT  I O4    1 
ATOM   420   C  C5    . DT  A 1 21  ? 10.265  77.687  22.639  1.00 99.19  ? 21  DT  I C5    1 
ATOM   421   C  C7    . DT  A 1 21  ? 11.759  77.740  22.583  1.00 99.19  ? 21  DT  I C7    1 
ATOM   422   C  C6    . DT  A 1 21  ? 9.579   77.776  23.786  1.00 99.19  ? 21  DT  I C6    1 
ATOM   423   P  P     . DC  A 1 22  ? 6.608   76.434  29.020  1.00 136.78 ? 22  DC  I P     1 
ATOM   424   O  OP1   . DC  A 1 22  ? 5.224   76.149  29.481  1.00 136.78 ? 22  DC  I OP1   1 
ATOM   425   O  OP2   . DC  A 1 22  ? 7.697   76.612  30.024  1.00 136.78 ? 22  DC  I OP2   1 
ATOM   426   O  "O5'" . DC  A 1 22  ? 7.054   75.292  28.004  1.00 140.75 ? 22  DC  I "O5'" 1 
ATOM   427   C  "C5'" . DC  A 1 22  ? 6.977   73.922  28.363  1.00 140.75 ? 22  DC  I "C5'" 1 
ATOM   428   C  "C4'" . DC  A 1 22  ? 5.903   73.236  27.554  1.00 140.75 ? 22  DC  I "C4'" 1 
ATOM   429   O  "O4'" . DC  A 1 22  ? 5.877   73.783  26.208  1.00 140.75 ? 22  DC  I "O4'" 1 
ATOM   430   C  "C3'" . DC  A 1 22  ? 6.117   71.730  27.404  1.00 140.75 ? 22  DC  I "C3'" 1 
ATOM   431   O  "O3'" . DC  A 1 22  ? 4.886   71.032  27.586  1.00 140.75 ? 22  DC  I "O3'" 1 
ATOM   432   C  "C2'" . DC  A 1 22  ? 6.632   71.580  25.985  1.00 140.75 ? 22  DC  I "C2'" 1 
ATOM   433   C  "C1'" . DC  A 1 22  ? 5.957   72.730  25.261  1.00 140.75 ? 22  DC  I "C1'" 1 
ATOM   434   N  N1    . DC  A 1 22  ? 6.722   73.202  24.093  1.00 101.08 ? 22  DC  I N1    1 
ATOM   435   C  C2    . DC  A 1 22  ? 6.027   73.618  22.940  1.00 101.08 ? 22  DC  I C2    1 
ATOM   436   O  O2    . DC  A 1 22  ? 4.785   73.677  22.967  1.00 101.08 ? 22  DC  I O2    1 
ATOM   437   N  N3    . DC  A 1 22  ? 6.733   73.951  21.832  1.00 101.08 ? 22  DC  I N3    1 
ATOM   438   C  C4    . DC  A 1 22  ? 8.071   73.906  21.852  1.00 101.08 ? 22  DC  I C4    1 
ATOM   439   N  N4    . DC  A 1 22  ? 8.721   74.214  20.729  1.00 101.08 ? 22  DC  I N4    1 
ATOM   440   C  C5    . DC  A 1 22  ? 8.797   73.537  23.023  1.00 101.08 ? 22  DC  I C5    1 
ATOM   441   C  C6    . DC  A 1 22  ? 8.091   73.200  24.109  1.00 101.08 ? 22  DC  I C6    1 
ATOM   442   P  P     . DT  A 1 23  ? 4.647   69.641  26.828  1.00 129.19 ? 23  DT  I P     1 
ATOM   443   O  OP1   . DT  A 1 23  ? 3.556   68.917  27.525  1.00 129.19 ? 23  DT  I OP1   1 
ATOM   444   O  OP2   . DT  A 1 23  ? 5.967   68.979  26.639  1.00 129.19 ? 23  DT  I OP2   1 
ATOM   445   O  "O5'" . DT  A 1 23  ? 4.118   70.099  25.398  1.00 186.42 ? 23  DT  I "O5'" 1 
ATOM   446   C  "C5'" . DT  A 1 23  ? 2.793   69.789  24.974  1.00 186.42 ? 23  DT  I "C5'" 1 
ATOM   447   C  "C4'" . DT  A 1 23  ? 2.812   68.525  24.150  1.00 186.42 ? 23  DT  I "C4'" 1 
ATOM   448   O  "O4'" . DT  A 1 23  ? 3.551   68.786  22.929  1.00 186.42 ? 23  DT  I "O4'" 1 
ATOM   449   C  "C3'" . DT  A 1 23  ? 3.545   67.385  24.859  1.00 186.42 ? 23  DT  I "C3'" 1 
ATOM   450   O  "O3'" . DT  A 1 23  ? 2.896   66.128  24.646  1.00 186.42 ? 23  DT  I "O3'" 1 
ATOM   451   C  "C2'" . DT  A 1 23  ? 4.936   67.417  24.252  1.00 186.42 ? 23  DT  I "C2'" 1 
ATOM   452   C  "C1'" . DT  A 1 23  ? 4.694   67.943  22.845  1.00 186.42 ? 23  DT  I "C1'" 1 
ATOM   453   N  N1    . DT  A 1 23  ? 5.829   68.743  22.319  1.00 147.51 ? 23  DT  I N1    1 
ATOM   454   C  C2    . DT  A 1 23  ? 5.844   69.121  20.983  1.00 147.51 ? 23  DT  I C2    1 
ATOM   455   O  O2    . DT  A 1 23  ? 4.940   68.864  20.195  1.00 147.51 ? 23  DT  I O2    1 
ATOM   456   N  N3    . DT  A 1 23  ? 6.972   69.821  20.604  1.00 147.51 ? 23  DT  I N3    1 
ATOM   457   C  C4    . DT  A 1 23  ? 8.044   70.183  21.403  1.00 147.51 ? 23  DT  I C4    1 
ATOM   458   O  O4    . DT  A 1 23  ? 8.982   70.815  20.917  1.00 147.51 ? 23  DT  I O4    1 
ATOM   459   C  C5    . DT  A 1 23  ? 7.951   69.766  22.788  1.00 147.51 ? 23  DT  I C5    1 
ATOM   460   C  C7    . DT  A 1 23  ? 9.062   70.109  23.730  1.00 147.51 ? 23  DT  I C7    1 
ATOM   461   C  C6    . DT  A 1 23  ? 6.866   69.082  23.168  1.00 147.51 ? 23  DT  I C6    1 
ATOM   462   P  P     . DA  A 1 24  ? 3.720   64.764  24.850  1.00 165.21 ? 24  DA  I P     1 
ATOM   463   O  OP1   . DA  A 1 24  ? 2.745   63.647  24.950  1.00 165.21 ? 24  DA  I OP1   1 
ATOM   464   O  OP2   . DA  A 1 24  ? 4.711   64.972  25.939  1.00 165.21 ? 24  DA  I OP2   1 
ATOM   465   O  "O5'" . DA  A 1 24  ? 4.515   64.631  23.477  1.00 147.31 ? 24  DA  I "O5'" 1 
ATOM   466   C  "C5'" . DA  A 1 24  ? 3.838   64.796  22.230  1.00 147.31 ? 24  DA  I "C5'" 1 
ATOM   467   C  "C4'" . DA  A 1 24  ? 4.669   64.224  21.106  1.00 147.31 ? 24  DA  I "C4'" 1 
ATOM   468   O  "O4'" . DA  A 1 24  ? 5.723   65.149  20.741  1.00 147.31 ? 24  DA  I "O4'" 1 
ATOM   469   C  "C3'" . DA  A 1 24  ? 5.352   62.909  21.473  1.00 147.31 ? 24  DA  I "C3'" 1 
ATOM   470   O  "O3'" . DA  A 1 24  ? 5.216   61.949  20.411  1.00 147.31 ? 24  DA  I "O3'" 1 
ATOM   471   C  "C2'" . DA  A 1 24  ? 6.787   63.317  21.766  1.00 147.31 ? 24  DA  I "C2'" 1 
ATOM   472   C  "C1'" . DA  A 1 24  ? 7.001   64.540  20.886  1.00 147.31 ? 24  DA  I "C1'" 1 
ATOM   473   N  N9    . DA  A 1 24  ? 7.916   65.528  21.474  1.00 172.68 ? 24  DA  I N9    1 
ATOM   474   C  C8    . DA  A 1 24  ? 8.090   65.795  22.814  1.00 172.68 ? 24  DA  I C8    1 
ATOM   475   N  N7    . DA  A 1 24  ? 8.993   66.716  23.061  1.00 172.68 ? 24  DA  I N7    1 
ATOM   476   C  C5    . DA  A 1 24  ? 9.444   67.087  21.801  1.00 172.68 ? 24  DA  I C5    1 
ATOM   477   C  C6    . DA  A 1 24  ? 10.411  68.025  21.380  1.00 172.68 ? 24  DA  I C6    1 
ATOM   478   N  N6    . DA  A 1 24  ? 11.125  68.785  22.218  1.00 172.68 ? 24  DA  I N6    1 
ATOM   479   N  N1    . DA  A 1 24  ? 10.622  68.155  20.051  1.00 172.68 ? 24  DA  I N1    1 
ATOM   480   C  C2    . DA  A 1 24  ? 9.909   67.391  19.211  1.00 172.68 ? 24  DA  I C2    1 
ATOM   481   N  N3    . DA  A 1 24  ? 8.977   66.476  19.483  1.00 172.68 ? 24  DA  I N3    1 
ATOM   482   C  C4    . DA  A 1 24  ? 8.788   66.368  20.811  1.00 172.68 ? 24  DA  I C4    1 
ATOM   483   P  P     . DC  A 1 25  ? 6.450   60.996  20.018  1.00 158.27 ? 25  DC  I P     1 
ATOM   484   O  OP1   . DC  A 1 25  ? 5.942   59.910  19.140  1.00 158.27 ? 25  DC  I OP1   1 
ATOM   485   O  OP2   . DC  A 1 25  ? 7.226   60.647  21.240  1.00 158.27 ? 25  DC  I OP2   1 
ATOM   486   O  "O5'" . DC  A 1 25  ? 7.328   61.975  19.129  1.00 113.15 ? 25  DC  I "O5'" 1 
ATOM   487   C  "C5'" . DC  A 1 25  ? 6.902   62.340  17.821  1.00 113.15 ? 25  DC  I "C5'" 1 
ATOM   488   C  "C4'" . DC  A 1 25  ? 7.865   61.754  16.824  1.00 113.15 ? 25  DC  I "C4'" 1 
ATOM   489   O  "O4'" . DC  A 1 25  ? 9.040   62.594  16.813  1.00 113.15 ? 25  DC  I "O4'" 1 
ATOM   490   C  "C3'" . DC  A 1 25  ? 8.344   60.384  17.293  1.00 113.15 ? 25  DC  I "C3'" 1 
ATOM   491   O  "O3'" . DC  A 1 25  ? 8.695   59.567  16.179  1.00 113.15 ? 25  DC  I "O3'" 1 
ATOM   492   C  "C2'" . DC  A 1 25  ? 9.540   60.715  18.160  1.00 113.15 ? 25  DC  I "C2'" 1 
ATOM   493   C  "C1'" . DC  A 1 25  ? 10.112  61.955  17.493  1.00 113.15 ? 25  DC  I "C1'" 1 
ATOM   494   N  N1    . DC  A 1 25  ? 10.671  62.913  18.457  1.00 101.19 ? 25  DC  I N1    1 
ATOM   495   C  C2    . DC  A 1 25  ? 11.388  64.007  17.979  1.00 101.19 ? 25  DC  I C2    1 
ATOM   496   O  O2    . DC  A 1 25  ? 11.494  64.162  16.748  1.00 101.19 ? 25  DC  I O2    1 
ATOM   497   N  N3    . DC  A 1 25  ? 11.948  64.866  18.867  1.00 101.19 ? 25  DC  I N3    1 
ATOM   498   C  C4    . DC  A 1 25  ? 11.811  64.657  20.179  1.00 101.19 ? 25  DC  I C4    1 
ATOM   499   N  N4    . DC  A 1 25  ? 12.415  65.501  21.014  1.00 101.19 ? 25  DC  I N4    1 
ATOM   500   C  C5    . DC  A 1 25  ? 11.058  63.566  20.690  1.00 101.19 ? 25  DC  I C5    1 
ATOM   501   C  C6    . DC  A 1 25  ? 10.507  62.728  19.803  1.00 101.19 ? 25  DC  I C6    1 
ATOM   502   P  P     . DC  A 1 26  ? 9.667   58.307  16.389  1.00 113.18 ? 26  DC  I P     1 
ATOM   503   O  OP1   . DC  A 1 26  ? 8.977   57.107  15.857  1.00 113.18 ? 26  DC  I OP1   1 
ATOM   504   O  OP2   . DC  A 1 26  ? 10.157  58.306  17.795  1.00 113.18 ? 26  DC  I OP2   1 
ATOM   505   O  "O5'" . DC  A 1 26  ? 10.887  58.644  15.424  1.00 99.13  ? 26  DC  I "O5'" 1 
ATOM   506   C  "C5'" . DC  A 1 26  ? 11.056  59.966  14.906  1.00 99.13  ? 26  DC  I "C5'" 1 
ATOM   507   C  "C4'" . DC  A 1 26  ? 12.524  60.281  14.754  1.00 99.13  ? 26  DC  I "C4'" 1 
ATOM   508   O  "O4'" . DC  A 1 26  ? 12.984  61.154  15.815  1.00 99.13  ? 26  DC  I "O4'" 1 
ATOM   509   C  "C3'" . DC  A 1 26  ? 13.426  59.054  14.813  1.00 99.13  ? 26  DC  I "C3'" 1 
ATOM   510   O  "O3'" . DC  A 1 26  ? 14.501  59.285  13.925  1.00 99.13  ? 26  DC  I "O3'" 1 
ATOM   511   C  "C2'" . DC  A 1 26  ? 13.941  59.066  16.241  1.00 99.13  ? 26  DC  I "C2'" 1 
ATOM   512   C  "C1'" . DC  A 1 26  ? 14.089  60.554  16.478  1.00 99.13  ? 26  DC  I "C1'" 1 
ATOM   513   N  N1    . DC  A 1 26  ? 14.062  60.985  17.884  1.00 92.40  ? 26  DC  I N1    1 
ATOM   514   C  C2    . DC  A 1 26  ? 14.545  62.267  18.200  1.00 92.40  ? 26  DC  I C2    1 
ATOM   515   O  O2    . DC  A 1 26  ? 15.014  62.974  17.285  1.00 92.40  ? 26  DC  I O2    1 
ATOM   516   N  N3    . DC  A 1 26  ? 14.488  62.699  19.487  1.00 92.40  ? 26  DC  I N3    1 
ATOM   517   C  C4    . DC  A 1 26  ? 13.972  61.908  20.434  1.00 92.40  ? 26  DC  I C4    1 
ATOM   518   N  N4    . DC  A 1 26  ? 13.890  62.391  21.673  1.00 92.40  ? 26  DC  I N4    1 
ATOM   519   C  C5    . DC  A 1 26  ? 13.505  60.589  20.145  1.00 92.40  ? 26  DC  I C5    1 
ATOM   520   C  C6    . DC  A 1 26  ? 13.569  60.172  18.868  1.00 92.40  ? 26  DC  I C6    1 
ATOM   521   P  P     . DA  A 1 27  ? 15.095  58.079  13.067  1.00 120.75 ? 27  DA  I P     1 
ATOM   522   O  OP1   . DA  A 1 27  ? 14.285  57.973  11.824  1.00 120.75 ? 27  DA  I OP1   1 
ATOM   523   O  OP2   . DA  A 1 27  ? 15.225  56.904  13.964  1.00 120.75 ? 27  DA  I OP2   1 
ATOM   524   O  "O5'" . DA  A 1 27  ? 16.548  58.615  12.690  1.00 109.52 ? 27  DA  I "O5'" 1 
ATOM   525   C  "C5'" . DA  A 1 27  ? 16.740  59.972  12.272  1.00 109.52 ? 27  DA  I "C5'" 1 
ATOM   526   C  "C4'" . DA  A 1 27  ? 18.049  60.510  12.803  1.00 109.52 ? 27  DA  I "C4'" 1 
ATOM   527   O  "O4'" . DA  A 1 27  ? 17.969  60.769  14.226  1.00 109.52 ? 27  DA  I "O4'" 1 
ATOM   528   C  "C3'" . DA  A 1 27  ? 19.241  59.582  12.606  1.00 109.52 ? 27  DA  I "C3'" 1 
ATOM   529   O  "O3'" . DA  A 1 27  ? 20.359  60.379  12.266  1.00 109.52 ? 27  DA  I "O3'" 1 
ATOM   530   C  "C2'" . DA  A 1 27  ? 19.436  58.958  13.978  1.00 109.52 ? 27  DA  I "C2'" 1 
ATOM   531   C  "C1'" . DA  A 1 27  ? 18.988  60.062  14.926  1.00 109.52 ? 27  DA  I "C1'" 1 
ATOM   532   N  N9    . DA  A 1 27  ? 18.417  59.583  16.194  1.00 108.29 ? 27  DA  I N9    1 
ATOM   533   C  C8    . DA  A 1 27  ? 17.881  58.341  16.435  1.00 108.29 ? 27  DA  I C8    1 
ATOM   534   N  N7    . DA  A 1 27  ? 17.409  58.190  17.651  1.00 108.29 ? 27  DA  I N7    1 
ATOM   535   C  C5    . DA  A 1 27  ? 17.655  59.411  18.261  1.00 108.29 ? 27  DA  I C5    1 
ATOM   536   C  C6    . DA  A 1 27  ? 17.377  59.894  19.557  1.00 108.29 ? 27  DA  I C6    1 
ATOM   537   N  N6    . DA  A 1 27  ? 16.763  59.178  20.498  1.00 108.29 ? 27  DA  I N6    1 
ATOM   538   N  N1    . DA  A 1 27  ? 17.751  61.155  19.850  1.00 108.29 ? 27  DA  I N1    1 
ATOM   539   C  C2    . DA  A 1 27  ? 18.358  61.879  18.898  1.00 108.29 ? 27  DA  I C2    1 
ATOM   540   N  N3    . DA  A 1 27  ? 18.670  61.541  17.642  1.00 108.29 ? 27  DA  I N3    1 
ATOM   541   C  C4    . DA  A 1 27  ? 18.286  60.279  17.381  1.00 108.29 ? 27  DA  I C4    1 
ATOM   542   P  P     . DA  A 1 28  ? 21.563  59.758  11.411  1.00 119.93 ? 28  DA  I P     1 
ATOM   543   O  OP1   . DA  A 1 28  ? 21.216  59.808  9.968   1.00 119.93 ? 28  DA  I OP1   1 
ATOM   544   O  OP2   . DA  A 1 28  ? 21.962  58.470  12.031  1.00 119.93 ? 28  DA  I OP2   1 
ATOM   545   O  "O5'" . DA  A 1 28  ? 22.701  60.828  11.679  1.00 78.84  ? 28  DA  I "O5'" 1 
ATOM   546   C  "C5'" . DA  A 1 28  ? 22.332  62.144  12.072  1.00 78.84  ? 28  DA  I "C5'" 1 
ATOM   547   C  "C4'" . DA  A 1 28  ? 22.784  62.423  13.486  1.00 78.84  ? 28  DA  I "C4'" 1 
ATOM   548   O  "O4'" . DA  A 1 28  ? 22.049  61.656  14.484  1.00 78.84  ? 28  DA  I "O4'" 1 
ATOM   549   C  "C3'" . DA  A 1 28  ? 24.265  62.141  13.728  1.00 78.84  ? 28  DA  I "C3'" 1 
ATOM   550   O  "O3'" . DA  A 1 28  ? 24.852  63.280  14.339  1.00 78.84  ? 28  DA  I "O3'" 1 
ATOM   551   C  "C2'" . DA  A 1 28  ? 24.259  60.972  14.698  1.00 78.84  ? 28  DA  I "C2'" 1 
ATOM   552   C  "C1'" . DA  A 1 28  ? 22.975  61.221  15.468  1.00 78.84  ? 28  DA  I "C1'" 1 
ATOM   553   N  N9    . DA  A 1 28  ? 22.434  60.052  16.172  1.00 82.33  ? 28  DA  I N9    1 
ATOM   554   C  C8    . DA  A 1 28  ? 22.463  58.738  15.776  1.00 82.33  ? 28  DA  I C8    1 
ATOM   555   N  N7    . DA  A 1 28  ? 21.965  57.903  16.662  1.00 82.33  ? 28  DA  I N7    1 
ATOM   556   C  C5    . DA  A 1 28  ? 21.562  58.723  17.706  1.00 82.33  ? 28  DA  I C5    1 
ATOM   557   C  C6    . DA  A 1 28  ? 20.963  58.448  18.960  1.00 82.33  ? 28  DA  I C6    1 
ATOM   558   N  N6    . DA  A 1 28  ? 20.660  57.228  19.395  1.00 82.33  ? 28  DA  I N6    1 
ATOM   559   N  N1    . DA  A 1 28  ? 20.688  59.492  19.765  1.00 82.33  ? 28  DA  I N1    1 
ATOM   560   C  C2    . DA  A 1 28  ? 21.001  60.724  19.341  1.00 82.33  ? 28  DA  I C2    1 
ATOM   561   N  N3    . DA  A 1 28  ? 21.569  61.111  18.192  1.00 82.33  ? 28  DA  I N3    1 
ATOM   562   C  C4    . DA  A 1 28  ? 21.829  60.052  17.410  1.00 82.33  ? 28  DA  I C4    1 
ATOM   563   P  P     . DA  A 1 29  ? 26.400  63.591  14.103  1.00 114.27 ? 29  DA  I P     1 
ATOM   564   O  OP1   . DA  A 1 29  ? 26.512  65.025  13.724  1.00 114.27 ? 29  DA  I OP1   1 
ATOM   565   O  OP2   . DA  A 1 29  ? 26.930  62.535  13.201  1.00 114.27 ? 29  DA  I OP2   1 
ATOM   566   O  "O5'" . DA  A 1 29  ? 27.025  63.367  15.543  1.00 60.34  ? 29  DA  I "O5'" 1 
ATOM   567   C  "C5'" . DA  A 1 29  ? 26.294  62.644  16.502  1.00 60.34  ? 29  DA  I "C5'" 1 
ATOM   568   C  "C4'" . DA  A 1 29  ? 26.061  63.493  17.723  1.00 60.34  ? 29  DA  I "C4'" 1 
ATOM   569   O  "O4'" . DA  A 1 29  ? 25.053  62.838  18.516  1.00 60.34  ? 29  DA  I "O4'" 1 
ATOM   570   C  "C3'" . DA  A 1 29  ? 27.295  63.578  18.605  1.00 60.34  ? 29  DA  I "C3'" 1 
ATOM   571   O  "O3'" . DA  A 1 29  ? 27.341  64.809  19.316  1.00 60.34  ? 29  DA  I "O3'" 1 
ATOM   572   C  "C2'" . DA  A 1 29  ? 27.153  62.384  19.534  1.00 60.34  ? 29  DA  I "C2'" 1 
ATOM   573   C  "C1'" . DA  A 1 29  ? 25.650  62.115  19.592  1.00 60.34  ? 29  DA  I "C1'" 1 
ATOM   574   N  N9    . DA  A 1 29  ? 25.291  60.698  19.424  1.00 64.40  ? 29  DA  I N9    1 
ATOM   575   C  C8    . DA  A 1 29  ? 25.639  59.865  18.380  1.00 64.40  ? 29  DA  I C8    1 
ATOM   576   N  N7    . DA  A 1 29  ? 25.125  58.662  18.469  1.00 64.40  ? 29  DA  I N7    1 
ATOM   577   C  C5    . DA  A 1 29  ? 24.400  58.695  19.655  1.00 64.40  ? 29  DA  I C5    1 
ATOM   578   C  C6    . DA  A 1 29  ? 23.606  57.738  20.301  1.00 64.40  ? 29  DA  I C6    1 
ATOM   579   N  N6    . DA  A 1 29  ? 23.394  56.512  19.827  1.00 64.40  ? 29  DA  I N6    1 
ATOM   580   N  N1    . DA  A 1 29  ? 23.024  58.089  21.465  1.00 64.40  ? 29  DA  I N1    1 
ATOM   581   C  C2    . DA  A 1 29  ? 23.231  59.317  21.941  1.00 64.40  ? 29  DA  I C2    1 
ATOM   582   N  N3    . DA  A 1 29  ? 23.948  60.309  21.427  1.00 64.40  ? 29  DA  I N3    1 
ATOM   583   C  C4    . DA  A 1 29  ? 24.511  59.934  20.265  1.00 64.40  ? 29  DA  I C4    1 
ATOM   584   P  P     . DA  A 1 30  ? 28.615  65.141  20.233  1.00 65.58  ? 30  DA  I P     1 
ATOM   585   O  OP1   . DA  A 1 30  ? 28.470  66.541  20.735  1.00 65.58  ? 30  DA  I OP1   1 
ATOM   586   O  OP2   . DA  A 1 30  ? 29.860  64.708  19.536  1.00 65.58  ? 30  DA  I OP2   1 
ATOM   587   O  "O5'" . DA  A 1 30  ? 28.424  64.178  21.464  1.00 43.90  ? 30  DA  I "O5'" 1 
ATOM   588   C  "C5'" . DA  A 1 30  ? 27.349  64.393  22.334  1.00 43.90  ? 30  DA  I "C5'" 1 
ATOM   589   C  "C4'" . DA  A 1 30  ? 27.453  63.427  23.475  1.00 43.90  ? 30  DA  I "C4'" 1 
ATOM   590   O  "O4'" . DA  A 1 30  ? 26.976  62.128  23.047  1.00 43.90  ? 30  DA  I "O4'" 1 
ATOM   591   C  "C3'" . DA  A 1 30  ? 28.892  63.243  23.947  1.00 43.90  ? 30  DA  I "C3'" 1 
ATOM   592   O  "O3'" . DA  A 1 30  ? 28.867  63.290  25.373  1.00 43.90  ? 30  DA  I "O3'" 1 
ATOM   593   C  "C2'" . DA  A 1 30  ? 29.285  61.888  23.373  1.00 43.90  ? 30  DA  I "C2'" 1 
ATOM   594   C  "C1'" . DA  A 1 30  ? 27.954  61.140  23.315  1.00 43.90  ? 30  DA  I "C1'" 1 
ATOM   595   N  N9    . DA  A 1 30  ? 27.821  60.079  22.302  1.00 64.74  ? 30  DA  I N9    1 
ATOM   596   C  C8    . DA  A 1 30  ? 28.370  60.013  21.042  1.00 64.74  ? 30  DA  I C8    1 
ATOM   597   N  N7    . DA  A 1 30  ? 28.093  58.901  20.399  1.00 64.74  ? 30  DA  I N7    1 
ATOM   598   C  C5    . DA  A 1 30  ? 27.303  58.184  21.291  1.00 64.74  ? 30  DA  I C5    1 
ATOM   599   C  C6    . DA  A 1 30  ? 26.698  56.902  21.222  1.00 64.74  ? 30  DA  I C6    1 
ATOM   600   N  N6    . DA  A 1 30  ? 26.814  56.073  20.182  1.00 64.74  ? 30  DA  I N6    1 
ATOM   601   N  N1    . DA  A 1 30  ? 25.966  56.495  22.283  1.00 64.74  ? 30  DA  I N1    1 
ATOM   602   C  C2    . DA  A 1 30  ? 25.858  57.309  23.337  1.00 64.74  ? 30  DA  I C2    1 
ATOM   603   N  N3    . DA  A 1 30  ? 26.386  58.520  23.530  1.00 64.74  ? 30  DA  I N3    1 
ATOM   604   C  C4    . DA  A 1 30  ? 27.109  58.905  22.459  1.00 64.74  ? 30  DA  I C4    1 
ATOM   605   P  P     . DG  A 1 31  ? 30.215  63.124  26.224  1.00 63.08  ? 31  DG  I P     1 
ATOM   606   O  OP1   . DG  A 1 31  ? 30.311  64.256  27.187  1.00 63.08  ? 31  DG  I OP1   1 
ATOM   607   O  OP2   . DG  A 1 31  ? 31.348  62.853  25.297  1.00 63.08  ? 31  DG  I OP2   1 
ATOM   608   O  "O5'" . DG  A 1 31  ? 29.884  61.808  27.054  1.00 76.79  ? 31  DG  I "O5'" 1 
ATOM   609   C  "C5'" . DG  A 1 31  ? 28.530  61.519  27.428  1.00 76.79  ? 31  DG  I "C5'" 1 
ATOM   610   C  "C4'" . DG  A 1 31  ? 28.379  60.063  27.803  1.00 76.79  ? 31  DG  I "C4'" 1 
ATOM   611   O  "O4'" . DG  A 1 31  ? 28.172  59.215  26.644  1.00 76.79  ? 31  DG  I "O4'" 1 
ATOM   612   C  "C3'" . DG  A 1 31  ? 29.592  59.503  28.535  1.00 76.79  ? 31  DG  I "C3'" 1 
ATOM   613   O  "O3'" . DG  A 1 31  ? 29.187  58.826  29.703  1.00 76.79  ? 31  DG  I "O3'" 1 
ATOM   614   C  "C2'" . DG  A 1 31  ? 30.218  58.534  27.547  1.00 76.79  ? 31  DG  I "C2'" 1 
ATOM   615   C  "C1'" . DG  A 1 31  ? 29.040  58.091  26.703  1.00 76.79  ? 31  DG  I "C1'" 1 
ATOM   616   N  N9    . DG  A 1 31  ? 29.413  57.732  25.336  1.00 90.91  ? 31  DG  I N9    1 
ATOM   617   C  C8    . DG  A 1 31  ? 29.986  58.555  24.396  1.00 90.91  ? 31  DG  I C8    1 
ATOM   618   N  N7    . DG  A 1 31  ? 30.228  57.952  23.262  1.00 90.91  ? 31  DG  I N7    1 
ATOM   619   C  C5    . DG  A 1 31  ? 29.786  56.651  23.461  1.00 90.91  ? 31  DG  I C5    1 
ATOM   620   C  C6    . DG  A 1 31  ? 29.791  55.529  22.580  1.00 90.91  ? 31  DG  I C6    1 
ATOM   621   O  O6    . DG  A 1 31  ? 30.204  55.461  21.412  1.00 90.91  ? 31  DG  I O6    1 
ATOM   622   N  N1    . DG  A 1 31  ? 29.245  54.406  23.189  1.00 90.91  ? 31  DG  I N1    1 
ATOM   623   C  C2    . DG  A 1 31  ? 28.757  54.362  24.471  1.00 90.91  ? 31  DG  I C2    1 
ATOM   624   N  N2    . DG  A 1 31  ? 28.268  53.178  24.859  1.00 90.91  ? 31  DG  I N2    1 
ATOM   625   N  N3    . DG  A 1 31  ? 28.746  55.393  25.301  1.00 90.91  ? 31  DG  I N3    1 
ATOM   626   C  C4    . DG  A 1 31  ? 29.273  56.498  24.735  1.00 90.91  ? 31  DG  I C4    1 
ATOM   627   P  P     . DT  A 1 32  ? 30.300  58.267  30.696  1.00 67.38  ? 32  DT  I P     1 
ATOM   628   O  OP1   . DT  A 1 32  ? 29.819  58.513  32.076  1.00 67.38  ? 32  DT  I OP1   1 
ATOM   629   O  OP2   . DT  A 1 32  ? 31.628  58.787  30.275  1.00 67.38  ? 32  DT  I OP2   1 
ATOM   630   O  "O5'" . DT  A 1 32  ? 30.242  56.711  30.396  1.00 115.84 ? 32  DT  I "O5'" 1 
ATOM   631   C  "C5'" . DT  A 1 32  ? 29.011  56.012  30.519  1.00 115.84 ? 32  DT  I "C5'" 1 
ATOM   632   C  "C4'" . DT  A 1 32  ? 29.258  54.525  30.485  1.00 115.84 ? 32  DT  I "C4'" 1 
ATOM   633   O  "O4'" . DT  A 1 32  ? 29.426  54.087  29.117  1.00 115.84 ? 32  DT  I "O4'" 1 
ATOM   634   C  "C3'" . DT  A 1 32  ? 30.518  54.096  31.236  1.00 115.84 ? 32  DT  I "C3'" 1 
ATOM   635   O  "O3'" . DT  A 1 32  ? 30.260  52.906  31.981  1.00 115.84 ? 32  DT  I "O3'" 1 
ATOM   636   C  "C2'" . DT  A 1 32  ? 31.528  53.855  30.128  1.00 115.84 ? 32  DT  I "C2'" 1 
ATOM   637   C  "C1'" . DT  A 1 32  ? 30.654  53.393  28.973  1.00 115.84 ? 32  DT  I "C1'" 1 
ATOM   638   N  N1    . DT  A 1 32  ? 31.190  53.713  27.639  1.00 94.85  ? 32  DT  I N1    1 
ATOM   639   C  C2    . DT  A 1 32  ? 30.973  52.827  26.602  1.00 94.85  ? 32  DT  I C2    1 
ATOM   640   O  O2    . DT  A 1 32  ? 30.386  51.762  26.737  1.00 94.85  ? 32  DT  I O2    1 
ATOM   641   N  N3    . DT  A 1 32  ? 31.477  53.236  25.392  1.00 94.85  ? 32  DT  I N3    1 
ATOM   642   C  C4    . DT  A 1 32  ? 32.164  54.405  25.124  1.00 94.85  ? 32  DT  I C4    1 
ATOM   643   O  O4    . DT  A 1 32  ? 32.531  54.646  23.979  1.00 94.85  ? 32  DT  I O4    1 
ATOM   644   C  C5    . DT  A 1 32  ? 32.383  55.267  26.262  1.00 94.85  ? 32  DT  I C5    1 
ATOM   645   C  C7    . DT  A 1 32  ? 33.158  56.534  26.077  1.00 94.85  ? 32  DT  I C7    1 
ATOM   646   C  C6    . DT  A 1 32  ? 31.886  54.887  27.443  1.00 94.85  ? 32  DT  I C6    1 
ATOM   647   P  P     . DG  A 1 33  ? 31.445  52.210  32.805  1.00 112.46 ? 33  DG  I P     1 
ATOM   648   O  OP1   . DG  A 1 33  ? 30.842  51.593  34.013  1.00 112.46 ? 33  DG  I OP1   1 
ATOM   649   O  OP2   . DG  A 1 33  ? 32.552  53.193  32.957  1.00 112.46 ? 33  DG  I OP2   1 
ATOM   650   O  "O5'" . DG  A 1 33  ? 31.920  51.054  31.819  1.00 121.33 ? 33  DG  I "O5'" 1 
ATOM   651   C  "C5'" . DG  A 1 33  ? 30.973  50.141  31.269  1.00 121.33 ? 33  DG  I "C5'" 1 
ATOM   652   C  "C4'" . DG  A 1 33  ? 31.673  49.093  30.437  1.00 121.33 ? 33  DG  I "C4'" 1 
ATOM   653   O  "O4'" . DG  A 1 33  ? 31.996  49.612  29.124  1.00 121.33 ? 33  DG  I "O4'" 1 
ATOM   654   C  "C3'" . DG  A 1 33  ? 32.982  48.587  31.040  1.00 121.33 ? 33  DG  I "C3'" 1 
ATOM   655   O  "O3'" . DG  A 1 33  ? 33.053  47.162  30.957  1.00 121.33 ? 33  DG  I "O3'" 1 
ATOM   656   C  "C2'" . DG  A 1 33  ? 34.054  49.249  30.190  1.00 121.33 ? 33  DG  I "C2'" 1 
ATOM   657   C  "C1'" . DG  A 1 33  ? 33.373  49.412  28.840  1.00 121.33 ? 33  DG  I "C1'" 1 
ATOM   658   N  N9    . DG  A 1 33  ? 33.847  50.570  28.087  1.00 135.78 ? 33  DG  I N9    1 
ATOM   659   C  C8    . DG  A 1 33  ? 34.136  51.812  28.598  1.00 135.78 ? 33  DG  I C8    1 
ATOM   660   N  N7    . DG  A 1 33  ? 34.558  52.653  27.694  1.00 135.78 ? 33  DG  I N7    1 
ATOM   661   C  C5    . DG  A 1 33  ? 34.544  51.928  26.511  1.00 135.78 ? 33  DG  I C5    1 
ATOM   662   C  C6    . DG  A 1 33  ? 34.904  52.314  25.190  1.00 135.78 ? 33  DG  I C6    1 
ATOM   663   O  O6    . DG  A 1 33  ? 35.314  53.409  24.791  1.00 135.78 ? 33  DG  I O6    1 
ATOM   664   N  N1    . DG  A 1 33  ? 34.748  51.268  24.290  1.00 135.78 ? 33  DG  I N1    1 
ATOM   665   C  C2    . DG  A 1 33  ? 34.300  50.018  24.611  1.00 135.78 ? 33  DG  I C2    1 
ATOM   666   N  N2    . DG  A 1 33  ? 34.235  49.162  23.586  1.00 135.78 ? 33  DG  I N2    1 
ATOM   667   N  N3    . DG  A 1 33  ? 33.952  49.640  25.834  1.00 135.78 ? 33  DG  I N3    1 
ATOM   668   C  C4    . DG  A 1 33  ? 34.102  50.640  26.731  1.00 135.78 ? 33  DG  I C4    1 
ATOM   669   P  P     . DT  A 1 34  ? 34.339  46.397  31.539  1.00 160.78 ? 34  DT  I P     1 
ATOM   670   O  OP1   . DT  A 1 34  ? 33.898  45.094  32.102  1.00 160.78 ? 34  DT  I OP1   1 
ATOM   671   O  OP2   . DT  A 1 34  ? 35.112  47.339  32.389  1.00 160.78 ? 34  DT  I OP2   1 
ATOM   672   O  "O5'" . DT  A 1 34  ? 35.193  46.129  30.229  1.00 118.03 ? 34  DT  I "O5'" 1 
ATOM   673   C  "C5'" . DT  A 1 34  ? 36.430  45.460  30.300  1.00 118.03 ? 34  DT  I "C5'" 1 
ATOM   674   C  "C4'" . DT  A 1 34  ? 36.575  44.548  29.110  1.00 118.03 ? 34  DT  I "C4'" 1 
ATOM   675   O  "O4'" . DT  A 1 34  ? 36.219  45.289  27.919  1.00 118.03 ? 34  DT  I "O4'" 1 
ATOM   676   C  "C3'" . DT  A 1 34  ? 38.011  44.087  28.917  1.00 118.03 ? 34  DT  I "C3'" 1 
ATOM   677   O  "O3'" . DT  A 1 34  ? 38.063  42.774  28.375  1.00 118.03 ? 34  DT  I "O3'" 1 
ATOM   678   C  "C2'" . DT  A 1 34  ? 38.569  45.091  27.930  1.00 118.03 ? 34  DT  I "C2'" 1 
ATOM   679   C  "C1'" . DT  A 1 34  ? 37.360  45.464  27.087  1.00 118.03 ? 34  DT  I "C1'" 1 
ATOM   680   N  N1    . DT  A 1 34  ? 37.407  46.877  26.679  1.00 125.56 ? 34  DT  I N1    1 
ATOM   681   C  C2    . DT  A 1 34  ? 37.681  47.191  25.361  1.00 125.56 ? 34  DT  I C2    1 
ATOM   682   O  O2    . DT  A 1 34  ? 37.853  46.352  24.491  1.00 125.56 ? 34  DT  I O2    1 
ATOM   683   N  N3    . DT  A 1 34  ? 37.748  48.536  25.100  1.00 125.56 ? 34  DT  I N3    1 
ATOM   684   C  C4    . DT  A 1 34  ? 37.564  49.570  25.996  1.00 125.56 ? 34  DT  I C4    1 
ATOM   685   O  O4    . DT  A 1 34  ? 37.664  50.732  25.609  1.00 125.56 ? 34  DT  I O4    1 
ATOM   686   C  C5    . DT  A 1 34  ? 37.264  49.167  27.355  1.00 125.56 ? 34  DT  I C5    1 
ATOM   687   C  C7    . DT  A 1 34  ? 37.042  50.217  28.398  1.00 125.56 ? 34  DT  I C7    1 
ATOM   688   C  C6    . DT  A 1 34  ? 37.199  47.859  27.621  1.00 125.56 ? 34  DT  I C6    1 
ATOM   689   P  P     . DA  A 1 35  ? 39.487  42.141  28.005  1.00 141.32 ? 35  DA  I P     1 
ATOM   690   O  OP1   . DA  A 1 35  ? 39.298  40.709  27.665  1.00 141.32 ? 35  DA  I OP1   1 
ATOM   691   O  OP2   . DA  A 1 35  ? 40.414  42.526  29.104  1.00 141.32 ? 35  DA  I OP2   1 
ATOM   692   O  "O5'" . DA  A 1 35  ? 39.910  42.921  26.681  1.00 139.14 ? 35  DA  I "O5'" 1 
ATOM   693   C  "C5'" . DA  A 1 35  ? 39.244  42.669  25.443  1.00 139.14 ? 35  DA  I "C5'" 1 
ATOM   694   C  "C4'" . DA  A 1 35  ? 40.075  43.171  24.284  1.00 139.14 ? 35  DA  I "C4'" 1 
ATOM   695   O  "O4'" . DA  A 1 35  ? 39.979  44.615  24.175  1.00 139.14 ? 35  DA  I "O4'" 1 
ATOM   696   C  "C3'" . DA  A 1 35  ? 41.570  42.844  24.362  1.00 139.14 ? 35  DA  I "C3'" 1 
ATOM   697   O  "O3'" . DA  A 1 35  ? 42.055  42.430  23.075  1.00 139.14 ? 35  DA  I "O3'" 1 
ATOM   698   C  "C2'" . DA  A 1 35  ? 42.196  44.163  24.781  1.00 139.14 ? 35  DA  I "C2'" 1 
ATOM   699   C  "C1'" . DA  A 1 35  ? 41.283  45.178  24.112  1.00 139.14 ? 35  DA  I "C1'" 1 
ATOM   700   N  N9    . DA  A 1 35  ? 41.252  46.492  24.763  1.00 97.78  ? 35  DA  I N9    1 
ATOM   701   C  C8    . DA  A 1 35  ? 40.977  46.775  26.082  1.00 97.78  ? 35  DA  I C8    1 
ATOM   702   N  N7    . DA  A 1 35  ? 41.037  48.053  26.376  1.00 97.78  ? 35  DA  I N7    1 
ATOM   703   C  C5    . DA  A 1 35  ? 41.373  48.655  25.172  1.00 97.78  ? 35  DA  I C5    1 
ATOM   704   C  C6    . DA  A 1 35  ? 41.589  49.996  24.818  1.00 97.78  ? 35  DA  I C6    1 
ATOM   705   N  N6    . DA  A 1 35  ? 41.492  51.013  25.678  1.00 97.78  ? 35  DA  I N6    1 
ATOM   706   N  N1    . DA  A 1 35  ? 41.910  50.261  23.534  1.00 97.78  ? 35  DA  I N1    1 
ATOM   707   C  C2    . DA  A 1 35  ? 42.002  49.240  22.671  1.00 97.78  ? 35  DA  I C2    1 
ATOM   708   N  N3    . DA  A 1 35  ? 41.820  47.939  22.882  1.00 97.78  ? 35  DA  I N3    1 
ATOM   709   C  C4    . DA  A 1 35  ? 41.505  47.707  24.168  1.00 97.78  ? 35  DA  I C4    1 
ATOM   710   P  P     . DT  A 1 36  ? 43.628  42.158  22.851  1.00 101.49 ? 36  DT  I P     1 
ATOM   711   O  OP1   . DT  A 1 36  ? 43.776  41.036  21.889  1.00 101.49 ? 36  DT  I OP1   1 
ATOM   712   O  OP2   . DT  A 1 36  ? 44.300  42.084  24.183  1.00 101.49 ? 36  DT  I OP2   1 
ATOM   713   O  "O5'" . DT  A 1 36  ? 44.113  43.476  22.103  1.00 154.52 ? 36  DT  I "O5'" 1 
ATOM   714   C  "C5'" . DT  A 1 36  ? 43.501  43.874  20.876  1.00 154.52 ? 36  DT  I "C5'" 1 
ATOM   715   C  "C4'" . DT  A 1 36  ? 44.323  44.945  20.200  1.00 154.52 ? 36  DT  I "C4'" 1 
ATOM   716   O  "O4'" . DT  A 1 36  ? 44.177  46.212  20.885  1.00 154.52 ? 36  DT  I "O4'" 1 
ATOM   717   C  "C3'" . DT  A 1 36  ? 45.824  44.661  20.164  1.00 154.52 ? 36  DT  I "C3'" 1 
ATOM   718   O  "O3'" . DT  A 1 36  ? 46.347  45.102  18.907  1.00 154.52 ? 36  DT  I "O3'" 1 
ATOM   719   C  "C2'" . DT  A 1 36  ? 46.361  45.498  21.311  1.00 154.52 ? 36  DT  I "C2'" 1 
ATOM   720   C  "C1'" . DT  A 1 36  ? 45.459  46.713  21.234  1.00 154.52 ? 36  DT  I "C1'" 1 
ATOM   721   N  N1    . DT  A 1 36  ? 45.326  47.482  22.485  1.00 70.72  ? 36  DT  I N1    1 
ATOM   722   C  C2    . DT  A 1 36  ? 45.451  48.860  22.415  1.00 70.72  ? 36  DT  I C2    1 
ATOM   723   O  O2    . DT  A 1 36  ? 45.702  49.463  21.375  1.00 70.72  ? 36  DT  I O2    1 
ATOM   724   N  N3    . DT  A 1 36  ? 45.276  49.508  23.616  1.00 70.72  ? 36  DT  I N3    1 
ATOM   725   C  C4    . DT  A 1 36  ? 45.001  48.937  24.848  1.00 70.72  ? 36  DT  I C4    1 
ATOM   726   O  O4    . DT  A 1 36  ? 44.856  49.658  25.833  1.00 70.72  ? 36  DT  I O4    1 
ATOM   727   C  C5    . DT  A 1 36  ? 44.906  47.487  24.850  1.00 70.72  ? 36  DT  I C5    1 
ATOM   728   C  C7    . DT  A 1 36  ? 44.630  46.777  26.139  1.00 70.72  ? 36  DT  I C7    1 
ATOM   729   C  C6    . DT  A 1 36  ? 45.072  46.843  23.684  1.00 70.72  ? 36  DT  I C6    1 
ATOM   730   P  P     . DT  A 1 37  ? 47.906  45.455  18.770  1.00 91.25  ? 37  DT  I P     1 
ATOM   731   O  OP1   . DT  A 1 37  ? 48.352  45.027  17.415  1.00 91.25  ? 37  DT  I OP1   1 
ATOM   732   O  OP2   . DT  A 1 37  ? 48.624  44.959  19.977  1.00 91.25  ? 37  DT  I OP2   1 
ATOM   733   O  "O5'" . DT  A 1 37  ? 47.927  47.047  18.808  1.00 109.41 ? 37  DT  I "O5'" 1 
ATOM   734   C  "C5'" . DT  A 1 37  ? 47.139  47.811  17.892  1.00 109.41 ? 37  DT  I "C5'" 1 
ATOM   735   C  "C4'" . DT  A 1 37  ? 47.698  49.209  17.759  1.00 109.41 ? 37  DT  I "C4'" 1 
ATOM   736   O  "O4'" . DT  A 1 37  ? 47.557  49.903  19.019  1.00 109.41 ? 37  DT  I "O4'" 1 
ATOM   737   C  "C3'" . DT  A 1 37  ? 49.184  49.274  17.405  1.00 109.41 ? 37  DT  I "C3'" 1 
ATOM   738   O  "O3'" . DT  A 1 37  ? 49.423  50.358  16.508  1.00 109.41 ? 37  DT  I "O3'" 1 
ATOM   739   C  "C2'" . DT  A 1 37  ? 49.863  49.508  18.742  1.00 109.41 ? 37  DT  I "C2'" 1 
ATOM   740   C  "C1'" . DT  A 1 37  ? 48.826  50.314  19.503  1.00 109.41 ? 37  DT  I "C1'" 1 
ATOM   741   N  N1    . DT  A 1 37  ? 48.832  50.077  20.946  1.00 69.00  ? 37  DT  I N1    1 
ATOM   742   C  C2    . DT  A 1 37  ? 48.636  51.152  21.778  1.00 69.00  ? 37  DT  I C2    1 
ATOM   743   O  O2    . DT  A 1 37  ? 48.461  52.292  21.372  1.00 69.00  ? 37  DT  I O2    1 
ATOM   744   N  N3    . DT  A 1 37  ? 48.652  50.849  23.113  1.00 69.00  ? 37  DT  I N3    1 
ATOM   745   C  C4    . DT  A 1 37  ? 48.839  49.606  23.686  1.00 69.00  ? 37  DT  I C4    1 
ATOM   746   O  O4    . DT  A 1 37  ? 48.831  49.493  24.908  1.00 69.00  ? 37  DT  I O4    1 
ATOM   747   C  C5    . DT  A 1 37  ? 49.036  48.519  22.752  1.00 69.00  ? 37  DT  I C5    1 
ATOM   748   C  C7    . DT  A 1 37  ? 49.239  47.132  23.279  1.00 69.00  ? 37  DT  I C7    1 
ATOM   749   C  C6    . DT  A 1 37  ? 49.026  48.809  21.444  1.00 69.00  ? 37  DT  I C6    1 
ATOM   750   P  P     . DT  A 1 38  ? 50.924  50.708  16.076  1.00 80.38  ? 38  DT  I P     1 
ATOM   751   O  OP1   . DT  A 1 38  ? 50.921  51.167  14.658  1.00 80.38  ? 38  DT  I OP1   1 
ATOM   752   O  OP2   . DT  A 1 38  ? 51.793  49.574  16.494  1.00 80.38  ? 38  DT  I OP2   1 
ATOM   753   O  "O5'" . DT  A 1 38  ? 51.287  51.952  16.992  1.00 49.42  ? 38  DT  I "O5'" 1 
ATOM   754   C  "C5'" . DT  A 1 38  ? 50.454  53.102  17.003  1.00 49.42  ? 38  DT  I "C5'" 1 
ATOM   755   C  "C4'" . DT  A 1 38  ? 51.025  54.140  17.933  1.00 49.42  ? 38  DT  I "C4'" 1 
ATOM   756   O  "O4'" . DT  A 1 38  ? 50.810  53.752  19.309  1.00 49.42  ? 38  DT  I "O4'" 1 
ATOM   757   C  "C3'" . DT  A 1 38  ? 52.536  54.312  17.770  1.00 49.42  ? 38  DT  I "C3'" 1 
ATOM   758   O  "O3'" . DT  A 1 38  ? 52.877  55.692  17.908  1.00 49.42  ? 38  DT  I "O3'" 1 
ATOM   759   C  "C2'" . DT  A 1 38  ? 53.094  53.520  18.935  1.00 49.42  ? 38  DT  I "C2'" 1 
ATOM   760   C  "C1'" . DT  A 1 38  ? 52.047  53.818  19.977  1.00 49.42  ? 38  DT  I "C1'" 1 
ATOM   761   N  N1    . DT  A 1 38  ? 52.007  52.914  21.121  1.00 62.92  ? 38  DT  I N1    1 
ATOM   762   C  C2    . DT  A 1 38  ? 51.769  53.506  22.327  1.00 62.92  ? 38  DT  I C2    1 
ATOM   763   O  O2    . DT  A 1 38  ? 51.523  54.698  22.434  1.00 62.92  ? 38  DT  I O2    1 
ATOM   764   N  N3    . DT  A 1 38  ? 51.816  52.659  23.406  1.00 62.92  ? 38  DT  I N3    1 
ATOM   765   C  C4    . DT  A 1 38  ? 52.054  51.304  23.392  1.00 62.92  ? 38  DT  I C4    1 
ATOM   766   O  O4    . DT  A 1 38  ? 52.103  50.691  24.452  1.00 62.92  ? 38  DT  I O4    1 
ATOM   767   C  C5    . DT  A 1 38  ? 52.240  50.723  22.073  1.00 62.92  ? 38  DT  I C5    1 
ATOM   768   C  C7    . DT  A 1 38  ? 52.436  49.243  21.948  1.00 62.92  ? 38  DT  I C7    1 
ATOM   769   C  C6    . DT  A 1 38  ? 52.216  51.554  21.013  1.00 62.92  ? 38  DT  I C6    1 
ATOM   770   P  P     . DG  A 1 39  ? 53.144  56.573  16.599  1.00 63.21  ? 39  DG  I P     1 
ATOM   771   O  OP1   . DG  A 1 39  ? 52.078  56.277  15.611  1.00 63.21  ? 39  DG  I OP1   1 
ATOM   772   O  OP2   . DG  A 1 39  ? 54.565  56.380  16.227  1.00 63.21  ? 39  DG  I OP2   1 
ATOM   773   O  "O5'" . DG  A 1 39  ? 52.969  58.068  17.104  1.00 51.08  ? 39  DG  I "O5'" 1 
ATOM   774   C  "C5'" . DG  A 1 39  ? 51.739  58.509  17.651  1.00 51.08  ? 39  DG  I "C5'" 1 
ATOM   775   C  "C4'" . DG  A 1 39  ? 51.980  59.154  18.995  1.00 51.08  ? 39  DG  I "C4'" 1 
ATOM   776   O  "O4'" . DG  A 1 39  ? 52.429  58.139  19.923  1.00 51.08  ? 39  DG  I "O4'" 1 
ATOM   777   C  "C3'" . DG  A 1 39  ? 53.065  60.232  18.980  1.00 51.08  ? 39  DG  I "C3'" 1 
ATOM   778   O  "O3'" . DG  A 1 39  ? 52.713  61.335  19.827  1.00 51.08  ? 39  DG  I "O3'" 1 
ATOM   779   C  "C2'" . DG  A 1 39  ? 54.291  59.513  19.508  1.00 51.08  ? 39  DG  I "C2'" 1 
ATOM   780   C  "C1'" . DG  A 1 39  ? 53.706  58.469  20.442  1.00 51.08  ? 39  DG  I "C1'" 1 
ATOM   781   N  N9    . DG  A 1 39  ? 54.498  57.243  20.503  1.00 87.19  ? 39  DG  I N9    1 
ATOM   782   C  C8    . DG  A 1 39  ? 55.218  56.655  19.484  1.00 87.19  ? 39  DG  I C8    1 
ATOM   783   N  N7    . DG  A 1 39  ? 55.871  55.589  19.864  1.00 87.19  ? 39  DG  I N7    1 
ATOM   784   C  C5    . DG  A 1 39  ? 55.552  55.460  21.209  1.00 87.19  ? 39  DG  I C5    1 
ATOM   785   C  C6    . DG  A 1 39  ? 55.969  54.505  22.156  1.00 87.19  ? 39  DG  I C6    1 
ATOM   786   O  O6    . DG  A 1 39  ? 56.740  53.554  21.995  1.00 87.19  ? 39  DG  I O6    1 
ATOM   787   N  N1    . DG  A 1 39  ? 55.398  54.741  23.405  1.00 87.19  ? 39  DG  I N1    1 
ATOM   788   C  C2    . DG  A 1 39  ? 54.542  55.773  23.701  1.00 87.19  ? 39  DG  I C2    1 
ATOM   789   N  N2    . DG  A 1 39  ? 54.092  55.826  24.959  1.00 87.19  ? 39  DG  I N2    1 
ATOM   790   N  N3    . DG  A 1 39  ? 54.156  56.679  22.829  1.00 87.19  ? 39  DG  I N3    1 
ATOM   791   C  C4    . DG  A 1 39  ? 54.694  56.464  21.612  1.00 87.19  ? 39  DG  I C4    1 
ATOM   792   P  P     . DG  A 1 40  ? 53.333  62.797  19.541  1.00 42.89  ? 40  DG  I P     1 
ATOM   793   O  OP1   . DG  A 1 40  ? 52.226  63.782  19.665  1.00 42.89  ? 40  DG  I OP1   1 
ATOM   794   O  OP2   . DG  A 1 40  ? 54.122  62.726  18.271  1.00 42.89  ? 40  DG  I OP2   1 
ATOM   795   O  "O5'" . DG  A 1 40  ? 54.324  63.014  20.772  1.00 51.93  ? 40  DG  I "O5'" 1 
ATOM   796   C  "C5'" . DG  A 1 40  ? 53.829  62.954  22.107  1.00 51.93  ? 40  DG  I "C5'" 1 
ATOM   797   C  "C4'" . DG  A 1 40  ? 54.924  62.572  23.078  1.00 51.93  ? 40  DG  I "C4'" 1 
ATOM   798   O  "O4'" . DG  A 1 40  ? 55.341  61.189  22.926  1.00 51.93  ? 40  DG  I "O4'" 1 
ATOM   799   C  "C3'" . DG  A 1 40  ? 56.206  63.410  23.040  1.00 51.93  ? 40  DG  I "C3'" 1 
ATOM   800   O  "O3'" . DG  A 1 40  ? 56.574  63.718  24.381  1.00 51.93  ? 40  DG  I "O3'" 1 
ATOM   801   C  "C2'" . DG  A 1 40  ? 57.235  62.450  22.464  1.00 51.93  ? 40  DG  I "C2'" 1 
ATOM   802   C  "C1'" . DG  A 1 40  ? 56.752  61.143  23.063  1.00 51.93  ? 40  DG  I "C1'" 1 
ATOM   803   N  N9    . DG  A 1 40  ? 57.256  59.895  22.483  1.00 80.43  ? 40  DG  I N9    1 
ATOM   804   C  C8    . DG  A 1 40  ? 57.638  59.655  21.182  1.00 80.43  ? 40  DG  I C8    1 
ATOM   805   N  N7    . DG  A 1 40  ? 58.088  58.441  20.993  1.00 80.43  ? 40  DG  I N7    1 
ATOM   806   C  C5    . DG  A 1 40  ? 57.990  57.837  22.243  1.00 80.43  ? 40  DG  I C5    1 
ATOM   807   C  C6    . DG  A 1 40  ? 58.333  56.511  22.670  1.00 80.43  ? 40  DG  I C6    1 
ATOM   808   O  O6    . DG  A 1 40  ? 58.817  55.579  22.008  1.00 80.43  ? 40  DG  I O6    1 
ATOM   809   N  N1    . DG  A 1 40  ? 58.058  56.323  24.023  1.00 80.43  ? 40  DG  I N1    1 
ATOM   810   C  C2    . DG  A 1 40  ? 57.528  57.277  24.863  1.00 80.43  ? 40  DG  I C2    1 
ATOM   811   N  N2    . DG  A 1 40  ? 57.328  56.899  26.144  1.00 80.43  ? 40  DG  I N2    1 
ATOM   812   N  N3    . DG  A 1 40  ? 57.213  58.508  24.482  1.00 80.43  ? 40  DG  I N3    1 
ATOM   813   C  C4    . DG  A 1 40  ? 57.468  58.717  23.171  1.00 80.43  ? 40  DG  I C4    1 
ATOM   814   P  P     . DA  A 1 41  ? 56.605  65.242  24.872  1.00 63.87  ? 41  DA  I P     1 
ATOM   815   O  OP1   . DA  A 1 41  ? 55.245  65.826  24.743  1.00 63.87  ? 41  DA  I OP1   1 
ATOM   816   O  OP2   . DA  A 1 41  ? 57.758  65.904  24.210  1.00 63.87  ? 41  DA  I OP2   1 
ATOM   817   O  "O5'" . DA  A 1 41  ? 56.929  65.112  26.422  1.00 64.83  ? 41  DA  I "O5'" 1 
ATOM   818   C  "C5'" . DA  A 1 41  ? 55.987  64.509  27.298  1.00 64.83  ? 41  DA  I "C5'" 1 
ATOM   819   C  "C4'" . DA  A 1 41  ? 56.686  63.618  28.299  1.00 64.83  ? 41  DA  I "C4'" 1 
ATOM   820   O  "O4'" . DA  A 1 41  ? 57.196  62.425  27.669  1.00 64.83  ? 41  DA  I "O4'" 1 
ATOM   821   C  "C3'" . DA  A 1 41  ? 57.862  64.241  29.041  1.00 64.83  ? 41  DA  I "C3'" 1 
ATOM   822   O  "O3'" . DA  A 1 41  ? 57.761  63.859  30.414  1.00 64.83  ? 41  DA  I "O3'" 1 
ATOM   823   C  "C2'" . DA  A 1 41  ? 59.078  63.637  28.355  1.00 64.83  ? 41  DA  I "C2'" 1 
ATOM   824   C  "C1'" . DA  A 1 41  ? 58.577  62.264  27.951  1.00 64.83  ? 41  DA  I "C1'" 1 
ATOM   825   N  N9    . DA  A 1 41  ? 59.187  61.682  26.755  1.00 75.11  ? 41  DA  I N9    1 
ATOM   826   C  C8    . DA  A 1 41  ? 59.343  62.266  25.521  1.00 75.11  ? 41  DA  I C8    1 
ATOM   827   N  N7    . DA  A 1 41  ? 59.855  61.467  24.616  1.00 75.11  ? 41  DA  I N7    1 
ATOM   828   C  C5    . DA  A 1 41  ? 60.069  60.278  25.304  1.00 75.11  ? 41  DA  I C5    1 
ATOM   829   C  C6    . DA  A 1 41  ? 60.585  59.026  24.900  1.00 75.11  ? 41  DA  I C6    1 
ATOM   830   N  N6    . DA  A 1 41  ? 60.994  58.758  23.656  1.00 75.11  ? 41  DA  I N6    1 
ATOM   831   N  N1    . DA  A 1 41  ? 60.664  58.049  25.833  1.00 75.11  ? 41  DA  I N1    1 
ATOM   832   C  C2    . DA  A 1 41  ? 60.250  58.318  27.085  1.00 75.11  ? 41  DA  I C2    1 
ATOM   833   N  N3    . DA  A 1 41  ? 59.747  59.450  27.584  1.00 75.11  ? 41  DA  I N3    1 
ATOM   834   C  C4    . DA  A 1 41  ? 59.679  60.403  26.630  1.00 75.11  ? 41  DA  I C4    1 
ATOM   835   P  P     . DA  A 1 42  ? 58.968  64.163  31.410  1.00 91.67  ? 42  DA  I P     1 
ATOM   836   O  OP1   . DA  A 1 42  ? 58.504  63.871  32.788  1.00 91.67  ? 42  DA  I OP1   1 
ATOM   837   O  OP2   . DA  A 1 42  ? 59.532  65.501  31.084  1.00 91.67  ? 42  DA  I OP2   1 
ATOM   838   O  "O5'" . DA  A 1 42  ? 60.020  63.061  30.982  1.00 94.41  ? 42  DA  I "O5'" 1 
ATOM   839   C  "C5'" . DA  A 1 42  ? 59.786  61.697  31.288  1.00 94.41  ? 42  DA  I "C5'" 1 
ATOM   840   C  "C4'" . DA  A 1 42  ? 61.108  60.994  31.447  1.00 94.41  ? 42  DA  I "C4'" 1 
ATOM   841   O  "O4'" . DA  A 1 42  ? 61.532  60.456  30.172  1.00 94.41  ? 42  DA  I "O4'" 1 
ATOM   842   C  "C3'" . DA  A 1 42  ? 62.208  61.950  31.908  1.00 94.41  ? 42  DA  I "C3'" 1 
ATOM   843   O  "O3'" . DA  A 1 42  ? 63.029  61.332  32.896  1.00 94.41  ? 42  DA  I "O3'" 1 
ATOM   844   C  "C2'" . DA  A 1 42  ? 62.981  62.235  30.633  1.00 94.41  ? 42  DA  I "C2'" 1 
ATOM   845   C  "C1'" . DA  A 1 42  ? 62.818  60.947  29.847  1.00 94.41  ? 42  DA  I "C1'" 1 
ATOM   846   N  N9    . DA  A 1 42  ? 62.866  61.124  28.400  1.00 91.43  ? 42  DA  I N9    1 
ATOM   847   C  C8    . DA  A 1 42  ? 62.506  62.235  27.675  1.00 91.43  ? 42  DA  I C8    1 
ATOM   848   N  N7    . DA  A 1 42  ? 62.664  62.094  26.381  1.00 91.43  ? 42  DA  I N7    1 
ATOM   849   C  C5    . DA  A 1 42  ? 63.160  60.804  26.244  1.00 91.43  ? 42  DA  I C5    1 
ATOM   850   C  C6    . DA  A 1 42  ? 63.527  60.045  25.118  1.00 91.43  ? 42  DA  I C6    1 
ATOM   851   N  N6    . DA  A 1 42  ? 63.455  60.498  23.860  1.00 91.43  ? 42  DA  I N6    1 
ATOM   852   N  N1    . DA  A 1 42  ? 63.975  58.786  25.331  1.00 91.43  ? 42  DA  I N1    1 
ATOM   853   C  C2    . DA  A 1 42  ? 64.046  58.332  26.590  1.00 91.43  ? 42  DA  I C2    1 
ATOM   854   N  N3    . DA  A 1 42  ? 63.731  58.949  27.725  1.00 91.43  ? 42  DA  I N3    1 
ATOM   855   C  C4    . DA  A 1 42  ? 63.289  60.195  27.481  1.00 91.43  ? 42  DA  I C4    1 
ATOM   856   P  P     . DA  A 1 43  ? 64.215  62.164  33.590  1.00 109.59 ? 43  DA  I P     1 
ATOM   857   O  OP1   . DA  A 1 43  ? 64.016  62.064  35.058  1.00 109.59 ? 43  DA  I OP1   1 
ATOM   858   O  OP2   . DA  A 1 43  ? 64.320  63.508  32.955  1.00 109.59 ? 43  DA  I OP2   1 
ATOM   859   O  "O5'" . DA  A 1 43  ? 65.504  61.316  33.193  1.00 114.51 ? 43  DA  I "O5'" 1 
ATOM   860   C  "C5'" . DA  A 1 43  ? 65.494  59.895  33.323  1.00 114.51 ? 43  DA  I "C5'" 1 
ATOM   861   C  "C4'" . DA  A 1 43  ? 66.658  59.276  32.584  1.00 114.51 ? 43  DA  I "C4'" 1 
ATOM   862   O  "O4'" . DA  A 1 43  ? 66.441  59.344  31.152  1.00 114.51 ? 43  DA  I "O4'" 1 
ATOM   863   C  "C3'" . DA  A 1 43  ? 68.021  59.921  32.855  1.00 114.51 ? 43  DA  I "C3'" 1 
ATOM   864   O  "O3'" . DA  A 1 43  ? 69.024  58.921  33.094  1.00 114.51 ? 43  DA  I "O3'" 1 
ATOM   865   C  "C2'" . DA  A 1 43  ? 68.310  60.688  31.577  1.00 114.51 ? 43  DA  I "C2'" 1 
ATOM   866   C  "C1'" . DA  A 1 43  ? 67.599  59.862  30.521  1.00 114.51 ? 43  DA  I "C1'" 1 
ATOM   867   N  N9    . DA  A 1 43  ? 67.179  60.644  29.357  1.00 76.76  ? 43  DA  I N9    1 
ATOM   868   C  C8    . DA  A 1 43  ? 66.604  61.893  29.344  1.00 76.76  ? 43  DA  I C8    1 
ATOM   869   N  N7    . DA  A 1 43  ? 66.390  62.364  28.140  1.00 76.76  ? 43  DA  I N7    1 
ATOM   870   C  C5    . DA  A 1 43  ? 66.841  61.352  27.300  1.00 76.76  ? 43  DA  I C5    1 
ATOM   871   C  C6    . DA  A 1 43  ? 66.900  61.241  25.900  1.00 76.76  ? 43  DA  I C6    1 
ATOM   872   N  N6    . DA  A 1 43  ? 66.487  62.199  25.067  1.00 76.76  ? 43  DA  I N6    1 
ATOM   873   N  N1    . DA  A 1 43  ? 67.408  60.101  25.379  1.00 76.76  ? 43  DA  I N1    1 
ATOM   874   C  C2    . DA  A 1 43  ? 67.825  59.145  26.217  1.00 76.76  ? 43  DA  I C2    1 
ATOM   875   N  N3    . DA  A 1 43  ? 67.825  59.133  27.547  1.00 76.76  ? 43  DA  I N3    1 
ATOM   876   C  C4    . DA  A 1 43  ? 67.316  60.281  28.035  1.00 76.76  ? 43  DA  I C4    1 
ATOM   877   P  P     . DC  A 1 44  ? 70.375  59.307  33.889  1.00 135.14 ? 44  DC  I P     1 
ATOM   878   O  OP1   . DC  A 1 44  ? 70.648  58.274  34.932  1.00 135.14 ? 44  DC  I OP1   1 
ATOM   879   O  OP2   . DC  A 1 44  ? 70.286  60.734  34.289  1.00 135.14 ? 44  DC  I OP2   1 
ATOM   880   O  "O5'" . DC  A 1 44  ? 71.487  59.201  32.753  1.00 105.23 ? 44  DC  I "O5'" 1 
ATOM   881   C  "C5'" . DC  A 1 44  ? 71.352  59.935  31.539  1.00 105.23 ? 44  DC  I "C5'" 1 
ATOM   882   C  "C4'" . DC  A 1 44  ? 72.003  59.193  30.396  1.00 105.23 ? 44  DC  I "C4'" 1 
ATOM   883   O  "O4'" . DC  A 1 44  ? 71.201  59.412  29.212  1.00 105.23 ? 44  DC  I "O4'" 1 
ATOM   884   C  "C3'" . DC  A 1 44  ? 73.402  59.708  30.060  1.00 105.23 ? 44  DC  I "C3'" 1 
ATOM   885   O  "O3'" . DC  A 1 44  ? 74.259  58.644  29.606  1.00 105.23 ? 44  DC  I "O3'" 1 
ATOM   886   C  "C2'" . DC  A 1 44  ? 73.142  60.738  28.977  1.00 105.23 ? 44  DC  I "C2'" 1 
ATOM   887   C  "C1'" . DC  A 1 44  ? 71.908  60.201  28.262  1.00 105.23 ? 44  DC  I "C1'" 1 
ATOM   888   N  N1    . DC  A 1 44  ? 71.006  61.273  27.794  1.00 73.33  ? 44  DC  I N1    1 
ATOM   889   C  C2    . DC  A 1 44  ? 70.648  61.332  26.426  1.00 73.33  ? 44  DC  I C2    1 
ATOM   890   O  O2    . DC  A 1 44  ? 71.066  60.461  25.644  1.00 73.33  ? 44  DC  I O2    1 
ATOM   891   N  N3    . DC  A 1 44  ? 69.852  62.342  25.996  1.00 73.33  ? 44  DC  I N3    1 
ATOM   892   C  C4    . DC  A 1 44  ? 69.408  63.261  26.861  1.00 73.33  ? 44  DC  I C4    1 
ATOM   893   N  N4    . DC  A 1 44  ? 68.633  64.244  26.385  1.00 73.33  ? 44  DC  I N4    1 
ATOM   894   C  C5    . DC  A 1 44  ? 69.739  63.215  28.252  1.00 73.33  ? 44  DC  I C5    1 
ATOM   895   C  C6    . DC  A 1 44  ? 70.532  62.213  28.670  1.00 73.33  ? 44  DC  I C6    1 
ATOM   896   P  P     . DT  A 1 45  ? 75.851  58.894  29.471  1.00 89.38  ? 45  DT  I P     1 
ATOM   897   O  OP1   . DT  A 1 45  ? 76.577  57.597  29.503  1.00 89.38  ? 45  DT  I OP1   1 
ATOM   898   O  OP2   . DT  A 1 45  ? 76.229  59.968  30.424  1.00 89.38  ? 45  DT  I OP2   1 
ATOM   899   O  "O5'" . DT  A 1 45  ? 76.000  59.474  28.004  1.00 120.01 ? 45  DT  I "O5'" 1 
ATOM   900   C  "C5'" . DT  A 1 45  ? 75.826  58.629  26.878  1.00 120.01 ? 45  DT  I "C5'" 1 
ATOM   901   C  "C4'" . DT  A 1 45  ? 76.193  59.380  25.625  1.00 120.01 ? 45  DT  I "C4'" 1 
ATOM   902   O  "O4'" . DT  A 1 45  ? 75.170  60.370  25.343  1.00 120.01 ? 45  DT  I "O4'" 1 
ATOM   903   C  "C3'" . DT  A 1 45  ? 77.505  60.153  25.771  1.00 120.01 ? 45  DT  I "C3'" 1 
ATOM   904   O  "O3'" . DT  A 1 45  ? 78.235  60.113  24.545  1.00 120.01 ? 45  DT  I "O3'" 1 
ATOM   905   C  "C2'" . DT  A 1 45  ? 77.042  61.567  26.071  1.00 120.01 ? 45  DT  I "C2'" 1 
ATOM   906   C  "C1'" . DT  A 1 45  ? 75.769  61.652  25.248  1.00 120.01 ? 45  DT  I "C1'" 1 
ATOM   907   N  N1    . DT  A 1 45  ? 74.797  62.660  25.715  1.00 82.12  ? 45  DT  I N1    1 
ATOM   908   C  C2    . DT  A 1 45  ? 74.039  63.324  24.768  1.00 82.12  ? 45  DT  I C2    1 
ATOM   909   O  O2    . DT  A 1 45  ? 74.106  63.089  23.568  1.00 82.12  ? 45  DT  I O2    1 
ATOM   910   N  N3    . DT  A 1 45  ? 73.191  64.278  25.282  1.00 82.12  ? 45  DT  I N3    1 
ATOM   911   C  C4    . DT  A 1 45  ? 73.023  64.618  26.615  1.00 82.12  ? 45  DT  I C4    1 
ATOM   912   O  O4    . DT  A 1 45  ? 72.228  65.506  26.927  1.00 82.12  ? 45  DT  I O4    1 
ATOM   913   C  C5    . DT  A 1 45  ? 73.834  63.866  27.552  1.00 82.12  ? 45  DT  I C5    1 
ATOM   914   C  C7    . DT  A 1 45  ? 73.707  64.151  29.017  1.00 82.12  ? 45  DT  I C7    1 
ATOM   915   C  C6    . DT  A 1 45  ? 74.668  62.937  27.059  1.00 82.12  ? 45  DT  I C6    1 
ATOM   916   P  P     . DG  A 1 46  ? 79.678  60.811  24.450  1.00 84.74  ? 46  DG  I P     1 
ATOM   917   O  OP1   . DG  A 1 46  ? 80.673  59.813  24.907  1.00 84.74  ? 46  DG  I OP1   1 
ATOM   918   O  OP2   . DG  A 1 46  ? 79.627  62.145  25.103  1.00 84.74  ? 46  DG  I OP2   1 
ATOM   919   O  "O5'" . DG  A 1 46  ? 79.867  61.037  22.885  1.00 85.38  ? 46  DG  I "O5'" 1 
ATOM   920   C  "C5'" . DG  A 1 46  ? 78.959  60.458  21.942  1.00 85.38  ? 46  DG  I "C5'" 1 
ATOM   921   C  "C4'" . DG  A 1 46  ? 78.583  61.472  20.885  1.00 85.38  ? 46  DG  I "C4'" 1 
ATOM   922   O  "O4'" . DG  A 1 46  ? 77.621  62.433  21.388  1.00 85.38  ? 46  DG  I "O4'" 1 
ATOM   923   C  "C3'" . DG  A 1 46  ? 79.747  62.296  20.335  1.00 85.38  ? 46  DG  I "C3'" 1 
ATOM   924   O  "O3'" . DG  A 1 46  ? 79.546  62.497  18.939  1.00 85.38  ? 46  DG  I "O3'" 1 
ATOM   925   C  "C2'" . DG  A 1 46  ? 79.631  63.612  21.085  1.00 85.38  ? 46  DG  I "C2'" 1 
ATOM   926   C  "C1'" . DG  A 1 46  ? 78.125  63.755  21.227  1.00 85.38  ? 46  DG  I "C1'" 1 
ATOM   927   N  N9    . DG  A 1 46  ? 77.688  64.537  22.378  1.00 97.88  ? 46  DG  I N9    1 
ATOM   928   C  C8    . DG  A 1 46  ? 78.163  64.465  23.667  1.00 97.88  ? 46  DG  I C8    1 
ATOM   929   N  N7    . DG  A 1 46  ? 77.543  65.268  24.487  1.00 97.88  ? 46  DG  I N7    1 
ATOM   930   C  C5    . DG  A 1 46  ? 76.607  65.913  23.690  1.00 97.88  ? 46  DG  I C5    1 
ATOM   931   C  C6    . DG  A 1 46  ? 75.631  66.892  24.022  1.00 97.88  ? 46  DG  I C6    1 
ATOM   932   O  O6    . DG  A 1 46  ? 75.373  67.384  25.127  1.00 97.88  ? 46  DG  I O6    1 
ATOM   933   N  N1    . DG  A 1 46  ? 74.904  67.286  22.903  1.00 97.88  ? 46  DG  I N1    1 
ATOM   934   C  C2    . DG  A 1 46  ? 75.077  66.790  21.635  1.00 97.88  ? 46  DG  I C2    1 
ATOM   935   N  N2    . DG  A 1 46  ? 74.266  67.302  20.700  1.00 97.88  ? 46  DG  I N2    1 
ATOM   936   N  N3    . DG  A 1 46  ? 75.970  65.869  21.314  1.00 97.88  ? 46  DG  I N3    1 
ATOM   937   C  C4    . DG  A 1 46  ? 76.696  65.481  22.383  1.00 97.88  ? 46  DG  I C4    1 
ATOM   938   P  P     . DC  A 1 47  ? 80.741  63.063  18.033  1.00 93.20  ? 47  DC  I P     1 
ATOM   939   O  OP1   . DC  A 1 47  ? 81.229  61.973  17.141  1.00 93.20  ? 47  DC  I OP1   1 
ATOM   940   O  OP2   . DC  A 1 47  ? 81.685  63.769  18.941  1.00 93.20  ? 47  DC  I OP2   1 
ATOM   941   O  "O5'" . DC  A 1 47  ? 80.014  64.138  17.117  1.00 97.12  ? 47  DC  I "O5'" 1 
ATOM   942   C  "C5'" . DC  A 1 47  ? 78.600  64.306  17.195  1.00 97.12  ? 47  DC  I "C5'" 1 
ATOM   943   C  "C4'" . DC  A 1 47  ? 78.243  65.761  17.028  1.00 97.12  ? 47  DC  I "C4'" 1 
ATOM   944   O  "O4'" . DC  A 1 47  ? 77.992  66.360  18.323  1.00 97.12  ? 47  DC  I "O4'" 1 
ATOM   945   C  "C3'" . DC  A 1 47  ? 79.360  66.570  16.384  1.00 97.12  ? 47  DC  I "C3'" 1 
ATOM   946   O  "O3'" . DC  A 1 47  ? 78.784  67.452  15.428  1.00 97.12  ? 47  DC  I "O3'" 1 
ATOM   947   C  "C2'" . DC  A 1 47  ? 80.009  67.292  17.557  1.00 97.12  ? 47  DC  I "C2'" 1 
ATOM   948   C  "C1'" . DC  A 1 47  ? 78.861  67.458  18.542  1.00 97.12  ? 47  DC  I "C1'" 1 
ATOM   949   N  N1    . DC  A 1 47  ? 79.222  67.479  19.980  1.00 65.35  ? 47  DC  I N1    1 
ATOM   950   C  C2    . DC  A 1 47  ? 78.547  68.369  20.828  1.00 65.35  ? 47  DC  I C2    1 
ATOM   951   O  O2    . DC  A 1 47  ? 77.647  69.071  20.363  1.00 65.35  ? 47  DC  I O2    1 
ATOM   952   N  N3    . DC  A 1 47  ? 78.883  68.435  22.137  1.00 65.35  ? 47  DC  I N3    1 
ATOM   953   C  C4    . DC  A 1 47  ? 79.833  67.642  22.620  1.00 65.35  ? 47  DC  I C4    1 
ATOM   954   N  N4    . DC  A 1 47  ? 80.126  67.753  23.920  1.00 65.35  ? 47  DC  I N4    1 
ATOM   955   C  C5    . DC  A 1 47  ? 80.524  66.703  21.793  1.00 65.35  ? 47  DC  I C5    1 
ATOM   956   C  C6    . DC  A 1 47  ? 80.192  66.659  20.487  1.00 65.35  ? 47  DC  I C6    1 
ATOM   957   P  P     . DT  A 1 48  ? 79.374  67.515  13.931  1.00 93.31  ? 48  DT  I P     1 
ATOM   958   O  OP1   . DT  A 1 48  ? 78.377  66.952  12.967  1.00 93.31  ? 48  DT  I OP1   1 
ATOM   959   O  OP2   . DT  A 1 48  ? 80.757  66.979  13.957  1.00 93.31  ? 48  DT  I OP2   1 
ATOM   960   O  "O5'" . DT  A 1 48  ? 79.481  69.083  13.698  1.00 70.47  ? 48  DT  I "O5'" 1 
ATOM   961   C  "C5'" . DT  A 1 48  ? 79.382  69.971  14.814  1.00 70.47  ? 48  DT  I "C5'" 1 
ATOM   962   C  "C4'" . DT  A 1 48  ? 77.978  70.526  14.923  1.00 70.47  ? 48  DT  I "C4'" 1 
ATOM   963   O  "O4'" . DT  A 1 48  ? 77.591  70.556  16.309  1.00 70.47  ? 48  DT  I "O4'" 1 
ATOM   964   C  "C3'" . DT  A 1 48  ? 77.824  71.959  14.432  1.00 70.47  ? 48  DT  I "C3'" 1 
ATOM   965   O  "O3'" . DT  A 1 48  ? 76.489  72.177  13.945  1.00 70.47  ? 48  DT  I "O3'" 1 
ATOM   966   C  "C2'" . DT  A 1 48  ? 78.146  72.769  15.678  1.00 70.47  ? 48  DT  I "C2'" 1 
ATOM   967   C  "C1'" . DT  A 1 48  ? 77.682  71.875  16.822  1.00 70.47  ? 48  DT  I "C1'" 1 
ATOM   968   N  N1    . DT  A 1 48  ? 78.590  71.815  17.978  1.00 98.38  ? 48  DT  I N1    1 
ATOM   969   C  C2    . DT  A 1 48  ? 78.271  72.519  19.112  1.00 98.38  ? 48  DT  I C2    1 
ATOM   970   O  O2    . DT  A 1 48  ? 77.308  73.260  19.187  1.00 98.38  ? 48  DT  I O2    1 
ATOM   971   N  N3    . DT  A 1 48  ? 79.125  72.320  20.166  1.00 98.38  ? 48  DT  I N3    1 
ATOM   972   C  C4    . DT  A 1 48  ? 80.243  71.518  20.197  1.00 98.38  ? 48  DT  I C4    1 
ATOM   973   O  O4    . DT  A 1 48  ? 80.890  71.416  21.237  1.00 98.38  ? 48  DT  I O4    1 
ATOM   974   C  C5    . DT  A 1 48  ? 80.543  70.839  18.955  1.00 98.38  ? 48  DT  I C5    1 
ATOM   975   C  C7    . DT  A 1 48  ? 81.748  69.956  18.877  1.00 98.38  ? 48  DT  I C7    1 
ATOM   976   C  C6    . DT  A 1 48  ? 79.716  71.026  17.922  1.00 98.38  ? 48  DT  I C6    1 
ATOM   977   P  P     . DC  A 1 49  ? 76.156  73.491  13.072  1.00 65.72  ? 49  DC  I P     1 
ATOM   978   O  OP1   . DC  A 1 49  ? 74.862  73.290  12.362  1.00 65.72  ? 49  DC  I OP1   1 
ATOM   979   O  OP2   . DC  A 1 49  ? 77.379  73.832  12.301  1.00 65.72  ? 49  DC  I OP2   1 
ATOM   980   O  "O5'" . DC  A 1 49  ? 75.873  74.590  14.174  1.00 37.82  ? 49  DC  I "O5'" 1 
ATOM   981   C  "C5'" . DC  A 1 49  ? 75.082  74.237  15.292  1.00 37.82  ? 49  DC  I "C5'" 1 
ATOM   982   C  "C4'" . DC  A 1 49  ? 74.887  75.434  16.177  1.00 37.82  ? 49  DC  I "C4'" 1 
ATOM   983   O  "O4'" . DC  A 1 49  ? 75.929  75.477  17.178  1.00 37.82  ? 49  DC  I "O4'" 1 
ATOM   984   C  "C3'" . DC  A 1 49  ? 74.985  76.743  15.413  1.00 37.82  ? 49  DC  I "C3'" 1 
ATOM   985   O  "O3'" . DC  A 1 49  ? 74.022  77.627  15.999  1.00 37.82  ? 49  DC  I "O3'" 1 
ATOM   986   C  "C2'" . DC  A 1 49  ? 76.438  77.149  15.615  1.00 37.82  ? 49  DC  I "C2'" 1 
ATOM   987   C  "C1'" . DC  A 1 49  ? 76.734  76.638  17.014  1.00 37.82  ? 49  DC  I "C1'" 1 
ATOM   988   N  N1    . DC  A 1 49  ? 78.133  76.239  17.274  1.00 81.63  ? 49  DC  I N1    1 
ATOM   989   C  C2    . DC  A 1 49  ? 78.586  76.159  18.606  1.00 81.63  ? 49  DC  I C2    1 
ATOM   990   O  O2    . DC  A 1 49  ? 77.837  76.531  19.527  1.00 81.63  ? 49  DC  I O2    1 
ATOM   991   N  N3    . DC  A 1 49  ? 79.827  75.679  18.850  1.00 81.63  ? 49  DC  I N3    1 
ATOM   992   C  C4    . DC  A 1 49  ? 80.609  75.305  17.838  1.00 81.63  ? 49  DC  I C4    1 
ATOM   993   N  N4    . DC  A 1 49  ? 81.790  74.772  18.127  1.00 81.63  ? 49  DC  I N4    1 
ATOM   994   C  C5    . DC  A 1 49  ? 80.204  75.442  16.481  1.00 81.63  ? 49  DC  I C5    1 
ATOM   995   C  C6    . DC  A 1 49  ? 78.971  75.911  16.246  1.00 81.63  ? 49  DC  I C6    1 
ATOM   996   P  P     . DC  A 1 50  ? 74.239  79.206  15.947  1.00 53.70  ? 50  DC  I P     1 
ATOM   997   O  OP1   . DC  A 1 50  ? 73.294  79.774  14.940  1.00 53.70  ? 50  DC  I OP1   1 
ATOM   998   O  OP2   . DC  A 1 50  ? 75.688  79.497  15.807  1.00 53.70  ? 50  DC  I OP2   1 
ATOM   999   O  "O5'" . DC  A 1 50  ? 73.861  79.614  17.432  1.00 37.09  ? 50  DC  I "O5'" 1 
ATOM   1000  C  "C5'" . DC  A 1 50  ? 74.711  80.509  18.105  1.00 37.09  ? 50  DC  I "C5'" 1 
ATOM   1001  C  "C4'" . DC  A 1 50  ? 74.622  80.365  19.606  1.00 37.09  ? 50  DC  I "C4'" 1 
ATOM   1002  O  "O4'" . DC  A 1 50  ? 75.652  79.454  20.057  1.00 37.09  ? 50  DC  I "O4'" 1 
ATOM   1003  C  "C3'" . DC  A 1 50  ? 75.017  81.720  20.178  1.00 37.09  ? 50  DC  I "C3'" 1 
ATOM   1004  O  "O3'" . DC  A 1 50  ? 74.354  82.103  21.356  1.00 37.09  ? 50  DC  I "O3'" 1 
ATOM   1005  C  "C2'" . DC  A 1 50  ? 76.510  81.637  20.397  1.00 37.09  ? 50  DC  I "C2'" 1 
ATOM   1006  C  "C1'" . DC  A 1 50  ? 76.754  80.167  20.652  1.00 37.09  ? 50  DC  I "C1'" 1 
ATOM   1007  N  N1    . DC  A 1 50  ? 78.008  79.715  20.004  1.00 51.49  ? 50  DC  I N1    1 
ATOM   1008  C  C2    . DC  A 1 50  ? 79.002  79.089  20.779  1.00 51.49  ? 50  DC  I C2    1 
ATOM   1009  O  O2    . DC  A 1 50  ? 78.833  78.962  22.001  1.00 51.49  ? 50  DC  I O2    1 
ATOM   1010  N  N3    . DC  A 1 50  ? 80.123  78.649  20.177  1.00 51.49  ? 50  DC  I N3    1 
ATOM   1011  C  C4    . DC  A 1 50  ? 80.290  78.824  18.866  1.00 51.49  ? 50  DC  I C4    1 
ATOM   1012  N  N4    . DC  A 1 50  ? 81.417  78.361  18.310  1.00 51.49  ? 50  DC  I N4    1 
ATOM   1013  C  C5    . DC  A 1 50  ? 79.313  79.477  18.061  1.00 51.49  ? 50  DC  I C5    1 
ATOM   1014  C  C6    . DC  A 1 50  ? 78.199  79.902  18.663  1.00 51.49  ? 50  DC  I C6    1 
ATOM   1015  P  P     . DA  A 1 51  ? 74.351  83.652  21.721  1.00 35.38  ? 51  DA  I P     1 
ATOM   1016  O  OP1   . DA  A 1 51  ? 73.059  84.050  22.327  1.00 35.38  ? 51  DA  I OP1   1 
ATOM   1017  O  OP2   . DA  A 1 51  ? 74.837  84.321  20.469  1.00 35.38  ? 51  DA  I OP2   1 
ATOM   1018  O  "O5'" . DA  A 1 51  ? 75.474  83.774  22.827  1.00 41.04  ? 51  DA  I "O5'" 1 
ATOM   1019  C  "C5'" . DA  A 1 51  ? 75.313  83.163  24.097  1.00 41.04  ? 51  DA  I "C5'" 1 
ATOM   1020  C  "C4'" . DA  A 1 51  ? 76.523  83.466  24.943  1.00 41.04  ? 51  DA  I "C4'" 1 
ATOM   1021  O  "O4'" . DA  A 1 51  ? 77.671  82.861  24.293  1.00 41.04  ? 51  DA  I "O4'" 1 
ATOM   1022  C  "C3'" . DA  A 1 51  ? 76.828  84.962  25.041  1.00 41.04  ? 51  DA  I "C3'" 1 
ATOM   1023  O  "O3'" . DA  A 1 51  ? 77.303  85.275  26.350  1.00 41.04  ? 51  DA  I "O3'" 1 
ATOM   1024  C  "C2'" . DA  A 1 51  ? 77.885  85.181  23.975  1.00 41.04  ? 51  DA  I "C2'" 1 
ATOM   1025  C  "C1'" . DA  A 1 51  ? 78.619  83.852  23.945  1.00 41.04  ? 51  DA  I "C1'" 1 
ATOM   1026  N  N9    . DA  A 1 51  ? 79.185  83.484  22.648  1.00 73.66  ? 51  DA  I N9    1 
ATOM   1027  C  C8    . DA  A 1 51  ? 78.753  83.844  21.395  1.00 73.66  ? 51  DA  I C8    1 
ATOM   1028  N  N7    . DA  A 1 51  ? 79.484  83.353  20.424  1.00 73.66  ? 51  DA  I N7    1 
ATOM   1029  C  C5    . DA  A 1 51  ? 80.459  82.616  21.082  1.00 73.66  ? 51  DA  I C5    1 
ATOM   1030  C  C6    . DA  A 1 51  ? 81.540  81.854  20.617  1.00 73.66  ? 51  DA  I C6    1 
ATOM   1031  N  N6    . DA  A 1 51  ? 81.817  81.685  19.325  1.00 73.66  ? 51  DA  I N6    1 
ATOM   1032  N  N1    . DA  A 1 51  ? 82.336  81.261  21.534  1.00 73.66  ? 51  DA  I N1    1 
ATOM   1033  C  C2    . DA  A 1 51  ? 82.048  81.421  22.828  1.00 73.66  ? 51  DA  I C2    1 
ATOM   1034  N  N3    . DA  A 1 51  ? 81.055  82.104  23.389  1.00 73.66  ? 51  DA  I N3    1 
ATOM   1035  C  C4    . DA  A 1 51  ? 80.288  82.688  22.450  1.00 73.66  ? 51  DA  I C4    1 
ATOM   1036  P  P     . DT  A 1 52  ? 77.972  86.709  26.642  1.00 66.62  ? 52  DT  I P     1 
ATOM   1037  O  OP1   . DT  A 1 52  ? 77.614  87.092  28.031  1.00 66.62  ? 52  DT  I OP1   1 
ATOM   1038  O  OP2   . DT  A 1 52  ? 77.681  87.645  25.523  1.00 66.62  ? 52  DT  I OP2   1 
ATOM   1039  O  "O5'" . DT  A 1 52  ? 79.527  86.375  26.596  1.00 76.18  ? 52  DT  I "O5'" 1 
ATOM   1040  C  "C5'" . DT  A 1 52  ? 80.064  85.320  27.397  1.00 76.18  ? 52  DT  I "C5'" 1 
ATOM   1041  C  "C4'" . DT  A 1 52  ? 81.571  85.310  27.310  1.00 76.18  ? 52  DT  I "C4'" 1 
ATOM   1042  O  "O4'" . DT  A 1 52  ? 81.985  84.790  26.022  1.00 76.18  ? 52  DT  I "O4'" 1 
ATOM   1043  C  "C3'" . DT  A 1 52  ? 82.220  86.692  27.442  1.00 76.18  ? 52  DT  I "C3'" 1 
ATOM   1044  O  "O3'" . DT  A 1 52  ? 83.412  86.622  28.236  1.00 76.18  ? 52  DT  I "O3'" 1 
ATOM   1045  C  "C2'" . DT  A 1 52  ? 82.580  87.040  26.011  1.00 76.18  ? 52  DT  I "C2'" 1 
ATOM   1046  C  "C1'" . DT  A 1 52  ? 82.933  85.675  25.461  1.00 76.18  ? 52  DT  I "C1'" 1 
ATOM   1047  N  N1    . DT  A 1 52  ? 82.848  85.582  24.004  1.00 111.58 ? 52  DT  I N1    1 
ATOM   1048  C  C2    . DT  A 1 52  ? 83.806  84.852  23.334  1.00 111.58 ? 52  DT  I C2    1 
ATOM   1049  O  O2    . DT  A 1 52  ? 84.692  84.220  23.897  1.00 111.58 ? 52  DT  I O2    1 
ATOM   1050  N  N3    . DT  A 1 52  ? 83.683  84.880  21.971  1.00 111.58 ? 52  DT  I N3    1 
ATOM   1051  C  C4    . DT  A 1 52  ? 82.708  85.524  21.232  1.00 111.58 ? 52  DT  I C4    1 
ATOM   1052  O  O4    . DT  A 1 52  ? 82.728  85.461  20.012  1.00 111.58 ? 52  DT  I O4    1 
ATOM   1053  C  C5    . DT  A 1 52  ? 81.722  86.239  22.001  1.00 111.58 ? 52  DT  I C5    1 
ATOM   1054  C  C7    . DT  A 1 52  ? 80.616  86.949  21.285  1.00 111.58 ? 52  DT  I C7    1 
ATOM   1055  C  C6    . DT  A 1 52  ? 81.841  86.235  23.332  1.00 111.58 ? 52  DT  I C6    1 
ATOM   1056  P  P     . DC  A 1 53  ? 84.029  87.962  28.880  1.00 81.59  ? 53  DC  I P     1 
ATOM   1057  O  OP1   . DC  A 1 53  ? 83.945  87.804  30.355  1.00 81.59  ? 53  DC  I OP1   1 
ATOM   1058  O  OP2   . DC  A 1 53  ? 83.417  89.152  28.225  1.00 81.59  ? 53  DC  I OP2   1 
ATOM   1059  O  "O5'" . DC  A 1 53  ? 85.555  87.913  28.432  1.00 99.57  ? 53  DC  I "O5'" 1 
ATOM   1060  C  "C5'" . DC  A 1 53  ? 85.883  87.643  27.080  1.00 99.57  ? 53  DC  I "C5'" 1 
ATOM   1061  C  "C4'" . DC  A 1 53  ? 87.378  87.667  26.879  1.00 99.57  ? 53  DC  I "C4'" 1 
ATOM   1062  O  "O4'" . DC  A 1 53  ? 87.599  87.122  25.560  1.00 99.57  ? 53  DC  I "O4'" 1 
ATOM   1063  C  "C3'" . DC  A 1 53  ? 87.955  89.081  26.856  1.00 99.57  ? 53  DC  I "C3'" 1 
ATOM   1064  O  "O3'" . DC  A 1 53  ? 89.295  89.168  27.351  1.00 99.57  ? 53  DC  I "O3'" 1 
ATOM   1065  C  "C2'" . DC  A 1 53  ? 87.914  89.473  25.395  1.00 99.57  ? 53  DC  I "C2'" 1 
ATOM   1066  C  "C1'" . DC  A 1 53  ? 87.872  88.160  24.627  1.00 99.57  ? 53  DC  I "C1'" 1 
ATOM   1067  N  N1    . DC  A 1 53  ? 86.749  88.224  23.691  1.00 94.23  ? 53  DC  I N1    1 
ATOM   1068  C  C2    . DC  A 1 53  ? 86.851  87.628  22.435  1.00 94.23  ? 53  DC  I C2    1 
ATOM   1069  O  O2    . DC  A 1 53  ? 87.870  86.980  22.150  1.00 94.23  ? 53  DC  I O2    1 
ATOM   1070  N  N3    . DC  A 1 53  ? 85.833  87.776  21.560  1.00 94.23  ? 53  DC  I N3    1 
ATOM   1071  C  C4    . DC  A 1 53  ? 84.752  88.480  21.907  1.00 94.23  ? 53  DC  I C4    1 
ATOM   1072  N  N4    . DC  A 1 53  ? 83.795  88.644  21.004  1.00 94.23  ? 53  DC  I N4    1 
ATOM   1073  C  C5    . DC  A 1 53  ? 84.610  89.058  23.195  1.00 94.23  ? 53  DC  I C5    1 
ATOM   1074  C  C6    . DC  A 1 53  ? 85.618  88.904  24.047  1.00 94.23  ? 53  DC  I C6    1 
ATOM   1075  P  P     . DA  A 1 54  ? 90.124  90.535  27.134  1.00 113.09 ? 54  DA  I P     1 
ATOM   1076  O  OP1   . DA  A 1 54  ? 91.235  90.566  28.116  1.00 113.09 ? 54  DA  I OP1   1 
ATOM   1077  O  OP2   . DA  A 1 54  ? 89.153  91.666  27.092  1.00 113.09 ? 54  DA  I OP2   1 
ATOM   1078  O  "O5'" . DA  A 1 54  ? 90.744  90.372  25.672  1.00 119.58 ? 54  DA  I "O5'" 1 
ATOM   1079  C  "C5'" . DA  A 1 54  ? 91.633  89.293  25.370  1.00 119.58 ? 54  DA  I "C5'" 1 
ATOM   1080  C  "C4'" . DA  A 1 54  ? 92.247  89.475  23.999  1.00 119.58 ? 54  DA  I "C4'" 1 
ATOM   1081  O  "O4'" . DA  A 1 54  ? 91.229  89.315  22.985  1.00 119.58 ? 54  DA  I "O4'" 1 
ATOM   1082  C  "C3'" . DA  A 1 54  ? 92.874  90.848  23.752  1.00 119.58 ? 54  DA  I "C3'" 1 
ATOM   1083  O  "O3'" . DA  A 1 54  ? 94.010  90.741  22.888  1.00 119.58 ? 54  DA  I "O3'" 1 
ATOM   1084  C  "C2'" . DA  A 1 54  ? 91.771  91.602  23.042  1.00 119.58 ? 54  DA  I "C2'" 1 
ATOM   1085  C  "C1'" . DA  A 1 54  ? 91.126  90.504  22.219  1.00 119.58 ? 54  DA  I "C1'" 1 
ATOM   1086  N  N9    . DA  A 1 54  ? 89.713  90.745  21.960  1.00 120.14 ? 54  DA  I N9    1 
ATOM   1087  C  C8    . DA  A 1 54  ? 88.752  91.235  22.812  1.00 120.14 ? 54  DA  I C8    1 
ATOM   1088  N  N7    . DA  A 1 54  ? 87.574  91.360  22.258  1.00 120.14 ? 54  DA  I N7    1 
ATOM   1089  C  C5    . DA  A 1 54  ? 87.774  90.917  20.959  1.00 120.14 ? 54  DA  I C5    1 
ATOM   1090  C  C6    . DA  A 1 54  ? 86.922  90.806  19.868  1.00 120.14 ? 54  DA  I C6    1 
ATOM   1091  N  N6    . DA  A 1 54  ? 85.632  91.143  19.906  1.00 120.14 ? 54  DA  I N6    1 
ATOM   1092  N  N1    . DA  A 1 54  ? 87.441  90.330  18.716  1.00 120.14 ? 54  DA  I N1    1 
ATOM   1093  C  C2    . DA  A 1 54  ? 88.733  89.995  18.679  1.00 120.14 ? 54  DA  I C2    1 
ATOM   1094  N  N3    . DA  A 1 54  ? 89.635  90.054  19.640  1.00 120.14 ? 54  DA  I N3    1 
ATOM   1095  C  C4    . DA  A 1 54  ? 89.084  90.531  20.767  1.00 120.14 ? 54  DA  I C4    1 
ATOM   1096  P  P     . DA  A 1 55  ? 94.915  92.038  22.604  1.00 142.98 ? 55  DA  I P     1 
ATOM   1097  O  OP1   . DA  A 1 55  ? 96.332  91.629  22.735  1.00 142.98 ? 55  DA  I OP1   1 
ATOM   1098  O  OP2   . DA  A 1 55  ? 94.396  93.163  23.427  1.00 142.98 ? 55  DA  I OP2   1 
ATOM   1099  O  "O5'" . DA  A 1 55  ? 94.640  92.369  21.073  1.00 156.61 ? 55  DA  I "O5'" 1 
ATOM   1100  C  "C5'" . DA  A 1 55  ? 95.199  91.558  20.046  1.00 156.61 ? 55  DA  I "C5'" 1 
ATOM   1101  C  "C4'" . DA  A 1 55  ? 94.995  92.205  18.698  1.00 156.61 ? 55  DA  I "C4'" 1 
ATOM   1102  O  "O4'" . DA  A 1 55  ? 93.563  92.257  18.472  1.00 156.61 ? 55  DA  I "O4'" 1 
ATOM   1103  C  "C3'" . DA  A 1 55  ? 95.507  93.644  18.593  1.00 156.61 ? 55  DA  I "C3'" 1 
ATOM   1104  O  "O3'" . DA  A 1 55  ? 96.477  93.871  17.530  1.00 156.61 ? 55  DA  I "O3'" 1 
ATOM   1105  C  "C2'" . DA  A 1 55  ? 94.265  94.522  18.640  1.00 156.61 ? 55  DA  I "C2'" 1 
ATOM   1106  C  "C1'" . DA  A 1 55  ? 93.104  93.592  18.285  1.00 156.61 ? 55  DA  I "C1'" 1 
ATOM   1107  N  N9    . DA  A 1 55  ? 91.904  93.784  19.115  1.00 79.18  ? 55  DA  I N9    1 
ATOM   1108  C  C8    . DA  A 1 55  ? 91.849  94.284  20.398  1.00 79.18  ? 55  DA  I C8    1 
ATOM   1109  N  N7    . DA  A 1 55  ? 90.630  94.382  20.878  1.00 79.18  ? 55  DA  I N7    1 
ATOM   1110  C  C5    . DA  A 1 55  ? 89.825  93.905  19.852  1.00 79.18  ? 55  DA  I C5    1 
ATOM   1111  C  C6    . DA  A 1 55  ? 88.429  93.756  19.734  1.00 79.18  ? 55  DA  I C6    1 
ATOM   1112  N  N6    . DA  A 1 55  ? 87.561  94.063  20.699  1.00 79.18  ? 55  DA  I N6    1 
ATOM   1113  N  N1    . DA  A 1 55  ? 87.948  93.265  18.573  1.00 79.18  ? 55  DA  I N1    1 
ATOM   1114  C  C2    . DA  A 1 55  ? 88.813  92.930  17.609  1.00 79.18  ? 55  DA  I C2    1 
ATOM   1115  N  N3    . DA  A 1 55  ? 90.143  93.013  17.600  1.00 79.18  ? 55  DA  I N3    1 
ATOM   1116  C  C4    . DA  A 1 55  ? 90.595  93.521  18.762  1.00 79.18  ? 55  DA  I C4    1 
ATOM   1117  P  P     . DA  A 1 56  ? 96.081  93.728  15.964  1.00 118.11 ? 56  DA  I P     1 
ATOM   1118  O  OP1   . DA  A 1 56  ? 96.610  92.425  15.487  1.00 118.11 ? 56  DA  I OP1   1 
ATOM   1119  O  OP2   . DA  A 1 56  ? 96.494  94.980  15.268  1.00 118.11 ? 56  DA  I OP2   1 
ATOM   1120  O  "O5'" . DA  A 1 56  ? 94.493  93.640  15.931  1.00 154.03 ? 56  DA  I "O5'" 1 
ATOM   1121  C  "C5'" . DA  A 1 56  ? 93.833  92.759  15.020  1.00 154.03 ? 56  DA  I "C5'" 1 
ATOM   1122  C  "C4'" . DA  A 1 56  ? 93.035  93.554  14.014  1.00 154.03 ? 56  DA  I "C4'" 1 
ATOM   1123  O  "O4'" . DA  A 1 56  ? 91.938  94.215  14.687  1.00 154.03 ? 56  DA  I "O4'" 1 
ATOM   1124  C  "C3'" . DA  A 1 56  ? 93.830  94.658  13.319  1.00 154.03 ? 56  DA  I "C3'" 1 
ATOM   1125  O  "O3'" . DA  A 1 56  ? 93.411  94.756  11.953  1.00 154.03 ? 56  DA  I "O3'" 1 
ATOM   1126  C  "C2'" . DA  A 1 56  ? 93.483  95.897  14.125  1.00 154.03 ? 56  DA  I "C2'" 1 
ATOM   1127  C  "C1'" . DA  A 1 56  ? 92.052  95.625  14.554  1.00 154.03 ? 56  DA  I "C1'" 1 
ATOM   1128  N  N9    . DA  A 1 56  ? 91.692  96.223  15.840  1.00 103.77 ? 56  DA  I N9    1 
ATOM   1129  C  C8    . DA  A 1 56  ? 92.478  96.981  16.677  1.00 103.77 ? 56  DA  I C8    1 
ATOM   1130  N  N7    . DA  A 1 56  ? 91.867  97.366  17.771  1.00 103.77 ? 56  DA  I N7    1 
ATOM   1131  C  C5    . DA  A 1 56  ? 90.590  96.828  17.646  1.00 103.77 ? 56  DA  I C5    1 
ATOM   1132  C  C6    . DA  A 1 56  ? 89.450  96.871  18.479  1.00 103.77 ? 56  DA  I C6    1 
ATOM   1133  N  N6    . DA  A 1 56  ? 89.408  97.501  19.655  1.00 103.77 ? 56  DA  I N6    1 
ATOM   1134  N  N1    . DA  A 1 56  ? 88.338  96.232  18.054  1.00 103.77 ? 56  DA  I N1    1 
ATOM   1135  C  C2    . DA  A 1 56  ? 88.373  95.596  16.878  1.00 103.77 ? 56  DA  I C2    1 
ATOM   1136  N  N3    . DA  A 1 56  ? 89.376  95.480  16.012  1.00 103.77 ? 56  DA  I N3    1 
ATOM   1137  C  C4    . DA  A 1 56  ? 90.469  96.125  16.460  1.00 103.77 ? 56  DA  I C4    1 
ATOM   1138  P  P     . DA  A 1 57  ? 93.607  96.130  11.140  1.00 159.99 ? 57  DA  I P     1 
ATOM   1139  O  OP1   . DA  A 1 57  ? 94.106  95.794  9.784   1.00 159.99 ? 57  DA  I OP1   1 
ATOM   1140  O  OP2   . DA  A 1 57  ? 94.359  97.101  11.981  1.00 159.99 ? 57  DA  I OP2   1 
ATOM   1141  O  "O5'" . DA  A 1 57  ? 92.116  96.658  10.981  1.00 157.02 ? 57  DA  I "O5'" 1 
ATOM   1142  C  "C5'" . DA  A 1 57  ? 91.087  95.773  10.547  1.00 157.02 ? 57  DA  I "C5'" 1 
ATOM   1143  C  "C4'" . DA  A 1 57  ? 89.775  96.509  10.415  1.00 157.02 ? 57  DA  I "C4'" 1 
ATOM   1144  O  "O4'" . DA  A 1 57  ? 89.276  96.859  11.729  1.00 157.02 ? 57  DA  I "O4'" 1 
ATOM   1145  C  "C3'" . DA  A 1 57  ? 89.839  97.807  9.607   1.00 157.02 ? 57  DA  I "C3'" 1 
ATOM   1146  O  "O3'" . DA  A 1 57  ? 88.719  97.868  8.714   1.00 157.02 ? 57  DA  I "O3'" 1 
ATOM   1147  C  "C2'" . DA  A 1 57  ? 89.809  98.895  10.671  1.00 157.02 ? 57  DA  I "C2'" 1 
ATOM   1148  C  "C1'" . DA  A 1 57  ? 89.038  98.255  11.822  1.00 157.02 ? 57  DA  I "C1'" 1 
ATOM   1149  N  N9    . DA  A 1 57  ? 89.455  98.694  13.160  1.00 115.79 ? 57  DA  I N9    1 
ATOM   1150  C  C8    . DA  A 1 57  ? 90.734  98.743  13.666  1.00 115.79 ? 57  DA  I C8    1 
ATOM   1151  N  N7    . DA  A 1 57  ? 90.802  99.194  14.896  1.00 115.79 ? 57  DA  I N7    1 
ATOM   1152  C  C5    . DA  A 1 57  ? 89.480  99.459  15.227  1.00 115.79 ? 57  DA  I C5    1 
ATOM   1153  C  C6    . DA  A 1 57  ? 88.884  99.967  16.391  1.00 115.79 ? 57  DA  I C6    1 
ATOM   1154  N  N6    . DA  A 1 57  ? 89.568  100.308 17.485  1.00 115.79 ? 57  DA  I N6    1 
ATOM   1155  N  N1    . DA  A 1 57  ? 87.544  100.118 16.395  1.00 115.79 ? 57  DA  I N1    1 
ATOM   1156  C  C2    . DA  A 1 57  ? 86.856  99.775  15.303  1.00 115.79 ? 57  DA  I C2    1 
ATOM   1157  N  N3    . DA  A 1 57  ? 87.300  99.285  14.148  1.00 115.79 ? 57  DA  I N3    1 
ATOM   1158  C  C4    . DA  A 1 57  ? 88.639  99.152  14.172  1.00 115.79 ? 57  DA  I C4    1 
ATOM   1159  P  P     . DG  A 1 58  ? 88.603  99.054  7.632   1.00 92.50  ? 58  DG  I P     1 
ATOM   1160  O  OP1   . DG  A 1 58  ? 88.056  98.474  6.378   1.00 92.50  ? 58  DG  I OP1   1 
ATOM   1161  O  OP2   . DG  A 1 58  ? 89.867  99.839  7.588   1.00 92.50  ? 58  DG  I OP2   1 
ATOM   1162  O  "O5'" . DG  A 1 58  ? 87.481  99.977  8.277   1.00 109.15 ? 58  DG  I "O5'" 1 
ATOM   1163  C  "C5'" . DG  A 1 58  ? 86.292  99.389  8.800   1.00 109.15 ? 58  DG  I "C5'" 1 
ATOM   1164  C  "C4'" . DG  A 1 58  ? 85.165  100.388 8.759   1.00 109.15 ? 58  DG  I "C4'" 1 
ATOM   1165  O  "O4'" . DG  A 1 58  ? 85.153  101.172 9.972   1.00 109.15 ? 58  DG  I "O4'" 1 
ATOM   1166  C  "C3'" . DG  A 1 58  ? 85.303  101.370 7.605   1.00 109.15 ? 58  DG  I "C3'" 1 
ATOM   1167  O  "O3'" . DG  A 1 58  ? 84.092  101.431 6.841   1.00 109.15 ? 58  DG  I "O3'" 1 
ATOM   1168  C  "C2'" . DG  A 1 58  ? 85.846  102.643 8.239   1.00 109.15 ? 58  DG  I "C2'" 1 
ATOM   1169  C  "C1'" . DG  A 1 58  ? 85.604  102.501 9.746   1.00 109.15 ? 58  DG  I "C1'" 1 
ATOM   1170  N  N9    . DG  A 1 58  ? 86.822  102.670 10.540  1.00 106.40 ? 58  DG  I N9    1 
ATOM   1171  C  C8    . DG  A 1 58  ? 88.110  102.697 10.055  1.00 106.40 ? 58  DG  I C8    1 
ATOM   1172  N  N7    . DG  A 1 58  ? 89.014  102.788 10.994  1.00 106.40 ? 58  DG  I N7    1 
ATOM   1173  C  C5    . DG  A 1 58  ? 88.286  102.837 12.177  1.00 106.40 ? 58  DG  I C5    1 
ATOM   1174  C  C6    . DG  A 1 58  ? 88.731  102.919 13.527  1.00 106.40 ? 58  DG  I C6    1 
ATOM   1175  O  O6    . DG  A 1 58  ? 89.890  102.936 13.957  1.00 106.40 ? 58  DG  I O6    1 
ATOM   1176  N  N1    . DG  A 1 58  ? 87.664  102.970 14.417  1.00 106.40 ? 58  DG  I N1    1 
ATOM   1177  C  C2    . DG  A 1 58  ? 86.339  102.927 14.059  1.00 106.40 ? 58  DG  I C2    1 
ATOM   1178  N  N2    . DG  A 1 58  ? 85.462  103.000 15.072  1.00 106.40 ? 58  DG  I N2    1 
ATOM   1179  N  N3    . DG  A 1 58  ? 85.906  102.825 12.805  1.00 106.40 ? 58  DG  I N3    1 
ATOM   1180  C  C4    . DG  A 1 58  ? 86.928  102.789 11.919  1.00 106.40 ? 58  DG  I C4    1 
ATOM   1181  P  P     . DG  A 1 59  ? 83.025  102.601 7.077   1.00 63.53  ? 59  DG  I P     1 
ATOM   1182  O  OP1   . DG  A 1 59  ? 82.331  102.785 5.777   1.00 63.53  ? 59  DG  I OP1   1 
ATOM   1183  O  OP2   . DG  A 1 59  ? 83.617  103.770 7.767   1.00 63.53  ? 59  DG  I OP2   1 
ATOM   1184  O  "O5'" . DG  A 1 59  ? 81.988  101.955 8.087   1.00 52.63  ? 59  DG  I "O5'" 1 
ATOM   1185  C  "C5'" . DG  A 1 59  ? 80.766  102.616 8.329   1.00 52.63  ? 59  DG  I "C5'" 1 
ATOM   1186  C  "C4'" . DG  A 1 59  ? 80.702  103.119 9.751   1.00 52.63  ? 59  DG  I "C4'" 1 
ATOM   1187  O  "O4'" . DG  A 1 59  ? 81.988  103.602 10.215  1.00 52.63  ? 59  DG  I "O4'" 1 
ATOM   1188  C  "C3'" . DG  A 1 59  ? 79.740  104.296 9.895   1.00 52.63  ? 59  DG  I "C3'" 1 
ATOM   1189  O  "O3'" . DG  A 1 59  ? 78.922  104.174 11.043  1.00 52.63  ? 59  DG  I "O3'" 1 
ATOM   1190  C  "C2'" . DG  A 1 59  ? 80.656  105.491 10.071  1.00 52.63  ? 59  DG  I "C2'" 1 
ATOM   1191  C  "C1'" . DG  A 1 59  ? 81.792  104.864 10.830  1.00 52.63  ? 59  DG  I "C1'" 1 
ATOM   1192  N  N9    . DG  A 1 59  ? 83.050  105.591 10.778  1.00 82.27  ? 59  DG  I N9    1 
ATOM   1193  C  C8    . DG  A 1 59  ? 83.773  105.952 9.665   1.00 82.27  ? 59  DG  I C8    1 
ATOM   1194  N  N7    . DG  A 1 59  ? 84.910  106.517 9.961   1.00 82.27  ? 59  DG  I N7    1 
ATOM   1195  C  C5    . DG  A 1 59  ? 84.926  106.542 11.350  1.00 82.27  ? 59  DG  I C5    1 
ATOM   1196  C  C6    . DG  A 1 59  ? 85.916  106.999 12.251  1.00 82.27  ? 59  DG  I C6    1 
ATOM   1197  O  O6    . DG  A 1 59  ? 87.034  107.461 12.000  1.00 82.27  ? 59  DG  I O6    1 
ATOM   1198  N  N1    . DG  A 1 59  ? 85.509  106.857 13.573  1.00 82.27  ? 59  DG  I N1    1 
ATOM   1199  C  C2    . DG  A 1 59  ? 84.314  106.326 13.978  1.00 82.27  ? 59  DG  I C2    1 
ATOM   1200  N  N2    . DG  A 1 59  ? 84.104  106.289 15.301  1.00 82.27  ? 59  DG  I N2    1 
ATOM   1201  N  N3    . DG  A 1 59  ? 83.396  105.871 13.150  1.00 82.27  ? 59  DG  I N3    1 
ATOM   1202  C  C4    . DG  A 1 59  ? 83.768  106.007 11.862  1.00 82.27  ? 59  DG  I C4    1 
ATOM   1203  P  P     . DC  A 1 60  ? 77.616  105.077 11.146  1.00 41.85  ? 60  DC  I P     1 
ATOM   1204  O  OP1   . DC  A 1 60  ? 76.489  104.163 11.475  1.00 41.85  ? 60  DC  I OP1   1 
ATOM   1205  O  OP2   . DC  A 1 60  ? 77.535  105.942 9.942   1.00 41.85  ? 60  DC  I OP2   1 
ATOM   1206  O  "O5'" . DC  A 1 60  ? 77.909  106.039 12.373  1.00 45.42  ? 60  DC  I "O5'" 1 
ATOM   1207  C  "C5'" . DC  A 1 60  ? 77.704  105.583 13.703  1.00 45.42  ? 60  DC  I "C5'" 1 
ATOM   1208  C  "C4'" . DC  A 1 60  ? 78.129  106.640 14.695  1.00 45.42  ? 60  DC  I "C4'" 1 
ATOM   1209  O  "O4'" . DC  A 1 60  ? 79.468  107.086 14.381  1.00 45.42  ? 60  DC  I "O4'" 1 
ATOM   1210  C  "C3'" . DC  A 1 60  ? 77.265  107.898 14.729  1.00 45.42  ? 60  DC  I "C3'" 1 
ATOM   1211  O  "O3'" . DC  A 1 60  ? 77.252  108.375 16.056  1.00 45.42  ? 60  DC  I "O3'" 1 
ATOM   1212  C  "C2'" . DC  A 1 60  ? 78.034  108.873 13.861  1.00 45.42  ? 60  DC  I "C2'" 1 
ATOM   1213  C  "C1'" . DC  A 1 60  ? 79.477  108.494 14.182  1.00 45.42  ? 60  DC  I "C1'" 1 
ATOM   1214  N  N1    . DC  A 1 60  ? 80.470  108.790 13.131  1.00 68.12  ? 60  DC  I N1    1 
ATOM   1215  C  C2    . DC  A 1 60  ? 81.694  109.385 13.498  1.00 68.12  ? 60  DC  I C2    1 
ATOM   1216  O  O2    . DC  A 1 60  ? 81.899  109.672 14.696  1.00 68.12  ? 60  DC  I O2    1 
ATOM   1217  N  N3    . DC  A 1 60  ? 82.616  109.634 12.539  1.00 68.12  ? 60  DC  I N3    1 
ATOM   1218  C  C4    . DC  A 1 60  ? 82.356  109.323 11.261  1.00 68.12  ? 60  DC  I C4    1 
ATOM   1219  N  N4    . DC  A 1 60  ? 83.302  109.581 10.346  1.00 68.12  ? 60  DC  I N4    1 
ATOM   1220  C  C5    . DC  A 1 60  ? 81.119  108.732 10.865  1.00 68.12  ? 60  DC  I C5    1 
ATOM   1221  C  C6    . DC  A 1 60  ? 80.215  108.484 11.821  1.00 68.12  ? 60  DC  I C6    1 
ATOM   1222  P  P     . DA  A 1 61  ? 75.898  108.925 16.681  1.00 63.86  ? 61  DA  I P     1 
ATOM   1223  O  OP1   . DA  A 1 61  ? 75.188  107.821 17.365  1.00 63.86  ? 61  DA  I OP1   1 
ATOM   1224  O  OP2   . DA  A 1 61  ? 75.207  109.732 15.646  1.00 63.86  ? 61  DA  I OP2   1 
ATOM   1225  O  "O5'" . DA  A 1 61  ? 76.413  109.917 17.801  1.00 44.23  ? 61  DA  I "O5'" 1 
ATOM   1226  C  "C5'" . DA  A 1 61  ? 77.549  109.579 18.582  1.00 44.23  ? 61  DA  I "C5'" 1 
ATOM   1227  C  "C4'" . DA  A 1 61  ? 78.461  110.772 18.714  1.00 44.23  ? 61  DA  I "C4'" 1 
ATOM   1228  O  "O4'" . DA  A 1 61  ? 79.233  110.978 17.504  1.00 44.23  ? 61  DA  I "O4'" 1 
ATOM   1229  C  "C3'" . DA  A 1 61  ? 77.711  112.072 18.978  1.00 44.23  ? 61  DA  I "C3'" 1 
ATOM   1230  O  "O3'" . DA  A 1 61  ? 78.218  112.687 20.151  1.00 44.23  ? 61  DA  I "O3'" 1 
ATOM   1231  C  "C2'" . DA  A 1 61  ? 77.948  112.912 17.731  1.00 44.23  ? 61  DA  I "C2'" 1 
ATOM   1232  C  "C1'" . DA  A 1 61  ? 79.214  112.342 17.138  1.00 44.23  ? 61  DA  I "C1'" 1 
ATOM   1233  N  N9    . DA  A 1 61  ? 79.260  112.390 15.685  1.00 65.56  ? 61  DA  I N9    1 
ATOM   1234  C  C8    . DA  A 1 61  ? 78.279  112.036 14.800  1.00 65.56  ? 61  DA  I C8    1 
ATOM   1235  N  N7    . DA  A 1 61  ? 78.633  112.152 13.544  1.00 65.56  ? 61  DA  I N7    1 
ATOM   1236  C  C5    . DA  A 1 61  ? 79.933  112.620 13.611  1.00 65.56  ? 61  DA  I C5    1 
ATOM   1237  C  C6    . DA  A 1 61  ? 80.869  112.936 12.622  1.00 65.56  ? 61  DA  I C6    1 
ATOM   1238  N  N6    . DA  A 1 61  ? 80.628  112.828 11.317  1.00 65.56  ? 61  DA  I N6    1 
ATOM   1239  N  N1    . DA  A 1 61  ? 82.079  113.374 13.021  1.00 65.56  ? 61  DA  I N1    1 
ATOM   1240  C  C2    . DA  A 1 61  ? 82.318  113.486 14.331  1.00 65.56  ? 61  DA  I C2    1 
ATOM   1241  N  N3    . DA  A 1 61  ? 81.517  113.219 15.359  1.00 65.56  ? 61  DA  I N3    1 
ATOM   1242  C  C4    . DA  A 1 61  ? 80.326  112.782 14.924  1.00 65.56  ? 61  DA  I C4    1 
ATOM   1243  P  P     . DT  A 1 62  ? 77.371  113.842 20.867  1.00 52.42  ? 62  DT  I P     1 
ATOM   1244  O  OP1   . DT  A 1 62  ? 77.499  113.652 22.335  1.00 52.42  ? 62  DT  I OP1   1 
ATOM   1245  O  OP2   . DT  A 1 62  ? 76.019  113.952 20.250  1.00 52.42  ? 62  DT  I OP2   1 
ATOM   1246  O  "O5'" . DT  A 1 62  ? 78.210  115.111 20.433  1.00 50.64  ? 62  DT  I "O5'" 1 
ATOM   1247  C  "C5'" . DT  A 1 62  ? 79.058  115.034 19.292  1.00 50.64  ? 62  DT  I "C5'" 1 
ATOM   1248  C  "C4'" . DT  A 1 62  ? 79.950  116.245 19.233  1.00 50.64  ? 62  DT  I "C4'" 1 
ATOM   1249  O  "O4'" . DT  A 1 62  ? 80.631  116.207 17.960  1.00 50.64  ? 62  DT  I "O4'" 1 
ATOM   1250  C  "C3'" . DT  A 1 62  ? 79.147  117.538 19.260  1.00 50.64  ? 62  DT  I "C3'" 1 
ATOM   1251  O  "O3'" . DT  A 1 62  ? 79.763  118.512 20.100  1.00 50.64  ? 62  DT  I "O3'" 1 
ATOM   1252  C  "C2'" . DT  A 1 62  ? 79.049  117.956 17.804  1.00 50.64  ? 62  DT  I "C2'" 1 
ATOM   1253  C  "C1'" . DT  A 1 62  ? 80.190  117.240 17.104  1.00 50.64  ? 62  DT  I "C1'" 1 
ATOM   1254  N  N1    . DT  A 1 62  ? 79.758  116.612 15.846  1.00 62.94  ? 62  DT  I N1    1 
ATOM   1255  C  C2    . DT  A 1 62  ? 80.637  116.597 14.792  1.00 62.94  ? 62  DT  I C2    1 
ATOM   1256  O  O2    . DT  A 1 62  ? 81.777  117.025 14.869  1.00 62.94  ? 62  DT  I O2    1 
ATOM   1257  N  N3    . DT  A 1 62  ? 80.134  116.056 13.635  1.00 62.94  ? 62  DT  I N3    1 
ATOM   1258  C  C4    . DT  A 1 62  ? 78.869  115.524 13.436  1.00 62.94  ? 62  DT  I C4    1 
ATOM   1259  O  O4    . DT  A 1 62  ? 78.553  115.079 12.336  1.00 62.94  ? 62  DT  I O4    1 
ATOM   1260  C  C5    . DT  A 1 62  ? 78.005  115.550 14.593  1.00 62.94  ? 62  DT  I C5    1 
ATOM   1261  C  C7    . DT  A 1 62  ? 76.617  114.999 14.473  1.00 62.94  ? 62  DT  I C7    1 
ATOM   1262  C  C6    . DT  A 1 62  ? 78.488  116.078 15.728  1.00 62.94  ? 62  DT  I C6    1 
ATOM   1263  P  P     . DG  A 1 63  ? 78.918  119.795 20.581  1.00 85.98  ? 63  DG  I P     1 
ATOM   1264  O  OP1   . DG  A 1 63  ? 79.368  120.142 21.954  1.00 85.98  ? 63  DG  I OP1   1 
ATOM   1265  O  OP2   . DG  A 1 63  ? 77.473  119.548 20.318  1.00 85.98  ? 63  DG  I OP2   1 
ATOM   1266  O  "O5'" . DG  A 1 63  ? 79.389  120.935 19.574  1.00 97.04  ? 63  DG  I "O5'" 1 
ATOM   1267  C  "C5'" . DG  A 1 63  ? 80.773  121.111 19.274  1.00 97.04  ? 63  DG  I "C5'" 1 
ATOM   1268  C  "C4'" . DG  A 1 63  ? 80.941  122.111 18.157  1.00 97.04  ? 63  DG  I "C4'" 1 
ATOM   1269  O  "O4'" . DG  A 1 63  ? 80.618  121.508 16.884  1.00 97.04  ? 63  DG  I "O4'" 1 
ATOM   1270  C  "C3'" . DG  A 1 63  ? 80.024  123.323 18.289  1.00 97.04  ? 63  DG  I "C3'" 1 
ATOM   1271  O  "O3'" . DG  A 1 63  ? 80.701  124.476 17.786  1.00 97.04  ? 63  DG  I "O3'" 1 
ATOM   1272  C  "C2'" . DG  A 1 63  ? 78.847  122.951 17.410  1.00 97.04  ? 63  DG  I "C2'" 1 
ATOM   1273  C  "C1'" . DG  A 1 63  ? 79.534  122.206 16.284  1.00 97.04  ? 63  DG  I "C1'" 1 
ATOM   1274  N  N9    . DG  A 1 63  ? 78.682  121.224 15.625  1.00 65.42  ? 63  DG  I N9    1 
ATOM   1275  C  C8    . DG  A 1 63  ? 77.664  120.496 16.191  1.00 65.42  ? 63  DG  I C8    1 
ATOM   1276  N  N7    . DG  A 1 63  ? 77.097  119.673 15.352  1.00 65.42  ? 63  DG  I N7    1 
ATOM   1277  C  C5    . DG  A 1 63  ? 77.778  119.874 14.163  1.00 65.42  ? 63  DG  I C5    1 
ATOM   1278  C  C6    . DG  A 1 63  ? 77.612  119.262 12.898  1.00 65.42  ? 63  DG  I C6    1 
ATOM   1279  O  O6    . DG  A 1 63  ? 76.813  118.384 12.567  1.00 65.42  ? 63  DG  I O6    1 
ATOM   1280  N  N1    . DG  A 1 63  ? 78.504  119.773 11.964  1.00 65.42  ? 63  DG  I N1    1 
ATOM   1281  C  C2    . DG  A 1 63  ? 79.438  120.746 12.215  1.00 65.42  ? 63  DG  I C2    1 
ATOM   1282  N  N2    . DG  A 1 63  ? 80.180  121.105 11.163  1.00 65.42  ? 63  DG  I N2    1 
ATOM   1283  N  N3    . DG  A 1 63  ? 79.617  121.317 13.395  1.00 65.42  ? 63  DG  I N3    1 
ATOM   1284  C  C4    . DG  A 1 63  ? 78.755  120.837 14.314  1.00 65.42  ? 63  DG  I C4    1 
ATOM   1285  P  P     . DT  A 1 64  ? 79.892  125.845 17.538  1.00 147.98 ? 64  DT  I P     1 
ATOM   1286  O  OP1   . DT  A 1 64  ? 80.688  126.954 18.122  1.00 147.98 ? 64  DT  I OP1   1 
ATOM   1287  O  OP2   . DT  A 1 64  ? 78.480  125.651 17.968  1.00 147.98 ? 64  DT  I OP2   1 
ATOM   1288  O  "O5'" . DT  A 1 64  ? 79.938  125.991 15.952  1.00 116.41 ? 64  DT  I "O5'" 1 
ATOM   1289  C  "C5'" . DT  A 1 64  ? 81.176  125.873 15.250  1.00 116.41 ? 64  DT  I "C5'" 1 
ATOM   1290  C  "C4'" . DT  A 1 64  ? 81.048  126.440 13.856  1.00 116.41 ? 64  DT  I "C4'" 1 
ATOM   1291  O  "O4'" . DT  A 1 64  ? 80.364  125.499 12.993  1.00 116.41 ? 64  DT  I "O4'" 1 
ATOM   1292  C  "C3'" . DT  A 1 64  ? 80.266  127.751 13.774  1.00 116.41 ? 64  DT  I "C3'" 1 
ATOM   1293  O  "O3'" . DT  A 1 64  ? 80.946  128.685 12.922  1.00 116.41 ? 64  DT  I "O3'" 1 
ATOM   1294  C  "C2'" . DT  A 1 64  ? 78.910  127.330 13.225  1.00 116.41 ? 64  DT  I "C2'" 1 
ATOM   1295  C  "C1'" . DT  A 1 64  ? 79.242  126.116 12.371  1.00 116.41 ? 64  DT  I "C1'" 1 
ATOM   1296  N  N1    . DT  A 1 64  ? 78.161  125.100 12.268  1.00 69.74  ? 64  DT  I N1    1 
ATOM   1297  C  C2    . DT  A 1 64  ? 78.012  124.415 11.076  1.00 69.74  ? 64  DT  I C2    1 
ATOM   1298  O  O2    . DT  A 1 64  ? 78.692  124.632 10.087  1.00 69.74  ? 64  DT  I O2    1 
ATOM   1299  N  N3    . DT  A 1 64  ? 77.028  123.458 11.086  1.00 69.74  ? 64  DT  I N3    1 
ATOM   1300  C  C4    . DT  A 1 64  ? 76.187  123.130 12.130  1.00 69.74  ? 64  DT  I C4    1 
ATOM   1301  O  O4    . DT  A 1 64  ? 75.357  122.235 11.986  1.00 69.74  ? 64  DT  I O4    1 
ATOM   1302  C  C5    . DT  A 1 64  ? 76.375  123.900 13.337  1.00 69.74  ? 64  DT  I C5    1 
ATOM   1303  C  C7    . DT  A 1 64  ? 75.494  123.622 14.514  1.00 69.74  ? 64  DT  I C7    1 
ATOM   1304  C  C6    . DT  A 1 64  ? 77.338  124.836 13.346  1.00 69.74  ? 64  DT  I C6    1 
ATOM   1305  P  P     . DT  A 1 65  ? 80.183  130.002 12.396  1.00 73.21  ? 65  DT  I P     1 
ATOM   1306  O  OP1   . DT  A 1 65  ? 81.204  130.970 11.897  1.00 73.21  ? 65  DT  I OP1   1 
ATOM   1307  O  OP2   . DT  A 1 65  ? 79.172  130.442 13.405  1.00 73.21  ? 65  DT  I OP2   1 
ATOM   1308  O  "O5'" . DT  A 1 65  ? 79.413  129.443 11.128  1.00 77.01  ? 65  DT  I "O5'" 1 
ATOM   1309  C  "C5'" . DT  A 1 65  ? 80.148  128.867 10.053  1.00 77.01  ? 65  DT  I "C5'" 1 
ATOM   1310  C  "C4'" . DT  A 1 65  ? 79.303  128.863 8.806   1.00 77.01  ? 65  DT  I "C4'" 1 
ATOM   1311  O  "O4'" . DT  A 1 65  ? 78.413  127.725 8.798   1.00 77.01  ? 65  DT  I "O4'" 1 
ATOM   1312  C  "C3'" . DT  A 1 65  ? 78.413  130.097 8.708   1.00 77.01  ? 65  DT  I "C3'" 1 
ATOM   1313  O  "O3'" . DT  A 1 65  ? 78.346  130.503 7.352   1.00 77.01  ? 65  DT  I "O3'" 1 
ATOM   1314  C  "C2'" . DT  A 1 65  ? 77.069  129.595 9.196   1.00 77.01  ? 65  DT  I "C2'" 1 
ATOM   1315  C  "C1'" . DT  A 1 65  ? 77.085  128.177 8.669   1.00 77.01  ? 65  DT  I "C1'" 1 
ATOM   1316  N  N1    . DT  A 1 65  ? 76.224  127.248 9.394   1.00 41.88  ? 65  DT  I N1    1 
ATOM   1317  C  C2    . DT  A 1 65  ? 75.715  126.175 8.696   1.00 41.88  ? 65  DT  I C2    1 
ATOM   1318  O  O2    . DT  A 1 65  ? 75.988  125.940 7.519   1.00 41.88  ? 65  DT  I O2    1 
ATOM   1319  N  N3    . DT  A 1 65  ? 74.861  125.386 9.424   1.00 41.88  ? 65  DT  I N3    1 
ATOM   1320  C  C4    . DT  A 1 65  ? 74.467  125.561 10.740  1.00 41.88  ? 65  DT  I C4    1 
ATOM   1321  O  O4    . DT  A 1 65  ? 73.652  124.777 11.253  1.00 41.88  ? 65  DT  I O4    1 
ATOM   1322  C  C5    . DT  A 1 65  ? 75.061  126.689 11.411  1.00 41.88  ? 65  DT  I C5    1 
ATOM   1323  C  C7    . DT  A 1 65  ? 74.696  126.949 12.835  1.00 41.88  ? 65  DT  I C7    1 
ATOM   1324  C  C6    . DT  A 1 65  ? 75.911  127.462 10.719  1.00 41.88  ? 65  DT  I C6    1 
ATOM   1325  P  P     . DC  A 1 66  ? 77.638  131.883 6.975   1.00 74.93  ? 66  DC  I P     1 
ATOM   1326  O  OP1   . DC  A 1 66  ? 78.634  132.714 6.251   1.00 74.93  ? 66  DC  I OP1   1 
ATOM   1327  O  OP2   . DC  A 1 66  ? 76.991  132.404 8.218   1.00 74.93  ? 66  DC  I OP2   1 
ATOM   1328  O  "O5'" . DC  A 1 66  ? 76.519  131.412 5.945   1.00 70.38  ? 66  DC  I "O5'" 1 
ATOM   1329  C  "C5'" . DC  A 1 66  ? 76.782  130.335 5.042   1.00 70.38  ? 66  DC  I "C5'" 1 
ATOM   1330  C  "C4'" . DC  A 1 66  ? 75.499  129.739 4.505   1.00 70.38  ? 66  DC  I "C4'" 1 
ATOM   1331  O  "O4'" . DC  A 1 66  ? 74.832  128.875 5.461   1.00 70.38  ? 66  DC  I "O4'" 1 
ATOM   1332  C  "C3'" . DC  A 1 66  ? 74.435  130.710 4.008   1.00 70.38  ? 66  DC  I "C3'" 1 
ATOM   1333  O  "O3'" . DC  A 1 66  ? 73.901  130.122 2.852   1.00 70.38  ? 66  DC  I "O3'" 1 
ATOM   1334  C  "C2'" . DC  A 1 66  ? 73.372  130.662 5.091   1.00 70.38  ? 66  DC  I "C2'" 1 
ATOM   1335  C  "C1'" . DC  A 1 66  ? 73.449  129.208 5.515   1.00 70.38  ? 66  DC  I "C1'" 1 
ATOM   1336  N  N1    . DC  A 1 66  ? 72.968  128.924 6.879   1.00 44.13  ? 66  DC  I N1    1 
ATOM   1337  C  C2    . DC  A 1 66  ? 72.504  127.627 7.187   1.00 44.13  ? 66  DC  I C2    1 
ATOM   1338  O  O2    . DC  A 1 66  ? 72.452  126.764 6.284   1.00 44.13  ? 66  DC  I O2    1 
ATOM   1339  N  N3    . DC  A 1 66  ? 72.113  127.354 8.453   1.00 44.13  ? 66  DC  I N3    1 
ATOM   1340  C  C4    . DC  A 1 66  ? 72.155  128.309 9.384   1.00 44.13  ? 66  DC  I C4    1 
ATOM   1341  N  N4    . DC  A 1 66  ? 71.797  127.992 10.622  1.00 44.13  ? 66  DC  I N4    1 
ATOM   1342  C  C5    . DC  A 1 66  ? 72.579  129.633 9.089   1.00 44.13  ? 66  DC  I C5    1 
ATOM   1343  C  C6    . DC  A 1 66  ? 72.979  129.895 7.839   1.00 44.13  ? 66  DC  I C6    1 
ATOM   1344  P  P     . DA  A 1 67  ? 73.298  131.034 1.705   1.00 46.51  ? 67  DA  I P     1 
ATOM   1345  O  OP1   . DA  A 1 67  ? 74.449  131.557 0.941   1.00 46.51  ? 67  DA  I OP1   1 
ATOM   1346  O  OP2   . DA  A 1 67  ? 72.314  131.977 2.308   1.00 46.51  ? 67  DA  I OP2   1 
ATOM   1347  O  "O5'" . DA  A 1 67  ? 72.572  129.947 0.794   1.00 44.45  ? 67  DA  I "O5'" 1 
ATOM   1348  C  "C5'" . DA  A 1 67  ? 73.179  128.655 0.595   1.00 44.45  ? 67  DA  I "C5'" 1 
ATOM   1349  C  "C4'" . DA  A 1 67  ? 72.140  127.549 0.566   1.00 44.45  ? 67  DA  I "C4'" 1 
ATOM   1350  O  "O4'" . DA  A 1 67  ? 71.547  127.321 1.869   1.00 44.45  ? 67  DA  I "O4'" 1 
ATOM   1351  C  "C3'" . DA  A 1 67  ? 70.974  127.758 -0.397  1.00 44.45  ? 67  DA  I "C3'" 1 
ATOM   1352  O  "O3'" . DA  A 1 67  ? 70.680  126.507 -1.037  1.00 44.45  ? 67  DA  I "O3'" 1 
ATOM   1353  C  "C2'" . DA  A 1 67  ? 69.867  128.285 0.505   1.00 44.45  ? 67  DA  I "C2'" 1 
ATOM   1354  C  "C1'" . DA  A 1 67  ? 70.147  127.596 1.835   1.00 44.45  ? 67  DA  I "C1'" 1 
ATOM   1355  N  N9    . DA  A 1 67  ? 69.833  128.364 3.042   1.00 36.56  ? 67  DA  I N9    1 
ATOM   1356  C  C8    . DA  A 1 67  ? 70.076  129.684 3.295   1.00 36.56  ? 67  DA  I C8    1 
ATOM   1357  N  N7    . DA  A 1 67  ? 69.778  130.055 4.523   1.00 36.56  ? 67  DA  I N7    1 
ATOM   1358  C  C5    . DA  A 1 67  ? 69.279  128.903 5.108   1.00 36.56  ? 67  DA  I C5    1 
ATOM   1359  C  C6    . DA  A 1 67  ? 68.801  128.617 6.417   1.00 36.56  ? 67  DA  I C6    1 
ATOM   1360  N  N6    . DA  A 1 67  ? 68.741  129.509 7.415   1.00 36.56  ? 67  DA  I N6    1 
ATOM   1361  N  N1    . DA  A 1 67  ? 68.379  127.357 6.666   1.00 36.56  ? 67  DA  I N1    1 
ATOM   1362  C  C2    . DA  A 1 67  ? 68.427  126.456 5.674   1.00 36.56  ? 67  DA  I C2    1 
ATOM   1363  N  N3    . DA  A 1 67  ? 68.851  126.601 4.415   1.00 36.56  ? 67  DA  I N3    1 
ATOM   1364  C  C4    . DA  A 1 67  ? 69.277  127.859 4.197   1.00 36.56  ? 67  DA  I C4    1 
ATOM   1365  P  P     . DG  A 1 68  ? 69.610  126.447 -2.234  1.00 39.82  ? 68  DG  I P     1 
ATOM   1366  O  OP1   . DG  A 1 68  ? 69.972  125.447 -3.266  1.00 39.82  ? 68  DG  I OP1   1 
ATOM   1367  O  OP2   . DG  A 1 68  ? 69.311  127.838 -2.638  1.00 39.82  ? 68  DG  I OP2   1 
ATOM   1368  O  "O5'" . DG  A 1 68  ? 68.356  125.849 -1.489  1.00 53.10  ? 68  DG  I "O5'" 1 
ATOM   1369  C  "C5'" . DG  A 1 68  ? 68.275  125.944 -0.083  1.00 53.10  ? 68  DG  I "C5'" 1 
ATOM   1370  C  "C4'" . DG  A 1 68  ? 67.105  125.136 0.386   1.00 53.10  ? 68  DG  I "C4'" 1 
ATOM   1371  O  "O4'" . DG  A 1 68  ? 66.638  125.669 1.636   1.00 53.10  ? 68  DG  I "O4'" 1 
ATOM   1372  C  "C3'" . DG  A 1 68  ? 65.958  125.302 -0.594  1.00 53.10  ? 68  DG  I "C3'" 1 
ATOM   1373  O  "O3'" . DG  A 1 68  ? 65.264  124.063 -0.661  1.00 53.10  ? 68  DG  I "O3'" 1 
ATOM   1374  C  "C2'" . DG  A 1 68  ? 65.178  126.483 -0.051  1.00 53.10  ? 68  DG  I "C2'" 1 
ATOM   1375  C  "C1'" . DG  A 1 68  ? 65.517  126.513 1.428   1.00 53.10  ? 68  DG  I "C1'" 1 
ATOM   1376  N  N9    . DG  A 1 68  ? 65.910  127.846 1.859   1.00 48.31  ? 68  DG  I N9    1 
ATOM   1377  C  C8    . DG  A 1 68  ? 66.412  128.849 1.069   1.00 48.31  ? 68  DG  I C8    1 
ATOM   1378  N  N7    . DG  A 1 68  ? 66.669  129.945 1.731   1.00 48.31  ? 68  DG  I N7    1 
ATOM   1379  C  C5    . DG  A 1 68  ? 66.312  129.648 3.036   1.00 48.31  ? 68  DG  I C5    1 
ATOM   1380  C  C6    . DG  A 1 68  ? 66.350  130.457 4.205   1.00 48.31  ? 68  DG  I C6    1 
ATOM   1381  O  O6    . DG  A 1 68  ? 66.716  131.640 4.321   1.00 48.31  ? 68  DG  I O6    1 
ATOM   1382  N  N1    . DG  A 1 68  ? 65.892  129.757 5.321   1.00 48.31  ? 68  DG  I N1    1 
ATOM   1383  C  C2    . DG  A 1 68  ? 65.443  128.447 5.307   1.00 48.31  ? 68  DG  I C2    1 
ATOM   1384  N  N2    . DG  A 1 68  ? 65.023  127.959 6.493   1.00 48.31  ? 68  DG  I N2    1 
ATOM   1385  N  N3    . DG  A 1 68  ? 65.406  127.687 4.221   1.00 48.31  ? 68  DG  I N3    1 
ATOM   1386  C  C4    . DG  A 1 68  ? 65.848  128.349 3.132   1.00 48.31  ? 68  DG  I C4    1 
ATOM   1387  P  P     . DC  A 1 69  ? 63.763  124.009 -1.190  1.00 57.62  ? 69  DC  I P     1 
ATOM   1388  O  OP1   . DC  A 1 69  ? 63.676  122.848 -2.106  1.00 57.62  ? 69  DC  I OP1   1 
ATOM   1389  O  OP2   . DC  A 1 69  ? 63.378  125.361 -1.672  1.00 57.62  ? 69  DC  I OP2   1 
ATOM   1390  O  "O5'" . DC  A 1 69  ? 62.945  123.709 0.142   1.00 29.96  ? 69  DC  I "O5'" 1 
ATOM   1391  C  "C5'" . DC  A 1 69  ? 63.435  122.799 1.114   1.00 29.96  ? 69  DC  I "C5'" 1 
ATOM   1392  C  "C4'" . DC  A 1 69  ? 62.610  122.931 2.364   1.00 29.96  ? 69  DC  I "C4'" 1 
ATOM   1393  O  "O4'" . DC  A 1 69  ? 62.851  124.249 2.909   1.00 29.96  ? 69  DC  I "O4'" 1 
ATOM   1394  C  "C3'" . DC  A 1 69  ? 61.112  122.865 2.068   1.00 29.96  ? 69  DC  I "C3'" 1 
ATOM   1395  O  "O3'" . DC  A 1 69  ? 60.407  122.269 3.159   1.00 29.96  ? 69  DC  I "O3'" 1 
ATOM   1396  C  "C2'" . DC  A 1 69  ? 60.722  124.318 1.940   1.00 29.96  ? 69  DC  I "C2'" 1 
ATOM   1397  C  "C1'" . DC  A 1 69  ? 61.632  124.977 2.961   1.00 29.96  ? 69  DC  I "C1'" 1 
ATOM   1398  N  N1    . DC  A 1 69  ? 61.917  126.389 2.638   1.00 24.77  ? 69  DC  I N1    1 
ATOM   1399  C  C2    . DC  A 1 69  ? 62.025  127.330 3.686   1.00 24.77  ? 69  DC  I C2    1 
ATOM   1400  O  O2    . DC  A 1 69  ? 61.911  126.946 4.856   1.00 24.77  ? 69  DC  I O2    1 
ATOM   1401  N  N3    . DC  A 1 69  ? 62.248  128.627 3.389   1.00 24.77  ? 69  DC  I N3    1 
ATOM   1402  C  C4    . DC  A 1 69  ? 62.378  129.006 2.110   1.00 24.77  ? 69  DC  I C4    1 
ATOM   1403  N  N4    . DC  A 1 69  ? 62.622  130.312 1.858   1.00 24.77  ? 69  DC  I N4    1 
ATOM   1404  C  C5    . DC  A 1 69  ? 62.276  128.069 1.028   1.00 24.77  ? 69  DC  I C5    1 
ATOM   1405  C  C6    . DC  A 1 69  ? 62.052  126.787 1.335   1.00 24.77  ? 69  DC  I C6    1 
ATOM   1406  P  P     . DT  A 1 70  ? 58.951  121.617 2.918   1.00 35.51  ? 70  DT  I P     1 
ATOM   1407  O  OP1   . DT  A 1 70  ? 59.046  120.147 3.065   1.00 35.51  ? 70  DT  I OP1   1 
ATOM   1408  O  OP2   . DT  A 1 70  ? 58.323  122.190 1.692   1.00 35.51  ? 70  DT  I OP2   1 
ATOM   1409  O  "O5'" . DT  A 1 70  ? 58.168  122.146 4.180   1.00 30.72  ? 70  DT  I "O5'" 1 
ATOM   1410  C  "C5'" . DT  A 1 70  ? 58.764  122.025 5.445   1.00 30.72  ? 70  DT  I "C5'" 1 
ATOM   1411  C  "C4'" . DT  A 1 70  ? 58.258  123.111 6.354   1.00 30.72  ? 70  DT  I "C4'" 1 
ATOM   1412  O  "O4'" . DT  A 1 70  ? 58.655  124.416 5.864   1.00 30.72  ? 70  DT  I "O4'" 1 
ATOM   1413  C  "C3'" . DT  A 1 70  ? 56.743  123.160 6.504   1.00 30.72  ? 70  DT  I "C3'" 1 
ATOM   1414  O  "O3'" . DT  A 1 70  ? 56.498  123.354 7.887   1.00 30.72  ? 70  DT  I "O3'" 1 
ATOM   1415  C  "C2'" . DT  A 1 70  ? 56.331  124.378 5.677   1.00 30.72  ? 70  DT  I "C2'" 1 
ATOM   1416  C  "C1'" . DT  A 1 70  ? 57.537  125.289 5.823   1.00 30.72  ? 70  DT  I "C1'" 1 
ATOM   1417  N  N1    . DT  A 1 70  ? 57.780  126.264 4.741   1.00 23.69  ? 70  DT  I N1    1 
ATOM   1418  C  C2    . DT  A 1 70  ? 58.174  127.531 5.112   1.00 23.69  ? 70  DT  I C2    1 
ATOM   1419  O  O2    . DT  A 1 70  ? 58.259  127.886 6.276   1.00 23.69  ? 70  DT  I O2    1 
ATOM   1420  N  N3    . DT  A 1 70  ? 58.454  128.375 4.075   1.00 23.69  ? 70  DT  I N3    1 
ATOM   1421  C  C4    . DT  A 1 70  ? 58.362  128.101 2.730   1.00 23.69  ? 70  DT  I C4    1 
ATOM   1422  O  O4    . DT  A 1 70  ? 58.649  128.981 1.915   1.00 23.69  ? 70  DT  I O4    1 
ATOM   1423  C  C5    . DT  A 1 70  ? 57.914  126.750 2.400   1.00 23.69  ? 70  DT  I C5    1 
ATOM   1424  C  C7    . DT  A 1 70  ? 57.775  126.349 0.964   1.00 23.69  ? 70  DT  I C7    1 
ATOM   1425  C  C6    . DT  A 1 70  ? 57.647  125.916 3.414   1.00 23.69  ? 70  DT  I C6    1 
ATOM   1426  P  P     . DG  A 1 71  ? 55.098  122.939 8.518   1.00 34.42  ? 71  DG  I P     1 
ATOM   1427  O  OP1   . DG  A 1 71  ? 55.286  121.749 9.384   1.00 34.42  ? 71  DG  I OP1   1 
ATOM   1428  O  OP2   . DG  A 1 71  ? 54.055  122.937 7.435   1.00 34.42  ? 71  DG  I OP2   1 
ATOM   1429  O  "O5'" . DG  A 1 71  ? 54.855  124.114 9.542   1.00 46.23  ? 71  DG  I "O5'" 1 
ATOM   1430  C  "C5'" . DG  A 1 71  ? 53.679  124.851 9.472   1.00 46.23  ? 71  DG  I "C5'" 1 
ATOM   1431  C  "C4'" . DG  A 1 71  ? 53.985  126.323 9.418   1.00 46.23  ? 71  DG  I "C4'" 1 
ATOM   1432  O  "O4'" . DG  A 1 71  ? 54.709  126.695 8.218   1.00 46.23  ? 71  DG  I "O4'" 1 
ATOM   1433  C  "C3'" . DG  A 1 71  ? 52.660  127.061 9.352   1.00 46.23  ? 71  DG  I "C3'" 1 
ATOM   1434  O  "O3'" . DG  A 1 71  ? 52.666  128.103 10.286  1.00 46.23  ? 71  DG  I "O3'" 1 
ATOM   1435  C  "C2'" . DG  A 1 71  ? 52.557  127.551 7.925   1.00 46.23  ? 71  DG  I "C2'" 1 
ATOM   1436  C  "C1'" . DG  A 1 71  ? 54.003  127.732 7.568   1.00 46.23  ? 71  DG  I "C1'" 1 
ATOM   1437  N  N9    . DG  A 1 71  ? 54.219  127.620 6.141   1.00 34.75  ? 71  DG  I N9    1 
ATOM   1438  C  C8    . DG  A 1 71  ? 54.009  126.542 5.321   1.00 34.75  ? 71  DG  I C8    1 
ATOM   1439  N  N7    . DG  A 1 71  ? 54.258  126.799 4.065   1.00 34.75  ? 71  DG  I N7    1 
ATOM   1440  C  C5    . DG  A 1 71  ? 54.663  128.119 4.075   1.00 34.75  ? 71  DG  I C5    1 
ATOM   1441  C  C6    . DG  A 1 71  ? 55.065  128.946 3.028   1.00 34.75  ? 71  DG  I C6    1 
ATOM   1442  O  O6    . DG  A 1 71  ? 55.145  128.668 1.830   1.00 34.75  ? 71  DG  I O6    1 
ATOM   1443  N  N1    . DG  A 1 71  ? 55.404  130.221 3.482   1.00 34.75  ? 71  DG  I N1    1 
ATOM   1444  C  C2    . DG  A 1 71  ? 55.357  130.622 4.793   1.00 34.75  ? 71  DG  I C2    1 
ATOM   1445  N  N2    . DG  A 1 71  ? 55.736  131.863 5.048   1.00 34.75  ? 71  DG  I N2    1 
ATOM   1446  N  N3    . DG  A 1 71  ? 54.975  129.856 5.779   1.00 34.75  ? 71  DG  I N3    1 
ATOM   1447  C  C4    . DG  A 1 71  ? 54.649  128.625 5.352   1.00 34.75  ? 71  DG  I C4    1 
ATOM   1448  P  P     . DA  A 1 72  ? 51.443  128.230 11.287  1.00 45.92  ? 72  DA  I P     1 
ATOM   1449  O  OP1   . DA  A 1 72  ? 51.797  127.623 12.601  1.00 45.92  ? 72  DA  I OP1   1 
ATOM   1450  O  OP2   . DA  A 1 72  ? 50.283  127.700 10.508  1.00 45.92  ? 72  DA  I OP2   1 
ATOM   1451  O  "O5'" . DA  A 1 72  ? 51.332  129.810 11.438  1.00 65.02  ? 72  DA  I "O5'" 1 
ATOM   1452  C  "C5'" . DA  A 1 72  ? 52.499  130.631 11.416  1.00 65.02  ? 72  DA  I "C5'" 1 
ATOM   1453  C  "C4'" . DA  A 1 72  ? 52.267  131.836 10.537  1.00 65.02  ? 72  DA  I "C4'" 1 
ATOM   1454  O  "O4'" . DA  A 1 72  ? 52.634  131.568 9.166   1.00 65.02  ? 72  DA  I "O4'" 1 
ATOM   1455  C  "C3'" . DA  A 1 72  ? 50.809  132.297 10.499  1.00 65.02  ? 72  DA  I "C3'" 1 
ATOM   1456  O  "O3'" . DA  A 1 72  ? 50.714  133.710 10.589  1.00 65.02  ? 72  DA  I "O3'" 1 
ATOM   1457  C  "C2'" . DA  A 1 72  ? 50.337  131.877 9.125   1.00 65.02  ? 72  DA  I "C2'" 1 
ATOM   1458  C  "C1'" . DA  A 1 72  ? 51.601  132.059 8.333   1.00 65.02  ? 72  DA  I "C1'" 1 
ATOM   1459  N  N9    . DA  A 1 72  ? 51.611  131.290 7.102   1.00 51.41  ? 72  DA  I N9    1 
ATOM   1460  C  C8    . DA  A 1 72  ? 51.229  129.992 6.925   1.00 51.41  ? 72  DA  I C8    1 
ATOM   1461  N  N7    . DA  A 1 72  ? 51.332  129.577 5.687   1.00 51.41  ? 72  DA  I N7    1 
ATOM   1462  C  C5    . DA  A 1 72  ? 51.822  130.681 5.004   1.00 51.41  ? 72  DA  I C5    1 
ATOM   1463  C  C6    . DA  A 1 72  ? 52.152  130.894 3.645   1.00 51.41  ? 72  DA  I C6    1 
ATOM   1464  N  N6    . DA  A 1 72  ? 52.028  129.963 2.687   1.00 51.41  ? 72  DA  I N6    1 
ATOM   1465  N  N1    . DA  A 1 72  ? 52.613  132.115 3.301   1.00 51.41  ? 72  DA  I N1    1 
ATOM   1466  C  C2    . DA  A 1 72  ? 52.728  133.052 4.256   1.00 51.41  ? 72  DA  I C2    1 
ATOM   1467  N  N3    . DA  A 1 72  ? 52.449  132.971 5.559   1.00 51.41  ? 72  DA  I N3    1 
ATOM   1468  C  C4    . DA  A 1 72  ? 51.998  131.744 5.868   1.00 51.41  ? 72  DA  I C4    1 
ATOM   1469  P  P     . DA  A 1 73  ? 49.376  134.366 11.183  1.00 53.82  ? 73  DA  I P     1 
ATOM   1470  O  OP1   . DA  A 1 73  ? 49.604  134.676 12.619  1.00 53.82  ? 73  DA  I OP1   1 
ATOM   1471  O  OP2   . DA  A 1 73  ? 48.209  133.515 10.779  1.00 53.82  ? 73  DA  I OP2   1 
ATOM   1472  O  "O5'" . DA  A 1 73  ? 49.297  135.722 10.380  1.00 57.54  ? 73  DA  I "O5'" 1 
ATOM   1473  C  "C5'" . DA  A 1 73  ? 50.379  136.129 9.571   1.00 57.54  ? 73  DA  I "C5'" 1 
ATOM   1474  C  "C4'" . DA  A 1 73  ? 49.847  136.786 8.326   1.00 57.54  ? 73  DA  I "C4'" 1 
ATOM   1475  O  "O4'" . DA  A 1 73  ? 49.986  135.907 7.186   1.00 57.54  ? 73  DA  I "O4'" 1 
ATOM   1476  C  "C3'" . DA  A 1 73  ? 48.367  137.155 8.415   1.00 57.54  ? 73  DA  I "C3'" 1 
ATOM   1477  O  "O3'" . DA  A 1 73  ? 48.191  138.509 7.975   1.00 57.54  ? 73  DA  I "O3'" 1 
ATOM   1478  C  "C2'" . DA  A 1 73  ? 47.692  136.133 7.511   1.00 57.54  ? 73  DA  I "C2'" 1 
ATOM   1479  C  "C1'" . DA  A 1 73  ? 48.767  135.839 6.483   1.00 57.54  ? 73  DA  I "C1'" 1 
ATOM   1480  N  N9    . DA  A 1 73  ? 48.693  134.516 5.881   1.00 53.60  ? 73  DA  I N9    1 
ATOM   1481  C  C8    . DA  A 1 73  ? 48.271  133.341 6.453   1.00 53.60  ? 73  DA  I C8    1 
ATOM   1482  N  N7    . DA  A 1 73  ? 48.312  132.309 5.639   1.00 53.60  ? 73  DA  I N7    1 
ATOM   1483  C  C5    . DA  A 1 73  ? 48.796  132.844 4.454   1.00 53.60  ? 73  DA  I C5    1 
ATOM   1484  C  C6    . DA  A 1 73  ? 49.063  132.272 3.195   1.00 53.60  ? 73  DA  I C6    1 
ATOM   1485  N  N6    . DA  A 1 73  ? 48.875  130.981 2.912   1.00 53.60  ? 73  DA  I N6    1 
ATOM   1486  N  N1    . DA  A 1 73  ? 49.538  133.087 2.222   1.00 53.60  ? 73  DA  I N1    1 
ATOM   1487  C  C2    . DA  A 1 73  ? 49.734  134.382 2.510   1.00 53.60  ? 73  DA  I C2    1 
ATOM   1488  N  N3    . DA  A 1 73  ? 49.523  135.034 3.656   1.00 53.60  ? 73  DA  I N3    1 
ATOM   1489  C  C4    . DA  A 1 73  ? 49.044  134.201 4.593   1.00 53.60  ? 73  DA  I C4    1 
ATOM   1490  P  P     . DT  A 1 74  ? 46.727  139.050 7.601   1.00 68.60  ? 74  DT  I P     1 
ATOM   1491  O  OP1   . DT  A 1 74  ? 46.730  140.523 7.800   1.00 68.60  ? 74  DT  I OP1   1 
ATOM   1492  O  OP2   . DT  A 1 74  ? 45.726  138.208 8.317   1.00 68.60  ? 74  DT  I OP2   1 
ATOM   1493  O  "O5'" . DT  A 1 74  ? 46.638  138.759 6.039   1.00 51.36  ? 74  DT  I "O5'" 1 
ATOM   1494  C  "C5'" . DT  A 1 74  ? 47.576  139.343 5.145   1.00 51.36  ? 74  DT  I "C5'" 1 
ATOM   1495  C  "C4'" . DT  A 1 74  ? 46.987  139.403 3.759   1.00 51.36  ? 74  DT  I "C4'" 1 
ATOM   1496  O  "O4'" . DT  A 1 74  ? 47.128  138.122 3.103   1.00 51.36  ? 74  DT  I "O4'" 1 
ATOM   1497  C  "C3'" . DT  A 1 74  ? 45.493  139.731 3.745   1.00 51.36  ? 74  DT  I "C3'" 1 
ATOM   1498  O  "O3'" . DT  A 1 74  ? 45.197  140.685 2.713   1.00 51.36  ? 74  DT  I "O3'" 1 
ATOM   1499  C  "C2'" . DT  A 1 74  ? 44.836  138.383 3.482   1.00 51.36  ? 74  DT  I "C2'" 1 
ATOM   1500  C  "C1'" . DT  A 1 74  ? 45.868  137.689 2.611   1.00 51.36  ? 74  DT  I "C1'" 1 
ATOM   1501  N  N1    . DT  A 1 74  ? 45.844  136.222 2.691   1.00 29.80  ? 74  DT  I N1    1 
ATOM   1502  C  C2    . DT  A 1 74  ? 46.151  135.496 1.564   1.00 29.80  ? 74  DT  I C2    1 
ATOM   1503  O  O2    . DT  A 1 74  ? 46.377  136.004 0.471   1.00 29.80  ? 74  DT  I O2    1 
ATOM   1504  N  N3    . DT  A 1 74  ? 46.163  134.138 1.756   1.00 29.80  ? 74  DT  I N3    1 
ATOM   1505  C  C4    . DT  A 1 74  ? 45.880  133.452 2.922   1.00 29.80  ? 74  DT  I C4    1 
ATOM   1506  O  O4    . DT  A 1 74  ? 45.926  132.210 2.937   1.00 29.80  ? 74  DT  I O4    1 
ATOM   1507  C  C5    . DT  A 1 74  ? 45.537  134.277 4.048   1.00 29.80  ? 74  DT  I C5    1 
ATOM   1508  C  C7    . DT  A 1 74  ? 45.197  133.621 5.345   1.00 29.80  ? 74  DT  I C7    1 
ATOM   1509  C  C6    . DT  A 1 74  ? 45.538  135.602 3.881   1.00 29.80  ? 74  DT  I C6    1 
ATOM   1510  P  P     . DT  A 1 75  ? 43.668  141.066 2.388   1.00 76.25  ? 75  DT  I P     1 
ATOM   1511  O  OP1   . DT  A 1 75  ? 43.641  142.499 1.985   1.00 76.25  ? 75  DT  I OP1   1 
ATOM   1512  O  OP2   . DT  A 1 75  ? 42.805  140.590 3.509   1.00 76.25  ? 75  DT  I OP2   1 
ATOM   1513  O  "O5'" . DT  A 1 75  ? 43.370  140.182 1.104   1.00 63.46  ? 75  DT  I "O5'" 1 
ATOM   1514  C  "C5'" . DT  A 1 75  ? 44.292  140.199 0.030   1.00 63.46  ? 75  DT  I "C5'" 1 
ATOM   1515  C  "C4'" . DT  A 1 75  ? 43.765  139.398 -1.131  1.00 63.46  ? 75  DT  I "C4'" 1 
ATOM   1516  O  "O4'" . DT  A 1 75  ? 43.957  137.986 -0.907  1.00 63.46  ? 75  DT  I "O4'" 1 
ATOM   1517  C  "C3'" . DT  A 1 75  ? 42.282  139.591 -1.414  1.00 63.46  ? 75  DT  I "C3'" 1 
ATOM   1518  O  "O3'" . DT  A 1 75  ? 42.110  139.601 -2.817  1.00 63.46  ? 75  DT  I "O3'" 1 
ATOM   1519  C  "C2'" . DT  A 1 75  ? 41.652  138.333 -0.848  1.00 63.46  ? 75  DT  I "C2'" 1 
ATOM   1520  C  "C1'" . DT  A 1 75  ? 42.735  137.311 -1.132  1.00 63.46  ? 75  DT  I "C1'" 1 
ATOM   1521  N  N1    . DT  A 1 75  ? 42.717  136.128 -0.262  1.00 40.15  ? 75  DT  I N1    1 
ATOM   1522  C  C2    . DT  A 1 75  ? 43.032  134.906 -0.823  1.00 40.15  ? 75  DT  I C2    1 
ATOM   1523  O  O2    . DT  A 1 75  ? 43.362  134.762 -2.002  1.00 40.15  ? 75  DT  I O2    1 
ATOM   1524  N  N3    . DT  A 1 75  ? 42.954  133.849 0.057   1.00 40.15  ? 75  DT  I N3    1 
ATOM   1525  C  C4    . DT  A 1 75  ? 42.620  133.897 1.399   1.00 40.15  ? 75  DT  I C4    1 
ATOM   1526  O  O4    . DT  A 1 75  ? 42.579  132.865 2.054   1.00 40.15  ? 75  DT  I O4    1 
ATOM   1527  C  C5    . DT  A 1 75  ? 42.337  135.205 1.917   1.00 40.15  ? 75  DT  I C5    1 
ATOM   1528  C  C7    . DT  A 1 75  ? 42.003  135.347 3.367   1.00 40.15  ? 75  DT  I C7    1 
ATOM   1529  C  C6    . DT  A 1 75  ? 42.390  136.243 1.074   1.00 40.15  ? 75  DT  I C6    1 
ATOM   1530  P  P     . DC  A 1 76  ? 40.900  140.419 -3.458  1.00 62.68  ? 76  DC  I P     1 
ATOM   1531  O  OP1   . DC  A 1 76  ? 41.492  141.539 -4.231  1.00 62.68  ? 76  DC  I OP1   1 
ATOM   1532  O  OP2   . DC  A 1 76  ? 39.921  140.704 -2.376  1.00 62.68  ? 76  DC  I OP2   1 
ATOM   1533  O  "O5'" . DC  A 1 76  ? 40.279  139.359 -4.471  1.00 64.72  ? 76  DC  I "O5'" 1 
ATOM   1534  C  "C5'" . DC  A 1 76  ? 41.083  138.290 -4.985  1.00 64.72  ? 76  DC  I "C5'" 1 
ATOM   1535  C  "C4'" . DC  A 1 76  ? 40.215  137.126 -5.404  1.00 64.72  ? 76  DC  I "C4'" 1 
ATOM   1536  O  "O4'" . DC  A 1 76  ? 40.309  136.057 -4.432  1.00 64.72  ? 76  DC  I "O4'" 1 
ATOM   1537  C  "C3'" . DC  A 1 76  ? 38.722  137.429 -5.540  1.00 64.72  ? 76  DC  I "C3'" 1 
ATOM   1538  O  "O3'" . DC  A 1 76  ? 38.201  136.628 -6.594  1.00 64.72  ? 76  DC  I "O3'" 1 
ATOM   1539  C  "C2'" . DC  A 1 76  ? 38.153  136.919 -4.229  1.00 64.72  ? 76  DC  I "C2'" 1 
ATOM   1540  C  "C1'" . DC  A 1 76  ? 39.001  135.685 -4.026  1.00 64.72  ? 76  DC  I "C1'" 1 
ATOM   1541  N  N1    . DC  A 1 76  ? 39.074  135.183 -2.650  1.00 33.62  ? 76  DC  I N1    1 
ATOM   1542  C  C2    . DC  A 1 76  ? 39.438  133.834 -2.444  1.00 33.62  ? 76  DC  I C2    1 
ATOM   1543  O  O2    . DC  A 1 76  ? 39.686  133.125 -3.433  1.00 33.62  ? 76  DC  I O2    1 
ATOM   1544  N  N3    . DC  A 1 76  ? 39.506  133.345 -1.176  1.00 33.62  ? 76  DC  I N3    1 
ATOM   1545  C  C4    . DC  A 1 76  ? 39.224  134.147 -0.140  1.00 33.62  ? 76  DC  I C4    1 
ATOM   1546  N  N4    . DC  A 1 76  ? 39.286  133.627 1.098   1.00 33.62  ? 76  DC  I N4    1 
ATOM   1547  C  C5    . DC  A 1 76  ? 38.858  135.525 -0.325  1.00 33.62  ? 76  DC  I C5    1 
ATOM   1548  C  C6    . DC  A 1 76  ? 38.796  135.994 -1.584  1.00 33.62  ? 76  DC  I C6    1 
ATOM   1549  P  P     . DA  A 1 77  ? 37.324  137.297 -7.755  1.00 70.45  ? 77  DA  I P     1 
ATOM   1550  O  OP1   . DA  A 1 77  ? 38.146  138.342 -8.418  1.00 70.45  ? 77  DA  I OP1   1 
ATOM   1551  O  OP2   . DA  A 1 77  ? 35.997  137.652 -7.171  1.00 70.45  ? 77  DA  I OP2   1 
ATOM   1552  O  "O5'" . DA  A 1 77  ? 37.140  136.104 -8.796  1.00 46.80  ? 77  DA  I "O5'" 1 
ATOM   1553  C  "C5'" . DA  A 1 77  ? 38.281  135.437 -9.348  1.00 46.80  ? 77  DA  I "C5'" 1 
ATOM   1554  C  "C4'" . DA  A 1 77  ? 38.112  133.933 -9.283  1.00 46.80  ? 77  DA  I "C4'" 1 
ATOM   1555  O  "O4'" . DA  A 1 77  ? 38.084  133.471 -7.906  1.00 46.80  ? 77  DA  I "O4'" 1 
ATOM   1556  C  "C3'" . DA  A 1 77  ? 36.848  133.383 -9.939  1.00 46.80  ? 77  DA  I "C3'" 1 
ATOM   1557  O  "O3'" . DA  A 1 77  ? 37.170  132.193 -10.664 1.00 46.80  ? 77  DA  I "O3'" 1 
ATOM   1558  C  "C2'" . DA  A 1 77  ? 35.916  133.119 -8.764  1.00 46.80  ? 77  DA  I "C2'" 1 
ATOM   1559  C  "C1'" . DA  A 1 77  ? 36.870  132.776 -7.626  1.00 46.80  ? 77  DA  I "C1'" 1 
ATOM   1560  N  N9    . DA  A 1 77  ? 36.417  133.208 -6.300  1.00 35.03  ? 77  DA  I N9    1 
ATOM   1561  C  C8    . DA  A 1 77  ? 35.781  134.383 -5.980  1.00 35.03  ? 77  DA  I C8    1 
ATOM   1562  N  N7    . DA  A 1 77  ? 35.533  134.524 -4.697  1.00 35.03  ? 77  DA  I N7    1 
ATOM   1563  C  C5    . DA  A 1 77  ? 36.033  133.359 -4.131  1.00 35.03  ? 77  DA  I C5    1 
ATOM   1564  C  C6    . DA  A 1 77  ? 36.086  132.900 -2.791  1.00 35.03  ? 77  DA  I C6    1 
ATOM   1565  N  N6    . DA  A 1 77  ? 35.641  133.599 -1.739  1.00 35.03  ? 77  DA  I N6    1 
ATOM   1566  N  N1    . DA  A 1 77  ? 36.629  131.684 -2.573  1.00 35.03  ? 77  DA  I N1    1 
ATOM   1567  C  C2    . DA  A 1 77  ? 37.099  130.990 -3.630  1.00 35.03  ? 77  DA  I C2    1 
ATOM   1568  N  N3    . DA  A 1 77  ? 37.121  131.319 -4.924  1.00 35.03  ? 77  DA  I N3    1 
ATOM   1569  C  C4    . DA  A 1 77  ? 36.567  132.529 -5.111  1.00 35.03  ? 77  DA  I C4    1 
ATOM   1570  P  P     . DG  A 1 78  ? 36.138  131.617 -11.755 1.00 59.13  ? 78  DG  I P     1 
ATOM   1571  O  OP1   . DG  A 1 78  ? 36.912  130.980 -12.852 1.00 59.13  ? 78  DG  I OP1   1 
ATOM   1572  O  OP2   . DG  A 1 78  ? 35.087  132.628 -12.067 1.00 59.13  ? 78  DG  I OP2   1 
ATOM   1573  O  "O5'" . DG  A 1 78  ? 35.406  130.459 -10.972 1.00 70.76  ? 78  DG  I "O5'" 1 
ATOM   1574  C  "C5'" . DG  A 1 78  ? 35.253  130.546 -9.572  1.00 70.76  ? 78  DG  I "C5'" 1 
ATOM   1575  C  "C4'" . DG  A 1 78  ? 35.096  129.166 -8.996  1.00 70.76  ? 78  DG  I "C4'" 1 
ATOM   1576  O  "O4'" . DG  A 1 78  ? 34.837  129.289 -7.593  1.00 70.76  ? 78  DG  I "O4'" 1 
ATOM   1577  C  "C3'" . DG  A 1 78  ? 33.887  128.440 -9.549  1.00 70.76  ? 78  DG  I "C3'" 1 
ATOM   1578  O  "O3'" . DG  A 1 78  ? 34.135  127.069 -9.306  1.00 70.76  ? 78  DG  I "O3'" 1 
ATOM   1579  C  "C2'" . DG  A 1 78  ? 32.760  128.998 -8.703  1.00 70.76  ? 78  DG  I "C2'" 1 
ATOM   1580  C  "C1'" . DG  A 1 78  ? 33.442  129.262 -7.366  1.00 70.76  ? 78  DG  I "C1'" 1 
ATOM   1581  N  N9    . DG  A 1 78  ? 33.116  130.532 -6.739  1.00 48.59  ? 78  DG  I N9    1 
ATOM   1582  C  C8    . DG  A 1 78  ? 32.826  131.728 -7.346  1.00 48.59  ? 78  DG  I C8    1 
ATOM   1583  N  N7    . DG  A 1 78  ? 32.616  132.692 -6.491  1.00 48.59  ? 78  DG  I N7    1 
ATOM   1584  C  C5    . DG  A 1 78  ? 32.767  132.088 -5.252  1.00 48.59  ? 78  DG  I C5    1 
ATOM   1585  C  C6    . DG  A 1 78  ? 32.642  132.624 -3.950  1.00 48.59  ? 78  DG  I C6    1 
ATOM   1586  O  O6    . DG  A 1 78  ? 32.346  133.791 -3.616  1.00 48.59  ? 78  DG  I O6    1 
ATOM   1587  N  N1    . DG  A 1 78  ? 32.879  131.651 -2.976  1.00 48.59  ? 78  DG  I N1    1 
ATOM   1588  C  C2    . DG  A 1 78  ? 33.175  130.329 -3.234  1.00 48.59  ? 78  DG  I C2    1 
ATOM   1589  N  N2    . DG  A 1 78  ? 33.340  129.535 -2.168  1.00 48.59  ? 78  DG  I N2    1 
ATOM   1590  N  N3    . DG  A 1 78  ? 33.291  129.826 -4.441  1.00 48.59  ? 78  DG  I N3    1 
ATOM   1591  C  C4    . DG  A 1 78  ? 33.073  130.755 -5.394  1.00 48.59  ? 78  DG  I C4    1 
ATOM   1592  P  P     . DC  A 1 79  ? 33.379  125.945 -10.153 1.00 56.07  ? 79  DC  I P     1 
ATOM   1593  O  OP1   . DC  A 1 79  ? 34.184  125.565 -11.344 1.00 56.07  ? 79  DC  I OP1   1 
ATOM   1594  O  OP2   . DC  A 1 79  ? 31.978  126.382 -10.331 1.00 56.07  ? 79  DC  I OP2   1 
ATOM   1595  O  "O5'" . DC  A 1 79  ? 33.440  124.732 -9.127  1.00 36.59  ? 79  DC  I "O5'" 1 
ATOM   1596  C  "C5'" . DC  A 1 79  ? 34.666  124.429 -8.462  1.00 36.59  ? 79  DC  I "C5'" 1 
ATOM   1597  C  "C4'" . DC  A 1 79  ? 34.412  124.076 -7.018  1.00 36.59  ? 79  DC  I "C4'" 1 
ATOM   1598  O  "O4'" . DC  A 1 79  ? 33.836  125.183 -6.290  1.00 36.59  ? 79  DC  I "O4'" 1 
ATOM   1599  C  "C3'" . DC  A 1 79  ? 33.469  122.907 -6.793  1.00 36.59  ? 79  DC  I "C3'" 1 
ATOM   1600  O  "O3'" . DC  A 1 79  ? 33.963  122.232 -5.652  1.00 36.59  ? 79  DC  I "O3'" 1 
ATOM   1601  C  "C2'" . DC  A 1 79  ? 32.146  123.582 -6.480  1.00 36.59  ? 79  DC  I "C2'" 1 
ATOM   1602  C  "C1'" . DC  A 1 79  ? 32.610  124.789 -5.692  1.00 36.59  ? 79  DC  I "C1'" 1 
ATOM   1603  N  N1    . DC  A 1 79  ? 31.725  125.957 -5.722  1.00 35.92  ? 79  DC  I N1    1 
ATOM   1604  C  C2    . DC  A 1 79  ? 31.571  126.710 -4.559  1.00 35.92  ? 79  DC  I C2    1 
ATOM   1605  O  O2    . DC  A 1 79  ? 32.127  126.321 -3.508  1.00 35.92  ? 79  DC  I O2    1 
ATOM   1606  N  N3    . DC  A 1 79  ? 30.824  127.840 -4.603  1.00 35.92  ? 79  DC  I N3    1 
ATOM   1607  C  C4    . DC  A 1 79  ? 30.241  128.213 -5.747  1.00 35.92  ? 79  DC  I C4    1 
ATOM   1608  N  N4    . DC  A 1 79  ? 29.546  129.350 -5.757  1.00 35.92  ? 79  DC  I N4    1 
ATOM   1609  C  C5    . DC  A 1 79  ? 30.352  127.442 -6.933  1.00 35.92  ? 79  DC  I C5    1 
ATOM   1610  C  C6    . DC  A 1 79  ? 31.092  126.329 -6.875  1.00 35.92  ? 79  DC  I C6    1 
ATOM   1611  P  P     . DT  A 1 80  ? 33.566  120.718 -5.404  1.00 33.22  ? 80  DT  I P     1 
ATOM   1612  O  OP1   . DT  A 1 80  ? 34.800  120.115 -4.851  1.00 33.22  ? 80  DT  I OP1   1 
ATOM   1613  O  OP2   . DT  A 1 80  ? 32.923  120.140 -6.627  1.00 33.22  ? 80  DT  I OP2   1 
ATOM   1614  O  "O5'" . DT  A 1 80  ? 32.502  120.835 -4.240  1.00 24.73  ? 80  DT  I "O5'" 1 
ATOM   1615  C  "C5'" . DT  A 1 80  ? 32.924  121.286 -2.976  1.00 24.73  ? 80  DT  I "C5'" 1 
ATOM   1616  C  "C4'" . DT  A 1 80  ? 31.735  121.661 -2.132  1.00 24.73  ? 80  DT  I "C4'" 1 
ATOM   1617  O  "O4'" . DT  A 1 80  ? 31.118  122.843 -2.699  1.00 24.73  ? 80  DT  I "O4'" 1 
ATOM   1618  C  "C3'" . DT  A 1 80  ? 30.635  120.598 -2.019  1.00 24.73  ? 80  DT  I "C3'" 1 
ATOM   1619  O  "O3'" . DT  A 1 80  ? 30.244  120.482 -0.638  1.00 24.73  ? 80  DT  I "O3'" 1 
ATOM   1620  C  "C2'" . DT  A 1 80  ? 29.520  121.156 -2.891  1.00 24.73  ? 80  DT  I "C2'" 1 
ATOM   1621  C  "C1'" . DT  A 1 80  ? 29.721  122.659 -2.753  1.00 24.73  ? 80  DT  I "C1'" 1 
ATOM   1622  N  N1    . DT  A 1 80  ? 29.184  123.487 -3.862  1.00 35.42  ? 80  DT  I N1    1 
ATOM   1623  C  C2    . DT  A 1 80  ? 28.673  124.749 -3.582  1.00 35.42  ? 80  DT  I C2    1 
ATOM   1624  O  O2    . DT  A 1 80  ? 28.667  125.261 -2.466  1.00 35.42  ? 80  DT  I O2    1 
ATOM   1625  N  N3    . DT  A 1 80  ? 28.168  125.398 -4.672  1.00 35.42  ? 80  DT  I N3    1 
ATOM   1626  C  C4    . DT  A 1 80  ? 28.134  124.947 -5.980  1.00 35.42  ? 80  DT  I C4    1 
ATOM   1627  O  O4    . DT  A 1 80  ? 27.662  125.659 -6.863  1.00 35.42  ? 80  DT  I O4    1 
ATOM   1628  C  C5    . DT  A 1 80  ? 28.688  123.643 -6.195  1.00 35.42  ? 80  DT  I C5    1 
ATOM   1629  C  C7    . DT  A 1 80  ? 28.692  123.083 -7.579  1.00 35.42  ? 80  DT  I C7    1 
ATOM   1630  C  C6    . DT  A 1 80  ? 29.180  122.987 -5.143  1.00 35.42  ? 80  DT  I C6    1 
ATOM   1631  P  P     . DG  A 1 81  ? 29.165  119.385 -0.178  1.00 22.94  ? 81  DG  I P     1 
ATOM   1632  O  OP1   . DG  A 1 81  ? 29.806  118.352 0.670   1.00 22.94  ? 81  DG  I OP1   1 
ATOM   1633  O  OP2   . DG  A 1 81  ? 28.358  118.951 -1.338  1.00 22.94  ? 81  DG  I OP2   1 
ATOM   1634  O  "O5'" . DG  A 1 81  ? 28.253  120.254 0.780   1.00 25.83  ? 81  DG  I "O5'" 1 
ATOM   1635  C  "C5'" . DG  A 1 81  ? 28.852  121.127 1.739   1.00 25.83  ? 81  DG  I "C5'" 1 
ATOM   1636  C  "C4'" . DG  A 1 81  ? 27.818  122.081 2.285   1.00 25.83  ? 81  DG  I "C4'" 1 
ATOM   1637  O  "O4'" . DG  A 1 81  ? 27.408  123.006 1.255   1.00 25.83  ? 81  DG  I "O4'" 1 
ATOM   1638  C  "C3'" . DG  A 1 81  ? 26.543  121.381 2.742   1.00 25.83  ? 81  DG  I "C3'" 1 
ATOM   1639  O  "O3'" . DG  A 1 81  ? 25.987  122.115 3.810   1.00 25.83  ? 81  DG  I "O3'" 1 
ATOM   1640  C  "C2'" . DG  A 1 81  ? 25.630  121.471 1.538   1.00 25.83  ? 81  DG  I "C2'" 1 
ATOM   1641  C  "C1'" . DG  A 1 81  ? 26.035  122.800 0.924   1.00 25.83  ? 81  DG  I "C1'" 1 
ATOM   1642  N  N9    . DG  A 1 81  ? 25.920  122.826 -0.529  1.00 33.91  ? 81  DG  I N9    1 
ATOM   1643  C  C8    . DG  A 1 81  ? 26.342  121.872 -1.421  1.00 33.91  ? 81  DG  I C8    1 
ATOM   1644  N  N7    . DG  A 1 81  ? 26.080  122.176 -2.661  1.00 33.91  ? 81  DG  I N7    1 
ATOM   1645  C  C5    . DG  A 1 81  ? 25.449  123.406 -2.580  1.00 33.91  ? 81  DG  I C5    1 
ATOM   1646  C  C6    . DG  A 1 81  ? 24.920  124.234 -3.600  1.00 33.91  ? 81  DG  I C6    1 
ATOM   1647  O  O6    . DG  A 1 81  ? 24.883  124.022 -4.820  1.00 33.91  ? 81  DG  I O6    1 
ATOM   1648  N  N1    . DG  A 1 81  ? 24.379  125.410 -3.080  1.00 33.91  ? 81  DG  I N1    1 
ATOM   1649  C  C2    . DG  A 1 81  ? 24.336  125.734 -1.740  1.00 33.91  ? 81  DG  I C2    1 
ATOM   1650  N  N2    . DG  A 1 81  ? 23.766  126.903 -1.429  1.00 33.91  ? 81  DG  I N2    1 
ATOM   1651  N  N3    . DG  A 1 81  ? 24.814  124.963 -0.779  1.00 33.91  ? 81  DG  I N3    1 
ATOM   1652  C  C4    . DG  A 1 81  ? 25.353  123.823 -1.269  1.00 33.91  ? 81  DG  I C4    1 
ATOM   1653  P  P     . DA  A 1 82  ? 24.787  121.496 4.638   1.00 20.26  ? 82  DA  I P     1 
ATOM   1654  O  OP1   . DA  A 1 82  ? 25.090  121.643 6.089   1.00 20.26  ? 82  DA  I OP1   1 
ATOM   1655  O  OP2   . DA  A 1 82  ? 24.505  120.157 4.058   1.00 20.26  ? 82  DA  I OP2   1 
ATOM   1656  O  "O5'" . DA  A 1 82  ? 23.586  122.450 4.257   1.00 24.82  ? 82  DA  I "O5'" 1 
ATOM   1657  C  "C5'" . DA  A 1 82  ? 23.628  123.827 4.594   1.00 24.82  ? 82  DA  I "C5'" 1 
ATOM   1658  C  "C4'" . DA  A 1 82  ? 22.362  124.504 4.132   1.00 24.82  ? 82  DA  I "C4'" 1 
ATOM   1659  O  "O4'" . DA  A 1 82  ? 22.374  124.607 2.691   1.00 24.82  ? 82  DA  I "O4'" 1 
ATOM   1660  C  "C3'" . DA  A 1 82  ? 21.071  123.768 4.497   1.00 24.82  ? 82  DA  I "C3'" 1 
ATOM   1661  O  "O3'" . DA  A 1 82  ? 20.104  124.750 4.866   1.00 24.82  ? 82  DA  I "O3'" 1 
ATOM   1662  C  "C2'" . DA  A 1 82  ? 20.692  123.082 3.198   1.00 24.82  ? 82  DA  I "C2'" 1 
ATOM   1663  C  "C1'" . DA  A 1 82  ? 21.181  124.073 2.166   1.00 24.82  ? 82  DA  I "C1'" 1 
ATOM   1664  N  N9    . DA  A 1 82  ? 21.488  123.504 0.857   1.00 28.26  ? 82  DA  I N9    1 
ATOM   1665  C  C8    . DA  A 1 82  ? 21.929  122.241 0.568   1.00 28.26  ? 82  DA  I C8    1 
ATOM   1666  N  N7    . DA  A 1 82  ? 22.069  122.011 -0.718  1.00 28.26  ? 82  DA  I N7    1 
ATOM   1667  C  C5    . DA  A 1 82  ? 21.701  123.211 -1.314  1.00 28.26  ? 82  DA  I C5    1 
ATOM   1668  C  C6    . DA  A 1 82  ? 21.609  123.613 -2.663  1.00 28.26  ? 82  DA  I C6    1 
ATOM   1669  N  N6    . DA  A 1 82  ? 21.858  122.803 -3.697  1.00 28.26  ? 82  DA  I N6    1 
ATOM   1670  N  N1    . DA  A 1 82  ? 21.230  124.884 -2.916  1.00 28.26  ? 82  DA  I N1    1 
ATOM   1671  C  C2    . DA  A 1 82  ? 20.943  125.681 -1.886  1.00 28.26  ? 82  DA  I C2    1 
ATOM   1672  N  N3    . DA  A 1 82  ? 20.970  125.416 -0.575  1.00 28.26  ? 82  DA  I N3    1 
ATOM   1673  C  C4    . DA  A 1 82  ? 21.362  124.146 -0.355  1.00 28.26  ? 82  DA  I C4    1 
ATOM   1674  P  P     . DA  A 1 83  ? 18.702  124.312 5.518   1.00 28.62  ? 83  DA  I P     1 
ATOM   1675  O  OP1   . DA  A 1 83  ? 18.459  125.303 6.622   1.00 28.62  ? 83  DA  I OP1   1 
ATOM   1676  O  OP2   . DA  A 1 83  ? 18.706  122.836 5.808   1.00 28.62  ? 83  DA  I OP2   1 
ATOM   1677  O  "O5'" . DA  A 1 83  ? 17.676  124.593 4.333   1.00 31.28  ? 83  DA  I "O5'" 1 
ATOM   1678  C  "C5'" . DA  A 1 83  ? 17.777  125.795 3.576   1.00 31.28  ? 83  DA  I "C5'" 1 
ATOM   1679  C  "C4'" . DA  A 1 83  ? 16.861  125.745 2.377   1.00 31.28  ? 83  DA  I "C4'" 1 
ATOM   1680  O  "O4'" . DA  A 1 83  ? 17.498  125.148 1.220   1.00 31.28  ? 83  DA  I "O4'" 1 
ATOM   1681  C  "C3'" . DA  A 1 83  ? 15.550  124.989 2.593   1.00 31.28  ? 83  DA  I "C3'" 1 
ATOM   1682  O  "O3'" . DA  A 1 83  ? 14.465  125.769 2.077   1.00 31.28  ? 83  DA  I "O3'" 1 
ATOM   1683  C  "C2'" . DA  A 1 83  ? 15.747  123.725 1.773   1.00 31.28  ? 83  DA  I "C2'" 1 
ATOM   1684  C  "C1'" . DA  A 1 83  ? 16.602  124.230 0.632   1.00 31.28  ? 83  DA  I "C1'" 1 
ATOM   1685  N  N9    . DA  A 1 83  ? 17.379  123.204 -0.063  1.00 38.29  ? 83  DA  I N9    1 
ATOM   1686  C  C8    . DA  A 1 83  ? 17.968  122.079 0.456   1.00 38.29  ? 83  DA  I C8    1 
ATOM   1687  N  N7    . DA  A 1 83  ? 18.593  121.349 -0.441  1.00 38.29  ? 83  DA  I N7    1 
ATOM   1688  C  C5    . DA  A 1 83  ? 18.405  122.045 -1.631  1.00 38.29  ? 83  DA  I C5    1 
ATOM   1689  C  C6    . DA  A 1 83  ? 18.823  121.799 -2.964  1.00 38.29  ? 83  DA  I C6    1 
ATOM   1690  N  N6    . DA  A 1 83  ? 19.591  120.777 -3.335  1.00 38.29  ? 83  DA  I N6    1 
ATOM   1691  N  N1    . DA  A 1 83  ? 18.429  122.666 -3.910  1.00 38.29  ? 83  DA  I N1    1 
ATOM   1692  C  C2    . DA  A 1 83  ? 17.701  123.721 -3.545  1.00 38.29  ? 83  DA  I C2    1 
ATOM   1693  N  N3    . DA  A 1 83  ? 17.269  124.079 -2.330  1.00 38.29  ? 83  DA  I N3    1 
ATOM   1694  C  C4    . DA  A 1 83  ? 17.654  123.184 -1.410  1.00 38.29  ? 83  DA  I C4    1 
ATOM   1695  P  P     . DC  A 1 84  ? 12.947  125.369 2.412   1.00 53.71  ? 84  DC  I P     1 
ATOM   1696  O  OP1   . DC  A 1 84  ? 12.386  126.501 3.185   1.00 53.71  ? 84  DC  I OP1   1 
ATOM   1697  O  OP2   . DC  A 1 84  ? 12.877  123.991 2.981   1.00 53.71  ? 84  DC  I OP2   1 
ATOM   1698  O  "O5'" . DC  A 1 84  ? 12.326  125.401 0.952   1.00 50.38  ? 84  DC  I "O5'" 1 
ATOM   1699  C  "C5'" . DC  A 1 84  ? 13.095  125.949 -0.125  1.00 50.38  ? 84  DC  I "C5'" 1 
ATOM   1700  C  "C4'" . DC  A 1 84  ? 12.440  125.628 -1.444  1.00 50.38  ? 84  DC  I "C4'" 1 
ATOM   1701  O  "O4'" . DC  A 1 84  ? 13.277  124.735 -2.222  1.00 50.38  ? 84  DC  I "O4'" 1 
ATOM   1702  C  "C3'" . DC  A 1 84  ? 11.121  124.900 -1.237  1.00 50.38  ? 84  DC  I "C3'" 1 
ATOM   1703  O  "O3'" . DC  A 1 84  ? 10.201  125.305 -2.248  1.00 50.38  ? 84  DC  I "O3'" 1 
ATOM   1704  C  "C2'" . DC  A 1 84  ? 11.512  123.442 -1.368  1.00 50.38  ? 84  DC  I "C2'" 1 
ATOM   1705  C  "C1'" . DC  A 1 84  ? 12.612  123.493 -2.414  1.00 50.38  ? 84  DC  I "C1'" 1 
ATOM   1706  N  N1    . DC  A 1 84  ? 13.592  122.397 -2.271  1.00 33.88  ? 84  DC  I N1    1 
ATOM   1707  C  C2    . DC  A 1 84  ? 14.262  121.905 -3.424  1.00 33.88  ? 84  DC  I C2    1 
ATOM   1708  O  O2    . DC  A 1 84  ? 14.055  122.446 -4.533  1.00 33.88  ? 84  DC  I O2    1 
ATOM   1709  N  N3    . DC  A 1 84  ? 15.117  120.851 -3.290  1.00 33.88  ? 84  DC  I N3    1 
ATOM   1710  C  C4    . DC  A 1 84  ? 15.322  120.299 -2.080  1.00 33.88  ? 84  DC  I C4    1 
ATOM   1711  N  N4    . DC  A 1 84  ? 16.154  119.251 -1.997  1.00 33.88  ? 84  DC  I N4    1 
ATOM   1712  C  C5    . DC  A 1 84  ? 14.677  120.796 -0.902  1.00 33.88  ? 84  DC  I C5    1 
ATOM   1713  C  C6    . DC  A 1 84  ? 13.833  121.836 -1.043  1.00 33.88  ? 84  DC  I C6    1 
ATOM   1714  P  P     . DA  A 1 85  ? 8.677   124.783 -2.210  1.00 57.81  ? 85  DA  I P     1 
ATOM   1715  O  OP1   . DA  A 1 85  ? 7.808   125.989 -2.154  1.00 57.81  ? 85  DA  I OP1   1 
ATOM   1716  O  OP2   . DA  A 1 85  ? 8.533   123.724 -1.169  1.00 57.81  ? 85  DA  I OP2   1 
ATOM   1717  O  "O5'" . DA  A 1 85  ? 8.518   124.116 -3.646  1.00 56.09  ? 85  DA  I "O5'" 1 
ATOM   1718  C  "C5'" . DA  A 1 85  ? 8.990   124.788 -4.807  1.00 56.09  ? 85  DA  I "C5'" 1 
ATOM   1719  C  "C4'" . DA  A 1 85  ? 9.030   123.832 -5.971  1.00 56.09  ? 85  DA  I "C4'" 1 
ATOM   1720  O  "O4'" . DA  A 1 85  ? 10.131  122.911 -5.790  1.00 56.09  ? 85  DA  I "O4'" 1 
ATOM   1721  C  "C3'" . DA  A 1 85  ? 7.769   122.971 -6.103  1.00 56.09  ? 85  DA  I "C3'" 1 
ATOM   1722  O  "O3'" . DA  A 1 85  ? 7.423   122.794 -7.493  1.00 56.09  ? 85  DA  I "O3'" 1 
ATOM   1723  C  "C2'" . DA  A 1 85  ? 8.175   121.661 -5.449  1.00 56.09  ? 85  DA  I "C2'" 1 
ATOM   1724  C  "C1'" . DA  A 1 85  ? 9.648   121.578 -5.805  1.00 56.09  ? 85  DA  I "C1'" 1 
ATOM   1725  N  N9    . DA  A 1 85  ? 10.449  120.782 -4.873  1.00 47.43  ? 85  DA  I N9    1 
ATOM   1726  C  C8    . DA  A 1 85  ? 10.415  120.766 -3.500  1.00 47.43  ? 85  DA  I C8    1 
ATOM   1727  N  N7    . DA  A 1 85  ? 11.222  119.885 -2.962  1.00 47.43  ? 85  DA  I N7    1 
ATOM   1728  C  C5    . DA  A 1 85  ? 11.839  119.286 -4.054  1.00 47.43  ? 85  DA  I C5    1 
ATOM   1729  C  C6    . DA  A 1 85  ? 12.799  118.251 -4.164  1.00 47.43  ? 85  DA  I C6    1 
ATOM   1730  N  N6    . DA  A 1 85  ? 13.291  117.577 -3.123  1.00 47.43  ? 85  DA  I N6    1 
ATOM   1731  N  N1    . DA  A 1 85  ? 13.223  117.917 -5.406  1.00 47.43  ? 85  DA  I N1    1 
ATOM   1732  C  C2    . DA  A 1 85  ? 12.698  118.559 -6.459  1.00 47.43  ? 85  DA  I C2    1 
ATOM   1733  N  N3    . DA  A 1 85  ? 11.780  119.525 -6.486  1.00 47.43  ? 85  DA  I N3    1 
ATOM   1734  C  C4    . DA  A 1 85  ? 11.389  119.847 -5.236  1.00 47.43  ? 85  DA  I C4    1 
ATOM   1735  P  P     . DT  A 1 86  ? 5.944   122.273 -7.914  1.00 47.26  ? 86  DT  I P     1 
ATOM   1736  O  OP1   . DT  A 1 86  ? 5.423   123.201 -8.958  1.00 47.26  ? 86  DT  I OP1   1 
ATOM   1737  O  OP2   . DT  A 1 86  ? 5.116   121.981 -6.698  1.00 47.26  ? 86  DT  I OP2   1 
ATOM   1738  O  "O5'" . DT  A 1 86  ? 6.260   120.885 -8.625  1.00 52.82  ? 86  DT  I "O5'" 1 
ATOM   1739  C  "C5'" . DT  A 1 86  ? 7.319   120.786 -9.573  1.00 52.82  ? 86  DT  I "C5'" 1 
ATOM   1740  C  "C4'" . DT  A 1 86  ? 7.716   119.343 -9.771  1.00 52.82  ? 86  DT  I "C4'" 1 
ATOM   1741  O  "O4'" . DT  A 1 86  ? 8.601   118.856 -8.727  1.00 52.82  ? 86  DT  I "O4'" 1 
ATOM   1742  C  "C3'" . DT  A 1 86  ? 6.558   118.346 -9.857  1.00 52.82  ? 86  DT  I "C3'" 1 
ATOM   1743  O  "O3'" . DT  A 1 86  ? 6.804   117.512 -10.989 1.00 52.82  ? 86  DT  I "O3'" 1 
ATOM   1744  C  "C2'" . DT  A 1 86  ? 6.694   117.538 -8.569  1.00 52.82  ? 86  DT  I "C2'" 1 
ATOM   1745  C  "C1'" . DT  A 1 86  ? 8.199   117.539 -8.377  1.00 52.82  ? 86  DT  I "C1'" 1 
ATOM   1746  N  N1    . DT  A 1 86  ? 8.735   117.217 -7.025  1.00 36.85  ? 86  DT  I N1    1 
ATOM   1747  C  C2    . DT  A 1 86  ? 9.848   116.394 -6.942  1.00 36.85  ? 86  DT  I C2    1 
ATOM   1748  O  O2    . DT  A 1 86  ? 10.412  115.910 -7.909  1.00 36.85  ? 86  DT  I O2    1 
ATOM   1749  N  N3    . DT  A 1 86  ? 10.283  116.158 -5.673  1.00 36.85  ? 86  DT  I N3    1 
ATOM   1750  C  C4    . DT  A 1 86  ? 9.757   116.639 -4.500  1.00 36.85  ? 86  DT  I C4    1 
ATOM   1751  O  O4    . DT  A 1 86  ? 10.279  116.344 -3.432  1.00 36.85  ? 86  DT  I O4    1 
ATOM   1752  C  C5    . DT  A 1 86  ? 8.600   117.477 -4.641  1.00 36.85  ? 86  DT  I C5    1 
ATOM   1753  C  C7    . DT  A 1 86  ? 7.954   118.020 -3.405  1.00 36.85  ? 86  DT  I C7    1 
ATOM   1754  C  C6    . DT  A 1 86  ? 8.149   117.727 -5.884  1.00 36.85  ? 86  DT  I C6    1 
ATOM   1755  P  P     . DG  A 1 87  ? 5.600   117.055 -11.951 1.00 25.47  ? 87  DG  I P     1 
ATOM   1756  O  OP1   . DG  A 1 87  ? 5.516   117.916 -13.158 1.00 25.47  ? 87  DG  I OP1   1 
ATOM   1757  O  OP2   . DG  A 1 87  ? 4.402   116.771 -11.119 1.00 25.47  ? 87  DG  I OP2   1 
ATOM   1758  O  "O5'" . DG  A 1 87  ? 6.143   115.689 -12.510 1.00 27.94  ? 87  DG  I "O5'" 1 
ATOM   1759  C  "C5'" . DG  A 1 87  ? 7.537   115.503 -12.625 1.00 27.94  ? 87  DG  I "C5'" 1 
ATOM   1760  C  "C4'" . DG  A 1 87  ? 7.921   114.193 -11.993 1.00 27.94  ? 87  DG  I "C4'" 1 
ATOM   1761  O  "O4'" . DG  A 1 87  ? 8.067   114.303 -10.559 1.00 27.94  ? 87  DG  I "O4'" 1 
ATOM   1762  C  "C3'" . DG  A 1 87  ? 6.908   113.075 -12.239 1.00 27.94  ? 87  DG  I "C3'" 1 
ATOM   1763  O  "O3'" . DG  A 1 87  ? 7.600   112.044 -12.914 1.00 27.94  ? 87  DG  I "O3'" 1 
ATOM   1764  C  "C2'" . DG  A 1 87  ? 6.423   112.684 -10.842 1.00 27.94  ? 87  DG  I "C2'" 1 
ATOM   1765  C  "C1'" . DG  A 1 87  ? 7.589   113.107 -9.973  1.00 27.94  ? 87  DG  I "C1'" 1 
ATOM   1766  N  N9    . DG  A 1 87  ? 7.380   113.365 -8.550  1.00 54.83  ? 87  DG  I N9    1 
ATOM   1767  C  C8    . DG  A 1 87  ? 6.409   114.140 -7.963  1.00 54.83  ? 87  DG  I C8    1 
ATOM   1768  N  N7    . DG  A 1 87  ? 6.552   114.253 -6.666  1.00 54.83  ? 87  DG  I N7    1 
ATOM   1769  C  C5    . DG  A 1 87  ? 7.673   113.487 -6.375  1.00 54.83  ? 87  DG  I C5    1 
ATOM   1770  C  C6    . DG  A 1 87  ? 8.336   113.245 -5.132  1.00 54.83  ? 87  DG  I C6    1 
ATOM   1771  O  O6    . DG  A 1 87  ? 8.057   113.687 -4.005  1.00 54.83  ? 87  DG  I O6    1 
ATOM   1772  N  N1    . DG  A 1 87  ? 9.443   112.404 -5.293  1.00 54.83  ? 87  DG  I N1    1 
ATOM   1773  C  C2    . DG  A 1 87  ? 9.871   111.877 -6.491  1.00 54.83  ? 87  DG  I C2    1 
ATOM   1774  N  N2    . DG  A 1 87  ? 10.959  111.097 -6.442  1.00 54.83  ? 87  DG  I N2    1 
ATOM   1775  N  N3    . DG  A 1 87  ? 9.271   112.103 -7.655  1.00 54.83  ? 87  DG  I N3    1 
ATOM   1776  C  C4    . DG  A 1 87  ? 8.185   112.911 -7.523  1.00 54.83  ? 87  DG  I C4    1 
ATOM   1777  P  P     . DC  A 1 88  ? 6.862   110.680 -13.240 1.00 36.08  ? 88  DC  I P     1 
ATOM   1778  O  OP1   . DC  A 1 88  ? 6.302   110.745 -14.617 1.00 36.08  ? 88  DC  I OP1   1 
ATOM   1779  O  OP2   . DC  A 1 88  ? 5.982   110.400 -12.084 1.00 36.08  ? 88  DC  I OP2   1 
ATOM   1780  O  "O5'" . DC  A 1 88  ? 8.065   109.637 -13.195 1.00 50.77  ? 88  DC  I "O5'" 1 
ATOM   1781  C  "C5'" . DC  A 1 88  ? 9.417   110.094 -13.260 1.00 50.77  ? 88  DC  I "C5'" 1 
ATOM   1782  C  "C4'" . DC  A 1 88  ? 10.287  109.303 -12.315 1.00 50.77  ? 88  DC  I "C4'" 1 
ATOM   1783  O  "O4'" . DC  A 1 88  ? 9.882   109.536 -10.952 1.00 50.77  ? 88  DC  I "O4'" 1 
ATOM   1784  C  "C3'" . DC  A 1 88  ? 10.247  107.787 -12.492 1.00 50.77  ? 88  DC  I "C3'" 1 
ATOM   1785  O  "O3'" . DC  A 1 88  ? 11.541  107.268 -12.190 1.00 50.77  ? 88  DC  I "O3'" 1 
ATOM   1786  C  "C2'" . DC  A 1 88  ? 9.276   107.337 -11.418 1.00 50.77  ? 88  DC  I "C2'" 1 
ATOM   1787  C  "C1'" . DC  A 1 88  ? 9.647   108.292 -10.313 1.00 50.77  ? 88  DC  I "C1'" 1 
ATOM   1788  N  N1    . DC  A 1 88  ? 8.630   108.518 -9.292  1.00 56.98  ? 88  DC  I N1    1 
ATOM   1789  C  C2    . DC  A 1 88  ? 9.041   108.625 -7.959  1.00 56.98  ? 88  DC  I C2    1 
ATOM   1790  O  O2    . DC  A 1 88  ? 10.244  108.434 -7.675  1.00 56.98  ? 88  DC  I O2    1 
ATOM   1791  N  N3    . DC  A 1 88  ? 8.127   108.937 -7.018  1.00 56.98  ? 88  DC  I N3    1 
ATOM   1792  C  C4    . DC  A 1 88  ? 6.855   109.146 -7.367  1.00 56.98  ? 88  DC  I C4    1 
ATOM   1793  N  N4    . DC  A 1 88  ? 6.009   109.542 -6.419  1.00 56.98  ? 88  DC  I N4    1 
ATOM   1794  C  C5    . DC  A 1 88  ? 6.401   108.981 -8.709  1.00 56.98  ? 88  DC  I C5    1 
ATOM   1795  C  C6    . DC  A 1 88  ? 7.314   108.666 -9.629  1.00 56.98  ? 88  DC  I C6    1 
ATOM   1796  P  P     . DC  A 1 89  ? 11.998  105.872 -12.818 1.00 74.09  ? 89  DC  I P     1 
ATOM   1797  O  OP1   . DC  A 1 89  ? 12.918  106.182 -13.947 1.00 74.09  ? 89  DC  I OP1   1 
ATOM   1798  O  OP2   . DC  A 1 89  ? 10.778  105.054 -13.050 1.00 74.09  ? 89  DC  I OP2   1 
ATOM   1799  O  "O5'" . DC  A 1 89  ? 12.837  105.183 -11.659 1.00 42.03  ? 89  DC  I "O5'" 1 
ATOM   1800  C  "C5'" . DC  A 1 89  ? 13.052  105.844 -10.429 1.00 42.03  ? 89  DC  I "C5'" 1 
ATOM   1801  C  "C4'" . DC  A 1 89  ? 12.900  104.865 -9.296  1.00 42.03  ? 89  DC  I "C4'" 1 
ATOM   1802  O  "O4'" . DC  A 1 89  ? 11.641  105.106 -8.636  1.00 42.03  ? 89  DC  I "O4'" 1 
ATOM   1803  C  "C3'" . DC  A 1 89  ? 12.878  103.390 -9.702  1.00 42.03  ? 89  DC  I "C3'" 1 
ATOM   1804  O  "O3'" . DC  A 1 89  ? 13.338  102.646 -8.574  1.00 42.03  ? 89  DC  I "O3'" 1 
ATOM   1805  C  "C2'" . DC  A 1 89  ? 11.393  103.124 -9.839  1.00 42.03  ? 89  DC  I "C2'" 1 
ATOM   1806  C  "C1'" . DC  A 1 89  ? 10.890  103.908 -8.647  1.00 42.03  ? 89  DC  I "C1'" 1 
ATOM   1807  N  N1    . DC  A 1 89  ? 9.475   104.274 -8.633  1.00 38.14  ? 89  DC  I N1    1 
ATOM   1808  C  C2    . DC  A 1 89  ? 8.880   104.493 -7.402  1.00 38.14  ? 89  DC  I C2    1 
ATOM   1809  O  O2    . DC  A 1 89  ? 9.563   104.354 -6.382  1.00 38.14  ? 89  DC  I O2    1 
ATOM   1810  N  N3    . DC  A 1 89  ? 7.585   104.852 -7.346  1.00 38.14  ? 89  DC  I N3    1 
ATOM   1811  C  C4    . DC  A 1 89  ? 6.881   104.983 -8.476  1.00 38.14  ? 89  DC  I C4    1 
ATOM   1812  N  N4    . DC  A 1 89  ? 5.598   105.347 -8.369  1.00 38.14  ? 89  DC  I N4    1 
ATOM   1813  C  C5    . DC  A 1 89  ? 7.462   104.754 -9.755  1.00 38.14  ? 89  DC  I C5    1 
ATOM   1814  C  C6    . DC  A 1 89  ? 8.753   104.404 -9.788  1.00 38.14  ? 89  DC  I C6    1 
ATOM   1815  P  P     . DT  A 1 90  ? 14.474  101.521 -8.731  1.00 25.78  ? 90  DT  I P     1 
ATOM   1816  O  OP1   . DT  A 1 90  ? 15.704  102.142 -9.285  1.00 25.78  ? 90  DT  I OP1   1 
ATOM   1817  O  OP2   . DT  A 1 90  ? 13.867  100.331 -9.398  1.00 25.78  ? 90  DT  I OP2   1 
ATOM   1818  O  "O5'" . DT  A 1 90  ? 14.738  101.184 -7.205  1.00 20.65  ? 90  DT  I "O5'" 1 
ATOM   1819  C  "C5'" . DT  A 1 90  ? 15.061  102.242 -6.313  1.00 20.65  ? 90  DT  I "C5'" 1 
ATOM   1820  C  "C4'" . DT  A 1 90  ? 14.230  102.176 -5.051  1.00 20.65  ? 90  DT  I "C4'" 1 
ATOM   1821  O  "O4'" . DT  A 1 90  ? 12.838  102.478 -5.326  1.00 20.65  ? 90  DT  I "O4'" 1 
ATOM   1822  C  "C3'" . DT  A 1 90  ? 14.246  100.857 -4.285  1.00 20.65  ? 90  DT  I "C3'" 1 
ATOM   1823  O  "O3'" . DT  A 1 90  ? 14.519  101.095 -2.918  1.00 20.65  ? 90  DT  I "O3'" 1 
ATOM   1824  C  "C2'" . DT  A 1 90  ? 12.832  100.322 -4.431  1.00 20.65  ? 90  DT  I "C2'" 1 
ATOM   1825  C  "C1'" . DT  A 1 90  ? 12.002  101.581 -4.608  1.00 20.65  ? 90  DT  I "C1'" 1 
ATOM   1826  N  N1    . DT  A 1 90  ? 10.757  101.410 -5.401  1.00 50.17  ? 90  DT  I N1    1 
ATOM   1827  C  C2    . DT  A 1 90  ? 9.536   101.698 -4.812  1.00 50.17  ? 90  DT  I C2    1 
ATOM   1828  O  O2    . DT  A 1 90  ? 9.413   102.023 -3.631  1.00 50.17  ? 90  DT  I O2    1 
ATOM   1829  N  N3    . DT  A 1 90  ? 8.457   101.581 -5.662  1.00 50.17  ? 90  DT  I N3    1 
ATOM   1830  C  C4    . DT  A 1 90  ? 8.473   101.193 -6.990  1.00 50.17  ? 90  DT  I C4    1 
ATOM   1831  O  O4    . DT  A 1 90  ? 7.428   101.151 -7.630  1.00 50.17  ? 90  DT  I O4    1 
ATOM   1832  C  C5    . DT  A 1 90  ? 9.765   100.871 -7.520  1.00 50.17  ? 90  DT  I C5    1 
ATOM   1833  C  C7    . DT  A 1 90  ? 9.867   100.419 -8.942  1.00 50.17  ? 90  DT  I C7    1 
ATOM   1834  C  C6    . DT  A 1 90  ? 10.830  100.993 -6.715  1.00 50.17  ? 90  DT  I C6    1 
ATOM   1835  P  P     . DT  A 1 91  ? 14.640  99.852  -1.927  1.00 26.11  ? 91  DT  I P     1 
ATOM   1836  O  OP1   . DT  A 1 91  ? 15.635  100.164 -0.866  1.00 26.11  ? 91  DT  I OP1   1 
ATOM   1837  O  OP2   . DT  A 1 91  ? 14.809  98.647  -2.786  1.00 26.11  ? 91  DT  I OP2   1 
ATOM   1838  O  "O5'" . DT  A 1 91  ? 13.203  99.772  -1.264  1.00 34.41  ? 91  DT  I "O5'" 1 
ATOM   1839  C  "C5'" . DT  A 1 91  ? 12.710  100.852 -0.488  1.00 34.41  ? 91  DT  I "C5'" 1 
ATOM   1840  C  "C4'" . DT  A 1 91  ? 11.361  100.501 0.081   1.00 34.41  ? 91  DT  I "C4'" 1 
ATOM   1841  O  "O4'" . DT  A 1 91  ? 10.384  100.481 -0.993  1.00 34.41  ? 91  DT  I "O4'" 1 
ATOM   1842  C  "C3'" . DT  A 1 91  ? 11.323  99.119  0.729   1.00 34.41  ? 91  DT  I "C3'" 1 
ATOM   1843  O  "O3'" . DT  A 1 91  ? 10.624  99.193  1.970   1.00 34.41  ? 91  DT  I "O3'" 1 
ATOM   1844  C  "C2'" . DT  A 1 91  ? 10.590  98.252  -0.287  1.00 34.41  ? 91  DT  I "C2'" 1 
ATOM   1845  C  "C1'" . DT  A 1 91  ? 9.672   99.249  -0.982  1.00 34.41  ? 91  DT  I "C1'" 1 
ATOM   1846  N  N1    . DT  A 1 91  ? 9.283   98.926  -2.382  1.00 39.57  ? 91  DT  I N1    1 
ATOM   1847  C  C2    . DT  A 1 91  ? 8.001   99.261  -2.789  1.00 39.57  ? 91  DT  I C2    1 
ATOM   1848  O  O2    . DT  A 1 91  ? 7.190   99.807  -2.058  1.00 39.57  ? 91  DT  I O2    1 
ATOM   1849  N  N3    . DT  A 1 91  ? 7.703   98.938  -4.095  1.00 39.57  ? 91  DT  I N3    1 
ATOM   1850  C  C4    . DT  A 1 91  ? 8.546   98.345  -5.024  1.00 39.57  ? 91  DT  I C4    1 
ATOM   1851  O  O4    . DT  A 1 91  ? 8.149   98.140  -6.173  1.00 39.57  ? 91  DT  I O4    1 
ATOM   1852  C  C5    . DT  A 1 91  ? 9.872   98.016  -4.532  1.00 39.57  ? 91  DT  I C5    1 
ATOM   1853  C  C7    . DT  A 1 91  ? 10.847  97.367  -5.464  1.00 39.57  ? 91  DT  I C7    1 
ATOM   1854  C  C6    . DT  A 1 91  ? 10.168  98.316  -3.251  1.00 39.57  ? 91  DT  I C6    1 
ATOM   1855  P  P     . DT  A 1 92  ? 10.435  97.870  2.867   1.00 56.01  ? 92  DT  I P     1 
ATOM   1856  O  OP1   . DT  A 1 92  ? 10.436  98.293  4.289   1.00 56.01  ? 92  DT  I OP1   1 
ATOM   1857  O  OP2   . DT  A 1 92  ? 11.402  96.843  2.412   1.00 56.01  ? 92  DT  I OP2   1 
ATOM   1858  O  "O5'" . DT  A 1 92  ? 8.969   97.396  2.466   1.00 51.56  ? 92  DT  I "O5'" 1 
ATOM   1859  C  "C5'" . DT  A 1 92  ? 7.902   98.350  2.415   1.00 51.56  ? 92  DT  I "C5'" 1 
ATOM   1860  C  "C4'" . DT  A 1 92  ? 6.579   97.668  2.152   1.00 51.56  ? 92  DT  I "C4'" 1 
ATOM   1861  O  "O4'" . DT  A 1 92  ? 6.307   97.570  0.733   1.00 51.56  ? 92  DT  I "O4'" 1 
ATOM   1862  C  "C3'" . DT  A 1 92  ? 6.437   96.259  2.732   1.00 51.56  ? 92  DT  I "C3'" 1 
ATOM   1863  O  "O3'" . DT  A 1 92  ? 5.198   96.151  3.440   1.00 51.56  ? 92  DT  I "O3'" 1 
ATOM   1864  C  "C2'" . DT  A 1 92  ? 6.474   95.363  1.504   1.00 51.56  ? 92  DT  I "C2'" 1 
ATOM   1865  C  "C1'" . DT  A 1 92  ? 5.896   96.255  0.415   1.00 51.56  ? 92  DT  I "C1'" 1 
ATOM   1866  N  N1    . DT  A 1 92  ? 6.369   95.956  -0.952  1.00 55.43  ? 92  DT  I N1    1 
ATOM   1867  C  C2    . DT  A 1 92  ? 5.462   96.063  -1.987  1.00 55.43  ? 92  DT  I C2    1 
ATOM   1868  O  O2    . DT  A 1 92  ? 4.295   96.367  -1.818  1.00 55.43  ? 92  DT  I O2    1 
ATOM   1869  N  N3    . DT  A 1 92  ? 5.976   95.798  -3.234  1.00 55.43  ? 92  DT  I N3    1 
ATOM   1870  C  C4    . DT  A 1 92  ? 7.274   95.443  -3.540  1.00 55.43  ? 92  DT  I C4    1 
ATOM   1871  O  O4    . DT  A 1 92  ? 7.593   95.262  -4.706  1.00 55.43  ? 92  DT  I O4    1 
ATOM   1872  C  C5    . DT  A 1 92  ? 8.165   95.325  -2.410  1.00 55.43  ? 92  DT  I C5    1 
ATOM   1873  C  C7    . DT  A 1 92  ? 9.581   94.919  -2.649  1.00 55.43  ? 92  DT  I C7    1 
ATOM   1874  C  C6    . DT  A 1 92  ? 7.679   95.587  -1.188  1.00 55.43  ? 92  DT  I C6    1 
ATOM   1875  P  P     . DT  A 1 93  ? 4.876   94.836  4.313   1.00 75.42  ? 93  DT  I P     1 
ATOM   1876  O  OP1   . DT  A 1 93  ? 4.276   95.298  5.592   1.00 75.42  ? 93  DT  I OP1   1 
ATOM   1877  O  OP2   . DT  A 1 93  ? 6.035   93.898  4.338   1.00 75.42  ? 93  DT  I OP2   1 
ATOM   1878  O  "O5'" . DT  A 1 93  ? 3.730   94.160  3.453   1.00 111.96 ? 93  DT  I "O5'" 1 
ATOM   1879  C  "C5'" . DT  A 1 93  ? 2.538   94.882  3.166   1.00 111.96 ? 93  DT  I "C5'" 1 
ATOM   1880  C  "C4'" . DT  A 1 93  ? 1.575   93.998  2.418   1.00 111.96 ? 93  DT  I "C4'" 1 
ATOM   1881  O  "O4'" . DT  A 1 93  ? 1.965   93.943  1.029   1.00 111.96 ? 93  DT  I "O4'" 1 
ATOM   1882  C  "C3'" . DT  A 1 93  ? 1.587   92.557  2.926   1.00 111.96 ? 93  DT  I "C3'" 1 
ATOM   1883  O  "O3'" . DT  A 1 93  ? 0.266   92.013  2.936   1.00 111.96 ? 93  DT  I "O3'" 1 
ATOM   1884  C  "C2'" . DT  A 1 93  ? 2.492   91.843  1.939   1.00 111.96 ? 93  DT  I "C2'" 1 
ATOM   1885  C  "C1'" . DT  A 1 93  ? 2.222   92.602  0.655   1.00 111.96 ? 93  DT  I "C1'" 1 
ATOM   1886  N  N1    . DT  A 1 93  ? 3.334   92.617  -0.303  1.00 75.69  ? 93  DT  I N1    1 
ATOM   1887  C  C2    . DT  A 1 93  ? 3.015   92.729  -1.633  1.00 75.69  ? 93  DT  I C2    1 
ATOM   1888  O  O2    . DT  A 1 93  ? 1.867   92.843  -2.031  1.00 75.69  ? 93  DT  I O2    1 
ATOM   1889  N  N3    . DT  A 1 93  ? 4.091   92.715  -2.488  1.00 75.69  ? 93  DT  I N3    1 
ATOM   1890  C  C4    . DT  A 1 93  ? 5.424   92.624  -2.147  1.00 75.69  ? 93  DT  I C4    1 
ATOM   1891  O  O4    . DT  A 1 93  ? 6.279   92.622  -3.033  1.00 75.69  ? 93  DT  I O4    1 
ATOM   1892  C  C5    . DT  A 1 93  ? 5.686   92.533  -0.721  1.00 75.69  ? 93  DT  I C5    1 
ATOM   1893  C  C7    . DT  A 1 93  ? 7.098   92.462  -0.242  1.00 75.69  ? 93  DT  I C7    1 
ATOM   1894  C  C6    . DT  A 1 93  ? 4.640   92.524  0.116   1.00 75.69  ? 93  DT  I C6    1 
ATOM   1895  P  P     . DG  A 1 94  ? 0.011   90.558  3.565   1.00 120.46 ? 94  DG  I P     1 
ATOM   1896  O  OP1   . DG  A 1 94  ? -1.279  90.595  4.301   1.00 120.46 ? 94  DG  I OP1   1 
ATOM   1897  O  OP2   . DG  A 1 94  ? 1.244   90.119  4.267   1.00 120.46 ? 94  DG  I OP2   1 
ATOM   1898  O  "O5'" . DG  A 1 94  ? -0.151  89.643  2.276   1.00 81.48  ? 94  DG  I "O5'" 1 
ATOM   1899  C  "C5'" . DG  A 1 94  ? 0.326   90.080  1.008   1.00 81.48  ? 94  DG  I "C5'" 1 
ATOM   1900  C  "C4'" . DG  A 1 94  ? -0.381  89.325  -0.088  1.00 81.48  ? 94  DG  I "C4'" 1 
ATOM   1901  O  "O4'" . DG  A 1 94  ? 0.259   89.622  -1.354  1.00 81.48  ? 94  DG  I "O4'" 1 
ATOM   1902  C  "C3'" . DG  A 1 94  ? -0.249  87.818  0.110   1.00 81.48  ? 94  DG  I "C3'" 1 
ATOM   1903  O  "O3'" . DG  A 1 94  ? -1.427  87.128  -0.310  1.00 81.48  ? 94  DG  I "O3'" 1 
ATOM   1904  C  "C2'" . DG  A 1 94  ? 0.941   87.447  -0.743  1.00 81.48  ? 94  DG  I "C2'" 1 
ATOM   1905  C  "C1'" . DG  A 1 94  ? 0.891   88.459  -1.873  1.00 81.48  ? 94  DG  I "C1'" 1 
ATOM   1906  N  N9    . DG  A 1 94  ? 2.248   88.811  -2.271  1.00 71.31  ? 94  DG  I N9    1 
ATOM   1907  C  C8    . DG  A 1 94  ? 3.299   89.068  -1.424  1.00 71.31  ? 94  DG  I C8    1 
ATOM   1908  N  N7    . DG  A 1 94  ? 4.425   89.260  -2.050  1.00 71.31  ? 94  DG  I N7    1 
ATOM   1909  C  C5    . DG  A 1 94  ? 4.094   89.149  -3.396  1.00 71.31  ? 94  DG  I C5    1 
ATOM   1910  C  C6    . DG  A 1 94  ? 4.907   89.253  -4.550  1.00 71.31  ? 94  DG  I C6    1 
ATOM   1911  O  O6    . DG  A 1 94  ? 6.119   89.486  -4.620  1.00 71.31  ? 94  DG  I O6    1 
ATOM   1912  N  N1    . DG  A 1 94  ? 4.172   89.057  -5.712  1.00 71.31  ? 94  DG  I N1    1 
ATOM   1913  C  C2    . DG  A 1 94  ? 2.831   88.807  -5.763  1.00 71.31  ? 94  DG  I C2    1 
ATOM   1914  N  N2    . DG  A 1 94  ? 2.325   88.656  -6.996  1.00 71.31  ? 94  DG  I N2    1 
ATOM   1915  N  N3    . DG  A 1 94  ? 2.055   88.713  -4.694  1.00 71.31  ? 94  DG  I N3    1 
ATOM   1916  C  C4    . DG  A 1 94  ? 2.750   88.890  -3.551  1.00 71.31  ? 94  DG  I C4    1 
ATOM   1917  P  P     . DA  A 1 95  ? -1.471  85.520  -0.247  1.00 132.32 ? 95  DA  I P     1 
ATOM   1918  O  OP1   . DA  A 1 95  ? -2.854  85.084  0.060   1.00 132.32 ? 95  DA  I OP1   1 
ATOM   1919  O  OP2   . DA  A 1 95  ? -0.345  85.042  0.602   1.00 132.32 ? 95  DA  I OP2   1 
ATOM   1920  O  "O5'" . DA  A 1 95  ? -1.162  85.109  -1.747  1.00 84.29  ? 95  DA  I "O5'" 1 
ATOM   1921  C  "C5'" . DA  A 1 95  ? -1.888  85.688  -2.821  1.00 84.29  ? 95  DA  I "C5'" 1 
ATOM   1922  C  "C4'" . DA  A 1 95  ? -1.401  85.090  -4.113  1.00 84.29  ? 95  DA  I "C4'" 1 
ATOM   1923  O  "O4'" . DA  A 1 95  ? -0.123  85.678  -4.475  1.00 84.29  ? 95  DA  I "O4'" 1 
ATOM   1924  C  "C3'" . DA  A 1 95  ? -1.141  83.595  -3.933  1.00 84.29  ? 95  DA  I "C3'" 1 
ATOM   1925  O  "O3'" . DA  A 1 95  ? -1.495  82.879  -5.118  1.00 84.29  ? 95  DA  I "O3'" 1 
ATOM   1926  C  "C2'" . DA  A 1 95  ? 0.355   83.535  -3.696  1.00 84.29  ? 95  DA  I "C2'" 1 
ATOM   1927  C  "C1'" . DA  A 1 95  ? 0.828   84.638  -4.619  1.00 84.29  ? 95  DA  I "C1'" 1 
ATOM   1928  N  N9    . DA  A 1 95  ? 2.172   85.149  -4.326  1.00 77.14  ? 95  DA  I N9    1 
ATOM   1929  C  C8    . DA  A 1 95  ? 2.740   85.475  -3.111  1.00 77.14  ? 95  DA  I C8    1 
ATOM   1930  N  N7    . DA  A 1 95  ? 4.011   85.799  -3.191  1.00 77.14  ? 95  DA  I N7    1 
ATOM   1931  C  C5    . DA  A 1 95  ? 4.294   85.701  -4.551  1.00 77.14  ? 95  DA  I C5    1 
ATOM   1932  C  C6    . DA  A 1 95  ? 5.476   85.896  -5.290  1.00 77.14  ? 95  DA  I C6    1 
ATOM   1933  N  N6    . DA  A 1 95  ? 6.644   86.229  -4.736  1.00 77.14  ? 95  DA  I N6    1 
ATOM   1934  N  N1    . DA  A 1 95  ? 5.414   85.725  -6.633  1.00 77.14  ? 95  DA  I N1    1 
ATOM   1935  C  C2    . DA  A 1 95  ? 4.243   85.373  -7.184  1.00 77.14  ? 95  DA  I C2    1 
ATOM   1936  N  N3    . DA  A 1 95  ? 3.071   85.151  -6.597  1.00 77.14  ? 95  DA  I N3    1 
ATOM   1937  C  C4    . DA  A 1 95  ? 3.164   85.331  -5.264  1.00 77.14  ? 95  DA  I C4    1 
ATOM   1938  P  P     . DT  A 1 96  ? -1.428  81.272  -5.135  1.00 104.59 ? 96  DT  I P     1 
ATOM   1939  O  OP1   . DT  A 1 96  ? -2.802  80.760  -5.371  1.00 104.59 ? 96  DT  I OP1   1 
ATOM   1940  O  OP2   . DT  A 1 96  ? -0.661  80.788  -3.951  1.00 104.59 ? 96  DT  I OP2   1 
ATOM   1941  O  "O5'" . DT  A 1 96  ? -0.562  80.998  -6.438  1.00 132.20 ? 96  DT  I "O5'" 1 
ATOM   1942  C  "C5'" . DT  A 1 96  ? -0.799  81.741  -7.634  1.00 132.20 ? 96  DT  I "C5'" 1 
ATOM   1943  C  "C4'" . DT  A 1 96  ? 0.211   81.349  -8.682  1.00 132.20 ? 96  DT  I "C4'" 1 
ATOM   1944  O  "O4'" . DT  A 1 96  ? 1.471   82.028  -8.431  1.00 132.20 ? 96  DT  I "O4'" 1 
ATOM   1945  C  "C3'" . DT  A 1 96  ? 0.510   79.849  -8.638  1.00 132.20 ? 96  DT  I "C3'" 1 
ATOM   1946  O  "O3'" . DT  A 1 96  ? 0.606   79.284  -9.943  1.00 132.20 ? 96  DT  I "O3'" 1 
ATOM   1947  C  "C2'" . DT  A 1 96  ? 1.856   79.776  -7.947  1.00 132.20 ? 96  DT  I "C2'" 1 
ATOM   1948  C  "C1'" . DT  A 1 96  ? 2.511   81.066  -8.405  1.00 132.20 ? 96  DT  I "C1'" 1 
ATOM   1949  N  N1    . DT  A 1 96  ? 3.579   81.524  -7.495  1.00 58.49  ? 96  DT  I N1    1 
ATOM   1950  C  C2    . DT  A 1 96  ? 4.736   82.044  -8.049  1.00 58.49  ? 96  DT  I C2    1 
ATOM   1951  O  O2    . DT  A 1 96  ? 4.869   82.274  -9.243  1.00 58.49  ? 96  DT  I O2    1 
ATOM   1952  N  N3    . DT  A 1 96  ? 5.734   82.295  -7.141  1.00 58.49  ? 96  DT  I N3    1 
ATOM   1953  C  C4    . DT  A 1 96  ? 5.684   82.121  -5.766  1.00 58.49  ? 96  DT  I C4    1 
ATOM   1954  O  O4    . DT  A 1 96  ? 6.680   82.362  -5.088  1.00 58.49  ? 96  DT  I O4    1 
ATOM   1955  C  C5    . DT  A 1 96  ? 4.415   81.644  -5.245  1.00 58.49  ? 96  DT  I C5    1 
ATOM   1956  C  C7    . DT  A 1 96  ? 4.250   81.469  -3.765  1.00 58.49  ? 96  DT  I C7    1 
ATOM   1957  C  C6    . DT  A 1 96  ? 3.440   81.377  -6.126  1.00 58.49  ? 96  DT  I C6    1 
ATOM   1958  P  P     . DG  A 1 97  ? 0.627   77.685  -10.114 1.00 104.02 ? 97  DG  I P     1 
ATOM   1959  O  OP1   . DG  A 1 97  ? -0.664  77.258  -10.708 1.00 104.02 ? 97  DG  I OP1   1 
ATOM   1960  O  OP2   . DG  A 1 97  ? 1.076   77.086  -8.827  1.00 104.02 ? 97  DG  I OP2   1 
ATOM   1961  O  "O5'" . DG  A 1 97  ? 1.763   77.454  -11.202 1.00 104.90 ? 97  DG  I "O5'" 1 
ATOM   1962  C  "C5'" . DG  A 1 97  ? 2.036   78.445  -12.192 1.00 104.90 ? 97  DG  I "C5'" 1 
ATOM   1963  C  "C4'" . DG  A 1 97  ? 3.504   78.429  -12.544 1.00 104.90 ? 97  DG  I "C4'" 1 
ATOM   1964  O  "O4'" . DG  A 1 97  ? 4.300   78.965  -11.458 1.00 104.90 ? 97  DG  I "O4'" 1 
ATOM   1965  C  "C3'" . DG  A 1 97  ? 4.045   77.026  -12.807 1.00 104.90 ? 97  DG  I "C3'" 1 
ATOM   1966  O  "O3'" . DG  A 1 97  ? 5.007   77.085  -13.857 1.00 104.90 ? 97  DG  I "O3'" 1 
ATOM   1967  C  "C2'" . DG  A 1 97  ? 4.716   76.662  -11.497 1.00 104.90 ? 97  DG  I "C2'" 1 
ATOM   1968  C  "C1'" . DG  A 1 97  ? 5.267   78.004  -11.057 1.00 104.90 ? 97  DG  I "C1'" 1 
ATOM   1969  N  N9    . DG  A 1 97  ? 5.474   78.137  -9.619  1.00 65.16  ? 97  DG  I N9    1 
ATOM   1970  C  C8    . DG  A 1 97  ? 4.666   77.661  -8.613  1.00 65.16  ? 97  DG  I C8    1 
ATOM   1971  N  N7    . DG  A 1 97  ? 5.116   77.940  -7.419  1.00 65.16  ? 97  DG  I N7    1 
ATOM   1972  C  C5    . DG  A 1 97  ? 6.292   78.643  -7.652  1.00 65.16  ? 97  DG  I C5    1 
ATOM   1973  C  C6    . DG  A 1 97  ? 7.220   79.211  -6.743  1.00 65.16  ? 97  DG  I C6    1 
ATOM   1974  O  O6    . DG  A 1 97  ? 7.184   79.222  -5.516  1.00 65.16  ? 97  DG  I O6    1 
ATOM   1975  N  N1    . DG  A 1 97  ? 8.276   79.818  -7.401  1.00 65.16  ? 97  DG  I N1    1 
ATOM   1976  C  C2    . DG  A 1 97  ? 8.422   79.884  -8.756  1.00 65.16  ? 97  DG  I C2    1 
ATOM   1977  N  N2    . DG  A 1 97  ? 9.532   80.505  -9.183  1.00 65.16  ? 97  DG  I N2    1 
ATOM   1978  N  N3    . DG  A 1 97  ? 7.560   79.378  -9.621  1.00 65.16  ? 97  DG  I N3    1 
ATOM   1979  C  C4    . DG  A 1 97  ? 6.527   78.770  -9.003  1.00 65.16  ? 97  DG  I C4    1 
ATOM   1980  P  P     . DG  A 1 98  ? 5.498   75.729  -14.566 1.00 71.67  ? 98  DG  I P     1 
ATOM   1981  O  OP1   . DG  A 1 98  ? 5.522   75.981  -16.036 1.00 71.67  ? 98  DG  I OP1   1 
ATOM   1982  O  OP2   . DG  A 1 98  ? 4.702   74.591  -14.008 1.00 71.67  ? 98  DG  I OP2   1 
ATOM   1983  O  "O5'" . DG  A 1 98  ? 6.997   75.553  -14.050 1.00 69.98  ? 98  DG  I "O5'" 1 
ATOM   1984  C  "C5'" . DG  A 1 98  ? 7.989   76.567  -14.265 1.00 69.98  ? 98  DG  I "C5'" 1 
ATOM   1985  C  "C4'" . DG  A 1 98  ? 9.208   76.299  -13.410 1.00 69.98  ? 98  DG  I "C4'" 1 
ATOM   1986  O  "O4'" . DG  A 1 98  ? 8.964   76.633  -12.021 1.00 69.98  ? 98  DG  I "O4'" 1 
ATOM   1987  C  "C3'" . DG  A 1 98  ? 9.674   74.845  -13.412 1.00 69.98  ? 98  DG  I "C3'" 1 
ATOM   1988  O  "O3'" . DG  A 1 98  ? 11.090  74.813  -13.412 1.00 69.98  ? 98  DG  I "O3'" 1 
ATOM   1989  C  "C2'" . DG  A 1 98  ? 9.165   74.311  -12.086 1.00 69.98  ? 98  DG  I "C2'" 1 
ATOM   1990  C  "C1'" . DG  A 1 98  ? 9.316   75.529  -11.207 1.00 69.98  ? 98  DG  I "C1'" 1 
ATOM   1991  N  N9    . DG  A 1 98  ? 8.459   75.544  -10.031 1.00 84.48  ? 98  DG  I N9    1 
ATOM   1992  C  C8    . DG  A 1 98  ? 7.140   75.169  -9.946  1.00 84.48  ? 98  DG  I C8    1 
ATOM   1993  N  N7    . DG  A 1 98  ? 6.643   75.310  -8.747  1.00 84.48  ? 98  DG  I N7    1 
ATOM   1994  C  C5    . DG  A 1 98  ? 7.701   75.805  -7.997  1.00 84.48  ? 98  DG  I C5    1 
ATOM   1995  C  C6    . DG  A 1 98  ? 7.769   76.163  -6.621  1.00 84.48  ? 98  DG  I C6    1 
ATOM   1996  O  O6    . DG  A 1 98  ? 6.872   76.110  -5.760  1.00 84.48  ? 98  DG  I O6    1 
ATOM   1997  N  N1    . DG  A 1 98  ? 9.039   76.625  -6.280  1.00 84.48  ? 98  DG  I N1    1 
ATOM   1998  C  C2    . DG  A 1 98  ? 10.098  76.727  -7.147  1.00 84.48  ? 98  DG  I C2    1 
ATOM   1999  N  N2    . DG  A 1 98  ? 11.225  77.183  -6.622  1.00 84.48  ? 98  DG  I N2    1 
ATOM   2000  N  N3    . DG  A 1 98  ? 10.049  76.400  -8.424  1.00 84.48  ? 98  DG  I N3    1 
ATOM   2001  C  C4    . DG  A 1 98  ? 8.829   75.951  -8.778  1.00 84.48  ? 98  DG  I C4    1 
ATOM   2002  P  P     . DA  A 1 99  ? 11.852  73.888  -14.462 1.00 84.90  ? 99  DA  I P     1 
ATOM   2003  O  OP1   . DA  A 1 99  ? 11.268  74.125  -15.802 1.00 84.90  ? 99  DA  I OP1   1 
ATOM   2004  O  OP2   . DA  A 1 99  ? 11.886  72.511  -13.896 1.00 84.90  ? 99  DA  I OP2   1 
ATOM   2005  O  "O5'" . DA  A 1 99  ? 13.313  74.503  -14.470 1.00 108.09 ? 99  DA  I "O5'" 1 
ATOM   2006  C  "C5'" . DA  A 1 99  ? 13.494  75.908  -14.583 1.00 108.09 ? 99  DA  I "C5'" 1 
ATOM   2007  C  "C4'" . DA  A 1 99  ? 14.323  76.412  -13.428 1.00 108.09 ? 99  DA  I "C4'" 1 
ATOM   2008  O  "O4'" . DA  A 1 99  ? 13.586  76.232  -12.193 1.00 108.09 ? 99  DA  I "O4'" 1 
ATOM   2009  C  "C3'" . DA  A 1 99  ? 15.648  75.673  -13.247 1.00 108.09 ? 99  DA  I "C3'" 1 
ATOM   2010  O  "O3'" . DA  A 1 99  ? 16.674  76.613  -12.912 1.00 108.09 ? 99  DA  I "O3'" 1 
ATOM   2011  C  "C2'" . DA  A 1 99  ? 15.362  74.700  -12.115 1.00 108.09 ? 99  DA  I "C2'" 1 
ATOM   2012  C  "C1'" . DA  A 1 99  ? 14.331  75.441  -11.280 1.00 108.09 ? 99  DA  I "C1'" 1 
ATOM   2013  N  N9    . DA  A 1 99  ? 13.389  74.573  -10.573 1.00 48.72  ? 99  DA  I N9    1 
ATOM   2014  C  C8    . DA  A 1 99  ? 12.630  73.551  -11.096 1.00 48.72  ? 99  DA  I C8    1 
ATOM   2015  N  N7    . DA  A 1 99  ? 11.866  72.948  -10.210 1.00 48.72  ? 99  DA  I N7    1 
ATOM   2016  C  C5    . DA  A 1 99  ? 12.142  73.620  -9.022  1.00 48.72  ? 99  DA  I C5    1 
ATOM   2017  C  C6    . DA  A 1 99  ? 11.662  73.461  -7.703  1.00 48.72  ? 99  DA  I C6    1 
ATOM   2018  N  N6    . DA  A 1 99  ? 10.750  72.556  -7.347  1.00 48.72  ? 99  DA  I N6    1 
ATOM   2019  N  N1    . DA  A 1 99  ? 12.160  74.281  -6.750  1.00 48.72  ? 99  DA  I N1    1 
ATOM   2020  C  C2    . DA  A 1 99  ? 13.057  75.200  -7.104  1.00 48.72  ? 99  DA  I C2    1 
ATOM   2021  N  N3    . DA  A 1 99  ? 13.576  75.458  -8.302  1.00 48.72  ? 99  DA  I N3    1 
ATOM   2022  C  C4    . DA  A 1 99  ? 13.078  74.621  -9.231  1.00 48.72  ? 99  DA  I C4    1 
ATOM   2023  P  P     . DG  A 1 100 ? 18.215  76.157  -12.906 1.00 100.05 ? 100 DG  I P     1 
ATOM   2024  O  OP1   . DG  A 1 100 ? 19.036  77.313  -13.366 1.00 100.05 ? 100 DG  I OP1   1 
ATOM   2025  O  OP2   . DG  A 1 100 ? 18.316  74.855  -13.616 1.00 100.05 ? 100 DG  I OP2   1 
ATOM   2026  O  "O5'" . DG  A 1 100 ? 18.492  75.903  -11.359 1.00 37.80  ? 100 DG  I "O5'" 1 
ATOM   2027  C  "C5'" . DG  A 1 100 ? 17.420  75.524  -10.513 1.00 37.80  ? 100 DG  I "C5'" 1 
ATOM   2028  C  "C4'" . DG  A 1 100 ? 17.928  75.184  -9.140  1.00 37.80  ? 100 DG  I "C4'" 1 
ATOM   2029  O  "O4'" . DG  A 1 100 ? 16.938  74.312  -8.557  1.00 37.80  ? 100 DG  I "O4'" 1 
ATOM   2030  C  "C3'" . DG  A 1 100 ? 19.217  74.370  -9.151  1.00 37.80  ? 100 DG  I "C3'" 1 
ATOM   2031  O  "O3'" . DG  A 1 100 ? 19.807  74.498  -7.857  1.00 37.80  ? 100 DG  I "O3'" 1 
ATOM   2032  C  "C2'" . DG  A 1 100 ? 18.708  72.956  -9.345  1.00 37.80  ? 100 DG  I "C2'" 1 
ATOM   2033  C  "C1'" . DG  A 1 100 ? 17.449  72.979  -8.491  1.00 37.80  ? 100 DG  I "C1'" 1 
ATOM   2034  N  N9    . DG  A 1 100 ? 16.384  72.056  -8.891  1.00 72.12  ? 100 DG  I N9    1 
ATOM   2035  C  C8    . DG  A 1 100 ? 16.226  71.402  -10.096 1.00 72.12  ? 100 DG  I C8    1 
ATOM   2036  N  N7    . DG  A 1 100 ? 15.165  70.638  -10.129 1.00 72.12  ? 100 DG  I N7    1 
ATOM   2037  C  C5    . DG  A 1 100 ? 14.592  70.799  -8.874  1.00 72.12  ? 100 DG  I C5    1 
ATOM   2038  C  C6    . DG  A 1 100 ? 13.421  70.232  -8.317  1.00 72.12  ? 100 DG  I C6    1 
ATOM   2039  O  O6    . DG  A 1 100 ? 12.617  69.443  -8.838  1.00 72.12  ? 100 DG  I O6    1 
ATOM   2040  N  N1    . DG  A 1 100 ? 13.214  70.677  -7.014  1.00 72.12  ? 100 DG  I N1    1 
ATOM   2041  C  C2    . DG  A 1 100 ? 14.027  71.557  -6.340  1.00 72.12  ? 100 DG  I C2    1 
ATOM   2042  N  N2    . DG  A 1 100 ? 13.651  71.878  -5.100  1.00 72.12  ? 100 DG  I N2    1 
ATOM   2043  N  N3    . DG  A 1 100 ? 15.113  72.084  -6.845  1.00 72.12  ? 100 DG  I N3    1 
ATOM   2044  C  C4    . DG  A 1 100 ? 15.335  71.670  -8.104  1.00 72.12  ? 100 DG  I C4    1 
ATOM   2045  P  P     . DC  A 1 101 ? 21.396  74.603  -7.693  1.00 34.39  ? 101 DC  I P     1 
ATOM   2046  O  OP1   . DC  A 1 101 ? 21.913  75.752  -8.455  1.00 34.39  ? 101 DC  I OP1   1 
ATOM   2047  O  OP2   . DC  A 1 101 ? 21.976  73.265  -7.899  1.00 34.39  ? 101 DC  I OP2   1 
ATOM   2048  O  "O5'" . DC  A 1 101 ? 21.574  74.952  -6.165  1.00 47.73  ? 101 DC  I "O5'" 1 
ATOM   2049  C  "C5'" . DC  A 1 101 ? 21.884  73.926  -5.264  1.00 47.73  ? 101 DC  I "C5'" 1 
ATOM   2050  C  "C4'" . DC  A 1 101 ? 20.850  73.871  -4.173  1.00 47.73  ? 101 DC  I "C4'" 1 
ATOM   2051  O  "O4'" . DC  A 1 101 ? 19.600  73.361  -4.697  1.00 47.73  ? 101 DC  I "O4'" 1 
ATOM   2052  C  "C3'" . DC  A 1 101 ? 21.281  72.914  -3.076  1.00 47.73  ? 101 DC  I "C3'" 1 
ATOM   2053  O  "O3'" . DC  A 1 101 ? 21.055  73.516  -1.812  1.00 47.73  ? 101 DC  I "O3'" 1 
ATOM   2054  C  "C2'" . DC  A 1 101 ? 20.479  71.647  -3.336  1.00 47.73  ? 101 DC  I "C2'" 1 
ATOM   2055  C  "C1'" . DC  A 1 101 ? 19.242  72.138  -4.072  1.00 47.73  ? 101 DC  I "C1'" 1 
ATOM   2056  N  N1    . DC  A 1 101 ? 18.733  71.222  -5.123  1.00 41.45  ? 101 DC  I N1    1 
ATOM   2057  C  C2    . DC  A 1 101 ? 17.621  70.418  -4.827  1.00 41.45  ? 101 DC  I C2    1 
ATOM   2058  O  O2    . DC  A 1 101 ? 17.124  70.474  -3.690  1.00 41.45  ? 101 DC  I O2    1 
ATOM   2059  N  N3    . DC  A 1 101 ? 17.115  69.595  -5.787  1.00 41.45  ? 101 DC  I N3    1 
ATOM   2060  C  C4    . DC  A 1 101 ? 17.678  69.554  -6.997  1.00 41.45  ? 101 DC  I C4    1 
ATOM   2061  N  N4    . DC  A 1 101 ? 17.120  68.748  -7.917  1.00 41.45  ? 101 DC  I N4    1 
ATOM   2062  C  C5    . DC  A 1 101 ? 18.829  70.342  -7.320  1.00 41.45  ? 101 DC  I C5    1 
ATOM   2063  C  C6    . DC  A 1 101 ? 19.317  71.157  -6.361  1.00 41.45  ? 101 DC  I C6    1 
ATOM   2064  P  P     . DA  A 1 102 ? 21.849  72.970  -0.540  1.00 96.48  ? 102 DA  I P     1 
ATOM   2065  O  OP1   . DA  A 1 102 ? 21.695  73.955  0.564   1.00 96.48  ? 102 DA  I OP1   1 
ATOM   2066  O  OP2   . DA  A 1 102 ? 23.206  72.541  -0.977  1.00 96.48  ? 102 DA  I OP2   1 
ATOM   2067  O  "O5'" . DA  A 1 102 ? 21.013  71.673  -0.179  1.00 92.71  ? 102 DA  I "O5'" 1 
ATOM   2068  C  "C5'" . DA  A 1 102 ? 19.636  71.794  0.150   1.00 92.71  ? 102 DA  I "C5'" 1 
ATOM   2069  C  "C4'" . DA  A 1 102 ? 19.036  70.432  0.384   1.00 92.71  ? 102 DA  I "C4'" 1 
ATOM   2070  O  "O4'" . DA  A 1 102 ? 18.707  69.807  -0.874  1.00 92.71  ? 102 DA  I "O4'" 1 
ATOM   2071  C  "C3'" . DA  A 1 102 ? 19.960  69.463  1.122   1.00 92.71  ? 102 DA  I "C3'" 1 
ATOM   2072  O  "O3'" . DA  A 1 102 ? 19.194  68.767  2.104   1.00 92.71  ? 102 DA  I "O3'" 1 
ATOM   2073  C  "C2'" . DA  A 1 102 ? 20.441  68.536  0.018   1.00 92.71  ? 102 DA  I "C2'" 1 
ATOM   2074  C  "C1'" . DA  A 1 102 ? 19.224  68.498  -0.878  1.00 92.71  ? 102 DA  I "C1'" 1 
ATOM   2075  N  N9    . DA  A 1 102 ? 19.469  68.128  -2.262  1.00 56.56  ? 102 DA  I N9    1 
ATOM   2076  C  C8    . DA  A 1 102 ? 20.529  68.442  -3.073  1.00 56.56  ? 102 DA  I C8    1 
ATOM   2077  N  N7    . DA  A 1 102 ? 20.433  67.946  -4.288  1.00 56.56  ? 102 DA  I N7    1 
ATOM   2078  C  C5    . DA  A 1 102 ? 19.221  67.260  -4.271  1.00 56.56  ? 102 DA  I C5    1 
ATOM   2079  C  C6    . DA  A 1 102 ? 18.527  66.506  -5.256  1.00 56.56  ? 102 DA  I C6    1 
ATOM   2080  N  N6    . DA  A 1 102 ? 18.967  66.319  -6.509  1.00 56.56  ? 102 DA  I N6    1 
ATOM   2081  N  N1    . DA  A 1 102 ? 17.348  65.947  -4.897  1.00 56.56  ? 102 DA  I N1    1 
ATOM   2082  C  C2    . DA  A 1 102 ? 16.897  66.138  -3.644  1.00 56.56  ? 102 DA  I C2    1 
ATOM   2083  N  N3    . DA  A 1 102 ? 17.448  66.823  -2.643  1.00 56.56  ? 102 DA  I N3    1 
ATOM   2084  C  C4    . DA  A 1 102 ? 18.621  67.363  -3.025  1.00 56.56  ? 102 DA  I C4    1 
ATOM   2085  P  P     . DG  A 1 103 ? 19.907  67.736  3.108   1.00 65.02  ? 103 DG  I P     1 
ATOM   2086  O  OP1   . DG  A 1 103 ? 20.317  68.428  4.360   1.00 65.02  ? 103 DG  I OP1   1 
ATOM   2087  O  OP2   . DG  A 1 103 ? 20.908  66.935  2.335   1.00 65.02  ? 103 DG  I OP2   1 
ATOM   2088  O  "O5'" . DG  A 1 103 ? 18.690  66.794  3.494   1.00 82.77  ? 103 DG  I "O5'" 1 
ATOM   2089  C  "C5'" . DG  A 1 103 ? 18.903  65.420  3.693   1.00 82.77  ? 103 DG  I "C5'" 1 
ATOM   2090  C  "C4'" . DG  A 1 103 ? 17.812  64.618  3.035   1.00 82.77  ? 103 DG  I "C4'" 1 
ATOM   2091  O  "O4'" . DG  A 1 103 ? 17.777  64.854  1.604   1.00 82.77  ? 103 DG  I "O4'" 1 
ATOM   2092  C  "C3'" . DG  A 1 103 ? 18.108  63.139  3.211   1.00 82.77  ? 103 DG  I "C3'" 1 
ATOM   2093  O  "O3'" . DG  A 1 103 ? 16.956  62.448  3.641   1.00 82.77  ? 103 DG  I "O3'" 1 
ATOM   2094  C  "C2'" . DG  A 1 103 ? 18.577  62.675  1.847   1.00 82.77  ? 103 DG  I "C2'" 1 
ATOM   2095  C  "C1'" . DG  A 1 103 ? 17.867  63.620  0.909   1.00 82.77  ? 103 DG  I "C1'" 1 
ATOM   2096  N  N9    . DG  A 1 103 ? 18.614  63.835  -0.326  1.00 67.50  ? 103 DG  I N9    1 
ATOM   2097  C  C8    . DG  A 1 103 ? 19.733  64.609  -0.502  1.00 67.50  ? 103 DG  I C8    1 
ATOM   2098  N  N7    . DG  A 1 103 ? 20.198  64.569  -1.723  1.00 67.50  ? 103 DG  I N7    1 
ATOM   2099  C  C5    . DG  A 1 103 ? 19.327  63.726  -2.394  1.00 67.50  ? 103 DG  I C5    1 
ATOM   2100  C  C6    . DG  A 1 103 ? 19.315  63.301  -3.753  1.00 67.50  ? 103 DG  I C6    1 
ATOM   2101  O  O6    . DG  A 1 103 ? 20.093  63.596  -4.667  1.00 67.50  ? 103 DG  I O6    1 
ATOM   2102  N  N1    . DG  A 1 103 ? 18.253  62.446  -4.009  1.00 67.50  ? 103 DG  I N1    1 
ATOM   2103  C  C2    . DG  A 1 103 ? 17.318  62.049  -3.081  1.00 67.50  ? 103 DG  I C2    1 
ATOM   2104  N  N2    . DG  A 1 103 ? 16.370  61.213  -3.531  1.00 67.50  ? 103 DG  I N2    1 
ATOM   2105  N  N3    . DG  A 1 103 ? 17.314  62.439  -1.816  1.00 67.50  ? 103 DG  I N3    1 
ATOM   2106  C  C4    . DG  A 1 103 ? 18.340  63.270  -1.545  1.00 67.50  ? 103 DG  I C4    1 
ATOM   2107  P  P     . DT  A 1 104 ? 17.141  61.102  4.473   1.00 88.97  ? 104 DT  I P     1 
ATOM   2108  O  OP1   . DT  A 1 104 ? 15.887  60.843  5.230   1.00 88.97  ? 104 DT  I OP1   1 
ATOM   2109  O  OP2   . DT  A 1 104 ? 18.431  61.246  5.201   1.00 88.97  ? 104 DT  I OP2   1 
ATOM   2110  O  "O5'" . DT  A 1 104 ? 17.321  60.021  3.323   1.00 95.25  ? 104 DT  I "O5'" 1 
ATOM   2111  C  "C5'" . DT  A 1 104 ? 16.308  59.851  2.336   1.00 95.25  ? 104 DT  I "C5'" 1 
ATOM   2112  C  "C4'" . DT  A 1 104 ? 16.630  58.669  1.455   1.00 95.25  ? 104 DT  I "C4'" 1 
ATOM   2113  O  "O4'" . DT  A 1 104 ? 17.213  59.083  0.197   1.00 95.25  ? 104 DT  I "O4'" 1 
ATOM   2114  C  "C3'" . DT  A 1 104 ? 17.612  57.682  2.083   1.00 95.25  ? 104 DT  I "C3'" 1 
ATOM   2115  O  "O3'" . DT  A 1 104 ? 17.169  56.350  1.829   1.00 95.25  ? 104 DT  I "O3'" 1 
ATOM   2116  C  "C2'" . DT  A 1 104 ? 18.910  57.976  1.351   1.00 95.25  ? 104 DT  I "C2'" 1 
ATOM   2117  C  "C1'" . DT  A 1 104 ? 18.401  58.352  -0.026  1.00 95.25  ? 104 DT  I "C1'" 1 
ATOM   2118  N  N1    . DT  A 1 104 ? 19.306  59.186  -0.829  1.00 71.00  ? 104 DT  I N1    1 
ATOM   2119  C  C2    . DT  A 1 104 ? 19.269  59.020  -2.191  1.00 71.00  ? 104 DT  I C2    1 
ATOM   2120  O  O2    . DT  A 1 104 ? 18.508  58.246  -2.742  1.00 71.00  ? 104 DT  I O2    1 
ATOM   2121  N  N3    . DT  A 1 104 ? 20.155  59.805  -2.893  1.00 71.00  ? 104 DT  I N3    1 
ATOM   2122  C  C4    . DT  A 1 104 ? 21.040  60.734  -2.376  1.00 71.00  ? 104 DT  I C4    1 
ATOM   2123  O  O4    . DT  A 1 104 ? 21.769  61.369  -3.135  1.00 71.00  ? 104 DT  I O4    1 
ATOM   2124  C  C5    . DT  A 1 104 ? 21.013  60.871  -0.936  1.00 71.00  ? 104 DT  I C5    1 
ATOM   2125  C  C7    . DT  A 1 104 ? 21.921  61.864  -0.286  1.00 71.00  ? 104 DT  I C7    1 
ATOM   2126  C  C6    . DT  A 1 104 ? 20.162  60.095  -0.242  1.00 71.00  ? 104 DT  I C6    1 
ATOM   2127  P  P     . DT  A 1 105 ? 17.884  55.115  2.560   1.00 104.52 ? 105 DT  I P     1 
ATOM   2128  O  OP1   . DT  A 1 105 ? 16.904  54.585  3.536   1.00 104.52 ? 105 DT  I OP1   1 
ATOM   2129  O  OP2   . DT  A 1 105 ? 19.236  55.516  3.028   1.00 104.52 ? 105 DT  I OP2   1 
ATOM   2130  O  "O5'" . DT  A 1 105 ? 18.053  54.094  1.354   1.00 104.76 ? 105 DT  I "O5'" 1 
ATOM   2131  C  "C5'" . DT  A 1 105 ? 17.147  54.141  0.257   1.00 104.76 ? 105 DT  I "C5'" 1 
ATOM   2132  C  "C4'" . DT  A 1 105 ? 17.816  53.662  -1.009  1.00 104.76 ? 105 DT  I "C4'" 1 
ATOM   2133  O  "O4'" . DT  A 1 105 ? 18.655  54.686  -1.599  1.00 104.76 ? 105 DT  I "O4'" 1 
ATOM   2134  C  "C3'" . DT  A 1 105 ? 18.694  52.421  -0.853  1.00 104.76 ? 105 DT  I "C3'" 1 
ATOM   2135  O  "O3'" . DT  A 1 105 ? 18.391  51.501  -1.907  1.00 104.76 ? 105 DT  I "O3'" 1 
ATOM   2136  C  "C2'" . DT  A 1 105 ? 20.109  52.969  -0.975  1.00 104.76 ? 105 DT  I "C2'" 1 
ATOM   2137  C  "C1'" . DT  A 1 105 ? 19.912  54.120  -1.945  1.00 104.76 ? 105 DT  I "C1'" 1 
ATOM   2138  N  N1    . DT  A 1 105 ? 20.932  55.199  -1.915  1.00 78.32  ? 105 DT  I N1    1 
ATOM   2139  C  C2    . DT  A 1 105 ? 21.529  55.555  -3.110  1.00 78.32  ? 105 DT  I C2    1 
ATOM   2140  O  O2    . DT  A 1 105 ? 21.303  54.985  -4.165  1.00 78.32  ? 105 DT  I O2    1 
ATOM   2141  N  N3    . DT  A 1 105 ? 22.414  56.607  -3.021  1.00 78.32  ? 105 DT  I N3    1 
ATOM   2142  C  C4    . DT  A 1 105 ? 22.764  57.314  -1.882  1.00 78.32  ? 105 DT  I C4    1 
ATOM   2143  O  O4    . DT  A 1 105 ? 23.558  58.251  -1.961  1.00 78.32  ? 105 DT  I O4    1 
ATOM   2144  C  C5    . DT  A 1 105 ? 22.128  56.868  -0.662  1.00 78.32  ? 105 DT  I C5    1 
ATOM   2145  C  C7    . DT  A 1 105 ? 22.462  57.564  0.620   1.00 78.32  ? 105 DT  I C7    1 
ATOM   2146  C  C6    . DT  A 1 105 ? 21.257  55.845  -0.737  1.00 78.32  ? 105 DT  I C6    1 
ATOM   2147  P  P     . DT  A 1 106 ? 19.158  50.095  -1.983  1.00 113.89 ? 106 DT  I P     1 
ATOM   2148  O  OP1   . DT  A 1 106 ? 18.239  49.091  -2.584  1.00 113.89 ? 106 DT  I OP1   1 
ATOM   2149  O  OP2   . DT  A 1 106 ? 19.786  49.825  -0.663  1.00 113.89 ? 106 DT  I OP2   1 
ATOM   2150  O  "O5'" . DT  A 1 106 ? 20.317  50.401  -3.021  1.00 133.78 ? 106 DT  I "O5'" 1 
ATOM   2151  C  "C5'" . DT  A 1 106 ? 20.032  51.030  -4.264  1.00 133.78 ? 106 DT  I "C5'" 1 
ATOM   2152  C  "C4'" . DT  A 1 106 ? 21.288  51.073  -5.093  1.00 133.78 ? 106 DT  I "C4'" 1 
ATOM   2153  O  "O4'" . DT  A 1 106 ? 22.066  52.256  -4.775  1.00 133.78 ? 106 DT  I "O4'" 1 
ATOM   2154  C  "C3'" . DT  A 1 106 ? 22.177  49.872  -4.777  1.00 133.78 ? 106 DT  I "C3'" 1 
ATOM   2155  O  "O3'" . DT  A 1 106 ? 22.701  49.292  -5.963  1.00 133.78 ? 106 DT  I "O3'" 1 
ATOM   2156  C  "C2'" . DT  A 1 106 ? 23.283  50.456  -3.914  1.00 133.78 ? 106 DT  I "C2'" 1 
ATOM   2157  C  "C1'" . DT  A 1 106 ? 23.394  51.869  -4.457  1.00 133.78 ? 106 DT  I "C1'" 1 
ATOM   2158  N  N1    . DT  A 1 106 ? 23.983  52.875  -3.528  1.00 93.55  ? 106 DT  I N1    1 
ATOM   2159  C  C2    . DT  A 1 106 ? 24.672  53.937  -4.084  1.00 93.55  ? 106 DT  I C2    1 
ATOM   2160  O  O2    . DT  A 1 106 ? 24.773  54.115  -5.287  1.00 93.55  ? 106 DT  I O2    1 
ATOM   2161  N  N3    . DT  A 1 106 ? 25.236  54.795  -3.175  1.00 93.55  ? 106 DT  I N3    1 
ATOM   2162  C  C4    . DT  A 1 106 ? 25.170  54.721  -1.797  1.00 93.55  ? 106 DT  I C4    1 
ATOM   2163  O  O4    . DT  A 1 106 ? 25.732  55.577  -1.114  1.00 93.55  ? 106 DT  I O4    1 
ATOM   2164  C  C5    . DT  A 1 106 ? 24.414  53.597  -1.276  1.00 93.55  ? 106 DT  I C5    1 
ATOM   2165  C  C7    . DT  A 1 106 ? 24.280  53.438  0.205   1.00 93.55  ? 106 DT  I C7    1 
ATOM   2166  C  C6    . DT  A 1 106 ? 23.865  52.743  -2.155  1.00 93.55  ? 106 DT  I C6    1 
ATOM   2167  P  P     . DC  A 1 107 ? 22.762  47.696  -6.095  1.00 101.03 ? 107 DC  I P     1 
ATOM   2168  O  OP1   . DC  A 1 107 ? 21.557  47.238  -6.823  1.00 101.03 ? 107 DC  I OP1   1 
ATOM   2169  O  OP2   . DC  A 1 107 ? 23.064  47.143  -4.747  1.00 101.03 ? 107 DC  I OP2   1 
ATOM   2170  O  "O5'" . DC  A 1 107 ? 24.029  47.472  -7.022  1.00 84.59  ? 107 DC  I "O5'" 1 
ATOM   2171  C  "C5'" . DC  A 1 107 ? 25.324  47.817  -6.550  1.00 84.59  ? 107 DC  I "C5'" 1 
ATOM   2172  C  "C4'" . DC  A 1 107 ? 26.021  48.713  -7.545  1.00 84.59  ? 107 DC  I "C4'" 1 
ATOM   2173  O  "O4'" . DC  A 1 107 ? 26.041  50.055  -7.009  1.00 84.59  ? 107 DC  I "O4'" 1 
ATOM   2174  C  "C3'" . DC  A 1 107 ? 27.478  48.314  -7.760  1.00 84.59  ? 107 DC  I "C3'" 1 
ATOM   2175  O  "O3'" . DC  A 1 107 ? 27.883  48.464  -9.119  1.00 84.59  ? 107 DC  I "O3'" 1 
ATOM   2176  C  "C2'" . DC  A 1 107 ? 28.259  49.213  -6.822  1.00 84.59  ? 107 DC  I "C2'" 1 
ATOM   2177  C  "C1'" . DC  A 1 107 ? 27.352  50.414  -6.582  1.00 84.59  ? 107 DC  I "C1'" 1 
ATOM   2178  N  N1    . DC  A 1 107 ? 27.277  50.766  -5.152  1.00 73.55  ? 107 DC  I N1    1 
ATOM   2179  C  C2    . DC  A 1 107 ? 27.837  51.967  -4.728  1.00 73.55  ? 107 DC  I C2    1 
ATOM   2180  O  O2    . DC  A 1 107 ? 28.382  52.698  -5.567  1.00 73.55  ? 107 DC  I O2    1 
ATOM   2181  N  N3    . DC  A 1 107 ? 27.779  52.303  -3.414  1.00 73.55  ? 107 DC  I N3    1 
ATOM   2182  C  C4    . DC  A 1 107 ? 27.190  51.482  -2.541  1.00 73.55  ? 107 DC  I C4    1 
ATOM   2183  N  N4    . DC  A 1 107 ? 27.150  51.856  -1.255  1.00 73.55  ? 107 DC  I N4    1 
ATOM   2184  C  C5    . DC  A 1 107 ? 26.613  50.242  -2.946  1.00 73.55  ? 107 DC  I C5    1 
ATOM   2185  C  C6    . DC  A 1 107 ? 26.675  49.928  -4.249  1.00 73.55  ? 107 DC  I C6    1 
ATOM   2186  P  P     . DC  A 1 108 ? 28.822  47.343  -9.783  1.00 115.61 ? 108 DC  I P     1 
ATOM   2187  O  OP1   . DC  A 1 108 ? 28.146  46.795  -10.987 1.00 115.61 ? 108 DC  I OP1   1 
ATOM   2188  O  OP2   . DC  A 1 108 ? 29.251  46.425  -8.693  1.00 115.61 ? 108 DC  I OP2   1 
ATOM   2189  O  "O5'" . DC  A 1 108 ? 30.097  48.157  -10.267 1.00 79.75  ? 108 DC  I "O5'" 1 
ATOM   2190  C  "C5'" . DC  A 1 108 ? 29.945  49.365  -11.009 1.00 79.75  ? 108 DC  I "C5'" 1 
ATOM   2191  C  "C4'" . DC  A 1 108 ? 31.107  50.291  -10.739 1.00 79.75  ? 108 DC  I "C4'" 1 
ATOM   2192  O  "O4'" . DC  A 1 108 ? 31.072  50.761  -9.372  1.00 79.75  ? 108 DC  I "O4'" 1 
ATOM   2193  C  "C3'" . DC  A 1 108 ? 32.483  49.657  -10.916 1.00 79.75  ? 108 DC  I "C3'" 1 
ATOM   2194  O  "O3'" . DC  A 1 108 ? 33.354  50.686  -11.348 1.00 79.75  ? 108 DC  I "O3'" 1 
ATOM   2195  C  "C2'" . DC  A 1 108 ? 32.865  49.271  -9.500  1.00 79.75  ? 108 DC  I "C2'" 1 
ATOM   2196  C  "C1'" . DC  A 1 108 ? 32.303  50.453  -8.742  1.00 79.75  ? 108 DC  I "C1'" 1 
ATOM   2197  N  N1    . DC  A 1 108 ? 32.038  50.245  -7.317  1.00 69.94  ? 108 DC  I N1    1 
ATOM   2198  C  C2    . DC  A 1 108 ? 31.990  51.364  -6.484  1.00 69.94  ? 108 DC  I C2    1 
ATOM   2199  O  O2    . DC  A 1 108 ? 32.179  52.492  -6.975  1.00 69.94  ? 108 DC  I O2    1 
ATOM   2200  N  N3    . DC  A 1 108 ? 31.745  51.199  -5.169  1.00 69.94  ? 108 DC  I N3    1 
ATOM   2201  C  C4    . DC  A 1 108 ? 31.553  49.978  -4.677  1.00 69.94  ? 108 DC  I C4    1 
ATOM   2202  N  N4    . DC  A 1 108 ? 31.315  49.869  -3.369  1.00 69.94  ? 108 DC  I N4    1 
ATOM   2203  C  C5    . DC  A 1 108 ? 31.599  48.817  -5.502  1.00 69.94  ? 108 DC  I C5    1 
ATOM   2204  C  C6    . DC  A 1 108 ? 31.839  48.996  -6.807  1.00 69.94  ? 108 DC  I C6    1 
ATOM   2205  P  P     . DA  A 1 109 ? 34.309  50.451  -12.604 1.00 87.07  ? 109 DA  I P     1 
ATOM   2206  O  OP1   . DA  A 1 109 ? 33.495  50.490  -13.849 1.00 87.07  ? 109 DA  I OP1   1 
ATOM   2207  O  OP2   . DA  A 1 109 ? 35.125  49.252  -12.290 1.00 87.07  ? 109 DA  I OP2   1 
ATOM   2208  O  "O5'" . DA  A 1 109 ? 35.250  51.735  -12.556 1.00 74.61  ? 109 DA  I "O5'" 1 
ATOM   2209  C  "C5'" . DA  A 1 109 ? 34.689  53.051  -12.502 1.00 74.61  ? 109 DA  I "C5'" 1 
ATOM   2210  C  "C4'" . DA  A 1 109 ? 35.498  53.943  -11.585 1.00 74.61  ? 109 DA  I "C4'" 1 
ATOM   2211  O  "O4'" . DA  A 1 109 ? 35.234  53.636  -10.198 1.00 74.61  ? 109 DA  I "O4'" 1 
ATOM   2212  C  "C3'" . DA  A 1 109 ? 37.014  53.862  -11.759 1.00 74.61  ? 109 DA  I "C3'" 1 
ATOM   2213  O  "O3'" . DA  A 1 109 ? 37.601  55.161  -11.661 1.00 74.61  ? 109 DA  I "O3'" 1 
ATOM   2214  C  "C2'" . DA  A 1 109 ? 37.456  52.989  -10.602 1.00 74.61  ? 109 DA  I "C2'" 1 
ATOM   2215  C  "C1'" . DA  A 1 109 ? 36.437  53.305  -9.528  1.00 74.61  ? 109 DA  I "C1'" 1 
ATOM   2216  N  N9    . DA  A 1 109 ? 36.151  52.143  -8.707  1.00 61.81  ? 109 DA  I N9    1 
ATOM   2217  C  C8    . DA  A 1 109 ? 36.103  50.838  -9.122  1.00 61.81  ? 109 DA  I C8    1 
ATOM   2218  N  N7    . DA  A 1 109 ? 35.786  49.996  -8.173  1.00 61.81  ? 109 DA  I N7    1 
ATOM   2219  C  C5    . DA  A 1 109 ? 35.621  50.803  -7.054  1.00 61.81  ? 109 DA  I C5    1 
ATOM   2220  C  C6    . DA  A 1 109 ? 35.268  50.514  -5.722  1.00 61.81  ? 109 DA  I C6    1 
ATOM   2221  N  N6    . DA  A 1 109 ? 35.001  49.279  -5.282  1.00 61.81  ? 109 DA  I N6    1 
ATOM   2222  N  N1    . DA  A 1 109 ? 35.193  51.548  -4.855  1.00 61.81  ? 109 DA  I N1    1 
ATOM   2223  C  C2    . DA  A 1 109 ? 35.451  52.783  -5.306  1.00 61.81  ? 109 DA  I C2    1 
ATOM   2224  N  N3    . DA  A 1 109 ? 35.786  53.181  -6.535  1.00 61.81  ? 109 DA  I N3    1 
ATOM   2225  C  C4    . DA  A 1 109 ? 35.853  52.129  -7.369  1.00 61.81  ? 109 DA  I C4    1 
ATOM   2226  P  P     . DA  A 1 110 ? 39.196  55.321  -11.732 1.00 101.93 ? 110 DA  I P     1 
ATOM   2227  O  OP1   . DA  A 1 110 ? 39.543  56.377  -12.721 1.00 101.93 ? 110 DA  I OP1   1 
ATOM   2228  O  OP2   . DA  A 1 110 ? 39.784  53.966  -11.863 1.00 101.93 ? 110 DA  I OP2   1 
ATOM   2229  O  "O5'" . DA  A 1 110 ? 39.554  55.835  -10.279 1.00 70.56  ? 110 DA  I "O5'" 1 
ATOM   2230  C  "C5'" . DA  A 1 110 ? 38.589  56.536  -9.518  1.00 70.56  ? 110 DA  I "C5'" 1 
ATOM   2231  C  "C4'" . DA  A 1 110 ? 38.999  56.552  -8.070  1.00 70.56  ? 110 DA  I "C4'" 1 
ATOM   2232  O  "O4'" . DA  A 1 110 ? 38.638  55.324  -7.398  1.00 70.56  ? 110 DA  I "O4'" 1 
ATOM   2233  C  "C3'" . DA  A 1 110 ? 40.503  56.708  -7.892  1.00 70.56  ? 110 DA  I "C3'" 1 
ATOM   2234  O  "O3'" . DA  A 1 110 ? 40.732  57.620  -6.833  1.00 70.56  ? 110 DA  I "O3'" 1 
ATOM   2235  C  "C2'" . DA  A 1 110 ? 40.963  55.307  -7.526  1.00 70.56  ? 110 DA  I "C2'" 1 
ATOM   2236  C  "C1'" . DA  A 1 110 ? 39.773  54.784  -6.750  1.00 70.56  ? 110 DA  I "C1'" 1 
ATOM   2237  N  N9    . DA  A 1 110 ? 39.627  53.333  -6.754  1.00 69.21  ? 110 DA  I N9    1 
ATOM   2238  C  C8    . DA  A 1 110 ? 39.861  52.466  -7.789  1.00 69.21  ? 110 DA  I C8    1 
ATOM   2239  N  N7    . DA  A 1 110 ? 39.598  51.214  -7.497  1.00 69.21  ? 110 DA  I N7    1 
ATOM   2240  C  C5    . DA  A 1 110 ? 39.168  51.263  -6.177  1.00 69.21  ? 110 DA  I C5    1 
ATOM   2241  C  C6    . DA  A 1 110 ? 38.724  50.267  -5.284  1.00 69.21  ? 110 DA  I C6    1 
ATOM   2242  N  N6    . DA  A 1 110 ? 38.606  48.977  -5.609  1.00 69.21  ? 110 DA  I N6    1 
ATOM   2243  N  N1    . DA  A 1 110 ? 38.387  50.650  -4.034  1.00 69.21  ? 110 DA  I N1    1 
ATOM   2244  C  C2    . DA  A 1 110 ? 38.470  51.942  -3.717  1.00 69.21  ? 110 DA  I C2    1 
ATOM   2245  N  N3    . DA  A 1 110 ? 38.853  52.971  -4.470  1.00 69.21  ? 110 DA  I N3    1 
ATOM   2246  C  C4    . DA  A 1 110 ? 39.195  52.559  -5.704  1.00 69.21  ? 110 DA  I C4    1 
ATOM   2247  P  P     . DA  A 1 111 ? 42.223  58.060  -6.480  1.00 78.14  ? 111 DA  I P     1 
ATOM   2248  O  OP1   . DA  A 1 111 ? 42.243  59.532  -6.623  1.00 78.14  ? 111 DA  I OP1   1 
ATOM   2249  O  OP2   . DA  A 1 111 ? 43.176  57.229  -7.267  1.00 78.14  ? 111 DA  I OP2   1 
ATOM   2250  O  "O5'" . DA  A 1 111 ? 42.313  57.657  -4.945  1.00 70.74  ? 111 DA  I "O5'" 1 
ATOM   2251  C  "C5'" . DA  A 1 111 ? 41.204  57.889  -4.073  1.00 70.74  ? 111 DA  I "C5'" 1 
ATOM   2252  C  "C4'" . DA  A 1 111 ? 41.396  57.150  -2.769  1.00 70.74  ? 111 DA  I "C4'" 1 
ATOM   2253  O  "O4'" . DA  A 1 111 ? 40.974  55.766  -2.901  1.00 70.74  ? 111 DA  I "O4'" 1 
ATOM   2254  C  "C3'" . DA  A 1 111 ? 42.854  57.121  -2.312  1.00 70.74  ? 111 DA  I "C3'" 1 
ATOM   2255  O  "O3'" . DA  A 1 111 ? 42.979  57.364  -0.916  1.00 70.74  ? 111 DA  I "O3'" 1 
ATOM   2256  C  "C2'" . DA  A 1 111 ? 43.297  55.708  -2.629  1.00 70.74  ? 111 DA  I "C2'" 1 
ATOM   2257  C  "C1'" . DA  A 1 111 ? 42.016  54.904  -2.462  1.00 70.74  ? 111 DA  I "C1'" 1 
ATOM   2258  N  N9    . DA  A 1 111 ? 41.998  53.673  -3.270  1.00 72.28  ? 111 DA  I N9    1 
ATOM   2259  C  C8    . DA  A 1 111 ? 42.241  53.540  -4.620  1.00 72.28  ? 111 DA  I C8    1 
ATOM   2260  N  N7    . DA  A 1 111 ? 42.237  52.296  -5.040  1.00 72.28  ? 111 DA  I N7    1 
ATOM   2261  C  C5    . DA  A 1 111 ? 41.953  51.559  -3.898  1.00 72.28  ? 111 DA  I C5    1 
ATOM   2262  C  C6    . DA  A 1 111 ? 41.815  50.174  -3.671  1.00 72.28  ? 111 DA  I C6    1 
ATOM   2263  N  N6    . DA  A 1 111 ? 41.980  49.248  -4.615  1.00 72.28  ? 111 DA  I N6    1 
ATOM   2264  N  N1    . DA  A 1 111 ? 41.509  49.767  -2.420  1.00 72.28  ? 111 DA  I N1    1 
ATOM   2265  C  C2    . DA  A 1 111 ? 41.369  50.691  -1.465  1.00 72.28  ? 111 DA  I C2    1 
ATOM   2266  N  N3    . DA  A 1 111 ? 41.486  52.018  -1.548  1.00 72.28  ? 111 DA  I N3    1 
ATOM   2267  C  C4    . DA  A 1 111 ? 41.782  52.393  -2.805  1.00 72.28  ? 111 DA  I C4    1 
ATOM   2268  P  P     . DT  A 1 112 ? 44.444  57.527  -0.271  1.00 42.86  ? 112 DT  I P     1 
ATOM   2269  O  OP1   . DT  A 1 112 ? 44.581  58.853  0.371   1.00 42.86  ? 112 DT  I OP1   1 
ATOM   2270  O  OP2   . DT  A 1 112 ? 45.430  57.122  -1.305  1.00 42.86  ? 112 DT  I OP2   1 
ATOM   2271  O  "O5'" . DT  A 1 112 ? 44.415  56.480  0.920   1.00 50.49  ? 112 DT  I "O5'" 1 
ATOM   2272  C  "C5'" . DT  A 1 112 ? 43.391  56.559  1.897   1.00 50.49  ? 112 DT  I "C5'" 1 
ATOM   2273  C  "C4'" . DT  A 1 112 ? 43.267  55.248  2.628   1.00 50.49  ? 112 DT  I "C4'" 1 
ATOM   2274  O  "O4'" . DT  A 1 112 ? 43.030  54.170  1.682   1.00 50.49  ? 112 DT  I "O4'" 1 
ATOM   2275  C  "C3'" . DT  A 1 112 ? 44.511  54.855  3.418   1.00 50.49  ? 112 DT  I "C3'" 1 
ATOM   2276  O  "O3'" . DT  A 1 112 ? 44.093  54.353  4.682   1.00 50.49  ? 112 DT  I "O3'" 1 
ATOM   2277  C  "C2'" . DT  A 1 112 ? 45.151  53.760  2.576   1.00 50.49  ? 112 DT  I "C2'" 1 
ATOM   2278  C  "C1'" . DT  A 1 112 ? 43.946  53.108  1.926   1.00 50.49  ? 112 DT  I "C1'" 1 
ATOM   2279  N  N1    . DT  A 1 112 ? 44.218  52.424  0.637   1.00 56.91  ? 112 DT  I N1    1 
ATOM   2280  C  C2    . DT  A 1 112 ? 44.020  51.058  0.570   1.00 56.91  ? 112 DT  I C2    1 
ATOM   2281  O  O2    . DT  A 1 112 ? 43.673  50.386  1.528   1.00 56.91  ? 112 DT  I O2    1 
ATOM   2282  N  N3    . DT  A 1 112 ? 44.255  50.506  -0.670  1.00 56.91  ? 112 DT  I N3    1 
ATOM   2283  C  C4    . DT  A 1 112 ? 44.665  51.165  -1.812  1.00 56.91  ? 112 DT  I C4    1 
ATOM   2284  O  O4    . DT  A 1 112 ? 44.805  50.544  -2.857  1.00 56.91  ? 112 DT  I O4    1 
ATOM   2285  C  C5    . DT  A 1 112 ? 44.891  52.577  -1.662  1.00 56.91  ? 112 DT  I C5    1 
ATOM   2286  C  C7    . DT  A 1 112 ? 45.392  53.352  -2.839  1.00 56.91  ? 112 DT  I C7    1 
ATOM   2287  C  C6    . DT  A 1 112 ? 44.650  53.134  -0.465  1.00 56.91  ? 112 DT  I C6    1 
ATOM   2288  P  P     . DA  A 1 113 ? 45.145  53.617  5.632   1.00 70.99  ? 113 DA  I P     1 
ATOM   2289  O  OP1   . DA  A 1 113 ? 44.510  53.477  6.972   1.00 70.99  ? 113 DA  I OP1   1 
ATOM   2290  O  OP2   . DA  A 1 113 ? 46.451  54.323  5.495   1.00 70.99  ? 113 DA  I OP2   1 
ATOM   2291  O  "O5'" . DA  A 1 113 ? 45.263  52.174  4.972   1.00 105.55 ? 113 DA  I "O5'" 1 
ATOM   2292  C  "C5'" . DA  A 1 113 ? 44.312  51.157  5.277   1.00 105.55 ? 113 DA  I "C5'" 1 
ATOM   2293  C  "C4'" . DA  A 1 113 ? 45.025  49.841  5.465   1.00 105.55 ? 113 DA  I "C4'" 1 
ATOM   2294  O  "O4'" . DA  A 1 113 ? 45.362  49.293  4.169   1.00 105.55 ? 113 DA  I "O4'" 1 
ATOM   2295  C  "C3'" . DA  A 1 113 ? 46.341  49.990  6.230   1.00 105.55 ? 113 DA  I "C3'" 1 
ATOM   2296  O  "O3'" . DA  A 1 113 ? 46.525  48.905  7.147   1.00 105.55 ? 113 DA  I "O3'" 1 
ATOM   2297  C  "C2'" . DA  A 1 113 ? 47.388  50.018  5.128   1.00 105.55 ? 113 DA  I "C2'" 1 
ATOM   2298  C  "C1'" . DA  A 1 113 ? 46.771  49.159  4.032   1.00 105.55 ? 113 DA  I "C1'" 1 
ATOM   2299  N  N9    . DA  A 1 113 ? 47.127  49.558  2.665   1.00 70.52  ? 113 DA  I N9    1 
ATOM   2300  C  C8    . DA  A 1 113 ? 47.392  50.822  2.196   1.00 70.52  ? 113 DA  I C8    1 
ATOM   2301  N  N7    . DA  A 1 113 ? 47.663  50.867  0.912   1.00 70.52  ? 113 DA  I N7    1 
ATOM   2302  C  C5    . DA  A 1 113 ? 47.577  49.546  0.507   1.00 70.52  ? 113 DA  I C5    1 
ATOM   2303  C  C6    . DA  A 1 113 ? 47.749  48.932  -0.740  1.00 70.52  ? 113 DA  I C6    1 
ATOM   2304  N  N6    . DA  A 1 113 ? 48.048  49.593  -1.860  1.00 70.52  ? 113 DA  I N6    1 
ATOM   2305  N  N1    . DA  A 1 113 ? 47.598  47.594  -0.803  1.00 70.52  ? 113 DA  I N1    1 
ATOM   2306  C  C2    . DA  A 1 113 ? 47.289  46.927  0.319   1.00 70.52  ? 113 DA  I C2    1 
ATOM   2307  N  N3    . DA  A 1 113 ? 47.096  47.391  1.549   1.00 70.52  ? 113 DA  I N3    1 
ATOM   2308  C  C4    . DA  A 1 113 ? 47.254  48.725  1.577   1.00 70.52  ? 113 DA  I C4    1 
ATOM   2309  P  P     . DC  A 1 114 ? 47.860  48.829  8.041   1.00 105.53 ? 114 DC  I P     1 
ATOM   2310  O  OP1   . DC  A 1 114 ? 47.775  47.576  8.832   1.00 105.53 ? 114 DC  I OP1   1 
ATOM   2311  O  OP2   . DC  A 1 114 ? 48.051  50.128  8.744   1.00 105.53 ? 114 DC  I OP2   1 
ATOM   2312  O  "O5'" . DC  A 1 114 ? 49.002  48.669  6.938   1.00 92.52  ? 114 DC  I "O5'" 1 
ATOM   2313  C  "C5'" . DC  A 1 114 ? 50.216  47.978  7.213   1.00 92.52  ? 114 DC  I "C5'" 1 
ATOM   2314  C  "C4'" . DC  A 1 114 ? 50.149  46.562  6.684   1.00 92.52  ? 114 DC  I "C4'" 1 
ATOM   2315  O  "O4'" . DC  A 1 114 ? 49.610  46.517  5.340   1.00 92.52  ? 114 DC  I "O4'" 1 
ATOM   2316  C  "C3'" . DC  A 1 114 ? 51.513  45.890  6.614   1.00 92.52  ? 114 DC  I "C3'" 1 
ATOM   2317  O  "O3'" . DC  A 1 114 ? 51.422  44.535  7.041   1.00 92.52  ? 114 DC  I "O3'" 1 
ATOM   2318  C  "C2'" . DC  A 1 114 ? 51.904  45.989  5.153   1.00 92.52  ? 114 DC  I "C2'" 1 
ATOM   2319  C  "C1'" . DC  A 1 114 ? 50.578  46.035  4.414   1.00 92.52  ? 114 DC  I "C1'" 1 
ATOM   2320  N  N1    . DC  A 1 114 ? 50.624  46.987  3.292   1.00 63.64  ? 114 DC  I N1    1 
ATOM   2321  C  C2    . DC  A 1 114 ? 50.478  46.517  1.972   1.00 63.64  ? 114 DC  I C2    1 
ATOM   2322  O  O2    . DC  A 1 114 ? 50.314  45.303  1.774   1.00 63.64  ? 114 DC  I O2    1 
ATOM   2323  N  N3    . DC  A 1 114 ? 50.530  47.408  0.946   1.00 63.64  ? 114 DC  I N3    1 
ATOM   2324  C  C4    . DC  A 1 114 ? 50.732  48.708  1.196   1.00 63.64  ? 114 DC  I C4    1 
ATOM   2325  N  N4    . DC  A 1 114 ? 50.798  49.548  0.160   1.00 63.64  ? 114 DC  I N4    1 
ATOM   2326  C  C5    . DC  A 1 114 ? 50.882  49.206  2.524   1.00 63.64  ? 114 DC  I C5    1 
ATOM   2327  C  C6    . DC  A 1 114 ? 50.820  48.321  3.530   1.00 63.64  ? 114 DC  I C6    1 
ATOM   2328  P  P     . DA  A 1 115 ? 52.764  43.732  7.375   1.00 86.86  ? 115 DA  I P     1 
ATOM   2329  O  OP1   . DA  A 1 115 ? 52.404  42.445  8.033   1.00 86.86  ? 115 DA  I OP1   1 
ATOM   2330  O  OP2   . DA  A 1 115 ? 53.677  44.683  8.061   1.00 86.86  ? 115 DA  I OP2   1 
ATOM   2331  O  "O5'" . DA  A 1 115 ? 53.341  43.420  5.929   1.00 154.94 ? 115 DA  I "O5'" 1 
ATOM   2332  C  "C5'" . DA  A 1 115 ? 52.705  42.455  5.100   1.00 154.94 ? 115 DA  I "C5'" 1 
ATOM   2333  C  "C4'" . DA  A 1 115 ? 53.546  42.194  3.876   1.00 154.94 ? 115 DA  I "C4'" 1 
ATOM   2334  O  "O4'" . DA  A 1 115 ? 53.291  43.211  2.878   1.00 154.94 ? 115 DA  I "O4'" 1 
ATOM   2335  C  "C3'" . DA  A 1 115 ? 55.048  42.226  4.163   1.00 154.94 ? 115 DA  I "C3'" 1 
ATOM   2336  O  "O3'" . DA  A 1 115 ? 55.703  41.162  3.472   1.00 154.94 ? 115 DA  I "O3'" 1 
ATOM   2337  C  "C2'" . DA  A 1 115 ? 55.477  43.582  3.628   1.00 154.94 ? 115 DA  I "C2'" 1 
ATOM   2338  C  "C1'" . DA  A 1 115 ? 54.516  43.795  2.470   1.00 154.94 ? 115 DA  I "C1'" 1 
ATOM   2339  N  N9    . DA  A 1 115 ? 54.267  45.201  2.139   1.00 93.27  ? 115 DA  I N9    1 
ATOM   2340  C  C8    . DA  A 1 115 ? 54.022  46.239  3.004   1.00 93.27  ? 115 DA  I C8    1 
ATOM   2341  N  N7    . DA  A 1 115 ? 53.881  47.400  2.410   1.00 93.27  ? 115 DA  I N7    1 
ATOM   2342  C  C5    . DA  A 1 115 ? 54.035  47.107  1.061   1.00 93.27  ? 115 DA  I C5    1 
ATOM   2343  C  C6    . DA  A 1 115 ? 54.003  47.913  -0.099  1.00 93.27  ? 115 DA  I C6    1 
ATOM   2344  N  N6    . DA  A 1 115 ? 53.805  49.239  -0.085  1.00 93.27  ? 115 DA  I N6    1 
ATOM   2345  N  N1    . DA  A 1 115 ? 54.187  47.303  -1.289  1.00 93.27  ? 115 DA  I N1    1 
ATOM   2346  C  C2    . DA  A 1 115 ? 54.390  45.982  -1.309  1.00 93.27  ? 115 DA  I C2    1 
ATOM   2347  N  N3    . DA  A 1 115 ? 54.445  45.122  -0.294  1.00 93.27  ? 115 DA  I N3    1 
ATOM   2348  C  C4    . DA  A 1 115 ? 54.259  45.754  0.879   1.00 93.27  ? 115 DA  I C4    1 
ATOM   2349  P  P     . DC  A 1 116 ? 57.244  40.822  3.790   1.00 106.13 ? 116 DC  I P     1 
ATOM   2350  O  OP1   . DC  A 1 116 ? 57.301  39.569  4.585   1.00 106.13 ? 116 DC  I OP1   1 
ATOM   2351  O  OP2   . DC  A 1 116 ? 57.907  42.050  4.307   1.00 106.13 ? 116 DC  I OP2   1 
ATOM   2352  O  "O5'" . DC  A 1 116 ? 57.817  40.534  2.335   1.00 158.95 ? 116 DC  I "O5'" 1 
ATOM   2353  C  "C5'" . DC  A 1 116 ? 57.048  40.887  1.183   1.00 158.95 ? 116 DC  I "C5'" 1 
ATOM   2354  C  "C4'" . DC  A 1 116 ? 57.953  41.298  0.045   1.00 158.95 ? 116 DC  I "C4'" 1 
ATOM   2355  O  "O4'" . DC  A 1 116 ? 57.598  42.630  -0.407  1.00 158.95 ? 116 DC  I "O4'" 1 
ATOM   2356  C  "C3'" . DC  A 1 116 ? 59.443  41.352  0.391   1.00 158.95 ? 116 DC  I "C3'" 1 
ATOM   2357  O  "O3'" . DC  A 1 116 ? 60.206  40.807  -0.690  1.00 158.95 ? 116 DC  I "O3'" 1 
ATOM   2358  C  "C2'" . DC  A 1 116 ? 59.715  42.836  0.555   1.00 158.95 ? 116 DC  I "C2'" 1 
ATOM   2359  C  "C1'" . DC  A 1 116 ? 58.761  43.446  -0.452  1.00 158.95 ? 116 DC  I "C1'" 1 
ATOM   2360  N  N1    . DC  A 1 116 ? 58.375  44.833  -0.137  1.00 116.12 ? 116 DC  I N1    1 
ATOM   2361  C  C2    . DC  A 1 116 ? 57.827  45.644  -1.150  1.00 116.12 ? 116 DC  I C2    1 
ATOM   2362  O  O2    . DC  A 1 116 ? 57.656  45.166  -2.290  1.00 116.12 ? 116 DC  I O2    1 
ATOM   2363  N  N3    . DC  A 1 116 ? 57.500  46.926  -0.856  1.00 116.12 ? 116 DC  I N3    1 
ATOM   2364  C  C4    . DC  A 1 116 ? 57.695  47.403  0.380   1.00 116.12 ? 116 DC  I C4    1 
ATOM   2365  N  N4    . DC  A 1 116 ? 57.362  48.668  0.624   1.00 116.12 ? 116 DC  I N4    1 
ATOM   2366  C  C5    . DC  A 1 116 ? 58.240  46.599  1.421   1.00 116.12 ? 116 DC  I C5    1 
ATOM   2367  C  C6    . DC  A 1 116 ? 58.560  45.334  1.123   1.00 116.12 ? 116 DC  I C6    1 
ATOM   2368  P  P     . DT  A 1 117 ? 61.774  41.138  -0.812  1.00 120.60 ? 117 DT  I P     1 
ATOM   2369  O  OP1   . DT  A 1 117 ? 62.445  39.942  -1.381  1.00 120.60 ? 117 DT  I OP1   1 
ATOM   2370  O  OP2   . DT  A 1 117 ? 62.242  41.693  0.488   1.00 120.60 ? 117 DT  I OP2   1 
ATOM   2371  O  "O5'" . DT  A 1 117 ? 61.812  42.303  -1.898  1.00 135.17 ? 117 DT  I "O5'" 1 
ATOM   2372  C  "C5'" . DT  A 1 117 ? 61.129  42.155  -3.144  1.00 135.17 ? 117 DT  I "C5'" 1 
ATOM   2373  C  "C4'" . DT  A 1 117 ? 61.633  43.167  -4.146  1.00 135.17 ? 117 DT  I "C4'" 1 
ATOM   2374  O  "O4'" . DT  A 1 117 ? 61.104  44.481  -3.842  1.00 135.17 ? 117 DT  I "O4'" 1 
ATOM   2375  C  "C3'" . DT  A 1 117 ? 63.154  43.308  -4.187  1.00 135.17 ? 117 DT  I "C3'" 1 
ATOM   2376  O  "O3'" . DT  A 1 117 ? 63.617  43.380  -5.536  1.00 135.17 ? 117 DT  I "O3'" 1 
ATOM   2377  C  "C2'" . DT  A 1 117 ? 63.422  44.596  -3.429  1.00 135.17 ? 117 DT  I "C2'" 1 
ATOM   2378  C  "C1'" . DT  A 1 117 ? 62.158  45.415  -3.644  1.00 135.17 ? 117 DT  I "C1'" 1 
ATOM   2379  N  N1    . DT  A 1 117 ? 61.805  46.249  -2.474  1.00 83.79  ? 117 DT  I N1    1 
ATOM   2380  C  C2    . DT  A 1 117 ? 61.443  47.559  -2.683  1.00 83.79  ? 117 DT  I C2    1 
ATOM   2381  O  O2    . DT  A 1 117 ? 61.365  48.057  -3.793  1.00 83.79  ? 117 DT  I O2    1 
ATOM   2382  N  N3    . DT  A 1 117 ? 61.166  48.266  -1.533  1.00 83.79  ? 117 DT  I N3    1 
ATOM   2383  C  C4    . DT  A 1 117 ? 61.197  47.793  -0.229  1.00 83.79  ? 117 DT  I C4    1 
ATOM   2384  O  O4    . DT  A 1 117 ? 60.926  48.548  0.702   1.00 83.79  ? 117 DT  I O4    1 
ATOM   2385  C  C5    . DT  A 1 117 ? 61.562  46.402  -0.086  1.00 83.79  ? 117 DT  I C5    1 
ATOM   2386  C  C7    . DT  A 1 117 ? 61.599  45.794  1.282   1.00 83.79  ? 117 DT  I C7    1 
ATOM   2387  C  C6    . DT  A 1 117 ? 61.850  45.712  -1.199  1.00 83.79  ? 117 DT  I C6    1 
ATOM   2388  P  P     . DT  A 1 118 ? 65.154  43.737  -5.836  1.00 120.38 ? 118 DT  I P     1 
ATOM   2389  O  OP1   . DT  A 1 118 ? 65.542  43.011  -7.075  1.00 120.38 ? 118 DT  I OP1   1 
ATOM   2390  O  OP2   . DT  A 1 118 ? 65.971  43.578  -4.602  1.00 120.38 ? 118 DT  I OP2   1 
ATOM   2391  O  "O5'" . DT  A 1 118 ? 65.076  45.283  -6.183  1.00 90.80  ? 118 DT  I "O5'" 1 
ATOM   2392  C  "C5'" . DT  A 1 118 ? 64.069  45.752  -7.068  1.00 90.80  ? 118 DT  I "C5'" 1 
ATOM   2393  C  "C4'" . DT  A 1 118 ? 64.163  47.248  -7.225  1.00 90.80  ? 118 DT  I "C4'" 1 
ATOM   2394  O  "O4'" . DT  A 1 118 ? 63.832  47.873  -5.965  1.00 90.80  ? 118 DT  I "O4'" 1 
ATOM   2395  C  "C3'" . DT  A 1 118 ? 65.548  47.775  -7.607  1.00 90.80  ? 118 DT  I "C3'" 1 
ATOM   2396  O  "O3'" . DT  A 1 118 ? 65.394  48.833  -8.566  1.00 90.80  ? 118 DT  I "O3'" 1 
ATOM   2397  C  "C2'" . DT  A 1 118 ? 66.104  48.277  -6.286  1.00 90.80  ? 118 DT  I "C2'" 1 
ATOM   2398  C  "C1'" . DT  A 1 118 ? 64.850  48.793  -5.622  1.00 90.80  ? 118 DT  I "C1'" 1 
ATOM   2399  N  N1    . DT  A 1 118 ? 64.886  48.888  -4.166  1.00 77.56  ? 118 DT  I N1    1 
ATOM   2400  C  C2    . DT  A 1 118 ? 64.614  50.113  -3.607  1.00 77.56  ? 118 DT  I C2    1 
ATOM   2401  O  O2    . DT  A 1 118 ? 64.437  51.126  -4.268  1.00 77.56  ? 118 DT  I O2    1 
ATOM   2402  N  N3    . DT  A 1 118 ? 64.567  50.115  -2.240  1.00 77.56  ? 118 DT  I N3    1 
ATOM   2403  C  C4    . DT  A 1 118 ? 64.794  49.050  -1.397  1.00 77.56  ? 118 DT  I C4    1 
ATOM   2404  O  O4    . DT  A 1 118 ? 64.691  49.206  -0.188  1.00 77.56  ? 118 DT  I O4    1 
ATOM   2405  C  C5    . DT  A 1 118 ? 65.134  47.804  -2.053  1.00 77.56  ? 118 DT  I C5    1 
ATOM   2406  C  C7    . DT  A 1 118 ? 65.452  46.603  -1.219  1.00 77.56  ? 118 DT  I C7    1 
ATOM   2407  C  C6    . DT  A 1 118 ? 65.153  47.786  -3.391  1.00 77.56  ? 118 DT  I C6    1 
ATOM   2408  P  P     . DT  A 1 119 ? 66.613  49.838  -8.865  1.00 87.10  ? 119 DT  I P     1 
ATOM   2409  O  OP1   . DT  A 1 119 ? 66.486  50.279  -10.281 1.00 87.10  ? 119 DT  I OP1   1 
ATOM   2410  O  OP2   . DT  A 1 119 ? 67.890  49.231  -8.397  1.00 87.10  ? 119 DT  I OP2   1 
ATOM   2411  O  "O5'" . DT  A 1 119 ? 66.309  51.069  -7.899  1.00 88.48  ? 119 DT  I "O5'" 1 
ATOM   2412  C  "C5'" . DT  A 1 119 ? 65.320  52.037  -8.236  1.00 88.48  ? 119 DT  I "C5'" 1 
ATOM   2413  C  "C4'" . DT  A 1 119 ? 65.819  53.424  -7.909  1.00 88.48  ? 119 DT  I "C4'" 1 
ATOM   2414  O  "O4'" . DT  A 1 119 ? 65.733  53.594  -6.475  1.00 88.48  ? 119 DT  I "O4'" 1 
ATOM   2415  C  "C3'" . DT  A 1 119 ? 67.282  53.669  -8.292  1.00 88.48  ? 119 DT  I "C3'" 1 
ATOM   2416  O  "O3'" . DT  A 1 119 ? 67.510  54.774  -9.190  1.00 88.48  ? 119 DT  I "O3'" 1 
ATOM   2417  C  "C2'" . DT  A 1 119 ? 68.047  53.728  -6.982  1.00 88.48  ? 119 DT  I "C2'" 1 
ATOM   2418  C  "C1'" . DT  A 1 119 ? 66.991  53.934  -5.907  1.00 88.48  ? 119 DT  I "C1'" 1 
ATOM   2419  N  N1    . DT  A 1 119 ? 67.205  53.053  -4.741  1.00 89.04  ? 119 DT  I N1    1 
ATOM   2420  C  C2    . DT  A 1 119 ? 67.051  53.571  -3.474  1.00 89.04  ? 119 DT  I C2    1 
ATOM   2421  O  O2    . DT  A 1 119 ? 66.748  54.733  -3.258  1.00 89.04  ? 119 DT  I O2    1 
ATOM   2422  N  N3    . DT  A 1 119 ? 67.272  52.671  -2.460  1.00 89.04  ? 119 DT  I N3    1 
ATOM   2423  C  C4    . DT  A 1 119 ? 67.629  51.343  -2.585  1.00 89.04  ? 119 DT  I C4    1 
ATOM   2424  O  O4    . DT  A 1 119 ? 67.791  50.658  -1.584  1.00 89.04  ? 119 DT  I O4    1 
ATOM   2425  C  C5    . DT  A 1 119 ? 67.777  50.873  -3.936  1.00 89.04  ? 119 DT  I C5    1 
ATOM   2426  C  C7    . DT  A 1 119 ? 68.166  49.450  -4.166  1.00 89.04  ? 119 DT  I C7    1 
ATOM   2427  C  C6    . DT  A 1 119 ? 67.559  51.736  -4.933  1.00 89.04  ? 119 DT  I C6    1 
ATOM   2428  P  P     . DT  A 1 120 ? 66.619  56.107  -9.103  1.00 75.71  ? 120 DT  I P     1 
ATOM   2429  O  OP1   . DT  A 1 120 ? 65.225  55.757  -9.496  1.00 75.71  ? 120 DT  I OP1   1 
ATOM   2430  O  OP2   . DT  A 1 120 ? 67.346  57.162  -9.856  1.00 75.71  ? 120 DT  I OP2   1 
ATOM   2431  O  "O5'" . DT  A 1 120 ? 66.646  56.503  -7.563  1.00 67.52  ? 120 DT  I "O5'" 1 
ATOM   2432  C  "C5'" . DT  A 1 120 ? 65.537  57.171  -6.975  1.00 67.52  ? 120 DT  I "C5'" 1 
ATOM   2433  C  "C4'" . DT  A 1 120 ? 66.016  58.185  -5.970  1.00 67.52  ? 120 DT  I "C4'" 1 
ATOM   2434  O  "O4'" . DT  A 1 120 ? 66.621  57.500  -4.849  1.00 67.52  ? 120 DT  I "O4'" 1 
ATOM   2435  C  "C3'" . DT  A 1 120 ? 67.066  59.162  -6.495  1.00 67.52  ? 120 DT  I "C3'" 1 
ATOM   2436  O  "O3'" . DT  A 1 120 ? 66.821  60.421  -5.886  1.00 67.52  ? 120 DT  I "O3'" 1 
ATOM   2437  C  "C2'" . DT  A 1 120 ? 68.368  58.582  -5.971  1.00 67.52  ? 120 DT  I "C2'" 1 
ATOM   2438  C  "C1'" . DT  A 1 120 ? 67.935  57.982  -4.640  1.00 67.52  ? 120 DT  I "C1'" 1 
ATOM   2439  N  N1    . DT  A 1 120 ? 68.748  56.852  -4.154  1.00 89.08  ? 120 DT  I N1    1 
ATOM   2440  C  C2    . DT  A 1 120 ? 68.808  56.635  -2.792  1.00 89.08  ? 120 DT  I C2    1 
ATOM   2441  O  O2    . DT  A 1 120 ? 68.248  57.346  -1.978  1.00 89.08  ? 120 DT  I O2    1 
ATOM   2442  N  N3    . DT  A 1 120 ? 69.559  55.552  -2.416  1.00 89.08  ? 120 DT  I N3    1 
ATOM   2443  C  C4    . DT  A 1 120 ? 70.248  54.686  -3.241  1.00 89.08  ? 120 DT  I C4    1 
ATOM   2444  O  O4    . DT  A 1 120 ? 70.864  53.743  -2.747  1.00 89.08  ? 120 DT  I O4    1 
ATOM   2445  C  C5    . DT  A 1 120 ? 70.162  54.990  -4.666  1.00 89.08  ? 120 DT  I C5    1 
ATOM   2446  C  C7    . DT  A 1 120 ? 70.901  54.134  -5.648  1.00 89.08  ? 120 DT  I C7    1 
ATOM   2447  C  C6    . DT  A 1 120 ? 69.421  56.039  -5.040  1.00 89.08  ? 120 DT  I C6    1 
ATOM   2448  P  P     . DG  A 1 121 ? 66.998  61.776  -6.722  1.00 63.18  ? 121 DG  I P     1 
ATOM   2449  O  OP1   . DG  A 1 121 ? 65.909  61.914  -7.731  1.00 63.18  ? 121 DG  I OP1   1 
ATOM   2450  O  OP2   . DG  A 1 121 ? 68.424  61.848  -7.150  1.00 63.18  ? 121 DG  I OP2   1 
ATOM   2451  O  "O5'" . DG  A 1 121 ? 66.749  62.879  -5.600  1.00 58.04  ? 121 DG  I "O5'" 1 
ATOM   2452  C  "C5'" . DG  A 1 121 ? 65.685  62.722  -4.654  1.00 58.04  ? 121 DG  I "C5'" 1 
ATOM   2453  C  "C4'" . DG  A 1 121 ? 66.200  62.896  -3.243  1.00 58.04  ? 121 DG  I "C4'" 1 
ATOM   2454  O  "O4'" . DG  A 1 121 ? 67.114  61.830  -2.900  1.00 58.04  ? 121 DG  I "O4'" 1 
ATOM   2455  C  "C3'" . DG  A 1 121 ? 66.971  64.189  -3.007  1.00 58.04  ? 121 DG  I "C3'" 1 
ATOM   2456  O  "O3'" . DG  A 1 121 ? 66.756  64.628  -1.672  1.00 58.04  ? 121 DG  I "O3'" 1 
ATOM   2457  C  "C2'" . DG  A 1 121 ? 68.418  63.766  -3.166  1.00 58.04  ? 121 DG  I "C2'" 1 
ATOM   2458  C  "C1'" . DG  A 1 121 ? 68.398  62.367  -2.586  1.00 58.04  ? 121 DG  I "C1'" 1 
ATOM   2459  N  N9    . DG  A 1 121 ? 69.402  61.491  -3.177  1.00 74.45  ? 121 DG  I N9    1 
ATOM   2460  C  C8    . DG  A 1 121 ? 69.836  61.488  -4.483  1.00 74.45  ? 121 DG  I C8    1 
ATOM   2461  N  N7    . DG  A 1 121 ? 70.732  60.573  -4.721  1.00 74.45  ? 121 DG  I N7    1 
ATOM   2462  C  C5    . DG  A 1 121 ? 70.902  59.940  -3.501  1.00 74.45  ? 121 DG  I C5    1 
ATOM   2463  C  C6    . DG  A 1 121 ? 71.738  58.869  -3.147  1.00 74.45  ? 121 DG  I C6    1 
ATOM   2464  O  O6    . DG  A 1 121 ? 72.512  58.233  -3.873  1.00 74.45  ? 121 DG  I O6    1 
ATOM   2465  N  N1    . DG  A 1 121 ? 71.612  58.547  -1.794  1.00 74.45  ? 121 DG  I N1    1 
ATOM   2466  C  C2    . DG  A 1 121 ? 70.773  59.177  -0.906  1.00 74.45  ? 121 DG  I C2    1 
ATOM   2467  N  N2    . DG  A 1 121 ? 70.806  58.736  0.359   1.00 74.45  ? 121 DG  I N2    1 
ATOM   2468  N  N3    . DG  A 1 121 ? 69.970  60.169  -1.235  1.00 74.45  ? 121 DG  I N3    1 
ATOM   2469  C  C4    . DG  A 1 121 ? 70.091  60.500  -2.537  1.00 74.45  ? 121 DG  I C4    1 
ATOM   2470  P  P     . DG  A 1 122 ? 67.134  66.127  -1.261  1.00 45.73  ? 122 DG  I P     1 
ATOM   2471  O  OP1   . DG  A 1 122 ? 65.899  66.708  -0.714  1.00 45.73  ? 122 DG  I OP1   1 
ATOM   2472  O  OP2   . DG  A 1 122 ? 67.829  66.807  -2.384  1.00 45.73  ? 122 DG  I OP2   1 
ATOM   2473  O  "O5'" . DG  A 1 122 ? 68.136  65.926  -0.050  1.00 41.47  ? 122 DG  I "O5'" 1 
ATOM   2474  C  "C5'" . DG  A 1 122 ? 67.659  65.344  1.153   1.00 41.47  ? 122 DG  I "C5'" 1 
ATOM   2475  C  "C4'" . DG  A 1 122 ? 68.804  64.880  2.019   1.00 41.47  ? 122 DG  I "C4'" 1 
ATOM   2476  O  "O4'" . DG  A 1 122 ? 69.479  63.766  1.395   1.00 41.47  ? 122 DG  I "O4'" 1 
ATOM   2477  C  "C3'" . DG  A 1 122 ? 69.878  65.923  2.324   1.00 41.47  ? 122 DG  I "C3'" 1 
ATOM   2478  O  "O3'" . DG  A 1 122 ? 70.139  65.914  3.724   1.00 41.47  ? 122 DG  I "O3'" 1 
ATOM   2479  C  "C2'" . DG  A 1 122 ? 71.090  65.451  1.537   1.00 41.47  ? 122 DG  I "C2'" 1 
ATOM   2480  C  "C1'" . DG  A 1 122 ? 70.875  63.954  1.487   1.00 41.47  ? 122 DG  I "C1'" 1 
ATOM   2481  N  N9    . DG  A 1 122 ? 71.498  63.265  0.363   1.00 80.72  ? 122 DG  I N9    1 
ATOM   2482  C  C8    . DG  A 1 122 ? 71.443  63.589  -0.973  1.00 80.72  ? 122 DG  I C8    1 
ATOM   2483  N  N7    . DG  A 1 122 ? 72.141  62.780  -1.725  1.00 80.72  ? 122 DG  I N7    1 
ATOM   2484  C  C5    . DG  A 1 122 ? 72.684  61.865  -0.830  1.00 80.72  ? 122 DG  I C5    1 
ATOM   2485  C  C6    . DG  A 1 122 ? 73.539  60.751  -1.048  1.00 80.72  ? 122 DG  I C6    1 
ATOM   2486  O  O6    . DG  A 1 122 ? 74.018  60.338  -2.114  1.00 80.72  ? 122 DG  I O6    1 
ATOM   2487  N  N1    . DG  A 1 122 ? 73.831  60.092  0.145   1.00 80.72  ? 122 DG  I N1    1 
ATOM   2488  C  C2    . DG  A 1 122 ? 73.358  60.452  1.388   1.00 80.72  ? 122 DG  I C2    1 
ATOM   2489  N  N2    . DG  A 1 122 ? 73.727  59.683  2.418   1.00 80.72  ? 122 DG  I N2    1 
ATOM   2490  N  N3    . DG  A 1 122 ? 72.577  61.489  1.604   1.00 80.72  ? 122 DG  I N3    1 
ATOM   2491  C  C4    . DG  A 1 122 ? 72.282  62.147  0.459   1.00 80.72  ? 122 DG  I C4    1 
ATOM   2492  P  P     . DT  A 1 123 ? 71.235  66.911  4.336   1.00 63.59  ? 123 DT  I P     1 
ATOM   2493  O  OP1   . DT  A 1 123 ? 70.810  67.322  5.706   1.00 63.59  ? 123 DT  I OP1   1 
ATOM   2494  O  OP2   . DT  A 1 123 ? 71.544  67.951  3.315   1.00 63.59  ? 123 DT  I OP2   1 
ATOM   2495  O  "O5'" . DT  A 1 123 ? 72.488  65.947  4.461   1.00 96.42  ? 123 DT  I "O5'" 1 
ATOM   2496  C  "C5'" . DT  A 1 123 ? 72.366  64.691  5.119   1.00 96.42  ? 123 DT  I "C5'" 1 
ATOM   2497  C  "C4'" . DT  A 1 123 ? 73.736  64.107  5.344   1.00 96.42  ? 123 DT  I "C4'" 1 
ATOM   2498  O  "O4'" . DT  A 1 123 ? 74.198  63.475  4.124   1.00 96.42  ? 123 DT  I "O4'" 1 
ATOM   2499  C  "C3'" . DT  A 1 123 ? 74.763  65.187  5.694   1.00 96.42  ? 123 DT  I "C3'" 1 
ATOM   2500  O  "O3'" . DT  A 1 123 ? 75.593  64.775  6.791   1.00 96.42  ? 123 DT  I "O3'" 1 
ATOM   2501  C  "C2'" . DT  A 1 123 ? 75.539  65.380  4.399   1.00 96.42  ? 123 DT  I "C2'" 1 
ATOM   2502  C  "C1'" . DT  A 1 123 ? 75.468  63.998  3.774   1.00 96.42  ? 123 DT  I "C1'" 1 
ATOM   2503  N  N1    . DT  A 1 123 ? 75.617  63.943  2.298   1.00 65.23  ? 123 DT  I N1    1 
ATOM   2504  C  C2    . DT  A 1 123 ? 76.111  62.771  1.751   1.00 65.23  ? 123 DT  I C2    1 
ATOM   2505  O  O2    . DT  A 1 123 ? 76.341  61.772  2.413   1.00 65.23  ? 123 DT  I O2    1 
ATOM   2506  N  N3    . DT  A 1 123 ? 76.317  62.811  0.390   1.00 65.23  ? 123 DT  I N3    1 
ATOM   2507  C  C4    . DT  A 1 123 ? 76.053  63.868  -0.466  1.00 65.23  ? 123 DT  I C4    1 
ATOM   2508  O  O4    . DT  A 1 123 ? 76.299  63.763  -1.668  1.00 65.23  ? 123 DT  I O4    1 
ATOM   2509  C  C5    . DT  A 1 123 ? 75.498  65.046  0.161   1.00 65.23  ? 123 DT  I C5    1 
ATOM   2510  C  C7    . DT  A 1 123 ? 75.171  66.225  -0.697  1.00 65.23  ? 123 DT  I C7    1 
ATOM   2511  C  C6    . DT  A 1 123 ? 75.308  65.028  1.495   1.00 65.23  ? 123 DT  I C6    1 
ATOM   2512  P  P     . DA  A 1 124 ? 76.714  65.778  7.375   1.00 96.30  ? 124 DA  I P     1 
ATOM   2513  O  OP1   . DA  A 1 124 ? 76.651  65.804  8.868   1.00 96.30  ? 124 DA  I OP1   1 
ATOM   2514  O  OP2   . DA  A 1 124 ? 76.668  67.054  6.609   1.00 96.30  ? 124 DA  I OP2   1 
ATOM   2515  O  "O5'" . DA  A 1 124 ? 78.066  65.059  6.959   1.00 117.14 ? 124 DA  I "O5'" 1 
ATOM   2516  C  "C5'" . DA  A 1 124 ? 78.314  63.703  7.320   1.00 117.14 ? 124 DA  I "C5'" 1 
ATOM   2517  C  "C4'" . DA  A 1 124 ? 79.695  63.317  6.857   1.00 117.14 ? 124 DA  I "C4'" 1 
ATOM   2518  O  "O4'" . DA  A 1 124 ? 79.671  63.203  5.415   1.00 117.14 ? 124 DA  I "O4'" 1 
ATOM   2519  C  "C3'" . DA  A 1 124 ? 80.687  64.432  7.179   1.00 117.14 ? 124 DA  I "C3'" 1 
ATOM   2520  O  "O3'" . DA  A 1 124 ? 81.953  63.934  7.594   1.00 117.14 ? 124 DA  I "O3'" 1 
ATOM   2521  C  "C2'" . DA  A 1 124 ? 80.787  65.214  5.884   1.00 117.14 ? 124 DA  I "C2'" 1 
ATOM   2522  C  "C1'" . DA  A 1 124 ? 80.556  64.146  4.837   1.00 117.14 ? 124 DA  I "C1'" 1 
ATOM   2523  N  N9    . DA  A 1 124 ? 79.947  64.657  3.612   1.00 80.33  ? 124 DA  I N9    1 
ATOM   2524  C  C8    . DA  A 1 124 ? 79.258  65.837  3.444   1.00 80.33  ? 124 DA  I C8    1 
ATOM   2525  N  N7    . DA  A 1 124 ? 78.909  66.073  2.201   1.00 80.33  ? 124 DA  I N7    1 
ATOM   2526  C  C5    . DA  A 1 124 ? 79.381  64.963  1.506   1.00 80.33  ? 124 DA  I C5    1 
ATOM   2527  C  C6    . DA  A 1 124 ? 79.347  64.610  0.138   1.00 80.33  ? 124 DA  I C6    1 
ATOM   2528  N  N6    . DA  A 1 124 ? 78.812  65.387  -0.816  1.00 80.33  ? 124 DA  I N6    1 
ATOM   2529  N  N1    . DA  A 1 124 ? 79.900  63.421  -0.219  1.00 80.33  ? 124 DA  I N1    1 
ATOM   2530  C  C2    . DA  A 1 124 ? 80.451  62.655  0.735   1.00 80.33  ? 124 DA  I C2    1 
ATOM   2531  N  N3    . DA  A 1 124 ? 80.554  62.884  2.044   1.00 80.33  ? 124 DA  I N3    1 
ATOM   2532  C  C4    . DA  A 1 124 ? 79.997  64.069  2.369   1.00 80.33  ? 124 DA  I C4    1 
ATOM   2533  P  P     . DG  A 1 125 ? 82.956  64.921  8.356   1.00 133.47 ? 125 DG  I P     1 
ATOM   2534  O  OP1   . DG  A 1 125 ? 84.273  64.247  8.450   1.00 133.47 ? 125 DG  I OP1   1 
ATOM   2535  O  OP2   . DG  A 1 125 ? 82.279  65.392  9.594   1.00 133.47 ? 125 DG  I OP2   1 
ATOM   2536  O  "O5'" . DG  A 1 125 ? 83.069  66.152  7.351   1.00 103.83 ? 125 DG  I "O5'" 1 
ATOM   2537  C  "C5'" . DG  A 1 125 ? 84.320  66.512  6.782   1.00 103.83 ? 125 DG  I "C5'" 1 
ATOM   2538  C  "C4'" . DG  A 1 125 ? 84.902  65.339  6.030   1.00 103.83 ? 125 DG  I "C4'" 1 
ATOM   2539  O  "O4'" . DG  A 1 125 ? 84.003  64.943  4.969   1.00 103.83 ? 125 DG  I "O4'" 1 
ATOM   2540  C  "C3'" . DG  A 1 125 ? 86.239  65.640  5.361   1.00 103.83 ? 125 DG  I "C3'" 1 
ATOM   2541  O  "O3'" . DG  A 1 125 ? 87.092  64.493  5.422   1.00 103.83 ? 125 DG  I "O3'" 1 
ATOM   2542  C  "C2'" . DG  A 1 125 ? 85.851  65.960  3.932   1.00 103.83 ? 125 DG  I "C2'" 1 
ATOM   2543  C  "C1'" . DG  A 1 125 ? 84.635  65.082  3.704   1.00 103.83 ? 125 DG  I "C1'" 1 
ATOM   2544  N  N9    . DG  A 1 125 ? 83.681  65.716  2.804   1.00 119.69 ? 125 DG  I N9    1 
ATOM   2545  C  C8    . DG  A 1 125 ? 82.875  66.792  3.096   1.00 119.69 ? 125 DG  I C8    1 
ATOM   2546  N  N7    . DG  A 1 125 ? 82.145  67.176  2.084   1.00 119.69 ? 125 DG  I N7    1 
ATOM   2547  C  C5    . DG  A 1 125 ? 82.480  66.297  1.060   1.00 119.69 ? 125 DG  I C5    1 
ATOM   2548  C  C6    . DG  A 1 125 ? 82.011  66.226  -0.282  1.00 119.69 ? 125 DG  I C6    1 
ATOM   2549  O  O6    . DG  A 1 125 ? 81.173  66.948  -0.845  1.00 119.69 ? 125 DG  I O6    1 
ATOM   2550  N  N1    . DG  A 1 125 ? 82.618  65.184  -0.981  1.00 119.69 ? 125 DG  I N1    1 
ATOM   2551  C  C2    . DG  A 1 125 ? 83.537  64.307  -0.454  1.00 119.69 ? 125 DG  I C2    1 
ATOM   2552  N  N2    . DG  A 1 125 ? 83.971  63.353  -1.288  1.00 119.69 ? 125 DG  I N2    1 
ATOM   2553  N  N3    . DG  A 1 125 ? 83.987  64.362  0.794   1.00 119.69 ? 125 DG  I N3    1 
ATOM   2554  C  C4    . DG  A 1 125 ? 83.421  65.379  1.490   1.00 119.69 ? 125 DG  I C4    1 
ATOM   2555  P  P     . DA  A 1 126 ? 88.491  64.506  4.637   1.00 114.28 ? 126 DA  I P     1 
ATOM   2556  O  OP1   . DA  A 1 126 ? 89.195  63.221  4.882   1.00 114.28 ? 126 DA  I OP1   1 
ATOM   2557  O  OP2   . DA  A 1 126 ? 89.170  65.790  4.950   1.00 114.28 ? 126 DA  I OP2   1 
ATOM   2558  O  "O5'" . DA  A 1 126 ? 88.040  64.545  3.114   1.00 151.17 ? 126 DA  I "O5'" 1 
ATOM   2559  C  "C5'" . DA  A 1 126 ? 88.438  63.525  2.211   1.00 151.17 ? 126 DA  I "C5'" 1 
ATOM   2560  C  "C4'" . DA  A 1 126 ? 89.018  64.150  0.967   1.00 151.17 ? 126 DA  I "C4'" 1 
ATOM   2561  O  "O4'" . DA  A 1 126 ? 87.953  64.722  0.162   1.00 151.17 ? 126 DA  I "O4'" 1 
ATOM   2562  C  "C3'" . DA  A 1 126 ? 89.990  65.294  1.271   1.00 151.17 ? 126 DA  I "C3'" 1 
ATOM   2563  O  "O3'" . DA  A 1 126 ? 91.123  65.220  0.398   1.00 151.17 ? 126 DA  I "O3'" 1 
ATOM   2564  C  "C2'" . DA  A 1 126 ? 89.157  66.536  1.011   1.00 151.17 ? 126 DA  I "C2'" 1 
ATOM   2565  C  "C1'" . DA  A 1 126 ? 88.249  66.081  -0.116  1.00 151.17 ? 126 DA  I "C1'" 1 
ATOM   2566  N  N9    . DA  A 1 126 ? 86.992  66.831  -0.209  1.00 138.40 ? 126 DA  I N9    1 
ATOM   2567  C  C8    . DA  A 1 126 ? 86.439  67.650  0.749   1.00 138.40 ? 126 DA  I C8    1 
ATOM   2568  N  N7    . DA  A 1 126 ? 85.336  68.246  0.362   1.00 138.40 ? 126 DA  I N7    1 
ATOM   2569  C  C5    . DA  A 1 126 ? 85.139  67.779  -0.931  1.00 138.40 ? 126 DA  I C5    1 
ATOM   2570  C  C6    . DA  A 1 126 ? 84.145  68.044  -1.891  1.00 138.40 ? 126 DA  I C6    1 
ATOM   2571  N  N6    . DA  A 1 126 ? 83.125  68.881  -1.689  1.00 138.40 ? 126 DA  I N6    1 
ATOM   2572  N  N1    . DA  A 1 126 ? 84.238  67.413  -3.081  1.00 138.40 ? 126 DA  I N1    1 
ATOM   2573  C  C2    . DA  A 1 126 ? 85.264  66.577  -3.284  1.00 138.40 ? 126 DA  I C2    1 
ATOM   2574  N  N3    . DA  A 1 126 ? 86.262  66.249  -2.465  1.00 138.40 ? 126 DA  I N3    1 
ATOM   2575  C  C4    . DA  A 1 126 ? 86.142  66.893  -1.290  1.00 138.40 ? 126 DA  I C4    1 
ATOM   2576  P  P     . DA  A 1 127 ? 92.055  66.513  0.165   1.00 165.61 ? 127 DA  I P     1 
ATOM   2577  O  OP1   . DA  A 1 127 ? 93.475  66.094  0.282   1.00 165.61 ? 127 DA  I OP1   1 
ATOM   2578  O  OP2   . DA  A 1 127 ? 91.550  67.616  1.022   1.00 165.61 ? 127 DA  I OP2   1 
ATOM   2579  O  "O5'" . DA  A 1 127 ? 91.763  66.883  -1.361  1.00 174.46 ? 127 DA  I "O5'" 1 
ATOM   2580  C  "C5'" . DA  A 1 127 ? 91.477  65.851  -2.312  1.00 174.46 ? 127 DA  I "C5'" 1 
ATOM   2581  C  "C4'" . DA  A 1 127 ? 91.145  66.437  -3.666  1.00 174.46 ? 127 DA  I "C4'" 1 
ATOM   2582  O  "O4'" . DA  A 1 127 ? 89.849  67.087  -3.637  1.00 174.46 ? 127 DA  I "O4'" 1 
ATOM   2583  C  "C3'" . DA  A 1 127 ? 92.136  67.473  -4.196  1.00 174.46 ? 127 DA  I "C3'" 1 
ATOM   2584  O  "O3'" . DA  A 1 127 ? 92.402  67.226  -5.583  1.00 174.46 ? 127 DA  I "O3'" 1 
ATOM   2585  C  "C2'" . DA  A 1 127 ? 91.423  68.798  -3.971  1.00 174.46 ? 127 DA  I "C2'" 1 
ATOM   2586  C  "C1'" . DA  A 1 127 ? 89.953  68.429  -4.103  1.00 174.46 ? 127 DA  I "C1'" 1 
ATOM   2587  N  N9    . DA  A 1 127 ? 89.039  69.258  -3.304  1.00 130.98 ? 127 DA  I N9    1 
ATOM   2588  C  C8    . DA  A 1 127 ? 89.261  69.783  -2.050  1.00 130.98 ? 127 DA  I C8    1 
ATOM   2589  N  N7    . DA  A 1 127 ? 88.247  70.466  -1.573  1.00 130.98 ? 127 DA  I N7    1 
ATOM   2590  C  C5    . DA  A 1 127 ? 87.293  70.393  -2.579  1.00 130.98 ? 127 DA  I C5    1 
ATOM   2591  C  C6    . DA  A 1 127 ? 85.990  70.908  -2.682  1.00 130.98 ? 127 DA  I C6    1 
ATOM   2592  N  N6    . DA  A 1 127 ? 85.399  71.630  -1.725  1.00 130.98 ? 127 DA  I N6    1 
ATOM   2593  N  N1    . DA  A 1 127 ? 85.304  70.651  -3.817  1.00 130.98 ? 127 DA  I N1    1 
ATOM   2594  C  C2    . DA  A 1 127 ? 85.897  69.932  -4.780  1.00 130.98 ? 127 DA  I C2    1 
ATOM   2595  N  N3    . DA  A 1 127 ? 87.113  69.395  -4.802  1.00 130.98 ? 127 DA  I N3    1 
ATOM   2596  C  C4    . DA  A 1 127 ? 87.769  69.660  -3.657  1.00 130.98 ? 127 DA  I C4    1 
ATOM   2597  P  P     . DT  A 1 128 ? 93.154  68.338  -6.470  1.00 175.78 ? 128 DT  I P     1 
ATOM   2598  O  OP1   . DT  A 1 128 ? 93.865  67.626  -7.565  1.00 175.78 ? 128 DT  I OP1   1 
ATOM   2599  O  OP2   . DT  A 1 128 ? 93.922  69.238  -5.570  1.00 175.78 ? 128 DT  I OP2   1 
ATOM   2600  O  "O5'" . DT  A 1 128 ? 91.939  69.156  -7.102  1.00 146.66 ? 128 DT  I "O5'" 1 
ATOM   2601  C  "C5'" . DT  A 1 128 ? 90.905  68.480  -7.827  1.00 146.66 ? 128 DT  I "C5'" 1 
ATOM   2602  C  "C4'" . DT  A 1 128 ? 90.127  69.464  -8.668  1.00 146.66 ? 128 DT  I "C4'" 1 
ATOM   2603  O  "O4'" . DT  A 1 128 ? 88.994  69.998  -7.938  1.00 146.66 ? 128 DT  I "O4'" 1 
ATOM   2604  C  "C3'" . DT  A 1 128 ? 90.962  70.666  -9.110  1.00 146.66 ? 128 DT  I "C3'" 1 
ATOM   2605  O  "O3'" . DT  A 1 128 ? 90.718  70.976  -10.480 1.00 146.66 ? 128 DT  I "O3'" 1 
ATOM   2606  C  "C2'" . DT  A 1 128 ? 90.471  71.786  -8.214  1.00 146.66 ? 128 DT  I "C2'" 1 
ATOM   2607  C  "C1'" . DT  A 1 128 ? 89.014  71.413  -8.016  1.00 146.66 ? 128 DT  I "C1'" 1 
ATOM   2608  N  N1    . DT  A 1 128 ? 88.417  71.963  -6.782  1.00 109.45 ? 128 DT  I N1    1 
ATOM   2609  C  C2    . DT  A 1 128 ? 87.085  72.327  -6.803  1.00 109.45 ? 128 DT  I C2    1 
ATOM   2610  O  O2    . DT  A 1 128 ? 86.357  72.152  -7.774  1.00 109.45 ? 128 DT  I O2    1 
ATOM   2611  N  N3    . DT  A 1 128 ? 86.634  72.907  -5.632  1.00 109.45 ? 128 DT  I N3    1 
ATOM   2612  C  C4    . DT  A 1 128 ? 87.357  73.123  -4.465  1.00 109.45 ? 128 DT  I C4    1 
ATOM   2613  O  O4    . DT  A 1 128 ? 86.815  73.658  -3.493  1.00 109.45 ? 128 DT  I O4    1 
ATOM   2614  C  C5    . DT  A 1 128 ? 88.736  72.686  -4.508  1.00 109.45 ? 128 DT  I C5    1 
ATOM   2615  C  C7    . DT  A 1 128 ? 89.593  72.869  -3.295  1.00 109.45 ? 128 DT  I C7    1 
ATOM   2616  C  C6    . DT  A 1 128 ? 89.189  72.135  -5.646  1.00 109.45 ? 128 DT  I C6    1 
ATOM   2617  P  P     . DC  A 1 129 ? 91.267  72.356  -11.088 1.00 107.64 ? 129 DC  I P     1 
ATOM   2618  O  OP1   . DC  A 1 129 ? 91.479  72.189  -12.555 1.00 107.64 ? 129 DC  I OP1   1 
ATOM   2619  O  OP2   . DC  A 1 129 ? 92.398  72.802  -10.222 1.00 107.64 ? 129 DC  I OP2   1 
ATOM   2620  O  "O5'" . DC  A 1 129 ? 90.036  73.346  -10.871 1.00 101.14 ? 129 DC  I "O5'" 1 
ATOM   2621  C  "C5'" . DC  A 1 129 ? 88.709  72.949  -11.231 1.00 101.14 ? 129 DC  I "C5'" 1 
ATOM   2622  C  "C4'" . DC  A 1 129 ? 87.882  74.149  -11.632 1.00 101.14 ? 129 DC  I "C4'" 1 
ATOM   2623  O  "O4'" . DC  A 1 129 ? 87.173  74.566  -10.442 1.00 101.14 ? 129 DC  I "O4'" 1 
ATOM   2624  C  "C3'" . DC  A 1 129 ? 88.668  75.373  -12.120 1.00 101.14 ? 129 DC  I "C3'" 1 
ATOM   2625  O  "O3'" . DC  A 1 129 ? 88.316  75.867  -13.431 1.00 101.14 ? 129 DC  I "O3'" 1 
ATOM   2626  C  "C2'" . DC  A 1 129 ? 88.559  76.403  -11.014 1.00 101.14 ? 129 DC  I "C2'" 1 
ATOM   2627  C  "C1'" . DC  A 1 129 ? 87.402  75.940  -10.147 1.00 101.14 ? 129 DC  I "C1'" 1 
ATOM   2628  N  N1    . DC  A 1 129 ? 87.731  76.050  -8.713  1.00 95.28  ? 129 DC  I N1    1 
ATOM   2629  C  C2    . DC  A 1 129 ? 86.726  76.408  -7.795  1.00 95.28  ? 129 DC  I C2    1 
ATOM   2630  O  O2    . DC  A 1 129 ? 85.564  76.576  -8.200  1.00 95.28  ? 129 DC  I O2    1 
ATOM   2631  N  N3    . DC  A 1 129 ? 87.050  76.560  -6.489  1.00 95.28  ? 129 DC  I N3    1 
ATOM   2632  C  C4    . DC  A 1 129 ? 88.309  76.362  -6.086  1.00 95.28  ? 129 DC  I C4    1 
ATOM   2633  N  N4    . DC  A 1 129 ? 88.586  76.545  -4.789  1.00 95.28  ? 129 DC  I N4    1 
ATOM   2634  C  C5    . DC  A 1 129 ? 89.341  75.974  -6.992  1.00 95.28  ? 129 DC  I C5    1 
ATOM   2635  C  C6    . DC  A 1 129 ? 89.010  75.828  -8.281  1.00 95.28  ? 129 DC  I C6    1 
ATOM   2636  P  P     . DT  A 1 130 ? 86.779  76.010  -13.890 1.00 83.96  ? 130 DT  I P     1 
ATOM   2637  O  OP1   . DT  A 1 130 ? 86.086  74.707  -13.661 1.00 83.96  ? 130 DT  I OP1   1 
ATOM   2638  O  OP2   . DT  A 1 130 ? 86.814  76.594  -15.259 1.00 83.96  ? 130 DT  I OP2   1 
ATOM   2639  O  "O5'" . DT  A 1 130 ? 86.133  77.125  -12.949 1.00 71.24  ? 130 DT  I "O5'" 1 
ATOM   2640  C  "C5'" . DT  A 1 130 ? 84.704  77.268  -12.879 1.00 71.24  ? 130 DT  I "C5'" 1 
ATOM   2641  C  "C4'" . DT  A 1 130 ? 84.315  78.633  -12.359 1.00 71.24  ? 130 DT  I "C4'" 1 
ATOM   2642  O  "O4'" . DT  A 1 130 ? 84.863  78.869  -11.043 1.00 71.24  ? 130 DT  I "O4'" 1 
ATOM   2643  C  "C3'" . DT  A 1 130 ? 84.762  79.822  -13.197 1.00 71.24  ? 130 DT  I "C3'" 1 
ATOM   2644  O  "O3'" . DT  A 1 130 ? 83.782  80.825  -13.014 1.00 71.24  ? 130 DT  I "O3'" 1 
ATOM   2645  C  "C2'" . DT  A 1 130 ? 86.013  80.287  -12.481 1.00 71.24  ? 130 DT  I "C2'" 1 
ATOM   2646  C  "C1'" . DT  A 1 130 ? 85.575  80.097  -11.046 1.00 71.24  ? 130 DT  I "C1'" 1 
ATOM   2647  N  N1    . DT  A 1 130 ? 86.652  79.985  -10.060 1.00 91.95  ? 130 DT  I N1    1 
ATOM   2648  C  C2    . DT  A 1 130 ? 86.447  80.513  -8.804  1.00 91.95  ? 130 DT  I C2    1 
ATOM   2649  O  O2    . DT  A 1 130 ? 85.438  81.120  -8.483  1.00 91.95  ? 130 DT  I O2    1 
ATOM   2650  N  N3    . DT  A 1 130 ? 87.475  80.302  -7.928  1.00 91.95  ? 130 DT  I N3    1 
ATOM   2651  C  C4    . DT  A 1 130 ? 88.666  79.649  -8.173  1.00 91.95  ? 130 DT  I C4    1 
ATOM   2652  O  O4    . DT  A 1 130 ? 89.483  79.518  -7.267  1.00 91.95  ? 130 DT  I O4    1 
ATOM   2653  C  C5    . DT  A 1 130 ? 88.827  79.156  -9.524  1.00 91.95  ? 130 DT  I C5    1 
ATOM   2654  C  C7    . DT  A 1 130 ? 90.093  78.459  -9.900  1.00 91.95  ? 130 DT  I C7    1 
ATOM   2655  C  C6    . DT  A 1 130 ? 87.826  79.347  -10.386 1.00 91.95  ? 130 DT  I C6    1 
ATOM   2656  P  P     . DG  A 1 131 ? 82.843  81.247  -14.227 1.00 52.84  ? 131 DG  I P     1 
ATOM   2657  O  OP1   . DG  A 1 131 ? 82.040  80.068  -14.636 1.00 52.84  ? 131 DG  I OP1   1 
ATOM   2658  O  OP2   . DG  A 1 131 ? 83.707  81.939  -15.216 1.00 52.84  ? 131 DG  I OP2   1 
ATOM   2659  O  "O5'" . DG  A 1 131 ? 81.870  82.321  -13.570 1.00 44.44  ? 131 DG  I "O5'" 1 
ATOM   2660  C  "C5'" . DG  A 1 131 ? 80.932  81.943  -12.560 1.00 44.44  ? 131 DG  I "C5'" 1 
ATOM   2661  C  "C4'" . DG  A 1 131 ? 80.717  83.073  -11.578 1.00 44.44  ? 131 DG  I "C4'" 1 
ATOM   2662  O  "O4'" . DG  A 1 131 ? 81.837  83.228  -10.677 1.00 44.44  ? 131 DG  I "O4'" 1 
ATOM   2663  C  "C3'" . DG  A 1 131 ? 80.442  84.460  -12.147 1.00 44.44  ? 131 DG  I "C3'" 1 
ATOM   2664  O  "O3'" . DG  A 1 131 ? 79.424  85.037  -11.319 1.00 44.44  ? 131 DG  I "O3'" 1 
ATOM   2665  C  "C2'" . DG  A 1 131 ? 81.797  85.154  -12.035 1.00 44.44  ? 131 DG  I "C2'" 1 
ATOM   2666  C  "C1'" . DG  A 1 131 ? 82.462  84.500  -10.826 1.00 44.44  ? 131 DG  I "C1'" 1 
ATOM   2667  N  N9    . DG  A 1 131 ? 83.898  84.238  -10.952 1.00 54.66  ? 131 DG  I N9    1 
ATOM   2668  C  C8    . DG  A 1 131 ? 84.568  83.842  -12.088 1.00 54.66  ? 131 DG  I C8    1 
ATOM   2669  N  N7    . DG  A 1 131 ? 85.812  83.507  -11.862 1.00 54.66  ? 131 DG  I N7    1 
ATOM   2670  C  C5    . DG  A 1 131 ? 85.990  83.731  -10.502 1.00 54.66  ? 131 DG  I C5    1 
ATOM   2671  C  C6    . DG  A 1 131 ? 87.125  83.505  -9.670  1.00 54.66  ? 131 DG  I C6    1 
ATOM   2672  O  O6    . DG  A 1 131 ? 88.218  83.015  -9.970  1.00 54.66  ? 131 DG  I O6    1 
ATOM   2673  N  N1    . DG  A 1 131 ? 86.881  83.889  -8.361  1.00 54.66  ? 131 DG  I N1    1 
ATOM   2674  C  C2    . DG  A 1 131 ? 85.698  84.395  -7.897  1.00 54.66  ? 131 DG  I C2    1 
ATOM   2675  N  N2    . DG  A 1 131 ? 85.681  84.692  -6.594  1.00 54.66  ? 131 DG  I N2    1 
ATOM   2676  N  N3    . DG  A 1 131 ? 84.622  84.588  -8.647  1.00 54.66  ? 131 DG  I N3    1 
ATOM   2677  C  C4    . DG  A 1 131 ? 84.836  84.235  -9.933  1.00 54.66  ? 131 DG  I C4    1 
ATOM   2678  P  P     . DC  A 1 132 ? 78.863  86.515  -11.601 1.00 51.60  ? 132 DC  I P     1 
ATOM   2679  O  OP1   . DC  A 1 132 ? 77.475  86.504  -11.074 1.00 51.60  ? 132 DC  I OP1   1 
ATOM   2680  O  OP2   . DC  A 1 132 ? 79.104  86.880  -13.017 1.00 51.60  ? 132 DC  I OP2   1 
ATOM   2681  O  "O5'" . DC  A 1 132 ? 79.732  87.408  -10.611 1.00 42.51  ? 132 DC  I "O5'" 1 
ATOM   2682  C  "C5'" . DC  A 1 132 ? 80.189  86.851  -9.379  1.00 42.51  ? 132 DC  I "C5'" 1 
ATOM   2683  C  "C4'" . DC  A 1 132 ? 81.082  87.825  -8.652  1.00 42.51  ? 132 DC  I "C4'" 1 
ATOM   2684  O  "O4'" . DC  A 1 132 ? 82.471  87.439  -8.795  1.00 42.51  ? 132 DC  I "O4'" 1 
ATOM   2685  C  "C3'" . DC  A 1 132 ? 80.997  89.261  -9.159  1.00 42.51  ? 132 DC  I "C3'" 1 
ATOM   2686  O  "O3'" . DC  A 1 132 ? 81.233  90.143  -8.058  1.00 42.51  ? 132 DC  I "O3'" 1 
ATOM   2687  C  "C2'" . DC  A 1 132 ? 82.176  89.344  -10.108 1.00 42.51  ? 132 DC  I "C2'" 1 
ATOM   2688  C  "C1'" . DC  A 1 132 ? 83.201  88.521  -9.349  1.00 42.51  ? 132 DC  I "C1'" 1 
ATOM   2689  N  N1    . DC  A 1 132 ? 84.289  87.964  -10.168 1.00 51.98  ? 132 DC  I N1    1 
ATOM   2690  C  C2    . DC  A 1 132 ? 85.429  87.489  -9.519  1.00 51.98  ? 132 DC  I C2    1 
ATOM   2691  O  O2    . DC  A 1 132 ? 85.501  87.594  -8.288  1.00 51.98  ? 132 DC  I O2    1 
ATOM   2692  N  N3    . DC  A 1 132 ? 86.423  86.936  -10.254 1.00 51.98  ? 132 DC  I N3    1 
ATOM   2693  C  C4    . DC  A 1 132 ? 86.313  86.872  -11.593 1.00 51.98  ? 132 DC  I C4    1 
ATOM   2694  N  N4    . DC  A 1 132 ? 87.319  86.323  -12.283 1.00 51.98  ? 132 DC  I N4    1 
ATOM   2695  C  C5    . DC  A 1 132 ? 85.167  87.370  -12.280 1.00 51.98  ? 132 DC  I C5    1 
ATOM   2696  C  C6    . DC  A 1 132 ? 84.189  87.901  -11.536 1.00 51.98  ? 132 DC  I C6    1 
ATOM   2697  P  P     . DA  A 1 133 ? 80.090  91.167  -7.580  1.00 53.13  ? 133 DA  I P     1 
ATOM   2698  O  OP1   . DA  A 1 133 ? 78.852  90.350  -7.428  1.00 53.13  ? 133 DA  I OP1   1 
ATOM   2699  O  OP2   . DA  A 1 133 ? 80.077  92.373  -8.459  1.00 53.13  ? 133 DA  I OP2   1 
ATOM   2700  O  "O5'" . DA  A 1 133 ? 80.622  91.604  -6.146  1.00 68.57  ? 133 DA  I "O5'" 1 
ATOM   2701  C  "C5'" . DA  A 1 133 ? 80.997  90.618  -5.182  1.00 68.57  ? 133 DA  I "C5'" 1 
ATOM   2702  C  "C4'" . DA  A 1 133 ? 82.263  91.026  -4.462  1.00 68.57  ? 133 DA  I "C4'" 1 
ATOM   2703  O  "O4'" . DA  A 1 133 ? 83.414  90.883  -5.327  1.00 68.57  ? 133 DA  I "O4'" 1 
ATOM   2704  C  "C3'" . DA  A 1 133 ? 82.287  92.466  -3.961  1.00 68.57  ? 133 DA  I "C3'" 1 
ATOM   2705  O  "O3'" . DA  A 1 133 ? 83.004  92.523  -2.730  1.00 68.57  ? 133 DA  I "O3'" 1 
ATOM   2706  C  "C2'" . DA  A 1 133 ? 83.024  93.204  -5.064  1.00 68.57  ? 133 DA  I "C2'" 1 
ATOM   2707  C  "C1'" . DA  A 1 133 ? 83.992  92.152  -5.604  1.00 68.57  ? 133 DA  I "C1'" 1 
ATOM   2708  N  N9    . DA  A 1 133 ? 84.208  92.210  -7.047  1.00 67.29  ? 133 DA  I N9    1 
ATOM   2709  C  C8    . DA  A 1 133 ? 83.419  92.769  -8.036  1.00 67.29  ? 133 DA  I C8    1 
ATOM   2710  N  N7    . DA  A 1 133 ? 83.876  92.570  -9.248  1.00 67.29  ? 133 DA  I N7    1 
ATOM   2711  C  C5    . DA  A 1 133 ? 85.049  91.847  -9.041  1.00 67.29  ? 133 DA  I C5    1 
ATOM   2712  C  C6    . DA  A 1 133 ? 85.994  91.312  -9.921  1.00 67.29  ? 133 DA  I C6    1 
ATOM   2713  N  N6    . DA  A 1 133 ? 85.906  91.412  -11.244 1.00 67.29  ? 133 DA  I N6    1 
ATOM   2714  N  N1    . DA  A 1 133 ? 87.047  90.654  -9.390  1.00 67.29  ? 133 DA  I N1    1 
ATOM   2715  C  C2    . DA  A 1 133 ? 87.137  90.550  -8.063  1.00 67.29  ? 133 DA  I C2    1 
ATOM   2716  N  N3    . DA  A 1 133 ? 86.313  91.004  -7.131  1.00 67.29  ? 133 DA  I N3    1 
ATOM   2717  C  C4    . DA  A 1 133 ? 85.275  91.645  -7.692  1.00 67.29  ? 133 DA  I C4    1 
ATOM   2718  P  P     . DG  A 1 134 ? 82.938  93.847  -1.832  1.00 71.31  ? 134 DG  I P     1 
ATOM   2719  O  OP1   . DG  A 1 134 ? 82.165  93.571  -0.602  1.00 71.31  ? 134 DG  I OP1   1 
ATOM   2720  O  OP2   . DG  A 1 134 ? 82.560  94.997  -2.691  1.00 71.31  ? 134 DG  I OP2   1 
ATOM   2721  O  "O5'" . DG  A 1 134 ? 84.450  94.035  -1.409  1.00 72.42  ? 134 DG  I "O5'" 1 
ATOM   2722  C  "C5'" . DG  A 1 134 ? 85.085  95.273  -1.619  1.00 72.42  ? 134 DG  I "C5'" 1 
ATOM   2723  C  "C4'" . DG  A 1 134 ? 86.452  95.064  -2.215  1.00 72.42  ? 134 DG  I "C4'" 1 
ATOM   2724  O  "O4'" . DG  A 1 134 ? 86.382  94.500  -3.553  1.00 72.42  ? 134 DG  I "O4'" 1 
ATOM   2725  C  "C3'" . DG  A 1 134 ? 87.161  96.399  -2.356  1.00 72.42  ? 134 DG  I "C3'" 1 
ATOM   2726  O  "O3'" . DG  A 1 134 ? 88.515  96.244  -1.986  1.00 72.42  ? 134 DG  I "O3'" 1 
ATOM   2727  C  "C2'" . DG  A 1 134 ? 87.031  96.726  -3.828  1.00 72.42  ? 134 DG  I "C2'" 1 
ATOM   2728  C  "C1'" . DG  A 1 134 ? 87.067  95.352  -4.463  1.00 72.42  ? 134 DG  I "C1'" 1 
ATOM   2729  N  N9    . DG  A 1 134 ? 86.387  95.310  -5.757  1.00 53.77  ? 134 DG  I N9    1 
ATOM   2730  C  C8    . DG  A 1 134 ? 85.109  95.749  -6.045  1.00 53.77  ? 134 DG  I C8    1 
ATOM   2731  N  N7    . DG  A 1 134 ? 84.783  95.610  -7.306  1.00 53.77  ? 134 DG  I N7    1 
ATOM   2732  C  C5    . DG  A 1 134 ? 85.906  95.032  -7.885  1.00 53.77  ? 134 DG  I C5    1 
ATOM   2733  C  C6    . DG  A 1 134 ? 86.138  94.638  -9.220  1.00 53.77  ? 134 DG  I C6    1 
ATOM   2734  O  O6    . DG  A 1 134 ? 85.364  94.698  -10.183 1.00 53.77  ? 134 DG  I O6    1 
ATOM   2735  N  N1    . DG  A 1 134 ? 87.422  94.121  -9.382  1.00 53.77  ? 134 DG  I N1    1 
ATOM   2736  C  C2    . DG  A 1 134 ? 88.356  93.994  -8.378  1.00 53.77  ? 134 DG  I C2    1 
ATOM   2737  N  N2    . DG  A 1 134 ? 89.541  93.503  -8.751  1.00 53.77  ? 134 DG  I N2    1 
ATOM   2738  N  N3    . DG  A 1 134 ? 88.145  94.332  -7.118  1.00 53.77  ? 134 DG  I N3    1 
ATOM   2739  C  C4    . DG  A 1 134 ? 86.909  94.845  -6.943  1.00 53.77  ? 134 DG  I C4    1 
ATOM   2740  P  P     . DG  A 1 135 ? 89.323  97.505  -1.441  1.00 121.64 ? 135 DG  I P     1 
ATOM   2741  O  OP1   . DG  A 1 135 ? 89.552  97.299  0.011   1.00 121.64 ? 135 DG  I OP1   1 
ATOM   2742  O  OP2   . DG  A 1 135 ? 88.585  98.710  -1.912  1.00 121.64 ? 135 DG  I OP2   1 
ATOM   2743  O  "O5'" . DG  A 1 135 ? 90.707  97.393  -2.217  1.00 79.97  ? 135 DG  I "O5'" 1 
ATOM   2744  C  "C5'" . DG  A 1 135 ? 90.749  96.792  -3.505  1.00 79.97  ? 135 DG  I "C5'" 1 
ATOM   2745  C  "C4'" . DG  A 1 135 ? 91.858  97.388  -4.336  1.00 79.97  ? 135 DG  I "C4'" 1 
ATOM   2746  O  "O4'" . DG  A 1 135 ? 91.615  96.934  -5.690  1.00 79.97  ? 135 DG  I "O4'" 1 
ATOM   2747  C  "C3'" . DG  A 1 135 ? 91.848  98.918  -4.392  1.00 79.97  ? 135 DG  I "C3'" 1 
ATOM   2748  O  "O3'" . DG  A 1 135 ? 93.179  99.452  -4.509  1.00 79.97  ? 135 DG  I "O3'" 1 
ATOM   2749  C  "C2'" . DG  A 1 135 ? 91.019  99.214  -5.621  1.00 79.97  ? 135 DG  I "C2'" 1 
ATOM   2750  C  "C1'" . DG  A 1 135 ? 91.314  98.034  -6.526  1.00 79.97  ? 135 DG  I "C1'" 1 
ATOM   2751  N  N9    . DG  A 1 135 ? 90.146  97.695  -7.322  1.00 55.24  ? 135 DG  I N9    1 
ATOM   2752  C  C8    . DG  A 1 135 ? 88.833  97.824  -6.952  1.00 55.24  ? 135 DG  I C8    1 
ATOM   2753  N  N7    . DG  A 1 135 ? 88.004  97.554  -7.917  1.00 55.24  ? 135 DG  I N7    1 
ATOM   2754  C  C5    . DG  A 1 135 ? 88.822  97.198  -8.974  1.00 55.24  ? 135 DG  I C5    1 
ATOM   2755  C  C6    . DG  A 1 135 ? 88.497  96.816  -10.288 1.00 55.24  ? 135 DG  I C6    1 
ATOM   2756  O  O6    . DG  A 1 135 ? 87.383  96.703  -10.808 1.00 55.24  ? 135 DG  I O6    1 
ATOM   2757  N  N1    . DG  A 1 135 ? 89.637  96.549  -11.037 1.00 55.24  ? 135 DG  I N1    1 
ATOM   2758  C  C2    . DG  A 1 135 ? 90.924  96.627  -10.572 1.00 55.24  ? 135 DG  I C2    1 
ATOM   2759  N  N2    . DG  A 1 135 ? 91.884  96.320  -11.449 1.00 55.24  ? 135 DG  I N2    1 
ATOM   2760  N  N3    . DG  A 1 135 ? 91.239  96.979  -9.342  1.00 55.24  ? 135 DG  I N3    1 
ATOM   2761  C  C4    . DG  A 1 135 ? 90.146  97.255  -8.607  1.00 55.24  ? 135 DG  I C4    1 
ATOM   2762  P  P     . DT  A 1 136 ? 93.435  100.824 -5.324  1.00 85.90  ? 136 DT  I P     1 
ATOM   2763  O  OP1   . DT  A 1 136 ? 94.750  101.374 -4.906  1.00 85.90  ? 136 DT  I OP1   1 
ATOM   2764  O  OP2   . DT  A 1 136 ? 92.223  101.683 -5.257  1.00 85.90  ? 136 DT  I OP2   1 
ATOM   2765  O  "O5'" . DT  A 1 136 ? 93.566  100.340 -6.834  1.00 99.73  ? 136 DT  I "O5'" 1 
ATOM   2766  C  "C5'" . DT  A 1 136 ? 94.698  99.590  -7.265  1.00 99.73  ? 136 DT  I "C5'" 1 
ATOM   2767  C  "C4'" . DT  A 1 136 ? 95.167  100.108 -8.602  1.00 99.73  ? 136 DT  I "C4'" 1 
ATOM   2768  O  "O4'" . DT  A 1 136 ? 94.196  99.731  -9.609  1.00 99.73  ? 136 DT  I "O4'" 1 
ATOM   2769  C  "C3'" . DT  A 1 136 ? 95.250  101.634 -8.637  1.00 99.73  ? 136 DT  I "C3'" 1 
ATOM   2770  O  "O3'" . DT  A 1 136 ? 96.374  102.093 -9.396  1.00 99.73  ? 136 DT  I "O3'" 1 
ATOM   2771  C  "C2'" . DT  A 1 136 ? 93.949  102.044 -9.294  1.00 99.73  ? 136 DT  I "C2'" 1 
ATOM   2772  C  "C1'" . DT  A 1 136 ? 93.644  100.885 -10.227 1.00 99.73  ? 136 DT  I "C1'" 1 
ATOM   2773  N  N1    . DT  A 1 136 ? 92.191  100.682 -10.355 1.00 66.59  ? 136 DT  I N1    1 
ATOM   2774  C  C2    . DT  A 1 136 ? 91.627  100.417 -11.591 1.00 66.59  ? 136 DT  I C2    1 
ATOM   2775  O  O2    . DT  A 1 136 ? 92.271  100.268 -12.616 1.00 66.59  ? 136 DT  I O2    1 
ATOM   2776  N  N3    . DT  A 1 136 ? 90.268  100.323 -11.578 1.00 66.59  ? 136 DT  I N3    1 
ATOM   2777  C  C4    . DT  A 1 136 ? 89.431  100.435 -10.485 1.00 66.59  ? 136 DT  I C4    1 
ATOM   2778  O  O4    . DT  A 1 136 ? 88.219  100.325 -10.643 1.00 66.59  ? 136 DT  I O4    1 
ATOM   2779  C  C5    . DT  A 1 136 ? 90.095  100.679 -9.218  1.00 66.59  ? 136 DT  I C5    1 
ATOM   2780  C  C7    . DT  A 1 136 ? 89.286  100.794 -7.966  1.00 66.59  ? 136 DT  I C7    1 
ATOM   2781  C  C6    . DT  A 1 136 ? 91.417  100.789 -9.223  1.00 66.59  ? 136 DT  I C6    1 
ATOM   2782  P  P     . DG  A 1 137 ? 96.339  103.559 -10.062 1.00 111.43 ? 137 DG  I P     1 
ATOM   2783  O  OP1   . DG  A 1 137 ? 97.722  103.971 -10.392 1.00 111.43 ? 137 DG  I OP1   1 
ATOM   2784  O  OP2   . DG  A 1 137 ? 95.492  104.458 -9.228  1.00 111.43 ? 137 DG  I OP2   1 
ATOM   2785  O  "O5'" . DG  A 1 137 ? 95.577  103.276 -11.425 1.00 112.14 ? 137 DG  I "O5'" 1 
ATOM   2786  C  "C5'" . DG  A 1 137 ? 96.137  102.405 -12.406 1.00 112.14 ? 137 DG  I "C5'" 1 
ATOM   2787  C  "C4'" . DG  A 1 137 ? 95.875  102.969 -13.780 1.00 112.14 ? 137 DG  I "C4'" 1 
ATOM   2788  O  "O4'" . DG  A 1 137 ? 94.462  102.837 -14.068 1.00 112.14 ? 137 DG  I "O4'" 1 
ATOM   2789  C  "C3'" . DG  A 1 137 ? 96.178  104.465 -13.824 1.00 112.14 ? 137 DG  I "C3'" 1 
ATOM   2790  O  "O3'" . DG  A 1 137 ? 96.689  104.874 -15.097 1.00 112.14 ? 137 DG  I "O3'" 1 
ATOM   2791  C  "C2'" . DG  A 1 137 ? 94.840  105.106 -13.504 1.00 112.14 ? 137 DG  I "C2'" 1 
ATOM   2792  C  "C1'" . DG  A 1 137 ? 93.827  104.112 -14.058 1.00 112.14 ? 137 DG  I "C1'" 1 
ATOM   2793  N  N9    . DG  A 1 137 ? 92.616  104.004 -13.246 1.00 71.97  ? 137 DG  I N9    1 
ATOM   2794  C  C8    . DG  A 1 137 ? 92.495  104.212 -11.884 1.00 71.97  ? 137 DG  I C8    1 
ATOM   2795  N  N7    . DG  A 1 137 ? 91.275  104.049 -11.447 1.00 71.97  ? 137 DG  I N7    1 
ATOM   2796  C  C5    . DG  A 1 137 ? 90.550  103.709 -12.583 1.00 71.97  ? 137 DG  I C5    1 
ATOM   2797  C  C6    . DG  A 1 137 ? 89.187  103.418 -12.736 1.00 71.97  ? 137 DG  I C6    1 
ATOM   2798  O  O6    . DG  A 1 137 ? 88.316  103.381 -11.865 1.00 71.97  ? 137 DG  I O6    1 
ATOM   2799  N  N1    . DG  A 1 137 ? 88.867  103.149 -14.064 1.00 71.97  ? 137 DG  I N1    1 
ATOM   2800  C  C2    . DG  A 1 137 ? 89.754  103.149 -15.109 1.00 71.97  ? 137 DG  I C2    1 
ATOM   2801  N  N2    . DG  A 1 137 ? 89.251  102.863 -16.309 1.00 71.97  ? 137 DG  I N2    1 
ATOM   2802  N  N3    . DG  A 1 137 ? 91.033  103.410 -14.982 1.00 71.97  ? 137 DG  I N3    1 
ATOM   2803  C  C4    . DG  A 1 137 ? 91.363  103.682 -13.700 1.00 71.97  ? 137 DG  I C4    1 
ATOM   2804  P  P     . DG  A 1 138 ? 96.674  106.432 -15.491 1.00 106.48 ? 138 DG  I P     1 
ATOM   2805  O  OP1   . DG  A 1 138 ? 97.622  106.655 -16.610 1.00 106.48 ? 138 DG  I OP1   1 
ATOM   2806  O  OP2   . DG  A 1 138 ? 96.781  107.256 -14.255 1.00 106.48 ? 138 DG  I OP2   1 
ATOM   2807  O  "O5'" . DG  A 1 138 ? 95.206  106.636 -16.049 1.00 108.29 ? 138 DG  I "O5'" 1 
ATOM   2808  C  "C5'" . DG  A 1 138 ? 94.733  105.843 -17.125 1.00 108.29 ? 138 DG  I "C5'" 1 
ATOM   2809  C  "C4'" . DG  A 1 138 ? 93.495  106.476 -17.698 1.00 108.29 ? 138 DG  I "C4'" 1 
ATOM   2810  O  "O4'" . DG  A 1 138 ? 92.394  106.312 -16.779 1.00 108.29 ? 138 DG  I "O4'" 1 
ATOM   2811  C  "C3'" . DG  A 1 138 ? 93.646  107.982 -17.889 1.00 108.29 ? 138 DG  I "C3'" 1 
ATOM   2812  O  "O3'" . DG  A 1 138 ? 92.822  108.340 -18.986 1.00 108.29 ? 138 DG  I "O3'" 1 
ATOM   2813  C  "C2'" . DG  A 1 138 ? 93.066  108.543 -16.604 1.00 108.29 ? 138 DG  I "C2'" 1 
ATOM   2814  C  "C1'" . DG  A 1 138 ? 91.909  107.592 -16.421 1.00 108.29 ? 138 DG  I "C1'" 1 
ATOM   2815  N  N9    . DG  A 1 138 ? 91.300  107.490 -15.104 1.00 47.71  ? 138 DG  I N9    1 
ATOM   2816  C  C8    . DG  A 1 138 ? 91.811  107.822 -13.868 1.00 47.71  ? 138 DG  I C8    1 
ATOM   2817  N  N7    . DG  A 1 138 ? 90.960  107.616 -12.896 1.00 47.71  ? 138 DG  I N7    1 
ATOM   2818  C  C5    . DG  A 1 138 ? 89.834  107.112 -13.537 1.00 47.71  ? 138 DG  I C5    1 
ATOM   2819  C  C6    . DG  A 1 138 ? 88.587  106.706 -13.024 1.00 47.71  ? 138 DG  I C6    1 
ATOM   2820  O  O6    . DG  A 1 138 ? 88.205  106.668 -11.838 1.00 47.71  ? 138 DG  I O6    1 
ATOM   2821  N  N1    . DG  A 1 138 ? 87.730  106.297 -14.044 1.00 47.71  ? 138 DG  I N1    1 
ATOM   2822  C  C2    . DG  A 1 138 ? 88.047  106.253 -15.377 1.00 47.71  ? 138 DG  I C2    1 
ATOM   2823  N  N2    . DG  A 1 138 ? 87.093  105.829 -16.215 1.00 47.71  ? 138 DG  I N2    1 
ATOM   2824  N  N3    . DG  A 1 138 ? 89.206  106.602 -15.857 1.00 47.71  ? 138 DG  I N3    1 
ATOM   2825  C  C4    . DG  A 1 138 ? 90.041  107.028 -14.894 1.00 47.71  ? 138 DG  I C4    1 
ATOM   2826  P  P     . DA  A 1 139 ? 93.040  109.736 -19.730 1.00 87.47  ? 139 DA  I P     1 
ATOM   2827  O  OP1   . DA  A 1 139 ? 94.239  109.625 -20.595 1.00 87.47  ? 139 DA  I OP1   1 
ATOM   2828  O  OP2   . DA  A 1 139 ? 92.946  110.826 -18.723 1.00 87.47  ? 139 DA  I OP2   1 
ATOM   2829  O  "O5'" . DA  A 1 139 ? 91.752  109.811 -20.651 1.00 58.85  ? 139 DA  I "O5'" 1 
ATOM   2830  C  "C5'" . DA  A 1 139 ? 91.129  108.618 -21.105 1.00 58.85  ? 139 DA  I "C5'" 1 
ATOM   2831  C  "C4'" . DA  A 1 139 ? 89.644  108.684 -20.846 1.00 58.85  ? 139 DA  I "C4'" 1 
ATOM   2832  O  "O4'" . DA  A 1 139 ? 89.343  108.430 -19.450 1.00 58.85  ? 139 DA  I "O4'" 1 
ATOM   2833  C  "C3'" . DA  A 1 139 ? 89.012  110.035 -21.184 1.00 58.85  ? 139 DA  I "C3'" 1 
ATOM   2834  O  "O3'" . DA  A 1 139 ? 87.791  109.821 -21.896 1.00 58.85  ? 139 DA  I "O3'" 1 
ATOM   2835  C  "C2'" . DA  A 1 139 ? 88.741  110.648 -19.819 1.00 58.85  ? 139 DA  I "C2'" 1 
ATOM   2836  C  "C1'" . DA  A 1 139 ? 88.441  109.418 -18.983 1.00 58.85  ? 139 DA  I "C1'" 1 
ATOM   2837  N  N9    . DA  A 1 139 ? 88.651  109.588 -17.546 1.00 41.52  ? 139 DA  I N9    1 
ATOM   2838  C  C8    . DA  A 1 139 ? 89.836  109.847 -16.900 1.00 41.52  ? 139 DA  I C8    1 
ATOM   2839  N  N7    . DA  A 1 139 ? 89.714  109.977 -15.599 1.00 41.52  ? 139 DA  I N7    1 
ATOM   2840  C  C5    . DA  A 1 139 ? 88.359  109.779 -15.369 1.00 41.52  ? 139 DA  I C5    1 
ATOM   2841  C  C6    . DA  A 1 139 ? 87.595  109.776 -14.191 1.00 41.52  ? 139 DA  I C6    1 
ATOM   2842  N  N6    . DA  A 1 139 ? 88.117  109.966 -12.977 1.00 41.52  ? 139 DA  I N6    1 
ATOM   2843  N  N1    . DA  A 1 139 ? 86.265  109.560 -14.304 1.00 41.52  ? 139 DA  I N1    1 
ATOM   2844  C  C2    . DA  A 1 139 ? 85.753  109.339 -15.526 1.00 41.52  ? 139 DA  I C2    1 
ATOM   2845  N  N3    . DA  A 1 139 ? 86.371  109.297 -16.706 1.00 41.52  ? 139 DA  I N3    1 
ATOM   2846  C  C4    . DA  A 1 139 ? 87.689  109.533 -16.558 1.00 41.52  ? 139 DA  I C4    1 
ATOM   2847  P  P     . DT  A 1 140 ? 87.167  111.004 -22.789 1.00 84.09  ? 140 DT  I P     1 
ATOM   2848  O  OP1   . DT  A 1 140 ? 86.761  110.435 -24.104 1.00 84.09  ? 140 DT  I OP1   1 
ATOM   2849  O  OP2   . DT  A 1 140 ? 88.085  112.178 -22.736 1.00 84.09  ? 140 DT  I OP2   1 
ATOM   2850  O  "O5'" . DT  A 1 140 ? 85.841  111.398 -22.001 1.00 83.73  ? 140 DT  I "O5'" 1 
ATOM   2851  C  "C5'" . DT  A 1 140 ? 84.924  110.398 -21.555 1.00 83.73  ? 140 DT  I "C5'" 1 
ATOM   2852  C  "C4'" . DT  A 1 140 ? 83.999  110.977 -20.511 1.00 83.73  ? 140 DT  I "C4'" 1 
ATOM   2853  O  "O4'" . DT  A 1 140 ? 84.605  111.019 -19.192 1.00 83.73  ? 140 DT  I "O4'" 1 
ATOM   2854  C  "C3'" . DT  A 1 140 ? 83.533  112.405 -20.804 1.00 83.73  ? 140 DT  I "C3'" 1 
ATOM   2855  O  "O3'" . DT  A 1 140 ? 82.175  112.497 -20.407 1.00 83.73  ? 140 DT  I "O3'" 1 
ATOM   2856  C  "C2'" . DT  A 1 140 ? 84.351  113.233 -19.827 1.00 83.73  ? 140 DT  I "C2'" 1 
ATOM   2857  C  "C1'" . DT  A 1 140 ? 84.355  112.301 -18.635 1.00 83.73  ? 140 DT  I "C1'" 1 
ATOM   2858  N  N1    . DT  A 1 140 ? 85.341  112.567 -17.558 1.00 60.47  ? 140 DT  I N1    1 
ATOM   2859  C  C2    . DT  A 1 140 ? 84.890  112.528 -16.242 1.00 60.47  ? 140 DT  I C2    1 
ATOM   2860  O  O2    . DT  A 1 140 ? 83.740  112.253 -15.926 1.00 60.47  ? 140 DT  I O2    1 
ATOM   2861  N  N3    . DT  A 1 140 ? 85.845  112.818 -15.298 1.00 60.47  ? 140 DT  I N3    1 
ATOM   2862  C  C4    . DT  A 1 140 ? 87.177  113.123 -15.517 1.00 60.47  ? 140 DT  I C4    1 
ATOM   2863  O  O4    . DT  A 1 140 ? 87.914  113.370 -14.563 1.00 60.47  ? 140 DT  I O4    1 
ATOM   2864  C  C5    . DT  A 1 140 ? 87.587  113.121 -16.909 1.00 60.47  ? 140 DT  I C5    1 
ATOM   2865  C  C7    . DT  A 1 140 ? 89.016  113.413 -17.239 1.00 60.47  ? 140 DT  I C7    1 
ATOM   2866  C  C6    . DT  A 1 140 ? 86.660  112.852 -17.847 1.00 60.47  ? 140 DT  I C6    1 
ATOM   2867  P  P     . DA  A 1 141 ? 81.047  112.942 -21.452 1.00 98.02  ? 141 DA  I P     1 
ATOM   2868  O  OP1   . DA  A 1 141 ? 80.978  111.958 -22.565 1.00 98.02  ? 141 DA  I OP1   1 
ATOM   2869  O  OP2   . DA  A 1 141 ? 81.254  114.385 -21.757 1.00 98.02  ? 141 DA  I OP2   1 
ATOM   2870  O  "O5'" . DA  A 1 141 ? 79.741  112.792 -20.552 1.00 77.28  ? 141 DA  I "O5'" 1 
ATOM   2871  C  "C5'" . DA  A 1 141 ? 79.650  111.742 -19.572 1.00 77.28  ? 141 DA  I "C5'" 1 
ATOM   2872  C  "C4'" . DA  A 1 141 ? 79.236  112.283 -18.218 1.00 77.28  ? 141 DA  I "C4'" 1 
ATOM   2873  O  "O4'" . DA  A 1 141 ? 80.339  112.651 -17.360 1.00 77.28  ? 141 DA  I "O4'" 1 
ATOM   2874  C  "C3'" . DA  A 1 141 ? 78.306  113.488 -18.224 1.00 77.28  ? 141 DA  I "C3'" 1 
ATOM   2875  O  "O3'" . DA  A 1 141 ? 77.341  113.312 -17.210 1.00 77.28  ? 141 DA  I "O3'" 1 
ATOM   2876  C  "C2'" . DA  A 1 141 ? 79.206  114.629 -17.805 1.00 77.28  ? 141 DA  I "C2'" 1 
ATOM   2877  C  "C1'" . DA  A 1 141 ? 80.067  113.923 -16.793 1.00 77.28  ? 141 DA  I "C1'" 1 
ATOM   2878  N  N9    . DA  A 1 141 ? 81.340  114.572 -16.522 1.00 41.39  ? 141 DA  I N9    1 
ATOM   2879  C  C8    . DA  A 1 141 ? 82.301  115.006 -17.401 1.00 41.39  ? 141 DA  I C8    1 
ATOM   2880  N  N7    . DA  A 1 141 ? 83.372  115.487 -16.816 1.00 41.39  ? 141 DA  I N7    1 
ATOM   2881  C  C5    . DA  A 1 141 ? 83.086  115.373 -15.461 1.00 41.39  ? 141 DA  I C5    1 
ATOM   2882  C  C6    . DA  A 1 141 ? 83.819  115.697 -14.307 1.00 41.39  ? 141 DA  I C6    1 
ATOM   2883  N  N6    . DA  A 1 141 ? 85.057  116.199 -14.326 1.00 41.39  ? 141 DA  I N6    1 
ATOM   2884  N  N1    . DA  A 1 141 ? 83.228  115.476 -13.114 1.00 41.39  ? 141 DA  I N1    1 
ATOM   2885  C  C2    . DA  A 1 141 ? 81.993  114.958 -13.089 1.00 41.39  ? 141 DA  I C2    1 
ATOM   2886  N  N3    . DA  A 1 141 ? 81.212  114.601 -14.102 1.00 41.39  ? 141 DA  I N3    1 
ATOM   2887  C  C4    . DA  A 1 141 ? 81.827  114.836 -15.271 1.00 41.39  ? 141 DA  I C4    1 
ATOM   2888  P  P     . DT  A 1 142 ? 75.820  113.641 -17.529 1.00 89.61  ? 142 DT  I P     1 
ATOM   2889  O  OP1   . DT  A 1 142 ? 75.130  112.405 -17.987 1.00 89.61  ? 142 DT  I OP1   1 
ATOM   2890  O  OP2   . DT  A 1 142 ? 75.806  114.866 -18.379 1.00 89.61  ? 142 DT  I OP2   1 
ATOM   2891  O  "O5'" . DT  A 1 142 ? 75.267  114.038 -16.113 1.00 62.85  ? 142 DT  I "O5'" 1 
ATOM   2892  C  "C5'" . DT  A 1 142 ? 75.496  115.328 -15.638 1.00 62.85  ? 142 DT  I "C5'" 1 
ATOM   2893  C  "C4'" . DT  A 1 142 ? 75.937  115.261 -14.205 1.00 62.85  ? 142 DT  I "C4'" 1 
ATOM   2894  O  "O4'" . DT  A 1 142 ? 77.377  115.412 -14.135 1.00 62.85  ? 142 DT  I "O4'" 1 
ATOM   2895  C  "C3'" . DT  A 1 142 ? 75.342  116.419 -13.418 1.00 62.85  ? 142 DT  I "C3'" 1 
ATOM   2896  O  "O3'" . DT  A 1 142 ? 74.886  115.950 -12.161 1.00 62.85  ? 142 DT  I "O3'" 1 
ATOM   2897  C  "C2'" . DT  A 1 142 ? 76.478  117.421 -13.307 1.00 62.85  ? 142 DT  I "C2'" 1 
ATOM   2898  C  "C1'" . DT  A 1 142 ? 77.709  116.541 -13.334 1.00 62.85  ? 142 DT  I "C1'" 1 
ATOM   2899  N  N1    . DT  A 1 142 ? 78.884  117.203 -13.925 1.00 53.31  ? 142 DT  I N1    1 
ATOM   2900  C  C2    . DT  A 1 142 ? 79.854  117.660 -13.058 1.00 53.31  ? 142 DT  I C2    1 
ATOM   2901  O  O2    . DT  A 1 142 ? 79.775  117.543 -11.840 1.00 53.31  ? 142 DT  I O2    1 
ATOM   2902  N  N3    . DT  A 1 142 ? 80.926  118.264 -13.668 1.00 53.31  ? 142 DT  I N3    1 
ATOM   2903  C  C4    . DT  A 1 142 ? 81.119  118.453 -15.019 1.00 53.31  ? 142 DT  I C4    1 
ATOM   2904  O  O4    . DT  A 1 142 ? 82.135  119.015 -15.408 1.00 53.31  ? 142 DT  I O4    1 
ATOM   2905  C  C5    . DT  A 1 142 ? 80.063  117.950 -15.871 1.00 53.31  ? 142 DT  I C5    1 
ATOM   2906  C  C7    . DT  A 1 142 ? 80.193  118.103 -17.351 1.00 53.31  ? 142 DT  I C7    1 
ATOM   2907  C  C6    . DT  A 1 142 ? 79.011  117.361 -15.290 1.00 53.31  ? 142 DT  I C6    1 
ATOM   2908  P  P     . DT  A 1 143 ? 73.749  116.764 -11.398 1.00 50.87  ? 143 DT  I P     1 
ATOM   2909  O  OP1   . DT  A 1 143 ? 73.107  115.840 -10.426 1.00 50.87  ? 143 DT  I OP1   1 
ATOM   2910  O  OP2   . DT  A 1 143 ? 72.931  117.423 -12.455 1.00 50.87  ? 143 DT  I OP2   1 
ATOM   2911  O  "O5'" . DT  A 1 143 ? 74.586  117.854 -10.595 1.00 52.75  ? 143 DT  I "O5'" 1 
ATOM   2912  C  "C5'" . DT  A 1 143 ? 75.529  117.439 -9.614  1.00 52.75  ? 143 DT  I "C5'" 1 
ATOM   2913  C  "C4'" . DT  A 1 143 ? 76.327  118.613 -9.100  1.00 52.75  ? 143 DT  I "C4'" 1 
ATOM   2914  O  "O4'" . DT  A 1 143 ? 77.414  118.975 -9.988  1.00 52.75  ? 143 DT  I "O4'" 1 
ATOM   2915  C  "C3'" . DT  A 1 143 ? 75.532  119.892 -8.844  1.00 52.75  ? 143 DT  I "C3'" 1 
ATOM   2916  O  "O3'" . DT  A 1 143 ? 75.847  120.366 -7.532  1.00 52.75  ? 143 DT  I "O3'" 1 
ATOM   2917  C  "C2'" . DT  A 1 143 ? 76.039  120.846 -9.915  1.00 52.75  ? 143 DT  I "C2'" 1 
ATOM   2918  C  "C1'" . DT  A 1 143 ? 77.474  120.385 -10.086 1.00 52.75  ? 143 DT  I "C1'" 1 
ATOM   2919  N  N1    . DT  A 1 143 ? 78.118  120.732 -11.365 1.00 39.29  ? 143 DT  I N1    1 
ATOM   2920  C  C2    . DT  A 1 143 ? 79.389  121.262 -11.319 1.00 39.29  ? 143 DT  I C2    1 
ATOM   2921  O  O2    . DT  A 1 143 ? 80.001  121.462 -10.273 1.00 39.29  ? 143 DT  I O2    1 
ATOM   2922  N  N3    . DT  A 1 143 ? 79.926  121.551 -12.550 1.00 39.29  ? 143 DT  I N3    1 
ATOM   2923  C  C4    . DT  A 1 143 ? 79.333  121.373 -13.788 1.00 39.29  ? 143 DT  I C4    1 
ATOM   2924  O  O4    . DT  A 1 143 ? 79.949  121.679 -14.813 1.00 39.29  ? 143 DT  I O4    1 
ATOM   2925  C  C5    . DT  A 1 143 ? 78.004  120.819 -13.758 1.00 39.29  ? 143 DT  I C5    1 
ATOM   2926  C  C7    . DT  A 1 143 ? 77.288  120.593 -15.051 1.00 39.29  ? 143 DT  I C7    1 
ATOM   2927  C  C6    . DT  A 1 143 ? 77.469  120.529 -12.564 1.00 39.29  ? 143 DT  I C6    1 
ATOM   2928  P  P     . DG  A 1 144 ? 74.960  121.526 -6.861  1.00 47.55  ? 144 DG  I P     1 
ATOM   2929  O  OP1   . DG  A 1 144 ? 74.698  121.199 -5.437  1.00 47.55  ? 144 DG  I OP1   1 
ATOM   2930  O  OP2   . DG  A 1 144 ? 73.825  121.821 -7.773  1.00 47.55  ? 144 DG  I OP2   1 
ATOM   2931  O  "O5'" . DG  A 1 144 ? 75.965  122.750 -6.856  1.00 82.56  ? 144 DG  I "O5'" 1 
ATOM   2932  C  "C5'" . DG  A 1 144 ? 77.159  122.687 -6.089  1.00 82.56  ? 144 DG  I "C5'" 1 
ATOM   2933  C  "C4'" . DG  A 1 144 ? 77.953  123.949 -6.296  1.00 82.56  ? 144 DG  I "C4'" 1 
ATOM   2934  O  "O4'" . DG  A 1 144 ? 78.575  123.924 -7.601  1.00 82.56  ? 144 DG  I "O4'" 1 
ATOM   2935  C  "C3'" . DG  A 1 144 ? 77.083  125.205 -6.261  1.00 82.56  ? 144 DG  I "C3'" 1 
ATOM   2936  O  "O3'" . DG  A 1 144 ? 77.749  126.200 -5.487  1.00 82.56  ? 144 DG  I "O3'" 1 
ATOM   2937  C  "C2'" . DG  A 1 144 ? 76.931  125.579 -7.726  1.00 82.56  ? 144 DG  I "C2'" 1 
ATOM   2938  C  "C1'" . DG  A 1 144 ? 78.242  125.101 -8.304  1.00 82.56  ? 144 DG  I "C1'" 1 
ATOM   2939  N  N9    . DG  A 1 144 ? 78.214  124.789 -9.725  1.00 43.55  ? 144 DG  I N9    1 
ATOM   2940  C  C8    . DG  A 1 144 ? 77.147  124.358 -10.478 1.00 43.55  ? 144 DG  I C8    1 
ATOM   2941  N  N7    . DG  A 1 144 ? 77.434  124.234 -11.751 1.00 43.55  ? 144 DG  I N7    1 
ATOM   2942  C  C5    . DG  A 1 144 ? 78.778  124.588 -11.836 1.00 43.55  ? 144 DG  I C5    1 
ATOM   2943  C  C6    . DG  A 1 144 ? 79.649  124.676 -12.970 1.00 43.55  ? 144 DG  I C6    1 
ATOM   2944  O  O6    . DG  A 1 144 ? 79.394  124.441 -14.164 1.00 43.55  ? 144 DG  I O6    1 
ATOM   2945  N  N1    . DG  A 1 144 ? 80.930  125.093 -12.599 1.00 43.55  ? 144 DG  I N1    1 
ATOM   2946  C  C2    . DG  A 1 144 ? 81.329  125.378 -11.304 1.00 43.55  ? 144 DG  I C2    1 
ATOM   2947  N  N2    . DG  A 1 144 ? 82.614  125.737 -11.143 1.00 43.55  ? 144 DG  I N2    1 
ATOM   2948  N  N3    . DG  A 1 144 ? 80.529  125.311 -10.250 1.00 43.55  ? 144 DG  I N3    1 
ATOM   2949  C  C4    . DG  A 1 144 ? 79.277  124.915 -10.588 1.00 43.55  ? 144 DG  I C4    1 
ATOM   2950  P  P     . DA  A 1 145 ? 77.299  127.736 -5.581  1.00 80.34  ? 145 DA  I P     1 
ATOM   2951  O  OP1   . DA  A 1 145 ? 77.036  128.227 -4.199  1.00 80.34  ? 145 DA  I OP1   1 
ATOM   2952  O  OP2   . DA  A 1 145 ? 76.242  127.875 -6.628  1.00 80.34  ? 145 DA  I OP2   1 
ATOM   2953  O  "O5'" . DA  A 1 145 ? 78.641  128.412 -6.099  1.00 66.94  ? 145 DA  I "O5'" 1 
ATOM   2954  C  "C5'" . DA  A 1 145 ? 79.915  128.027 -5.575  1.00 66.94  ? 145 DA  I "C5'" 1 
ATOM   2955  C  "C4'" . DA  A 1 145 ? 80.984  128.823 -6.279  1.00 66.94  ? 145 DA  I "C4'" 1 
ATOM   2956  O  "O4'" . DA  A 1 145 ? 81.139  128.254 -7.599  1.00 66.94  ? 145 DA  I "O4'" 1 
ATOM   2957  C  "C3'" . DA  A 1 145 ? 80.486  130.256 -6.486  1.00 66.94  ? 145 DA  I "C3'" 1 
ATOM   2958  O  "O3'" . DA  A 1 145 ? 81.434  131.297 -6.294  1.00 66.94  ? 145 DA  I "O3'" 1 
ATOM   2959  C  "C2'" . DA  A 1 145 ? 80.033  130.295 -7.922  1.00 66.94  ? 145 DA  I "C2'" 1 
ATOM   2960  C  "C1'" . DA  A 1 145 ? 80.873  129.235 -8.580  1.00 66.94  ? 145 DA  I "C1'" 1 
ATOM   2961  N  N9    . DA  A 1 145 ? 80.030  128.648 -9.597  1.00 35.04  ? 145 DA  I N9    1 
ATOM   2962  C  C8    . DA  A 1 145 ? 78.795  128.088 -9.435  1.00 35.04  ? 145 DA  I C8    1 
ATOM   2963  N  N7    . DA  A 1 145 ? 78.194  127.806 -10.566 1.00 35.04  ? 145 DA  I N7    1 
ATOM   2964  C  C5    . DA  A 1 145 ? 79.116  128.174 -11.528 1.00 35.04  ? 145 DA  I C5    1 
ATOM   2965  C  C6    . DA  A 1 145 ? 79.076  128.151 -12.915 1.00 35.04  ? 145 DA  I C6    1 
ATOM   2966  N  N6    . DA  A 1 145 ? 78.000  127.778 -13.615 1.00 35.04  ? 145 DA  I N6    1 
ATOM   2967  N  N1    . DA  A 1 145 ? 80.185  128.555 -13.582 1.00 35.04  ? 145 DA  I N1    1 
ATOM   2968  C  C2    . DA  A 1 145 ? 81.238  128.990 -12.874 1.00 35.04  ? 145 DA  I C2    1 
ATOM   2969  N  N3    . DA  A 1 145 ? 81.379  129.087 -11.563 1.00 35.04  ? 145 DA  I N3    1 
ATOM   2970  C  C4    . DA  A 1 145 ? 80.270  128.652 -10.942 1.00 35.04  ? 145 DA  I C4    1 
ATOM   2971  P  P     . DT  A 1 146 ? 80.908  132.819 -6.318  1.00 79.53  ? 146 DT  I P     1 
ATOM   2972  O  OP1   . DT  A 1 146 ? 80.973  133.380 -4.940  1.00 79.53  ? 146 DT  I OP1   1 
ATOM   2973  O  OP2   . DT  A 1 146 ? 79.613  132.831 -7.059  1.00 79.53  ? 146 DT  I OP2   1 
ATOM   2974  O  "O5'" . DT  A 1 146 ? 81.967  133.557 -7.237  1.00 74.83  ? 146 DT  I "O5'" 1 
ATOM   2975  C  "C5'" . DT  A 1 146 ? 83.074  132.860 -7.785  1.00 74.83  ? 146 DT  I "C5'" 1 
ATOM   2976  C  "C4'" . DT  A 1 146 ? 83.354  133.389 -9.168  1.00 74.83  ? 146 DT  I "C4'" 1 
ATOM   2977  O  "O4'" . DT  A 1 146 ? 82.627  132.623 -10.160 1.00 74.83  ? 146 DT  I "O4'" 1 
ATOM   2978  C  "C3'" . DT  A 1 146 ? 82.906  134.845 -9.336  1.00 74.83  ? 146 DT  I "C3'" 1 
ATOM   2979  O  "O3'" . DT  A 1 146 ? 83.686  135.572 -10.277 1.00 74.83  ? 146 DT  I "O3'" 1 
ATOM   2980  C  "C2'" . DT  A 1 146 ? 81.571  134.698 -10.036 1.00 74.83  ? 146 DT  I "C2'" 1 
ATOM   2981  C  "C1'" . DT  A 1 146 ? 81.855  133.512 -10.943 1.00 74.83  ? 146 DT  I "C1'" 1 
ATOM   2982  N  N1    . DT  A 1 146 ? 80.646  132.808 -11.374 1.00 54.79  ? 146 DT  I N1    1 
ATOM   2983  C  C2    . DT  A 1 146 ? 80.514  132.436 -12.701 1.00 54.79  ? 146 DT  I C2    1 
ATOM   2984  O  O2    . DT  A 1 146 ? 81.383  132.604 -13.545 1.00 54.79  ? 146 DT  I O2    1 
ATOM   2985  N  N3    . DT  A 1 146 ? 79.317  131.852 -13.004 1.00 54.79  ? 146 DT  I N3    1 
ATOM   2986  C  C4    . DT  A 1 146 ? 78.270  131.586 -12.142 1.00 54.79  ? 146 DT  I C4    1 
ATOM   2987  O  O4    . DT  A 1 146 ? 77.247  131.053 -12.576 1.00 54.79  ? 146 DT  I O4    1 
ATOM   2988  C  C5    . DT  A 1 146 ? 78.492  131.980 -10.758 1.00 54.79  ? 146 DT  I C5    1 
ATOM   2989  C  C7    . DT  A 1 146 ? 77.426  131.738 -9.738  1.00 54.79  ? 146 DT  I C7    1 
ATOM   2990  C  C6    . DT  A 1 146 ? 79.654  132.556 -10.453 1.00 54.79  ? 146 DT  I C6    1 
ATOM   2991  O  "O5'" . DA  B 1 1   ? 76.848  129.368 -22.671 1.00 202.00 ? 147 DA  J "O5'" 1 
ATOM   2992  C  "C5'" . DA  B 1 1   ? 77.522  130.162 -23.648 1.00 202.00 ? 147 DA  J "C5'" 1 
ATOM   2993  C  "C4'" . DA  B 1 1   ? 78.764  130.836 -23.109 1.00 202.00 ? 147 DA  J "C4'" 1 
ATOM   2994  O  "O4'" . DA  B 1 1   ? 78.414  131.513 -21.877 1.00 202.00 ? 147 DA  J "O4'" 1 
ATOM   2995  C  "C3'" . DA  B 1 1   ? 79.913  129.883 -22.767 1.00 202.00 ? 147 DA  J "C3'" 1 
ATOM   2996  O  "O3'" . DA  B 1 1   ? 81.187  130.417 -23.150 1.00 202.00 ? 147 DA  J "O3'" 1 
ATOM   2997  C  "C2'" . DA  B 1 1   ? 79.844  129.760 -21.259 1.00 202.00 ? 147 DA  J "C2'" 1 
ATOM   2998  C  "C1'" . DA  B 1 1   ? 79.251  131.085 -20.815 1.00 202.00 ? 147 DA  J "C1'" 1 
ATOM   2999  N  N9    . DA  B 1 1   ? 78.423  130.903 -19.624 1.00 42.19  ? 147 DA  J N9    1 
ATOM   3000  C  C8    . DA  B 1 1   ? 77.192  130.281 -19.553 1.00 42.19  ? 147 DA  J C8    1 
ATOM   3001  N  N7    . DA  B 1 1   ? 76.737  130.142 -18.323 1.00 42.19  ? 147 DA  J N7    1 
ATOM   3002  C  C5    . DA  B 1 1   ? 77.720  130.730 -17.533 1.00 42.19  ? 147 DA  J C5    1 
ATOM   3003  C  C6    . DA  B 1 1   ? 77.848  130.885 -16.129 1.00 42.19  ? 147 DA  J C6    1 
ATOM   3004  N  N6    . DA  B 1 1   ? 76.962  130.413 -15.239 1.00 42.19  ? 147 DA  J N6    1 
ATOM   3005  N  N1    . DA  B 1 1   ? 78.937  131.539 -15.669 1.00 42.19  ? 147 DA  J N1    1 
ATOM   3006  C  C2    . DA  B 1 1   ? 79.835  131.999 -16.558 1.00 42.19  ? 147 DA  J C2    1 
ATOM   3007  N  N3    . DA  B 1 1   ? 79.835  131.902 -17.897 1.00 42.19  ? 147 DA  J N3    1 
ATOM   3008  C  C4    . DA  B 1 1   ? 78.743  131.244 -18.325 1.00 42.19  ? 147 DA  J C4    1 
ATOM   3009  P  P     . DT  B 1 2   ? 82.495  129.470 -23.114 1.00 128.18 ? 148 DT  J P     1 
ATOM   3010  O  OP1   . DT  B 1 2   ? 83.399  129.898 -24.212 1.00 128.18 ? 148 DT  J OP1   1 
ATOM   3011  O  OP2   . DT  B 1 2   ? 82.045  128.054 -23.052 1.00 128.18 ? 148 DT  J OP2   1 
ATOM   3012  O  "O5'" . DT  B 1 2   ? 83.193  129.827 -21.726 1.00 106.82 ? 148 DT  J "O5'" 1 
ATOM   3013  C  "C5'" . DT  B 1 2   ? 83.880  131.065 -21.547 1.00 106.82 ? 148 DT  J "C5'" 1 
ATOM   3014  C  "C4'" . DT  B 1 2   ? 84.714  131.023 -20.287 1.00 106.82 ? 148 DT  J "C4'" 1 
ATOM   3015  O  "O4'" . DT  B 1 2   ? 83.843  130.994 -19.131 1.00 106.82 ? 148 DT  J "O4'" 1 
ATOM   3016  C  "C3'" . DT  B 1 2   ? 85.606  129.786 -20.168 1.00 106.82 ? 148 DT  J "C3'" 1 
ATOM   3017  O  "O3'" . DT  B 1 2   ? 86.813  130.112 -19.470 1.00 106.82 ? 148 DT  J "O3'" 1 
ATOM   3018  C  "C2'" . DT  B 1 2   ? 84.775  128.851 -19.316 1.00 106.82 ? 148 DT  J "C2'" 1 
ATOM   3019  C  "C1'" . DT  B 1 2   ? 84.115  129.829 -18.362 1.00 106.82 ? 148 DT  J "C1'" 1 
ATOM   3020  N  N1    . DT  B 1 2   ? 82.844  129.339 -17.800 1.00 74.82  ? 148 DT  J N1    1 
ATOM   3021  C  C2    . DT  B 1 2   ? 82.644  129.447 -16.437 1.00 74.82  ? 148 DT  J C2    1 
ATOM   3022  O  O2    . DT  B 1 2   ? 83.472  129.937 -15.669 1.00 74.82  ? 148 DT  J O2    1 
ATOM   3023  N  N3    . DT  B 1 2   ? 81.431  128.953 -16.004 1.00 74.82  ? 148 DT  J N3    1 
ATOM   3024  C  C4    . DT  B 1 2   ? 80.432  128.378 -16.775 1.00 74.82  ? 148 DT  J C4    1 
ATOM   3025  O  O4    . DT  B 1 2   ? 79.396  127.983 -16.244 1.00 74.82  ? 148 DT  J O4    1 
ATOM   3026  C  C5    . DT  B 1 2   ? 80.712  128.296 -18.184 1.00 74.82  ? 148 DT  J C5    1 
ATOM   3027  C  C7    . DT  B 1 2   ? 79.691  127.679 -19.086 1.00 74.82  ? 148 DT  J C7    1 
ATOM   3028  C  C6    . DT  B 1 2   ? 81.884  128.777 -18.623 1.00 74.82  ? 148 DT  J C6    1 
ATOM   3029  P  P     . DC  B 1 3   ? 87.956  128.993 -19.286 1.00 124.16 ? 149 DC  J P     1 
ATOM   3030  O  OP1   . DC  B 1 3   ? 89.001  129.524 -18.366 1.00 124.16 ? 149 DC  J OP1   1 
ATOM   3031  O  OP2   . DC  B 1 3   ? 88.336  128.524 -20.646 1.00 124.16 ? 149 DC  J OP2   1 
ATOM   3032  O  "O5'" . DC  B 1 3   ? 87.219  127.792 -18.544 1.00 112.14 ? 149 DC  J "O5'" 1 
ATOM   3033  C  "C5'" . DC  B 1 3   ? 87.955  126.665 -18.078 1.00 112.14 ? 149 DC  J "C5'" 1 
ATOM   3034  C  "C4'" . DC  B 1 3   ? 88.475  126.937 -16.687 1.00 112.14 ? 149 DC  J "C4'" 1 
ATOM   3035  O  "O4'" . DC  B 1 3   ? 87.390  127.474 -15.893 1.00 112.14 ? 149 DC  J "O4'" 1 
ATOM   3036  C  "C3'" . DC  B 1 3   ? 88.982  125.707 -15.943 1.00 112.14 ? 149 DC  J "C3'" 1 
ATOM   3037  O  "O3'" . DC  B 1 3   ? 90.151  126.024 -15.185 1.00 112.14 ? 149 DC  J "O3'" 1 
ATOM   3038  C  "C2'" . DC  B 1 3   ? 87.804  125.275 -15.093 1.00 112.14 ? 149 DC  J "C2'" 1 
ATOM   3039  C  "C1'" . DC  B 1 3   ? 86.921  126.517 -14.949 1.00 112.14 ? 149 DC  J "C1'" 1 
ATOM   3040  N  N1    . DC  B 1 3   ? 85.514  126.201 -15.286 1.00 67.30  ? 149 DC  J N1    1 
ATOM   3041  C  C2    . DC  B 1 3   ? 84.517  126.304 -14.298 1.00 67.30  ? 149 DC  J C2    1 
ATOM   3042  O  O2    . DC  B 1 3   ? 84.821  126.731 -13.174 1.00 67.30  ? 149 DC  J O2    1 
ATOM   3043  N  N3    . DC  B 1 3   ? 83.249  125.933 -14.604 1.00 67.30  ? 149 DC  J N3    1 
ATOM   3044  C  C4    . DC  B 1 3   ? 82.960  125.487 -15.837 1.00 67.30  ? 149 DC  J C4    1 
ATOM   3045  N  N4    . DC  B 1 3   ? 81.702  125.097 -16.100 1.00 67.30  ? 149 DC  J N4    1 
ATOM   3046  C  C5    . DC  B 1 3   ? 83.946  125.410 -16.862 1.00 67.30  ? 149 DC  J C5    1 
ATOM   3047  C  C6    . DC  B 1 3   ? 85.193  125.776 -16.548 1.00 67.30  ? 149 DC  J C6    1 
ATOM   3048  P  P     . DA  B 1 4   ? 90.045  127.017 -13.928 1.00 106.86 ? 150 DA  J P     1 
ATOM   3049  O  OP1   . DA  B 1 4   ? 89.491  128.320 -14.395 1.00 106.86 ? 150 DA  J OP1   1 
ATOM   3050  O  OP2   . DA  B 1 4   ? 91.339  126.982 -13.198 1.00 106.86 ? 150 DA  J OP2   1 
ATOM   3051  O  "O5'" . DA  B 1 4   ? 88.964  126.355 -12.978 1.00 87.06  ? 150 DA  J "O5'" 1 
ATOM   3052  C  "C5'" . DA  B 1 4   ? 88.553  127.028 -11.802 1.00 87.06  ? 150 DA  J "C5'" 1 
ATOM   3053  C  "C4'" . DA  B 1 4   ? 88.199  126.024 -10.735 1.00 87.06  ? 150 DA  J "C4'" 1 
ATOM   3054  O  "O4'" . DA  B 1 4   ? 87.025  125.296 -11.160 1.00 87.06  ? 150 DA  J "O4'" 1 
ATOM   3055  C  "C3'" . DA  B 1 4   ? 89.271  124.975 -10.453 1.00 87.06  ? 150 DA  J "C3'" 1 
ATOM   3056  O  "O3'" . DA  B 1 4   ? 89.286  124.723 -9.041  1.00 87.06  ? 150 DA  J "O3'" 1 
ATOM   3057  C  "C2'" . DA  B 1 4   ? 88.813  123.781 -11.279 1.00 87.06  ? 150 DA  J "C2'" 1 
ATOM   3058  C  "C1'" . DA  B 1 4   ? 87.299  123.908 -11.243 1.00 87.06  ? 150 DA  J "C1'" 1 
ATOM   3059  N  N9    . DA  B 1 4   ? 86.575  123.398 -12.408 1.00 53.74  ? 150 DA  J N9    1 
ATOM   3060  C  C8    . DA  B 1 4   ? 87.037  123.107 -13.669 1.00 53.74  ? 150 DA  J C8    1 
ATOM   3061  N  N7    . DA  B 1 4   ? 86.094  122.727 -14.501 1.00 53.74  ? 150 DA  J N7    1 
ATOM   3062  C  C5    . DA  B 1 4   ? 84.937  122.755 -13.729 1.00 53.74  ? 150 DA  J C5    1 
ATOM   3063  C  C6    . DA  B 1 4   ? 83.590  122.468 -14.020 1.00 53.74  ? 150 DA  J C6    1 
ATOM   3064  N  N6    . DA  B 1 4   ? 83.143  122.125 -15.231 1.00 53.74  ? 150 DA  J N6    1 
ATOM   3065  N  N1    . DA  B 1 4   ? 82.697  122.564 -13.013 1.00 53.74  ? 150 DA  J N1    1 
ATOM   3066  C  C2    . DA  B 1 4   ? 83.126  122.948 -11.808 1.00 53.74  ? 150 DA  J C2    1 
ATOM   3067  N  N3    . DA  B 1 4   ? 84.351  123.266 -11.417 1.00 53.74  ? 150 DA  J N3    1 
ATOM   3068  C  C4    . DA  B 1 4   ? 85.222  123.146 -12.436 1.00 53.74  ? 150 DA  J C4    1 
ATOM   3069  P  P     . DA  B 1 5   ? 89.918  123.361 -8.463  1.00 67.15  ? 151 DA  J P     1 
ATOM   3070  O  OP1   . DA  B 1 5   ? 90.679  123.681 -7.226  1.00 67.15  ? 151 DA  J OP1   1 
ATOM   3071  O  OP2   . DA  B 1 5   ? 90.589  122.647 -9.577  1.00 67.15  ? 151 DA  J OP2   1 
ATOM   3072  O  "O5'" . DA  B 1 5   ? 88.649  122.507 -8.007  1.00 94.04  ? 151 DA  J "O5'" 1 
ATOM   3073  C  "C5'" . DA  B 1 5   ? 87.723  123.052 -7.063  1.00 94.04  ? 151 DA  J "C5'" 1 
ATOM   3074  C  "C4'" . DA  B 1 5   ? 86.667  122.041 -6.674  1.00 94.04  ? 151 DA  J "C4'" 1 
ATOM   3075  O  "O4'" . DA  B 1 5   ? 85.841  121.672 -7.806  1.00 94.04  ? 151 DA  J "O4'" 1 
ATOM   3076  C  "C3'" . DA  B 1 5   ? 87.150  120.736 -6.047  1.00 94.04  ? 151 DA  J "C3'" 1 
ATOM   3077  O  "O3'" . DA  B 1 5   ? 86.273  120.446 -4.938  1.00 94.04  ? 151 DA  J "O3'" 1 
ATOM   3078  C  "C2'" . DA  B 1 5   ? 87.046  119.742 -7.200  1.00 94.04  ? 151 DA  J "C2'" 1 
ATOM   3079  C  "C1'" . DA  B 1 5   ? 85.861  120.267 -8.006  1.00 94.04  ? 151 DA  J "C1'" 1 
ATOM   3080  N  N9    . DA  B 1 5   ? 85.890  120.047 -9.456  1.00 41.12  ? 151 DA  J N9    1 
ATOM   3081  C  C8    . DA  B 1 5   ? 86.934  120.244 -10.333 1.00 41.12  ? 151 DA  J C8    1 
ATOM   3082  N  N7    . DA  B 1 5   ? 86.608  120.068 -11.597 1.00 41.12  ? 151 DA  J N7    1 
ATOM   3083  C  C5    . DA  B 1 5   ? 85.268  119.708 -11.547 1.00 41.12  ? 151 DA  J C5    1 
ATOM   3084  C  C6    . DA  B 1 5   ? 84.334  119.417 -12.550 1.00 41.12  ? 151 DA  J C6    1 
ATOM   3085  N  N6    . DA  B 1 5   ? 84.613  119.455 -13.851 1.00 41.12  ? 151 DA  J N6    1 
ATOM   3086  N  N1    . DA  B 1 5   ? 83.080  119.090 -12.166 1.00 41.12  ? 151 DA  J N1    1 
ATOM   3087  C  C2    . DA  B 1 5   ? 82.792  119.068 -10.856 1.00 41.12  ? 151 DA  J C2    1 
ATOM   3088  N  N3    . DA  B 1 5   ? 83.578  119.333 -9.816  1.00 41.12  ? 151 DA  J N3    1 
ATOM   3089  C  C4    . DA  B 1 5   ? 84.820  119.656 -10.233 1.00 41.12  ? 151 DA  J C4    1 
ATOM   3090  P  P     . DT  B 1 6   ? 86.773  119.521 -3.711  1.00 80.90  ? 152 DT  J P     1 
ATOM   3091  O  OP1   . DT  B 1 6   ? 86.184  119.982 -2.422  1.00 80.90  ? 152 DT  J OP1   1 
ATOM   3092  O  OP2   . DT  B 1 6   ? 88.237  119.333 -3.829  1.00 80.90  ? 152 DT  J OP2   1 
ATOM   3093  O  "O5'" . DT  B 1 6   ? 86.125  118.127 -4.082  1.00 57.87  ? 152 DT  J "O5'" 1 
ATOM   3094  C  "C5'" . DT  B 1 6   ? 85.792  117.873 -5.433  1.00 57.87  ? 152 DT  J "C5'" 1 
ATOM   3095  C  "C4'" . DT  B 1 6   ? 84.463  117.180 -5.507  1.00 57.87  ? 152 DT  J "C4'" 1 
ATOM   3096  O  "O4'" . DT  B 1 6   ? 83.980  117.291 -6.858  1.00 57.87  ? 152 DT  J "O4'" 1 
ATOM   3097  C  "C3'" . DT  B 1 6   ? 84.574  115.698 -5.188  1.00 57.87  ? 152 DT  J "C3'" 1 
ATOM   3098  O  "O3'" . DT  B 1 6   ? 83.448  115.292 -4.409  1.00 57.87  ? 152 DT  J "O3'" 1 
ATOM   3099  C  "C2'" . DT  B 1 6   ? 84.672  115.046 -6.552  1.00 57.87  ? 152 DT  J "C2'" 1 
ATOM   3100  C  "C1'" . DT  B 1 6   ? 83.988  116.031 -7.490  1.00 57.87  ? 152 DT  J "C1'" 1 
ATOM   3101  N  N1    . DT  B 1 6   ? 84.699  116.188 -8.767  1.00 43.58  ? 152 DT  J N1    1 
ATOM   3102  C  C2    . DT  B 1 6   ? 83.974  116.078 -9.935  1.00 43.58  ? 152 DT  J C2    1 
ATOM   3103  O  O2    . DT  B 1 6   ? 82.765  115.879 -9.969  1.00 43.58  ? 152 DT  J O2    1 
ATOM   3104  N  N3    . DT  B 1 6   ? 84.718  116.192 -11.074 1.00 43.58  ? 152 DT  J N3    1 
ATOM   3105  C  C4    . DT  B 1 6   ? 86.073  116.387 -11.175 1.00 43.58  ? 152 DT  J C4    1 
ATOM   3106  O  O4    . DT  B 1 6   ? 86.594  116.447 -12.283 1.00 43.58  ? 152 DT  J O4    1 
ATOM   3107  C  C5    . DT  B 1 6   ? 86.775  116.495 -9.917  1.00 43.58  ? 152 DT  J C5    1 
ATOM   3108  C  C7    . DT  B 1 6   ? 88.262  116.678 -9.931  1.00 43.58  ? 152 DT  J C7    1 
ATOM   3109  C  C6    . DT  B 1 6   ? 86.060  116.410 -8.788  1.00 43.58  ? 152 DT  J C6    1 
ATOM   3110  P  P     . DA  B 1 7   ? 83.233  113.744 -4.039  1.00 54.44  ? 153 DA  J P     1 
ATOM   3111  O  OP1   . DA  B 1 7   ? 82.469  113.744 -2.765  1.00 54.44  ? 153 DA  J OP1   1 
ATOM   3112  O  OP2   . DA  B 1 7   ? 84.512  112.995 -4.124  1.00 54.44  ? 153 DA  J OP2   1 
ATOM   3113  O  "O5'" . DA  B 1 7   ? 82.297  113.257 -5.229  1.00 51.97  ? 153 DA  J "O5'" 1 
ATOM   3114  C  "C5'" . DA  B 1 7   ? 81.209  114.076 -5.647  1.00 51.97  ? 153 DA  J "C5'" 1 
ATOM   3115  C  "C4'" . DA  B 1 7   ? 80.481  113.436 -6.799  1.00 51.97  ? 153 DA  J "C4'" 1 
ATOM   3116  O  "O4'" . DA  B 1 7   ? 81.236  113.571 -8.022  1.00 51.97  ? 153 DA  J "O4'" 1 
ATOM   3117  C  "C3'" . DA  B 1 7   ? 80.218  111.948 -6.627  1.00 51.97  ? 153 DA  J "C3'" 1 
ATOM   3118  O  "O3'" . DA  B 1 7   ? 78.914  111.675 -7.152  1.00 51.97  ? 153 DA  J "O3'" 1 
ATOM   3119  C  "C2'" . DA  B 1 7   ? 81.341  111.301 -7.426  1.00 51.97  ? 153 DA  J "C2'" 1 
ATOM   3120  C  "C1'" . DA  B 1 7   ? 81.558  112.294 -8.555  1.00 51.97  ? 153 DA  J "C1'" 1 
ATOM   3121  N  N9    . DA  B 1 7   ? 82.922  112.376 -9.093  1.00 47.69  ? 153 DA  J N9    1 
ATOM   3122  C  C8    . DA  B 1 7   ? 84.102  112.499 -8.395  1.00 47.69  ? 153 DA  J C8    1 
ATOM   3123  N  N7    . DA  B 1 7   ? 85.162  112.617 -9.165  1.00 47.69  ? 153 DA  J N7    1 
ATOM   3124  C  C5    . DA  B 1 7   ? 84.650  112.560 -10.457 1.00 47.69  ? 153 DA  J C5    1 
ATOM   3125  C  C6    . DA  B 1 7   ? 85.262  112.646 -11.734 1.00 47.69  ? 153 DA  J C6    1 
ATOM   3126  N  N6    . DA  B 1 7   ? 86.575  112.835 -11.921 1.00 47.69  ? 153 DA  J N6    1 
ATOM   3127  N  N1    . DA  B 1 7   ? 84.464  112.537 -12.824 1.00 47.69  ? 153 DA  J N1    1 
ATOM   3128  C  C2    . DA  B 1 7   ? 83.150  112.362 -12.637 1.00 47.69  ? 153 DA  J C2    1 
ATOM   3129  N  N3    . DA  B 1 7   ? 82.457  112.279 -11.497 1.00 47.69  ? 153 DA  J N3    1 
ATOM   3130  C  C4    . DA  B 1 7   ? 83.274  112.388 -10.430 1.00 47.69  ? 153 DA  J C4    1 
ATOM   3131  P  P     . DT  B 1 8   ? 78.319  110.186 -7.101  1.00 62.64  ? 154 DT  J P     1 
ATOM   3132  O  OP1   . DT  B 1 8   ? 76.848  110.349 -7.047  1.00 62.64  ? 154 DT  J OP1   1 
ATOM   3133  O  OP2   . DT  B 1 8   ? 79.018  109.388 -6.049  1.00 62.64  ? 154 DT  J OP2   1 
ATOM   3134  O  "O5'" . DT  B 1 8   ? 78.679  109.623 -8.542  1.00 53.68  ? 154 DT  J "O5'" 1 
ATOM   3135  C  "C5'" . DT  B 1 8   ? 78.215  110.310 -9.695  1.00 53.68  ? 154 DT  J "C5'" 1 
ATOM   3136  C  "C4'" . DT  B 1 8   ? 78.607  109.561 -10.942 1.00 53.68  ? 154 DT  J "C4'" 1 
ATOM   3137  O  "O4'" . DT  B 1 8   ? 79.967  109.847 -11.351 1.00 53.68  ? 154 DT  J "O4'" 1 
ATOM   3138  C  "C3'" . DT  B 1 8   ? 78.521  108.048 -10.798 1.00 53.68  ? 154 DT  J "C3'" 1 
ATOM   3139  O  "O3'" . DT  B 1 8   ? 78.037  107.508 -12.024 1.00 53.68  ? 154 DT  J "O3'" 1 
ATOM   3140  C  "C2'" . DT  B 1 8   ? 79.969  107.647 -10.606 1.00 53.68  ? 154 DT  J "C2'" 1 
ATOM   3141  C  "C1'" . DT  B 1 8   ? 80.639  108.620 -11.555 1.00 53.68  ? 154 DT  J "C1'" 1 
ATOM   3142  N  N1    . DT  B 1 8   ? 82.071  108.831 -11.309 1.00 44.79  ? 154 DT  J N1    1 
ATOM   3143  C  C2    . DT  B 1 8   ? 82.891  109.029 -12.392 1.00 44.79  ? 154 DT  J C2    1 
ATOM   3144  O  O2    . DT  B 1 8   ? 82.483  109.045 -13.542 1.00 44.79  ? 154 DT  J O2    1 
ATOM   3145  N  N3    . DT  B 1 8   ? 84.210  109.207 -12.078 1.00 44.79  ? 154 DT  J N3    1 
ATOM   3146  C  C4    . DT  B 1 8   ? 84.772  109.215 -10.811 1.00 44.79  ? 154 DT  J C4    1 
ATOM   3147  O  O4    . DT  B 1 8   ? 85.985  109.408 -10.677 1.00 44.79  ? 154 DT  J O4    1 
ATOM   3148  C  C5    . DT  B 1 8   ? 83.845  108.997 -9.726  1.00 44.79  ? 154 DT  J C5    1 
ATOM   3149  C  C7    . DT  B 1 8   ? 84.355  108.984 -8.323  1.00 44.79  ? 154 DT  J C7    1 
ATOM   3150  C  C6    . DT  B 1 8   ? 82.562  108.818 -10.025 1.00 44.79  ? 154 DT  J C6    1 
ATOM   3151  P  P     . DC  B 1 9   ? 77.617  105.968 -12.101 1.00 83.45  ? 155 DC  J P     1 
ATOM   3152  O  OP1   . DC  B 1 9   ? 76.135  105.902 -12.128 1.00 83.45  ? 155 DC  J OP1   1 
ATOM   3153  O  OP2   . DC  B 1 9   ? 78.378  105.245 -11.041 1.00 83.45  ? 155 DC  J OP2   1 
ATOM   3154  O  "O5'" . DC  B 1 9   ? 78.172  105.537 -13.521 1.00 90.12  ? 155 DC  J "O5'" 1 
ATOM   3155  C  "C5'" . DC  B 1 9   ? 79.501  105.863 -13.869 1.00 90.12  ? 155 DC  J "C5'" 1 
ATOM   3156  C  "C4'" . DC  B 1 9   ? 79.700  105.752 -15.358 1.00 90.12  ? 155 DC  J "C4'" 1 
ATOM   3157  O  "O4'" . DC  B 1 9   ? 80.940  106.429 -15.645 1.00 90.12  ? 155 DC  J "O4'" 1 
ATOM   3158  C  "C3'" . DC  B 1 9   ? 79.886  104.313 -15.826 1.00 90.12  ? 155 DC  J "C3'" 1 
ATOM   3159  O  "O3'" . DC  B 1 9   ? 79.364  104.118 -17.145 1.00 90.12  ? 155 DC  J "O3'" 1 
ATOM   3160  C  "C2'" . DC  B 1 9   ? 81.385  104.096 -15.736 1.00 90.12  ? 155 DC  J "C2'" 1 
ATOM   3161  C  "C1'" . DC  B 1 9   ? 82.005  105.496 -15.723 1.00 90.12  ? 155 DC  J "C1'" 1 
ATOM   3162  N  N1    . DC  B 1 9   ? 82.857  105.697 -14.531 1.00 43.59  ? 155 DC  J N1    1 
ATOM   3163  C  C2    . DC  B 1 9   ? 84.224  105.950 -14.705 1.00 43.59  ? 155 DC  J C2    1 
ATOM   3164  O  O2    . DC  B 1 9   ? 84.674  106.071 -15.869 1.00 43.59  ? 155 DC  J O2    1 
ATOM   3165  N  N3    . DC  B 1 9   ? 85.017  106.052 -13.605 1.00 43.59  ? 155 DC  J N3    1 
ATOM   3166  C  C4    . DC  B 1 9   ? 84.492  105.915 -12.379 1.00 43.59  ? 155 DC  J C4    1 
ATOM   3167  N  N4    . DC  B 1 9   ? 85.322  105.971 -11.318 1.00 43.59  ? 155 DC  J N4    1 
ATOM   3168  C  C5    . DC  B 1 9   ? 83.100  105.701 -12.180 1.00 43.59  ? 155 DC  J C5    1 
ATOM   3169  C  C6    . DC  B 1 9   ? 82.328  105.604 -13.271 1.00 43.59  ? 155 DC  J C6    1 
ATOM   3170  P  P     . DC  B 1 10  ? 79.074  102.625 -17.677 1.00 62.07  ? 156 DC  J P     1 
ATOM   3171  O  OP1   . DC  B 1 10  ? 77.970  102.683 -18.672 1.00 62.07  ? 156 DC  J OP1   1 
ATOM   3172  O  OP2   . DC  B 1 10  ? 78.958  101.725 -16.492 1.00 62.07  ? 156 DC  J OP2   1 
ATOM   3173  O  "O5'" . DC  B 1 10  ? 80.411  102.256 -18.459 1.00 75.04  ? 156 DC  J "O5'" 1 
ATOM   3174  C  "C5'" . DC  B 1 10  ? 81.370  103.276 -18.767 1.00 75.04  ? 156 DC  J "C5'" 1 
ATOM   3175  C  "C4'" . DC  B 1 10  ? 82.596  102.677 -19.415 1.00 75.04  ? 156 DC  J "C4'" 1 
ATOM   3176  O  "O4'" . DC  B 1 10  ? 83.759  103.035 -18.642 1.00 75.04  ? 156 DC  J "O4'" 1 
ATOM   3177  C  "C3'" . DC  B 1 10  ? 82.611  101.154 -19.514 1.00 75.04  ? 156 DC  J "C3'" 1 
ATOM   3178  O  "O3'" . DC  B 1 10  ? 83.274  100.768 -20.715 1.00 75.04  ? 156 DC  J "O3'" 1 
ATOM   3179  C  "C2'" . DC  B 1 10  ? 83.424  100.729 -18.311 1.00 75.04  ? 156 DC  J "C2'" 1 
ATOM   3180  C  "C1'" . DC  B 1 10  ? 84.414  101.867 -18.179 1.00 75.04  ? 156 DC  J "C1'" 1 
ATOM   3181  N  N1    . DC  B 1 10  ? 84.783  102.101 -16.790 1.00 50.44  ? 156 DC  J N1    1 
ATOM   3182  C  C2    . DC  B 1 10  ? 86.050  102.570 -16.503 1.00 50.44  ? 156 DC  J C2    1 
ATOM   3183  O  O2    . DC  B 1 10  ? 86.822  102.827 -17.449 1.00 50.44  ? 156 DC  J O2    1 
ATOM   3184  N  N3    . DC  B 1 10  ? 86.404  102.742 -15.207 1.00 50.44  ? 156 DC  J N3    1 
ATOM   3185  C  C4    . DC  B 1 10  ? 85.528  102.484 -14.234 1.00 50.44  ? 156 DC  J C4    1 
ATOM   3186  N  N4    . DC  B 1 10  ? 85.912  102.652 -12.975 1.00 50.44  ? 156 DC  J N4    1 
ATOM   3187  C  C5    . DC  B 1 10  ? 84.219  102.035 -14.510 1.00 50.44  ? 156 DC  J C5    1 
ATOM   3188  C  C6    . DC  B 1 10  ? 83.891  101.854 -15.790 1.00 50.44  ? 156 DC  J C6    1 
ATOM   3189  P  P     . DA  B 1 11  ? 83.537  99.214  -21.017 1.00 54.11  ? 157 DA  J P     1 
ATOM   3190  O  OP1   . DA  B 1 11  ? 83.307  99.032  -22.480 1.00 54.11  ? 157 DA  J OP1   1 
ATOM   3191  O  OP2   . DA  B 1 11  ? 82.803  98.367  -20.023 1.00 54.11  ? 157 DA  J OP2   1 
ATOM   3192  O  "O5'" . DA  B 1 11  ? 85.085  99.026  -20.698 1.00 50.89  ? 157 DA  J "O5'" 1 
ATOM   3193  C  "C5'" . DA  B 1 11  ? 86.069  99.691  -21.470 1.00 50.89  ? 157 DA  J "C5'" 1 
ATOM   3194  C  "C4'" . DA  B 1 11  ? 87.433  99.176  -21.093 1.00 50.89  ? 157 DA  J "C4'" 1 
ATOM   3195  O  "O4'" . DA  B 1 11  ? 87.735  99.623  -19.750 1.00 50.89  ? 157 DA  J "O4'" 1 
ATOM   3196  C  "C3'" . DA  B 1 11  ? 87.519  97.651  -21.072 1.00 50.89  ? 157 DA  J "C3'" 1 
ATOM   3197  O  "O3'" . DA  B 1 11  ? 88.737  97.207  -21.695 1.00 50.89  ? 157 DA  J "O3'" 1 
ATOM   3198  C  "C2'" . DA  B 1 11  ? 87.465  97.316  -19.591 1.00 50.89  ? 157 DA  J "C2'" 1 
ATOM   3199  C  "C1'" . DA  B 1 11  ? 88.085  98.531  -18.936 1.00 50.89  ? 157 DA  J "C1'" 1 
ATOM   3200  N  N9    . DA  B 1 11  ? 87.552  98.795  -17.608 1.00 48.77  ? 157 DA  J N9    1 
ATOM   3201  C  C8    . DA  B 1 11  ? 86.253  98.627  -17.202 1.00 48.77  ? 157 DA  J C8    1 
ATOM   3202  N  N7    . DA  B 1 11  ? 86.059  98.885  -15.929 1.00 48.77  ? 157 DA  J N7    1 
ATOM   3203  C  C5    . DA  B 1 11  ? 87.314  99.262  -15.468 1.00 48.77  ? 157 DA  J C5    1 
ATOM   3204  C  C6    . DA  B 1 11  ? 87.781  99.639  -14.194 1.00 48.77  ? 157 DA  J C6    1 
ATOM   3205  N  N6    . DA  B 1 11  ? 87.009  99.679  -13.110 1.00 48.77  ? 157 DA  J N6    1 
ATOM   3206  N  N1    . DA  B 1 11  ? 89.084  99.966  -14.072 1.00 48.77  ? 157 DA  J N1    1 
ATOM   3207  C  C2    . DA  B 1 11  ? 89.859  99.907  -15.156 1.00 48.77  ? 157 DA  J C2    1 
ATOM   3208  N  N3    . DA  B 1 11  ? 89.543  99.555  -16.408 1.00 48.77  ? 157 DA  J N3    1 
ATOM   3209  C  C4    . DA  B 1 11  ? 88.239  99.235  -16.498 1.00 48.77  ? 157 DA  J C4    1 
ATOM   3210  P  P     . DC  B 1 12  ? 88.836  95.712  -22.299 1.00 68.14  ? 158 DC  J P     1 
ATOM   3211  O  OP1   . DC  B 1 12  ? 89.593  95.758  -23.577 1.00 68.14  ? 158 DC  J OP1   1 
ATOM   3212  O  OP2   . DC  B 1 12  ? 87.491  95.088  -22.278 1.00 68.14  ? 158 DC  J OP2   1 
ATOM   3213  O  "O5'" . DC  B 1 12  ? 89.732  94.979  -21.213 1.00 64.73  ? 158 DC  J "O5'" 1 
ATOM   3214  C  "C5'" . DC  B 1 12  ? 89.604  95.323  -19.842 1.00 64.73  ? 158 DC  J "C5'" 1 
ATOM   3215  C  "C4'" . DC  B 1 12  ? 90.959  95.593  -19.237 1.00 64.73  ? 158 DC  J "C4'" 1 
ATOM   3216  O  "O4'" . DC  B 1 12  ? 90.758  96.483  -18.113 1.00 64.73  ? 158 DC  J "O4'" 1 
ATOM   3217  C  "C3'" . DC  B 1 12  ? 91.569  94.319  -18.664 1.00 64.73  ? 158 DC  J "C3'" 1 
ATOM   3218  O  "O3'" . DC  B 1 12  ? 92.983  94.236  -18.794 1.00 64.73  ? 158 DC  J "O3'" 1 
ATOM   3219  C  "C2'" . DC  B 1 12  ? 91.201  94.356  -17.197 1.00 64.73  ? 158 DC  J "C2'" 1 
ATOM   3220  C  "C1'" . DC  B 1 12  ? 91.040  95.827  -16.883 1.00 64.73  ? 158 DC  J "C1'" 1 
ATOM   3221  N  N1    . DC  B 1 12  ? 89.874  95.969  -16.011 1.00 38.98  ? 158 DC  J N1    1 
ATOM   3222  C  C2    . DC  B 1 12  ? 90.070  96.256  -14.657 1.00 38.98  ? 158 DC  J C2    1 
ATOM   3223  O  O2    . DC  B 1 12  ? 91.211  96.528  -14.257 1.00 38.98  ? 158 DC  J O2    1 
ATOM   3224  N  N3    . DC  B 1 12  ? 89.008  96.238  -13.819 1.00 38.98  ? 158 DC  J N3    1 
ATOM   3225  C  C4    . DC  B 1 12  ? 87.791  95.978  -14.293 1.00 38.98  ? 158 DC  J C4    1 
ATOM   3226  N  N4    . DC  B 1 12  ? 86.781  95.923  -13.427 1.00 38.98  ? 158 DC  J N4    1 
ATOM   3227  C  C5    . DC  B 1 12  ? 87.554  95.752  -15.681 1.00 38.98  ? 158 DC  J C5    1 
ATOM   3228  C  C6    . DC  B 1 12  ? 88.616  95.760  -16.498 1.00 38.98  ? 158 DC  J C6    1 
ATOM   3229  P  P     . DC  B 1 13  ? 93.725  92.903  -18.291 1.00 74.22  ? 159 DC  J P     1 
ATOM   3230  O  OP1   . DC  B 1 13  ? 95.146  92.957  -18.699 1.00 74.22  ? 159 DC  J OP1   1 
ATOM   3231  O  OP2   . DC  B 1 13  ? 92.878  91.757  -18.711 1.00 74.22  ? 159 DC  J OP2   1 
ATOM   3232  O  "O5'" . DC  B 1 13  ? 93.643  92.986  -16.705 1.00 68.71  ? 159 DC  J "O5'" 1 
ATOM   3233  C  "C5'" . DC  B 1 13  ? 94.325  94.011  -15.990 1.00 68.71  ? 159 DC  J "C5'" 1 
ATOM   3234  C  "C4'" . DC  B 1 13  ? 94.639  93.529  -14.594 1.00 68.71  ? 159 DC  J "C4'" 1 
ATOM   3235  O  "O4'" . DC  B 1 13  ? 93.514  93.799  -13.725 1.00 68.71  ? 159 DC  J "O4'" 1 
ATOM   3236  C  "C3'" . DC  B 1 13  ? 94.881  92.024  -14.493 1.00 68.71  ? 159 DC  J "C3'" 1 
ATOM   3237  O  "O3'" . DC  B 1 13  ? 95.792  91.781  -13.416 1.00 68.71  ? 159 DC  J "O3'" 1 
ATOM   3238  C  "C2'" . DC  B 1 13  ? 93.503  91.488  -14.155 1.00 68.71  ? 159 DC  J "C2'" 1 
ATOM   3239  C  "C1'" . DC  B 1 13  ? 92.968  92.579  -13.237 1.00 68.71  ? 159 DC  J "C1'" 1 
ATOM   3240  N  N1    . DC  B 1 13  ? 91.501  92.715  -13.232 1.00 58.46  ? 159 DC  J N1    1 
ATOM   3241  C  C2    . DC  B 1 13  ? 90.843  92.990  -12.013 1.00 58.46  ? 159 DC  J C2    1 
ATOM   3242  O  O2    . DC  B 1 13  ? 91.513  93.056  -10.955 1.00 58.46  ? 159 DC  J O2    1 
ATOM   3243  N  N3    . DC  B 1 13  ? 89.495  93.169  -12.024 1.00 58.46  ? 159 DC  J N3    1 
ATOM   3244  C  C4    . DC  B 1 13  ? 88.814  93.071  -13.173 1.00 58.46  ? 159 DC  J C4    1 
ATOM   3245  N  N4    . DC  B 1 13  ? 87.497  93.285  -13.141 1.00 58.46  ? 159 DC  J N4    1 
ATOM   3246  C  C5    . DC  B 1 13  ? 89.455  92.758  -14.407 1.00 58.46  ? 159 DC  J C5    1 
ATOM   3247  C  C6    . DC  B 1 13  ? 90.783  92.592  -14.392 1.00 58.46  ? 159 DC  J C6    1 
ATOM   3248  P  P     . DT  B 1 14  ? 96.561  90.371  -13.306 1.00 70.67  ? 160 DT  J P     1 
ATOM   3249  O  OP1   . DT  B 1 14  ? 98.019  90.661  -13.281 1.00 70.67  ? 160 DT  J OP1   1 
ATOM   3250  O  OP2   . DT  B 1 14  ? 96.014  89.440  -14.329 1.00 70.67  ? 160 DT  J OP2   1 
ATOM   3251  O  "O5'" . DT  B 1 14  ? 96.137  89.843  -11.865 1.00 98.25  ? 160 DT  J "O5'" 1 
ATOM   3252  C  "C5'" . DT  B 1 14  ? 96.211  90.699  -10.726 1.00 98.25  ? 160 DT  J "C5'" 1 
ATOM   3253  C  "C4'" . DT  B 1 14  ? 95.385  90.132  -9.596  1.00 98.25  ? 160 DT  J "C4'" 1 
ATOM   3254  O  "O4'" . DT  B 1 14  ? 93.973  90.426  -9.770  1.00 98.25  ? 160 DT  J "O4'" 1 
ATOM   3255  C  "C3'" . DT  B 1 14  ? 95.491  88.610  -9.451  1.00 98.25  ? 160 DT  J "C3'" 1 
ATOM   3256  O  "O3'" . DT  B 1 14  ? 95.541  88.268  -8.070  1.00 98.25  ? 160 DT  J "O3'" 1 
ATOM   3257  C  "C2'" . DT  B 1 14  ? 94.177  88.116  -10.028 1.00 98.25  ? 160 DT  J "C2'" 1 
ATOM   3258  C  "C1'" . DT  B 1 14  ? 93.247  89.222  -9.569  1.00 98.25  ? 160 DT  J "C1'" 1 
ATOM   3259  N  N1    . DT  B 1 14  ? 91.939  89.321  -10.259 1.00 65.27  ? 160 DT  J N1    1 
ATOM   3260  C  C2    . DT  B 1 14  ? 90.903  89.894  -9.557  1.00 65.27  ? 160 DT  J C2    1 
ATOM   3261  O  O2    . DT  B 1 14  ? 91.035  90.370  -8.438  1.00 65.27  ? 160 DT  J O2    1 
ATOM   3262  N  N3    . DT  B 1 14  ? 89.702  89.899  -10.219 1.00 65.27  ? 160 DT  J N3    1 
ATOM   3263  C  C4    . DT  B 1 14  ? 89.445  89.426  -11.487 1.00 65.27  ? 160 DT  J C4    1 
ATOM   3264  O  O4    . DT  B 1 14  ? 88.316  89.497  -11.943 1.00 65.27  ? 160 DT  J O4    1 
ATOM   3265  C  C5    . DT  B 1 14  ? 90.575  88.874  -12.183 1.00 65.27  ? 160 DT  J C5    1 
ATOM   3266  C  C7    . DT  B 1 14  ? 90.382  88.375  -13.580 1.00 65.27  ? 160 DT  J C7    1 
ATOM   3267  C  C6    . DT  B 1 14  ? 91.755  88.840  -11.542 1.00 65.27  ? 160 DT  J C6    1 
ATOM   3268  P  P     . DG  B 1 15  ? 96.525  87.106  -7.570  1.00 124.73 ? 161 DG  J P     1 
ATOM   3269  O  OP1   . DG  B 1 15  ? 97.891  87.685  -7.480  1.00 124.73 ? 161 DG  J OP1   1 
ATOM   3270  O  OP2   . DG  B 1 15  ? 96.288  85.894  -8.399  1.00 124.73 ? 161 DG  J OP2   1 
ATOM   3271  O  "O5'" . DG  B 1 15  ? 96.006  86.822  -6.095  1.00 118.51 ? 161 DG  J "O5'" 1 
ATOM   3272  C  "C5'" . DG  B 1 15  ? 95.751  87.909  -5.213  1.00 118.51 ? 161 DG  J "C5'" 1 
ATOM   3273  C  "C4'" . DG  B 1 15  ? 94.431  87.721  -4.502  1.00 118.51 ? 161 DG  J "C4'" 1 
ATOM   3274  O  "O4'" . DG  B 1 15  ? 93.323  87.823  -5.433  1.00 118.51 ? 161 DG  J "O4'" 1 
ATOM   3275  C  "C3'" . DG  B 1 15  ? 94.279  86.380  -3.790  1.00 118.51 ? 161 DG  J "C3'" 1 
ATOM   3276  O  "O3'" . DG  B 1 15  ? 93.716  86.600  -2.498  1.00 118.51 ? 161 DG  J "O3'" 1 
ATOM   3277  C  "C2'" . DG  B 1 15  ? 93.328  85.603  -4.684  1.00 118.51 ? 161 DG  J "C2'" 1 
ATOM   3278  C  "C1'" . DG  B 1 15  ? 92.470  86.694  -5.307  1.00 118.51 ? 161 DG  J "C1'" 1 
ATOM   3279  N  N9    . DG  B 1 15  ? 91.957  86.361  -6.637  1.00 77.99  ? 161 DG  J N9    1 
ATOM   3280  C  C8    . DG  B 1 15  ? 92.616  85.670  -7.625  1.00 77.99  ? 161 DG  J C8    1 
ATOM   3281  N  N7    . DG  B 1 15  ? 91.904  85.514  -8.708  1.00 77.99  ? 161 DG  J N7    1 
ATOM   3282  C  C5    . DG  B 1 15  ? 90.703  86.141  -8.422  1.00 77.99  ? 161 DG  J C5    1 
ATOM   3283  C  C6    . DG  B 1 15  ? 89.550  86.292  -9.213  1.00 77.99  ? 161 DG  J C6    1 
ATOM   3284  O  O6    . DG  B 1 15  ? 89.349  85.902  -10.368 1.00 77.99  ? 161 DG  J O6    1 
ATOM   3285  N  N1    . DG  B 1 15  ? 88.557  86.981  -8.535  1.00 77.99  ? 161 DG  J N1    1 
ATOM   3286  C  C2    . DG  B 1 15  ? 88.666  87.472  -7.259  1.00 77.99  ? 161 DG  J C2    1 
ATOM   3287  N  N2    . DG  B 1 15  ? 87.593  88.105  -6.780  1.00 77.99  ? 161 DG  J N2    1 
ATOM   3288  N  N3    . DG  B 1 15  ? 89.744  87.348  -6.510  1.00 77.99  ? 161 DG  J N3    1 
ATOM   3289  C  C4    . DG  B 1 15  ? 90.717  86.672  -7.147  1.00 77.99  ? 161 DG  J C4    1 
ATOM   3290  P  P     . DC  B 1 16  ? 93.891  85.493  -1.344  1.00 104.81 ? 162 DC  J P     1 
ATOM   3291  O  OP1   . DC  B 1 16  ? 94.455  86.163  -0.136  1.00 104.81 ? 162 DC  J OP1   1 
ATOM   3292  O  OP2   . DC  B 1 16  ? 94.552  84.282  -1.902  1.00 104.81 ? 162 DC  J OP2   1 
ATOM   3293  O  "O5'" . DC  B 1 16  ? 92.388  85.121  -1.019  1.00 96.09  ? 162 DC  J "O5'" 1 
ATOM   3294  C  "C5'" . DC  B 1 16  ? 91.425  86.153  -0.881  1.00 96.09  ? 162 DC  J "C5'" 1 
ATOM   3295  C  "C4'" . DC  B 1 16  ? 90.120  85.567  -0.419  1.00 96.09  ? 162 DC  J "C4'" 1 
ATOM   3296  O  "O4'" . DC  B 1 16  ? 89.313  85.363  -1.599  1.00 96.09  ? 162 DC  J "O4'" 1 
ATOM   3297  C  "C3'" . DC  B 1 16  ? 90.287  84.202  0.243   1.00 96.09  ? 162 DC  J "C3'" 1 
ATOM   3298  O  "O3'" . DC  B 1 16  ? 89.615  84.153  1.524   1.00 96.09  ? 162 DC  J "O3'" 1 
ATOM   3299  C  "C2'" . DC  B 1 16  ? 89.941  83.194  -0.846  1.00 96.09  ? 162 DC  J "C2'" 1 
ATOM   3300  C  "C1'" . DC  B 1 16  ? 89.106  83.984  -1.858  1.00 96.09  ? 162 DC  J "C1'" 1 
ATOM   3301  N  N1    . DC  B 1 16  ? 89.410  83.749  -3.290  1.00 83.72  ? 162 DC  J N1    1 
ATOM   3302  C  C2    . DC  B 1 16  ? 88.652  84.434  -4.260  1.00 83.72  ? 162 DC  J C2    1 
ATOM   3303  O  O2    . DC  B 1 16  ? 87.785  85.244  -3.885  1.00 83.72  ? 162 DC  J O2    1 
ATOM   3304  N  N3    . DC  B 1 16  ? 88.889  84.198  -5.578  1.00 83.72  ? 162 DC  J N3    1 
ATOM   3305  C  C4    . DC  B 1 16  ? 89.841  83.335  -5.943  1.00 83.72  ? 162 DC  J C4    1 
ATOM   3306  N  N4    . DC  B 1 16  ? 90.034  83.135  -7.250  1.00 83.72  ? 162 DC  J N4    1 
ATOM   3307  C  C5    . DC  B 1 16  ? 90.637  82.642  -4.982  1.00 83.72  ? 162 DC  J C5    1 
ATOM   3308  C  C6    . DC  B 1 16  ? 90.392  82.877  -3.678  1.00 83.72  ? 162 DC  J C6    1 
ATOM   3309  P  P     . DA  B 1 17  ? 88.086  83.674  1.643   1.00 137.94 ? 163 DA  J P     1 
ATOM   3310  O  OP1   . DA  B 1 17  ? 87.487  84.428  2.777   1.00 137.94 ? 163 DA  J OP1   1 
ATOM   3311  O  OP2   . DA  B 1 17  ? 88.068  82.186  1.666   1.00 137.94 ? 163 DA  J OP2   1 
ATOM   3312  O  "O5'" . DA  B 1 17  ? 87.423  84.184  0.285   1.00 106.21 ? 163 DA  J "O5'" 1 
ATOM   3313  C  "C5'" . DA  B 1 17  ? 86.616  85.367  0.229   1.00 106.21 ? 163 DA  J "C5'" 1 
ATOM   3314  C  "C4'" . DA  B 1 17  ? 85.192  84.980  -0.083  1.00 106.21 ? 163 DA  J "C4'" 1 
ATOM   3315  O  "O4'" . DA  B 1 17  ? 85.230  84.129  -1.254  1.00 106.21 ? 163 DA  J "O4'" 1 
ATOM   3316  C  "C3'" . DA  B 1 17  ? 84.598  84.116  1.026   1.00 106.21 ? 163 DA  J "C3'" 1 
ATOM   3317  O  "O3'" . DA  B 1 17  ? 83.178  84.255  1.079   1.00 106.21 ? 163 DA  J "O3'" 1 
ATOM   3318  C  "C2'" . DA  B 1 17  ? 84.988  82.712  0.621   1.00 106.21 ? 163 DA  J "C2'" 1 
ATOM   3319  C  "C1'" . DA  B 1 17  ? 84.965  82.776  -0.891  1.00 106.21 ? 163 DA  J "C1'" 1 
ATOM   3320  N  N9    . DA  B 1 17  ? 86.005  81.933  -1.475  1.00 87.75  ? 163 DA  J N9    1 
ATOM   3321  C  C8    . DA  B 1 17  ? 87.003  81.260  -0.814  1.00 87.75  ? 163 DA  J C8    1 
ATOM   3322  N  N7    . DA  B 1 17  ? 87.792  80.577  -1.601  1.00 87.75  ? 163 DA  J N7    1 
ATOM   3323  C  C5    . DA  B 1 17  ? 87.282  80.817  -2.869  1.00 87.75  ? 163 DA  J C5    1 
ATOM   3324  C  C6    . DA  B 1 17  ? 87.677  80.384  -4.146  1.00 87.75  ? 163 DA  J C6    1 
ATOM   3325  N  N6    . DA  B 1 17  ? 88.724  79.582  -4.369  1.00 87.75  ? 163 DA  J N6    1 
ATOM   3326  N  N1    . DA  B 1 17  ? 86.947  80.805  -5.203  1.00 87.75  ? 163 DA  J N1    1 
ATOM   3327  C  C2    . DA  B 1 17  ? 85.896  81.603  -4.982  1.00 87.75  ? 163 DA  J C2    1 
ATOM   3328  N  N3    . DA  B 1 17  ? 85.430  82.081  -3.831  1.00 87.75  ? 163 DA  J N3    1 
ATOM   3329  C  C4    . DA  B 1 17  ? 86.178  81.647  -2.803  1.00 87.75  ? 163 DA  J C4    1 
ATOM   3330  P  P     . DG  B 1 18  ? 82.315  83.322  2.073   1.00 96.36  ? 164 DG  J P     1 
ATOM   3331  O  OP1   . DG  B 1 18  ? 81.667  84.187  3.091   1.00 96.36  ? 164 DG  J OP1   1 
ATOM   3332  O  OP2   . DG  B 1 18  ? 83.150  82.170  2.511   1.00 96.36  ? 164 DG  J OP2   1 
ATOM   3333  O  "O5'" . DG  B 1 18  ? 81.185  82.759  1.110   1.00 68.80  ? 164 DG  J "O5'" 1 
ATOM   3334  C  "C5'" . DG  B 1 18  ? 80.937  83.398  -0.128  1.00 68.80  ? 164 DG  J "C5'" 1 
ATOM   3335  C  "C4'" . DG  B 1 18  ? 80.863  82.377  -1.236  1.00 68.80  ? 164 DG  J "C4'" 1 
ATOM   3336  O  "O4'" . DG  B 1 18  ? 82.129  81.716  -1.488  1.00 68.80  ? 164 DG  J "O4'" 1 
ATOM   3337  C  "C3'" . DG  B 1 18  ? 79.850  81.253  -1.044  1.00 68.80  ? 164 DG  J "C3'" 1 
ATOM   3338  O  "O3'" . DG  B 1 18  ? 79.301  81.046  -2.333  1.00 68.80  ? 164 DG  J "O3'" 1 
ATOM   3339  C  "C2'" . DG  B 1 18  ? 80.721  80.058  -0.695  1.00 68.80  ? 164 DG  J "C2'" 1 
ATOM   3340  C  "C1'" . DG  B 1 18  ? 81.870  80.328  -1.638  1.00 68.80  ? 164 DG  J "C1'" 1 
ATOM   3341  N  N9    . DG  B 1 18  ? 83.113  79.592  -1.427  1.00 84.97  ? 164 DG  J N9    1 
ATOM   3342  C  C8    . DG  B 1 18  ? 83.724  79.291  -0.234  1.00 84.97  ? 164 DG  J C8    1 
ATOM   3343  N  N7    . DG  B 1 18  ? 84.845  78.636  -0.383  1.00 84.97  ? 164 DG  J N7    1 
ATOM   3344  C  C5    . DG  B 1 18  ? 84.979  78.493  -1.758  1.00 84.97  ? 164 DG  J C5    1 
ATOM   3345  C  C6    . DG  B 1 18  ? 86.008  77.879  -2.526  1.00 84.97  ? 164 DG  J C6    1 
ATOM   3346  O  O6    . DG  B 1 18  ? 87.053  77.331  -2.128  1.00 84.97  ? 164 DG  J O6    1 
ATOM   3347  N  N1    . DG  B 1 18  ? 85.735  77.955  -3.891  1.00 84.97  ? 164 DG  J N1    1 
ATOM   3348  C  C2    . DG  B 1 18  ? 84.638  78.564  -4.445  1.00 84.97  ? 164 DG  J C2    1 
ATOM   3349  N  N2    . DG  B 1 18  ? 84.580  78.544  -5.779  1.00 84.97  ? 164 DG  J N2    1 
ATOM   3350  N  N3    . DG  B 1 18  ? 83.683  79.147  -3.745  1.00 84.97  ? 164 DG  J N3    1 
ATOM   3351  C  C4    . DG  B 1 18  ? 83.915  79.071  -2.416  1.00 84.97  ? 164 DG  J C4    1 
ATOM   3352  P  P     . DA  B 1 19  ? 77.967  80.206  -2.506  1.00 66.14  ? 165 DA  J P     1 
ATOM   3353  O  OP1   . DA  B 1 19  ? 76.807  81.107  -2.331  1.00 66.14  ? 165 DA  J OP1   1 
ATOM   3354  O  OP2   . DA  B 1 19  ? 78.088  78.987  -1.671  1.00 66.14  ? 165 DA  J OP2   1 
ATOM   3355  O  "O5'" . DA  B 1 19  ? 78.027  79.785  -4.030  1.00 59.08  ? 165 DA  J "O5'" 1 
ATOM   3356  C  "C5'" . DA  B 1 19  ? 77.608  78.499  -4.411  1.00 59.08  ? 165 DA  J "C5'" 1 
ATOM   3357  C  "C4'" . DA  B 1 19  ? 77.871  78.296  -5.878  1.00 59.08  ? 165 DA  J "C4'" 1 
ATOM   3358  O  "O4'" . DA  B 1 19  ? 79.299  78.408  -6.069  1.00 59.08  ? 165 DA  J "O4'" 1 
ATOM   3359  C  "C3'" . DA  B 1 19  ? 77.472  76.901  -6.341  1.00 59.08  ? 165 DA  J "C3'" 1 
ATOM   3360  O  "O3'" . DA  B 1 19  ? 76.660  76.922  -7.529  1.00 59.08  ? 165 DA  J "O3'" 1 
ATOM   3361  C  "C2'" . DA  B 1 19  ? 78.766  76.106  -6.354  1.00 59.08  ? 165 DA  J "C2'" 1 
ATOM   3362  C  "C1'" . DA  B 1 19  ? 79.889  77.137  -6.308  1.00 59.08  ? 165 DA  J "C1'" 1 
ATOM   3363  N  N9    . DA  B 1 19  ? 80.834  76.876  -5.215  1.00 69.83  ? 165 DA  J N9    1 
ATOM   3364  C  C8    . DA  B 1 19  ? 80.685  77.199  -3.885  1.00 69.83  ? 165 DA  J C8    1 
ATOM   3365  N  N7    . DA  B 1 19  ? 81.698  76.829  -3.133  1.00 69.83  ? 165 DA  J N7    1 
ATOM   3366  C  C5    . DA  B 1 19  ? 82.576  76.223  -4.025  1.00 69.83  ? 165 DA  J C5    1 
ATOM   3367  C  C6    . DA  B 1 19  ? 83.842  75.621  -3.857  1.00 69.83  ? 165 DA  J C6    1 
ATOM   3368  N  N6    . DA  B 1 19  ? 84.469  75.517  -2.683  1.00 69.83  ? 165 DA  J N6    1 
ATOM   3369  N  N1    . DA  B 1 19  ? 84.450  75.120  -4.954  1.00 69.83  ? 165 DA  J N1    1 
ATOM   3370  C  C2    . DA  B 1 19  ? 83.825  75.210  -6.133  1.00 69.83  ? 165 DA  J C2    1 
ATOM   3371  N  N3    . DA  B 1 19  ? 82.639  75.741  -6.420  1.00 69.83  ? 165 DA  J N3    1 
ATOM   3372  C  C4    . DA  B 1 19  ? 82.057  76.242  -5.312  1.00 69.83  ? 165 DA  J C4    1 
ATOM   3373  P  P     . DT  B 1 20  ? 77.331  76.890  -8.978  1.00 95.43  ? 166 DT  J P     1 
ATOM   3374  O  OP1   . DT  B 1 20  ? 77.716  78.283  -9.316  1.00 95.43  ? 166 DT  J OP1   1 
ATOM   3375  O  OP2   . DT  B 1 20  ? 76.370  76.156  -9.848  1.00 95.43  ? 166 DT  J OP2   1 
ATOM   3376  O  "O5'" . DT  B 1 20  ? 78.656  76.027  -8.820  1.00 75.61  ? 166 DT  J "O5'" 1 
ATOM   3377  C  "C5'" . DT  B 1 20  ? 78.583  74.614  -8.782  1.00 75.61  ? 166 DT  J "C5'" 1 
ATOM   3378  C  "C4'" . DT  B 1 20  ? 79.862  74.004  -9.302  1.00 75.61  ? 166 DT  J "C4'" 1 
ATOM   3379  O  "O4'" . DT  B 1 20  ? 80.906  74.132  -8.300  1.00 75.61  ? 166 DT  J "O4'" 1 
ATOM   3380  C  "C3'" . DT  B 1 20  ? 79.694  72.508  -9.552  1.00 75.61  ? 166 DT  J "C3'" 1 
ATOM   3381  O  "O3'" . DT  B 1 20  ? 80.205  72.117  -10.817 1.00 75.61  ? 166 DT  J "O3'" 1 
ATOM   3382  C  "C2'" . DT  B 1 20  ? 80.433  71.837  -8.413  1.00 75.61  ? 166 DT  J "C2'" 1 
ATOM   3383  C  "C1'" . DT  B 1 20  ? 81.470  72.860  -8.015  1.00 75.61  ? 166 DT  J "C1'" 1 
ATOM   3384  N  N1    . DT  B 1 20  ? 81.766  72.789  -6.574  1.00 115.63 ? 166 DT  J N1    1 
ATOM   3385  C  C2    . DT  B 1 20  ? 82.903  72.117  -6.189  1.00 115.63 ? 166 DT  J C2    1 
ATOM   3386  O  O2    . DT  B 1 20  ? 83.693  71.622  -6.984  1.00 115.63 ? 166 DT  J O2    1 
ATOM   3387  N  N3    . DT  B 1 20  ? 83.087  72.044  -4.831  1.00 115.63 ? 166 DT  J N3    1 
ATOM   3388  C  C4    . DT  B 1 20  ? 82.280  72.576  -3.844  1.00 115.63 ? 166 DT  J C4    1 
ATOM   3389  O  O4    . DT  B 1 20  ? 82.579  72.419  -2.662  1.00 115.63 ? 166 DT  J O4    1 
ATOM   3390  C  C5    . DT  B 1 20  ? 81.121  73.290  -4.319  1.00 115.63 ? 166 DT  J C5    1 
ATOM   3391  C  C7    . DT  B 1 20  ? 80.202  73.924  -3.323  1.00 115.63 ? 166 DT  J C7    1 
ATOM   3392  C  C6    . DT  B 1 20  ? 80.922  73.357  -5.644  1.00 115.63 ? 166 DT  J C6    1 
ATOM   3393  P  P     . DT  B 1 21  ? 79.287  71.214  -11.773 1.00 117.46 ? 167 DT  J P     1 
ATOM   3394  O  OP1   . DT  B 1 21  ? 79.328  71.807  -13.130 1.00 117.46 ? 167 DT  J OP1   1 
ATOM   3395  O  OP2   . DT  B 1 21  ? 77.976  71.021  -11.095 1.00 117.46 ? 167 DT  J OP2   1 
ATOM   3396  O  "O5'" . DT  B 1 21  ? 80.054  69.825  -11.816 1.00 112.13 ? 167 DT  J "O5'" 1 
ATOM   3397  C  "C5'" . DT  B 1 21  ? 81.319  69.746  -12.447 1.00 112.13 ? 167 DT  J "C5'" 1 
ATOM   3398  C  "C4'" . DT  B 1 21  ? 82.192  68.722  -11.763 1.00 112.13 ? 167 DT  J "C4'" 1 
ATOM   3399  O  "O4'" . DT  B 1 21  ? 82.476  69.115  -10.392 1.00 112.13 ? 167 DT  J "O4'" 1 
ATOM   3400  C  "C3'" . DT  B 1 21  ? 81.603  67.312  -11.691 1.00 112.13 ? 167 DT  J "C3'" 1 
ATOM   3401  O  "O3'" . DT  B 1 21  ? 82.628  66.374  -12.036 1.00 112.13 ? 167 DT  J "O3'" 1 
ATOM   3402  C  "C2'" . DT  B 1 21  ? 81.211  67.176  -10.230 1.00 112.13 ? 167 DT  J "C2'" 1 
ATOM   3403  C  "C1'" . DT  B 1 21  ? 82.316  67.973  -9.568  1.00 112.13 ? 167 DT  J "C1'" 1 
ATOM   3404  N  N1    . DT  B 1 21  ? 82.042  68.409  -8.183  1.00 103.01 ? 167 DT  J N1    1 
ATOM   3405  C  C2    . DT  B 1 21  ? 83.117  68.573  -7.325  1.00 103.01 ? 167 DT  J C2    1 
ATOM   3406  O  O2    . DT  B 1 21  ? 84.281  68.417  -7.665  1.00 103.01 ? 167 DT  J O2    1 
ATOM   3407  N  N3    . DT  B 1 21  ? 82.772  68.929  -6.042  1.00 103.01 ? 167 DT  J N3    1 
ATOM   3408  C  C4    . DT  B 1 21  ? 81.497  69.135  -5.543  1.00 103.01 ? 167 DT  J C4    1 
ATOM   3409  O  O4    . DT  B 1 21  ? 81.345  69.433  -4.363  1.00 103.01 ? 167 DT  J O4    1 
ATOM   3410  C  C5    . DT  B 1 21  ? 80.427  68.967  -6.499  1.00 103.01 ? 167 DT  J C5    1 
ATOM   3411  C  C7    . DT  B 1 21  ? 79.018  69.183  -6.052  1.00 103.01 ? 167 DT  J C7    1 
ATOM   3412  C  C6    . DT  B 1 21  ? 80.747  68.621  -7.755  1.00 103.01 ? 167 DT  J C6    1 
ATOM   3413  P  P     . DC  B 1 22  ? 82.711  64.963  -11.278 1.00 125.07 ? 168 DC  J P     1 
ATOM   3414  O  OP1   . DC  B 1 22  ? 83.681  64.123  -12.022 1.00 125.07 ? 168 DC  J OP1   1 
ATOM   3415  O  OP2   . DC  B 1 22  ? 81.327  64.469  -11.059 1.00 125.07 ? 168 DC  J OP2   1 
ATOM   3416  O  "O5'" . DC  B 1 22  ? 83.340  65.329  -9.860  1.00 169.04 ? 168 DC  J "O5'" 1 
ATOM   3417  C  "C5'" . DC  B 1 22  ? 84.743  65.212  -9.624  1.00 169.04 ? 168 DC  J "C5'" 1 
ATOM   3418  C  "C4'" . DC  B 1 22  ? 85.031  63.915  -8.906  1.00 169.04 ? 168 DC  J "C4'" 1 
ATOM   3419  O  "O4'" . DC  B 1 22  ? 84.826  64.115  -7.486  1.00 169.04 ? 168 DC  J "O4'" 1 
ATOM   3420  C  "C3'" . DC  B 1 22  ? 84.085  62.784  -9.312  1.00 169.04 ? 168 DC  J "C3'" 1 
ATOM   3421  O  "O3'" . DC  B 1 22  ? 84.764  61.524  -9.356  1.00 169.04 ? 168 DC  J "O3'" 1 
ATOM   3422  C  "C2'" . DC  B 1 22  ? 83.027  62.798  -8.228  1.00 169.04 ? 168 DC  J "C2'" 1 
ATOM   3423  C  "C1'" . DC  B 1 22  ? 83.809  63.245  -7.007  1.00 169.04 ? 168 DC  J "C1'" 1 
ATOM   3424  N  N1    . DC  B 1 22  ? 82.982  63.992  -6.047  1.00 110.48 ? 168 DC  J N1    1 
ATOM   3425  C  C2    . DC  B 1 22  ? 83.545  64.399  -4.833  1.00 110.48 ? 168 DC  J C2    1 
ATOM   3426  O  O2    . DC  B 1 22  ? 84.738  64.131  -4.602  1.00 110.48 ? 168 DC  J O2    1 
ATOM   3427  N  N3    . DC  B 1 22  ? 82.775  65.075  -3.946  1.00 110.48 ? 168 DC  J N3    1 
ATOM   3428  C  C4    . DC  B 1 22  ? 81.501  65.350  -4.238  1.00 110.48 ? 168 DC  J C4    1 
ATOM   3429  N  N4    . DC  B 1 22  ? 80.784  66.026  -3.342  1.00 110.48 ? 168 DC  J N4    1 
ATOM   3430  C  C5    . DC  B 1 22  ? 80.905  64.947  -5.467  1.00 110.48 ? 168 DC  J C5    1 
ATOM   3431  C  C6    . DC  B 1 22  ? 81.674  64.278  -6.334  1.00 110.48 ? 168 DC  J C6    1 
ATOM   3432  P  P     . DT  B 1 23  ? 83.924  60.159  -9.216  1.00 121.12 ? 169 DT  J P     1 
ATOM   3433  O  OP1   . DT  B 1 23  ? 84.690  59.072  -9.875  1.00 121.12 ? 169 DT  J OP1   1 
ATOM   3434  O  OP2   . DT  B 1 23  ? 82.515  60.418  -9.628  1.00 121.12 ? 169 DT  J OP2   1 
ATOM   3435  O  "O5'" . DT  B 1 23  ? 83.966  59.889  -7.651  1.00 150.72 ? 169 DT  J "O5'" 1 
ATOM   3436  C  "C5'" . DT  B 1 23  ? 85.217  59.757  -6.983  1.00 150.72 ? 169 DT  J "C5'" 1 
ATOM   3437  C  "C4'" . DT  B 1 23  ? 85.050  58.923  -5.737  1.00 150.72 ? 169 DT  J "C4'" 1 
ATOM   3438  O  "O4'" . DT  B 1 23  ? 84.383  59.720  -4.727  1.00 150.72 ? 169 DT  J "O4'" 1 
ATOM   3439  C  "C3'" . DT  B 1 23  ? 84.198  57.666  -5.944  1.00 150.72 ? 169 DT  J "C3'" 1 
ATOM   3440  O  "O3'" . DT  B 1 23  ? 84.800  56.519  -5.317  1.00 150.72 ? 169 DT  J "O3'" 1 
ATOM   3441  C  "C2'" . DT  B 1 23  ? 82.857  58.034  -5.330  1.00 150.72 ? 169 DT  J "C2'" 1 
ATOM   3442  C  "C1'" . DT  B 1 23  ? 83.215  59.061  -4.263  1.00 150.72 ? 169 DT  J "C1'" 1 
ATOM   3443  N  N1    . DT  B 1 23  ? 82.164  60.085  -4.039  1.00 138.36 ? 169 DT  J N1    1 
ATOM   3444  C  C2    . DT  B 1 23  ? 82.188  60.830  -2.873  1.00 138.36 ? 169 DT  J C2    1 
ATOM   3445  O  O2    . DT  B 1 23  ? 83.056  60.720  -2.021  1.00 138.36 ? 169 DT  J O2    1 
ATOM   3446  N  N3    . DT  B 1 23  ? 81.147  61.722  -2.744  1.00 138.36 ? 169 DT  J N3    1 
ATOM   3447  C  C4    . DT  B 1 23  ? 80.125  61.952  -3.647  1.00 138.36 ? 169 DT  J C4    1 
ATOM   3448  O  O4    . DT  B 1 23  ? 79.262  62.790  -3.392  1.00 138.36 ? 169 DT  J O4    1 
ATOM   3449  C  C5    . DT  B 1 23  ? 80.170  61.150  -4.849  1.00 138.36 ? 169 DT  J C5    1 
ATOM   3450  C  C7    . DT  B 1 23  ? 79.103  61.330  -5.883  1.00 138.36 ? 169 DT  J C7    1 
ATOM   3451  C  C6    . DT  B 1 23  ? 81.173  60.272  -4.983  1.00 138.36 ? 169 DT  J C6    1 
ATOM   3452  P  P     . DA  B 1 24  ? 84.064  55.080  -5.376  1.00 140.46 ? 170 DA  J P     1 
ATOM   3453  O  OP1   . DA  B 1 24  ? 85.105  54.021  -5.462  1.00 140.46 ? 170 DA  J OP1   1 
ATOM   3454  O  OP2   . DA  B 1 24  ? 82.969  55.109  -6.382  1.00 140.46 ? 170 DA  J OP2   1 
ATOM   3455  O  "O5'" . DA  B 1 24  ? 83.402  54.996  -3.935  1.00 126.15 ? 170 DA  J "O5'" 1 
ATOM   3456  C  "C5'" . DA  B 1 24  ? 84.144  55.396  -2.788  1.00 126.15 ? 170 DA  J "C5'" 1 
ATOM   3457  C  "C4'" . DA  B 1 24  ? 83.251  55.411  -1.573  1.00 126.15 ? 170 DA  J "C4'" 1 
ATOM   3458  O  "O4'" . DA  B 1 24  ? 82.447  56.618  -1.533  1.00 126.15 ? 170 DA  J "O4'" 1 
ATOM   3459  C  "C3'" . DA  B 1 24  ? 82.272  54.237  -1.519  1.00 126.15 ? 170 DA  J "C3'" 1 
ATOM   3460  O  "O3'" . DA  B 1 24  ? 82.262  53.677  -0.204  1.00 126.15 ? 170 DA  J "O3'" 1 
ATOM   3461  C  "C2'" . DA  B 1 24  ? 80.934  54.877  -1.853  1.00 126.15 ? 170 DA  J "C2'" 1 
ATOM   3462  C  "C1'" . DA  B 1 24  ? 81.096  56.270  -1.273  1.00 126.15 ? 170 DA  J "C1'" 1 
ATOM   3463  N  N9    . DA  B 1 24  ? 80.229  57.290  -1.869  1.00 111.14 ? 170 DA  J N9    1 
ATOM   3464  C  C8    . DA  B 1 24  ? 79.755  57.330  -3.159  1.00 111.14 ? 170 DA  J C8    1 
ATOM   3465  N  N7    . DA  B 1 24  ? 78.984  58.362  -3.411  1.00 111.14 ? 170 DA  J N7    1 
ATOM   3466  C  C5    . DA  B 1 24  ? 78.948  59.052  -2.209  1.00 111.14 ? 170 DA  J C5    1 
ATOM   3467  C  C6    . DA  B 1 24  ? 78.303  60.237  -1.825  1.00 111.14 ? 170 DA  J C6    1 
ATOM   3468  N  N6    . DA  B 1 24  ? 77.543  60.966  -2.652  1.00 111.14 ? 170 DA  J N6    1 
ATOM   3469  N  N1    . DA  B 1 24  ? 78.467  60.655  -0.550  1.00 111.14 ? 170 DA  J N1    1 
ATOM   3470  C  C2    . DA  B 1 24  ? 79.234  59.924  0.273   1.00 111.14 ? 170 DA  J C2    1 
ATOM   3471  N  N3    . DA  B 1 24  ? 79.895  58.795  0.028   1.00 111.14 ? 170 DA  J N3    1 
ATOM   3472  C  C4    . DA  B 1 24  ? 79.710  58.405  -1.246  1.00 111.14 ? 170 DA  J C4    1 
ATOM   3473  P  P     . DC  B 1 25  ? 81.172  52.564  0.182   1.00 146.06 ? 171 DC  J P     1 
ATOM   3474  O  OP1   . DC  B 1 25  ? 81.870  51.480  0.910   1.00 146.06 ? 171 DC  J OP1   1 
ATOM   3475  O  OP2   . DC  B 1 25  ? 80.382  52.241  -1.038  1.00 146.06 ? 171 DC  J OP2   1 
ATOM   3476  O  "O5'" . DC  B 1 25  ? 80.231  53.332  1.211   1.00 102.70 ? 171 DC  J "O5'" 1 
ATOM   3477  C  "C5'" . DC  B 1 25  ? 80.783  54.237  2.177   1.00 102.70 ? 171 DC  J "C5'" 1 
ATOM   3478  C  "C4'" . DC  B 1 25  ? 79.759  54.541  3.246   1.00 102.70 ? 171 DC  J "C4'" 1 
ATOM   3479  O  "O4'" . DC  B 1 25  ? 78.961  55.677  2.833   1.00 102.70 ? 171 DC  J "O4'" 1 
ATOM   3480  C  "C3'" . DC  B 1 25  ? 78.777  53.395  3.454   1.00 102.70 ? 171 DC  J "C3'" 1 
ATOM   3481  O  "O3'" . DC  B 1 25  ? 78.413  53.248  4.822   1.00 102.70 ? 171 DC  J "O3'" 1 
ATOM   3482  C  "C2'" . DC  B 1 25  ? 77.582  53.775  2.601   1.00 102.70 ? 171 DC  J "C2'" 1 
ATOM   3483  C  "C1'" . DC  B 1 25  ? 77.607  55.294  2.603   1.00 102.70 ? 171 DC  J "C1'" 1 
ATOM   3484  N  N1    . DC  B 1 25  ? 77.193  55.870  1.310   1.00 103.61 ? 171 DC  J N1    1 
ATOM   3485  C  C2    . DC  B 1 25  ? 76.563  57.117  1.292   1.00 103.61 ? 171 DC  J C2    1 
ATOM   3486  O  O2    . DC  B 1 25  ? 76.386  57.714  2.364   1.00 103.61 ? 171 DC  J O2    1 
ATOM   3487  N  N3    . DC  B 1 25  ? 76.167  57.639  0.103   1.00 103.61 ? 171 DC  J N3    1 
ATOM   3488  C  C4    . DC  B 1 25  ? 76.388  56.965  -1.033  1.00 103.61 ? 171 DC  J C4    1 
ATOM   3489  N  N4    . DC  B 1 25  ? 75.980  57.512  -2.182  1.00 103.61 ? 171 DC  J N4    1 
ATOM   3490  C  C5    . DC  B 1 25  ? 77.036  55.698  -1.042  1.00 103.61 ? 171 DC  J C5    1 
ATOM   3491  C  C6    . DC  B 1 25  ? 77.417  55.192  0.140   1.00 103.61 ? 171 DC  J C6    1 
ATOM   3492  P  P     . DC  B 1 26  ? 77.467  52.027  5.243   1.00 104.62 ? 172 DC  J P     1 
ATOM   3493  O  OP1   . DC  B 1 26  ? 77.166  52.126  6.691   1.00 104.62 ? 172 DC  J OP1   1 
ATOM   3494  O  OP2   . DC  B 1 26  ? 78.051  50.773  4.698   1.00 104.62 ? 172 DC  J OP2   1 
ATOM   3495  O  "O5'" . DC  B 1 26  ? 76.142  52.327  4.417   1.00 98.24  ? 172 DC  J "O5'" 1 
ATOM   3496  C  "C5'" . DC  B 1 26  ? 74.897  51.752  4.791   1.00 98.24  ? 172 DC  J "C5'" 1 
ATOM   3497  C  "C4'" . DC  B 1 26  ? 74.025  52.795  5.449   1.00 98.24  ? 172 DC  J "C4'" 1 
ATOM   3498  O  "O4'" . DC  B 1 26  ? 74.009  54.001  4.654   1.00 98.24  ? 172 DC  J "O4'" 1 
ATOM   3499  C  "C3'" . DC  B 1 26  ? 72.572  52.374  5.604   1.00 98.24  ? 172 DC  J "C3'" 1 
ATOM   3500  O  "O3'" . DC  B 1 26  ? 72.055  52.906  6.818   1.00 98.24  ? 172 DC  J "O3'" 1 
ATOM   3501  C  "C2'" . DC  B 1 26  ? 71.895  52.997  4.399   1.00 98.24  ? 172 DC  J "C2'" 1 
ATOM   3502  C  "C1'" . DC  B 1 26  ? 72.709  54.253  4.147   1.00 98.24  ? 172 DC  J "C1'" 1 
ATOM   3503  N  N1    . DC  B 1 26  ? 72.857  54.560  2.721   1.00 99.46  ? 172 DC  J N1    1 
ATOM   3504  C  C2    . DC  B 1 26  ? 73.074  55.882  2.330   1.00 99.46  ? 172 DC  J C2    1 
ATOM   3505  O  O2    . DC  B 1 26  ? 73.099  56.773  3.200   1.00 99.46  ? 172 DC  J O2    1 
ATOM   3506  N  N3    . DC  B 1 26  ? 73.245  56.159  1.014   1.00 99.46  ? 172 DC  J N3    1 
ATOM   3507  C  C4    . DC  B 1 26  ? 73.189  55.175  0.111   1.00 99.46  ? 172 DC  J C4    1 
ATOM   3508  N  N4    . DC  B 1 26  ? 73.367  55.490  -1.176  1.00 99.46  ? 172 DC  J N4    1 
ATOM   3509  C  C5    . DC  B 1 26  ? 72.950  53.826  0.487   1.00 99.46  ? 172 DC  J C5    1 
ATOM   3510  C  C6    . DC  B 1 26  ? 72.794  53.565  1.788   1.00 99.46  ? 172 DC  J C6    1 
ATOM   3511  P  P     . DA  B 1 27  ? 71.116  51.999  7.751   1.00 138.20 ? 173 DA  J P     1 
ATOM   3512  O  OP1   . DA  B 1 27  ? 71.910  51.554  8.925   1.00 138.20 ? 173 DA  J OP1   1 
ATOM   3513  O  OP2   . DA  B 1 27  ? 70.438  50.985  6.897   1.00 138.20 ? 173 DA  J OP2   1 
ATOM   3514  O  "O5'" . DA  B 1 27  ? 70.031  53.048  8.253   1.00 80.00  ? 173 DA  J "O5'" 1 
ATOM   3515  C  "C5'" . DA  B 1 27  ? 70.400  54.410  8.483   1.00 80.00  ? 173 DA  J "C5'" 1 
ATOM   3516  C  "C4'" . DA  B 1 27  ? 69.457  55.338  7.754   1.00 80.00  ? 173 DA  J "C4'" 1 
ATOM   3517  O  "O4'" . DA  B 1 27  ? 69.713  55.294  6.325   1.00 80.00  ? 173 DA  J "O4'" 1 
ATOM   3518  C  "C3'" . DA  B 1 27  ? 67.985  54.978  7.939   1.00 80.00  ? 173 DA  J "C3'" 1 
ATOM   3519  O  "O3'" . DA  B 1 27  ? 67.207  56.149  8.169   1.00 80.00  ? 173 DA  J "O3'" 1 
ATOM   3520  C  "C2'" . DA  B 1 27  ? 67.602  54.341  6.615   1.00 80.00  ? 173 DA  J "C2'" 1 
ATOM   3521  C  "C1'" . DA  B 1 27  ? 68.505  55.050  5.625   1.00 80.00  ? 173 DA  J "C1'" 1 
ATOM   3522  N  N9    . DA  B 1 27  ? 68.815  54.242  4.443   1.00 81.91  ? 173 DA  J N9    1 
ATOM   3523  C  C8    . DA  B 1 27  ? 68.714  52.878  4.330   1.00 81.91  ? 173 DA  J C8    1 
ATOM   3524  N  N7    . DA  B 1 27  ? 69.046  52.416  3.146   1.00 81.91  ? 173 DA  J N7    1 
ATOM   3525  C  C5    . DA  B 1 27  ? 69.393  53.553  2.430   1.00 81.91  ? 173 DA  J C5    1 
ATOM   3526  C  C6    . DA  B 1 27  ? 69.841  53.740  1.104   1.00 81.91  ? 173 DA  J C6    1 
ATOM   3527  N  N6    . DA  B 1 27  ? 70.026  52.746  0.229   1.00 81.91  ? 173 DA  J N6    1 
ATOM   3528  N  N1    . DA  B 1 27  ? 70.097  55.000  0.703   1.00 81.91  ? 173 DA  J N1    1 
ATOM   3529  C  C2    . DA  B 1 27  ? 69.919  55.997  1.579   1.00 81.91  ? 173 DA  J C2    1 
ATOM   3530  N  N3    . DA  B 1 27  ? 69.508  55.950  2.848   1.00 81.91  ? 173 DA  J N3    1 
ATOM   3531  C  C4    . DA  B 1 27  ? 69.257  54.686  3.217   1.00 81.91  ? 173 DA  J C4    1 
ATOM   3532  P  P     . DA  B 1 28  ? 65.692  56.011  8.692   1.00 126.78 ? 174 DA  J P     1 
ATOM   3533  O  OP1   . DA  B 1 28  ? 65.648  56.471  10.105  1.00 126.78 ? 174 DA  J OP1   1 
ATOM   3534  O  OP2   . DA  B 1 28  ? 65.191  54.658  8.342   1.00 126.78 ? 174 DA  J OP2   1 
ATOM   3535  O  "O5'" . DA  B 1 28  ? 64.893  57.045  7.786   1.00 83.96  ? 174 DA  J "O5'" 1 
ATOM   3536  C  "C5'" . DA  B 1 28  ? 65.579  58.106  7.127   1.00 83.96  ? 174 DA  J "C5'" 1 
ATOM   3537  C  "C4'" . DA  B 1 28  ? 65.105  58.227  5.698   1.00 83.96  ? 174 DA  J "C4'" 1 
ATOM   3538  O  "O4'" . DA  B 1 28  ? 65.700  57.224  4.834   1.00 83.96  ? 174 DA  J "O4'" 1 
ATOM   3539  C  "C3'" . DA  B 1 28  ? 63.591  58.105  5.522   1.00 83.96  ? 174 DA  J "C3'" 1 
ATOM   3540  O  "O3'" . DA  B 1 28  ? 63.146  59.119  4.627   1.00 83.96  ? 174 DA  J "O3'" 1 
ATOM   3541  C  "C2'" . DA  B 1 28  ? 63.417  56.742  4.873   1.00 83.96  ? 174 DA  J "C2'" 1 
ATOM   3542  C  "C1'" . DA  B 1 28  ? 64.677  56.648  4.034   1.00 83.96  ? 174 DA  J "C1'" 1 
ATOM   3543  N  N9    . DA  B 1 28  ? 65.078  55.287  3.678   1.00 86.48  ? 174 DA  J N9    1 
ATOM   3544  C  C8    . DA  B 1 28  ? 64.953  54.152  4.434   1.00 86.48  ? 174 DA  J C8    1 
ATOM   3545  N  N7    . DA  B 1 28  ? 65.365  53.065  3.826   1.00 86.48  ? 174 DA  J N7    1 
ATOM   3546  C  C5    . DA  B 1 28  ? 65.796  53.518  2.587   1.00 86.48  ? 174 DA  J C5    1 
ATOM   3547  C  C6    . DA  B 1 28  ? 66.329  52.852  1.465   1.00 86.48  ? 174 DA  J C6    1 
ATOM   3548  N  N6    . DA  B 1 28  ? 66.515  51.533  1.401   1.00 86.48  ? 174 DA  J N6    1 
ATOM   3549  N  N1    . DA  B 1 28  ? 66.660  53.598  0.394   1.00 86.48  ? 174 DA  J N1    1 
ATOM   3550  C  C2    . DA  B 1 28  ? 66.459  54.914  0.450   1.00 86.48  ? 174 DA  J C2    1 
ATOM   3551  N  N3    . DA  B 1 28  ? 65.957  55.652  1.437   1.00 86.48  ? 174 DA  J N3    1 
ATOM   3552  C  C4    . DA  B 1 28  ? 65.640  54.885  2.489   1.00 86.48  ? 174 DA  J C4    1 
ATOM   3553  P  P     . DA  B 1 29  ? 62.123  60.238  5.145   1.00 117.29 ? 175 DA  J P     1 
ATOM   3554  O  OP1   . DA  B 1 29  ? 62.815  61.557  5.183   1.00 117.29 ? 175 DA  J OP1   1 
ATOM   3555  O  OP2   . DA  B 1 29  ? 61.481  59.709  6.372   1.00 117.29 ? 175 DA  J OP2   1 
ATOM   3556  O  "O5'" . DA  B 1 29  ? 61.025  60.265  3.999   1.00 81.99  ? 175 DA  J "O5'" 1 
ATOM   3557  C  "C5'" . DA  B 1 29  ? 60.698  59.079  3.291   1.00 81.99  ? 175 DA  J "C5'" 1 
ATOM   3558  C  "C4'" . DA  B 1 29  ? 61.258  59.153  1.892   1.00 81.99  ? 175 DA  J "C4'" 1 
ATOM   3559  O  "O4'" . DA  B 1 29  ? 62.195  58.073  1.717   1.00 81.99  ? 175 DA  J "O4'" 1 
ATOM   3560  C  "C3'" . DA  B 1 29  ? 60.213  58.992  0.790   1.00 81.99  ? 175 DA  J "C3'" 1 
ATOM   3561  O  "O3'" . DA  B 1 29  ? 60.566  59.777  -0.354  1.00 81.99  ? 175 DA  J "O3'" 1 
ATOM   3562  C  "C2'" . DA  B 1 29  ? 60.282  57.515  0.466   1.00 81.99  ? 175 DA  J "C2'" 1 
ATOM   3563  C  "C1'" . DA  B 1 29  ? 61.747  57.202  0.693   1.00 81.99  ? 175 DA  J "C1'" 1 
ATOM   3564  N  N9    . DA  B 1 29  ? 61.997  55.832  1.130   1.00 86.90  ? 175 DA  J N9    1 
ATOM   3565  C  C8    . DA  B 1 29  ? 61.809  55.272  2.371   1.00 86.90  ? 175 DA  J C8    1 
ATOM   3566  N  N7    . DA  B 1 29  ? 62.159  54.012  2.437   1.00 86.90  ? 175 DA  J N7    1 
ATOM   3567  C  C5    . DA  B 1 29  ? 62.604  53.723  1.152   1.00 86.90  ? 175 DA  J C5    1 
ATOM   3568  C  C6    . DA  B 1 29  ? 63.120  52.553  0.566   1.00 86.90  ? 175 DA  J C6    1 
ATOM   3569  N  N6    . DA  B 1 29  ? 63.293  51.409  1.230   1.00 86.90  ? 175 DA  J N6    1 
ATOM   3570  N  N1    . DA  B 1 29  ? 63.461  52.602  -0.744  1.00 86.90  ? 175 DA  J N1    1 
ATOM   3571  C  C2    . DA  B 1 29  ? 63.298  53.754  -1.407  1.00 86.90  ? 175 DA  J C2    1 
ATOM   3572  N  N3    . DA  B 1 29  ? 62.834  54.917  -0.966  1.00 86.90  ? 175 DA  J N3    1 
ATOM   3573  C  C4    . DA  B 1 29  ? 62.501  54.833  0.337   1.00 86.90  ? 175 DA  J C4    1 
ATOM   3574  P  P     . DA  B 1 30  ? 59.413  60.449  -1.252  1.00 79.70  ? 176 DA  J P     1 
ATOM   3575  O  OP1   . DA  B 1 30  ? 59.973  61.726  -1.777  1.00 79.70  ? 176 DA  J OP1   1 
ATOM   3576  O  OP2   . DA  B 1 30  ? 58.124  60.442  -0.503  1.00 79.70  ? 176 DA  J OP2   1 
ATOM   3577  O  "O5'" . DA  B 1 30  ? 59.237  59.445  -2.465  1.00 61.35  ? 176 DA  J "O5'" 1 
ATOM   3578  C  "C5'" . DA  B 1 30  ? 60.304  59.214  -3.362  1.00 61.35  ? 176 DA  J "C5'" 1 
ATOM   3579  C  "C4'" . DA  B 1 30  ? 60.094  57.896  -4.063  1.00 61.35  ? 176 DA  J "C4'" 1 
ATOM   3580  O  "O4'" . DA  B 1 30  ? 60.399  56.772  -3.200  1.00 61.35  ? 176 DA  J "O4'" 1 
ATOM   3581  C  "C3'" . DA  B 1 30  ? 58.665  57.673  -4.552  1.00 61.35  ? 176 DA  J "C3'" 1 
ATOM   3582  O  "O3'" . DA  B 1 30  ? 58.742  57.072  -5.827  1.00 61.35  ? 176 DA  J "O3'" 1 
ATOM   3583  C  "C2'" . DA  B 1 30  ? 58.107  56.662  -3.564  1.00 61.35  ? 176 DA  J "C2'" 1 
ATOM   3584  C  "C1'" . DA  B 1 30  ? 59.343  55.831  -3.302  1.00 61.35  ? 176 DA  J "C1'" 1 
ATOM   3585  N  N9    . DA  B 1 30  ? 59.344  55.007  -2.093  1.00 72.02  ? 176 DA  J N9    1 
ATOM   3586  C  C8    . DA  B 1 30  ? 58.939  55.328  -0.822  1.00 72.02  ? 176 DA  J C8    1 
ATOM   3587  N  N7    . DA  B 1 30  ? 59.093  54.355  0.045   1.00 72.02  ? 176 DA  J N7    1 
ATOM   3588  C  C5    . DA  B 1 30  ? 59.630  53.319  -0.710  1.00 72.02  ? 176 DA  J C5    1 
ATOM   3589  C  C6    . DA  B 1 30  ? 60.023  52.005  -0.383  1.00 72.02  ? 176 DA  J C6    1 
ATOM   3590  N  N6    . DA  B 1 30  ? 59.936  51.487  0.846   1.00 72.02  ? 176 DA  J N6    1 
ATOM   3591  N  N1    . DA  B 1 30  ? 60.517  51.231  -1.377  1.00 72.02  ? 176 DA  J N1    1 
ATOM   3592  C  C2    . DA  B 1 30  ? 60.610  51.748  -2.605  1.00 72.02  ? 176 DA  J C2    1 
ATOM   3593  N  N3    . DA  B 1 30  ? 60.277  52.960  -3.035  1.00 72.02  ? 176 DA  J N3    1 
ATOM   3594  C  C4    . DA  B 1 30  ? 59.787  53.707  -2.028  1.00 72.02  ? 176 DA  J C4    1 
ATOM   3595  P  P     . DG  B 1 31  ? 57.528  57.225  -6.847  1.00 78.59  ? 177 DG  J P     1 
ATOM   3596  O  OP1   . DG  B 1 31  ? 57.802  58.347  -7.789  1.00 78.59  ? 177 DG  J OP1   1 
ATOM   3597  O  OP2   . DG  B 1 31  ? 56.282  57.233  -6.034  1.00 78.59  ? 177 DG  J OP2   1 
ATOM   3598  O  "O5'" . DG  B 1 31  ? 57.608  55.866  -7.670  1.00 79.54  ? 177 DG  J "O5'" 1 
ATOM   3599  C  "C5'" . DG  B 1 31  ? 58.866  55.378  -8.137  1.00 79.54  ? 177 DG  J "C5'" 1 
ATOM   3600  C  "C4'" . DG  B 1 31  ? 58.877  53.868  -8.134  1.00 79.54  ? 177 DG  J "C4'" 1 
ATOM   3601  O  "O4'" . DG  B 1 31  ? 59.099  53.337  -6.798  1.00 79.54  ? 177 DG  J "O4'" 1 
ATOM   3602  C  "C3'" . DG  B 1 31  ? 57.580  53.242  -8.640  1.00 79.54  ? 177 DG  J "C3'" 1 
ATOM   3603  O  "O3'" . DG  B 1 31  ? 57.862  52.259  -9.631  1.00 79.54  ? 177 DG  J "O3'" 1 
ATOM   3604  C  "C2'" . DG  B 1 31  ? 56.975  52.602  -7.400  1.00 79.54  ? 177 DG  J "C2'" 1 
ATOM   3605  C  "C1'" . DG  B 1 31  ? 58.189  52.282  -6.548  1.00 79.54  ? 177 DG  J "C1'" 1 
ATOM   3606  N  N9    . DG  B 1 31  ? 57.886  52.268  -5.122  1.00 74.30  ? 177 DG  J N9    1 
ATOM   3607  C  C8    . DG  B 1 31  ? 57.604  53.354  -4.339  1.00 74.30  ? 177 DG  J C8    1 
ATOM   3608  N  N7    . DG  B 1 31  ? 57.290  53.036  -3.114  1.00 74.30  ? 177 DG  J N7    1 
ATOM   3609  C  C5    . DG  B 1 31  ? 57.388  51.655  -3.081  1.00 74.30  ? 177 DG  J C5    1 
ATOM   3610  C  C6    . DG  B 1 31  ? 57.142  50.742  -2.019  1.00 74.30  ? 177 DG  J C6    1 
ATOM   3611  O  O6    . DG  B 1 31  ? 56.746  50.984  -0.874  1.00 74.30  ? 177 DG  J O6    1 
ATOM   3612  N  N1    . DG  B 1 31  ? 57.383  49.427  -2.405  1.00 74.30  ? 177 DG  J N1    1 
ATOM   3613  C  C2    . DG  B 1 31  ? 57.785  49.035  -3.654  1.00 74.30  ? 177 DG  J C2    1 
ATOM   3614  N  N2    . DG  B 1 31  ? 57.966  47.708  -3.808  1.00 74.30  ? 177 DG  J N2    1 
ATOM   3615  N  N3    . DG  B 1 31  ? 57.994  49.876  -4.666  1.00 74.30  ? 177 DG  J N3    1 
ATOM   3616  C  C4    . DG  B 1 31  ? 57.780  51.164  -4.306  1.00 74.30  ? 177 DG  J C4    1 
ATOM   3617  P  P     . DT  B 1 32  ? 56.656  51.604  -10.466 1.00 114.94 ? 178 DT  J P     1 
ATOM   3618  O  OP1   . DT  B 1 32  ? 57.228  51.287  -11.799 1.00 114.94 ? 178 DT  J OP1   1 
ATOM   3619  O  OP2   . DT  B 1 32  ? 55.438  52.451  -10.382 1.00 114.94 ? 178 DT  J OP2   1 
ATOM   3620  O  "O5'" . DT  B 1 32  ? 56.384  50.247  -9.679  1.00 105.86 ? 178 DT  J "O5'" 1 
ATOM   3621  C  "C5'" . DT  B 1 32  ? 57.435  49.302  -9.500  1.00 105.86 ? 178 DT  J "C5'" 1 
ATOM   3622  C  "C4'" . DT  B 1 32  ? 56.899  48.008  -8.935  1.00 105.86 ? 178 DT  J "C4'" 1 
ATOM   3623  O  "O4'" . DT  B 1 32  ? 56.708  48.117  -7.505  1.00 105.86 ? 178 DT  J "O4'" 1 
ATOM   3624  C  "C3'" . DT  B 1 32  ? 55.571  47.521  -9.522  1.00 105.86 ? 178 DT  J "C3'" 1 
ATOM   3625  O  "O3'" . DT  B 1 32  ? 55.668  46.119  -9.828  1.00 105.86 ? 178 DT  J "O3'" 1 
ATOM   3626  C  "C2'" . DT  B 1 32  ? 54.570  47.804  -8.409  1.00 105.86 ? 178 DT  J "C2'" 1 
ATOM   3627  C  "C1'" . DT  B 1 32  ? 55.416  47.653  -7.155  1.00 105.86 ? 178 DT  J "C1'" 1 
ATOM   3628  N  N1    . DT  B 1 32  ? 54.966  48.436  -5.990  1.00 111.58 ? 178 DT  J N1    1 
ATOM   3629  C  C2    . DT  B 1 32  ? 54.948  47.817  -4.752  1.00 111.58 ? 178 DT  J C2    1 
ATOM   3630  O  O2    . DT  B 1 32  ? 55.241  46.642  -4.579  1.00 111.58 ? 178 DT  J O2    1 
ATOM   3631  N  N3    . DT  B 1 32  ? 54.567  48.628  -3.716  1.00 111.58 ? 178 DT  J N3    1 
ATOM   3632  C  C4    . DT  B 1 32  ? 54.205  49.961  -3.781  1.00 111.58 ? 178 DT  J C4    1 
ATOM   3633  O  O4    . DT  B 1 32  ? 53.910  50.564  -2.745  1.00 111.58 ? 178 DT  J O4    1 
ATOM   3634  C  C5    . DT  B 1 32  ? 54.215  50.537  -5.114  1.00 111.58 ? 178 DT  J C5    1 
ATOM   3635  C  C7    . DT  B 1 32  ? 53.805  51.964  -5.293  1.00 111.58 ? 178 DT  J C7    1 
ATOM   3636  C  C6    . DT  B 1 32  ? 54.592  49.755  -6.136  1.00 111.58 ? 178 DT  J C6    1 
ATOM   3637  P  P     . DG  B 1 33  ? 54.516  45.384  -10.687 1.00 98.21  ? 179 DG  J P     1 
ATOM   3638  O  OP1   . DG  B 1 33  ? 55.164  44.590  -11.763 1.00 98.21  ? 179 DG  J OP1   1 
ATOM   3639  O  OP2   . DG  B 1 33  ? 53.439  46.352  -11.039 1.00 98.21  ? 179 DG  J OP2   1 
ATOM   3640  O  "O5'" . DG  B 1 33  ? 53.926  44.374  -9.615  1.00 108.05 ? 179 DG  J "O5'" 1 
ATOM   3641  C  "C5'" . DG  B 1 33  ? 54.796  43.714  -8.695  1.00 108.05 ? 179 DG  J "C5'" 1 
ATOM   3642  C  "C4'" . DG  B 1 33  ? 53.985  43.047  -7.615  1.00 108.05 ? 179 DG  J "C4'" 1 
ATOM   3643  O  "O4'" . DG  B 1 33  ? 53.813  43.920  -6.471  1.00 108.05 ? 179 DG  J "O4'" 1 
ATOM   3644  C  "C3'" . DG  B 1 33  ? 52.581  42.697  -8.103  1.00 108.05 ? 179 DG  J "C3'" 1 
ATOM   3645  O  "O3'" . DG  B 1 33  ? 52.189  41.408  -7.653  1.00 108.05 ? 179 DG  J "O3'" 1 
ATOM   3646  C  "C2'" . DG  B 1 33  ? 51.708  43.756  -7.458  1.00 108.05 ? 179 DG  J "C2'" 1 
ATOM   3647  C  "C1'" . DG  B 1 33  ? 52.434  43.982  -6.150  1.00 108.05 ? 179 DG  J "C1'" 1 
ATOM   3648  N  N9    . DG  B 1 33  ? 52.154  45.278  -5.550  1.00 80.42  ? 179 DG  J N9    1 
ATOM   3649  C  C8    . DG  B 1 33  ? 52.028  46.481  -6.199  1.00 80.42  ? 179 DG  J C8    1 
ATOM   3650  N  N7    . DG  B 1 33  ? 51.713  47.461  -5.401  1.00 80.42  ? 179 DG  J N7    1 
ATOM   3651  C  C5    . DG  B 1 33  ? 51.638  46.871  -4.145  1.00 80.42  ? 179 DG  J C5    1 
ATOM   3652  C  C6    . DG  B 1 33  ? 51.314  47.434  -2.872  1.00 80.42  ? 179 DG  J C6    1 
ATOM   3653  O  O6    . DG  B 1 33  ? 51.018  48.604  -2.589  1.00 80.42  ? 179 DG  J O6    1 
ATOM   3654  N  N1    . DG  B 1 33  ? 51.352  46.476  -1.866  1.00 80.42  ? 179 DG  J N1    1 
ATOM   3655  C  C2    . DG  B 1 33  ? 51.664  45.155  -2.047  1.00 80.42  ? 179 DG  J C2    1 
ATOM   3656  N  N2    . DG  B 1 33  ? 51.647  44.408  -0.935  1.00 80.42  ? 179 DG  J N2    1 
ATOM   3657  N  N3    . DG  B 1 33  ? 51.966  44.615  -3.222  1.00 80.42  ? 179 DG  J N3    1 
ATOM   3658  C  C4    . DG  B 1 33  ? 51.927  45.527  -4.220  1.00 80.42  ? 179 DG  J C4    1 
ATOM   3659  P  P     . DT  B 1 34  ? 50.949  40.677  -8.354  1.00 136.92 ? 180 DT  J P     1 
ATOM   3660  O  OP1   . DT  B 1 34  ? 51.477  39.597  -9.220  1.00 136.92 ? 180 DT  J OP1   1 
ATOM   3661  O  OP2   . DT  B 1 34  ? 50.064  41.716  -8.943  1.00 136.92 ? 180 DT  J OP2   1 
ATOM   3662  O  "O5'" . DT  B 1 34  ? 50.196  40.022  -7.120  1.00 101.12 ? 180 DT  J "O5'" 1 
ATOM   3663  C  "C5'" . DT  B 1 34  ? 48.937  40.510  -6.692  1.00 101.12 ? 180 DT  J "C5'" 1 
ATOM   3664  C  "C4'" . DT  B 1 34  ? 48.822  40.378  -5.194  1.00 101.12 ? 180 DT  J "C4'" 1 
ATOM   3665  O  "O4'" . DT  B 1 34  ? 49.304  41.596  -4.567  1.00 101.12 ? 180 DT  J "O4'" 1 
ATOM   3666  C  "C3'" . DT  B 1 34  ? 47.377  40.205  -4.740  1.00 101.12 ? 180 DT  J "C3'" 1 
ATOM   3667  O  "O3'" . DT  B 1 34  ? 47.268  39.211  -3.724  1.00 101.12 ? 180 DT  J "O3'" 1 
ATOM   3668  C  "C2'" . DT  B 1 34  ? 46.983  41.570  -4.218  1.00 101.12 ? 180 DT  J "C2'" 1 
ATOM   3669  C  "C1'" . DT  B 1 34  ? 48.295  42.149  -3.727  1.00 101.12 ? 180 DT  J "C1'" 1 
ATOM   3670  N  N1    . DT  B 1 34  ? 48.314  43.629  -3.854  1.00 87.11  ? 180 DT  J N1    1 
ATOM   3671  C  C2    . DT  B 1 34  ? 48.075  44.380  -2.721  1.00 87.11  ? 180 DT  J C2    1 
ATOM   3672  O  O2    . DT  B 1 34  ? 47.954  43.895  -1.610  1.00 87.11  ? 180 DT  J O2    1 
ATOM   3673  N  N3    . DT  B 1 34  ? 47.992  45.727  -2.937  1.00 87.11  ? 180 DT  J N3    1 
ATOM   3674  C  C4    . DT  B 1 34  ? 48.144  46.394  -4.129  1.00 87.11  ? 180 DT  J C4    1 
ATOM   3675  O  O4    . DT  B 1 34  ? 48.004  47.612  -4.158  1.00 87.11  ? 180 DT  J O4    1 
ATOM   3676  C  C5    . DT  B 1 34  ? 48.457  45.555  -5.268  1.00 87.11  ? 180 DT  J C5    1 
ATOM   3677  C  C7    . DT  B 1 34  ? 48.700  46.189  -6.599  1.00 87.11  ? 180 DT  J C7    1 
ATOM   3678  C  C6    . DT  B 1 34  ? 48.523  44.233  -5.075  1.00 87.11  ? 180 DT  J C6    1 
ATOM   3679  P  P     . DA  B 1 35  ? 45.813  38.715  -3.264  1.00 141.70 ? 181 DA  J P     1 
ATOM   3680  O  OP1   . DA  B 1 35  ? 45.957  37.481  -2.451  1.00 141.70 ? 181 DA  J OP1   1 
ATOM   3681  O  OP2   . DA  B 1 35  ? 44.936  38.708  -4.464  1.00 141.70 ? 181 DA  J OP2   1 
ATOM   3682  O  "O5'" . DA  B 1 35  ? 45.336  39.888  -2.306  1.00 123.98 ? 181 DA  J "O5'" 1 
ATOM   3683  C  "C5'" . DA  B 1 35  ? 46.029  40.144  -1.092  1.00 123.98 ? 181 DA  J "C5'" 1 
ATOM   3684  C  "C4'" . DA  B 1 35  ? 45.119  40.861  -0.127  1.00 123.98 ? 181 DA  J "C4'" 1 
ATOM   3685  O  "O4'" . DA  B 1 35  ? 45.132  42.285  -0.387  1.00 123.98 ? 181 DA  J "O4'" 1 
ATOM   3686  C  "C3'" . DA  B 1 35  ? 43.662  40.414  -0.206  1.00 123.98 ? 181 DA  J "C3'" 1 
ATOM   3687  O  "O3'" . DA  B 1 35  ? 43.141  40.269  1.119   1.00 123.98 ? 181 DA  J "O3'" 1 
ATOM   3688  C  "C2'" . DA  B 1 35  ? 42.994  41.515  -1.019  1.00 123.98 ? 181 DA  J "C2'" 1 
ATOM   3689  C  "C1'" . DA  B 1 35  ? 43.826  42.756  -0.694  1.00 123.98 ? 181 DA  J "C1'" 1 
ATOM   3690  N  N9    . DA  B 1 35  ? 43.960  43.740  -1.777  1.00 91.38  ? 181 DA  J N9    1 
ATOM   3691  C  C8    . DA  B 1 35  ? 43.901  43.529  -3.138  1.00 91.38  ? 181 DA  J C8    1 
ATOM   3692  N  N7    . DA  B 1 35  ? 44.109  44.612  -3.852  1.00 91.38  ? 181 DA  J N7    1 
ATOM   3693  C  C5    . DA  B 1 35  ? 44.308  45.604  -2.901  1.00 91.38  ? 181 DA  J C5    1 
ATOM   3694  C  C6    . DA  B 1 35  ? 44.580  46.976  -3.014  1.00 91.38  ? 181 DA  J C6    1 
ATOM   3695  N  N6    . DA  B 1 35  ? 44.725  47.610  -4.179  1.00 91.38  ? 181 DA  J N6    1 
ATOM   3696  N  N1    . DA  B 1 35  ? 44.706  47.688  -1.871  1.00 91.38  ? 181 DA  J N1    1 
ATOM   3697  C  C2    . DA  B 1 35  ? 44.576  47.052  -0.702  1.00 91.38  ? 181 DA  J C2    1 
ATOM   3698  N  N3    . DA  B 1 35  ? 44.332  45.765  -0.465  1.00 91.38  ? 181 DA  J N3    1 
ATOM   3699  C  C4    . DA  B 1 35  ? 44.204  45.086  -1.620  1.00 91.38  ? 181 DA  J C4    1 
ATOM   3700  P  P     . DT  B 1 36  ? 41.557  40.167  1.357   1.00 90.97  ? 182 DT  J P     1 
ATOM   3701  O  OP1   . DT  B 1 36  ? 41.327  39.348  2.584   1.00 90.97  ? 182 DT  J OP1   1 
ATOM   3702  O  OP2   . DT  B 1 36  ? 40.902  39.784  0.073   1.00 90.97  ? 182 DT  J OP2   1 
ATOM   3703  O  "O5'" . DT  B 1 36  ? 41.179  41.673  1.689   1.00 154.72 ? 182 DT  J "O5'" 1 
ATOM   3704  C  "C5'" . DT  B 1 36  ? 41.832  42.352  2.760   1.00 154.72 ? 182 DT  J "C5'" 1 
ATOM   3705  C  "C4'" . DT  B 1 36  ? 41.053  43.587  3.134   1.00 154.72 ? 182 DT  J "C4'" 1 
ATOM   3706  O  "O4'" . DT  B 1 36  ? 41.334  44.640  2.180   1.00 154.72 ? 182 DT  J "O4'" 1 
ATOM   3707  C  "C3'" . DT  B 1 36  ? 39.542  43.359  3.101   1.00 154.72 ? 182 DT  J "C3'" 1 
ATOM   3708  O  "O3'" . DT  B 1 36  ? 38.906  43.958  4.237   1.00 154.72 ? 182 DT  J "O3'" 1 
ATOM   3709  C  "C2'" . DT  B 1 36  ? 39.118  43.981  1.781   1.00 154.72 ? 182 DT  J "C2'" 1 
ATOM   3710  C  "C1'" . DT  B 1 36  ? 40.127  45.102  1.597   1.00 154.72 ? 182 DT  J "C1'" 1 
ATOM   3711  N  N1    . DT  B 1 36  ? 40.396  45.441  0.184   1.00 78.21  ? 182 DT  J N1    1 
ATOM   3712  C  C2    . DT  B 1 36  ? 40.851  46.717  -0.125  1.00 78.21  ? 182 DT  J C2    1 
ATOM   3713  O  O2    . DT  B 1 36  ? 41.064  47.584  0.716   1.00 78.21  ? 182 DT  J O2    1 
ATOM   3714  N  N3    . DT  B 1 36  ? 41.047  46.942  -1.470  1.00 78.21  ? 182 DT  J N3    1 
ATOM   3715  C  C4    . DT  B 1 36  ? 40.852  46.046  -2.509  1.00 78.21  ? 182 DT  J C4    1 
ATOM   3716  O  O4    . DT  B 1 36  ? 41.093  46.392  -3.668  1.00 78.21  ? 182 DT  J O4    1 
ATOM   3717  C  C5    . DT  B 1 36  ? 40.369  44.734  -2.109  1.00 78.21  ? 182 DT  J C5    1 
ATOM   3718  C  C7    . DT  B 1 36  ? 40.095  43.707  -3.161  1.00 78.21  ? 182 DT  J C7    1 
ATOM   3719  C  C6    . DT  B 1 36  ? 40.178  44.501  -0.801  1.00 78.21  ? 182 DT  J C6    1 
ATOM   3720  P  P     . DT  B 1 37  ? 37.380  44.454  4.132   1.00 66.93  ? 183 DT  J P     1 
ATOM   3721  O  OP1   . DT  B 1 37  ? 36.753  44.437  5.483   1.00 66.93  ? 183 DT  J OP1   1 
ATOM   3722  O  OP2   . DT  B 1 37  ? 36.731  43.720  3.004   1.00 66.93  ? 183 DT  J OP2   1 
ATOM   3723  O  "O5'" . DT  B 1 37  ? 37.566  45.977  3.705   1.00 77.51  ? 183 DT  J "O5'" 1 
ATOM   3724  C  "C5'" . DT  B 1 37  ? 38.719  46.711  4.142   1.00 77.51  ? 183 DT  J "C5'" 1 
ATOM   3725  C  "C4'" . DT  B 1 37  ? 38.562  48.181  3.828   1.00 77.51  ? 183 DT  J "C4'" 1 
ATOM   3726  O  "O4'" . DT  B 1 37  ? 38.916  48.478  2.454   1.00 77.51  ? 183 DT  J "O4'" 1 
ATOM   3727  C  "C3'" . DT  B 1 37  ? 37.144  48.703  4.034   1.00 77.51  ? 183 DT  J "C3'" 1 
ATOM   3728  O  "O3'" . DT  B 1 37  ? 37.192  49.951  4.716   1.00 77.51  ? 183 DT  J "O3'" 1 
ATOM   3729  C  "C2'" . DT  B 1 37  ? 36.603  48.848  2.621   1.00 77.51  ? 183 DT  J "C2'" 1 
ATOM   3730  C  "C1'" . DT  B 1 37  ? 37.852  49.169  1.818   1.00 77.51  ? 183 DT  J "C1'" 1 
ATOM   3731  N  N1    . DT  B 1 37  ? 37.804  48.730  0.411   1.00 83.98  ? 183 DT  J N1    1 
ATOM   3732  C  C2    . DT  B 1 37  ? 38.280  49.586  -0.556  1.00 83.98  ? 183 DT  J C2    1 
ATOM   3733  O  O2    . DT  B 1 37  ? 38.737  50.684  -0.312  1.00 83.98  ? 183 DT  J O2    1 
ATOM   3734  N  N3    . DT  B 1 37  ? 38.205  49.105  -1.831  1.00 83.98  ? 183 DT  J N3    1 
ATOM   3735  C  C4    . DT  B 1 37  ? 37.730  47.879  -2.234  1.00 83.98  ? 183 DT  J C4    1 
ATOM   3736  O  O4    . DT  B 1 37  ? 37.749  47.583  -3.422  1.00 83.98  ? 183 DT  J O4    1 
ATOM   3737  C  C5    . DT  B 1 37  ? 37.243  47.029  -1.175  1.00 83.98  ? 183 DT  J C5    1 
ATOM   3738  C  C7    . DT  B 1 37  ? 36.705  45.677  -1.522  1.00 83.98  ? 183 DT  J C7    1 
ATOM   3739  C  C6    . DT  B 1 37  ? 37.298  47.493  0.080   1.00 83.98  ? 183 DT  J C6    1 
ATOM   3740  P  P     . DT  B 1 38  ? 35.831  50.645  5.195   1.00 65.25  ? 184 DT  J P     1 
ATOM   3741  O  OP1   . DT  B 1 38  ? 36.127  51.329  6.483   1.00 65.25  ? 184 DT  J OP1   1 
ATOM   3742  O  OP2   . DT  B 1 38  ? 34.728  49.651  5.126   1.00 65.25  ? 184 DT  J OP2   1 
ATOM   3743  O  "O5'" . DT  B 1 38  ? 35.566  51.730  4.055   1.00 61.23  ? 184 DT  J "O5'" 1 
ATOM   3744  C  "C5'" . DT  B 1 38  ? 36.546  52.730  3.756   1.00 61.23  ? 184 DT  J "C5'" 1 
ATOM   3745  C  "C4'" . DT  B 1 38  ? 36.065  53.631  2.642   1.00 61.23  ? 184 DT  J "C4'" 1 
ATOM   3746  O  "O4'" . DT  B 1 38  ? 36.157  52.979  1.352   1.00 61.23  ? 184 DT  J "O4'" 1 
ATOM   3747  C  "C3'" . DT  B 1 38  ? 34.615  54.096  2.781   1.00 61.23  ? 184 DT  J "C3'" 1 
ATOM   3748  O  "O3'" . DT  B 1 38  ? 34.515  55.450  2.337   1.00 61.23  ? 184 DT  J "O3'" 1 
ATOM   3749  C  "C2'" . DT  B 1 38  ? 33.883  53.199  1.803   1.00 61.23  ? 184 DT  J "C2'" 1 
ATOM   3750  C  "C1'" . DT  B 1 38  ? 34.910  53.090  0.700   1.00 61.23  ? 184 DT  J "C1'" 1 
ATOM   3751  N  N1    . DT  B 1 38  ? 34.758  51.931  -0.167  1.00 51.98  ? 184 DT  J N1    1 
ATOM   3752  C  C2    . DT  B 1 38  ? 35.157  52.070  -1.469  1.00 51.98  ? 184 DT  J C2    1 
ATOM   3753  O  O2    . DT  B 1 38  ? 35.660  53.088  -1.913  1.00 51.98  ? 184 DT  J O2    1 
ATOM   3754  N  N3    . DT  B 1 38  ? 34.956  50.971  -2.242  1.00 51.98  ? 184 DT  J N3    1 
ATOM   3755  C  C4    . DT  B 1 38  ? 34.428  49.766  -1.852  1.00 51.98  ? 184 DT  J C4    1 
ATOM   3756  O  O4    . DT  B 1 38  ? 34.304  48.875  -2.669  1.00 51.98  ? 184 DT  J O4    1 
ATOM   3757  C  C5    . DT  B 1 38  ? 34.055  49.674  -0.466  1.00 51.98  ? 184 DT  J C5    1 
ATOM   3758  C  C7    . DT  B 1 38  ? 33.502  48.385  0.047   1.00 51.98  ? 184 DT  J C7    1 
ATOM   3759  C  C6    . DT  B 1 38  ? 34.229  50.753  0.302   1.00 51.98  ? 184 DT  J C6    1 
ATOM   3760  P  P     . DG  B 1 39  ? 34.470  56.647  3.410   1.00 67.28  ? 185 DG  J P     1 
ATOM   3761  O  OP1   . DG  B 1 39  ? 35.608  56.507  4.363   1.00 67.28  ? 185 DG  J OP1   1 
ATOM   3762  O  OP2   . DG  B 1 39  ? 33.081  56.720  3.930   1.00 67.28  ? 185 DG  J OP2   1 
ATOM   3763  O  "O5'" . DG  B 1 39  ? 34.726  57.937  2.510   1.00 58.47  ? 185 DG  J "O5'" 1 
ATOM   3764  C  "C5'" . DG  B 1 39  ? 36.005  58.181  1.925   1.00 58.47  ? 185 DG  J "C5'" 1 
ATOM   3765  C  "C4'" . DG  B 1 39  ? 35.846  58.614  0.486   1.00 58.47  ? 185 DG  J "C4'" 1 
ATOM   3766  O  "O4'" . DG  B 1 39  ? 35.335  57.523  -0.313  1.00 58.47  ? 185 DG  J "O4'" 1 
ATOM   3767  C  "C3'" . DG  B 1 39  ? 34.866  59.762  0.288   1.00 58.47  ? 185 DG  J "C3'" 1 
ATOM   3768  O  "O3'" . DG  B 1 39  ? 35.316  60.557  -0.806  1.00 58.47  ? 185 DG  J "O3'" 1 
ATOM   3769  C  "C2'" . DG  B 1 39  ? 33.572  59.049  -0.055  1.00 58.47  ? 185 DG  J "C2'" 1 
ATOM   3770  C  "C1'" . DG  B 1 39  ? 34.052  57.841  -0.836  1.00 58.47  ? 185 DG  J "C1'" 1 
ATOM   3771  N  N9    . DG  B 1 39  ? 33.220  56.653  -0.676  1.00 60.29  ? 185 DG  J N9    1 
ATOM   3772  C  C8    . DG  B 1 39  ? 32.647  56.191  0.489   1.00 60.29  ? 185 DG  J C8    1 
ATOM   3773  N  N7    . DG  B 1 39  ? 32.037  55.045  0.343   1.00 60.29  ? 185 DG  J N7    1 
ATOM   3774  C  C5    . DG  B 1 39  ? 32.205  54.738  -1.004  1.00 60.29  ? 185 DG  J C5    1 
ATOM   3775  C  C6    . DG  B 1 39  ? 31.796  53.602  -1.747  1.00 60.29  ? 185 DG  J C6    1 
ATOM   3776  O  O6    . DG  B 1 39  ? 31.217  52.590  -1.344  1.00 60.29  ? 185 DG  J O6    1 
ATOM   3777  N  N1    . DG  B 1 39  ? 32.145  53.710  -3.090  1.00 60.29  ? 185 DG  J N1    1 
ATOM   3778  C  C2    . DG  B 1 39  ? 32.801  54.773  -3.649  1.00 60.29  ? 185 DG  J C2    1 
ATOM   3779  N  N2    . DG  B 1 39  ? 32.984  54.710  -4.978  1.00 60.29  ? 185 DG  J N2    1 
ATOM   3780  N  N3    . DG  B 1 39  ? 33.229  55.822  -2.963  1.00 60.29  ? 185 DG  J N3    1 
ATOM   3781  C  C4    . DG  B 1 39  ? 32.899  55.739  -1.655  1.00 60.29  ? 185 DG  J C4    1 
ATOM   3782  P  P     . DG  B 1 40  ? 34.758  62.042  -0.994  1.00 35.38  ? 186 DG  J P     1 
ATOM   3783  O  OP1   . DG  B 1 40  ? 35.885  62.874  -1.482  1.00 35.38  ? 186 DG  J OP1   1 
ATOM   3784  O  OP2   . DG  B 1 40  ? 34.065  62.399  0.270   1.00 35.38  ? 186 DG  J OP2   1 
ATOM   3785  O  "O5'" . DG  B 1 40  ? 33.736  61.890  -2.196  1.00 53.97  ? 186 DG  J "O5'" 1 
ATOM   3786  C  "C5'" . DG  B 1 40  ? 34.171  61.347  -3.431  1.00 53.97  ? 186 DG  J "C5'" 1 
ATOM   3787  C  "C4'" . DG  B 1 40  ? 32.978  60.881  -4.226  1.00 53.97  ? 186 DG  J "C4'" 1 
ATOM   3788  O  "O4'" . DG  B 1 40  ? 32.419  59.671  -3.648  1.00 53.97  ? 186 DG  J "O4'" 1 
ATOM   3789  C  "C3'" . DG  B 1 40  ? 31.842  61.908  -4.230  1.00 53.97  ? 186 DG  J "C3'" 1 
ATOM   3790  O  "O3'" . DG  B 1 40  ? 31.200  61.919  -5.508  1.00 53.97  ? 186 DG  J "O3'" 1 
ATOM   3791  C  "C2'" . DG  B 1 40  ? 30.877  61.353  -3.198  1.00 53.97  ? 186 DG  J "C2'" 1 
ATOM   3792  C  "C1'" . DG  B 1 40  ? 31.027  59.876  -3.475  1.00 53.97  ? 186 DG  J "C1'" 1 
ATOM   3793  N  N9    . DG  B 1 40  ? 30.526  58.951  -2.462  1.00 62.85  ? 186 DG  J N9    1 
ATOM   3794  C  C8    . DG  B 1 40  ? 30.332  59.165  -1.115  1.00 62.85  ? 186 DG  J C8    1 
ATOM   3795  N  N7    . DG  B 1 40  ? 29.857  58.119  -0.493  1.00 62.85  ? 186 DG  J N7    1 
ATOM   3796  C  C5    . DG  B 1 40  ? 29.741  57.157  -1.489  1.00 62.85  ? 186 DG  J C5    1 
ATOM   3797  C  C6    . DG  B 1 40  ? 29.297  55.802  -1.427  1.00 62.85  ? 186 DG  J C6    1 
ATOM   3798  O  O6    . DG  B 1 40  ? 28.947  55.140  -0.425  1.00 62.85  ? 186 DG  J O6    1 
ATOM   3799  N  N1    . DG  B 1 40  ? 29.304  55.210  -2.697  1.00 62.85  ? 186 DG  J N1    1 
ATOM   3800  C  C2    . DG  B 1 40  ? 29.727  55.830  -3.863  1.00 62.85  ? 186 DG  J C2    1 
ATOM   3801  N  N2    . DG  B 1 40  ? 29.666  55.115  -4.997  1.00 62.85  ? 186 DG  J N2    1 
ATOM   3802  N  N3    . DG  B 1 40  ? 30.175  57.065  -3.917  1.00 62.85  ? 186 DG  J N3    1 
ATOM   3803  C  C4    . DG  B 1 40  ? 30.145  57.667  -2.709  1.00 62.85  ? 186 DG  J C4    1 
ATOM   3804  P  P     . DA  B 1 41  ? 31.310  63.217  -6.443  1.00 64.00  ? 187 DA  J P     1 
ATOM   3805  O  OP1   . DA  B 1 41  ? 32.739  63.638  -6.433  1.00 64.00  ? 187 DA  J OP1   1 
ATOM   3806  O  OP2   . DA  B 1 41  ? 30.245  64.174  -6.026  1.00 64.00  ? 187 DA  J OP2   1 
ATOM   3807  O  "O5'" . DA  B 1 41  ? 30.946  62.657  -7.886  1.00 77.10  ? 187 DA  J "O5'" 1 
ATOM   3808  C  "C5'" . DA  B 1 41  ? 31.682  61.575  -8.459  1.00 77.10  ? 187 DA  J "C5'" 1 
ATOM   3809  C  "C4'" . DA  B 1 41  ? 30.740  60.614  -9.151  1.00 77.10  ? 187 DA  J "C4'" 1 
ATOM   3810  O  "O4'" . DA  B 1 41  ? 30.155  59.695  -8.196  1.00 77.10  ? 187 DA  J "O4'" 1 
ATOM   3811  C  "C3'" . DA  B 1 41  ? 29.574  61.294  -9.869  1.00 77.10  ? 187 DA  J "C3'" 1 
ATOM   3812  O  "O3'" . DA  B 1 41  ? 29.327  60.668  -11.134 1.00 77.10  ? 187 DA  J "O3'" 1 
ATOM   3813  C  "C2'" . DA  B 1 41  ? 28.411  61.100  -8.914  1.00 77.10  ? 187 DA  J "C2'" 1 
ATOM   3814  C  "C1'" . DA  B 1 41  ? 28.738  59.780  -8.234  1.00 77.10  ? 187 DA  J "C1'" 1 
ATOM   3815  N  N9    . DA  B 1 41  ? 28.257  59.696  -6.858  1.00 72.73  ? 187 DA  J N9    1 
ATOM   3816  C  C8    . DA  B 1 41  ? 28.174  60.707  -5.930  1.00 72.73  ? 187 DA  J C8    1 
ATOM   3817  N  N7    . DA  B 1 41  ? 27.713  60.322  -4.767  1.00 72.73  ? 187 DA  J N7    1 
ATOM   3818  C  C5    . DA  B 1 41  ? 27.468  58.963  -4.940  1.00 72.73  ? 187 DA  J C5    1 
ATOM   3819  C  C6    . DA  B 1 41  ? 26.966  57.960  -4.067  1.00 72.73  ? 187 DA  J C6    1 
ATOM   3820  N  N6    . DA  B 1 41  ? 26.607  58.190  -2.794  1.00 72.73  ? 187 DA  J N6    1 
ATOM   3821  N  N1    . DA  B 1 41  ? 26.846  56.701  -4.558  1.00 72.73  ? 187 DA  J N1    1 
ATOM   3822  C  C2    . DA  B 1 41  ? 27.205  56.474  -5.828  1.00 72.73  ? 187 DA  J C2    1 
ATOM   3823  N  N3    . DA  B 1 41  ? 27.687  57.328  -6.741  1.00 72.73  ? 187 DA  J N3    1 
ATOM   3824  C  C4    . DA  B 1 41  ? 27.796  58.567  -6.226  1.00 72.73  ? 187 DA  J C4    1 
ATOM   3825  P  P     . DA  B 1 42  ? 28.331  61.364  -12.193 1.00 128.75 ? 188 DA  J P     1 
ATOM   3826  O  OP1   . DA  B 1 42  ? 28.974  61.358  -13.533 1.00 128.75 ? 188 DA  J OP1   1 
ATOM   3827  O  OP2   . DA  B 1 42  ? 27.848  62.646  -11.616 1.00 128.75 ? 188 DA  J OP2   1 
ATOM   3828  O  "O5'" . DA  B 1 42  ? 27.103  60.356  -12.235 1.00 96.02  ? 188 DA  J "O5'" 1 
ATOM   3829  C  "C5'" . DA  B 1 42  ? 27.323  58.968  -12.472 1.00 96.02  ? 188 DA  J "C5'" 1 
ATOM   3830  C  "C4'" . DA  B 1 42  ? 26.005  58.243  -12.603 1.00 96.02  ? 188 DA  J "C4'" 1 
ATOM   3831  O  "O4'" . DA  B 1 42  ? 25.568  57.774  -11.306 1.00 96.02  ? 188 DA  J "O4'" 1 
ATOM   3832  C  "C3'" . DA  B 1 42  ? 24.886  59.106  -13.177 1.00 96.02  ? 188 DA  J "C3'" 1 
ATOM   3833  O  "O3'" . DA  B 1 42  ? 24.423  58.586  -14.437 1.00 96.02  ? 188 DA  J "O3'" 1 
ATOM   3834  C  "C2'" . DA  B 1 42  ? 23.914  59.329  -12.027 1.00 96.02  ? 188 DA  J "C2'" 1 
ATOM   3835  C  "C1'" . DA  B 1 42  ? 24.324  58.343  -10.926 1.00 96.02  ? 188 DA  J "C1'" 1 
ATOM   3836  N  N9    . DA  B 1 42  ? 24.508  58.981  -9.611  1.00 96.48  ? 188 DA  J N9    1 
ATOM   3837  C  C8    . DA  B 1 42  ? 24.919  60.274  -9.381  1.00 96.48  ? 188 DA  J C8    1 
ATOM   3838  N  N7    . DA  B 1 42  ? 24.947  60.606  -8.111  1.00 96.48  ? 188 DA  J N7    1 
ATOM   3839  C  C5    . DA  B 1 42  ? 24.538  59.454  -7.454  1.00 96.48  ? 188 DA  J C5    1 
ATOM   3840  C  C6    . DA  B 1 42  ? 24.340  59.160  -6.084  1.00 96.48  ? 188 DA  J C6    1 
ATOM   3841  N  N6    . DA  B 1 42  ? 24.535  60.039  -5.097  1.00 96.48  ? 188 DA  J N6    1 
ATOM   3842  N  N1    . DA  B 1 42  ? 23.926  57.916  -5.761  1.00 96.48  ? 188 DA  J N1    1 
ATOM   3843  C  C2    . DA  B 1 42  ? 23.728  57.036  -6.746  1.00 96.48  ? 188 DA  J C2    1 
ATOM   3844  N  N3    . DA  B 1 42  ? 23.874  57.191  -8.066  1.00 96.48  ? 188 DA  J N3    1 
ATOM   3845  C  C4    . DA  B 1 42  ? 24.282  58.438  -8.361  1.00 96.48  ? 188 DA  J C4    1 
ATOM   3846  P  P     . DA  B 1 43  ? 23.043  57.778  -14.567 1.00 87.94  ? 189 DA  J P     1 
ATOM   3847  O  OP1   . DA  B 1 43  ? 23.442  56.523  -15.247 1.00 87.94  ? 189 DA  J OP1   1 
ATOM   3848  O  OP2   . DA  B 1 43  ? 22.030  58.665  -15.197 1.00 87.94  ? 189 DA  J OP2   1 
ATOM   3849  O  "O5'" . DA  B 1 43  ? 22.568  57.422  -13.087 1.00 110.01 ? 189 DA  J "O5'" 1 
ATOM   3850  C  "C5'" . DA  B 1 43  ? 21.977  56.151  -12.809 1.00 110.01 ? 189 DA  J "C5'" 1 
ATOM   3851  C  "C4'" . DA  B 1 43  ? 20.580  56.312  -12.252 1.00 110.01 ? 189 DA  J "C4'" 1 
ATOM   3852  O  "O4'" . DA  B 1 43  ? 20.655  56.871  -10.918 1.00 110.01 ? 189 DA  J "O4'" 1 
ATOM   3853  C  "C3'" . DA  B 1 43  ? 19.600  57.194  -13.042 1.00 110.01 ? 189 DA  J "C3'" 1 
ATOM   3854  O  "O3'" . DA  B 1 43  ? 18.315  56.530  -13.164 1.00 110.01 ? 189 DA  J "O3'" 1 
ATOM   3855  C  "C2'" . DA  B 1 43  ? 19.520  58.459  -12.204 1.00 110.01 ? 189 DA  J "C2'" 1 
ATOM   3856  C  "C1'" . DA  B 1 43  ? 19.741  57.944  -10.790 1.00 110.01 ? 189 DA  J "C1'" 1 
ATOM   3857  N  N9    . DA  B 1 43  ? 20.321  58.932  -9.877  1.00 55.04  ? 189 DA  J N9    1 
ATOM   3858  C  C8    . DA  B 1 43  ? 21.006  60.070  -10.224 1.00 55.04  ? 189 DA  J C8    1 
ATOM   3859  N  N7    . DA  B 1 43  ? 21.387  60.794  -9.198  1.00 55.04  ? 189 DA  J N7    1 
ATOM   3860  C  C5    . DA  B 1 43  ? 20.930  60.086  -8.098  1.00 55.04  ? 189 DA  J C5    1 
ATOM   3861  C  C6    . DA  B 1 43  ? 21.009  60.334  -6.716  1.00 55.04  ? 189 DA  J C6    1 
ATOM   3862  N  N6    . DA  B 1 43  ? 21.570  61.422  -6.194  1.00 55.04  ? 189 DA  J N6    1 
ATOM   3863  N  N1    . DA  B 1 43  ? 20.473  59.423  -5.880  1.00 55.04  ? 189 DA  J N1    1 
ATOM   3864  C  C2    . DA  B 1 43  ? 19.877  58.347  -6.407  1.00 55.04  ? 189 DA  J C2    1 
ATOM   3865  N  N3    . DA  B 1 43  ? 19.718  58.010  -7.690  1.00 55.04  ? 189 DA  J N3    1 
ATOM   3866  C  C4    . DA  B 1 43  ? 20.278  58.930  -8.497  1.00 55.04  ? 189 DA  J C4    1 
ATOM   3867  P  P     . DC  B 1 44  ? 17.009  57.338  -13.689 1.00 94.27  ? 190 DC  J P     1 
ATOM   3868  O  OP1   . DC  B 1 44  ? 15.903  56.361  -13.873 1.00 94.27  ? 190 DC  J OP1   1 
ATOM   3869  O  OP2   . DC  B 1 44  ? 17.399  58.216  -14.830 1.00 94.27  ? 190 DC  J OP2   1 
ATOM   3870  O  "O5'" . DC  B 1 44  ? 16.643  58.243  -12.428 1.00 104.70 ? 190 DC  J "O5'" 1 
ATOM   3871  C  "C5'" . DC  B 1 44  ? 15.297  58.588  -12.133 1.00 104.70 ? 190 DC  J "C5'" 1 
ATOM   3872  C  "C4'" . DC  B 1 44  ? 14.937  58.163  -10.727 1.00 104.70 ? 190 DC  J "C4'" 1 
ATOM   3873  O  "O4'" . DC  B 1 44  ? 16.023  58.419  -9.802  1.00 104.70 ? 190 DC  J "O4'" 1 
ATOM   3874  C  "C3'" . DC  B 1 44  ? 13.729  58.918  -10.178 1.00 104.70 ? 190 DC  J "C3'" 1 
ATOM   3875  O  "O3'" . DC  B 1 44  ? 12.847  58.042  -9.492  1.00 104.70 ? 190 DC  J "O3'" 1 
ATOM   3876  C  "C2'" . DC  B 1 44  ? 14.322  59.930  -9.218  1.00 104.70 ? 190 DC  J "C2'" 1 
ATOM   3877  C  "C1'" . DC  B 1 44  ? 15.573  59.234  -8.725  1.00 104.70 ? 190 DC  J "C1'" 1 
ATOM   3878  N  N1    . DC  B 1 44  ? 16.641  60.188  -8.399  1.00 60.46  ? 190 DC  J N1    1 
ATOM   3879  C  C2    . DC  B 1 44  ? 16.854  60.528  -7.057  1.00 60.46  ? 190 DC  J C2    1 
ATOM   3880  O  O2    . DC  B 1 44  ? 16.139  60.015  -6.187  1.00 60.46  ? 190 DC  J O2    1 
ATOM   3881  N  N3    . DC  B 1 44  ? 17.829  61.417  -6.744  1.00 60.46  ? 190 DC  J N3    1 
ATOM   3882  C  C4    . DC  B 1 44  ? 18.568  61.969  -7.715  1.00 60.46  ? 190 DC  J C4    1 
ATOM   3883  N  N4    . DC  B 1 44  ? 19.513  62.856  -7.365  1.00 60.46  ? 190 DC  J N4    1 
ATOM   3884  C  C5    . DC  B 1 44  ? 18.371  61.639  -9.092  1.00 60.46  ? 190 DC  J C5    1 
ATOM   3885  C  C6    . DC  B 1 44  ? 17.409  60.748  -9.384  1.00 60.46  ? 190 DC  J C6    1 
ATOM   3886  P  P     . DT  B 1 45  ? 11.332  58.495  -9.261  1.00 111.31 ? 191 DT  J P     1 
ATOM   3887  O  OP1   . DT  B 1 45  ? 10.571  57.346  -8.708  1.00 111.31 ? 191 DT  J OP1   1 
ATOM   3888  O  OP2   . DT  B 1 45  ? 10.880  59.140  -10.518 1.00 111.31 ? 191 DT  J OP2   1 
ATOM   3889  O  "O5'" . DT  B 1 45  ? 11.465  59.616  -8.141  1.00 103.30 ? 191 DT  J "O5'" 1 
ATOM   3890  C  "C5'" . DT  B 1 45  ? 11.838  59.259  -6.815  1.00 103.30 ? 191 DT  J "C5'" 1 
ATOM   3891  C  "C4'" . DT  B 1 45  ? 11.827  60.473  -5.918  1.00 103.30 ? 191 DT  J "C4'" 1 
ATOM   3892  O  "O4'" . DT  B 1 45  ? 13.034  61.248  -6.096  1.00 103.30 ? 191 DT  J "O4'" 1 
ATOM   3893  C  "C3'" . DT  B 1 45  ? 10.662  61.437  -6.147  1.00 103.30 ? 191 DT  J "C3'" 1 
ATOM   3894  O  "O3'" . DT  B 1 45  ? 10.177  61.896  -4.886  1.00 103.30 ? 191 DT  J "O3'" 1 
ATOM   3895  C  "C2'" . DT  B 1 45  ? 11.316  62.591  -6.885  1.00 103.30 ? 191 DT  J "C2'" 1 
ATOM   3896  C  "C1'" . DT  B 1 45  ? 12.667  62.605  -6.207  1.00 103.30 ? 191 DT  J "C1'" 1 
ATOM   3897  N  N1    . DT  B 1 45  ? 13.748  63.317  -6.897  1.00 61.88  ? 191 DT  J N1    1 
ATOM   3898  C  C2    . DT  B 1 45  ? 14.745  63.858  -6.109  1.00 61.88  ? 191 DT  J C2    1 
ATOM   3899  O  O2    . DT  B 1 45  ? 14.745  63.790  -4.882  1.00 61.88  ? 191 DT  J O2    1 
ATOM   3900  N  N3    . DT  B 1 45  ? 15.741  64.492  -6.811  1.00 61.88  ? 191 DT  J N3    1 
ATOM   3901  C  C4    . DT  B 1 45  ? 15.839  64.633  -8.184  1.00 61.88  ? 191 DT  J C4    1 
ATOM   3902  O  O4    . DT  B 1 45  ? 16.810  65.200  -8.671  1.00 61.88  ? 191 DT  J O4    1 
ATOM   3903  C  C5    . DT  B 1 45  ? 14.745  64.069  -8.938  1.00 61.88  ? 191 DT  J C5    1 
ATOM   3904  C  C7    . DT  B 1 45  ? 14.740  64.216  -10.423 1.00 61.88  ? 191 DT  J C7    1 
ATOM   3905  C  C6    . DT  B 1 45  ? 13.771  63.439  -8.267  1.00 61.88  ? 191 DT  J C6    1 
ATOM   3906  P  P     . DG  B 1 46  ? 8.599   62.019  -4.639  1.00 89.02  ? 192 DG  J P     1 
ATOM   3907  O  OP1   . DG  B 1 46  ? 8.003   60.670  -4.800  1.00 89.02  ? 192 DG  J OP1   1 
ATOM   3908  O  OP2   . DG  B 1 46  ? 8.120   63.152  -5.477  1.00 89.02  ? 192 DG  J OP2   1 
ATOM   3909  O  "O5'" . DG  B 1 46  ? 8.475   62.440  -3.112  1.00 84.27  ? 192 DG  J "O5'" 1 
ATOM   3910  C  "C5'" . DG  B 1 46  ? 9.464   62.051  -2.167  1.00 84.27  ? 192 DG  J "C5'" 1 
ATOM   3911  C  "C4'" . DG  B 1 46  ? 10.089  63.275  -1.537  1.00 84.27  ? 192 DG  J "C4'" 1 
ATOM   3912  O  "O4'" . DG  B 1 46  ? 11.064  63.901  -2.411  1.00 84.27  ? 192 DG  J "O4'" 1 
ATOM   3913  C  "C3'" . DG  B 1 46  ? 9.103   64.376  -1.154  1.00 84.27  ? 192 DG  J "C3'" 1 
ATOM   3914  O  "O3'" . DG  B 1 46  ? 9.474   64.877  0.130   1.00 84.27  ? 192 DG  J "O3'" 1 
ATOM   3915  C  "C2'" . DG  B 1 46  ? 9.312   65.431  -2.233  1.00 84.27  ? 192 DG  J "C2'" 1 
ATOM   3916  C  "C1'" . DG  B 1 46  ? 10.804  65.298  -2.491  1.00 84.27  ? 192 DG  J "C1'" 1 
ATOM   3917  N  N9    . DG  B 1 46  ? 11.324  65.783  -3.774  1.00 66.15  ? 192 DG  J N9    1 
ATOM   3918  C  C8    . DG  B 1 46  ? 10.878  65.457  -5.035  1.00 66.15  ? 192 DG  J C8    1 
ATOM   3919  N  N7    . DG  B 1 46  ? 11.617  65.964  -5.991  1.00 66.15  ? 192 DG  J N7    1 
ATOM   3920  C  C5    . DG  B 1 46  ? 12.597  66.689  -5.325  1.00 66.15  ? 192 DG  J C5    1 
ATOM   3921  C  C6    . DG  B 1 46  ? 13.706  67.437  -5.833  1.00 66.15  ? 192 DG  J C6    1 
ATOM   3922  O  O6    . DG  B 1 46  ? 14.077  67.592  -7.012  1.00 66.15  ? 192 DG  J O6    1 
ATOM   3923  N  N1    . DG  B 1 46  ? 14.430  68.024  -4.806  1.00 66.15  ? 192 DG  J N1    1 
ATOM   3924  C  C2    . DG  B 1 46  ? 14.142  67.904  -3.464  1.00 66.15  ? 192 DG  J C2    1 
ATOM   3925  N  N2    . DG  B 1 46  ? 14.958  68.564  -2.630  1.00 66.15  ? 192 DG  J N2    1 
ATOM   3926  N  N3    . DG  B 1 46  ? 13.134  67.197  -2.978  1.00 66.15  ? 192 DG  J N3    1 
ATOM   3927  C  C4    . DG  B 1 46  ? 12.409  66.619  -3.955  1.00 66.15  ? 192 DG  J C4    1 
ATOM   3928  P  P     . DC  B 1 47  ? 8.409   65.695  1.009   1.00 106.91 ? 193 DC  J P     1 
ATOM   3929  O  OP1   . DC  B 1 47  ? 8.360   65.105  2.377   1.00 106.91 ? 193 DC  J OP1   1 
ATOM   3930  O  OP2   . DC  B 1 47  ? 7.166   65.808  0.199   1.00 106.91 ? 193 DC  J OP2   1 
ATOM   3931  O  "O5'" . DC  B 1 47  ? 9.063   67.142  1.115   1.00 88.46  ? 193 DC  J "O5'" 1 
ATOM   3932  C  "C5'" . DC  B 1 47  ? 10.481  67.313  1.027   1.00 88.46  ? 193 DC  J "C5'" 1 
ATOM   3933  C  "C4'" . DC  B 1 47  ? 10.824  68.747  0.696   1.00 88.46  ? 193 DC  J "C4'" 1 
ATOM   3934  O  "O4'" . DC  B 1 47  ? 11.170  68.864  -0.703  1.00 88.46  ? 193 DC  J "O4'" 1 
ATOM   3935  C  "C3'" . DC  B 1 47  ? 9.716   69.779  0.940   1.00 88.46  ? 193 DC  J "C3'" 1 
ATOM   3936  O  "O3'" . DC  B 1 47  ? 10.318  70.990  1.400   1.00 88.46  ? 193 DC  J "O3'" 1 
ATOM   3937  C  "C2'" . DC  B 1 47  ? 9.161   70.013  -0.452  1.00 88.46  ? 193 DC  J "C2'" 1 
ATOM   3938  C  "C1'" . DC  B 1 47  ? 10.436  69.939  -1.257  1.00 88.46  ? 193 DC  J "C1'" 1 
ATOM   3939  N  N1    . DC  B 1 47  ? 10.289  69.700  -2.693  1.00 88.37  ? 193 DC  J N1    1 
ATOM   3940  C  C2    . DC  B 1 47  ? 11.168  70.353  -3.560  1.00 88.37  ? 193 DC  J C2    1 
ATOM   3941  O  O2    . DC  B 1 47  ? 12.047  71.093  -3.079  1.00 88.37  ? 193 DC  J O2    1 
ATOM   3942  N  N3    . DC  B 1 47  ? 11.048  70.163  -4.895  1.00 88.37  ? 193 DC  J N3    1 
ATOM   3943  C  C4    . DC  B 1 47  ? 10.097  69.355  -5.370  1.00 88.37  ? 193 DC  J C4    1 
ATOM   3944  N  N4    . DC  B 1 47  ? 10.012  69.208  -6.702  1.00 88.37  ? 193 DC  J N4    1 
ATOM   3945  C  C5    . DC  B 1 47  ? 9.192   68.667  -4.504  1.00 88.37  ? 193 DC  J C5    1 
ATOM   3946  C  C6    . DC  B 1 47  ? 9.322   68.869  -3.184  1.00 88.37  ? 193 DC  J C6    1 
ATOM   3947  P  P     . DT  B 1 48  ? 9.946   71.584  2.850   1.00 87.58  ? 194 DT  J P     1 
ATOM   3948  O  OP1   . DT  B 1 48  ? 9.948   70.532  3.914   1.00 87.58  ? 194 DT  J OP1   1 
ATOM   3949  O  OP2   . DT  B 1 48  ? 8.744   72.433  2.644   1.00 87.58  ? 194 DT  J OP2   1 
ATOM   3950  O  "O5'" . DT  B 1 48  ? 11.158  72.562  3.160   1.00 77.34  ? 194 DT  J "O5'" 1 
ATOM   3951  C  "C5'" . DT  B 1 48  ? 11.190  73.870  2.605   1.00 77.34  ? 194 DT  J "C5'" 1 
ATOM   3952  C  "C4'" . DT  B 1 48  ? 12.567  74.177  2.068   1.00 77.34  ? 194 DT  J "C4'" 1 
ATOM   3953  O  "O4'" . DT  B 1 48  ? 12.699  73.700  0.707   1.00 77.34  ? 194 DT  J "O4'" 1 
ATOM   3954  C  "C3'" . DT  B 1 48  ? 12.838  75.672  2.010   1.00 77.34  ? 194 DT  J "C3'" 1 
ATOM   3955  O  "O3'" . DT  B 1 48  ? 14.194  75.901  2.390   1.00 77.34  ? 194 DT  J "O3'" 1 
ATOM   3956  C  "C2'" . DT  B 1 48  ? 12.554  76.035  0.565   1.00 77.34  ? 194 DT  J "C2'" 1 
ATOM   3957  C  "C1'" . DT  B 1 48  ? 12.966  74.782  -0.176  1.00 77.34  ? 194 DT  J "C1'" 1 
ATOM   3958  N  N1    . DT  B 1 48  ? 12.198  74.548  -1.408  1.00 72.36  ? 194 DT  J N1    1 
ATOM   3959  C  C2    . DT  B 1 48  ? 12.812  74.682  -2.646  1.00 72.36  ? 194 DT  J C2    1 
ATOM   3960  O  O2    . DT  B 1 48  ? 13.967  75.068  -2.798  1.00 72.36  ? 194 DT  J O2    1 
ATOM   3961  N  N3    . DT  B 1 48  ? 12.008  74.353  -3.712  1.00 72.36  ? 194 DT  J N3    1 
ATOM   3962  C  C4    . DT  B 1 48  ? 10.691  73.937  -3.669  1.00 72.36  ? 194 DT  J C4    1 
ATOM   3963  O  O4    . DT  B 1 48  ? 10.117  73.624  -4.708  1.00 72.36  ? 194 DT  J O4    1 
ATOM   3964  C  C5    . DT  B 1 48  ? 10.103  73.889  -2.352  1.00 72.36  ? 194 DT  J C5    1 
ATOM   3965  C  C7    . DT  B 1 48  ? 8.659   73.526  -2.213  1.00 72.36  ? 194 DT  J C7    1 
ATOM   3966  C  C6    . DT  B 1 48  ? 10.879  74.181  -1.304  1.00 72.36  ? 194 DT  J C6    1 
ATOM   3967  P  P     . DC  B 1 49  ? 14.708  77.397  2.642   1.00 57.79  ? 195 DC  J P     1 
ATOM   3968  O  OP1   . DC  B 1 49  ? 16.090  77.285  3.167   1.00 57.79  ? 195 DC  J OP1   1 
ATOM   3969  O  OP2   . DC  B 1 49  ? 13.686  78.156  3.411   1.00 57.79  ? 195 DC  J OP2   1 
ATOM   3970  O  "O5'" . DC  B 1 49  ? 14.746  77.974  1.165   1.00 40.36  ? 195 DC  J "O5'" 1 
ATOM   3971  C  "C5'" . DC  B 1 49  ? 15.057  77.118  0.082   1.00 40.36  ? 195 DC  J "C5'" 1 
ATOM   3972  C  "C4'" . DC  B 1 49  ? 15.375  77.946  -1.129  1.00 40.36  ? 195 DC  J "C4'" 1 
ATOM   3973  O  "O4'" . DC  B 1 49  ? 14.389  77.712  -2.153  1.00 40.36  ? 195 DC  J "O4'" 1 
ATOM   3974  C  "C3'" . DC  B 1 49  ? 15.349  79.443  -0.854  1.00 40.36  ? 195 DC  J "C3'" 1 
ATOM   3975  O  "O3'" . DC  B 1 49  ? 16.374  80.011  -1.682  1.00 40.36  ? 195 DC  J "O3'" 1 
ATOM   3976  C  "C2'" . DC  B 1 49  ? 13.924  79.836  -1.214  1.00 40.36  ? 195 DC  J "C2'" 1 
ATOM   3977  C  "C1'" . DC  B 1 49  ? 13.593  78.874  -2.356  1.00 40.36  ? 195 DC  J "C1'" 1 
ATOM   3978  N  N1    . DC  B 1 49  ? 12.187  78.422  -2.463  1.00 64.42  ? 195 DC  J N1    1 
ATOM   3979  C  C2    . DC  B 1 49  ? 11.680  78.090  -3.733  1.00 64.42  ? 195 DC  J C2    1 
ATOM   3980  O  O2    . DC  B 1 49  ? 12.400  78.252  -4.725  1.00 64.42  ? 195 DC  J O2    1 
ATOM   3981  N  N3    . DC  B 1 49  ? 10.423  77.606  -3.841  1.00 64.42  ? 195 DC  J N3    1 
ATOM   3982  C  C4    . DC  B 1 49  ? 9.672   77.456  -2.752  1.00 64.42  ? 195 DC  J C4    1 
ATOM   3983  N  N4    . DC  B 1 49  ? 8.457   76.948  -2.905  1.00 64.42  ? 195 DC  J N4    1 
ATOM   3984  C  C5    . DC  B 1 49  ? 10.142  77.816  -1.454  1.00 64.42  ? 195 DC  J C5    1 
ATOM   3985  C  C6    . DC  B 1 49  ? 11.394  78.294  -1.355  1.00 64.42  ? 195 DC  J C6    1 
ATOM   3986  P  P     . DC  B 1 50  ? 16.532  81.594  -1.816  1.00 47.94  ? 196 DC  J P     1 
ATOM   3987  O  OP1   . DC  B 1 50  ? 17.946  81.831  -1.512  1.00 47.94  ? 196 DC  J OP1   1 
ATOM   3988  O  OP2   . DC  B 1 50  ? 15.481  82.313  -1.052  1.00 47.94  ? 196 DC  J OP2   1 
ATOM   3989  O  "O5'" . DC  B 1 50  ? 16.337  81.811  -3.372  1.00 40.61  ? 196 DC  J "O5'" 1 
ATOM   3990  C  "C5'" . DC  B 1 50  ? 17.039  80.980  -4.284  1.00 40.61  ? 196 DC  J "C5'" 1 
ATOM   3991  C  "C4'" . DC  B 1 50  ? 16.639  81.297  -5.706  1.00 40.61  ? 196 DC  J "C4'" 1 
ATOM   3992  O  "O4'" . DC  B 1 50  ? 15.333  80.724  -5.955  1.00 40.61  ? 196 DC  J "O4'" 1 
ATOM   3993  C  "C3'" . DC  B 1 50  ? 16.534  82.783  -6.051  1.00 40.61  ? 196 DC  J "C3'" 1 
ATOM   3994  O  "O3'" . DC  B 1 50  ? 17.150  83.058  -7.300  1.00 40.61  ? 196 DC  J "O3'" 1 
ATOM   3995  C  "C2'" . DC  B 1 50  ? 15.042  83.049  -6.120  1.00 40.61  ? 196 DC  J "C2'" 1 
ATOM   3996  C  "C1'" . DC  B 1 50  ? 14.442  81.700  -6.477  1.00 40.61  ? 196 DC  J "C1'" 1 
ATOM   3997  N  N1    . DC  B 1 50  ? 13.121  81.471  -5.861  1.00 49.17  ? 196 DC  J N1    1 
ATOM   3998  C  C2    . DC  B 1 50  ? 12.047  81.051  -6.668  1.00 49.17  ? 196 DC  J C2    1 
ATOM   3999  O  O2    . DC  B 1 50  ? 12.241  80.857  -7.879  1.00 49.17  ? 196 DC  J O2    1 
ATOM   4000  N  N3    . DC  B 1 50  ? 10.832  80.866  -6.096  1.00 49.17  ? 196 DC  J N3    1 
ATOM   4001  C  C4    . DC  B 1 50  ? 10.665  81.081  -4.779  1.00 49.17  ? 196 DC  J C4    1 
ATOM   4002  N  N4    . DC  B 1 50  ? 9.450   80.899  -4.257  1.00 49.17  ? 196 DC  J N4    1 
ATOM   4003  C  C5    . DC  B 1 50  ? 11.738  81.495  -3.941  1.00 49.17  ? 196 DC  J C5    1 
ATOM   4004  C  C6    . DC  B 1 50  ? 12.938  81.674  -4.516  1.00 49.17  ? 196 DC  J C6    1 
ATOM   4005  P  P     . DA  B 1 51  ? 16.976  84.503  -7.961  1.00 27.94  ? 197 DA  J P     1 
ATOM   4006  O  OP1   . DA  B 1 51  ? 18.153  84.723  -8.849  1.00 27.94  ? 197 DA  J OP1   1 
ATOM   4007  O  OP2   . DA  B 1 51  ? 16.619  85.524  -6.924  1.00 27.94  ? 197 DA  J OP2   1 
ATOM   4008  O  "O5'" . DA  B 1 51  ? 15.712  84.299  -8.894  1.00 38.92  ? 197 DA  J "O5'" 1 
ATOM   4009  C  "C5'" . DA  B 1 51  ? 15.731  83.280  -9.881  1.00 38.92  ? 197 DA  J "C5'" 1 
ATOM   4010  C  "C4'" . DA  B 1 51  ? 14.692  83.556  -10.937 1.00 38.92  ? 197 DA  J "C4'" 1 
ATOM   4011  O  "O4'" . DA  B 1 51  ? 13.380  83.317  -10.390 1.00 38.92  ? 197 DA  J "O4'" 1 
ATOM   4012  C  "C3'" . DA  B 1 51  ? 14.678  84.987  -11.458 1.00 38.92  ? 197 DA  J "C3'" 1 
ATOM   4013  O  "O3'" . DA  B 1 51  ? 14.424  84.958  -12.865 1.00 38.92  ? 197 DA  J "O3'" 1 
ATOM   4014  C  "C2'" . DA  B 1 51  ? 13.550  85.636  -10.672 1.00 38.92  ? 197 DA  J "C2'" 1 
ATOM   4015  C  "C1'" . DA  B 1 51  ? 12.591  84.491  -10.435 1.00 38.92  ? 197 DA  J "C1'" 1 
ATOM   4016  N  N9    . DA  B 1 51  ? 11.875  84.547  -9.169  1.00 37.21  ? 197 DA  J N9    1 
ATOM   4017  C  C8    . DA  B 1 51  ? 12.317  85.045  -7.976  1.00 37.21  ? 197 DA  J C8    1 
ATOM   4018  N  N7    . DA  B 1 51  ? 11.471  84.884  -6.989  1.00 37.21  ? 197 DA  J N7    1 
ATOM   4019  C  C5    . DA  B 1 51  ? 10.393  84.249  -7.579  1.00 37.21  ? 197 DA  J C5    1 
ATOM   4020  C  C6    . DA  B 1 51  ? 9.181   83.799  -7.065  1.00 37.21  ? 197 DA  J C6    1 
ATOM   4021  N  N6    . DA  B 1 51  ? 8.854   83.904  -5.780  1.00 37.21  ? 197 DA  J N6    1 
ATOM   4022  N  N1    . DA  B 1 51  ? 8.305   83.224  -7.920  1.00 37.21  ? 197 DA  J N1    1 
ATOM   4023  C  C2    . DA  B 1 51  ? 8.651   83.109  -9.209  1.00 37.21  ? 197 DA  J C2    1 
ATOM   4024  N  N3    . DA  B 1 51  ? 9.777   83.481  -9.813  1.00 37.21  ? 197 DA  J N3    1 
ATOM   4025  C  C4    . DA  B 1 51  ? 10.617  84.054  -8.928  1.00 37.21  ? 197 DA  J C4    1 
ATOM   4026  P  P     . DT  B 1 52  ? 13.841  86.258  -13.598 1.00 61.91  ? 198 DT  J P     1 
ATOM   4027  O  OP1   . DT  B 1 52  ? 13.822  85.980  -15.058 1.00 61.91  ? 198 DT  J OP1   1 
ATOM   4028  O  OP2   . DT  B 1 52  ? 14.564  87.461  -13.069 1.00 61.91  ? 198 DT  J OP2   1 
ATOM   4029  O  "O5'" . DT  B 1 52  ? 12.332  86.278  -13.105 1.00 74.61  ? 198 DT  J "O5'" 1 
ATOM   4030  C  "C5'" . DT  B 1 52  ? 11.447  85.246  -13.512 1.00 74.61  ? 198 DT  J "C5'" 1 
ATOM   4031  C  "C4'" . DT  B 1 52  ? 10.031  85.759  -13.532 1.00 74.61  ? 198 DT  J "C4'" 1 
ATOM   4032  O  "O4'" . DT  B 1 52  ? 9.438   85.619  -12.222 1.00 74.61  ? 198 DT  J "O4'" 1 
ATOM   4033  C  "C3'" . DT  B 1 52  ? 9.917   87.238  -13.904 1.00 74.61  ? 198 DT  J "C3'" 1 
ATOM   4034  O  "O3'" . DT  B 1 52  ? 8.817   87.432  -14.798 1.00 74.61  ? 198 DT  J "O3'" 1 
ATOM   4035  C  "C2'" . DT  B 1 52  ? 9.655   87.911  -12.569 1.00 74.61  ? 198 DT  J "C2'" 1 
ATOM   4036  C  "C1'" . DT  B 1 52  ? 8.851   86.849  -11.857 1.00 74.61  ? 198 DT  J "C1'" 1 
ATOM   4037  N  N1    . DT  B 1 52  ? 8.868   86.938  -10.402 1.00 47.31  ? 198 DT  J N1    1 
ATOM   4038  C  C2    . DT  B 1 52  ? 7.798   86.399  -9.718  1.00 47.31  ? 198 DT  J C2    1 
ATOM   4039  O  O2    . DT  B 1 52  ? 6.889   85.795  -10.260 1.00 47.31  ? 198 DT  J O2    1 
ATOM   4040  N  N3    . DT  B 1 52  ? 7.839   86.581  -8.365  1.00 47.31  ? 198 DT  J N3    1 
ATOM   4041  C  C4    . DT  B 1 52  ? 8.830   87.203  -7.638  1.00 47.31  ? 198 DT  J C4    1 
ATOM   4042  O  O4    . DT  B 1 52  ? 8.715   87.289  -6.424  1.00 47.31  ? 198 DT  J O4    1 
ATOM   4043  C  C5    . DT  B 1 52  ? 9.947   87.711  -8.414  1.00 47.31  ? 198 DT  J C5    1 
ATOM   4044  C  C7    . DT  B 1 52  ? 11.080  88.376  -7.705  1.00 47.31  ? 198 DT  J C7    1 
ATOM   4045  C  C6    . DT  B 1 52  ? 9.909   87.556  -9.741  1.00 47.31  ? 198 DT  J C6    1 
ATOM   4046  P  P     . DC  B 1 53  ? 8.392   88.920  -15.243 1.00 100.93 ? 199 DC  J P     1 
ATOM   4047  O  OP1   . DC  B 1 53  ? 8.261   88.917  -16.719 1.00 100.93 ? 199 DC  J OP1   1 
ATOM   4048  O  OP2   . DC  B 1 53  ? 9.280   89.921  -14.588 1.00 100.93 ? 199 DC  J OP2   1 
ATOM   4049  O  "O5'" . DC  B 1 53  ? 6.936   89.060  -14.619 1.00 70.94  ? 199 DC  J "O5'" 1 
ATOM   4050  C  "C5'" . DC  B 1 53  ? 6.075   87.924  -14.534 1.00 70.94  ? 199 DC  J "C5'" 1 
ATOM   4051  C  "C4'" . DC  B 1 53  ? 4.676   88.352  -14.159 1.00 70.94  ? 199 DC  J "C4'" 1 
ATOM   4052  O  "O4'" . DC  B 1 53  ? 4.501   88.075  -12.746 1.00 70.94  ? 199 DC  J "O4'" 1 
ATOM   4053  C  "C3'" . DC  B 1 53  ? 4.398   89.847  -14.355 1.00 70.94  ? 199 DC  J "C3'" 1 
ATOM   4054  O  "O3'" . DC  B 1 53  ? 3.114   90.102  -14.952 1.00 70.94  ? 199 DC  J "O3'" 1 
ATOM   4055  C  "C2'" . DC  B 1 53  ? 4.501   90.428  -12.956 1.00 70.94  ? 199 DC  J "C2'" 1 
ATOM   4056  C  "C1'" . DC  B 1 53  ? 4.166   89.259  -12.037 1.00 70.94  ? 199 DC  J "C1'" 1 
ATOM   4057  N  N1    . DC  B 1 53  ? 4.974   89.303  -10.803 1.00 66.89  ? 199 DC  J N1    1 
ATOM   4058  C  C2    . DC  B 1 53  ? 4.380   88.972  -9.569  1.00 66.89  ? 199 DC  J C2    1 
ATOM   4059  O  O2    . DC  B 1 53  ? 3.205   88.551  -9.547  1.00 66.89  ? 199 DC  J O2    1 
ATOM   4060  N  N3    . DC  B 1 53  ? 5.107   89.121  -8.435  1.00 66.89  ? 199 DC  J N3    1 
ATOM   4061  C  C4    . DC  B 1 53  ? 6.367   89.565  -8.501  1.00 66.89  ? 199 DC  J C4    1 
ATOM   4062  N  N4    . DC  B 1 53  ? 7.027   89.745  -7.359  1.00 66.89  ? 199 DC  J N4    1 
ATOM   4063  C  C5    . DC  B 1 53  ? 7.002   89.854  -9.740  1.00 66.89  ? 199 DC  J C5    1 
ATOM   4064  C  C6    . DC  B 1 53  ? 6.281   89.706  -10.853 1.00 66.89  ? 199 DC  J C6    1 
ATOM   4065  P  P     . DA  B 1 54  ? 2.493   91.591  -14.908 1.00 107.67 ? 200 DA  J P     1 
ATOM   4066  O  OP1   . DA  B 1 54  ? 1.297   91.659  -15.787 1.00 107.67 ? 200 DA  J OP1   1 
ATOM   4067  O  OP2   . DA  B 1 54  ? 3.592   92.580  -15.091 1.00 107.67 ? 200 DA  J OP2   1 
ATOM   4068  O  "O5'" . DA  B 1 54  ? 1.973   91.693  -13.409 1.00 74.03  ? 200 DA  J "O5'" 1 
ATOM   4069  C  "C5'" . DA  B 1 54  ? 0.957   90.816  -12.925 1.00 74.03  ? 200 DA  J "C5'" 1 
ATOM   4070  C  "C4'" . DA  B 1 54  ? 0.175   91.511  -11.840 1.00 74.03  ? 200 DA  J "C4'" 1 
ATOM   4071  O  "O4'" . DA  B 1 54  ? 0.850   91.414  -10.565 1.00 74.03  ? 200 DA  J "O4'" 1 
ATOM   4072  C  "C3'" . DA  B 1 54  ? 0.024   93.001  -12.124 1.00 74.03  ? 200 DA  J "C3'" 1 
ATOM   4073  O  "O3'" . DA  B 1 54  ? -1.255  93.440  -11.698 1.00 74.03  ? 200 DA  J "O3'" 1 
ATOM   4074  C  "C2'" . DA  B 1 54  ? 1.109   93.630  -11.270 1.00 74.03  ? 200 DA  J "C2'" 1 
ATOM   4075  C  "C1'" . DA  B 1 54  ? 1.125   92.714  -10.066 1.00 74.03  ? 200 DA  J "C1'" 1 
ATOM   4076  N  N9    . DA  B 1 54  ? 2.416   92.672  -9.383  1.00 50.04  ? 200 DA  J N9    1 
ATOM   4077  C  C8    . DA  B 1 54  ? 3.670   92.716  -9.940  1.00 50.04  ? 200 DA  J C8    1 
ATOM   4078  N  N7    . DA  B 1 54  ? 4.639   92.670  -9.058  1.00 50.04  ? 200 DA  J N7    1 
ATOM   4079  C  C5    . DA  B 1 54  ? 3.980   92.590  -7.837  1.00 50.04  ? 200 DA  J C5    1 
ATOM   4080  C  C6    . DA  B 1 54  ? 4.446   92.523  -6.500  1.00 50.04  ? 200 DA  J C6    1 
ATOM   4081  N  N6    . DA  B 1 54  ? 5.740   92.505  -6.154  1.00 50.04  ? 200 DA  J N6    1 
ATOM   4082  N  N1    . DA  B 1 54  ? 3.518   92.468  -5.515  1.00 50.04  ? 200 DA  J N1    1 
ATOM   4083  C  C2    . DA  B 1 54  ? 2.219   92.473  -5.858  1.00 50.04  ? 200 DA  J C2    1 
ATOM   4084  N  N3    . DA  B 1 54  ? 1.664   92.529  -7.071  1.00 50.04  ? 200 DA  J N3    1 
ATOM   4085  C  C4    . DA  B 1 54  ? 2.610   92.589  -8.024  1.00 50.04  ? 200 DA  J C4    1 
ATOM   4086  P  P     . DA  B 1 55  ? -1.729  94.937  -12.019 1.00 89.49  ? 201 DA  J P     1 
ATOM   4087  O  OP1   . DA  B 1 55  ? -2.374  94.939  -13.361 1.00 89.49  ? 201 DA  J OP1   1 
ATOM   4088  O  OP2   . DA  B 1 55  ? -0.601  95.873  -11.741 1.00 89.49  ? 201 DA  J OP2   1 
ATOM   4089  O  "O5'" . DA  B 1 55  ? -2.828  95.159  -10.895 1.00 80.35  ? 201 DA  J "O5'" 1 
ATOM   4090  C  "C5'" . DA  B 1 55  ? -2.679  94.554  -9.609  1.00 80.35  ? 201 DA  J "C5'" 1 
ATOM   4091  C  "C4'" . DA  B 1 55  ? -2.261  95.596  -8.599  1.00 80.35  ? 201 DA  J "C4'" 1 
ATOM   4092  O  "O4'" . DA  B 1 55  ? -0.880  95.428  -8.188  1.00 80.35  ? 201 DA  J "O4'" 1 
ATOM   4093  C  "C3'" . DA  B 1 55  ? -2.384  97.036  -9.107  1.00 80.35  ? 201 DA  J "C3'" 1 
ATOM   4094  O  "O3'" . DA  B 1 55  ? -2.970  97.853  -8.096  1.00 80.35  ? 201 DA  J "O3'" 1 
ATOM   4095  C  "C2'" . DA  B 1 55  ? -0.940  97.452  -9.335  1.00 80.35  ? 201 DA  J "C2'" 1 
ATOM   4096  C  "C1'" . DA  B 1 55  ? -0.255  96.702  -8.209  1.00 80.35  ? 201 DA  J "C1'" 1 
ATOM   4097  N  N9    . DA  B 1 55  ? 1.198   96.526  -8.330  1.00 66.94  ? 201 DA  J N9    1 
ATOM   4098  C  C8    . DA  B 1 55  ? 1.980   96.576  -9.466  1.00 66.94  ? 201 DA  J C8    1 
ATOM   4099  N  N7    . DA  B 1 55  ? 3.265   96.416  -9.231  1.00 66.94  ? 201 DA  J N7    1 
ATOM   4100  C  C5    . DA  B 1 55  ? 3.335   96.242  -7.851  1.00 66.94  ? 201 DA  J C5    1 
ATOM   4101  C  C6    . DA  B 1 55  ? 4.421   96.026  -6.968  1.00 66.94  ? 201 DA  J C6    1 
ATOM   4102  N  N6    . DA  B 1 55  ? 5.693   95.954  -7.363  1.00 66.94  ? 201 DA  J N6    1 
ATOM   4103  N  N1    . DA  B 1 55  ? 4.146   95.887  -5.650  1.00 66.94  ? 201 DA  J N1    1 
ATOM   4104  C  C2    . DA  B 1 55  ? 2.872   95.961  -5.253  1.00 66.94  ? 201 DA  J C2    1 
ATOM   4105  N  N3    . DA  B 1 55  ? 1.769   96.164  -5.978  1.00 66.94  ? 201 DA  J N3    1 
ATOM   4106  C  C4    . DA  B 1 55  ? 2.070   96.298  -7.284  1.00 66.94  ? 201 DA  J C4    1 
ATOM   4107  P  P     . DA  B 1 56  ? -3.686  99.237  -8.498  1.00 103.61 ? 202 DA  J P     1 
ATOM   4108  O  OP1   . DA  B 1 56  ? -5.095  98.938  -8.861  1.00 103.61 ? 202 DA  J OP1   1 
ATOM   4109  O  OP2   . DA  B 1 56  ? -2.813  99.978  -9.460  1.00 103.61 ? 202 DA  J OP2   1 
ATOM   4110  O  "O5'" . DA  B 1 56  ? -3.674  100.033 -7.120  1.00 98.69  ? 202 DA  J "O5'" 1 
ATOM   4111  C  "C5'" . DA  B 1 56  ? -3.851  99.343  -5.883  1.00 98.69  ? 202 DA  J "C5'" 1 
ATOM   4112  C  "C4'" . DA  B 1 56  ? -2.998  99.968  -4.802  1.00 98.69  ? 202 DA  J "C4'" 1 
ATOM   4113  O  "O4'" . DA  B 1 56  ? -1.614  99.542  -4.892  1.00 98.69  ? 202 DA  J "O4'" 1 
ATOM   4114  C  "C3'" . DA  B 1 56  ? -2.978  101.496 -4.791  1.00 98.69  ? 202 DA  J "C3'" 1 
ATOM   4115  O  "O3'" . DA  B 1 56  ? -3.180  101.962 -3.455  1.00 98.69  ? 202 DA  J "O3'" 1 
ATOM   4116  C  "C2'" . DA  B 1 56  ? -1.592  101.842 -5.315  1.00 98.69  ? 202 DA  J "C2'" 1 
ATOM   4117  C  "C1'" . DA  B 1 56  ? -0.747  100.667 -4.844  1.00 98.69  ? 202 DA  J "C1'" 1 
ATOM   4118  N  N9    . DA  B 1 56  ? 0.420   100.376 -5.687  1.00 70.27  ? 202 DA  J N9    1 
ATOM   4119  C  C8    . DA  B 1 56  ? 0.464   100.394 -7.063  1.00 70.27  ? 202 DA  J C8    1 
ATOM   4120  N  N7    . DA  B 1 56  ? 1.636   100.075 -7.564  1.00 70.27  ? 202 DA  J N7    1 
ATOM   4121  C  C5    . DA  B 1 56  ? 2.423   99.833  -6.447  1.00 70.27  ? 202 DA  J C5    1 
ATOM   4122  C  C6    . DA  B 1 56  ? 3.769   99.446  -6.309  1.00 70.27  ? 202 DA  J C6    1 
ATOM   4123  N  N6    . DA  B 1 56  ? 4.580   99.217  -7.347  1.00 70.27  ? 202 DA  J N6    1 
ATOM   4124  N  N1    . DA  B 1 56  ? 4.258   99.297  -5.056  1.00 70.27  ? 202 DA  J N1    1 
ATOM   4125  C  C2    . DA  B 1 56  ? 3.440   99.522  -4.020  1.00 70.27  ? 202 DA  J C2    1 
ATOM   4126  N  N3    . DA  B 1 56  ? 2.151   99.884  -4.020  1.00 70.27  ? 202 DA  J N3    1 
ATOM   4127  C  C4    . DA  B 1 56  ? 1.693   100.024 -5.281  1.00 70.27  ? 202 DA  J C4    1 
ATOM   4128  P  P     . DA  B 1 57  ? -3.082  103.531 -3.129  1.00 91.72  ? 203 DA  J P     1 
ATOM   4129  O  OP1   . DA  B 1 57  ? -3.944  103.818 -1.950  1.00 91.72  ? 203 DA  J OP1   1 
ATOM   4130  O  OP2   . DA  B 1 57  ? -3.262  104.308 -4.387  1.00 91.72  ? 203 DA  J OP2   1 
ATOM   4131  O  "O5'" . DA  B 1 57  ? -1.574  103.681 -2.663  1.00 140.54 ? 203 DA  J "O5'" 1 
ATOM   4132  C  "C5'" . DA  B 1 57  ? -1.097  102.918 -1.563  1.00 140.54 ? 203 DA  J "C5'" 1 
ATOM   4133  C  "C4'" . DA  B 1 57  ? 0.034   103.650 -0.888  1.00 140.54 ? 203 DA  J "C4'" 1 
ATOM   4134  O  "O4'" . DA  B 1 57  ? 1.260   103.456 -1.629  1.00 140.54 ? 203 DA  J "O4'" 1 
ATOM   4135  C  "C3'" . DA  B 1 57  ? -0.186  105.157 -0.795  1.00 140.54 ? 203 DA  J "C3'" 1 
ATOM   4136  O  "O3'" . DA  B 1 57  ? 0.218   105.591 0.506   1.00 140.54 ? 203 DA  J "O3'" 1 
ATOM   4137  C  "C2'" . DA  B 1 57  ? 0.638   105.711 -1.949  1.00 140.54 ? 203 DA  J "C2'" 1 
ATOM   4138  C  "C1'" . DA  B 1 57  ? 1.764   104.695 -2.109  1.00 140.54 ? 203 DA  J "C1'" 1 
ATOM   4139  N  N9    . DA  B 1 57  ? 2.242   104.472 -3.481  1.00 56.43  ? 203 DA  J N9    1 
ATOM   4140  C  C8    . DA  B 1 57  ? 1.659   104.831 -4.679  1.00 56.43  ? 203 DA  J C8    1 
ATOM   4141  N  N7    . DA  B 1 57  ? 2.337   104.442 -5.737  1.00 56.43  ? 203 DA  J N7    1 
ATOM   4142  C  C5    . DA  B 1 57  ? 3.448   103.792 -5.204  1.00 56.43  ? 203 DA  J C5    1 
ATOM   4143  C  C6    . DA  B 1 57  ? 4.556   103.136 -5.802  1.00 56.43  ? 203 DA  J C6    1 
ATOM   4144  N  N6    . DA  B 1 57  ? 4.739   103.019 -7.117  1.00 56.43  ? 203 DA  J N6    1 
ATOM   4145  N  N1    . DA  B 1 57  ? 5.479   102.594 -4.982  1.00 56.43  ? 203 DA  J N1    1 
ATOM   4146  C  C2    . DA  B 1 57  ? 5.304   102.698 -3.658  1.00 56.43  ? 203 DA  J C2    1 
ATOM   4147  N  N3    . DA  B 1 57  ? 4.316   103.282 -2.976  1.00 56.43  ? 203 DA  J N3    1 
ATOM   4148  C  C4    . DA  B 1 57  ? 3.408   103.814 -3.816  1.00 56.43  ? 203 DA  J C4    1 
ATOM   4149  P  P     . DG  B 1 58  ? 0.676   107.106 0.756   1.00 81.30  ? 204 DG  J P     1 
ATOM   4150  O  OP1   . DG  B 1 58  ? 0.096   107.547 2.043   1.00 81.30  ? 204 DG  J OP1   1 
ATOM   4151  O  OP2   . DG  B 1 58  ? 0.466   107.925 -0.471  1.00 81.30  ? 204 DG  J OP2   1 
ATOM   4152  O  "O5'" . DG  B 1 58  ? 2.228   106.928 0.997   1.00 110.04 ? 204 DG  J "O5'" 1 
ATOM   4153  C  "C5'" . DG  B 1 58  ? 2.722   105.738 1.601   1.00 110.04 ? 204 DG  J "C5'" 1 
ATOM   4154  C  "C4'" . DG  B 1 58  ? 4.217   105.837 1.739   1.00 110.04 ? 204 DG  J "C4'" 1 
ATOM   4155  O  "O4'" . DG  B 1 58  ? 4.817   105.848 0.423   1.00 110.04 ? 204 DG  J "O4'" 1 
ATOM   4156  C  "C3'" . DG  B 1 58  ? 4.622   107.152 2.386   1.00 110.04 ? 204 DG  J "C3'" 1 
ATOM   4157  O  "O3'" . DG  B 1 58  ? 5.796   106.940 3.145   1.00 110.04 ? 204 DG  J "O3'" 1 
ATOM   4158  C  "C2'" . DG  B 1 58  ? 4.868   108.073 1.203   1.00 110.04 ? 204 DG  J "C2'" 1 
ATOM   4159  C  "C1'" . DG  B 1 58  ? 5.388   107.123 0.138   1.00 110.04 ? 204 DG  J "C1'" 1 
ATOM   4160  N  N9    . DG  B 1 58  ? 4.997   107.484 -1.222  1.00 73.48  ? 204 DG  J N9    1 
ATOM   4161  C  C8    . DG  B 1 58  ? 4.005   108.360 -1.591  1.00 73.48  ? 204 DG  J C8    1 
ATOM   4162  N  N7    . DG  B 1 58  ? 3.854   108.450 -2.886  1.00 73.48  ? 204 DG  J N7    1 
ATOM   4163  C  C5    . DG  B 1 58  ? 4.808   107.585 -3.406  1.00 73.48  ? 204 DG  J C5    1 
ATOM   4164  C  C6    . DG  B 1 58  ? 5.113   107.246 -4.763  1.00 73.48  ? 204 DG  J C6    1 
ATOM   4165  O  O6    . DG  B 1 58  ? 4.559   107.629 -5.801  1.00 73.48  ? 204 DG  J O6    1 
ATOM   4166  N  N1    . DG  B 1 58  ? 6.175   106.346 -4.840  1.00 73.48  ? 204 DG  J N1    1 
ATOM   4167  C  C2    . DG  B 1 58  ? 6.844   105.822 -3.761  1.00 73.48  ? 204 DG  J C2    1 
ATOM   4168  N  N2    . DG  B 1 58  ? 7.843   104.976 -4.062  1.00 73.48  ? 204 DG  J N2    1 
ATOM   4169  N  N3    . DG  B 1 58  ? 6.556   106.107 -2.493  1.00 73.48  ? 204 DG  J N3    1 
ATOM   4170  C  C4    . DG  B 1 58  ? 5.535   106.993 -2.393  1.00 73.48  ? 204 DG  J C4    1 
ATOM   4171  P  P     . DG  B 1 59  ? 6.511   108.178 3.857   1.00 64.48  ? 205 DG  J P     1 
ATOM   4172  O  OP1   . DG  B 1 59  ? 6.135   108.158 5.294   1.00 64.48  ? 205 DG  J OP1   1 
ATOM   4173  O  OP2   . DG  B 1 59  ? 6.244   109.389 3.023   1.00 64.48  ? 205 DG  J OP2   1 
ATOM   4174  O  "O5'" . DG  B 1 59  ? 8.050   107.777 3.778   1.00 48.62  ? 205 DG  J "O5'" 1 
ATOM   4175  C  "C5'" . DG  B 1 59  ? 8.434   106.436 3.449   1.00 48.62  ? 205 DG  J "C5'" 1 
ATOM   4176  C  "C4'" . DG  B 1 59  ? 9.508   106.450 2.390   1.00 48.62  ? 205 DG  J "C4'" 1 
ATOM   4177  O  "O4'" . DG  B 1 59  ? 9.012   106.861 1.094   1.00 48.62  ? 205 DG  J "O4'" 1 
ATOM   4178  C  "C3'" . DG  B 1 59  ? 10.643  107.411 2.711   1.00 48.62  ? 205 DG  J "C3'" 1 
ATOM   4179  O  "O3'" . DG  B 1 59  ? 11.819  106.810 2.248   1.00 48.62  ? 205 DG  J "O3'" 1 
ATOM   4180  C  "C2'" . DG  B 1 59  ? 10.360  108.607 1.825   1.00 48.62  ? 205 DG  J "C2'" 1 
ATOM   4181  C  "C1'" . DG  B 1 59  ? 9.845   107.904 0.600   1.00 48.62  ? 205 DG  J "C1'" 1 
ATOM   4182  N  N9    . DG  B 1 59  ? 9.063   108.736 -0.305  1.00 61.32  ? 205 DG  J N9    1 
ATOM   4183  C  C8    . DG  B 1 59  ? 8.176   109.729 0.028   1.00 61.32  ? 205 DG  J C8    1 
ATOM   4184  N  N7    . DG  B 1 59  ? 7.615   110.282 -1.012  1.00 61.32  ? 205 DG  J N7    1 
ATOM   4185  C  C5    . DG  B 1 59  ? 8.169   109.616 -2.098  1.00 61.32  ? 205 DG  J C5    1 
ATOM   4186  C  C6    . DG  B 1 59  ? 7.934   109.769 -3.486  1.00 61.32  ? 205 DG  J C6    1 
ATOM   4187  O  O6    . DG  B 1 59  ? 7.160   110.541 -4.054  1.00 61.32  ? 205 DG  J O6    1 
ATOM   4188  N  N1    . DG  B 1 59  ? 8.710   108.894 -4.238  1.00 61.32  ? 205 DG  J N1    1 
ATOM   4189  C  C2    . DG  B 1 59  ? 9.602   107.988 -3.724  1.00 61.32  ? 205 DG  J C2    1 
ATOM   4190  N  N2    . DG  B 1 59  ? 10.277  107.253 -4.624  1.00 61.32  ? 205 DG  J N2    1 
ATOM   4191  N  N3    . DG  B 1 59  ? 9.819   107.822 -2.428  1.00 61.32  ? 205 DG  J N3    1 
ATOM   4192  C  C4    . DG  B 1 59  ? 9.072   108.667 -1.678  1.00 61.32  ? 205 DG  J C4    1 
ATOM   4193  P  P     . DC  B 1 60  ? 13.137  106.891 3.120   1.00 46.58  ? 206 DC  J P     1 
ATOM   4194  O  OP1   . DC  B 1 60  ? 13.342  105.607 3.838   1.00 46.58  ? 206 DC  J OP1   1 
ATOM   4195  O  OP2   . DC  B 1 60  ? 13.110  108.171 3.874   1.00 46.58  ? 206 DC  J OP2   1 
ATOM   4196  O  "O5'" . DC  B 1 60  ? 14.217  107.073 1.990   1.00 34.79  ? 206 DC  J "O5'" 1 
ATOM   4197  C  "C5'" . DC  B 1 60  ? 14.118  108.202 1.174   1.00 34.79  ? 206 DC  J "C5'" 1 
ATOM   4198  C  "C4'" . DC  B 1 60  ? 14.244  107.807 -0.267  1.00 34.79  ? 206 DC  J "C4'" 1 
ATOM   4199  O  "O4'" . DC  B 1 60  ? 13.061  108.266 -0.959  1.00 34.79  ? 206 DC  J "O4'" 1 
ATOM   4200  C  "C3'" . DC  B 1 60  ? 15.409  108.587 -0.841  1.00 34.79  ? 206 DC  J "C3'" 1 
ATOM   4201  O  "O3'" . DC  B 1 60  ? 16.149  107.808 -1.761  1.00 34.79  ? 206 DC  J "O3'" 1 
ATOM   4202  C  "C2'" . DC  B 1 60  ? 14.767  109.819 -1.448  1.00 34.79  ? 206 DC  J "C2'" 1 
ATOM   4203  C  "C1'" . DC  B 1 60  ? 13.374  109.351 -1.819  1.00 34.79  ? 206 DC  J "C1'" 1 
ATOM   4204  N  N1    . DC  B 1 60  ? 12.356  110.395 -1.636  1.00 35.23  ? 206 DC  J N1    1 
ATOM   4205  C  C2    . DC  B 1 60  ? 11.755  110.941 -2.769  1.00 35.23  ? 206 DC  J C2    1 
ATOM   4206  O  O2    . DC  B 1 60  ? 12.082  110.522 -3.875  1.00 35.23  ? 206 DC  J O2    1 
ATOM   4207  N  N3    . DC  B 1 60  ? 10.828  111.911 -2.635  1.00 35.23  ? 206 DC  J N3    1 
ATOM   4208  C  C4    . DC  B 1 60  ? 10.476  112.337 -1.421  1.00 35.23  ? 206 DC  J C4    1 
ATOM   4209  N  N4    . DC  B 1 60  ? 9.525   113.283 -1.348  1.00 35.23  ? 206 DC  J N4    1 
ATOM   4210  C  C5    . DC  B 1 60  ? 11.077  111.804 -0.231  1.00 35.23  ? 206 DC  J C5    1 
ATOM   4211  C  C6    . DC  B 1 60  ? 12.005  110.838 -0.387  1.00 35.23  ? 206 DC  J C6    1 
ATOM   4212  P  P     . DA  B 1 61  ? 17.651  108.220 -2.080  1.00 32.96  ? 207 DA  J P     1 
ATOM   4213  O  OP1   . DA  B 1 61  ? 18.466  106.987 -2.118  1.00 32.96  ? 207 DA  J OP1   1 
ATOM   4214  O  OP2   . DA  B 1 61  ? 18.048  109.345 -1.191  1.00 32.96  ? 207 DA  J OP2   1 
ATOM   4215  O  "O5'" . DA  B 1 61  ? 17.540  108.775 -3.551  1.00 23.75  ? 207 DA  J "O5'" 1 
ATOM   4216  C  "C5'" . DA  B 1 61  ? 17.063  107.926 -4.569  1.00 23.75  ? 207 DA  J "C5'" 1 
ATOM   4217  C  "C4'" . DA  B 1 61  ? 16.820  108.704 -5.839  1.00 23.75  ? 207 DA  J "C4'" 1 
ATOM   4218  O  "O4'" . DA  B 1 61  ? 15.702  109.595 -5.639  1.00 23.75  ? 207 DA  J "O4'" 1 
ATOM   4219  C  "C3'" . DA  B 1 61  ? 17.982  109.562 -6.339  1.00 23.75  ? 207 DA  J "C3'" 1 
ATOM   4220  O  "O3'" . DA  B 1 61  ? 18.177  109.274 -7.723  1.00 23.75  ? 207 DA  J "O3'" 1 
ATOM   4221  C  "C2'" . DA  B 1 61  ? 17.558  110.997 -6.026  1.00 23.75  ? 207 DA  J "C2'" 1 
ATOM   4222  C  "C1'" . DA  B 1 61  ? 16.032  110.925 -5.986  1.00 23.75  ? 207 DA  J "C1'" 1 
ATOM   4223  N  N9    . DA  B 1 61  ? 15.355  111.783 -5.014  1.00 28.89  ? 207 DA  J N9    1 
ATOM   4224  C  C8    . DA  B 1 61  ? 15.577  111.862 -3.673  1.00 28.89  ? 207 DA  J C8    1 
ATOM   4225  N  N7    . DA  B 1 61  ? 14.777  112.691 -3.052  1.00 28.89  ? 207 DA  J N7    1 
ATOM   4226  C  C5    . DA  B 1 61  ? 13.981  113.204 -4.061  1.00 28.89  ? 207 DA  J C5    1 
ATOM   4227  C  C6    . DA  B 1 61  ? 12.920  114.145 -4.059  1.00 28.89  ? 207 DA  J C6    1 
ATOM   4228  N  N6    . DA  B 1 61  ? 12.487  114.786 -2.959  1.00 28.89  ? 207 DA  J N6    1 
ATOM   4229  N  N1    . DA  B 1 61  ? 12.320  114.411 -5.241  1.00 28.89  ? 207 DA  J N1    1 
ATOM   4230  C  C2    . DA  B 1 61  ? 12.769  113.791 -6.340  1.00 28.89  ? 207 DA  J C2    1 
ATOM   4231  N  N3    . DA  B 1 61  ? 13.761  112.908 -6.468  1.00 28.89  ? 207 DA  J N3    1 
ATOM   4232  C  C4    . DA  B 1 61  ? 14.328  112.653 -5.277  1.00 28.89  ? 207 DA  J C4    1 
ATOM   4233  P  P     . DT  B 1 62  ? 19.314  110.028 -8.548  1.00 21.74  ? 208 DT  J P     1 
ATOM   4234  O  OP1   . DT  B 1 62  ? 19.685  109.176 -9.712  1.00 21.74  ? 208 DT  J OP1   1 
ATOM   4235  O  OP2   . DT  B 1 62  ? 20.360  110.575 -7.660  1.00 21.74  ? 208 DT  J OP2   1 
ATOM   4236  O  "O5'" . DT  B 1 62  ? 18.547  111.295 -9.089  1.00 28.53  ? 208 DT  J "O5'" 1 
ATOM   4237  C  "C5'" . DT  B 1 62  ? 17.431  111.129 -9.917  1.00 28.53  ? 208 DT  J "C5'" 1 
ATOM   4238  C  "C4'" . DT  B 1 62  ? 16.987  112.470 -10.428 1.00 28.53  ? 208 DT  J "C4'" 1 
ATOM   4239  O  "O4'" . DT  B 1 62  ? 16.269  113.223 -9.430  1.00 28.53  ? 208 DT  J "O4'" 1 
ATOM   4240  C  "C3'" . DT  B 1 62  ? 18.101  113.375 -10.934 1.00 28.53  ? 208 DT  J "C3'" 1 
ATOM   4241  O  "O3'" . DT  B 1 62  ? 17.608  113.851 -12.177 1.00 28.53  ? 208 DT  J "O3'" 1 
ATOM   4242  C  "C2'" . DT  B 1 62  ? 18.179  114.472 -9.878  1.00 28.53  ? 208 DT  J "C2'" 1 
ATOM   4243  C  "C1'" . DT  B 1 62  ? 16.746  114.554 -9.390  1.00 28.53  ? 208 DT  J "C1'" 1 
ATOM   4244  N  N1    . DT  B 1 62  ? 16.531  115.025 -8.017  1.00 36.35  ? 208 DT  J N1    1 
ATOM   4245  C  C2    . DT  B 1 62  ? 15.433  115.837 -7.755  1.00 36.35  ? 208 DT  J C2    1 
ATOM   4246  O  O2    . DT  B 1 62  ? 14.679  116.265 -8.614  1.00 36.35  ? 208 DT  J O2    1 
ATOM   4247  N  N3    . DT  B 1 62  ? 15.246  116.127 -6.435  1.00 36.35  ? 208 DT  J N3    1 
ATOM   4248  C  C4    . DT  B 1 62  ? 16.014  115.708 -5.372  1.00 36.35  ? 208 DT  J C4    1 
ATOM   4249  O  O4    . DT  B 1 62  ? 15.667  116.005 -4.227  1.00 36.35  ? 208 DT  J O4    1 
ATOM   4250  C  C5    . DT  B 1 62  ? 17.185  114.913 -5.726  1.00 36.35  ? 208 DT  J C5    1 
ATOM   4251  C  C7    . DT  B 1 62  ? 18.120  114.464 -4.647  1.00 36.35  ? 208 DT  J C7    1 
ATOM   4252  C  C6    . DT  B 1 62  ? 17.379  114.620 -7.013  1.00 36.35  ? 208 DT  J C6    1 
ATOM   4253  P  P     . DG  B 1 63  ? 18.596  114.477 -13.260 1.00 46.23  ? 209 DG  J P     1 
ATOM   4254  O  OP1   . DG  B 1 63  ? 18.109  114.026 -14.591 1.00 46.23  ? 209 DG  J OP1   1 
ATOM   4255  O  OP2   . DG  B 1 63  ? 20.022  114.257 -12.875 1.00 46.23  ? 209 DG  J OP2   1 
ATOM   4256  O  "O5'" . DG  B 1 63  ? 18.217  116.009 -13.085 1.00 34.77  ? 209 DG  J "O5'" 1 
ATOM   4257  C  "C5'" . DG  B 1 63  ? 16.843  116.399 -12.994 1.00 34.77  ? 209 DG  J "C5'" 1 
ATOM   4258  C  "C4'" . DG  B 1 63  ? 16.741  117.863 -12.650 1.00 34.77  ? 209 DG  J "C4'" 1 
ATOM   4259  O  "O4'" . DG  B 1 63  ? 16.580  118.048 -11.230 1.00 34.77  ? 209 DG  J "O4'" 1 
ATOM   4260  C  "C3'" . DG  B 1 63  ? 17.959  118.683 -13.059 1.00 34.77  ? 209 DG  J "C3'" 1 
ATOM   4261  O  "O3'" . DG  B 1 63  ? 17.510  119.843 -13.752 1.00 34.77  ? 209 DG  J "O3'" 1 
ATOM   4262  C  "C2'" . DG  B 1 63  ? 18.647  118.995 -11.738 1.00 34.77  ? 209 DG  J "C2'" 1 
ATOM   4263  C  "C1'" . DG  B 1 63  ? 17.485  119.030 -10.768 1.00 34.77  ? 209 DG  J "C1'" 1 
ATOM   4264  N  N9    . DG  B 1 63  ? 17.805  118.716 -9.377  1.00 42.96  ? 209 DG  J N9    1 
ATOM   4265  C  C8    . DG  B 1 63  ? 18.800  117.882 -8.915  1.00 42.96  ? 209 DG  J C8    1 
ATOM   4266  N  N7    . DG  B 1 63  ? 18.838  117.800 -7.609  1.00 42.96  ? 209 DG  J N7    1 
ATOM   4267  C  C5    . DG  B 1 63  ? 17.804  118.629 -7.178  1.00 42.96  ? 209 DG  J C5    1 
ATOM   4268  C  C6    . DG  B 1 63  ? 17.358  118.951 -5.857  1.00 42.96  ? 209 DG  J C6    1 
ATOM   4269  O  O6    . DG  B 1 63  ? 17.799  118.559 -4.771  1.00 42.96  ? 209 DG  J O6    1 
ATOM   4270  N  N1    . DG  B 1 63  ? 16.281  119.833 -5.881  1.00 42.96  ? 209 DG  J N1    1 
ATOM   4271  C  C2    . DG  B 1 63  ? 15.697  120.340 -7.015  1.00 42.96  ? 209 DG  J C2    1 
ATOM   4272  N  N2    . DG  B 1 63  ? 14.665  121.162 -6.804  1.00 42.96  ? 209 DG  J N2    1 
ATOM   4273  N  N3    . DG  B 1 63  ? 16.098  120.058 -8.250  1.00 42.96  ? 209 DG  J N3    1 
ATOM   4274  C  C4    . DG  B 1 63  ? 17.152  119.201 -8.256  1.00 42.96  ? 209 DG  J C4    1 
ATOM   4275  P  P     . DT  B 1 64  ? 18.561  120.961 -14.219 1.00 40.57  ? 210 DT  J P     1 
ATOM   4276  O  OP1   . DT  B 1 64  ? 18.254  121.367 -15.623 1.00 40.57  ? 210 DT  J OP1   1 
ATOM   4277  O  OP2   . DT  B 1 64  ? 19.938  120.516 -13.863 1.00 40.57  ? 210 DT  J OP2   1 
ATOM   4278  O  "O5'" . DT  B 1 64  ? 18.166  122.162 -13.261 1.00 65.84  ? 210 DT  J "O5'" 1 
ATOM   4279  C  "C5'" . DT  B 1 64  ? 16.798  122.395 -12.939 1.00 65.84  ? 210 DT  J "C5'" 1 
ATOM   4280  C  "C4'" . DT  B 1 64  ? 16.693  123.501 -11.921 1.00 65.84  ? 210 DT  J "C4'" 1 
ATOM   4281  O  "O4'" . DT  B 1 64  ? 16.844  122.964 -10.584 1.00 65.84  ? 210 DT  J "O4'" 1 
ATOM   4282  C  "C3'" . DT  B 1 64  ? 17.777  124.564 -12.094 1.00 65.84  ? 210 DT  J "C3'" 1 
ATOM   4283  O  "O3'" . DT  B 1 64  ? 17.216  125.866 -12.099 1.00 65.84  ? 210 DT  J "O3'" 1 
ATOM   4284  C  "C2'" . DT  B 1 64  ? 18.678  124.371 -10.888 1.00 65.84  ? 210 DT  J "C2'" 1 
ATOM   4285  C  "C1'" . DT  B 1 64  ? 17.736  123.782 -9.856  1.00 65.84  ? 210 DT  J "C1'" 1 
ATOM   4286  N  N1    . DT  B 1 64  ? 18.402  122.951 -8.827  1.00 43.10  ? 210 DT  J N1    1 
ATOM   4287  C  C2    . DT  B 1 64  ? 17.978  123.076 -7.517  1.00 43.10  ? 210 DT  J C2    1 
ATOM   4288  O  O2    . DT  B 1 64  ? 17.032  123.781 -7.171  1.00 43.10  ? 210 DT  J O2    1 
ATOM   4289  N  N3    . DT  B 1 64  ? 18.703  122.335 -6.614  1.00 43.10  ? 210 DT  J N3    1 
ATOM   4290  C  C4    . DT  B 1 64  ? 19.758  121.488 -6.877  1.00 43.10  ? 210 DT  J C4    1 
ATOM   4291  O  O4    . DT  B 1 64  ? 20.304  120.899 -5.956  1.00 43.10  ? 210 DT  J O4    1 
ATOM   4292  C  C5    . DT  B 1 64  ? 20.124  121.376 -8.267  1.00 43.10  ? 210 DT  J C5    1 
ATOM   4293  C  C7    . DT  B 1 64  ? 21.252  120.467 -8.645  1.00 43.10  ? 210 DT  J C7    1 
ATOM   4294  C  C6    . DT  B 1 64  ? 19.435  122.099 -9.163  1.00 43.10  ? 210 DT  J C6    1 
ATOM   4295  P  P     . DT  B 1 65  ? 18.158  127.128 -12.403 1.00 74.60  ? 211 DT  J P     1 
ATOM   4296  O  OP1   . DT  B 1 65  ? 17.500  127.932 -13.468 1.00 74.60  ? 211 DT  J OP1   1 
ATOM   4297  O  OP2   . DT  B 1 65  ? 19.559  126.670 -12.583 1.00 74.60  ? 211 DT  J OP2   1 
ATOM   4298  O  "O5'" . DT  B 1 65  ? 18.089  127.921 -11.031 1.00 50.10  ? 211 DT  J "O5'" 1 
ATOM   4299  C  "C5'" . DT  B 1 65  ? 16.837  128.085 -10.380 1.00 50.10  ? 211 DT  J "C5'" 1 
ATOM   4300  C  "C4'" . DT  B 1 65  ? 17.042  128.674 -9.010  1.00 50.10  ? 211 DT  J "C4'" 1 
ATOM   4301  O  "O4'" . DT  B 1 65  ? 17.584  127.673 -8.123  1.00 50.10  ? 211 DT  J "O4'" 1 
ATOM   4302  C  "C3'" . DT  B 1 65  ? 18.018  129.847 -8.977  1.00 50.10  ? 211 DT  J "C3'" 1 
ATOM   4303  O  "O3'" . DT  B 1 65  ? 17.536  130.774 -8.023  1.00 50.10  ? 211 DT  J "O3'" 1 
ATOM   4304  C  "C2'" . DT  B 1 65  ? 19.296  129.227 -8.457  1.00 50.10  ? 211 DT  J "C2'" 1 
ATOM   4305  C  "C1'" . DT  B 1 65  ? 18.752  128.184 -7.504  1.00 50.10  ? 211 DT  J "C1'" 1 
ATOM   4306  N  N1    . DT  B 1 65  ? 19.661  127.057 -7.261  1.00 37.44  ? 211 DT  J N1    1 
ATOM   4307  C  C2    . DT  B 1 65  ? 19.767  126.580 -5.978  1.00 37.44  ? 211 DT  J C2    1 
ATOM   4308  O  O2    . DT  B 1 65  ? 19.134  127.037 -5.052  1.00 37.44  ? 211 DT  J O2    1 
ATOM   4309  N  N3    . DT  B 1 65  ? 20.645  125.549 -5.818  1.00 37.44  ? 211 DT  J N3    1 
ATOM   4310  C  C4    . DT  B 1 65  ? 21.415  124.956 -6.793  1.00 37.44  ? 211 DT  J C4    1 
ATOM   4311  O  O4    . DT  B 1 65  ? 22.162  124.025 -6.490  1.00 37.44  ? 211 DT  J O4    1 
ATOM   4312  C  C5    . DT  B 1 65  ? 21.257  125.518 -8.132  1.00 37.44  ? 211 DT  J C5    1 
ATOM   4313  C  C7    . DT  B 1 65  ? 22.074  124.977 -9.262  1.00 37.44  ? 211 DT  J C7    1 
ATOM   4314  C  C6    . DT  B 1 65  ? 20.389  126.516 -8.292  1.00 37.44  ? 211 DT  J C6    1 
ATOM   4315  P  P     . DC  B 1 66  ? 18.023  132.300 -8.066  1.00 41.91  ? 212 DC  J P     1 
ATOM   4316  O  OP1   . DC  B 1 66  ? 16.783  133.041 -7.730  1.00 41.91  ? 212 DC  J OP1   1 
ATOM   4317  O  OP2   . DC  B 1 66  ? 18.768  132.615 -9.323  1.00 41.91  ? 212 DC  J OP2   1 
ATOM   4318  O  "O5'" . DC  B 1 66  ? 18.987  132.380 -6.803  1.00 48.54  ? 212 DC  J "O5'" 1 
ATOM   4319  C  "C5'" . DC  B 1 66  ? 18.517  131.899 -5.546  1.00 48.54  ? 212 DC  J "C5'" 1 
ATOM   4320  C  "C4'" . DC  B 1 66  ? 19.610  131.948 -4.507  1.00 48.54  ? 212 DC  J "C4'" 1 
ATOM   4321  O  "O4'" . DC  B 1 66  ? 20.329  130.692 -4.474  1.00 48.54  ? 212 DC  J "O4'" 1 
ATOM   4322  C  "C3'" . DC  B 1 66  ? 20.664  133.038 -4.680  1.00 48.54  ? 212 DC  J "C3'" 1 
ATOM   4323  O  "O3'" . DC  B 1 66  ? 20.925  133.619 -3.401  1.00 48.54  ? 212 DC  J "O3'" 1 
ATOM   4324  C  "C2'" . DC  B 1 66  ? 21.880  132.277 -5.187  1.00 48.54  ? 212 DC  J "C2'" 1 
ATOM   4325  C  "C1'" . DC  B 1 66  ? 21.722  130.936 -4.497  1.00 48.54  ? 212 DC  J "C1'" 1 
ATOM   4326  N  N1    . DC  B 1 66  ? 22.354  129.814 -5.194  1.00 31.23  ? 212 DC  J N1    1 
ATOM   4327  C  C2    . DC  B 1 66  ? 22.712  128.656 -4.461  1.00 31.23  ? 212 DC  J C2    1 
ATOM   4328  O  O2    . DC  B 1 66  ? 22.477  128.605 -3.239  1.00 31.23  ? 212 DC  J O2    1 
ATOM   4329  N  N3    . DC  B 1 66  ? 23.308  127.623 -5.112  1.00 31.23  ? 212 DC  J N3    1 
ATOM   4330  C  C4    . DC  B 1 66  ? 23.547  127.711 -6.428  1.00 31.23  ? 212 DC  J C4    1 
ATOM   4331  N  N4    . DC  B 1 66  ? 24.144  126.671 -7.029  1.00 31.23  ? 212 DC  J N4    1 
ATOM   4332  C  C5    . DC  B 1 66  ? 23.187  128.868 -7.188  1.00 31.23  ? 212 DC  J C5    1 
ATOM   4333  C  C6    . DC  B 1 66  ? 22.599  129.883 -6.537  1.00 31.23  ? 212 DC  J C6    1 
ATOM   4334  P  P     . DA  B 1 67  ? 21.702  135.017 -3.305  1.00 38.14  ? 213 DA  J P     1 
ATOM   4335  O  OP1   . DA  B 1 67  ? 20.853  135.990 -2.560  1.00 38.14  ? 213 DA  J OP1   1 
ATOM   4336  O  OP2   . DA  B 1 67  ? 22.207  135.349 -4.665  1.00 38.14  ? 213 DA  J OP2   1 
ATOM   4337  O  "O5'" . DA  B 1 67  ? 22.956  134.674 -2.395  1.00 34.50  ? 213 DA  J "O5'" 1 
ATOM   4338  C  "C5'" . DA  B 1 67  ? 22.776  133.976 -1.172  1.00 34.50  ? 213 DA  J "C5'" 1 
ATOM   4339  C  "C4'" . DA  B 1 67  ? 24.077  133.356 -0.729  1.00 34.50  ? 213 DA  J "C4'" 1 
ATOM   4340  O  "O4'" . DA  B 1 67  ? 24.400  132.228 -1.566  1.00 34.50  ? 213 DA  J "O4'" 1 
ATOM   4341  C  "C3'" . DA  B 1 67  ? 25.283  134.292 -0.800  1.00 34.50  ? 213 DA  J "C3'" 1 
ATOM   4342  O  "O3'" . DA  B 1 67  ? 26.133  134.006 0.302   1.00 34.50  ? 213 DA  J "O3'" 1 
ATOM   4343  C  "C2'" . DA  B 1 67  ? 25.962  133.875 -2.086  1.00 34.50  ? 213 DA  J "C2'" 1 
ATOM   4344  C  "C1'" . DA  B 1 67  ? 25.717  132.387 -2.035  1.00 34.50  ? 213 DA  J "C1'" 1 
ATOM   4345  N  N9    . DA  B 1 67  ? 25.819  131.707 -3.313  1.00 29.74  ? 213 DA  J N9    1 
ATOM   4346  C  C8    . DA  B 1 67  ? 25.643  132.193 -4.586  1.00 29.74  ? 213 DA  J C8    1 
ATOM   4347  N  N7    . DA  B 1 67  ? 25.877  131.305 -5.524  1.00 29.74  ? 213 DA  J N7    1 
ATOM   4348  C  C5    . DA  B 1 67  ? 26.219  130.158 -4.817  1.00 29.74  ? 213 DA  J C5    1 
ATOM   4349  C  C6    . DA  B 1 67  ? 26.590  128.878 -5.224  1.00 29.74  ? 213 DA  J C6    1 
ATOM   4350  N  N6    . DA  B 1 67  ? 26.739  128.526 -6.502  1.00 29.74  ? 213 DA  J N6    1 
ATOM   4351  N  N1    . DA  B 1 67  ? 26.825  127.958 -4.260  1.00 29.74  ? 213 DA  J N1    1 
ATOM   4352  C  C2    . DA  B 1 67  ? 26.723  128.325 -2.975  1.00 29.74  ? 213 DA  J C2    1 
ATOM   4353  N  N3    . DA  B 1 67  ? 26.410  129.503 -2.467  1.00 29.74  ? 213 DA  J N3    1 
ATOM   4354  C  C4    . DA  B 1 67  ? 26.164  130.386 -3.454  1.00 29.74  ? 213 DA  J C4    1 
ATOM   4355  P  P     . DG  B 1 68  ? 25.869  134.741 1.693   1.00 35.57  ? 214 DG  J P     1 
ATOM   4356  O  OP1   . DG  B 1 68  ? 24.407  134.680 1.939   1.00 35.57  ? 214 DG  J OP1   1 
ATOM   4357  O  OP2   . DG  B 1 68  ? 26.576  136.060 1.639   1.00 35.57  ? 214 DG  J OP2   1 
ATOM   4358  O  "O5'" . DG  B 1 68  ? 26.579  133.810 2.772   1.00 27.59  ? 214 DG  J "O5'" 1 
ATOM   4359  C  "C5'" . DG  B 1 68  ? 25.902  132.679 3.320   1.00 27.59  ? 214 DG  J "C5'" 1 
ATOM   4360  C  "C4'" . DG  B 1 68  ? 26.883  131.573 3.634   1.00 27.59  ? 214 DG  J "C4'" 1 
ATOM   4361  O  "O4'" . DG  B 1 68  ? 27.420  130.976 2.428   1.00 27.59  ? 214 DG  J "O4'" 1 
ATOM   4362  C  "C3'" . DG  B 1 68  ? 28.086  131.977 4.477   1.00 27.59  ? 214 DG  J "C3'" 1 
ATOM   4363  O  "O3'" . DG  B 1 68  ? 28.319  130.900 5.387   1.00 27.59  ? 214 DG  J "O3'" 1 
ATOM   4364  C  "C2'" . DG  B 1 68  ? 29.193  132.162 3.447   1.00 27.59  ? 214 DG  J "C2'" 1 
ATOM   4365  C  "C1'" . DG  B 1 68  ? 28.835  131.132 2.382   1.00 27.59  ? 214 DG  J "C1'" 1 
ATOM   4366  N  N9    . DG  B 1 68  ? 29.161  131.481 1.008   1.00 33.74  ? 214 DG  J N9    1 
ATOM   4367  C  C8    . DG  B 1 68  ? 29.088  132.716 0.420   1.00 33.74  ? 214 DG  J C8    1 
ATOM   4368  N  N7    . DG  B 1 68  ? 29.286  132.681 -0.871  1.00 33.74  ? 214 DG  J N7    1 
ATOM   4369  C  C5    . DG  B 1 68  ? 29.544  131.348 -1.140  1.00 33.74  ? 214 DG  J C5    1 
ATOM   4370  C  C6    . DG  B 1 68  ? 29.804  130.697 -2.366  1.00 33.74  ? 214 DG  J C6    1 
ATOM   4371  O  O6    . DG  B 1 68  ? 29.824  131.178 -3.503  1.00 33.74  ? 214 DG  J O6    1 
ATOM   4372  N  N1    . DG  B 1 68  ? 30.029  129.333 -2.187  1.00 33.74  ? 214 DG  J N1    1 
ATOM   4373  C  C2    . DG  B 1 68  ? 29.972  128.674 -0.980  1.00 33.74  ? 214 DG  J C2    1 
ATOM   4374  N  N2    . DG  B 1 68  ? 30.189  127.342 -1.005  1.00 33.74  ? 214 DG  J N2    1 
ATOM   4375  N  N3    . DG  B 1 68  ? 29.713  129.274 0.170   1.00 33.74  ? 214 DG  J N3    1 
ATOM   4376  C  C4    . DG  B 1 68  ? 29.510  130.601 0.016   1.00 33.74  ? 214 DG  J C4    1 
ATOM   4377  P  P     . DC  B 1 69  ? 29.552  130.951 6.409   1.00 38.45  ? 215 DC  J P     1 
ATOM   4378  O  OP1   . DC  B 1 69  ? 29.159  130.048 7.520   1.00 38.45  ? 215 DC  J OP1   1 
ATOM   4379  O  OP2   . DC  B 1 69  ? 29.892  132.362 6.704   1.00 38.45  ? 215 DC  J OP2   1 
ATOM   4380  O  "O5'" . DC  B 1 69  ? 30.724  130.272 5.560   1.00 32.65  ? 215 DC  J "O5'" 1 
ATOM   4381  C  "C5'" . DC  B 1 69  ? 30.552  128.944 5.025   1.00 32.65  ? 215 DC  J "C5'" 1 
ATOM   4382  C  "C4'" . DC  B 1 69  ? 31.785  128.495 4.275   1.00 32.65  ? 215 DC  J "C4'" 1 
ATOM   4383  O  "O4'" . DC  B 1 69  ? 31.831  129.136 2.988   1.00 32.65  ? 215 DC  J "O4'" 1 
ATOM   4384  C  "C3'" . DC  B 1 69  ? 33.112  128.848 4.942   1.00 32.65  ? 215 DC  J "C3'" 1 
ATOM   4385  O  "O3'" . DC  B 1 69  ? 34.076  127.838 4.626   1.00 32.65  ? 215 DC  J "O3'" 1 
ATOM   4386  C  "C2'" . DC  B 1 69  ? 33.492  130.147 4.261   1.00 32.65  ? 215 DC  J "C2'" 1 
ATOM   4387  C  "C1'" . DC  B 1 69  ? 33.062  129.819 2.862   1.00 32.65  ? 215 DC  J "C1'" 1 
ATOM   4388  N  N1    . DC  B 1 69  ? 32.842  130.968 2.011   1.00 30.55  ? 215 DC  J N1    1 
ATOM   4389  C  C2    . DC  B 1 69  ? 33.022  130.805 0.652   1.00 30.55  ? 215 DC  J C2    1 
ATOM   4390  O  O2    . DC  B 1 69  ? 33.336  129.679 0.228   1.00 30.55  ? 215 DC  J O2    1 
ATOM   4391  N  N3    . DC  B 1 69  ? 32.845  131.856 -0.169  1.00 30.55  ? 215 DC  J N3    1 
ATOM   4392  C  C4    . DC  B 1 69  ? 32.483  133.035 0.335   1.00 30.55  ? 215 DC  J C4    1 
ATOM   4393  N  N4    . DC  B 1 69  ? 32.317  134.053 -0.516  1.00 30.55  ? 215 DC  J N4    1 
ATOM   4394  C  C5    . DC  B 1 69  ? 32.275  133.225 1.734   1.00 30.55  ? 215 DC  J C5    1 
ATOM   4395  C  C6    . DC  B 1 69  ? 32.468  132.173 2.528   1.00 30.55  ? 215 DC  J C6    1 
ATOM   4396  P  P     . DT  B 1 70  ? 34.461  126.736 5.731   1.00 27.66  ? 216 DT  J P     1 
ATOM   4397  O  OP1   . DT  B 1 70  ? 33.200  126.114 6.242   1.00 27.66  ? 216 DT  J OP1   1 
ATOM   4398  O  OP2   . DT  B 1 70  ? 35.400  127.350 6.688   1.00 27.66  ? 216 DT  J OP2   1 
ATOM   4399  O  "O5'" . DT  B 1 70  ? 35.231  125.658 4.853   1.00 27.71  ? 216 DT  J "O5'" 1 
ATOM   4400  C  "C5'" . DT  B 1 70  ? 34.559  124.972 3.803   1.00 27.71  ? 216 DT  J "C5'" 1 
ATOM   4401  C  "C4'" . DT  B 1 70  ? 35.373  125.030 2.530   1.00 27.71  ? 216 DT  J "C4'" 1 
ATOM   4402  O  "O4'" . DT  B 1 70  ? 35.203  126.293 1.812   1.00 27.71  ? 216 DT  J "O4'" 1 
ATOM   4403  C  "C3'" . DT  B 1 70  ? 36.870  124.863 2.773   1.00 27.71  ? 216 DT  J "C3'" 1 
ATOM   4404  O  "O3'" . DT  B 1 70  ? 37.414  123.932 1.855   1.00 27.71  ? 216 DT  J "O3'" 1 
ATOM   4405  C  "C2'" . DT  B 1 70  ? 37.426  126.236 2.461   1.00 27.71  ? 216 DT  J "C2'" 1 
ATOM   4406  C  "C1'" . DT  B 1 70  ? 36.479  126.729 1.382   1.00 27.71  ? 216 DT  J "C1'" 1 
ATOM   4407  N  N1    . DT  B 1 70  ? 36.466  128.206 1.213   1.00 41.33  ? 216 DT  J N1    1 
ATOM   4408  C  C2    . DT  B 1 70  ? 36.554  128.715 -0.071  1.00 41.33  ? 216 DT  J C2    1 
ATOM   4409  O  O2    . DT  B 1 70  ? 36.601  128.017 -1.070  1.00 41.33  ? 216 DT  J O2    1 
ATOM   4410  N  N3    . DT  B 1 70  ? 36.585  130.087 -0.141  1.00 41.33  ? 216 DT  J N3    1 
ATOM   4411  C  C4    . DT  B 1 70  ? 36.532  130.984 0.912   1.00 41.33  ? 216 DT  J C4    1 
ATOM   4412  O  O4    . DT  B 1 70  ? 36.559  132.194 0.687   1.00 41.33  ? 216 DT  J O4    1 
ATOM   4413  C  C5    . DT  B 1 70  ? 36.436  130.391 2.221   1.00 41.33  ? 216 DT  J C5    1 
ATOM   4414  C  C7    . DT  B 1 70  ? 36.384  131.291 3.413   1.00 41.33  ? 216 DT  J C7    1 
ATOM   4415  C  C6    . DT  B 1 70  ? 36.400  129.050 2.307   1.00 41.33  ? 216 DT  J C6    1 
ATOM   4416  P  P     . DG  B 1 71  ? 38.697  123.058 2.274   1.00 23.27  ? 217 DG  J P     1 
ATOM   4417  O  OP1   . DG  B 1 71  ? 38.356  121.622 2.412   1.00 23.27  ? 217 DG  J OP1   1 
ATOM   4418  O  OP2   . DG  B 1 71  ? 39.379  123.750 3.397   1.00 23.27  ? 217 DG  J OP2   1 
ATOM   4419  O  "O5'" . DG  B 1 71  ? 39.576  123.137 0.959   1.00 20.80  ? 217 DG  J "O5'" 1 
ATOM   4420  C  "C5'" . DG  B 1 71  ? 39.056  122.622 -0.255  1.00 20.80  ? 217 DG  J "C5'" 1 
ATOM   4421  C  "C4'" . DG  B 1 71  ? 39.581  123.410 -1.427  1.00 20.80  ? 217 DG  J "C4'" 1 
ATOM   4422  O  "O4'" . DG  B 1 71  ? 39.353  124.818 -1.177  1.00 20.80  ? 217 DG  J "O4'" 1 
ATOM   4423  C  "C3'" . DG  B 1 71  ? 41.076  123.256 -1.688  1.00 20.80  ? 217 DG  J "C3'" 1 
ATOM   4424  O  "O3'" . DG  B 1 71  ? 41.279  123.257 -3.097  1.00 20.80  ? 217 DG  J "O3'" 1 
ATOM   4425  C  "C2'" . DG  B 1 71  ? 41.673  124.493 -1.043  1.00 20.80  ? 217 DG  J "C2'" 1 
ATOM   4426  C  "C1'" . DG  B 1 71  ? 40.577  125.532 -1.217  1.00 20.80  ? 217 DG  J "C1'" 1 
ATOM   4427  N  N9    . DG  B 1 71  ? 40.528  126.583 -0.197  1.00 30.27  ? 217 DG  J N9    1 
ATOM   4428  C  C8    . DG  B 1 71  ? 40.692  126.458 1.164   1.00 30.27  ? 217 DG  J C8    1 
ATOM   4429  N  N7    . DG  B 1 71  ? 40.613  127.598 1.806   1.00 30.27  ? 217 DG  J N7    1 
ATOM   4430  C  C5    . DG  B 1 71  ? 40.376  128.527 0.801   1.00 30.27  ? 217 DG  J C5    1 
ATOM   4431  C  C6    . DG  B 1 71  ? 40.209  129.943 0.872   1.00 30.27  ? 217 DG  J C6    1 
ATOM   4432  O  O6    . DG  B 1 71  ? 40.227  130.682 1.884   1.00 30.27  ? 217 DG  J O6    1 
ATOM   4433  N  N1    . DG  B 1 71  ? 40.007  130.492 -0.396  1.00 30.27  ? 217 DG  J N1    1 
ATOM   4434  C  C2    . DG  B 1 71  ? 39.975  129.773 -1.570  1.00 30.27  ? 217 DG  J C2    1 
ATOM   4435  N  N2    . DG  B 1 71  ? 39.790  130.484 -2.670  1.00 30.27  ? 217 DG  J N2    1 
ATOM   4436  N  N3    . DG  B 1 71  ? 40.119  128.466 -1.651  1.00 30.27  ? 217 DG  J N3    1 
ATOM   4437  C  C4    . DG  B 1 71  ? 40.318  127.910 -0.438  1.00 30.27  ? 217 DG  J C4    1 
ATOM   4438  P  P     . DA  B 1 72  ? 42.584  122.568 -3.725  1.00 32.10  ? 218 DA  J P     1 
ATOM   4439  O  OP1   . DA  B 1 72  ? 42.133  121.545 -4.693  1.00 32.10  ? 218 DA  J OP1   1 
ATOM   4440  O  OP2   . DA  B 1 72  ? 43.540  122.207 -2.640  1.00 32.10  ? 218 DA  J OP2   1 
ATOM   4441  O  "O5'" . DA  B 1 72  ? 43.225  123.751 -4.557  1.00 40.86  ? 218 DA  J "O5'" 1 
ATOM   4442  C  "C5'" . DA  B 1 72  ? 42.394  124.668 -5.246  1.00 40.86  ? 218 DA  J "C5'" 1 
ATOM   4443  C  "C4'" . DA  B 1 72  ? 43.097  125.996 -5.388  1.00 40.86  ? 218 DA  J "C4'" 1 
ATOM   4444  O  "O4'" . DA  B 1 72  ? 42.884  126.851 -4.238  1.00 40.86  ? 218 DA  J "O4'" 1 
ATOM   4445  C  "C3'" . DA  B 1 72  ? 44.612  125.878 -5.568  1.00 40.86  ? 218 DA  J "C3'" 1 
ATOM   4446  O  "O3'" . DA  B 1 72  ? 45.012  126.741 -6.627  1.00 40.86  ? 218 DA  J "O3'" 1 
ATOM   4447  C  "C2'" . DA  B 1 72  ? 45.166  126.362 -4.236  1.00 40.86  ? 218 DA  J "C2'" 1 
ATOM   4448  C  "C1'" . DA  B 1 72  ? 44.123  127.387 -3.833  1.00 40.86  ? 218 DA  J "C1'" 1 
ATOM   4449  N  N9    . DA  B 1 72  ? 44.042  127.704 -2.410  1.00 35.93  ? 218 DA  J N9    1 
ATOM   4450  C  C8    . DA  B 1 72  ? 44.263  126.909 -1.305  1.00 35.93  ? 218 DA  J C8    1 
ATOM   4451  N  N7    . DA  B 1 72  ? 44.131  127.542 -0.160  1.00 35.93  ? 218 DA  J N7    1 
ATOM   4452  C  C5    . DA  B 1 72  ? 43.792  128.842 -0.541  1.00 35.93  ? 218 DA  J C5    1 
ATOM   4453  C  C6    . DA  B 1 72  ? 43.521  130.016 0.198   1.00 35.93  ? 218 DA  J C6    1 
ATOM   4454  N  N6    . DA  B 1 72  ? 43.549  130.076 1.535   1.00 35.93  ? 218 DA  J N6    1 
ATOM   4455  N  N1    . DA  B 1 72  ? 43.221  131.139 -0.494  1.00 35.93  ? 218 DA  J N1    1 
ATOM   4456  C  C2    . DA  B 1 72  ? 43.201  131.089 -1.831  1.00 35.93  ? 218 DA  J C2    1 
ATOM   4457  N  N3    . DA  B 1 72  ? 43.439  130.057 -2.638  1.00 35.93  ? 218 DA  J N3    1 
ATOM   4458  C  C4    . DA  B 1 72  ? 43.730  128.950 -1.922  1.00 35.93  ? 218 DA  J C4    1 
ATOM   4459  P  P     . DA  B 1 73  ? 46.307  126.390 -7.506  1.00 45.75  ? 219 DA  J P     1 
ATOM   4460  O  OP1   . DA  B 1 73  ? 45.827  125.843 -8.811  1.00 45.75  ? 219 DA  J OP1   1 
ATOM   4461  O  OP2   . DA  B 1 73  ? 47.273  125.624 -6.678  1.00 45.75  ? 219 DA  J OP2   1 
ATOM   4462  O  "O5'" . DA  B 1 73  ? 46.925  127.833 -7.728  1.00 50.38  ? 219 DA  J "O5'" 1 
ATOM   4463  C  "C5'" . DA  B 1 73  ? 46.053  128.933 -7.961  1.00 50.38  ? 219 DA  J "C5'" 1 
ATOM   4464  C  "C4'" . DA  B 1 73  ? 46.588  130.181 -7.303  1.00 50.38  ? 219 DA  J "C4'" 1 
ATOM   4465  O  "O4'" . DA  B 1 73  ? 46.170  130.322 -5.923  1.00 50.38  ? 219 DA  J "O4'" 1 
ATOM   4466  C  "C3'" . DA  B 1 73  ? 48.105  130.279 -7.312  1.00 50.38  ? 219 DA  J "C3'" 1 
ATOM   4467  O  "O3'" . DA  B 1 73  ? 48.469  131.460 -8.005  1.00 50.38  ? 219 DA  J "O3'" 1 
ATOM   4468  C  "C2'" . DA  B 1 73  ? 48.489  130.313 -5.839  1.00 50.38  ? 219 DA  J "C2'" 1 
ATOM   4469  C  "C1'" . DA  B 1 73  ? 47.237  130.833 -5.163  1.00 50.38  ? 219 DA  J "C1'" 1 
ATOM   4470  N  N9    . DA  B 1 73  ? 47.069  130.351 -3.797  1.00 33.64  ? 219 DA  J N9    1 
ATOM   4471  C  C8    . DA  B 1 73  ? 47.183  129.054 -3.373  1.00 33.64  ? 219 DA  J C8    1 
ATOM   4472  N  N7    . DA  B 1 73  ? 47.059  128.908 -2.068  1.00 33.64  ? 219 DA  J N7    1 
ATOM   4473  C  C5    . DA  B 1 73  ? 46.832  130.200 -1.602  1.00 33.64  ? 219 DA  J C5    1 
ATOM   4474  C  C6    . DA  B 1 73  ? 46.634  130.738 -0.292  1.00 33.64  ? 219 DA  J C6    1 
ATOM   4475  N  N6    . DA  B 1 73  ? 46.669  130.029 0.835   1.00 33.64  ? 219 DA  J N6    1 
ATOM   4476  N  N1    . DA  B 1 73  ? 46.410  132.059 -0.188  1.00 33.64  ? 219 DA  J N1    1 
ATOM   4477  C  C2    . DA  B 1 73  ? 46.396  132.795 -1.305  1.00 33.64  ? 219 DA  J C2    1 
ATOM   4478  N  N3    . DA  B 1 73  ? 46.583  132.419 -2.578  1.00 33.64  ? 219 DA  J N3    1 
ATOM   4479  C  C4    . DA  B 1 73  ? 46.804  131.095 -2.662  1.00 33.64  ? 219 DA  J C4    1 
ATOM   4480  P  P     . DT  B 1 74  ? 49.989  131.687 -8.432  1.00 73.26  ? 220 DT  J P     1 
ATOM   4481  O  OP1   . DT  B 1 74  ? 49.976  132.230 -9.812  1.00 73.26  ? 220 DT  J OP1   1 
ATOM   4482  O  OP2   . DT  B 1 74  ? 50.790  130.471 -8.124  1.00 73.26  ? 220 DT  J OP2   1 
ATOM   4483  O  "O5'" . DT  B 1 74  ? 50.393  132.834 -7.416  1.00 58.76  ? 220 DT  J "O5'" 1 
ATOM   4484  C  "C5'" . DT  B 1 74  ? 49.484  133.896 -7.162  1.00 58.76  ? 220 DT  J "C5'" 1 
ATOM   4485  C  "C4'" . DT  B 1 74  ? 50.019  134.783 -6.069  1.00 58.76  ? 220 DT  J "C4'" 1 
ATOM   4486  O  "O4'" . DT  B 1 74  ? 49.607  134.291 -4.775  1.00 58.76  ? 220 DT  J "O4'" 1 
ATOM   4487  C  "C3'" . DT  B 1 74  ? 51.545  134.872 -6.035  1.00 58.76  ? 220 DT  J "C3'" 1 
ATOM   4488  O  "O3'" . DT  B 1 74  ? 51.959  136.241 -5.909  1.00 58.76  ? 220 DT  J "O3'" 1 
ATOM   4489  C  "C2'" . DT  B 1 74  ? 51.913  134.043 -4.816  1.00 58.76  ? 220 DT  J "C2'" 1 
ATOM   4490  C  "C1'" . DT  B 1 74  ? 50.722  134.287 -3.914  1.00 58.76  ? 220 DT  J "C1'" 1 
ATOM   4491  N  N1    . DT  B 1 74  ? 50.499  133.267 -2.876  1.00 64.10  ? 220 DT  J N1    1 
ATOM   4492  C  C2    . DT  B 1 74  ? 50.165  133.696 -1.602  1.00 64.10  ? 220 DT  J C2    1 
ATOM   4493  O  O2    . DT  B 1 74  ? 50.048  134.874 -1.296  1.00 64.10  ? 220 DT  J O2    1 
ATOM   4494  N  N3    . DT  B 1 74  ? 49.976  132.683 -0.691  1.00 64.10  ? 220 DT  J N3    1 
ATOM   4495  C  C4    . DT  B 1 74  ? 50.090  131.316 -0.915  1.00 64.10  ? 220 DT  J C4    1 
ATOM   4496  O  O4    . DT  B 1 74  ? 49.876  130.524 0.009   1.00 64.10  ? 220 DT  J O4    1 
ATOM   4497  C  C5    . DT  B 1 74  ? 50.461  130.940 -2.266  1.00 64.10  ? 220 DT  J C5    1 
ATOM   4498  C  C7    . DT  B 1 74  ? 50.649  129.489 -2.590  1.00 64.10  ? 220 DT  J C7    1 
ATOM   4499  C  C6    . DT  B 1 74  ? 50.631  131.922 -3.169  1.00 64.10  ? 220 DT  J C6    1 
ATOM   4500  P  P     . DT  B 1 75  ? 53.527  136.624 -5.975  1.00 62.08  ? 221 DT  J P     1 
ATOM   4501  O  OP1   . DT  B 1 75  ? 53.622  137.903 -6.735  1.00 62.08  ? 221 DT  J OP1   1 
ATOM   4502  O  OP2   . DT  B 1 75  ? 54.350  135.453 -6.393  1.00 62.08  ? 221 DT  J OP2   1 
ATOM   4503  O  "O5'" . DT  B 1 75  ? 53.843  136.913 -4.447  1.00 55.20  ? 221 DT  J "O5'" 1 
ATOM   4504  C  "C5'" . DT  B 1 75  ? 52.959  137.724 -3.696  1.00 55.20  ? 221 DT  J "C5'" 1 
ATOM   4505  C  "C4'" . DT  B 1 75  ? 53.426  137.787 -2.269  1.00 55.20  ? 221 DT  J "C4'" 1 
ATOM   4506  O  "O4'" . DT  B 1 75  ? 53.044  136.590 -1.563  1.00 55.20  ? 221 DT  J "O4'" 1 
ATOM   4507  C  "C3'" . DT  B 1 75  ? 54.943  137.871 -2.148  1.00 55.20  ? 221 DT  J "C3'" 1 
ATOM   4508  O  "O3'" . DT  B 1 75  ? 55.265  138.720 -1.047  1.00 55.20  ? 221 DT  J "O3'" 1 
ATOM   4509  C  "C2'" . DT  B 1 75  ? 55.331  136.445 -1.811  1.00 55.20  ? 221 DT  J "C2'" 1 
ATOM   4510  C  "C1'" . DT  B 1 75  ? 54.184  136.094 -0.901  1.00 55.20  ? 221 DT  J "C1'" 1 
ATOM   4511  N  N1    . DT  B 1 75  ? 53.972  134.674 -0.641  1.00 53.92  ? 221 DT  J N1    1 
ATOM   4512  C  C2    . DT  B 1 75  ? 53.690  134.309 0.657   1.00 53.92  ? 221 DT  J C2    1 
ATOM   4513  O  O2    . DT  B 1 75  ? 53.666  135.105 1.589   1.00 53.92  ? 221 DT  J O2    1 
ATOM   4514  N  N3    . DT  B 1 75  ? 53.447  132.972 0.832   1.00 53.92  ? 221 DT  J N3    1 
ATOM   4515  C  C4    . DT  B 1 75  ? 53.476  131.983 -0.130  1.00 53.92  ? 221 DT  J C4    1 
ATOM   4516  O  O4    . DT  B 1 75  ? 53.209  130.826 0.183   1.00 53.92  ? 221 DT  J O4    1 
ATOM   4517  C  C5    . DT  B 1 75  ? 53.820  132.431 -1.465  1.00 53.92  ? 221 DT  J C5    1 
ATOM   4518  C  C7    . DT  B 1 75  ? 53.920  131.425 -2.567  1.00 53.92  ? 221 DT  J C7    1 
ATOM   4519  C  C6    . DT  B 1 75  ? 54.039  133.741 -1.652  1.00 53.92  ? 221 DT  J C6    1 
ATOM   4520  P  P     . DC  B 1 76  ? 56.595  139.616 -1.093  1.00 76.40  ? 222 DC  J P     1 
ATOM   4521  O  OP1   . DC  B 1 76  ? 56.187  141.022 -1.336  1.00 76.40  ? 222 DC  J OP1   1 
ATOM   4522  O  OP2   . DC  B 1 76  ? 57.577  138.953 -2.001  1.00 76.40  ? 222 DC  J OP2   1 
ATOM   4523  O  "O5'" . DC  B 1 76  ? 57.122  139.538 0.399   1.00 95.23  ? 222 DC  J "O5'" 1 
ATOM   4524  C  "C5'" . DC  B 1 76  ? 56.204  139.363 1.469   1.00 95.23  ? 222 DC  J "C5'" 1 
ATOM   4525  C  "C4'" . DC  B 1 76  ? 56.850  138.571 2.579   1.00 95.23  ? 222 DC  J "C4'" 1 
ATOM   4526  O  "O4'" . DC  B 1 76  ? 56.426  137.186 2.532   1.00 95.23  ? 222 DC  J "O4'" 1 
ATOM   4527  C  "C3'" . DC  B 1 76  ? 58.379  138.539 2.520   1.00 95.23  ? 222 DC  J "C3'" 1 
ATOM   4528  O  "O3'" . DC  B 1 76  ? 58.870  138.571 3.857   1.00 95.23  ? 222 DC  J "O3'" 1 
ATOM   4529  C  "C2'" . DC  B 1 76  ? 58.667  137.176 1.923   1.00 95.23  ? 222 DC  J "C2'" 1 
ATOM   4530  C  "C1'" . DC  B 1 76  ? 57.584  136.383 2.605   1.00 95.23  ? 222 DC  J "C1'" 1 
ATOM   4531  N  N1    . DC  B 1 76  ? 57.289  135.069 2.037   1.00 33.19  ? 222 DC  J N1    1 
ATOM   4532  C  C2    . DC  B 1 76  ? 56.807  134.090 2.895   1.00 33.19  ? 222 DC  J C2    1 
ATOM   4533  O  O2    . DC  B 1 76  ? 56.544  134.415 4.084   1.00 33.19  ? 222 DC  J O2    1 
ATOM   4534  N  N3    . DC  B 1 76  ? 56.631  132.827 2.426   1.00 33.19  ? 222 DC  J N3    1 
ATOM   4535  C  C4    . DC  B 1 76  ? 56.902  132.544 1.152   1.00 33.19  ? 222 DC  J C4    1 
ATOM   4536  N  N4    . DC  B 1 76  ? 56.766  131.274 0.747   1.00 33.19  ? 222 DC  J N4    1 
ATOM   4537  C  C5    . DC  B 1 76  ? 57.338  133.545 0.239   1.00 33.19  ? 222 DC  J C5    1 
ATOM   4538  C  C6    . DC  B 1 76  ? 57.514  134.786 0.719   1.00 33.19  ? 222 DC  J C6    1 
ATOM   4539  P  P     . DA  B 1 77  ? 60.362  139.078 4.159   1.00 77.49  ? 223 DA  J P     1 
ATOM   4540  O  OP1   . DA  B 1 77  ? 60.371  140.561 4.087   1.00 77.49  ? 223 DA  J OP1   1 
ATOM   4541  O  OP2   . DA  B 1 77  ? 61.311  138.284 3.325   1.00 77.49  ? 223 DA  J OP2   1 
ATOM   4542  O  "O5'" . DA  B 1 77  ? 60.555  138.659 5.677   1.00 71.91  ? 223 DA  J "O5'" 1 
ATOM   4543  C  "C5'" . DA  B 1 77  ? 59.467  138.762 6.599   1.00 71.91  ? 223 DA  J "C5'" 1 
ATOM   4544  C  "C4'" . DA  B 1 77  ? 59.547  137.650 7.616   1.00 71.91  ? 223 DA  J "C4'" 1 
ATOM   4545  O  "O4'" . DA  B 1 77  ? 59.204  136.384 6.994   1.00 71.91  ? 223 DA  J "O4'" 1 
ATOM   4546  C  "C3'" . DA  B 1 77  ? 60.957  137.488 8.167   1.00 71.91  ? 223 DA  J "C3'" 1 
ATOM   4547  O  "O3'" . DA  B 1 77  ? 60.914  137.210 9.560   1.00 71.91  ? 223 DA  J "O3'" 1 
ATOM   4548  C  "C2'" . DA  B 1 77  ? 61.524  136.331 7.361   1.00 71.91  ? 223 DA  J "C2'" 1 
ATOM   4549  C  "C1'" . DA  B 1 77  ? 60.299  135.485 7.047   1.00 71.91  ? 223 DA  J "C1'" 1 
ATOM   4550  N  N9    . DA  B 1 77  ? 60.366  134.768 5.766   1.00 64.49  ? 223 DA  J N9    1 
ATOM   4551  C  C8    . DA  B 1 77  ? 60.904  135.204 4.573   1.00 64.49  ? 223 DA  J C8    1 
ATOM   4552  N  N7    . DA  B 1 77  ? 60.838  134.318 3.606   1.00 64.49  ? 223 DA  J N7    1 
ATOM   4553  C  C5    . DA  B 1 77  ? 60.209  133.228 4.194   1.00 64.49  ? 223 DA  J C5    1 
ATOM   4554  C  C6    . DA  B 1 77  ? 59.835  131.966 3.695   1.00 64.49  ? 223 DA  J C6    1 
ATOM   4555  N  N6    . DA  B 1 77  ? 60.052  131.570 2.439   1.00 64.49  ? 223 DA  J N6    1 
ATOM   4556  N  N1    . DA  B 1 77  ? 59.219  131.112 4.542   1.00 64.49  ? 223 DA  J N1    1 
ATOM   4557  C  C2    . DA  B 1 77  ? 58.990  131.508 5.800   1.00 64.49  ? 223 DA  J C2    1 
ATOM   4558  N  N3    . DA  B 1 77  ? 59.290  132.665 6.387   1.00 64.49  ? 223 DA  J N3    1 
ATOM   4559  C  C4    . DA  B 1 77  ? 59.906  133.492 5.521   1.00 64.49  ? 223 DA  J C4    1 
ATOM   4560  P  P     . DG  B 1 78  ? 62.121  137.692 10.503  1.00 77.45  ? 224 DG  J P     1 
ATOM   4561  O  OP1   . DG  B 1 78  ? 61.863  139.091 10.930  1.00 77.45  ? 224 DG  J OP1   1 
ATOM   4562  O  OP2   . DG  B 1 78  ? 63.395  137.361 9.797   1.00 77.45  ? 224 DG  J OP2   1 
ATOM   4563  O  "O5'" . DG  B 1 78  ? 61.959  136.757 11.791  1.00 44.18  ? 224 DG  J "O5'" 1 
ATOM   4564  C  "C5'" . DG  B 1 78  ? 60.743  136.035 12.028  1.00 44.18  ? 224 DG  J "C5'" 1 
ATOM   4565  C  "C4'" . DG  B 1 78  ? 60.960  134.544 11.865  1.00 44.18  ? 224 DG  J "C4'" 1 
ATOM   4566  O  "O4'" . DG  B 1 78  ? 61.163  134.137 10.489  1.00 44.18  ? 224 DG  J "O4'" 1 
ATOM   4567  C  "C3'" . DG  B 1 78  ? 62.102  133.909 12.647  1.00 44.18  ? 224 DG  J "C3'" 1 
ATOM   4568  O  "O3'" . DG  B 1 78  ? 61.602  132.685 13.120  1.00 44.18  ? 224 DG  J "O3'" 1 
ATOM   4569  C  "C2'" . DG  B 1 78  ? 63.148  133.607 11.585  1.00 44.18  ? 224 DG  J "C2'" 1 
ATOM   4570  C  "C1'" . DG  B 1 78  ? 62.284  133.257 10.391  1.00 44.18  ? 224 DG  J "C1'" 1 
ATOM   4571  N  N9    . DG  B 1 78  ? 62.903  133.470 9.081   1.00 65.79  ? 224 DG  J N9    1 
ATOM   4572  C  C8    . DG  B 1 78  ? 63.629  134.570 8.699   1.00 65.79  ? 224 DG  J C8    1 
ATOM   4573  N  N7    . DG  B 1 78  ? 64.021  134.525 7.453   1.00 65.79  ? 224 DG  J N7    1 
ATOM   4574  C  C5    . DG  B 1 78  ? 63.532  133.317 6.980   1.00 65.79  ? 224 DG  J C5    1 
ATOM   4575  C  C6    . DG  B 1 78  ? 63.637  132.729 5.684   1.00 65.79  ? 224 DG  J C6    1 
ATOM   4576  O  O6    . DG  B 1 78  ? 64.196  133.190 4.663   1.00 65.79  ? 224 DG  J O6    1 
ATOM   4577  N  N1    . DG  B 1 78  ? 63.009  131.486 5.636   1.00 65.79  ? 224 DG  J N1    1 
ATOM   4578  C  C2    . DG  B 1 78  ? 62.371  130.890 6.693   1.00 65.79  ? 224 DG  J C2    1 
ATOM   4579  N  N2    . DG  B 1 78  ? 61.856  129.682 6.443   1.00 65.79  ? 224 DG  J N2    1 
ATOM   4580  N  N3    . DG  B 1 78  ? 62.253  131.432 7.900   1.00 65.79  ? 224 DG  J N3    1 
ATOM   4581  C  C4    . DG  B 1 78  ? 62.853  132.639 7.973   1.00 65.79  ? 224 DG  J C4    1 
ATOM   4582  P  P     . DC  B 1 79  ? 62.049  132.139 14.544  1.00 60.56  ? 225 DC  J P     1 
ATOM   4583  O  OP1   . DC  B 1 79  ? 61.029  132.562 15.548  1.00 60.56  ? 225 DC  J OP1   1 
ATOM   4584  O  OP2   . DC  B 1 79  ? 63.473  132.530 14.714  1.00 60.56  ? 225 DC  J OP2   1 
ATOM   4585  O  "O5'" . DC  B 1 79  ? 61.963  130.562 14.333  1.00 90.95  ? 225 DC  J "O5'" 1 
ATOM   4586  C  "C5'" . DC  B 1 79  ? 61.506  130.018 13.087  1.00 90.95  ? 225 DC  J "C5'" 1 
ATOM   4587  C  "C4'" . DC  B 1 79  ? 62.422  128.906 12.628  1.00 90.95  ? 225 DC  J "C4'" 1 
ATOM   4588  O  "O4'" . DC  B 1 79  ? 63.027  129.254 11.360  1.00 90.95  ? 225 DC  J "O4'" 1 
ATOM   4589  C  "C3'" . DC  B 1 79  ? 63.585  128.588 13.571  1.00 90.95  ? 225 DC  J "C3'" 1 
ATOM   4590  O  "O3'" . DC  B 1 79  ? 63.828  127.179 13.547  1.00 90.95  ? 225 DC  J "O3'" 1 
ATOM   4591  C  "C2'" . DC  B 1 79  ? 64.755  129.314 12.929  1.00 90.95  ? 225 DC  J "C2'" 1 
ATOM   4592  C  "C1'" . DC  B 1 79  ? 64.436  129.116 11.462  1.00 90.95  ? 225 DC  J "C1'" 1 
ATOM   4593  N  N1    . DC  B 1 79  ? 65.060  130.067 10.533  1.00 88.80  ? 225 DC  J N1    1 
ATOM   4594  C  C2    . DC  B 1 79  ? 65.096  129.740 9.172   1.00 88.80  ? 225 DC  J C2    1 
ATOM   4595  O  O2    . DC  B 1 79  ? 64.601  128.666 8.802   1.00 88.80  ? 225 DC  J O2    1 
ATOM   4596  N  N3    . DC  B 1 79  ? 65.668  130.599 8.298   1.00 88.80  ? 225 DC  J N3    1 
ATOM   4597  C  C4    . DC  B 1 79  ? 66.192  131.750 8.739   1.00 88.80  ? 225 DC  J C4    1 
ATOM   4598  N  N4    . DC  B 1 79  ? 66.748  132.580 7.832   1.00 88.80  ? 225 DC  J N4    1 
ATOM   4599  C  C5    . DC  B 1 79  ? 66.169  132.106 10.126  1.00 88.80  ? 225 DC  J C5    1 
ATOM   4600  C  C6    . DC  B 1 79  ? 65.598  131.242 10.978  1.00 88.80  ? 225 DC  J C6    1 
ATOM   4601  P  P     . DT  B 1 80  ? 63.223  126.245 14.703  1.00 94.45  ? 226 DT  J P     1 
ATOM   4602  O  OP1   . DT  B 1 80  ? 61.887  126.758 15.105  1.00 94.45  ? 226 DT  J OP1   1 
ATOM   4603  O  OP2   . DT  B 1 80  ? 64.288  126.079 15.718  1.00 94.45  ? 226 DT  J OP2   1 
ATOM   4604  O  "O5'" . DT  B 1 80  ? 62.998  124.851 13.977  1.00 56.93  ? 226 DT  J "O5'" 1 
ATOM   4605  C  "C5'" . DT  B 1 80  ? 62.105  124.753 12.871  1.00 56.93  ? 226 DT  J "C5'" 1 
ATOM   4606  C  "C4'" . DT  B 1 80  ? 62.761  123.997 11.738  1.00 56.93  ? 226 DT  J "C4'" 1 
ATOM   4607  O  "O4'" . DT  B 1 80  ? 63.638  124.807 10.917  1.00 56.93  ? 226 DT  J "O4'" 1 
ATOM   4608  C  "C3'" . DT  B 1 80  ? 63.589  122.795 12.170  1.00 56.93  ? 226 DT  J "C3'" 1 
ATOM   4609  O  "O3'" . DT  B 1 80  ? 63.337  121.790 11.210  1.00 56.93  ? 226 DT  J "O3'" 1 
ATOM   4610  C  "C2'" . DT  B 1 80  ? 65.019  123.286 12.005  1.00 56.93  ? 226 DT  J "C2'" 1 
ATOM   4611  C  "C1'" . DT  B 1 80  ? 64.877  124.129 10.758  1.00 56.93  ? 226 DT  J "C1'" 1 
ATOM   4612  N  N1    . DT  B 1 80  ? 65.926  125.141 10.522  1.00 56.58  ? 226 DT  J N1    1 
ATOM   4613  C  C2    . DT  B 1 80  ? 66.214  125.470 9.212   1.00 56.58  ? 226 DT  J C2    1 
ATOM   4614  O  O2    . DT  B 1 80  ? 65.702  124.912 8.249   1.00 56.58  ? 226 DT  J O2    1 
ATOM   4615  N  N3    . DT  B 1 80  ? 67.125  126.486 9.065   1.00 56.58  ? 226 DT  J N3    1 
ATOM   4616  C  C4    . DT  B 1 80  ? 67.753  127.195 10.060  1.00 56.58  ? 226 DT  J C4    1 
ATOM   4617  O  O4    . DT  B 1 80  ? 68.485  128.129 9.759   1.00 56.58  ? 226 DT  J O4    1 
ATOM   4618  C  C5    . DT  B 1 80  ? 67.450  126.763 11.408  1.00 56.58  ? 226 DT  J C5    1 
ATOM   4619  C  C7    . DT  B 1 80  ? 68.121  127.442 12.557  1.00 56.58  ? 226 DT  J C7    1 
ATOM   4620  C  C6    . DT  B 1 80  ? 66.569  125.764 11.570  1.00 56.58  ? 226 DT  J C6    1 
ATOM   4621  P  P     . DG  B 1 81  ? 63.360  120.253 11.623  1.00 40.43  ? 227 DG  J P     1 
ATOM   4622  O  OP1   . DG  B 1 81  ? 61.987  119.841 11.997  1.00 40.43  ? 227 DG  J OP1   1 
ATOM   4623  O  OP2   . DG  B 1 81  ? 64.502  119.961 12.543  1.00 40.43  ? 227 DG  J OP2   1 
ATOM   4624  O  "O5'" . DG  B 1 81  ? 63.693  119.617 10.221  1.00 38.42  ? 227 DG  J "O5'" 1 
ATOM   4625  C  "C5'" . DG  B 1 81  ? 64.946  119.042 10.022  1.00 38.42  ? 227 DG  J "C5'" 1 
ATOM   4626  C  "C4'" . DG  B 1 81  ? 65.549  119.519 8.729   1.00 38.42  ? 227 DG  J "C4'" 1 
ATOM   4627  O  "O4'" . DG  B 1 81  ? 66.049  120.870 8.862   1.00 38.42  ? 227 DG  J "O4'" 1 
ATOM   4628  C  "C3'" . DG  B 1 81  ? 66.768  118.653 8.469   1.00 38.42  ? 227 DG  J "C3'" 1 
ATOM   4629  O  "O3'" . DG  B 1 81  ? 66.885  118.326 7.109   1.00 38.42  ? 227 DG  J "O3'" 1 
ATOM   4630  C  "C2'" . DG  B 1 81  ? 67.933  119.480 8.955   1.00 38.42  ? 227 DG  J "C2'" 1 
ATOM   4631  C  "C1'" . DG  B 1 81  ? 67.464  120.883 8.665   1.00 38.42  ? 227 DG  J "C1'" 1 
ATOM   4632  N  N9    . DG  B 1 81  ? 68.062  121.882 9.552   1.00 40.96  ? 227 DG  J N9    1 
ATOM   4633  C  C8    . DG  B 1 81  ? 67.912  122.009 10.918  1.00 40.96  ? 227 DG  J C8    1 
ATOM   4634  N  N7    . DG  B 1 81  ? 68.561  123.026 11.412  1.00 40.96  ? 227 DG  J N7    1 
ATOM   4635  C  C5    . DG  B 1 81  ? 69.177  123.602 10.305  1.00 40.96  ? 227 DG  J C5    1 
ATOM   4636  C  C6    . DG  B 1 81  ? 70.001  124.754 10.205  1.00 40.96  ? 227 DG  J C6    1 
ATOM   4637  O  O6    . DG  B 1 81  ? 70.350  125.538 11.101  1.00 40.96  ? 227 DG  J O6    1 
ATOM   4638  N  N1    . DG  B 1 81  ? 70.425  124.969 8.895   1.00 40.96  ? 227 DG  J N1    1 
ATOM   4639  C  C2    . DG  B 1 81  ? 70.096  124.180 7.821   1.00 40.96  ? 227 DG  J C2    1 
ATOM   4640  N  N2    . DG  B 1 81  ? 70.636  124.536 6.638   1.00 40.96  ? 227 DG  J N2    1 
ATOM   4641  N  N3    . DG  B 1 81  ? 69.308  123.119 7.898   1.00 40.96  ? 227 DG  J N3    1 
ATOM   4642  C  C4    . DG  B 1 81  ? 68.891  122.892 9.158   1.00 40.96  ? 227 DG  J C4    1 
ATOM   4643  P  P     . DA  B 1 82  ? 67.826  117.121 6.706   1.00 28.41  ? 228 DA  J P     1 
ATOM   4644  O  OP1   . DA  B 1 82  ? 67.142  116.125 5.826   1.00 28.41  ? 228 DA  J OP1   1 
ATOM   4645  O  OP2   . DA  B 1 82  ? 68.415  116.666 7.993   1.00 28.41  ? 228 DA  J OP2   1 
ATOM   4646  O  "O5'" . DA  B 1 82  ? 68.911  117.884 5.837   1.00 28.47  ? 228 DA  J "O5'" 1 
ATOM   4647  C  "C5'" . DA  B 1 82  ? 68.530  118.601 4.665   1.00 28.47  ? 228 DA  J "C5'" 1 
ATOM   4648  C  "C4'" . DA  B 1 82  ? 69.758  119.114 3.946   1.00 28.47  ? 228 DA  J "C4'" 1 
ATOM   4649  O  "O4'" . DA  B 1 82  ? 70.360  120.190 4.710   1.00 28.47  ? 228 DA  J "O4'" 1 
ATOM   4650  C  "C3'" . DA  B 1 82  ? 70.856  118.072 3.724   1.00 28.47  ? 228 DA  J "C3'" 1 
ATOM   4651  O  "O3'" . DA  B 1 82  ? 71.423  118.254 2.420   1.00 28.47  ? 228 DA  J "O3'" 1 
ATOM   4652  C  "C2'" . DA  B 1 82  ? 71.833  118.343 4.854   1.00 28.47  ? 228 DA  J "C2'" 1 
ATOM   4653  C  "C1'" . DA  B 1 82  ? 71.642  119.827 5.171   1.00 28.47  ? 228 DA  J "C1'" 1 
ATOM   4654  N  N9    . DA  B 1 82  ? 71.686  120.137 6.595   1.00 30.07  ? 228 DA  J N9    1 
ATOM   4655  C  C8    . DA  B 1 82  ? 71.134  119.426 7.636   1.00 30.07  ? 228 DA  J C8    1 
ATOM   4656  N  N7    . DA  B 1 82  ? 71.369  119.946 8.826   1.00 30.07  ? 228 DA  J N7    1 
ATOM   4657  C  C5    . DA  B 1 82  ? 72.121  121.079 8.546   1.00 30.07  ? 228 DA  J C5    1 
ATOM   4658  C  C6    . DA  B 1 82  ? 72.701  122.059 9.375   1.00 30.07  ? 228 DA  J C6    1 
ATOM   4659  N  N6    . DA  B 1 82  ? 72.612  122.062 10.705  1.00 30.07  ? 228 DA  J N6    1 
ATOM   4660  N  N1    . DA  B 1 82  ? 73.394  123.050 8.776   1.00 30.07  ? 228 DA  J N1    1 
ATOM   4661  C  C2    . DA  B 1 82  ? 73.495  123.055 7.430   1.00 30.07  ? 228 DA  J C2    1 
ATOM   4662  N  N3    . DA  B 1 82  ? 72.999  122.192 6.542   1.00 30.07  ? 228 DA  J N3    1 
ATOM   4663  C  C4    . DA  B 1 82  ? 72.316  121.214 7.171   1.00 30.07  ? 228 DA  J C4    1 
ATOM   4664  P  P     . DA  B 1 83  ? 72.459  117.176 1.818   1.00 33.93  ? 229 DA  J P     1 
ATOM   4665  O  OP1   . DA  B 1 83  ? 72.202  117.082 0.356   1.00 33.93  ? 229 DA  J OP1   1 
ATOM   4666  O  OP2   . DA  B 1 83  ? 72.473  115.939 2.649   1.00 33.93  ? 229 DA  J OP2   1 
ATOM   4667  O  "O5'" . DA  B 1 83  ? 73.858  117.903 2.032   1.00 33.59  ? 229 DA  J "O5'" 1 
ATOM   4668  C  "C5'" . DA  B 1 83  ? 74.062  119.229 1.532   1.00 33.59  ? 229 DA  J "C5'" 1 
ATOM   4669  C  "C4'" . DA  B 1 83  ? 75.363  119.804 2.044   1.00 33.59  ? 229 DA  J "C4'" 1 
ATOM   4670  O  "O4'" . DA  B 1 83  ? 75.231  120.242 3.417   1.00 33.59  ? 229 DA  J "O4'" 1 
ATOM   4671  C  "C3'" . DA  B 1 83  ? 76.577  118.872 1.995   1.00 33.59  ? 229 DA  J "C3'" 1 
ATOM   4672  O  "O3'" . DA  B 1 83  ? 77.688  119.578 1.409   1.00 33.59  ? 229 DA  J "O3'" 1 
ATOM   4673  C  "C2'" . DA  B 1 83  ? 76.813  118.533 3.459   1.00 33.59  ? 229 DA  J "C2'" 1 
ATOM   4674  C  "C1'" . DA  B 1 83  ? 76.324  119.774 4.174   1.00 33.59  ? 229 DA  J "C1'" 1 
ATOM   4675  N  N9    . DA  B 1 83  ? 75.853  119.559 5.536   1.00 48.40  ? 229 DA  J N9    1 
ATOM   4676  C  C8    . DA  B 1 83  ? 75.087  118.524 6.005   1.00 48.40  ? 229 DA  J C8    1 
ATOM   4677  N  N7    . DA  B 1 83  ? 74.807  118.605 7.285   1.00 48.40  ? 229 DA  J N7    1 
ATOM   4678  C  C5    . DA  B 1 83  ? 75.438  119.773 7.691   1.00 48.40  ? 229 DA  J C5    1 
ATOM   4679  C  C6    . DA  B 1 83  ? 75.529  120.424 8.945   1.00 48.40  ? 229 DA  J C6    1 
ATOM   4680  N  N6    . DA  B 1 83  ? 74.971  119.970 10.070  1.00 48.40  ? 229 DA  J N6    1 
ATOM   4681  N  N1    . DA  B 1 83  ? 76.232  121.575 9.002   1.00 48.40  ? 229 DA  J N1    1 
ATOM   4682  C  C2    . DA  B 1 83  ? 76.808  122.033 7.882   1.00 48.40  ? 229 DA  J C2    1 
ATOM   4683  N  N3    . DA  B 1 83  ? 76.800  121.514 6.651   1.00 48.40  ? 229 DA  J N3    1 
ATOM   4684  C  C4    . DA  B 1 83  ? 76.087  120.372 6.621   1.00 48.40  ? 229 DA  J C4    1 
ATOM   4685  P  P     . DC  B 1 84  ? 79.014  118.782 0.934   1.00 36.79  ? 230 DC  J P     1 
ATOM   4686  O  OP1   . DC  B 1 84  ? 79.545  119.471 -0.271  1.00 36.79  ? 230 DC  J OP1   1 
ATOM   4687  O  OP2   . DC  B 1 84  ? 78.677  117.339 0.845   1.00 36.79  ? 230 DC  J OP2   1 
ATOM   4688  O  "O5'" . DC  B 1 84  ? 80.022  119.061 2.146   1.00 32.06  ? 230 DC  J "O5'" 1 
ATOM   4689  C  "C5'" . DC  B 1 84  ? 80.065  120.357 2.756   1.00 32.06  ? 230 DC  J "C5'" 1 
ATOM   4690  C  "C4'" . DC  B 1 84  ? 81.101  120.424 3.858   1.00 32.06  ? 230 DC  J "C4'" 1 
ATOM   4691  O  "O4'" . DC  B 1 84  ? 80.425  120.503 5.141   1.00 32.06  ? 230 DC  J "O4'" 1 
ATOM   4692  C  "C3'" . DC  B 1 84  ? 82.112  119.271 3.963   1.00 32.06  ? 230 DC  J "C3'" 1 
ATOM   4693  O  "O3'" . DC  B 1 84  ? 83.453  119.764 4.164   1.00 32.06  ? 230 DC  J "O3'" 1 
ATOM   4694  C  "C2'" . DC  B 1 84  ? 81.669  118.524 5.207   1.00 32.06  ? 230 DC  J "C2'" 1 
ATOM   4695  C  "C1'" . DC  B 1 84  ? 81.034  119.614 6.060   1.00 32.06  ? 230 DC  J "C1'" 1 
ATOM   4696  N  N1    . DC  B 1 84  ? 79.999  119.111 7.001   1.00 49.38  ? 230 DC  J N1    1 
ATOM   4697  C  C2    . DC  B 1 84  ? 79.786  119.789 8.218   1.00 49.38  ? 230 DC  J C2    1 
ATOM   4698  O  O2    . DC  B 1 84  ? 80.381  120.852 8.432   1.00 49.38  ? 230 DC  J O2    1 
ATOM   4699  N  N3    . DC  B 1 84  ? 78.929  119.267 9.125   1.00 49.38  ? 230 DC  J N3    1 
ATOM   4700  C  C4    . DC  B 1 84  ? 78.277  118.134 8.856   1.00 49.38  ? 230 DC  J C4    1 
ATOM   4701  N  N4    . DC  B 1 84  ? 77.473  117.641 9.803   1.00 49.38  ? 230 DC  J N4    1 
ATOM   4702  C  C5    . DC  B 1 84  ? 78.427  117.454 7.611   1.00 49.38  ? 230 DC  J C5    1 
ATOM   4703  C  C6    . DC  B 1 84  ? 79.287  117.974 6.719   1.00 49.38  ? 230 DC  J C6    1 
ATOM   4704  P  P     . DA  B 1 85  ? 84.715  118.915 3.614   1.00 72.18  ? 231 DA  J P     1 
ATOM   4705  O  OP1   . DA  B 1 85  ? 84.891  119.184 2.161   1.00 72.18  ? 231 DA  J OP1   1 
ATOM   4706  O  OP2   . DA  B 1 85  ? 84.583  117.508 4.085   1.00 72.18  ? 231 DA  J OP2   1 
ATOM   4707  O  "O5'" . DA  B 1 85  ? 85.948  119.562 4.381   1.00 146.67 ? 231 DA  J "O5'" 1 
ATOM   4708  C  "C5'" . DA  B 1 85  ? 85.764  120.623 5.320   1.00 146.67 ? 231 DA  J "C5'" 1 
ATOM   4709  C  "C4'" . DA  B 1 85  ? 86.351  120.231 6.655   1.00 146.67 ? 231 DA  J "C4'" 1 
ATOM   4710  O  "O4'" . DA  B 1 85  ? 85.300  119.805 7.563   1.00 146.67 ? 231 DA  J "O4'" 1 
ATOM   4711  C  "C3'" . DA  B 1 85  ? 87.339  119.062 6.557   1.00 146.67 ? 231 DA  J "C3'" 1 
ATOM   4712  O  "O3'" . DA  B 1 85  ? 88.519  119.267 7.346   1.00 146.67 ? 231 DA  J "O3'" 1 
ATOM   4713  C  "C2'" . DA  B 1 85  ? 86.550  117.889 7.108   1.00 146.67 ? 231 DA  J "C2'" 1 
ATOM   4714  C  "C1'" . DA  B 1 85  ? 85.672  118.565 8.141   1.00 146.67 ? 231 DA  J "C1'" 1 
ATOM   4715  N  N9    . DA  B 1 85  ? 84.466  117.801 8.457   1.00 119.90 ? 231 DA  J N9    1 
ATOM   4716  C  C8    . DA  B 1 85  ? 83.766  116.963 7.622   1.00 119.90 ? 231 DA  J C8    1 
ATOM   4717  N  N7    . DA  B 1 85  ? 82.776  116.337 8.210   1.00 119.90 ? 231 DA  J N7    1 
ATOM   4718  C  C5    . DA  B 1 85  ? 82.813  116.810 9.514   1.00 119.90 ? 231 DA  J C5    1 
ATOM   4719  C  C6    . DA  B 1 85  ? 82.034  116.516 10.644  1.00 119.90 ? 231 DA  J C6    1 
ATOM   4720  N  N6    . DA  B 1 85  ? 81.028  115.636 10.635  1.00 119.90 ? 231 DA  J N6    1 
ATOM   4721  N  N1    . DA  B 1 85  ? 82.328  117.161 11.797  1.00 119.90 ? 231 DA  J N1    1 
ATOM   4722  C  C2    . DA  B 1 85  ? 83.344  118.038 11.801  1.00 119.90 ? 231 DA  J C2    1 
ATOM   4723  N  N3    . DA  B 1 85  ? 84.155  118.392 10.804  1.00 119.90 ? 231 DA  J N3    1 
ATOM   4724  C  C4    . DA  B 1 85  ? 83.834  117.731 9.675   1.00 119.90 ? 231 DA  J C4    1 
ATOM   4725  P  P     . DT  B 1 86  ? 89.673  118.137 7.363   1.00 158.32 ? 232 DT  J P     1 
ATOM   4726  O  OP1   . DT  B 1 86  ? 90.991  118.819 7.341   1.00 158.32 ? 232 DT  J OP1   1 
ATOM   4727  O  OP2   . DT  B 1 86  ? 89.362  117.116 6.328   1.00 158.32 ? 232 DT  J OP2   1 
ATOM   4728  O  "O5'" . DT  B 1 86  ? 89.492  117.444 8.784   1.00 193.87 ? 232 DT  J "O5'" 1 
ATOM   4729  C  "C5'" . DT  B 1 86  ? 90.047  116.158 9.051   1.00 193.87 ? 232 DT  J "C5'" 1 
ATOM   4730  C  "C4'" . DT  B 1 86  ? 89.746  115.754 10.476  1.00 193.87 ? 232 DT  J "C4'" 1 
ATOM   4731  O  "O4'" . DT  B 1 86  ? 88.310  115.746 10.686  1.00 193.87 ? 232 DT  J "O4'" 1 
ATOM   4732  C  "C3'" . DT  B 1 86  ? 90.241  114.361 10.871  1.00 193.87 ? 232 DT  J "C3'" 1 
ATOM   4733  O  "O3'" . DT  B 1 86  ? 90.722  114.383 12.221  1.00 193.87 ? 232 DT  J "O3'" 1 
ATOM   4734  C  "C2'" . DT  B 1 86  ? 88.985  113.510 10.788  1.00 193.87 ? 232 DT  J "C2'" 1 
ATOM   4735  C  "C1'" . DT  B 1 86  ? 87.917  114.494 11.231  1.00 193.87 ? 232 DT  J "C1'" 1 
ATOM   4736  N  N1    . DT  B 1 86  ? 86.544  114.185 10.765  1.00 169.77 ? 232 DT  J N1    1 
ATOM   4737  C  C2    . DT  B 1 86  ? 85.539  114.123 11.709  1.00 169.77 ? 232 DT  J C2    1 
ATOM   4738  O  O2    . DT  B 1 86  ? 85.716  114.350 12.896  1.00 169.77 ? 232 DT  J O2    1 
ATOM   4739  N  N3    . DT  B 1 86  ? 84.308  113.789 11.206  1.00 169.77 ? 232 DT  J N3    1 
ATOM   4740  C  C4    . DT  B 1 86  ? 83.979  113.536 9.888   1.00 169.77 ? 232 DT  J C4    1 
ATOM   4741  O  O4    . DT  B 1 86  ? 82.826  113.245 9.596   1.00 169.77 ? 232 DT  J O4    1 
ATOM   4742  C  C5    . DT  B 1 86  ? 85.068  113.642 8.949   1.00 169.77 ? 232 DT  J C5    1 
ATOM   4743  C  C7    . DT  B 1 86  ? 84.799  113.402 7.495   1.00 169.77 ? 232 DT  J C7    1 
ATOM   4744  C  C6    . DT  B 1 86  ? 86.283  113.954 9.428   1.00 169.77 ? 232 DT  J C6    1 
ATOM   4745  P  P     . DG  B 1 87  ? 92.066  113.589 12.609  1.00 169.02 ? 233 DG  J P     1 
ATOM   4746  O  OP1   . DG  B 1 87  ? 93.235  114.394 12.168  1.00 169.02 ? 233 DG  J OP1   1 
ATOM   4747  O  OP2   . DG  B 1 87  ? 91.922  112.186 12.135  1.00 169.02 ? 233 DG  J OP2   1 
ATOM   4748  O  "O5'" . DG  B 1 87  ? 92.038  113.571 14.202  1.00 153.54 ? 233 DG  J "O5'" 1 
ATOM   4749  C  "C5'" . DG  B 1 87  ? 91.798  114.763 14.956  1.00 153.54 ? 233 DG  J "C5'" 1 
ATOM   4750  C  "C4'" . DG  B 1 87  ? 90.940  114.447 16.160  1.00 153.54 ? 233 DG  J "C4'" 1 
ATOM   4751  O  "O4'" . DG  B 1 87  ? 89.591  114.156 15.724  1.00 153.54 ? 233 DG  J "O4'" 1 
ATOM   4752  C  "C3'" . DG  B 1 87  ? 91.400  113.215 16.939  1.00 153.54 ? 233 DG  J "C3'" 1 
ATOM   4753  O  "O3'" . DG  B 1 87  ? 91.152  113.381 18.339  1.00 153.54 ? 233 DG  J "O3'" 1 
ATOM   4754  C  "C2'" . DG  B 1 87  ? 90.551  112.099 16.359  1.00 153.54 ? 233 DG  J "C2'" 1 
ATOM   4755  C  "C1'" . DG  B 1 87  ? 89.245  112.807 16.036  1.00 153.54 ? 233 DG  J "C1'" 1 
ATOM   4756  N  N9    . DG  B 1 87  ? 88.556  112.247 14.878  1.00 186.84 ? 233 DG  J N9    1 
ATOM   4757  C  C8    . DG  B 1 87  ? 89.089  112.052 13.626  1.00 186.84 ? 233 DG  J C8    1 
ATOM   4758  N  N7    . DG  B 1 87  ? 88.236  111.548 12.777  1.00 186.84 ? 233 DG  J N7    1 
ATOM   4759  C  C5    . DG  B 1 87  ? 87.067  111.397 13.510  1.00 186.84 ? 233 DG  J C5    1 
ATOM   4760  C  C6    . DG  B 1 87  ? 85.801  110.905 13.117  1.00 186.84 ? 233 DG  J C6    1 
ATOM   4761  O  O6    . DG  B 1 87  ? 85.439  110.512 12.003  1.00 186.84 ? 233 DG  J O6    1 
ATOM   4762  N  N1    . DG  B 1 87  ? 84.901  110.903 14.175  1.00 186.84 ? 233 DG  J N1    1 
ATOM   4763  C  C2    . DG  B 1 87  ? 85.178  111.332 15.450  1.00 186.84 ? 233 DG  J C2    1 
ATOM   4764  N  N2    . DG  B 1 87  ? 84.172  111.233 16.330  1.00 186.84 ? 233 DG  J N2    1 
ATOM   4765  N  N3    . DG  B 1 87  ? 86.353  111.814 15.829  1.00 186.84 ? 233 DG  J N3    1 
ATOM   4766  C  C4    . DG  B 1 87  ? 87.247  111.815 14.814  1.00 186.84 ? 233 DG  J C4    1 
ATOM   4767  P  P     . DC  B 1 88  ? 91.317  112.126 19.336  1.00 139.25 ? 234 DC  J P     1 
ATOM   4768  O  OP1   . DC  B 1 88  ? 91.414  112.662 20.719  1.00 139.25 ? 234 DC  J OP1   1 
ATOM   4769  O  OP2   . DC  B 1 88  ? 92.373  111.213 18.819  1.00 139.25 ? 234 DC  J OP2   1 
ATOM   4770  O  "O5'" . DC  B 1 88  ? 89.921  111.372 19.215  1.00 158.75 ? 234 DC  J "O5'" 1 
ATOM   4771  C  "C5'" . DC  B 1 88  ? 88.696  112.080 19.384  1.00 158.75 ? 234 DC  J "C5'" 1 
ATOM   4772  C  "C4'" . DC  B 1 88  ? 87.643  111.161 19.952  1.00 158.75 ? 234 DC  J "C4'" 1 
ATOM   4773  O  "O4'" . DC  B 1 88  ? 87.129  110.321 18.896  1.00 158.75 ? 234 DC  J "O4'" 1 
ATOM   4774  C  "C3'" . DC  B 1 88  ? 88.159  110.210 21.025  1.00 158.75 ? 234 DC  J "C3'" 1 
ATOM   4775  O  "O3'" . DC  B 1 88  ? 87.127  109.987 21.982  1.00 158.75 ? 234 DC  J "O3'" 1 
ATOM   4776  C  "C2'" . DC  B 1 88  ? 88.495  108.950 20.247  1.00 158.75 ? 234 DC  J "C2'" 1 
ATOM   4777  C  "C1'" . DC  B 1 88  ? 87.491  108.962 19.105  1.00 158.75 ? 234 DC  J "C1'" 1 
ATOM   4778  N  N1    . DC  B 1 88  ? 88.027  108.463 17.830  1.00 135.04 ? 234 DC  J N1    1 
ATOM   4779  C  C2    . DC  B 1 88  ? 87.161  108.342 16.733  1.00 135.04 ? 234 DC  J C2    1 
ATOM   4780  O  O2    . DC  B 1 88  ? 85.954  108.615 16.880  1.00 135.04 ? 234 DC  J O2    1 
ATOM   4781  N  N3    . DC  B 1 88  ? 87.657  107.933 15.545  1.00 135.04 ? 234 DC  J N3    1 
ATOM   4782  C  C4    . DC  B 1 88  ? 88.954  107.652 15.426  1.00 135.04 ? 234 DC  J C4    1 
ATOM   4783  N  N4    . DC  B 1 88  ? 89.405  107.296 14.224  1.00 135.04 ? 234 DC  J N4    1 
ATOM   4784  C  C5    . DC  B 1 88  ? 89.849  107.736 16.530  1.00 135.04 ? 234 DC  J C5    1 
ATOM   4785  C  C6    . DC  B 1 88  ? 89.348  108.140 17.702  1.00 135.04 ? 234 DC  J C6    1 
ATOM   4786  P  P     . DC  B 1 89  ? 87.307  108.854 23.100  1.00 81.09  ? 235 DC  J P     1 
ATOM   4787  O  OP1   . DC  B 1 89  ? 87.101  109.454 24.443  1.00 81.09  ? 235 DC  J OP1   1 
ATOM   4788  O  OP2   . DC  B 1 89  ? 88.550  108.088 22.804  1.00 81.09  ? 235 DC  J OP2   1 
ATOM   4789  O  "O5'" . DC  B 1 89  ? 86.081  107.888 22.836  1.00 113.21 ? 235 DC  J "O5'" 1 
ATOM   4790  C  "C5'" . DC  B 1 89  ? 84.767  108.407 22.714  1.00 113.21 ? 235 DC  J "C5'" 1 
ATOM   4791  C  "C4'" . DC  B 1 89  ? 83.858  107.328 22.185  1.00 113.21 ? 235 DC  J "C4'" 1 
ATOM   4792  O  "O4'" . DC  B 1 89  ? 84.361  106.906 20.893  1.00 113.21 ? 235 DC  J "O4'" 1 
ATOM   4793  C  "C3'" . DC  B 1 89  ? 83.853  106.077 23.063  1.00 113.21 ? 235 DC  J "C3'" 1 
ATOM   4794  O  "O3'" . DC  B 1 89  ? 82.540  105.517 23.095  1.00 113.21 ? 235 DC  J "O3'" 1 
ATOM   4795  C  "C2'" . DC  B 1 89  ? 84.850  105.155 22.381  1.00 113.21 ? 235 DC  J "C2'" 1 
ATOM   4796  C  "C1'" . DC  B 1 89  ? 84.696  105.526 20.920  1.00 113.21 ? 235 DC  J "C1'" 1 
ATOM   4797  N  N1    . DC  B 1 89  ? 85.906  105.340 20.105  1.00 108.11 ? 235 DC  J N1    1 
ATOM   4798  C  C2    . DC  B 1 89  ? 85.793  105.424 18.715  1.00 108.11 ? 235 DC  J C2    1 
ATOM   4799  O  O2    . DC  B 1 89  ? 84.686  105.670 18.218  1.00 108.11 ? 235 DC  J O2    1 
ATOM   4800  N  N3    . DC  B 1 89  ? 86.887  105.242 17.947  1.00 108.11 ? 235 DC  J N3    1 
ATOM   4801  C  C4    . DC  B 1 89  ? 88.063  104.997 18.517  1.00 108.11 ? 235 DC  J C4    1 
ATOM   4802  N  N4    . DC  B 1 89  ? 89.109  104.834 17.715  1.00 108.11 ? 235 DC  J N4    1 
ATOM   4803  C  C5    . DC  B 1 89  ? 88.214  104.911 19.934  1.00 108.11 ? 235 DC  J C5    1 
ATOM   4804  C  C6    . DC  B 1 89  ? 87.118  105.086 20.683  1.00 108.11 ? 235 DC  J C6    1 
ATOM   4805  P  P     . DT  B 1 90  ? 82.297  104.077 23.757  1.00 131.18 ? 236 DT  J P     1 
ATOM   4806  O  OP1   . DT  B 1 90  ? 81.208  104.223 24.756  1.00 131.18 ? 236 DT  J OP1   1 
ATOM   4807  O  OP2   . DT  B 1 90  ? 83.605  103.503 24.170  1.00 131.18 ? 236 DT  J OP2   1 
ATOM   4808  O  "O5'" . DT  B 1 90  ? 81.752  103.230 22.527  1.00 143.00 ? 236 DT  J "O5'" 1 
ATOM   4809  C  "C5'" . DT  B 1 90  ? 80.977  103.866 21.513  1.00 143.00 ? 236 DT  J "C5'" 1 
ATOM   4810  C  "C4'" . DT  B 1 90  ? 80.921  103.016 20.264  1.00 143.00 ? 236 DT  J "C4'" 1 
ATOM   4811  O  "O4'" . DT  B 1 90  ? 82.209  102.960 19.600  1.00 143.00 ? 236 DT  J "O4'" 1 
ATOM   4812  C  "C3'" . DT  B 1 90  ? 80.472  101.568 20.453  1.00 143.00 ? 236 DT  J "C3'" 1 
ATOM   4813  O  "O3'" . DT  B 1 90  ? 79.564  101.246 19.404  1.00 143.00 ? 236 DT  J "O3'" 1 
ATOM   4814  C  "C2'" . DT  B 1 90  ? 81.758  100.773 20.298  1.00 143.00 ? 236 DT  J "C2'" 1 
ATOM   4815  C  "C1'" . DT  B 1 90  ? 82.546  101.612 19.307  1.00 143.00 ? 236 DT  J "C1'" 1 
ATOM   4816  N  N1    . DT  B 1 90  ? 84.014  101.476 19.424  1.00 104.25 ? 236 DT  J N1    1 
ATOM   4817  C  C2    . DT  B 1 90  ? 84.750  101.245 18.279  1.00 104.25 ? 236 DT  J C2    1 
ATOM   4818  O  O2    . DT  B 1 90  ? 84.258  101.145 17.168  1.00 104.25 ? 236 DT  J O2    1 
ATOM   4819  N  N3    . DT  B 1 90  ? 86.099  101.132 18.487  1.00 104.25 ? 236 DT  J N3    1 
ATOM   4820  C  C4    . DT  B 1 90  ? 86.778  101.231 19.686  1.00 104.25 ? 236 DT  J C4    1 
ATOM   4821  O  O4    . DT  B 1 90  ? 88.001  101.115 19.701  1.00 104.25 ? 236 DT  J O4    1 
ATOM   4822  C  C5    . DT  B 1 90  ? 85.947  101.470 20.848  1.00 104.25 ? 236 DT  J C5    1 
ATOM   4823  C  C7    . DT  B 1 90  ? 86.587  101.577 22.198  1.00 104.25 ? 236 DT  J C7    1 
ATOM   4824  C  C6    . DT  B 1 90  ? 84.625  101.580 20.659  1.00 104.25 ? 236 DT  J C6    1 
ATOM   4825  P  P     . DT  B 1 91  ? 78.643  99.938  19.504  1.00 52.64  ? 237 DT  J P     1 
ATOM   4826  O  OP1   . DT  B 1 91  ? 77.236  100.385 19.606  1.00 52.64  ? 237 DT  J OP1   1 
ATOM   4827  O  OP2   . DT  B 1 91  ? 79.198  99.015  20.527  1.00 52.64  ? 237 DT  J OP2   1 
ATOM   4828  O  "O5'" . DT  B 1 91  ? 78.859  99.289  18.075  1.00 37.64  ? 237 DT  J "O5'" 1 
ATOM   4829  C  "C5'" . DT  B 1 91  ? 79.003  100.140 16.946  1.00 37.64  ? 237 DT  J "C5'" 1 
ATOM   4830  C  "C4'" . DT  B 1 91  ? 79.780  99.447  15.855  1.00 37.64  ? 237 DT  J "C4'" 1 
ATOM   4831  O  "O4'" . DT  B 1 91  ? 81.185  99.394  16.200  1.00 37.64  ? 237 DT  J "O4'" 1 
ATOM   4832  C  "C3'" . DT  B 1 91  ? 79.343  98.008  15.581  1.00 37.64  ? 237 DT  J "C3'" 1 
ATOM   4833  O  "O3'" . DT  B 1 91  ? 79.174  97.832  14.176  1.00 37.64  ? 237 DT  J "O3'" 1 
ATOM   4834  C  "C2'" . DT  B 1 91  ? 80.496  97.178  16.116  1.00 37.64  ? 237 DT  J "C2'" 1 
ATOM   4835  C  "C1'" . DT  B 1 91  ? 81.679  98.103  15.903  1.00 37.64  ? 237 DT  J "C1'" 1 
ATOM   4836  N  N1    . DT  B 1 91  ? 82.823  97.838  16.790  1.00 54.88  ? 237 DT  J N1    1 
ATOM   4837  C  C2    . DT  B 1 91  ? 84.085  97.652  16.243  1.00 54.88  ? 237 DT  J C2    1 
ATOM   4838  O  O2    . DT  B 1 91  ? 84.325  97.709  15.044  1.00 54.88  ? 237 DT  J O2    1 
ATOM   4839  N  N3    . DT  B 1 91  ? 85.063  97.395  17.166  1.00 54.88  ? 237 DT  J N3    1 
ATOM   4840  C  C4    . DT  B 1 91  ? 84.920  97.317  18.535  1.00 54.88  ? 237 DT  J C4    1 
ATOM   4841  O  O4    . DT  B 1 91  ? 85.897  97.089  19.236  1.00 54.88  ? 237 DT  J O4    1 
ATOM   4842  C  C5    . DT  B 1 91  ? 83.581  97.523  19.033  1.00 54.88  ? 237 DT  J C5    1 
ATOM   4843  C  C7    . DT  B 1 91  ? 83.331  97.453  20.507  1.00 54.88  ? 237 DT  J C7    1 
ATOM   4844  C  C6    . DT  B 1 91  ? 82.614  97.770  18.146  1.00 54.88  ? 237 DT  J C6    1 
ATOM   4845  P  P     . DT  B 1 92  ? 79.090  96.355  13.556  1.00 30.33  ? 238 DT  J P     1 
ATOM   4846  O  OP1   . DT  B 1 92  ? 78.319  96.332  12.268  1.00 30.33  ? 238 DT  J OP1   1 
ATOM   4847  O  OP2   . DT  B 1 92  ? 78.749  95.393  14.645  1.00 30.33  ? 238 DT  J OP2   1 
ATOM   4848  O  "O5'" . DT  B 1 92  ? 80.590  96.107  13.132  1.00 48.10  ? 238 DT  J "O5'" 1 
ATOM   4849  C  "C5'" . DT  B 1 92  ? 80.901  94.992  12.356  1.00 48.10  ? 238 DT  J "C5'" 1 
ATOM   4850  C  "C4'" . DT  B 1 92  ? 82.245  95.168  11.710  1.00 48.10  ? 238 DT  J "C4'" 1 
ATOM   4851  O  "O4'" . DT  B 1 92  ? 83.199  95.644  12.695  1.00 48.10  ? 238 DT  J "O4'" 1 
ATOM   4852  C  "C3'" . DT  B 1 92  ? 82.716  93.798  11.264  1.00 48.10  ? 238 DT  J "C3'" 1 
ATOM   4853  O  "O3'" . DT  B 1 92  ? 83.238  93.828  9.943   1.00 48.10  ? 238 DT  J "O3'" 1 
ATOM   4854  C  "C2'" . DT  B 1 92  ? 83.687  93.359  12.348  1.00 48.10  ? 238 DT  J "C2'" 1 
ATOM   4855  C  "C1'" . DT  B 1 92  ? 84.167  94.650  12.999  1.00 48.10  ? 238 DT  J "C1'" 1 
ATOM   4856  N  N1    . DT  B 1 92  ? 84.265  94.546  14.477  1.00 68.29  ? 238 DT  J N1    1 
ATOM   4857  C  C2    . DT  B 1 92  ? 85.512  94.381  15.059  1.00 68.29  ? 238 DT  J C2    1 
ATOM   4858  O  O2    . DT  B 1 92  ? 86.554  94.314  14.419  1.00 68.29  ? 238 DT  J O2    1 
ATOM   4859  N  N3    . DT  B 1 92  ? 85.493  94.289  16.434  1.00 68.29  ? 238 DT  J N3    1 
ATOM   4860  C  C4    . DT  B 1 92  ? 84.388  94.341  17.262  1.00 68.29  ? 238 DT  J C4    1 
ATOM   4861  O  O4    . DT  B 1 92  ? 84.530  94.259  18.482  1.00 68.29  ? 238 DT  J O4    1 
ATOM   4862  C  C5    . DT  B 1 92  ? 83.122  94.500  16.588  1.00 68.29  ? 238 DT  J C5    1 
ATOM   4863  C  C7    . DT  B 1 92  ? 81.871  94.537  17.407  1.00 68.29  ? 238 DT  J C7    1 
ATOM   4864  C  C6    . DT  B 1 92  ? 83.124  94.601  15.250  1.00 68.29  ? 238 DT  J C6    1 
ATOM   4865  P  P     . DT  B 1 93  ? 83.331  92.458  9.106   1.00 76.19  ? 239 DT  J P     1 
ATOM   4866  O  OP1   . DT  B 1 93  ? 83.166  92.771  7.657   1.00 76.19  ? 239 DT  J OP1   1 
ATOM   4867  O  OP2   . DT  B 1 93  ? 82.436  91.464  9.755   1.00 76.19  ? 239 DT  J OP2   1 
ATOM   4868  O  "O5'" . DT  B 1 93  ? 84.832  92.012  9.384   1.00 70.92  ? 239 DT  J "O5'" 1 
ATOM   4869  C  "C5'" . DT  B 1 93  ? 85.481  92.456  10.567  1.00 70.92  ? 239 DT  J "C5'" 1 
ATOM   4870  C  "C4'" . DT  B 1 93  ? 86.783  91.729  10.759  1.00 70.92  ? 239 DT  J "C4'" 1 
ATOM   4871  O  "O4'" . DT  B 1 93  ? 87.098  91.843  12.160  1.00 70.92  ? 239 DT  J "O4'" 1 
ATOM   4872  C  "C3'" . DT  B 1 93  ? 86.690  90.233  10.481  1.00 70.92  ? 239 DT  J "C3'" 1 
ATOM   4873  O  "O3'" . DT  B 1 93  ? 87.967  89.754  10.032  1.00 70.92  ? 239 DT  J "O3'" 1 
ATOM   4874  C  "C2'" . DT  B 1 93  ? 86.300  89.656  11.828  1.00 70.92  ? 239 DT  J "C2'" 1 
ATOM   4875  C  "C1'" . DT  B 1 93  ? 87.024  90.575  12.786  1.00 70.92  ? 239 DT  J "C1'" 1 
ATOM   4876  N  N1    . DT  B 1 93  ? 86.319  90.764  14.039  1.00 92.50  ? 239 DT  J N1    1 
ATOM   4877  C  C2    . DT  B 1 93  ? 87.003  90.572  15.210  1.00 92.50  ? 239 DT  J C2    1 
ATOM   4878  O  O2    . DT  B 1 93  ? 88.171  90.213  15.260  1.00 92.50  ? 239 DT  J O2    1 
ATOM   4879  N  N3    . DT  B 1 93  ? 86.267  90.812  16.333  1.00 92.50  ? 239 DT  J N3    1 
ATOM   4880  C  C4    . DT  B 1 93  ? 84.952  91.209  16.403  1.00 92.50  ? 239 DT  J C4    1 
ATOM   4881  O  O4    . DT  B 1 93  ? 84.438  91.394  17.490  1.00 92.50  ? 239 DT  J O4    1 
ATOM   4882  C  C5    . DT  B 1 93  ? 84.292  91.375  15.135  1.00 92.50  ? 239 DT  J C5    1 
ATOM   4883  C  C7    . DT  B 1 93  ? 82.858  91.796  15.110  1.00 92.50  ? 239 DT  J C7    1 
ATOM   4884  C  C6    . DT  B 1 93  ? 85.000  91.144  14.029  1.00 92.50  ? 239 DT  J C6    1 
ATOM   4885  P  P     . DG  B 1 94  ? 88.100  88.269  9.443   1.00 114.93 ? 240 DG  J P     1 
ATOM   4886  O  OP1   . DG  B 1 94  ? 89.535  87.902  9.515   1.00 114.93 ? 240 DG  J OP1   1 
ATOM   4887  O  OP2   . DG  B 1 94  ? 87.390  88.204  8.137   1.00 114.93 ? 240 DG  J OP2   1 
ATOM   4888  O  "O5'" . DG  B 1 94  ? 87.296  87.398  10.510  1.00 154.49 ? 240 DG  J "O5'" 1 
ATOM   4889  C  "C5'" . DG  B 1 94  ? 87.736  86.099  10.879  1.00 154.49 ? 240 DG  J "C5'" 1 
ATOM   4890  C  "C4'" . DG  B 1 94  ? 88.874  86.200  11.867  1.00 154.49 ? 240 DG  J "C4'" 1 
ATOM   4891  O  "O4'" . DG  B 1 94  ? 88.495  87.042  12.981  1.00 154.49 ? 240 DG  J "O4'" 1 
ATOM   4892  C  "C3'" . DG  B 1 94  ? 89.285  84.859  12.471  1.00 154.49 ? 240 DG  J "C3'" 1 
ATOM   4893  O  "O3'" . DG  B 1 94  ? 90.700  84.800  12.631  1.00 154.49 ? 240 DG  J "O3'" 1 
ATOM   4894  C  "C2'" . DG  B 1 94  ? 88.609  84.860  13.825  1.00 154.49 ? 240 DG  J "C2'" 1 
ATOM   4895  C  "C1'" . DG  B 1 94  ? 88.641  86.327  14.198  1.00 154.49 ? 240 DG  J "C1'" 1 
ATOM   4896  N  N9    . DG  B 1 94  ? 87.538  86.699  15.069  1.00 108.40 ? 240 DG  J N9    1 
ATOM   4897  C  C8    . DG  B 1 94  ? 86.232  86.913  14.702  1.00 108.40 ? 240 DG  J C8    1 
ATOM   4898  N  N7    . DG  B 1 94  ? 85.463  87.207  15.710  1.00 108.40 ? 240 DG  J N7    1 
ATOM   4899  C  C5    . DG  B 1 94  ? 86.314  87.191  16.808  1.00 108.40 ? 240 DG  J C5    1 
ATOM   4900  C  C6    . DG  B 1 94  ? 86.046  87.429  18.175  1.00 108.40 ? 240 DG  J C6    1 
ATOM   4901  O  O6    . DG  B 1 94  ? 84.974  87.714  18.707  1.00 108.40 ? 240 DG  J O6    1 
ATOM   4902  N  N1    . DG  B 1 94  ? 87.192  87.307  18.955  1.00 108.40 ? 240 DG  J N1    1 
ATOM   4903  C  C2    . DG  B 1 94  ? 88.444  86.998  18.480  1.00 108.40 ? 240 DG  J C2    1 
ATOM   4904  N  N2    . DG  B 1 94  ? 89.425  86.928  19.404  1.00 108.40 ? 240 DG  J N2    1 
ATOM   4905  N  N3    . DG  B 1 94  ? 88.709  86.775  17.199  1.00 108.40 ? 240 DG  J N3    1 
ATOM   4906  C  C4    . DG  B 1 94  ? 87.600  86.886  16.427  1.00 108.40 ? 240 DG  J C4    1 
ATOM   4907  P  P     . DA  B 1 95  ? 91.418  83.374  12.794  1.00 121.92 ? 241 DA  J P     1 
ATOM   4908  O  OP1   . DA  B 1 95  ? 92.716  83.440  12.083  1.00 121.92 ? 241 DA  J OP1   1 
ATOM   4909  O  OP2   . DA  B 1 95  ? 90.439  82.318  12.428  1.00 121.92 ? 241 DA  J OP2   1 
ATOM   4910  O  "O5'" . DA  B 1 95  ? 91.689  83.257  14.359  1.00 114.59 ? 241 DA  J "O5'" 1 
ATOM   4911  C  "C5'" . DA  B 1 95  ? 91.769  81.983  14.975  1.00 114.59 ? 241 DA  J "C5'" 1 
ATOM   4912  C  "C4'" . DA  B 1 95  ? 91.998  82.120  16.461  1.00 114.59 ? 241 DA  J "C4'" 1 
ATOM   4913  O  "O4'" . DA  B 1 95  ? 91.033  83.064  16.994  1.00 114.59 ? 241 DA  J "O4'" 1 
ATOM   4914  C  "C3'" . DA  B 1 95  ? 91.763  80.799  17.198  1.00 114.59 ? 241 DA  J "C3'" 1 
ATOM   4915  O  "O3'" . DA  B 1 95  ? 92.652  80.611  18.304  1.00 114.59 ? 241 DA  J "O3'" 1 
ATOM   4916  C  "C2'" . DA  B 1 95  ? 90.336  80.925  17.690  1.00 114.59 ? 241 DA  J "C2'" 1 
ATOM   4917  C  "C1'" . DA  B 1 95  ? 90.211  82.415  17.956  1.00 114.59 ? 241 DA  J "C1'" 1 
ATOM   4918  N  N9    . DA  B 1 95  ? 88.840  82.884  17.785  1.00 103.90 ? 241 DA  J N9    1 
ATOM   4919  C  C8    . DA  B 1 95  ? 88.147  83.124  16.623  1.00 103.90 ? 241 DA  J C8    1 
ATOM   4920  N  N7    . DA  B 1 95  ? 86.904  83.486  16.818  1.00 103.90 ? 241 DA  J N7    1 
ATOM   4921  C  C5    . DA  B 1 95  ? 86.778  83.496  18.199  1.00 103.90 ? 241 DA  J C5    1 
ATOM   4922  C  C6    . DA  B 1 95  ? 85.707  83.793  19.036  1.00 103.90 ? 241 DA  J C6    1 
ATOM   4923  N  N6    . DA  B 1 95  ? 84.509  84.152  18.585  1.00 103.90 ? 241 DA  J N6    1 
ATOM   4924  N  N1    . DA  B 1 95  ? 85.905  83.708  20.369  1.00 103.90 ? 241 DA  J N1    1 
ATOM   4925  C  C2    . DA  B 1 95  ? 87.114  83.348  20.814  1.00 103.90 ? 241 DA  J C2    1 
ATOM   4926  N  N3    . DA  B 1 95  ? 88.201  83.046  20.124  1.00 103.90 ? 241 DA  J N3    1 
ATOM   4927  C  C4    . DA  B 1 95  ? 87.963  83.140  18.805  1.00 103.90 ? 241 DA  J C4    1 
ATOM   4928  P  P     . DT  B 1 96  ? 92.362  79.424  19.351  1.00 135.22 ? 242 DT  J P     1 
ATOM   4929  O  OP1   . DT  B 1 96  ? 93.547  79.246  20.222  1.00 135.22 ? 242 DT  J OP1   1 
ATOM   4930  O  OP2   . DT  B 1 96  ? 91.823  78.266  18.592  1.00 135.22 ? 242 DT  J OP2   1 
ATOM   4931  O  "O5'" . DT  B 1 96  ? 91.186  80.000  20.249  1.00 118.22 ? 242 DT  J "O5'" 1 
ATOM   4932  C  "C5'" . DT  B 1 96  ? 91.460  80.617  21.499  1.00 118.22 ? 242 DT  J "C5'" 1 
ATOM   4933  C  "C4'" . DT  B 1 96  ? 90.583  80.007  22.563  1.00 118.22 ? 242 DT  J "C4'" 1 
ATOM   4934  O  "O4'" . DT  B 1 96  ? 89.199  80.356  22.307  1.00 118.22 ? 242 DT  J "O4'" 1 
ATOM   4935  C  "C3'" . DT  B 1 96  ? 90.628  78.480  22.585  1.00 118.22 ? 242 DT  J "C3'" 1 
ATOM   4936  O  "O3'" . DT  B 1 96  ? 90.475  78.041  23.932  1.00 118.22 ? 242 DT  J "O3'" 1 
ATOM   4937  C  "C2'" . DT  B 1 96  ? 89.411  78.087  21.767  1.00 118.22 ? 242 DT  J "C2'" 1 
ATOM   4938  C  "C1'" . DT  B 1 96  ? 88.427  79.172  22.165  1.00 118.22 ? 242 DT  J "C1'" 1 
ATOM   4939  N  N1    . DT  B 1 96  ? 87.364  79.437  21.186  1.00 76.38  ? 242 DT  J N1    1 
ATOM   4940  C  C2    . DT  B 1 96  ? 86.208  80.037  21.632  1.00 76.38  ? 242 DT  J C2    1 
ATOM   4941  O  O2    . DT  B 1 96  ? 86.043  80.395  22.793  1.00 76.38  ? 242 DT  J O2    1 
ATOM   4942  N  N3    . DT  B 1 96  ? 85.248  80.215  20.663  1.00 76.38  ? 242 DT  J N3    1 
ATOM   4943  C  C4    . DT  B 1 96  ? 85.339  79.882  19.323  1.00 76.38  ? 242 DT  J C4    1 
ATOM   4944  O  O4    . DT  B 1 96  ? 84.398  80.102  18.574  1.00 76.38  ? 242 DT  J O4    1 
ATOM   4945  C  C5    . DT  B 1 96  ? 86.587  79.280  18.923  1.00 76.38  ? 242 DT  J C5    1 
ATOM   4946  C  C7    . DT  B 1 96  ? 86.782  78.907  17.488  1.00 76.38  ? 242 DT  J C7    1 
ATOM   4947  C  C6    . DT  B 1 96  ? 87.524  79.084  19.863  1.00 76.38  ? 242 DT  J C6    1 
ATOM   4948  P  P     . DG  B 1 97  ? 90.379  76.478  24.256  1.00 104.97 ? 243 DG  J P     1 
ATOM   4949  O  OP1   . DG  B 1 97  ? 91.777  75.974  24.192  1.00 104.97 ? 243 DG  J OP1   1 
ATOM   4950  O  OP2   . DG  B 1 97  ? 89.347  75.874  23.373  1.00 104.97 ? 243 DG  J OP2   1 
ATOM   4951  O  "O5'" . DG  B 1 97  ? 89.862  76.467  25.769  1.00 104.53 ? 243 DG  J "O5'" 1 
ATOM   4952  C  "C5'" . DG  B 1 97  ? 88.888  75.519  26.233  1.00 104.53 ? 243 DG  J "C5'" 1 
ATOM   4953  C  "C4'" . DG  B 1 97  ? 87.756  76.228  26.949  1.00 104.53 ? 243 DG  J "C4'" 1 
ATOM   4954  O  "O4'" . DG  B 1 97  ? 87.065  77.096  26.018  1.00 104.53 ? 243 DG  J "O4'" 1 
ATOM   4955  C  "C3'" . DG  B 1 97  ? 86.673  75.320  27.538  1.00 104.53 ? 243 DG  J "C3'" 1 
ATOM   4956  O  "O3'" . DG  B 1 97  ? 86.147  75.898  28.740  1.00 104.53 ? 243 DG  J "O3'" 1 
ATOM   4957  C  "C2'" . DG  B 1 97  ? 85.609  75.298  26.460  1.00 104.53 ? 243 DG  J "C2'" 1 
ATOM   4958  C  "C1'" . DG  B 1 97  ? 85.708  76.689  25.859  1.00 104.53 ? 243 DG  J "C1'" 1 
ATOM   4959  N  N9    . DG  B 1 97  ? 85.403  76.719  24.431  1.00 105.48 ? 243 DG  J N9    1 
ATOM   4960  C  C8    . DG  B 1 97  ? 86.165  76.197  23.408  1.00 105.48 ? 243 DG  J C8    1 
ATOM   4961  N  N7    . DG  B 1 97  ? 85.636  76.377  22.229  1.00 105.48 ? 243 DG  J N7    1 
ATOM   4962  C  C5    . DG  B 1 97  ? 84.454  77.060  22.486  1.00 105.48 ? 243 DG  J C5    1 
ATOM   4963  C  C6    . DG  B 1 97  ? 83.455  77.534  21.598  1.00 105.48 ? 243 DG  J C6    1 
ATOM   4964  O  O6    . DG  B 1 97  ? 83.418  77.462  20.360  1.00 105.48 ? 243 DG  J O6    1 
ATOM   4965  N  N1    . DG  B 1 97  ? 82.417  78.155  22.285  1.00 105.48 ? 243 DG  J N1    1 
ATOM   4966  C  C2    . DG  B 1 97  ? 82.357  78.322  23.653  1.00 105.48 ? 243 DG  J C2    1 
ATOM   4967  N  N2    . DG  B 1 97  ? 81.276  78.953  24.129  1.00 105.48 ? 243 DG  J N2    1 
ATOM   4968  N  N3    . DG  B 1 97  ? 83.289  77.899  24.489  1.00 105.48 ? 243 DG  J N3    1 
ATOM   4969  C  C4    . DG  B 1 97  ? 84.297  77.277  23.844  1.00 105.48 ? 243 DG  J C4    1 
ATOM   4970  P  P     . DG  B 1 98  ? 85.138  75.049  29.664  1.00 102.73 ? 244 DG  J P     1 
ATOM   4971  O  OP1   . DG  B 1 98  ? 85.008  75.731  30.986  1.00 102.73 ? 244 DG  J OP1   1 
ATOM   4972  O  OP2   . DG  B 1 98  ? 85.551  73.617  29.613  1.00 102.73 ? 244 DG  J OP2   1 
ATOM   4973  O  "O5'" . DG  B 1 98  ? 83.741  75.181  28.908  1.00 91.84  ? 244 DG  J "O5'" 1 
ATOM   4974  C  "C5'" . DG  B 1 98  ? 82.836  76.248  29.213  1.00 91.84  ? 244 DG  J "C5'" 1 
ATOM   4975  C  "C4'" . DG  B 1 98  ? 81.464  75.947  28.656  1.00 91.84  ? 244 DG  J "C4'" 1 
ATOM   4976  O  "O4'" . DG  B 1 98  ? 81.511  75.956  27.213  1.00 91.84  ? 244 DG  J "O4'" 1 
ATOM   4977  C  "C3'" . DG  B 1 98  ? 80.915  74.576  29.046  1.00 91.84  ? 244 DG  J "C3'" 1 
ATOM   4978  O  "O3'" . DG  B 1 98  ? 79.493  74.650  29.130  1.00 91.84  ? 244 DG  J "O3'" 1 
ATOM   4979  C  "C2'" . DG  B 1 98  ? 81.309  73.709  27.864  1.00 91.84  ? 244 DG  J "C2'" 1 
ATOM   4980  C  "C1'" . DG  B 1 98  ? 81.140  74.680  26.712  1.00 91.84  ? 244 DG  J "C1'" 1 
ATOM   4981  N  N9    . DG  B 1 98  ? 81.966  74.412  25.541  1.00 85.05  ? 244 DG  J N9    1 
ATOM   4982  C  C8    . DG  B 1 98  ? 83.237  73.896  25.513  1.00 85.05  ? 244 DG  J C8    1 
ATOM   4983  N  N7    . DG  B 1 98  ? 83.722  73.798  24.306  1.00 85.05  ? 244 DG  J N7    1 
ATOM   4984  C  C5    . DG  B 1 98  ? 82.705  74.269  23.491  1.00 85.05  ? 244 DG  J C5    1 
ATOM   4985  C  C6    . DG  B 1 98  ? 82.649  74.404  22.095  1.00 85.05  ? 244 DG  J C6    1 
ATOM   4986  O  O6    . DG  B 1 98  ? 83.514  74.123  21.266  1.00 85.05  ? 244 DG  J O6    1 
ATOM   4987  N  N1    . DG  B 1 98  ? 81.431  74.934  21.681  1.00 85.05  ? 244 DG  J N1    1 
ATOM   4988  C  C2    . DG  B 1 98  ? 80.405  75.292  22.514  1.00 85.05  ? 244 DG  J C2    1 
ATOM   4989  N  N2    . DG  B 1 98  ? 79.323  75.806  21.922  1.00 85.05  ? 244 DG  J N2    1 
ATOM   4990  N  N3    . DG  B 1 98  ? 80.441  75.162  23.820  1.00 85.05  ? 244 DG  J N3    1 
ATOM   4991  C  C4    . DG  B 1 98  ? 81.614  74.650  24.239  1.00 85.05  ? 244 DG  J C4    1 
ATOM   4992  P  P     . DA  B 1 99  ? 78.779  74.958  30.538  1.00 103.71 ? 245 DA  J P     1 
ATOM   4993  O  OP1   . DA  B 1 99  ? 79.530  76.025  31.254  1.00 103.71 ? 245 DA  J OP1   1 
ATOM   4994  O  OP2   . DA  B 1 99  ? 78.506  73.658  31.217  1.00 103.71 ? 245 DA  J OP2   1 
ATOM   4995  O  "O5'" . DA  B 1 99  ? 77.378  75.569  30.096  1.00 83.07  ? 245 DA  J "O5'" 1 
ATOM   4996  C  "C5'" . DA  B 1 99  ? 77.322  76.807  29.388  1.00 83.07  ? 245 DA  J "C5'" 1 
ATOM   4997  C  "C4'" . DA  B 1 99  ? 76.353  76.731  28.226  1.00 83.07  ? 245 DA  J "C4'" 1 
ATOM   4998  O  "O4'" . DA  B 1 99  ? 76.913  76.040  27.087  1.00 83.07  ? 245 DA  J "O4'" 1 
ATOM   4999  C  "C3'" . DA  B 1 99  ? 74.992  76.094  28.492  1.00 83.07  ? 245 DA  J "C3'" 1 
ATOM   5000  O  "O3'" . DA  B 1 99  ? 73.996  76.910  27.871  1.00 83.07  ? 245 DA  J "O3'" 1 
ATOM   5001  C  "C2'" . DA  B 1 99  ? 75.109  74.726  27.835  1.00 83.07  ? 245 DA  J "C2'" 1 
ATOM   5002  C  "C1'" . DA  B 1 99  ? 76.072  74.971  26.679  1.00 83.07  ? 245 DA  J "C1'" 1 
ATOM   5003  N  N9    . DA  B 1 99  ? 76.954  73.851  26.340  1.00 67.02  ? 245 DA  J N9    1 
ATOM   5004  C  C8    . DA  B 1 99  ? 77.576  72.979  27.203  1.00 67.02  ? 245 DA  J C8    1 
ATOM   5005  N  N7    . DA  B 1 99  ? 78.395  72.141  26.611  1.00 67.02  ? 245 DA  J N7    1 
ATOM   5006  C  C5    . DA  B 1 99  ? 78.294  72.468  25.266  1.00 67.02  ? 245 DA  J C5    1 
ATOM   5007  C  C6    . DA  B 1 99  ? 78.931  71.967  24.124  1.00 67.02  ? 245 DA  J C6    1 
ATOM   5008  N  N6    . DA  B 1 99  ? 79.860  71.006  24.150  1.00 67.02  ? 245 DA  J N6    1 
ATOM   5009  N  N1    . DA  B 1 99  ? 78.589  72.502  22.934  1.00 67.02  ? 245 DA  J N1    1 
ATOM   5010  C  C2    . DA  B 1 99  ? 77.680  73.478  22.903  1.00 67.02  ? 245 DA  J C2    1 
ATOM   5011  N  N3    . DA  B 1 99  ? 77.028  74.049  23.904  1.00 67.02  ? 245 DA  J N3    1 
ATOM   5012  C  C4    . DA  B 1 99  ? 77.385  73.496  25.079  1.00 67.02  ? 245 DA  J C4    1 
ATOM   5013  P  P     . DG  B 1 100 ? 72.455  76.760  28.285  1.00 65.37  ? 246 DG  J P     1 
ATOM   5014  O  OP1   . DG  B 1 100 ? 71.944  77.980  28.970  1.00 65.37  ? 246 DG  J OP1   1 
ATOM   5015  O  OP2   . DG  B 1 100 ? 72.302  75.433  28.945  1.00 65.37  ? 246 DG  J OP2   1 
ATOM   5016  O  "O5'" . DG  B 1 100 ? 71.768  76.697  26.858  1.00 47.97  ? 246 DG  J "O5'" 1 
ATOM   5017  C  "C5'" . DG  B 1 100 ? 70.941  75.608  26.524  1.00 47.97  ? 246 DG  J "C5'" 1 
ATOM   5018  C  "C4'" . DG  B 1 100 ? 71.270  75.091  25.146  1.00 47.97  ? 246 DG  J "C4'" 1 
ATOM   5019  O  "O4'" . DG  B 1 100 ? 72.578  74.458  25.116  1.00 47.97  ? 246 DG  J "O4'" 1 
ATOM   5020  C  "C3'" . DG  B 1 100 ? 70.273  74.005  24.760  1.00 47.97  ? 246 DG  J "C3'" 1 
ATOM   5021  O  "O3'" . DG  B 1 100 ? 69.876  74.148  23.416  1.00 47.97  ? 246 DG  J "O3'" 1 
ATOM   5022  C  "C2'" . DG  B 1 100 ? 71.038  72.715  24.944  1.00 47.97  ? 246 DG  J "C2'" 1 
ATOM   5023  C  "C1'" . DG  B 1 100 ? 72.442  73.136  24.594  1.00 47.97  ? 246 DG  J "C1'" 1 
ATOM   5024  N  N9    . DG  B 1 100 ? 73.442  72.265  25.206  1.00 75.80  ? 246 DG  J N9    1 
ATOM   5025  C  C8    . DG  B 1 100 ? 73.622  72.008  26.547  1.00 75.80  ? 246 DG  J C8    1 
ATOM   5026  N  N7    . DG  B 1 100 ? 74.593  71.167  26.783  1.00 75.80  ? 246 DG  J N7    1 
ATOM   5027  C  C5    . DG  B 1 100 ? 75.089  70.856  25.523  1.00 75.80  ? 246 DG  J C5    1 
ATOM   5028  C  C6    . DG  B 1 100 ? 76.165  70.011  25.141  1.00 75.80  ? 246 DG  J C6    1 
ATOM   5029  O  O6    . DG  B 1 100 ? 76.922  69.354  25.868  1.00 75.80  ? 246 DG  J O6    1 
ATOM   5030  N  N1    . DG  B 1 100 ? 76.324  69.981  23.755  1.00 75.80  ? 246 DG  J N1    1 
ATOM   5031  C  C2    . DG  B 1 100 ? 75.547  70.678  22.859  1.00 75.80  ? 246 DG  J C2    1 
ATOM   5032  N  N2    . DG  B 1 100 ? 75.845  70.517  21.566  1.00 75.80  ? 246 DG  J N2    1 
ATOM   5033  N  N3    . DG  B 1 100 ? 74.551  71.475  23.204  1.00 75.80  ? 246 DG  J N3    1 
ATOM   5034  C  C4    . DG  B 1 100 ? 74.381  71.519  24.540  1.00 75.80  ? 246 DG  J C4    1 
ATOM   5035  P  P     . DC  B 1 101 ? 68.324  74.235  23.082  1.00 44.36  ? 247 DC  J P     1 
ATOM   5036  O  OP1   . DC  B 1 101 ? 67.890  75.509  23.667  1.00 44.36  ? 247 DC  J OP1   1 
ATOM   5037  O  OP2   . DC  B 1 101 ? 67.651  72.979  23.486  1.00 44.36  ? 247 DC  J OP2   1 
ATOM   5038  O  "O5'" . DC  B 1 101 ? 68.325  74.348  21.505  1.00 61.15  ? 247 DC  J "O5'" 1 
ATOM   5039  C  "C5'" . DC  B 1 101 ? 69.513  74.731  20.834  1.00 61.15  ? 247 DC  J "C5'" 1 
ATOM   5040  C  "C4'" . DC  B 1 101 ? 69.944  73.643  19.880  1.00 61.15  ? 247 DC  J "C4'" 1 
ATOM   5041  O  "O4'" . DC  B 1 101 ? 70.872  72.735  20.521  1.00 61.15  ? 247 DC  J "O4'" 1 
ATOM   5042  C  "C3'" . DC  B 1 101 ? 68.812  72.779  19.330  1.00 61.15  ? 247 DC  J "C3'" 1 
ATOM   5043  O  "O3'" . DC  B 1 101 ? 69.039  72.597  17.931  1.00 61.15  ? 247 DC  J "O3'" 1 
ATOM   5044  C  "C2'" . DC  B 1 101 ? 68.932  71.482  20.118  1.00 61.15  ? 247 DC  J "C2'" 1 
ATOM   5045  C  "C1'" . DC  B 1 101 ? 70.428  71.391  20.371  1.00 61.15  ? 247 DC  J "C1'" 1 
ATOM   5046  N  N1    . DC  B 1 101 ? 70.828  70.655  21.586  1.00 56.36  ? 247 DC  J N1    1 
ATOM   5047  C  C2    . DC  B 1 101 ? 72.074  69.990  21.602  1.00 56.36  ? 247 DC  J C2    1 
ATOM   5048  O  O2    . DC  B 1 101 ? 72.775  69.978  20.566  1.00 56.36  ? 247 DC  J O2    1 
ATOM   5049  N  N3    . DC  B 1 101 ? 72.478  69.377  22.740  1.00 56.36  ? 247 DC  J N3    1 
ATOM   5050  C  C4    . DC  B 1 101 ? 71.695  69.393  23.820  1.00 56.36  ? 247 DC  J C4    1 
ATOM   5051  N  N4    . DC  B 1 101 ? 72.148  68.801  24.923  1.00 56.36  ? 247 DC  J N4    1 
ATOM   5052  C  C5    . DC  B 1 101 ? 70.414  70.023  23.818  1.00 56.36  ? 247 DC  J C5    1 
ATOM   5053  C  C6    . DC  B 1 101 ? 70.024  70.635  22.692  1.00 56.36  ? 247 DC  J C6    1 
ATOM   5054  P  P     . DA  B 1 102 ? 68.050  71.680  17.066  1.00 54.49  ? 248 DA  J P     1 
ATOM   5055  O  OP1   . DA  B 1 102 ? 67.611  72.425  15.859  1.00 54.49  ? 248 DA  J OP1   1 
ATOM   5056  O  OP2   . DA  B 1 102 ? 67.034  71.053  17.978  1.00 54.49  ? 248 DA  J OP2   1 
ATOM   5057  O  "O5'" . DA  B 1 102 ? 69.003  70.506  16.588  1.00 82.84  ? 248 DA  J "O5'" 1 
ATOM   5058  C  "C5'" . DA  B 1 102 ? 68.464  69.227  16.347  1.00 82.84  ? 248 DA  J "C5'" 1 
ATOM   5059  C  "C4'" . DA  B 1 102 ? 69.458  68.148  16.698  1.00 82.84  ? 248 DA  J "C4'" 1 
ATOM   5060  O  "O4'" . DA  B 1 102 ? 69.913  68.252  18.071  1.00 82.84  ? 248 DA  J "O4'" 1 
ATOM   5061  C  "C3'" . DA  B 1 102 ? 68.774  66.795  16.588  1.00 82.84  ? 248 DA  J "C3'" 1 
ATOM   5062  O  "O3'" . DA  B 1 102 ? 69.618  65.874  15.946  1.00 82.84  ? 248 DA  J "O3'" 1 
ATOM   5063  C  "C2'" . DA  B 1 102 ? 68.518  66.387  18.021  1.00 82.84  ? 248 DA  J "C2'" 1 
ATOM   5064  C  "C1'" . DA  B 1 102 ? 69.682  67.018  18.735  1.00 82.84  ? 248 DA  J "C1'" 1 
ATOM   5065  N  N9    . DA  B 1 102 ? 69.363  67.282  20.133  1.00 83.86  ? 248 DA  J N9    1 
ATOM   5066  C  C8    . DA  B 1 102 ? 68.316  68.007  20.646  1.00 83.86  ? 248 DA  J C8    1 
ATOM   5067  N  N7    . DA  B 1 102 ? 68.240  67.974  21.954  1.00 83.86  ? 248 DA  J N7    1 
ATOM   5068  C  C5    . DA  B 1 102 ? 69.324  67.191  22.329  1.00 83.86  ? 248 DA  J C5    1 
ATOM   5069  C  C6    . DA  B 1 102 ? 69.793  66.757  23.584  1.00 83.86  ? 248 DA  J C6    1 
ATOM   5070  N  N6    . DA  B 1 102 ? 69.191  67.050  24.745  1.00 83.86  ? 248 DA  J N6    1 
ATOM   5071  N  N1    . DA  B 1 102 ? 70.913  65.994  23.604  1.00 83.86  ? 248 DA  J N1    1 
ATOM   5072  C  C2    . DA  B 1 102 ? 71.507  65.688  22.438  1.00 83.86  ? 248 DA  J C2    1 
ATOM   5073  N  N3    . DA  B 1 102 ? 71.155  66.026  21.202  1.00 83.86  ? 248 DA  J N3    1 
ATOM   5074  C  C4    . DA  B 1 102 ? 70.041  66.783  21.217  1.00 83.86  ? 248 DA  J C4    1 
ATOM   5075  P  P     . DG  B 1 103 ? 69.026  64.978  14.771  1.00 73.61  ? 249 DG  J P     1 
ATOM   5076  O  OP1   . DG  B 1 103 ? 68.577  65.873  13.672  1.00 73.61  ? 249 DG  J OP1   1 
ATOM   5077  O  OP2   . DG  B 1 103 ? 68.066  64.007  15.374  1.00 73.61  ? 249 DG  J OP2   1 
ATOM   5078  O  "O5'" . DG  B 1 103 ? 70.304  64.175  14.300  1.00 106.31 ? 249 DG  J "O5'" 1 
ATOM   5079  C  "C5'" . DG  B 1 103 ? 70.214  62.789  14.156  1.00 106.31 ? 249 DG  J "C5'" 1 
ATOM   5080  C  "C4'" . DG  B 1 103 ? 70.919  62.088  15.289  1.00 106.31 ? 249 DG  J "C4'" 1 
ATOM   5081  O  "O4'" . DG  B 1 103 ? 70.786  62.759  16.572  1.00 106.31 ? 249 DG  J "O4'" 1 
ATOM   5082  C  "C3'" . DG  B 1 103 ? 70.289  60.716  15.459  1.00 106.31 ? 249 DG  J "C3'" 1 
ATOM   5083  O  "O3'" . DG  B 1 103 ? 71.248  59.689  15.312  1.00 106.31 ? 249 DG  J "O3'" 1 
ATOM   5084  C  "C2'" . DG  B 1 103 ? 69.625  60.752  16.829  1.00 106.31 ? 249 DG  J "C2'" 1 
ATOM   5085  C  "C1'" . DG  B 1 103 ? 70.415  61.809  17.567  1.00 106.31 ? 249 DG  J "C1'" 1 
ATOM   5086  N  N9    . DG  B 1 103 ? 69.675  62.500  18.628  1.00 92.68  ? 249 DG  J N9    1 
ATOM   5087  C  C8    . DG  B 1 103 ? 68.736  63.493  18.477  1.00 92.68  ? 249 DG  J C8    1 
ATOM   5088  N  N7    . DG  B 1 103 ? 68.285  63.955  19.614  1.00 92.68  ? 249 DG  J N7    1 
ATOM   5089  C  C5    . DG  B 1 103 ? 68.958  63.218  20.579  1.00 92.68  ? 249 DG  J C5    1 
ATOM   5090  C  C6    . DG  B 1 103 ? 68.900  63.287  22.004  1.00 92.68  ? 249 DG  J C6    1 
ATOM   5091  O  O6    . DG  B 1 103 ? 68.244  64.053  22.719  1.00 92.68  ? 249 DG  J O6    1 
ATOM   5092  N  N1    . DG  B 1 103 ? 69.729  62.344  22.597  1.00 92.68  ? 249 DG  J N1    1 
ATOM   5093  C  C2    . DG  B 1 103 ? 70.524  61.458  21.919  1.00 92.68  ? 249 DG  J C2    1 
ATOM   5094  N  N2    . DG  B 1 103 ? 71.246  60.621  22.683  1.00 92.68  ? 249 DG  J N2    1 
ATOM   5095  N  N3    . DG  B 1 103 ? 70.605  61.394  20.595  1.00 92.68  ? 249 DG  J N3    1 
ATOM   5096  C  C4    . DG  B 1 103 ? 69.801  62.298  19.992  1.00 92.68  ? 249 DG  J C4    1 
ATOM   5097  P  P     . DT  B 1 104 ? 70.738  58.206  15.035  1.00 109.16 ? 250 DT  J P     1 
ATOM   5098  O  OP1   . DT  B 1 104 ? 71.882  57.438  14.491  1.00 109.16 ? 250 DT  J OP1   1 
ATOM   5099  O  OP2   . DT  B 1 104 ? 69.457  58.264  14.274  1.00 109.16 ? 250 DT  J OP2   1 
ATOM   5100  O  "O5'" . DT  B 1 104 ? 70.448  57.722  16.515  1.00 82.94  ? 250 DT  J "O5'" 1 
ATOM   5101  C  "C5'" . DT  B 1 104 ? 71.410  57.981  17.533  1.00 82.94  ? 250 DT  J "C5'" 1 
ATOM   5102  C  "C4'" . DT  B 1 104 ? 71.049  57.225  18.783  1.00 82.94  ? 250 DT  J "C4'" 1 
ATOM   5103  O  "O4'" . DT  B 1 104 ? 70.408  58.100  19.737  1.00 82.94  ? 250 DT  J "O4'" 1 
ATOM   5104  C  "C3'" . DT  B 1 104 ? 70.076  56.076  18.525  1.00 82.94  ? 250 DT  J "C3'" 1 
ATOM   5105  O  "O3'" . DT  B 1 104 ? 70.505  54.923  19.243  1.00 82.94  ? 250 DT  J "O3'" 1 
ATOM   5106  C  "C2'" . DT  B 1 104 ? 68.753  56.607  19.052  1.00 82.94  ? 250 DT  J "C2'" 1 
ATOM   5107  C  "C1'" . DT  B 1 104 ? 69.216  57.492  20.193  1.00 82.94  ? 250 DT  J "C1'" 1 
ATOM   5108  N  N1    . DT  B 1 104 ? 68.293  58.563  20.600  1.00 87.36  ? 250 DT  J N1    1 
ATOM   5109  C  C2    . DT  B 1 104 ? 68.176  58.825  21.947  1.00 87.36  ? 250 DT  J C2    1 
ATOM   5110  O  O2    . DT  B 1 104 ? 68.801  58.226  22.802  1.00 87.36  ? 250 DT  J O2    1 
ATOM   5111  N  N3    . DT  B 1 104 ? 67.298  59.818  22.261  1.00 87.36  ? 250 DT  J N3    1 
ATOM   5112  C  C4    . DT  B 1 104 ? 66.539  60.564  21.388  1.00 87.36  ? 250 DT  J C4    1 
ATOM   5113  O  O4    . DT  B 1 104 ? 65.783  61.421  21.825  1.00 87.36  ? 250 DT  J O4    1 
ATOM   5114  C  C5    . DT  B 1 104 ? 66.715  60.246  19.987  1.00 87.36  ? 250 DT  J C5    1 
ATOM   5115  C  C7    . DT  B 1 104 ? 65.936  61.009  18.962  1.00 87.36  ? 250 DT  J C7    1 
ATOM   5116  C  C6    . DT  B 1 104 ? 67.574  59.273  19.667  1.00 87.36  ? 250 DT  J C6    1 
ATOM   5117  P  P     . DT  B 1 105 ? 69.815  53.509  18.950  1.00 130.75 ? 251 DT  J P     1 
ATOM   5118  O  OP1   . DT  B 1 105 ? 70.874  52.542  18.566  1.00 130.75 ? 251 DT  J OP1   1 
ATOM   5119  O  OP2   . DT  B 1 105 ? 68.668  53.749  18.037  1.00 130.75 ? 251 DT  J OP2   1 
ATOM   5120  O  "O5'" . DT  B 1 105 ? 69.244  53.103  20.374  1.00 107.80 ? 251 DT  J "O5'" 1 
ATOM   5121  C  "C5'" . DT  B 1 105 ? 70.076  53.171  21.525  1.00 107.80 ? 251 DT  J "C5'" 1 
ATOM   5122  C  "C4'" . DT  B 1 105 ? 69.264  52.891  22.764  1.00 107.80 ? 251 DT  J "C4'" 1 
ATOM   5123  O  "O4'" . DT  B 1 105 ? 68.540  54.076  23.181  1.00 107.80 ? 251 DT  J "O4'" 1 
ATOM   5124  C  "C3'" . DT  B 1 105 ? 68.221  51.793  22.567  1.00 107.80 ? 251 DT  J "C3'" 1 
ATOM   5125  O  "O3'" . DT  B 1 105 ? 68.243  50.899  23.678  1.00 107.80 ? 251 DT  J "O3'" 1 
ATOM   5126  C  "C2'" . DT  B 1 105 ? 66.909  52.557  22.466  1.00 107.80 ? 251 DT  J "C2'" 1 
ATOM   5127  C  "C1'" . DT  B 1 105 ? 67.167  53.767  23.347  1.00 107.80 ? 251 DT  J "C1'" 1 
ATOM   5128  N  N1    . DT  B 1 105 ? 66.381  54.972  23.003  1.00 93.28  ? 251 DT  J N1    1 
ATOM   5129  C  C2    . DT  B 1 105 ? 66.044  55.837  24.021  1.00 93.28  ? 251 DT  J C2    1 
ATOM   5130  O  O2    . DT  B 1 105 ? 66.367  55.658  25.182  1.00 93.28  ? 251 DT  J O2    1 
ATOM   5131  N  N3    . DT  B 1 105 ? 65.310  56.927  23.626  1.00 93.28  ? 251 DT  J N3    1 
ATOM   5132  C  C4    . DT  B 1 105 ? 64.898  57.239  22.348  1.00 93.28  ? 251 DT  J C4    1 
ATOM   5133  O  O4    . DT  B 1 105 ? 64.258  58.267  22.151  1.00 93.28  ? 251 DT  J O4    1 
ATOM   5134  C  C5    . DT  B 1 105 ? 65.280  56.288  21.328  1.00 93.28  ? 251 DT  J C5    1 
ATOM   5135  C  C7    . DT  B 1 105 ? 64.863  56.534  19.913  1.00 93.28  ? 251 DT  J C7    1 
ATOM   5136  C  C6    . DT  B 1 105 ? 65.996  55.217  21.701  1.00 93.28  ? 251 DT  J C6    1 
ATOM   5137  P  P     . DT  B 1 106 ? 67.052  49.845  23.875  1.00 85.03  ? 252 DT  J P     1 
ATOM   5138  O  OP1   . DT  B 1 106 ? 67.645  48.580  24.395  1.00 85.03  ? 252 DT  J OP1   1 
ATOM   5139  O  OP2   . DT  B 1 106 ? 66.209  49.818  22.644  1.00 85.03  ? 252 DT  J OP2   1 
ATOM   5140  O  "O5'" . DT  B 1 106 ? 66.206  50.525  25.031  1.00 79.65  ? 252 DT  J "O5'" 1 
ATOM   5141  C  "C5'" . DT  B 1 106 ? 66.862  51.191  26.109  1.00 79.65  ? 252 DT  J "C5'" 1 
ATOM   5142  C  "C4'" . DT  B 1 106 ? 65.843  51.633  27.129  1.00 79.65  ? 252 DT  J "C4'" 1 
ATOM   5143  O  "O4'" . DT  B 1 106 ? 65.199  52.864  26.714  1.00 79.65  ? 252 DT  J "O4'" 1 
ATOM   5144  C  "C3'" . DT  B 1 106 ? 64.732  50.607  27.314  1.00 79.65  ? 252 DT  J "C3'" 1 
ATOM   5145  O  "O3'" . DT  B 1 106 ? 64.429  50.466  28.696  1.00 79.65  ? 252 DT  J "O3'" 1 
ATOM   5146  C  "C2'" . DT  B 1 106 ? 63.568  51.182  26.518  1.00 79.65  ? 252 DT  J "C2'" 1 
ATOM   5147  C  "C1'" . DT  B 1 106 ? 63.790  52.685  26.622  1.00 79.65  ? 252 DT  J "C1'" 1 
ATOM   5148  N  N1    . DT  B 1 106 ? 63.304  53.494  25.471  1.00 78.34  ? 252 DT  J N1    1 
ATOM   5149  C  C2    . DT  B 1 106 ? 62.618  54.663  25.741  1.00 78.34  ? 252 DT  J C2    1 
ATOM   5150  O  O2    . DT  B 1 106 ? 62.345  55.034  26.872  1.00 78.34  ? 252 DT  J O2    1 
ATOM   5151  N  N3    . DT  B 1 106 ? 62.258  55.386  24.628  1.00 78.34  ? 252 DT  J N3    1 
ATOM   5152  C  C4    . DT  B 1 106 ? 62.499  55.063  23.302  1.00 78.34  ? 252 DT  J C4    1 
ATOM   5153  O  O4    . DT  B 1 106 ? 62.137  55.823  22.407  1.00 78.34  ? 252 DT  J O4    1 
ATOM   5154  C  C5    . DT  B 1 106 ? 63.187  53.813  23.090  1.00 78.34  ? 252 DT  J C5    1 
ATOM   5155  C  C7    . DT  B 1 106 ? 63.466  53.371  21.687  1.00 78.34  ? 252 DT  J C7    1 
ATOM   5156  C  C6    . DT  B 1 106 ? 63.550  53.099  24.169  1.00 78.34  ? 252 DT  J C6    1 
ATOM   5157  P  P     . DC  B 1 107 ? 63.213  49.531  29.139  1.00 85.52  ? 253 DC  J P     1 
ATOM   5158  O  OP1   . DC  B 1 107 ? 63.518  49.051  30.510  1.00 85.52  ? 253 DC  J OP1   1 
ATOM   5159  O  OP2   . DC  B 1 107 ? 62.942  48.553  28.045  1.00 85.52  ? 253 DC  J OP2   1 
ATOM   5160  O  "O5'" . DC  B 1 107 ? 61.985  50.538  29.211  1.00 109.10 ? 253 DC  J "O5'" 1 
ATOM   5161  C  "C5'" . DC  B 1 107 ? 62.007  51.657  30.094  1.00 109.10 ? 253 DC  J "C5'" 1 
ATOM   5162  C  "C4'" . DC  B 1 107 ? 60.597  52.023  30.489  1.00 109.10 ? 253 DC  J "C4'" 1 
ATOM   5163  O  "O4'" . DC  B 1 107 ? 59.994  52.808  29.435  1.00 109.10 ? 253 DC  J "O4'" 1 
ATOM   5164  C  "C3'" . DC  B 1 107 ? 59.691  50.810  30.667  1.00 109.10 ? 253 DC  J "C3'" 1 
ATOM   5165  O  "O3'" . DC  B 1 107 ? 58.723  51.095  31.672  1.00 109.10 ? 253 DC  J "O3'" 1 
ATOM   5166  C  "C2'" . DC  B 1 107 ? 59.050  50.650  29.300  1.00 109.10 ? 253 DC  J "C2'" 1 
ATOM   5167  C  "C1'" . DC  B 1 107 ? 58.945  52.081  28.804  1.00 109.10 ? 253 DC  J "C1'" 1 
ATOM   5168  N  N1    . DC  B 1 107 ? 59.141  52.209  27.356  1.00 81.34  ? 253 DC  J N1    1 
ATOM   5169  C  C2    . DC  B 1 107 ? 58.574  53.299  26.693  1.00 81.34  ? 253 DC  J C2    1 
ATOM   5170  O  O2    . DC  B 1 107 ? 57.897  54.114  27.343  1.00 81.34  ? 253 DC  J O2    1 
ATOM   5171  N  N3    . DC  B 1 107 ? 58.778  53.441  25.362  1.00 81.34  ? 253 DC  J N3    1 
ATOM   5172  C  C4    . DC  B 1 107 ? 59.511  52.543  24.701  1.00 81.34  ? 253 DC  J C4    1 
ATOM   5173  N  N4    . DC  B 1 107 ? 59.694  52.722  23.391  1.00 81.34  ? 253 DC  J N4    1 
ATOM   5174  C  C5    . DC  B 1 107 ? 60.091  51.417  25.353  1.00 81.34  ? 253 DC  J C5    1 
ATOM   5175  C  C6    . DC  B 1 107 ? 59.880  51.288  26.667  1.00 81.34  ? 253 DC  J C6    1 
ATOM   5176  P  P     . DC  B 1 108 ? 57.514  50.073  31.935  1.00 114.20 ? 254 DC  J P     1 
ATOM   5177  O  OP1   . DC  B 1 108 ? 57.893  49.157  33.038  1.00 114.20 ? 254 DC  J OP1   1 
ATOM   5178  O  OP2   . DC  B 1 108 ? 57.058  49.508  30.633  1.00 114.20 ? 254 DC  J OP2   1 
ATOM   5179  O  "O5'" . DC  B 1 108 ? 56.383  51.044  32.479  1.00 92.13  ? 254 DC  J "O5'" 1 
ATOM   5180  C  "C5'" . DC  B 1 108 ? 56.707  52.387  32.822  1.00 92.13  ? 254 DC  J "C5'" 1 
ATOM   5181  C  "C4'" . DC  B 1 108 ? 55.682  53.336  32.248  1.00 92.13  ? 254 DC  J "C4'" 1 
ATOM   5182  O  "O4'" . DC  B 1 108 ? 55.848  53.460  30.812  1.00 92.13  ? 254 DC  J "O4'" 1 
ATOM   5183  C  "C3'" . DC  B 1 108 ? 54.223  52.929  32.470  1.00 92.13  ? 254 DC  J "C3'" 1 
ATOM   5184  O  "O3'" . DC  B 1 108 ? 53.472  54.119  32.704  1.00 92.13  ? 254 DC  J "O3'" 1 
ATOM   5185  C  "C2'" . DC  B 1 108 ? 53.825  52.343  31.127  1.00 92.13  ? 254 DC  J "C2'" 1 
ATOM   5186  C  "C1'" . DC  B 1 108 ? 54.586  53.257  30.193  1.00 92.13  ? 254 DC  J "C1'" 1 
ATOM   5187  N  N1    . DC  B 1 108 ? 54.802  52.756  28.826  1.00 67.33  ? 254 DC  J N1    1 
ATOM   5188  C  C2    . DC  B 1 108 ? 54.587  53.631  27.757  1.00 67.33  ? 254 DC  J C2    1 
ATOM   5189  O  O2    . DC  B 1 108 ? 54.261  54.803  27.996  1.00 67.33  ? 254 DC  J O2    1 
ATOM   5190  N  N3    . DC  B 1 108 ? 54.747  53.189  26.498  1.00 67.33  ? 254 DC  J N3    1 
ATOM   5191  C  C4    . DC  B 1 108 ? 55.120  51.935  26.276  1.00 67.33  ? 254 DC  J C4    1 
ATOM   5192  N  N4    . DC  B 1 108 ? 55.254  51.551  25.012  1.00 67.33  ? 254 DC  J N4    1 
ATOM   5193  C  C5    . DC  B 1 108 ? 55.367  51.020  27.343  1.00 67.33  ? 254 DC  J C5    1 
ATOM   5194  C  C6    . DC  B 1 108 ? 55.195  51.468  28.592  1.00 67.33  ? 254 DC  J C6    1 
ATOM   5195  P  P     . DA  B 1 109 ? 52.018  54.045  33.381  1.00 76.17  ? 255 DA  J P     1 
ATOM   5196  O  OP1   . DA  B 1 109 ? 52.234  54.052  34.847  1.00 76.17  ? 255 DA  J OP1   1 
ATOM   5197  O  OP2   . DA  B 1 109 ? 51.200  52.964  32.764  1.00 76.17  ? 255 DA  J OP2   1 
ATOM   5198  O  "O5'" . DA  B 1 109 ? 51.384  55.447  32.959  1.00 80.39  ? 255 DA  J "O5'" 1 
ATOM   5199  C  "C5'" . DA  B 1 109 ? 52.222  56.599  32.783  1.00 80.39  ? 255 DA  J "C5'" 1 
ATOM   5200  C  "C4'" . DA  B 1 109 ? 51.656  57.528  31.732  1.00 80.39  ? 255 DA  J "C4'" 1 
ATOM   5201  O  "O4'" . DA  B 1 109 ? 51.706  56.917  30.424  1.00 80.39  ? 255 DA  J "O4'" 1 
ATOM   5202  C  "C3'" . DA  B 1 109 ? 50.199  57.916  31.951  1.00 80.39  ? 255 DA  J "C3'" 1 
ATOM   5203  O  "O3'" . DA  B 1 109 ? 49.998  59.272  31.549  1.00 80.39  ? 255 DA  J "O3'" 1 
ATOM   5204  C  "C2'" . DA  B 1 109 ? 49.437  56.937  31.076  1.00 80.39  ? 255 DA  J "C2'" 1 
ATOM   5205  C  "C1'" . DA  B 1 109 ? 50.394  56.670  29.931  1.00 80.39  ? 255 DA  J "C1'" 1 
ATOM   5206  N  N9    . DA  B 1 109 ? 50.372  55.284  29.492  1.00 75.08  ? 255 DA  J N9    1 
ATOM   5207  C  C8    . DA  B 1 109 ? 50.120  54.167  30.246  1.00 75.08  ? 255 DA  J C8    1 
ATOM   5208  N  N7    . DA  B 1 109 ? 50.267  53.045  29.589  1.00 75.08  ? 255 DA  J N7    1 
ATOM   5209  C  C5    . DA  B 1 109 ? 50.623  53.452  28.311  1.00 75.08  ? 255 DA  J C5    1 
ATOM   5210  C  C6    . DA  B 1 109 ? 50.948  52.740  27.143  1.00 75.08  ? 255 DA  J C6    1 
ATOM   5211  N  N6    . DA  B 1 109 ? 50.999  51.410  27.070  1.00 75.08  ? 255 DA  J N6    1 
ATOM   5212  N  N1    . DA  B 1 109 ? 51.240  53.456  26.037  1.00 75.08  ? 255 DA  J N1    1 
ATOM   5213  C  C2    . DA  B 1 109 ? 51.220  54.792  26.112  1.00 75.08  ? 255 DA  J C2    1 
ATOM   5214  N  N3    . DA  B 1 109 ? 50.950  55.572  27.153  1.00 75.08  ? 255 DA  J N3    1 
ATOM   5215  C  C4    . DA  B 1 109 ? 50.659  54.831  28.233  1.00 75.08  ? 255 DA  J C4    1 
ATOM   5216  P  P     . DA  B 1 110 ? 48.508  59.827  31.347  1.00 102.07 ? 256 DA  J P     1 
ATOM   5217  O  OP1   . DA  B 1 110 ? 48.572  61.295  31.556  1.00 102.07 ? 256 DA  J OP1   1 
ATOM   5218  O  OP2   . DA  B 1 110 ? 47.572  59.008  32.158  1.00 102.07 ? 256 DA  J OP2   1 
ATOM   5219  O  "O5'" . DA  B 1 110 ? 48.224  59.524  29.811  1.00 77.02  ? 256 DA  J "O5'" 1 
ATOM   5220  C  "C5'" . DA  B 1 110 ? 49.107  60.030  28.813  1.00 77.02  ? 256 DA  J "C5'" 1 
ATOM   5221  C  "C4'" . DA  B 1 110 ? 48.566  59.732  27.438  1.00 77.02  ? 256 DA  J "C4'" 1 
ATOM   5222  O  "O4'" . DA  B 1 110 ? 48.740  58.334  27.135  1.00 77.02  ? 256 DA  J "O4'" 1 
ATOM   5223  C  "C3'" . DA  B 1 110 ? 47.072  60.008  27.263  1.00 77.02  ? 256 DA  J "C3'" 1 
ATOM   5224  O  "O3'" . DA  B 1 110 ? 46.848  60.402  25.908  1.00 77.02  ? 256 DA  J "O3'" 1 
ATOM   5225  C  "C2'" . DA  B 1 110 ? 46.463  58.640  27.483  1.00 77.02  ? 256 DA  J "C2'" 1 
ATOM   5226  C  "C1'" . DA  B 1 110 ? 47.489  57.806  26.761  1.00 77.02  ? 256 DA  J "C1'" 1 
ATOM   5227  N  N9    . DA  B 1 110 ? 47.497  56.396  27.083  1.00 74.09  ? 256 DA  J N9    1 
ATOM   5228  C  C8    . DA  B 1 110 ? 47.218  55.761  28.260  1.00 74.09  ? 256 DA  J C8    1 
ATOM   5229  N  N7    . DA  B 1 110 ? 47.324  54.458  28.189  1.00 74.09  ? 256 DA  J N7    1 
ATOM   5230  C  C5    . DA  B 1 110 ? 47.701  54.229  26.874  1.00 74.09  ? 256 DA  J C5    1 
ATOM   5231  C  C6    . DA  B 1 110 ? 47.981  53.057  26.164  1.00 74.09  ? 256 DA  J C6    1 
ATOM   5232  N  N6    . DA  B 1 110 ? 47.916  51.836  26.704  1.00 74.09  ? 256 DA  J N6    1 
ATOM   5233  N  N1    . DA  B 1 110 ? 48.334  53.182  24.861  1.00 74.09  ? 256 DA  J N1    1 
ATOM   5234  C  C2    . DA  B 1 110 ? 48.397  54.413  24.327  1.00 74.09  ? 256 DA  J C2    1 
ATOM   5235  N  N3    . DA  B 1 110 ? 48.158  55.586  24.898  1.00 74.09  ? 256 DA  J N3    1 
ATOM   5236  C  C4    . DA  B 1 110 ? 47.811  55.417  26.185  1.00 74.09  ? 256 DA  J C4    1 
ATOM   5237  P  P     . DA  B 1 111 ? 45.461  61.087  25.488  1.00 55.44  ? 257 DA  J P     1 
ATOM   5238  O  OP1   . DA  B 1 111 ? 45.675  62.569  25.491  1.00 55.44  ? 257 DA  J OP1   1 
ATOM   5239  O  OP2   . DA  B 1 111 ? 44.370  60.482  26.296  1.00 55.44  ? 257 DA  J OP2   1 
ATOM   5240  O  "O5'" . DA  B 1 111 ? 45.253  60.594  23.996  1.00 45.93  ? 257 DA  J "O5'" 1 
ATOM   5241  C  "C5'" . DA  B 1 111 ? 46.361  60.516  23.116  1.00 45.93  ? 257 DA  J "C5'" 1 
ATOM   5242  C  "C4'" . DA  B 1 111 ? 46.092  59.489  22.045  1.00 45.93  ? 257 DA  J "C4'" 1 
ATOM   5243  O  "O4'" . DA  B 1 111 ? 46.323  58.139  22.519  1.00 45.93  ? 257 DA  J "O4'" 1 
ATOM   5244  C  "C3'" . DA  B 1 111 ? 44.657  59.533  21.537  1.00 45.93  ? 257 DA  J "C3'" 1 
ATOM   5245  O  "O3'" . DA  B 1 111 ? 44.649  59.502  20.125  1.00 45.93  ? 257 DA  J "O3'" 1 
ATOM   5246  C  "C2'" . DA  B 1 111 ? 44.029  58.278  22.107  1.00 45.93  ? 257 DA  J "C2'" 1 
ATOM   5247  C  "C1'" . DA  B 1 111 ? 45.203  57.326  22.238  1.00 45.93  ? 257 DA  J "C1'" 1 
ATOM   5248  N  N9    . DA  B 1 111 ? 45.054  56.389  23.351  1.00 63.46  ? 257 DA  J N9    1 
ATOM   5249  C  C8    . DA  B 1 111 ? 44.648  56.661  24.638  1.00 63.46  ? 257 DA  J C8    1 
ATOM   5250  N  N7    . DA  B 1 111 ? 44.594  55.607  25.412  1.00 63.46  ? 257 DA  J N7    1 
ATOM   5251  C  C5    . DA  B 1 111 ? 44.997  54.569  24.584  1.00 63.46  ? 257 DA  J C5    1 
ATOM   5252  C  C6    . DA  B 1 111 ? 45.148  53.196  24.805  1.00 63.46  ? 257 DA  J C6    1 
ATOM   5253  N  N6    . DA  B 1 111 ? 44.925  52.608  25.984  1.00 63.46  ? 257 DA  J N6    1 
ATOM   5254  N  N1    . DA  B 1 111 ? 45.549  52.433  23.762  1.00 63.46  ? 257 DA  J N1    1 
ATOM   5255  C  C2    . DA  B 1 111 ? 45.794  53.026  22.584  1.00 63.46  ? 257 DA  J C2    1 
ATOM   5256  N  N3    . DA  B 1 111 ? 45.701  54.310  22.256  1.00 63.46  ? 257 DA  J N3    1 
ATOM   5257  C  C4    . DA  B 1 111 ? 45.288  55.037  23.312  1.00 63.46  ? 257 DA  J C4    1 
ATOM   5258  P  P     . DT  B 1 112 ? 43.294  59.800  19.354  1.00 49.05  ? 258 DT  J P     1 
ATOM   5259  O  OP1   . DT  B 1 112 ? 43.511  60.827  18.317  1.00 49.05  ? 258 DT  J OP1   1 
ATOM   5260  O  OP2   . DT  B 1 112 ? 42.260  60.016  20.398  1.00 49.05  ? 258 DT  J OP2   1 
ATOM   5261  O  "O5'" . DT  B 1 112 ? 43.031  58.408  18.656  1.00 58.61  ? 258 DT  J "O5'" 1 
ATOM   5262  C  "C5'" . DT  B 1 112 ? 43.453  57.234  19.314  1.00 58.61  ? 258 DT  J "C5'" 1 
ATOM   5263  C  "C4'" . DT  B 1 112 ? 43.772  56.158  18.311  1.00 58.61  ? 258 DT  J "C4'" 1 
ATOM   5264  O  "O4'" . DT  B 1 112 ? 44.016  54.978  19.091  1.00 58.61  ? 258 DT  J "O4'" 1 
ATOM   5265  C  "C3'" . DT  B 1 112 ? 42.574  55.821  17.437  1.00 58.61  ? 258 DT  J "C3'" 1 
ATOM   5266  O  "O3'" . DT  B 1 112 ? 43.004  55.179  16.228  1.00 58.61  ? 258 DT  J "O3'" 1 
ATOM   5267  C  "C2'" . DT  B 1 112 ? 41.773  54.908  18.336  1.00 58.61  ? 258 DT  J "C2'" 1 
ATOM   5268  C  "C1'" . DT  B 1 112 ? 42.831  54.219  19.184  1.00 58.61  ? 258 DT  J "C1'" 1 
ATOM   5269  N  N1    . DT  B 1 112 ? 42.477  54.179  20.592  1.00 53.19  ? 258 DT  J N1    1 
ATOM   5270  C  C2    . DT  B 1 112 ? 42.628  52.988  21.247  1.00 53.19  ? 258 DT  J C2    1 
ATOM   5271  O  O2    . DT  B 1 112 ? 43.027  51.976  20.702  1.00 53.19  ? 258 DT  J O2    1 
ATOM   5272  N  N3    . DT  B 1 112 ? 42.302  53.019  22.569  1.00 53.19  ? 258 DT  J N3    1 
ATOM   5273  C  C4    . DT  B 1 112 ? 41.872  54.109  23.296  1.00 53.19  ? 258 DT  J C4    1 
ATOM   5274  O  O4    . DT  B 1 112 ? 41.658  53.983  24.496  1.00 53.19  ? 258 DT  J O4    1 
ATOM   5275  C  C5    . DT  B 1 112 ? 41.721  55.341  22.537  1.00 53.19  ? 258 DT  J C5    1 
ATOM   5276  C  C7    . DT  B 1 112 ? 41.247  56.578  23.233  1.00 53.19  ? 258 DT  J C7    1 
ATOM   5277  C  C6    . DT  B 1 112 ? 42.021  55.308  21.235  1.00 53.19  ? 258 DT  J C6    1 
ATOM   5278  P  P     . DA  B 1 113 ? 41.954  54.921  15.032  1.00 119.77 ? 259 DA  J P     1 
ATOM   5279  O  OP1   . DA  B 1 113 ? 42.730  54.661  13.786  1.00 119.77 ? 259 DA  J OP1   1 
ATOM   5280  O  OP2   . DA  B 1 113 ? 40.936  56.005  15.054  1.00 119.77 ? 259 DA  J OP2   1 
ATOM   5281  O  "O5'" . DA  B 1 113 ? 41.249  53.551  15.437  1.00 110.54 ? 259 DA  J "O5'" 1 
ATOM   5282  C  "C5'" . DA  B 1 113 ? 41.949  52.312  15.326  1.00 110.54 ? 259 DA  J "C5'" 1 
ATOM   5283  C  "C4'" . DA  B 1 113 ? 41.051  51.166  15.728  1.00 110.54 ? 259 DA  J "C4'" 1 
ATOM   5284  O  "O4'" . DA  B 1 113 ? 40.834  51.184  17.159  1.00 110.54 ? 259 DA  J "O4'" 1 
ATOM   5285  C  "C3'" . DA  B 1 113 ? 39.661  51.183  15.090  1.00 110.54 ? 259 DA  J "C3'" 1 
ATOM   5286  O  "O3'" . DA  B 1 113 ? 39.274  49.849  14.749  1.00 110.54 ? 259 DA  J "O3'" 1 
ATOM   5287  C  "C2'" . DA  B 1 113 ? 38.775  51.725  16.198  1.00 110.54 ? 259 DA  J "C2'" 1 
ATOM   5288  C  "C1'" . DA  B 1 113 ? 39.443  51.149  17.430  1.00 110.54 ? 259 DA  J "C1'" 1 
ATOM   5289  N  N9    . DA  B 1 113 ? 39.203  51.887  18.670  1.00 116.92 ? 259 DA  J N9    1 
ATOM   5290  C  C8    . DA  B 1 113 ? 38.977  53.233  18.834  1.00 116.92 ? 259 DA  J C8    1 
ATOM   5291  N  N7    . DA  B 1 113 ? 38.790  53.590  20.083  1.00 116.92 ? 259 DA  J N7    1 
ATOM   5292  C  C5    . DA  B 1 113 ? 38.899  52.398  20.789  1.00 116.92 ? 259 DA  J C5    1 
ATOM   5293  C  C6    . DA  B 1 113 ? 38.791  52.095  22.158  1.00 116.92 ? 259 DA  J C6    1 
ATOM   5294  N  N6    . DA  B 1 113 ? 38.536  53.004  23.100  1.00 116.92 ? 259 DA  J N6    1 
ATOM   5295  N  N1    . DA  B 1 113 ? 38.954  50.804  22.531  1.00 116.92 ? 259 DA  J N1    1 
ATOM   5296  C  C2    . DA  B 1 113 ? 39.200  49.892  21.587  1.00 116.92 ? 259 DA  J C2    1 
ATOM   5297  N  N3    . DA  B 1 113 ? 39.318  50.051  20.272  1.00 116.92 ? 259 DA  J N3    1 
ATOM   5298  C  C4    . DA  B 1 113 ? 39.155  51.343  19.933  1.00 116.92 ? 259 DA  J C4    1 
ATOM   5299  P  P     . DC  B 1 114 ? 37.956  49.595  13.864  1.00 123.13 ? 260 DC  J P     1 
ATOM   5300  O  OP1   . DC  B 1 114 ? 38.383  48.912  12.614  1.00 123.13 ? 260 DC  J OP1   1 
ATOM   5301  O  OP2   . DC  B 1 114 ? 37.158  50.850  13.784  1.00 123.13 ? 260 DC  J OP2   1 
ATOM   5302  O  "O5'" . DC  B 1 114 ? 37.148  48.550  14.746  1.00 102.32 ? 260 DC  J "O5'" 1 
ATOM   5303  C  "C5'" . DC  B 1 114 ? 37.800  47.820  15.783  1.00 102.32 ? 260 DC  J "C5'" 1 
ATOM   5304  C  "C4'" . DC  B 1 114 ? 36.773  47.179  16.683  1.00 102.32 ? 260 DC  J "C4'" 1 
ATOM   5305  O  "O4'" . DC  B 1 114 ? 36.763  47.869  17.959  1.00 102.32 ? 260 DC  J "O4'" 1 
ATOM   5306  C  "C3'" . DC  B 1 114 ? 35.350  47.282  16.131  1.00 102.32 ? 260 DC  J "C3'" 1 
ATOM   5307  O  "O3'" . DC  B 1 114 ? 34.618  46.076  16.383  1.00 102.32 ? 260 DC  J "O3'" 1 
ATOM   5308  C  "C2'" . DC  B 1 114 ? 34.767  48.461  16.886  1.00 102.32 ? 260 DC  J "C2'" 1 
ATOM   5309  C  "C1'" . DC  B 1 114 ? 35.457  48.351  18.235  1.00 102.32 ? 260 DC  J "C1'" 1 
ATOM   5310  N  N1    . DC  B 1 114 ? 35.569  49.629  18.962  1.00 103.69 ? 260 DC  J N1    1 
ATOM   5311  C  C2    . DC  B 1 114 ? 35.549  49.619  20.365  1.00 103.69 ? 260 DC  J C2    1 
ATOM   5312  O  O2    . DC  B 1 114 ? 35.496  48.533  20.955  1.00 103.69 ? 260 DC  J O2    1 
ATOM   5313  N  N3    . DC  B 1 114 ? 35.591  50.796  21.038  1.00 103.69 ? 260 DC  J N3    1 
ATOM   5314  C  C4    . DC  B 1 114 ? 35.673  51.948  20.364  1.00 103.69 ? 260 DC  J C4    1 
ATOM   5315  N  N4    . DC  B 1 114 ? 35.704  53.088  21.066  1.00 103.69 ? 260 DC  J N4    1 
ATOM   5316  C  C5    . DC  B 1 114 ? 35.723  51.985  18.938  1.00 103.69 ? 260 DC  J C5    1 
ATOM   5317  C  C6    . DC  B 1 114 ? 35.671  50.814  18.284  1.00 103.69 ? 260 DC  J C6    1 
ATOM   5318  P  P     . DA  B 1 115 ? 33.093  45.947  15.882  1.00 122.34 ? 261 DA  J P     1 
ATOM   5319  O  OP1   . DA  B 1 115 ? 32.892  44.562  15.398  1.00 122.34 ? 261 DA  J OP1   1 
ATOM   5320  O  OP2   . DA  B 1 115 ? 32.781  47.089  14.981  1.00 122.34 ? 261 DA  J OP2   1 
ATOM   5321  O  "O5'" . DA  B 1 115 ? 32.246  46.124  17.219  1.00 124.59 ? 261 DA  J "O5'" 1 
ATOM   5322  C  "C5'" . DA  B 1 115 ? 32.494  45.299  18.359  1.00 124.59 ? 261 DA  J "C5'" 1 
ATOM   5323  C  "C4'" . DA  B 1 115 ? 31.456  45.558  19.426  1.00 124.59 ? 261 DA  J "C4'" 1 
ATOM   5324  O  "O4'" . DA  B 1 115 ? 31.682  46.845  20.050  1.00 124.59 ? 261 DA  J "O4'" 1 
ATOM   5325  C  "C3'" . DA  B 1 115 ? 30.027  45.593  18.890  1.00 124.59 ? 261 DA  J "C3'" 1 
ATOM   5326  O  "O3'" . DA  B 1 115 ? 29.138  44.977  19.821  1.00 124.59 ? 261 DA  J "O3'" 1 
ATOM   5327  C  "C2'" . DA  B 1 115 ? 29.730  47.079  18.771  1.00 124.59 ? 261 DA  J "C2'" 1 
ATOM   5328  C  "C1'" . DA  B 1 115 ? 30.521  47.662  19.931  1.00 124.59 ? 261 DA  J "C1'" 1 
ATOM   5329  N  N9    . DA  B 1 115 ? 30.956  49.053  19.746  1.00 123.90 ? 261 DA  J N9    1 
ATOM   5330  C  C8    . DA  B 1 115 ? 31.046  49.757  18.567  1.00 123.90 ? 261 DA  J C8    1 
ATOM   5331  N  N7    . DA  B 1 115 ? 31.485  50.985  18.715  1.00 123.90 ? 261 DA  J N7    1 
ATOM   5332  C  C5    . DA  B 1 115 ? 31.694  51.103  20.082  1.00 123.90 ? 261 DA  J C5    1 
ATOM   5333  C  C6    . DA  B 1 115 ? 32.158  52.170  20.886  1.00 123.90 ? 261 DA  J C6    1 
ATOM   5334  N  N6    . DA  B 1 115 ? 32.515  53.368  20.408  1.00 123.90 ? 261 DA  J N6    1 
ATOM   5335  N  N1    . DA  B 1 115 ? 32.244  51.958  22.219  1.00 123.90 ? 261 DA  J N1    1 
ATOM   5336  C  C2    . DA  B 1 115 ? 31.886  50.762  22.703  1.00 123.90 ? 261 DA  J C2    1 
ATOM   5337  N  N3    . DA  B 1 115 ? 31.437  49.688  22.054  1.00 123.90 ? 261 DA  J N3    1 
ATOM   5338  C  C4    . DA  B 1 115 ? 31.365  49.924  20.731  1.00 123.90 ? 261 DA  J C4    1 
ATOM   5339  P  P     . DC  B 1 116 ? 27.902  44.104  19.281  1.00 157.91 ? 262 DC  J P     1 
ATOM   5340  O  OP1   . DC  B 1 116 ? 28.242  42.667  19.440  1.00 157.91 ? 262 DC  J OP1   1 
ATOM   5341  O  OP2   . DC  B 1 116 ? 27.514  44.625  17.942  1.00 157.91 ? 262 DC  J OP2   1 
ATOM   5342  O  "O5'" . DC  B 1 116 ? 26.734  44.462  20.298  1.00 106.91 ? 262 DC  J "O5'" 1 
ATOM   5343  C  "C5'" . DC  B 1 116 ? 26.358  45.819  20.507  1.00 106.91 ? 262 DC  J "C5'" 1 
ATOM   5344  C  "C4'" . DC  B 1 116 ? 26.264  46.117  21.985  1.00 106.91 ? 262 DC  J "C4'" 1 
ATOM   5345  O  "O4'" . DC  B 1 116 ? 27.243  47.136  22.316  1.00 106.91 ? 262 DC  J "O4'" 1 
ATOM   5346  C  "C3'" . DC  B 1 116 ? 24.904  46.683  22.385  1.00 106.91 ? 262 DC  J "C3'" 1 
ATOM   5347  O  "O3'" . DC  B 1 116 ? 24.494  46.207  23.669  1.00 106.91 ? 262 DC  J "O3'" 1 
ATOM   5348  C  "C2'" . DC  B 1 116 ? 25.130  48.182  22.397  1.00 106.91 ? 262 DC  J "C2'" 1 
ATOM   5349  C  "C1'" . DC  B 1 116 ? 26.599  48.320  22.771  1.00 106.91 ? 262 DC  J "C1'" 1 
ATOM   5350  N  N1    . DC  B 1 116 ? 27.237  49.475  22.110  1.00 131.93 ? 262 DC  J N1    1 
ATOM   5351  C  C2    . DC  B 1 116 ? 27.926  50.416  22.887  1.00 131.93 ? 262 DC  J C2    1 
ATOM   5352  O  O2    . DC  B 1 116 ? 28.026  50.231  24.108  1.00 131.93 ? 262 DC  J O2    1 
ATOM   5353  N  N3    . DC  B 1 116 ? 28.461  51.503  22.284  1.00 131.93 ? 262 DC  J N3    1 
ATOM   5354  C  C4    . DC  B 1 116 ? 28.332  51.667  20.965  1.00 131.93 ? 262 DC  J C4    1 
ATOM   5355  N  N4    . DC  B 1 116 ? 28.846  52.771  20.416  1.00 131.93 ? 262 DC  J N4    1 
ATOM   5356  C  C5    . DC  B 1 116 ? 27.664  50.712  20.149  1.00 131.93 ? 262 DC  J C5    1 
ATOM   5357  C  C6    . DC  B 1 116 ? 27.139  49.640  20.756  1.00 131.93 ? 262 DC  J C6    1 
ATOM   5358  P  P     . DT  B 1 117 ? 23.082  46.685  24.273  1.00 109.70 ? 263 DT  J P     1 
ATOM   5359  O  OP1   . DT  B 1 117 ? 22.660  45.757  25.360  1.00 109.70 ? 263 DT  J OP1   1 
ATOM   5360  O  OP2   . DT  B 1 117 ? 22.165  46.961  23.133  1.00 109.70 ? 263 DT  J OP2   1 
ATOM   5361  O  "O5'" . DT  B 1 117 ? 23.431  48.085  24.936  1.00 104.51 ? 263 DT  J "O5'" 1 
ATOM   5362  C  "C5'" . DT  B 1 117 ? 24.277  48.158  26.078  1.00 104.51 ? 263 DT  J "C5'" 1 
ATOM   5363  C  "C4'" . DT  B 1 117 ? 24.020  49.447  26.817  1.00 104.51 ? 263 DT  J "C4'" 1 
ATOM   5364  O  "O4'" . DT  B 1 117 ? 24.651  50.566  26.147  1.00 104.51 ? 263 DT  J "O4'" 1 
ATOM   5365  C  "C3'" . DT  B 1 117 ? 22.536  49.779  26.892  1.00 104.51 ? 263 DT  J "C3'" 1 
ATOM   5366  O  "O3'" . DT  B 1 117 ? 22.242  50.278  28.187  1.00 104.51 ? 263 DT  J "O3'" 1 
ATOM   5367  C  "C2'" . DT  B 1 117 ? 22.337  50.813  25.792  1.00 104.51 ? 263 DT  J "C2'" 1 
ATOM   5368  C  "C1'" . DT  B 1 117 ? 23.681  51.525  25.738  1.00 104.51 ? 263 DT  J "C1'" 1 
ATOM   5369  N  N1    . DT  B 1 117 ? 24.086  52.030  24.397  1.00 92.57  ? 263 DT  J N1    1 
ATOM   5370  C  C2    . DT  B 1 117 ? 24.580  53.321  24.292  1.00 92.57  ? 263 DT  J C2    1 
ATOM   5371  O  O2    . DT  B 1 117 ? 24.664  54.095  25.235  1.00 92.57  ? 263 DT  J O2    1 
ATOM   5372  N  N3    . DT  B 1 117 ? 24.974  53.678  23.024  1.00 92.57  ? 263 DT  J N3    1 
ATOM   5373  C  C4    . DT  B 1 117 ? 24.929  52.905  21.883  1.00 92.57  ? 263 DT  J C4    1 
ATOM   5374  O  O4    . DT  B 1 117 ? 25.363  53.358  20.830  1.00 92.57  ? 263 DT  J O4    1 
ATOM   5375  C  C5    . DT  B 1 117 ? 24.366  51.585  22.052  1.00 92.57  ? 263 DT  J C5    1 
ATOM   5376  C  C7    . DT  B 1 117 ? 24.227  50.696  20.856  1.00 92.57  ? 263 DT  J C7    1 
ATOM   5377  C  C6    . DT  B 1 117 ? 23.984  51.216  23.285  1.00 92.57  ? 263 DT  J C6    1 
ATOM   5378  P  P     . DT  B 1 118 ? 20.935  51.160  28.409  1.00 110.00 ? 264 DT  J P     1 
ATOM   5379  O  OP1   . DT  B 1 118 ? 20.635  51.161  29.867  1.00 110.00 ? 264 DT  J OP1   1 
ATOM   5380  O  OP2   . DT  B 1 118 ? 19.914  50.686  27.439  1.00 110.00 ? 264 DT  J OP2   1 
ATOM   5381  O  "O5'" . DT  B 1 118 ? 21.421  52.612  27.976  1.00 110.10 ? 264 DT  J "O5'" 1 
ATOM   5382  C  "C5'" . DT  B 1 118 ? 22.552  53.214  28.609  1.00 110.10 ? 264 DT  J "C5'" 1 
ATOM   5383  C  "C4'" . DT  B 1 118 ? 22.559  54.705  28.365  1.00 110.10 ? 264 DT  J "C4'" 1 
ATOM   5384  O  "O4'" . DT  B 1 118 ? 22.973  55.003  27.012  1.00 110.10 ? 264 DT  J "O4'" 1 
ATOM   5385  C  "C3'" . DT  B 1 118 ? 21.198  55.371  28.546  1.00 110.10 ? 264 DT  J "C3'" 1 
ATOM   5386  O  "O3'" . DT  B 1 118 ? 21.380  56.649  29.127  1.00 110.10 ? 264 DT  J "O3'" 1 
ATOM   5387  C  "C2'" . DT  B 1 118 ? 20.693  55.530  27.125  1.00 110.10 ? 264 DT  J "C2'" 1 
ATOM   5388  C  "C1'" . DT  B 1 118 ? 21.978  55.779  26.361  1.00 110.10 ? 264 DT  J "C1'" 1 
ATOM   5389  N  N1    . DT  B 1 118 ? 21.926  55.355  24.951  1.00 74.83  ? 264 DT  J N1    1 
ATOM   5390  C  C2    . DT  B 1 118 ? 22.336  56.247  23.986  1.00 74.83  ? 264 DT  J C2    1 
ATOM   5391  O  O2    . DT  B 1 118 ? 22.777  57.361  24.242  1.00 74.83  ? 264 DT  J O2    1 
ATOM   5392  N  N3    . DT  B 1 118 ? 22.224  55.787  22.702  1.00 74.83  ? 264 DT  J N3    1 
ATOM   5393  C  C4    . DT  B 1 118 ? 21.781  54.547  22.291  1.00 74.83  ? 264 DT  J C4    1 
ATOM   5394  O  O4    . DT  B 1 118 ? 21.747  54.280  21.098  1.00 74.83  ? 264 DT  J O4    1 
ATOM   5395  C  C5    . DT  B 1 118 ? 21.388  53.650  23.357  1.00 74.83  ? 264 DT  J C5    1 
ATOM   5396  C  C7    . DT  B 1 118 ? 20.913  52.273  23.015  1.00 74.83  ? 264 DT  J C7    1 
ATOM   5397  C  C6    . DT  B 1 118 ? 21.471  54.096  24.615  1.00 74.83  ? 264 DT  J C6    1 
ATOM   5398  P  P     . DT  B 1 119 ? 20.209  57.301  30.005  1.00 106.78 ? 265 DT  J P     1 
ATOM   5399  O  OP1   . DT  B 1 119 ? 20.247  56.690  31.360  1.00 106.78 ? 265 DT  J OP1   1 
ATOM   5400  O  OP2   . DT  B 1 119 ? 18.948  57.269  29.211  1.00 106.78 ? 265 DT  J OP2   1 
ATOM   5401  O  "O5'" . DT  B 1 119 ? 20.685  58.813  30.111  1.00 95.80  ? 265 DT  J "O5'" 1 
ATOM   5402  C  "C5'" . DT  B 1 119 ? 22.063  59.145  29.935  1.00 95.80  ? 265 DT  J "C5'" 1 
ATOM   5403  C  "C4'" . DT  B 1 119 ? 22.219  60.277  28.945  1.00 95.80  ? 265 DT  J "C4'" 1 
ATOM   5404  O  "O4'" . DT  B 1 119 ? 22.088  59.825  27.573  1.00 95.80  ? 265 DT  J "O4'" 1 
ATOM   5405  C  "C3'" . DT  B 1 119 ? 21.230  61.430  29.114  1.00 95.80  ? 265 DT  J "C3'" 1 
ATOM   5406  O  "O3'" . DT  B 1 119 ? 21.951  62.660  29.137  1.00 95.80  ? 265 DT  J "O3'" 1 
ATOM   5407  C  "C2'" . DT  B 1 119 ? 20.337  61.327  27.885  1.00 95.80  ? 265 DT  J "C2'" 1 
ATOM   5408  C  "C1'" . DT  B 1 119 ? 21.287  60.750  26.859  1.00 95.80  ? 265 DT  J "C1'" 1 
ATOM   5409  N  N1    . DT  B 1 119 ? 20.669  60.045  25.716  1.00 106.48 ? 265 DT  J N1    1 
ATOM   5410  C  C2    . DT  B 1 119 ? 20.661  60.683  24.494  1.00 106.48 ? 265 DT  J C2    1 
ATOM   5411  O  O2    . DT  B 1 119 ? 21.089  61.808  24.330  1.00 106.48 ? 265 DT  J O2    1 
ATOM   5412  N  N3    . DT  B 1 119 ? 20.126  59.953  23.464  1.00 106.48 ? 265 DT  J N3    1 
ATOM   5413  C  C4    . DT  B 1 119 ? 19.593  58.686  23.530  1.00 106.48 ? 265 DT  J C4    1 
ATOM   5414  O  O4    . DT  B 1 119 ? 19.170  58.152  22.507  1.00 106.48 ? 265 DT  J O4    1 
ATOM   5415  C  C5    . DT  B 1 119 ? 19.597  58.083  24.852  1.00 106.48 ? 265 DT  J C5    1 
ATOM   5416  C  C7    . DT  B 1 119 ? 19.006  56.719  25.034  1.00 106.48 ? 265 DT  J C7    1 
ATOM   5417  C  C6    . DT  B 1 119 ? 20.134  58.785  25.863  1.00 106.48 ? 265 DT  J C6    1 
ATOM   5418  P  P     . DT  B 1 120 ? 21.183  64.036  28.856  1.00 67.86  ? 266 DT  J P     1 
ATOM   5419  O  OP1   . DT  B 1 120 ? 22.006  65.143  29.428  1.00 67.86  ? 266 DT  J OP1   1 
ATOM   5420  O  OP2   . DT  B 1 120 ? 19.761  63.871  29.264  1.00 67.86  ? 266 DT  J OP2   1 
ATOM   5421  O  "O5'" . DT  B 1 120 ? 21.224  64.137  27.273  1.00 63.87  ? 266 DT  J "O5'" 1 
ATOM   5422  C  "C5'" . DT  B 1 120 ? 22.471  64.170  26.589  1.00 63.87  ? 266 DT  J "C5'" 1 
ATOM   5423  C  "C4'" . DT  B 1 120 ? 22.352  65.055  25.377  1.00 63.87  ? 266 DT  J "C4'" 1 
ATOM   5424  O  "O4'" . DT  B 1 120 ? 21.437  64.448  24.435  1.00 63.87  ? 266 DT  J "O4'" 1 
ATOM   5425  C  "C3'" . DT  B 1 120 ? 21.762  66.422  25.701  1.00 63.87  ? 266 DT  J "C3'" 1 
ATOM   5426  O  "O3'" . DT  B 1 120 ? 22.284  67.359  24.783  1.00 63.87  ? 266 DT  J "O3'" 1 
ATOM   5427  C  "C2'" . DT  B 1 120 ? 20.292  66.239  25.395  1.00 63.87  ? 266 DT  J "C2'" 1 
ATOM   5428  C  "C1'" . DT  B 1 120 ? 20.356  65.328  24.186  1.00 63.87  ? 266 DT  J "C1'" 1 
ATOM   5429  N  N1    . DT  B 1 120 ? 19.140  64.522  23.981  1.00 101.50 ? 266 DT  J N1    1 
ATOM   5430  C  C2    . DT  B 1 120 ? 19.029  63.741  22.847  1.00 101.50 ? 266 DT  J C2    1 
ATOM   5431  O  O2    . DT  B 1 120 ? 19.902  63.651  22.003  1.00 101.50 ? 266 DT  J O2    1 
ATOM   5432  N  N3    . DT  B 1 120 ? 17.845  63.063  22.739  1.00 101.50 ? 266 DT  J N3    1 
ATOM   5433  C  C4    . DT  B 1 120 ? 16.786  63.084  23.629  1.00 101.50 ? 266 DT  J C4    1 
ATOM   5434  O  O4    . DT  B 1 120 ? 15.780  62.430  23.389  1.00 101.50 ? 266 DT  J O4    1 
ATOM   5435  C  C5    . DT  B 1 120 ? 16.977  63.913  24.803  1.00 101.50 ? 266 DT  J C5    1 
ATOM   5436  C  C7    . DT  B 1 120 ? 15.891  63.999  25.830  1.00 101.50 ? 266 DT  J C7    1 
ATOM   5437  C  C6    . DT  B 1 120 ? 18.129  64.576  24.916  1.00 101.50 ? 266 DT  J C6    1 
ATOM   5438  P  P     . DG  B 1 121 ? 22.216  68.918  25.114  1.00 70.98  ? 267 DG  J P     1 
ATOM   5439  O  OP1   . DG  B 1 121 ? 23.492  69.255  25.811  1.00 70.98  ? 267 DG  J OP1   1 
ATOM   5440  O  OP2   . DG  B 1 121 ? 20.905  69.223  25.751  1.00 70.98  ? 267 DG  J OP2   1 
ATOM   5441  O  "O5'" . DG  B 1 121 ? 22.227  69.574  23.669  1.00 56.67  ? 267 DG  J "O5'" 1 
ATOM   5442  C  "C5'" . DG  B 1 121 ? 23.064  69.036  22.654  1.00 56.67  ? 267 DG  J "C5'" 1 
ATOM   5443  C  "C4'" . DG  B 1 121 ? 22.330  68.999  21.334  1.00 56.67  ? 267 DG  J "C4'" 1 
ATOM   5444  O  "O4'" . DG  B 1 121 ? 21.183  68.123  21.418  1.00 56.67  ? 267 DG  J "O4'" 1 
ATOM   5445  C  "C3'" . DG  B 1 121 ? 21.798  70.342  20.836  1.00 56.67  ? 267 DG  J "C3'" 1 
ATOM   5446  O  "O3'" . DG  B 1 121 ? 21.983  70.401  19.423  1.00 56.67  ? 267 DG  J "O3'" 1 
ATOM   5447  C  "C2'" . DG  B 1 121 ? 20.320  70.276  21.161  1.00 56.67  ? 267 DG  J "C2'" 1 
ATOM   5448  C  "C1'" . DG  B 1 121 ? 20.028  68.804  20.964  1.00 56.67  ? 267 DG  J "C1'" 1 
ATOM   5449  N  N9    . DG  B 1 121 ? 18.891  68.305  21.728  1.00 61.99  ? 267 DG  J N9    1 
ATOM   5450  C  C8    . DG  B 1 121 ? 18.442  68.758  22.948  1.00 61.99  ? 267 DG  J C8    1 
ATOM   5451  N  N7    . DG  B 1 121 ? 17.403  68.104  23.384  1.00 61.99  ? 267 DG  J N7    1 
ATOM   5452  C  C5    . DG  B 1 121 ? 17.153  67.163  22.394  1.00 61.99  ? 267 DG  J C5    1 
ATOM   5453  C  C6    . DG  B 1 121 ? 16.152  66.163  22.310  1.00 61.99  ? 267 DG  J C6    1 
ATOM   5454  O  O6    . DG  B 1 121 ? 15.256  65.904  23.129  1.00 61.99  ? 267 DG  J O6    1 
ATOM   5455  N  N1    . DG  B 1 121 ? 16.263  65.424  21.128  1.00 61.99  ? 267 DG  J N1    1 
ATOM   5456  C  C2    . DG  B 1 121 ? 17.218  65.624  20.164  1.00 61.99  ? 267 DG  J C2    1 
ATOM   5457  N  N2    . DG  B 1 121 ? 17.165  64.808  19.116  1.00 61.99  ? 267 DG  J N2    1 
ATOM   5458  N  N3    . DG  B 1 121 ? 18.152  66.552  20.230  1.00 61.99  ? 267 DG  J N3    1 
ATOM   5459  C  C4    . DG  B 1 121 ? 18.062  67.280  21.364  1.00 61.99  ? 267 DG  J C4    1 
ATOM   5460  P  P     . DG  B 1 122 ? 21.789  71.792  18.646  1.00 42.33  ? 268 DG  J P     1 
ATOM   5461  O  OP1   . DG  B 1 122 ? 23.080  72.167  18.013  1.00 42.33  ? 268 DG  J OP1   1 
ATOM   5462  O  OP2   . DG  B 1 122 ? 21.126  72.738  19.582  1.00 42.33  ? 268 DG  J OP2   1 
ATOM   5463  O  "O5'" . DG  B 1 122 ? 20.771  71.402  17.485  1.00 47.23  ? 268 DG  J "O5'" 1 
ATOM   5464  C  "C5'" . DG  B 1 122 ? 21.143  70.447  16.486  1.00 47.23  ? 268 DG  J "C5'" 1 
ATOM   5465  C  "C4'" . DG  B 1 122 ? 19.939  70.035  15.672  1.00 47.23  ? 268 DG  J "C4'" 1 
ATOM   5466  O  "O4'" . DG  B 1 122 ? 19.063  69.252  16.517  1.00 47.23  ? 268 DG  J "O4'" 1 
ATOM   5467  C  "C3'" . DG  B 1 122 ? 19.106  71.205  15.150  1.00 47.23  ? 268 DG  J "C3'" 1 
ATOM   5468  O  "O3'" . DG  B 1 122 ? 18.724  71.021  13.789  1.00 47.23  ? 268 DG  J "O3'" 1 
ATOM   5469  C  "C2'" . DG  B 1 122 ? 17.898  71.246  16.070  1.00 47.23  ? 268 DG  J "C2'" 1 
ATOM   5470  C  "C1'" . DG  B 1 122 ? 17.771  69.820  16.566  1.00 47.23  ? 268 DG  J "C1'" 1 
ATOM   5471  N  N9    . DG  B 1 122 ? 17.314  69.747  17.945  1.00 92.18  ? 268 DG  J N9    1 
ATOM   5472  C  C8    . DG  B 1 122 ? 17.806  70.429  19.030  1.00 92.18  ? 268 DG  J C8    1 
ATOM   5473  N  N7    . DG  B 1 122 ? 17.141  70.188  20.125  1.00 92.18  ? 268 DG  J N7    1 
ATOM   5474  C  C5    . DG  B 1 122 ? 16.165  69.285  19.735  1.00 92.18  ? 268 DG  J C5    1 
ATOM   5475  C  C6    . DG  B 1 122 ? 15.130  68.673  20.479  1.00 92.18  ? 268 DG  J C6    1 
ATOM   5476  O  O6    . DG  B 1 122 ? 14.854  68.814  21.687  1.00 92.18  ? 268 DG  J O6    1 
ATOM   5477  N  N1    . DG  B 1 122 ? 14.363  67.827  19.677  1.00 92.18  ? 268 DG  J N1    1 
ATOM   5478  C  C2    . DG  B 1 122 ? 14.581  67.595  18.339  1.00 92.18  ? 268 DG  J C2    1 
ATOM   5479  N  N2    . DG  B 1 122 ? 13.761  66.739  17.728  1.00 92.18  ? 268 DG  J N2    1 
ATOM   5480  N  N3    . DG  B 1 122 ? 15.535  68.165  17.644  1.00 92.18  ? 268 DG  J N3    1 
ATOM   5481  C  C4    . DG  B 1 122 ? 16.278  68.994  18.396  1.00 92.18  ? 268 DG  J C4    1 
ATOM   5482  P  P     . DT  B 1 123 ? 17.673  72.037  13.120  1.00 65.24  ? 269 DT  J P     1 
ATOM   5483  O  OP1   . DT  B 1 123 ? 17.927  72.091  11.654  1.00 65.24  ? 269 DT  J OP1   1 
ATOM   5484  O  OP2   . DT  B 1 123 ? 17.622  73.304  13.905  1.00 65.24  ? 269 DT  J OP2   1 
ATOM   5485  O  "O5'" . DT  B 1 123 ? 16.285  71.307  13.385  1.00 82.97  ? 269 DT  J "O5'" 1 
ATOM   5486  C  "C5'" . DT  B 1 123 ? 16.025  70.009  12.853  1.00 82.97  ? 269 DT  J "C5'" 1 
ATOM   5487  C  "C4'" . DT  B 1 123 ? 14.537  69.780  12.810  1.00 82.97  ? 269 DT  J "C4'" 1 
ATOM   5488  O  "O4'" . DT  B 1 123 ? 14.059  69.534  14.155  1.00 82.97  ? 269 DT  J "O4'" 1 
ATOM   5489  C  "C3'" . DT  B 1 123 ? 13.790  71.018  12.306  1.00 82.97  ? 269 DT  J "C3'" 1 
ATOM   5490  O  "O3'" . DT  B 1 123 ? 12.635  70.626  11.568  1.00 82.97  ? 269 DT  J "O3'" 1 
ATOM   5491  C  "C2'" . DT  B 1 123 ? 13.353  71.695  13.592  1.00 82.97  ? 269 DT  J "C2'" 1 
ATOM   5492  C  "C1'" . DT  B 1 123 ? 13.065  70.494  14.480  1.00 82.97  ? 269 DT  J "C1'" 1 
ATOM   5493  N  N1    . DT  B 1 123 ? 13.098  70.744  15.946  1.00 81.21  ? 269 DT  J N1    1 
ATOM   5494  C  C2    . DT  B 1 123 ? 12.552  69.785  16.784  1.00 81.21  ? 269 DT  J C2    1 
ATOM   5495  O  O2    . DT  B 1 123 ? 12.114  68.717  16.384  1.00 81.21  ? 269 DT  J O2    1 
ATOM   5496  N  N3    . DT  B 1 123 ? 12.549  70.117  18.116  1.00 81.21  ? 269 DT  J N3    1 
ATOM   5497  C  C4    . DT  B 1 123 ? 13.056  71.262  18.692  1.00 81.21  ? 269 DT  J C4    1 
ATOM   5498  O  O4    . DT  B 1 123 ? 12.989  71.409  19.910  1.00 81.21  ? 269 DT  J O4    1 
ATOM   5499  C  C5    . DT  B 1 123 ? 13.642  72.213  17.763  1.00 81.21  ? 269 DT  J C5    1 
ATOM   5500  C  C7    . DT  B 1 123 ? 14.228  73.482  18.294  1.00 81.21  ? 269 DT  J C7    1 
ATOM   5501  C  C6    . DT  B 1 123 ? 13.633  71.910  16.456  1.00 81.21  ? 269 DT  J C6    1 
ATOM   5502  P  P     . DA  B 1 124 ? 12.550  70.892  9.981   1.00 111.66 ? 270 DA  J P     1 
ATOM   5503  O  OP1   . DA  B 1 124 ? 13.517  69.997  9.282   1.00 111.66 ? 270 DA  J OP1   1 
ATOM   5504  O  OP2   . DA  B 1 124 ? 12.586  72.357  9.729   1.00 111.66 ? 270 DA  J OP2   1 
ATOM   5505  O  "O5'" . DA  B 1 124 ? 11.081  70.381  9.649   1.00 188.00 ? 270 DA  J "O5'" 1 
ATOM   5506  C  "C5'" . DA  B 1 124 ? 10.652  69.091  10.085  1.00 188.00 ? 270 DA  J "C5'" 1 
ATOM   5507  C  "C4'" . DA  B 1 124 ? 9.410   69.193  10.946  1.00 188.00 ? 270 DA  J "C4'" 1 
ATOM   5508  O  "O4'" . DA  B 1 124 ? 9.721   69.516  12.331  1.00 188.00 ? 270 DA  J "O4'" 1 
ATOM   5509  C  "C3'" . DA  B 1 124 ? 8.351   70.208  10.491  1.00 188.00 ? 270 DA  J "C3'" 1 
ATOM   5510  O  "O3'" . DA  B 1 124 ? 7.049   69.600  10.444  1.00 188.00 ? 270 DA  J "O3'" 1 
ATOM   5511  C  "C2'" . DA  B 1 124 ? 8.378   71.257  11.590  1.00 188.00 ? 270 DA  J "C2'" 1 
ATOM   5512  C  "C1'" . DA  B 1 124 ? 8.728   70.414  12.800  1.00 188.00 ? 270 DA  J "C1'" 1 
ATOM   5513  N  N9    . DA  B 1 124 ? 9.237   71.155  13.961  1.00 107.08 ? 270 DA  J N9    1 
ATOM   5514  C  C8    . DA  B 1 124 ? 10.056  72.261  13.978  1.00 107.08 ? 270 DA  J C8    1 
ATOM   5515  N  N7    . DA  B 1 124 ? 10.276  72.742  15.182  1.00 107.08 ? 270 DA  J N7    1 
ATOM   5516  C  C5    . DA  B 1 124 ? 9.568   71.886  16.018  1.00 107.08 ? 270 DA  J C5    1 
ATOM   5517  C  C6    . DA  B 1 124 ? 9.392   71.853  17.423  1.00 107.08 ? 270 DA  J C6    1 
ATOM   5518  N  N6    . DA  B 1 124 ? 9.933   72.738  18.264  1.00 107.08 ? 270 DA  J N6    1 
ATOM   5519  N  N1    . DA  B 1 124 ? 8.627   70.865  17.938  1.00 107.08 ? 270 DA  J N1    1 
ATOM   5520  C  C2    . DA  B 1 124 ? 8.082   69.975  17.099  1.00 107.08 ? 270 DA  J C2    1 
ATOM   5521  N  N3    . DA  B 1 124 ? 8.171   69.900  15.768  1.00 107.08 ? 270 DA  J N3    1 
ATOM   5522  C  C4    . DA  B 1 124 ? 8.936   70.895  15.282  1.00 107.08 ? 270 DA  J C4    1 
ATOM   5523  P  P     . DG  B 1 125 ? 5.808   70.408  9.802   1.00 132.56 ? 271 DG  J P     1 
ATOM   5524  O  OP1   . DG  B 1 125 ? 4.929   69.435  9.098   1.00 132.56 ? 271 DG  J OP1   1 
ATOM   5525  O  OP2   . DG  B 1 125 ? 6.354   71.573  9.058   1.00 132.56 ? 271 DG  J OP2   1 
ATOM   5526  O  "O5'" . DG  B 1 125 ? 5.012   70.947  11.074  1.00 135.63 ? 271 DG  J "O5'" 1 
ATOM   5527  C  "C5'" . DG  B 1 125 ? 4.185   70.067  11.834  1.00 135.63 ? 271 DG  J "C5'" 1 
ATOM   5528  C  "C4'" . DG  B 1 125 ? 3.329   70.843  12.809  1.00 135.63 ? 271 DG  J "C4'" 1 
ATOM   5529  O  "O4'" . DG  B 1 125 ? 4.129   71.300  13.929  1.00 135.63 ? 271 DG  J "O4'" 1 
ATOM   5530  C  "C3'" . DG  B 1 125 ? 2.623   72.082  12.244  1.00 135.63 ? 271 DG  J "C3'" 1 
ATOM   5531  O  "O3'" . DG  B 1 125 ? 1.239   72.078  12.639  1.00 135.63 ? 271 DG  J "O3'" 1 
ATOM   5532  C  "C2'" . DG  B 1 125 ? 3.382   73.238  12.875  1.00 135.63 ? 271 DG  J "C2'" 1 
ATOM   5533  C  "C1'" . DG  B 1 125 ? 3.810   72.652  14.206  1.00 135.63 ? 271 DG  J "C1'" 1 
ATOM   5534  N  N9    . DG  B 1 125 ? 4.976   73.293  14.809  1.00 98.15  ? 271 DG  J N9    1 
ATOM   5535  C  C8    . DG  B 1 125 ? 5.929   74.045  14.162  1.00 98.15  ? 271 DG  J C8    1 
ATOM   5536  N  N7    . DG  B 1 125 ? 6.842   74.523  14.968  1.00 98.15  ? 271 DG  J N7    1 
ATOM   5537  C  C5    . DG  B 1 125 ? 6.476   74.053  16.224  1.00 98.15  ? 271 DG  J C5    1 
ATOM   5538  C  C6    . DG  B 1 125 ? 7.086   74.250  17.495  1.00 98.15  ? 271 DG  J C6    1 
ATOM   5539  O  O6    . DG  B 1 125 ? 8.111   74.890  17.770  1.00 98.15  ? 271 DG  J O6    1 
ATOM   5540  N  N1    . DG  B 1 125 ? 6.377   73.606  18.506  1.00 98.15  ? 271 DG  J N1    1 
ATOM   5541  C  C2    . DG  B 1 125 ? 5.243   72.859  18.321  1.00 98.15  ? 271 DG  J C2    1 
ATOM   5542  N  N2    . DG  B 1 125 ? 4.725   72.325  19.429  1.00 98.15  ? 271 DG  J N2    1 
ATOM   5543  N  N3    . DG  B 1 125 ? 4.668   72.657  17.146  1.00 98.15  ? 271 DG  J N3    1 
ATOM   5544  C  C4    . DG  B 1 125 ? 5.330   73.285  16.146  1.00 98.15  ? 271 DG  J C4    1 
ATOM   5545  P  P     . DA  B 1 126 ? 0.313   73.381  12.400  1.00 169.15 ? 272 DA  J P     1 
ATOM   5546  O  OP1   . DA  B 1 126 ? -0.960  72.938  11.772  1.00 169.15 ? 272 DA  J OP1   1 
ATOM   5547  O  OP2   . DA  B 1 126 ? 1.107   74.462  11.765  1.00 169.15 ? 272 DA  J OP2   1 
ATOM   5548  O  "O5'" . DA  B 1 126 ? -0.013  73.841  13.884  1.00 158.59 ? 272 DA  J "O5'" 1 
ATOM   5549  C  "C5'" . DA  B 1 126 ? -0.226  72.859  14.886  1.00 158.59 ? 272 DA  J "C5'" 1 
ATOM   5550  C  "C4'" . DA  B 1 126 ? -0.230  73.490  16.255  1.00 158.59 ? 272 DA  J "C4'" 1 
ATOM   5551  O  "O4'" . DA  B 1 126 ? 1.110   73.842  16.682  1.00 158.59 ? 272 DA  J "O4'" 1 
ATOM   5552  C  "C3'" . DA  B 1 126 ? -1.073  74.757  16.368  1.00 158.59 ? 272 DA  J "C3'" 1 
ATOM   5553  O  "O3'" . DA  B 1 126 ? -1.878  74.641  17.537  1.00 158.59 ? 272 DA  J "O3'" 1 
ATOM   5554  C  "C2'" . DA  B 1 126 ? -0.037  75.866  16.496  1.00 158.59 ? 272 DA  J "C2'" 1 
ATOM   5555  C  "C1'" . DA  B 1 126 ? 1.111   75.161  17.203  1.00 158.59 ? 272 DA  J "C1'" 1 
ATOM   5556  N  N9    . DA  B 1 126 ? 2.446   75.735  16.993  1.00 137.45 ? 272 DA  J N9    1 
ATOM   5557  C  C8    . DA  B 1 126 ? 2.994   76.189  15.816  1.00 137.45 ? 272 DA  J C8    1 
ATOM   5558  N  N7    . DA  B 1 126 ? 4.216   76.652  15.945  1.00 137.45 ? 272 DA  J N7    1 
ATOM   5559  C  C5    . DA  B 1 126 ? 4.496   76.495  17.296  1.00 137.45 ? 272 DA  J C5    1 
ATOM   5560  C  C6    . DA  B 1 126 ? 5.636   76.799  18.073  1.00 137.45 ? 272 DA  J C6    1 
ATOM   5561  N  N6    . DA  B 1 126 ? 6.750   77.346  17.578  1.00 137.45 ? 272 DA  J N6    1 
ATOM   5562  N  N1    . DA  B 1 126 ? 5.591   76.518  19.392  1.00 137.45 ? 272 DA  J N1    1 
ATOM   5563  C  C2    . DA  B 1 126 ? 4.476   75.969  19.891  1.00 137.45 ? 272 DA  J C2    1 
ATOM   5564  N  N3    . DA  B 1 126 ? 3.343   75.638  19.268  1.00 137.45 ? 272 DA  J N3    1 
ATOM   5565  C  C4    . DA  B 1 126 ? 3.417   75.930  17.956  1.00 137.45 ? 272 DA  J C4    1 
ATOM   5566  P  P     . DA  B 1 127 ? -3.066  75.679  17.799  1.00 138.61 ? 273 DA  J P     1 
ATOM   5567  O  OP1   . DA  B 1 127 ? -4.324  74.914  18.018  1.00 138.61 ? 273 DA  J OP1   1 
ATOM   5568  O  OP2   . DA  B 1 127 ? -3.015  76.725  16.745  1.00 138.61 ? 273 DA  J OP2   1 
ATOM   5569  O  "O5'" . DA  B 1 127 ? -2.616  76.326  19.177  1.00 174.73 ? 273 DA  J "O5'" 1 
ATOM   5570  C  "C5'" . DA  B 1 127 ? -1.976  75.525  20.172  1.00 174.73 ? 273 DA  J "C5'" 1 
ATOM   5571  C  "C4'" . DA  B 1 127 ? -1.333  76.410  21.210  1.00 174.73 ? 273 DA  J "C4'" 1 
ATOM   5572  O  "O4'" . DA  B 1 127 ? 0.042   76.722  20.862  1.00 174.73 ? 273 DA  J "O4'" 1 
ATOM   5573  C  "C3'" . DA  B 1 127 ? -2.061  77.744  21.350  1.00 174.73 ? 273 DA  J "C3'" 1 
ATOM   5574  O  "O3'" . DA  B 1 127 ? -2.281  78.068  22.719  1.00 174.73 ? 273 DA  J "O3'" 1 
ATOM   5575  C  "C2'" . DA  B 1 127 ? -1.124  78.740  20.687  1.00 174.73 ? 273 DA  J "C2'" 1 
ATOM   5576  C  "C1'" . DA  B 1 127 ? 0.243   78.127  20.935  1.00 174.73 ? 273 DA  J "C1'" 1 
ATOM   5577  N  N9    . DA  B 1 127 ? 1.261   78.512  19.948  1.00 168.57 ? 273 DA  J N9    1 
ATOM   5578  C  C8    . DA  B 1 127 ? 1.115   78.614  18.584  1.00 168.57 ? 273 DA  J C8    1 
ATOM   5579  N  N7    . DA  B 1 127 ? 2.197   79.019  17.963  1.00 168.57 ? 273 DA  J N7    1 
ATOM   5580  C  C5    . DA  B 1 127 ? 3.124   79.190  18.983  1.00 168.57 ? 273 DA  J C5    1 
ATOM   5581  C  C6    . DA  B 1 127 ? 4.472   79.610  18.981  1.00 168.57 ? 273 DA  J C6    1 
ATOM   5582  N  N6    . DA  B 1 127 ? 5.145   79.948  17.880  1.00 168.57 ? 273 DA  J N6    1 
ATOM   5583  N  N1    . DA  B 1 127 ? 5.112   79.673  20.169  1.00 168.57 ? 273 DA  J N1    1 
ATOM   5584  C  C2    . DA  B 1 127 ? 4.439   79.335  21.276  1.00 168.57 ? 273 DA  J C2    1 
ATOM   5585  N  N3    . DA  B 1 127 ? 3.175   78.927  21.408  1.00 168.57 ? 273 DA  J N3    1 
ATOM   5586  C  C4    . DA  B 1 127 ? 2.565   78.874  20.211  1.00 168.57 ? 273 DA  J C4    1 
ATOM   5587  P  P     . DT  B 1 128 ? -3.119  79.385  23.096  1.00 154.52 ? 274 DT  J P     1 
ATOM   5588  O  OP1   . DT  B 1 128 ? -4.100  78.999  24.143  1.00 154.52 ? 274 DT  J OP1   1 
ATOM   5589  O  OP2   . DT  B 1 128 ? -3.598  80.027  21.840  1.00 154.52 ? 274 DT  J OP2   1 
ATOM   5590  O  "O5'" . DT  B 1 128 ? -2.010  80.312  23.763  1.00 157.35 ? 274 DT  J "O5'" 1 
ATOM   5591  C  "C5'" . DT  B 1 128 ? -1.106  79.769  24.727  1.00 157.35 ? 274 DT  J "C5'" 1 
ATOM   5592  C  "C4'" . DT  B 1 128 ? -0.081  80.802  25.130  1.00 157.35 ? 274 DT  J "C4'" 1 
ATOM   5593  O  "O4'" . DT  B 1 128 ? 0.953   80.923  24.120  1.00 157.35 ? 274 DT  J "O4'" 1 
ATOM   5594  C  "C3'" . DT  B 1 128 ? -0.666  82.202  25.320  1.00 157.35 ? 274 DT  J "C3'" 1 
ATOM   5595  O  "O3'" . DT  B 1 128 ? -0.101  82.821  26.474  1.00 157.35 ? 274 DT  J "O3'" 1 
ATOM   5596  C  "C2'" . DT  B 1 128 ? -0.220  82.938  24.070  1.00 157.35 ? 274 DT  J "C2'" 1 
ATOM   5597  C  "C1'" . DT  B 1 128 ? 1.130   82.296  23.815  1.00 157.35 ? 274 DT  J "C1'" 1 
ATOM   5598  N  N1    . DT  B 1 128 ? 1.637   82.418  22.429  1.00 114.06 ? 274 DT  J N1    1 
ATOM   5599  C  C2    . DT  B 1 128 ? 3.005   82.485  22.246  1.00 114.06 ? 274 DT  J C2    1 
ATOM   5600  O  O2    . DT  B 1 128 ? 3.811   82.386  23.165  1.00 114.06 ? 274 DT  J O2    1 
ATOM   5601  N  N3    . DT  B 1 128 ? 3.398   82.671  20.937  1.00 114.06 ? 274 DT  J N3    1 
ATOM   5602  C  C4    . DT  B 1 128 ? 2.581   82.773  19.822  1.00 114.06 ? 274 DT  J C4    1 
ATOM   5603  O  O4    . DT  B 1 128 ? 3.084   82.943  18.711  1.00 114.06 ? 274 DT  J O4    1 
ATOM   5604  C  C5    . DT  B 1 128 ? 1.159   82.667  20.088  1.00 114.06 ? 274 DT  J C5    1 
ATOM   5605  C  C7    . DT  B 1 128 ? 0.196   82.756  18.946  1.00 114.06 ? 274 DT  J C7    1 
ATOM   5606  C  C6    . DT  B 1 128 ? 0.766   82.495  21.358  1.00 114.06 ? 274 DT  J C6    1 
ATOM   5607  P  P     . DC  B 1 129 ? -0.907  83.993  27.222  1.00 145.29 ? 275 DC  J P     1 
ATOM   5608  O  OP1   . DC  B 1 129 ? -1.769  83.360  28.251  1.00 145.29 ? 275 DC  J OP1   1 
ATOM   5609  O  OP2   . DC  B 1 129 ? -1.522  84.867  26.187  1.00 145.29 ? 275 DC  J OP2   1 
ATOM   5610  O  "O5'" . DC  B 1 129 ? 0.244   84.808  27.966  1.00 117.02 ? 275 DC  J "O5'" 1 
ATOM   5611  C  "C5'" . DC  B 1 129 ? 1.101   85.685  27.234  1.00 117.02 ? 275 DC  J "C5'" 1 
ATOM   5612  C  "C4'" . DC  B 1 129 ? 2.530   85.191  27.268  1.00 117.02 ? 275 DC  J "C4'" 1 
ATOM   5613  O  "O4'" . DC  B 1 129 ? 2.871   84.632  25.974  1.00 117.02 ? 275 DC  J "O4'" 1 
ATOM   5614  C  "C3'" . DC  B 1 129 ? 3.532   86.315  27.514  1.00 117.02 ? 275 DC  J "C3'" 1 
ATOM   5615  O  "O3'" . DC  B 1 129 ? 4.639   85.877  28.300  1.00 117.02 ? 275 DC  J "O3'" 1 
ATOM   5616  C  "C2'" . DC  B 1 129 ? 3.979   86.709  26.122  1.00 117.02 ? 275 DC  J "C2'" 1 
ATOM   5617  C  "C1'" . DC  B 1 129 ? 3.858   85.422  25.325  1.00 117.02 ? 275 DC  J "C1'" 1 
ATOM   5618  N  N1    . DC  B 1 129 ? 3.400   85.685  23.954  1.00 96.21  ? 275 DC  J N1    1 
ATOM   5619  C  C2    . DC  B 1 129 ? 4.278   86.316  23.064  1.00 96.21  ? 275 DC  J C2    1 
ATOM   5620  O  O2    . DC  B 1 129 ? 5.435   86.578  23.442  1.00 96.21  ? 275 DC  J O2    1 
ATOM   5621  N  N3    . DC  B 1 129 ? 3.849   86.619  21.813  1.00 96.21  ? 275 DC  J N3    1 
ATOM   5622  C  C4    . DC  B 1 129 ? 2.612   86.298  21.434  1.00 96.21  ? 275 DC  J C4    1 
ATOM   5623  N  N4    . DC  B 1 129 ? 2.244   86.615  20.194  1.00 96.21  ? 275 DC  J N4    1 
ATOM   5624  C  C5    . DC  B 1 129 ? 1.705   85.636  22.311  1.00 96.21  ? 275 DC  J C5    1 
ATOM   5625  C  C6    . DC  B 1 129 ? 2.138   85.350  23.552  1.00 96.21  ? 275 DC  J C6    1 
ATOM   5626  P  P     . DT  B 1 130 ? 5.422   86.948  29.204  1.00 104.64 ? 276 DT  J P     1 
ATOM   5627  O  OP1   . DT  B 1 130 ? 6.595   86.291  29.846  1.00 104.64 ? 276 DT  J OP1   1 
ATOM   5628  O  OP2   . DT  B 1 130 ? 4.412   87.640  30.045  1.00 104.64 ? 276 DT  J OP2   1 
ATOM   5629  O  "O5'" . DT  B 1 130 ? 5.962   88.006  28.145  1.00 55.96  ? 276 DT  J "O5'" 1 
ATOM   5630  C  "C5'" . DT  B 1 130 ? 7.217   87.820  27.500  1.00 55.96  ? 276 DT  J "C5'" 1 
ATOM   5631  C  "C4'" . DT  B 1 130 ? 7.497   88.967  26.558  1.00 55.96  ? 276 DT  J "C4'" 1 
ATOM   5632  O  "O4'" . DT  B 1 130 ? 6.733   88.822  25.333  1.00 55.96  ? 276 DT  J "O4'" 1 
ATOM   5633  C  "C3'" . DT  B 1 130 ? 7.195   90.373  27.097  1.00 55.96  ? 276 DT  J "C3'" 1 
ATOM   5634  O  "O3'" . DT  B 1 130 ? 8.293   91.252  26.827  1.00 55.96  ? 276 DT  J "O3'" 1 
ATOM   5635  C  "C2'" . DT  B 1 130 ? 6.021   90.822  26.234  1.00 55.96  ? 276 DT  J "C2'" 1 
ATOM   5636  C  "C1'" . DT  B 1 130 ? 6.347   90.119  24.933  1.00 55.96  ? 276 DT  J "C1'" 1 
ATOM   5637  N  N1    . DT  B 1 130 ? 5.300   90.020  23.878  1.00 85.97  ? 276 DT  J N1    1 
ATOM   5638  C  C2    . DT  B 1 130 ? 5.589   90.566  22.635  1.00 85.97  ? 276 DT  J C2    1 
ATOM   5639  O  O2    . DT  B 1 130 ? 6.661   91.077  22.359  1.00 85.97  ? 276 DT  J O2    1 
ATOM   5640  N  N3    . DT  B 1 130 ? 4.572   90.477  21.718  1.00 85.97  ? 276 DT  J N3    1 
ATOM   5641  C  C4    . DT  B 1 130 ? 3.338   89.894  21.894  1.00 85.97  ? 276 DT  J C4    1 
ATOM   5642  O  O4    . DT  B 1 130 ? 2.531   89.894  20.975  1.00 85.97  ? 276 DT  J O4    1 
ATOM   5643  C  C5    . DT  B 1 130 ? 3.107   89.317  23.198  1.00 85.97  ? 276 DT  J C5    1 
ATOM   5644  C  C7    . DT  B 1 130 ? 1.802   88.632  23.461  1.00 85.97  ? 276 DT  J C7    1 
ATOM   5645  C  C6    . DT  B 1 130 ? 4.083   89.416  24.119  1.00 85.97  ? 276 DT  J C6    1 
ATOM   5646  P  P     . DG  B 1 131 ? 9.377   91.592  27.973  1.00 50.99  ? 277 DG  J P     1 
ATOM   5647  O  OP1   . DG  B 1 131 ? 9.464   90.532  29.006  1.00 50.99  ? 277 DG  J OP1   1 
ATOM   5648  O  OP2   . DG  B 1 131 ? 9.136   92.990  28.388  1.00 50.99  ? 277 DG  J OP2   1 
ATOM   5649  O  "O5'" . DG  B 1 131 ? 10.752  91.551  27.174  1.00 40.72  ? 277 DG  J "O5'" 1 
ATOM   5650  C  "C5'" . DG  B 1 131 ? 11.489  92.742  26.933  1.00 40.72  ? 277 DG  J "C5'" 1 
ATOM   5651  C  "C4'" . DG  B 1 131 ? 11.895  92.834  25.479  1.00 40.72  ? 277 DG  J "C4'" 1 
ATOM   5652  O  "O4'" . DG  B 1 131 ? 10.778  92.511  24.617  1.00 40.72  ? 277 DG  J "O4'" 1 
ATOM   5653  C  "C3'" . DG  B 1 131 ? 12.277  94.267  25.142  1.00 40.72  ? 277 DG  J "C3'" 1 
ATOM   5654  O  "O3'" . DG  B 1 131 ? 13.310  94.345  24.190  1.00 40.72  ? 277 DG  J "O3'" 1 
ATOM   5655  C  "C2'" . DG  B 1 131 ? 11.009  94.847  24.562  1.00 40.72  ? 277 DG  J "C2'" 1 
ATOM   5656  C  "C1'" . DG  B 1 131 ? 10.388  93.658  23.872  1.00 40.72  ? 277 DG  J "C1'" 1 
ATOM   5657  N  N9    . DG  B 1 131 ? 8.938   93.745  23.917  1.00 61.53  ? 277 DG  J N9    1 
ATOM   5658  C  C8    . DG  B 1 131 ? 8.156   93.851  25.039  1.00 61.53  ? 277 DG  J C8    1 
ATOM   5659  N  N7    . DG  B 1 131 ? 6.883   93.912  24.770  1.00 61.53  ? 277 DG  J N7    1 
ATOM   5660  C  C5    . DG  B 1 131 ? 6.823   93.841  23.387  1.00 61.53  ? 277 DG  J C5    1 
ATOM   5661  C  C6    . DG  B 1 131 ? 5.705   93.843  22.518  1.00 61.53  ? 277 DG  J C6    1 
ATOM   5662  O  O6    . DG  B 1 131 ? 4.503   93.892  22.808  1.00 61.53  ? 277 DG  J O6    1 
ATOM   5663  N  N1    . DG  B 1 131 ? 6.090   93.761  21.183  1.00 61.53  ? 277 DG  J N1    1 
ATOM   5664  C  C2    . DG  B 1 131 ? 7.390   93.678  20.740  1.00 61.53  ? 277 DG  J C2    1 
ATOM   5665  N  N2    . DG  B 1 131 ? 7.558   93.618  19.402  1.00 61.53  ? 277 DG  J N2    1 
ATOM   5666  N  N3    . DG  B 1 131 ? 8.445   93.658  21.546  1.00 61.53  ? 277 DG  J N3    1 
ATOM   5667  C  C4    . DG  B 1 131 ? 8.086   93.743  22.847  1.00 61.53  ? 277 DG  J C4    1 
ATOM   5668  P  P     . DC  B 1 132 ? 14.012  95.755  23.939  1.00 49.82  ? 278 DC  J P     1 
ATOM   5669  O  OP1   . DC  B 1 132 ? 15.449  95.467  23.742  1.00 49.82  ? 278 DC  J OP1   1 
ATOM   5670  O  OP2   . DC  B 1 132 ? 13.583  96.697  25.010  1.00 49.82  ? 278 DC  J OP2   1 
ATOM   5671  O  "O5'" . DC  B 1 132 ? 13.383  96.253  22.568  1.00 46.57  ? 278 DC  J "O5'" 1 
ATOM   5672  C  "C5'" . DC  B 1 132 ? 12.496  95.419  21.828  1.00 46.57  ? 278 DC  J "C5'" 1 
ATOM   5673  C  "C4'" . DC  B 1 132 ? 11.752  96.231  20.794  1.00 46.57  ? 278 DC  J "C4'" 1 
ATOM   5674  O  "O4'" . DC  B 1 132 ? 10.337  96.142  21.066  1.00 46.57  ? 278 DC  J "O4'" 1 
ATOM   5675  C  "C3'" . DC  B 1 132 ? 12.072  97.727  20.772  1.00 46.57  ? 278 DC  J "C3'" 1 
ATOM   5676  O  "O3'" . DC  B 1 132 ? 11.946  98.219  19.433  1.00 46.57  ? 278 DC  J "O3'" 1 
ATOM   5677  C  "C2'" . DC  B 1 132 ? 10.984  98.328  21.645  1.00 46.57  ? 278 DC  J "C2'" 1 
ATOM   5678  C  "C1'" . DC  B 1 132 ? 9.804   97.442  21.298  1.00 46.57  ? 278 DC  J "C1'" 1 
ATOM   5679  N  N1    . DC  B 1 132 ? 8.775   97.320  22.339  1.00 53.85  ? 278 DC  J N1    1 
ATOM   5680  C  C2    . DC  B 1 132 ? 7.459   97.145  21.935  1.00 53.85  ? 278 DC  J C2    1 
ATOM   5681  O  O2    . DC  B 1 132 ? 7.202   97.159  20.727  1.00 53.85  ? 278 DC  J O2    1 
ATOM   5682  N  N3    . DC  B 1 132 ? 6.500   96.970  22.862  1.00 53.85  ? 278 DC  J N3    1 
ATOM   5683  C  C4    . DC  B 1 132 ? 6.815   96.986  24.160  1.00 53.85  ? 278 DC  J C4    1 
ATOM   5684  N  N4    . DC  B 1 132 ? 5.829   96.799  25.040  1.00 53.85  ? 278 DC  J N4    1 
ATOM   5685  C  C5    . DC  B 1 132 ? 8.155   97.194  24.608  1.00 53.85  ? 278 DC  J C5    1 
ATOM   5686  C  C6    . DC  B 1 132 ? 9.094   97.356  23.671  1.00 53.85  ? 278 DC  J C6    1 
ATOM   5687  P  P     . DA  B 1 133 ? 13.039  99.243  18.847  1.00 51.99  ? 279 DA  J P     1 
ATOM   5688  O  OP1   . DA  B 1 133 ? 14.359  98.583  18.985  1.00 51.99  ? 279 DA  J OP1   1 
ATOM   5689  O  OP2   . DA  B 1 133 ? 12.836  100.604 19.415  1.00 51.99  ? 279 DA  J OP2   1 
ATOM   5690  O  "O5'" . DA  B 1 133 ? 12.672  99.307  17.306  1.00 71.89  ? 279 DA  J "O5'" 1 
ATOM   5691  C  "C5'" . DA  B 1 133 ? 12.176  98.159  16.632  1.00 71.89  ? 279 DA  J "C5'" 1 
ATOM   5692  C  "C4'" . DA  B 1 133 ? 10.942  98.533  15.850  1.00 71.89  ? 279 DA  J "C4'" 1 
ATOM   5693  O  "O4'" . DA  B 1 133 ? 9.779   98.598  16.713  1.00 71.89  ? 279 DA  J "O4'" 1 
ATOM   5694  C  "C3'" . DA  B 1 133 ? 11.067  99.906  15.204  1.00 71.89  ? 279 DA  J "C3'" 1 
ATOM   5695  O  "O3'" . DA  B 1 133 ? 10.452  99.888  13.923  1.00 71.89  ? 279 DA  J "O3'" 1 
ATOM   5696  C  "C2'" . DA  B 1 133 ? 10.333  100.822 16.167  1.00 71.89  ? 279 DA  J "C2'" 1 
ATOM   5697  C  "C1'" . DA  B 1 133 ? 9.258   99.921  16.753  1.00 71.89  ? 279 DA  J "C1'" 1 
ATOM   5698  N  N9    . DA  B 1 133 ? 8.940   100.219 18.148  1.00 58.53  ? 279 DA  J N9    1 
ATOM   5699  C  C8    . DA  B 1 133 ? 9.783   100.703 19.116  1.00 58.53  ? 279 DA  J C8    1 
ATOM   5700  N  N7    . DA  B 1 133 ? 9.216   100.847 20.287  1.00 58.53  ? 279 DA  J N7    1 
ATOM   5701  C  C5    . DA  B 1 133 ? 7.908   100.444 20.071  1.00 58.53  ? 279 DA  J C5    1 
ATOM   5702  C  C6    . DA  B 1 133 ? 6.790   100.383 20.915  1.00 58.53  ? 279 DA  J C6    1 
ATOM   5703  N  N6    . DA  B 1 133 ? 6.807   100.749 22.196  1.00 58.53  ? 279 DA  J N6    1 
ATOM   5704  N  N1    . DA  B 1 133 ? 5.635   99.938  20.390  1.00 58.53  ? 279 DA  J N1    1 
ATOM   5705  C  C2    . DA  B 1 133 ? 5.610   99.590  19.098  1.00 58.53  ? 279 DA  J C2    1 
ATOM   5706  N  N3    . DA  B 1 133 ? 6.590   99.611  18.202  1.00 58.53  ? 279 DA  J N3    1 
ATOM   5707  C  C4    . DA  B 1 133 ? 7.726   100.054 18.759  1.00 58.53  ? 279 DA  J C4    1 
ATOM   5708  P  P     . DG  B 1 134 ? 10.617  101.144 12.953  1.00 63.68  ? 280 DG  J P     1 
ATOM   5709  O  OP1   . DG  B 1 134 ? 11.405  100.748 11.759  1.00 63.68  ? 280 DG  J OP1   1 
ATOM   5710  O  OP2   . DG  B 1 134 ? 11.054  102.314 13.778  1.00 63.68  ? 280 DG  J OP2   1 
ATOM   5711  O  "O5'" . DG  B 1 134 ? 9.124   101.389 12.494  1.00 82.78  ? 280 DG  J "O5'" 1 
ATOM   5712  C  "C5'" . DG  B 1 134 ? 8.644   102.701 12.385  1.00 82.78  ? 280 DG  J "C5'" 1 
ATOM   5713  C  "C4'" . DG  B 1 134 ? 7.270   102.806 12.991  1.00 82.78  ? 280 DG  J "C4'" 1 
ATOM   5714  O  "O4'" . DG  B 1 134 ? 7.303   102.411 14.391  1.00 82.78  ? 280 DG  J "O4'" 1 
ATOM   5715  C  "C3'" . DG  B 1 134 ? 6.814   104.259 12.955  1.00 82.78  ? 280 DG  J "C3'" 1 
ATOM   5716  O  "O3'" . DG  B 1 134 ? 5.521   104.394 12.377  1.00 82.78  ? 280 DG  J "O3'" 1 
ATOM   5717  C  "C2'" . DG  B 1 134 ? 6.874   104.718 14.400  1.00 82.78  ? 280 DG  J "C2'" 1 
ATOM   5718  C  "C1'" . DG  B 1 134 ? 6.771   103.442 15.214  1.00 82.78  ? 280 DG  J "C1'" 1 
ATOM   5719  N  N9    . DG  B 1 134 ? 7.558   103.528 16.448  1.00 69.68  ? 280 DG  J N9    1 
ATOM   5720  C  C8    . DG  B 1 134 ? 8.924   103.655 16.562  1.00 69.68  ? 280 DG  J C8    1 
ATOM   5721  N  N7    . DG  B 1 134 ? 9.327   103.808 17.795  1.00 69.68  ? 280 DG  J N7    1 
ATOM   5722  C  C5    . DG  B 1 134 ? 8.164   103.758 18.539  1.00 69.68  ? 280 DG  J C5    1 
ATOM   5723  C  C6    . DG  B 1 134 ? 7.976   103.873 19.924  1.00 69.68  ? 280 DG  J C6    1 
ATOM   5724  O  O6    . DG  B 1 134 ? 8.832   104.071 20.800  1.00 69.68  ? 280 DG  J O6    1 
ATOM   5725  N  N1    . DG  B 1 134 ? 6.626   103.742 20.267  1.00 69.68  ? 280 DG  J N1    1 
ATOM   5726  C  C2    . DG  B 1 134 ? 5.600   103.536 19.371  1.00 69.68  ? 280 DG  J C2    1 
ATOM   5727  N  N2    . DG  B 1 134 ? 4.377   103.419 19.888  1.00 69.68  ? 280 DG  J N2    1 
ATOM   5728  N  N3    . DG  B 1 134 ? 5.768   103.447 18.071  1.00 69.68  ? 280 DG  J N3    1 
ATOM   5729  C  C4    . DG  B 1 134 ? 7.065   103.563 17.725  1.00 69.68  ? 280 DG  J C4    1 
ATOM   5730  P  P     . DG  B 1 135 ? 5.117   105.778 11.678  1.00 94.51  ? 281 DG  J P     1 
ATOM   5731  O  OP1   . DG  B 1 135 ? 4.474   105.452 10.381  1.00 94.51  ? 281 DG  J OP1   1 
ATOM   5732  O  OP2   . DG  B 1 135 ? 6.303   106.677 11.699  1.00 94.51  ? 281 DG  J OP2   1 
ATOM   5733  O  "O5'" . DG  B 1 135 ? 4.027   106.360 12.683  1.00 135.91 ? 281 DG  J "O5'" 1 
ATOM   5734  C  "C5'" . DG  B 1 135 ? 3.013   105.518 13.241  1.00 135.91 ? 281 DG  J "C5'" 1 
ATOM   5735  C  "C4'" . DG  B 1 135 ? 2.247   106.274 14.301  1.00 135.91 ? 281 DG  J "C4'" 1 
ATOM   5736  O  "O4'" . DG  B 1 135 ? 2.790   106.013 15.623  1.00 135.91 ? 281 DG  J "O4'" 1 
ATOM   5737  C  "C3'" . DG  B 1 135 ? 2.319   107.784 14.083  1.00 135.91 ? 281 DG  J "C3'" 1 
ATOM   5738  O  "O3'" . DG  B 1 135 ? 1.034   108.404 14.087  1.00 135.91 ? 281 DG  J "O3'" 1 
ATOM   5739  C  "C2'" . DG  B 1 135 ? 3.212   108.287 15.206  1.00 135.91 ? 281 DG  J "C2'" 1 
ATOM   5740  C  "C1'" . DG  B 1 135 ? 3.109   107.228 16.296  1.00 135.91 ? 281 DG  J "C1'" 1 
ATOM   5741  N  N9    . DG  B 1 135 ? 4.392   107.043 16.978  1.00 63.55  ? 281 DG  J N9    1 
ATOM   5742  C  C8    . DG  B 1 135 ? 5.597   106.841 16.356  1.00 63.55  ? 281 DG  J C8    1 
ATOM   5743  N  N7    . DG  B 1 135 ? 6.603   106.757 17.184  1.00 63.55  ? 281 DG  J N7    1 
ATOM   5744  C  C5    . DG  B 1 135 ? 6.035   106.902 18.435  1.00 63.55  ? 281 DG  J C5    1 
ATOM   5745  C  C6    . DG  B 1 135 ? 6.647   106.905 19.706  1.00 63.55  ? 281 DG  J C6    1 
ATOM   5746  O  O6    . DG  B 1 135 ? 7.854   106.786 19.974  1.00 63.55  ? 281 DG  J O6    1 
ATOM   5747  N  N1    . DG  B 1 135 ? 5.711   107.070 20.726  1.00 63.55  ? 281 DG  J N1    1 
ATOM   5748  C  C2    . DG  B 1 135 ? 4.358   107.215 20.536  1.00 63.55  ? 281 DG  J C2    1 
ATOM   5749  N  N2    . DG  B 1 135 ? 3.631   107.347 21.659  1.00 63.55  ? 281 DG  J N2    1 
ATOM   5750  N  N3    . DG  B 1 135 ? 3.768   107.227 19.341  1.00 63.55  ? 281 DG  J N3    1 
ATOM   5751  C  C4    . DG  B 1 135 ? 4.664   107.066 18.338  1.00 63.55  ? 281 DG  J C4    1 
ATOM   5752  P  P     . DT  B 1 136 ? 0.865   109.875 13.455  1.00 128.78 ? 282 DT  J P     1 
ATOM   5753  O  OP1   . DT  B 1 136 ? -0.492  109.962 12.853  1.00 128.78 ? 282 DT  J OP1   1 
ATOM   5754  O  OP2   . DT  B 1 136 ? 2.055   110.170 12.615  1.00 128.78 ? 282 DT  J OP2   1 
ATOM   5755  O  "O5'" . DT  B 1 136 ? 0.938   110.813 14.738  1.00 138.13 ? 282 DT  J "O5'" 1 
ATOM   5756  C  "C5'" . DT  B 1 136 ? 1.600   110.370 15.924  1.00 138.13 ? 282 DT  J "C5'" 1 
ATOM   5757  C  "C4'" . DT  B 1 136 ? 0.890   110.899 17.147  1.00 138.13 ? 282 DT  J "C4'" 1 
ATOM   5758  O  "O4'" . DT  B 1 136 ? 1.519   110.357 18.333  1.00 138.13 ? 282 DT  J "O4'" 1 
ATOM   5759  C  "C3'" . DT  B 1 136 ? 0.967   112.417 17.275  1.00 138.13 ? 282 DT  J "C3'" 1 
ATOM   5760  O  "O3'" . DT  B 1 136 ? -0.278  112.969 17.707  1.00 138.13 ? 282 DT  J "O3'" 1 
ATOM   5761  C  "C2'" . DT  B 1 136 ? 2.080   112.653 18.280  1.00 138.13 ? 282 DT  J "C2'" 1 
ATOM   5762  C  "C1'" . DT  B 1 136 ? 2.111   111.385 19.119  1.00 138.13 ? 282 DT  J "C1'" 1 
ATOM   5763  N  N1    . DT  B 1 136 ? 3.495   110.971 19.430  1.00 69.49  ? 282 DT  J N1    1 
ATOM   5764  C  C2    . DT  B 1 136 ? 3.850   110.760 20.742  1.00 69.49  ? 282 DT  J C2    1 
ATOM   5765  O  O2    . DT  B 1 136 ? 3.076   110.896 21.672  1.00 69.49  ? 282 DT  J O2    1 
ATOM   5766  N  N3    . DT  B 1 136 ? 5.161   110.386 20.924  1.00 69.49  ? 282 DT  J N3    1 
ATOM   5767  C  C4    . DT  B 1 136 ? 6.126   110.209 19.939  1.00 69.49  ? 282 DT  J C4    1 
ATOM   5768  O  O4    . DT  B 1 136 ? 7.263   109.861 20.247  1.00 69.49  ? 282 DT  J O4    1 
ATOM   5769  C  C5    . DT  B 1 136 ? 5.684   110.459 18.591  1.00 69.49  ? 282 DT  J C5    1 
ATOM   5770  C  C7    . DT  B 1 136 ? 6.665   110.322 17.471  1.00 69.49  ? 282 DT  J C7    1 
ATOM   5771  C  C6    . DT  B 1 136 ? 4.409   110.814 18.406  1.00 69.49  ? 282 DT  J C6    1 
ATOM   5772  P  P     . DG  B 1 137 ? -0.450  114.564 17.794  1.00 130.65 ? 283 DG  J P     1 
ATOM   5773  O  OP1   . DG  B 1 137 ? -1.902  114.883 17.771  1.00 130.65 ? 283 DG  J OP1   1 
ATOM   5774  O  OP2   . DG  B 1 137 ? 0.454   115.188 16.791  1.00 130.65 ? 283 DG  J OP2   1 
ATOM   5775  O  "O5'" . DG  B 1 137 ? 0.134   114.890 19.236  1.00 125.50 ? 283 DG  J "O5'" 1 
ATOM   5776  C  "C5'" . DG  B 1 137 ? -0.338  114.200 20.395  1.00 125.50 ? 283 DG  J "C5'" 1 
ATOM   5777  C  "C4'" . DG  B 1 137 ? 0.315   114.788 21.619  1.00 125.50 ? 283 DG  J "C4'" 1 
ATOM   5778  O  "O4'" . DG  B 1 137 ? 1.686   114.328 21.669  1.00 125.50 ? 283 DG  J "O4'" 1 
ATOM   5779  C  "C3'" . DG  B 1 137 ? 0.380   116.309 21.498  1.00 125.50 ? 283 DG  J "C3'" 1 
ATOM   5780  O  "O3'" . DG  B 1 137 ? 0.227   116.968 22.750  1.00 125.50 ? 283 DG  J "O3'" 1 
ATOM   5781  C  "C2'" . DG  B 1 137 ? 1.761   116.562 20.937  1.00 125.50 ? 283 DG  J "C2'" 1 
ATOM   5782  C  "C1'" . DG  B 1 137 ? 2.570   115.427 21.528  1.00 125.50 ? 283 DG  J "C1'" 1 
ATOM   5783  N  N9    . DG  B 1 137 ? 3.660   115.026 20.647  1.00 113.99 ? 283 DG  J N9    1 
ATOM   5784  C  C8    . DG  B 1 137 ? 3.700   115.131 19.273  1.00 113.99 ? 283 DG  J C8    1 
ATOM   5785  N  N7    . DG  B 1 137 ? 4.845   114.767 18.764  1.00 113.99 ? 283 DG  J N7    1 
ATOM   5786  C  C5    . DG  B 1 137 ? 5.601   114.379 19.865  1.00 113.99 ? 283 DG  J C5    1 
ATOM   5787  C  C6    . DG  B 1 137 ? 6.937   113.903 19.944  1.00 113.99 ? 283 DG  J C6    1 
ATOM   5788  O  O6    . DG  B 1 137 ? 7.751   113.730 19.024  1.00 113.99 ? 283 DG  J O6    1 
ATOM   5789  N  N1    . DG  B 1 137 ? 7.305   113.628 21.265  1.00 113.99 ? 283 DG  J N1    1 
ATOM   5790  C  C2    . DG  B 1 137 ? 6.498   113.797 22.366  1.00 113.99 ? 283 DG  J C2    1 
ATOM   5791  N  N2    . DG  B 1 137 ? 7.051   113.480 23.552  1.00 113.99 ? 283 DG  J N2    1 
ATOM   5792  N  N3    . DG  B 1 137 ? 5.252   114.243 22.306  1.00 113.99 ? 283 DG  J N3    1 
ATOM   5793  C  C4    . DG  B 1 137 ? 4.873   114.515 21.034  1.00 113.99 ? 283 DG  J C4    1 
ATOM   5794  P  P     . DG  B 1 138 ? 0.057   118.566 22.782  1.00 150.25 ? 284 DG  J P     1 
ATOM   5795  O  OP1   . DG  B 1 138 ? -1.338  118.895 23.184  1.00 150.25 ? 284 DG  J OP1   1 
ATOM   5796  O  OP2   . DG  B 1 138 ? 0.603   119.101 21.507  1.00 150.25 ? 284 DG  J OP2   1 
ATOM   5797  O  "O5'" . DG  B 1 138 ? 1.040   119.009 23.946  1.00 125.01 ? 284 DG  J "O5'" 1 
ATOM   5798  C  "C5'" . DG  B 1 138 ? 1.343   118.117 25.007  1.00 125.01 ? 284 DG  J "C5'" 1 
ATOM   5799  C  "C4'" . DG  B 1 138 ? 2.799   118.243 25.368  1.00 125.01 ? 284 DG  J "C4'" 1 
ATOM   5800  O  "O4'" . DG  B 1 138 ? 3.636   117.572 24.391  1.00 125.01 ? 284 DG  J "O4'" 1 
ATOM   5801  C  "C3'" . DG  B 1 138 ? 3.260   119.700 25.387  1.00 125.01 ? 284 DG  J "C3'" 1 
ATOM   5802  O  "O3'" . DG  B 1 138 ? 4.145   119.895 26.478  1.00 125.01 ? 284 DG  J "O3'" 1 
ATOM   5803  C  "C2'" . DG  B 1 138 ? 4.037   119.838 24.092  1.00 125.01 ? 284 DG  J "C2'" 1 
ATOM   5804  C  "C1'" . DG  B 1 138 ? 4.674   118.467 24.029  1.00 125.01 ? 284 DG  J "C1'" 1 
ATOM   5805  N  N9    . DG  B 1 138 ? 5.250   118.061 22.745  1.00 92.97  ? 284 DG  J N9    1 
ATOM   5806  C  C8    . DG  B 1 138 ? 4.740   118.268 21.479  1.00 92.97  ? 284 DG  J C8    1 
ATOM   5807  N  N7    . DG  B 1 138 ? 5.536   117.844 20.529  1.00 92.97  ? 284 DG  J N7    1 
ATOM   5808  C  C5    . DG  B 1 138 ? 6.634   117.313 21.206  1.00 92.97  ? 284 DG  J C5    1 
ATOM   5809  C  C6    . DG  B 1 138 ? 7.847   116.712 20.708  1.00 92.97  ? 284 DG  J C6    1 
ATOM   5810  O  O6    . DG  B 1 138 ? 8.202   116.524 19.530  1.00 92.97  ? 284 DG  J O6    1 
ATOM   5811  N  N1    . DG  B 1 138 ? 8.682   116.314 21.753  1.00 92.97  ? 284 DG  J N1    1 
ATOM   5812  C  C2    . DG  B 1 138 ? 8.399   116.455 23.092  1.00 92.97  ? 284 DG  J C2    1 
ATOM   5813  N  N2    . DG  B 1 138 ? 9.326   115.978 23.930  1.00 92.97  ? 284 DG  J N2    1 
ATOM   5814  N  N3    . DG  B 1 138 ? 7.294   117.012 23.566  1.00 92.97  ? 284 DG  J N3    1 
ATOM   5815  C  C4    . DG  B 1 138 ? 6.463   117.420 22.575  1.00 92.97  ? 284 DG  J C4    1 
ATOM   5816  P  P     . DA  B 1 139 ? 4.140   121.293 27.246  1.00 165.61 ? 285 DA  J P     1 
ATOM   5817  O  OP1   . DA  B 1 139 ? 2.930   121.324 28.104  1.00 165.61 ? 285 DA  J OP1   1 
ATOM   5818  O  OP2   . DA  B 1 139 ? 4.332   122.339 26.209  1.00 165.61 ? 285 DA  J OP2   1 
ATOM   5819  O  "O5'" . DA  B 1 139 ? 5.432   121.213 28.174  1.00 125.20 ? 285 DA  J "O5'" 1 
ATOM   5820  C  "C5'" . DA  B 1 139 ? 5.655   120.081 29.012  1.00 125.20 ? 285 DA  J "C5'" 1 
ATOM   5821  C  "C4'" . DA  B 1 139 ? 7.093   119.630 28.911  1.00 125.20 ? 285 DA  J "C4'" 1 
ATOM   5822  O  "O4'" . DA  B 1 139 ? 7.369   119.191 27.552  1.00 125.20 ? 285 DA  J "O4'" 1 
ATOM   5823  C  "C3'" . DA  B 1 139 ? 8.133   120.714 29.224  1.00 125.20 ? 285 DA  J "C3'" 1 
ATOM   5824  O  "O3'" . DA  B 1 139 ? 9.224   120.160 29.975  1.00 125.20 ? 285 DA  J "O3'" 1 
ATOM   5825  C  "C2'" . DA  B 1 139 ? 8.627   121.126 27.850  1.00 125.20 ? 285 DA  J "C2'" 1 
ATOM   5826  C  "C1'" . DA  B 1 139 ? 8.581   119.799 27.123  1.00 125.20 ? 285 DA  J "C1'" 1 
ATOM   5827  N  N9    . DA  B 1 139 ? 8.592   119.884 25.659  1.00 104.16 ? 285 DA  J N9    1 
ATOM   5828  C  C8    . DA  B 1 139 ? 7.606   120.328 24.812  1.00 104.16 ? 285 DA  J C8    1 
ATOM   5829  N  N7    . DA  B 1 139 ? 7.949   120.309 23.543  1.00 104.16 ? 285 DA  J N7    1 
ATOM   5830  C  C5    . DA  B 1 139 ? 9.249   119.811 23.551  1.00 104.16 ? 285 DA  J C5    1 
ATOM   5831  C  C6    . DA  B 1 139 ? 10.187  119.550 22.513  1.00 104.16 ? 285 DA  J C6    1 
ATOM   5832  N  N6    . DA  B 1 139 ? 9.956   119.774 21.213  1.00 104.16 ? 285 DA  J N6    1 
ATOM   5833  N  N1    . DA  B 1 139 ? 11.389  119.044 22.868  1.00 104.16 ? 285 DA  J N1    1 
ATOM   5834  C  C2    . DA  B 1 139 ? 11.633  118.825 24.168  1.00 104.16 ? 285 DA  J C2    1 
ATOM   5835  N  N3    . DA  B 1 139 ? 10.847  119.036 25.226  1.00 104.16 ? 285 DA  J N3    1 
ATOM   5836  C  C4    . DA  B 1 139 ? 9.654   119.535 24.847  1.00 104.16 ? 285 DA  J C4    1 
ATOM   5837  P  P     . DT  B 1 140 ? 10.556  121.036 30.221  1.00 153.15 ? 286 DT  J P     1 
ATOM   5838  O  OP1   . DT  B 1 140 ? 11.292  120.449 31.371  1.00 153.15 ? 286 DT  J OP1   1 
ATOM   5839  O  OP2   . DT  B 1 140 ? 10.180  122.476 30.245  1.00 153.15 ? 286 DT  J OP2   1 
ATOM   5840  O  "O5'" . DT  B 1 140 ? 11.445  120.768 28.927  1.00 170.64 ? 286 DT  J "O5'" 1 
ATOM   5841  C  "C5'" . DT  B 1 140 ? 12.171  119.548 28.788  1.00 170.64 ? 286 DT  J "C5'" 1 
ATOM   5842  C  "C4'" . DT  B 1 140 ? 13.501  119.790 28.111  1.00 170.64 ? 286 DT  J "C4'" 1 
ATOM   5843  O  "O4'" . DT  B 1 140 ? 13.337  119.989 26.684  1.00 170.64 ? 286 DT  J "O4'" 1 
ATOM   5844  C  "C3'" . DT  B 1 140 ? 14.316  120.981 28.619  1.00 170.64 ? 286 DT  J "C3'" 1 
ATOM   5845  O  "O3'" . DT  B 1 140 ? 15.677  120.558 28.802  1.00 170.64 ? 286 DT  J "O3'" 1 
ATOM   5846  C  "C2'" . DT  B 1 140 ? 14.153  122.022 27.517  1.00 170.64 ? 286 DT  J "C2'" 1 
ATOM   5847  C  "C1'" . DT  B 1 140 ? 14.026  121.163 26.269  1.00 170.64 ? 286 DT  J "C1'" 1 
ATOM   5848  N  N1    . DT  B 1 140 ? 13.286  121.744 25.113  1.00 55.99  ? 286 DT  J N1    1 
ATOM   5849  C  C2    . DT  B 1 140 ? 13.802  121.520 23.843  1.00 55.99  ? 286 DT  J C2    1 
ATOM   5850  O  O2    . DT  B 1 140 ? 14.852  120.923 23.640  1.00 55.99  ? 286 DT  J O2    1 
ATOM   5851  N  N3    . DT  B 1 140 ? 13.037  122.017 22.814  1.00 55.99  ? 286 DT  J N3    1 
ATOM   5852  C  C4    . DT  B 1 140 ? 11.844  122.694 22.914  1.00 55.99  ? 286 DT  J C4    1 
ATOM   5853  O  O4    . DT  B 1 140 ? 11.261  123.053 21.893  1.00 55.99  ? 286 DT  J O4    1 
ATOM   5854  C  C5    . DT  B 1 140 ? 11.371  122.916 24.265  1.00 55.99  ? 286 DT  J C5    1 
ATOM   5855  C  C7    . DT  B 1 140 ? 10.078  123.645 24.459  1.00 55.99  ? 286 DT  J C7    1 
ATOM   5856  C  C6    . DT  B 1 140 ? 12.111  122.448 25.287  1.00 55.99  ? 286 DT  J C6    1 
ATOM   5857  P  P     . DA  B 1 141 ? 16.874  121.631 28.784  1.00 122.19 ? 287 DA  J P     1 
ATOM   5858  O  OP1   . DA  B 1 141 ? 18.080  121.011 29.395  1.00 122.19 ? 287 DA  J OP1   1 
ATOM   5859  O  OP2   . DA  B 1 141 ? 16.391  122.945 29.283  1.00 122.19 ? 287 DA  J OP2   1 
ATOM   5860  O  "O5'" . DA  B 1 141 ? 17.164  121.801 27.234  1.00 91.86  ? 287 DA  J "O5'" 1 
ATOM   5861  C  "C5'" . DA  B 1 141 ? 18.398  122.325 26.787  1.00 91.86  ? 287 DA  J "C5'" 1 
ATOM   5862  C  "C4'" . DA  B 1 141 ? 18.842  121.598 25.543  1.00 91.86  ? 287 DA  J "C4'" 1 
ATOM   5863  O  "O4'" . DA  B 1 141 ? 17.774  121.592 24.565  1.00 91.86  ? 287 DA  J "O4'" 1 
ATOM   5864  C  "C3'" . DA  B 1 141 ? 20.013  122.302 24.886  1.00 91.86  ? 287 DA  J "C3'" 1 
ATOM   5865  O  "O3'" . DA  B 1 141 ? 20.930  121.360 24.351  1.00 91.86  ? 287 DA  J "O3'" 1 
ATOM   5866  C  "C2'" . DA  B 1 141 ? 19.366  123.176 23.824  1.00 91.86  ? 287 DA  J "C2'" 1 
ATOM   5867  C  "C1'" . DA  B 1 141 ? 18.080  122.443 23.462  1.00 91.86  ? 287 DA  J "C1'" 1 
ATOM   5868  N  N9    . DA  B 1 141 ? 16.931  123.338 23.254  1.00 62.59  ? 287 DA  J N9    1 
ATOM   5869  C  C8    . DA  B 1 141 ? 16.216  123.995 24.227  1.00 62.59  ? 287 DA  J C8    1 
ATOM   5870  N  N7    . DA  B 1 141 ? 15.218  124.710 23.764  1.00 62.59  ? 287 DA  J N7    1 
ATOM   5871  C  C5    . DA  B 1 141 ? 15.279  124.521 22.393  1.00 62.59  ? 287 DA  J C5    1 
ATOM   5872  C  C6    . DA  B 1 141 ? 14.488  125.006 21.339  1.00 62.59  ? 287 DA  J C6    1 
ATOM   5873  N  N6    . DA  B 1 141 ? 13.440  125.808 21.504  1.00 62.59  ? 287 DA  J N6    1 
ATOM   5874  N  N1    . DA  B 1 141 ? 14.815  124.633 20.090  1.00 62.59  ? 287 DA  J N1    1 
ATOM   5875  C  C2    . DA  B 1 141 ? 15.861  123.825 19.916  1.00 62.59  ? 287 DA  J C2    1 
ATOM   5876  N  N3    . DA  B 1 141 ? 16.680  123.297 20.821  1.00 62.59  ? 287 DA  J N3    1 
ATOM   5877  C  C4    . DA  B 1 141 ? 16.333  123.687 22.059  1.00 62.59  ? 287 DA  J C4    1 
ATOM   5878  P  P     . DT  B 1 142 ? 22.325  121.884 23.766  1.00 131.99 ? 288 DT  J P     1 
ATOM   5879  O  OP1   . DT  B 1 142 ? 23.242  120.727 23.592  1.00 131.99 ? 288 DT  J OP1   1 
ATOM   5880  O  OP2   . DT  B 1 142 ? 22.748  123.038 24.602  1.00 131.99 ? 288 DT  J OP2   1 
ATOM   5881  O  "O5'" . DT  B 1 142 ? 21.907  122.434 22.332  1.00 62.74  ? 288 DT  J "O5'" 1 
ATOM   5882  C  "C5'" . DT  B 1 142 ? 21.388  121.552 21.343  1.00 62.74  ? 288 DT  J "C5'" 1 
ATOM   5883  C  "C4'" . DT  B 1 142 ? 21.367  122.249 20.010  1.00 62.74  ? 288 DT  J "C4'" 1 
ATOM   5884  O  "O4'" . DT  B 1 142 ? 20.197  123.080 19.874  1.00 62.74  ? 288 DT  J "O4'" 1 
ATOM   5885  C  "C3'" . DT  B 1 142 ? 22.556  123.180 19.815  1.00 62.74  ? 288 DT  J "C3'" 1 
ATOM   5886  O  "O3'" . DT  B 1 142 ? 22.864  123.181 18.431  1.00 62.74  ? 288 DT  J "O3'" 1 
ATOM   5887  C  "C2'" . DT  B 1 142 ? 21.988  124.533 20.202  1.00 62.74  ? 288 DT  J "C2'" 1 
ATOM   5888  C  "C1'" . DT  B 1 142 ? 20.601  124.416 19.613  1.00 62.74  ? 288 DT  J "C1'" 1 
ATOM   5889  N  N1    . DT  B 1 142 ? 19.562  125.313 20.150  1.00 56.26  ? 288 DT  J N1    1 
ATOM   5890  C  C2    . DT  B 1 142 ? 18.540  125.654 19.293  1.00 56.26  ? 288 DT  J C2    1 
ATOM   5891  O  O2    . DT  B 1 142 ? 18.504  125.309 18.125  1.00 56.26  ? 288 DT  J O2    1 
ATOM   5892  N  N3    . DT  B 1 142 ? 17.559  126.416 19.850  1.00 56.26  ? 288 DT  J N3    1 
ATOM   5893  C  C4    . DT  B 1 142 ? 17.485  126.868 21.139  1.00 56.26  ? 288 DT  J C4    1 
ATOM   5894  O  O4    . DT  B 1 142 ? 16.499  127.516 21.483  1.00 56.26  ? 288 DT  J O4    1 
ATOM   5895  C  C5    . DT  B 1 142 ? 18.617  126.509 21.986  1.00 56.26  ? 288 DT  J C5    1 
ATOM   5896  C  C7    . DT  B 1 142 ? 18.649  126.973 23.403  1.00 56.26  ? 288 DT  J C7    1 
ATOM   5897  C  C6    . DT  B 1 142 ? 19.588  125.766 21.451  1.00 56.26  ? 288 DT  J C6    1 
ATOM   5898  P  P     . DT  B 1 143 ? 24.382  123.317 17.949  1.00 56.91  ? 289 DT  J P     1 
ATOM   5899  O  OP1   . DT  B 1 143 ? 24.966  121.970 17.665  1.00 56.91  ? 289 DT  J OP1   1 
ATOM   5900  O  OP2   . DT  B 1 143 ? 25.073  124.248 18.877  1.00 56.91  ? 289 DT  J OP2   1 
ATOM   5901  O  "O5'" . DT  B 1 143 ? 24.200  124.109 16.597  1.00 41.19  ? 289 DT  J "O5'" 1 
ATOM   5902  C  "C5'" . DT  B 1 143 ? 23.774  125.448 16.659  1.00 41.19  ? 289 DT  J "C5'" 1 
ATOM   5903  C  "C4'" . DT  B 1 143 ? 22.742  125.713 15.597  1.00 41.19  ? 289 DT  J "C4'" 1 
ATOM   5904  O  "O4'" . DT  B 1 143 ? 21.487  126.041 16.242  1.00 41.19  ? 289 DT  J "O4'" 1 
ATOM   5905  C  "C3'" . DT  B 1 143 ? 23.151  126.940 14.798  1.00 41.19  ? 289 DT  J "C3'" 1 
ATOM   5906  O  "O3'" . DT  B 1 143 ? 22.995  126.755 13.397  1.00 41.19  ? 289 DT  J "O3'" 1 
ATOM   5907  C  "C2'" . DT  B 1 143 ? 22.322  128.072 15.375  1.00 41.19  ? 289 DT  J "C2'" 1 
ATOM   5908  C  "C1'" . DT  B 1 143 ? 21.105  127.385 15.956  1.00 41.19  ? 289 DT  J "C1'" 1 
ATOM   5909  N  N1    . DT  B 1 143 ? 20.627  128.011 17.212  1.00 33.86  ? 289 DT  J N1    1 
ATOM   5910  C  C2    . DT  B 1 143 ? 19.453  128.741 17.167  1.00 33.86  ? 289 DT  J C2    1 
ATOM   5911  O  O2    . DT  B 1 143 ? 18.793  128.893 16.147  1.00 33.86  ? 289 DT  J O2    1 
ATOM   5912  N  N3    . DT  B 1 143 ? 19.076  129.288 18.367  1.00 33.86  ? 289 DT  J N3    1 
ATOM   5913  C  C4    . DT  B 1 143 ? 19.723  129.169 19.587  1.00 33.86  ? 289 DT  J C4    1 
ATOM   5914  O  O4    . DT  B 1 143 ? 19.235  129.705 20.588  1.00 33.86  ? 289 DT  J O4    1 
ATOM   5915  C  C5    . DT  B 1 143 ? 20.952  128.388 19.563  1.00 33.86  ? 289 DT  J C5    1 
ATOM   5916  C  C7    . DT  B 1 143 ? 21.723  128.197 20.829  1.00 33.86  ? 289 DT  J C7    1 
ATOM   5917  C  C6    . DT  B 1 143 ? 21.337  127.864 18.392  1.00 33.86  ? 289 DT  J C6    1 
ATOM   5918  P  P     . DG  B 1 144 ? 23.937  127.587 12.406  1.00 41.87  ? 290 DG  J P     1 
ATOM   5919  O  OP1   . DG  B 1 144 ? 24.003  126.934 11.087  1.00 41.87  ? 290 DG  J OP1   1 
ATOM   5920  O  OP2   . DG  B 1 144 ? 25.186  127.891 13.142  1.00 41.87  ? 290 DG  J OP2   1 
ATOM   5921  O  "O5'" . DG  B 1 144 ? 23.164  128.971 12.251  1.00 47.43  ? 290 DG  J "O5'" 1 
ATOM   5922  C  "C5'" . DG  B 1 144 ? 21.866  129.018 11.657  1.00 47.43  ? 290 DG  J "C5'" 1 
ATOM   5923  C  "C4'" . DG  B 1 144 ? 21.292  130.410 11.767  1.00 47.43  ? 290 DG  J "C4'" 1 
ATOM   5924  O  "O4'" . DG  B 1 144 ? 20.840  130.665 13.118  1.00 47.43  ? 290 DG  J "O4'" 1 
ATOM   5925  C  "C3'" . DG  B 1 144 ? 22.280  131.526 11.427  1.00 47.43  ? 290 DG  J "C3'" 1 
ATOM   5926  O  "O3'" . DG  B 1 144 ? 21.622  132.527 10.649  1.00 47.43  ? 290 DG  J "O3'" 1 
ATOM   5927  C  "C2'" . DG  B 1 144 ? 22.664  132.072 12.789  1.00 47.43  ? 290 DG  J "C2'" 1 
ATOM   5928  C  "C1'" . DG  B 1 144 ? 21.390  131.878 13.575  1.00 47.43  ? 290 DG  J "C1'" 1 
ATOM   5929  N  N9    . DG  B 1 144 ? 21.599  131.747 15.001  1.00 39.78  ? 290 DG  J N9    1 
ATOM   5930  C  C8    . DG  B 1 144 ? 22.684  131.205 15.632  1.00 39.78  ? 290 DG  J C8    1 
ATOM   5931  N  N7    . DG  B 1 144 ? 22.594  131.244 16.934  1.00 39.78  ? 290 DG  J N7    1 
ATOM   5932  C  C5    . DG  B 1 144 ? 21.366  131.841 17.170  1.00 39.78  ? 290 DG  J C5    1 
ATOM   5933  C  C6    . DG  B 1 144 ? 20.715  132.157 18.397  1.00 39.78  ? 290 DG  J C6    1 
ATOM   5934  O  O6    . DG  B 1 144 ? 21.103  131.930 19.560  1.00 39.78  ? 290 DG  J O6    1 
ATOM   5935  N  N1    . DG  B 1 144 ? 19.497  132.794 18.177  1.00 39.78  ? 290 DG  J N1    1 
ATOM   5936  C  C2    . DG  B 1 144 ? 18.971  133.074 16.939  1.00 39.78  ? 290 DG  J C2    1 
ATOM   5937  N  N2    . DG  B 1 144 ? 17.806  133.724 16.936  1.00 39.78  ? 290 DG  J N2    1 
ATOM   5938  N  N3    . DG  B 1 144 ? 19.549  132.756 15.791  1.00 39.78  ? 290 DG  J N3    1 
ATOM   5939  C  C4    . DG  B 1 144 ? 20.741  132.155 15.983  1.00 39.78  ? 290 DG  J C4    1 
ATOM   5940  P  P     . DA  B 1 145 ? 22.482  133.644 9.886   1.00 59.35  ? 291 DA  J P     1 
ATOM   5941  O  OP1   . DA  B 1 145 ? 22.549  133.260 8.454   1.00 59.35  ? 291 DA  J OP1   1 
ATOM   5942  O  OP2   . DA  B 1 145 ? 23.748  133.881 10.646  1.00 59.35  ? 291 DA  J OP2   1 
ATOM   5943  O  "O5'" . DA  B 1 145 ? 21.520  134.908 9.976   1.00 75.17  ? 291 DA  J "O5'" 1 
ATOM   5944  C  "C5'" . DA  B 1 145 ? 20.131  134.771 9.672   1.00 75.17  ? 291 DA  J "C5'" 1 
ATOM   5945  C  "C4'" . DA  B 1 145 ? 19.311  135.754 10.477  1.00 75.17  ? 291 DA  J "C4'" 1 
ATOM   5946  O  "O4'" . DA  B 1 145 ? 19.312  135.389 11.882  1.00 75.17  ? 291 DA  J "O4'" 1 
ATOM   5947  C  "C3'" . DA  B 1 145 ? 19.804  137.198 10.406  1.00 75.17  ? 291 DA  J "C3'" 1 
ATOM   5948  O  "O3'" . DA  B 1 145 ? 18.700  138.101 10.224  1.00 75.17  ? 291 DA  J "O3'" 1 
ATOM   5949  C  "C2'" . DA  B 1 145 ? 20.480  137.410 11.748  1.00 75.17  ? 291 DA  J "C2'" 1 
ATOM   5950  C  "C1'" . DA  B 1 145 ? 19.705  136.494 12.677  1.00 75.17  ? 291 DA  J "C1'" 1 
ATOM   5951  N  N9    . DA  B 1 145 ? 20.548  135.999 13.764  1.00 43.24  ? 291 DA  J N9    1 
ATOM   5952  C  C8    . DA  B 1 145 ? 21.725  135.305 13.625  1.00 43.24  ? 291 DA  J C8    1 
ATOM   5953  N  N7    . DA  B 1 145 ? 22.344  135.069 14.764  1.00 43.24  ? 291 DA  J N7    1 
ATOM   5954  C  C5    . DA  B 1 145 ? 21.511  135.629 15.719  1.00 43.24  ? 291 DA  J C5    1 
ATOM   5955  C  C6    . DA  B 1 145 ? 21.617  135.732 17.113  1.00 43.24  ? 291 DA  J C6    1 
ATOM   5956  N  N6    . DA  B 1 145 ? 22.652  135.271 17.815  1.00 43.24  ? 291 DA  J N6    1 
ATOM   5957  N  N1    . DA  B 1 145 ? 20.610  136.341 17.776  1.00 43.24  ? 291 DA  J N1    1 
ATOM   5958  C  C2    . DA  B 1 145 ? 19.575  136.811 17.079  1.00 43.24  ? 291 DA  J C2    1 
ATOM   5959  N  N3    . DA  B 1 145 ? 19.360  136.784 15.763  1.00 43.24  ? 291 DA  J N3    1 
ATOM   5960  C  C4    . DA  B 1 145 ? 20.382  136.177 15.125  1.00 43.24  ? 291 DA  J C4    1 
ATOM   5961  P  P     . DT  B 1 146 ? 18.974  139.663 9.900   1.00 56.82  ? 292 DT  J P     1 
ATOM   5962  O  OP1   . DT  B 1 146 ? 17.736  140.208 9.261   1.00 56.82  ? 292 DT  J OP1   1 
ATOM   5963  O  OP2   . DT  B 1 146 ? 20.293  139.806 9.214   1.00 56.82  ? 292 DT  J OP2   1 
ATOM   5964  O  "O5'" . DT  B 1 146 ? 19.103  140.302 11.349  1.00 53.78  ? 292 DT  J "O5'" 1 
ATOM   5965  C  "C5'" . DT  B 1 146 ? 18.017  140.236 12.268  1.00 53.78  ? 292 DT  J "C5'" 1 
ATOM   5966  C  "C4'" . DT  B 1 146 ? 18.365  141.010 13.514  1.00 53.78  ? 292 DT  J "C4'" 1 
ATOM   5967  O  "O4'" . DT  B 1 146 ? 19.230  140.233 14.382  1.00 53.78  ? 292 DT  J "O4'" 1 
ATOM   5968  C  "C3'" . DT  B 1 146 ? 19.120  142.312 13.224  1.00 53.78  ? 292 DT  J "C3'" 1 
ATOM   5969  O  "O3'" . DT  B 1 146 ? 18.687  143.321 14.148  1.00 53.78  ? 292 DT  J "O3'" 1 
ATOM   5970  C  "C2'" . DT  B 1 146 ? 20.564  141.936 13.521  1.00 53.78  ? 292 DT  J "C2'" 1 
ATOM   5971  C  "C1'" . DT  B 1 146 ? 20.365  141.014 14.708  1.00 53.78  ? 292 DT  J "C1'" 1 
ATOM   5972  N  N1    . DT  B 1 146 ? 21.484  140.113 15.065  1.00 57.75  ? 292 DT  J N1    1 
ATOM   5973  C  C2    . DT  B 1 146 ? 21.561  139.712 16.382  1.00 57.75  ? 292 DT  J C2    1 
ATOM   5974  O  O2    . DT  B 1 146 ? 20.740  140.037 17.223  1.00 57.75  ? 292 DT  J O2    1 
ATOM   5975  N  N3    . DT  B 1 146 ? 22.638  138.918 16.683  1.00 57.75  ? 292 DT  J N3    1 
ATOM   5976  C  C4    . DT  B 1 146 ? 23.630  138.482 15.815  1.00 57.75  ? 292 DT  J C4    1 
ATOM   5977  O  O4    . DT  B 1 146 ? 24.554  137.785 16.235  1.00 57.75  ? 292 DT  J O4    1 
ATOM   5978  C  C5    . DT  B 1 146 ? 23.480  138.918 14.436  1.00 57.75  ? 292 DT  J C5    1 
ATOM   5979  C  C7    . DT  B 1 146 ? 24.497  138.483 13.423  1.00 57.75  ? 292 DT  J C7    1 
ATOM   5980  C  C6    . DT  B 1 146 ? 22.425  139.702 14.134  1.00 57.75  ? 292 DT  J C6    1 
ATOM   5981  N  N     . PRO C 2 19  ? 85.595  127.850 -1.418  1.00 106.36 ? 38  PRO A N     1 
ATOM   5982  C  CA    . PRO C 2 19  ? 85.568  126.379 -1.251  1.00 106.36 ? 38  PRO A CA    1 
ATOM   5983  C  C     . PRO C 2 19  ? 84.377  125.749 -1.958  1.00 106.36 ? 38  PRO A C     1 
ATOM   5984  O  O     . PRO C 2 19  ? 83.423  126.432 -2.347  1.00 106.36 ? 38  PRO A O     1 
ATOM   5985  C  CB    . PRO C 2 19  ? 85.480  126.088 0.245   1.00 84.25  ? 38  PRO A CB    1 
ATOM   5986  C  CG    . PRO C 2 19  ? 86.020  127.374 0.845   1.00 84.25  ? 38  PRO A CG    1 
ATOM   5987  C  CD    . PRO C 2 19  ? 85.506  128.487 -0.093  1.00 84.25  ? 38  PRO A CD    1 
ATOM   5988  N  N     . HIS C 2 20  ? 84.440  124.431 -2.107  1.00 129.33 ? 39  HIS A N     1 
ATOM   5989  C  CA    . HIS C 2 20  ? 83.372  123.689 -2.750  1.00 129.33 ? 39  HIS A CA    1 
ATOM   5990  C  C     . HIS C 2 20  ? 82.356  123.251 -1.727  1.00 129.33 ? 39  HIS A C     1 
ATOM   5991  O  O     . HIS C 2 20  ? 82.700  122.844 -0.616  1.00 129.33 ? 39  HIS A O     1 
ATOM   5992  C  CB    . HIS C 2 20  ? 83.901  122.454 -3.458  1.00 81.91  ? 39  HIS A CB    1 
ATOM   5993  C  CG    . HIS C 2 20  ? 82.864  121.746 -4.270  1.00 81.91  ? 39  HIS A CG    1 
ATOM   5994  N  ND1   . HIS C 2 20  ? 82.075  120.740 -3.755  1.00 81.91  ? 39  HIS A ND1   1 
ATOM   5995  C  CD2   . HIS C 2 20  ? 82.497  121.892 -5.566  1.00 81.91  ? 39  HIS A CD2   1 
ATOM   5996  C  CE1   . HIS C 2 20  ? 81.271  120.293 -4.703  1.00 81.91  ? 39  HIS A CE1   1 
ATOM   5997  N  NE2   . HIS C 2 20  ? 81.507  120.975 -5.810  1.00 81.91  ? 39  HIS A NE2   1 
ATOM   5998  N  N     . ARG C 2 21  ? 81.103  123.249 -2.148  1.00 69.13  ? 40  ARG A N     1 
ATOM   5999  C  CA    . ARG C 2 21  ? 80.028  122.874 -1.257  1.00 69.13  ? 40  ARG A CA    1 
ATOM   6000  C  C     . ARG C 2 21  ? 78.762  122.563 -2.063  1.00 69.13  ? 40  ARG A C     1 
ATOM   6001  O  O     . ARG C 2 21  ? 78.324  123.360 -2.894  1.00 69.13  ? 40  ARG A O     1 
ATOM   6002  C  CB    . ARG C 2 21  ? 79.796  124.027 -0.270  1.00 55.90  ? 40  ARG A CB    1 
ATOM   6003  C  CG    . ARG C 2 21  ? 79.092  123.647 1.003   1.00 55.90  ? 40  ARG A CG    1 
ATOM   6004  C  CD    . ARG C 2 21  ? 78.797  124.873 1.812   1.00 55.90  ? 40  ARG A CD    1 
ATOM   6005  N  NE    . ARG C 2 21  ? 77.690  124.648 2.730   1.00 55.90  ? 40  ARG A NE    1 
ATOM   6006  C  CZ    . ARG C 2 21  ? 77.779  123.935 3.843   1.00 55.90  ? 40  ARG A CZ    1 
ATOM   6007  N  NH1   . ARG C 2 21  ? 78.924  123.369 4.186   1.00 55.90  ? 40  ARG A NH1   1 
ATOM   6008  N  NH2   . ARG C 2 21  ? 76.726  123.825 4.635   1.00 55.90  ? 40  ARG A NH2   1 
ATOM   6009  N  N     . TYR C 2 22  ? 78.239  121.357 -1.871  1.00 59.40  ? 41  TYR A N     1 
ATOM   6010  C  CA    . TYR C 2 22  ? 77.023  120.897 -2.546  1.00 59.40  ? 41  TYR A CA    1 
ATOM   6011  C  C     . TYR C 2 22  ? 75.761  121.511 -1.896  1.00 59.40  ? 41  TYR A C     1 
ATOM   6012  O  O     . TYR C 2 22  ? 75.711  121.695 -0.672  1.00 59.40  ? 41  TYR A O     1 
ATOM   6013  C  CB    . TYR C 2 22  ? 76.977  119.356 -2.519  1.00 37.17  ? 41  TYR A CB    1 
ATOM   6014  C  CG    . TYR C 2 22  ? 77.894  118.667 -3.528  1.00 37.17  ? 41  TYR A CG    1 
ATOM   6015  C  CD1   . TYR C 2 22  ? 77.617  118.732 -4.896  1.00 37.17  ? 41  TYR A CD1   1 
ATOM   6016  C  CD2   . TYR C 2 22  ? 79.025  117.943 -3.118  1.00 37.17  ? 41  TYR A CD2   1 
ATOM   6017  C  CE1   . TYR C 2 22  ? 78.437  118.095 -5.843  1.00 37.17  ? 41  TYR A CE1   1 
ATOM   6018  C  CE2   . TYR C 2 22  ? 79.865  117.300 -4.065  1.00 37.17  ? 41  TYR A CE2   1 
ATOM   6019  C  CZ    . TYR C 2 22  ? 79.560  117.384 -5.430  1.00 37.17  ? 41  TYR A CZ    1 
ATOM   6020  O  OH    . TYR C 2 22  ? 80.359  116.797 -6.404  1.00 37.17  ? 41  TYR A OH    1 
ATOM   6021  N  N     . ARG C 2 23  ? 74.755  121.833 -2.713  1.00 50.55  ? 42  ARG A N     1 
ATOM   6022  C  CA    . ARG C 2 23  ? 73.515  122.447 -2.219  1.00 50.55  ? 42  ARG A CA    1 
ATOM   6023  C  C     . ARG C 2 23  ? 72.647  121.528 -1.367  1.00 50.55  ? 42  ARG A C     1 
ATOM   6024  O  O     . ARG C 2 23  ? 72.639  120.311 -1.565  1.00 50.55  ? 42  ARG A O     1 
ATOM   6025  C  CB    . ARG C 2 23  ? 72.690  123.029 -3.368  1.00 81.38  ? 42  ARG A CB    1 
ATOM   6026  C  CG    . ARG C 2 23  ? 73.298  124.271 -3.970  1.00 81.38  ? 42  ARG A CG    1 
ATOM   6027  C  CD    . ARG C 2 23  ? 72.321  124.990 -4.865  1.00 81.38  ? 42  ARG A CD    1 
ATOM   6028  N  NE    . ARG C 2 23  ? 73.002  125.963 -5.713  1.00 81.38  ? 42  ARG A NE    1 
ATOM   6029  C  CZ    . ARG C 2 23  ? 72.679  126.213 -6.984  1.00 81.38  ? 42  ARG A CZ    1 
ATOM   6030  N  NH1   . ARG C 2 23  ? 71.661  125.569 -7.553  1.00 81.38  ? 42  ARG A NH1   1 
ATOM   6031  N  NH2   . ARG C 2 23  ? 73.445  127.022 -7.725  1.00 81.38  ? 42  ARG A NH2   1 
ATOM   6032  N  N     . PRO C 2 24  ? 71.890  122.100 -0.406  1.00 42.50  ? 43  PRO A N     1 
ATOM   6033  C  CA    . PRO C 2 24  ? 71.054  121.233 0.426   1.00 42.50  ? 43  PRO A CA    1 
ATOM   6034  C  C     . PRO C 2 24  ? 70.061  120.426 -0.408  1.00 42.50  ? 43  PRO A C     1 
ATOM   6035  O  O     . PRO C 2 24  ? 69.377  120.968 -1.290  1.00 42.50  ? 43  PRO A O     1 
ATOM   6036  C  CB    . PRO C 2 24  ? 70.402  122.212 1.410   1.00 52.35  ? 43  PRO A CB    1 
ATOM   6037  C  CG    . PRO C 2 24  ? 70.406  123.518 0.683   1.00 52.35  ? 43  PRO A CG    1 
ATOM   6038  C  CD    . PRO C 2 24  ? 71.735  123.516 -0.021  1.00 52.35  ? 43  PRO A CD    1 
ATOM   6039  N  N     . GLY C 2 25  ? 70.126  119.107 -0.218  1.00 40.87  ? 44  GLY A N     1 
ATOM   6040  C  CA    . GLY C 2 25  ? 69.264  118.184 -0.930  1.00 40.87  ? 44  GLY A CA    1 
ATOM   6041  C  C     . GLY C 2 25  ? 69.949  117.423 -2.055  1.00 40.87  ? 44  GLY A C     1 
ATOM   6042  O  O     . GLY C 2 25  ? 69.379  116.459 -2.578  1.00 40.87  ? 44  GLY A O     1 
ATOM   6043  N  N     . THR C 2 26  ? 71.164  117.827 -2.430  1.00 38.61  ? 45  THR A N     1 
ATOM   6044  C  CA    . THR C 2 26  ? 71.890  117.162 -3.520  1.00 38.61  ? 45  THR A CA    1 
ATOM   6045  C  C     . THR C 2 26  ? 72.576  115.888 -3.085  1.00 38.61  ? 45  THR A C     1 
ATOM   6046  O  O     . THR C 2 26  ? 72.438  114.860 -3.730  1.00 38.61  ? 45  THR A O     1 
ATOM   6047  C  CB    . THR C 2 26  ? 72.935  118.086 -4.182  1.00 42.13  ? 45  THR A CB    1 
ATOM   6048  O  OG1   . THR C 2 26  ? 72.275  119.223 -4.745  1.00 42.13  ? 45  THR A OG1   1 
ATOM   6049  C  CG2   . THR C 2 26  ? 73.662  117.353 -5.299  1.00 42.13  ? 45  THR A CG2   1 
ATOM   6050  N  N     . VAL C 2 27  ? 73.362  115.972 -2.023  1.00 38.80  ? 46  VAL A N     1 
ATOM   6051  C  CA    . VAL C 2 27  ? 74.047  114.799 -1.504  1.00 38.80  ? 46  VAL A CA    1 
ATOM   6052  C  C     . VAL C 2 27  ? 72.987  113.755 -1.109  1.00 38.80  ? 46  VAL A C     1 
ATOM   6053  O  O     . VAL C 2 27  ? 73.125  112.575 -1.431  1.00 38.80  ? 46  VAL A O     1 
ATOM   6054  C  CB    . VAL C 2 27  ? 74.952  115.171 -0.302  1.00 50.21  ? 46  VAL A CB    1 
ATOM   6055  C  CG1   . VAL C 2 27  ? 75.609  113.938 0.292   1.00 50.21  ? 46  VAL A CG1   1 
ATOM   6056  C  CG2   . VAL C 2 27  ? 76.014  116.148 -0.757  1.00 50.21  ? 46  VAL A CG2   1 
ATOM   6057  N  N     . ALA C 2 28  ? 71.902  114.217 -0.485  1.00 43.20  ? 47  ALA A N     1 
ATOM   6058  C  CA    . ALA C 2 28  ? 70.791  113.346 -0.075  1.00 43.20  ? 47  ALA A CA    1 
ATOM   6059  C  C     . ALA C 2 28  ? 70.265  112.594 -1.295  1.00 43.20  ? 47  ALA A C     1 
ATOM   6060  O  O     . ALA C 2 28  ? 70.002  111.392 -1.244  1.00 43.20  ? 47  ALA A O     1 
ATOM   6061  C  CB    . ALA C 2 28  ? 69.650  114.176 0.545   1.00 7.11   ? 47  ALA A CB    1 
ATOM   6062  N  N     . LEU C 2 29  ? 70.122  113.319 -2.397  1.00 29.41  ? 48  LEU A N     1 
ATOM   6063  C  CA    . LEU C 2 29  ? 69.647  112.750 -3.647  1.00 29.41  ? 48  LEU A CA    1 
ATOM   6064  C  C     . LEU C 2 29  ? 70.531  111.580 -4.122  1.00 29.41  ? 48  LEU A C     1 
ATOM   6065  O  O     . LEU C 2 29  ? 70.033  110.487 -4.366  1.00 29.41  ? 48  LEU A O     1 
ATOM   6066  C  CB    . LEU C 2 29  ? 69.558  113.854 -4.710  1.00 42.76  ? 48  LEU A CB    1 
ATOM   6067  C  CG    . LEU C 2 29  ? 68.243  114.033 -5.480  1.00 42.76  ? 48  LEU A CG    1 
ATOM   6068  C  CD1   . LEU C 2 29  ? 67.070  113.820 -4.560  1.00 42.76  ? 48  LEU A CD1   1 
ATOM   6069  C  CD2   . LEU C 2 29  ? 68.177  115.423 -6.101  1.00 42.76  ? 48  LEU A CD2   1 
ATOM   6070  N  N     . ARG C 2 30  ? 71.841  111.776 -4.216  1.00 34.24  ? 49  ARG A N     1 
ATOM   6071  C  CA    . ARG C 2 30  ? 72.687  110.675 -4.668  1.00 34.24  ? 49  ARG A CA    1 
ATOM   6072  C  C     . ARG C 2 30  ? 72.774  109.519 -3.655  1.00 34.24  ? 49  ARG A C     1 
ATOM   6073  O  O     . ARG C 2 30  ? 73.093  108.389 -4.017  1.00 34.24  ? 49  ARG A O     1 
ATOM   6074  C  CB    . ARG C 2 30  ? 74.065  111.167 -5.116  1.00 43.06  ? 49  ARG A CB    1 
ATOM   6075  C  CG    . ARG C 2 30  ? 75.001  111.613 -4.008  1.00 43.06  ? 49  ARG A CG    1 
ATOM   6076  C  CD    . ARG C 2 30  ? 76.418  111.847 -4.576  1.00 43.06  ? 49  ARG A CD    1 
ATOM   6077  N  NE    . ARG C 2 30  ? 77.182  112.798 -3.772  1.00 43.06  ? 49  ARG A NE    1 
ATOM   6078  C  CZ    . ARG C 2 30  ? 77.421  114.060 -4.121  1.00 43.06  ? 49  ARG A CZ    1 
ATOM   6079  N  NH1   . ARG C 2 30  ? 76.985  114.550 -5.289  1.00 43.06  ? 49  ARG A NH1   1 
ATOM   6080  N  NH2   . ARG C 2 30  ? 77.970  114.870 -3.224  1.00 43.06  ? 49  ARG A NH2   1 
ATOM   6081  N  N     . GLU C 2 31  ? 72.524  109.821 -2.386  1.00 21.20  ? 50  GLU A N     1 
ATOM   6082  C  CA    . GLU C 2 31  ? 72.494  108.806 -1.345  1.00 21.20  ? 50  GLU A CA    1 
ATOM   6083  C  C     . GLU C 2 31  ? 71.278  107.914 -1.619  1.00 21.20  ? 50  GLU A C     1 
ATOM   6084  O  O     . GLU C 2 31  ? 71.327  106.697 -1.436  1.00 21.20  ? 50  GLU A O     1 
ATOM   6085  C  CB    . GLU C 2 31  ? 72.344  109.444 0.027   1.00 31.05  ? 50  GLU A CB    1 
ATOM   6086  C  CG    . GLU C 2 31  ? 73.598  110.035 0.584   1.00 31.05  ? 50  GLU A CG    1 
ATOM   6087  C  CD    . GLU C 2 31  ? 73.391  110.568 1.993   1.00 31.05  ? 50  GLU A CD    1 
ATOM   6088  O  OE1   . GLU C 2 31  ? 72.900  109.827 2.876   1.00 31.05  ? 50  GLU A OE1   1 
ATOM   6089  O  OE2   . GLU C 2 31  ? 73.700  111.752 2.227   1.00 31.05  ? 50  GLU A OE2   1 
ATOM   6090  N  N     . ILE C 2 32  ? 70.169  108.534 -2.010  1.00 20.69  ? 51  ILE A N     1 
ATOM   6091  C  CA    . ILE C 2 32  ? 68.962  107.786 -2.342  1.00 20.69  ? 51  ILE A CA    1 
ATOM   6092  C  C     . ILE C 2 32  ? 69.353  106.880 -3.489  1.00 20.69  ? 51  ILE A C     1 
ATOM   6093  O  O     . ILE C 2 32  ? 69.295  105.669 -3.370  1.00 20.69  ? 51  ILE A O     1 
ATOM   6094  C  CB    . ILE C 2 32  ? 67.800  108.745 -2.732  1.00 9.99   ? 51  ILE A CB    1 
ATOM   6095  C  CG1   . ILE C 2 32  ? 67.312  109.466 -1.477  1.00 9.99   ? 51  ILE A CG1   1 
ATOM   6096  C  CG2   . ILE C 2 32  ? 66.642  108.014 -3.377  1.00 9.99   ? 51  ILE A CG2   1 
ATOM   6097  C  CD1   . ILE C 2 32  ? 66.251  110.456 -1.750  1.00 9.99   ? 51  ILE A CD1   1 
ATOM   6098  N  N     . ARG C 2 33  ? 69.889  107.461 -4.547  1.00 18.39  ? 52  ARG A N     1 
ATOM   6099  C  CA    . ARG C 2 33  ? 70.304  106.663 -5.680  1.00 18.39  ? 52  ARG A CA    1 
ATOM   6100  C  C     . ARG C 2 33  ? 71.193  105.472 -5.298  1.00 18.39  ? 52  ARG A C     1 
ATOM   6101  O  O     . ARG C 2 33  ? 70.942  104.352 -5.770  1.00 18.39  ? 52  ARG A O     1 
ATOM   6102  C  CB    . ARG C 2 33  ? 70.915  107.553 -6.759  1.00 59.59  ? 52  ARG A CB    1 
ATOM   6103  C  CG    . ARG C 2 33  ? 69.859  108.512 -7.256  1.00 59.59  ? 52  ARG A CG    1 
ATOM   6104  C  CD    . ARG C 2 33  ? 70.253  109.442 -8.388  1.00 59.59  ? 52  ARG A CD    1 
ATOM   6105  N  NE    . ARG C 2 33  ? 69.254  110.514 -8.481  1.00 59.59  ? 52  ARG A NE    1 
ATOM   6106  C  CZ    . ARG C 2 33  ? 69.471  111.702 -9.031  1.00 59.59  ? 52  ARG A CZ    1 
ATOM   6107  N  NH1   . ARG C 2 33  ? 70.648  111.975 -9.565  1.00 59.59  ? 52  ARG A NH1   1 
ATOM   6108  N  NH2   . ARG C 2 33  ? 68.547  112.649 -8.959  1.00 59.59  ? 52  ARG A NH2   1 
ATOM   6109  N  N     . ARG C 2 34  ? 72.160  105.689 -4.400  1.00 34.07  ? 53  ARG A N     1 
ATOM   6110  C  CA    . ARG C 2 34  ? 73.072  104.627 -3.944  1.00 34.07  ? 53  ARG A CA    1 
ATOM   6111  C  C     . ARG C 2 34  ? 72.417  103.530 -3.100  1.00 34.07  ? 53  ARG A C     1 
ATOM   6112  O  O     . ARG C 2 34  ? 72.595  102.335 -3.369  1.00 34.07  ? 53  ARG A O     1 
ATOM   6113  C  CB    . ARG C 2 34  ? 74.244  105.210 -3.151  1.00 50.84  ? 53  ARG A CB    1 
ATOM   6114  C  CG    . ARG C 2 34  ? 75.073  104.171 -2.370  1.00 50.84  ? 53  ARG A CG    1 
ATOM   6115  C  CD    . ARG C 2 34  ? 75.897  104.856 -1.297  1.00 50.84  ? 53  ARG A CD    1 
ATOM   6116  N  NE    . ARG C 2 34  ? 76.464  106.101 -1.829  1.00 50.84  ? 53  ARG A NE    1 
ATOM   6117  C  CZ    . ARG C 2 34  ? 76.654  107.231 -1.141  1.00 50.84  ? 53  ARG A CZ    1 
ATOM   6118  N  NH1   . ARG C 2 34  ? 76.337  107.309 0.148   1.00 50.84  ? 53  ARG A NH1   1 
ATOM   6119  N  NH2   . ARG C 2 34  ? 77.127  108.311 -1.764  1.00 50.84  ? 53  ARG A NH2   1 
ATOM   6120  N  N     . TYR C 2 35  ? 71.695  103.929 -2.058  1.00 27.70  ? 54  TYR A N     1 
ATOM   6121  C  CA    . TYR C 2 35  ? 71.058  102.961 -1.191  1.00 27.70  ? 54  TYR A CA    1 
ATOM   6122  C  C     . TYR C 2 35  ? 69.964  102.185 -1.880  1.00 27.70  ? 54  TYR A C     1 
ATOM   6123  O  O     . TYR C 2 35  ? 69.709  101.035 -1.533  1.00 27.70  ? 54  TYR A O     1 
ATOM   6124  C  CB    . TYR C 2 35  ? 70.553  103.626 0.069   1.00 34.70  ? 54  TYR A CB    1 
ATOM   6125  C  CG    . TYR C 2 35  ? 71.679  104.107 0.919   1.00 34.70  ? 54  TYR A CG    1 
ATOM   6126  C  CD1   . TYR C 2 35  ? 72.706  103.239 1.304   1.00 34.70  ? 54  TYR A CD1   1 
ATOM   6127  C  CD2   . TYR C 2 35  ? 71.761  105.441 1.305   1.00 34.70  ? 54  TYR A CD2   1 
ATOM   6128  C  CE1   . TYR C 2 35  ? 73.802  103.697 2.055   1.00 34.70  ? 54  TYR A CE1   1 
ATOM   6129  C  CE2   . TYR C 2 35  ? 72.841  105.914 2.059   1.00 34.70  ? 54  TYR A CE2   1 
ATOM   6130  C  CZ    . TYR C 2 35  ? 73.855  105.038 2.425   1.00 34.70  ? 54  TYR A CZ    1 
ATOM   6131  O  OH    . TYR C 2 35  ? 74.903  105.526 3.163   1.00 34.70  ? 54  TYR A OH    1 
ATOM   6132  N  N     . GLN C 2 36  ? 69.289  102.808 -2.834  1.00 25.84  ? 55  GLN A N     1 
ATOM   6133  C  CA    . GLN C 2 36  ? 68.255  102.087 -3.559  1.00 25.84  ? 55  GLN A CA    1 
ATOM   6134  C  C     . GLN C 2 36  ? 68.874  100.981 -4.421  1.00 25.84  ? 55  GLN A C     1 
ATOM   6135  O  O     . GLN C 2 36  ? 68.318  99.883  -4.517  1.00 25.84  ? 55  GLN A O     1 
ATOM   6136  C  CB    . GLN C 2 36  ? 67.388  103.047 -4.370  1.00 37.88  ? 55  GLN A CB    1 
ATOM   6137  C  CG    . GLN C 2 36  ? 66.524  103.909 -3.456  1.00 37.88  ? 55  GLN A CG    1 
ATOM   6138  C  CD    . GLN C 2 36  ? 65.351  104.563 -4.165  1.00 37.88  ? 55  GLN A CD    1 
ATOM   6139  O  OE1   . GLN C 2 36  ? 65.374  104.757 -5.384  1.00 37.88  ? 55  GLN A OE1   1 
ATOM   6140  N  NE2   . GLN C 2 36  ? 64.303  104.888 -3.406  1.00 37.88  ? 55  GLN A NE2   1 
ATOM   6141  N  N     . LYS C 2 37  ? 70.067  101.253 -4.957  1.00 32.05  ? 56  LYS A N     1 
ATOM   6142  C  CA    . LYS C 2 37  ? 70.814  100.307 -5.795  1.00 32.05  ? 56  LYS A CA    1 
ATOM   6143  C  C     . LYS C 2 37  ? 71.347  99.095  -5.025  1.00 32.05  ? 56  LYS A C     1 
ATOM   6144  O  O     . LYS C 2 37  ? 71.294  97.966  -5.523  1.00 32.05  ? 56  LYS A O     1 
ATOM   6145  C  CB    . LYS C 2 37  ? 71.981  101.013 -6.502  1.00 92.65  ? 56  LYS A CB    1 
ATOM   6146  C  CG    . LYS C 2 37  ? 71.563  102.003 -7.577  1.00 92.65  ? 56  LYS A CG    1 
ATOM   6147  C  CD    . LYS C 2 37  ? 72.765  102.748 -8.168  1.00 92.65  ? 56  LYS A CD    1 
ATOM   6148  C  CE    . LYS C 2 37  ? 72.328  103.780 -9.225  1.00 92.65  ? 56  LYS A CE    1 
ATOM   6149  N  NZ    . LYS C 2 37  ? 73.454  104.621 -9.752  1.00 92.65  ? 56  LYS A NZ    1 
ATOM   6150  N  N     . SER C 2 38  ? 71.893  99.338  -3.835  1.00 27.56  ? 57  SER A N     1 
ATOM   6151  C  CA    . SER C 2 38  ? 72.446  98.271  -3.011  1.00 27.56  ? 57  SER A CA    1 
ATOM   6152  C  C     . SER C 2 38  ? 71.381  97.528  -2.196  1.00 27.56  ? 57  SER A C     1 
ATOM   6153  O  O     . SER C 2 38  ? 70.183  97.839  -2.305  1.00 27.56  ? 57  SER A O     1 
ATOM   6154  C  CB    . SER C 2 38  ? 73.524  98.840  -2.098  1.00 27.72  ? 57  SER A CB    1 
ATOM   6155  O  OG    . SER C 2 38  ? 73.004  99.866  -1.272  1.00 27.72  ? 57  SER A OG    1 
ATOM   6156  N  N     . THR C 2 39  ? 71.820  96.539  -1.400  1.00 20.76  ? 58  THR A N     1 
ATOM   6157  C  CA    . THR C 2 39  ? 70.920  95.737  -0.563  1.00 20.76  ? 58  THR A CA    1 
ATOM   6158  C  C     . THR C 2 39  ? 71.471  95.419  0.824   1.00 20.76  ? 58  THR A C     1 
ATOM   6159  O  O     . THR C 2 39  ? 70.818  94.754  1.614   1.00 20.76  ? 58  THR A O     1 
ATOM   6160  C  CB    . THR C 2 39  ? 70.580  94.381  -1.214  1.00 18.87  ? 58  THR A CB    1 
ATOM   6161  O  OG1   . THR C 2 39  ? 71.745  93.555  -1.211  1.00 18.87  ? 58  THR A OG1   1 
ATOM   6162  C  CG2   . THR C 2 39  ? 70.065  94.550  -2.664  1.00 18.87  ? 58  THR A CG2   1 
ATOM   6163  N  N     . GLU C 2 40  ? 72.678  95.880  1.112   1.00 20.79  ? 59  GLU A N     1 
ATOM   6164  C  CA    . GLU C 2 40  ? 73.324  95.633  2.406   1.00 20.79  ? 59  GLU A CA    1 
ATOM   6165  C  C     . GLU C 2 40  ? 72.454  96.142  3.550   1.00 20.79  ? 59  GLU A C     1 
ATOM   6166  O  O     . GLU C 2 40  ? 71.641  97.037  3.348   1.00 20.79  ? 59  GLU A O     1 
ATOM   6167  C  CB    . GLU C 2 40  ? 74.700  96.315  2.442   1.00 49.37  ? 59  GLU A CB    1 
ATOM   6168  C  CG    . GLU C 2 40  ? 75.028  97.245  1.234   1.00 49.37  ? 59  GLU A CG    1 
ATOM   6169  C  CD    . GLU C 2 40  ? 74.631  98.718  1.438   1.00 49.37  ? 59  GLU A CD    1 
ATOM   6170  O  OE1   . GLU C 2 40  ? 74.040  99.042  2.484   1.00 49.37  ? 59  GLU A OE1   1 
ATOM   6171  O  OE2   . GLU C 2 40  ? 74.933  99.567  0.564   1.00 49.37  ? 59  GLU A OE2   1 
ATOM   6172  N  N     . LEU C 2 41  ? 72.551  95.538  4.725   1.00 23.94  ? 60  LEU A N     1 
ATOM   6173  C  CA    . LEU C 2 41  ? 71.750  96.025  5.846   1.00 23.94  ? 60  LEU A CA    1 
ATOM   6174  C  C     . LEU C 2 41  ? 72.263  97.420  6.185   1.00 23.94  ? 60  LEU A C     1 
ATOM   6175  O  O     . LEU C 2 41  ? 73.340  97.785  5.749   1.00 23.94  ? 60  LEU A O     1 
ATOM   6176  C  CB    . LEU C 2 41  ? 71.865  95.091  7.041   1.00 28.99  ? 60  LEU A CB    1 
ATOM   6177  C  CG    . LEU C 2 41  ? 71.216  93.731  6.795   1.00 28.99  ? 60  LEU A CG    1 
ATOM   6178  C  CD1   . LEU C 2 41  ? 71.326  92.877  8.048   1.00 28.99  ? 60  LEU A CD1   1 
ATOM   6179  C  CD2   . LEU C 2 41  ? 69.763  93.939  6.406   1.00 28.99  ? 60  LEU A CD2   1 
ATOM   6180  N  N     . LEU C 2 42  ? 71.541  98.205  6.971   1.00 16.11  ? 61  LEU A N     1 
ATOM   6181  C  CA    . LEU C 2 42  ? 72.008  99.557  7.224   1.00 16.11  ? 61  LEU A CA    1 
ATOM   6182  C  C     . LEU C 2 42  ? 72.103  99.932  8.673   1.00 16.11  ? 61  LEU A C     1 
ATOM   6183  O  O     . LEU C 2 42  ? 72.622  100.999 9.002   1.00 16.11  ? 61  LEU A O     1 
ATOM   6184  C  CB    . LEU C 2 42  ? 71.143  100.568 6.468   1.00 17.45  ? 61  LEU A CB    1 
ATOM   6185  C  CG    . LEU C 2 42  ? 70.920  100.289 4.977   1.00 17.45  ? 61  LEU A CG    1 
ATOM   6186  C  CD1   . LEU C 2 42  ? 69.761  101.117 4.432   1.00 17.45  ? 61  LEU A CD1   1 
ATOM   6187  C  CD2   . LEU C 2 42  ? 72.177  100.545 4.206   1.00 17.45  ? 61  LEU A CD2   1 
ATOM   6188  N  N     . ILE C 2 43  ? 71.555  99.108  9.546   1.00 25.59  ? 62  ILE A N     1 
ATOM   6189  C  CA    . ILE C 2 43  ? 71.679  99.393  10.966  1.00 25.59  ? 62  ILE A CA    1 
ATOM   6190  C  C     . ILE C 2 43  ? 72.970  98.666  11.392  1.00 25.59  ? 62  ILE A C     1 
ATOM   6191  O  O     . ILE C 2 43  ? 73.379  97.677  10.773  1.00 25.59  ? 62  ILE A O     1 
ATOM   6192  C  CB    . ILE C 2 43  ? 70.468  98.855  11.772  1.00 20.19  ? 62  ILE A CB    1 
ATOM   6193  C  CG1   . ILE C 2 43  ? 69.156  99.387  11.202  1.00 20.19  ? 62  ILE A CG1   1 
ATOM   6194  C  CG2   . ILE C 2 43  ? 70.543  99.332  13.212  1.00 20.19  ? 62  ILE A CG2   1 
ATOM   6195  C  CD1   . ILE C 2 43  ? 67.957  98.734  11.839  1.00 20.19  ? 62  ILE A CD1   1 
ATOM   6196  N  N     . ARG C 2 44  ? 73.672  99.167  12.391  1.00 57.10  ? 63  ARG A N     1 
ATOM   6197  C  CA    . ARG C 2 44  ? 74.872  98.447  12.780  1.00 57.10  ? 63  ARG A CA    1 
ATOM   6198  C  C     . ARG C 2 44  ? 74.501  97.161  13.559  1.00 57.10  ? 63  ARG A C     1 
ATOM   6199  O  O     . ARG C 2 44  ? 73.710  97.183  14.503  1.00 57.10  ? 63  ARG A O     1 
ATOM   6200  C  CB    . ARG C 2 44  ? 75.852  99.382  13.501  1.00 79.09  ? 63  ARG A CB    1 
ATOM   6201  C  CG    . ARG C 2 44  ? 76.911  99.974  12.547  1.00 79.09  ? 63  ARG A CG    1 
ATOM   6202  C  CD    . ARG C 2 44  ? 77.401  101.371 12.934  1.00 79.09  ? 63  ARG A CD    1 
ATOM   6203  N  NE    . ARG C 2 44  ? 77.537  101.579 14.379  1.00 79.09  ? 63  ARG A NE    1 
ATOM   6204  C  CZ    . ARG C 2 44  ? 76.774  102.417 15.084  1.00 79.09  ? 63  ARG A CZ    1 
ATOM   6205  N  NH1   . ARG C 2 44  ? 75.829  103.125 14.466  1.00 79.09  ? 63  ARG A NH1   1 
ATOM   6206  N  NH2   . ARG C 2 44  ? 76.932  102.536 16.401  1.00 79.09  ? 63  ARG A NH2   1 
ATOM   6207  N  N     . LYS C 2 45  ? 75.016  96.031  13.078  1.00 31.58  ? 64  LYS A N     1 
ATOM   6208  C  CA    . LYS C 2 45  ? 74.749  94.700  13.647  1.00 31.58  ? 64  LYS A CA    1 
ATOM   6209  C  C     . LYS C 2 45  ? 74.779  94.511  15.172  1.00 31.58  ? 64  LYS A C     1 
ATOM   6210  O  O     . LYS C 2 45  ? 73.833  93.991  15.744  1.00 31.58  ? 64  LYS A O     1 
ATOM   6211  C  CB    . LYS C 2 45  ? 75.627  93.652  12.955  1.00 55.38  ? 64  LYS A CB    1 
ATOM   6212  C  CG    . LYS C 2 45  ? 75.503  93.675  11.442  1.00 55.38  ? 64  LYS A CG    1 
ATOM   6213  C  CD    . LYS C 2 45  ? 75.417  92.275  10.869  1.00 55.38  ? 64  LYS A CD    1 
ATOM   6214  C  CE    . LYS C 2 45  ? 74.725  92.287  9.513   1.00 55.38  ? 64  LYS A CE    1 
ATOM   6215  N  NZ    . LYS C 2 45  ? 74.675  90.932  8.899   1.00 55.38  ? 64  LYS A NZ    1 
ATOM   6216  N  N     . LEU C 2 46  ? 75.856  94.901  15.839  1.00 45.79  ? 65  LEU A N     1 
ATOM   6217  C  CA    . LEU C 2 46  ? 75.911  94.741  17.289  1.00 45.79  ? 65  LEU A CA    1 
ATOM   6218  C  C     . LEU C 2 46  ? 74.819  95.515  18.024  1.00 45.79  ? 65  LEU A C     1 
ATOM   6219  O  O     . LEU C 2 46  ? 74.118  94.942  18.845  1.00 45.79  ? 65  LEU A O     1 
ATOM   6220  C  CB    . LEU C 2 46  ? 77.287  95.121  17.845  1.00 68.84  ? 65  LEU A CB    1 
ATOM   6221  C  CG    . LEU C 2 46  ? 77.401  95.152  19.375  1.00 68.84  ? 65  LEU A CG    1 
ATOM   6222  C  CD1   . LEU C 2 46  ? 77.065  93.780  19.970  1.00 68.84  ? 65  LEU A CD1   1 
ATOM   6223  C  CD2   . LEU C 2 46  ? 78.796  95.603  19.771  1.00 68.84  ? 65  LEU A CD2   1 
ATOM   6224  N  N     . PRO C 2 47  ? 74.652  96.825  17.736  1.00 51.32  ? 66  PRO A N     1 
ATOM   6225  C  CA    . PRO C 2 47  ? 73.598  97.573  18.442  1.00 51.32  ? 66  PRO A CA    1 
ATOM   6226  C  C     . PRO C 2 47  ? 72.262  96.841  18.304  1.00 51.32  ? 66  PRO A C     1 
ATOM   6227  O  O     . PRO C 2 47  ? 71.535  96.652  19.276  1.00 51.32  ? 66  PRO A O     1 
ATOM   6228  C  CB    . PRO C 2 47  ? 73.552  98.902  17.688  1.00 24.78  ? 66  PRO A CB    1 
ATOM   6229  C  CG    . PRO C 2 47  ? 74.937  99.048  17.106  1.00 24.78  ? 66  PRO A CG    1 
ATOM   6230  C  CD    . PRO C 2 47  ? 75.300  97.652  16.694  1.00 24.78  ? 66  PRO A CD    1 
ATOM   6231  N  N     . PHE C 2 48  ? 71.967  96.405  17.081  1.00 27.70  ? 67  PHE A N     1 
ATOM   6232  C  CA    . PHE C 2 48  ? 70.743  95.685  16.794  1.00 27.70  ? 67  PHE A CA    1 
ATOM   6233  C  C     . PHE C 2 48  ? 70.685  94.388  17.615  1.00 27.70  ? 67  PHE A C     1 
ATOM   6234  O  O     . PHE C 2 48  ? 69.668  94.085  18.244  1.00 27.70  ? 67  PHE A O     1 
ATOM   6235  C  CB    . PHE C 2 48  ? 70.667  95.403  15.301  1.00 39.08  ? 67  PHE A CB    1 
ATOM   6236  C  CG    . PHE C 2 48  ? 69.338  94.894  14.860  1.00 39.08  ? 67  PHE A CG    1 
ATOM   6237  C  CD1   . PHE C 2 48  ? 68.307  95.773  14.597  1.00 39.08  ? 67  PHE A CD1   1 
ATOM   6238  C  CD2   . PHE C 2 48  ? 69.096  93.529  14.766  1.00 39.08  ? 67  PHE A CD2   1 
ATOM   6239  C  CE1   . PHE C 2 48  ? 67.053  95.298  14.258  1.00 39.08  ? 67  PHE A CE1   1 
ATOM   6240  C  CE2   . PHE C 2 48  ? 67.840  93.048  14.426  1.00 39.08  ? 67  PHE A CE2   1 
ATOM   6241  C  CZ    . PHE C 2 48  ? 66.818  93.931  14.175  1.00 39.08  ? 67  PHE A CZ    1 
ATOM   6242  N  N     . GLN C 2 49  ? 71.798  93.650  17.618  1.00 28.04  ? 68  GLN A N     1 
ATOM   6243  C  CA    . GLN C 2 49  ? 71.955  92.406  18.367  1.00 28.04  ? 68  GLN A CA    1 
ATOM   6244  C  C     . GLN C 2 49  ? 71.547  92.682  19.798  1.00 28.04  ? 68  GLN A C     1 
ATOM   6245  O  O     . GLN C 2 49  ? 70.645  92.058  20.331  1.00 28.04  ? 68  GLN A O     1 
ATOM   6246  C  CB    . GLN C 2 49  ? 73.418  92.004  18.365  1.00 61.85  ? 68  GLN A CB    1 
ATOM   6247  C  CG    . GLN C 2 49  ? 73.695  90.694  19.029  1.00 61.85  ? 68  GLN A CG    1 
ATOM   6248  C  CD    . GLN C 2 49  ? 73.596  89.551  18.054  1.00 61.85  ? 68  GLN A CD    1 
ATOM   6249  O  OE1   . GLN C 2 49  ? 73.947  89.695  16.881  1.00 61.85  ? 68  GLN A OE1   1 
ATOM   6250  N  NE2   . GLN C 2 49  ? 73.120  88.406  18.524  1.00 61.85  ? 68  GLN A NE2   1 
ATOM   6251  N  N     . ARG C 2 50  ? 72.178  93.691  20.381  1.00 24.75  ? 69  ARG A N     1 
ATOM   6252  C  CA    . ARG C 2 50  ? 71.933  94.108  21.760  1.00 24.75  ? 69  ARG A CA    1 
ATOM   6253  C  C     . ARG C 2 50  ? 70.483  94.488  22.034  1.00 24.75  ? 69  ARG A C     1 
ATOM   6254  O  O     . ARG C 2 50  ? 69.936  94.127  23.073  1.00 24.75  ? 69  ARG A O     1 
ATOM   6255  C  CB    . ARG C 2 50  ? 72.854  95.280  22.119  1.00 53.70  ? 69  ARG A CB    1 
ATOM   6256  C  CG    . ARG C 2 50  ? 73.504  95.171  23.491  1.00 53.70  ? 69  ARG A CG    1 
ATOM   6257  C  CD    . ARG C 2 50  ? 74.324  96.416  23.826  1.00 53.70  ? 69  ARG A CD    1 
ATOM   6258  N  NE    . ARG C 2 50  ? 75.365  96.685  22.841  1.00 53.70  ? 69  ARG A NE    1 
ATOM   6259  C  CZ    . ARG C 2 50  ? 75.457  97.803  22.126  1.00 53.70  ? 69  ARG A CZ    1 
ATOM   6260  N  NH1   . ARG C 2 50  ? 74.568  98.784  22.273  1.00 53.70  ? 69  ARG A NH1   1 
ATOM   6261  N  NH2   . ARG C 2 50  ? 76.453  97.941  21.265  1.00 53.70  ? 69  ARG A NH2   1 
ATOM   6262  N  N     . LEU C 2 51  ? 69.887  95.245  21.111  1.00 42.28  ? 70  LEU A N     1 
ATOM   6263  C  CA    . LEU C 2 51  ? 68.498  95.675  21.225  1.00 42.28  ? 70  LEU A CA    1 
ATOM   6264  C  C     . LEU C 2 51  ? 67.534  94.481  21.235  1.00 42.28  ? 70  LEU A C     1 
ATOM   6265  O  O     . LEU C 2 51  ? 66.696  94.362  22.129  1.00 42.28  ? 70  LEU A O     1 
ATOM   6266  C  CB    . LEU C 2 51  ? 68.162  96.628  20.090  1.00 24.78  ? 70  LEU A CB    1 
ATOM   6267  C  CG    . LEU C 2 51  ? 66.775  97.262  20.145  1.00 24.78  ? 70  LEU A CG    1 
ATOM   6268  C  CD1   . LEU C 2 51  ? 66.501  97.859  21.510  1.00 24.78  ? 70  LEU A CD1   1 
ATOM   6269  C  CD2   . LEU C 2 51  ? 66.716  98.341  19.100  1.00 24.78  ? 70  LEU A CD2   1 
ATOM   6270  N  N     . VAL C 2 52  ? 67.676  93.591  20.255  1.00 16.88  ? 71  VAL A N     1 
ATOM   6271  C  CA    . VAL C 2 52  ? 66.863  92.379  20.170  1.00 16.88  ? 71  VAL A CA    1 
ATOM   6272  C  C     . VAL C 2 52  ? 66.921  91.603  21.512  1.00 16.88  ? 71  VAL A C     1 
ATOM   6273  O  O     . VAL C 2 52  ? 65.892  91.286  22.128  1.00 16.88  ? 71  VAL A O     1 
ATOM   6274  C  CB    . VAL C 2 52  ? 67.381  91.485  19.020  1.00 29.66  ? 71  VAL A CB    1 
ATOM   6275  C  CG1   . VAL C 2 52  ? 66.870  90.065  19.169  1.00 29.66  ? 71  VAL A CG1   1 
ATOM   6276  C  CG2   . VAL C 2 52  ? 66.967  92.057  17.684  1.00 29.66  ? 71  VAL A CG2   1 
ATOM   6277  N  N     . ARG C 2 53  ? 68.138  91.327  21.978  1.00 33.20  ? 72  ARG A N     1 
ATOM   6278  C  CA    . ARG C 2 53  ? 68.346  90.613  23.239  1.00 33.20  ? 72  ARG A CA    1 
ATOM   6279  C  C     . ARG C 2 53  ? 67.722  91.303  24.439  1.00 33.20  ? 72  ARG A C     1 
ATOM   6280  O  O     . ARG C 2 53  ? 67.181  90.627  25.310  1.00 33.20  ? 72  ARG A O     1 
ATOM   6281  C  CB    . ARG C 2 53  ? 69.829  90.404  23.487  1.00 31.62  ? 72  ARG A CB    1 
ATOM   6282  C  CG    . ARG C 2 53  ? 70.449  89.476  22.505  1.00 31.62  ? 72  ARG A CG    1 
ATOM   6283  C  CD    . ARG C 2 53  ? 71.908  89.411  22.741  1.00 31.62  ? 72  ARG A CD    1 
ATOM   6284  N  NE    . ARG C 2 53  ? 72.546  88.669  21.671  1.00 31.62  ? 72  ARG A NE    1 
ATOM   6285  C  CZ    . ARG C 2 53  ? 72.569  87.346  21.625  1.00 31.62  ? 72  ARG A CZ    1 
ATOM   6286  N  NH1   . ARG C 2 53  ? 71.990  86.649  22.610  1.00 31.62  ? 72  ARG A NH1   1 
ATOM   6287  N  NH2   . ARG C 2 53  ? 73.129  86.721  20.588  1.00 31.62  ? 72  ARG A NH2   1 
ATOM   6288  N  N     . GLU C 2 54  ? 67.825  92.637  24.492  1.00 34.93  ? 73  GLU A N     1 
ATOM   6289  C  CA    . GLU C 2 54  ? 67.256  93.422  25.583  1.00 34.93  ? 73  GLU A CA    1 
ATOM   6290  C  C     . GLU C 2 54  ? 65.762  93.216  25.658  1.00 34.93  ? 73  GLU A C     1 
ATOM   6291  O  O     . GLU C 2 54  ? 65.236  92.946  26.740  1.00 34.93  ? 73  GLU A O     1 
ATOM   6292  C  CB    . GLU C 2 54  ? 67.542  94.916  25.424  1.00 61.50  ? 73  GLU A CB    1 
ATOM   6293  C  CG    . GLU C 2 54  ? 66.894  95.772  26.525  1.00 61.50  ? 73  GLU A CG    1 
ATOM   6294  C  CD    . GLU C 2 54  ? 66.830  97.256  26.183  1.00 61.50  ? 73  GLU A CD    1 
ATOM   6295  O  OE1   . GLU C 2 54  ? 67.829  97.965  26.424  1.00 61.50  ? 73  GLU A OE1   1 
ATOM   6296  O  OE2   . GLU C 2 54  ? 65.779  97.719  25.679  1.00 61.50  ? 73  GLU A OE2   1 
ATOM   6297  N  N     . ILE C 2 55  ? 65.080  93.339  24.515  1.00 41.09  ? 74  ILE A N     1 
ATOM   6298  C  CA    . ILE C 2 55  ? 63.625  93.166  24.455  1.00 41.09  ? 74  ILE A CA    1 
ATOM   6299  C  C     . ILE C 2 55  ? 63.215  91.752  24.831  1.00 41.09  ? 74  ILE A C     1 
ATOM   6300  O  O     . ILE C 2 55  ? 62.276  91.551  25.616  1.00 41.09  ? 74  ILE A O     1 
ATOM   6301  C  CB    . ILE C 2 55  ? 63.071  93.422  23.058  1.00 17.06  ? 74  ILE A CB    1 
ATOM   6302  C  CG1   . ILE C 2 55  ? 63.276  94.876  22.640  1.00 17.06  ? 74  ILE A CG1   1 
ATOM   6303  C  CG2   . ILE C 2 55  ? 61.607  93.080  23.012  1.00 17.06  ? 74  ILE A CG2   1 
ATOM   6304  C  CD1   . ILE C 2 55  ? 63.088  95.090  21.146  1.00 17.06  ? 74  ILE A CD1   1 
ATOM   6305  N  N     . ALA C 2 56  ? 63.897  90.771  24.245  1.00 20.97  ? 75  ALA A N     1 
ATOM   6306  C  CA    . ALA C 2 56  ? 63.611  89.367  24.523  1.00 20.97  ? 75  ALA A CA    1 
ATOM   6307  C  C     . ALA C 2 56  ? 63.674  88.985  26.019  1.00 20.97  ? 75  ALA A C     1 
ATOM   6308  O  O     . ALA C 2 56  ? 62.897  88.147  26.483  1.00 20.97  ? 75  ALA A O     1 
ATOM   6309  C  CB    . ALA C 2 56  ? 64.529  88.493  23.699  1.00 12.53  ? 75  ALA A CB    1 
ATOM   6310  N  N     . GLN C 2 57  ? 64.618  89.570  26.759  1.00 41.77  ? 76  GLN A N     1 
ATOM   6311  C  CA    . GLN C 2 57  ? 64.766  89.309  28.197  1.00 41.77  ? 76  GLN A CA    1 
ATOM   6312  C  C     . GLN C 2 57  ? 63.467  89.557  28.973  1.00 41.77  ? 76  GLN A C     1 
ATOM   6313  O  O     . GLN C 2 57  ? 63.231  88.919  30.007  1.00 41.77  ? 76  GLN A O     1 
ATOM   6314  C  CB    . GLN C 2 57  ? 65.890  90.169  28.785  1.00 57.41  ? 76  GLN A CB    1 
ATOM   6315  C  CG    . GLN C 2 57  ? 66.298  89.801  30.217  1.00 57.41  ? 76  GLN A CG    1 
ATOM   6316  C  CD    . GLN C 2 57  ? 67.035  88.474  30.318  1.00 57.41  ? 76  GLN A CD    1 
ATOM   6317  O  OE1   . GLN C 2 57  ? 67.027  87.646  29.398  1.00 57.41  ? 76  GLN A OE1   1 
ATOM   6318  N  NE2   . GLN C 2 57  ? 67.665  88.263  31.451  1.00 57.41  ? 76  GLN A NE2   1 
ATOM   6319  N  N     . ASP C 2 58  ? 62.656  90.506  28.489  1.00 36.47  ? 77  ASP A N     1 
ATOM   6320  C  CA    . ASP C 2 58  ? 61.368  90.830  29.101  1.00 36.47  ? 77  ASP A CA    1 
ATOM   6321  C  C     . ASP C 2 58  ? 60.439  89.652  28.950  1.00 36.47  ? 77  ASP A C     1 
ATOM   6322  O  O     . ASP C 2 58  ? 59.582  89.446  29.786  1.00 36.47  ? 77  ASP A O     1 
ATOM   6323  C  CB    . ASP C 2 58  ? 60.708  92.025  28.416  1.00 84.41  ? 77  ASP A CB    1 
ATOM   6324  C  CG    . ASP C 2 58  ? 61.380  93.331  28.742  1.00 84.41  ? 77  ASP A CG    1 
ATOM   6325  O  OD1   . ASP C 2 58  ? 61.716  93.549  29.929  1.00 84.41  ? 77  ASP A OD1   1 
ATOM   6326  O  OD2   . ASP C 2 58  ? 61.553  94.147  27.808  1.00 84.41  ? 77  ASP A OD2   1 
ATOM   6327  N  N     . PHE C 2 59  ? 60.623  88.882  27.877  1.00 30.32  ? 78  PHE A N     1 
ATOM   6328  C  CA    . PHE C 2 59  ? 59.786  87.713  27.579  1.00 30.32  ? 78  PHE A CA    1 
ATOM   6329  C  C     . PHE C 2 59  ? 60.191  86.393  28.264  1.00 30.32  ? 78  PHE A C     1 
ATOM   6330  O  O     . PHE C 2 59  ? 59.342  85.599  28.685  1.00 30.32  ? 78  PHE A O     1 
ATOM   6331  C  CB    . PHE C 2 59  ? 59.683  87.542  26.055  1.00 44.69  ? 78  PHE A CB    1 
ATOM   6332  C  CG    . PHE C 2 59  ? 59.082  88.744  25.342  1.00 44.69  ? 78  PHE A CG    1 
ATOM   6333  C  CD1   . PHE C 2 59  ? 58.019  89.462  25.914  1.00 44.69  ? 78  PHE A CD1   1 
ATOM   6334  C  CD2   . PHE C 2 59  ? 59.576  89.154  24.103  1.00 44.69  ? 78  PHE A CD2   1 
ATOM   6335  C  CE1   . PHE C 2 59  ? 57.463  90.565  25.268  1.00 44.69  ? 78  PHE A CE1   1 
ATOM   6336  C  CE2   . PHE C 2 59  ? 59.026  90.256  23.449  1.00 44.69  ? 78  PHE A CE2   1 
ATOM   6337  C  CZ    . PHE C 2 59  ? 57.967  90.964  24.034  1.00 44.69  ? 78  PHE A CZ    1 
ATOM   6338  N  N     . LYS C 2 60  ? 61.486  86.124  28.286  1.00 35.07  ? 79  LYS A N     1 
ATOM   6339  C  CA    . LYS C 2 60  ? 62.014  84.939  28.942  1.00 35.07  ? 79  LYS A CA    1 
ATOM   6340  C  C     . LYS C 2 60  ? 63.497  85.162  29.162  1.00 35.07  ? 79  LYS A C     1 
ATOM   6341  O  O     . LYS C 2 60  ? 64.196  85.686  28.287  1.00 35.07  ? 79  LYS A O     1 
ATOM   6342  C  CB    . LYS C 2 60  ? 61.788  83.686  28.123  1.00 56.97  ? 79  LYS A CB    1 
ATOM   6343  C  CG    . LYS C 2 60  ? 62.194  82.452  28.884  1.00 56.97  ? 79  LYS A CG    1 
ATOM   6344  C  CD    . LYS C 2 60  ? 62.137  81.215  28.028  1.00 56.97  ? 79  LYS A CD    1 
ATOM   6345  C  CE    . LYS C 2 60  ? 62.841  80.065  28.712  1.00 56.97  ? 79  LYS A CE    1 
ATOM   6346  N  NZ    . LYS C 2 60  ? 62.923  78.913  27.775  1.00 56.97  ? 79  LYS A NZ    1 
ATOM   6347  N  N     . THR C 2 61  ? 63.971  84.800  30.348  1.00 52.81  ? 80  THR A N     1 
ATOM   6348  C  CA    . THR C 2 61  ? 65.369  84.992  30.695  1.00 52.81  ? 80  THR A CA    1 
ATOM   6349  C  C     . THR C 2 61  ? 66.318  83.876  30.313  1.00 52.81  ? 80  THR A C     1 
ATOM   6350  O  O     . THR C 2 61  ? 65.929  82.706  30.183  1.00 52.81  ? 80  THR A O     1 
ATOM   6351  C  CB    . THR C 2 61  ? 65.527  85.259  32.170  1.00 41.91  ? 80  THR A CB    1 
ATOM   6352  O  OG1   . THR C 2 61  ? 64.689  84.353  32.898  1.00 41.91  ? 80  THR A OG1   1 
ATOM   6353  C  CG2   . THR C 2 61  ? 65.149  86.678  32.483  1.00 41.91  ? 80  THR A CG2   1 
ATOM   6354  N  N     . ASP C 2 62  ? 67.583  84.277  30.186  1.00 52.49  ? 81  ASP A N     1 
ATOM   6355  C  CA    . ASP C 2 62  ? 68.700  83.412  29.816  1.00 52.49  ? 81  ASP A CA    1 
ATOM   6356  C  C     . ASP C 2 62  ? 68.443  82.743  28.487  1.00 52.49  ? 81  ASP A C     1 
ATOM   6357  O  O     . ASP C 2 62  ? 68.246  81.531  28.398  1.00 52.49  ? 81  ASP A O     1 
ATOM   6358  C  CB    . ASP C 2 62  ? 69.004  82.376  30.897  1.00 67.39  ? 81  ASP A CB    1 
ATOM   6359  C  CG    . ASP C 2 62  ? 70.358  81.721  30.704  1.00 67.39  ? 81  ASP A CG    1 
ATOM   6360  O  OD1   . ASP C 2 62  ? 71.208  82.262  29.942  1.00 67.39  ? 81  ASP A OD1   1 
ATOM   6361  O  OD2   . ASP C 2 62  ? 70.568  80.661  31.326  1.00 67.39  ? 81  ASP A OD2   1 
ATOM   6362  N  N     . LEU C 2 63  ? 68.440  83.565  27.451  1.00 26.75  ? 82  LEU A N     1 
ATOM   6363  C  CA    . LEU C 2 63  ? 68.190  83.083  26.109  1.00 26.75  ? 82  LEU A CA    1 
ATOM   6364  C  C     . LEU C 2 63  ? 69.355  83.200  25.136  1.00 26.75  ? 82  LEU A C     1 
ATOM   6365  O  O     . LEU C 2 63  ? 70.113  84.166  25.154  1.00 26.75  ? 82  LEU A O     1 
ATOM   6366  C  CB    . LEU C 2 63  ? 66.966  83.793  25.525  1.00 39.45  ? 82  LEU A CB    1 
ATOM   6367  C  CG    . LEU C 2 63  ? 65.602  83.325  26.016  1.00 39.45  ? 82  LEU A CG    1 
ATOM   6368  C  CD1   . LEU C 2 63  ? 64.508  84.165  25.413  1.00 39.45  ? 82  LEU A CD1   1 
ATOM   6369  C  CD2   . LEU C 2 63  ? 65.423  81.884  25.619  1.00 39.45  ? 82  LEU A CD2   1 
ATOM   6370  N  N     . ARG C 2 64  ? 69.542  82.164  24.338  1.00 31.29  ? 83  ARG A N     1 
ATOM   6371  C  CA    . ARG C 2 64  ? 70.579  82.218  23.342  1.00 31.29  ? 83  ARG A CA    1 
ATOM   6372  C  C     . ARG C 2 64  ? 69.841  82.498  22.035  1.00 31.29  ? 83  ARG A C     1 
ATOM   6373  O  O     . ARG C 2 64  ? 68.650  82.173  21.893  1.00 31.29  ? 83  ARG A O     1 
ATOM   6374  C  CB    . ARG C 2 64  ? 71.367  80.909  23.266  1.00 112.49 ? 83  ARG A CB    1 
ATOM   6375  C  CG    . ARG C 2 64  ? 72.220  80.602  24.491  1.00 112.49 ? 83  ARG A CG    1 
ATOM   6376  C  CD    . ARG C 2 64  ? 73.280  79.563  24.162  1.00 112.49 ? 83  ARG A CD    1 
ATOM   6377  N  NE    . ARG C 2 64  ? 72.724  78.471  23.361  1.00 112.49 ? 83  ARG A NE    1 
ATOM   6378  C  CZ    . ARG C 2 64  ? 73.440  77.547  22.721  1.00 112.49 ? 83  ARG A CZ    1 
ATOM   6379  N  NH1   . ARG C 2 64  ? 74.768  77.556  22.769  1.00 112.49 ? 83  ARG A NH1   1 
ATOM   6380  N  NH2   . ARG C 2 64  ? 72.814  76.617  22.012  1.00 112.49 ? 83  ARG A NH2   1 
ATOM   6381  N  N     . PHE C 2 65  ? 70.525  83.178  21.123  1.00 50.30  ? 84  PHE A N     1 
ATOM   6382  C  CA    . PHE C 2 65  ? 69.979  83.519  19.820  1.00 50.30  ? 84  PHE A CA    1 
ATOM   6383  C  C     . PHE C 2 65  ? 70.843  82.973  18.692  1.00 50.30  ? 84  PHE A C     1 
ATOM   6384  O  O     . PHE C 2 65  ? 72.015  83.341  18.509  1.00 50.30  ? 84  PHE A O     1 
ATOM   6385  C  CB    . PHE C 2 65  ? 69.845  85.036  19.659  1.00 38.50  ? 84  PHE A CB    1 
ATOM   6386  C  CG    . PHE C 2 65  ? 68.523  85.580  20.094  1.00 38.50  ? 84  PHE A CG    1 
ATOM   6387  C  CD1   . PHE C 2 65  ? 67.467  85.666  19.197  1.00 38.50  ? 84  PHE A CD1   1 
ATOM   6388  C  CD2   . PHE C 2 65  ? 68.323  86.001  21.402  1.00 38.50  ? 84  PHE A CD2   1 
ATOM   6389  C  CE1   . PHE C 2 65  ? 66.227  86.164  19.602  1.00 38.50  ? 84  PHE A CE1   1 
ATOM   6390  C  CE2   . PHE C 2 65  ? 67.087  86.498  21.814  1.00 38.50  ? 84  PHE A CE2   1 
ATOM   6391  C  CZ    . PHE C 2 65  ? 66.040  86.576  20.911  1.00 38.50  ? 84  PHE A CZ    1 
ATOM   6392  N  N     . GLN C 2 66  ? 70.232  82.107  17.912  1.00 24.04  ? 85  GLN A N     1 
ATOM   6393  C  CA    . GLN C 2 66  ? 70.878  81.515  16.774  1.00 24.04  ? 85  GLN A CA    1 
ATOM   6394  C  C     . GLN C 2 66  ? 71.339  82.711  15.892  1.00 24.04  ? 85  GLN A C     1 
ATOM   6395  O  O     . GLN C 2 66  ? 70.632  83.709  15.752  1.00 24.04  ? 85  GLN A O     1 
ATOM   6396  C  CB    . GLN C 2 66  ? 69.822  80.641  16.100  1.00 24.74  ? 85  GLN A CB    1 
ATOM   6397  C  CG    . GLN C 2 66  ? 70.326  79.677  15.121  1.00 24.74  ? 85  GLN A CG    1 
ATOM   6398  C  CD    . GLN C 2 66  ? 69.406  78.488  14.987  1.00 24.74  ? 85  GLN A CD    1 
ATOM   6399  O  OE1   . GLN C 2 66  ? 68.503  78.487  14.141  1.00 24.74  ? 85  GLN A OE1   1 
ATOM   6400  N  NE2   . GLN C 2 66  ? 69.619  77.460  15.828  1.00 24.74  ? 85  GLN A NE2   1 
ATOM   6401  N  N     . SER C 2 67  ? 72.562  82.666  15.382  1.00 27.51  ? 86  SER A N     1 
ATOM   6402  C  CA    . SER C 2 67  ? 73.084  83.748  14.537  1.00 27.51  ? 86  SER A CA    1 
ATOM   6403  C  C     . SER C 2 67  ? 72.109  84.077  13.430  1.00 27.51  ? 86  SER A C     1 
ATOM   6404  O  O     . SER C 2 67  ? 71.916  85.238  13.089  1.00 27.51  ? 86  SER A O     1 
ATOM   6405  C  CB    . SER C 2 67  ? 74.405  83.337  13.907  1.00 49.92  ? 86  SER A CB    1 
ATOM   6406  O  OG    . SER C 2 67  ? 74.630  84.078  12.726  1.00 49.92  ? 86  SER A OG    1 
ATOM   6407  N  N     . SER C 2 68  ? 71.508  83.031  12.868  1.00 30.54  ? 87  SER A N     1 
ATOM   6408  C  CA    . SER C 2 68  ? 70.528  83.167  11.783  1.00 30.54  ? 87  SER A CA    1 
ATOM   6409  C  C     . SER C 2 68  ? 69.203  83.804  12.237  1.00 30.54  ? 87  SER A C     1 
ATOM   6410  O  O     . SER C 2 68  ? 68.555  84.501  11.453  1.00 30.54  ? 87  SER A O     1 
ATOM   6411  C  CB    . SER C 2 68  ? 70.283  81.815  11.083  1.00 37.41  ? 87  SER A CB    1 
ATOM   6412  O  OG    . SER C 2 68  ? 70.703  80.707  11.869  1.00 37.41  ? 87  SER A OG    1 
ATOM   6413  N  N     . ALA C 2 69  ? 68.822  83.595  13.503  1.00 25.82  ? 88  ALA A N     1 
ATOM   6414  C  CA    . ALA C 2 69  ? 67.592  84.187  14.053  1.00 25.82  ? 88  ALA A CA    1 
ATOM   6415  C  C     . ALA C 2 69  ? 67.713  85.704  14.044  1.00 25.82  ? 88  ALA A C     1 
ATOM   6416  O  O     . ALA C 2 69  ? 66.801  86.410  13.613  1.00 25.82  ? 88  ALA A O     1 
ATOM   6417  C  CB    . ALA C 2 69  ? 67.346  83.707  15.463  1.00 18.97  ? 88  ALA A CB    1 
ATOM   6418  N  N     . VAL C 2 70  ? 68.863  86.196  14.496  1.00 20.15  ? 89  VAL A N     1 
ATOM   6419  C  CA    . VAL C 2 70  ? 69.108  87.629  14.522  1.00 20.15  ? 89  VAL A CA    1 
ATOM   6420  C  C     . VAL C 2 70  ? 69.189  88.248  13.126  1.00 20.15  ? 89  VAL A C     1 
ATOM   6421  O  O     . VAL C 2 70  ? 68.607  89.299  12.884  1.00 20.15  ? 89  VAL A O     1 
ATOM   6422  C  CB    . VAL C 2 70  ? 70.339  87.986  15.337  1.00 10.54  ? 89  VAL A CB    1 
ATOM   6423  C  CG1   . VAL C 2 70  ? 70.506  89.498  15.345  1.00 10.54  ? 89  VAL A CG1   1 
ATOM   6424  C  CG2   . VAL C 2 70  ? 70.171  87.477  16.758  1.00 10.54  ? 89  VAL A CG2   1 
ATOM   6425  N  N     . MET C 2 71  ? 69.918  87.619  12.211  1.00 38.44  ? 90  MET A N     1 
ATOM   6426  C  CA    . MET C 2 71  ? 69.983  88.138  10.856  1.00 38.44  ? 90  MET A CA    1 
ATOM   6427  C  C     . MET C 2 71  ? 68.547  88.230  10.304  1.00 38.44  ? 90  MET A C     1 
ATOM   6428  O  O     . MET C 2 71  ? 68.169  89.232  9.706   1.00 38.44  ? 90  MET A O     1 
ATOM   6429  C  CB    . MET C 2 71  ? 70.825  87.226  9.975   1.00 62.99  ? 90  MET A CB    1 
ATOM   6430  C  CG    . MET C 2 71  ? 72.263  87.649  9.807   1.00 62.99  ? 90  MET A CG    1 
ATOM   6431  S  SD    . MET C 2 71  ? 73.044  86.567  8.584   1.00 62.99  ? 90  MET A SD    1 
ATOM   6432  C  CE    . MET C 2 71  ? 72.411  87.289  6.968   1.00 62.99  ? 90  MET A CE    1 
ATOM   6433  N  N     . ALA C 2 72  ? 67.736  87.198  10.528  1.00 51.18  ? 91  ALA A N     1 
ATOM   6434  C  CA    . ALA C 2 72  ? 66.348  87.205  10.068  1.00 51.18  ? 91  ALA A CA    1 
ATOM   6435  C  C     . ALA C 2 72  ? 65.600  88.426  10.606  1.00 51.18  ? 91  ALA A C     1 
ATOM   6436  O  O     . ALA C 2 72  ? 65.034  89.190  9.826   1.00 51.18  ? 91  ALA A O     1 
ATOM   6437  C  CB    . ALA C 2 72  ? 65.652  85.936  10.491  1.00 13.60  ? 91  ALA A CB    1 
ATOM   6438  N  N     . LEU C 2 73  ? 65.597  88.605  11.930  1.00 26.26  ? 92  LEU A N     1 
ATOM   6439  C  CA    . LEU C 2 73  ? 64.940  89.758  12.544  1.00 26.26  ? 92  LEU A CA    1 
ATOM   6440  C  C     . LEU C 2 73  ? 65.439  91.075  11.953  1.00 26.26  ? 92  LEU A C     1 
ATOM   6441  O  O     . LEU C 2 73  ? 64.641  91.963  11.679  1.00 26.26  ? 92  LEU A O     1 
ATOM   6442  C  CB    . LEU C 2 73  ? 65.154  89.775  14.052  1.00 18.67  ? 92  LEU A CB    1 
ATOM   6443  C  CG    . LEU C 2 73  ? 64.309  88.820  14.910  1.00 18.67  ? 92  LEU A CG    1 
ATOM   6444  C  CD1   . LEU C 2 73  ? 64.851  88.762  16.311  1.00 18.67  ? 92  LEU A CD1   1 
ATOM   6445  C  CD2   . LEU C 2 73  ? 62.872  89.267  14.943  1.00 18.67  ? 92  LEU A CD2   1 
ATOM   6446  N  N     . GLN C 2 74  ? 66.744  91.209  11.730  1.00 9.93   ? 93  GLN A N     1 
ATOM   6447  C  CA    . GLN C 2 74  ? 67.235  92.434  11.150  1.00 9.93   ? 93  GLN A CA    1 
ATOM   6448  C  C     . GLN C 2 74  ? 66.741  92.622  9.738   1.00 9.93   ? 93  GLN A C     1 
ATOM   6449  O  O     . GLN C 2 74  ? 66.317  93.706  9.371   1.00 9.93   ? 93  GLN A O     1 
ATOM   6450  C  CB    . GLN C 2 74  ? 68.743  92.519  11.194  1.00 20.57  ? 93  GLN A CB    1 
ATOM   6451  C  CG    . GLN C 2 74  ? 69.252  93.842  10.666  1.00 20.57  ? 93  GLN A CG    1 
ATOM   6452  C  CD    . GLN C 2 74  ? 70.608  94.210  11.210  1.00 20.57  ? 93  GLN A CD    1 
ATOM   6453  O  OE1   . GLN C 2 74  ? 71.150  93.526  12.088  1.00 20.57  ? 93  GLN A OE1   1 
ATOM   6454  N  NE2   . GLN C 2 74  ? 71.169  95.307  10.695  1.00 20.57  ? 93  GLN A NE2   1 
ATOM   6455  N  N     . GLU C 2 75  ? 66.772  91.574  8.938   1.00 19.06  ? 94  GLU A N     1 
ATOM   6456  C  CA    . GLU C 2 75  ? 66.267  91.664  7.580   1.00 19.06  ? 94  GLU A CA    1 
ATOM   6457  C  C     . GLU C 2 75  ? 64.806  92.124  7.586   1.00 19.06  ? 94  GLU A C     1 
ATOM   6458  O  O     . GLU C 2 75  ? 64.454  93.082  6.902   1.00 19.06  ? 94  GLU A O     1 
ATOM   6459  C  CB    . GLU C 2 75  ? 66.346  90.301  6.921   1.00 27.58  ? 94  GLU A CB    1 
ATOM   6460  C  CG    . GLU C 2 75  ? 67.725  89.903  6.486   1.00 27.58  ? 94  GLU A CG    1 
ATOM   6461  C  CD    . GLU C 2 75  ? 68.116  90.502  5.155   1.00 27.58  ? 94  GLU A CD    1 
ATOM   6462  O  OE1   . GLU C 2 75  ? 67.246  90.769  4.297   1.00 27.58  ? 94  GLU A OE1   1 
ATOM   6463  O  OE2   . GLU C 2 75  ? 69.324  90.703  4.954   1.00 27.58  ? 94  GLU A OE2   1 
ATOM   6464  N  N     . ALA C 2 76  ? 63.970  91.453  8.376   1.00 29.50  ? 95  ALA A N     1 
ATOM   6465  C  CA    . ALA C 2 76  ? 62.560  91.793  8.474   1.00 29.50  ? 95  ALA A CA    1 
ATOM   6466  C  C     . ALA C 2 76  ? 62.331  93.220  8.943   1.00 29.50  ? 95  ALA A C     1 
ATOM   6467  O  O     . ALA C 2 76  ? 61.551  93.950  8.347   1.00 29.50  ? 95  ALA A O     1 
ATOM   6468  C  CB    . ALA C 2 76  ? 61.847  90.834  9.387   1.00 5.00   ? 95  ALA A CB    1 
ATOM   6469  N  N     . SER C 2 77  ? 63.011  93.624  10.007  1.00 13.19  ? 96  SER A N     1 
ATOM   6470  C  CA    . SER C 2 77  ? 62.874  94.976  10.552  1.00 13.19  ? 96  SER A CA    1 
ATOM   6471  C  C     . SER C 2 77  ? 63.195  96.053  9.544   1.00 13.19  ? 96  SER A C     1 
ATOM   6472  O  O     . SER C 2 77  ? 62.379  96.906  9.263   1.00 13.19  ? 96  SER A O     1 
ATOM   6473  C  CB    . SER C 2 77  ? 63.753  95.134  11.779  1.00 21.66  ? 96  SER A CB    1 
ATOM   6474  O  OG    . SER C 2 77  ? 63.344  94.210  12.778  1.00 21.66  ? 96  SER A OG    1 
ATOM   6475  N  N     . GLU C 2 78  ? 64.373  95.989  8.946   1.00 12.43  ? 97  GLU A N     1 
ATOM   6476  C  CA    . GLU C 2 78  ? 64.730  96.983  7.951   1.00 12.43  ? 97  GLU A CA    1 
ATOM   6477  C  C     . GLU C 2 78  ? 63.745  96.973  6.785   1.00 12.43  ? 97  GLU A C     1 
ATOM   6478  O  O     . GLU C 2 78  ? 63.277  98.015  6.373   1.00 12.43  ? 97  GLU A O     1 
ATOM   6479  C  CB    . GLU C 2 78  ? 66.151  96.759  7.480   1.00 29.48  ? 97  GLU A CB    1 
ATOM   6480  C  CG    . GLU C 2 78  ? 67.163  96.996  8.574   1.00 29.48  ? 97  GLU A CG    1 
ATOM   6481  C  CD    . GLU C 2 78  ? 68.542  97.184  8.016   1.00 29.48  ? 97  GLU A CD    1 
ATOM   6482  O  OE1   . GLU C 2 78  ? 68.636  97.710  6.881   1.00 29.48  ? 97  GLU A OE1   1 
ATOM   6483  O  OE2   . GLU C 2 78  ? 69.523  96.805  8.695   1.00 29.48  ? 97  GLU A OE2   1 
ATOM   6484  N  N     . ALA C 2 79  ? 63.421  95.796  6.266   1.00 17.19  ? 98  ALA A N     1 
ATOM   6485  C  CA    . ALA C 2 79  ? 62.460  95.683  5.176   1.00 17.19  ? 98  ALA A CA    1 
ATOM   6486  C  C     . ALA C 2 79  ? 61.197  96.444  5.566   1.00 17.19  ? 98  ALA A C     1 
ATOM   6487  O  O     . ALA C 2 79  ? 60.623  97.178  4.758   1.00 17.19  ? 98  ALA A O     1 
ATOM   6488  C  CB    . ALA C 2 79  ? 62.126  94.205  4.922   1.00 10.58  ? 98  ALA A CB    1 
ATOM   6489  N  N     . TYR C 2 80  ? 60.801  96.284  6.826   1.00 27.15  ? 99  TYR A N     1 
ATOM   6490  C  CA    . TYR C 2 80  ? 59.629  96.936  7.387   1.00 27.15  ? 99  TYR A CA    1 
ATOM   6491  C  C     . TYR C 2 80  ? 59.754  98.453  7.415   1.00 27.15  ? 99  TYR A C     1 
ATOM   6492  O  O     . TYR C 2 80  ? 58.868  99.156  6.939   1.00 27.15  ? 99  TYR A O     1 
ATOM   6493  C  CB    . TYR C 2 80  ? 59.383  96.403  8.792   1.00 16.67  ? 99  TYR A CB    1 
ATOM   6494  C  CG    . TYR C 2 80  ? 58.404  97.226  9.558   1.00 16.67  ? 99  TYR A CG    1 
ATOM   6495  C  CD1   . TYR C 2 80  ? 57.062  97.272  9.192   1.00 16.67  ? 99  TYR A CD1   1 
ATOM   6496  C  CD2   . TYR C 2 80  ? 58.806  97.991  10.626  1.00 16.67  ? 99  TYR A CD2   1 
ATOM   6497  C  CE1   . TYR C 2 80  ? 56.143  98.063  9.876   1.00 16.67  ? 99  TYR A CE1   1 
ATOM   6498  C  CE2   . TYR C 2 80  ? 57.892  98.788  11.314  1.00 16.67  ? 99  TYR A CE2   1 
ATOM   6499  C  CZ    . TYR C 2 80  ? 56.568  98.812  10.931  1.00 16.67  ? 99  TYR A CZ    1 
ATOM   6500  O  OH    . TYR C 2 80  ? 55.683  99.590  11.630  1.00 16.67  ? 99  TYR A OH    1 
ATOM   6501  N  N     . LEU C 2 81  ? 60.835  98.942  8.009   1.00 12.09  ? 100 LEU A N     1 
ATOM   6502  C  CA    . LEU C 2 81  ? 61.103  100.365 8.104   1.00 12.09  ? 100 LEU A CA    1 
ATOM   6503  C  C     . LEU C 2 81  ? 61.220  101.048 6.759   1.00 12.09  ? 100 LEU A C     1 
ATOM   6504  O  O     . LEU C 2 81  ? 60.610  102.080 6.534   1.00 12.09  ? 100 LEU A O     1 
ATOM   6505  C  CB    . LEU C 2 81  ? 62.368  100.614 8.905   1.00 17.79  ? 100 LEU A CB    1 
ATOM   6506  C  CG    . LEU C 2 81  ? 62.141  100.291 10.384  1.00 17.79  ? 100 LEU A CG    1 
ATOM   6507  C  CD1   . LEU C 2 81  ? 63.400  100.532 11.188  1.00 17.79  ? 100 LEU A CD1   1 
ATOM   6508  C  CD2   . LEU C 2 81  ? 60.998  101.154 10.909  1.00 17.79  ? 100 LEU A CD2   1 
ATOM   6509  N  N     . VAL C 2 82  ? 61.987  100.476 5.848   1.00 26.76  ? 101 VAL A N     1 
ATOM   6510  C  CA    . VAL C 2 82  ? 62.138  101.076 4.539   1.00 26.76  ? 101 VAL A CA    1 
ATOM   6511  C  C     . VAL C 2 82  ? 60.795  101.375 3.902   1.00 26.76  ? 101 VAL A C     1 
ATOM   6512  O  O     . VAL C 2 82  ? 60.593  102.488 3.418   1.00 26.76  ? 101 VAL A O     1 
ATOM   6513  C  CB    . VAL C 2 82  ? 62.944  100.176 3.603   1.00 7.17   ? 101 VAL A CB    1 
ATOM   6514  C  CG1   . VAL C 2 82  ? 62.840  100.678 2.162   1.00 7.17   ? 101 VAL A CG1   1 
ATOM   6515  C  CG2   . VAL C 2 82  ? 64.395  100.130 4.071   1.00 7.17   ? 101 VAL A CG2   1 
ATOM   6516  N  N     . ALA C 2 83  ? 59.880  100.396 3.920   1.00 17.92  ? 102 ALA A N     1 
ATOM   6517  C  CA    . ALA C 2 83  ? 58.535  100.551 3.328   1.00 17.92  ? 102 ALA A CA    1 
ATOM   6518  C  C     . ALA C 2 83  ? 57.679  101.560 4.075   1.00 17.92  ? 102 ALA A C     1 
ATOM   6519  O  O     . ALA C 2 83  ? 56.903  102.303 3.478   1.00 17.92  ? 102 ALA A O     1 
ATOM   6520  C  CB    . ALA C 2 83  ? 57.845  99.239  3.261   1.00 5.00   ? 102 ALA A CB    1 
ATOM   6521  N  N     . LEU C 2 84  ? 57.798  101.563 5.390   1.00 15.01  ? 103 LEU A N     1 
ATOM   6522  C  CA    . LEU C 2 84  ? 57.069  102.539 6.178   1.00 15.01  ? 103 LEU A CA    1 
ATOM   6523  C  C     . LEU C 2 84  ? 57.550  103.929 5.740   1.00 15.01  ? 103 LEU A C     1 
ATOM   6524  O  O     . LEU C 2 84  ? 56.753  104.861 5.650   1.00 15.01  ? 103 LEU A O     1 
ATOM   6525  C  CB    . LEU C 2 84  ? 57.292  102.322 7.685   1.00 12.43  ? 103 LEU A CB    1 
ATOM   6526  C  CG    . LEU C 2 84  ? 56.518  103.267 8.608   1.00 12.43  ? 103 LEU A CG    1 
ATOM   6527  C  CD1   . LEU C 2 84  ? 55.013  103.117 8.422   1.00 12.43  ? 103 LEU A CD1   1 
ATOM   6528  C  CD2   . LEU C 2 84  ? 56.901  102.992 10.028  1.00 12.43  ? 103 LEU A CD2   1 
ATOM   6529  N  N     . PHE C 2 85  ? 58.850  104.072 5.473   1.00 20.53  ? 104 PHE A N     1 
ATOM   6530  C  CA    . PHE C 2 85  ? 59.382  105.350 4.993   1.00 20.53  ? 104 PHE A CA    1 
ATOM   6531  C  C     . PHE C 2 85  ? 58.804  105.659 3.598   1.00 20.53  ? 104 PHE A C     1 
ATOM   6532  O  O     . PHE C 2 85  ? 58.569  106.806 3.273   1.00 20.53  ? 104 PHE A O     1 
ATOM   6533  C  CB    . PHE C 2 85  ? 60.920  105.366 5.000   1.00 11.05  ? 104 PHE A CB    1 
ATOM   6534  C  CG    . PHE C 2 85  ? 61.535  105.626 6.378   1.00 11.05  ? 104 PHE A CG    1 
ATOM   6535  C  CD1   . PHE C 2 85  ? 61.223  106.779 7.102   1.00 11.05  ? 104 PHE A CD1   1 
ATOM   6536  C  CD2   . PHE C 2 85  ? 62.409  104.711 6.958   1.00 11.05  ? 104 PHE A CD2   1 
ATOM   6537  C  CE1   . PHE C 2 85  ? 61.755  107.016 8.379   1.00 11.05  ? 104 PHE A CE1   1 
ATOM   6538  C  CE2   . PHE C 2 85  ? 62.951  104.946 8.244   1.00 11.05  ? 104 PHE A CE2   1 
ATOM   6539  C  CZ    . PHE C 2 85  ? 62.616  106.106 8.946   1.00 11.05  ? 104 PHE A CZ    1 
ATOM   6540  N  N     . GLU C 2 86  ? 58.495  104.642 2.799   1.00 22.12  ? 105 GLU A N     1 
ATOM   6541  C  CA    . GLU C 2 86  ? 57.896  104.886 1.483   1.00 22.12  ? 105 GLU A CA    1 
ATOM   6542  C  C     . GLU C 2 86  ? 56.550  105.546 1.670   1.00 22.12  ? 105 GLU A C     1 
ATOM   6543  O  O     . GLU C 2 86  ? 56.316  106.666 1.224   1.00 22.12  ? 105 GLU A O     1 
ATOM   6544  C  CB    . GLU C 2 86  ? 57.701  103.585 0.719   1.00 35.59  ? 105 GLU A CB    1 
ATOM   6545  C  CG    . GLU C 2 86  ? 58.994  102.997 0.231   1.00 35.59  ? 105 GLU A CG    1 
ATOM   6546  C  CD    . GLU C 2 86  ? 58.832  101.681 -0.493  1.00 35.59  ? 105 GLU A CD    1 
ATOM   6547  O  OE1   . GLU C 2 86  ? 57.776  101.451 -1.135  1.00 35.59  ? 105 GLU A OE1   1 
ATOM   6548  O  OE2   . GLU C 2 86  ? 59.788  100.881 -0.431  1.00 35.59  ? 105 GLU A OE2   1 
ATOM   6549  N  N     . ASP C 2 87  ? 55.679  104.853 2.380   1.00 30.69  ? 106 ASP A N     1 
ATOM   6550  C  CA    . ASP C 2 87  ? 54.348  105.355 2.636   1.00 30.69  ? 106 ASP A CA    1 
ATOM   6551  C  C     . ASP C 2 87  ? 54.414  106.720 3.287   1.00 30.69  ? 106 ASP A C     1 
ATOM   6552  O  O     . ASP C 2 87  ? 53.724  107.645 2.855   1.00 30.69  ? 106 ASP A O     1 
ATOM   6553  C  CB    . ASP C 2 87  ? 53.585  104.382 3.526   1.00 26.48  ? 106 ASP A CB    1 
ATOM   6554  C  CG    . ASP C 2 87  ? 53.364  103.029 2.861   1.00 26.48  ? 106 ASP A CG    1 
ATOM   6555  O  OD1   . ASP C 2 87  ? 53.423  102.938 1.599   1.00 26.48  ? 106 ASP A OD1   1 
ATOM   6556  O  OD2   . ASP C 2 87  ? 53.137  102.059 3.621   1.00 26.48  ? 106 ASP A OD2   1 
ATOM   6557  N  N     . THR C 2 88  ? 55.249  106.845 4.322   1.00 19.57  ? 107 THR A N     1 
ATOM   6558  C  CA    . THR C 2 88  ? 55.429  108.111 5.053   1.00 19.57  ? 107 THR A CA    1 
ATOM   6559  C  C     . THR C 2 88  ? 55.712  109.250 4.061   1.00 19.57  ? 107 THR A C     1 
ATOM   6560  O  O     . THR C 2 88  ? 55.131  110.333 4.150   1.00 19.57  ? 107 THR A O     1 
ATOM   6561  C  CB    . THR C 2 88  ? 56.603  108.013 6.065   1.00 10.91  ? 107 THR A CB    1 
ATOM   6562  O  OG1   . THR C 2 88  ? 56.327  107.010 7.059   1.00 10.91  ? 107 THR A OG1   1 
ATOM   6563  C  CG2   . THR C 2 88  ? 56.857  109.353 6.727   1.00 10.91  ? 107 THR A CG2   1 
ATOM   6564  N  N     . ASN C 2 89  ? 56.560  108.970 3.075   1.00 23.14  ? 108 ASN A N     1 
ATOM   6565  C  CA    . ASN C 2 89  ? 56.913  109.957 2.083   1.00 23.14  ? 108 ASN A CA    1 
ATOM   6566  C  C     . ASN C 2 89  ? 55.690  110.432 1.355   1.00 23.14  ? 108 ASN A C     1 
ATOM   6567  O  O     . ASN C 2 89  ? 55.487  111.631 1.216   1.00 23.14  ? 108 ASN A O     1 
ATOM   6568  C  CB    . ASN C 2 89  ? 57.919  109.401 1.088   1.00 20.45  ? 108 ASN A CB    1 
ATOM   6569  C  CG    . ASN C 2 89  ? 58.955  110.426 0.705   1.00 20.45  ? 108 ASN A CG    1 
ATOM   6570  O  OD1   . ASN C 2 89  ? 59.286  111.294 1.511   1.00 20.45  ? 108 ASN A OD1   1 
ATOM   6571  N  ND2   . ASN C 2 89  ? 59.471  110.345 -0.514  1.00 20.45  ? 108 ASN A ND2   1 
ATOM   6572  N  N     . LEU C 2 90  ? 54.883  109.491 0.880   1.00 19.44  ? 109 LEU A N     1 
ATOM   6573  C  CA    . LEU C 2 90  ? 53.647  109.823 0.167   1.00 19.44  ? 109 LEU A CA    1 
ATOM   6574  C  C     . LEU C 2 90  ? 52.735  110.725 0.996   1.00 19.44  ? 109 LEU A C     1 
ATOM   6575  O  O     . LEU C 2 90  ? 52.092  111.621 0.463   1.00 19.44  ? 109 LEU A O     1 
ATOM   6576  C  CB    . LEU C 2 90  ? 52.897  108.556 -0.219  1.00 14.09  ? 109 LEU A CB    1 
ATOM   6577  C  CG    . LEU C 2 90  ? 53.730  107.628 -1.096  1.00 14.09  ? 109 LEU A CG    1 
ATOM   6578  C  CD1   . LEU C 2 90  ? 52.976  106.341 -1.385  1.00 14.09  ? 109 LEU A CD1   1 
ATOM   6579  C  CD2   . LEU C 2 90  ? 54.083  108.370 -2.394  1.00 14.09  ? 109 LEU A CD2   1 
ATOM   6580  N  N     . CYS C 2 91  ? 52.648  110.463 2.291   1.00 14.96  ? 110 CYS A N     1 
ATOM   6581  C  CA    . CYS C 2 91  ? 51.836  111.292 3.147   1.00 14.96  ? 110 CYS A CA    1 
ATOM   6582  C  C     . CYS C 2 91  ? 52.346  112.728 3.156   1.00 14.96  ? 110 CYS A C     1 
ATOM   6583  O  O     . CYS C 2 91  ? 51.579  113.671 2.930   1.00 14.96  ? 110 CYS A O     1 
ATOM   6584  C  CB    . CYS C 2 91  ? 51.823  110.741 4.560   1.00 17.45  ? 110 CYS A CB    1 
ATOM   6585  S  SG    . CYS C 2 91  ? 50.854  109.266 4.653   1.00 17.45  ? 110 CYS A SG    1 
ATOM   6586  N  N     . ALA C 2 92  ? 53.641  112.892 3.418   1.00 22.03  ? 111 ALA A N     1 
ATOM   6587  C  CA    . ALA C 2 92  ? 54.258  114.213 3.445   1.00 22.03  ? 111 ALA A CA    1 
ATOM   6588  C  C     . ALA C 2 92  ? 54.025  114.943 2.130   1.00 22.03  ? 111 ALA A C     1 
ATOM   6589  O  O     . ALA C 2 92  ? 53.649  116.115 2.096   1.00 22.03  ? 111 ALA A O     1 
ATOM   6590  C  CB    . ALA C 2 92  ? 55.716  114.075 3.702   1.00 9.33   ? 111 ALA A CB    1 
ATOM   6591  N  N     . ILE C 2 93  ? 54.249  114.242 1.039   1.00 15.55  ? 112 ILE A N     1 
ATOM   6592  C  CA    . ILE C 2 93  ? 54.047  114.820 -0.263  1.00 15.55  ? 112 ILE A CA    1 
ATOM   6593  C  C     . ILE C 2 93  ? 52.575  115.141 -0.454  1.00 15.55  ? 112 ILE A C     1 
ATOM   6594  O  O     . ILE C 2 93  ? 52.214  116.174 -1.033  1.00 15.55  ? 112 ILE A O     1 
ATOM   6595  C  CB    . ILE C 2 93  ? 54.533  113.853 -1.334  1.00 14.57  ? 112 ILE A CB    1 
ATOM   6596  C  CG1   . ILE C 2 93  ? 55.991  113.492 -1.031  1.00 14.57  ? 112 ILE A CG1   1 
ATOM   6597  C  CG2   . ILE C 2 93  ? 54.396  114.462 -2.714  1.00 14.57  ? 112 ILE A CG2   1 
ATOM   6598  C  CD1   . ILE C 2 93  ? 56.612  112.611 -2.047  1.00 14.57  ? 112 ILE A CD1   1 
ATOM   6599  N  N     . HIS C 2 94  ? 51.714  114.271 0.051   1.00 26.92  ? 113 HIS A N     1 
ATOM   6600  C  CA    . HIS C 2 94  ? 50.287  114.498 -0.068  1.00 26.92  ? 113 HIS A CA    1 
ATOM   6601  C  C     . HIS C 2 94  ? 49.970  115.866 0.524   1.00 26.92  ? 113 HIS A C     1 
ATOM   6602  O  O     . HIS C 2 94  ? 49.105  116.602 0.031   1.00 26.92  ? 113 HIS A O     1 
ATOM   6603  C  CB    . HIS C 2 94  ? 49.518  113.429 0.694   1.00 18.28  ? 113 HIS A CB    1 
ATOM   6604  C  CG    . HIS C 2 94  ? 48.040  113.498 0.482   1.00 18.28  ? 113 HIS A CG    1 
ATOM   6605  N  ND1   . HIS C 2 94  ? 47.159  113.831 1.490   1.00 18.28  ? 113 HIS A ND1   1 
ATOM   6606  C  CD2   . HIS C 2 94  ? 47.287  113.271 -0.619  1.00 18.28  ? 113 HIS A CD2   1 
ATOM   6607  C  CE1   . HIS C 2 94  ? 45.925  113.806 1.021   1.00 18.28  ? 113 HIS A CE1   1 
ATOM   6608  N  NE2   . HIS C 2 94  ? 45.975  113.468 -0.256  1.00 18.28  ? 113 HIS A NE2   1 
ATOM   6609  N  N     . ALA C 2 95  ? 50.656  116.167 1.616   1.00 18.46  ? 114 ALA A N     1 
ATOM   6610  C  CA    . ALA C 2 95  ? 50.484  117.423 2.296   1.00 18.46  ? 114 ALA A CA    1 
ATOM   6611  C  C     . ALA C 2 95  ? 51.389  118.533 1.750   1.00 18.46  ? 114 ALA A C     1 
ATOM   6612  O  O     . ALA C 2 95  ? 51.749  119.488 2.458   1.00 18.46  ? 114 ALA A O     1 
ATOM   6613  C  CB    . ALA C 2 95  ? 50.667  117.233 3.770   1.00 5.00   ? 114 ALA A CB    1 
ATOM   6614  N  N     . LYS C 2 96  ? 51.701  118.433 0.464   1.00 30.35  ? 115 LYS A N     1 
ATOM   6615  C  CA    . LYS C 2 96  ? 52.512  119.429 -0.209  1.00 30.35  ? 115 LYS A CA    1 
ATOM   6616  C  C     . LYS C 2 96  ? 53.854  119.669 0.466   1.00 30.35  ? 115 LYS A C     1 
ATOM   6617  O  O     . LYS C 2 96  ? 54.358  120.789 0.482   1.00 30.35  ? 115 LYS A O     1 
ATOM   6618  C  CB    . LYS C 2 96  ? 51.734  120.740 -0.335  1.00 79.74  ? 115 LYS A CB    1 
ATOM   6619  C  CG    . LYS C 2 96  ? 50.431  120.607 -1.105  1.00 79.74  ? 115 LYS A CG    1 
ATOM   6620  C  CD    . LYS C 2 96  ? 49.632  121.889 -1.049  1.00 79.74  ? 115 LYS A CD    1 
ATOM   6621  C  CE    . LYS C 2 96  ? 48.333  121.758 -1.810  1.00 79.74  ? 115 LYS A CE    1 
ATOM   6622  N  NZ    . LYS C 2 96  ? 47.567  123.040 -1.824  1.00 79.74  ? 115 LYS A NZ    1 
ATOM   6623  N  N     . ARG C 2 97  ? 54.415  118.630 1.075   1.00 18.65  ? 116 ARG A N     1 
ATOM   6624  C  CA    . ARG C 2 97  ? 55.720  118.767 1.708   1.00 18.65  ? 116 ARG A CA    1 
ATOM   6625  C  C     . ARG C 2 97  ? 56.756  117.887 1.022   1.00 18.65  ? 116 ARG A C     1 
ATOM   6626  O  O     . ARG C 2 97  ? 56.468  117.196 0.048   1.00 18.65  ? 116 ARG A O     1 
ATOM   6627  C  CB    . ARG C 2 97  ? 55.651  118.486 3.221   1.00 31.71  ? 116 ARG A CB    1 
ATOM   6628  C  CG    . ARG C 2 97  ? 55.060  119.629 4.030   1.00 31.71  ? 116 ARG A CG    1 
ATOM   6629  C  CD    . ARG C 2 97  ? 55.110  119.369 5.510   1.00 31.71  ? 116 ARG A CD    1 
ATOM   6630  N  NE    . ARG C 2 97  ? 54.019  118.509 5.969   1.00 31.71  ? 116 ARG A NE    1 
ATOM   6631  C  CZ    . ARG C 2 97  ? 54.157  117.248 6.390   1.00 31.71  ? 116 ARG A CZ    1 
ATOM   6632  N  NH1   . ARG C 2 97  ? 55.343  116.658 6.406   1.00 31.71  ? 116 ARG A NH1   1 
ATOM   6633  N  NH2   . ARG C 2 97  ? 53.107  116.580 6.851   1.00 31.71  ? 116 ARG A NH2   1 
ATOM   6634  N  N     . VAL C 2 98  ? 57.970  117.968 1.544   1.00 27.74  ? 117 VAL A N     1 
ATOM   6635  C  CA    . VAL C 2 98  ? 59.135  117.250 1.059   1.00 27.74  ? 117 VAL A CA    1 
ATOM   6636  C  C     . VAL C 2 98  ? 59.861  116.659 2.277   1.00 27.74  ? 117 VAL A C     1 
ATOM   6637  O  O     . VAL C 2 98  ? 60.673  115.720 2.175   1.00 27.74  ? 117 VAL A O     1 
ATOM   6638  C  CB    . VAL C 2 98  ? 60.054  118.250 0.352   1.00 18.19  ? 117 VAL A CB    1 
ATOM   6639  C  CG1   . VAL C 2 98  ? 61.434  117.680 0.217   1.00 18.19  ? 117 VAL A CG1   1 
ATOM   6640  C  CG2   . VAL C 2 98  ? 59.481  118.597 -1.009  1.00 18.19  ? 117 VAL A CG2   1 
ATOM   6641  N  N     . THR C 2 99  ? 59.610  117.306 3.409   1.00 32.53  ? 118 THR A N     1 
ATOM   6642  C  CA    . THR C 2 99  ? 60.149  116.930 4.703   1.00 32.53  ? 118 THR A CA    1 
ATOM   6643  C  C     . THR C 2 99  ? 59.166  116.028 5.452   1.00 32.53  ? 118 THR A C     1 
ATOM   6644  O  O     . THR C 2 99  ? 58.083  116.474 5.831   1.00 32.53  ? 118 THR A O     1 
ATOM   6645  C  CB    . THR C 2 99  ? 60.344  118.190 5.577   1.00 15.25  ? 118 THR A CB    1 
ATOM   6646  O  OG1   . THR C 2 99  ? 60.900  119.248 4.783   1.00 15.25  ? 118 THR A OG1   1 
ATOM   6647  C  CG2   . THR C 2 99  ? 61.234  117.885 6.779   1.00 15.25  ? 118 THR A CG2   1 
ATOM   6648  N  N     . ILE C 2 100 ? 59.542  114.776 5.688   1.00 27.40  ? 119 ILE A N     1 
ATOM   6649  C  CA    . ILE C 2 100 ? 58.667  113.876 6.431   1.00 27.40  ? 119 ILE A CA    1 
ATOM   6650  C  C     . ILE C 2 100 ? 58.766  114.183 7.928   1.00 27.40  ? 119 ILE A C     1 
ATOM   6651  O  O     . ILE C 2 100 ? 59.848  114.447 8.445   1.00 27.40  ? 119 ILE A O     1 
ATOM   6652  C  CB    . ILE C 2 100 ? 59.027  112.414 6.216   1.00 10.86  ? 119 ILE A CB    1 
ATOM   6653  C  CG1   . ILE C 2 100 ? 60.459  112.170 6.677   1.00 10.86  ? 119 ILE A CG1   1 
ATOM   6654  C  CG2   . ILE C 2 100 ? 58.805  112.038 4.768   1.00 10.86  ? 119 ILE A CG2   1 
ATOM   6655  C  CD1   . ILE C 2 100 ? 60.823  110.703 6.963   1.00 10.86  ? 119 ILE A CD1   1 
ATOM   6656  N  N     . MET C 2 101 ? 57.624  114.178 8.604   1.00 16.70  ? 120 MET A N     1 
ATOM   6657  C  CA    . MET C 2 101 ? 57.551  114.455 10.030  1.00 16.70  ? 120 MET A CA    1 
ATOM   6658  C  C     . MET C 2 101 ? 56.793  113.336 10.731  1.00 16.70  ? 120 MET A C     1 
ATOM   6659  O  O     . MET C 2 101 ? 56.288  112.417 10.085  1.00 16.70  ? 120 MET A O     1 
ATOM   6660  C  CB    . MET C 2 101 ? 56.841  115.801 10.293  1.00 26.53  ? 120 MET A CB    1 
ATOM   6661  C  CG    . MET C 2 101 ? 56.733  116.726 9.093   1.00 26.53  ? 120 MET A CG    1 
ATOM   6662  S  SD    . MET C 2 101 ? 56.342  118.427 9.514   1.00 26.53  ? 120 MET A SD    1 
ATOM   6663  C  CE    . MET C 2 101 ? 57.586  119.235 8.455   1.00 26.53  ? 120 MET A CE    1 
ATOM   6664  N  N     . PRO C 2 102 ? 56.719  113.392 12.072  1.00 25.85  ? 121 PRO A N     1 
ATOM   6665  C  CA    . PRO C 2 102 ? 56.009  112.364 12.828  1.00 25.85  ? 121 PRO A CA    1 
ATOM   6666  C  C     . PRO C 2 102 ? 54.567  112.168 12.332  1.00 25.85  ? 121 PRO A C     1 
ATOM   6667  O  O     . PRO C 2 102 ? 54.118  111.022 12.197  1.00 25.85  ? 121 PRO A O     1 
ATOM   6668  C  CB    . PRO C 2 102 ? 56.054  112.918 14.251  1.00 45.14  ? 121 PRO A CB    1 
ATOM   6669  C  CG    . PRO C 2 102 ? 57.362  113.631 14.274  1.00 45.14  ? 121 PRO A CG    1 
ATOM   6670  C  CD    . PRO C 2 102 ? 57.317  114.382 12.988  1.00 45.14  ? 121 PRO A CD    1 
ATOM   6671  N  N     . LYS C 2 103 ? 53.863  113.276 12.042  1.00 23.23  ? 122 LYS A N     1 
ATOM   6672  C  CA    . LYS C 2 103 ? 52.483  113.225 11.539  1.00 23.23  ? 122 LYS A CA    1 
ATOM   6673  C  C     . LYS C 2 103 ? 52.385  112.195 10.409  1.00 23.23  ? 122 LYS A C     1 
ATOM   6674  O  O     . LYS C 2 103 ? 51.424  111.432 10.337  1.00 23.23  ? 122 LYS A O     1 
ATOM   6675  C  CB    . LYS C 2 103 ? 52.041  114.529 10.877  1.00 44.36  ? 122 LYS A CB    1 
ATOM   6676  C  CG    . LYS C 2 103 ? 52.497  115.860 11.389  1.00 44.36  ? 122 LYS A CG    1 
ATOM   6677  C  CD    . LYS C 2 103 ? 52.104  116.852 10.284  1.00 44.36  ? 122 LYS A CD    1 
ATOM   6678  C  CE    . LYS C 2 103 ? 52.160  118.314 10.703  1.00 44.36  ? 122 LYS A CE    1 
ATOM   6679  N  NZ    . LYS C 2 103 ? 51.937  119.212 9.501   1.00 44.36  ? 122 LYS A NZ    1 
ATOM   6680  N  N     . ASP C 2 104 ? 53.350  112.250 9.488   1.00 16.39  ? 123 ASP A N     1 
ATOM   6681  C  CA    . ASP C 2 104 ? 53.404  111.356 8.350   1.00 16.39  ? 123 ASP A CA    1 
ATOM   6682  C  C     . ASP C 2 104 ? 53.564  109.909 8.760   1.00 16.39  ? 123 ASP A C     1 
ATOM   6683  O  O     . ASP C 2 104 ? 52.856  109.057 8.241   1.00 16.39  ? 123 ASP A O     1 
ATOM   6684  C  CB    . ASP C 2 104 ? 54.515  111.779 7.414   1.00 34.42  ? 123 ASP A CB    1 
ATOM   6685  C  CG    . ASP C 2 104 ? 54.382  113.220 6.992   1.00 34.42  ? 123 ASP A CG    1 
ATOM   6686  O  OD1   . ASP C 2 104 ? 53.390  113.570 6.342   1.00 34.42  ? 123 ASP A OD1   1 
ATOM   6687  O  OD2   . ASP C 2 104 ? 55.246  114.030 7.319   1.00 34.42  ? 123 ASP A OD2   1 
ATOM   6688  N  N     . ILE C 2 105 ? 54.467  109.593 9.682   1.00 20.35  ? 124 ILE A N     1 
ATOM   6689  C  CA    . ILE C 2 105 ? 54.573  108.190 10.090  1.00 20.35  ? 124 ILE A CA    1 
ATOM   6690  C  C     . ILE C 2 105 ? 53.247  107.747 10.719  1.00 20.35  ? 124 ILE A C     1 
ATOM   6691  O  O     . ILE C 2 105 ? 52.676  106.744 10.321  1.00 20.35  ? 124 ILE A O     1 
ATOM   6692  C  CB    . ILE C 2 105 ? 55.729  107.918 11.079  1.00 32.31  ? 124 ILE A CB    1 
ATOM   6693  C  CG1   . ILE C 2 105 ? 57.068  107.944 10.350  1.00 32.31  ? 124 ILE A CG1   1 
ATOM   6694  C  CG2   . ILE C 2 105 ? 55.584  106.531 11.714  1.00 32.31  ? 124 ILE A CG2   1 
ATOM   6695  C  CD1   . ILE C 2 105 ? 58.243  107.789 11.298  1.00 32.31  ? 124 ILE A CD1   1 
ATOM   6696  N  N     . GLN C 2 106 ? 52.721  108.552 11.636  1.00 29.36  ? 125 GLN A N     1 
ATOM   6697  C  CA    . GLN C 2 106 ? 51.467  108.257 12.332  1.00 29.36  ? 125 GLN A CA    1 
ATOM   6698  C  C     . GLN C 2 106 ? 50.283  107.986 11.427  1.00 29.36  ? 125 GLN A C     1 
ATOM   6699  O  O     . GLN C 2 106 ? 49.596  106.991 11.593  1.00 29.36  ? 125 GLN A O     1 
ATOM   6700  C  CB    . GLN C 2 106 ? 51.145  109.393 13.277  1.00 45.90  ? 125 GLN A CB    1 
ATOM   6701  C  CG    . GLN C 2 106 ? 52.205  109.564 14.331  1.00 45.90  ? 125 GLN A CG    1 
ATOM   6702  C  CD    . GLN C 2 106 ? 52.073  110.856 15.066  1.00 45.90  ? 125 GLN A CD    1 
ATOM   6703  O  OE1   . GLN C 2 106 ? 51.162  111.642 14.805  1.00 45.90  ? 125 GLN A OE1   1 
ATOM   6704  N  NE2   . GLN C 2 106 ? 52.993  111.104 15.985  1.00 45.90  ? 125 GLN A NE2   1 
ATOM   6705  N  N     . LEU C 2 107 ? 50.037  108.878 10.478  1.00 11.90  ? 126 LEU A N     1 
ATOM   6706  C  CA    . LEU C 2 107 ? 48.952  108.713 9.533   1.00 11.90  ? 126 LEU A CA    1 
ATOM   6707  C  C     . LEU C 2 107 ? 49.120  107.358 8.852   1.00 11.90  ? 126 LEU A C     1 
ATOM   6708  O  O     . LEU C 2 107 ? 48.228  106.509 8.916   1.00 11.90  ? 126 LEU A O     1 
ATOM   6709  C  CB    . LEU C 2 107 ? 48.974  109.838 8.481   1.00 5.00   ? 126 LEU A CB    1 
ATOM   6710  C  CG    . LEU C 2 107 ? 47.983  109.707 7.310   1.00 5.00   ? 126 LEU A CG    1 
ATOM   6711  C  CD1   . LEU C 2 107 ? 46.577  109.841 7.865   1.00 5.00   ? 126 LEU A CD1   1 
ATOM   6712  C  CD2   . LEU C 2 107 ? 48.220  110.709 6.177   1.00 5.00   ? 126 LEU A CD2   1 
ATOM   6713  N  N     . ALA C 2 108 ? 50.285  107.135 8.244   1.00 16.60  ? 127 ALA A N     1 
ATOM   6714  C  CA    . ALA C 2 108 ? 50.547  105.879 7.559   1.00 16.60  ? 127 ALA A CA    1 
ATOM   6715  C  C     . ALA C 2 108 ? 50.285  104.672 8.476   1.00 16.60  ? 127 ALA A C     1 
ATOM   6716  O  O     . ALA C 2 108 ? 49.551  103.778 8.121   1.00 16.60  ? 127 ALA A O     1 
ATOM   6717  C  CB    . ALA C 2 108 ? 51.947  105.873 7.005   1.00 5.00   ? 127 ALA A CB    1 
ATOM   6718  N  N     . ARG C 2 109 ? 50.810  104.664 9.684   1.00 17.84  ? 128 ARG A N     1 
ATOM   6719  C  CA    . ARG C 2 109 ? 50.522  103.548 10.557  1.00 17.84  ? 128 ARG A CA    1 
ATOM   6720  C  C     . ARG C 2 109 ? 49.009  103.394 10.791  1.00 17.84  ? 128 ARG A C     1 
ATOM   6721  O  O     . ARG C 2 109 ? 48.510  102.275 10.813  1.00 17.84  ? 128 ARG A O     1 
ATOM   6722  C  CB    . ARG C 2 109 ? 51.301  103.659 11.867  1.00 21.08  ? 128 ARG A CB    1 
ATOM   6723  C  CG    . ARG C 2 109 ? 52.791  103.404 11.676  1.00 21.08  ? 128 ARG A CG    1 
ATOM   6724  C  CD    . ARG C 2 109 ? 53.514  103.273 12.986  1.00 21.08  ? 128 ARG A CD    1 
ATOM   6725  N  NE    . ARG C 2 109 ? 53.180  102.051 13.708  1.00 21.08  ? 128 ARG A NE    1 
ATOM   6726  C  CZ    . ARG C 2 109 ? 52.955  102.003 15.021  1.00 21.08  ? 128 ARG A CZ    1 
ATOM   6727  N  NH1   . ARG C 2 109 ? 53.015  103.106 15.752  1.00 21.08  ? 128 ARG A NH1   1 
ATOM   6728  N  NH2   . ARG C 2 109 ? 52.742  100.846 15.633  1.00 21.08  ? 128 ARG A NH2   1 
ATOM   6729  N  N     . ARG C 2 110 ? 48.269  104.498 10.938  1.00 18.14  ? 129 ARG A N     1 
ATOM   6730  C  CA    . ARG C 2 110 ? 46.806  104.425 11.115  1.00 18.14  ? 129 ARG A CA    1 
ATOM   6731  C  C     . ARG C 2 110 ? 46.124  103.710 9.942   1.00 18.14  ? 129 ARG A C     1 
ATOM   6732  O  O     . ARG C 2 110 ? 45.473  102.684 10.106  1.00 18.14  ? 129 ARG A O     1 
ATOM   6733  C  CB    . ARG C 2 110 ? 46.218  105.815 11.275  1.00 126.87 ? 129 ARG A CB    1 
ATOM   6734  C  CG    . ARG C 2 110 ? 46.757  106.506 12.478  1.00 126.87 ? 129 ARG A CG    1 
ATOM   6735  C  CD    . ARG C 2 110 ? 46.477  107.976 12.433  1.00 126.87 ? 129 ARG A CD    1 
ATOM   6736  N  NE    . ARG C 2 110 ? 47.159  108.662 13.524  1.00 126.87 ? 129 ARG A NE    1 
ATOM   6737  C  CZ    . ARG C 2 110 ? 46.633  109.663 14.220  1.00 126.87 ? 129 ARG A CZ    1 
ATOM   6738  N  NH1   . ARG C 2 110 ? 45.410  110.104 13.940  1.00 126.87 ? 129 ARG A NH1   1 
ATOM   6739  N  NH2   . ARG C 2 110 ? 47.333  110.218 15.200  1.00 126.87 ? 129 ARG A NH2   1 
ATOM   6740  N  N     . ILE C 2 111 ? 46.348  104.213 8.741   1.00 20.19  ? 130 ILE A N     1 
ATOM   6741  C  CA    . ILE C 2 111 ? 45.743  103.630 7.566   1.00 20.19  ? 130 ILE A CA    1 
ATOM   6742  C  C     . ILE C 2 111 ? 46.187  102.187 7.341   1.00 20.19  ? 130 ILE A C     1 
ATOM   6743  O  O     . ILE C 2 111 ? 45.417  101.372 6.837   1.00 20.19  ? 130 ILE A O     1 
ATOM   6744  C  CB    . ILE C 2 111 ? 46.015  104.517 6.354   1.00 12.22  ? 130 ILE A CB    1 
ATOM   6745  C  CG1   . ILE C 2 111 ? 45.465  105.905 6.641   1.00 12.22  ? 130 ILE A CG1   1 
ATOM   6746  C  CG2   . ILE C 2 111 ? 45.333  103.976 5.082   1.00 12.22  ? 130 ILE A CG2   1 
ATOM   6747  C  CD1   . ILE C 2 111 ? 45.771  106.859 5.532   1.00 12.22  ? 130 ILE A CD1   1 
ATOM   6748  N  N     . ARG C 2 112 ? 47.426  101.884 7.720   1.00 30.25  ? 131 ARG A N     1 
ATOM   6749  C  CA    . ARG C 2 112 ? 48.001  100.546 7.606   1.00 30.25  ? 131 ARG A CA    1 
ATOM   6750  C  C     . ARG C 2 112 ? 47.337  99.534  8.540   1.00 30.25  ? 131 ARG A C     1 
ATOM   6751  O  O     . ARG C 2 112 ? 47.445  98.320  8.339   1.00 30.25  ? 131 ARG A O     1 
ATOM   6752  C  CB    . ARG C 2 112 ? 49.478  100.604 7.943   1.00 24.89  ? 131 ARG A CB    1 
ATOM   6753  C  CG    . ARG C 2 112 ? 50.382  100.895 6.776   1.00 24.89  ? 131 ARG A CG    1 
ATOM   6754  C  CD    . ARG C 2 112 ? 51.806  100.801 7.287   1.00 24.89  ? 131 ARG A CD    1 
ATOM   6755  N  NE    . ARG C 2 112 ? 52.837  100.745 6.255   1.00 24.89  ? 131 ARG A NE    1 
ATOM   6756  C  CZ    . ARG C 2 112 ? 53.976  100.079 6.390   1.00 24.89  ? 131 ARG A CZ    1 
ATOM   6757  N  NH1   . ARG C 2 112 ? 54.228  99.387  7.503   1.00 24.89  ? 131 ARG A NH1   1 
ATOM   6758  N  NH2   . ARG C 2 112 ? 54.887  100.154 5.428   1.00 24.89  ? 131 ARG A NH2   1 
ATOM   6759  N  N     . GLY C 2 113 ? 46.710  100.046 9.595   1.00 24.85  ? 132 GLY A N     1 
ATOM   6760  C  CA    . GLY C 2 113 ? 46.026  99.202  10.547  1.00 24.85  ? 132 GLY A CA    1 
ATOM   6761  C  C     . GLY C 2 113 ? 46.820  98.915  11.799  1.00 24.85  ? 132 GLY A C     1 
ATOM   6762  O  O     . GLY C 2 113 ? 46.341  98.218  12.685  1.00 24.85  ? 132 GLY A O     1 
ATOM   6763  N  N     . GLU C 2 114 ? 47.983  99.534  11.942  1.00 48.90  ? 133 GLU A N     1 
ATOM   6764  C  CA    . GLU C 2 114 ? 48.834  99.284  13.099  1.00 48.90  ? 133 GLU A CA    1 
ATOM   6765  C  C     . GLU C 2 114 ? 48.501  100.218 14.263  1.00 48.90  ? 133 GLU A C     1 
ATOM   6766  O  O     . GLU C 2 114 ? 48.916  99.986  15.406  1.00 48.90  ? 133 GLU A O     1 
ATOM   6767  C  CB    . GLU C 2 114 ? 50.305  99.426  12.684  1.00 38.49  ? 133 GLU A CB    1 
ATOM   6768  C  CG    . GLU C 2 114 ? 50.688  98.567  11.457  1.00 38.49  ? 133 GLU A CG    1 
ATOM   6769  C  CD    . GLU C 2 114 ? 52.002  98.970  10.798  1.00 38.49  ? 133 GLU A CD    1 
ATOM   6770  O  OE1   . GLU C 2 114 ? 52.811  99.660  11.456  1.00 38.49  ? 133 GLU A OE1   1 
ATOM   6771  O  OE2   . GLU C 2 114 ? 52.228  98.594  9.619   1.00 38.49  ? 133 GLU A OE2   1 
ATOM   6772  N  N     . ARG C 2 115 ? 47.720  101.255 13.967  1.00 106.93 ? 134 ARG A N     1 
ATOM   6773  C  CA    . ARG C 2 115 ? 47.310  102.250 14.958  1.00 106.93 ? 134 ARG A CA    1 
ATOM   6774  C  C     . ARG C 2 115 ? 45.788  102.448 14.960  1.00 106.93 ? 134 ARG A C     1 
ATOM   6775  O  O     . ARG C 2 115 ? 45.195  102.723 16.005  1.00 106.93 ? 134 ARG A O     1 
ATOM   6776  C  CB    . ARG C 2 115 ? 47.977  103.589 14.643  1.00 104.85 ? 134 ARG A CB    1 
ATOM   6777  C  CG    . ARG C 2 115 ? 48.931  104.111 15.684  1.00 104.85 ? 134 ARG A CG    1 
ATOM   6778  C  CD    . ARG C 2 115 ? 49.533  105.415 15.184  1.00 104.85 ? 134 ARG A CD    1 
ATOM   6779  N  NE    . ARG C 2 115 ? 50.582  105.925 16.064  1.00 104.85 ? 134 ARG A NE    1 
ATOM   6780  C  CZ    . ARG C 2 115 ? 51.814  106.237 15.665  1.00 104.85 ? 134 ARG A CZ    1 
ATOM   6781  N  NH1   . ARG C 2 115 ? 52.166  106.086 14.392  1.00 104.85 ? 134 ARG A NH1   1 
ATOM   6782  N  NH2   . ARG C 2 115 ? 52.694  106.703 16.545  1.00 104.85 ? 134 ARG A NH2   1 
ATOM   6783  N  N     . ALA C 2 116 ? 45.172  102.353 13.781  1.00 111.01 ? 135 ALA A N     1 
ATOM   6784  C  CA    . ALA C 2 116 ? 43.726  102.533 13.643  1.00 111.01 ? 135 ALA A CA    1 
ATOM   6785  C  C     . ALA C 2 116 ? 43.000  101.199 13.511  1.00 111.01 ? 135 ALA A C     1 
ATOM   6786  O  O     . ALA C 2 116 ? 42.049  100.971 14.289  1.00 155.71 ? 135 ALA A O     1 
ATOM   6787  C  CB    . ALA C 2 116 ? 43.406  103.441 12.440  1.00 155.71 ? 135 ALA A CB    1 
ATOM   6788  O  OXT   . ALA C 2 116 ? 43.390  100.394 12.636  1.00 155.71 ? 135 ALA A OXT   1 
ATOM   6789  N  N     . LYS D 3 5   ? 80.171  110.516 27.125  1.00 137.95 ? 20  LYS B N     1 
ATOM   6790  C  CA    . LYS D 3 5   ? 79.905  109.494 26.071  1.00 137.95 ? 20  LYS B CA    1 
ATOM   6791  C  C     . LYS D 3 5   ? 80.444  108.117 26.468  1.00 137.95 ? 20  LYS B C     1 
ATOM   6792  O  O     . LYS D 3 5   ? 81.617  107.807 26.233  1.00 137.95 ? 20  LYS B O     1 
ATOM   6793  C  CB    . LYS D 3 5   ? 80.510  109.936 24.728  1.00 111.72 ? 20  LYS B CB    1 
ATOM   6794  C  CG    . LYS D 3 5   ? 80.126  109.033 23.557  1.00 111.72 ? 20  LYS B CG    1 
ATOM   6795  C  CD    . LYS D 3 5   ? 80.729  109.479 22.227  1.00 111.72 ? 20  LYS B CD    1 
ATOM   6796  C  CE    . LYS D 3 5   ? 80.265  108.553 21.103  1.00 111.72 ? 20  LYS B CE    1 
ATOM   6797  N  NZ    . LYS D 3 5   ? 80.860  108.887 19.779  1.00 111.72 ? 20  LYS B NZ    1 
ATOM   6798  N  N     . VAL D 3 6   ? 79.581  107.315 27.092  1.00 162.32 ? 21  VAL B N     1 
ATOM   6799  C  CA    . VAL D 3 6   ? 79.910  105.954 27.537  1.00 162.32 ? 21  VAL B CA    1 
ATOM   6800  C  C     . VAL D 3 6   ? 78.655  105.162 27.958  1.00 162.32 ? 21  VAL B C     1 
ATOM   6801  O  O     . VAL D 3 6   ? 78.349  104.110 27.391  1.00 162.32 ? 21  VAL B O     1 
ATOM   6802  C  CB    . VAL D 3 6   ? 80.951  105.934 28.727  1.00 139.26 ? 21  VAL B CB    1 
ATOM   6803  C  CG1   . VAL D 3 6   ? 82.392  105.831 28.199  1.00 139.26 ? 21  VAL B CG1   1 
ATOM   6804  C  CG2   . VAL D 3 6   ? 80.789  107.171 29.626  1.00 139.26 ? 21  VAL B CG2   1 
ATOM   6805  N  N     . LEU D 3 7   ? 77.914  105.716 28.915  1.00 115.40 ? 22  LEU B N     1 
ATOM   6806  C  CA    . LEU D 3 7   ? 76.700  105.112 29.484  1.00 115.40 ? 22  LEU B CA    1 
ATOM   6807  C  C     . LEU D 3 7   ? 75.513  105.173 28.520  1.00 115.40 ? 22  LEU B C     1 
ATOM   6808  O  O     . LEU D 3 7   ? 74.654  106.050 28.627  1.00 115.40 ? 22  LEU B O     1 
ATOM   6809  C  CB    . LEU D 3 7   ? 76.348  105.836 30.789  1.00 120.13 ? 22  LEU B CB    1 
ATOM   6810  C  CG    . LEU D 3 7   ? 77.491  106.656 31.412  1.00 120.13 ? 22  LEU B CG    1 
ATOM   6811  C  CD1   . LEU D 3 7   ? 76.950  107.641 32.434  1.00 120.13 ? 22  LEU B CD1   1 
ATOM   6812  C  CD2   . LEU D 3 7   ? 78.560  105.737 32.010  1.00 120.13 ? 22  LEU B CD2   1 
ATOM   6813  N  N     . ARG D 3 8   ? 75.442  104.192 27.626  1.00 124.86 ? 23  ARG B N     1 
ATOM   6814  C  CA    . ARG D 3 8   ? 74.400  104.128 26.604  1.00 124.86 ? 23  ARG B CA    1 
ATOM   6815  C  C     . ARG D 3 8   ? 73.157  103.291 26.877  1.00 124.86 ? 23  ARG B C     1 
ATOM   6816  O  O     . ARG D 3 8   ? 73.131  102.439 27.772  1.00 124.86 ? 23  ARG B O     1 
ATOM   6817  C  CB    . ARG D 3 8   ? 75.012  103.636 25.294  1.00 93.82  ? 23  ARG B CB    1 
ATOM   6818  C  CG    . ARG D 3 8   ? 75.344  104.713 24.290  1.00 93.82  ? 23  ARG B CG    1 
ATOM   6819  C  CD    . ARG D 3 8   ? 76.230  104.123 23.201  1.00 93.82  ? 23  ARG B CD    1 
ATOM   6820  N  NE    . ARG D 3 8   ? 76.000  104.727 21.890  1.00 93.82  ? 23  ARG B NE    1 
ATOM   6821  C  CZ    . ARG D 3 8   ? 75.390  104.112 20.880  1.00 93.82  ? 23  ARG B CZ    1 
ATOM   6822  N  NH1   . ARG D 3 8   ? 74.944  102.873 21.033  1.00 93.82  ? 23  ARG B NH1   1 
ATOM   6823  N  NH2   . ARG D 3 8   ? 75.233  104.726 19.714  1.00 93.82  ? 23  ARG B NH2   1 
ATOM   6824  N  N     . ASP D 3 9   ? 72.135  103.564 26.064  1.00 60.17  ? 24  ASP B N     1 
ATOM   6825  C  CA    . ASP D 3 9   ? 70.857  102.856 26.086  1.00 60.17  ? 24  ASP B CA    1 
ATOM   6826  C  C     . ASP D 3 9   ? 70.813  102.156 24.726  1.00 60.17  ? 24  ASP B C     1 
ATOM   6827  O  O     . ASP D 3 9   ? 71.234  102.726 23.714  1.00 60.17  ? 24  ASP B O     1 
ATOM   6828  C  CB    . ASP D 3 9   ? 69.684  103.825 26.234  1.00 104.31 ? 24  ASP B CB    1 
ATOM   6829  C  CG    . ASP D 3 9   ? 68.462  103.160 26.842  1.00 104.31 ? 24  ASP B CG    1 
ATOM   6830  O  OD1   . ASP D 3 9   ? 67.962  102.163 26.263  1.00 104.31 ? 24  ASP B OD1   1 
ATOM   6831  O  OD2   . ASP D 3 9   ? 68.020  103.627 27.915  1.00 104.31 ? 24  ASP B OD2   1 
ATOM   6832  N  N     . ASN D 3 10  ? 70.277  100.941 24.699  1.00 36.20  ? 25  ASN B N     1 
ATOM   6833  C  CA    . ASN D 3 10  ? 70.252  100.125 23.484  1.00 36.20  ? 25  ASN B CA    1 
ATOM   6834  C  C     . ASN D 3 10  ? 69.468  100.569 22.263  1.00 36.20  ? 25  ASN B C     1 
ATOM   6835  O  O     . ASN D 3 10  ? 69.966  100.458 21.132  1.00 36.20  ? 25  ASN B O     1 
ATOM   6836  C  CB    . ASN D 3 10  ? 69.927  98.692  23.858  1.00 39.32  ? 25  ASN B CB    1 
ATOM   6837  C  CG    . ASN D 3 10  ? 70.992  98.104  24.734  1.00 39.32  ? 25  ASN B CG    1 
ATOM   6838  O  OD1   . ASN D 3 10  ? 72.177  98.299  24.477  1.00 39.32  ? 25  ASN B OD1   1 
ATOM   6839  N  ND2   . ASN D 3 10  ? 70.593  97.473  25.819  1.00 39.32  ? 25  ASN B ND2   1 
ATOM   6840  N  N     . ILE D 3 11  ? 68.251  101.061 22.487  1.00 44.14  ? 26  ILE B N     1 
ATOM   6841  C  CA    . ILE D 3 11  ? 67.417  101.554 21.396  1.00 44.14  ? 26  ILE B CA    1 
ATOM   6842  C  C     . ILE D 3 11  ? 68.086  102.812 20.808  1.00 44.14  ? 26  ILE B C     1 
ATOM   6843  O  O     . ILE D 3 11  ? 67.937  103.123 19.623  1.00 44.14  ? 26  ILE B O     1 
ATOM   6844  C  CB    . ILE D 3 11  ? 66.018  101.884 21.899  1.00 31.25  ? 26  ILE B CB    1 
ATOM   6845  C  CG1   . ILE D 3 11  ? 65.107  102.257 20.721  1.00 31.25  ? 26  ILE B CG1   1 
ATOM   6846  C  CG2   . ILE D 3 11  ? 66.094  103.000 22.918  1.00 31.25  ? 26  ILE B CG2   1 
ATOM   6847  C  CD1   . ILE D 3 11  ? 64.767  101.108 19.773  1.00 31.25  ? 26  ILE B CD1   1 
ATOM   6848  N  N     . GLN D 3 12  ? 68.839  103.513 21.657  1.00 29.81  ? 27  GLN B N     1 
ATOM   6849  C  CA    . GLN D 3 12  ? 69.592  104.700 21.259  1.00 29.81  ? 27  GLN B CA    1 
ATOM   6850  C  C     . GLN D 3 12  ? 70.782  104.249 20.424  1.00 29.81  ? 27  GLN B C     1 
ATOM   6851  O  O     . GLN D 3 12  ? 71.458  105.066 19.791  1.00 29.81  ? 27  GLN B O     1 
ATOM   6852  C  CB    . GLN D 3 12  ? 70.076  105.480 22.484  1.00 41.60  ? 27  GLN B CB    1 
ATOM   6853  C  CG    . GLN D 3 12  ? 68.965  106.173 23.281  1.00 41.60  ? 27  GLN B CG    1 
ATOM   6854  C  CD    . GLN D 3 12  ? 68.082  107.054 22.415  1.00 41.60  ? 27  GLN B CD    1 
ATOM   6855  O  OE1   . GLN D 3 12  ? 68.558  107.714 21.489  1.00 41.60  ? 27  GLN B OE1   1 
ATOM   6856  N  NE2   . GLN D 3 12  ? 66.782  107.055 22.705  1.00 41.60  ? 27  GLN B NE2   1 
ATOM   6857  N  N     . GLY D 3 13  ? 70.993  102.930 20.418  1.00 42.84  ? 28  GLY B N     1 
ATOM   6858  C  CA    . GLY D 3 13  ? 72.063  102.298 19.662  1.00 42.84  ? 28  GLY B CA    1 
ATOM   6859  C  C     . GLY D 3 13  ? 71.750  102.309 18.184  1.00 42.84  ? 28  GLY B C     1 
ATOM   6860  O  O     . GLY D 3 13  ? 72.652  102.178 17.343  1.00 42.84  ? 28  GLY B O     1 
ATOM   6861  N  N     . ILE D 3 14  ? 70.455  102.415 17.875  1.00 35.71  ? 29  ILE B N     1 
ATOM   6862  C  CA    . ILE D 3 14  ? 69.985  102.496 16.496  1.00 35.71  ? 29  ILE B CA    1 
ATOM   6863  C  C     . ILE D 3 14  ? 70.164  103.984 16.226  1.00 35.71  ? 29  ILE B C     1 
ATOM   6864  O  O     . ILE D 3 14  ? 69.310  104.790 16.593  1.00 35.71  ? 29  ILE B O     1 
ATOM   6865  C  CB    . ILE D 3 14  ? 68.503  102.157 16.396  1.00 22.51  ? 29  ILE B CB    1 
ATOM   6866  C  CG1   . ILE D 3 14  ? 68.168  100.924 17.249  1.00 22.51  ? 29  ILE B CG1   1 
ATOM   6867  C  CG2   . ILE D 3 14  ? 68.128  101.970 14.937  1.00 22.51  ? 29  ILE B CG2   1 
ATOM   6868  C  CD1   . ILE D 3 14  ? 68.853  99.664  16.833  1.00 22.51  ? 29  ILE B CD1   1 
ATOM   6869  N  N     . THR D 3 15  ? 71.317  104.329 15.653  1.00 52.84  ? 30  THR B N     1 
ATOM   6870  C  CA    . THR D 3 15  ? 71.717  105.717 15.407  1.00 52.84  ? 30  THR B CA    1 
ATOM   6871  C  C     . THR D 3 15  ? 71.069  106.513 14.298  1.00 52.84  ? 30  THR B C     1 
ATOM   6872  O  O     . THR D 3 15  ? 70.551  105.960 13.331  1.00 52.84  ? 30  THR B O     1 
ATOM   6873  C  CB    . THR D 3 15  ? 73.260  105.824 15.223  1.00 31.69  ? 30  THR B CB    1 
ATOM   6874  O  OG1   . THR D 3 15  ? 73.671  105.148 14.019  1.00 31.69  ? 30  THR B OG1   1 
ATOM   6875  C  CG2   . THR D 3 15  ? 73.976  105.225 16.426  1.00 31.69  ? 30  THR B CG2   1 
ATOM   6876  N  N     . LYS D 3 16  ? 71.161  107.835 14.432  1.00 37.51  ? 31  LYS B N     1 
ATOM   6877  C  CA    . LYS D 3 16  ? 70.625  108.758 13.438  1.00 37.51  ? 31  LYS B CA    1 
ATOM   6878  C  C     . LYS D 3 16  ? 71.101  108.478 11.996  1.00 37.51  ? 31  LYS B C     1 
ATOM   6879  O  O     . LYS D 3 16  ? 70.289  108.419 11.089  1.00 37.51  ? 31  LYS B O     1 
ATOM   6880  C  CB    . LYS D 3 16  ? 70.915  110.208 13.837  1.00 34.80  ? 31  LYS B CB    1 
ATOM   6881  C  CG    . LYS D 3 16  ? 70.790  111.199 12.693  1.00 34.80  ? 31  LYS B CG    1 
ATOM   6882  C  CD    . LYS D 3 16  ? 70.947  112.619 13.184  1.00 34.80  ? 31  LYS B CD    1 
ATOM   6883  C  CE    . LYS D 3 16  ? 70.822  113.626 12.050  1.00 34.80  ? 31  LYS B CE    1 
ATOM   6884  N  NZ    . LYS D 3 16  ? 70.754  115.012 12.597  1.00 34.80  ? 31  LYS B NZ    1 
ATOM   6885  N  N     . PRO D 3 17  ? 72.416  108.322 11.760  1.00 28.54  ? 32  PRO B N     1 
ATOM   6886  C  CA    . PRO D 3 17  ? 72.841  108.047 10.372  1.00 28.54  ? 32  PRO B CA    1 
ATOM   6887  C  C     . PRO D 3 17  ? 72.289  106.727 9.819   1.00 28.54  ? 32  PRO B C     1 
ATOM   6888  O  O     . PRO D 3 17  ? 72.054  106.599 8.610   1.00 28.54  ? 32  PRO B O     1 
ATOM   6889  C  CB    . PRO D 3 17  ? 74.362  108.033 10.470  1.00 36.76  ? 32  PRO B CB    1 
ATOM   6890  C  CG    . PRO D 3 17  ? 74.607  107.677 11.932  1.00 36.76  ? 32  PRO B CG    1 
ATOM   6891  C  CD    . PRO D 3 17  ? 73.579  108.481 12.645  1.00 36.76  ? 32  PRO B CD    1 
ATOM   6892  N  N     . ALA D 3 18  ? 72.090  105.742 10.703  1.00 34.01  ? 33  ALA B N     1 
ATOM   6893  C  CA    . ALA D 3 18  ? 71.519  104.449 10.293  1.00 34.01  ? 33  ALA B CA    1 
ATOM   6894  C  C     . ALA D 3 18  ? 70.071  104.665 9.870   1.00 34.01  ? 33  ALA B C     1 
ATOM   6895  O  O     . ALA D 3 18  ? 69.651  104.267 8.784   1.00 34.01  ? 33  ALA B O     1 
ATOM   6896  C  CB    . ALA D 3 18  ? 71.587  103.458 11.424  1.00 25.17  ? 33  ALA B CB    1 
ATOM   6897  N  N     . ILE D 3 19  ? 69.307  105.300 10.746  1.00 22.01  ? 34  ILE B N     1 
ATOM   6898  C  CA    . ILE D 3 19  ? 67.922  105.609 10.431  1.00 22.01  ? 34  ILE B CA    1 
ATOM   6899  C  C     . ILE D 3 19  ? 67.889  106.473 9.162   1.00 22.01  ? 34  ILE B C     1 
ATOM   6900  O  O     . ILE D 3 19  ? 67.036  106.294 8.296   1.00 22.01  ? 34  ILE B O     1 
ATOM   6901  C  CB    . ILE D 3 19  ? 67.250  106.379 11.567  1.00 5.92   ? 34  ILE B CB    1 
ATOM   6902  C  CG1   . ILE D 3 19  ? 67.182  105.524 12.837  1.00 5.92   ? 34  ILE B CG1   1 
ATOM   6903  C  CG2   . ILE D 3 19  ? 65.891  106.853 11.130  1.00 5.92   ? 34  ILE B CG2   1 
ATOM   6904  C  CD1   . ILE D 3 19  ? 66.586  106.268 14.007  1.00 5.92   ? 34  ILE B CD1   1 
ATOM   6905  N  N     . ARG D 3 20  ? 68.818  107.411 9.055   1.00 34.93  ? 35  ARG B N     1 
ATOM   6906  C  CA    . ARG D 3 20  ? 68.886  108.259 7.886   1.00 34.93  ? 35  ARG B CA    1 
ATOM   6907  C  C     . ARG D 3 20  ? 69.086  107.368 6.651   1.00 34.93  ? 35  ARG B C     1 
ATOM   6908  O  O     . ARG D 3 20  ? 68.404  107.555 5.645   1.00 34.93  ? 35  ARG B O     1 
ATOM   6909  C  CB    . ARG D 3 20  ? 70.005  109.286 8.041   1.00 68.42  ? 35  ARG B CB    1 
ATOM   6910  C  CG    . ARG D 3 20  ? 70.243  110.156 6.824   1.00 68.42  ? 35  ARG B CG    1 
ATOM   6911  C  CD    . ARG D 3 20  ? 71.082  111.360 7.183   1.00 68.42  ? 35  ARG B CD    1 
ATOM   6912  N  NE    . ARG D 3 20  ? 70.347  112.253 8.079   1.00 68.42  ? 35  ARG B NE    1 
ATOM   6913  C  CZ    . ARG D 3 20  ? 70.034  113.521 7.802   1.00 68.42  ? 35  ARG B CZ    1 
ATOM   6914  N  NH1   . ARG D 3 20  ? 70.397  114.072 6.644   1.00 68.42  ? 35  ARG B NH1   1 
ATOM   6915  N  NH2   . ARG D 3 20  ? 69.269  114.211 8.644   1.00 68.42  ? 35  ARG B NH2   1 
ATOM   6916  N  N     . ARG D 3 21  ? 69.988  106.382 6.720   1.00 22.76  ? 36  ARG B N     1 
ATOM   6917  C  CA    . ARG D 3 21  ? 70.202  105.475 5.582   1.00 22.76  ? 36  ARG B CA    1 
ATOM   6918  C  C     . ARG D 3 21  ? 68.918  104.723 5.183   1.00 22.76  ? 36  ARG B C     1 
ATOM   6919  O  O     . ARG D 3 21  ? 68.590  104.594 3.999   1.00 22.76  ? 36  ARG B O     1 
ATOM   6920  C  CB    . ARG D 3 21  ? 71.318  104.475 5.890   1.00 30.75  ? 36  ARG B CB    1 
ATOM   6921  C  CG    . ARG D 3 21  ? 72.718  105.055 5.849   1.00 30.75  ? 36  ARG B CG    1 
ATOM   6922  C  CD    . ARG D 3 21  ? 73.766  103.942 5.817   1.00 30.75  ? 36  ARG B CD    1 
ATOM   6923  N  NE    . ARG D 3 21  ? 73.912  103.277 7.109   1.00 30.75  ? 36  ARG B NE    1 
ATOM   6924  C  CZ    . ARG D 3 21  ? 74.522  103.820 8.161   1.00 30.75  ? 36  ARG B CZ    1 
ATOM   6925  N  NH1   . ARG D 3 21  ? 75.051  105.045 8.080   1.00 30.75  ? 36  ARG B NH1   1 
ATOM   6926  N  NH2   . ARG D 3 21  ? 74.554  103.153 9.310   1.00 30.75  ? 36  ARG B NH2   1 
ATOM   6927  N  N     . LEU D 3 22  ? 68.197  104.216 6.180   1.00 28.37  ? 37  LEU B N     1 
ATOM   6928  C  CA    . LEU D 3 22  ? 66.941  103.513 5.942   1.00 28.37  ? 37  LEU B CA    1 
ATOM   6929  C  C     . LEU D 3 22  ? 65.999  104.396 5.132   1.00 28.37  ? 37  LEU B C     1 
ATOM   6930  O  O     . LEU D 3 22  ? 65.594  104.043 4.025   1.00 28.37  ? 37  LEU B O     1 
ATOM   6931  C  CB    . LEU D 3 22  ? 66.324  103.120 7.274   1.00 10.93  ? 37  LEU B CB    1 
ATOM   6932  C  CG    . LEU D 3 22  ? 67.060  101.872 7.770   1.00 10.93  ? 37  LEU B CG    1 
ATOM   6933  C  CD1   . LEU D 3 22  ? 66.720  101.557 9.201   1.00 10.93  ? 37  LEU B CD1   1 
ATOM   6934  C  CD2   . LEU D 3 22  ? 66.745  100.678 6.848   1.00 10.93  ? 37  LEU B CD2   1 
ATOM   6935  N  N     . ALA D 3 23  ? 65.739  105.590 5.660   1.00 25.13  ? 38  ALA B N     1 
ATOM   6936  C  CA    . ALA D 3 23  ? 64.887  106.589 5.007   1.00 25.13  ? 38  ALA B CA    1 
ATOM   6937  C  C     . ALA D 3 23  ? 65.253  106.804 3.536   1.00 25.13  ? 38  ALA B C     1 
ATOM   6938  O  O     . ALA D 3 23  ? 64.386  106.880 2.680   1.00 25.13  ? 38  ALA B O     1 
ATOM   6939  C  CB    . ALA D 3 23  ? 64.983  107.908 5.759   1.00 5.00   ? 38  ALA B CB    1 
ATOM   6940  N  N     . ARG D 3 24  ? 66.543  106.949 3.261   1.00 25.01  ? 39  ARG B N     1 
ATOM   6941  C  CA    . ARG D 3 24  ? 67.024  107.160 1.905   1.00 25.01  ? 39  ARG B CA    1 
ATOM   6942  C  C     . ARG D 3 24  ? 66.643  106.028 0.969   1.00 25.01  ? 39  ARG B C     1 
ATOM   6943  O  O     . ARG D 3 24  ? 66.250  106.276 -0.171  1.00 25.01  ? 39  ARG B O     1 
ATOM   6944  C  CB    . ARG D 3 24  ? 68.533  107.382 1.902   1.00 29.79  ? 39  ARG B CB    1 
ATOM   6945  C  CG    . ARG D 3 24  ? 68.978  108.655 2.623   1.00 29.79  ? 39  ARG B CG    1 
ATOM   6946  C  CD    . ARG D 3 24  ? 68.987  109.881 1.702   1.00 29.79  ? 39  ARG B CD    1 
ATOM   6947  N  NE    . ARG D 3 24  ? 69.561  111.047 2.371   1.00 29.79  ? 39  ARG B NE    1 
ATOM   6948  C  CZ    . ARG D 3 24  ? 68.889  111.836 3.205   1.00 29.79  ? 39  ARG B CZ    1 
ATOM   6949  N  NH1   . ARG D 3 24  ? 67.618  111.597 3.477   1.00 29.79  ? 39  ARG B NH1   1 
ATOM   6950  N  NH2   . ARG D 3 24  ? 69.470  112.890 3.760   1.00 29.79  ? 39  ARG B NH2   1 
ATOM   6951  N  N     . ARG D 3 25  ? 66.784  104.788 1.431   1.00 33.70  ? 40  ARG B N     1 
ATOM   6952  C  CA    . ARG D 3 25  ? 66.414  103.627 0.617   1.00 33.70  ? 40  ARG B CA    1 
ATOM   6953  C  C     . ARG D 3 25  ? 64.901  103.713 0.342   1.00 33.70  ? 40  ARG B C     1 
ATOM   6954  O  O     . ARG D 3 25  ? 64.403  103.225 -0.692  1.00 33.70  ? 40  ARG B O     1 
ATOM   6955  C  CB    . ARG D 3 25  ? 66.771  102.347 1.359   1.00 29.79  ? 40  ARG B CB    1 
ATOM   6956  C  CG    . ARG D 3 25  ? 66.703  101.105 0.506   1.00 29.79  ? 40  ARG B CG    1 
ATOM   6957  C  CD    . ARG D 3 25  ? 67.395  99.919  1.171   1.00 29.79  ? 40  ARG B CD    1 
ATOM   6958  N  NE    . ARG D 3 25  ? 68.771  99.710  0.702   1.00 29.79  ? 40  ARG B NE    1 
ATOM   6959  C  CZ    . ARG D 3 25  ? 69.690  99.009  1.362   1.00 29.79  ? 40  ARG B CZ    1 
ATOM   6960  N  NH1   . ARG D 3 25  ? 69.396  98.442  2.528   1.00 29.79  ? 40  ARG B NH1   1 
ATOM   6961  N  NH2   . ARG D 3 25  ? 70.914  98.884  0.875   1.00 29.79  ? 40  ARG B NH2   1 
ATOM   6962  N  N     . GLY D 3 26  ? 64.186  104.331 1.295   1.00 32.71  ? 41  GLY B N     1 
ATOM   6963  C  CA    . GLY D 3 26  ? 62.751  104.561 1.177   1.00 32.71  ? 41  GLY B CA    1 
ATOM   6964  C  C     . GLY D 3 26  ? 62.411  105.751 0.271   1.00 32.71  ? 41  GLY B C     1 
ATOM   6965  O  O     . GLY D 3 26  ? 61.245  106.030 0.008   1.00 32.71  ? 41  GLY B O     1 
ATOM   6966  N  N     . GLY D 3 27  ? 63.432  106.466 -0.193  1.00 16.73  ? 42  GLY B N     1 
ATOM   6967  C  CA    . GLY D 3 27  ? 63.225  107.594 -1.079  1.00 16.73  ? 42  GLY B CA    1 
ATOM   6968  C  C     . GLY D 3 27  ? 62.995  108.965 -0.455  1.00 16.73  ? 42  GLY B C     1 
ATOM   6969  O  O     . GLY D 3 27  ? 62.558  109.886 -1.163  1.00 16.73  ? 42  GLY B O     1 
ATOM   6970  N  N     . VAL D 3 28  ? 63.252  109.094 0.848   1.00 31.31  ? 43  VAL B N     1 
ATOM   6971  C  CA    . VAL D 3 28  ? 63.087  110.356 1.583   1.00 31.31  ? 43  VAL B CA    1 
ATOM   6972  C  C     . VAL D 3 28  ? 64.279  111.304 1.325   1.00 31.31  ? 43  VAL B C     1 
ATOM   6973  O  O     . VAL D 3 28  ? 65.435  110.878 1.389   1.00 31.31  ? 43  VAL B O     1 
ATOM   6974  C  CB    . VAL D 3 28  ? 62.971  110.069 3.091   1.00 13.12  ? 43  VAL B CB    1 
ATOM   6975  C  CG1   . VAL D 3 28  ? 62.828  111.336 3.870   1.00 13.12  ? 43  VAL B CG1   1 
ATOM   6976  C  CG2   . VAL D 3 28  ? 61.820  109.122 3.356   1.00 13.12  ? 43  VAL B CG2   1 
ATOM   6977  N  N     . LYS D 3 29  ? 63.991  112.584 1.066   1.00 29.43  ? 44  LYS B N     1 
ATOM   6978  C  CA    . LYS D 3 29  ? 65.025  113.577 0.772   1.00 29.43  ? 44  LYS B CA    1 
ATOM   6979  C  C     . LYS D 3 29  ? 65.387  114.507 1.935   1.00 29.43  ? 44  LYS B C     1 
ATOM   6980  O  O     . LYS D 3 29  ? 66.563  114.812 2.161   1.00 29.43  ? 44  LYS B O     1 
ATOM   6981  C  CB    . LYS D 3 29  ? 64.603  114.408 -0.430  1.00 46.92  ? 44  LYS B CB    1 
ATOM   6982  C  CG    . LYS D 3 29  ? 65.566  115.527 -0.802  1.00 46.92  ? 44  LYS B CG    1 
ATOM   6983  C  CD    . LYS D 3 29  ? 65.024  116.340 -1.969  1.00 46.92  ? 44  LYS B CD    1 
ATOM   6984  C  CE    . LYS D 3 29  ? 66.026  117.355 -2.471  1.00 46.92  ? 44  LYS B CE    1 
ATOM   6985  N  NZ    . LYS D 3 29  ? 65.510  117.996 -3.716  1.00 46.92  ? 44  LYS B NZ    1 
ATOM   6986  N  N     . ARG D 3 30  ? 64.376  115.013 2.631   1.00 21.86  ? 45  ARG B N     1 
ATOM   6987  C  CA    . ARG D 3 30  ? 64.581  115.907 3.767   1.00 21.86  ? 45  ARG B CA    1 
ATOM   6988  C  C     . ARG D 3 30  ? 63.868  115.232 4.956   1.00 21.86  ? 45  ARG B C     1 
ATOM   6989  O  O     . ARG D 3 30  ? 62.769  114.676 4.791   1.00 21.86  ? 45  ARG B O     1 
ATOM   6990  C  CB    . ARG D 3 30  ? 63.992  117.281 3.430   1.00 42.28  ? 45  ARG B CB    1 
ATOM   6991  C  CG    . ARG D 3 30  ? 64.574  118.432 4.212   1.00 42.28  ? 45  ARG B CG    1 
ATOM   6992  C  CD    . ARG D 3 30  ? 64.265  119.772 3.551   1.00 42.28  ? 45  ARG B CD    1 
ATOM   6993  N  NE    . ARG D 3 30  ? 64.981  120.864 4.202   1.00 42.28  ? 45  ARG B NE    1 
ATOM   6994  C  CZ    . ARG D 3 30  ? 64.555  121.508 5.288   1.00 42.28  ? 45  ARG B CZ    1 
ATOM   6995  N  NH1   . ARG D 3 30  ? 63.395  121.188 5.857   1.00 42.28  ? 45  ARG B NH1   1 
ATOM   6996  N  NH2   . ARG D 3 30  ? 65.308  122.473 5.819   1.00 42.28  ? 45  ARG B NH2   1 
ATOM   6997  N  N     . ILE D 3 31  ? 64.498  115.264 6.139   1.00 27.20  ? 46  ILE B N     1 
ATOM   6998  C  CA    . ILE D 3 31  ? 63.963  114.618 7.343   1.00 27.20  ? 46  ILE B CA    1 
ATOM   6999  C  C     . ILE D 3 31  ? 63.875  115.494 8.599   1.00 27.20  ? 46  ILE B C     1 
ATOM   7000  O  O     . ILE D 3 31  ? 64.889  115.959 9.104   1.00 27.20  ? 46  ILE B O     1 
ATOM   7001  C  CB    . ILE D 3 31  ? 64.843  113.399 7.686   1.00 9.84   ? 46  ILE B CB    1 
ATOM   7002  C  CG1   . ILE D 3 31  ? 64.863  112.408 6.507   1.00 9.84   ? 46  ILE B CG1   1 
ATOM   7003  C  CG2   . ILE D 3 31  ? 64.385  112.737 8.983   1.00 9.84   ? 46  ILE B CG2   1 
ATOM   7004  C  CD1   . ILE D 3 31  ? 65.955  111.332 6.607   1.00 9.84   ? 46  ILE B CD1   1 
ATOM   7005  N  N     . SER D 3 32  ? 62.672  115.634 9.149   1.00 29.26  ? 47  SER B N     1 
ATOM   7006  C  CA    . SER D 3 32  ? 62.447  116.414 10.370  1.00 29.26  ? 47  SER B CA    1 
ATOM   7007  C  C     . SER D 3 32  ? 63.256  115.864 11.547  1.00 29.26  ? 47  SER B C     1 
ATOM   7008  O  O     . SER D 3 32  ? 63.369  114.642 11.731  1.00 29.26  ? 47  SER B O     1 
ATOM   7009  C  CB    . SER D 3 32  ? 60.950  116.429 10.741  1.00 27.36  ? 47  SER B CB    1 
ATOM   7010  O  OG    . SER D 3 32  ? 60.729  116.713 12.125  1.00 27.36  ? 47  SER B OG    1 
ATOM   7011  N  N     . GLY D 3 33  ? 63.719  116.777 12.397  1.00 30.03  ? 48  GLY B N     1 
ATOM   7012  C  CA    . GLY D 3 33  ? 64.512  116.391 13.542  1.00 30.03  ? 48  GLY B CA    1 
ATOM   7013  C  C     . GLY D 3 33  ? 63.854  115.398 14.468  1.00 30.03  ? 48  GLY B C     1 
ATOM   7014  O  O     . GLY D 3 33  ? 64.535  114.623 15.133  1.00 30.03  ? 48  GLY B O     1 
ATOM   7015  N  N     . LEU D 3 34  ? 62.529  115.343 14.447  1.00 29.92  ? 49  LEU B N     1 
ATOM   7016  C  CA    . LEU D 3 34  ? 61.804  114.445 15.346  1.00 29.92  ? 49  LEU B CA    1 
ATOM   7017  C  C     . LEU D 3 34  ? 61.573  113.013 14.872  1.00 29.92  ? 49  LEU B C     1 
ATOM   7018  O  O     . LEU D 3 34  ? 61.085  112.157 15.636  1.00 29.92  ? 49  LEU B O     1 
ATOM   7019  C  CB    . LEU D 3 34  ? 60.488  115.092 15.725  1.00 35.14  ? 49  LEU B CB    1 
ATOM   7020  C  CG    . LEU D 3 34  ? 60.790  116.405 16.426  1.00 35.14  ? 49  LEU B CG    1 
ATOM   7021  C  CD1   . LEU D 3 34  ? 59.529  117.216 16.550  1.00 35.14  ? 49  LEU B CD1   1 
ATOM   7022  C  CD2   . LEU D 3 34  ? 61.433  116.104 17.780  1.00 35.14  ? 49  LEU B CD2   1 
ATOM   7023  N  N     . ILE D 3 35  ? 61.986  112.735 13.639  1.00 23.59  ? 50  ILE B N     1 
ATOM   7024  C  CA    . ILE D 3 35  ? 61.813  111.406 13.065  1.00 23.59  ? 50  ILE B CA    1 
ATOM   7025  C  C     . ILE D 3 35  ? 62.586  110.280 13.755  1.00 23.59  ? 50  ILE B C     1 
ATOM   7026  O  O     . ILE D 3 35  ? 62.085  109.176 13.864  1.00 23.59  ? 50  ILE B O     1 
ATOM   7027  C  CB    . ILE D 3 35  ? 62.134  111.415 11.558  1.00 14.73  ? 50  ILE B CB    1 
ATOM   7028  C  CG1   . ILE D 3 35  ? 60.996  112.108 10.786  1.00 14.73  ? 50  ILE B CG1   1 
ATOM   7029  C  CG2   . ILE D 3 35  ? 62.443  110.004 11.062  1.00 14.73  ? 50  ILE B CG2   1 
ATOM   7030  C  CD1   . ILE D 3 35  ? 59.628  111.408 10.854  1.00 14.73  ? 50  ILE B CD1   1 
ATOM   7031  N  N     . TYR D 3 36  ? 63.754  110.588 14.306  1.00 29.80  ? 51  TYR B N     1 
ATOM   7032  C  CA    . TYR D 3 36  ? 64.575  109.560 14.943  1.00 29.80  ? 51  TYR B CA    1 
ATOM   7033  C  C     . TYR D 3 36  ? 63.931  108.930 16.151  1.00 29.80  ? 51  TYR B C     1 
ATOM   7034  O  O     . TYR D 3 36  ? 63.844  107.707 16.239  1.00 29.80  ? 51  TYR B O     1 
ATOM   7035  C  CB    . TYR D 3 36  ? 65.976  110.098 15.235  1.00 22.15  ? 51  TYR B CB    1 
ATOM   7036  C  CG    . TYR D 3 36  ? 66.520  110.820 14.015  1.00 22.15  ? 51  TYR B CG    1 
ATOM   7037  C  CD1   . TYR D 3 36  ? 67.014  110.117 12.899  1.00 22.15  ? 51  TYR B CD1   1 
ATOM   7038  C  CD2   . TYR D 3 36  ? 66.411  112.203 13.919  1.00 22.15  ? 51  TYR B CD2   1 
ATOM   7039  C  CE1   . TYR D 3 36  ? 67.368  110.802 11.725  1.00 22.15  ? 51  TYR B CE1   1 
ATOM   7040  C  CE2   . TYR D 3 36  ? 66.756  112.876 12.763  1.00 22.15  ? 51  TYR B CE2   1 
ATOM   7041  C  CZ    . TYR D 3 36  ? 67.226  112.189 11.679  1.00 22.15  ? 51  TYR B CZ    1 
ATOM   7042  O  OH    . TYR D 3 36  ? 67.510  112.931 10.557  1.00 22.15  ? 51  TYR B OH    1 
ATOM   7043  N  N     . GLU D 3 37  ? 63.401  109.754 17.044  1.00 40.91  ? 52  GLU B N     1 
ATOM   7044  C  CA    . GLU D 3 37  ? 62.755  109.203 18.216  1.00 40.91  ? 52  GLU B CA    1 
ATOM   7045  C  C     . GLU D 3 37  ? 61.502  108.490 17.786  1.00 40.91  ? 52  GLU B C     1 
ATOM   7046  O  O     . GLU D 3 37  ? 61.246  107.369 18.211  1.00 40.91  ? 52  GLU B O     1 
ATOM   7047  C  CB    . GLU D 3 37  ? 62.463  110.279 19.254  1.00 53.48  ? 52  GLU B CB    1 
ATOM   7048  C  CG    . GLU D 3 37  ? 63.634  110.504 20.187  1.00 53.48  ? 52  GLU B CG    1 
ATOM   7049  C  CD    . GLU D 3 37  ? 63.944  109.282 21.055  1.00 53.48  ? 52  GLU B CD    1 
ATOM   7050  O  OE1   . GLU D 3 37  ? 63.297  109.154 22.120  1.00 53.48  ? 52  GLU B OE1   1 
ATOM   7051  O  OE2   . GLU D 3 37  ? 64.826  108.463 20.688  1.00 53.48  ? 52  GLU B OE2   1 
ATOM   7052  N  N     . GLU D 3 38  ? 60.769  109.098 16.866  1.00 29.91  ? 53  GLU B N     1 
ATOM   7053  C  CA    . GLU D 3 38  ? 59.546  108.482 16.381  1.00 29.91  ? 53  GLU B CA    1 
ATOM   7054  C  C     . GLU D 3 38  ? 59.858  107.080 15.824  1.00 29.91  ? 53  GLU B C     1 
ATOM   7055  O  O     . GLU D 3 38  ? 59.257  106.092 16.251  1.00 29.91  ? 53  GLU B O     1 
ATOM   7056  C  CB    . GLU D 3 38  ? 58.880  109.399 15.330  1.00 36.25  ? 53  GLU B CB    1 
ATOM   7057  C  CG    . GLU D 3 38  ? 57.416  109.082 14.965  1.00 36.25  ? 53  GLU B CG    1 
ATOM   7058  C  CD    . GLU D 3 38  ? 56.444  109.147 16.148  1.00 36.25  ? 53  GLU B CD    1 
ATOM   7059  O  OE1   . GLU D 3 38  ? 56.681  109.930 17.098  1.00 36.25  ? 53  GLU B OE1   1 
ATOM   7060  O  OE2   . GLU D 3 38  ? 55.432  108.404 16.131  1.00 36.25  ? 53  GLU B OE2   1 
ATOM   7061  N  N     . THR D 3 39  ? 60.869  106.998 14.959  1.00 20.76  ? 54  THR B N     1 
ATOM   7062  C  CA    . THR D 3 39  ? 61.287  105.743 14.323  1.00 20.76  ? 54  THR B CA    1 
ATOM   7063  C  C     . THR D 3 39  ? 61.722  104.692 15.344  1.00 20.76  ? 54  THR B C     1 
ATOM   7064  O  O     . THR D 3 39  ? 61.387  103.506 15.222  1.00 20.76  ? 54  THR B O     1 
ATOM   7065  C  CB    . THR D 3 39  ? 62.455  105.960 13.305  1.00 14.31  ? 54  THR B CB    1 
ATOM   7066  O  OG1   . THR D 3 39  ? 62.197  107.109 12.488  1.00 14.31  ? 54  THR B OG1   1 
ATOM   7067  C  CG2   . THR D 3 39  ? 62.611  104.757 12.394  1.00 14.31  ? 54  THR B CG2   1 
ATOM   7068  N  N     . ARG D 3 40  ? 62.493  105.107 16.340  1.00 34.75  ? 55  ARG B N     1 
ATOM   7069  C  CA    . ARG D 3 40  ? 62.934  104.160 17.356  1.00 34.75  ? 55  ARG B CA    1 
ATOM   7070  C  C     . ARG D 3 40  ? 61.735  103.506 18.023  1.00 34.75  ? 55  ARG B C     1 
ATOM   7071  O  O     . ARG D 3 40  ? 61.721  102.313 18.242  1.00 34.75  ? 55  ARG B O     1 
ATOM   7072  C  CB    . ARG D 3 40  ? 63.848  104.834 18.378  1.00 28.55  ? 55  ARG B CB    1 
ATOM   7073  C  CG    . ARG D 3 40  ? 65.198  105.211 17.800  1.00 28.55  ? 55  ARG B CG    1 
ATOM   7074  C  CD    . ARG D 3 40  ? 66.259  105.507 18.873  1.00 28.55  ? 55  ARG B CD    1 
ATOM   7075  N  NE    . ARG D 3 40  ? 67.406  106.105 18.205  1.00 28.55  ? 55  ARG B NE    1 
ATOM   7076  C  CZ    . ARG D 3 40  ? 67.628  107.410 18.127  1.00 28.55  ? 55  ARG B CZ    1 
ATOM   7077  N  NH1   . ARG D 3 40  ? 66.821  108.272 18.724  1.00 28.55  ? 55  ARG B NH1   1 
ATOM   7078  N  NH2   . ARG D 3 40  ? 68.516  107.856 17.255  1.00 28.55  ? 55  ARG B NH2   1 
ATOM   7079  N  N     . GLY D 3 41  ? 60.687  104.279 18.245  1.00 17.78  ? 56  GLY B N     1 
ATOM   7080  C  CA    . GLY D 3 41  ? 59.494  103.740 18.868  1.00 17.78  ? 56  GLY B CA    1 
ATOM   7081  C  C     . GLY D 3 41  ? 58.750  102.740 18.014  1.00 17.78  ? 56  GLY B C     1 
ATOM   7082  O  O     . GLY D 3 41  ? 58.153  101.787 18.529  1.00 17.78  ? 56  GLY B O     1 
ATOM   7083  N  N     . VAL D 3 42  ? 58.718  103.003 16.714  1.00 32.52  ? 57  VAL B N     1 
ATOM   7084  C  CA    . VAL D 3 42  ? 58.072  102.106 15.769  1.00 32.52  ? 57  VAL B CA    1 
ATOM   7085  C  C     . VAL D 3 42  ? 58.850  100.798 15.798  1.00 32.52  ? 57  VAL B C     1 
ATOM   7086  O  O     . VAL D 3 42  ? 58.267  99.726  15.933  1.00 32.52  ? 57  VAL B O     1 
ATOM   7087  C  CB    . VAL D 3 42  ? 58.140  102.665 14.318  1.00 16.43  ? 57  VAL B CB    1 
ATOM   7088  C  CG1   . VAL D 3 42  ? 57.605  101.651 13.316  1.00 16.43  ? 57  VAL B CG1   1 
ATOM   7089  C  CG2   . VAL D 3 42  ? 57.381  103.949 14.207  1.00 16.43  ? 57  VAL B CG2   1 
ATOM   7090  N  N     . LEU D 3 43  ? 60.175  100.898 15.701  1.00 25.14  ? 58  LEU B N     1 
ATOM   7091  C  CA    . LEU D 3 43  ? 61.013  99.708  15.686  1.00 25.14  ? 58  LEU B CA    1 
ATOM   7092  C  C     . LEU D 3 43  ? 60.870  98.870  16.929  1.00 25.14  ? 58  LEU B C     1 
ATOM   7093  O  O     . LEU D 3 43  ? 60.908  97.652  16.856  1.00 25.14  ? 58  LEU B O     1 
ATOM   7094  C  CB    . LEU D 3 43  ? 62.476  100.060 15.451  1.00 22.90  ? 58  LEU B CB    1 
ATOM   7095  C  CG    . LEU D 3 43  ? 63.386  98.837  15.269  1.00 22.90  ? 58  LEU B CG    1 
ATOM   7096  C  CD1   . LEU D 3 43  ? 62.875  97.913  14.185  1.00 22.90  ? 58  LEU B CD1   1 
ATOM   7097  C  CD2   . LEU D 3 43  ? 64.765  99.327  14.924  1.00 22.90  ? 58  LEU B CD2   1 
ATOM   7098  N  N     . LYS D 3 44  ? 60.741  99.522  18.071  1.00 29.02  ? 59  LYS B N     1 
ATOM   7099  C  CA    . LYS D 3 44  ? 60.554  98.813  19.320  1.00 29.02  ? 59  LYS B CA    1 
ATOM   7100  C  C     . LYS D 3 44  ? 59.249  98.003  19.273  1.00 29.02  ? 59  LYS B C     1 
ATOM   7101  O  O     . LYS D 3 44  ? 59.257  96.816  19.606  1.00 29.02  ? 59  LYS B O     1 
ATOM   7102  C  CB    . LYS D 3 44  ? 60.528  99.786  20.487  1.00 44.35  ? 59  LYS B CB    1 
ATOM   7103  C  CG    . LYS D 3 44  ? 60.800  99.130  21.810  1.00 44.35  ? 59  LYS B CG    1 
ATOM   7104  C  CD    . LYS D 3 44  ? 60.772  100.146 22.928  1.00 44.35  ? 59  LYS B CD    1 
ATOM   7105  C  CE    . LYS D 3 44  ? 61.110  99.511  24.259  1.00 44.35  ? 59  LYS B CE    1 
ATOM   7106  N  NZ    . LYS D 3 44  ? 60.348  100.179 25.343  1.00 44.35  ? 59  LYS B NZ    1 
ATOM   7107  N  N     . VAL D 3 45  ? 58.140  98.622  18.842  1.00 17.05  ? 60  VAL B N     1 
ATOM   7108  C  CA    . VAL D 3 45  ? 56.859  97.914  18.739  1.00 17.05  ? 60  VAL B CA    1 
ATOM   7109  C  C     . VAL D 3 45  ? 57.024  96.765  17.750  1.00 17.05  ? 60  VAL B C     1 
ATOM   7110  O  O     . VAL D 3 45  ? 56.601  95.647  18.029  1.00 17.05  ? 60  VAL B O     1 
ATOM   7111  C  CB    . VAL D 3 45  ? 55.715  98.849  18.306  1.00 26.72  ? 60  VAL B CB    1 
ATOM   7112  C  CG1   . VAL D 3 45  ? 54.497  98.057  17.933  1.00 26.72  ? 60  VAL B CG1   1 
ATOM   7113  C  CG2   . VAL D 3 45  ? 55.358  99.798  19.432  1.00 26.72  ? 60  VAL B CG2   1 
ATOM   7114  N  N     . PHE D 3 46  ? 57.697  97.012  16.630  1.00 17.06  ? 61  PHE B N     1 
ATOM   7115  C  CA    . PHE D 3 46  ? 57.922  95.946  15.665  1.00 17.06  ? 61  PHE B CA    1 
ATOM   7116  C  C     . PHE D 3 46  ? 58.606  94.750  16.333  1.00 17.06  ? 61  PHE B C     1 
ATOM   7117  O  O     . PHE D 3 46  ? 58.029  93.655  16.411  1.00 17.06  ? 61  PHE B O     1 
ATOM   7118  C  CB    . PHE D 3 46  ? 58.767  96.415  14.467  1.00 14.75  ? 61  PHE B CB    1 
ATOM   7119  C  CG    . PHE D 3 46  ? 58.818  95.398  13.327  1.00 14.75  ? 61  PHE B CG    1 
ATOM   7120  C  CD1   . PHE D 3 46  ? 57.808  95.358  12.362  1.00 14.75  ? 61  PHE B CD1   1 
ATOM   7121  C  CD2   . PHE D 3 46  ? 59.823  94.424  13.275  1.00 14.75  ? 61  PHE B CD2   1 
ATOM   7122  C  CE1   . PHE D 3 46  ? 57.793  94.364  11.373  1.00 14.75  ? 61  PHE B CE1   1 
ATOM   7123  C  CE2   . PHE D 3 46  ? 59.809  93.422  12.282  1.00 14.75  ? 61  PHE B CE2   1 
ATOM   7124  C  CZ    . PHE D 3 46  ? 58.795  93.395  11.335  1.00 14.75  ? 61  PHE B CZ    1 
ATOM   7125  N  N     . LEU D 3 47  ? 59.810  94.970  16.854  1.00 15.90  ? 62  LEU B N     1 
ATOM   7126  C  CA    . LEU D 3 47  ? 60.567  93.913  17.507  1.00 15.90  ? 62  LEU B CA    1 
ATOM   7127  C  C     . LEU D 3 47  ? 59.797  93.239  18.633  1.00 15.90  ? 62  LEU B C     1 
ATOM   7128  O  O     . LEU D 3 47  ? 59.708  92.017  18.639  1.00 15.90  ? 62  LEU B O     1 
ATOM   7129  C  CB    . LEU D 3 47  ? 61.924  94.438  17.979  1.00 21.23  ? 62  LEU B CB    1 
ATOM   7130  C  CG    . LEU D 3 47  ? 62.823  94.861  16.805  1.00 21.23  ? 62  LEU B CG    1 
ATOM   7131  C  CD1   . LEU D 3 47  ? 64.070  95.545  17.295  1.00 21.23  ? 62  LEU B CD1   1 
ATOM   7132  C  CD2   . LEU D 3 47  ? 63.180  93.659  15.959  1.00 21.23  ? 62  LEU B CD2   1 
ATOM   7133  N  N     . GLU D 3 48  ? 59.176  94.021  19.528  1.00 8.40   ? 63  GLU B N     1 
ATOM   7134  C  CA    . GLU D 3 48  ? 58.373  93.477  20.647  1.00 8.40   ? 63  GLU B CA    1 
ATOM   7135  C  C     . GLU D 3 48  ? 57.364  92.463  20.146  1.00 8.40   ? 63  GLU B C     1 
ATOM   7136  O  O     . GLU D 3 48  ? 57.449  91.293  20.497  1.00 8.40   ? 63  GLU B O     1 
ATOM   7137  C  CB    . GLU D 3 48  ? 57.646  94.590  21.421  1.00 23.16  ? 63  GLU B CB    1 
ATOM   7138  C  CG    . GLU D 3 48  ? 58.594  95.525  22.196  1.00 23.16  ? 63  GLU B CG    1 
ATOM   7139  C  CD    . GLU D 3 48  ? 57.892  96.600  23.039  1.00 23.16  ? 63  GLU B CD    1 
ATOM   7140  O  OE1   . GLU D 3 48  ? 56.671  96.783  22.863  1.00 23.16  ? 63  GLU B OE1   1 
ATOM   7141  O  OE2   . GLU D 3 48  ? 58.565  97.267  23.877  1.00 23.16  ? 63  GLU B OE2   1 
ATOM   7142  N  N     . ASN D 3 49  ? 56.495  92.877  19.230  1.00 23.87  ? 64  ASN B N     1 
ATOM   7143  C  CA    . ASN D 3 49  ? 55.478  91.974  18.684  1.00 23.87  ? 64  ASN B CA    1 
ATOM   7144  C  C     . ASN D 3 49  ? 56.027  90.675  18.134  1.00 23.87  ? 64  ASN B C     1 
ATOM   7145  O  O     . ASN D 3 49  ? 55.586  89.592  18.543  1.00 23.87  ? 64  ASN B O     1 
ATOM   7146  C  CB    . ASN D 3 49  ? 54.650  92.647  17.591  1.00 41.03  ? 64  ASN B CB    1 
ATOM   7147  C  CG    . ASN D 3 49  ? 53.732  93.712  18.131  1.00 41.03  ? 64  ASN B CG    1 
ATOM   7148  O  OD1   . ASN D 3 49  ? 53.460  93.773  19.344  1.00 41.03  ? 64  ASN B OD1   1 
ATOM   7149  N  ND2   . ASN D 3 49  ? 53.249  94.570  17.237  1.00 41.03  ? 64  ASN B ND2   1 
ATOM   7150  N  N     . VAL D 3 50  ? 57.002  90.783  17.230  1.00 27.49  ? 65  VAL B N     1 
ATOM   7151  C  CA    . VAL D 3 50  ? 57.603  89.606  16.601  1.00 27.49  ? 65  VAL B CA    1 
ATOM   7152  C  C     . VAL D 3 50  ? 58.312  88.685  17.600  1.00 27.49  ? 65  VAL B C     1 
ATOM   7153  O  O     . VAL D 3 50  ? 58.048  87.478  17.636  1.00 27.49  ? 65  VAL B O     1 
ATOM   7154  C  CB    . VAL D 3 50  ? 58.612  89.994  15.484  1.00 22.96  ? 65  VAL B CB    1 
ATOM   7155  C  CG1   . VAL D 3 50  ? 58.901  88.804  14.597  1.00 22.96  ? 65  VAL B CG1   1 
ATOM   7156  C  CG2   . VAL D 3 50  ? 58.076  91.109  14.647  1.00 22.96  ? 65  VAL B CG2   1 
ATOM   7157  N  N     . ILE D 3 51  ? 59.179  89.259  18.435  1.00 24.75  ? 66  ILE B N     1 
ATOM   7158  C  CA    . ILE D 3 51  ? 59.942  88.477  19.408  1.00 24.75  ? 66  ILE B CA    1 
ATOM   7159  C  C     . ILE D 3 51  ? 59.034  87.793  20.393  1.00 24.75  ? 66  ILE B C     1 
ATOM   7160  O  O     . ILE D 3 51  ? 59.297  86.661  20.761  1.00 24.75  ? 66  ILE B O     1 
ATOM   7161  C  CB    . ILE D 3 51  ? 61.018  89.324  20.165  1.00 16.46  ? 66  ILE B CB    1 
ATOM   7162  C  CG1   . ILE D 3 51  ? 62.037  89.888  19.153  1.00 16.46  ? 66  ILE B CG1   1 
ATOM   7163  C  CG2   . ILE D 3 51  ? 61.699  88.466  21.254  1.00 16.46  ? 66  ILE B CG2   1 
ATOM   7164  C  CD1   . ILE D 3 51  ? 62.985  90.952  19.690  1.00 16.46  ? 66  ILE B CD1   1 
ATOM   7165  N  N     . ARG D 3 52  ? 57.962  88.469  20.803  1.00 28.78  ? 67  ARG B N     1 
ATOM   7166  C  CA    . ARG D 3 52  ? 57.026  87.868  21.736  1.00 28.78  ? 67  ARG B CA    1 
ATOM   7167  C  C     . ARG D 3 52  ? 56.569  86.534  21.183  1.00 28.78  ? 67  ARG B C     1 
ATOM   7168  O  O     . ARG D 3 52  ? 56.581  85.535  21.892  1.00 28.78  ? 67  ARG B O     1 
ATOM   7169  C  CB    . ARG D 3 52  ? 55.814  88.746  21.973  1.00 53.98  ? 67  ARG B CB    1 
ATOM   7170  C  CG    . ARG D 3 52  ? 54.950  88.200  23.090  1.00 53.98  ? 67  ARG B CG    1 
ATOM   7171  C  CD    . ARG D 3 52  ? 53.636  88.935  23.235  1.00 53.98  ? 67  ARG B CD    1 
ATOM   7172  N  NE    . ARG D 3 52  ? 53.826  90.378  23.333  1.00 53.98  ? 67  ARG B NE    1 
ATOM   7173  C  CZ    . ARG D 3 52  ? 53.553  91.229  22.345  1.00 53.98  ? 67  ARG B CZ    1 
ATOM   7174  N  NH1   . ARG D 3 52  ? 53.065  90.775  21.184  1.00 53.98  ? 67  ARG B NH1   1 
ATOM   7175  N  NH2   . ARG D 3 52  ? 53.814  92.528  22.493  1.00 53.98  ? 67  ARG B NH2   1 
ATOM   7176  N  N     . ASP D 3 53  ? 56.177  86.520  19.913  1.00 22.59  ? 68  ASP B N     1 
ATOM   7177  C  CA    . ASP D 3 53  ? 55.732  85.289  19.280  1.00 22.59  ? 68  ASP B CA    1 
ATOM   7178  C  C     . ASP D 3 53  ? 56.876  84.281  19.113  1.00 22.59  ? 68  ASP B C     1 
ATOM   7179  O  O     . ASP D 3 53  ? 56.723  83.101  19.459  1.00 22.59  ? 68  ASP B O     1 
ATOM   7180  C  CB    . ASP D 3 53  ? 55.059  85.579  17.941  1.00 22.38  ? 68  ASP B CB    1 
ATOM   7181  C  CG    . ASP D 3 53  ? 53.685  86.217  18.093  1.00 22.38  ? 68  ASP B CG    1 
ATOM   7182  O  OD1   . ASP D 3 53  ? 53.308  86.668  19.209  1.00 22.38  ? 68  ASP B OD1   1 
ATOM   7183  O  OD2   . ASP D 3 53  ? 52.974  86.267  17.071  1.00 22.38  ? 68  ASP B OD2   1 
ATOM   7184  N  N     . ALA D 3 54  ? 58.017  84.737  18.588  1.00 15.96  ? 69  ALA B N     1 
ATOM   7185  C  CA    . ALA D 3 54  ? 59.188  83.867  18.416  1.00 15.96  ? 69  ALA B CA    1 
ATOM   7186  C  C     . ALA D 3 54  ? 59.514  83.172  19.749  1.00 15.96  ? 69  ALA B C     1 
ATOM   7187  O  O     . ALA D 3 54  ? 59.477  81.957  19.854  1.00 15.96  ? 69  ALA B O     1 
ATOM   7188  C  CB    . ALA D 3 54  ? 60.383  84.672  17.933  1.00 37.17  ? 69  ALA B CB    1 
ATOM   7189  N  N     . VAL D 3 55  ? 59.764  83.947  20.790  1.00 21.46  ? 70  VAL B N     1 
ATOM   7190  C  CA    . VAL D 3 55  ? 60.044  83.359  22.087  1.00 21.46  ? 70  VAL B CA    1 
ATOM   7191  C  C     . VAL D 3 55  ? 58.926  82.399  22.544  1.00 21.46  ? 70  VAL B C     1 
ATOM   7192  O  O     . VAL D 3 55  ? 59.217  81.382  23.160  1.00 21.46  ? 70  VAL B O     1 
ATOM   7193  C  CB    . VAL D 3 55  ? 60.328  84.438  23.137  1.00 11.71  ? 70  VAL B CB    1 
ATOM   7194  C  CG1   . VAL D 3 55  ? 60.367  83.838  24.509  1.00 11.71  ? 70  VAL B CG1   1 
ATOM   7195  C  CG2   . VAL D 3 55  ? 61.657  85.093  22.843  1.00 11.71  ? 70  VAL B CG2   1 
ATOM   7196  N  N     . THR D 3 56  ? 57.665  82.702  22.224  1.00 15.44  ? 71  THR B N     1 
ATOM   7197  C  CA    . THR D 3 56  ? 56.544  81.818  22.563  1.00 15.44  ? 71  THR B CA    1 
ATOM   7198  C  C     . THR D 3 56  ? 56.740  80.497  21.844  1.00 15.44  ? 71  THR B C     1 
ATOM   7199  O  O     . THR D 3 56  ? 56.430  79.439  22.373  1.00 15.44  ? 71  THR B O     1 
ATOM   7200  C  CB    . THR D 3 56  ? 55.173  82.429  22.181  1.00 25.57  ? 71  THR B CB    1 
ATOM   7201  O  OG1   . THR D 3 56  ? 54.472  82.761  23.377  1.00 25.57  ? 71  THR B OG1   1 
ATOM   7202  C  CG2   . THR D 3 56  ? 54.308  81.452  21.401  1.00 25.57  ? 71  THR B CG2   1 
ATOM   7203  N  N     . TYR D 3 57  ? 57.209  80.552  20.609  1.00 15.76  ? 72  TYR B N     1 
ATOM   7204  C  CA    . TYR D 3 57  ? 57.456  79.321  19.894  1.00 15.76  ? 72  TYR B CA    1 
ATOM   7205  C  C     . TYR D 3 57  ? 58.634  78.624  20.558  1.00 15.76  ? 72  TYR B C     1 
ATOM   7206  O  O     . TYR D 3 57  ? 58.596  77.425  20.766  1.00 15.76  ? 72  TYR B O     1 
ATOM   7207  C  CB    . TYR D 3 57  ? 57.777  79.606  18.447  1.00 18.40  ? 72  TYR B CB    1 
ATOM   7208  C  CG    . TYR D 3 57  ? 56.575  79.863  17.561  1.00 18.40  ? 72  TYR B CG    1 
ATOM   7209  C  CD1   . TYR D 3 57  ? 55.608  78.881  17.375  1.00 18.40  ? 72  TYR B CD1   1 
ATOM   7210  C  CD2   . TYR D 3 57  ? 56.465  81.046  16.825  1.00 18.40  ? 72  TYR B CD2   1 
ATOM   7211  C  CE1   . TYR D 3 57  ? 54.568  79.061  16.469  1.00 18.40  ? 72  TYR B CE1   1 
ATOM   7212  C  CE2   . TYR D 3 57  ? 55.432  81.240  15.919  1.00 18.40  ? 72  TYR B CE2   1 
ATOM   7213  C  CZ    . TYR D 3 57  ? 54.482  80.242  15.737  1.00 18.40  ? 72  TYR B CZ    1 
ATOM   7214  O  OH    . TYR D 3 57  ? 53.461  80.398  14.814  1.00 18.40  ? 72  TYR B OH    1 
ATOM   7215  N  N     . THR D 3 58  ? 59.664  79.387  20.930  1.00 33.08  ? 73  THR B N     1 
ATOM   7216  C  CA    . THR D 3 58  ? 60.843  78.820  21.582  1.00 33.08  ? 73  THR B CA    1 
ATOM   7217  C  C     . THR D 3 58  ? 60.419  78.034  22.796  1.00 33.08  ? 73  THR B C     1 
ATOM   7218  O  O     . THR D 3 58  ? 60.690  76.846  22.875  1.00 33.08  ? 73  THR B O     1 
ATOM   7219  C  CB    . THR D 3 58  ? 61.852  79.891  22.038  1.00 8.96   ? 73  THR B CB    1 
ATOM   7220  O  OG1   . THR D 3 58  ? 62.249  80.680  20.910  1.00 8.96   ? 73  THR B OG1   1 
ATOM   7221  C  CG2   . THR D 3 58  ? 63.089  79.225  22.627  1.00 8.96   ? 73  THR B CG2   1 
ATOM   7222  N  N     . GLU D 3 59  ? 59.735  78.699  23.722  1.00 26.40  ? 74  GLU B N     1 
ATOM   7223  C  CA    . GLU D 3 59  ? 59.271  78.073  24.958  1.00 26.40  ? 74  GLU B CA    1 
ATOM   7224  C  C     . GLU D 3 59  ? 58.488  76.797  24.653  1.00 26.40  ? 74  GLU B C     1 
ATOM   7225  O  O     . GLU D 3 59  ? 58.776  75.736  25.190  1.00 26.40  ? 74  GLU B O     1 
ATOM   7226  C  CB    . GLU D 3 59  ? 58.389  79.033  25.780  1.00 92.82  ? 74  GLU B CB    1 
ATOM   7227  C  CG    . GLU D 3 59  ? 59.125  80.055  26.668  1.00 92.82  ? 74  GLU B CG    1 
ATOM   7228  C  CD    . GLU D 3 59  ? 58.166  80.946  27.481  1.00 92.82  ? 74  GLU B CD    1 
ATOM   7229  O  OE1   . GLU D 3 59  ? 57.186  80.422  28.055  1.00 92.82  ? 74  GLU B OE1   1 
ATOM   7230  O  OE2   . GLU D 3 59  ? 58.386  82.176  27.550  1.00 92.82  ? 74  GLU B OE2   1 
ATOM   7231  N  N     . HIS D 3 60  ? 57.506  76.878  23.770  1.00 44.41  ? 75  HIS B N     1 
ATOM   7232  C  CA    . HIS D 3 60  ? 56.748  75.689  23.463  1.00 44.41  ? 75  HIS B CA    1 
ATOM   7233  C  C     . HIS D 3 60  ? 57.640  74.546  22.999  1.00 44.41  ? 75  HIS B C     1 
ATOM   7234  O  O     . HIS D 3 60  ? 57.383  73.393  23.307  1.00 44.41  ? 75  HIS B O     1 
ATOM   7235  C  CB    . HIS D 3 60  ? 55.708  75.977  22.408  1.00 29.94  ? 75  HIS B CB    1 
ATOM   7236  C  CG    . HIS D 3 60  ? 54.769  74.841  22.199  1.00 29.94  ? 75  HIS B CG    1 
ATOM   7237  N  ND1   . HIS D 3 60  ? 54.937  73.916  21.196  1.00 29.94  ? 75  HIS B ND1   1 
ATOM   7238  C  CD2   . HIS D 3 60  ? 53.684  74.443  22.902  1.00 29.94  ? 75  HIS B CD2   1 
ATOM   7239  C  CE1   . HIS D 3 60  ? 53.997  72.994  21.286  1.00 29.94  ? 75  HIS B CE1   1 
ATOM   7240  N  NE2   . HIS D 3 60  ? 53.224  73.292  22.313  1.00 29.94  ? 75  HIS B NE2   1 
ATOM   7241  N  N     . ALA D 3 61  ? 58.671  74.869  22.231  1.00 44.71  ? 76  ALA B N     1 
ATOM   7242  C  CA    . ALA D 3 61  ? 59.604  73.871  21.726  1.00 44.71  ? 76  ALA B CA    1 
ATOM   7243  C  C     . ALA D 3 61  ? 60.531  73.358  22.821  1.00 44.71  ? 76  ALA B C     1 
ATOM   7244  O  O     . ALA D 3 61  ? 61.466  72.603  22.542  1.00 44.71  ? 76  ALA B O     1 
ATOM   7245  C  CB    . ALA D 3 61  ? 60.420  74.455  20.593  1.00 15.73  ? 76  ALA B CB    1 
ATOM   7246  N  N     . LYS D 3 62  ? 60.275  73.786  24.057  1.00 37.32  ? 77  LYS B N     1 
ATOM   7247  C  CA    . LYS D 3 62  ? 61.063  73.394  25.224  1.00 37.32  ? 77  LYS B CA    1 
ATOM   7248  C  C     . LYS D 3 62  ? 62.540  73.807  25.095  1.00 37.32  ? 77  LYS B C     1 
ATOM   7249  O  O     . LYS D 3 62  ? 63.387  73.272  25.814  1.00 37.32  ? 77  LYS B O     1 
ATOM   7250  C  CB    . LYS D 3 62  ? 60.951  71.875  25.459  1.00 75.40  ? 77  LYS B CB    1 
ATOM   7251  C  CG    . LYS D 3 62  ? 59.533  71.369  25.709  1.00 75.40  ? 77  LYS B CG    1 
ATOM   7252  C  CD    . LYS D 3 62  ? 59.470  69.846  25.787  1.00 75.40  ? 77  LYS B CD    1 
ATOM   7253  C  CE    . LYS D 3 62  ? 58.064  69.380  26.178  1.00 75.40  ? 77  LYS B CE    1 
ATOM   7254  N  NZ    . LYS D 3 62  ? 57.974  67.913  26.429  1.00 75.40  ? 77  LYS B NZ    1 
ATOM   7255  N  N     . ARG D 3 63  ? 62.837  74.766  24.207  1.00 40.18  ? 78  ARG B N     1 
ATOM   7256  C  CA    . ARG D 3 63  ? 64.210  75.241  23.978  1.00 40.18  ? 78  ARG B CA    1 
ATOM   7257  C  C     . ARG D 3 63  ? 64.592  76.501  24.744  1.00 40.18  ? 78  ARG B C     1 
ATOM   7258  O  O     . ARG D 3 63  ? 63.732  77.289  25.132  1.00 40.18  ? 78  ARG B O     1 
ATOM   7259  C  CB    . ARG D 3 63  ? 64.467  75.480  22.491  1.00 43.03  ? 78  ARG B CB    1 
ATOM   7260  C  CG    . ARG D 3 63  ? 64.825  74.237  21.721  1.00 43.03  ? 78  ARG B CG    1 
ATOM   7261  C  CD    . ARG D 3 63  ? 65.046  74.535  20.260  1.00 43.03  ? 78  ARG B CD    1 
ATOM   7262  N  NE    . ARG D 3 63  ? 63.797  74.777  19.543  1.00 43.03  ? 78  ARG B NE    1 
ATOM   7263  C  CZ    . ARG D 3 63  ? 63.254  75.981  19.372  1.00 43.03  ? 78  ARG B CZ    1 
ATOM   7264  N  NH1   . ARG D 3 63  ? 63.842  77.068  19.869  1.00 43.03  ? 78  ARG B NH1   1 
ATOM   7265  N  NH2   . ARG D 3 63  ? 62.125  76.110  18.692  1.00 43.03  ? 78  ARG B NH2   1 
ATOM   7266  N  N     . LYS D 3 64  ? 65.897  76.680  24.939  1.00 28.50  ? 79  LYS B N     1 
ATOM   7267  C  CA    . LYS D 3 64  ? 66.462  77.825  25.636  1.00 28.50  ? 79  LYS B CA    1 
ATOM   7268  C  C     . LYS D 3 64  ? 67.177  78.727  24.611  1.00 28.50  ? 79  LYS B C     1 
ATOM   7269  O  O     . LYS D 3 64  ? 67.835  79.716  24.971  1.00 28.50  ? 79  LYS B O     1 
ATOM   7270  C  CB    . LYS D 3 64  ? 67.434  77.345  26.707  1.00 82.66  ? 79  LYS B CB    1 
ATOM   7271  C  CG    . LYS D 3 64  ? 67.296  78.116  27.985  1.00 82.66  ? 79  LYS B CG    1 
ATOM   7272  C  CD    . LYS D 3 64  ? 68.323  77.698  28.998  1.00 82.66  ? 79  LYS B CD    1 
ATOM   7273  C  CE    . LYS D 3 64  ? 68.248  78.594  30.223  1.00 82.66  ? 79  LYS B CE    1 
ATOM   7274  N  NZ    . LYS D 3 64  ? 69.389  78.339  31.140  1.00 82.66  ? 79  LYS B NZ    1 
ATOM   7275  N  N     . THR D 3 65  ? 66.982  78.413  23.325  1.00 28.17  ? 80  THR B N     1 
ATOM   7276  C  CA    . THR D 3 65  ? 67.590  79.169  22.233  1.00 28.17  ? 80  THR B CA    1 
ATOM   7277  C  C     . THR D 3 65  ? 66.588  79.456  21.133  1.00 28.17  ? 80  THR B C     1 
ATOM   7278  O  O     . THR D 3 65  ? 65.979  78.533  20.578  1.00 28.17  ? 80  THR B O     1 
ATOM   7279  C  CB    . THR D 3 65  ? 68.749  78.394  21.582  1.00 46.58  ? 80  THR B CB    1 
ATOM   7280  O  OG1   . THR D 3 65  ? 69.734  78.062  22.570  1.00 46.58  ? 80  THR B OG1   1 
ATOM   7281  C  CG2   . THR D 3 65  ? 69.394  79.238  20.482  1.00 46.58  ? 80  THR B CG2   1 
ATOM   7282  N  N     . VAL D 3 66  ? 66.494  80.729  20.755  1.00 23.08  ? 81  VAL B N     1 
ATOM   7283  C  CA    . VAL D 3 66  ? 65.567  81.167  19.709  1.00 23.08  ? 81  VAL B CA    1 
ATOM   7284  C  C     . VAL D 3 66  ? 66.102  80.830  18.315  1.00 23.08  ? 81  VAL B C     1 
ATOM   7285  O  O     . VAL D 3 66  ? 67.113  81.374  17.877  1.00 23.08  ? 81  VAL B O     1 
ATOM   7286  C  CB    . VAL D 3 66  ? 65.312  82.676  19.815  1.00 15.28  ? 81  VAL B CB    1 
ATOM   7287  C  CG1   . VAL D 3 66  ? 64.297  83.113  18.782  1.00 15.28  ? 81  VAL B CG1   1 
ATOM   7288  C  CG2   . VAL D 3 66  ? 64.842  83.019  21.207  1.00 15.28  ? 81  VAL B CG2   1 
ATOM   7289  N  N     . THR D 3 67  ? 65.436  79.927  17.614  1.00 16.08  ? 82  THR B N     1 
ATOM   7290  C  CA    . THR D 3 67  ? 65.915  79.558  16.289  1.00 16.08  ? 82  THR B CA    1 
ATOM   7291  C  C     . THR D 3 67  ? 65.401  80.465  15.195  1.00 16.08  ? 82  THR B C     1 
ATOM   7292  O  O     . THR D 3 67  ? 64.405  81.138  15.372  1.00 16.08  ? 82  THR B O     1 
ATOM   7293  C  CB    . THR D 3 67  ? 65.552  78.114  15.951  1.00 21.76  ? 82  THR B CB    1 
ATOM   7294  O  OG1   . THR D 3 67  ? 64.148  78.011  15.681  1.00 21.76  ? 82  THR B OG1   1 
ATOM   7295  C  CG2   . THR D 3 67  ? 65.926  77.213  17.136  1.00 21.76  ? 82  THR B CG2   1 
ATOM   7296  N  N     . ALA D 3 68  ? 66.090  80.487  14.059  1.00 27.09  ? 83  ALA B N     1 
ATOM   7297  C  CA    . ALA D 3 68  ? 65.659  81.304  12.937  1.00 27.09  ? 83  ALA B CA    1 
ATOM   7298  C  C     . ALA D 3 68  ? 64.253  80.839  12.590  1.00 27.09  ? 83  ALA B C     1 
ATOM   7299  O  O     . ALA D 3 68  ? 63.407  81.644  12.246  1.00 27.09  ? 83  ALA B O     1 
ATOM   7300  C  CB    . ALA D 3 68  ? 66.572  81.110  11.764  1.00 33.80  ? 83  ALA B CB    1 
ATOM   7301  N  N     . MET D 3 69  ? 63.991  79.540  12.749  1.00 10.33  ? 84  MET B N     1 
ATOM   7302  C  CA    . MET D 3 69  ? 62.674  78.982  12.477  1.00 10.33  ? 84  MET B CA    1 
ATOM   7303  C  C     . MET D 3 69  ? 61.636  79.693  13.301  1.00 10.33  ? 84  MET B C     1 
ATOM   7304  O  O     . MET D 3 69  ? 60.631  80.164  12.771  1.00 10.33  ? 84  MET B O     1 
ATOM   7305  C  CB    . MET D 3 69  ? 62.648  77.499  12.787  1.00 52.77  ? 84  MET B CB    1 
ATOM   7306  C  CG    . MET D 3 69  ? 63.310  76.710  11.706  1.00 52.77  ? 84  MET B CG    1 
ATOM   7307  S  SD    . MET D 3 69  ? 62.752  77.371  10.127  1.00 52.77  ? 84  MET B SD    1 
ATOM   7308  C  CE    . MET D 3 69  ? 61.591  76.132  9.599   1.00 52.77  ? 84  MET B CE    1 
ATOM   7309  N  N     . ASP D 3 70  ? 61.899  79.821  14.595  1.00 18.96  ? 85  ASP B N     1 
ATOM   7310  C  CA    . ASP D 3 70  ? 60.954  80.496  15.481  1.00 18.96  ? 85  ASP B CA    1 
ATOM   7311  C  C     . ASP D 3 70  ? 60.679  81.903  14.975  1.00 18.96  ? 85  ASP B C     1 
ATOM   7312  O  O     . ASP D 3 70  ? 59.540  82.324  14.945  1.00 18.96  ? 85  ASP B O     1 
ATOM   7313  C  CB    . ASP D 3 70  ? 61.448  80.532  16.940  1.00 24.55  ? 85  ASP B CB    1 
ATOM   7314  C  CG    . ASP D 3 70  ? 61.768  79.146  17.504  1.00 24.55  ? 85  ASP B CG    1 
ATOM   7315  O  OD1   . ASP D 3 70  ? 61.227  78.131  17.009  1.00 24.55  ? 85  ASP B OD1   1 
ATOM   7316  O  OD2   . ASP D 3 70  ? 62.579  79.070  18.448  1.00 24.55  ? 85  ASP B OD2   1 
ATOM   7317  N  N     . VAL D 3 71  ? 61.712  82.614  14.533  1.00 21.48  ? 86  VAL B N     1 
ATOM   7318  C  CA    . VAL D 3 71  ? 61.537  83.977  14.017  1.00 21.48  ? 86  VAL B CA    1 
ATOM   7319  C  C     . VAL D 3 71  ? 60.691  84.021  12.743  1.00 21.48  ? 86  VAL B C     1 
ATOM   7320  O  O     . VAL D 3 71  ? 59.833  84.882  12.576  1.00 21.48  ? 86  VAL B O     1 
ATOM   7321  C  CB    . VAL D 3 71  ? 62.877  84.623  13.750  1.00 13.43  ? 86  VAL B CB    1 
ATOM   7322  C  CG1   . VAL D 3 71  ? 62.693  85.964  13.089  1.00 13.43  ? 86  VAL B CG1   1 
ATOM   7323  C  CG2   . VAL D 3 71  ? 63.620  84.755  15.054  1.00 13.43  ? 86  VAL B CG2   1 
ATOM   7324  N  N     . VAL D 3 72  ? 60.942  83.076  11.851  1.00 17.90  ? 87  VAL B N     1 
ATOM   7325  C  CA    . VAL D 3 72  ? 60.209  82.961  10.604  1.00 17.90  ? 87  VAL B CA    1 
ATOM   7326  C  C     . VAL D 3 72  ? 58.743  82.672  10.800  1.00 17.90  ? 87  VAL B C     1 
ATOM   7327  O  O     . VAL D 3 72  ? 57.907  83.282  10.148  1.00 17.90  ? 87  VAL B O     1 
ATOM   7328  C  CB    . VAL D 3 72  ? 60.789  81.864  9.742   1.00 17.42  ? 87  VAL B CB    1 
ATOM   7329  C  CG1   . VAL D 3 72  ? 59.869  81.589  8.567   1.00 17.42  ? 87  VAL B CG1   1 
ATOM   7330  C  CG2   . VAL D 3 72  ? 62.172  82.292  9.255   1.00 17.42  ? 87  VAL B CG2   1 
ATOM   7331  N  N     . TYR D 3 73  ? 58.449  81.687  11.638  1.00 27.78  ? 88  TYR B N     1 
ATOM   7332  C  CA    . TYR D 3 73  ? 57.079  81.303  11.949  1.00 27.78  ? 88  TYR B CA    1 
ATOM   7333  C  C     . TYR D 3 73  ? 56.315  82.495  12.533  1.00 27.78  ? 88  TYR B C     1 
ATOM   7334  O  O     . TYR D 3 73  ? 55.146  82.692  12.214  1.00 27.78  ? 88  TYR B O     1 
ATOM   7335  C  CB    . TYR D 3 73  ? 57.076  80.165  12.970  1.00 30.89  ? 88  TYR B CB    1 
ATOM   7336  C  CG    . TYR D 3 73  ? 57.596  78.834  12.480  1.00 30.89  ? 88  TYR B CG    1 
ATOM   7337  C  CD1   . TYR D 3 73  ? 57.437  78.447  11.156  1.00 30.89  ? 88  TYR B CD1   1 
ATOM   7338  C  CD2   . TYR D 3 73  ? 58.171  77.927  13.365  1.00 30.89  ? 88  TYR B CD2   1 
ATOM   7339  C  CE1   . TYR D 3 73  ? 57.818  77.194  10.721  1.00 30.89  ? 88  TYR B CE1   1 
ATOM   7340  C  CE2   . TYR D 3 73  ? 58.555  76.665  12.945  1.00 30.89  ? 88  TYR B CE2   1 
ATOM   7341  C  CZ    . TYR D 3 73  ? 58.365  76.303  11.618  1.00 30.89  ? 88  TYR B CZ    1 
ATOM   7342  O  OH    . TYR D 3 73  ? 58.637  75.019  11.198  1.00 30.89  ? 88  TYR B OH    1 
ATOM   7343  N  N     . ALA D 3 74  ? 56.963  83.254  13.424  1.00 26.47  ? 89  ALA B N     1 
ATOM   7344  C  CA    . ALA D 3 74  ? 56.364  84.441  14.053  1.00 26.47  ? 89  ALA B CA    1 
ATOM   7345  C  C     . ALA D 3 74  ? 56.050  85.501  13.009  1.00 26.47  ? 89  ALA B C     1 
ATOM   7346  O  O     . ALA D 3 74  ? 55.024  86.160  13.100  1.00 26.47  ? 89  ALA B O     1 
ATOM   7347  C  CB    . ALA D 3 74  ? 57.292  85.016  15.108  1.00 21.23  ? 89  ALA B CB    1 
ATOM   7348  N  N     . LEU D 3 75  ? 56.973  85.717  12.073  1.00 15.46  ? 90  LEU B N     1 
ATOM   7349  C  CA    . LEU D 3 75  ? 56.758  86.666  11.001  1.00 15.46  ? 90  LEU B CA    1 
ATOM   7350  C  C     . LEU D 3 75  ? 55.559  86.242  10.137  1.00 15.46  ? 90  LEU B C     1 
ATOM   7351  O  O     . LEU D 3 75  ? 54.677  87.059  9.852   1.00 15.46  ? 90  LEU B O     1 
ATOM   7352  C  CB    . LEU D 3 75  ? 58.021  86.816  10.148  1.00 18.59  ? 90  LEU B CB    1 
ATOM   7353  C  CG    . LEU D 3 75  ? 59.194  87.607  10.765  1.00 18.59  ? 90  LEU B CG    1 
ATOM   7354  C  CD1   . LEU D 3 75  ? 60.437  87.509  9.934   1.00 18.59  ? 90  LEU B CD1   1 
ATOM   7355  C  CD2   . LEU D 3 75  ? 58.823  89.056  10.924  1.00 18.59  ? 90  LEU B CD2   1 
ATOM   7356  N  N     . LYS D 3 76  ? 55.487  84.974  9.739   1.00 23.84  ? 91  LYS B N     1 
ATOM   7357  C  CA    . LYS D 3 76  ? 54.350  84.540  8.921   1.00 23.84  ? 91  LYS B CA    1 
ATOM   7358  C  C     . LYS D 3 76  ? 53.018  84.895  9.567   1.00 23.84  ? 91  LYS B C     1 
ATOM   7359  O  O     . LYS D 3 76  ? 52.077  85.251  8.865   1.00 23.84  ? 91  LYS B O     1 
ATOM   7360  C  CB    . LYS D 3 76  ? 54.402  83.056  8.582   1.00 36.83  ? 91  LYS B CB    1 
ATOM   7361  C  CG    . LYS D 3 76  ? 53.411  82.699  7.494   1.00 36.83  ? 91  LYS B CG    1 
ATOM   7362  C  CD    . LYS D 3 76  ? 53.923  81.633  6.551   1.00 36.83  ? 91  LYS B CD    1 
ATOM   7363  C  CE    . LYS D 3 76  ? 54.307  80.382  7.318   1.00 36.83  ? 91  LYS B CE    1 
ATOM   7364  N  NZ    . LYS D 3 76  ? 55.274  79.488  6.582   1.00 36.83  ? 91  LYS B NZ    1 
ATOM   7365  N  N     . ARG D 3 77  ? 52.942  84.773  10.893  1.00 36.26  ? 92  ARG B N     1 
ATOM   7366  C  CA    . ARG D 3 77  ? 51.738  85.126  11.641  1.00 36.26  ? 92  ARG B CA    1 
ATOM   7367  C  C     . ARG D 3 77  ? 51.522  86.618  11.621  1.00 36.26  ? 92  ARG B C     1 
ATOM   7368  O  O     . ARG D 3 77  ? 50.385  87.063  11.710  1.00 36.26  ? 92  ARG B O     1 
ATOM   7369  C  CB    . ARG D 3 77  ? 51.841  84.766  13.108  1.00 34.11  ? 92  ARG B CB    1 
ATOM   7370  C  CG    . ARG D 3 77  ? 51.906  83.336  13.440  1.00 34.11  ? 92  ARG B CG    1 
ATOM   7371  C  CD    . ARG D 3 77  ? 51.678  83.222  14.919  1.00 34.11  ? 92  ARG B CD    1 
ATOM   7372  N  NE    . ARG D 3 77  ? 50.278  83.461  15.212  1.00 34.11  ? 92  ARG B NE    1 
ATOM   7373  C  CZ    . ARG D 3 77  ? 49.804  84.524  15.843  1.00 34.11  ? 92  ARG B CZ    1 
ATOM   7374  N  NH1   . ARG D 3 77  ? 50.623  85.479  16.262  1.00 34.11  ? 92  ARG B NH1   1 
ATOM   7375  N  NH2   . ARG D 3 77  ? 48.497  84.631  16.038  1.00 34.11  ? 92  ARG B NH2   1 
ATOM   7376  N  N     . GLN D 3 78  ? 52.601  87.393  11.705  1.00 24.43  ? 93  GLN B N     1 
ATOM   7377  C  CA    . GLN D 3 78  ? 52.443  88.844  11.661  1.00 24.43  ? 93  GLN B CA    1 
ATOM   7378  C  C     . GLN D 3 78  ? 51.985  89.228  10.253  1.00 24.43  ? 93  GLN B C     1 
ATOM   7379  O  O     . GLN D 3 78  ? 51.521  90.338  10.023  1.00 24.43  ? 93  GLN B O     1 
ATOM   7380  C  CB    . GLN D 3 78  ? 53.757  89.591  11.980  1.00 38.51  ? 93  GLN B CB    1 
ATOM   7381  C  CG    . GLN D 3 78  ? 54.376  89.367  13.346  1.00 38.51  ? 93  GLN B CG    1 
ATOM   7382  C  CD    . GLN D 3 78  ? 53.352  89.262  14.457  1.00 38.51  ? 93  GLN B CD    1 
ATOM   7383  O  OE1   . GLN D 3 78  ? 52.666  90.223  14.793  1.00 38.51  ? 93  GLN B OE1   1 
ATOM   7384  N  NE2   . GLN D 3 78  ? 53.236  88.074  15.025  1.00 38.51  ? 93  GLN B NE2   1 
ATOM   7385  N  N     . GLY D 3 79  ? 52.122  88.302  9.313   1.00 18.83  ? 94  GLY B N     1 
ATOM   7386  C  CA    . GLY D 3 79  ? 51.752  88.587  7.943   1.00 18.83  ? 94  GLY B CA    1 
ATOM   7387  C  C     . GLY D 3 79  ? 52.955  89.293  7.359   1.00 18.83  ? 94  GLY B C     1 
ATOM   7388  O  O     . GLY D 3 79  ? 52.830  90.139  6.472   1.00 18.83  ? 94  GLY B O     1 
ATOM   7389  N  N     . ARG D 3 80  ? 54.124  88.950  7.905   1.00 24.27  ? 95  ARG B N     1 
ATOM   7390  C  CA    . ARG D 3 80  ? 55.398  89.507  7.507   1.00 24.27  ? 95  ARG B CA    1 
ATOM   7391  C  C     . ARG D 3 80  ? 56.306  88.490  6.851   1.00 24.27  ? 95  ARG B C     1 
ATOM   7392  O  O     . ARG D 3 80  ? 57.516  88.656  6.874   1.00 24.27  ? 95  ARG B O     1 
ATOM   7393  C  CB    . ARG D 3 80  ? 56.094  90.082  8.725   1.00 49.19  ? 95  ARG B CB    1 
ATOM   7394  C  CG    . ARG D 3 80  ? 55.546  91.405  9.135   1.00 49.19  ? 95  ARG B CG    1 
ATOM   7395  C  CD    . ARG D 3 80  ? 56.169  92.481  8.313   1.00 49.19  ? 95  ARG B CD    1 
ATOM   7396  N  NE    . ARG D 3 80  ? 55.212  93.519  7.974   1.00 49.19  ? 95  ARG B NE    1 
ATOM   7397  C  CZ    . ARG D 3 80  ? 54.460  94.186  8.853   1.00 49.19  ? 95  ARG B CZ    1 
ATOM   7398  N  NH1   . ARG D 3 80  ? 54.541  93.929  10.161  1.00 49.19  ? 95  ARG B NH1   1 
ATOM   7399  N  NH2   . ARG D 3 80  ? 53.616  95.126  8.414   1.00 49.19  ? 95  ARG B NH2   1 
ATOM   7400  N  N     . THR D 3 81  ? 55.720  87.472  6.232   1.00 34.74  ? 96  THR B N     1 
ATOM   7401  C  CA    . THR D 3 81  ? 56.452  86.398  5.561   1.00 34.74  ? 96  THR B CA    1 
ATOM   7402  C  C     . THR D 3 81  ? 57.837  86.749  5.000   1.00 34.74  ? 96  THR B C     1 
ATOM   7403  O  O     . THR D 3 81  ? 57.944  87.631  4.137   1.00 34.74  ? 96  THR B O     1 
ATOM   7404  C  CB    . THR D 3 81  ? 55.595  85.820  4.423   1.00 21.96  ? 96  THR B CB    1 
ATOM   7405  O  OG1   . THR D 3 81  ? 54.549  85.025  4.979   1.00 21.96  ? 96  THR B OG1   1 
ATOM   7406  C  CG2   . THR D 3 81  ? 56.435  84.969  3.444   1.00 21.96  ? 96  THR B CG2   1 
ATOM   7407  N  N     . LEU D 3 82  ? 58.872  86.002  5.433   1.00 27.88  ? 97  LEU B N     1 
ATOM   7408  C  CA    . LEU D 3 82  ? 60.274  86.207  4.986   1.00 27.88  ? 97  LEU B CA    1 
ATOM   7409  C  C     . LEU D 3 82  ? 60.949  85.026  4.250   1.00 27.88  ? 97  LEU B C     1 
ATOM   7410  O  O     . LEU D 3 82  ? 61.016  83.923  4.774   1.00 27.88  ? 97  LEU B O     1 
ATOM   7411  C  CB    . LEU D 3 82  ? 61.135  86.581  6.196   1.00 17.85  ? 97  LEU B CB    1 
ATOM   7412  C  CG    . LEU D 3 82  ? 62.643  86.850  6.029   1.00 17.85  ? 97  LEU B CG    1 
ATOM   7413  C  CD1   . LEU D 3 82  ? 62.883  88.183  5.316   1.00 17.85  ? 97  LEU B CD1   1 
ATOM   7414  C  CD2   . LEU D 3 82  ? 63.330  86.821  7.409   1.00 17.85  ? 97  LEU B CD2   1 
ATOM   7415  N  N     . TYR D 3 83  ? 61.516  85.267  3.072   1.00 27.30  ? 98  TYR B N     1 
ATOM   7416  C  CA    . TYR D 3 83  ? 62.186  84.181  2.349   1.00 27.30  ? 98  TYR B CA    1 
ATOM   7417  C  C     . TYR D 3 83  ? 63.686  84.207  2.637   1.00 27.30  ? 98  TYR B C     1 
ATOM   7418  O  O     . TYR D 3 83  ? 64.284  85.279  2.739   1.00 27.30  ? 98  TYR B O     1 
ATOM   7419  C  CB    . TYR D 3 83  ? 61.989  84.292  0.831   1.00 18.12  ? 98  TYR B CB    1 
ATOM   7420  C  CG    . TYR D 3 83  ? 60.620  83.934  0.273   1.00 18.12  ? 98  TYR B CG    1 
ATOM   7421  C  CD1   . TYR D 3 83  ? 59.597  83.419  1.080   1.00 18.12  ? 98  TYR B CD1   1 
ATOM   7422  C  CD2   . TYR D 3 83  ? 60.350  84.126  -1.073  1.00 18.12  ? 98  TYR B CD2   1 
ATOM   7423  C  CE1   . TYR D 3 83  ? 58.339  83.105  0.549   1.00 18.12  ? 98  TYR B CE1   1 
ATOM   7424  C  CE2   . TYR D 3 83  ? 59.109  83.820  -1.612  1.00 18.12  ? 98  TYR B CE2   1 
ATOM   7425  C  CZ    . TYR D 3 83  ? 58.114  83.308  -0.802  1.00 18.12  ? 98  TYR B CZ    1 
ATOM   7426  O  OH    . TYR D 3 83  ? 56.919  82.975  -1.392  1.00 18.12  ? 98  TYR B OH    1 
ATOM   7427  N  N     . GLY D 3 84  ? 64.293  83.027  2.755   1.00 24.18  ? 99  GLY B N     1 
ATOM   7428  C  CA    . GLY D 3 84  ? 65.723  82.947  2.996   1.00 24.18  ? 99  GLY B CA    1 
ATOM   7429  C  C     . GLY D 3 84  ? 66.207  82.331  4.285   1.00 24.18  ? 99  GLY B C     1 
ATOM   7430  O  O     . GLY D 3 84  ? 67.404  82.160  4.487   1.00 24.18  ? 99  GLY B O     1 
ATOM   7431  N  N     . PHE D 3 85  ? 65.300  82.001  5.179   1.00 28.64  ? 100 PHE B N     1 
ATOM   7432  C  CA    . PHE D 3 85  ? 65.747  81.423  6.426   1.00 28.64  ? 100 PHE B CA    1 
ATOM   7433  C  C     . PHE D 3 85  ? 65.023  80.113  6.752   1.00 28.64  ? 100 PHE B C     1 
ATOM   7434  O  O     . PHE D 3 85  ? 64.891  79.740  7.917   1.00 28.64  ? 100 PHE B O     1 
ATOM   7435  C  CB    . PHE D 3 85  ? 65.636  82.461  7.551   1.00 33.11  ? 100 PHE B CB    1 
ATOM   7436  C  CG    . PHE D 3 85  ? 66.460  83.718  7.309   1.00 33.11  ? 100 PHE B CG    1 
ATOM   7437  C  CD1   . PHE D 3 85  ? 65.998  84.731  6.475   1.00 33.11  ? 100 PHE B CD1   1 
ATOM   7438  C  CD2   . PHE D 3 85  ? 67.716  83.880  7.898   1.00 33.11  ? 100 PHE B CD2   1 
ATOM   7439  C  CE1   . PHE D 3 85  ? 66.780  85.882  6.230   1.00 33.11  ? 100 PHE B CE1   1 
ATOM   7440  C  CE2   . PHE D 3 85  ? 68.500  85.035  7.654   1.00 33.11  ? 100 PHE B CE2   1 
ATOM   7441  C  CZ    . PHE D 3 85  ? 68.027  86.026  6.822   1.00 33.11  ? 100 PHE B CZ    1 
ATOM   7442  N  N     . GLY D 3 86  ? 64.601  79.404  5.705   1.00 102.38 ? 101 GLY B N     1 
ATOM   7443  C  CA    . GLY D 3 86  ? 63.911  78.138  5.881   1.00 102.38 ? 101 GLY B CA    1 
ATOM   7444  C  C     . GLY D 3 86  ? 62.921  77.813  4.772   1.00 102.38 ? 101 GLY B C     1 
ATOM   7445  O  O     . GLY D 3 86  ? 63.289  77.679  3.596   1.00 102.38 ? 101 GLY B O     1 
ATOM   7446  N  N     . GLY D 3 87  ? 61.655  77.668  5.160   1.00 133.12 ? 102 GLY B N     1 
ATOM   7447  C  CA    . GLY D 3 87  ? 60.604  77.353  4.210   1.00 133.12 ? 102 GLY B CA    1 
ATOM   7448  C  C     . GLY D 3 87  ? 59.275  77.025  4.873   1.00 133.12 ? 102 GLY B C     1 
ATOM   7449  O  O     . GLY D 3 87  ? 58.222  77.405  4.315   1.00 129.84 ? 102 GLY B O     1 
ATOM   7450  O  OXT   . GLY D 3 87  ? 59.275  76.385  5.948   1.00 129.84 ? 102 GLY B OXT   1 
ATOM   7451  N  N     . GLY E 4 1   ? 31.804  39.350  28.925  1.00 123.40 ? 4   GLY C N     1 
ATOM   7452  C  CA    . GLY E 4 1   ? 32.039  40.417  29.944  1.00 123.40 ? 4   GLY C CA    1 
ATOM   7453  C  C     . GLY E 4 1   ? 31.229  41.687  29.725  1.00 123.40 ? 4   GLY C C     1 
ATOM   7454  O  O     . GLY E 4 1   ? 31.620  42.760  30.194  1.00 123.40 ? 4   GLY C O     1 
ATOM   7455  N  N     . LYS E 4 2   ? 30.097  41.569  29.027  1.00 147.93 ? 5   LYS C N     1 
ATOM   7456  C  CA    . LYS E 4 2   ? 29.225  42.718  28.751  1.00 147.93 ? 5   LYS C CA    1 
ATOM   7457  C  C     . LYS E 4 2   ? 28.214  42.948  29.875  1.00 147.93 ? 5   LYS C C     1 
ATOM   7458  O  O     . LYS E 4 2   ? 27.151  43.539  29.659  1.00 147.93 ? 5   LYS C O     1 
ATOM   7459  C  CB    . LYS E 4 2   ? 28.484  42.547  27.414  1.00 103.49 ? 5   LYS C CB    1 
ATOM   7460  C  CG    . LYS E 4 2   ? 29.395  42.346  26.199  1.00 103.49 ? 5   LYS C CG    1 
ATOM   7461  C  CD    . LYS E 4 2   ? 30.268  43.559  25.924  1.00 103.49 ? 5   LYS C CD    1 
ATOM   7462  C  CE    . LYS E 4 2   ? 31.540  43.154  25.200  1.00 103.49 ? 5   LYS C CE    1 
ATOM   7463  N  NZ    . LYS E 4 2   ? 32.438  42.342  26.076  1.00 103.49 ? 5   LYS C NZ    1 
ATOM   7464  N  N     . GLN E 4 3   ? 28.564  42.487  31.076  1.00 150.26 ? 6   GLN C N     1 
ATOM   7465  C  CA    . GLN E 4 3   ? 27.715  42.646  32.254  1.00 150.26 ? 6   GLN C CA    1 
ATOM   7466  C  C     . GLN E 4 3   ? 27.709  44.115  32.702  1.00 150.26 ? 6   GLN C C     1 
ATOM   7467  O  O     . GLN E 4 3   ? 26.865  44.523  33.504  1.00 150.26 ? 6   GLN C O     1 
ATOM   7468  C  CB    . GLN E 4 3   ? 28.192  41.716  33.395  1.00 114.92 ? 6   GLN C CB    1 
ATOM   7469  C  CG    . GLN E 4 3   ? 29.133  42.331  34.471  1.00 114.92 ? 6   GLN C CG    1 
ATOM   7470  C  CD    . GLN E 4 3   ? 30.586  42.493  34.028  1.00 114.92 ? 6   GLN C CD    1 
ATOM   7471  O  OE1   . GLN E 4 3   ? 31.153  41.623  33.365  1.00 114.92 ? 6   GLN C OE1   1 
ATOM   7472  N  NE2   . GLN E 4 3   ? 31.205  43.595  34.438  1.00 114.92 ? 6   GLN C NE2   1 
ATOM   7473  N  N     . GLY E 4 4   ? 28.638  44.899  32.149  1.00 160.45 ? 7   GLY C N     1 
ATOM   7474  C  CA    . GLY E 4 4   ? 28.758  46.311  32.482  1.00 160.45 ? 7   GLY C CA    1 
ATOM   7475  C  C     . GLY E 4 4   ? 27.754  47.264  31.849  1.00 160.45 ? 7   GLY C C     1 
ATOM   7476  O  O     . GLY E 4 4   ? 27.507  48.341  32.398  1.00 160.45 ? 7   GLY C O     1 
ATOM   7477  N  N     . GLY E 4 5   ? 27.188  46.892  30.699  1.00 116.43 ? 8   GLY C N     1 
ATOM   7478  C  CA    . GLY E 4 5   ? 26.214  47.746  30.036  1.00 116.43 ? 8   GLY C CA    1 
ATOM   7479  C  C     . GLY E 4 5   ? 24.813  47.575  30.601  1.00 116.43 ? 8   GLY C C     1 
ATOM   7480  O  O     . GLY E 4 5   ? 23.888  47.225  29.862  1.00 116.43 ? 8   GLY C O     1 
ATOM   7481  N  N     . LYS E 4 6   ? 24.663  47.827  31.906  1.00 164.89 ? 9   LYS C N     1 
ATOM   7482  C  CA    . LYS E 4 6   ? 23.382  47.699  32.614  1.00 164.89 ? 9   LYS C CA    1 
ATOM   7483  C  C     . LYS E 4 6   ? 23.210  48.645  33.829  1.00 164.89 ? 9   LYS C C     1 
ATOM   7484  O  O     . LYS E 4 6   ? 23.826  49.715  33.878  1.00 164.89 ? 9   LYS C O     1 
ATOM   7485  C  CB    . LYS E 4 6   ? 23.141  46.235  33.022  1.00 101.49 ? 9   LYS C CB    1 
ATOM   7486  C  CG    . LYS E 4 6   ? 22.698  45.323  31.872  1.00 101.49 ? 9   LYS C CG    1 
ATOM   7487  C  CD    . LYS E 4 6   ? 22.515  43.887  32.330  1.00 101.49 ? 9   LYS C CD    1 
ATOM   7488  C  CE    . LYS E 4 6   ? 22.051  42.995  31.194  1.00 101.49 ? 9   LYS C CE    1 
ATOM   7489  N  NZ    . LYS E 4 6   ? 21.907  41.591  31.665  1.00 101.49 ? 9   LYS C NZ    1 
ATOM   7490  N  N     . THR E 4 7   ? 22.380  48.235  34.797  1.00 200.00 ? 10  THR C N     1 
ATOM   7491  C  CA    . THR E 4 7   ? 22.051  49.016  36.009  1.00 200.00 ? 10  THR C CA    1 
ATOM   7492  C  C     . THR E 4 7   ? 23.173  49.645  36.852  1.00 200.00 ? 10  THR C C     1 
ATOM   7493  O  O     . THR E 4 7   ? 24.352  49.305  36.710  1.00 200.00 ? 10  THR C O     1 
ATOM   7494  C  CB    . THR E 4 7   ? 21.132  48.214  36.983  1.00 117.52 ? 10  THR C CB    1 
ATOM   7495  O  OG1   . THR E 4 7   ? 21.803  47.022  37.408  1.00 117.52 ? 10  THR C OG1   1 
ATOM   7496  C  CG2   . THR E 4 7   ? 19.800  47.851  36.318  1.00 117.52 ? 10  THR C CG2   1 
ATOM   7497  N  N     . ARG E 4 8   ? 22.761  50.556  37.740  1.00 190.26 ? 11  ARG C N     1 
ATOM   7498  C  CA    . ARG E 4 8   ? 23.634  51.295  38.664  1.00 190.26 ? 11  ARG C CA    1 
ATOM   7499  C  C     . ARG E 4 8   ? 24.693  52.218  38.029  1.00 190.26 ? 11  ARG C C     1 
ATOM   7500  O  O     . ARG E 4 8   ? 25.054  52.055  36.858  1.00 190.26 ? 11  ARG C O     1 
ATOM   7501  C  CB    . ARG E 4 8   ? 24.263  50.351  39.706  1.00 136.27 ? 11  ARG C CB    1 
ATOM   7502  C  CG    . ARG E 4 8   ? 23.264  49.788  40.719  1.00 136.27 ? 11  ARG C CG    1 
ATOM   7503  C  CD    . ARG E 4 8   ? 23.962  49.052  41.856  1.00 136.27 ? 11  ARG C CD    1 
ATOM   7504  N  NE    . ARG E 4 8   ? 23.006  48.549  42.841  1.00 136.27 ? 11  ARG C NE    1 
ATOM   7505  C  CZ    . ARG E 4 8   ? 23.014  48.863  44.136  1.00 136.27 ? 11  ARG C CZ    1 
ATOM   7506  N  NH1   . ARG E 4 8   ? 23.932  49.687  44.628  1.00 136.27 ? 11  ARG C NH1   1 
ATOM   7507  N  NH2   . ARG E 4 8   ? 22.095  48.355  44.943  1.00 136.27 ? 11  ARG C NH2   1 
ATOM   7508  N  N     . ALA E 4 9   ? 25.156  53.196  38.818  1.00 182.74 ? 12  ALA C N     1 
ATOM   7509  C  CA    . ALA E 4 9   ? 26.159  54.200  38.416  1.00 182.74 ? 12  ALA C CA    1 
ATOM   7510  C  C     . ALA E 4 9   ? 25.575  55.315  37.536  1.00 182.74 ? 12  ALA C C     1 
ATOM   7511  O  O     . ALA E 4 9   ? 25.199  56.378  38.040  1.00 182.74 ? 12  ALA C O     1 
ATOM   7512  C  CB    . ALA E 4 9   ? 27.373  53.535  37.725  1.00 59.54  ? 12  ALA C CB    1 
ATOM   7513  N  N     . LYS E 4 10  ? 25.518  55.059  36.228  1.00 160.17 ? 13  LYS C N     1 
ATOM   7514  C  CA    . LYS E 4 10  ? 24.982  55.982  35.218  1.00 160.17 ? 13  LYS C CA    1 
ATOM   7515  C  C     . LYS E 4 10  ? 25.815  57.219  34.829  1.00 160.17 ? 13  LYS C C     1 
ATOM   7516  O  O     . LYS E 4 10  ? 26.339  57.944  35.681  1.00 160.17 ? 13  LYS C O     1 
ATOM   7517  C  CB    . LYS E 4 10  ? 23.522  56.341  35.530  1.00 117.36 ? 13  LYS C CB    1 
ATOM   7518  C  CG    . LYS E 4 10  ? 22.558  55.135  35.428  1.00 117.36 ? 13  LYS C CG    1 
ATOM   7519  C  CD    . LYS E 4 10  ? 22.536  54.518  34.013  1.00 117.36 ? 13  LYS C CD    1 
ATOM   7520  C  CE    . LYS E 4 10  ? 21.549  53.352  33.888  1.00 117.36 ? 13  LYS C CE    1 
ATOM   7521  N  NZ    . LYS E 4 10  ? 21.404  52.918  32.470  1.00 117.36 ? 13  LYS C NZ    1 
ATOM   7522  N  N     . ALA E 4 11  ? 25.886  57.437  33.513  1.00 122.68 ? 14  ALA C N     1 
ATOM   7523  C  CA    . ALA E 4 11  ? 26.642  58.509  32.854  1.00 122.68 ? 14  ALA C CA    1 
ATOM   7524  C  C     . ALA E 4 11  ? 26.756  59.908  33.462  1.00 122.68 ? 14  ALA C C     1 
ATOM   7525  O  O     . ALA E 4 11  ? 26.083  60.268  34.428  1.00 122.68 ? 14  ALA C O     1 
ATOM   7526  C  CB    . ALA E 4 11  ? 26.207  58.618  31.383  1.00 51.52  ? 14  ALA C CB    1 
ATOM   7527  N  N     . LYS E 4 12  ? 27.628  60.692  32.838  1.00 63.03  ? 15  LYS C N     1 
ATOM   7528  C  CA    . LYS E 4 12  ? 27.919  62.055  33.239  1.00 63.03  ? 15  LYS C CA    1 
ATOM   7529  C  C     . LYS E 4 12  ? 28.709  62.687  32.091  1.00 63.03  ? 15  LYS C C     1 
ATOM   7530  O  O     . LYS E 4 12  ? 29.737  62.154  31.662  1.00 63.03  ? 15  LYS C O     1 
ATOM   7531  C  CB    . LYS E 4 12  ? 28.753  62.038  34.514  1.00 82.58  ? 15  LYS C CB    1 
ATOM   7532  C  CG    . LYS E 4 12  ? 28.933  63.388  35.122  1.00 82.58  ? 15  LYS C CG    1 
ATOM   7533  C  CD    . LYS E 4 12  ? 29.278  63.278  36.588  1.00 82.58  ? 15  LYS C CD    1 
ATOM   7534  C  CE    . LYS E 4 12  ? 29.318  64.657  37.228  1.00 82.58  ? 15  LYS C CE    1 
ATOM   7535  N  NZ    . LYS E 4 12  ? 29.686  64.630  38.673  1.00 82.58  ? 15  LYS C NZ    1 
ATOM   7536  N  N     . THR E 4 13  ? 28.214  63.805  31.574  1.00 36.52  ? 16  THR C N     1 
ATOM   7537  C  CA    . THR E 4 13  ? 28.885  64.465  30.462  1.00 36.52  ? 16  THR C CA    1 
ATOM   7538  C  C     . THR E 4 13  ? 30.253  65.009  30.835  1.00 36.52  ? 16  THR C C     1 
ATOM   7539  O  O     . THR E 4 13  ? 30.524  65.341  31.990  1.00 36.52  ? 16  THR C O     1 
ATOM   7540  C  CB    . THR E 4 13  ? 28.063  65.628  29.863  1.00 36.53  ? 16  THR C CB    1 
ATOM   7541  O  OG1   . THR E 4 13  ? 27.672  66.530  30.910  1.00 36.53  ? 16  THR C OG1   1 
ATOM   7542  C  CG2   . THR E 4 13  ? 26.853  65.110  29.087  1.00 36.53  ? 16  THR C CG2   1 
ATOM   7543  N  N     . ARG E 4 14  ? 31.094  65.147  29.816  1.00 44.30  ? 17  ARG C N     1 
ATOM   7544  C  CA    . ARG E 4 14  ? 32.439  65.653  30.002  1.00 44.30  ? 17  ARG C CA    1 
ATOM   7545  C  C     . ARG E 4 14  ? 32.444  67.141  30.314  1.00 44.30  ? 17  ARG C C     1 
ATOM   7546  O  O     . ARG E 4 14  ? 33.344  67.637  30.996  1.00 44.30  ? 17  ARG C O     1 
ATOM   7547  C  CB    . ARG E 4 14  ? 33.294  65.337  28.786  1.00 35.38  ? 17  ARG C CB    1 
ATOM   7548  C  CG    . ARG E 4 14  ? 33.516  63.837  28.604  1.00 35.38  ? 17  ARG C CG    1 
ATOM   7549  C  CD    . ARG E 4 14  ? 34.701  63.541  27.705  1.00 35.38  ? 17  ARG C CD    1 
ATOM   7550  N  NE    . ARG E 4 14  ? 34.368  63.615  26.292  1.00 35.38  ? 17  ARG C NE    1 
ATOM   7551  C  CZ    . ARG E 4 14  ? 35.242  63.931  25.346  1.00 35.38  ? 17  ARG C CZ    1 
ATOM   7552  N  NH1   . ARG E 4 14  ? 36.515  64.212  25.664  1.00 35.38  ? 17  ARG C NH1   1 
ATOM   7553  N  NH2   . ARG E 4 14  ? 34.849  63.898  24.078  1.00 35.38  ? 17  ARG C NH2   1 
ATOM   7554  N  N     . SER E 4 15  ? 31.425  67.859  29.844  1.00 27.18  ? 18  SER C N     1 
ATOM   7555  C  CA    . SER E 4 15  ? 31.349  69.280  30.153  1.00 27.18  ? 18  SER C CA    1 
ATOM   7556  C  C     . SER E 4 15  ? 31.086  69.326  31.644  1.00 27.18  ? 18  SER C C     1 
ATOM   7557  O  O     . SER E 4 15  ? 31.701  70.096  32.354  1.00 27.18  ? 18  SER C O     1 
ATOM   7558  C  CB    . SER E 4 15  ? 30.236  69.946  29.366  1.00 24.08  ? 18  SER C CB    1 
ATOM   7559  O  OG    . SER E 4 15  ? 30.425  69.682  27.991  1.00 24.08  ? 18  SER C OG    1 
ATOM   7560  N  N     . SER E 4 16  ? 30.225  68.425  32.110  1.00 34.32  ? 19  SER C N     1 
ATOM   7561  C  CA    . SER E 4 16  ? 29.887  68.304  33.523  1.00 34.32  ? 19  SER C CA    1 
ATOM   7562  C  C     . SER E 4 16  ? 31.161  68.104  34.372  1.00 34.32  ? 19  SER C C     1 
ATOM   7563  O  O     . SER E 4 16  ? 31.388  68.791  35.388  1.00 34.32  ? 19  SER C O     1 
ATOM   7564  C  CB    . SER E 4 16  ? 28.932  67.128  33.684  1.00 56.76  ? 19  SER C CB    1 
ATOM   7565  O  OG    . SER E 4 16  ? 28.762  66.800  35.038  1.00 56.76  ? 19  SER C OG    1 
ATOM   7566  N  N     . ARG E 4 17  ? 31.983  67.147  33.952  1.00 31.04  ? 20  ARG C N     1 
ATOM   7567  C  CA    . ARG E 4 17  ? 33.251  66.859  34.618  1.00 31.04  ? 20  ARG C CA    1 
ATOM   7568  C  C     . ARG E 4 17  ? 34.190  68.082  34.622  1.00 31.04  ? 20  ARG C C     1 
ATOM   7569  O  O     . ARG E 4 17  ? 34.740  68.431  35.667  1.00 31.04  ? 20  ARG C O     1 
ATOM   7570  C  CB    . ARG E 4 17  ? 33.920  65.660  33.951  1.00 96.39  ? 20  ARG C CB    1 
ATOM   7571  C  CG    . ARG E 4 17  ? 33.035  64.437  33.943  1.00 96.39  ? 20  ARG C CG    1 
ATOM   7572  C  CD    . ARG E 4 17  ? 33.631  63.309  33.161  1.00 96.39  ? 20  ARG C CD    1 
ATOM   7573  N  NE    . ARG E 4 17  ? 32.844  62.101  33.352  1.00 96.39  ? 20  ARG C NE    1 
ATOM   7574  C  CZ    . ARG E 4 17  ? 33.136  60.929  32.803  1.00 96.39  ? 20  ARG C CZ    1 
ATOM   7575  N  NH1   . ARG E 4 17  ? 34.199  60.808  32.017  1.00 96.39  ? 20  ARG C NH1   1 
ATOM   7576  N  NH2   . ARG E 4 17  ? 32.386  59.869  33.067  1.00 96.39  ? 20  ARG C NH2   1 
ATOM   7577  N  N     . ALA E 4 18  ? 34.345  68.749  33.474  1.00 30.60  ? 21  ALA C N     1 
ATOM   7578  C  CA    . ALA E 4 18  ? 35.210  69.933  33.372  1.00 30.60  ? 21  ALA C CA    1 
ATOM   7579  C  C     . ALA E 4 18  ? 34.711  71.144  34.161  1.00 30.60  ? 21  ALA C C     1 
ATOM   7580  O  O     . ALA E 4 18  ? 35.500  72.020  34.504  1.00 30.60  ? 21  ALA C O     1 
ATOM   7581  C  CB    . ALA E 4 18  ? 35.405  70.312  31.930  1.00 34.29  ? 21  ALA C CB    1 
ATOM   7582  N  N     . GLY E 4 19  ? 33.396  71.195  34.398  1.00 32.80  ? 22  GLY C N     1 
ATOM   7583  C  CA    . GLY E 4 19  ? 32.760  72.278  35.137  1.00 32.80  ? 22  GLY C CA    1 
ATOM   7584  C  C     . GLY E 4 19  ? 32.322  73.334  34.148  1.00 32.80  ? 22  GLY C C     1 
ATOM   7585  O  O     . GLY E 4 19  ? 32.238  74.523  34.471  1.00 32.80  ? 22  GLY C O     1 
ATOM   7586  N  N     . LEU E 4 20  ? 31.983  72.879  32.947  1.00 19.16  ? 23  LEU C N     1 
ATOM   7587  C  CA    . LEU E 4 20  ? 31.607  73.780  31.867  1.00 19.16  ? 23  LEU C CA    1 
ATOM   7588  C  C     . LEU E 4 20  ? 30.188  73.712  31.293  1.00 19.16  ? 23  LEU C C     1 
ATOM   7589  O  O     . LEU E 4 20  ? 29.495  72.685  31.367  1.00 19.16  ? 23  LEU C O     1 
ATOM   7590  C  CB    . LEU E 4 20  ? 32.606  73.626  30.701  1.00 24.74  ? 23  LEU C CB    1 
ATOM   7591  C  CG    . LEU E 4 20  ? 34.127  73.683  30.920  1.00 24.74  ? 23  LEU C CG    1 
ATOM   7592  C  CD1   . LEU E 4 20  ? 34.841  73.463  29.592  1.00 24.74  ? 23  LEU C CD1   1 
ATOM   7593  C  CD2   . LEU E 4 20  ? 34.540  75.009  31.527  1.00 24.74  ? 23  LEU C CD2   1 
ATOM   7594  N  N     . GLN E 4 21  ? 29.795  74.829  30.680  1.00 26.26  ? 24  GLN C N     1 
ATOM   7595  C  CA    . GLN E 4 21  ? 28.504  74.963  30.032  1.00 26.26  ? 24  GLN C CA    1 
ATOM   7596  C  C     . GLN E 4 21  ? 28.651  74.484  28.595  1.00 26.26  ? 24  GLN C C     1 
ATOM   7597  O  O     . GLN E 4 21  ? 27.807  73.742  28.118  1.00 26.26  ? 24  GLN C O     1 
ATOM   7598  C  CB    . GLN E 4 21  ? 28.015  76.419  30.047  1.00 20.89  ? 24  GLN C CB    1 
ATOM   7599  C  CG    . GLN E 4 21  ? 27.845  77.066  31.445  1.00 20.89  ? 24  GLN C CG    1 
ATOM   7600  C  CD    . GLN E 4 21  ? 26.904  76.296  32.341  1.00 20.89  ? 24  GLN C CD    1 
ATOM   7601  O  OE1   . GLN E 4 21  ? 25.735  76.091  32.019  1.00 20.89  ? 24  GLN C OE1   1 
ATOM   7602  N  NE2   . GLN E 4 21  ? 27.423  75.840  33.465  1.00 20.89  ? 24  GLN C NE2   1 
ATOM   7603  N  N     . PHE E 4 22  ? 29.751  74.873  27.941  1.00 27.29  ? 25  PHE C N     1 
ATOM   7604  C  CA    . PHE E 4 22  ? 30.051  74.494  26.546  1.00 27.29  ? 25  PHE C CA    1 
ATOM   7605  C  C     . PHE E 4 22  ? 30.239  72.972  26.357  1.00 27.29  ? 25  PHE C C     1 
ATOM   7606  O  O     . PHE E 4 22  ? 30.633  72.268  27.296  1.00 27.29  ? 25  PHE C O     1 
ATOM   7607  C  CB    . PHE E 4 22  ? 31.268  75.280  26.030  1.00 29.98  ? 25  PHE C CB    1 
ATOM   7608  C  CG    . PHE E 4 22  ? 30.915  76.611  25.398  1.00 29.98  ? 25  PHE C CG    1 
ATOM   7609  C  CD1   . PHE E 4 22  ? 29.913  77.423  25.944  1.00 29.98  ? 25  PHE C CD1   1 
ATOM   7610  C  CD2   . PHE E 4 22  ? 31.519  77.010  24.199  1.00 29.98  ? 25  PHE C CD2   1 
ATOM   7611  C  CE1   . PHE E 4 22  ? 29.508  78.611  25.301  1.00 29.98  ? 25  PHE C CE1   1 
ATOM   7612  C  CE2   . PHE E 4 22  ? 31.121  78.196  23.546  1.00 29.98  ? 25  PHE C CE2   1 
ATOM   7613  C  CZ    . PHE E 4 22  ? 30.108  78.993  24.100  1.00 29.98  ? 25  PHE C CZ    1 
ATOM   7614  N  N     . PRO E 4 23  ? 29.972  72.454  25.131  1.00 28.33  ? 26  PRO C N     1 
ATOM   7615  C  CA    . PRO E 4 23  ? 30.059  71.042  24.718  1.00 28.33  ? 26  PRO C CA    1 
ATOM   7616  C  C     . PRO E 4 23  ? 31.433  70.441  24.493  1.00 28.33  ? 26  PRO C C     1 
ATOM   7617  O  O     . PRO E 4 23  ? 31.931  70.470  23.380  1.00 28.33  ? 26  PRO C O     1 
ATOM   7618  C  CB    . PRO E 4 23  ? 29.276  71.032  23.413  1.00 22.13  ? 26  PRO C CB    1 
ATOM   7619  C  CG    . PRO E 4 23  ? 29.704  72.313  22.794  1.00 22.13  ? 26  PRO C CG    1 
ATOM   7620  C  CD    . PRO E 4 23  ? 29.630  73.299  23.969  1.00 22.13  ? 26  PRO C CD    1 
ATOM   7621  N  N     . VAL E 4 24  ? 32.008  69.825  25.523  1.00 19.54  ? 27  VAL C N     1 
ATOM   7622  C  CA    . VAL E 4 24  ? 33.321  69.207  25.404  1.00 19.54  ? 27  VAL C CA    1 
ATOM   7623  C  C     . VAL E 4 24  ? 33.204  68.063  24.416  1.00 19.54  ? 27  VAL C C     1 
ATOM   7624  O  O     . VAL E 4 24  ? 34.077  67.872  23.564  1.00 19.54  ? 27  VAL C O     1 
ATOM   7625  C  CB    . VAL E 4 24  ? 33.780  68.676  26.741  1.00 9.81   ? 27  VAL C CB    1 
ATOM   7626  C  CG1   . VAL E 4 24  ? 35.050  67.840  26.581  1.00 9.81   ? 27  VAL C CG1   1 
ATOM   7627  C  CG2   . VAL E 4 24  ? 33.996  69.835  27.689  1.00 9.81   ? 27  VAL C CG2   1 
ATOM   7628  N  N     . GLY E 4 25  ? 32.078  67.356  24.497  1.00 22.10  ? 28  GLY C N     1 
ATOM   7629  C  CA    . GLY E 4 25  ? 31.840  66.254  23.592  1.00 22.10  ? 28  GLY C CA    1 
ATOM   7630  C  C     . GLY E 4 25  ? 31.932  66.750  22.162  1.00 22.10  ? 28  GLY C C     1 
ATOM   7631  O  O     . GLY E 4 25  ? 32.791  66.313  21.411  1.00 22.10  ? 28  GLY C O     1 
ATOM   7632  N  N     . ARG E 4 26  ? 31.092  67.722  21.813  1.00 26.79  ? 29  ARG C N     1 
ATOM   7633  C  CA    . ARG E 4 26  ? 31.053  68.295  20.458  1.00 26.79  ? 29  ARG C CA    1 
ATOM   7634  C  C     . ARG E 4 26  ? 32.358  68.941  19.972  1.00 26.79  ? 29  ARG C C     1 
ATOM   7635  O  O     . ARG E 4 26  ? 32.737  68.807  18.816  1.00 26.79  ? 29  ARG C O     1 
ATOM   7636  C  CB    . ARG E 4 26  ? 29.892  69.299  20.352  1.00 40.02  ? 29  ARG C CB    1 
ATOM   7637  C  CG    . ARG E 4 26  ? 30.024  70.288  19.216  1.00 40.02  ? 29  ARG C CG    1 
ATOM   7638  C  CD    . ARG E 4 26  ? 28.866  70.225  18.281  1.00 40.02  ? 29  ARG C CD    1 
ATOM   7639  N  NE    . ARG E 4 26  ? 27.783  71.144  18.615  1.00 40.02  ? 29  ARG C NE    1 
ATOM   7640  C  CZ    . ARG E 4 26  ? 26.559  70.757  18.971  1.00 40.02  ? 29  ARG C CZ    1 
ATOM   7641  N  NH1   . ARG E 4 26  ? 26.252  69.465  19.063  1.00 40.02  ? 29  ARG C NH1   1 
ATOM   7642  N  NH2   . ARG E 4 26  ? 25.603  71.653  19.143  1.00 40.02  ? 29  ARG C NH2   1 
ATOM   7643  N  N     . VAL E 4 27  ? 33.011  69.693  20.843  1.00 26.10  ? 30  VAL C N     1 
ATOM   7644  C  CA    . VAL E 4 27  ? 34.259  70.344  20.506  1.00 26.10  ? 30  VAL C CA    1 
ATOM   7645  C  C     . VAL E 4 27  ? 35.313  69.287  20.148  1.00 26.10  ? 30  VAL C C     1 
ATOM   7646  O  O     . VAL E 4 27  ? 35.898  69.359  19.076  1.00 26.10  ? 30  VAL C O     1 
ATOM   7647  C  CB    . VAL E 4 27  ? 34.720  71.263  21.670  1.00 12.73  ? 30  VAL C CB    1 
ATOM   7648  C  CG1   . VAL E 4 27  ? 36.153  71.686  21.490  1.00 12.73  ? 30  VAL C CG1   1 
ATOM   7649  C  CG2   . VAL E 4 27  ? 33.828  72.494  21.755  1.00 12.73  ? 30  VAL C CG2   1 
ATOM   7650  N  N     . HIS E 4 28  ? 35.502  68.272  20.998  1.00 38.23  ? 31  HIS C N     1 
ATOM   7651  C  CA    . HIS E 4 28  ? 36.480  67.194  20.737  1.00 38.23  ? 31  HIS C CA    1 
ATOM   7652  C  C     . HIS E 4 28  ? 36.212  66.595  19.369  1.00 38.23  ? 31  HIS C C     1 
ATOM   7653  O  O     . HIS E 4 28  ? 37.124  66.306  18.607  1.00 38.23  ? 31  HIS C O     1 
ATOM   7654  C  CB    . HIS E 4 28  ? 36.348  66.081  21.783  1.00 40.63  ? 31  HIS C CB    1 
ATOM   7655  C  CG    . HIS E 4 28  ? 37.442  65.058  21.732  1.00 40.63  ? 31  HIS C CG    1 
ATOM   7656  N  ND1   . HIS E 4 28  ? 38.716  65.344  21.290  1.00 40.63  ? 31  HIS C ND1   1 
ATOM   7657  C  CD2   . HIS E 4 28  ? 37.460  63.757  22.107  1.00 40.63  ? 31  HIS C CD2   1 
ATOM   7658  C  CE1   . HIS E 4 28  ? 39.473  64.267  21.399  1.00 40.63  ? 31  HIS C CE1   1 
ATOM   7659  N  NE2   . HIS E 4 28  ? 38.734  63.291  21.892  1.00 40.63  ? 31  HIS C NE2   1 
ATOM   7660  N  N     . ARG E 4 29  ? 34.935  66.400  19.086  1.00 53.53  ? 32  ARG C N     1 
ATOM   7661  C  CA    . ARG E 4 29  ? 34.487  65.851  17.824  1.00 53.53  ? 32  ARG C CA    1 
ATOM   7662  C  C     . ARG E 4 29  ? 34.857  66.730  16.623  1.00 53.53  ? 32  ARG C C     1 
ATOM   7663  O  O     . ARG E 4 29  ? 35.311  66.222  15.593  1.00 53.53  ? 32  ARG C O     1 
ATOM   7664  C  CB    . ARG E 4 29  ? 32.977  65.653  17.887  1.00 39.79  ? 32  ARG C CB    1 
ATOM   7665  C  CG    . ARG E 4 29  ? 32.419  64.860  16.745  1.00 39.79  ? 32  ARG C CG    1 
ATOM   7666  C  CD    . ARG E 4 29  ? 30.921  64.815  16.821  1.00 39.79  ? 32  ARG C CD    1 
ATOM   7667  N  NE    . ARG E 4 29  ? 30.301  65.818  15.961  1.00 39.79  ? 32  ARG C NE    1 
ATOM   7668  C  CZ    . ARG E 4 29  ? 29.533  66.813  16.399  1.00 39.79  ? 32  ARG C CZ    1 
ATOM   7669  N  NH1   . ARG E 4 29  ? 29.293  66.975  17.694  1.00 39.79  ? 32  ARG C NH1   1 
ATOM   7670  N  NH2   . ARG E 4 29  ? 28.906  67.580  15.529  1.00 39.79  ? 32  ARG C NH2   1 
ATOM   7671  N  N     . LEU E 4 30  ? 34.624  68.039  16.736  1.00 52.46  ? 33  LEU C N     1 
ATOM   7672  C  CA    . LEU E 4 30  ? 34.943  68.980  15.658  1.00 52.46  ? 33  LEU C CA    1 
ATOM   7673  C  C     . LEU E 4 30  ? 36.433  69.057  15.368  1.00 52.46  ? 33  LEU C C     1 
ATOM   7674  O  O     . LEU E 4 30  ? 36.833  69.390  14.250  1.00 52.46  ? 33  LEU C O     1 
ATOM   7675  C  CB    . LEU E 4 30  ? 34.416  70.374  15.973  1.00 21.73  ? 33  LEU C CB    1 
ATOM   7676  C  CG    . LEU E 4 30  ? 32.901  70.513  16.055  1.00 21.73  ? 33  LEU C CG    1 
ATOM   7677  C  CD1   . LEU E 4 30  ? 32.514  71.928  16.553  1.00 21.73  ? 33  LEU C CD1   1 
ATOM   7678  C  CD2   . LEU E 4 30  ? 32.283  70.206  14.699  1.00 21.73  ? 33  LEU C CD2   1 
ATOM   7679  N  N     . LEU E 4 31  ? 37.242  68.844  16.404  1.00 35.66  ? 34  LEU C N     1 
ATOM   7680  C  CA    . LEU E 4 31  ? 38.695  68.840  16.271  1.00 35.66  ? 34  LEU C CA    1 
ATOM   7681  C  C     . LEU E 4 31  ? 39.181  67.689  15.370  1.00 35.66  ? 34  LEU C C     1 
ATOM   7682  O  O     . LEU E 4 31  ? 40.103  67.861  14.567  1.00 35.66  ? 34  LEU C O     1 
ATOM   7683  C  CB    . LEU E 4 31  ? 39.345  68.771  17.653  1.00 9.33   ? 34  LEU C CB    1 
ATOM   7684  C  CG    . LEU E 4 31  ? 39.366  70.086  18.452  1.00 9.33   ? 34  LEU C CG    1 
ATOM   7685  C  CD1   . LEU E 4 31  ? 40.000  69.908  19.832  1.00 9.33   ? 34  LEU C CD1   1 
ATOM   7686  C  CD2   . LEU E 4 31  ? 40.159  71.140  17.677  1.00 9.33   ? 34  LEU C CD2   1 
ATOM   7687  N  N     . ARG E 4 32  ? 38.576  66.515  15.522  1.00 52.98  ? 35  ARG C N     1 
ATOM   7688  C  CA    . ARG E 4 32  ? 38.928  65.370  14.698  1.00 52.98  ? 35  ARG C CA    1 
ATOM   7689  C  C     . ARG E 4 32  ? 38.544  65.646  13.252  1.00 52.98  ? 35  ARG C C     1 
ATOM   7690  O  O     . ARG E 4 32  ? 39.406  65.663  12.368  1.00 52.98  ? 35  ARG C O     1 
ATOM   7691  C  CB    . ARG E 4 32  ? 38.191  64.117  15.160  1.00 48.67  ? 35  ARG C CB    1 
ATOM   7692  C  CG    . ARG E 4 32  ? 38.459  63.726  16.581  1.00 48.67  ? 35  ARG C CG    1 
ATOM   7693  C  CD    . ARG E 4 32  ? 37.649  62.513  16.958  1.00 48.67  ? 35  ARG C CD    1 
ATOM   7694  N  NE    . ARG E 4 32  ? 37.898  62.116  18.339  1.00 48.67  ? 35  ARG C NE    1 
ATOM   7695  C  CZ    . ARG E 4 32  ? 39.095  61.794  18.828  1.00 48.67  ? 35  ARG C CZ    1 
ATOM   7696  N  NH1   . ARG E 4 32  ? 40.180  61.818  18.049  1.00 48.67  ? 35  ARG C NH1   1 
ATOM   7697  N  NH2   . ARG E 4 32  ? 39.210  61.436  20.105  1.00 48.67  ? 35  ARG C NH2   1 
ATOM   7698  N  N     . LYS E 4 33  ? 37.267  65.953  13.027  1.00 33.81  ? 36  LYS C N     1 
ATOM   7699  C  CA    . LYS E 4 33  ? 36.766  66.191  11.668  1.00 33.81  ? 36  LYS C CA    1 
ATOM   7700  C  C     . LYS E 4 33  ? 37.276  67.407  10.885  1.00 33.81  ? 36  LYS C C     1 
ATOM   7701  O  O     . LYS E 4 33  ? 36.921  67.588  9.713   1.00 33.81  ? 36  LYS C O     1 
ATOM   7702  C  CB    . LYS E 4 33  ? 35.237  66.109  11.653  1.00 120.36 ? 36  LYS C CB    1 
ATOM   7703  C  CG    . LYS E 4 33  ? 34.754  64.688  11.908  1.00 120.36 ? 36  LYS C CG    1 
ATOM   7704  C  CD    . LYS E 4 33  ? 33.267  64.600  12.176  1.00 120.36 ? 36  LYS C CD    1 
ATOM   7705  C  CE    . LYS E 4 33  ? 32.887  63.181  12.599  1.00 120.36 ? 36  LYS C CE    1 
ATOM   7706  N  NZ    . LYS E 4 33  ? 31.449  63.075  12.968  1.00 120.36 ? 36  LYS C NZ    1 
ATOM   7707  N  N     . GLY E 4 34  ? 38.174  68.178  11.505  1.00 26.55  ? 37  GLY C N     1 
ATOM   7708  C  CA    . GLY E 4 34  ? 38.737  69.364  10.873  1.00 26.55  ? 37  GLY C CA    1 
ATOM   7709  C  C     . GLY E 4 34  ? 40.157  69.162  10.389  1.00 26.55  ? 37  GLY C C     1 
ATOM   7710  O  O     . GLY E 4 34  ? 40.749  70.076  9.802   1.00 26.55  ? 37  GLY C O     1 
ATOM   7711  N  N     . ASN E 4 35  ? 40.703  67.975  10.659  1.00 50.66  ? 38  ASN C N     1 
ATOM   7712  C  CA    . ASN E 4 35  ? 42.049  67.596  10.244  1.00 50.66  ? 38  ASN C CA    1 
ATOM   7713  C  C     . ASN E 4 35  ? 43.100  68.613  10.603  1.00 50.66  ? 38  ASN C C     1 
ATOM   7714  O  O     . ASN E 4 35  ? 43.598  69.370  9.754   1.00 50.66  ? 38  ASN C O     1 
ATOM   7715  C  CB    . ASN E 4 35  ? 42.087  67.309  8.753   1.00 95.21  ? 38  ASN C CB    1 
ATOM   7716  C  CG    . ASN E 4 35  ? 41.230  66.137  8.372   1.00 95.21  ? 38  ASN C CG    1 
ATOM   7717  O  OD1   . ASN E 4 35  ? 40.960  65.933  7.194   1.00 95.21  ? 38  ASN C OD1   1 
ATOM   7718  N  ND2   . ASN E 4 35  ? 40.744  65.385  9.366   1.00 95.21  ? 38  ASN C ND2   1 
ATOM   7719  N  N     . TYR E 4 36  ? 43.416  68.636  11.886  1.00 45.69  ? 39  TYR C N     1 
ATOM   7720  C  CA    . TYR E 4 36  ? 44.402  69.554  12.406  1.00 45.69  ? 39  TYR C CA    1 
ATOM   7721  C  C     . TYR E 4 36  ? 45.686  68.815  12.705  1.00 45.69  ? 39  TYR C C     1 
ATOM   7722  O  O     . TYR E 4 36  ? 46.779  69.302  12.438  1.00 45.69  ? 39  TYR C O     1 
ATOM   7723  C  CB    . TYR E 4 36  ? 43.824  70.216  13.644  1.00 32.01  ? 39  TYR C CB    1 
ATOM   7724  C  CG    . TYR E 4 36  ? 42.669  71.113  13.289  1.00 32.01  ? 39  TYR C CG    1 
ATOM   7725  C  CD1   . TYR E 4 36  ? 42.866  72.220  12.459  1.00 32.01  ? 39  TYR C CD1   1 
ATOM   7726  C  CD2   . TYR E 4 36  ? 41.399  70.880  13.781  1.00 32.01  ? 39  TYR C CD2   1 
ATOM   7727  C  CE1   . TYR E 4 36  ? 41.832  73.081  12.134  1.00 32.01  ? 39  TYR C CE1   1 
ATOM   7728  C  CE2   . TYR E 4 36  ? 40.341  71.738  13.459  1.00 32.01  ? 39  TYR C CE2   1 
ATOM   7729  C  CZ    . TYR E 4 36  ? 40.561  72.850  12.633  1.00 32.01  ? 39  TYR C CZ    1 
ATOM   7730  O  OH    . TYR E 4 36  ? 39.533  73.746  12.327  1.00 32.01  ? 39  TYR C OH    1 
ATOM   7731  N  N     . ALA E 4 37  ? 45.536  67.610  13.230  1.00 27.55  ? 40  ALA C N     1 
ATOM   7732  C  CA    . ALA E 4 37  ? 46.666  66.768  13.560  1.00 27.55  ? 40  ALA C CA    1 
ATOM   7733  C  C     . ALA E 4 37  ? 46.163  65.346  13.447  1.00 27.55  ? 40  ALA C C     1 
ATOM   7734  O  O     . ALA E 4 37  ? 44.961  65.135  13.298  1.00 27.55  ? 40  ALA C O     1 
ATOM   7735  C  CB    . ALA E 4 37  ? 47.133  67.058  14.961  1.00 5.11   ? 40  ALA C CB    1 
ATOM   7736  N  N     . GLU E 4 38  ? 47.063  64.368  13.481  1.00 43.32  ? 41  GLU C N     1 
ATOM   7737  C  CA    . GLU E 4 38  ? 46.628  62.974  13.389  1.00 43.32  ? 41  GLU C CA    1 
ATOM   7738  C  C     . GLU E 4 38  ? 45.736  62.615  14.577  1.00 43.32  ? 41  GLU C C     1 
ATOM   7739  O  O     . GLU E 4 38  ? 44.556  62.304  14.418  1.00 43.32  ? 41  GLU C O     1 
ATOM   7740  C  CB    . GLU E 4 38  ? 47.832  62.029  13.317  1.00 165.44 ? 41  GLU C CB    1 
ATOM   7741  C  CG    . GLU E 4 38  ? 48.629  62.124  12.017  1.00 165.44 ? 41  GLU C CG    1 
ATOM   7742  C  CD    . GLU E 4 38  ? 47.781  61.896  10.765  1.00 165.44 ? 41  GLU C CD    1 
ATOM   7743  O  OE1   . GLU E 4 38  ? 46.791  61.131  10.823  1.00 165.44 ? 41  GLU C OE1   1 
ATOM   7744  O  OE2   . GLU E 4 38  ? 48.109  62.484  9.712   1.00 165.44 ? 41  GLU C OE2   1 
ATOM   7745  N  N     . ARG E 4 39  ? 46.278  62.783  15.771  1.00 23.94  ? 42  ARG C N     1 
ATOM   7746  C  CA    . ARG E 4 39  ? 45.561  62.472  16.985  1.00 23.94  ? 42  ARG C CA    1 
ATOM   7747  C  C     . ARG E 4 39  ? 45.230  63.739  17.795  1.00 23.94  ? 42  ARG C C     1 
ATOM   7748  O  O     . ARG E 4 39  ? 45.903  64.762  17.656  1.00 23.94  ? 42  ARG C O     1 
ATOM   7749  C  CB    . ARG E 4 39  ? 46.411  61.531  17.844  1.00 66.90  ? 42  ARG C CB    1 
ATOM   7750  C  CG    . ARG E 4 39  ? 46.914  60.283  17.143  1.00 66.90  ? 42  ARG C CG    1 
ATOM   7751  C  CD    . ARG E 4 39  ? 48.165  59.733  17.837  1.00 66.90  ? 42  ARG C CD    1 
ATOM   7752  N  NE    . ARG E 4 39  ? 48.024  58.339  18.264  1.00 66.90  ? 42  ARG C NE    1 
ATOM   7753  C  CZ    . ARG E 4 39  ? 48.224  57.916  19.512  1.00 66.90  ? 42  ARG C CZ    1 
ATOM   7754  N  NH1   . ARG E 4 39  ? 48.573  58.786  20.461  1.00 66.90  ? 42  ARG C NH1   1 
ATOM   7755  N  NH2   . ARG E 4 39  ? 48.080  56.623  19.814  1.00 66.90  ? 42  ARG C NH2   1 
ATOM   7756  N  N     . VAL E 4 40  ? 44.220  63.631  18.669  1.00 28.22  ? 43  VAL C N     1 
ATOM   7757  C  CA    . VAL E 4 40  ? 43.771  64.713  19.554  1.00 28.22  ? 43  VAL C CA    1 
ATOM   7758  C  C     . VAL E 4 40  ? 43.584  64.141  20.948  1.00 28.22  ? 43  VAL C C     1 
ATOM   7759  O  O     . VAL E 4 40  ? 42.728  63.287  21.157  1.00 28.22  ? 43  VAL C O     1 
ATOM   7760  C  CB    . VAL E 4 40  ? 42.412  65.337  19.093  1.00 15.12  ? 43  VAL C CB    1 
ATOM   7761  C  CG1   . VAL E 4 40  ? 41.837  66.257  20.175  1.00 15.12  ? 43  VAL C CG1   1 
ATOM   7762  C  CG2   . VAL E 4 40  ? 42.612  66.141  17.845  1.00 15.12  ? 43  VAL C CG2   1 
ATOM   7763  N  N     . GLY E 4 41  ? 44.325  64.672  21.912  1.00 20.39  ? 44  GLY C N     1 
ATOM   7764  C  CA    . GLY E 4 41  ? 44.235  64.169  23.275  1.00 20.39  ? 44  GLY C CA    1 
ATOM   7765  C  C     . GLY E 4 41  ? 42.967  64.605  23.962  1.00 20.39  ? 44  GLY C C     1 
ATOM   7766  O  O     . GLY E 4 41  ? 42.300  65.512  23.481  1.00 20.39  ? 44  GLY C O     1 
ATOM   7767  N  N     . ALA E 4 42  ? 42.653  64.000  25.101  1.00 32.90  ? 45  ALA C N     1 
ATOM   7768  C  CA    . ALA E 4 42  ? 41.437  64.336  25.857  1.00 32.90  ? 45  ALA C CA    1 
ATOM   7769  C  C     . ALA E 4 42  ? 41.356  65.774  26.380  1.00 32.90  ? 45  ALA C C     1 
ATOM   7770  O  O     . ALA E 4 42  ? 40.292  66.394  26.386  1.00 32.90  ? 45  ALA C O     1 
ATOM   7771  C  CB    . ALA E 4 42  ? 41.259  63.365  27.013  1.00 33.28  ? 45  ALA C CB    1 
ATOM   7772  N  N     . GLY E 4 43  ? 42.480  66.297  26.838  1.00 29.38  ? 46  GLY C N     1 
ATOM   7773  C  CA    . GLY E 4 43  ? 42.483  67.639  27.366  1.00 29.38  ? 46  GLY C CA    1 
ATOM   7774  C  C     . GLY E 4 43  ? 42.273  68.682  26.296  1.00 29.38  ? 46  GLY C C     1 
ATOM   7775  O  O     . GLY E 4 43  ? 41.789  69.752  26.584  1.00 29.38  ? 46  GLY C O     1 
ATOM   7776  N  N     . ALA E 4 44  ? 42.588  68.372  25.049  1.00 21.17  ? 47  ALA C N     1 
ATOM   7777  C  CA    . ALA E 4 44  ? 42.430  69.362  23.998  1.00 21.17  ? 47  ALA C CA    1 
ATOM   7778  C  C     . ALA E 4 44  ? 41.054  69.998  23.985  1.00 21.17  ? 47  ALA C C     1 
ATOM   7779  O  O     . ALA E 4 44  ? 40.927  71.196  24.202  1.00 21.17  ? 47  ALA C O     1 
ATOM   7780  C  CB    . ALA E 4 44  ? 42.771  68.771  22.621  1.00 50.96  ? 47  ALA C CB    1 
ATOM   7781  N  N     . PRO E 4 45  ? 39.995  69.189  23.817  1.00 27.08  ? 48  PRO C N     1 
ATOM   7782  C  CA    . PRO E 4 45  ? 38.660  69.786  23.791  1.00 27.08  ? 48  PRO C CA    1 
ATOM   7783  C  C     . PRO E 4 45  ? 38.285  70.509  25.079  1.00 27.08  ? 48  PRO C C     1 
ATOM   7784  O  O     . PRO E 4 45  ? 37.724  71.597  25.027  1.00 27.08  ? 48  PRO C O     1 
ATOM   7785  C  CB    . PRO E 4 45  ? 37.763  68.590  23.489  1.00 19.04  ? 48  PRO C CB    1 
ATOM   7786  C  CG    . PRO E 4 45  ? 38.503  67.445  24.114  1.00 19.04  ? 48  PRO C CG    1 
ATOM   7787  C  CD    . PRO E 4 45  ? 39.914  67.723  23.699  1.00 19.04  ? 48  PRO C CD    1 
ATOM   7788  N  N     . VAL E 4 46  ? 38.636  69.935  26.226  1.00 17.06  ? 49  VAL C N     1 
ATOM   7789  C  CA    . VAL E 4 46  ? 38.335  70.561  27.515  1.00 17.06  ? 49  VAL C CA    1 
ATOM   7790  C  C     . VAL E 4 46  ? 38.845  72.005  27.570  1.00 17.06  ? 49  VAL C C     1 
ATOM   7791  O  O     . VAL E 4 46  ? 38.124  72.933  27.944  1.00 17.06  ? 49  VAL C O     1 
ATOM   7792  C  CB    . VAL E 4 46  ? 38.970  69.776  28.676  1.00 18.11  ? 49  VAL C CB    1 
ATOM   7793  C  CG1   . VAL E 4 46  ? 38.743  70.504  29.990  1.00 18.11  ? 49  VAL C CG1   1 
ATOM   7794  C  CG2   . VAL E 4 46  ? 38.406  68.381  28.734  1.00 18.11  ? 49  VAL C CG2   1 
ATOM   7795  N  N     . TYR E 4 47  ? 40.096  72.182  27.180  1.00 27.15  ? 50  TYR C N     1 
ATOM   7796  C  CA    . TYR E 4 47  ? 40.727  73.487  27.167  1.00 27.15  ? 50  TYR C CA    1 
ATOM   7797  C  C     . TYR E 4 47  ? 40.063  74.436  26.195  1.00 27.15  ? 50  TYR C C     1 
ATOM   7798  O  O     . TYR E 4 47  ? 39.704  75.550  26.541  1.00 27.15  ? 50  TYR C O     1 
ATOM   7799  C  CB    . TYR E 4 47  ? 42.185  73.342  26.763  1.00 27.13  ? 50  TYR C CB    1 
ATOM   7800  C  CG    . TYR E 4 47  ? 43.027  74.461  27.288  1.00 27.13  ? 50  TYR C CG    1 
ATOM   7801  C  CD1   . TYR E 4 47  ? 42.875  75.756  26.808  1.00 27.13  ? 50  TYR C CD1   1 
ATOM   7802  C  CD2   . TYR E 4 47  ? 43.978  74.225  28.279  1.00 27.13  ? 50  TYR C CD2   1 
ATOM   7803  C  CE1   . TYR E 4 47  ? 43.648  76.782  27.299  1.00 27.13  ? 50  TYR C CE1   1 
ATOM   7804  C  CE2   . TYR E 4 47  ? 44.752  75.241  28.779  1.00 27.13  ? 50  TYR C CE2   1 
ATOM   7805  C  CZ    . TYR E 4 47  ? 44.589  76.516  28.283  1.00 27.13  ? 50  TYR C CZ    1 
ATOM   7806  O  OH    . TYR E 4 47  ? 45.400  77.518  28.750  1.00 27.13  ? 50  TYR C OH    1 
ATOM   7807  N  N     . LEU E 4 48  ? 39.957  74.002  24.953  1.00 17.39  ? 51  LEU C N     1 
ATOM   7808  C  CA    . LEU E 4 48  ? 39.356  74.819  23.925  1.00 17.39  ? 51  LEU C CA    1 
ATOM   7809  C  C     . LEU E 4 48  ? 37.964  75.241  24.348  1.00 17.39  ? 51  LEU C C     1 
ATOM   7810  O  O     . LEU E 4 48  ? 37.613  76.405  24.235  1.00 17.39  ? 51  LEU C O     1 
ATOM   7811  C  CB    . LEU E 4 48  ? 39.317  74.065  22.601  1.00 18.01  ? 51  LEU C CB    1 
ATOM   7812  C  CG    . LEU E 4 48  ? 38.849  74.958  21.460  1.00 18.01  ? 51  LEU C CG    1 
ATOM   7813  C  CD1   . LEU E 4 48  ? 39.588  76.282  21.479  1.00 18.01  ? 51  LEU C CD1   1 
ATOM   7814  C  CD2   . LEU E 4 48  ? 39.085  74.257  20.174  1.00 18.01  ? 51  LEU C CD2   1 
ATOM   7815  N  N     . ALA E 4 49  ? 37.194  74.306  24.888  1.00 24.24  ? 52  ALA C N     1 
ATOM   7816  C  CA    . ALA E 4 49  ? 35.849  74.601  25.349  1.00 24.24  ? 52  ALA C CA    1 
ATOM   7817  C  C     . ALA E 4 49  ? 35.867  75.665  26.463  1.00 24.24  ? 52  ALA C C     1 
ATOM   7818  O  O     . ALA E 4 49  ? 35.050  76.583  26.473  1.00 24.24  ? 52  ALA C O     1 
ATOM   7819  C  CB    . ALA E 4 49  ? 35.188  73.340  25.827  1.00 16.03  ? 52  ALA C CB    1 
ATOM   7820  N  N     . ALA E 4 50  ? 36.817  75.562  27.383  1.00 26.35  ? 53  ALA C N     1 
ATOM   7821  C  CA    . ALA E 4 50  ? 36.929  76.534  28.463  1.00 26.35  ? 53  ALA C CA    1 
ATOM   7822  C  C     . ALA E 4 50  ? 37.212  77.921  27.904  1.00 26.35  ? 53  ALA C C     1 
ATOM   7823  O  O     . ALA E 4 50  ? 36.617  78.917  28.324  1.00 26.35  ? 53  ALA C O     1 
ATOM   7824  C  CB    . ALA E 4 50  ? 38.025  76.113  29.428  1.00 29.90  ? 53  ALA C CB    1 
ATOM   7825  N  N     . VAL E 4 51  ? 38.123  77.978  26.942  1.00 11.25  ? 54  VAL C N     1 
ATOM   7826  C  CA    . VAL E 4 51  ? 38.487  79.234  26.317  1.00 11.25  ? 54  VAL C CA    1 
ATOM   7827  C  C     . VAL E 4 51  ? 37.319  79.841  25.523  1.00 11.25  ? 54  VAL C C     1 
ATOM   7828  O  O     . VAL E 4 51  ? 36.988  81.003  25.683  1.00 11.25  ? 54  VAL C O     1 
ATOM   7829  C  CB    . VAL E 4 51  ? 39.741  79.024  25.444  1.00 21.58  ? 54  VAL C CB    1 
ATOM   7830  C  CG1   . VAL E 4 51  ? 40.103  80.279  24.653  1.00 21.58  ? 54  VAL C CG1   1 
ATOM   7831  C  CG2   . VAL E 4 51  ? 40.895  78.631  26.331  1.00 21.58  ? 54  VAL C CG2   1 
ATOM   7832  N  N     . LEU E 4 52  ? 36.667  79.048  24.689  1.00 25.41  ? 55  LEU C N     1 
ATOM   7833  C  CA    . LEU E 4 52  ? 35.553  79.560  23.917  1.00 25.41  ? 55  LEU C CA    1 
ATOM   7834  C  C     . LEU E 4 52  ? 34.459  80.056  24.857  1.00 25.41  ? 55  LEU C C     1 
ATOM   7835  O  O     . LEU E 4 52  ? 33.956  81.156  24.696  1.00 25.41  ? 55  LEU C O     1 
ATOM   7836  C  CB    . LEU E 4 52  ? 35.016  78.475  23.001  1.00 12.38  ? 55  LEU C CB    1 
ATOM   7837  C  CG    . LEU E 4 52  ? 35.902  77.940  21.867  1.00 12.38  ? 55  LEU C CG    1 
ATOM   7838  C  CD1   . LEU E 4 52  ? 35.607  76.483  21.727  1.00 12.38  ? 55  LEU C CD1   1 
ATOM   7839  C  CD2   . LEU E 4 52  ? 35.695  78.634  20.511  1.00 12.38  ? 55  LEU C CD2   1 
ATOM   7840  N  N     . GLU E 4 53  ? 34.105  79.265  25.861  1.00 18.75  ? 56  GLU C N     1 
ATOM   7841  C  CA    . GLU E 4 53  ? 33.082  79.685  26.802  1.00 18.75  ? 56  GLU C CA    1 
ATOM   7842  C  C     . GLU E 4 53  ? 33.467  81.008  27.443  1.00 18.75  ? 56  GLU C C     1 
ATOM   7843  O  O     . GLU E 4 53  ? 32.663  81.946  27.495  1.00 18.75  ? 56  GLU C O     1 
ATOM   7844  C  CB    . GLU E 4 53  ? 32.916  78.641  27.897  1.00 21.43  ? 56  GLU C CB    1 
ATOM   7845  C  CG    . GLU E 4 53  ? 31.962  79.033  29.020  1.00 21.43  ? 56  GLU C CG    1 
ATOM   7846  C  CD    . GLU E 4 53  ? 31.594  77.854  29.920  1.00 21.43  ? 56  GLU C CD    1 
ATOM   7847  O  OE1   . GLU E 4 53  ? 31.482  76.714  29.407  1.00 21.43  ? 56  GLU C OE1   1 
ATOM   7848  O  OE2   . GLU E 4 53  ? 31.375  78.060  31.132  1.00 21.43  ? 56  GLU C OE2   1 
ATOM   7849  N  N     . TYR E 4 54  ? 34.708  81.075  27.926  1.00 18.22  ? 57  TYR C N     1 
ATOM   7850  C  CA    . TYR E 4 54  ? 35.219  82.261  28.589  1.00 18.22  ? 57  TYR C CA    1 
ATOM   7851  C  C     . TYR E 4 54  ? 35.061  83.475  27.724  1.00 18.22  ? 57  TYR C C     1 
ATOM   7852  O  O     . TYR E 4 54  ? 34.542  84.474  28.171  1.00 18.22  ? 57  TYR C O     1 
ATOM   7853  C  CB    . TYR E 4 54  ? 36.693  82.081  28.977  1.00 29.28  ? 57  TYR C CB    1 
ATOM   7854  C  CG    . TYR E 4 54  ? 37.407  83.385  29.254  1.00 29.28  ? 57  TYR C CG    1 
ATOM   7855  C  CD1   . TYR E 4 54  ? 37.000  84.216  30.292  1.00 29.28  ? 57  TYR C CD1   1 
ATOM   7856  C  CD2   . TYR E 4 54  ? 38.433  83.831  28.415  1.00 29.28  ? 57  TYR C CD2   1 
ATOM   7857  C  CE1   . TYR E 4 54  ? 37.580  85.469  30.483  1.00 29.28  ? 57  TYR C CE1   1 
ATOM   7858  C  CE2   . TYR E 4 54  ? 39.028  85.082  28.599  1.00 29.28  ? 57  TYR C CE2   1 
ATOM   7859  C  CZ    . TYR E 4 54  ? 38.587  85.897  29.633  1.00 29.28  ? 57  TYR C CZ    1 
ATOM   7860  O  OH    . TYR E 4 54  ? 39.119  87.160  29.788  1.00 29.28  ? 57  TYR C OH    1 
ATOM   7861  N  N     . LEU E 4 55  ? 35.492  83.391  26.478  1.00 21.30  ? 58  LEU C N     1 
ATOM   7862  C  CA    . LEU E 4 55  ? 35.386  84.516  25.577  1.00 21.30  ? 58  LEU C CA    1 
ATOM   7863  C  C     . LEU E 4 55  ? 33.938  84.936  25.336  1.00 21.30  ? 58  LEU C C     1 
ATOM   7864  O  O     . LEU E 4 55  ? 33.640  86.138  25.337  1.00 21.30  ? 58  LEU C O     1 
ATOM   7865  C  CB    . LEU E 4 55  ? 36.077  84.202  24.256  1.00 8.81   ? 58  LEU C CB    1 
ATOM   7866  C  CG    . LEU E 4 55  ? 37.597  83.988  24.257  1.00 8.81   ? 58  LEU C CG    1 
ATOM   7867  C  CD1   . LEU E 4 55  ? 38.035  83.370  22.954  1.00 8.81   ? 58  LEU C CD1   1 
ATOM   7868  C  CD2   . LEU E 4 55  ? 38.323  85.320  24.488  1.00 8.81   ? 58  LEU C CD2   1 
ATOM   7869  N  N     . THR E 4 56  ? 33.027  83.980  25.128  1.00 20.47  ? 59  THR C N     1 
ATOM   7870  C  CA    . THR E 4 56  ? 31.637  84.369  24.907  1.00 20.47  ? 59  THR C CA    1 
ATOM   7871  C  C     . THR E 4 56  ? 31.085  85.076  26.166  1.00 20.47  ? 59  THR C C     1 
ATOM   7872  O  O     . THR E 4 56  ? 30.340  86.040  26.057  1.00 20.47  ? 59  THR C O     1 
ATOM   7873  C  CB    . THR E 4 56  ? 30.706  83.204  24.370  1.00 14.78  ? 59  THR C CB    1 
ATOM   7874  O  OG1   . THR E 4 56  ? 29.962  82.632  25.444  1.00 14.78  ? 59  THR C OG1   1 
ATOM   7875  C  CG2   . THR E 4 56  ? 31.489  82.120  23.658  1.00 14.78  ? 59  THR C CG2   1 
ATOM   7876  N  N     . ALA E 4 57  ? 31.486  84.651  27.364  1.00 18.29  ? 60  ALA C N     1 
ATOM   7877  C  CA    . ALA E 4 57  ? 31.029  85.357  28.580  1.00 18.29  ? 60  ALA C CA    1 
ATOM   7878  C  C     . ALA E 4 57  ? 31.495  86.816  28.556  1.00 18.29  ? 60  ALA C C     1 
ATOM   7879  O  O     . ALA E 4 57  ? 30.767  87.705  28.931  1.00 18.29  ? 60  ALA C O     1 
ATOM   7880  C  CB    . ALA E 4 57  ? 31.546  84.683  29.817  1.00 14.20  ? 60  ALA C CB    1 
ATOM   7881  N  N     . GLU E 4 58  ? 32.725  87.038  28.114  1.00 11.63  ? 61  GLU C N     1 
ATOM   7882  C  CA    . GLU E 4 58  ? 33.319  88.363  28.009  1.00 11.63  ? 61  GLU C CA    1 
ATOM   7883  C  C     . GLU E 4 58  ? 32.521  89.254  27.052  1.00 11.63  ? 61  GLU C C     1 
ATOM   7884  O  O     . GLU E 4 58  ? 32.134  90.370  27.394  1.00 11.63  ? 61  GLU C O     1 
ATOM   7885  C  CB    . GLU E 4 58  ? 34.764  88.211  27.535  1.00 35.41  ? 61  GLU C CB    1 
ATOM   7886  C  CG    . GLU E 4 58  ? 35.609  89.458  27.614  1.00 35.41  ? 61  GLU C CG    1 
ATOM   7887  C  CD    . GLU E 4 58  ? 35.651  90.103  29.003  1.00 35.41  ? 61  GLU C CD    1 
ATOM   7888  O  OE1   . GLU E 4 58  ? 35.499  89.385  30.031  1.00 35.41  ? 61  GLU C OE1   1 
ATOM   7889  O  OE2   . GLU E 4 58  ? 35.855  91.345  29.057  1.00 35.41  ? 61  GLU C OE2   1 
ATOM   7890  N  N     . ILE E 4 59  ? 32.252  88.768  25.849  1.00 18.09  ? 62  ILE C N     1 
ATOM   7891  C  CA    . ILE E 4 59  ? 31.488  89.563  24.895  1.00 18.09  ? 62  ILE C CA    1 
ATOM   7892  C  C     . ILE E 4 59  ? 30.061  89.828  25.370  1.00 18.09  ? 62  ILE C C     1 
ATOM   7893  O  O     . ILE E 4 59  ? 29.558  90.931  25.164  1.00 18.09  ? 62  ILE C O     1 
ATOM   7894  C  CB    . ILE E 4 59  ? 31.443  88.910  23.500  1.00 38.01  ? 62  ILE C CB    1 
ATOM   7895  C  CG1   . ILE E 4 59  ? 32.832  88.935  22.873  1.00 38.01  ? 62  ILE C CG1   1 
ATOM   7896  C  CG2   . ILE E 4 59  ? 30.458  89.634  22.601  1.00 38.01  ? 62  ILE C CG2   1 
ATOM   7897  C  CD1   . ILE E 4 59  ? 32.819  89.147  21.357  1.00 38.01  ? 62  ILE C CD1   1 
ATOM   7898  N  N     . LEU E 4 60  ? 29.415  88.816  25.974  1.00 12.07  ? 63  LEU C N     1 
ATOM   7899  C  CA    . LEU E 4 60  ? 28.028  88.913  26.489  1.00 12.07  ? 63  LEU C CA    1 
ATOM   7900  C  C     . LEU E 4 60  ? 27.925  89.874  27.690  1.00 12.07  ? 63  LEU C C     1 
ATOM   7901  O  O     . LEU E 4 60  ? 27.004  90.683  27.773  1.00 12.07  ? 63  LEU C O     1 
ATOM   7902  C  CB    . LEU E 4 60  ? 27.448  87.522  26.816  1.00 7.20   ? 63  LEU C CB    1 
ATOM   7903  C  CG    . LEU E 4 60  ? 27.134  86.500  25.683  1.00 7.20   ? 63  LEU C CG    1 
ATOM   7904  C  CD1   . LEU E 4 60  ? 26.664  85.182  26.244  1.00 7.20   ? 63  LEU C CD1   1 
ATOM   7905  C  CD2   . LEU E 4 60  ? 26.072  87.000  24.729  1.00 7.20   ? 63  LEU C CD2   1 
ATOM   7906  N  N     . GLU E 4 61  ? 28.883  89.815  28.607  1.00 12.85  ? 64  GLU C N     1 
ATOM   7907  C  CA    . GLU E 4 61  ? 28.877  90.746  29.727  1.00 12.85  ? 64  GLU C CA    1 
ATOM   7908  C  C     . GLU E 4 61  ? 28.979  92.118  29.109  1.00 12.85  ? 64  GLU C C     1 
ATOM   7909  O  O     . GLU E 4 61  ? 28.114  92.929  29.320  1.00 12.85  ? 64  GLU C O     1 
ATOM   7910  C  CB    . GLU E 4 61  ? 30.045  90.513  30.687  1.00 24.48  ? 64  GLU C CB    1 
ATOM   7911  C  CG    . GLU E 4 61  ? 30.127  91.527  31.827  1.00 24.48  ? 64  GLU C CG    1 
ATOM   7912  C  CD    . GLU E 4 61  ? 29.194  91.247  33.016  1.00 24.48  ? 64  GLU C CD    1 
ATOM   7913  O  OE1   . GLU E 4 61  ? 29.252  90.133  33.580  1.00 24.48  ? 64  GLU C OE1   1 
ATOM   7914  O  OE2   . GLU E 4 61  ? 28.444  92.160  33.439  1.00 24.48  ? 64  GLU C OE2   1 
ATOM   7915  N  N     . LEU E 4 62  ? 29.959  92.338  28.240  1.00 19.43  ? 65  LEU C N     1 
ATOM   7916  C  CA    . LEU E 4 62  ? 30.111  93.661  27.612  1.00 19.43  ? 65  LEU C CA    1 
ATOM   7917  C  C     . LEU E 4 62  ? 28.896  94.150  26.794  1.00 19.43  ? 65  LEU C C     1 
ATOM   7918  O  O     . LEU E 4 62  ? 28.468  95.301  26.956  1.00 19.43  ? 65  LEU C O     1 
ATOM   7919  C  CB    . LEU E 4 62  ? 31.398  93.727  26.776  1.00 22.04  ? 65  LEU C CB    1 
ATOM   7920  C  CG    . LEU E 4 62  ? 32.733  93.794  27.537  1.00 22.04  ? 65  LEU C CG    1 
ATOM   7921  C  CD1   . LEU E 4 62  ? 33.903  93.766  26.569  1.00 22.04  ? 65  LEU C CD1   1 
ATOM   7922  C  CD2   . LEU E 4 62  ? 32.768  95.062  28.390  1.00 22.04  ? 65  LEU C CD2   1 
ATOM   7923  N  N     . ALA E 4 63  ? 28.351  93.279  25.937  1.00 29.10  ? 66  ALA C N     1 
ATOM   7924  C  CA    . ALA E 4 63  ? 27.176  93.590  25.113  1.00 29.10  ? 66  ALA C CA    1 
ATOM   7925  C  C     . ALA E 4 63  ? 25.910  93.842  25.945  1.00 29.10  ? 66  ALA C C     1 
ATOM   7926  O  O     . ALA E 4 63  ? 25.124  94.749  25.654  1.00 29.10  ? 66  ALA C O     1 
ATOM   7927  C  CB    . ALA E 4 63  ? 26.926  92.482  24.105  1.00 16.64  ? 66  ALA C CB    1 
ATOM   7928  N  N     . GLY E 4 64  ? 25.700  93.035  26.975  1.00 11.25  ? 67  GLY C N     1 
ATOM   7929  C  CA    . GLY E 4 64  ? 24.553  93.245  27.820  1.00 11.25  ? 67  GLY C CA    1 
ATOM   7930  C  C     . GLY E 4 64  ? 24.580  94.649  28.403  1.00 11.25  ? 67  GLY C C     1 
ATOM   7931  O  O     . GLY E 4 64  ? 23.530  95.251  28.615  1.00 11.25  ? 67  GLY C O     1 
ATOM   7932  N  N     . ASN E 4 65  ? 25.769  95.164  28.717  1.00 21.17  ? 68  ASN C N     1 
ATOM   7933  C  CA    . ASN E 4 65  ? 25.867  96.514  29.267  1.00 21.17  ? 68  ASN C CA    1 
ATOM   7934  C  C     . ASN E 4 65  ? 25.404  97.499  28.217  1.00 21.17  ? 68  ASN C C     1 
ATOM   7935  O  O     . ASN E 4 65  ? 24.640  98.407  28.508  1.00 21.17  ? 68  ASN C O     1 
ATOM   7936  C  CB    . ASN E 4 65  ? 27.297  96.863  29.678  1.00 28.26  ? 68  ASN C CB    1 
ATOM   7937  C  CG    . ASN E 4 65  ? 27.817  96.003  30.811  1.00 28.26  ? 68  ASN C CG    1 
ATOM   7938  O  OD1   . ASN E 4 65  ? 27.065  95.403  31.566  1.00 28.26  ? 68  ASN C OD1   1 
ATOM   7939  N  ND2   . ASN E 4 65  ? 29.127  95.948  30.931  1.00 28.26  ? 68  ASN C ND2   1 
ATOM   7940  N  N     . ALA E 4 66  ? 25.882  97.335  26.991  1.00 20.87  ? 69  ALA C N     1 
ATOM   7941  C  CA    . ALA E 4 66  ? 25.467  98.232  25.943  1.00 20.87  ? 69  ALA C CA    1 
ATOM   7942  C  C     . ALA E 4 66  ? 23.946  98.198  25.876  1.00 20.87  ? 69  ALA C C     1 
ATOM   7943  O  O     . ALA E 4 66  ? 23.307  99.222  25.678  1.00 20.87  ? 69  ALA C O     1 
ATOM   7944  C  CB    . ALA E 4 66  ? 26.090  97.838  24.633  1.00 11.60  ? 69  ALA C CB    1 
ATOM   7945  N  N     . ALA E 4 67  ? 23.367  97.023  26.096  1.00 22.08  ? 70  ALA C N     1 
ATOM   7946  C  CA    . ALA E 4 67  ? 21.918  96.886  26.090  1.00 22.08  ? 70  ALA C CA    1 
ATOM   7947  C  C     . ALA E 4 67  ? 21.327  97.799  27.155  1.00 22.08  ? 70  ALA C C     1 
ATOM   7948  O  O     . ALA E 4 67  ? 20.450  98.590  26.866  1.00 22.08  ? 70  ALA C O     1 
ATOM   7949  C  CB    . ALA E 4 67  ? 21.524  95.444  26.344  1.00 29.84  ? 70  ALA C CB    1 
ATOM   7950  N  N     . ARG E 4 68  ? 21.789  97.663  28.391  1.00 27.17  ? 71  ARG C N     1 
ATOM   7951  C  CA    . ARG E 4 68  ? 21.335  98.499  29.510  1.00 27.17  ? 71  ARG C CA    1 
ATOM   7952  C  C     . ARG E 4 68  ? 21.463  99.980  29.158  1.00 27.17  ? 71  ARG C C     1 
ATOM   7953  O  O     . ARG E 4 68  ? 20.511  100.735 29.302  1.00 27.17  ? 71  ARG C O     1 
ATOM   7954  C  CB    . ARG E 4 68  ? 22.169  98.215  30.760  1.00 153.29 ? 71  ARG C CB    1 
ATOM   7955  C  CG    . ARG E 4 68  ? 21.785  96.959  31.525  1.00 153.29 ? 71  ARG C CG    1 
ATOM   7956  C  CD    . ARG E 4 68  ? 20.926  97.294  32.738  1.00 153.29 ? 71  ARG C CD    1 
ATOM   7957  N  NE    . ARG E 4 68  ? 21.571  98.262  33.631  1.00 153.29 ? 71  ARG C NE    1 
ATOM   7958  C  CZ    . ARG E 4 68  ? 21.787  98.072  34.934  1.00 153.29 ? 71  ARG C CZ    1 
ATOM   7959  N  NH1   . ARG E 4 68  ? 21.415  96.940  35.519  1.00 153.29 ? 71  ARG C NH1   1 
ATOM   7960  N  NH2   . ARG E 4 68  ? 22.364  99.024  35.663  1.00 153.29 ? 71  ARG C NH2   1 
ATOM   7961  N  N     . ASP E 4 69  ? 22.627  100.376 28.652  1.00 37.53  ? 72  ASP C N     1 
ATOM   7962  C  CA    . ASP E 4 69  ? 22.900  101.760 28.281  1.00 37.53  ? 72  ASP C CA    1 
ATOM   7963  C  C     . ASP E 4 69  ? 21.861  102.385 27.380  1.00 37.53  ? 72  ASP C C     1 
ATOM   7964  O  O     . ASP E 4 69  ? 21.562  103.559 27.523  1.00 37.53  ? 72  ASP C O     1 
ATOM   7965  C  CB    . ASP E 4 69  ? 24.247  101.872 27.588  1.00 45.02  ? 72  ASP C CB    1 
ATOM   7966  C  CG    . ASP E 4 69  ? 25.404  101.474 28.480  1.00 45.02  ? 72  ASP C CG    1 
ATOM   7967  O  OD1   . ASP E 4 69  ? 25.241  101.484 29.721  1.00 45.02  ? 72  ASP C OD1   1 
ATOM   7968  O  OD2   . ASP E 4 69  ? 26.484  101.153 27.929  1.00 45.02  ? 72  ASP C OD2   1 
ATOM   7969  N  N     . ASN E 4 70  ? 21.381  101.636 26.395  1.00 29.61  ? 73  ASN C N     1 
ATOM   7970  C  CA    . ASN E 4 70  ? 20.377  102.156 25.474  1.00 29.61  ? 73  ASN C CA    1 
ATOM   7971  C  C     . ASN E 4 70  ? 18.960  101.773 25.844  1.00 29.61  ? 73  ASN C C     1 
ATOM   7972  O  O     . ASN E 4 70  ? 18.044  101.799 25.012  1.00 29.61  ? 73  ASN C O     1 
ATOM   7973  C  CB    . ASN E 4 70  ? 20.720  101.741 24.058  1.00 61.07  ? 73  ASN C CB    1 
ATOM   7974  C  CG    . ASN E 4 70  ? 22.105  102.181 23.676  1.00 61.07  ? 73  ASN C CG    1 
ATOM   7975  O  OD1   . ASN E 4 70  ? 22.328  103.343 23.342  1.00 61.07  ? 73  ASN C OD1   1 
ATOM   7976  N  ND2   . ASN E 4 70  ? 23.069  101.291 23.844  1.00 61.07  ? 73  ASN C ND2   1 
ATOM   7977  N  N     . LYS E 4 71  ? 18.802  101.413 27.111  1.00 27.77  ? 74  LYS C N     1 
ATOM   7978  C  CA    . LYS E 4 71  ? 17.518  101.048 27.697  1.00 27.77  ? 74  LYS C CA    1 
ATOM   7979  C  C     . LYS E 4 71  ? 16.763  99.888  27.029  1.00 27.77  ? 74  LYS C C     1 
ATOM   7980  O  O     . LYS E 4 71  ? 15.539  99.779  27.118  1.00 27.77  ? 74  LYS C O     1 
ATOM   7981  C  CB    . LYS E 4 71  ? 16.674  102.323 27.860  1.00 112.03 ? 74  LYS C CB    1 
ATOM   7982  C  CG    . LYS E 4 71  ? 17.381  103.344 28.780  1.00 112.03 ? 74  LYS C CG    1 
ATOM   7983  C  CD    . LYS E 4 71  ? 16.914  104.787 28.638  1.00 112.03 ? 74  LYS C CD    1 
ATOM   7984  C  CE    . LYS E 4 71  ? 17.830  105.699 29.457  1.00 112.03 ? 74  LYS C CE    1 
ATOM   7985  N  NZ    . LYS E 4 71  ? 17.433  107.130 29.413  1.00 112.03 ? 74  LYS C NZ    1 
ATOM   7986  N  N     . LYS E 4 72  ? 17.533  98.965  26.458  1.00 33.45  ? 75  LYS C N     1 
ATOM   7987  C  CA    . LYS E 4 72  ? 16.990  97.792  25.796  1.00 33.45  ? 75  LYS C CA    1 
ATOM   7988  C  C     . LYS E 4 72  ? 17.242  96.561  26.660  1.00 33.45  ? 75  LYS C C     1 
ATOM   7989  O  O     . LYS E 4 72  ? 18.103  96.562  27.546  1.00 33.45  ? 75  LYS C O     1 
ATOM   7990  C  CB    . LYS E 4 72  ? 17.673  97.620  24.463  1.00 30.01  ? 75  LYS C CB    1 
ATOM   7991  C  CG    . LYS E 4 72  ? 17.610  98.853  23.625  1.00 30.01  ? 75  LYS C CG    1 
ATOM   7992  C  CD    . LYS E 4 72  ? 16.407  98.861  22.703  1.00 30.01  ? 75  LYS C CD    1 
ATOM   7993  C  CE    . LYS E 4 72  ? 16.438  100.097 21.796  1.00 30.01  ? 75  LYS C CE    1 
ATOM   7994  N  NZ    . LYS E 4 72  ? 16.124  101.357 22.548  1.00 30.01  ? 75  LYS C NZ    1 
ATOM   7995  N  N     . THR E 4 73  ? 16.517  95.496  26.366  1.00 35.80  ? 76  THR C N     1 
ATOM   7996  C  CA    . THR E 4 73  ? 16.633  94.262  27.115  1.00 35.80  ? 76  THR C CA    1 
ATOM   7997  C  C     . THR E 4 73  ? 17.103  93.128  26.231  1.00 35.80  ? 76  THR C C     1 
ATOM   7998  O  O     . THR E 4 73  ? 17.628  92.123  26.715  1.00 35.80  ? 76  THR C O     1 
ATOM   7999  C  CB    . THR E 4 73  ? 15.272  93.924  27.740  1.00 32.82  ? 76  THR C CB    1 
ATOM   8000  O  OG1   . THR E 4 73  ? 15.218  94.523  29.037  1.00 32.82  ? 76  THR C OG1   1 
ATOM   8001  C  CG2   . THR E 4 73  ? 14.992  92.382  27.799  1.00 32.82  ? 76  THR C CG2   1 
ATOM   8002  N  N     . ARG E 4 74  ? 16.853  93.258  24.934  1.00 25.08  ? 77  ARG C N     1 
ATOM   8003  C  CA    . ARG E 4 74  ? 17.268  92.241  24.010  1.00 25.08  ? 77  ARG C CA    1 
ATOM   8004  C  C     . ARG E 4 74  ? 18.489  92.789  23.289  1.00 25.08  ? 77  ARG C C     1 
ATOM   8005  O  O     . ARG E 4 74  ? 18.436  93.843  22.647  1.00 25.08  ? 77  ARG C O     1 
ATOM   8006  C  CB    . ARG E 4 74  ? 16.153  91.929  23.019  1.00 41.83  ? 77  ARG C CB    1 
ATOM   8007  C  CG    . ARG E 4 74  ? 16.282  90.557  22.391  1.00 41.83  ? 77  ARG C CG    1 
ATOM   8008  C  CD    . ARG E 4 74  ? 15.158  90.262  21.423  1.00 41.83  ? 77  ARG C CD    1 
ATOM   8009  N  NE    . ARG E 4 74  ? 13.847  90.244  22.074  1.00 41.83  ? 77  ARG C NE    1 
ATOM   8010  C  CZ    . ARG E 4 74  ? 12.860  91.097  21.788  1.00 41.83  ? 77  ARG C CZ    1 
ATOM   8011  N  NH1   . ARG E 4 74  ? 13.035  92.027  20.859  1.00 41.83  ? 77  ARG C NH1   1 
ATOM   8012  N  NH2   . ARG E 4 74  ? 11.710  91.052  22.459  1.00 41.83  ? 77  ARG C NH2   1 
ATOM   8013  N  N     . ILE E 4 75  ? 19.608  92.107  23.477  1.00 20.39  ? 78  ILE C N     1 
ATOM   8014  C  CA    . ILE E 4 75  ? 20.857  92.463  22.825  1.00 20.39  ? 78  ILE C CA    1 
ATOM   8015  C  C     . ILE E 4 75  ? 20.649  92.313  21.318  1.00 20.39  ? 78  ILE C C     1 
ATOM   8016  O  O     . ILE E 4 75  ? 20.033  91.343  20.859  1.00 20.39  ? 78  ILE C O     1 
ATOM   8017  C  CB    . ILE E 4 75  ? 21.996  91.463  23.190  1.00 7.96   ? 78  ILE C CB    1 
ATOM   8018  C  CG1   . ILE E 4 75  ? 22.377  91.566  24.659  1.00 7.96   ? 78  ILE C CG1   1 
ATOM   8019  C  CG2   . ILE E 4 75  ? 23.204  91.666  22.296  1.00 7.96   ? 78  ILE C CG2   1 
ATOM   8020  C  CD1   . ILE E 4 75  ? 23.247  90.427  25.137  1.00 7.96   ? 78  ILE C CD1   1 
ATOM   8021  N  N     . ILE E 4 76  ? 21.149  93.283  20.562  1.00 26.88  ? 79  ILE C N     1 
ATOM   8022  C  CA    . ILE E 4 76  ? 21.080  93.223  19.120  1.00 26.88  ? 79  ILE C CA    1 
ATOM   8023  C  C     . ILE E 4 76  ? 22.499  93.433  18.633  1.00 26.88  ? 79  ILE C C     1 
ATOM   8024  O  O     . ILE E 4 76  ? 23.382  93.757  19.416  1.00 26.88  ? 79  ILE C O     1 
ATOM   8025  C  CB    . ILE E 4 76  ? 20.139  94.288  18.528  1.00 16.98  ? 79  ILE C CB    1 
ATOM   8026  C  CG1   . ILE E 4 76  ? 20.596  95.690  18.900  1.00 16.98  ? 79  ILE C CG1   1 
ATOM   8027  C  CG2   . ILE E 4 76  ? 18.704  94.015  18.958  1.00 16.98  ? 79  ILE C CG2   1 
ATOM   8028  C  CD1   . ILE E 4 76  ? 19.753  96.747  18.261  1.00 16.98  ? 79  ILE C CD1   1 
ATOM   8029  N  N     . PRO E 4 77  ? 22.750  93.217  17.338  1.00 31.46  ? 80  PRO C N     1 
ATOM   8030  C  CA    . PRO E 4 77  ? 24.102  93.401  16.799  1.00 31.46  ? 80  PRO C CA    1 
ATOM   8031  C  C     . PRO E 4 77  ? 24.776  94.704  17.174  1.00 31.46  ? 80  PRO C C     1 
ATOM   8032  O  O     . PRO E 4 77  ? 25.958  94.693  17.488  1.00 31.46  ? 80  PRO C O     1 
ATOM   8033  C  CB    . PRO E 4 77  ? 23.883  93.294  15.305  1.00 19.69  ? 80  PRO C CB    1 
ATOM   8034  C  CG    . PRO E 4 77  ? 22.794  92.236  15.236  1.00 19.69  ? 80  PRO C CG    1 
ATOM   8035  C  CD    . PRO E 4 77  ? 21.836  92.678  16.315  1.00 19.69  ? 80  PRO C CD    1 
ATOM   8036  N  N     . ARG E 4 78  ? 24.051  95.825  17.166  1.00 11.81  ? 81  ARG C N     1 
ATOM   8037  C  CA    . ARG E 4 78  ? 24.681  97.098  17.541  1.00 11.81  ? 81  ARG C CA    1 
ATOM   8038  C  C     . ARG E 4 78  ? 25.337  97.014  18.926  1.00 11.81  ? 81  ARG C C     1 
ATOM   8039  O  O     . ARG E 4 78  ? 26.406  97.590  19.165  1.00 11.81  ? 81  ARG C O     1 
ATOM   8040  C  CB    . ARG E 4 78  ? 23.710  98.288  17.495  1.00 12.63  ? 81  ARG C CB    1 
ATOM   8041  C  CG    . ARG E 4 78  ? 24.092  99.356  18.521  1.00 12.63  ? 81  ARG C CG    1 
ATOM   8042  C  CD    . ARG E 4 78  ? 24.413  100.773 18.021  1.00 12.63  ? 81  ARG C CD    1 
ATOM   8043  N  NE    . ARG E 4 78  ? 25.433  100.881 16.970  1.00 12.63  ? 81  ARG C NE    1 
ATOM   8044  C  CZ    . ARG E 4 78  ? 26.179  101.973 16.739  1.00 12.63  ? 81  ARG C CZ    1 
ATOM   8045  N  NH1   . ARG E 4 78  ? 26.080  103.064 17.501  1.00 12.63  ? 81  ARG C NH1   1 
ATOM   8046  N  NH2   . ARG E 4 78  ? 26.938  102.023 15.646  1.00 12.63  ? 81  ARG C NH2   1 
ATOM   8047  N  N     . HIS E 4 79  ? 24.711  96.271  19.830  1.00 25.22  ? 82  HIS C N     1 
ATOM   8048  C  CA    . HIS E 4 79  ? 25.239  96.121  21.176  1.00 25.22  ? 82  HIS C CA    1 
ATOM   8049  C  C     . HIS E 4 79  ? 26.554  95.354  21.122  1.00 25.22  ? 82  HIS C C     1 
ATOM   8050  O  O     . HIS E 4 79  ? 27.493  95.694  21.836  1.00 25.22  ? 82  HIS C O     1 
ATOM   8051  C  CB    . HIS E 4 79  ? 24.201  95.458  22.076  1.00 27.97  ? 82  HIS C CB    1 
ATOM   8052  C  CG    . HIS E 4 79  ? 22.902  96.202  22.132  1.00 27.97  ? 82  HIS C CG    1 
ATOM   8053  N  ND1   . HIS E 4 79  ? 21.732  95.632  22.573  1.00 27.97  ? 82  HIS C ND1   1 
ATOM   8054  C  CD2   . HIS E 4 79  ? 22.590  97.477  21.797  1.00 27.97  ? 82  HIS C CD2   1 
ATOM   8055  C  CE1   . HIS E 4 79  ? 20.754  96.518  22.509  1.00 27.97  ? 82  HIS C CE1   1 
ATOM   8056  N  NE2   . HIS E 4 79  ? 21.249  97.648  22.039  1.00 27.97  ? 82  HIS C NE2   1 
ATOM   8057  N  N     . LEU E 4 80  ? 26.638  94.365  20.227  1.00 11.71  ? 83  LEU C N     1 
ATOM   8058  C  CA    . LEU E 4 80  ? 27.869  93.591  20.027  1.00 11.71  ? 83  LEU C CA    1 
ATOM   8059  C  C     . LEU E 4 80  ? 28.979  94.507  19.460  1.00 11.71  ? 83  LEU C C     1 
ATOM   8060  O  O     . LEU E 4 80  ? 30.100  94.506  19.984  1.00 11.71  ? 83  LEU C O     1 
ATOM   8061  C  CB    . LEU E 4 80  ? 27.618  92.407  19.085  1.00 6.54   ? 83  LEU C CB    1 
ATOM   8062  C  CG    . LEU E 4 80  ? 26.644  91.357  19.628  1.00 6.54   ? 83  LEU C CG    1 
ATOM   8063  C  CD1   . LEU E 4 80  ? 26.223  90.333  18.555  1.00 6.54   ? 83  LEU C CD1   1 
ATOM   8064  C  CD2   . LEU E 4 80  ? 27.273  90.667  20.862  1.00 6.54   ? 83  LEU C CD2   1 
ATOM   8065  N  N     . GLN E 4 81  ? 28.665  95.299  18.419  1.00 11.71  ? 84  GLN C N     1 
ATOM   8066  C  CA    . GLN E 4 81  ? 29.652  96.220  17.827  1.00 11.71  ? 84  GLN C CA    1 
ATOM   8067  C  C     . GLN E 4 81  ? 30.199  97.147  18.883  1.00 11.71  ? 84  GLN C C     1 
ATOM   8068  O  O     . GLN E 4 81  ? 31.408  97.249  19.055  1.00 11.71  ? 84  GLN C O     1 
ATOM   8069  C  CB    . GLN E 4 81  ? 29.055  97.115  16.747  1.00 21.58  ? 84  GLN C CB    1 
ATOM   8070  C  CG    . GLN E 4 81  ? 29.554  96.848  15.345  1.00 21.58  ? 84  GLN C CG    1 
ATOM   8071  C  CD    . GLN E 4 81  ? 30.998  97.284  15.011  1.00 21.58  ? 84  GLN C CD    1 
ATOM   8072  O  OE1   . GLN E 4 81  ? 31.262  98.465  14.793  1.00 21.58  ? 84  GLN C OE1   1 
ATOM   8073  N  NE2   . GLN E 4 81  ? 31.880  96.298  14.790  1.00 21.58  ? 84  GLN C NE2   1 
ATOM   8074  N  N     . LEU E 4 82  ? 29.292  97.847  19.559  1.00 12.34  ? 85  LEU C N     1 
ATOM   8075  C  CA    . LEU E 4 82  ? 29.666  98.774  20.602  1.00 12.34  ? 85  LEU C CA    1 
ATOM   8076  C  C     . LEU E 4 82  ? 30.580  98.095  21.586  1.00 12.34  ? 85  LEU C C     1 
ATOM   8077  O  O     . LEU E 4 82  ? 31.678  98.573  21.787  1.00 12.34  ? 85  LEU C O     1 
ATOM   8078  C  CB    . LEU E 4 82  ? 28.436  99.326  21.302  1.00 21.97  ? 85  LEU C CB    1 
ATOM   8079  C  CG    . LEU E 4 82  ? 27.540  100.159 20.388  1.00 21.97  ? 85  LEU C CG    1 
ATOM   8080  C  CD1   . LEU E 4 82  ? 26.271  100.505 21.107  1.00 21.97  ? 85  LEU C CD1   1 
ATOM   8081  C  CD2   . LEU E 4 82  ? 28.261  101.410 19.928  1.00 21.97  ? 85  LEU C CD2   1 
ATOM   8082  N  N     . ALA E 4 83  ? 30.175  96.949  22.135  1.00 23.23  ? 86  ALA C N     1 
ATOM   8083  C  CA    . ALA E 4 83  ? 30.994  96.205  23.100  1.00 23.23  ? 86  ALA C CA    1 
ATOM   8084  C  C     . ALA E 4 83  ? 32.427  95.902  22.638  1.00 23.23  ? 86  ALA C C     1 
ATOM   8085  O  O     . ALA E 4 83  ? 33.388  96.107  23.388  1.00 23.23  ? 86  ALA C O     1 
ATOM   8086  C  CB    . ALA E 4 83  ? 30.300  94.922  23.475  1.00 29.12  ? 86  ALA C CB    1 
ATOM   8087  N  N     . VAL E 4 84  ? 32.547  95.370  21.424  1.00 17.48  ? 87  VAL C N     1 
ATOM   8088  C  CA    . VAL E 4 84  ? 33.822  95.040  20.814  1.00 17.48  ? 87  VAL C CA    1 
ATOM   8089  C  C     . VAL E 4 84  ? 34.649  96.296  20.537  1.00 17.48  ? 87  VAL C C     1 
ATOM   8090  O  O     . VAL E 4 84  ? 35.695  96.504  21.130  1.00 17.48  ? 87  VAL C O     1 
ATOM   8091  C  CB    . VAL E 4 84  ? 33.573  94.255  19.518  1.00 7.89   ? 87  VAL C CB    1 
ATOM   8092  C  CG1   . VAL E 4 84  ? 34.807  94.199  18.661  1.00 7.89   ? 87  VAL C CG1   1 
ATOM   8093  C  CG2   . VAL E 4 84  ? 33.079  92.854  19.858  1.00 7.89   ? 87  VAL C CG2   1 
ATOM   8094  N  N     . ARG E 4 85  ? 34.114  97.196  19.734  1.00 20.27  ? 88  ARG C N     1 
ATOM   8095  C  CA    . ARG E 4 85  ? 34.837  98.394  19.392  1.00 20.27  ? 88  ARG C CA    1 
ATOM   8096  C  C     . ARG E 4 85  ? 35.243  99.250  20.584  1.00 20.27  ? 88  ARG C C     1 
ATOM   8097  O  O     . ARG E 4 85  ? 36.218  100.003 20.496  1.00 20.27  ? 88  ARG C O     1 
ATOM   8098  C  CB    . ARG E 4 85  ? 34.067  99.213  18.343  1.00 8.63   ? 88  ARG C CB    1 
ATOM   8099  C  CG    . ARG E 4 85  ? 33.774  98.443  17.053  1.00 8.63   ? 88  ARG C CG    1 
ATOM   8100  C  CD    . ARG E 4 85  ? 34.950  97.555  16.652  1.00 8.63   ? 88  ARG C CD    1 
ATOM   8101  N  NE    . ARG E 4 85  ? 34.568  96.527  15.689  1.00 8.63   ? 88  ARG C NE    1 
ATOM   8102  C  CZ    . ARG E 4 85  ? 35.345  95.510  15.308  1.00 8.63   ? 88  ARG C CZ    1 
ATOM   8103  N  NH1   . ARG E 4 85  ? 36.566  95.371  15.808  1.00 8.63   ? 88  ARG C NH1   1 
ATOM   8104  N  NH2   . ARG E 4 85  ? 34.921  94.641  14.393  1.00 8.63   ? 88  ARG C NH2   1 
ATOM   8105  N  N     . ASN E 4 86  ? 34.520  99.155  21.693  1.00 24.83  ? 89  ASN C N     1 
ATOM   8106  C  CA    . ASN E 4 86  ? 34.873  99.949  22.880  1.00 24.83  ? 89  ASN C CA    1 
ATOM   8107  C  C     . ASN E 4 86  ? 35.901  99.313  23.801  1.00 24.83  ? 89  ASN C C     1 
ATOM   8108  O  O     . ASN E 4 86  ? 36.427  99.973  24.703  1.00 24.83  ? 89  ASN C O     1 
ATOM   8109  C  CB    . ASN E 4 86  ? 33.634  100.309 23.694  1.00 36.18  ? 89  ASN C CB    1 
ATOM   8110  C  CG    . ASN E 4 86  ? 32.871  101.470 23.102  1.00 36.18  ? 89  ASN C CG    1 
ATOM   8111  O  OD1   . ASN E 4 86  ? 33.448  102.522 22.799  1.00 36.18  ? 89  ASN C OD1   1 
ATOM   8112  N  ND2   . ASN E 4 86  ? 31.569  101.290 22.930  1.00 36.18  ? 89  ASN C ND2   1 
ATOM   8113  N  N     . ASP E 4 87  ? 36.185  98.037  23.552  1.00 30.38  ? 90  ASP C N     1 
ATOM   8114  C  CA    . ASP E 4 87  ? 37.122  97.256  24.332  1.00 30.38  ? 90  ASP C CA    1 
ATOM   8115  C  C     . ASP E 4 87  ? 38.352  97.089  23.465  1.00 30.38  ? 90  ASP C C     1 
ATOM   8116  O  O     . ASP E 4 87  ? 38.278  96.500  22.387  1.00 30.38  ? 90  ASP C O     1 
ATOM   8117  C  CB    . ASP E 4 87  ? 36.503  95.899  24.612  1.00 26.41  ? 90  ASP C CB    1 
ATOM   8118  C  CG    . ASP E 4 87  ? 37.317  95.079  25.546  1.00 26.41  ? 90  ASP C CG    1 
ATOM   8119  O  OD1   . ASP E 4 87  ? 37.460  95.521  26.706  1.00 26.41  ? 90  ASP C OD1   1 
ATOM   8120  O  OD2   . ASP E 4 87  ? 37.805  94.001  25.124  1.00 26.41  ? 90  ASP C OD2   1 
ATOM   8121  N  N     . GLU E 4 88  ? 39.494  97.572  23.954  1.00 22.86  ? 91  GLU C N     1 
ATOM   8122  C  CA    . GLU E 4 88  ? 40.748  97.510  23.207  1.00 22.86  ? 91  GLU C CA    1 
ATOM   8123  C  C     . GLU E 4 88  ? 41.107  96.129  22.735  1.00 22.86  ? 91  GLU C C     1 
ATOM   8124  O  O     . GLU E 4 88  ? 41.422  95.947  21.557  1.00 22.86  ? 91  GLU C O     1 
ATOM   8125  C  CB    . GLU E 4 88  ? 41.897  98.067  24.038  1.00 76.59  ? 91  GLU C CB    1 
ATOM   8126  C  CG    . GLU E 4 88  ? 42.273  99.484  23.669  1.00 76.59  ? 91  GLU C CG    1 
ATOM   8127  C  CD    . GLU E 4 88  ? 43.284  100.089 24.620  1.00 76.59  ? 91  GLU C CD    1 
ATOM   8128  O  OE1   . GLU E 4 88  ? 44.191  99.357  25.094  1.00 76.59  ? 91  GLU C OE1   1 
ATOM   8129  O  OE2   . GLU E 4 88  ? 43.166  101.306 24.887  1.00 76.59  ? 91  GLU C OE2   1 
ATOM   8130  N  N     . GLU E 4 89  ? 40.994  95.151  23.641  1.00 24.82  ? 92  GLU C N     1 
ATOM   8131  C  CA    . GLU E 4 89  ? 41.355  93.766  23.332  1.00 24.82  ? 92  GLU C CA    1 
ATOM   8132  C  C     . GLU E 4 89  ? 40.434  93.016  22.407  1.00 24.82  ? 92  GLU C C     1 
ATOM   8133  O  O     . GLU E 4 89  ? 40.899  92.376  21.457  1.00 24.82  ? 92  GLU C O     1 
ATOM   8134  C  CB    . GLU E 4 89  ? 41.704  92.992  24.591  1.00 34.30  ? 92  GLU C CB    1 
ATOM   8135  C  CG    . GLU E 4 89  ? 43.183  93.193  24.895  1.00 34.30  ? 92  GLU C CG    1 
ATOM   8136  C  CD    . GLU E 4 89  ? 43.593  92.837  26.302  1.00 34.30  ? 92  GLU C CD    1 
ATOM   8137  O  OE1   . GLU E 4 89  ? 42.816  92.131  26.978  1.00 34.30  ? 92  GLU C OE1   1 
ATOM   8138  O  OE2   . GLU E 4 89  ? 44.700  93.270  26.728  1.00 34.30  ? 92  GLU C OE2   1 
ATOM   8139  N  N     . LEU E 4 90  ? 39.130  93.135  22.640  1.00 16.31  ? 93  LEU C N     1 
ATOM   8140  C  CA    . LEU E 4 90  ? 38.162  92.509  21.753  1.00 16.31  ? 93  LEU C CA    1 
ATOM   8141  C  C     . LEU E 4 90  ? 38.296  93.176  20.388  1.00 16.31  ? 93  LEU C C     1 
ATOM   8142  O  O     . LEU E 4 90  ? 38.238  92.521  19.357  1.00 16.31  ? 93  LEU C O     1 
ATOM   8143  C  CB    . LEU E 4 90  ? 36.757  92.686  22.304  1.00 17.29  ? 93  LEU C CB    1 
ATOM   8144  C  CG    . LEU E 4 90  ? 36.308  91.665  23.352  1.00 17.29  ? 93  LEU C CG    1 
ATOM   8145  C  CD1   . LEU E 4 90  ? 34.948  92.038  23.858  1.00 17.29  ? 93  LEU C CD1   1 
ATOM   8146  C  CD2   . LEU E 4 90  ? 36.229  90.269  22.736  1.00 17.29  ? 93  LEU C CD2   1 
ATOM   8147  N  N     . ASN E 4 91  ? 38.521  94.486  20.390  1.00 17.48  ? 94  ASN C N     1 
ATOM   8148  C  CA    . ASN E 4 91  ? 38.687  95.216  19.144  1.00 17.48  ? 94  ASN C CA    1 
ATOM   8149  C  C     . ASN E 4 91  ? 39.882  94.703  18.360  1.00 17.48  ? 94  ASN C C     1 
ATOM   8150  O  O     . ASN E 4 91  ? 39.844  94.658  17.134  1.00 17.48  ? 94  ASN C O     1 
ATOM   8151  C  CB    . ASN E 4 91  ? 38.859  96.704  19.395  1.00 28.92  ? 94  ASN C CB    1 
ATOM   8152  C  CG    . ASN E 4 91  ? 38.837  97.498  18.116  1.00 28.92  ? 94  ASN C CG    1 
ATOM   8153  O  OD1   . ASN E 4 91  ? 37.963  97.298  17.280  1.00 28.92  ? 94  ASN C OD1   1 
ATOM   8154  N  ND2   . ASN E 4 91  ? 39.819  98.361  17.929  1.00 28.92  ? 94  ASN C ND2   1 
ATOM   8155  N  N     . LYS E 4 92  ? 40.969  94.400  19.066  1.00 19.82  ? 95  LYS C N     1 
ATOM   8156  C  CA    . LYS E 4 92  ? 42.157  93.865  18.420  1.00 19.82  ? 95  LYS C CA    1 
ATOM   8157  C  C     . LYS E 4 92  ? 41.821  92.496  17.838  1.00 19.82  ? 95  LYS C C     1 
ATOM   8158  O  O     . LYS E 4 92  ? 41.855  92.299  16.634  1.00 19.82  ? 95  LYS C O     1 
ATOM   8159  C  CB    . LYS E 4 92  ? 43.321  93.762  19.405  1.00 70.14  ? 95  LYS C CB    1 
ATOM   8160  C  CG    . LYS E 4 92  ? 44.651  93.501  18.723  1.00 70.14  ? 95  LYS C CG    1 
ATOM   8161  C  CD    . LYS E 4 92  ? 45.822  93.802  19.637  1.00 70.14  ? 95  LYS C CD    1 
ATOM   8162  C  CE    . LYS E 4 92  ? 47.149  93.605  18.904  1.00 70.14  ? 95  LYS C CE    1 
ATOM   8163  N  NZ    . LYS E 4 92  ? 48.349  93.952  19.740  1.00 70.14  ? 95  LYS C NZ    1 
ATOM   8164  N  N     . LEU E 4 93  ? 41.347  91.602  18.693  1.00 14.03  ? 96  LEU C N     1 
ATOM   8165  C  CA    . LEU E 4 93  ? 40.992  90.243  18.303  1.00 14.03  ? 96  LEU C CA    1 
ATOM   8166  C  C     . LEU E 4 93  ? 40.069  90.139  17.122  1.00 14.03  ? 96  LEU C C     1 
ATOM   8167  O  O     . LEU E 4 93  ? 40.101  89.127  16.436  1.00 14.03  ? 96  LEU C O     1 
ATOM   8168  C  CB    . LEU E 4 93  ? 40.355  89.515  19.493  1.00 15.02  ? 96  LEU C CB    1 
ATOM   8169  C  CG    . LEU E 4 93  ? 39.842  88.078  19.367  1.00 15.02  ? 96  LEU C CG    1 
ATOM   8170  C  CD1   . LEU E 4 93  ? 40.912  87.157  18.788  1.00 15.02  ? 96  LEU C CD1   1 
ATOM   8171  C  CD2   . LEU E 4 93  ? 39.444  87.586  20.750  1.00 15.02  ? 96  LEU C CD2   1 
ATOM   8172  N  N     . LEU E 4 94  ? 39.168  91.118  16.971  1.00 24.89  ? 97  LEU C N     1 
ATOM   8173  C  CA    . LEU E 4 94  ? 38.178  91.136  15.889  1.00 24.89  ? 97  LEU C CA    1 
ATOM   8174  C  C     . LEU E 4 94  ? 38.385  92.335  14.985  1.00 24.89  ? 97  LEU C C     1 
ATOM   8175  O  O     . LEU E 4 94  ? 37.433  92.904  14.425  1.00 24.89  ? 97  LEU C O     1 
ATOM   8176  C  CB    . LEU E 4 94  ? 36.769  91.149  16.487  1.00 16.23  ? 97  LEU C CB    1 
ATOM   8177  C  CG    . LEU E 4 94  ? 36.468  89.981  17.441  1.00 16.23  ? 97  LEU C CG    1 
ATOM   8178  C  CD1   . LEU E 4 94  ? 35.139  90.169  18.118  1.00 16.23  ? 97  LEU C CD1   1 
ATOM   8179  C  CD2   . LEU E 4 94  ? 36.494  88.641  16.713  1.00 16.23  ? 97  LEU C CD2   1 
ATOM   8180  N  N     . GLY E 4 95  ? 39.653  92.696  14.836  1.00 17.33  ? 98  GLY C N     1 
ATOM   8181  C  CA    . GLY E 4 95  ? 40.020  93.834  14.019  1.00 17.33  ? 98  GLY C CA    1 
ATOM   8182  C  C     . GLY E 4 95  ? 39.928  93.676  12.513  1.00 17.33  ? 98  GLY C C     1 
ATOM   8183  O  O     . GLY E 4 95  ? 40.153  94.646  11.785  1.00 17.33  ? 98  GLY C O     1 
ATOM   8184  N  N     . ARG E 4 96  ? 39.675  92.455  12.044  1.00 25.00  ? 99  ARG C N     1 
ATOM   8185  C  CA    . ARG E 4 96  ? 39.540  92.173  10.617  1.00 25.00  ? 99  ARG C CA    1 
ATOM   8186  C  C     . ARG E 4 96  ? 38.182  91.492  10.435  1.00 25.00  ? 99  ARG C C     1 
ATOM   8187  O  O     . ARG E 4 96  ? 37.936  90.770  9.461   1.00 25.00  ? 99  ARG C O     1 
ATOM   8188  C  CB    . ARG E 4 96  ? 40.682  91.270  10.149  1.00 72.76  ? 99  ARG C CB    1 
ATOM   8189  C  CG    . ARG E 4 96  ? 42.018  91.974  10.015  1.00 72.76  ? 99  ARG C CG    1 
ATOM   8190  C  CD    . ARG E 4 96  ? 42.156  92.636  8.652   1.00 72.76  ? 99  ARG C CD    1 
ATOM   8191  N  NE    . ARG E 4 96  ? 43.375  93.444  8.532   1.00 72.76  ? 99  ARG C NE    1 
ATOM   8192  C  CZ    . ARG E 4 96  ? 44.470  93.099  7.847   1.00 72.76  ? 99  ARG C CZ    1 
ATOM   8193  N  NH1   . ARG E 4 96  ? 44.528  91.938  7.198   1.00 72.76  ? 99  ARG C NH1   1 
ATOM   8194  N  NH2   . ARG E 4 96  ? 45.514  93.928  7.803   1.00 72.76  ? 99  ARG C NH2   1 
ATOM   8195  N  N     . VAL E 4 97  ? 37.303  91.735  11.401  1.00 16.39  ? 100 VAL C N     1 
ATOM   8196  C  CA    . VAL E 4 97  ? 35.970  91.158  11.394  1.00 16.39  ? 100 VAL C CA    1 
ATOM   8197  C  C     . VAL E 4 97  ? 34.887  92.209  11.310  1.00 16.39  ? 100 VAL C C     1 
ATOM   8198  O  O     . VAL E 4 97  ? 34.971  93.262  11.952  1.00 16.39  ? 100 VAL C O     1 
ATOM   8199  C  CB    . VAL E 4 97  ? 35.714  90.317  12.651  1.00 9.64   ? 100 VAL C CB    1 
ATOM   8200  C  CG1   . VAL E 4 97  ? 34.258  89.989  12.776  1.00 9.64   ? 100 VAL C CG1   1 
ATOM   8201  C  CG2   . VAL E 4 97  ? 36.497  89.032  12.572  1.00 9.64   ? 100 VAL C CG2   1 
ATOM   8202  N  N     . THR E 4 98  ? 33.912  91.964  10.445  1.00 10.48  ? 101 THR C N     1 
ATOM   8203  C  CA    . THR E 4 98  ? 32.807  92.887  10.342  1.00 10.48  ? 101 THR C CA    1 
ATOM   8204  C  C     . THR E 4 98  ? 31.513  92.195  10.797  1.00 10.48  ? 101 THR C C     1 
ATOM   8205  O  O     . THR E 4 98  ? 31.190  91.120  10.344  1.00 10.48  ? 101 THR C O     1 
ATOM   8206  C  CB    . THR E 4 98  ? 32.726  93.633  8.936   1.00 24.76  ? 101 THR C CB    1 
ATOM   8207  O  OG1   . THR E 4 98  ? 31.475  93.357  8.297   1.00 24.76  ? 101 THR C OG1   1 
ATOM   8208  C  CG2   . THR E 4 98  ? 33.882  93.258  8.013   1.00 24.76  ? 101 THR C CG2   1 
ATOM   8209  N  N     . ILE E 4 99  ? 30.952  92.731  11.877  1.00 8.73   ? 102 ILE C N     1 
ATOM   8210  C  CA    . ILE E 4 99  ? 29.707  92.298  12.509  1.00 8.73   ? 102 ILE C CA    1 
ATOM   8211  C  C     . ILE E 4 99  ? 28.590  92.983  11.715  1.00 8.73   ? 102 ILE C C     1 
ATOM   8212  O  O     . ILE E 4 99  ? 28.420  94.212  11.793  1.00 8.73   ? 102 ILE C O     1 
ATOM   8213  C  CB    . ILE E 4 99  ? 29.622  92.858  13.958  1.00 5.00   ? 102 ILE C CB    1 
ATOM   8214  C  CG1   . ILE E 4 99  ? 30.689  92.232  14.856  1.00 5.00   ? 102 ILE C CG1   1 
ATOM   8215  C  CG2   . ILE E 4 99  ? 28.230  92.721  14.519  1.00 5.00   ? 102 ILE C CG2   1 
ATOM   8216  C  CD1   . ILE E 4 99  ? 30.674  92.776  16.287  1.00 5.00   ? 102 ILE C CD1   1 
ATOM   8217  N  N     . ALA E 4 100 ? 27.856  92.208  10.924  1.00 17.87  ? 103 ALA C N     1 
ATOM   8218  C  CA    . ALA E 4 100 ? 26.773  92.756  10.132  1.00 17.87  ? 103 ALA C CA    1 
ATOM   8219  C  C     . ALA E 4 100 ? 25.775  93.502  11.052  1.00 17.87  ? 103 ALA C C     1 
ATOM   8220  O  O     . ALA E 4 100 ? 25.642  93.151  12.228  1.00 17.87  ? 103 ALA C O     1 
ATOM   8221  C  CB    . ALA E 4 100 ? 26.099  91.640  9.364   1.00 5.00   ? 103 ALA C CB    1 
ATOM   8222  N  N     . GLN E 4 101 ? 25.157  94.567  10.517  1.00 20.70  ? 104 GLN C N     1 
ATOM   8223  C  CA    . GLN E 4 101 ? 24.193  95.448  11.191  1.00 20.70  ? 104 GLN C CA    1 
ATOM   8224  C  C     . GLN E 4 101 ? 24.686  96.076  12.491  1.00 20.70  ? 104 GLN C C     1 
ATOM   8225  O  O     . GLN E 4 101 ? 23.886  96.406  13.390  1.00 20.70  ? 104 GLN C O     1 
ATOM   8226  C  CB    . GLN E 4 101 ? 22.836  94.766  11.398  1.00 26.73  ? 104 GLN C CB    1 
ATOM   8227  C  CG    . GLN E 4 101 ? 21.873  94.811  10.182  1.00 26.73  ? 104 GLN C CG    1 
ATOM   8228  C  CD    . GLN E 4 101 ? 21.459  96.247  9.720   1.00 26.73  ? 104 GLN C CD    1 
ATOM   8229  O  OE1   . GLN E 4 101 ? 20.778  97.006  10.452  1.00 26.73  ? 104 GLN C OE1   1 
ATOM   8230  N  NE2   . GLN E 4 101 ? 21.835  96.593  8.480   1.00 26.73  ? 104 GLN C NE2   1 
ATOM   8231  N  N     . GLY E 4 102 ? 26.000  96.268  12.594  1.00 13.32  ? 105 GLY C N     1 
ATOM   8232  C  CA    . GLY E 4 102 ? 26.545  96.866  13.804  1.00 13.32  ? 105 GLY C CA    1 
ATOM   8233  C  C     . GLY E 4 102 ? 26.840  98.363  13.734  1.00 13.32  ? 105 GLY C C     1 
ATOM   8234  O  O     . GLY E 4 102 ? 26.944  99.029  14.780  1.00 13.32  ? 105 GLY C O     1 
ATOM   8235  N  N     . GLY E 4 103 ? 26.961  98.895  12.509  1.00 17.90  ? 106 GLY C N     1 
ATOM   8236  C  CA    . GLY E 4 103 ? 27.253  100.303 12.332  1.00 17.90  ? 106 GLY C CA    1 
ATOM   8237  C  C     . GLY E 4 103 ? 28.652  100.646 12.807  1.00 17.90  ? 106 GLY C C     1 
ATOM   8238  O  O     . GLY E 4 103 ? 29.540  99.780  12.904  1.00 17.90  ? 106 GLY C O     1 
ATOM   8239  N  N     . VAL E 4 104 ? 28.851  101.910 13.160  1.00 19.93  ? 107 VAL C N     1 
ATOM   8240  C  CA    . VAL E 4 104 ? 30.166  102.373 13.587  1.00 19.93  ? 107 VAL C CA    1 
ATOM   8241  C  C     . VAL E 4 104 ? 30.037  103.142 14.878  1.00 19.93  ? 107 VAL C C     1 
ATOM   8242  O  O     . VAL E 4 104 ? 28.933  103.503 15.263  1.00 19.93  ? 107 VAL C O     1 
ATOM   8243  C  CB    . VAL E 4 104 ? 30.799  103.308 12.510  1.00 5.00   ? 107 VAL C CB    1 
ATOM   8244  C  CG1   . VAL E 4 104 ? 30.940  102.574 11.175  1.00 5.00   ? 107 VAL C CG1   1 
ATOM   8245  C  CG2   . VAL E 4 104 ? 29.977  104.614 12.344  1.00 5.00   ? 107 VAL C CG2   1 
ATOM   8246  N  N     . LEU E 4 105 ? 31.158  103.357 15.565  1.00 31.65  ? 108 LEU C N     1 
ATOM   8247  C  CA    . LEU E 4 105 ? 31.146  104.127 16.811  1.00 31.65  ? 108 LEU C CA    1 
ATOM   8248  C  C     . LEU E 4 105 ? 31.038  105.591 16.440  1.00 31.65  ? 108 LEU C C     1 
ATOM   8249  O  O     . LEU E 4 105 ? 31.678  106.038 15.482  1.00 31.65  ? 108 LEU C O     1 
ATOM   8250  C  CB    . LEU E 4 105 ? 32.438  103.937 17.599  1.00 10.35  ? 108 LEU C CB    1 
ATOM   8251  C  CG    . LEU E 4 105 ? 32.712  102.607 18.290  1.00 10.35  ? 108 LEU C CG    1 
ATOM   8252  C  CD1   . LEU E 4 105 ? 33.811  102.846 19.272  1.00 10.35  ? 108 LEU C CD1   1 
ATOM   8253  C  CD2   . LEU E 4 105 ? 31.475  102.100 19.014  1.00 10.35  ? 108 LEU C CD2   1 
ATOM   8254  N  N     . PRO E 4 106 ? 30.164  106.342 17.129  1.00 24.79  ? 109 PRO C N     1 
ATOM   8255  C  CA    . PRO E 4 106 ? 30.061  107.759 16.773  1.00 24.79  ? 109 PRO C CA    1 
ATOM   8256  C  C     . PRO E 4 106 ? 31.335  108.474 17.148  1.00 24.79  ? 109 PRO C C     1 
ATOM   8257  O  O     . PRO E 4 106 ? 31.754  108.425 18.304  1.00 24.79  ? 109 PRO C O     1 
ATOM   8258  C  CB    . PRO E 4 106 ? 28.848  108.245 17.574  1.00 20.28  ? 109 PRO C CB    1 
ATOM   8259  C  CG    . PRO E 4 106 ? 28.656  107.216 18.642  1.00 20.28  ? 109 PRO C CG    1 
ATOM   8260  C  CD    . PRO E 4 106 ? 29.041  105.928 17.986  1.00 20.28  ? 109 PRO C CD    1 
ATOM   8261  N  N     . ASN E 4 107 ? 31.983  109.070 16.145  1.00 20.40  ? 110 ASN C N     1 
ATOM   8262  C  CA    . ASN E 4 107 ? 33.238  109.784 16.350  1.00 20.40  ? 110 ASN C CA    1 
ATOM   8263  C  C     . ASN E 4 107 ? 33.520  110.800 15.262  1.00 20.40  ? 110 ASN C C     1 
ATOM   8264  O  O     . ASN E 4 107 ? 33.844  110.426 14.125  1.00 20.40  ? 110 ASN C O     1 
ATOM   8265  C  CB    . ASN E 4 107 ? 34.403  108.777 16.418  1.00 57.71  ? 110 ASN C CB    1 
ATOM   8266  C  CG    . ASN E 4 107 ? 35.756  109.435 16.671  1.00 57.71  ? 110 ASN C CG    1 
ATOM   8267  O  OD1   . ASN E 4 107 ? 35.852  110.480 17.322  1.00 57.71  ? 110 ASN C OD1   1 
ATOM   8268  N  ND2   . ASN E 4 107 ? 36.813  108.805 16.175  1.00 57.71  ? 110 ASN C ND2   1 
ATOM   8269  N  N     . ILE E 4 108 ? 33.434  112.078 15.632  1.00 28.97  ? 111 ILE C N     1 
ATOM   8270  C  CA    . ILE E 4 108 ? 33.713  113.187 14.717  1.00 28.97  ? 111 ILE C CA    1 
ATOM   8271  C  C     . ILE E 4 108 ? 35.065  113.837 15.022  1.00 28.97  ? 111 ILE C C     1 
ATOM   8272  O  O     . ILE E 4 108 ? 35.289  114.295 16.144  1.00 28.97  ? 111 ILE C O     1 
ATOM   8273  C  CB    . ILE E 4 108 ? 32.682  114.309 14.843  1.00 24.04  ? 111 ILE C CB    1 
ATOM   8274  C  CG1   . ILE E 4 108 ? 31.320  113.850 14.351  1.00 24.04  ? 111 ILE C CG1   1 
ATOM   8275  C  CG2   . ILE E 4 108 ? 33.126  115.510 14.037  1.00 24.04  ? 111 ILE C CG2   1 
ATOM   8276  C  CD1   . ILE E 4 108 ? 30.246  114.908 14.492  1.00 24.04  ? 111 ILE C CD1   1 
ATOM   8277  N  N     . GLN E 4 109 ? 35.917  113.959 14.000  1.00 18.78  ? 112 GLN C N     1 
ATOM   8278  C  CA    . GLN E 4 109 ? 37.238  114.568 14.140  1.00 18.78  ? 112 GLN C CA    1 
ATOM   8279  C  C     . GLN E 4 109 ? 37.048  115.984 14.622  1.00 18.78  ? 112 GLN C C     1 
ATOM   8280  O  O     . GLN E 4 109 ? 36.198  116.698 14.099  1.00 18.78  ? 112 GLN C O     1 
ATOM   8281  C  CB    . GLN E 4 109 ? 37.954  114.554 12.805  1.00 27.63  ? 112 GLN C CB    1 
ATOM   8282  C  CG    . GLN E 4 109 ? 38.144  113.158 12.270  1.00 27.63  ? 112 GLN C CG    1 
ATOM   8283  C  CD    . GLN E 4 109 ? 38.991  112.316 13.190  1.00 27.63  ? 112 GLN C CD    1 
ATOM   8284  O  OE1   . GLN E 4 109 ? 40.142  112.651 13.451  1.00 27.63  ? 112 GLN C OE1   1 
ATOM   8285  N  NE2   . GLN E 4 109 ? 38.425  111.233 13.707  1.00 27.63  ? 112 GLN C NE2   1 
ATOM   8286  N  N     . SER E 4 110 ? 37.833  116.363 15.630  1.00 41.64  ? 113 SER C N     1 
ATOM   8287  C  CA    . SER E 4 110 ? 37.784  117.683 16.267  1.00 41.64  ? 113 SER C CA    1 
ATOM   8288  C  C     . SER E 4 110 ? 37.725  118.890 15.335  1.00 41.64  ? 113 SER C C     1 
ATOM   8289  O  O     . SER E 4 110 ? 36.907  119.782 15.505  1.00 34.99  ? 113 SER C O     1 
ATOM   8290  C  CB    . SER E 4 110 ? 38.993  117.850 17.177  1.00 65.70  ? 113 SER C CB    1 
ATOM   8291  O  OG    . SER E 4 110 ? 39.349  116.610 17.747  1.00 65.70  ? 113 SER C OG    1 
ATOM   8292  N  N     . VAL E 4 111 ? 38.575  118.899 14.325  1.00 30.24  ? 114 VAL C N     1 
ATOM   8293  C  CA    . VAL E 4 111 ? 38.637  120.010 13.396  1.00 30.24  ? 114 VAL C CA    1 
ATOM   8294  C  C     . VAL E 4 111 ? 37.422  120.158 12.501  1.00 30.24  ? 114 VAL C C     1 
ATOM   8295  O  O     . VAL E 4 111 ? 37.408  121.016 11.614  1.00 30.24  ? 114 VAL C O     1 
ATOM   8296  C  CB    . VAL E 4 111 ? 39.876  119.901 12.513  1.00 37.79  ? 114 VAL C CB    1 
ATOM   8297  C  CG1   . VAL E 4 111 ? 41.140  119.889 13.384  1.00 37.79  ? 114 VAL C CG1   1 
ATOM   8298  C  CG2   . VAL E 4 111 ? 39.797  118.651 11.675  1.00 37.79  ? 114 VAL C CG2   1 
ATOM   8299  N  N     . LEU E 4 112 ? 36.420  119.305 12.700  1.00 26.44  ? 115 LEU C N     1 
ATOM   8300  C  CA    . LEU E 4 112 ? 35.198  119.358 11.896  1.00 26.44  ? 115 LEU C CA    1 
ATOM   8301  C  C     . LEU E 4 112 ? 34.086  120.089 12.638  1.00 26.44  ? 115 LEU C C     1 
ATOM   8302  O  O     . LEU E 4 112 ? 33.114  120.517 12.028  1.00 26.44  ? 115 LEU C O     1 
ATOM   8303  C  CB    . LEU E 4 112 ? 34.744  117.941 11.505  1.00 19.01  ? 115 LEU C CB    1 
ATOM   8304  C  CG    . LEU E 4 112 ? 35.695  117.108 10.629  1.00 19.01  ? 115 LEU C CG    1 
ATOM   8305  C  CD1   . LEU E 4 112 ? 35.099  115.757 10.323  1.00 19.01  ? 115 LEU C CD1   1 
ATOM   8306  C  CD2   . LEU E 4 112 ? 35.999  117.850 9.354   1.00 19.01  ? 115 LEU C CD2   1 
ATOM   8307  N  N     . LEU E 4 113 ? 34.254  120.240 13.950  1.00 24.39  ? 116 LEU C N     1 
ATOM   8308  C  CA    . LEU E 4 113 ? 33.288  120.935 14.781  1.00 24.39  ? 116 LEU C CA    1 
ATOM   8309  C  C     . LEU E 4 113 ? 33.389  122.438 14.486  1.00 24.39  ? 116 LEU C C     1 
ATOM   8310  O  O     . LEU E 4 113 ? 34.418  122.918 14.008  1.00 24.39  ? 116 LEU C O     1 
ATOM   8311  C  CB    . LEU E 4 113 ? 33.576  120.676 16.257  1.00 19.78  ? 116 LEU C CB    1 
ATOM   8312  C  CG    . LEU E 4 113 ? 33.634  119.222 16.732  1.00 19.78  ? 116 LEU C CG    1 
ATOM   8313  C  CD1   . LEU E 4 113 ? 34.027  119.221 18.204  1.00 19.78  ? 116 LEU C CD1   1 
ATOM   8314  C  CD2   . LEU E 4 113 ? 32.319  118.495 16.518  1.00 19.78  ? 116 LEU C CD2   1 
ATOM   8315  N  N     . PRO E 4 114 ? 32.317  123.200 14.778  1.00 72.63  ? 117 PRO C N     1 
ATOM   8316  C  CA    . PRO E 4 114 ? 32.241  124.651 14.555  1.00 72.63  ? 117 PRO C CA    1 
ATOM   8317  C  C     . PRO E 4 114 ? 33.195  125.511 15.397  1.00 72.63  ? 117 PRO C C     1 
ATOM   8318  O  O     . PRO E 4 114 ? 33.977  124.988 16.196  1.00 72.63  ? 117 PRO C O     1 
ATOM   8319  C  CB    . PRO E 4 114 ? 30.778  124.969 14.893  1.00 55.90  ? 117 PRO C CB    1 
ATOM   8320  C  CG    . PRO E 4 114 ? 30.062  123.671 14.686  1.00 55.90  ? 117 PRO C CG    1 
ATOM   8321  C  CD    . PRO E 4 114 ? 31.027  122.690 15.277  1.00 55.90  ? 117 PRO C CD    1 
ATOM   8322  N  N     . LYS E 4 115 ? 33.077  126.833 15.223  1.00 120.09 ? 118 LYS C N     1 
ATOM   8323  C  CA    . LYS E 4 115 ? 33.885  127.843 15.915  1.00 120.09 ? 118 LYS C CA    1 
ATOM   8324  C  C     . LYS E 4 115 ? 33.918  127.734 17.444  1.00 120.09 ? 118 LYS C C     1 
ATOM   8325  O  O     . LYS E 4 115 ? 35.044  127.711 18.001  1.00 56.68  ? 118 LYS C O     1 
ATOM   8326  C  CB    . LYS E 4 115 ? 33.413  129.252 15.531  1.00 92.79  ? 118 LYS C CB    1 
ATOM   8327  C  CG    . LYS E 4 115 ? 34.122  130.332 16.322  1.00 92.79  ? 118 LYS C CG    1 
ATOM   8328  C  CD    . LYS E 4 115 ? 33.680  131.733 15.989  1.00 92.79  ? 118 LYS C CD    1 
ATOM   8329  C  CE    . LYS E 4 115 ? 34.625  132.714 16.681  1.00 92.79  ? 118 LYS C CE    1 
ATOM   8330  N  NZ    . LYS E 4 115 ? 34.372  134.147 16.366  1.00 92.79  ? 118 LYS C NZ    1 
ATOM   8331  N  N     . LYS F 5 1   ? 5.819   58.872  -0.632  1.00 107.71 ? 24  LYS D N     1 
ATOM   8332  C  CA    . LYS F 5 1   ? 6.907   59.854  -0.352  1.00 107.71 ? 24  LYS D CA    1 
ATOM   8333  C  C     . LYS F 5 1   ? 7.776   59.411  0.821   1.00 107.71 ? 24  LYS D C     1 
ATOM   8334  O  O     . LYS F 5 1   ? 7.797   58.230  1.168   1.00 107.71 ? 24  LYS D O     1 
ATOM   8335  C  CB    . LYS F 5 1   ? 6.309   61.230  -0.077  1.00 69.93  ? 24  LYS D CB    1 
ATOM   8336  C  CG    . LYS F 5 1   ? 5.572   61.807  -1.262  1.00 69.93  ? 24  LYS D CG    1 
ATOM   8337  C  CD    . LYS F 5 1   ? 5.160   63.230  -0.981  1.00 69.93  ? 24  LYS D CD    1 
ATOM   8338  C  CE    . LYS F 5 1   ? 5.233   64.043  -2.253  1.00 69.93  ? 24  LYS D CE    1 
ATOM   8339  N  NZ    . LYS F 5 1   ? 5.212   65.493  -1.951  1.00 69.93  ? 24  LYS D NZ    1 
ATOM   8340  N  N     . LYS F 5 2   ? 8.490   60.351  1.438   1.00 109.97 ? 25  LYS D N     1 
ATOM   8341  C  CA    . LYS F 5 2   ? 9.371   60.013  2.558   1.00 109.97 ? 25  LYS D CA    1 
ATOM   8342  C  C     . LYS F 5 2   ? 9.397   61.080  3.674   1.00 109.97 ? 25  LYS D C     1 
ATOM   8343  O  O     . LYS F 5 2   ? 8.715   62.107  3.589   1.00 109.97 ? 25  LYS D O     1 
ATOM   8344  C  CB    . LYS F 5 2   ? 10.806  59.793  2.040   1.00 121.69 ? 25  LYS D CB    1 
ATOM   8345  C  CG    . LYS F 5 2   ? 10.956  58.924  0.777   1.00 121.69 ? 25  LYS D CG    1 
ATOM   8346  C  CD    . LYS F 5 2   ? 12.420  58.822  0.350   1.00 121.69 ? 25  LYS D CD    1 
ATOM   8347  C  CE    . LYS F 5 2   ? 12.595  58.021  -0.930  1.00 121.69 ? 25  LYS D CE    1 
ATOM   8348  N  NZ    . LYS F 5 2   ? 14.040  57.874  -1.275  1.00 121.69 ? 25  LYS D NZ    1 
ATOM   8349  N  N     . ARG F 5 3   ? 10.188  60.811  4.716   1.00 150.56 ? 26  ARG D N     1 
ATOM   8350  C  CA    . ARG F 5 3   ? 10.368  61.713  5.863   1.00 150.56 ? 26  ARG D CA    1 
ATOM   8351  C  C     . ARG F 5 3   ? 11.776  62.319  5.742   1.00 150.56 ? 26  ARG D C     1 
ATOM   8352  O  O     . ARG F 5 3   ? 12.758  61.760  6.243   1.00 150.56 ? 26  ARG D O     1 
ATOM   8353  C  CB    . ARG F 5 3   ? 10.249  60.922  7.172   1.00 133.59 ? 26  ARG D CB    1 
ATOM   8354  C  CG    . ARG F 5 3   ? 10.328  61.749  8.457   1.00 133.59 ? 26  ARG D CG    1 
ATOM   8355  C  CD    . ARG F 5 3   ? 11.064  60.981  9.557   1.00 133.59 ? 26  ARG D CD    1 
ATOM   8356  N  NE    . ARG F 5 3   ? 10.726  59.558  9.544   1.00 133.59 ? 26  ARG D NE    1 
ATOM   8357  C  CZ    . ARG F 5 3   ? 11.589  58.576  9.281   1.00 133.59 ? 26  ARG D CZ    1 
ATOM   8358  N  NH1   . ARG F 5 3   ? 12.861  58.848  9.014   1.00 133.59 ? 26  ARG D NH1   1 
ATOM   8359  N  NH2   . ARG F 5 3   ? 11.166  57.320  9.233   1.00 133.59 ? 26  ARG D NH2   1 
ATOM   8360  N  N     . ARG F 5 4   ? 11.863  63.472  5.088   1.00 148.32 ? 27  ARG D N     1 
ATOM   8361  C  CA    . ARG F 5 4   ? 13.145  64.124  4.859   1.00 148.32 ? 27  ARG D CA    1 
ATOM   8362  C  C     . ARG F 5 4   ? 13.502  65.273  5.818   1.00 148.32 ? 27  ARG D C     1 
ATOM   8363  O  O     . ARG F 5 4   ? 13.055  66.411  5.642   1.00 148.32 ? 27  ARG D O     1 
ATOM   8364  C  CB    . ARG F 5 4   ? 13.220  64.563  3.388   1.00 75.01  ? 27  ARG D CB    1 
ATOM   8365  C  CG    . ARG F 5 4   ? 13.053  63.391  2.380   1.00 75.01  ? 27  ARG D CG    1 
ATOM   8366  C  CD    . ARG F 5 4   ? 13.156  63.843  0.904   1.00 75.01  ? 27  ARG D CD    1 
ATOM   8367  N  NE    . ARG F 5 4   ? 13.082  62.737  -0.062  1.00 75.01  ? 27  ARG D NE    1 
ATOM   8368  C  CZ    . ARG F 5 4   ? 13.436  62.815  -1.349  1.00 75.01  ? 27  ARG D CZ    1 
ATOM   8369  N  NH1   . ARG F 5 4   ? 13.903  63.943  -1.871  1.00 75.01  ? 27  ARG D NH1   1 
ATOM   8370  N  NH2   . ARG F 5 4   ? 13.277  61.765  -2.142  1.00 75.01  ? 27  ARG D NH2   1 
ATOM   8371  N  N     . LYS F 5 5   ? 14.316  64.952  6.827   1.00 125.26 ? 28  LYS D N     1 
ATOM   8372  C  CA    . LYS F 5 5   ? 14.772  65.922  7.830   1.00 125.26 ? 28  LYS D CA    1 
ATOM   8373  C  C     . LYS F 5 5   ? 15.876  66.819  7.259   1.00 125.26 ? 28  LYS D C     1 
ATOM   8374  O  O     . LYS F 5 5   ? 15.934  67.031  6.046   1.00 125.26 ? 28  LYS D O     1 
ATOM   8375  C  CB    . LYS F 5 5   ? 15.309  65.198  9.069   1.00 118.41 ? 28  LYS D CB    1 
ATOM   8376  C  CG    . LYS F 5 5   ? 14.266  64.609  10.008  1.00 118.41 ? 28  LYS D CG    1 
ATOM   8377  C  CD    . LYS F 5 5   ? 14.953  64.097  11.279  1.00 118.41 ? 28  LYS D CD    1 
ATOM   8378  C  CE    . LYS F 5 5   ? 13.966  63.640  12.344  1.00 118.41 ? 28  LYS D CE    1 
ATOM   8379  N  NZ    . LYS F 5 5   ? 14.668  63.324  13.621  1.00 118.41 ? 28  LYS D NZ    1 
ATOM   8380  N  N     . THR F 5 6   ? 16.754  67.331  8.128   1.00 116.78 ? 29  THR D N     1 
ATOM   8381  C  CA    . THR F 5 6   ? 17.858  68.203  7.694   1.00 116.78 ? 29  THR D CA    1 
ATOM   8382  C  C     . THR F 5 6   ? 19.102  68.275  8.634   1.00 116.78 ? 29  THR D C     1 
ATOM   8383  O  O     . THR F 5 6   ? 20.208  67.883  8.241   1.00 116.78 ? 29  THR D O     1 
ATOM   8384  C  CB    . THR F 5 6   ? 17.334  69.636  7.374   1.00 97.47  ? 29  THR D CB    1 
ATOM   8385  O  OG1   . THR F 5 6   ? 15.918  69.710  7.615   1.00 97.47  ? 29  THR D OG1   1 
ATOM   8386  C  CG2   . THR F 5 6   ? 17.608  69.992  5.910   1.00 97.47  ? 29  THR D CG2   1 
ATOM   8387  N  N     . ARG F 5 7   ? 18.893  68.786  9.853   1.00 108.78 ? 30  ARG D N     1 
ATOM   8388  C  CA    . ARG F 5 7   ? 19.904  68.959  10.929  1.00 108.78 ? 30  ARG D CA    1 
ATOM   8389  C  C     . ARG F 5 7   ? 21.193  69.763  10.717  1.00 108.78 ? 30  ARG D C     1 
ATOM   8390  O  O     . ARG F 5 7   ? 22.101  69.337  9.999   1.00 108.78 ? 30  ARG D O     1 
ATOM   8391  C  CB    . ARG F 5 7   ? 20.248  67.639  11.640  1.00 83.99  ? 30  ARG D CB    1 
ATOM   8392  C  CG    . ARG F 5 7   ? 21.104  67.873  12.888  1.00 83.99  ? 30  ARG D CG    1 
ATOM   8393  C  CD    . ARG F 5 7   ? 21.110  66.722  13.870  1.00 83.99  ? 30  ARG D CD    1 
ATOM   8394  N  NE    . ARG F 5 7   ? 21.546  67.190  15.188  1.00 83.99  ? 30  ARG D NE    1 
ATOM   8395  C  CZ    . ARG F 5 7   ? 22.201  66.453  16.085  1.00 83.99  ? 30  ARG D CZ    1 
ATOM   8396  N  NH1   . ARG F 5 7   ? 22.514  65.194  15.822  1.00 83.99  ? 30  ARG D NH1   1 
ATOM   8397  N  NH2   . ARG F 5 7   ? 22.559  66.977  17.250  1.00 83.99  ? 30  ARG D NH2   1 
ATOM   8398  N  N     . LYS F 5 8   ? 21.289  70.865  11.470  1.00 56.71  ? 31  LYS D N     1 
ATOM   8399  C  CA    . LYS F 5 8   ? 22.423  71.800  11.452  1.00 56.71  ? 31  LYS D CA    1 
ATOM   8400  C  C     . LYS F 5 8   ? 22.735  72.304  12.879  1.00 56.71  ? 31  LYS D C     1 
ATOM   8401  O  O     . LYS F 5 8   ? 22.031  73.164  13.419  1.00 56.71  ? 31  LYS D O     1 
ATOM   8402  C  CB    . LYS F 5 8   ? 22.118  73.015  10.551  1.00 108.63 ? 31  LYS D CB    1 
ATOM   8403  C  CG    . LYS F 5 8   ? 21.608  72.691  9.139   1.00 108.63 ? 31  LYS D CG    1 
ATOM   8404  C  CD    . LYS F 5 8   ? 20.213  73.275  8.922   1.00 108.63 ? 31  LYS D CD    1 
ATOM   8405  C  CE    . LYS F 5 8   ? 19.354  72.379  8.047   1.00 108.63 ? 31  LYS D CE    1 
ATOM   8406  N  NZ    . LYS F 5 8   ? 17.919  72.583  8.384   1.00 108.63 ? 31  LYS D NZ    1 
ATOM   8407  N  N     . GLU F 5 9   ? 23.804  71.778  13.472  1.00 33.93  ? 32  GLU D N     1 
ATOM   8408  C  CA    . GLU F 5 9   ? 24.233  72.146  14.825  1.00 33.93  ? 32  GLU D CA    1 
ATOM   8409  C  C     . GLU F 5 9   ? 24.597  73.634  14.993  1.00 33.93  ? 32  GLU D C     1 
ATOM   8410  O  O     . GLU F 5 9   ? 24.992  74.301  14.035  1.00 33.93  ? 32  GLU D O     1 
ATOM   8411  C  CB    . GLU F 5 9   ? 25.426  71.296  15.192  1.00 90.36  ? 32  GLU D CB    1 
ATOM   8412  C  CG    . GLU F 5 9   ? 26.514  71.419  14.152  1.00 90.36  ? 32  GLU D CG    1 
ATOM   8413  C  CD    . GLU F 5 9   ? 27.561  70.366  14.292  1.00 90.36  ? 32  GLU D CD    1 
ATOM   8414  O  OE1   . GLU F 5 9   ? 27.729  69.878  15.422  1.00 90.36  ? 32  GLU D OE1   1 
ATOM   8415  O  OE2   . GLU F 5 9   ? 28.208  70.026  13.276  1.00 90.36  ? 32  GLU D OE2   1 
ATOM   8416  N  N     . SER F 5 10  ? 24.530  74.118  16.232  1.00 25.89  ? 33  SER D N     1 
ATOM   8417  C  CA    . SER F 5 10  ? 24.809  75.519  16.568  1.00 25.89  ? 33  SER D CA    1 
ATOM   8418  C  C     . SER F 5 10  ? 25.396  75.545  17.972  1.00 25.89  ? 33  SER D C     1 
ATOM   8419  O  O     . SER F 5 10  ? 25.616  74.496  18.541  1.00 25.89  ? 33  SER D O     1 
ATOM   8420  C  CB    . SER F 5 10  ? 23.478  76.297  16.537  1.00 32.72  ? 33  SER D CB    1 
ATOM   8421  O  OG    . SER F 5 10  ? 23.579  77.620  17.030  1.00 32.72  ? 33  SER D OG    1 
ATOM   8422  N  N     . TYR F 5 11  ? 25.782  76.719  18.466  1.00 24.46  ? 34  TYR D N     1 
ATOM   8423  C  CA    . TYR F 5 11  ? 26.300  76.862  19.836  1.00 24.46  ? 34  TYR D CA    1 
ATOM   8424  C  C     . TYR F 5 11  ? 25.260  77.659  20.608  1.00 24.46  ? 34  TYR D C     1 
ATOM   8425  O  O     . TYR F 5 11  ? 25.465  77.996  21.769  1.00 24.46  ? 34  TYR D O     1 
ATOM   8426  C  CB    . TYR F 5 11  ? 27.619  77.638  19.888  1.00 23.16  ? 34  TYR D CB    1 
ATOM   8427  C  CG    . TYR F 5 11  ? 28.822  76.869  19.420  1.00 23.16  ? 34  TYR D CG    1 
ATOM   8428  C  CD1   . TYR F 5 11  ? 29.570  76.084  20.308  1.00 23.16  ? 34  TYR D CD1   1 
ATOM   8429  C  CD2   . TYR F 5 11  ? 29.243  76.942  18.098  1.00 23.16  ? 34  TYR D CD2   1 
ATOM   8430  C  CE1   . TYR F 5 11  ? 30.721  75.394  19.878  1.00 23.16  ? 34  TYR D CE1   1 
ATOM   8431  C  CE2   . TYR F 5 11  ? 30.370  76.260  17.667  1.00 23.16  ? 34  TYR D CE2   1 
ATOM   8432  C  CZ    . TYR F 5 11  ? 31.104  75.493  18.556  1.00 23.16  ? 34  TYR D CZ    1 
ATOM   8433  O  OH    . TYR F 5 11  ? 32.223  74.834  18.093  1.00 23.16  ? 34  TYR D OH    1 
ATOM   8434  N  N     . ALA F 5 12  ? 24.164  77.982  19.922  1.00 30.67  ? 35  ALA D N     1 
ATOM   8435  C  CA    . ALA F 5 12  ? 23.054  78.753  20.468  1.00 30.67  ? 35  ALA D CA    1 
ATOM   8436  C  C     . ALA F 5 12  ? 22.639  78.462  21.918  1.00 30.67  ? 35  ALA D C     1 
ATOM   8437  O  O     . ALA F 5 12  ? 22.687  79.352  22.768  1.00 30.67  ? 35  ALA D O     1 
ATOM   8438  C  CB    . ALA F 5 12  ? 21.846  78.659  19.530  1.00 60.44  ? 35  ALA D CB    1 
ATOM   8439  N  N     . ILE F 5 13  ? 22.244  77.229  22.214  1.00 28.93  ? 36  ILE D N     1 
ATOM   8440  C  CA    . ILE F 5 13  ? 21.831  76.905  23.573  1.00 28.93  ? 36  ILE D CA    1 
ATOM   8441  C  C     . ILE F 5 13  ? 22.963  77.189  24.560  1.00 28.93  ? 36  ILE D C     1 
ATOM   8442  O  O     . ILE F 5 13  ? 22.733  77.686  25.665  1.00 28.93  ? 36  ILE D O     1 
ATOM   8443  C  CB    . ILE F 5 13  ? 21.353  75.429  23.708  1.00 23.57  ? 36  ILE D CB    1 
ATOM   8444  C  CG1   . ILE F 5 13  ? 22.504  74.460  23.482  1.00 23.57  ? 36  ILE D CG1   1 
ATOM   8445  C  CG2   . ILE F 5 13  ? 20.252  75.133  22.708  1.00 23.57  ? 36  ILE D CG2   1 
ATOM   8446  C  CD1   . ILE F 5 13  ? 22.086  73.023  23.654  1.00 23.57  ? 36  ILE D CD1   1 
ATOM   8447  N  N     . TYR F 5 14  ? 24.195  76.952  24.134  1.00 24.80  ? 37  TYR D N     1 
ATOM   8448  C  CA    . TYR F 5 14  ? 25.322  77.192  25.022  1.00 24.80  ? 37  TYR D CA    1 
ATOM   8449  C  C     . TYR F 5 14  ? 25.586  78.685  25.199  1.00 24.80  ? 37  TYR D C     1 
ATOM   8450  O  O     . TYR F 5 14  ? 25.862  79.136  26.314  1.00 24.80  ? 37  TYR D O     1 
ATOM   8451  C  CB    . TYR F 5 14  ? 26.549  76.440  24.526  1.00 30.83  ? 37  TYR D CB    1 
ATOM   8452  C  CG    . TYR F 5 14  ? 26.257  74.986  24.304  1.00 30.83  ? 37  TYR D CG    1 
ATOM   8453  C  CD1   . TYR F 5 14  ? 26.058  74.135  25.380  1.00 30.83  ? 37  TYR D CD1   1 
ATOM   8454  C  CD2   . TYR F 5 14  ? 26.112  74.473  23.012  1.00 30.83  ? 37  TYR D CD2   1 
ATOM   8455  C  CE1   . TYR F 5 14  ? 25.717  72.804  25.195  1.00 30.83  ? 37  TYR D CE1   1 
ATOM   8456  C  CE2   . TYR F 5 14  ? 25.773  73.124  22.800  1.00 30.83  ? 37  TYR D CE2   1 
ATOM   8457  C  CZ    . TYR F 5 14  ? 25.572  72.293  23.904  1.00 30.83  ? 37  TYR D CZ    1 
ATOM   8458  O  OH    . TYR F 5 14  ? 25.224  70.957  23.729  1.00 30.83  ? 37  TYR D OH    1 
ATOM   8459  N  N     . VAL F 5 15  ? 25.497  79.457  24.112  1.00 9.62   ? 38  VAL D N     1 
ATOM   8460  C  CA    . VAL F 5 15  ? 25.683  80.901  24.203  1.00 9.62   ? 38  VAL D CA    1 
ATOM   8461  C  C     . VAL F 5 15  ? 24.623  81.334  25.178  1.00 9.62   ? 38  VAL D C     1 
ATOM   8462  O  O     . VAL F 5 15  ? 24.942  81.930  26.199  1.00 9.62   ? 38  VAL D O     1 
ATOM   8463  C  CB    . VAL F 5 15  ? 25.475  81.630  22.864  1.00 8.16   ? 38  VAL D CB    1 
ATOM   8464  C  CG1   . VAL F 5 15  ? 25.486  83.116  23.078  1.00 8.16   ? 38  VAL D CG1   1 
ATOM   8465  C  CG2   . VAL F 5 15  ? 26.580  81.283  21.927  1.00 8.16   ? 38  VAL D CG2   1 
ATOM   8466  N  N     . TYR F 5 16  ? 23.383  80.893  24.943  1.00 18.17  ? 39  TYR D N     1 
ATOM   8467  C  CA    . TYR F 5 16  ? 22.272  81.223  25.828  1.00 18.17  ? 39  TYR D CA    1 
ATOM   8468  C  C     . TYR F 5 16  ? 22.525  80.898  27.333  1.00 18.17  ? 39  TYR D C     1 
ATOM   8469  O  O     . TYR F 5 16  ? 22.367  81.778  28.181  1.00 18.17  ? 39  TYR D O     1 
ATOM   8470  C  CB    . TYR F 5 16  ? 20.981  80.603  25.317  1.00 56.31  ? 39  TYR D CB    1 
ATOM   8471  C  CG    . TYR F 5 16  ? 19.769  81.355  25.789  1.00 56.31  ? 39  TYR D CG    1 
ATOM   8472  C  CD1   . TYR F 5 16  ? 19.265  82.442  25.067  1.00 56.31  ? 39  TYR D CD1   1 
ATOM   8473  C  CD2   . TYR F 5 16  ? 19.137  81.009  26.986  1.00 56.31  ? 39  TYR D CD2   1 
ATOM   8474  C  CE1   . TYR F 5 16  ? 18.142  83.180  25.538  1.00 56.31  ? 39  TYR D CE1   1 
ATOM   8475  C  CE2   . TYR F 5 16  ? 18.019  81.729  27.473  1.00 56.31  ? 39  TYR D CE2   1 
ATOM   8476  C  CZ    . TYR F 5 16  ? 17.519  82.814  26.750  1.00 56.31  ? 39  TYR D CZ    1 
ATOM   8477  O  OH    . TYR F 5 16  ? 16.401  83.492  27.240  1.00 56.31  ? 39  TYR D OH    1 
ATOM   8478  N  N     . LYS F 5 17  ? 22.969  79.685  27.674  1.00 22.61  ? 40  LYS D N     1 
ATOM   8479  C  CA    . LYS F 5 17  ? 23.228  79.357  29.085  1.00 22.61  ? 40  LYS D CA    1 
ATOM   8480  C  C     . LYS F 5 17  ? 24.124  80.398  29.723  1.00 22.61  ? 40  LYS D C     1 
ATOM   8481  O  O     . LYS F 5 17  ? 23.785  80.985  30.761  1.00 22.61  ? 40  LYS D O     1 
ATOM   8482  C  CB    . LYS F 5 17  ? 23.882  77.990  29.251  1.00 50.79  ? 40  LYS D CB    1 
ATOM   8483  C  CG    . LYS F 5 17  ? 22.976  76.824  28.989  1.00 50.79  ? 40  LYS D CG    1 
ATOM   8484  C  CD    . LYS F 5 17  ? 23.675  75.517  29.328  1.00 50.79  ? 40  LYS D CD    1 
ATOM   8485  C  CE    . LYS F 5 17  ? 22.853  74.295  28.920  1.00 50.79  ? 40  LYS D CE    1 
ATOM   8486  N  NZ    . LYS F 5 17  ? 23.535  73.039  29.358  1.00 50.79  ? 40  LYS D NZ    1 
ATOM   8487  N  N     . VAL F 5 18  ? 25.248  80.658  29.062  1.00 47.68  ? 41  VAL D N     1 
ATOM   8488  C  CA    . VAL F 5 18  ? 26.220  81.627  29.547  1.00 47.68  ? 41  VAL D CA    1 
ATOM   8489  C  C     . VAL F 5 18  ? 25.563  82.996  29.633  1.00 47.68  ? 41  VAL D C     1 
ATOM   8490  O  O     . VAL F 5 18  ? 25.744  83.721  30.615  1.00 47.68  ? 41  VAL D O     1 
ATOM   8491  C  CB    . VAL F 5 18  ? 27.470  81.676  28.638  1.00 38.76  ? 41  VAL D CB    1 
ATOM   8492  C  CG1   . VAL F 5 18  ? 28.437  82.749  29.128  1.00 38.76  ? 41  VAL D CG1   1 
ATOM   8493  C  CG2   . VAL F 5 18  ? 28.162  80.322  28.629  1.00 38.76  ? 41  VAL D CG2   1 
ATOM   8494  N  N     . LEU F 5 19  ? 24.787  83.334  28.607  1.00 21.97  ? 42  LEU D N     1 
ATOM   8495  C  CA    . LEU F 5 19  ? 24.075  84.604  28.582  1.00 21.97  ? 42  LEU D CA    1 
ATOM   8496  C  C     . LEU F 5 19  ? 23.317  84.808  29.886  1.00 21.97  ? 42  LEU D C     1 
ATOM   8497  O  O     . LEU F 5 19  ? 23.402  85.876  30.514  1.00 21.97  ? 42  LEU D O     1 
ATOM   8498  C  CB    . LEU F 5 19  ? 23.073  84.649  27.437  1.00 10.75  ? 42  LEU D CB    1 
ATOM   8499  C  CG    . LEU F 5 19  ? 22.168  85.894  27.507  1.00 10.75  ? 42  LEU D CG    1 
ATOM   8500  C  CD1   . LEU F 5 19  ? 23.028  87.179  27.604  1.00 10.75  ? 42  LEU D CD1   1 
ATOM   8501  C  CD2   . LEU F 5 19  ? 21.189  85.951  26.319  1.00 10.75  ? 42  LEU D CD2   1 
ATOM   8502  N  N     . LYS F 5 20  ? 22.592  83.768  30.291  1.00 26.05  ? 43  LYS D N     1 
ATOM   8503  C  CA    . LYS F 5 20  ? 21.803  83.825  31.509  1.00 26.05  ? 43  LYS D CA    1 
ATOM   8504  C  C     . LYS F 5 20  ? 22.641  83.939  32.741  1.00 26.05  ? 43  LYS D C     1 
ATOM   8505  O  O     . LYS F 5 20  ? 22.184  84.467  33.749  1.00 26.05  ? 43  LYS D O     1 
ATOM   8506  C  CB    . LYS F 5 20  ? 20.814  82.662  31.590  1.00 44.66  ? 43  LYS D CB    1 
ATOM   8507  C  CG    . LYS F 5 20  ? 19.661  82.839  30.618  1.00 44.66  ? 43  LYS D CG    1 
ATOM   8508  C  CD    . LYS F 5 20  ? 19.242  84.294  30.640  1.00 44.66  ? 43  LYS D CD    1 
ATOM   8509  C  CE    . LYS F 5 20  ? 17.961  84.547  29.909  1.00 44.66  ? 43  LYS D CE    1 
ATOM   8510  N  NZ    . LYS F 5 20  ? 17.517  85.935  30.183  1.00 44.66  ? 43  LYS D NZ    1 
ATOM   8511  N  N     . GLN F 5 21  ? 23.874  83.457  32.655  1.00 20.19  ? 44  GLN D N     1 
ATOM   8512  C  CA    . GLN F 5 21  ? 24.794  83.549  33.785  1.00 20.19  ? 44  GLN D CA    1 
ATOM   8513  C  C     . GLN F 5 21  ? 25.287  84.984  34.066  1.00 20.19  ? 44  GLN D C     1 
ATOM   8514  O  O     . GLN F 5 21  ? 25.281  85.426  35.220  1.00 20.19  ? 44  GLN D O     1 
ATOM   8515  C  CB    . GLN F 5 21  ? 25.998  82.615  33.585  1.00 34.11  ? 44  GLN D CB    1 
ATOM   8516  C  CG    . GLN F 5 21  ? 25.738  81.134  33.860  1.00 34.11  ? 44  GLN D CG    1 
ATOM   8517  C  CD    . GLN F 5 21  ? 26.978  80.267  33.649  1.00 34.11  ? 44  GLN D CD    1 
ATOM   8518  O  OE1   . GLN F 5 21  ? 27.752  80.492  32.713  1.00 34.11  ? 44  GLN D OE1   1 
ATOM   8519  N  NE2   . GLN F 5 21  ? 27.169  79.273  34.512  1.00 34.11  ? 44  GLN D NE2   1 
ATOM   8520  N  N     . VAL F 5 22  ? 25.699  85.714  33.021  1.00 36.55  ? 45  VAL D N     1 
ATOM   8521  C  CA    . VAL F 5 22  ? 26.236  87.075  33.198  1.00 36.55  ? 45  VAL D CA    1 
ATOM   8522  C  C     . VAL F 5 22  ? 25.214  88.167  33.490  1.00 36.55  ? 45  VAL D C     1 
ATOM   8523  O  O     . VAL F 5 22  ? 25.383  88.971  34.431  1.00 36.55  ? 45  VAL D O     1 
ATOM   8524  C  CB    . VAL F 5 22  ? 27.167  87.487  32.013  1.00 24.97  ? 45  VAL D CB    1 
ATOM   8525  C  CG1   . VAL F 5 22  ? 28.339  86.495  31.912  1.00 24.97  ? 45  VAL D CG1   1 
ATOM   8526  C  CG2   . VAL F 5 22  ? 26.396  87.549  30.696  1.00 24.97  ? 45  VAL D CG2   1 
ATOM   8527  N  N     . HIS F 5 23  ? 24.139  88.132  32.700  1.00 21.80  ? 46  HIS D N     1 
ATOM   8528  C  CA    . HIS F 5 23  ? 23.004  89.054  32.774  1.00 21.80  ? 46  HIS D CA    1 
ATOM   8529  C  C     . HIS F 5 23  ? 21.723  88.206  32.734  1.00 21.80  ? 46  HIS D C     1 
ATOM   8530  O  O     . HIS F 5 23  ? 21.102  88.022  31.684  1.00 21.80  ? 46  HIS D O     1 
ATOM   8531  C  CB    . HIS F 5 23  ? 23.032  89.992  31.578  1.00 14.96  ? 46  HIS D CB    1 
ATOM   8532  C  CG    . HIS F 5 23  ? 24.176  90.946  31.591  1.00 14.96  ? 46  HIS D CG    1 
ATOM   8533  N  ND1   . HIS F 5 23  ? 25.077  91.032  30.554  1.00 14.96  ? 46  HIS D ND1   1 
ATOM   8534  C  CD2   . HIS F 5 23  ? 24.541  91.887  32.493  1.00 14.96  ? 46  HIS D CD2   1 
ATOM   8535  C  CE1   . HIS F 5 23  ? 25.948  91.987  30.814  1.00 14.96  ? 46  HIS D CE1   1 
ATOM   8536  N  NE2   . HIS F 5 23  ? 25.645  92.523  31.982  1.00 14.96  ? 46  HIS D NE2   1 
ATOM   8537  N  N     . PRO F 5 24  ? 21.247  87.787  33.908  1.00 26.89  ? 47  PRO D N     1 
ATOM   8538  C  CA    . PRO F 5 24  ? 20.055  86.951  34.114  1.00 26.89  ? 47  PRO D CA    1 
ATOM   8539  C  C     . PRO F 5 24  ? 18.745  87.380  33.444  1.00 26.89  ? 47  PRO D C     1 
ATOM   8540  O  O     . PRO F 5 24  ? 17.975  86.533  32.980  1.00 26.89  ? 47  PRO D O     1 
ATOM   8541  C  CB    . PRO F 5 24  ? 19.922  86.929  35.643  1.00 25.83  ? 47  PRO D CB    1 
ATOM   8542  C  CG    . PRO F 5 24  ? 21.305  87.310  36.145  1.00 25.83  ? 47  PRO D CG    1 
ATOM   8543  C  CD    . PRO F 5 24  ? 21.693  88.366  35.186  1.00 25.83  ? 47  PRO D CD    1 
ATOM   8544  N  N     . ASP F 5 25  ? 18.528  88.687  33.340  1.00 28.06  ? 48  ASP D N     1 
ATOM   8545  C  CA    . ASP F 5 25  ? 17.286  89.192  32.760  1.00 28.06  ? 48  ASP D CA    1 
ATOM   8546  C  C     . ASP F 5 25  ? 17.400  89.817  31.362  1.00 28.06  ? 48  ASP D C     1 
ATOM   8547  O  O     . ASP F 5 25  ? 16.536  90.591  30.957  1.00 28.06  ? 48  ASP D O     1 
ATOM   8548  C  CB    . ASP F 5 25  ? 16.612  90.174  33.749  1.00 40.32  ? 48  ASP D CB    1 
ATOM   8549  C  CG    . ASP F 5 25  ? 16.301  89.532  35.128  1.00 40.32  ? 48  ASP D CG    1 
ATOM   8550  O  OD1   . ASP F 5 25  ? 16.074  88.299  35.212  1.00 40.32  ? 48  ASP D OD1   1 
ATOM   8551  O  OD2   . ASP F 5 25  ? 16.278  90.269  36.139  1.00 40.32  ? 48  ASP D OD2   1 
ATOM   8552  N  N     . THR F 5 26  ? 18.416  89.426  30.598  1.00 7.13   ? 49  THR D N     1 
ATOM   8553  C  CA    . THR F 5 26  ? 18.614  89.976  29.256  1.00 7.13   ? 49  THR D CA    1 
ATOM   8554  C  C     . THR F 5 26  ? 18.401  88.904  28.172  1.00 7.13   ? 49  THR D C     1 
ATOM   8555  O  O     . THR F 5 26  ? 18.631  87.726  28.405  1.00 7.13   ? 49  THR D O     1 
ATOM   8556  C  CB    . THR F 5 26  ? 20.046  90.597  29.160  1.00 14.55  ? 49  THR D CB    1 
ATOM   8557  O  OG1   . THR F 5 26  ? 20.242  91.504  30.257  1.00 14.55  ? 49  THR D OG1   1 
ATOM   8558  C  CG2   . THR F 5 26  ? 20.252  91.344  27.851  1.00 14.55  ? 49  THR D CG2   1 
ATOM   8559  N  N     . GLY F 5 27  ? 17.927  89.314  27.007  1.00 25.20  ? 50  GLY D N     1 
ATOM   8560  C  CA    . GLY F 5 27  ? 17.718  88.366  25.932  1.00 25.20  ? 50  GLY D CA    1 
ATOM   8561  C  C     . GLY F 5 27  ? 18.661  88.644  24.767  1.00 25.20  ? 50  GLY D C     1 
ATOM   8562  O  O     . GLY F 5 27  ? 19.582  89.440  24.897  1.00 25.20  ? 50  GLY D O     1 
ATOM   8563  N  N     . ILE F 5 28  ? 18.390  88.049  23.606  1.00 36.28  ? 51  ILE D N     1 
ATOM   8564  C  CA    . ILE F 5 28  ? 19.235  88.245  22.430  1.00 36.28  ? 51  ILE D CA    1 
ATOM   8565  C  C     . ILE F 5 28  ? 18.460  87.912  21.149  1.00 36.28  ? 51  ILE D C     1 
ATOM   8566  O  O     . ILE F 5 28  ? 17.854  86.843  21.042  1.00 36.28  ? 51  ILE D O     1 
ATOM   8567  C  CB    . ILE F 5 28  ? 20.548  87.396  22.548  1.00 20.49  ? 51  ILE D CB    1 
ATOM   8568  C  CG1   . ILE F 5 28  ? 21.473  87.631  21.343  1.00 20.49  ? 51  ILE D CG1   1 
ATOM   8569  C  CG2   . ILE F 5 28  ? 20.241  85.904  22.704  1.00 20.49  ? 51  ILE D CG2   1 
ATOM   8570  C  CD1   . ILE F 5 28  ? 22.901  87.033  21.505  1.00 20.49  ? 51  ILE D CD1   1 
ATOM   8571  N  N     . SER F 5 29  ? 18.454  88.841  20.191  1.00 23.83  ? 52  SER D N     1 
ATOM   8572  C  CA    . SER F 5 29  ? 17.738  88.627  18.938  1.00 23.83  ? 52  SER D CA    1 
ATOM   8573  C  C     . SER F 5 29  ? 18.368  87.470  18.181  1.00 23.83  ? 52  SER D C     1 
ATOM   8574  O  O     . SER F 5 29  ? 19.488  87.082  18.477  1.00 23.83  ? 52  SER D O     1 
ATOM   8575  C  CB    . SER F 5 29  ? 17.728  89.894  18.079  1.00 34.42  ? 52  SER D CB    1 
ATOM   8576  O  OG    . SER F 5 29  ? 19.011  90.232  17.594  1.00 34.42  ? 52  SER D OG    1 
ATOM   8577  N  N     . SER F 5 30  ? 17.667  86.902  17.207  1.00 24.91  ? 53  SER D N     1 
ATOM   8578  C  CA    . SER F 5 30  ? 18.238  85.779  16.475  1.00 24.91  ? 53  SER D CA    1 
ATOM   8579  C  C     . SER F 5 30  ? 19.428  86.241  15.647  1.00 24.91  ? 53  SER D C     1 
ATOM   8580  O  O     . SER F 5 30  ? 20.385  85.488  15.464  1.00 24.91  ? 53  SER D O     1 
ATOM   8581  C  CB    . SER F 5 30  ? 17.193  85.116  15.581  1.00 29.05  ? 53  SER D CB    1 
ATOM   8582  O  OG    . SER F 5 30  ? 16.867  85.959  14.498  1.00 29.05  ? 53  SER D OG    1 
ATOM   8583  N  N     . LYS F 5 31  ? 19.373  87.485  15.171  1.00 26.31  ? 54  LYS D N     1 
ATOM   8584  C  CA    . LYS F 5 31  ? 20.461  88.035  14.376  1.00 26.31  ? 54  LYS D CA    1 
ATOM   8585  C  C     . LYS F 5 31  ? 21.708  88.102  15.239  1.00 26.31  ? 54  LYS D C     1 
ATOM   8586  O  O     . LYS F 5 31  ? 22.766  87.649  14.830  1.00 26.31  ? 54  LYS D O     1 
ATOM   8587  C  CB    . LYS F 5 31  ? 20.118  89.416  13.825  1.00 57.06  ? 54  LYS D CB    1 
ATOM   8588  C  CG    . LYS F 5 31  ? 19.174  89.400  12.643  1.00 57.06  ? 54  LYS D CG    1 
ATOM   8589  C  CD    . LYS F 5 31  ? 19.054  90.791  11.991  1.00 57.06  ? 54  LYS D CD    1 
ATOM   8590  C  CE    . LYS F 5 31  ? 18.050  90.808  10.813  1.00 57.06  ? 54  LYS D CE    1 
ATOM   8591  N  NZ    . LYS F 5 31  ? 17.962  92.144  10.139  1.00 57.06  ? 54  LYS D NZ    1 
ATOM   8592  N  N     . ALA F 5 32  ? 21.592  88.636  16.449  1.00 20.14  ? 55  ALA D N     1 
ATOM   8593  C  CA    . ALA F 5 32  ? 22.738  88.696  17.343  1.00 20.14  ? 55  ALA D CA    1 
ATOM   8594  C  C     . ALA F 5 32  ? 23.264  87.292  17.673  1.00 20.14  ? 55  ALA D C     1 
ATOM   8595  O  O     . ALA F 5 32  ? 24.474  87.072  17.715  1.00 20.14  ? 55  ALA D O     1 
ATOM   8596  C  CB    . ALA F 5 32  ? 22.386  89.431  18.604  1.00 16.06  ? 55  ALA D CB    1 
ATOM   8597  N  N     . MET F 5 33  ? 22.374  86.335  17.914  1.00 23.36  ? 56  MET D N     1 
ATOM   8598  C  CA    . MET F 5 33  ? 22.827  84.981  18.203  1.00 23.36  ? 56  MET D CA    1 
ATOM   8599  C  C     . MET F 5 33  ? 23.594  84.450  17.011  1.00 23.36  ? 56  MET D C     1 
ATOM   8600  O  O     . MET F 5 33  ? 24.665  83.894  17.163  1.00 23.36  ? 56  MET D O     1 
ATOM   8601  C  CB    . MET F 5 33  ? 21.673  84.053  18.562  1.00 15.09  ? 56  MET D CB    1 
ATOM   8602  C  CG    . MET F 5 33  ? 22.115  82.631  18.841  1.00 15.09  ? 56  MET D CG    1 
ATOM   8603  S  SD    . MET F 5 33  ? 23.278  82.500  20.205  1.00 15.09  ? 56  MET D SD    1 
ATOM   8604  C  CE    . MET F 5 33  ? 22.171  82.731  21.660  1.00 15.09  ? 56  MET D CE    1 
ATOM   8605  N  N     . SER F 5 34  ? 23.071  84.661  15.816  1.00 25.65  ? 57  SER D N     1 
ATOM   8606  C  CA    . SER F 5 34  ? 23.768  84.221  14.618  1.00 25.65  ? 57  SER D CA    1 
ATOM   8607  C  C     . SER F 5 34  ? 25.206  84.706  14.672  1.00 25.65  ? 57  SER D C     1 
ATOM   8608  O  O     . SER F 5 34  ? 26.147  83.959  14.421  1.00 25.65  ? 57  SER D O     1 
ATOM   8609  C  CB    . SER F 5 34  ? 23.110  84.803  13.386  1.00 19.09  ? 57  SER D CB    1 
ATOM   8610  O  OG    . SER F 5 34  ? 23.849  84.416  12.254  1.00 19.09  ? 57  SER D OG    1 
ATOM   8611  N  N     . ILE F 5 35  ? 25.360  85.978  14.996  1.00 13.01  ? 58  ILE D N     1 
ATOM   8612  C  CA    . ILE F 5 35  ? 26.677  86.580  15.128  1.00 13.01  ? 58  ILE D CA    1 
ATOM   8613  C  C     . ILE F 5 35  ? 27.531  85.891  16.197  1.00 13.01  ? 58  ILE D C     1 
ATOM   8614  O  O     . ILE F 5 35  ? 28.684  85.523  15.936  1.00 13.01  ? 58  ILE D O     1 
ATOM   8615  C  CB    . ILE F 5 35  ? 26.548  88.107  15.372  1.00 13.30  ? 58  ILE D CB    1 
ATOM   8616  C  CG1   . ILE F 5 35  ? 26.305  88.789  14.022  1.00 13.30  ? 58  ILE D CG1   1 
ATOM   8617  C  CG2   . ILE F 5 35  ? 27.785  88.664  16.048  1.00 13.30  ? 58  ILE D CG2   1 
ATOM   8618  C  CD1   . ILE F 5 35  ? 26.047  90.216  14.135  1.00 13.30  ? 58  ILE D CD1   1 
ATOM   8619  N  N     . MET F 5 36  ? 26.956  85.678  17.382  1.00 12.73  ? 59  MET D N     1 
ATOM   8620  C  CA    . MET F 5 36  ? 27.679  85.010  18.466  1.00 12.73  ? 59  MET D CA    1 
ATOM   8621  C  C     . MET F 5 36  ? 28.149  83.647  18.021  1.00 12.73  ? 59  MET D C     1 
ATOM   8622  O  O     . MET F 5 36  ? 29.241  83.189  18.380  1.00 12.73  ? 59  MET D O     1 
ATOM   8623  C  CB    . MET F 5 36  ? 26.810  84.900  19.697  1.00 19.19  ? 59  MET D CB    1 
ATOM   8624  C  CG    . MET F 5 36  ? 26.740  86.199  20.444  1.00 19.19  ? 59  MET D CG    1 
ATOM   8625  S  SD    . MET F 5 36  ? 28.416  86.827  20.808  1.00 19.19  ? 59  MET D SD    1 
ATOM   8626  C  CE    . MET F 5 36  ? 28.871  85.879  22.278  1.00 19.19  ? 59  MET D CE    1 
ATOM   8627  N  N     . ASN F 5 37  ? 27.339  83.032  17.169  1.00 14.11  ? 60  ASN D N     1 
ATOM   8628  C  CA    . ASN F 5 37  ? 27.679  81.734  16.642  1.00 14.11  ? 60  ASN D CA    1 
ATOM   8629  C  C     . ASN F 5 37  ? 28.855  81.837  15.687  1.00 14.11  ? 60  ASN D C     1 
ATOM   8630  O  O     . ASN F 5 37  ? 29.766  81.011  15.757  1.00 14.11  ? 60  ASN D O     1 
ATOM   8631  C  CB    . ASN F 5 37  ? 26.482  81.066  15.985  1.00 20.73  ? 60  ASN D CB    1 
ATOM   8632  C  CG    . ASN F 5 37  ? 26.555  79.579  16.103  1.00 20.73  ? 60  ASN D CG    1 
ATOM   8633  O  OD1   . ASN F 5 37  ? 26.659  79.058  17.203  1.00 20.73  ? 60  ASN D OD1   1 
ATOM   8634  N  ND2   . ASN F 5 37  ? 26.585  78.882  14.977  1.00 20.73  ? 60  ASN D ND2   1 
ATOM   8635  N  N     . SER F 5 38  ? 28.834  82.843  14.804  1.00 25.59  ? 61  SER D N     1 
ATOM   8636  C  CA    . SER F 5 38  ? 29.932  83.078  13.859  1.00 25.59  ? 61  SER D CA    1 
ATOM   8637  C  C     . SER F 5 38  ? 31.228  83.275  14.627  1.00 25.59  ? 61  SER D C     1 
ATOM   8638  O  O     . SER F 5 38  ? 32.228  82.614  14.349  1.00 25.59  ? 61  SER D O     1 
ATOM   8639  C  CB    . SER F 5 38  ? 29.685  84.320  13.001  1.00 34.21  ? 61  SER D CB    1 
ATOM   8640  O  OG    . SER F 5 38  ? 28.742  84.068  11.976  1.00 34.21  ? 61  SER D OG    1 
ATOM   8641  N  N     . PHE F 5 39  ? 31.181  84.160  15.621  1.00 20.95  ? 62  PHE D N     1 
ATOM   8642  C  CA    . PHE F 5 39  ? 32.324  84.469  16.462  1.00 20.95  ? 62  PHE D CA    1 
ATOM   8643  C  C     . PHE F 5 39  ? 32.965  83.204  17.021  1.00 20.95  ? 62  PHE D C     1 
ATOM   8644  O  O     . PHE F 5 39  ? 34.139  82.946  16.793  1.00 20.95  ? 62  PHE D O     1 
ATOM   8645  C  CB    . PHE F 5 39  ? 31.866  85.353  17.594  1.00 17.36  ? 62  PHE D CB    1 
ATOM   8646  C  CG    . PHE F 5 39  ? 32.857  85.482  18.692  1.00 17.36  ? 62  PHE D CG    1 
ATOM   8647  C  CD1   . PHE F 5 39  ? 34.055  86.152  18.494  1.00 17.36  ? 62  PHE D CD1   1 
ATOM   8648  C  CD2   . PHE F 5 39  ? 32.587  84.968  19.946  1.00 17.36  ? 62  PHE D CD2   1 
ATOM   8649  C  CE1   . PHE F 5 39  ? 34.973  86.310  19.538  1.00 17.36  ? 62  PHE D CE1   1 
ATOM   8650  C  CE2   . PHE F 5 39  ? 33.499  85.124  20.996  1.00 17.36  ? 62  PHE D CE2   1 
ATOM   8651  C  CZ    . PHE F 5 39  ? 34.686  85.795  20.788  1.00 17.36  ? 62  PHE D CZ    1 
ATOM   8652  N  N     . VAL F 5 40  ? 32.176  82.410  17.735  1.00 21.26  ? 63  VAL D N     1 
ATOM   8653  C  CA    . VAL F 5 40  ? 32.651  81.166  18.333  1.00 21.26  ? 63  VAL D CA    1 
ATOM   8654  C  C     . VAL F 5 40  ? 33.382  80.257  17.348  1.00 21.26  ? 63  VAL D C     1 
ATOM   8655  O  O     . VAL F 5 40  ? 34.485  79.791  17.621  1.00 21.26  ? 63  VAL D O     1 
ATOM   8656  C  CB    . VAL F 5 40  ? 31.481  80.385  18.950  1.00 17.21  ? 63  VAL D CB    1 
ATOM   8657  C  CG1   . VAL F 5 40  ? 31.958  79.044  19.416  1.00 17.21  ? 63  VAL D CG1   1 
ATOM   8658  C  CG2   . VAL F 5 40  ? 30.865  81.168  20.108  1.00 17.21  ? 63  VAL D CG2   1 
ATOM   8659  N  N     . ASN F 5 41  ? 32.762  79.998  16.203  1.00 14.46  ? 64  ASN D N     1 
ATOM   8660  C  CA    . ASN F 5 41  ? 33.379  79.144  15.199  1.00 14.46  ? 64  ASN D CA    1 
ATOM   8661  C  C     . ASN F 5 41  ? 34.662  79.768  14.707  1.00 14.46  ? 64  ASN D C     1 
ATOM   8662  O  O     . ASN F 5 41  ? 35.683  79.108  14.645  1.00 14.46  ? 64  ASN D O     1 
ATOM   8663  C  CB    . ASN F 5 41  ? 32.411  78.868  14.054  1.00 46.77  ? 64  ASN D CB    1 
ATOM   8664  C  CG    . ASN F 5 41  ? 31.271  77.956  14.482  1.00 46.77  ? 64  ASN D CG    1 
ATOM   8665  O  OD1   . ASN F 5 41  ? 31.501  76.872  15.038  1.00 46.77  ? 64  ASN D OD1   1 
ATOM   8666  N  ND2   . ASN F 5 41  ? 30.036  78.390  14.237  1.00 46.77  ? 64  ASN D ND2   1 
ATOM   8667  N  N     . ASP F 5 42  ? 34.619  81.067  14.438  1.00 24.22  ? 65  ASP D N     1 
ATOM   8668  C  CA    . ASP F 5 42  ? 35.781  81.804  13.974  1.00 24.22  ? 65  ASP D CA    1 
ATOM   8669  C  C     . ASP F 5 42  ? 36.954  81.581  14.902  1.00 24.22  ? 65  ASP D C     1 
ATOM   8670  O  O     . ASP F 5 42  ? 37.967  81.043  14.508  1.00 24.22  ? 65  ASP D O     1 
ATOM   8671  C  CB    . ASP F 5 42  ? 35.479  83.292  13.933  1.00 33.89  ? 65  ASP D CB    1 
ATOM   8672  C  CG    . ASP F 5 42  ? 36.591  84.079  13.304  1.00 33.89  ? 65  ASP D CG    1 
ATOM   8673  O  OD1   . ASP F 5 42  ? 37.102  83.621  12.262  1.00 33.89  ? 65  ASP D OD1   1 
ATOM   8674  O  OD2   . ASP F 5 42  ? 36.954  85.142  13.841  1.00 33.89  ? 65  ASP D OD2   1 
ATOM   8675  N  N     . VAL F 5 43  ? 36.790  81.970  16.153  1.00 24.26  ? 66  VAL D N     1 
ATOM   8676  C  CA    . VAL F 5 43  ? 37.839  81.810  17.135  1.00 24.26  ? 66  VAL D CA    1 
ATOM   8677  C  C     . VAL F 5 43  ? 38.272  80.342  17.206  1.00 24.26  ? 66  VAL D C     1 
ATOM   8678  O  O     . VAL F 5 43  ? 39.462  80.033  17.305  1.00 24.26  ? 66  VAL D O     1 
ATOM   8679  C  CB    . VAL F 5 43  ? 37.372  82.292  18.505  1.00 5.83   ? 66  VAL D CB    1 
ATOM   8680  C  CG1   . VAL F 5 43  ? 38.465  82.058  19.517  1.00 5.83   ? 66  VAL D CG1   1 
ATOM   8681  C  CG2   . VAL F 5 43  ? 36.941  83.767  18.451  1.00 5.83   ? 66  VAL D CG2   1 
ATOM   8682  N  N     . PHE F 5 44  ? 37.308  79.434  17.140  1.00 21.67  ? 67  PHE D N     1 
ATOM   8683  C  CA    . PHE F 5 44  ? 37.617  78.013  17.162  1.00 21.67  ? 67  PHE D CA    1 
ATOM   8684  C  C     . PHE F 5 44  ? 38.602  77.615  16.040  1.00 21.67  ? 67  PHE D C     1 
ATOM   8685  O  O     . PHE F 5 44  ? 39.621  76.979  16.291  1.00 21.67  ? 67  PHE D O     1 
ATOM   8686  C  CB    . PHE F 5 44  ? 36.318  77.217  17.046  1.00 33.21  ? 67  PHE D CB    1 
ATOM   8687  C  CG    . PHE F 5 44  ? 36.520  75.745  16.876  1.00 33.21  ? 67  PHE D CG    1 
ATOM   8688  C  CD1   . PHE F 5 44  ? 36.638  74.919  17.978  1.00 33.21  ? 67  PHE D CD1   1 
ATOM   8689  C  CD2   . PHE F 5 44  ? 36.597  75.184  15.607  1.00 33.21  ? 67  PHE D CD2   1 
ATOM   8690  C  CE1   . PHE F 5 44  ? 36.836  73.553  17.818  1.00 33.21  ? 67  PHE D CE1   1 
ATOM   8691  C  CE2   . PHE F 5 44  ? 36.796  73.823  15.442  1.00 33.21  ? 67  PHE D CE2   1 
ATOM   8692  C  CZ    . PHE F 5 44  ? 36.915  73.009  16.556  1.00 33.21  ? 67  PHE D CZ    1 
ATOM   8693  N  N     . GLU F 5 45  ? 38.297  77.977  14.799  1.00 26.19  ? 68  GLU D N     1 
ATOM   8694  C  CA    . GLU F 5 45  ? 39.176  77.643  13.680  1.00 26.19  ? 68  GLU D CA    1 
ATOM   8695  C  C     . GLU F 5 45  ? 40.534  78.328  13.785  1.00 26.19  ? 68  GLU D C     1 
ATOM   8696  O  O     . GLU F 5 45  ? 41.531  77.834  13.261  1.00 26.19  ? 68  GLU D O     1 
ATOM   8697  C  CB    . GLU F 5 45  ? 38.510  78.002  12.361  1.00 72.74  ? 68  GLU D CB    1 
ATOM   8698  C  CG    . GLU F 5 45  ? 37.322  77.132  12.052  1.00 72.74  ? 68  GLU D CG    1 
ATOM   8699  C  CD    . GLU F 5 45  ? 36.238  77.853  11.282  1.00 72.74  ? 68  GLU D CD    1 
ATOM   8700  O  OE1   . GLU F 5 45  ? 36.548  78.791  10.510  1.00 72.74  ? 68  GLU D OE1   1 
ATOM   8701  O  OE2   . GLU F 5 45  ? 35.061  77.474  11.458  1.00 72.74  ? 68  GLU D OE2   1 
ATOM   8702  N  N     . ARG F 5 46  ? 40.559  79.492  14.427  1.00 20.80  ? 69  ARG D N     1 
ATOM   8703  C  CA    . ARG F 5 46  ? 41.790  80.247  14.602  1.00 20.80  ? 69  ARG D CA    1 
ATOM   8704  C  C     . ARG F 5 46  ? 42.703  79.564  15.573  1.00 20.80  ? 69  ARG D C     1 
ATOM   8705  O  O     . ARG F 5 46  ? 43.886  79.353  15.293  1.00 20.80  ? 69  ARG D O     1 
ATOM   8706  C  CB    . ARG F 5 46  ? 41.466  81.645  15.064  1.00 22.98  ? 69  ARG D CB    1 
ATOM   8707  C  CG    . ARG F 5 46  ? 40.762  82.418  13.972  1.00 22.98  ? 69  ARG D CG    1 
ATOM   8708  C  CD    . ARG F 5 46  ? 41.182  83.858  13.977  1.00 22.98  ? 69  ARG D CD    1 
ATOM   8709  N  NE    . ARG F 5 46  ? 40.091  84.757  14.297  1.00 22.98  ? 69  ARG D NE    1 
ATOM   8710  C  CZ    . ARG F 5 46  ? 40.259  85.894  14.945  1.00 22.98  ? 69  ARG D CZ    1 
ATOM   8711  N  NH1   . ARG F 5 46  ? 41.458  86.249  15.355  1.00 22.98  ? 69  ARG D NH1   1 
ATOM   8712  N  NH2   . ARG F 5 46  ? 39.250  86.725  15.104  1.00 22.98  ? 69  ARG D NH2   1 
ATOM   8713  N  N     . ILE F 5 47  ? 42.121  79.159  16.695  1.00 23.63  ? 70  ILE D N     1 
ATOM   8714  C  CA    . ILE F 5 47  ? 42.857  78.454  17.723  1.00 23.63  ? 70  ILE D CA    1 
ATOM   8715  C  C     . ILE F 5 47  ? 43.272  77.065  17.262  1.00 23.63  ? 70  ILE D C     1 
ATOM   8716  O  O     . ILE F 5 47  ? 44.420  76.675  17.472  1.00 23.63  ? 70  ILE D O     1 
ATOM   8717  C  CB    . ILE F 5 47  ? 42.047  78.356  18.997  1.00 13.50  ? 70  ILE D CB    1 
ATOM   8718  C  CG1   . ILE F 5 47  ? 42.069  79.707  19.711  1.00 13.50  ? 70  ILE D CG1   1 
ATOM   8719  C  CG2   . ILE F 5 47  ? 42.615  77.272  19.880  1.00 13.50  ? 70  ILE D CG2   1 
ATOM   8720  C  CD1   . ILE F 5 47  ? 41.261  79.766  20.966  1.00 13.50  ? 70  ILE D CD1   1 
ATOM   8721  N  N     . ALA F 5 48  ? 42.347  76.336  16.618  1.00 17.31  ? 71  ALA D N     1 
ATOM   8722  C  CA    . ALA F 5 48  ? 42.608  74.982  16.102  1.00 17.31  ? 71  ALA D CA    1 
ATOM   8723  C  C     . ALA F 5 48  ? 43.660  75.055  15.010  1.00 17.31  ? 71  ALA D C     1 
ATOM   8724  O  O     . ALA F 5 48  ? 44.533  74.204  14.916  1.00 17.31  ? 71  ALA D O     1 
ATOM   8725  C  CB    . ALA F 5 48  ? 41.328  74.354  15.569  1.00 12.33  ? 71  ALA D CB    1 
ATOM   8726  N  N     . GLY F 5 49  ? 43.598  76.125  14.236  1.00 20.95  ? 72  GLY D N     1 
ATOM   8727  C  CA    . GLY F 5 49  ? 44.562  76.320  13.178  1.00 20.95  ? 72  GLY D CA    1 
ATOM   8728  C  C     . GLY F 5 49  ? 45.949  76.545  13.764  1.00 20.95  ? 72  GLY D C     1 
ATOM   8729  O  O     . GLY F 5 49  ? 46.923  75.926  13.320  1.00 20.95  ? 72  GLY D O     1 
ATOM   8730  N  N     . GLU F 5 50  ? 46.055  77.460  14.729  1.00 32.31  ? 73  GLU D N     1 
ATOM   8731  C  CA    . GLU F 5 50  ? 47.336  77.717  15.372  1.00 32.31  ? 73  GLU D CA    1 
ATOM   8732  C  C     . GLU F 5 50  ? 47.876  76.381  15.841  1.00 32.31  ? 73  GLU D C     1 
ATOM   8733  O  O     . GLU F 5 50  ? 48.936  75.950  15.404  1.00 32.31  ? 73  GLU D O     1 
ATOM   8734  C  CB    . GLU F 5 50  ? 47.187  78.655  16.580  1.00 47.12  ? 73  GLU D CB    1 
ATOM   8735  C  CG    . GLU F 5 50  ? 47.173  80.139  16.261  1.00 47.12  ? 73  GLU D CG    1 
ATOM   8736  C  CD    . GLU F 5 50  ? 48.357  80.593  15.414  1.00 47.12  ? 73  GLU D CD    1 
ATOM   8737  O  OE1   . GLU F 5 50  ? 49.463  80.000  15.514  1.00 47.12  ? 73  GLU D OE1   1 
ATOM   8738  O  OE2   . GLU F 5 50  ? 48.173  81.554  14.637  1.00 47.12  ? 73  GLU D OE2   1 
ATOM   8739  N  N     . ALA F 5 51  ? 47.092  75.705  16.678  1.00 20.51  ? 74  ALA D N     1 
ATOM   8740  C  CA    . ALA F 5 51  ? 47.449  74.398  17.221  1.00 20.51  ? 74  ALA D CA    1 
ATOM   8741  C  C     . ALA F 5 51  ? 47.963  73.471  16.131  1.00 20.51  ? 74  ALA D C     1 
ATOM   8742  O  O     . ALA F 5 51  ? 49.016  72.878  16.278  1.00 20.51  ? 74  ALA D O     1 
ATOM   8743  C  CB    . ALA F 5 51  ? 46.252  73.778  17.910  1.00 27.58  ? 74  ALA D CB    1 
ATOM   8744  N  N     . SER F 5 52  ? 47.220  73.352  15.041  1.00 20.45  ? 75  SER D N     1 
ATOM   8745  C  CA    . SER F 5 52  ? 47.650  72.510  13.941  1.00 20.45  ? 75  SER D CA    1 
ATOM   8746  C  C     . SER F 5 52  ? 49.093  72.806  13.543  1.00 20.45  ? 75  SER D C     1 
ATOM   8747  O  O     . SER F 5 52  ? 49.942  71.926  13.615  1.00 20.45  ? 75  SER D O     1 
ATOM   8748  C  CB    . SER F 5 52  ? 46.739  72.696  12.725  1.00 28.27  ? 75  SER D CB    1 
ATOM   8749  O  OG    . SER F 5 52  ? 47.163  71.851  11.672  1.00 28.27  ? 75  SER D OG    1 
ATOM   8750  N  N     . ARG F 5 53  ? 49.367  74.058  13.182  1.00 20.62  ? 76  ARG D N     1 
ATOM   8751  C  CA    . ARG F 5 53  ? 50.695  74.489  12.759  1.00 20.62  ? 76  ARG D CA    1 
ATOM   8752  C  C     . ARG F 5 53  ? 51.742  74.303  13.822  1.00 20.62  ? 76  ARG D C     1 
ATOM   8753  O  O     . ARG F 5 53  ? 52.846  73.855  13.533  1.00 20.62  ? 76  ARG D O     1 
ATOM   8754  C  CB    . ARG F 5 53  ? 50.672  75.942  12.305  1.00 46.88  ? 76  ARG D CB    1 
ATOM   8755  C  CG    . ARG F 5 53  ? 50.341  76.101  10.839  1.00 46.88  ? 76  ARG D CG    1 
ATOM   8756  C  CD    . ARG F 5 53  ? 49.977  77.533  10.502  1.00 46.88  ? 76  ARG D CD    1 
ATOM   8757  N  NE    . ARG F 5 53  ? 48.524  77.729  10.501  1.00 46.88  ? 76  ARG D NE    1 
ATOM   8758  C  CZ    . ARG F 5 53  ? 47.869  78.573  11.300  1.00 46.88  ? 76  ARG D CZ    1 
ATOM   8759  N  NH1   . ARG F 5 53  ? 48.523  79.323  12.191  1.00 46.88  ? 76  ARG D NH1   1 
ATOM   8760  N  NH2   . ARG F 5 53  ? 46.554  78.682  11.198  1.00 46.88  ? 76  ARG D NH2   1 
ATOM   8761  N  N     . LEU F 5 54  ? 51.412  74.652  15.054  1.00 27.75  ? 77  LEU D N     1 
ATOM   8762  C  CA    . LEU F 5 54  ? 52.338  74.476  16.167  1.00 27.75  ? 77  LEU D CA    1 
ATOM   8763  C  C     . LEU F 5 54  ? 52.827  73.009  16.209  1.00 27.75  ? 77  LEU D C     1 
ATOM   8764  O  O     . LEU F 5 54  ? 54.023  72.752  16.267  1.00 27.75  ? 77  LEU D O     1 
ATOM   8765  C  CB    . LEU F 5 54  ? 51.625  74.841  17.459  1.00 18.60  ? 77  LEU D CB    1 
ATOM   8766  C  CG    . LEU F 5 54  ? 52.427  75.098  18.724  1.00 18.60  ? 77  LEU D CG    1 
ATOM   8767  C  CD1   . LEU F 5 54  ? 53.676  75.946  18.432  1.00 18.60  ? 77  LEU D CD1   1 
ATOM   8768  C  CD2   . LEU F 5 54  ? 51.506  75.799  19.717  1.00 18.60  ? 77  LEU D CD2   1 
ATOM   8769  N  N     . ALA F 5 55  ? 51.895  72.056  16.140  1.00 34.33  ? 78  ALA D N     1 
ATOM   8770  C  CA    . ALA F 5 55  ? 52.210  70.631  16.147  1.00 34.33  ? 78  ALA D CA    1 
ATOM   8771  C  C     . ALA F 5 55  ? 53.165  70.204  15.019  1.00 34.33  ? 78  ALA D C     1 
ATOM   8772  O  O     . ALA F 5 55  ? 54.082  69.425  15.244  1.00 34.33  ? 78  ALA D O     1 
ATOM   8773  C  CB    . ALA F 5 55  ? 50.930  69.826  16.074  1.00 22.89  ? 78  ALA D CB    1 
ATOM   8774  N  N     . HIS F 5 56  ? 52.917  70.634  13.788  1.00 19.86  ? 79  HIS D N     1 
ATOM   8775  C  CA    . HIS F 5 56  ? 53.826  70.254  12.713  1.00 19.86  ? 79  HIS D CA    1 
ATOM   8776  C  C     . HIS F 5 56  ? 55.198  70.893  12.940  1.00 19.86  ? 79  HIS D C     1 
ATOM   8777  O  O     . HIS F 5 56  ? 56.200  70.209  12.891  1.00 19.86  ? 79  HIS D O     1 
ATOM   8778  C  CB    . HIS F 5 56  ? 53.231  70.554  11.336  1.00 98.39  ? 79  HIS D CB    1 
ATOM   8779  C  CG    . HIS F 5 56  ? 52.038  69.704  11.006  1.00 98.39  ? 79  HIS D CG    1 
ATOM   8780  N  ND1   . HIS F 5 56  ? 51.526  69.596  9.730   1.00 98.39  ? 79  HIS D ND1   1 
ATOM   8781  C  CD2   . HIS F 5 56  ? 51.256  68.923  11.792  1.00 98.39  ? 79  HIS D CD2   1 
ATOM   8782  C  CE1   . HIS F 5 56  ? 50.480  68.789  9.744   1.00 98.39  ? 79  HIS D CE1   1 
ATOM   8783  N  NE2   . HIS F 5 56  ? 50.295  68.368  10.983  1.00 98.39  ? 79  HIS D NE2   1 
ATOM   8784  N  N     . TYR F 5 57  ? 55.231  72.156  13.350  1.00 39.77  ? 80  TYR D N     1 
ATOM   8785  C  CA    . TYR F 5 57  ? 56.498  72.845  13.630  1.00 39.77  ? 80  TYR D CA    1 
ATOM   8786  C  C     . TYR F 5 57  ? 57.394  72.041  14.557  1.00 39.77  ? 80  TYR D C     1 
ATOM   8787  O  O     . TYR F 5 57  ? 58.614  72.241  14.582  1.00 39.77  ? 80  TYR D O     1 
ATOM   8788  C  CB    . TYR F 5 57  ? 56.241  74.204  14.277  1.00 56.56  ? 80  TYR D CB    1 
ATOM   8789  C  CG    . TYR F 5 57  ? 55.509  75.162  13.384  1.00 56.56  ? 80  TYR D CG    1 
ATOM   8790  C  CD1   . TYR F 5 57  ? 55.369  74.899  12.020  1.00 56.56  ? 80  TYR D CD1   1 
ATOM   8791  C  CD2   . TYR F 5 57  ? 54.972  76.342  13.888  1.00 56.56  ? 80  TYR D CD2   1 
ATOM   8792  C  CE1   . TYR F 5 57  ? 54.715  75.787  11.175  1.00 56.56  ? 80  TYR D CE1   1 
ATOM   8793  C  CE2   . TYR F 5 57  ? 54.317  77.243  13.055  1.00 56.56  ? 80  TYR D CE2   1 
ATOM   8794  C  CZ    . TYR F 5 57  ? 54.190  76.962  11.693  1.00 56.56  ? 80  TYR D CZ    1 
ATOM   8795  O  OH    . TYR F 5 57  ? 53.546  77.853  10.846  1.00 56.56  ? 80  TYR D OH    1 
ATOM   8796  N  N     . ASN F 5 58  ? 56.776  71.146  15.326  1.00 29.42  ? 81  ASN D N     1 
ATOM   8797  C  CA    . ASN F 5 58  ? 57.502  70.318  16.277  1.00 29.42  ? 81  ASN D CA    1 
ATOM   8798  C  C     . ASN F 5 58  ? 57.458  68.836  16.000  1.00 29.42  ? 81  ASN D C     1 
ATOM   8799  O  O     . ASN F 5 58  ? 57.788  68.043  16.874  1.00 29.42  ? 81  ASN D O     1 
ATOM   8800  C  CB    . ASN F 5 58  ? 57.006  70.574  17.698  1.00 33.90  ? 81  ASN D CB    1 
ATOM   8801  C  CG    . ASN F 5 58  ? 57.319  71.968  18.175  1.00 33.90  ? 81  ASN D CG    1 
ATOM   8802  O  OD1   . ASN F 5 58  ? 58.338  72.202  18.823  1.00 33.90  ? 81  ASN D OD1   1 
ATOM   8803  N  ND2   . ASN F 5 58  ? 56.462  72.916  17.830  1.00 33.90  ? 81  ASN D ND2   1 
ATOM   8804  N  N     . LYS F 5 59  ? 57.081  68.460  14.786  1.00 42.10  ? 82  LYS D N     1 
ATOM   8805  C  CA    . LYS F 5 59  ? 56.987  67.050  14.401  1.00 42.10  ? 82  LYS D CA    1 
ATOM   8806  C  C     . LYS F 5 59  ? 56.143  66.239  15.392  1.00 42.10  ? 82  LYS D C     1 
ATOM   8807  O  O     . LYS F 5 59  ? 56.473  65.098  15.725  1.00 42.10  ? 82  LYS D O     1 
ATOM   8808  C  CB    . LYS F 5 59  ? 58.389  66.461  14.210  1.00 46.61  ? 82  LYS D CB    1 
ATOM   8809  C  CG    . LYS F 5 59  ? 59.225  67.291  13.249  1.00 46.61  ? 82  LYS D CG    1 
ATOM   8810  C  CD    . LYS F 5 59  ? 60.662  66.857  13.200  1.00 46.61  ? 82  LYS D CD    1 
ATOM   8811  C  CE    . LYS F 5 59  ? 61.506  67.864  12.406  1.00 46.61  ? 82  LYS D CE    1 
ATOM   8812  N  NZ    . LYS F 5 59  ? 62.978  67.519  12.402  1.00 46.61  ? 82  LYS D NZ    1 
ATOM   8813  N  N     . ARG F 5 60  ? 55.095  66.895  15.901  1.00 54.16  ? 83  ARG D N     1 
ATOM   8814  C  CA    . ARG F 5 60  ? 54.129  66.321  16.832  1.00 54.16  ? 83  ARG D CA    1 
ATOM   8815  C  C     . ARG F 5 60  ? 52.919  65.906  16.010  1.00 54.16  ? 83  ARG D C     1 
ATOM   8816  O  O     . ARG F 5 60  ? 52.498  66.629  15.095  1.00 54.16  ? 83  ARG D O     1 
ATOM   8817  C  CB    . ARG F 5 60  ? 53.651  67.347  17.864  1.00 118.10 ? 83  ARG D CB    1 
ATOM   8818  C  CG    . ARG F 5 60  ? 54.353  67.291  19.193  1.00 118.10 ? 83  ARG D CG    1 
ATOM   8819  C  CD    . ARG F 5 60  ? 55.617  68.094  19.146  1.00 118.10 ? 83  ARG D CD    1 
ATOM   8820  N  NE    . ARG F 5 60  ? 56.781  67.335  19.586  1.00 118.10 ? 83  ARG D NE    1 
ATOM   8821  C  CZ    . ARG F 5 60  ? 57.036  67.029  20.854  1.00 118.10 ? 83  ARG D CZ    1 
ATOM   8822  N  NH1   . ARG F 5 60  ? 56.204  67.418  21.817  1.00 118.10 ? 83  ARG D NH1   1 
ATOM   8823  N  NH2   . ARG F 5 60  ? 58.132  66.353  21.165  1.00 118.10 ? 83  ARG D NH2   1 
ATOM   8824  N  N     . SER F 5 61  ? 52.349  64.751  16.336  1.00 32.97  ? 84  SER D N     1 
ATOM   8825  C  CA    . SER F 5 61  ? 51.188  64.277  15.606  1.00 32.97  ? 84  SER D CA    1 
ATOM   8826  C  C     . SER F 5 61  ? 49.900  64.369  16.419  1.00 32.97  ? 84  SER D C     1 
ATOM   8827  O  O     . SER F 5 61  ? 48.820  64.105  15.890  1.00 32.97  ? 84  SER D O     1 
ATOM   8828  C  CB    . SER F 5 61  ? 51.422  62.865  15.077  1.00 24.81  ? 84  SER D CB    1 
ATOM   8829  O  OG    . SER F 5 61  ? 51.965  62.066  16.098  1.00 24.81  ? 84  SER D OG    1 
ATOM   8830  N  N     . THR F 5 62  ? 50.008  64.693  17.711  1.00 34.98  ? 85  THR D N     1 
ATOM   8831  C  CA    . THR F 5 62  ? 48.807  64.851  18.537  1.00 34.98  ? 85  THR D CA    1 
ATOM   8832  C  C     . THR F 5 62  ? 48.704  66.289  19.042  1.00 34.98  ? 85  THR D C     1 
ATOM   8833  O  O     . THR F 5 62  ? 49.724  66.948  19.293  1.00 34.98  ? 85  THR D O     1 
ATOM   8834  C  CB    . THR F 5 62  ? 48.765  63.905  19.776  1.00 57.56  ? 85  THR D CB    1 
ATOM   8835  O  OG1   . THR F 5 62  ? 49.644  64.396  20.784  1.00 57.56  ? 85  THR D OG1   1 
ATOM   8836  C  CG2   . THR F 5 62  ? 49.203  62.514  19.423  1.00 57.56  ? 85  THR D CG2   1 
ATOM   8837  N  N     . ILE F 5 63  ? 47.475  66.793  19.077  1.00 36.02  ? 86  ILE D N     1 
ATOM   8838  C  CA    . ILE F 5 63  ? 47.218  68.129  19.598  1.00 36.02  ? 86  ILE D CA    1 
ATOM   8839  C  C     . ILE F 5 63  ? 46.669  67.971  21.019  1.00 36.02  ? 86  ILE D C     1 
ATOM   8840  O  O     . ILE F 5 63  ? 45.558  67.467  21.225  1.00 36.02  ? 86  ILE D O     1 
ATOM   8841  C  CB    . ILE F 5 63  ? 46.196  68.939  18.749  1.00 23.29  ? 86  ILE D CB    1 
ATOM   8842  C  CG1   . ILE F 5 63  ? 46.785  69.287  17.386  1.00 23.29  ? 86  ILE D CG1   1 
ATOM   8843  C  CG2   . ILE F 5 63  ? 45.837  70.247  19.463  1.00 23.29  ? 86  ILE D CG2   1 
ATOM   8844  C  CD1   . ILE F 5 63  ? 45.804  69.988  16.473  1.00 23.29  ? 86  ILE D CD1   1 
ATOM   8845  N  N     . THR F 5 64  ? 47.470  68.367  21.998  1.00 21.80  ? 87  THR D N     1 
ATOM   8846  C  CA    . THR F 5 64  ? 47.057  68.254  23.372  1.00 21.80  ? 87  THR D CA    1 
ATOM   8847  C  C     . THR F 5 64  ? 46.704  69.611  23.971  1.00 21.80  ? 87  THR D C     1 
ATOM   8848  O  O     . THR F 5 64  ? 46.809  70.655  23.317  1.00 21.80  ? 87  THR D O     1 
ATOM   8849  C  CB    . THR F 5 64  ? 48.168  67.614  24.192  1.00 24.46  ? 87  THR D CB    1 
ATOM   8850  O  OG1   . THR F 5 64  ? 49.342  68.432  24.106  1.00 24.46  ? 87  THR D OG1   1 
ATOM   8851  C  CG2   . THR F 5 64  ? 48.490  66.255  23.646  1.00 24.46  ? 87  THR D CG2   1 
ATOM   8852  N  N     . SER F 5 65  ? 46.300  69.596  25.232  1.00 36.60  ? 88  SER D N     1 
ATOM   8853  C  CA    . SER F 5 65  ? 45.958  70.827  25.911  1.00 36.60  ? 88  SER D CA    1 
ATOM   8854  C  C     . SER F 5 65  ? 47.102  71.841  25.801  1.00 36.60  ? 88  SER D C     1 
ATOM   8855  O  O     . SER F 5 65  ? 46.862  73.043  25.672  1.00 36.60  ? 88  SER D O     1 
ATOM   8856  C  CB    . SER F 5 65  ? 45.623  70.543  27.383  1.00 24.19  ? 88  SER D CB    1 
ATOM   8857  O  OG    . SER F 5 65  ? 46.755  70.102  28.110  1.00 24.19  ? 88  SER D OG    1 
ATOM   8858  N  N     . ARG F 5 66  ? 48.336  71.344  25.720  1.00 27.44  ? 89  ARG D N     1 
ATOM   8859  C  CA    . ARG F 5 66  ? 49.518  72.214  25.629  1.00 27.44  ? 89  ARG D CA    1 
ATOM   8860  C  C     . ARG F 5 66  ? 49.592  73.025  24.319  1.00 27.44  ? 89  ARG D C     1 
ATOM   8861  O  O     . ARG F 5 66  ? 50.023  74.184  24.298  1.00 27.44  ? 89  ARG D O     1 
ATOM   8862  C  CB    . ARG F 5 66  ? 50.781  71.382  25.790  1.00 46.42  ? 89  ARG D CB    1 
ATOM   8863  C  CG    . ARG F 5 66  ? 52.008  72.224  25.955  1.00 46.42  ? 89  ARG D CG    1 
ATOM   8864  C  CD    . ARG F 5 66  ? 53.247  71.393  26.279  1.00 46.42  ? 89  ARG D CD    1 
ATOM   8865  N  NE    . ARG F 5 66  ? 54.371  72.274  26.605  1.00 46.42  ? 89  ARG D NE    1 
ATOM   8866  C  CZ    . ARG F 5 66  ? 55.326  72.621  25.755  1.00 46.42  ? 89  ARG D CZ    1 
ATOM   8867  N  NH1   . ARG F 5 66  ? 55.321  72.151  24.519  1.00 46.42  ? 89  ARG D NH1   1 
ATOM   8868  N  NH2   . ARG F 5 66  ? 56.242  73.499  26.131  1.00 46.42  ? 89  ARG D NH2   1 
ATOM   8869  N  N     . GLU F 5 67  ? 49.184  72.405  23.219  1.00 33.49  ? 90  GLU D N     1 
ATOM   8870  C  CA    . GLU F 5 67  ? 49.195  73.105  21.951  1.00 33.49  ? 90  GLU D CA    1 
ATOM   8871  C  C     . GLU F 5 67  ? 48.141  74.200  22.076  1.00 33.49  ? 90  GLU D C     1 
ATOM   8872  O  O     . GLU F 5 67  ? 48.432  75.370  21.853  1.00 33.49  ? 90  GLU D O     1 
ATOM   8873  C  CB    . GLU F 5 67  ? 48.867  72.176  20.773  1.00 29.09  ? 90  GLU D CB    1 
ATOM   8874  C  CG    . GLU F 5 67  ? 49.285  70.694  20.886  1.00 29.09  ? 90  GLU D CG    1 
ATOM   8875  C  CD    . GLU F 5 67  ? 50.711  70.457  21.372  1.00 29.09  ? 90  GLU D CD    1 
ATOM   8876  O  OE1   . GLU F 5 67  ? 51.676  70.953  20.754  1.00 29.09  ? 90  GLU D OE1   1 
ATOM   8877  O  OE2   . GLU F 5 67  ? 50.859  69.741  22.382  1.00 29.09  ? 90  GLU D OE2   1 
ATOM   8878  N  N     . ILE F 5 68  ? 46.947  73.819  22.532  1.00 21.46  ? 91  ILE D N     1 
ATOM   8879  C  CA    . ILE F 5 68  ? 45.841  74.770  22.711  1.00 21.46  ? 91  ILE D CA    1 
ATOM   8880  C  C     . ILE F 5 68  ? 46.304  75.947  23.543  1.00 21.46  ? 91  ILE D C     1 
ATOM   8881  O  O     . ILE F 5 68  ? 46.072  77.093  23.166  1.00 21.46  ? 91  ILE D O     1 
ATOM   8882  C  CB    . ILE F 5 68  ? 44.589  74.135  23.427  1.00 13.51  ? 91  ILE D CB    1 
ATOM   8883  C  CG1   . ILE F 5 68  ? 44.138  72.865  22.691  1.00 13.51  ? 91  ILE D CG1   1 
ATOM   8884  C  CG2   . ILE F 5 68  ? 43.418  75.149  23.518  1.00 13.51  ? 91  ILE D CG2   1 
ATOM   8885  C  CD1   . ILE F 5 68  ? 43.865  73.082  21.249  1.00 13.51  ? 91  ILE D CD1   1 
ATOM   8886  N  N     . GLN F 5 69  ? 47.003  75.674  24.641  1.00 25.30  ? 92  GLN D N     1 
ATOM   8887  C  CA    . GLN F 5 69  ? 47.474  76.761  25.489  1.00 25.30  ? 92  GLN D CA    1 
ATOM   8888  C  C     . GLN F 5 69  ? 48.357  77.781  24.773  1.00 25.30  ? 92  GLN D C     1 
ATOM   8889  O  O     . GLN F 5 69  ? 48.107  78.979  24.891  1.00 25.30  ? 92  GLN D O     1 
ATOM   8890  C  CB    . GLN F 5 69  ? 48.137  76.272  26.781  1.00 53.72  ? 92  GLN D CB    1 
ATOM   8891  C  CG    . GLN F 5 69  ? 48.383  77.432  27.747  1.00 53.72  ? 92  GLN D CG    1 
ATOM   8892  C  CD    . GLN F 5 69  ? 48.830  77.027  29.148  1.00 53.72  ? 92  GLN D CD    1 
ATOM   8893  O  OE1   . GLN F 5 69  ? 50.019  77.026  29.447  1.00 53.72  ? 92  GLN D OE1   1 
ATOM   8894  N  NE2   . GLN F 5 69  ? 47.871  76.786  30.033  1.00 53.72  ? 92  GLN D NE2   1 
ATOM   8895  N  N     . THR F 5 70  ? 49.376  77.344  24.030  1.00 20.58  ? 93  THR D N     1 
ATOM   8896  C  CA    . THR F 5 70  ? 50.196  78.333  23.323  1.00 20.58  ? 93  THR D CA    1 
ATOM   8897  C  C     . THR F 5 70  ? 49.448  78.943  22.121  1.00 20.58  ? 93  THR D C     1 
ATOM   8898  O  O     . THR F 5 70  ? 49.654  80.091  21.777  1.00 20.58  ? 93  THR D O     1 
ATOM   8899  C  CB    . THR F 5 70  ? 51.621  77.812  22.968  1.00 32.75  ? 93  THR D CB    1 
ATOM   8900  O  OG1   . THR F 5 70  ? 51.524  76.501  22.420  1.00 32.75  ? 93  THR D OG1   1 
ATOM   8901  C  CG2   . THR F 5 70  ? 52.495  77.749  24.232  1.00 32.75  ? 93  THR D CG2   1 
ATOM   8902  N  N     . ALA F 5 71  ? 48.536  78.197  21.514  1.00 13.14  ? 94  ALA D N     1 
ATOM   8903  C  CA    . ALA F 5 71  ? 47.746  78.741  20.411  1.00 13.14  ? 94  ALA D CA    1 
ATOM   8904  C  C     . ALA F 5 71  ? 47.022  79.959  20.969  1.00 13.14  ? 94  ALA D C     1 
ATOM   8905  O  O     . ALA F 5 71  ? 47.028  81.031  20.372  1.00 13.14  ? 94  ALA D O     1 
ATOM   8906  C  CB    . ALA F 5 71  ? 46.735  77.720  19.949  1.00 17.14  ? 94  ALA D CB    1 
ATOM   8907  N  N     . VAL F 5 72  ? 46.415  79.770  22.143  1.00 15.28  ? 95  VAL D N     1 
ATOM   8908  C  CA    . VAL F 5 72  ? 45.690  80.821  22.843  1.00 15.28  ? 95  VAL D CA    1 
ATOM   8909  C  C     . VAL F 5 72  ? 46.595  82.014  23.093  1.00 15.28  ? 95  VAL D C     1 
ATOM   8910  O  O     . VAL F 5 72  ? 46.185  83.138  22.895  1.00 15.28  ? 95  VAL D O     1 
ATOM   8911  C  CB    . VAL F 5 72  ? 45.159  80.323  24.204  1.00 14.13  ? 95  VAL D CB    1 
ATOM   8912  C  CG1   . VAL F 5 72  ? 44.667  81.489  25.030  1.00 14.13  ? 95  VAL D CG1   1 
ATOM   8913  C  CG2   . VAL F 5 72  ? 44.051  79.289  23.995  1.00 14.13  ? 95  VAL D CG2   1 
ATOM   8914  N  N     . ARG F 5 73  ? 47.808  81.761  23.575  1.00 31.61  ? 96  ARG D N     1 
ATOM   8915  C  CA    . ARG F 5 73  ? 48.773  82.828  23.854  1.00 31.61  ? 96  ARG D CA    1 
ATOM   8916  C  C     . ARG F 5 73  ? 49.188  83.584  22.590  1.00 31.61  ? 96  ARG D C     1 
ATOM   8917  O  O     . ARG F 5 73  ? 49.354  84.810  22.609  1.00 31.61  ? 96  ARG D O     1 
ATOM   8918  C  CB    . ARG F 5 73  ? 50.000  82.254  24.547  1.00 42.27  ? 96  ARG D CB    1 
ATOM   8919  C  CG    . ARG F 5 73  ? 49.712  81.635  25.898  1.00 42.27  ? 96  ARG D CG    1 
ATOM   8920  C  CD    . ARG F 5 73  ? 50.064  82.587  27.034  1.00 42.27  ? 96  ARG D CD    1 
ATOM   8921  N  NE    . ARG F 5 73  ? 50.044  81.933  28.347  1.00 42.27  ? 96  ARG D NE    1 
ATOM   8922  C  CZ    . ARG F 5 73  ? 50.856  80.942  28.727  1.00 42.27  ? 96  ARG D CZ    1 
ATOM   8923  N  NH1   . ARG F 5 73  ? 51.782  80.464  27.901  1.00 42.27  ? 96  ARG D NH1   1 
ATOM   8924  N  NH2   . ARG F 5 73  ? 50.729  80.406  29.937  1.00 42.27  ? 96  ARG D NH2   1 
ATOM   8925  N  N     . LEU F 5 74  ? 49.357  82.853  21.494  1.00 29.71  ? 97  LEU D N     1 
ATOM   8926  C  CA    . LEU F 5 74  ? 49.735  83.456  20.230  1.00 29.71  ? 97  LEU D CA    1 
ATOM   8927  C  C     . LEU F 5 74  ? 48.621  84.276  19.618  1.00 29.71  ? 97  LEU D C     1 
ATOM   8928  O  O     . LEU F 5 74  ? 48.885  85.280  18.967  1.00 29.71  ? 97  LEU D O     1 
ATOM   8929  C  CB    . LEU F 5 74  ? 50.152  82.391  19.227  1.00 13.82  ? 97  LEU D CB    1 
ATOM   8930  C  CG    . LEU F 5 74  ? 51.515  81.735  19.428  1.00 13.82  ? 97  LEU D CG    1 
ATOM   8931  C  CD1   . LEU F 5 74  ? 51.564  80.425  18.618  1.00 13.82  ? 97  LEU D CD1   1 
ATOM   8932  C  CD2   . LEU F 5 74  ? 52.637  82.718  19.039  1.00 13.82  ? 97  LEU D CD2   1 
ATOM   8933  N  N     . LEU F 5 75  ? 47.382  83.851  19.831  1.00 17.35  ? 98  LEU D N     1 
ATOM   8934  C  CA    . LEU F 5 75  ? 46.242  84.537  19.259  1.00 17.35  ? 98  LEU D CA    1 
ATOM   8935  C  C     . LEU F 5 75  ? 45.528  85.612  20.098  1.00 17.35  ? 98  LEU D C     1 
ATOM   8936  O  O     . LEU F 5 75  ? 45.123  86.659  19.590  1.00 17.35  ? 98  LEU D O     1 
ATOM   8937  C  CB    . LEU F 5 75  ? 45.262  83.482  18.761  1.00 25.48  ? 98  LEU D CB    1 
ATOM   8938  C  CG    . LEU F 5 75  ? 44.077  83.980  17.955  1.00 25.48  ? 98  LEU D CG    1 
ATOM   8939  C  CD1   . LEU F 5 75  ? 44.475  84.213  16.535  1.00 25.48  ? 98  LEU D CD1   1 
ATOM   8940  C  CD2   . LEU F 5 75  ? 42.993  82.950  18.025  1.00 25.48  ? 98  LEU D CD2   1 
ATOM   8941  N  N     . LEU F 5 76  ? 45.358  85.379  21.377  1.00 23.96  ? 99  LEU D N     1 
ATOM   8942  C  CA    . LEU F 5 76  ? 44.661  86.364  22.183  1.00 23.96  ? 99  LEU D CA    1 
ATOM   8943  C  C     . LEU F 5 76  ? 45.547  87.465  22.732  1.00 23.96  ? 99  LEU D C     1 
ATOM   8944  O  O     . LEU F 5 76  ? 46.675  87.217  23.180  1.00 23.96  ? 99  LEU D O     1 
ATOM   8945  C  CB    . LEU F 5 76  ? 43.954  85.686  23.351  1.00 19.68  ? 99  LEU D CB    1 
ATOM   8946  C  CG    . LEU F 5 76  ? 43.076  84.504  22.978  1.00 19.68  ? 99  LEU D CG    1 
ATOM   8947  C  CD1   . LEU F 5 76  ? 42.344  84.027  24.216  1.00 19.68  ? 99  LEU D CD1   1 
ATOM   8948  C  CD2   . LEU F 5 76  ? 42.104  84.925  21.907  1.00 19.68  ? 99  LEU D CD2   1 
ATOM   8949  N  N     . PRO F 5 77  ? 45.060  88.712  22.674  1.00 33.99  ? 100 PRO D N     1 
ATOM   8950  C  CA    . PRO F 5 77  ? 45.813  89.859  23.183  1.00 33.99  ? 100 PRO D CA    1 
ATOM   8951  C  C     . PRO F 5 77  ? 45.918  89.853  24.702  1.00 33.99  ? 100 PRO D C     1 
ATOM   8952  O  O     . PRO F 5 77  ? 45.174  89.165  25.374  1.00 33.99  ? 100 PRO D O     1 
ATOM   8953  C  CB    . PRO F 5 77  ? 45.009  91.057  22.669  1.00 45.52  ? 100 PRO D CB    1 
ATOM   8954  C  CG    . PRO F 5 77  ? 43.640  90.502  22.444  1.00 45.52  ? 100 PRO D CG    1 
ATOM   8955  C  CD    . PRO F 5 77  ? 43.942  89.168  21.833  1.00 45.52  ? 100 PRO D CD    1 
ATOM   8956  N  N     . GLY F 5 78  ? 46.928  90.562  25.202  1.00 15.80  ? 101 GLY D N     1 
ATOM   8957  C  CA    . GLY F 5 78  ? 47.218  90.716  26.622  1.00 15.80  ? 101 GLY D CA    1 
ATOM   8958  C  C     . GLY F 5 78  ? 46.368  90.127  27.712  1.00 15.80  ? 101 GLY D C     1 
ATOM   8959  O  O     . GLY F 5 78  ? 46.422  88.938  27.939  1.00 15.80  ? 101 GLY D O     1 
ATOM   8960  N  N     . GLU F 5 79  ? 45.591  90.965  28.393  1.00 24.73  ? 102 GLU D N     1 
ATOM   8961  C  CA    . GLU F 5 79  ? 44.750  90.520  29.509  1.00 24.73  ? 102 GLU D CA    1 
ATOM   8962  C  C     . GLU F 5 79  ? 43.765  89.374  29.233  1.00 24.73  ? 102 GLU D C     1 
ATOM   8963  O  O     . GLU F 5 79  ? 43.536  88.528  30.092  1.00 24.73  ? 102 GLU D O     1 
ATOM   8964  C  CB    . GLU F 5 79  ? 44.025  91.710  30.135  1.00 59.05  ? 102 GLU D CB    1 
ATOM   8965  C  CG    . GLU F 5 79  ? 43.653  91.517  31.608  1.00 59.05  ? 102 GLU D CG    1 
ATOM   8966  C  CD    . GLU F 5 79  ? 44.862  91.361  32.541  1.00 59.05  ? 102 GLU D CD    1 
ATOM   8967  O  OE1   . GLU F 5 79  ? 46.003  91.687  32.134  1.00 59.05  ? 102 GLU D OE1   1 
ATOM   8968  O  OE2   . GLU F 5 79  ? 44.665  90.911  33.696  1.00 59.05  ? 102 GLU D OE2   1 
ATOM   8969  N  N     . LEU F 5 80  ? 43.247  89.306  28.014  1.00 35.08  ? 103 LEU D N     1 
ATOM   8970  C  CA    . LEU F 5 80  ? 42.293  88.276  27.607  1.00 35.08  ? 103 LEU D CA    1 
ATOM   8971  C  C     . LEU F 5 80  ? 42.981  86.917  27.537  1.00 35.08  ? 103 LEU D C     1 
ATOM   8972  O  O     . LEU F 5 80  ? 42.426  85.916  27.970  1.00 35.08  ? 103 LEU D O     1 
ATOM   8973  C  CB    . LEU F 5 80  ? 41.722  88.655  26.246  1.00 17.41  ? 103 LEU D CB    1 
ATOM   8974  C  CG    . LEU F 5 80  ? 40.280  88.394  25.851  1.00 17.41  ? 103 LEU D CG    1 
ATOM   8975  C  CD1   . LEU F 5 80  ? 39.310  88.707  26.990  1.00 17.41  ? 103 LEU D CD1   1 
ATOM   8976  C  CD2   . LEU F 5 80  ? 39.996  89.253  24.619  1.00 17.41  ? 103 LEU D CD2   1 
ATOM   8977  N  N     . ALA F 5 81  ? 44.189  86.884  26.979  1.00 28.75  ? 104 ALA D N     1 
ATOM   8978  C  CA    . ALA F 5 81  ? 44.972  85.655  26.884  1.00 28.75  ? 104 ALA D CA    1 
ATOM   8979  C  C     . ALA F 5 81  ? 45.257  85.161  28.300  1.00 28.75  ? 104 ALA D C     1 
ATOM   8980  O  O     . ALA F 5 81  ? 45.120  83.971  28.596  1.00 28.75  ? 104 ALA D O     1 
ATOM   8981  C  CB    . ALA F 5 81  ? 46.267  85.915  26.153  1.00 5.90   ? 104 ALA D CB    1 
ATOM   8982  N  N     . LYS F 5 82  ? 45.616  86.094  29.179  1.00 25.77  ? 105 LYS D N     1 
ATOM   8983  C  CA    . LYS F 5 82  ? 45.893  85.784  30.571  1.00 25.77  ? 105 LYS D CA    1 
ATOM   8984  C  C     . LYS F 5 82  ? 44.703  85.077  31.203  1.00 25.77  ? 105 LYS D C     1 
ATOM   8985  O  O     . LYS F 5 82  ? 44.856  84.005  31.795  1.00 25.77  ? 105 LYS D O     1 
ATOM   8986  C  CB    . LYS F 5 82  ? 46.226  87.062  31.333  1.00 66.01  ? 105 LYS D CB    1 
ATOM   8987  C  CG    . LYS F 5 82  ? 46.521  86.870  32.806  1.00 66.01  ? 105 LYS D CG    1 
ATOM   8988  C  CD    . LYS F 5 82  ? 47.262  88.078  33.380  1.00 66.01  ? 105 LYS D CD    1 
ATOM   8989  C  CE    . LYS F 5 82  ? 48.638  88.254  32.724  1.00 66.01  ? 105 LYS D CE    1 
ATOM   8990  N  NZ    . LYS F 5 82  ? 49.384  89.446  33.228  1.00 66.01  ? 105 LYS D NZ    1 
ATOM   8991  N  N     . HIS F 5 83  ? 43.509  85.640  31.033  1.00 27.76  ? 106 HIS D N     1 
ATOM   8992  C  CA    . HIS F 5 83  ? 42.314  85.027  31.611  1.00 27.76  ? 106 HIS D CA    1 
ATOM   8993  C  C     . HIS F 5 83  ? 41.886  83.690  30.985  1.00 27.76  ? 106 HIS D C     1 
ATOM   8994  O  O     . HIS F 5 83  ? 41.505  82.766  31.725  1.00 27.76  ? 106 HIS D O     1 
ATOM   8995  C  CB    . HIS F 5 83  ? 41.143  86.022  31.701  1.00 33.04  ? 106 HIS D CB    1 
ATOM   8996  C  CG    . HIS F 5 83  ? 41.311  87.081  32.758  1.00 33.04  ? 106 HIS D CG    1 
ATOM   8997  N  ND1   . HIS F 5 83  ? 40.923  88.391  32.566  1.00 33.04  ? 106 HIS D ND1   1 
ATOM   8998  C  CD2   . HIS F 5 83  ? 41.818  87.022  34.014  1.00 33.04  ? 106 HIS D CD2   1 
ATOM   8999  C  CE1   . HIS F 5 83  ? 41.188  89.095  33.653  1.00 33.04  ? 106 HIS D CE1   1 
ATOM   9000  N  NE2   . HIS F 5 83  ? 41.731  88.288  34.546  1.00 33.04  ? 106 HIS D NE2   1 
ATOM   9001  N  N     . ALA F 5 84  ? 41.946  83.574  29.649  1.00 28.67  ? 107 ALA D N     1 
ATOM   9002  C  CA    . ALA F 5 84  ? 41.601  82.308  28.960  1.00 28.67  ? 107 ALA D CA    1 
ATOM   9003  C  C     . ALA F 5 84  ? 42.451  81.154  29.495  1.00 28.67  ? 107 ALA D C     1 
ATOM   9004  O  O     . ALA F 5 84  ? 41.934  80.076  29.766  1.00 28.67  ? 107 ALA D O     1 
ATOM   9005  C  CB    . ALA F 5 84  ? 41.800  82.430  27.470  1.00 7.98   ? 107 ALA D CB    1 
ATOM   9006  N  N     . VAL F 5 85  ? 43.751  81.401  29.667  1.00 24.38  ? 108 VAL D N     1 
ATOM   9007  C  CA    . VAL F 5 85  ? 44.674  80.399  30.204  1.00 24.38  ? 108 VAL D CA    1 
ATOM   9008  C  C     . VAL F 5 85  ? 44.278  79.904  31.580  1.00 24.38  ? 108 VAL D C     1 
ATOM   9009  O  O     . VAL F 5 85  ? 44.321  78.700  31.822  1.00 24.38  ? 108 VAL D O     1 
ATOM   9010  C  CB    . VAL F 5 85  ? 46.122  80.905  30.238  1.00 23.34  ? 108 VAL D CB    1 
ATOM   9011  C  CG1   . VAL F 5 85  ? 47.048  79.828  30.824  1.00 23.34  ? 108 VAL D CG1   1 
ATOM   9012  C  CG2   . VAL F 5 85  ? 46.561  81.260  28.816  1.00 23.34  ? 108 VAL D CG2   1 
ATOM   9013  N  N     . SER F 5 86  ? 43.939  80.820  32.492  1.00 32.26  ? 109 SER D N     1 
ATOM   9014  C  CA    . SER F 5 86  ? 43.487  80.411  33.825  1.00 32.26  ? 109 SER D CA    1 
ATOM   9015  C  C     . SER F 5 86  ? 42.287  79.484  33.662  1.00 32.26  ? 109 SER D C     1 
ATOM   9016  O  O     . SER F 5 86  ? 42.301  78.357  34.129  1.00 32.26  ? 109 SER D O     1 
ATOM   9017  C  CB    . SER F 5 86  ? 43.076  81.606  34.671  1.00 46.18  ? 109 SER D CB    1 
ATOM   9018  O  OG    . SER F 5 86  ? 44.211  82.345  35.058  1.00 46.18  ? 109 SER D OG    1 
ATOM   9019  N  N     . GLU F 5 87  ? 41.279  79.943  32.937  1.00 29.42  ? 110 GLU D N     1 
ATOM   9020  C  CA    . GLU F 5 87  ? 40.092  79.144  32.709  1.00 29.42  ? 110 GLU D CA    1 
ATOM   9021  C  C     . GLU F 5 87  ? 40.434  77.786  32.096  1.00 29.42  ? 110 GLU D C     1 
ATOM   9022  O  O     . GLU F 5 87  ? 39.981  76.754  32.582  1.00 29.42  ? 110 GLU D O     1 
ATOM   9023  C  CB    . GLU F 5 87  ? 39.108  79.903  31.817  1.00 82.75  ? 110 GLU D CB    1 
ATOM   9024  C  CG    . GLU F 5 87  ? 38.442  81.101  32.492  1.00 82.75  ? 110 GLU D CG    1 
ATOM   9025  C  CD    . GLU F 5 87  ? 37.007  80.832  32.924  1.00 82.75  ? 110 GLU D CD    1 
ATOM   9026  O  OE1   . GLU F 5 87  ? 36.419  79.806  32.510  1.00 82.75  ? 110 GLU D OE1   1 
ATOM   9027  O  OE2   . GLU F 5 87  ? 36.456  81.672  33.664  1.00 82.75  ? 110 GLU D OE2   1 
ATOM   9028  N  N     . GLY F 5 88  ? 41.247  77.780  31.045  1.00 23.14  ? 111 GLY D N     1 
ATOM   9029  C  CA    . GLY F 5 88  ? 41.626  76.531  30.407  1.00 23.14  ? 111 GLY D CA    1 
ATOM   9030  C  C     . GLY F 5 88  ? 42.271  75.566  31.378  1.00 23.14  ? 111 GLY D C     1 
ATOM   9031  O  O     . GLY F 5 88  ? 41.766  74.479  31.602  1.00 23.14  ? 111 GLY D O     1 
ATOM   9032  N  N     . THR F 5 89  ? 43.370  75.976  31.995  1.00 33.21  ? 112 THR D N     1 
ATOM   9033  C  CA    . THR F 5 89  ? 44.052  75.129  32.957  1.00 33.21  ? 112 THR D CA    1 
ATOM   9034  C  C     . THR F 5 89  ? 43.048  74.659  34.006  1.00 33.21  ? 112 THR D C     1 
ATOM   9035  O  O     . THR F 5 89  ? 42.929  73.474  34.246  1.00 33.21  ? 112 THR D O     1 
ATOM   9036  C  CB    . THR F 5 89  ? 45.165  75.891  33.648  1.00 27.40  ? 112 THR D CB    1 
ATOM   9037  O  OG1   . THR F 5 89  ? 45.944  76.578  32.663  1.00 27.40  ? 112 THR D OG1   1 
ATOM   9038  C  CG2   . THR F 5 89  ? 46.048  74.937  34.419  1.00 27.40  ? 112 THR D CG2   1 
ATOM   9039  N  N     . LYS F 5 90  ? 42.283  75.593  34.566  1.00 22.13  ? 113 LYS D N     1 
ATOM   9040  C  CA    . LYS F 5 90  ? 41.271  75.308  35.571  1.00 22.13  ? 113 LYS D CA    1 
ATOM   9041  C  C     . LYS F 5 90  ? 40.417  74.117  35.118  1.00 22.13  ? 113 LYS D C     1 
ATOM   9042  O  O     . LYS F 5 90  ? 40.376  73.085  35.774  1.00 22.13  ? 113 LYS D O     1 
ATOM   9043  C  CB    . LYS F 5 90  ? 40.388  76.543  35.743  1.00 73.02  ? 113 LYS D CB    1 
ATOM   9044  C  CG    . LYS F 5 90  ? 39.643  76.659  37.057  1.00 73.02  ? 113 LYS D CG    1 
ATOM   9045  C  CD    . LYS F 5 90  ? 38.628  77.802  36.974  1.00 73.02  ? 113 LYS D CD    1 
ATOM   9046  C  CE    . LYS F 5 90  ? 38.199  78.318  38.346  1.00 73.02  ? 113 LYS D CE    1 
ATOM   9047  N  NZ    . LYS F 5 90  ? 37.499  77.321  39.201  1.00 73.02  ? 113 LYS D NZ    1 
ATOM   9048  N  N     . ALA F 5 91  ? 39.788  74.238  33.958  1.00 25.11  ? 114 ALA D N     1 
ATOM   9049  C  CA    . ALA F 5 91  ? 38.947  73.185  33.433  1.00 25.11  ? 114 ALA D CA    1 
ATOM   9050  C  C     . ALA F 5 91  ? 39.680  71.867  33.272  1.00 25.11  ? 114 ALA D C     1 
ATOM   9051  O  O     . ALA F 5 91  ? 39.196  70.820  33.690  1.00 25.11  ? 114 ALA D O     1 
ATOM   9052  C  CB    . ALA F 5 91  ? 38.356  73.607  32.127  1.00 14.18  ? 114 ALA D CB    1 
ATOM   9053  N  N     . VAL F 5 92  ? 40.852  71.898  32.671  1.00 29.90  ? 115 VAL D N     1 
ATOM   9054  C  CA    . VAL F 5 92  ? 41.594  70.655  32.490  1.00 29.90  ? 115 VAL D CA    1 
ATOM   9055  C  C     . VAL F 5 92  ? 41.901  69.957  33.815  1.00 29.90  ? 115 VAL D C     1 
ATOM   9056  O  O     . VAL F 5 92  ? 41.571  68.790  33.984  1.00 29.90  ? 115 VAL D O     1 
ATOM   9057  C  CB    . VAL F 5 92  ? 42.867  70.884  31.669  1.00 24.44  ? 115 VAL D CB    1 
ATOM   9058  C  CG1   . VAL F 5 92  ? 43.741  69.661  31.707  1.00 24.44  ? 115 VAL D CG1   1 
ATOM   9059  C  CG2   . VAL F 5 92  ? 42.477  71.233  30.213  1.00 24.44  ? 115 VAL D CG2   1 
ATOM   9060  N  N     . THR F 5 93  ? 42.474  70.697  34.760  1.00 25.58  ? 116 THR D N     1 
ATOM   9061  C  CA    . THR F 5 93  ? 42.796  70.189  36.087  1.00 25.58  ? 116 THR D CA    1 
ATOM   9062  C  C     . THR F 5 93  ? 41.564  69.512  36.699  1.00 25.58  ? 116 THR D C     1 
ATOM   9063  O  O     . THR F 5 93  ? 41.654  68.376  37.178  1.00 25.58  ? 116 THR D O     1 
ATOM   9064  C  CB    . THR F 5 93  ? 43.237  71.330  37.018  1.00 25.88  ? 116 THR D CB    1 
ATOM   9065  O  OG1   . THR F 5 93  ? 44.379  71.976  36.460  1.00 25.88  ? 116 THR D OG1   1 
ATOM   9066  C  CG2   . THR F 5 93  ? 43.615  70.806  38.385  1.00 25.88  ? 116 THR D CG2   1 
ATOM   9067  N  N     . LYS F 5 94  ? 40.418  70.202  36.670  1.00 49.18  ? 117 LYS D N     1 
ATOM   9068  C  CA    . LYS F 5 94  ? 39.182  69.650  37.209  1.00 49.18  ? 117 LYS D CA    1 
ATOM   9069  C  C     . LYS F 5 94  ? 38.730  68.405  36.461  1.00 49.18  ? 117 LYS D C     1 
ATOM   9070  O  O     . LYS F 5 94  ? 38.230  67.463  37.073  1.00 49.18  ? 117 LYS D O     1 
ATOM   9071  C  CB    . LYS F 5 94  ? 38.036  70.669  37.215  1.00 32.95  ? 117 LYS D CB    1 
ATOM   9072  C  CG    . LYS F 5 94  ? 36.824  70.116  38.000  1.00 32.95  ? 117 LYS D CG    1 
ATOM   9073  C  CD    . LYS F 5 94  ? 35.528  70.936  37.983  1.00 32.95  ? 117 LYS D CD    1 
ATOM   9074  C  CE    . LYS F 5 94  ? 34.565  70.433  39.092  1.00 32.95  ? 117 LYS D CE    1 
ATOM   9075  N  NZ    . LYS F 5 94  ? 33.096  70.720  38.935  1.00 32.95  ? 117 LYS D NZ    1 
ATOM   9076  N  N     . TYR F 5 95  ? 38.841  68.418  35.139  1.00 28.93  ? 118 TYR D N     1 
ATOM   9077  C  CA    . TYR F 5 95  ? 38.445  67.260  34.348  1.00 28.93  ? 118 TYR D CA    1 
ATOM   9078  C  C     . TYR F 5 95  ? 39.219  65.998  34.731  1.00 28.93  ? 118 TYR D C     1 
ATOM   9079  O  O     . TYR F 5 95  ? 38.612  64.959  34.980  1.00 28.93  ? 118 TYR D O     1 
ATOM   9080  C  CB    . TYR F 5 95  ? 38.662  67.538  32.872  1.00 49.98  ? 118 TYR D CB    1 
ATOM   9081  C  CG    . TYR F 5 95  ? 38.395  66.354  31.969  1.00 49.98  ? 118 TYR D CG    1 
ATOM   9082  C  CD1   . TYR F 5 95  ? 37.100  66.035  31.581  1.00 49.98  ? 118 TYR D CD1   1 
ATOM   9083  C  CD2   . TYR F 5 95  ? 39.446  65.606  31.432  1.00 49.98  ? 118 TYR D CD2   1 
ATOM   9084  C  CE1   . TYR F 5 95  ? 36.850  65.011  30.668  1.00 49.98  ? 118 TYR D CE1   1 
ATOM   9085  C  CE2   . TYR F 5 95  ? 39.208  64.579  30.517  1.00 49.98  ? 118 TYR D CE2   1 
ATOM   9086  C  CZ    . TYR F 5 95  ? 37.905  64.291  30.133  1.00 49.98  ? 118 TYR D CZ    1 
ATOM   9087  O  OH    . TYR F 5 95  ? 37.650  63.321  29.178  1.00 49.98  ? 118 TYR D OH    1 
ATOM   9088  N  N     . THR F 5 96  ? 40.550  66.099  34.774  1.00 54.75  ? 119 THR D N     1 
ATOM   9089  C  CA    . THR F 5 96  ? 41.418  64.968  35.118  1.00 54.75  ? 119 THR D CA    1 
ATOM   9090  C  C     . THR F 5 96  ? 41.244  64.467  36.542  1.00 54.75  ? 119 THR D C     1 
ATOM   9091  O  O     . THR F 5 96  ? 41.786  63.411  36.884  1.00 54.75  ? 119 THR D O     1 
ATOM   9092  C  CB    . THR F 5 96  ? 42.904  65.303  34.942  1.00 49.95  ? 119 THR D CB    1 
ATOM   9093  O  OG1   . THR F 5 96  ? 43.284  66.316  35.884  1.00 49.95  ? 119 THR D OG1   1 
ATOM   9094  C  CG2   . THR F 5 96  ? 43.172  65.779  33.544  1.00 49.95  ? 119 THR D CG2   1 
ATOM   9095  N  N     . SER F 5 97  ? 40.566  65.267  37.374  1.00 52.09  ? 120 SER D N     1 
ATOM   9096  C  CA    . SER F 5 97  ? 40.282  64.934  38.776  1.00 52.09  ? 120 SER D CA    1 
ATOM   9097  C  C     . SER F 5 97  ? 39.217  63.853  38.905  1.00 52.09  ? 120 SER D C     1 
ATOM   9098  O  O     . SER F 5 97  ? 38.916  63.402  40.017  1.00 52.09  ? 120 SER D O     1 
ATOM   9099  C  CB    . SER F 5 97  ? 39.832  66.169  39.555  1.00 46.30  ? 120 SER D CB    1 
ATOM   9100  O  OG    . SER F 5 97  ? 40.881  67.114  39.649  1.00 46.30  ? 120 SER D OG    1 
ATOM   9101  N  N     . ALA F 5 98  ? 38.625  63.476  37.772  1.00 101.37 ? 121 ALA D N     1 
ATOM   9102  C  CA    . ALA F 5 98  ? 37.607  62.434  37.721  1.00 101.37 ? 121 ALA D CA    1 
ATOM   9103  C  C     . ALA F 5 98  ? 38.284  61.068  37.609  1.00 101.37 ? 121 ALA D C     1 
ATOM   9104  O  O     . ALA F 5 98  ? 39.012  60.801  36.648  1.00 101.37 ? 121 ALA D O     1 
ATOM   9105  C  CB    . ALA F 5 98  ? 36.672  62.664  36.533  1.00 115.63 ? 121 ALA D CB    1 
ATOM   9106  N  N     . LYS F 5 99  ? 38.061  60.227  38.615  1.00 131.28 ? 122 LYS D N     1 
ATOM   9107  C  CA    . LYS F 5 99  ? 38.633  58.886  38.656  1.00 131.28 ? 122 LYS D CA    1 
ATOM   9108  C  C     . LYS F 5 99  ? 37.745  57.878  37.919  1.00 131.28 ? 122 LYS D C     1 
ATOM   9109  O  O     . LYS F 5 99  ? 38.186  57.416  36.843  1.00 93.89  ? 122 LYS D O     1 
ATOM   9110  C  CB    . LYS F 5 99  ? 38.857  58.455  40.111  1.00 93.89  ? 122 LYS D CB    1 
ATOM   9111  C  CG    . LYS F 5 99  ? 39.295  57.013  40.294  1.00 93.89  ? 122 LYS D CG    1 
ATOM   9112  C  CD    . LYS F 5 99  ? 39.533  56.715  41.756  1.00 93.89  ? 122 LYS D CD    1 
ATOM   9113  C  CE    . LYS F 5 99  ? 39.931  55.274  41.968  1.00 93.89  ? 122 LYS D CE    1 
ATOM   9114  N  NZ    . LYS F 5 99  ? 40.659  55.134  43.257  1.00 93.89  ? 122 LYS D NZ    1 
ATOM   9115  O  OXT   . LYS F 5 99  ? 36.628  57.571  38.406  1.00 93.89  ? 122 LYS D OXT   1 
ATOM   9116  N  N     . LEU G 2 1   ? -14.486 153.224 11.692  1.00 106.36 ? 20  LEU E N     1 
ATOM   9117  C  CA    . LEU G 2 1   ? -13.348 153.712 12.530  1.00 106.36 ? 20  LEU E CA    1 
ATOM   9118  C  C     . LEU G 2 1   ? -12.884 155.127 12.154  1.00 106.36 ? 20  LEU E C     1 
ATOM   9119  O  O     . LEU G 2 1   ? -12.574 155.407 10.993  1.00 106.36 ? 20  LEU E O     1 
ATOM   9120  C  CB    . LEU G 2 1   ? -12.167 152.724 12.473  1.00 128.73 ? 20  LEU E CB    1 
ATOM   9121  C  CG    . LEU G 2 1   ? -12.309 151.374 13.195  1.00 128.73 ? 20  LEU E CG    1 
ATOM   9122  C  CD1   . LEU G 2 1   ? -11.098 150.489 12.913  1.00 128.73 ? 20  LEU E CD1   1 
ATOM   9123  C  CD2   . LEU G 2 1   ? -12.467 151.596 14.695  1.00 128.73 ? 20  LEU E CD2   1 
ATOM   9124  N  N     . ALA G 2 2   ? -12.841 156.002 13.160  1.00 91.92  ? 21  ALA E N     1 
ATOM   9125  C  CA    . ALA G 2 2   ? -12.430 157.408 13.027  1.00 91.92  ? 21  ALA E CA    1 
ATOM   9126  C  C     . ALA G 2 2   ? -11.630 157.784 14.285  1.00 91.92  ? 21  ALA E C     1 
ATOM   9127  O  O     . ALA G 2 2   ? -10.769 158.675 14.261  1.00 91.92  ? 21  ALA E O     1 
ATOM   9128  C  CB    . ALA G 2 2   ? -13.670 158.307 12.908  1.00 42.87  ? 21  ALA E CB    1 
ATOM   9129  N  N     . THR G 2 3   ? -11.903 157.024 15.350  1.00 177.26 ? 22  THR E N     1 
ATOM   9130  C  CA    . THR G 2 3   ? -11.321 157.144 16.692  1.00 177.26 ? 22  THR E CA    1 
ATOM   9131  C  C     . THR G 2 3   ? -9.813  157.436 16.784  1.00 177.26 ? 22  THR E C     1 
ATOM   9132  O  O     . THR G 2 3   ? -9.084  157.398 15.790  1.00 177.26 ? 22  THR E O     1 
ATOM   9133  C  CB    . THR G 2 3   ? -11.649 155.861 17.536  1.00 118.64 ? 22  THR E CB    1 
ATOM   9134  O  OG1   . THR G 2 3   ? -12.936 155.358 17.155  1.00 118.64 ? 22  THR E OG1   1 
ATOM   9135  C  CG2   . THR G 2 3   ? -11.681 156.167 19.040  1.00 118.64 ? 22  THR E CG2   1 
ATOM   9136  N  N     . LYS G 2 4   ? -9.378  157.713 18.010  1.00 182.95 ? 23  LYS E N     1 
ATOM   9137  C  CA    . LYS G 2 4   ? -8.000  158.041 18.372  1.00 182.95 ? 23  LYS E CA    1 
ATOM   9138  C  C     . LYS G 2 4   ? -6.827  157.251 17.755  1.00 182.95 ? 23  LYS E C     1 
ATOM   9139  O  O     . LYS G 2 4   ? -6.235  157.688 16.763  1.00 182.95 ? 23  LYS E O     1 
ATOM   9140  C  CB    . LYS G 2 4   ? -7.877  158.014 19.899  1.00 143.82 ? 23  LYS E CB    1 
ATOM   9141  C  CG    . LYS G 2 4   ? -8.862  158.909 20.649  1.00 143.82 ? 23  LYS E CG    1 
ATOM   9142  C  CD    . LYS G 2 4   ? -9.068  158.376 22.056  1.00 143.82 ? 23  LYS E CD    1 
ATOM   9143  C  CE    . LYS G 2 4   ? -7.732  158.123 22.734  1.00 143.82 ? 23  LYS E CE    1 
ATOM   9144  N  NZ    . LYS G 2 4   ? -7.855  157.189 23.880  1.00 143.82 ? 23  LYS E NZ    1 
ATOM   9145  N  N     . ALA G 2 5   ? -6.488  156.101 18.346  1.00 156.15 ? 24  ALA E N     1 
ATOM   9146  C  CA    . ALA G 2 5   ? -5.347  155.302 17.883  1.00 156.15 ? 24  ALA E CA    1 
ATOM   9147  C  C     . ALA G 2 5   ? -5.606  154.052 17.041  1.00 156.15 ? 24  ALA E C     1 
ATOM   9148  O  O     . ALA G 2 5   ? -6.271  153.109 17.483  1.00 156.15 ? 24  ALA E O     1 
ATOM   9149  C  CB    . ALA G 2 5   ? -4.444  154.952 19.070  1.00 77.70  ? 24  ALA E CB    1 
ATOM   9150  N  N     . ALA G 2 6   ? -5.004  154.059 15.849  1.00 167.90 ? 25  ALA E N     1 
ATOM   9151  C  CA    . ALA G 2 6   ? -5.061  152.982 14.851  1.00 167.90 ? 25  ALA E CA    1 
ATOM   9152  C  C     . ALA G 2 6   ? -4.699  153.506 13.451  1.00 167.90 ? 25  ALA E C     1 
ATOM   9153  O  O     . ALA G 2 6   ? -4.265  152.730 12.598  1.00 167.90 ? 25  ALA E O     1 
ATOM   9154  C  CB    . ALA G 2 6   ? -6.439  152.300 14.821  1.00 58.63  ? 25  ALA E CB    1 
ATOM   9155  N  N     . ARG G 2 7   ? -4.842  154.822 13.246  1.00 136.36 ? 26  ARG E N     1 
ATOM   9156  C  CA    . ARG G 2 7   ? -4.561  155.506 11.965  1.00 136.36 ? 26  ARG E CA    1 
ATOM   9157  C  C     . ARG G 2 7   ? -3.413  154.958 11.104  1.00 136.36 ? 26  ARG E C     1 
ATOM   9158  O  O     . ARG G 2 7   ? -2.239  155.181 11.414  1.00 136.36 ? 26  ARG E O     1 
ATOM   9159  C  CB    . ARG G 2 7   ? -4.328  157.002 12.203  1.00 164.62 ? 26  ARG E CB    1 
ATOM   9160  C  CG    . ARG G 2 7   ? -5.590  157.832 12.334  1.00 164.62 ? 26  ARG E CG    1 
ATOM   9161  C  CD    . ARG G 2 7   ? -5.251  159.314 12.392  1.00 164.62 ? 26  ARG E CD    1 
ATOM   9162  N  NE    . ARG G 2 7   ? -6.415  160.158 12.123  1.00 164.62 ? 26  ARG E NE    1 
ATOM   9163  C  CZ    . ARG G 2 7   ? -6.350  161.406 11.663  1.00 164.62 ? 26  ARG E CZ    1 
ATOM   9164  N  NH1   . ARG G 2 7   ? -5.174  161.972 11.424  1.00 164.62 ? 26  ARG E NH1   1 
ATOM   9165  N  NH2   . ARG G 2 7   ? -7.465  162.080 11.416  1.00 164.62 ? 26  ARG E NH2   1 
ATOM   9166  N  N     . LYS G 2 8   ? -3.777  154.311 9.991   1.00 179.64 ? 27  LYS E N     1 
ATOM   9167  C  CA    . LYS G 2 8   ? -2.842  153.687 9.036   1.00 179.64 ? 27  LYS E CA    1 
ATOM   9168  C  C     . LYS G 2 8   ? -1.484  153.276 9.602   1.00 179.64 ? 27  LYS E C     1 
ATOM   9169  O  O     . LYS G 2 8   ? -0.425  153.628 9.071   1.00 179.64 ? 27  LYS E O     1 
ATOM   9170  C  CB    . LYS G 2 8   ? -2.694  154.516 7.751   1.00 106.28 ? 27  LYS E CB    1 
ATOM   9171  C  CG    . LYS G 2 8   ? -3.870  154.340 6.785   1.00 106.28 ? 27  LYS E CG    1 
ATOM   9172  C  CD    . LYS G 2 8   ? -3.557  154.874 5.388   1.00 106.28 ? 27  LYS E CD    1 
ATOM   9173  C  CE    . LYS G 2 8   ? -4.720  154.641 4.413   1.00 106.28 ? 27  LYS E CE    1 
ATOM   9174  N  NZ    . LYS G 2 8   ? -4.458  155.175 3.036   1.00 106.28 ? 27  LYS E NZ    1 
ATOM   9175  N  N     . SER G 2 9   ? -1.553  152.539 10.708  1.00 177.31 ? 28  SER E N     1 
ATOM   9176  C  CA    . SER G 2 9   ? -0.388  152.027 11.416  1.00 177.31 ? 28  SER E CA    1 
ATOM   9177  C  C     . SER G 2 9   ? -0.064  150.610 10.918  1.00 177.31 ? 28  SER E C     1 
ATOM   9178  O  O     . SER G 2 9   ? -0.172  149.637 11.674  1.00 177.31 ? 28  SER E O     1 
ATOM   9179  C  CB    . SER G 2 9   ? -0.680  152.027 12.928  1.00 87.20  ? 28  SER E CB    1 
ATOM   9180  O  OG    . SER G 2 9   ? 0.426   151.581 13.693  1.00 87.20  ? 28  SER E OG    1 
ATOM   9181  N  N     . ALA G 2 10  ? 0.294   150.502 9.634   1.00 182.81 ? 29  ALA E N     1 
ATOM   9182  C  CA    . ALA G 2 10  ? 0.650   149.216 9.015   1.00 182.81 ? 29  ALA E CA    1 
ATOM   9183  C  C     . ALA G 2 10  ? 1.956   148.633 9.586   1.00 182.81 ? 29  ALA E C     1 
ATOM   9184  O  O     . ALA G 2 10  ? 2.071   147.411 9.734   1.00 182.81 ? 29  ALA E O     1 
ATOM   9185  C  CB    . ALA G 2 10  ? 0.724   149.339 7.467   1.00 79.14  ? 29  ALA E CB    1 
ATOM   9186  N  N     . PRO G 2 11  ? 2.970   149.491 9.866   1.00 200.00 ? 30  PRO E N     1 
ATOM   9187  C  CA    . PRO G 2 11  ? 4.246   149.012 10.424  1.00 200.00 ? 30  PRO E CA    1 
ATOM   9188  C  C     . PRO G 2 11  ? 4.284   148.906 11.969  1.00 200.00 ? 30  PRO E C     1 
ATOM   9189  O  O     . PRO G 2 11  ? 5.026   149.640 12.633  1.00 200.00 ? 30  PRO E O     1 
ATOM   9190  C  CB    . PRO G 2 11  ? 5.246   150.048 9.905   1.00 151.78 ? 30  PRO E CB    1 
ATOM   9191  C  CG    . PRO G 2 11  ? 4.445   151.315 9.930   1.00 151.78 ? 30  PRO E CG    1 
ATOM   9192  C  CD    . PRO G 2 11  ? 3.128   150.865 9.335   1.00 151.78 ? 30  PRO E CD    1 
ATOM   9193  N  N     . ALA G 2 12  ? 3.491   147.988 12.528  1.00 163.95 ? 31  ALA E N     1 
ATOM   9194  C  CA    . ALA G 2 12  ? 3.437   147.777 13.980  1.00 163.95 ? 31  ALA E CA    1 
ATOM   9195  C  C     . ALA G 2 12  ? 4.314   146.592 14.406  1.00 163.95 ? 31  ALA E C     1 
ATOM   9196  O  O     . ALA G 2 12  ? 5.190   146.742 15.263  1.00 163.95 ? 31  ALA E O     1 
ATOM   9197  C  CB    . ALA G 2 12  ? 1.986   147.579 14.444  1.00 46.45  ? 31  ALA E CB    1 
ATOM   9198  N  N     . THR G 2 13  ? 4.069   145.419 13.819  1.00 146.03 ? 32  THR E N     1 
ATOM   9199  C  CA    . THR G 2 13  ? 4.865   144.230 14.128  1.00 146.03 ? 32  THR E CA    1 
ATOM   9200  C  C     . THR G 2 13  ? 6.031   144.112 13.141  1.00 146.03 ? 32  THR E C     1 
ATOM   9201  O  O     . THR G 2 13  ? 5.943   143.414 12.125  1.00 146.03 ? 32  THR E O     1 
ATOM   9202  C  CB    . THR G 2 13  ? 4.021   142.909 14.137  1.00 121.24 ? 32  THR E CB    1 
ATOM   9203  O  OG1   . THR G 2 13  ? 3.385   142.710 12.867  1.00 121.24 ? 32  THR E OG1   1 
ATOM   9204  C  CG2   . THR G 2 13  ? 2.968   142.946 15.245  1.00 121.24 ? 32  THR E CG2   1 
ATOM   9205  N  N     . GLY G 2 14  ? 7.103   144.845 13.436  1.00 131.57 ? 33  GLY E N     1 
ATOM   9206  C  CA    . GLY G 2 14  ? 8.288   144.828 12.597  1.00 131.57 ? 33  GLY E CA    1 
ATOM   9207  C  C     . GLY G 2 14  ? 9.298   143.781 13.033  1.00 131.57 ? 33  GLY E C     1 
ATOM   9208  O  O     . GLY G 2 14  ? 10.299  143.560 12.348  1.00 131.57 ? 33  GLY E O     1 
ATOM   9209  N  N     . GLY G 2 15  ? 9.033   143.137 14.170  1.00 141.43 ? 34  GLY E N     1 
ATOM   9210  C  CA    . GLY G 2 15  ? 9.925   142.111 14.689  1.00 141.43 ? 34  GLY E CA    1 
ATOM   9211  C  C     . GLY G 2 15  ? 9.829   140.769 13.977  1.00 141.43 ? 34  GLY E C     1 
ATOM   9212  O  O     . GLY G 2 15  ? 10.669  139.887 14.184  1.00 141.43 ? 34  GLY E O     1 
ATOM   9213  N  N     . VAL G 2 16  ? 8.792   140.605 13.156  1.00 191.87 ? 35  VAL E N     1 
ATOM   9214  C  CA    . VAL G 2 16  ? 8.579   139.371 12.397  1.00 191.87 ? 35  VAL E CA    1 
ATOM   9215  C  C     . VAL G 2 16  ? 9.507   139.402 11.157  1.00 191.87 ? 35  VAL E C     1 
ATOM   9216  O  O     . VAL G 2 16  ? 9.272   140.173 10.219  1.00 191.87 ? 35  VAL E O     1 
ATOM   9217  C  CB    . VAL G 2 16  ? 7.059   139.229 11.975  1.00 99.07  ? 35  VAL E CB    1 
ATOM   9218  C  CG1   . VAL G 2 16  ? 6.739   137.798 11.514  1.00 99.07  ? 35  VAL E CG1   1 
ATOM   9219  C  CG2   . VAL G 2 16  ? 6.133   139.629 13.133  1.00 99.07  ? 35  VAL E CG2   1 
ATOM   9220  N  N     . LYS G 2 17  ? 10.592  138.616 11.186  1.00 162.54 ? 36  LYS E N     1 
ATOM   9221  C  CA    . LYS G 2 17  ? 11.547  138.565 10.068  1.00 162.54 ? 36  LYS E CA    1 
ATOM   9222  C  C     . LYS G 2 17  ? 11.201  137.559 8.963   1.00 162.54 ? 36  LYS E C     1 
ATOM   9223  O  O     . LYS G 2 17  ? 10.363  136.676 9.154   1.00 162.54 ? 36  LYS E O     1 
ATOM   9224  C  CB    . LYS G 2 17  ? 12.988  138.395 10.567  1.00 109.10 ? 36  LYS E CB    1 
ATOM   9225  C  CG    . LYS G 2 17  ? 13.495  139.613 11.350  1.00 109.10 ? 36  LYS E CG    1 
ATOM   9226  C  CD    . LYS G 2 17  ? 13.226  140.906 10.583  1.00 109.10 ? 36  LYS E CD    1 
ATOM   9227  C  CE    . LYS G 2 17  ? 13.305  142.132 11.477  1.00 109.10 ? 36  LYS E CE    1 
ATOM   9228  N  NZ    . LYS G 2 17  ? 14.690  142.624 11.732  1.00 109.10 ? 36  LYS E NZ    1 
ATOM   9229  N  N     . LYS G 2 18  ? 11.910  137.647 7.840   1.00 132.82 ? 37  LYS E N     1 
ATOM   9230  C  CA    . LYS G 2 18  ? 11.606  136.821 6.676   1.00 132.82 ? 37  LYS E CA    1 
ATOM   9231  C  C     . LYS G 2 18  ? 11.835  135.284 6.653   1.00 132.82 ? 37  LYS E C     1 
ATOM   9232  O  O     . LYS G 2 18  ? 10.943  134.547 7.094   1.00 132.82 ? 37  LYS E O     1 
ATOM   9233  C  CB    . LYS G 2 18  ? 12.063  137.546 5.398   1.00 78.08  ? 37  LYS E CB    1 
ATOM   9234  C  CG    . LYS G 2 18  ? 11.485  138.972 5.244   1.00 78.08  ? 37  LYS E CG    1 
ATOM   9235  C  CD    . LYS G 2 18  ? 12.185  139.979 6.172   1.00 78.08  ? 37  LYS E CD    1 
ATOM   9236  C  CE    . LYS G 2 18  ? 11.262  141.104 6.644   1.00 78.08  ? 37  LYS E CE    1 
ATOM   9237  N  NZ    . LYS G 2 18  ? 11.921  141.926 7.705   1.00 78.08  ? 37  LYS E NZ    1 
ATOM   9238  N  N     . PRO G 2 19  ? 12.991  134.769 6.152   1.00 156.93 ? 38  PRO E N     1 
ATOM   9239  C  CA    . PRO G 2 19  ? 13.100  133.299 6.170   1.00 156.93 ? 38  PRO E CA    1 
ATOM   9240  C  C     . PRO G 2 19  ? 14.101  132.704 7.177   1.00 156.93 ? 38  PRO E C     1 
ATOM   9241  O  O     . PRO G 2 19  ? 14.402  133.326 8.199   1.00 156.93 ? 38  PRO E O     1 
ATOM   9242  C  CB    . PRO G 2 19  ? 13.490  132.969 4.718   1.00 47.90  ? 38  PRO E CB    1 
ATOM   9243  C  CG    . PRO G 2 19  ? 13.997  134.359 4.124   1.00 47.90  ? 38  PRO E CG    1 
ATOM   9244  C  CD    . PRO G 2 19  ? 14.060  135.316 5.302   1.00 47.90  ? 38  PRO E CD    1 
ATOM   9245  N  N     . HIS G 2 20  ? 14.617  131.508 6.879   1.00 96.77  ? 39  HIS E N     1 
ATOM   9246  C  CA    . HIS G 2 20  ? 15.568  130.821 7.767   1.00 96.77  ? 39  HIS E CA    1 
ATOM   9247  C  C     . HIS G 2 20  ? 16.545  129.873 7.057   1.00 96.77  ? 39  HIS E C     1 
ATOM   9248  O  O     . HIS G 2 20  ? 16.141  129.100 6.185   1.00 96.77  ? 39  HIS E O     1 
ATOM   9249  C  CB    . HIS G 2 20  ? 14.802  130.034 8.830   1.00 75.75  ? 39  HIS E CB    1 
ATOM   9250  C  CG    . HIS G 2 20  ? 15.680  129.241 9.746   1.00 75.75  ? 39  HIS E CG    1 
ATOM   9251  N  ND1   . HIS G 2 20  ? 16.055  127.941 9.478   1.00 75.75  ? 39  HIS E ND1   1 
ATOM   9252  C  CD2   . HIS G 2 20  ? 16.246  129.558 10.936  1.00 75.75  ? 39  HIS E CD2   1 
ATOM   9253  C  CE1   . HIS G 2 20  ? 16.811  127.491 10.464  1.00 75.75  ? 39  HIS E CE1   1 
ATOM   9254  N  NE2   . HIS G 2 20  ? 16.941  128.453 11.361  1.00 75.75  ? 39  HIS E NE2   1 
ATOM   9255  N  N     . ARG G 2 21  ? 17.802  129.868 7.514   1.00 46.30  ? 40  ARG E N     1 
ATOM   9256  C  CA    . ARG G 2 21  ? 18.849  129.025 6.922   1.00 46.30  ? 40  ARG E CA    1 
ATOM   9257  C  C     . ARG G 2 21  ? 19.920  128.482 7.833   1.00 46.30  ? 40  ARG E C     1 
ATOM   9258  O  O     . ARG G 2 21  ? 20.493  129.214 8.636   1.00 46.30  ? 40  ARG E O     1 
ATOM   9259  C  CB    . ARG G 2 21  ? 19.606  129.783 5.840   1.00 24.00  ? 40  ARG E CB    1 
ATOM   9260  C  CG    . ARG G 2 21  ? 19.071  129.548 4.506   1.00 24.00  ? 40  ARG E CG    1 
ATOM   9261  C  CD    . ARG G 2 21  ? 20.118  129.518 3.473   1.00 24.00  ? 40  ARG E CD    1 
ATOM   9262  N  NE    . ARG G 2 21  ? 19.441  129.151 2.251   1.00 24.00  ? 40  ARG E NE    1 
ATOM   9263  C  CZ    . ARG G 2 21  ? 19.842  128.213 1.406   1.00 24.00  ? 40  ARG E CZ    1 
ATOM   9264  N  NH1   . ARG G 2 21  ? 20.964  127.514 1.612   1.00 24.00  ? 40  ARG E NH1   1 
ATOM   9265  N  NH2   . ARG G 2 21  ? 19.059  127.909 0.378   1.00 24.00  ? 40  ARG E NH2   1 
ATOM   9266  N  N     . TYR G 2 22  ? 20.245  127.206 7.661   1.00 26.00  ? 41  TYR E N     1 
ATOM   9267  C  CA    . TYR G 2 22  ? 21.337  126.629 8.432   1.00 26.00  ? 41  TYR E CA    1 
ATOM   9268  C  C     . TYR G 2 22  ? 22.635  126.889 7.645   1.00 26.00  ? 41  TYR E C     1 
ATOM   9269  O  O     . TYR G 2 22  ? 22.680  126.754 6.404   1.00 26.00  ? 41  TYR E O     1 
ATOM   9270  C  CB    . TYR G 2 22  ? 21.101  125.139 8.689   1.00 26.16  ? 41  TYR E CB    1 
ATOM   9271  C  CG    . TYR G 2 22  ? 20.116  124.878 9.811   1.00 26.16  ? 41  TYR E CG    1 
ATOM   9272  C  CD1   . TYR G 2 22  ? 20.417  125.248 11.118  1.00 26.16  ? 41  TYR E CD1   1 
ATOM   9273  C  CD2   . TYR G 2 22  ? 18.881  124.275 9.569   1.00 26.16  ? 41  TYR E CD2   1 
ATOM   9274  C  CE1   . TYR G 2 22  ? 19.519  125.030 12.161  1.00 26.16  ? 41  TYR E CE1   1 
ATOM   9275  C  CE2   . TYR G 2 22  ? 17.973  124.045 10.607  1.00 26.16  ? 41  TYR E CE2   1 
ATOM   9276  C  CZ    . TYR G 2 22  ? 18.300  124.427 11.902  1.00 26.16  ? 41  TYR E CZ    1 
ATOM   9277  O  OH    . TYR G 2 22  ? 17.421  124.218 12.953  1.00 26.16  ? 41  TYR E OH    1 
ATOM   9278  N  N     . ARG G 2 23  ? 23.673  127.314 8.356   1.00 24.35  ? 42  ARG E N     1 
ATOM   9279  C  CA    . ARG G 2 23  ? 24.941  127.629 7.723   1.00 24.35  ? 42  ARG E CA    1 
ATOM   9280  C  C     . ARG G 2 23  ? 25.577  126.382 7.122   1.00 24.35  ? 42  ARG E C     1 
ATOM   9281  O  O     . ARG G 2 23  ? 25.493  125.294 7.686   1.00 24.35  ? 42  ARG E O     1 
ATOM   9282  C  CB    . ARG G 2 23  ? 25.861  128.315 8.721   1.00 53.92  ? 42  ARG E CB    1 
ATOM   9283  C  CG    . ARG G 2 23  ? 25.363  129.681 9.091   1.00 53.92  ? 42  ARG E CG    1 
ATOM   9284  C  CD    . ARG G 2 23  ? 26.187  130.277 10.191  1.00 53.92  ? 42  ARG E CD    1 
ATOM   9285  N  NE    . ARG G 2 23  ? 27.582  130.504 9.804   1.00 53.92  ? 42  ARG E NE    1 
ATOM   9286  C  CZ    . ARG G 2 23  ? 28.556  130.841 10.656  1.00 53.92  ? 42  ARG E CZ    1 
ATOM   9287  N  NH1   . ARG G 2 23  ? 28.298  130.981 11.953  1.00 53.92  ? 42  ARG E NH1   1 
ATOM   9288  N  NH2   . ARG G 2 23  ? 29.791  131.067 10.214  1.00 53.92  ? 42  ARG E NH2   1 
ATOM   9289  N  N     . PRO G 2 24  ? 26.244  126.523 5.968   1.00 15.33  ? 43  PRO E N     1 
ATOM   9290  C  CA    . PRO G 2 24  ? 26.848  125.337 5.381   1.00 15.33  ? 43  PRO E CA    1 
ATOM   9291  C  C     . PRO G 2 24  ? 27.699  124.537 6.346   1.00 15.33  ? 43  PRO E C     1 
ATOM   9292  O  O     . PRO G 2 24  ? 28.593  125.085 7.004   1.00 15.33  ? 43  PRO E O     1 
ATOM   9293  C  CB    . PRO G 2 24  ? 27.659  125.913 4.211   1.00 16.96  ? 43  PRO E CB    1 
ATOM   9294  C  CG    . PRO G 2 24  ? 27.946  127.283 4.618   1.00 16.96  ? 43  PRO E CG    1 
ATOM   9295  C  CD    . PRO G 2 24  ? 26.657  127.726 5.220   1.00 16.96  ? 43  PRO E CD    1 
ATOM   9296  N  N     . GLY G 2 25  ? 27.326  123.267 6.502   1.00 12.88  ? 44  GLY E N     1 
ATOM   9297  C  CA    . GLY G 2 25  ? 28.077  122.369 7.358   1.00 12.88  ? 44  GLY E CA    1 
ATOM   9298  C  C     . GLY G 2 25  ? 27.347  121.918 8.598   1.00 12.88  ? 44  GLY E C     1 
ATOM   9299  O  O     . GLY G 2 25  ? 27.667  120.879 9.183   1.00 12.88  ? 44  GLY E O     1 
ATOM   9300  N  N     . THR G 2 26  ? 26.359  122.699 9.010   1.00 20.22  ? 45  THR E N     1 
ATOM   9301  C  CA    . THR G 2 26  ? 25.582  122.379 10.196  1.00 20.22  ? 45  THR E CA    1 
ATOM   9302  C  C     . THR G 2 26  ? 24.775  121.108 9.968   1.00 20.22  ? 45  THR E C     1 
ATOM   9303  O  O     . THR G 2 26  ? 24.794  120.177 10.778  1.00 20.22  ? 45  THR E O     1 
ATOM   9304  C  CB    . THR G 2 26  ? 24.645  123.535 10.520  1.00 43.22  ? 45  THR E CB    1 
ATOM   9305  O  OG1   . THR G 2 26  ? 25.414  124.736 10.579  1.00 43.22  ? 45  THR E OG1   1 
ATOM   9306  C  CG2   . THR G 2 26  ? 23.966  123.328 11.842  1.00 43.22  ? 45  THR E CG2   1 
ATOM   9307  N  N     . VAL G 2 27  ? 24.106  121.055 8.825   1.00 22.85  ? 46  VAL E N     1 
ATOM   9308  C  CA    . VAL G 2 27  ? 23.287  119.908 8.466   1.00 22.85  ? 46  VAL E CA    1 
ATOM   9309  C  C     . VAL G 2 27  ? 24.194  118.690 8.257   1.00 22.85  ? 46  VAL E C     1 
ATOM   9310  O  O     . VAL G 2 27  ? 23.897  117.606 8.738   1.00 22.85  ? 46  VAL E O     1 
ATOM   9311  C  CB    . VAL G 2 27  ? 22.481  120.198 7.177   1.00 15.66  ? 46  VAL E CB    1 
ATOM   9312  C  CG1   . VAL G 2 27  ? 21.552  119.031 6.856   1.00 15.66  ? 46  VAL E CG1   1 
ATOM   9313  C  CG2   . VAL G 2 27  ? 21.704  121.515 7.315   1.00 15.66  ? 46  VAL E CG2   1 
ATOM   9314  N  N     . ALA G 2 28  ? 25.332  118.899 7.592   1.00 28.37  ? 47  ALA E N     1 
ATOM   9315  C  CA    . ALA G 2 28  ? 26.303  117.832 7.330   1.00 28.37  ? 47  ALA E CA    1 
ATOM   9316  C  C     . ALA G 2 28  ? 26.733  117.116 8.610   1.00 28.37  ? 47  ALA E C     1 
ATOM   9317  O  O     . ALA G 2 28  ? 26.997  115.917 8.584   1.00 28.37  ? 47  ALA E O     1 
ATOM   9318  C  CB    . ALA G 2 28  ? 27.502  118.391 6.617   1.00 6.71   ? 47  ALA E CB    1 
ATOM   9319  N  N     . LEU G 2 29  ? 26.838  117.873 9.708   1.00 25.70  ? 48  LEU E N     1 
ATOM   9320  C  CA    . LEU G 2 29  ? 27.203  117.356 11.035  1.00 25.70  ? 48  LEU E CA    1 
ATOM   9321  C  C     . LEU G 2 29  ? 26.026  116.644 11.648  1.00 25.70  ? 48  LEU E C     1 
ATOM   9322  O  O     . LEU G 2 29  ? 26.197  115.640 12.316  1.00 25.70  ? 48  LEU E O     1 
ATOM   9323  C  CB    . LEU G 2 29  ? 27.614  118.493 11.954  1.00 31.39  ? 48  LEU E CB    1 
ATOM   9324  C  CG    . LEU G 2 29  ? 29.019  119.019 11.710  1.00 31.39  ? 48  LEU E CG    1 
ATOM   9325  C  CD1   . LEU G 2 29  ? 29.148  120.419 12.234  1.00 31.39  ? 48  LEU E CD1   1 
ATOM   9326  C  CD2   . LEU G 2 29  ? 30.025  118.099 12.383  1.00 31.39  ? 48  LEU E CD2   1 
ATOM   9327  N  N     . ARG G 2 30  ? 24.839  117.221 11.471  1.00 18.12  ? 49  ARG E N     1 
ATOM   9328  C  CA    . ARG G 2 30  ? 23.591  116.647 11.955  1.00 18.12  ? 49  ARG E CA    1 
ATOM   9329  C  C     . ARG G 2 30  ? 23.468  115.221 11.368  1.00 18.12  ? 49  ARG E C     1 
ATOM   9330  O  O     . ARG G 2 30  ? 23.176  114.253 12.073  1.00 18.12  ? 49  ARG E O     1 
ATOM   9331  C  CB    . ARG G 2 30  ? 22.438  117.515 11.452  1.00 48.87  ? 49  ARG E CB    1 
ATOM   9332  C  CG    . ARG G 2 30  ? 21.296  117.679 12.429  1.00 48.87  ? 49  ARG E CG    1 
ATOM   9333  C  CD    . ARG G 2 30  ? 19.913  117.786 11.737  1.00 48.87  ? 49  ARG E CD    1 
ATOM   9334  N  NE    . ARG G 2 30  ? 19.699  118.995 10.935  1.00 48.87  ? 49  ARG E NE    1 
ATOM   9335  C  CZ    . ARG G 2 30  ? 19.751  120.236 11.405  1.00 48.87  ? 49  ARG E CZ    1 
ATOM   9336  N  NH1   . ARG G 2 30  ? 20.022  120.470 12.684  1.00 48.87  ? 49  ARG E NH1   1 
ATOM   9337  N  NH2   . ARG G 2 30  ? 19.524  121.249 10.590  1.00 48.87  ? 49  ARG E NH2   1 
ATOM   9338  N  N     . GLU G 2 31  ? 23.726  115.116 10.065  1.00 27.71  ? 50  GLU E N     1 
ATOM   9339  C  CA    . GLU G 2 31  ? 23.674  113.859 9.334   1.00 27.71  ? 50  GLU E CA    1 
ATOM   9340  C  C     . GLU G 2 31  ? 24.722  112.852 9.832   1.00 27.71  ? 50  GLU E C     1 
ATOM   9341  O  O     . GLU G 2 31  ? 24.441  111.664 9.938   1.00 27.71  ? 50  GLU E O     1 
ATOM   9342  C  CB    . GLU G 2 31  ? 23.844  114.118 7.822   1.00 31.99  ? 50  GLU E CB    1 
ATOM   9343  C  CG    . GLU G 2 31  ? 22.671  114.809 7.121   1.00 31.99  ? 50  GLU E CG    1 
ATOM   9344  C  CD    . GLU G 2 31  ? 22.956  115.132 5.643   1.00 31.99  ? 50  GLU E CD    1 
ATOM   9345  O  OE1   . GLU G 2 31  ? 23.017  114.195 4.813   1.00 31.99  ? 50  GLU E OE1   1 
ATOM   9346  O  OE2   . GLU G 2 31  ? 23.133  116.327 5.295   1.00 31.99  ? 50  GLU E OE2   1 
ATOM   9347  N  N     . ILE G 2 32  ? 25.939  113.316 10.095  1.00 21.68  ? 51  ILE E N     1 
ATOM   9348  C  CA    . ILE G 2 32  ? 26.993  112.435 10.592  1.00 21.68  ? 51  ILE E CA    1 
ATOM   9349  C  C     . ILE G 2 32  ? 26.514  111.834 11.894  1.00 21.68  ? 51  ILE E C     1 
ATOM   9350  O  O     . ILE G 2 32  ? 26.457  110.612 12.044  1.00 21.68  ? 51  ILE E O     1 
ATOM   9351  C  CB    . ILE G 2 32  ? 28.301  113.200 10.837  1.00 6.79   ? 51  ILE E CB    1 
ATOM   9352  C  CG1   . ILE G 2 32  ? 28.864  113.682 9.503   1.00 6.79   ? 51  ILE E CG1   1 
ATOM   9353  C  CG2   . ILE G 2 32  ? 29.317  112.308 11.490  1.00 6.79   ? 51  ILE E CG2   1 
ATOM   9354  C  CD1   . ILE G 2 32  ? 30.059  114.582 9.619   1.00 6.79   ? 51  ILE E CD1   1 
ATOM   9355  N  N     . ARG G 2 33  ? 26.080  112.705 12.797  1.00 19.79  ? 52  ARG E N     1 
ATOM   9356  C  CA    . ARG G 2 33  ? 25.577  112.282 14.090  1.00 19.79  ? 52  ARG E CA    1 
ATOM   9357  C  C     . ARG G 2 33  ? 24.455  111.289 13.894  1.00 19.79  ? 52  ARG E C     1 
ATOM   9358  O  O     . ARG G 2 33  ? 24.391  110.274 14.583  1.00 19.79  ? 52  ARG E O     1 
ATOM   9359  C  CB    . ARG G 2 33  ? 25.093  113.484 14.907  1.00 33.55  ? 52  ARG E CB    1 
ATOM   9360  C  CG    . ARG G 2 33  ? 26.202  114.447 15.303  1.00 33.55  ? 52  ARG E CG    1 
ATOM   9361  C  CD    . ARG G 2 33  ? 25.704  115.540 16.216  1.00 33.55  ? 52  ARG E CD    1 
ATOM   9362  N  NE    . ARG G 2 33  ? 26.312  116.845 15.920  1.00 33.55  ? 52  ARG E NE    1 
ATOM   9363  C  CZ    . ARG G 2 33  ? 27.490  117.260 16.390  1.00 33.55  ? 52  ARG E CZ    1 
ATOM   9364  N  NH1   . ARG G 2 33  ? 28.217  116.459 17.187  1.00 33.55  ? 52  ARG E NH1   1 
ATOM   9365  N  NH2   . ARG G 2 33  ? 27.915  118.500 16.113  1.00 33.55  ? 52  ARG E NH2   1 
ATOM   9366  N  N     . ARG G 2 34  ? 23.593  111.577 12.929  1.00 21.63  ? 53  ARG E N     1 
ATOM   9367  C  CA    . ARG G 2 34  ? 22.459  110.728 12.629  1.00 21.63  ? 53  ARG E CA    1 
ATOM   9368  C  C     . ARG G 2 34  ? 22.826  109.319 12.187  1.00 21.63  ? 53  ARG E C     1 
ATOM   9369  O  O     . ARG G 2 34  ? 22.384  108.337 12.798  1.00 21.63  ? 53  ARG E O     1 
ATOM   9370  C  CB    . ARG G 2 34  ? 21.567  111.373 11.570  1.00 33.63  ? 53  ARG E CB    1 
ATOM   9371  C  CG    . ARG G 2 34  ? 20.443  110.456 11.150  1.00 33.63  ? 53  ARG E CG    1 
ATOM   9372  C  CD    . ARG G 2 34  ? 19.641  110.948 9.960   1.00 33.63  ? 53  ARG E CD    1 
ATOM   9373  N  NE    . ARG G 2 34  ? 18.865  109.840 9.397   1.00 33.63  ? 53  ARG E NE    1 
ATOM   9374  C  CZ    . ARG G 2 34  ? 17.931  109.968 8.457   1.00 33.63  ? 53  ARG E CZ    1 
ATOM   9375  N  NH1   . ARG G 2 34  ? 17.636  111.166 7.953   1.00 33.63  ? 53  ARG E NH1   1 
ATOM   9376  N  NH2   . ARG G 2 34  ? 17.311  108.879 8.000   1.00 33.63  ? 53  ARG E NH2   1 
ATOM   9377  N  N     . TYR G 2 35  ? 23.648  109.212 11.142  1.00 19.14  ? 54  TYR E N     1 
ATOM   9378  C  CA    . TYR G 2 35  ? 24.041  107.913 10.601  1.00 19.14  ? 54  TYR E CA    1 
ATOM   9379  C  C     . TYR G 2 35  ? 24.989  107.123 11.448  1.00 19.14  ? 54  TYR E C     1 
ATOM   9380  O  O     . TYR G 2 35  ? 25.008  105.900 11.362  1.00 19.14  ? 54  TYR E O     1 
ATOM   9381  C  CB    . TYR G 2 35  ? 24.533  108.055 9.168   1.00 18.72  ? 54  TYR E CB    1 
ATOM   9382  C  CG    . TYR G 2 35  ? 23.394  108.446 8.243   1.00 18.72  ? 54  TYR E CG    1 
ATOM   9383  C  CD1   . TYR G 2 35  ? 22.329  107.567 8.012   1.00 18.72  ? 54  TYR E CD1   1 
ATOM   9384  C  CD2   . TYR G 2 35  ? 23.334  109.719 7.659   1.00 18.72  ? 54  TYR E CD2   1 
ATOM   9385  C  CE1   . TYR G 2 35  ? 21.230  107.942 7.235   1.00 18.72  ? 54  TYR E CE1   1 
ATOM   9386  C  CE2   . TYR G 2 35  ? 22.243  110.104 6.873   1.00 18.72  ? 54  TYR E CE2   1 
ATOM   9387  C  CZ    . TYR G 2 35  ? 21.201  109.212 6.669   1.00 18.72  ? 54  TYR E CZ    1 
ATOM   9388  O  OH    . TYR G 2 35  ? 20.133  109.576 5.894   1.00 18.72  ? 54  TYR E OH    1 
ATOM   9389  N  N     . GLN G 2 36  ? 25.793  107.811 12.251  1.00 27.55  ? 55  GLN E N     1 
ATOM   9390  C  CA    . GLN G 2 36  ? 26.697  107.115 13.151  1.00 27.55  ? 55  GLN E CA    1 
ATOM   9391  C  C     . GLN G 2 36  ? 25.901  106.402 14.267  1.00 27.55  ? 55  GLN E C     1 
ATOM   9392  O  O     . GLN G 2 36  ? 26.375  105.401 14.818  1.00 27.55  ? 55  GLN E O     1 
ATOM   9393  C  CB    . GLN G 2 36  ? 27.756  108.065 13.715  1.00 31.00  ? 55  GLN E CB    1 
ATOM   9394  C  CG    . GLN G 2 36  ? 28.823  108.479 12.681  1.00 31.00  ? 55  GLN E CG    1 
ATOM   9395  C  CD    . GLN G 2 36  ? 30.050  109.160 13.302  1.00 31.00  ? 55  GLN E CD    1 
ATOM   9396  O  OE1   . GLN G 2 36  ? 29.961  109.762 14.373  1.00 31.00  ? 55  GLN E OE1   1 
ATOM   9397  N  NE2   . GLN G 2 36  ? 31.191  109.064 12.629  1.00 31.00  ? 55  GLN E NE2   1 
ATOM   9398  N  N     . LYS G 2 37  ? 24.689  106.899 14.564  1.00 23.85  ? 56  LYS E N     1 
ATOM   9399  C  CA    . LYS G 2 37  ? 23.800  106.317 15.575  1.00 23.85  ? 56  LYS E CA    1 
ATOM   9400  C  C     . LYS G 2 37  ? 23.073  105.094 15.014  1.00 23.85  ? 56  LYS E C     1 
ATOM   9401  O  O     . LYS G 2 37  ? 22.744  104.163 15.757  1.00 23.85  ? 56  LYS E O     1 
ATOM   9402  C  CB    . LYS G 2 37  ? 22.715  107.307 16.029  1.00 43.45  ? 56  LYS E CB    1 
ATOM   9403  C  CG    . LYS G 2 37  ? 23.110  108.442 16.978  1.00 43.45  ? 56  LYS E CG    1 
ATOM   9404  C  CD    . LYS G 2 37  ? 21.836  108.989 17.713  1.00 43.45  ? 56  LYS E CD    1 
ATOM   9405  C  CE    . LYS G 2 37  ? 21.703  110.552 17.764  1.00 43.45  ? 56  LYS E CE    1 
ATOM   9406  N  NZ    . LYS G 2 37  ? 21.091  111.216 16.539  1.00 43.45  ? 56  LYS E NZ    1 
ATOM   9407  N  N     . SER G 2 38  ? 22.721  105.125 13.731  1.00 28.47  ? 57  SER E N     1 
ATOM   9408  C  CA    . SER G 2 38  ? 22.022  103.978 13.158  1.00 28.47  ? 57  SER E CA    1 
ATOM   9409  C  C     . SER G 2 38  ? 22.897  102.867 12.563  1.00 28.47  ? 57  SER E C     1 
ATOM   9410  O  O     . SER G 2 38  ? 24.145  102.964 12.537  1.00 28.47  ? 57  SER E O     1 
ATOM   9411  C  CB    . SER G 2 38  ? 20.968  104.435 12.145  1.00 30.41  ? 57  SER E CB    1 
ATOM   9412  O  OG    . SER G 2 38  ? 21.499  105.321 11.185  1.00 30.41  ? 57  SER E OG    1 
ATOM   9413  N  N     . THR G 2 39  ? 22.225  101.813 12.088  1.00 15.13  ? 58  THR E N     1 
ATOM   9414  C  CA    . THR G 2 39  ? 22.899  100.665 11.489  1.00 15.13  ? 58  THR E CA    1 
ATOM   9415  C  C     . THR G 2 39  ? 22.237  100.185 10.202  1.00 15.13  ? 58  THR E C     1 
ATOM   9416  O  O     . THR G 2 39  ? 22.698  99.226  9.600   1.00 15.13  ? 58  THR E O     1 
ATOM   9417  C  CB    . THR G 2 39  ? 22.925  99.478  12.429  1.00 21.48  ? 58  THR E CB    1 
ATOM   9418  O  OG1   . THR G 2 39  ? 21.604  98.960  12.552  1.00 21.48  ? 58  THR E OG1   1 
ATOM   9419  C  CG2   . THR G 2 39  ? 23.415  99.883  13.790  1.00 21.48  ? 58  THR E CG2   1 
ATOM   9420  N  N     . GLU G 2 40  ? 21.103  100.791 9.858   1.00 16.27  ? 59  GLU E N     1 
ATOM   9421  C  CA    . GLU G 2 40  ? 20.326  100.524 8.631   1.00 16.27  ? 59  GLU E CA    1 
ATOM   9422  C  C     . GLU G 2 40  ? 21.299  100.625 7.469   1.00 16.27  ? 59  GLU E C     1 
ATOM   9423  O  O     . GLU G 2 40  ? 22.294  101.358 7.567   1.00 16.27  ? 59  GLU E O     1 
ATOM   9424  C  CB    . GLU G 2 40  ? 19.364  101.691 8.444   1.00 37.49  ? 59  GLU E CB    1 
ATOM   9425  C  CG    . GLU G 2 40  ? 20.104  103.008 8.770   1.00 37.49  ? 59  GLU E CG    1 
ATOM   9426  C  CD    . GLU G 2 40  ? 19.409  104.266 8.344   1.00 37.49  ? 59  GLU E CD    1 
ATOM   9427  O  OE1   . GLU G 2 40  ? 18.875  104.296 7.213   1.00 37.49  ? 59  GLU E OE1   1 
ATOM   9428  O  OE2   . GLU G 2 40  ? 19.457  105.255 9.123   1.00 37.49  ? 59  GLU E OE2   1 
ATOM   9429  N  N     . LEU G 2 41  ? 21.035  99.944  6.359   1.00 27.54  ? 60  LEU E N     1 
ATOM   9430  C  CA    . LEU G 2 41  ? 21.958  100.090 5.231   1.00 27.54  ? 60  LEU E CA    1 
ATOM   9431  C  C     . LEU G 2 41  ? 21.630  101.405 4.540   1.00 27.54  ? 60  LEU E C     1 
ATOM   9432  O  O     . LEU G 2 41  ? 20.536  101.960 4.715   1.00 27.54  ? 60  LEU E O     1 
ATOM   9433  C  CB    . LEU G 2 41  ? 21.893  98.922  4.250   1.00 12.49  ? 60  LEU E CB    1 
ATOM   9434  C  CG    . LEU G 2 41  ? 22.311  97.570  4.814   1.00 12.49  ? 60  LEU E CG    1 
ATOM   9435  C  CD1   . LEU G 2 41  ? 22.075  96.496  3.799   1.00 12.49  ? 60  LEU E CD1   1 
ATOM   9436  C  CD2   . LEU G 2 41  ? 23.767  97.611  5.242   1.00 12.49  ? 60  LEU E CD2   1 
ATOM   9437  N  N     . LEU G 2 42  ? 22.577  101.894 3.750   1.00 19.03  ? 61  LEU E N     1 
ATOM   9438  C  CA    . LEU G 2 42  ? 22.409  103.162 3.089   1.00 19.03  ? 61  LEU E CA    1 
ATOM   9439  C  C     . LEU G 2 42  ? 22.301  103.163 1.565   1.00 19.03  ? 61  LEU E C     1 
ATOM   9440  O  O     . LEU G 2 42  ? 22.061  104.207 0.982   1.00 19.03  ? 61  LEU E O     1 
ATOM   9441  C  CB    . LEU G 2 42  ? 23.494  104.114 3.594   1.00 10.35  ? 61  LEU E CB    1 
ATOM   9442  C  CG    . LEU G 2 42  ? 23.630  104.288 5.129   1.00 10.35  ? 61  LEU E CG    1 
ATOM   9443  C  CD1   . LEU G 2 42  ? 24.925  105.020 5.467   1.00 10.35  ? 61  LEU E CD1   1 
ATOM   9444  C  CD2   . LEU G 2 42  ? 22.441  105.033 5.722   1.00 10.35  ? 61  LEU E CD2   1 
ATOM   9445  N  N     . ILE G 2 43  ? 22.464  102.015 0.913   1.00 24.84  ? 62  ILE E N     1 
ATOM   9446  C  CA    . ILE G 2 43  ? 22.319  101.950 -0.549  1.00 24.84  ? 62  ILE E CA    1 
ATOM   9447  C  C     . ILE G 2 43  ? 20.952  101.314 -0.790  1.00 24.84  ? 62  ILE E C     1 
ATOM   9448  O  O     . ILE G 2 43  ? 20.598  100.365 -0.098  1.00 24.84  ? 62  ILE E O     1 
ATOM   9449  C  CB    . ILE G 2 43  ? 23.433  101.074 -1.199  1.00 13.17  ? 62  ILE E CB    1 
ATOM   9450  C  CG1   . ILE G 2 43  ? 24.760  101.808 -1.153  1.00 13.17  ? 62  ILE E CG1   1 
ATOM   9451  C  CG2   . ILE G 2 43  ? 23.116  100.749 -2.647  1.00 13.17  ? 62  ILE E CG2   1 
ATOM   9452  C  CD1   . ILE G 2 43  ? 25.939  100.887 -1.131  1.00 13.17  ? 62  ILE E CD1   1 
ATOM   9453  N  N     . ARG G 2 44  ? 20.168  101.859 -1.724  1.00 17.80  ? 63  ARG E N     1 
ATOM   9454  C  CA    . ARG G 2 44  ? 18.849  101.301 -1.999  1.00 17.80  ? 63  ARG E CA    1 
ATOM   9455  C  C     . ARG G 2 44  ? 18.991  99.842  -2.381  1.00 17.80  ? 63  ARG E C     1 
ATOM   9456  O  O     . ARG G 2 44  ? 19.732  99.494  -3.290  1.00 17.80  ? 63  ARG E O     1 
ATOM   9457  C  CB    . ARG G 2 44  ? 18.139  102.105 -3.067  1.00 73.98  ? 63  ARG E CB    1 
ATOM   9458  C  CG    . ARG G 2 44  ? 17.263  103.208 -2.506  1.00 73.98  ? 63  ARG E CG    1 
ATOM   9459  C  CD    . ARG G 2 44  ? 17.147  104.346 -3.506  1.00 73.98  ? 63  ARG E CD    1 
ATOM   9460  N  NE    . ARG G 2 44  ? 17.210  103.892 -4.903  1.00 73.98  ? 63  ARG E NE    1 
ATOM   9461  C  CZ    . ARG G 2 44  ? 17.794  104.572 -5.893  1.00 73.98  ? 63  ARG E CZ    1 
ATOM   9462  N  NH1   . ARG G 2 44  ? 18.365  105.735 -5.635  1.00 73.98  ? 63  ARG E NH1   1 
ATOM   9463  N  NH2   . ARG G 2 44  ? 17.813  104.102 -7.142  1.00 73.98  ? 63  ARG E NH2   1 
ATOM   9464  N  N     . LYS G 2 45  ? 18.290  98.984  -1.655  1.00 18.59  ? 64  LYS E N     1 
ATOM   9465  C  CA    . LYS G 2 45  ? 18.368  97.543  -1.866  1.00 18.59  ? 64  LYS E CA    1 
ATOM   9466  C  C     . LYS G 2 45  ? 18.200  97.019  -3.288  1.00 18.59  ? 64  LYS E C     1 
ATOM   9467  O  O     . LYS G 2 45  ? 19.011  96.227  -3.755  1.00 18.59  ? 64  LYS E O     1 
ATOM   9468  C  CB    . LYS G 2 45  ? 17.462  96.806  -0.869  1.00 59.69  ? 64  LYS E CB    1 
ATOM   9469  C  CG    . LYS G 2 45  ? 18.099  96.682  0.517   1.00 59.69  ? 64  LYS E CG    1 
ATOM   9470  C  CD    . LYS G 2 45  ? 17.071  96.659  1.631   1.00 59.69  ? 64  LYS E CD    1 
ATOM   9471  C  CE    . LYS G 2 45  ? 17.710  96.891  3.009   1.00 59.69  ? 64  LYS E CE    1 
ATOM   9472  N  NZ    . LYS G 2 45  ? 18.462  95.706  3.510   1.00 59.69  ? 64  LYS E NZ    1 
ATOM   9473  N  N     . LEU G 2 46  ? 17.167  97.440  -3.989  1.00 31.10  ? 65  LEU E N     1 
ATOM   9474  C  CA    . LEU G 2 46  ? 17.019  96.948  -5.334  1.00 31.10  ? 65  LEU E CA    1 
ATOM   9475  C  C     . LEU G 2 46  ? 18.183  97.362  -6.235  1.00 31.10  ? 65  LEU E C     1 
ATOM   9476  O  O     . LEU G 2 46  ? 18.877  96.503  -6.770  1.00 31.10  ? 65  LEU E O     1 
ATOM   9477  C  CB    . LEU G 2 46  ? 15.665  97.352  -5.928  1.00 23.29  ? 65  LEU E CB    1 
ATOM   9478  C  CG    . LEU G 2 46  ? 15.315  97.002  -7.388  1.00 23.29  ? 65  LEU E CG    1 
ATOM   9479  C  CD1   . LEU G 2 46  ? 15.633  95.552  -7.722  1.00 23.29  ? 65  LEU E CD1   1 
ATOM   9480  C  CD2   . LEU G 2 46  ? 13.842  97.273  -7.594  1.00 23.29  ? 65  LEU E CD2   1 
ATOM   9481  N  N     . PRO G 2 47  ? 18.489  98.662  -6.340  1.00 20.16  ? 66  PRO E N     1 
ATOM   9482  C  CA    . PRO G 2 47  ? 19.605  99.046  -7.219  1.00 20.16  ? 66  PRO E CA    1 
ATOM   9483  C  C     . PRO G 2 47  ? 20.874  98.235  -6.976  1.00 20.16  ? 66  PRO E C     1 
ATOM   9484  O  O     . PRO G 2 47  ? 21.545  97.829  -7.938  1.00 20.16  ? 66  PRO E O     1 
ATOM   9485  C  CB    . PRO G 2 47  ? 19.814  100.514 -6.898  1.00 15.14  ? 66  PRO E CB    1 
ATOM   9486  C  CG    . PRO G 2 47  ? 18.478  100.950 -6.500  1.00 15.14  ? 66  PRO E CG    1 
ATOM   9487  C  CD    . PRO G 2 47  ? 17.946  99.833  -5.648  1.00 15.14  ? 66  PRO E CD    1 
ATOM   9488  N  N     . PHE G 2 48  ? 21.191  97.995  -5.693  1.00 17.28  ? 67  PHE E N     1 
ATOM   9489  C  CA    . PHE G 2 48  ? 22.367  97.207  -5.316  1.00 17.28  ? 67  PHE E CA    1 
ATOM   9490  C  C     . PHE G 2 48  ? 22.231  95.780  -5.830  1.00 17.28  ? 67  PHE E C     1 
ATOM   9491  O  O     . PHE G 2 48  ? 23.146  95.274  -6.492  1.00 17.28  ? 67  PHE E O     1 
ATOM   9492  C  CB    . PHE G 2 48  ? 22.572  97.196  -3.815  1.00 16.74  ? 67  PHE E CB    1 
ATOM   9493  C  CG    . PHE G 2 48  ? 23.798  96.459  -3.392  1.00 16.74  ? 67  PHE E CG    1 
ATOM   9494  C  CD1   . PHE G 2 48  ? 25.018  97.114  -3.311  1.00 16.74  ? 67  PHE E CD1   1 
ATOM   9495  C  CD2   . PHE G 2 48  ? 23.747  95.091  -3.113  1.00 16.74  ? 67  PHE E CD2   1 
ATOM   9496  C  CE1   . PHE G 2 48  ? 26.177  96.425  -2.960  1.00 16.74  ? 67  PHE E CE1   1 
ATOM   9497  C  CE2   . PHE G 2 48  ? 24.901  94.383  -2.761  1.00 16.74  ? 67  PHE E CE2   1 
ATOM   9498  C  CZ    . PHE G 2 48  ? 26.121  95.063  -2.686  1.00 16.74  ? 67  PHE E CZ    1 
ATOM   9499  N  N     . GLN G 2 49  ? 21.093  95.133  -5.551  1.00 10.24  ? 68  GLN E N     1 
ATOM   9500  C  CA    . GLN G 2 49  ? 20.868  93.775  -6.049  1.00 10.24  ? 68  GLN E CA    1 
ATOM   9501  C  C     . GLN G 2 49  ? 21.133  93.671  -7.574  1.00 10.24  ? 68  GLN E C     1 
ATOM   9502  O  O     . GLN G 2 49  ? 21.760  92.727  -8.042  1.00 10.24  ? 68  GLN E O     1 
ATOM   9503  C  CB    . GLN G 2 49  ? 19.473  93.293  -5.720  1.00 43.59  ? 68  GLN E CB    1 
ATOM   9504  C  CG    . GLN G 2 49  ? 19.260  91.883  -6.177  1.00 43.59  ? 68  GLN E CG    1 
ATOM   9505  C  CD    . GLN G 2 49  ? 18.000  91.274  -5.624  1.00 43.59  ? 68  GLN E CD    1 
ATOM   9506  O  OE1   . GLN G 2 49  ? 16.950  91.284  -6.282  1.00 43.59  ? 68  GLN E OE1   1 
ATOM   9507  N  NE2   . GLN G 2 49  ? 18.086  90.741  -4.400  1.00 43.59  ? 68  GLN E NE2   1 
ATOM   9508  N  N     . ARG G 2 50  ? 20.723  94.690  -8.324  1.00 13.32  ? 69  ARG E N     1 
ATOM   9509  C  CA    . ARG G 2 50  ? 20.926  94.750  -9.771  1.00 13.32  ? 69  ARG E CA    1 
ATOM   9510  C  C     . ARG G 2 50  ? 22.400  94.868  -10.166 1.00 13.32  ? 69  ARG E C     1 
ATOM   9511  O  O     . ARG G 2 50  ? 22.839  94.239  -11.115 1.00 13.32  ? 69  ARG E O     1 
ATOM   9512  C  CB    . ARG G 2 50  ? 20.163  95.932  -10.340 1.00 28.76  ? 69  ARG E CB    1 
ATOM   9513  C  CG    . ARG G 2 50  ? 18.960  95.563  -11.141 1.00 28.76  ? 69  ARG E CG    1 
ATOM   9514  C  CD    . ARG G 2 50  ? 18.414  96.809  -11.849 1.00 28.76  ? 69  ARG E CD    1 
ATOM   9515  N  NE    . ARG G 2 50  ? 17.330  97.447  -11.105 1.00 28.76  ? 69  ARG E NE    1 
ATOM   9516  C  CZ    . ARG G 2 50  ? 17.342  98.704  -10.683 1.00 28.76  ? 69  ARG E CZ    1 
ATOM   9517  N  NH1   . ARG G 2 50  ? 18.395  99.492  -10.922 1.00 28.76  ? 69  ARG E NH1   1 
ATOM   9518  N  NH2   . ARG G 2 50  ? 16.284  99.168  -10.033 1.00 28.76  ? 69  ARG E NH2   1 
ATOM   9519  N  N     . LEU G 2 51  ? 23.145  95.733  -9.490  1.00 17.42  ? 70  LEU E N     1 
ATOM   9520  C  CA    . LEU G 2 51  ? 24.562  95.888  -9.782  1.00 17.42  ? 70  LEU E CA    1 
ATOM   9521  C  C     . LEU G 2 51  ? 25.245  94.550  -9.569  1.00 17.42  ? 70  LEU E C     1 
ATOM   9522  O  O     . LEU G 2 51  ? 26.055  94.124  -10.406 1.00 17.42  ? 70  LEU E O     1 
ATOM   9523  C  CB    . LEU G 2 51  ? 25.200  96.919  -8.848  1.00 15.96  ? 70  LEU E CB    1 
ATOM   9524  C  CG    . LEU G 2 51  ? 26.717  97.159  -8.997  1.00 15.96  ? 70  LEU E CG    1 
ATOM   9525  C  CD1   . LEU G 2 51  ? 27.052  97.750  -10.380 1.00 15.96  ? 70  LEU E CD1   1 
ATOM   9526  C  CD2   . LEU G 2 51  ? 27.215  98.047  -7.851  1.00 15.96  ? 70  LEU E CD2   1 
ATOM   9527  N  N     . VAL G 2 52  ? 24.943  93.901  -8.436  1.00 12.32  ? 71  VAL E N     1 
ATOM   9528  C  CA    . VAL G 2 52  ? 25.525  92.595  -8.132  1.00 12.32  ? 71  VAL E CA    1 
ATOM   9529  C  C     . VAL G 2 52  ? 25.220  91.643  -9.284  1.00 12.32  ? 71  VAL E C     1 
ATOM   9530  O  O     . VAL G 2 52  ? 26.137  91.100  -9.880  1.00 12.32  ? 71  VAL E O     1 
ATOM   9531  C  CB    . VAL G 2 52  ? 25.002  91.995  -6.788  1.00 12.93  ? 71  VAL E CB    1 
ATOM   9532  C  CG1   . VAL G 2 52  ? 25.348  90.506  -6.692  1.00 12.93  ? 71  VAL E CG1   1 
ATOM   9533  C  CG2   . VAL G 2 52  ? 25.598  92.741  -5.579  1.00 12.93  ? 71  VAL E CG2   1 
ATOM   9534  N  N     . ARG G 2 53  ? 23.944  91.489  -9.638  1.00 15.49  ? 72  ARG E N     1 
ATOM   9535  C  CA    . ARG G 2 53  ? 23.566  90.599  -10.732 1.00 15.49  ? 72  ARG E CA    1 
ATOM   9536  C  C     . ARG G 2 53  ? 24.282  90.931  -12.035 1.00 15.49  ? 72  ARG E C     1 
ATOM   9537  O  O     . ARG G 2 53  ? 24.701  90.032  -12.752 1.00 15.49  ? 72  ARG E O     1 
ATOM   9538  C  CB    . ARG G 2 53  ? 22.053  90.578  -10.942 1.00 23.81  ? 72  ARG E CB    1 
ATOM   9539  C  CG    . ARG G 2 53  ? 21.318  89.885  -9.825  1.00 23.81  ? 72  ARG E CG    1 
ATOM   9540  C  CD    . ARG G 2 53  ? 19.827  89.849  -10.053 1.00 23.81  ? 72  ARG E CD    1 
ATOM   9541  N  NE    . ARG G 2 53  ? 19.137  89.401  -8.843  1.00 23.81  ? 72  ARG E NE    1 
ATOM   9542  C  CZ    . ARG G 2 53  ? 19.013  88.126  -8.466  1.00 23.81  ? 72  ARG E CZ    1 
ATOM   9543  N  NH1   . ARG G 2 53  ? 19.525  87.147  -9.211  1.00 23.81  ? 72  ARG E NH1   1 
ATOM   9544  N  NH2   . ARG G 2 53  ? 18.405  87.833  -7.320  1.00 23.81  ? 72  ARG E NH2   1 
ATOM   9545  N  N     . GLU G 2 54  ? 24.443  92.215  -12.332 1.00 17.63  ? 73  GLU E N     1 
ATOM   9546  C  CA    . GLU G 2 54  ? 25.119  92.616  -13.552 1.00 17.63  ? 73  GLU E CA    1 
ATOM   9547  C  C     . GLU G 2 54  ? 26.558  92.113  -13.559 1.00 17.63  ? 73  GLU E C     1 
ATOM   9548  O  O     . GLU G 2 54  ? 26.974  91.424  -14.475 1.00 17.63  ? 73  GLU E O     1 
ATOM   9549  C  CB    . GLU G 2 54  ? 25.085  94.138  -13.702 1.00 21.24  ? 73  GLU E CB    1 
ATOM   9550  C  CG    . GLU G 2 54  ? 25.950  94.656  -14.848 1.00 21.24  ? 73  GLU E CG    1 
ATOM   9551  C  CD    . GLU G 2 54  ? 25.892  96.168  -15.020 1.00 21.24  ? 73  GLU E CD    1 
ATOM   9552  O  OE1   . GLU G 2 54  ? 24.790  96.748  -14.915 1.00 21.24  ? 73  GLU E OE1   1 
ATOM   9553  O  OE2   . GLU G 2 54  ? 26.951  96.775  -15.282 1.00 21.24  ? 73  GLU E OE2   1 
ATOM   9554  N  N     . ILE G 2 55  ? 27.303  92.436  -12.515 1.00 19.79  ? 74  ILE E N     1 
ATOM   9555  C  CA    . ILE G 2 55  ? 28.683  92.003  -12.416 1.00 19.79  ? 74  ILE E CA    1 
ATOM   9556  C  C     . ILE G 2 55  ? 28.798  90.483  -12.511 1.00 19.79  ? 74  ILE E C     1 
ATOM   9557  O  O     . ILE G 2 55  ? 29.532  89.967  -13.356 1.00 19.79  ? 74  ILE E O     1 
ATOM   9558  C  CB    . ILE G 2 55  ? 29.316  92.477  -11.077 1.00 12.86  ? 74  ILE E CB    1 
ATOM   9559  C  CG1   . ILE G 2 55  ? 29.413  94.000  -11.071 1.00 12.86  ? 74  ILE E CG1   1 
ATOM   9560  C  CG2   . ILE G 2 55  ? 30.707  91.857  -10.880 1.00 12.86  ? 74  ILE E CG2   1 
ATOM   9561  C  CD1   . ILE G 2 55  ? 29.735  94.563  -9.740  1.00 12.86  ? 74  ILE E CD1   1 
ATOM   9562  N  N     . ALA G 2 56  ? 28.062  89.781  -11.648 1.00 17.30  ? 75  ALA E N     1 
ATOM   9563  C  CA    . ALA G 2 56  ? 28.080  88.330  -11.586 1.00 17.30  ? 75  ALA E CA    1 
ATOM   9564  C  C     . ALA G 2 56  ? 27.835  87.725  -12.953 1.00 17.30  ? 75  ALA E C     1 
ATOM   9565  O  O     . ALA G 2 56  ? 28.592  86.882  -13.418 1.00 17.30  ? 75  ALA E O     1 
ATOM   9566  C  CB    . ALA G 2 56  ? 27.044  87.858  -10.623 1.00 23.14  ? 75  ALA E CB    1 
ATOM   9567  N  N     . GLN G 2 57  ? 26.783  88.186  -13.606 1.00 38.14  ? 76  GLN E N     1 
ATOM   9568  C  CA    . GLN G 2 57  ? 26.411  87.715  -14.922 1.00 38.14  ? 76  GLN E CA    1 
ATOM   9569  C  C     . GLN G 2 57  ? 27.529  87.924  -15.923 1.00 38.14  ? 76  GLN E C     1 
ATOM   9570  O  O     . GLN G 2 57  ? 27.619  87.198  -16.909 1.00 38.14  ? 76  GLN E O     1 
ATOM   9571  C  CB    . GLN G 2 57  ? 25.186  88.470  -15.365 1.00 36.55  ? 76  GLN E CB    1 
ATOM   9572  C  CG    . GLN G 2 57  ? 24.694  88.144  -16.722 1.00 36.55  ? 76  GLN E CG    1 
ATOM   9573  C  CD    . GLN G 2 57  ? 23.663  89.140  -17.150 1.00 36.55  ? 76  GLN E CD    1 
ATOM   9574  O  OE1   . GLN G 2 57  ? 23.871  90.353  -17.037 1.00 36.55  ? 76  GLN E OE1   1 
ATOM   9575  N  NE2   . GLN G 2 57  ? 22.530  88.647  -17.615 1.00 36.55  ? 76  GLN E NE2   1 
ATOM   9576  N  N     . ASP G 2 58  ? 28.326  88.970  -15.731 1.00 30.23  ? 77  ASP E N     1 
ATOM   9577  C  CA    . ASP G 2 58  ? 29.455  89.204  -16.633 1.00 30.23  ? 77  ASP E CA    1 
ATOM   9578  C  C     . ASP G 2 58  ? 30.725  88.320  -16.332 1.00 30.23  ? 77  ASP E C     1 
ATOM   9579  O  O     . ASP G 2 58  ? 31.700  88.338  -17.094 1.00 30.23  ? 77  ASP E O     1 
ATOM   9580  C  CB    . ASP G 2 58  ? 29.732  90.734  -16.829 1.00 58.30  ? 77  ASP E CB    1 
ATOM   9581  C  CG    . ASP G 2 58  ? 28.752  91.417  -17.881 1.00 58.30  ? 77  ASP E CG    1 
ATOM   9582  O  OD1   . ASP G 2 58  ? 28.366  90.785  -18.904 1.00 58.30  ? 77  ASP E OD1   1 
ATOM   9583  O  OD2   . ASP G 2 58  ? 28.371  92.598  -17.704 1.00 58.30  ? 77  ASP E OD2   1 
ATOM   9584  N  N     . PHE G 2 59  ? 30.671  87.497  -15.272 1.00 29.60  ? 78  PHE E N     1 
ATOM   9585  C  CA    . PHE G 2 59  ? 31.752  86.567  -14.911 1.00 29.60  ? 78  PHE E CA    1 
ATOM   9586  C  C     . PHE G 2 59  ? 31.237  85.164  -15.284 1.00 29.60  ? 78  PHE E C     1 
ATOM   9587  O  O     . PHE G 2 59  ? 31.973  84.322  -15.819 1.00 29.60  ? 78  PHE E O     1 
ATOM   9588  C  CB    . PHE G 2 59  ? 32.103  86.641  -13.414 1.00 50.46  ? 78  PHE E CB    1 
ATOM   9589  C  CG    . PHE G 2 59  ? 33.131  85.599  -12.965 1.00 50.46  ? 78  PHE E CG    1 
ATOM   9590  C  CD1   . PHE G 2 59  ? 34.276  85.332  -13.723 1.00 50.46  ? 78  PHE E CD1   1 
ATOM   9591  C  CD2   . PHE G 2 59  ? 32.949  84.869  -11.783 1.00 50.46  ? 78  PHE E CD2   1 
ATOM   9592  C  CE1   . PHE G 2 59  ? 35.213  84.355  -13.307 1.00 50.46  ? 78  PHE E CE1   1 
ATOM   9593  C  CE2   . PHE G 2 59  ? 33.890  83.890  -11.366 1.00 50.46  ? 78  PHE E CE2   1 
ATOM   9594  C  CZ    . PHE G 2 59  ? 35.011  83.642  -12.130 1.00 50.46  ? 78  PHE E CZ    1 
ATOM   9595  N  N     . LYS G 2 60  ? 29.959  84.927  -15.020 1.00 28.89  ? 79  LYS E N     1 
ATOM   9596  C  CA    . LYS G 2 60  ? 29.337  83.657  -15.354 1.00 28.89  ? 79  LYS E CA    1 
ATOM   9597  C  C     . LYS G 2 60  ? 27.819  83.875  -15.543 1.00 28.89  ? 79  LYS E C     1 
ATOM   9598  O  O     . LYS G 2 60  ? 27.138  84.486  -14.697 1.00 28.89  ? 79  LYS E O     1 
ATOM   9599  C  CB    . LYS G 2 60  ? 29.651  82.626  -14.260 1.00 39.61  ? 79  LYS E CB    1 
ATOM   9600  C  CG    . LYS G 2 60  ? 29.960  81.204  -14.756 1.00 39.61  ? 79  LYS E CG    1 
ATOM   9601  C  CD    . LYS G 2 60  ? 28.678  80.405  -14.983 1.00 39.61  ? 79  LYS E CD    1 
ATOM   9602  C  CE    . LYS G 2 60  ? 28.891  79.161  -15.838 1.00 39.61  ? 79  LYS E CE    1 
ATOM   9603  N  NZ    . LYS G 2 60  ? 27.582  78.755  -16.473 1.00 39.61  ? 79  LYS E NZ    1 
ATOM   9604  N  N     . THR G 2 61  ? 27.310  83.440  -16.695 1.00 24.38  ? 80  THR E N     1 
ATOM   9605  C  CA    . THR G 2 61  ? 25.892  83.589  -17.024 1.00 24.38  ? 80  THR E CA    1 
ATOM   9606  C  C     . THR G 2 61  ? 25.012  82.531  -16.387 1.00 24.38  ? 80  THR E C     1 
ATOM   9607  O  O     . THR G 2 61  ? 25.502  81.585  -15.778 1.00 24.38  ? 80  THR E O     1 
ATOM   9608  C  CB    . THR G 2 61  ? 25.678  83.525  -18.522 1.00 42.15  ? 80  THR E CB    1 
ATOM   9609  O  OG1   . THR G 2 61  ? 26.596  82.576  -19.074 1.00 42.15  ? 80  THR E OG1   1 
ATOM   9610  C  CG2   . THR G 2 61  ? 25.891  84.892  -19.157 1.00 42.15  ? 80  THR E CG2   1 
ATOM   9611  N  N     . ASP G 2 62  ? 23.705  82.694  -16.545 1.00 44.69  ? 81  ASP E N     1 
ATOM   9612  C  CA    . ASP G 2 62  ? 22.745  81.754  -15.978 1.00 44.69  ? 81  ASP E CA    1 
ATOM   9613  C  C     . ASP G 2 62  ? 23.085  81.452  -14.519 1.00 44.69  ? 81  ASP E C     1 
ATOM   9614  O  O     . ASP G 2 62  ? 23.499  80.342  -14.194 1.00 44.69  ? 81  ASP E O     1 
ATOM   9615  C  CB    . ASP G 2 62  ? 22.730  80.451  -16.785 1.00 94.42  ? 81  ASP E CB    1 
ATOM   9616  C  CG    . ASP G 2 62  ? 22.517  80.683  -18.263 1.00 94.42  ? 81  ASP E CG    1 
ATOM   9617  O  OD1   . ASP G 2 62  ? 21.384  81.031  -18.659 1.00 94.42  ? 81  ASP E OD1   1 
ATOM   9618  O  OD2   . ASP G 2 62  ? 23.491  80.520  -19.027 1.00 94.42  ? 81  ASP E OD2   1 
ATOM   9619  N  N     . LEU G 2 63  ? 22.953  82.455  -13.657 1.00 50.42  ? 82  LEU E N     1 
ATOM   9620  C  CA    . LEU G 2 63  ? 23.253  82.296  -12.237 1.00 50.42  ? 82  LEU E CA    1 
ATOM   9621  C  C     . LEU G 2 63  ? 22.106  82.717  -11.331 1.00 50.42  ? 82  LEU E C     1 
ATOM   9622  O  O     . LEU G 2 63  ? 21.355  83.624  -11.665 1.00 50.42  ? 82  LEU E O     1 
ATOM   9623  C  CB    . LEU G 2 63  ? 24.466  83.145  -11.860 1.00 31.71  ? 82  LEU E CB    1 
ATOM   9624  C  CG    . LEU G 2 63  ? 25.908  82.653  -11.986 1.00 31.71  ? 82  LEU E CG    1 
ATOM   9625  C  CD1   . LEU G 2 63  ? 26.836  83.802  -11.676 1.00 31.71  ? 82  LEU E CD1   1 
ATOM   9626  C  CD2   . LEU G 2 63  ? 26.168  81.523  -11.027 1.00 31.71  ? 82  LEU E CD2   1 
ATOM   9627  N  N     . ARG G 2 64  ? 21.961  82.044  -10.195 1.00 24.42  ? 83  ARG E N     1 
ATOM   9628  C  CA    . ARG G 2 64  ? 20.939  82.395  -9.215  1.00 24.42  ? 83  ARG E CA    1 
ATOM   9629  C  C     . ARG G 2 64  ? 21.603  82.922  -7.933  1.00 24.42  ? 83  ARG E C     1 
ATOM   9630  O  O     . ARG G 2 64  ? 22.789  82.684  -7.697  1.00 24.42  ? 83  ARG E O     1 
ATOM   9631  C  CB    . ARG G 2 64  ? 20.043  81.192  -8.907  1.00 48.97  ? 83  ARG E CB    1 
ATOM   9632  C  CG    . ARG G 2 64  ? 19.163  80.810  -10.064 1.00 48.97  ? 83  ARG E CG    1 
ATOM   9633  C  CD    . ARG G 2 64  ? 18.117  79.776  -9.711  1.00 48.97  ? 83  ARG E CD    1 
ATOM   9634  N  NE    . ARG G 2 64  ? 17.108  79.779  -10.766 1.00 48.97  ? 83  ARG E NE    1 
ATOM   9635  C  CZ    . ARG G 2 64  ? 15.789  79.798  -10.569 1.00 48.97  ? 83  ARG E CZ    1 
ATOM   9636  N  NH1   . ARG G 2 64  ? 15.284  79.790  -9.334  1.00 48.97  ? 83  ARG E NH1   1 
ATOM   9637  N  NH2   . ARG G 2 64  ? 14.976  79.918  -11.614 1.00 48.97  ? 83  ARG E NH2   1 
ATOM   9638  N  N     . PHE G 2 65  ? 20.814  83.572  -7.080  1.00 33.16  ? 84  PHE E N     1 
ATOM   9639  C  CA    . PHE G 2 65  ? 21.318  84.151  -5.835  1.00 33.16  ? 84  PHE E CA    1 
ATOM   9640  C  C     . PHE G 2 65  ? 20.349  84.062  -4.637  1.00 33.16  ? 84  PHE E C     1 
ATOM   9641  O  O     . PHE G 2 65  ? 19.204  84.522  -4.727  1.00 33.16  ? 84  PHE E O     1 
ATOM   9642  C  CB    . PHE G 2 65  ? 21.590  85.645  -6.035  1.00 32.55  ? 84  PHE E CB    1 
ATOM   9643  C  CG    . PHE G 2 65  ? 22.920  85.986  -6.668  1.00 32.55  ? 84  PHE E CG    1 
ATOM   9644  C  CD1   . PHE G 2 65  ? 23.098  85.918  -8.052  1.00 32.55  ? 84  PHE E CD1   1 
ATOM   9645  C  CD2   . PHE G 2 65  ? 23.944  86.537  -5.893  1.00 32.55  ? 84  PHE E CD2   1 
ATOM   9646  C  CE1   . PHE G 2 65  ? 24.274  86.410  -8.648  1.00 32.55  ? 84  PHE E CE1   1 
ATOM   9647  C  CE2   . PHE G 2 65  ? 25.108  87.026  -6.474  1.00 32.55  ? 84  PHE E CE2   1 
ATOM   9648  C  CZ    . PHE G 2 65  ? 25.274  86.966  -7.849  1.00 32.55  ? 84  PHE E CZ    1 
ATOM   9649  N  N     . GLN G 2 66  ? 20.824  83.534  -3.505  1.00 7.64   ? 85  GLN E N     1 
ATOM   9650  C  CA    . GLN G 2 66  ? 20.025  83.483  -2.280  1.00 7.64   ? 85  GLN E CA    1 
ATOM   9651  C  C     . GLN G 2 66  ? 19.757  84.937  -1.906  1.00 7.64   ? 85  GLN E C     1 
ATOM   9652  O  O     . GLN G 2 66  ? 20.577  85.818  -2.184  1.00 7.64   ? 85  GLN E O     1 
ATOM   9653  C  CB    . GLN G 2 66  ? 20.802  82.799  -1.144  1.00 18.63  ? 85  GLN E CB    1 
ATOM   9654  C  CG    . GLN G 2 66  ? 21.240  81.352  -1.459  1.00 18.63  ? 85  GLN E CG    1 
ATOM   9655  C  CD    . GLN G 2 66  ? 21.635  80.531  -0.214  1.00 18.63  ? 85  GLN E CD    1 
ATOM   9656  O  OE1   . GLN G 2 66  ? 22.367  80.997  0.666   1.00 18.63  ? 85  GLN E OE1   1 
ATOM   9657  N  NE2   . GLN G 2 66  ? 21.190  79.277  -0.177  1.00 18.63  ? 85  GLN E NE2   1 
ATOM   9658  N  N     . SER G 2 67  ? 18.609  85.222  -1.305  1.00 29.43  ? 86  SER E N     1 
ATOM   9659  C  CA    . SER G 2 67  ? 18.325  86.614  -0.954  1.00 29.43  ? 86  SER E CA    1 
ATOM   9660  C  C     . SER G 2 67  ? 19.445  87.070  -0.040  1.00 29.43  ? 86  SER E C     1 
ATOM   9661  O  O     . SER G 2 67  ? 20.002  88.144  -0.213  1.00 29.43  ? 86  SER E O     1 
ATOM   9662  C  CB    . SER G 2 67  ? 16.977  86.757  -0.246  1.00 44.20  ? 86  SER E CB    1 
ATOM   9663  O  OG    . SER G 2 67  ? 17.067  86.363  1.107   1.00 44.20  ? 86  SER E OG    1 
ATOM   9664  N  N     . SER G 2 68  ? 19.874  86.155  0.821   1.00 19.77  ? 87  SER E N     1 
ATOM   9665  C  CA    . SER G 2 68  ? 20.921  86.439  1.779   1.00 19.77  ? 87  SER E CA    1 
ATOM   9666  C  C     . SER G 2 68  ? 22.318  86.540  1.191   1.00 19.77  ? 87  SER E C     1 
ATOM   9667  O  O     . SER G 2 68  ? 23.181  87.173  1.779   1.00 19.77  ? 87  SER E O     1 
ATOM   9668  C  CB    . SER G 2 68  ? 20.898  85.426  2.915   1.00 23.89  ? 87  SER E CB    1 
ATOM   9669  O  OG    . SER G 2 68  ? 21.324  84.177  2.441   1.00 23.89  ? 87  SER E OG    1 
ATOM   9670  N  N     . ALA G 2 69  ? 22.575  85.898  0.064   1.00 19.03  ? 88  ALA E N     1 
ATOM   9671  C  CA    . ALA G 2 69  ? 23.892  86.031  -0.526  1.00 19.03  ? 88  ALA E CA    1 
ATOM   9672  C  C     . ALA G 2 69  ? 24.032  87.510  -0.863  1.00 19.03  ? 88  ALA E C     1 
ATOM   9673  O  O     . ALA G 2 69  ? 25.045  88.135  -0.565  1.00 19.03  ? 88  ALA E O     1 
ATOM   9674  C  CB    . ALA G 2 69  ? 23.979  85.224  -1.752  1.00 7.54   ? 88  ALA E CB    1 
ATOM   9675  N  N     . VAL G 2 70  ? 22.968  88.097  -1.402  1.00 13.75  ? 89  VAL E N     1 
ATOM   9676  C  CA    . VAL G 2 70  ? 22.987  89.519  -1.768  1.00 13.75  ? 89  VAL E CA    1 
ATOM   9677  C  C     . VAL G 2 70  ? 23.110  90.427  -0.555  1.00 13.75  ? 89  VAL E C     1 
ATOM   9678  O  O     . VAL G 2 70  ? 23.815  91.417  -0.608  1.00 13.75  ? 89  VAL E O     1 
ATOM   9679  C  CB    . VAL G 2 70  ? 21.729  89.925  -2.572  1.00 11.12  ? 89  VAL E CB    1 
ATOM   9680  C  CG1   . VAL G 2 70  ? 21.902  91.318  -3.172  1.00 11.12  ? 89  VAL E CG1   1 
ATOM   9681  C  CG2   . VAL G 2 70  ? 21.442  88.897  -3.648  1.00 11.12  ? 89  VAL E CG2   1 
ATOM   9682  N  N     . MET G 2 71  ? 22.367  90.131  0.507   1.00 14.56  ? 90  MET E N     1 
ATOM   9683  C  CA    . MET G 2 71  ? 22.442  90.915  1.729   1.00 14.56  ? 90  MET E CA    1 
ATOM   9684  C  C     . MET G 2 71  ? 23.884  90.846  2.244   1.00 14.56  ? 90  MET E C     1 
ATOM   9685  O  O     . MET G 2 71  ? 24.478  91.883  2.586   1.00 14.56  ? 90  MET E O     1 
ATOM   9686  C  CB    . MET G 2 71  ? 21.492  90.385  2.802   1.00 52.83  ? 90  MET E CB    1 
ATOM   9687  C  CG    . MET G 2 71  ? 20.018  90.728  2.625   1.00 52.83  ? 90  MET E CG    1 
ATOM   9688  S  SD    . MET G 2 71  ? 19.013  90.146  4.068   1.00 52.83  ? 90  MET E SD    1 
ATOM   9689  C  CE    . MET G 2 71  ? 18.702  88.350  3.708   1.00 52.83  ? 90  MET E CE    1 
ATOM   9690  N  N     . ALA G 2 72  ? 24.467  89.642  2.266   1.00 17.16  ? 91  ALA E N     1 
ATOM   9691  C  CA    . ALA G 2 72  ? 25.845  89.455  2.722   1.00 17.16  ? 91  ALA E CA    1 
ATOM   9692  C  C     . ALA G 2 72  ? 26.775  90.380  1.954   1.00 17.16  ? 91  ALA E C     1 
ATOM   9693  O  O     . ALA G 2 72  ? 27.597  91.066  2.548   1.00 17.16  ? 91  ALA E O     1 
ATOM   9694  C  CB    . ALA G 2 72  ? 26.264  88.027  2.541   1.00 26.01  ? 91  ALA E CB    1 
ATOM   9695  N  N     . LEU G 2 73  ? 26.638  90.415  0.635   1.00 16.85  ? 92  LEU E N     1 
ATOM   9696  C  CA    . LEU G 2 73  ? 27.457  91.318  -0.167  1.00 16.85  ? 92  LEU E CA    1 
ATOM   9697  C  C     . LEU G 2 73  ? 27.201  92.770  0.212   1.00 16.85  ? 92  LEU E C     1 
ATOM   9698  O  O     . LEU G 2 73  ? 28.145  93.538  0.348   1.00 16.85  ? 92  LEU E O     1 
ATOM   9699  C  CB    . LEU G 2 73  ? 27.190  91.140  -1.661  1.00 12.63  ? 92  LEU E CB    1 
ATOM   9700  C  CG    . LEU G 2 73  ? 27.647  89.797  -2.231  1.00 12.63  ? 92  LEU E CG    1 
ATOM   9701  C  CD1   . LEU G 2 73  ? 26.854  89.389  -3.438  1.00 12.63  ? 92  LEU E CD1   1 
ATOM   9702  C  CD2   . LEU G 2 73  ? 29.095  89.920  -2.562  1.00 12.63  ? 92  LEU E CD2   1 
ATOM   9703  N  N     . GLN G 2 74  ? 25.945  93.165  0.405   1.00 17.17  ? 93  GLN E N     1 
ATOM   9704  C  CA    . GLN G 2 74  ? 25.692  94.563  0.760   1.00 17.17  ? 93  GLN E CA    1 
ATOM   9705  C  C     . GLN G 2 74  ? 26.342  94.952  2.060   1.00 17.17  ? 93  GLN E C     1 
ATOM   9706  O  O     . GLN G 2 74  ? 27.003  95.979  2.149   1.00 17.17  ? 93  GLN E O     1 
ATOM   9707  C  CB    . GLN G 2 74  ? 24.211  94.882  0.817   1.00 18.53  ? 93  GLN E CB    1 
ATOM   9708  C  CG    . GLN G 2 74  ? 23.937  96.286  0.346   1.00 18.53  ? 93  GLN E CG    1 
ATOM   9709  C  CD    . GLN G 2 74  ? 22.475  96.556  0.175   1.00 18.53  ? 93  GLN E CD    1 
ATOM   9710  O  OE1   . GLN G 2 74  ? 21.710  95.700  -0.304  1.00 18.53  ? 93  GLN E OE1   1 
ATOM   9711  N  NE2   . GLN G 2 74  ? 22.063  97.757  0.562   1.00 18.53  ? 93  GLN E NE2   1 
ATOM   9712  N  N     . GLU G 2 75  ? 26.163  94.107  3.060   1.00 14.49  ? 94  GLU E N     1 
ATOM   9713  C  CA    . GLU G 2 75  ? 26.752  94.314  4.370   1.00 14.49  ? 94  GLU E CA    1 
ATOM   9714  C  C     . GLU G 2 75  ? 28.246  94.536  4.272   1.00 14.49  ? 94  GLU E C     1 
ATOM   9715  O  O     . GLU G 2 75  ? 28.759  95.510  4.793   1.00 14.49  ? 94  GLU E O     1 
ATOM   9716  C  CB    . GLU G 2 75  ? 26.473  93.105  5.239   1.00 35.41  ? 94  GLU E CB    1 
ATOM   9717  C  CG    . GLU G 2 75  ? 25.030  93.015  5.678   1.00 35.41  ? 94  GLU E CG    1 
ATOM   9718  C  CD    . GLU G 2 75  ? 24.653  94.093  6.688   1.00 35.41  ? 94  GLU E CD    1 
ATOM   9719  O  OE1   . GLU G 2 75  ? 25.548  94.614  7.402   1.00 35.41  ? 94  GLU E OE1   1 
ATOM   9720  O  OE2   . GLU G 2 75  ? 23.451  94.421  6.786   1.00 35.41  ? 94  GLU E OE2   1 
ATOM   9721  N  N     . ALA G 2 76  ? 28.934  93.640  3.575   1.00 10.08  ? 95  ALA E N     1 
ATOM   9722  C  CA    . ALA G 2 76  ? 30.369  93.736  3.387   1.00 10.08  ? 95  ALA E CA    1 
ATOM   9723  C  C     . ALA G 2 76  ? 30.733  94.957  2.578   1.00 10.08  ? 95  ALA E C     1 
ATOM   9724  O  O     . ALA G 2 76  ? 31.730  95.611  2.851   1.00 10.08  ? 95  ALA E O     1 
ATOM   9725  C  CB    . ALA G 2 76  ? 30.882  92.496  2.685   1.00 5.00   ? 95  ALA E CB    1 
ATOM   9726  N  N     . SER G 2 77  ? 29.928  95.260  1.570   1.00 13.59  ? 96  SER E N     1 
ATOM   9727  C  CA    . SER G 2 77  ? 30.186  96.393  0.690   1.00 13.59  ? 96  SER E CA    1 
ATOM   9728  C  C     . SER G 2 77  ? 30.199  97.743  1.380   1.00 13.59  ? 96  SER E C     1 
ATOM   9729  O  O     . SER G 2 77  ? 31.151  98.509  1.245   1.00 13.59  ? 96  SER E O     1 
ATOM   9730  C  CB    . SER G 2 77  ? 29.189  96.393  -0.469  1.00 29.71  ? 96  SER E CB    1 
ATOM   9731  O  OG    . SER G 2 77  ? 29.379  95.267  -1.321  1.00 29.71  ? 96  SER E OG    1 
ATOM   9732  N  N     . GLU G 2 78  ? 29.155  98.031  2.143   1.00 9.47   ? 97  GLU E N     1 
ATOM   9733  C  CA    . GLU G 2 78  ? 29.083  99.301  2.855   1.00 9.47   ? 97  GLU E CA    1 
ATOM   9734  C  C     . GLU G 2 78  ? 30.071  99.356  4.024   1.00 9.47   ? 97  GLU E C     1 
ATOM   9735  O  O     . GLU G 2 78  ? 30.661  100.396 4.263   1.00 9.47   ? 97  GLU E O     1 
ATOM   9736  C  CB    . GLU G 2 78  ? 27.665  99.554  3.354   1.00 21.93  ? 97  GLU E CB    1 
ATOM   9737  C  CG    . GLU G 2 78  ? 26.618  99.337  2.287   1.00 21.93  ? 97  GLU E CG    1 
ATOM   9738  C  CD    . GLU G 2 78  ? 25.297  100.045 2.570   1.00 21.93  ? 97  GLU E CD    1 
ATOM   9739  O  OE1   . GLU G 2 78  ? 25.160  100.705 3.623   1.00 21.93  ? 97  GLU E OE1   1 
ATOM   9740  O  OE2   . GLU G 2 78  ? 24.375  99.941  1.735   1.00 21.93  ? 97  GLU E OE2   1 
ATOM   9741  N  N     . ALA G 2 79  ? 30.254  98.247  4.746   1.00 5.00   ? 98  ALA E N     1 
ATOM   9742  C  CA    . ALA G 2 79  ? 31.167  98.234  5.881   1.00 5.00   ? 98  ALA E CA    1 
ATOM   9743  C  C     . ALA G 2 79  ? 32.527  98.665  5.392   1.00 5.00   ? 98  ALA E C     1 
ATOM   9744  O  O     . ALA G 2 79  ? 33.195  99.490  6.035   1.00 5.00   ? 98  ALA E O     1 
ATOM   9745  C  CB    . ALA G 2 79  ? 31.244  96.891  6.486   1.00 5.00   ? 98  ALA E CB    1 
ATOM   9746  N  N     . TYR G 2 80  ? 32.887  98.164  4.208   1.00 18.26  ? 99  TYR E N     1 
ATOM   9747  C  CA    . TYR G 2 80  ? 34.141  98.494  3.541   1.00 18.26  ? 99  TYR E CA    1 
ATOM   9748  C  C     . TYR G 2 80  ? 34.200  99.970  3.132   1.00 18.26  ? 99  TYR E C     1 
ATOM   9749  O  O     . TYR G 2 80  ? 35.174  100.663 3.414   1.00 18.26  ? 99  TYR E O     1 
ATOM   9750  C  CB    . TYR G 2 80  ? 34.320  97.591  2.320   1.00 9.24   ? 99  TYR E CB    1 
ATOM   9751  C  CG    . TYR G 2 80  ? 35.395  98.036  1.364   1.00 9.24   ? 99  TYR E CG    1 
ATOM   9752  C  CD1   . TYR G 2 80  ? 36.734  97.706  1.573   1.00 9.24   ? 99  TYR E CD1   1 
ATOM   9753  C  CD2   . TYR G 2 80  ? 35.077  98.850  0.268   1.00 9.24   ? 99  TYR E CD2   1 
ATOM   9754  C  CE1   . TYR G 2 80  ? 37.747  98.201  0.704   1.00 9.24   ? 99  TYR E CE1   1 
ATOM   9755  C  CE2   . TYR G 2 80  ? 36.057  99.339  -0.590  1.00 9.24   ? 99  TYR E CE2   1 
ATOM   9756  C  CZ    . TYR G 2 80  ? 37.386  99.021  -0.375  1.00 9.24   ? 99  TYR E CZ    1 
ATOM   9757  O  OH    . TYR G 2 80  ? 38.331  99.527  -1.261  1.00 9.24   ? 99  TYR E OH    1 
ATOM   9758  N  N     . LEU G 2 81  ? 33.169  100.430 2.433   1.00 17.47  ? 100 LEU E N     1 
ATOM   9759  C  CA    . LEU G 2 81  ? 33.093  101.810 1.976   1.00 17.47  ? 100 LEU E CA    1 
ATOM   9760  C  C     . LEU G 2 81  ? 33.101  102.828 3.099   1.00 17.47  ? 100 LEU E C     1 
ATOM   9761  O  O     . LEU G 2 81  ? 33.734  103.871 3.002   1.00 17.47  ? 100 LEU E O     1 
ATOM   9762  C  CB    . LEU G 2 81  ? 31.862  101.996 1.099   1.00 13.86  ? 100 LEU E CB    1 
ATOM   9763  C  CG    . LEU G 2 81  ? 32.116  101.518 -0.331  1.00 13.86  ? 100 LEU E CG    1 
ATOM   9764  C  CD1   . LEU G 2 81  ? 30.854  101.659 -1.144  1.00 13.86  ? 100 LEU E CD1   1 
ATOM   9765  C  CD2   . LEU G 2 81  ? 33.238  102.360 -0.961  1.00 13.86  ? 100 LEU E CD2   1 
ATOM   9766  N  N     . VAL G 2 82  ? 32.405  102.519 4.177   1.00 15.75  ? 101 VAL E N     1 
ATOM   9767  C  CA    . VAL G 2 82  ? 32.357  103.409 5.309   1.00 15.75  ? 101 VAL E CA    1 
ATOM   9768  C  C     . VAL G 2 82  ? 33.765  103.570 5.888   1.00 15.75  ? 101 VAL E C     1 
ATOM   9769  O  O     . VAL G 2 82  ? 34.222  104.693 6.078   1.00 15.75  ? 101 VAL E O     1 
ATOM   9770  C  CB    . VAL G 2 82  ? 31.337  102.902 6.364   1.00 10.48  ? 101 VAL E CB    1 
ATOM   9771  C  CG1   . VAL G 2 82  ? 31.449  103.702 7.660   1.00 10.48  ? 101 VAL E CG1   1 
ATOM   9772  C  CG2   . VAL G 2 82  ? 29.925  103.022 5.805   1.00 10.48  ? 101 VAL E CG2   1 
ATOM   9773  N  N     . ALA G 2 83  ? 34.470  102.460 6.118   1.00 30.71  ? 102 ALA E N     1 
ATOM   9774  C  CA    . ALA G 2 83  ? 35.835  102.514 6.652   1.00 30.71  ? 102 ALA E CA    1 
ATOM   9775  C  C     . ALA G 2 83  ? 36.757  103.244 5.674   1.00 30.71  ? 102 ALA E C     1 
ATOM   9776  O  O     . ALA G 2 83  ? 37.620  104.011 6.088   1.00 30.71  ? 102 ALA E O     1 
ATOM   9777  C  CB    . ALA G 2 83  ? 36.357  101.125 6.926   1.00 10.84  ? 102 ALA E CB    1 
ATOM   9778  N  N     . LEU G 2 84  ? 36.602  102.989 4.378   1.00 16.86  ? 103 LEU E N     1 
ATOM   9779  C  CA    . LEU G 2 84  ? 37.405  103.691 3.375   1.00 16.86  ? 103 LEU E CA    1 
ATOM   9780  C  C     . LEU G 2 84  ? 37.272  105.201 3.590   1.00 16.86  ? 103 LEU E C     1 
ATOM   9781  O  O     . LEU G 2 84  ? 38.254  105.922 3.563   1.00 16.86  ? 103 LEU E O     1 
ATOM   9782  C  CB    . LEU G 2 84  ? 36.929  103.352 1.966   1.00 5.00   ? 103 LEU E CB    1 
ATOM   9783  C  CG    . LEU G 2 84  ? 37.936  103.728 0.893   1.00 5.00   ? 103 LEU E CG    1 
ATOM   9784  C  CD1   . LEU G 2 84  ? 39.249  103.046 1.185   1.00 5.00   ? 103 LEU E CD1   1 
ATOM   9785  C  CD2   . LEU G 2 84  ? 37.436  103.301 -0.453  1.00 5.00   ? 103 LEU E CD2   1 
ATOM   9786  N  N     . PHE G 2 85  ? 36.045  105.675 3.804   1.00 21.69  ? 104 PHE E N     1 
ATOM   9787  C  CA    . PHE G 2 85  ? 35.805  107.095 4.035   1.00 21.69  ? 104 PHE E CA    1 
ATOM   9788  C  C     . PHE G 2 85  ? 36.475  107.634 5.301   1.00 21.69  ? 104 PHE E C     1 
ATOM   9789  O  O     . PHE G 2 85  ? 36.975  108.749 5.295   1.00 21.69  ? 104 PHE E O     1 
ATOM   9790  C  CB    . PHE G 2 85  ? 34.307  107.408 4.003   1.00 6.31   ? 104 PHE E CB    1 
ATOM   9791  C  CG    . PHE G 2 85  ? 33.700  107.361 2.618   1.00 6.31   ? 104 PHE E CG    1 
ATOM   9792  C  CD1   . PHE G 2 85  ? 34.199  108.168 1.600   1.00 6.31   ? 104 PHE E CD1   1 
ATOM   9793  C  CD2   . PHE G 2 85  ? 32.635  106.512 2.341   1.00 6.31   ? 104 PHE E CD2   1 
ATOM   9794  C  CE1   . PHE G 2 85  ? 33.654  108.137 0.319   1.00 6.31   ? 104 PHE E CE1   1 
ATOM   9795  C  CE2   . PHE G 2 85  ? 32.078  106.462 1.077   1.00 6.31   ? 104 PHE E CE2   1 
ATOM   9796  C  CZ    . PHE G 2 85  ? 32.584  107.277 0.050   1.00 6.31   ? 104 PHE E CZ    1 
ATOM   9797  N  N     . GLU G 2 86  ? 36.481  106.860 6.381   1.00 16.41  ? 105 GLU E N     1 
ATOM   9798  C  CA    . GLU G 2 86  ? 37.156  107.299 7.589   1.00 16.41  ? 105 GLU E CA    1 
ATOM   9799  C  C     . GLU G 2 86  ? 38.610  107.610 7.230   1.00 16.41  ? 105 GLU E C     1 
ATOM   9800  O  O     . GLU G 2 86  ? 39.107  108.679 7.561   1.00 16.41  ? 105 GLU E O     1 
ATOM   9801  C  CB    . GLU G 2 86  ? 37.130  106.224 8.668   1.00 35.72  ? 105 GLU E CB    1 
ATOM   9802  C  CG    . GLU G 2 86  ? 35.794  105.545 8.855   1.00 35.72  ? 105 GLU E CG    1 
ATOM   9803  C  CD    . GLU G 2 86  ? 35.713  104.717 10.126  1.00 35.72  ? 105 GLU E CD    1 
ATOM   9804  O  OE1   . GLU G 2 86  ? 36.782  104.430 10.710  1.00 35.72  ? 105 GLU E OE1   1 
ATOM   9805  O  OE2   . GLU G 2 86  ? 34.579  104.376 10.561  1.00 35.72  ? 105 GLU E OE2   1 
ATOM   9806  N  N     . ASP G 2 87  ? 39.284  106.706 6.510   1.00 20.74  ? 106 ASP E N     1 
ATOM   9807  C  CA    . ASP G 2 87  ? 40.691  106.909 6.118   1.00 20.74  ? 106 ASP E CA    1 
ATOM   9808  C  C     . ASP G 2 87  ? 40.843  108.108 5.213   1.00 20.74  ? 106 ASP E C     1 
ATOM   9809  O  O     . ASP G 2 87  ? 41.689  108.960 5.456   1.00 20.74  ? 106 ASP E O     1 
ATOM   9810  C  CB    . ASP G 2 87  ? 41.264  105.668 5.434   1.00 14.24  ? 106 ASP E CB    1 
ATOM   9811  C  CG    . ASP G 2 87  ? 41.362  104.477 6.373   1.00 14.24  ? 106 ASP E CG    1 
ATOM   9812  O  OD1   . ASP G 2 87  ? 41.285  104.659 7.610   1.00 14.24  ? 106 ASP E OD1   1 
ATOM   9813  O  OD2   . ASP G 2 87  ? 41.510  103.335 5.874   1.00 14.24  ? 106 ASP E OD2   1 
ATOM   9814  N  N     . THR G 2 88  ? 40.026  108.148 4.159   1.00 9.09   ? 107 THR E N     1 
ATOM   9815  C  CA    . THR G 2 88  ? 39.988  109.239 3.178   1.00 9.09   ? 107 THR E CA    1 
ATOM   9816  C  C     . THR G 2 88  ? 39.905  110.555 3.915   1.00 9.09   ? 107 THR E C     1 
ATOM   9817  O  O     . THR G 2 88  ? 40.681  111.453 3.662   1.00 9.09   ? 107 THR E O     1 
ATOM   9818  C  CB    . THR G 2 88  ? 38.749  109.114 2.287   1.00 11.61  ? 107 THR E CB    1 
ATOM   9819  O  OG1   . THR G 2 88  ? 38.901  107.991 1.416   1.00 11.61  ? 107 THR E OG1   1 
ATOM   9820  C  CG2   . THR G 2 88  ? 38.549  110.326 1.450   1.00 11.61  ? 107 THR E CG2   1 
ATOM   9821  N  N     . ASN G 2 89  ? 38.988  110.637 4.872   1.00 12.16  ? 108 ASN E N     1 
ATOM   9822  C  CA    . ASN G 2 89  ? 38.782  111.823 5.690   1.00 12.16  ? 108 ASN E CA    1 
ATOM   9823  C  C     . ASN G 2 89  ? 40.106  112.236 6.301   1.00 12.16  ? 108 ASN E C     1 
ATOM   9824  O  O     . ASN G 2 89  ? 40.504  113.403 6.200   1.00 12.16  ? 108 ASN E O     1 
ATOM   9825  C  CB    . ASN G 2 89  ? 37.789  111.484 6.803   1.00 25.35  ? 108 ASN E CB    1 
ATOM   9826  C  CG    . ASN G 2 89  ? 37.092  112.700 7.369   1.00 25.35  ? 108 ASN E CG    1 
ATOM   9827  O  OD1   . ASN G 2 89  ? 36.873  113.691 6.662   1.00 25.35  ? 108 ASN E OD1   1 
ATOM   9828  N  ND2   . ASN G 2 89  ? 36.688  112.614 8.637   1.00 25.35  ? 108 ASN E ND2   1 
ATOM   9829  N  N     . LEU G 2 90  ? 40.768  111.276 6.966   1.00 13.14  ? 109 LEU E N     1 
ATOM   9830  C  CA    . LEU G 2 90  ? 42.066  111.509 7.595   1.00 13.14  ? 109 LEU E CA    1 
ATOM   9831  C  C     . LEU G 2 90  ? 43.088  112.053 6.594   1.00 13.14  ? 109 LEU E C     1 
ATOM   9832  O  O     . LEU G 2 90  ? 43.820  112.978 6.901   1.00 13.14  ? 109 LEU E O     1 
ATOM   9833  C  CB    . LEU G 2 90  ? 42.572  110.250 8.251   1.00 5.00   ? 109 LEU E CB    1 
ATOM   9834  C  CG    . LEU G 2 90  ? 41.842  109.734 9.487   1.00 5.00   ? 109 LEU E CG    1 
ATOM   9835  C  CD1   . LEU G 2 90  ? 42.650  108.620 10.105  1.00 5.00   ? 109 LEU E CD1   1 
ATOM   9836  C  CD2   . LEU G 2 90  ? 41.717  110.813 10.511  1.00 5.00   ? 109 LEU E CD2   1 
ATOM   9837  N  N     . CYS G 2 91  ? 43.148  111.503 5.394   1.00 14.04  ? 110 CYS E N     1 
ATOM   9838  C  CA    . CYS G 2 91  ? 44.069  112.069 4.426   1.00 14.04  ? 110 CYS E CA    1 
ATOM   9839  C  C     . CYS G 2 91  ? 43.762  113.547 4.150   1.00 14.04  ? 110 CYS E C     1 
ATOM   9840  O  O     . CYS G 2 91  ? 44.644  114.394 4.285   1.00 14.04  ? 110 CYS E O     1 
ATOM   9841  C  CB    . CYS G 2 91  ? 44.069  111.268 3.132   1.00 16.17  ? 110 CYS E CB    1 
ATOM   9842  S  SG    . CYS G 2 91  ? 44.754  109.641 3.421   1.00 16.17  ? 110 CYS E SG    1 
ATOM   9843  N  N     . ALA G 2 92  ? 42.503  113.866 3.825   1.00 16.19  ? 111 ALA E N     1 
ATOM   9844  C  CA    . ALA G 2 92  ? 42.102  115.246 3.543   1.00 16.19  ? 111 ALA E CA    1 
ATOM   9845  C  C     . ALA G 2 92  ? 42.547  116.141 4.670   1.00 16.19  ? 111 ALA E C     1 
ATOM   9846  O  O     . ALA G 2 92  ? 43.186  117.155 4.445   1.00 16.19  ? 111 ALA E O     1 
ATOM   9847  C  CB    . ALA G 2 92  ? 40.608  115.350 3.359   1.00 7.47   ? 111 ALA E CB    1 
ATOM   9848  N  N     . ILE G 2 93  ? 42.247  115.736 5.892   1.00 22.10  ? 112 ILE E N     1 
ATOM   9849  C  CA    . ILE G 2 93  ? 42.626  116.524 7.051   1.00 22.10  ? 112 ILE E CA    1 
ATOM   9850  C  C     . ILE G 2 93  ? 44.125  116.722 7.120   1.00 22.10  ? 112 ILE E C     1 
ATOM   9851  O  O     . ILE G 2 93  ? 44.581  117.750 7.574   1.00 22.10  ? 112 ILE E O     1 
ATOM   9852  C  CB    . ILE G 2 93  ? 42.110  115.886 8.345   1.00 18.41  ? 112 ILE E CB    1 
ATOM   9853  C  CG1   . ILE G 2 93  ? 40.595  116.008 8.408   1.00 18.41  ? 112 ILE E CG1   1 
ATOM   9854  C  CG2   . ILE G 2 93  ? 42.725  116.536 9.549   1.00 18.41  ? 112 ILE E CG2   1 
ATOM   9855  C  CD1   . ILE G 2 93  ? 39.989  115.283 9.610   1.00 18.41  ? 112 ILE E CD1   1 
ATOM   9856  N  N     . HIS G 2 94  ? 44.881  115.724 6.684   1.00 18.03  ? 113 HIS E N     1 
ATOM   9857  C  CA    . HIS G 2 94  ? 46.339  115.785 6.669   1.00 18.03  ? 113 HIS E CA    1 
ATOM   9858  C  C     . HIS G 2 94  ? 46.838  116.900 5.759   1.00 18.03  ? 113 HIS E C     1 
ATOM   9859  O  O     . HIS G 2 94  ? 47.892  117.476 6.005   1.00 18.03  ? 113 HIS E O     1 
ATOM   9860  C  CB    . HIS G 2 94  ? 46.904  114.460 6.170   1.00 25.32  ? 113 HIS E CB    1 
ATOM   9861  C  CG    . HIS G 2 94  ? 48.364  114.302 6.429   1.00 25.32  ? 113 HIS E CG    1 
ATOM   9862  N  ND1   . HIS G 2 94  ? 49.309  114.391 5.428   1.00 25.32  ? 113 HIS E ND1   1 
ATOM   9863  C  CD2   . HIS G 2 94  ? 49.047  114.114 7.585   1.00 25.32  ? 113 HIS E CD2   1 
ATOM   9864  C  CE1   . HIS G 2 94  ? 50.513  114.272 5.957   1.00 25.32  ? 113 HIS E CE1   1 
ATOM   9865  N  NE2   . HIS G 2 94  ? 50.382  114.102 7.264   1.00 25.32  ? 113 HIS E NE2   1 
ATOM   9866  N  N     . ALA G 2 95  ? 46.131  117.096 4.648   1.00 19.45  ? 114 ALA E N     1 
ATOM   9867  C  CA    . ALA G 2 95  ? 46.423  118.152 3.676   1.00 19.45  ? 114 ALA E CA    1 
ATOM   9868  C  C     . ALA G 2 95  ? 45.856  119.484 4.169   1.00 19.45  ? 114 ALA E C     1 
ATOM   9869  O  O     . ALA G 2 95  ? 45.801  120.468 3.423   1.00 19.45  ? 114 ALA E O     1 
ATOM   9870  C  CB    . ALA G 2 95  ? 45.803  117.807 2.324   1.00 8.08   ? 114 ALA E CB    1 
ATOM   9871  N  N     . LYS G 2 96  ? 45.392  119.489 5.416   1.00 32.88  ? 115 LYS E N     1 
ATOM   9872  C  CA    . LYS G 2 96  ? 44.816  120.665 6.030   1.00 32.88  ? 115 LYS E CA    1 
ATOM   9873  C  C     . LYS G 2 96  ? 43.560  121.122 5.291   1.00 32.88  ? 115 LYS E C     1 
ATOM   9874  O  O     . LYS G 2 96  ? 43.289  122.318 5.215   1.00 32.88  ? 115 LYS E O     1 
ATOM   9875  C  CB    . LYS G 2 96  ? 45.857  121.771 6.106   1.00 49.66  ? 115 LYS E CB    1 
ATOM   9876  C  CG    . LYS G 2 96  ? 47.104  121.320 6.842   1.00 49.66  ? 115 LYS E CG    1 
ATOM   9877  C  CD    . LYS G 2 96  ? 48.192  122.361 6.845   1.00 49.66  ? 115 LYS E CD    1 
ATOM   9878  C  CE    . LYS G 2 96  ? 48.902  122.346 8.188   1.00 49.66  ? 115 LYS E CE    1 
ATOM   9879  N  NZ    . LYS G 2 96  ? 49.845  123.497 8.368   1.00 49.66  ? 115 LYS E NZ    1 
ATOM   9880  N  N     . ARG G 2 97  ? 42.826  120.161 4.713   1.00 29.09  ? 116 ARG E N     1 
ATOM   9881  C  CA    . ARG G 2 97  ? 41.558  120.410 4.016   1.00 29.09  ? 116 ARG E CA    1 
ATOM   9882  C  C     . ARG G 2 97  ? 40.439  119.796 4.854   1.00 29.09  ? 116 ARG E C     1 
ATOM   9883  O  O     . ARG G 2 97  ? 40.709  119.202 5.902   1.00 29.09  ? 116 ARG E O     1 
ATOM   9884  C  CB    . ARG G 2 97  ? 41.543  119.789 2.617   1.00 23.96  ? 116 ARG E CB    1 
ATOM   9885  C  CG    . ARG G 2 97  ? 42.475  120.470 1.628   1.00 23.96  ? 116 ARG E CG    1 
ATOM   9886  C  CD    . ARG G 2 97  ? 42.342  119.908 0.205   1.00 23.96  ? 116 ARG E CD    1 
ATOM   9887  N  NE    . ARG G 2 97  ? 43.222  118.771 -0.074  1.00 23.96  ? 116 ARG E NE    1 
ATOM   9888  C  CZ    . ARG G 2 97  ? 42.895  117.492 0.111   1.00 23.96  ? 116 ARG E CZ    1 
ATOM   9889  N  NH1   . ARG G 2 97  ? 41.694  117.142 0.577   1.00 23.96  ? 116 ARG E NH1   1 
ATOM   9890  N  NH2   . ARG G 2 97  ? 43.798  116.558 -0.142  1.00 23.96  ? 116 ARG E NH2   1 
ATOM   9891  N  N     . VAL G 2 98  ? 39.190  119.949 4.393   1.00 21.02  ? 117 VAL E N     1 
ATOM   9892  C  CA    . VAL G 2 98  ? 37.970  119.443 5.067   1.00 21.02  ? 117 VAL E CA    1 
ATOM   9893  C  C     . VAL G 2 98  ? 37.138  118.670 4.027   1.00 21.02  ? 117 VAL E C     1 
ATOM   9894  O  O     . VAL G 2 98  ? 36.291  117.843 4.358   1.00 21.02  ? 117 VAL E O     1 
ATOM   9895  C  CB    . VAL G 2 98  ? 37.116  120.633 5.624   1.00 26.46  ? 117 VAL E CB    1 
ATOM   9896  C  CG1   . VAL G 2 98  ? 35.859  120.143 6.281   1.00 26.46  ? 117 VAL E CG1   1 
ATOM   9897  C  CG2   . VAL G 2 98  ? 37.901  121.412 6.635   1.00 26.46  ? 117 VAL E CG2   1 
ATOM   9898  N  N     . THR G 2 99  ? 37.377  118.985 2.762   1.00 20.40  ? 118 THR E N     1 
ATOM   9899  C  CA    . THR G 2 99  ? 36.699  118.346 1.651   1.00 20.40  ? 118 THR E CA    1 
ATOM   9900  C  C     . THR G 2 99  ? 37.449  117.125 1.143   1.00 20.40  ? 118 THR E C     1 
ATOM   9901  O  O     . THR G 2 99  ? 38.523  117.260 0.561   1.00 20.40  ? 118 THR E O     1 
ATOM   9902  C  CB    . THR G 2 99  ? 36.596  119.311 0.472   1.00 19.98  ? 118 THR E CB    1 
ATOM   9903  O  OG1   . THR G 2 99  ? 36.050  120.551 0.921   1.00 19.98  ? 118 THR E OG1   1 
ATOM   9904  C  CG2   . THR G 2 99  ? 35.701  118.735 -0.602  1.00 19.98  ? 118 THR E CG2   1 
ATOM   9905  N  N     . ILE G 2 100 ? 36.882  115.938 1.301   1.00 13.88  ? 119 ILE E N     1 
ATOM   9906  C  CA    . ILE G 2 100 ? 37.586  114.767 0.794   1.00 13.88  ? 119 ILE E CA    1 
ATOM   9907  C  C     . ILE G 2 100 ? 37.598  114.850 -0.739  1.00 13.88  ? 119 ILE E C     1 
ATOM   9908  O  O     . ILE G 2 100 ? 36.663  115.380 -1.323  1.00 13.88  ? 119 ILE E O     1 
ATOM   9909  C  CB    . ILE G 2 100 ? 36.944  113.437 1.271   1.00 12.22  ? 119 ILE E CB    1 
ATOM   9910  C  CG1   . ILE G 2 100 ? 35.576  113.222 0.608   1.00 12.22  ? 119 ILE E CG1   1 
ATOM   9911  C  CG2   . ILE G 2 100 ? 36.859  113.410 2.799   1.00 12.22  ? 119 ILE E CG2   1 
ATOM   9912  C  CD1   . ILE G 2 100 ? 34.862  111.938 1.049   1.00 12.22  ? 119 ILE E CD1   1 
ATOM   9913  N  N     . MET G 2 101 ? 38.704  114.441 -1.358  1.00 26.11  ? 120 MET E N     1 
ATOM   9914  C  CA    . MET G 2 101 ? 38.862  114.445 -2.812  1.00 26.11  ? 120 MET E CA    1 
ATOM   9915  C  C     . MET G 2 101 ? 39.393  113.074 -3.229  1.00 26.11  ? 120 MET E C     1 
ATOM   9916  O  O     . MET G 2 101 ? 39.913  112.339 -2.396  1.00 26.11  ? 120 MET E O     1 
ATOM   9917  C  CB    . MET G 2 101 ? 39.887  115.488 -3.256  1.00 26.39  ? 120 MET E CB    1 
ATOM   9918  C  CG    . MET G 2 101 ? 39.857  116.818 -2.530  1.00 26.39  ? 120 MET E CG    1 
ATOM   9919  S  SD    . MET G 2 101 ? 40.863  118.061 -3.385  1.00 26.39  ? 120 MET E SD    1 
ATOM   9920  C  CE    . MET G 2 101 ? 39.969  119.541 -2.845  1.00 26.39  ? 120 MET E CE    1 
ATOM   9921  N  N     . PRO G 2 102 ? 39.279  112.717 -4.529  1.00 23.87  ? 121 PRO E N     1 
ATOM   9922  C  CA    . PRO G 2 102 ? 39.751  111.434 -5.072  1.00 23.87  ? 121 PRO E CA    1 
ATOM   9923  C  C     . PRO G 2 102 ? 41.207  111.173 -4.652  1.00 23.87  ? 121 PRO E C     1 
ATOM   9924  O  O     . PRO G 2 102 ? 41.588  110.073 -4.276  1.00 23.87  ? 121 PRO E O     1 
ATOM   9925  C  CB    . PRO G 2 102 ? 39.619  111.658 -6.576  1.00 15.50  ? 121 PRO E CB    1 
ATOM   9926  C  CG    . PRO G 2 102 ? 38.365  112.475 -6.669  1.00 15.50  ? 121 PRO E CG    1 
ATOM   9927  C  CD    . PRO G 2 102 ? 38.629  113.509 -5.591  1.00 15.50  ? 121 PRO E CD    1 
ATOM   9928  N  N     . LYS G 2 103 ? 41.996  112.231 -4.735  1.00 18.52  ? 122 LYS E N     1 
ATOM   9929  C  CA    . LYS G 2 103 ? 43.400  112.283 -4.342  1.00 18.52  ? 122 LYS E CA    1 
ATOM   9930  C  C     . LYS G 2 103 ? 43.535  111.602 -2.946  1.00 18.52  ? 122 LYS E C     1 
ATOM   9931  O  O     . LYS G 2 103 ? 44.406  110.776 -2.732  1.00 18.52  ? 122 LYS E O     1 
ATOM   9932  C  CB    . LYS G 2 103 ? 43.745  113.783 -4.267  1.00 44.76  ? 122 LYS E CB    1 
ATOM   9933  C  CG    . LYS G 2 103 ? 45.179  114.205 -4.299  1.00 44.76  ? 122 LYS E CG    1 
ATOM   9934  C  CD    . LYS G 2 103 ? 45.289  115.703 -3.975  1.00 44.76  ? 122 LYS E CD    1 
ATOM   9935  C  CE    . LYS G 2 103 ? 44.524  116.575 -4.981  1.00 44.76  ? 122 LYS E CE    1 
ATOM   9936  N  NZ    . LYS G 2 103 ? 44.589  118.056 -4.699  1.00 44.76  ? 122 LYS E NZ    1 
ATOM   9937  N  N     . ASP G 2 104 ? 42.639  111.917 -2.016  1.00 24.10  ? 123 ASP E N     1 
ATOM   9938  C  CA    . ASP G 2 104 ? 42.669  111.317 -0.678  1.00 24.10  ? 123 ASP E CA    1 
ATOM   9939  C  C     . ASP G 2 104 ? 42.318  109.836 -0.742  1.00 24.10  ? 123 ASP E C     1 
ATOM   9940  O  O     . ASP G 2 104 ? 43.013  109.007 -0.172  1.00 24.10  ? 123 ASP E O     1 
ATOM   9941  C  CB    . ASP G 2 104 ? 41.680  112.016 0.245   1.00 32.41  ? 123 ASP E CB    1 
ATOM   9942  C  CG    . ASP G 2 104 ? 41.933  113.490 0.346   1.00 32.41  ? 123 ASP E CG    1 
ATOM   9943  O  OD1   . ASP G 2 104 ? 42.889  113.874 1.031   1.00 32.41  ? 123 ASP E OD1   1 
ATOM   9944  O  OD2   . ASP G 2 104 ? 41.188  114.267 -0.262  1.00 32.41  ? 123 ASP E OD2   1 
ATOM   9945  N  N     . ILE G 2 105 ? 41.214  109.519 -1.416  1.00 31.41  ? 124 ILE E N     1 
ATOM   9946  C  CA    . ILE G 2 105 ? 40.776  108.136 -1.586  1.00 31.41  ? 124 ILE E CA    1 
ATOM   9947  C  C     . ILE G 2 105 ? 41.927  107.287 -2.112  1.00 31.41  ? 124 ILE E C     1 
ATOM   9948  O  O     . ILE G 2 105 ? 42.209  106.233 -1.570  1.00 31.41  ? 124 ILE E O     1 
ATOM   9949  C  CB    . ILE G 2 105 ? 39.621  108.027 -2.602  1.00 36.45  ? 124 ILE E CB    1 
ATOM   9950  C  CG1   . ILE G 2 105 ? 38.346  108.657 -2.030  1.00 36.45  ? 124 ILE E CG1   1 
ATOM   9951  C  CG2   . ILE G 2 105 ? 39.417  106.571 -3.031  1.00 36.45  ? 124 ILE E CG2   1 
ATOM   9952  C  CD1   . ILE G 2 105 ? 37.101  108.355 -2.844  1.00 36.45  ? 124 ILE E CD1   1 
ATOM   9953  N  N     . GLN G 2 106 ? 42.598  107.766 -3.158  1.00 23.28  ? 125 GLN E N     1 
ATOM   9954  C  CA    . GLN G 2 106 ? 43.718  107.056 -3.767  1.00 23.28  ? 125 GLN E CA    1 
ATOM   9955  C  C     . GLN G 2 106 ? 44.929  106.894 -2.852  1.00 23.28  ? 125 GLN E C     1 
ATOM   9956  O  O     . GLN G 2 106 ? 45.614  105.880 -2.914  1.00 23.28  ? 125 GLN E O     1 
ATOM   9957  C  CB    . GLN G 2 106 ? 44.101  107.723 -5.076  1.00 31.66  ? 125 GLN E CB    1 
ATOM   9958  C  CG    . GLN G 2 106 ? 42.997  107.627 -6.115  1.00 31.66  ? 125 GLN E CG    1 
ATOM   9959  C  CD    . GLN G 2 106 ? 43.102  108.692 -7.202  1.00 31.66  ? 125 GLN E CD    1 
ATOM   9960  O  OE1   . GLN G 2 106 ? 44.125  109.362 -7.336  1.00 31.66  ? 125 GLN E OE1   1 
ATOM   9961  N  NE2   . GLN G 2 106 ? 42.026  108.868 -7.972  1.00 31.66  ? 125 GLN E NE2   1 
ATOM   9962  N  N     . LEU G 2 107 ? 45.188  107.879 -1.997  1.00 16.70  ? 126 LEU E N     1 
ATOM   9963  C  CA    . LEU G 2 107 ? 46.315  107.793 -1.077  1.00 16.70  ? 126 LEU E CA    1 
ATOM   9964  C  C     . LEU G 2 107 ? 45.981  106.756 -0.013  1.00 16.70  ? 126 LEU E C     1 
ATOM   9965  O  O     . LEU G 2 107 ? 46.833  105.967 0.398   1.00 16.70  ? 126 LEU E O     1 
ATOM   9966  C  CB    . LEU G 2 107 ? 46.634  109.165 -0.432  1.00 8.01   ? 126 LEU E CB    1 
ATOM   9967  C  CG    . LEU G 2 107 ? 47.706  109.082 0.661   1.00 8.01   ? 126 LEU E CG    1 
ATOM   9968  C  CD1   . LEU G 2 107 ? 49.007  108.742 0.010   1.00 8.01   ? 126 LEU E CD1   1 
ATOM   9969  C  CD2   . LEU G 2 107 ? 47.836  110.345 1.484   1.00 8.01   ? 126 LEU E CD2   1 
ATOM   9970  N  N     . ALA G 2 108 ? 44.733  106.763 0.444   1.00 15.14  ? 127 ALA E N     1 
ATOM   9971  C  CA    . ALA G 2 108 ? 44.294  105.815 1.458   1.00 15.14  ? 127 ALA E CA    1 
ATOM   9972  C  C     . ALA G 2 108 ? 44.559  104.399 0.977   1.00 15.14  ? 127 ALA E C     1 
ATOM   9973  O  O     . ALA G 2 108 ? 45.236  103.643 1.647   1.00 15.14  ? 127 ALA E O     1 
ATOM   9974  C  CB    . ALA G 2 108 ? 42.814  106.012 1.769   1.00 32.30  ? 127 ALA E CB    1 
ATOM   9975  N  N     . ARG G 2 109 ? 44.064  104.072 -0.216  1.00 22.16  ? 128 ARG E N     1 
ATOM   9976  C  CA    . ARG G 2 109 ? 44.234  102.750 -0.818  1.00 22.16  ? 128 ARG E CA    1 
ATOM   9977  C  C     . ARG G 2 109 ? 45.689  102.432 -1.109  1.00 22.16  ? 128 ARG E C     1 
ATOM   9978  O  O     . ARG G 2 109 ? 46.106  101.305 -0.911  1.00 22.16  ? 128 ARG E O     1 
ATOM   9979  C  CB    . ARG G 2 109 ? 43.400  102.615 -2.090  1.00 27.57  ? 128 ARG E CB    1 
ATOM   9980  C  CG    . ARG G 2 109 ? 41.974  103.110 -1.935  1.00 27.57  ? 128 ARG E CG    1 
ATOM   9981  C  CD    . ARG G 2 109 ? 40.992  102.209 -2.633  1.00 27.57  ? 128 ARG E CD    1 
ATOM   9982  N  NE    . ARG G 2 109 ? 41.306  102.021 -4.046  1.00 27.57  ? 128 ARG E NE    1 
ATOM   9983  C  CZ    . ARG G 2 109 ? 41.062  100.898 -4.712  1.00 27.57  ? 128 ARG E CZ    1 
ATOM   9984  N  NH1   . ARG G 2 109 ? 40.497  99.864  -4.100  1.00 27.57  ? 128 ARG E NH1   1 
ATOM   9985  N  NH2   . ARG G 2 109 ? 41.419  100.790 -5.980  1.00 27.57  ? 128 ARG E NH2   1 
ATOM   9986  N  N     . ARG G 2 110 ? 46.455  103.401 -1.611  1.00 20.42  ? 129 ARG E N     1 
ATOM   9987  C  CA    . ARG G 2 110 ? 47.880  103.184 -1.877  1.00 20.42  ? 129 ARG E CA    1 
ATOM   9988  C  C     . ARG G 2 110 ? 48.544  102.668 -0.594  1.00 20.42  ? 129 ARG E C     1 
ATOM   9989  O  O     . ARG G 2 110 ? 49.173  101.615 -0.598  1.00 20.42  ? 129 ARG E O     1 
ATOM   9990  C  CB    . ARG G 2 110 ? 48.549  104.488 -2.340  1.00 84.01  ? 129 ARG E CB    1 
ATOM   9991  C  CG    . ARG G 2 110 ? 50.083  104.450 -2.498  1.00 84.01  ? 129 ARG E CG    1 
ATOM   9992  C  CD    . ARG G 2 110 ? 50.568  104.424 -3.966  1.00 84.01  ? 129 ARG E CD    1 
ATOM   9993  N  NE    . ARG G 2 110 ? 49.581  104.903 -4.946  1.00 84.01  ? 129 ARG E NE    1 
ATOM   9994  C  CZ    . ARG G 2 110 ? 49.363  106.182 -5.263  1.00 84.01  ? 129 ARG E CZ    1 
ATOM   9995  N  NH1   . ARG G 2 110 ? 50.064  107.148 -4.682  1.00 84.01  ? 129 ARG E NH1   1 
ATOM   9996  N  NH2   . ARG G 2 110 ? 48.423  106.498 -6.148  1.00 84.01  ? 129 ARG E NH2   1 
ATOM   9997  N  N     . ILE G 2 111 ? 48.345  103.369 0.518   1.00 28.10  ? 130 ILE E N     1 
ATOM   9998  C  CA    . ILE G 2 111 ? 48.943  102.956 1.775   1.00 28.10  ? 130 ILE E CA    1 
ATOM   9999  C  C     . ILE G 2 111 ? 48.405  101.609 2.244   1.00 28.10  ? 130 ILE E C     1 
ATOM   10000 O  O     . ILE G 2 111 ? 49.183  100.755 2.672   1.00 28.10  ? 130 ILE E O     1 
ATOM   10001 C  CB    . ILE G 2 111 ? 48.776  104.050 2.846   1.00 25.00  ? 130 ILE E CB    1 
ATOM   10002 C  CG1   . ILE G 2 111 ? 49.569  105.294 2.417   1.00 25.00  ? 130 ILE E CG1   1 
ATOM   10003 C  CG2   . ILE G 2 111 ? 49.227  103.561 4.221   1.00 25.00  ? 130 ILE E CG2   1 
ATOM   10004 C  CD1   . ILE G 2 111 ? 49.143  106.557 3.150   1.00 25.00  ? 130 ILE E CD1   1 
ATOM   10005 N  N     . ARG G 2 112 ? 47.090  101.421 2.145   1.00 39.55  ? 131 ARG E N     1 
ATOM   10006 C  CA    . ARG G 2 112 ? 46.413  100.181 2.541   1.00 39.55  ? 131 ARG E CA    1 
ATOM   10007 C  C     . ARG G 2 112 ? 46.888  98.946  1.782   1.00 39.55  ? 131 ARG E C     1 
ATOM   10008 O  O     . ARG G 2 112 ? 46.661  97.825  2.221   1.00 39.55  ? 131 ARG E O     1 
ATOM   10009 C  CB    . ARG G 2 112 ? 44.917  100.298 2.289   1.00 16.53  ? 131 ARG E CB    1 
ATOM   10010 C  CG    . ARG G 2 112 ? 44.105  101.089 3.284   1.00 16.53  ? 131 ARG E CG    1 
ATOM   10011 C  CD    . ARG G 2 112 ? 42.710  101.273 2.684   1.00 16.53  ? 131 ARG E CD    1 
ATOM   10012 N  NE    . ARG G 2 112 ? 41.660  101.437 3.677   1.00 16.53  ? 131 ARG E NE    1 
ATOM   10013 C  CZ    . ARG G 2 112 ? 40.490  100.825 3.585   1.00 16.53  ? 131 ARG E CZ    1 
ATOM   10014 N  NH1   . ARG G 2 112 ? 40.262  100.022 2.548   1.00 16.53  ? 131 ARG E NH1   1 
ATOM   10015 N  NH2   . ARG G 2 112 ? 39.544  101.029 4.501   1.00 16.53  ? 131 ARG E NH2   1 
ATOM   10016 N  N     . GLY G 2 113 ? 47.412  99.146  0.581   1.00 32.31  ? 132 GLY E N     1 
ATOM   10017 C  CA    . GLY G 2 113 ? 47.893  98.026  -0.205  1.00 32.31  ? 132 GLY E CA    1 
ATOM   10018 C  C     . GLY G 2 113 ? 46.838  97.445  -1.132  1.00 32.31  ? 132 GLY E C     1 
ATOM   10019 O  O     . GLY G 2 113 ? 46.650  96.227  -1.169  1.00 32.31  ? 132 GLY E O     1 
ATOM   10020 N  N     . GLU G 2 114 ? 46.124  98.314  -1.850  1.00 47.32  ? 133 GLU E N     1 
ATOM   10021 C  CA    . GLU G 2 114 ? 45.075  97.903  -2.791  1.00 47.32  ? 133 GLU E CA    1 
ATOM   10022 C  C     . GLU G 2 114 ? 45.418  98.377  -4.201  1.00 47.32  ? 133 GLU E C     1 
ATOM   10023 O  O     . GLU G 2 114 ? 44.846  97.922  -5.192  1.00 47.32  ? 133 GLU E O     1 
ATOM   10024 C  CB    . GLU G 2 114 ? 43.703  98.458  -2.340  1.00 16.09  ? 133 GLU E CB    1 
ATOM   10025 C  CG    . GLU G 2 114 ? 43.218  97.879  -0.986  1.00 16.09  ? 133 GLU E CG    1 
ATOM   10026 C  CD    . GLU G 2 114 ? 41.939  98.523  -0.420  1.00 16.09  ? 133 GLU E CD    1 
ATOM   10027 O  OE1   . GLU G 2 114 ? 41.174  99.168  -1.186  1.00 16.09  ? 133 GLU E OE1   1 
ATOM   10028 O  OE2   . GLU G 2 114 ? 41.706  98.373  0.810   1.00 16.09  ? 133 GLU E OE2   1 
ATOM   10029 N  N     . ARG G 2 115 ? 46.398  99.266  -4.282  1.00 123.79 ? 134 ARG E N     1 
ATOM   10030 C  CA    . ARG G 2 115 ? 46.845  99.829  -5.547  1.00 123.79 ? 134 ARG E CA    1 
ATOM   10031 C  C     . ARG G 2 115 ? 48.100  100.635 -5.195  1.00 123.79 ? 134 ARG E C     1 
ATOM   10032 O  O     . ARG G 2 115 ? 48.283  101.766 -5.657  1.00 123.79 ? 134 ARG E O     1 
ATOM   10033 C  CB    . ARG G 2 115 ? 45.742  100.741 -6.092  1.00 182.72 ? 134 ARG E CB    1 
ATOM   10034 C  CG    . ARG G 2 115 ? 45.895  101.136 -7.537  1.00 182.72 ? 134 ARG E CG    1 
ATOM   10035 C  CD    . ARG G 2 115 ? 44.722  101.990 -7.979  1.00 182.72 ? 134 ARG E CD    1 
ATOM   10036 N  NE    . ARG G 2 115 ? 44.882  102.441 -9.358  1.00 182.72 ? 134 ARG E NE    1 
ATOM   10037 C  CZ    . ARG G 2 115 ? 43.982  103.154 -10.031 1.00 182.72 ? 134 ARG E CZ    1 
ATOM   10038 N  NH1   . ARG G 2 115 ? 42.835  103.508 -9.458  1.00 182.72 ? 134 ARG E NH1   1 
ATOM   10039 N  NH2   . ARG G 2 115 ? 44.239  103.521 -11.281 1.00 182.72 ? 134 ARG E NH2   1 
ATOM   10040 N  N     . ALA G 2 116 ? 48.956  100.021 -4.373  1.00 181.34 ? 135 ALA E N     1 
ATOM   10041 C  CA    . ALA G 2 116 ? 50.203  100.609 -3.857  1.00 181.34 ? 135 ALA E CA    1 
ATOM   10042 C  C     . ALA G 2 116 ? 51.401  100.780 -4.822  1.00 181.34 ? 135 ALA E C     1 
ATOM   10043 O  O     . ALA G 2 116 ? 52.556  100.481 -4.397  1.00 49.58  ? 135 ALA E O     1 
ATOM   10044 C  CB    . ALA G 2 116 ? 50.634  99.837  -2.588  1.00 49.58  ? 135 ALA E CB    1 
ATOM   10045 O  OXT   . ALA G 2 116 ? 51.183  101.276 -5.962  1.00 49.58  ? 135 ALA E OXT   1 
ATOM   10046 N  N     . LYS H 3 1   ? 8.938   85.187  -27.137 1.00 192.20 ? 16  LYS F N     1 
ATOM   10047 C  CA    . LYS H 3 1   ? 10.295  85.240  -26.507 1.00 192.20 ? 16  LYS F CA    1 
ATOM   10048 C  C     . LYS H 3 1   ? 10.236  84.666  -25.086 1.00 192.20 ? 16  LYS F C     1 
ATOM   10049 O  O     . LYS H 3 1   ? 9.232   84.821  -24.386 1.00 192.20 ? 16  LYS F O     1 
ATOM   10050 C  CB    . LYS H 3 1   ? 10.803  86.685  -26.457 1.00 64.20  ? 16  LYS F CB    1 
ATOM   10051 C  CG    . LYS H 3 1   ? 12.318  86.845  -26.499 1.00 64.20  ? 16  LYS F CG    1 
ATOM   10052 C  CD    . LYS H 3 1   ? 12.709  88.281  -26.205 1.00 64.20  ? 16  LYS F CD    1 
ATOM   10053 C  CE    . LYS H 3 1   ? 13.946  88.675  -26.969 1.00 64.20  ? 16  LYS F CE    1 
ATOM   10054 N  NZ    . LYS H 3 1   ? 14.242  90.087  -26.732 1.00 64.20  ? 16  LYS F NZ    1 
ATOM   10055 N  N     . ARG H 3 2   ? 11.319  84.011  -24.669 1.00 147.11 ? 17  ARG F N     1 
ATOM   10056 C  CA    . ARG H 3 2   ? 11.402  83.405  -23.345 1.00 147.11 ? 17  ARG F CA    1 
ATOM   10057 C  C     . ARG H 3 2   ? 11.407  84.459  -22.252 1.00 147.11 ? 17  ARG F C     1 
ATOM   10058 O  O     . ARG H 3 2   ? 10.349  84.889  -21.793 1.00 147.11 ? 17  ARG F O     1 
ATOM   10059 C  CB    . ARG H 3 2   ? 12.654  82.526  -23.241 1.00 124.37 ? 17  ARG F CB    1 
ATOM   10060 C  CG    . ARG H 3 2   ? 12.781  81.749  -21.941 1.00 124.37 ? 17  ARG F CG    1 
ATOM   10061 C  CD    . ARG H 3 2   ? 13.802  80.647  -22.076 1.00 124.37 ? 17  ARG F CD    1 
ATOM   10062 N  NE    . ARG H 3 2   ? 13.458  79.772  -23.194 1.00 124.37 ? 17  ARG F NE    1 
ATOM   10063 C  CZ    . ARG H 3 2   ? 14.285  79.452  -24.188 1.00 124.37 ? 17  ARG F CZ    1 
ATOM   10064 N  NH1   . ARG H 3 2   ? 15.527  79.925  -24.216 1.00 124.37 ? 17  ARG F NH1   1 
ATOM   10065 N  NH2   . ARG H 3 2   ? 13.851  78.694  -25.186 1.00 124.37 ? 17  ARG F NH2   1 
ATOM   10066 N  N     . HIS H 3 3   ? 12.596  84.913  -21.878 1.00 88.38  ? 18  HIS F N     1 
ATOM   10067 C  CA    . HIS H 3 3   ? 12.732  85.899  -20.817 1.00 88.38  ? 18  HIS F CA    1 
ATOM   10068 C  C     . HIS H 3 3   ? 13.943  86.792  -21.084 1.00 88.38  ? 18  HIS F C     1 
ATOM   10069 O  O     . HIS H 3 3   ? 14.383  86.959  -22.226 1.00 88.38  ? 18  HIS F O     1 
ATOM   10070 C  CB    . HIS H 3 3   ? 12.974  85.185  -19.464 1.00 179.56 ? 18  HIS F CB    1 
ATOM   10071 C  CG    . HIS H 3 3   ? 11.799  84.421  -18.925 1.00 179.56 ? 18  HIS F CG    1 
ATOM   10072 N  ND1   . HIS H 3 3   ? 11.467  83.154  -19.356 1.00 179.56 ? 18  HIS F ND1   1 
ATOM   10073 C  CD2   . HIS H 3 3   ? 10.929  84.713  -17.927 1.00 179.56 ? 18  HIS F CD2   1 
ATOM   10074 C  CE1   . HIS H 3 3   ? 10.449  82.697  -18.649 1.00 179.56 ? 18  HIS F CE1   1 
ATOM   10075 N  NE2   . HIS H 3 3   ? 10.104  83.624  -17.774 1.00 179.56 ? 18  HIS F NE2   1 
ATOM   10076 N  N     . ARG H 3 4   ? 14.447  87.358  -19.986 1.00 143.68 ? 19  ARG F N     1 
ATOM   10077 C  CA    . ARG H 3 4   ? 15.629  88.205  -19.924 1.00 143.68 ? 19  ARG F CA    1 
ATOM   10078 C  C     . ARG H 3 4   ? 15.569  89.650  -20.394 1.00 143.68 ? 19  ARG F C     1 
ATOM   10079 O  O     . ARG H 3 4   ? 15.128  89.950  -21.507 1.00 143.68 ? 19  ARG F O     1 
ATOM   10080 C  CB    . ARG H 3 4   ? 16.820  87.501  -20.577 1.00 166.80 ? 19  ARG F CB    1 
ATOM   10081 C  CG    . ARG H 3 4   ? 18.168  87.948  -20.041 1.00 166.80 ? 19  ARG F CG    1 
ATOM   10082 C  CD    . ARG H 3 4   ? 19.066  88.449  -21.158 1.00 166.80 ? 19  ARG F CD    1 
ATOM   10083 N  NE    . ARG H 3 4   ? 20.465  88.532  -20.741 1.00 166.80 ? 19  ARG F NE    1 
ATOM   10084 C  CZ    . ARG H 3 4   ? 21.396  87.631  -21.054 1.00 166.80 ? 19  ARG F CZ    1 
ATOM   10085 N  NH1   . ARG H 3 4   ? 21.079  86.572  -21.790 1.00 166.80 ? 19  ARG F NH1   1 
ATOM   10086 N  NH2   . ARG H 3 4   ? 22.648  87.786  -20.635 1.00 166.80 ? 19  ARG F NH2   1 
ATOM   10087 N  N     . LYS H 3 5   ? 16.011  90.532  -19.498 1.00 42.55  ? 20  LYS F N     1 
ATOM   10088 C  CA    . LYS H 3 5   ? 16.121  91.971  -19.748 1.00 42.55  ? 20  LYS F CA    1 
ATOM   10089 C  C     . LYS H 3 5   ? 17.638  92.213  -19.648 1.00 42.55  ? 20  LYS F C     1 
ATOM   10090 O  O     . LYS H 3 5   ? 18.330  91.530  -18.876 1.00 42.55  ? 20  LYS F O     1 
ATOM   10091 C  CB    . LYS H 3 5   ? 15.387  92.784  -18.665 1.00 52.35  ? 20  LYS F CB    1 
ATOM   10092 C  CG    . LYS H 3 5   ? 14.811  94.141  -19.145 1.00 52.35  ? 20  LYS F CG    1 
ATOM   10093 C  CD    . LYS H 3 5   ? 15.869  95.140  -19.650 1.00 52.35  ? 20  LYS F CD    1 
ATOM   10094 C  CE    . LYS H 3 5   ? 15.245  96.412  -20.251 1.00 52.35  ? 20  LYS F CE    1 
ATOM   10095 N  NZ    . LYS H 3 5   ? 15.884  97.662  -19.745 1.00 52.35  ? 20  LYS F NZ    1 
ATOM   10096 N  N     . VAL H 3 6   ? 18.174  93.121  -20.461 1.00 29.96  ? 21  VAL F N     1 
ATOM   10097 C  CA    . VAL H 3 6   ? 19.609  93.380  -20.407 1.00 29.96  ? 21  VAL F CA    1 
ATOM   10098 C  C     . VAL H 3 6   ? 19.939  94.271  -19.245 1.00 29.96  ? 21  VAL F C     1 
ATOM   10099 O  O     . VAL H 3 6   ? 19.278  95.290  -19.006 1.00 29.96  ? 21  VAL F O     1 
ATOM   10100 C  CB    . VAL H 3 6   ? 20.187  93.989  -21.704 1.00 26.17  ? 21  VAL F CB    1 
ATOM   10101 C  CG1   . VAL H 3 6   ? 19.914  93.078  -22.839 1.00 26.17  ? 21  VAL F CG1   1 
ATOM   10102 C  CG2   . VAL H 3 6   ? 19.596  95.373  -21.982 1.00 26.17  ? 21  VAL F CG2   1 
ATOM   10103 N  N     . LEU H 3 7   ? 20.951  93.849  -18.504 1.00 30.71  ? 22  LEU F N     1 
ATOM   10104 C  CA    . LEU H 3 7   ? 21.403  94.592  -17.350 1.00 30.71  ? 22  LEU F CA    1 
ATOM   10105 C  C     . LEU H 3 7   ? 22.598  95.402  -17.767 1.00 30.71  ? 22  LEU F C     1 
ATOM   10106 O  O     . LEU H 3 7   ? 23.573  94.844  -18.264 1.00 30.71  ? 22  LEU F O     1 
ATOM   10107 C  CB    . LEU H 3 7   ? 21.800  93.629  -16.245 1.00 19.20  ? 22  LEU F CB    1 
ATOM   10108 C  CG    . LEU H 3 7   ? 20.620  92.847  -15.686 1.00 19.20  ? 22  LEU F CG    1 
ATOM   10109 C  CD1   . LEU H 3 7   ? 21.092  91.500  -15.181 1.00 19.20  ? 22  LEU F CD1   1 
ATOM   10110 C  CD2   . LEU H 3 7   ? 19.954  93.647  -14.588 1.00 19.20  ? 22  LEU F CD2   1 
ATOM   10111 N  N     . ARG H 3 8   ? 22.491  96.720  -17.636 1.00 29.57  ? 23  ARG F N     1 
ATOM   10112 C  CA    . ARG H 3 8   ? 23.598  97.596  -17.984 1.00 29.57  ? 23  ARG F CA    1 
ATOM   10113 C  C     . ARG H 3 8   ? 23.549  98.913  -17.259 1.00 29.57  ? 23  ARG F C     1 
ATOM   10114 O  O     . ARG H 3 8   ? 22.479  99.403  -16.915 1.00 29.57  ? 23  ARG F O     1 
ATOM   10115 C  CB    . ARG H 3 8   ? 23.699  97.823  -19.492 1.00 15.25  ? 23  ARG F CB    1 
ATOM   10116 C  CG    . ARG H 3 8   ? 22.531  98.487  -20.130 1.00 15.25  ? 23  ARG F CG    1 
ATOM   10117 C  CD    . ARG H 3 8   ? 22.723  98.396  -21.612 1.00 15.25  ? 23  ARG F CD    1 
ATOM   10118 N  NE    . ARG H 3 8   ? 22.447  99.656  -22.304 1.00 15.25  ? 23  ARG F NE    1 
ATOM   10119 C  CZ    . ARG H 3 8   ? 21.224  100.136 -22.544 1.00 15.25  ? 23  ARG F CZ    1 
ATOM   10120 N  NH1   . ARG H 3 8   ? 20.126  99.480  -22.145 1.00 15.25  ? 23  ARG F NH1   1 
ATOM   10121 N  NH2   . ARG H 3 8   ? 21.099  101.257 -23.231 1.00 15.25  ? 23  ARG F NH2   1 
ATOM   10122 N  N     . ASP H 3 9   ? 24.738  99.428  -16.954 1.00 17.59  ? 24  ASP F N     1 
ATOM   10123 C  CA    . ASP H 3 9   ? 24.906  100.702 -16.259 1.00 17.59  ? 24  ASP F CA    1 
ATOM   10124 C  C     . ASP H 3 9   ? 24.298  100.748 -14.875 1.00 17.59  ? 24  ASP F C     1 
ATOM   10125 O  O     . ASP H 3 9   ? 24.037  101.818 -14.361 1.00 17.59  ? 24  ASP F O     1 
ATOM   10126 C  CB    . ASP H 3 9   ? 24.331  101.828 -17.106 1.00 44.09  ? 24  ASP F CB    1 
ATOM   10127 C  CG    . ASP H 3 9   ? 25.037  103.123 -16.881 1.00 44.09  ? 24  ASP F CG    1 
ATOM   10128 O  OD1   . ASP H 3 9   ? 26.277  103.141 -17.034 1.00 44.09  ? 24  ASP F OD1   1 
ATOM   10129 O  OD2   . ASP H 3 9   ? 24.360  104.119 -16.552 1.00 44.09  ? 24  ASP F OD2   1 
ATOM   10130 N  N     . ASN H 3 10  ? 24.087  99.598  -14.252 1.00 19.05  ? 25  ASN F N     1 
ATOM   10131 C  CA    . ASN H 3 10  ? 23.514  99.584  -12.922 1.00 19.05  ? 25  ASN F CA    1 
ATOM   10132 C  C     . ASN H 3 10  ? 24.426  100.194 -11.876 1.00 19.05  ? 25  ASN F C     1 
ATOM   10133 O  O     . ASN H 3 10  ? 24.012  100.413 -10.741 1.00 19.05  ? 25  ASN F O     1 
ATOM   10134 C  CB    . ASN H 3 10  ? 23.085  98.183  -12.531 1.00 20.91  ? 25  ASN F CB    1 
ATOM   10135 C  CG    . ASN H 3 10  ? 21.805  97.767  -13.230 1.00 20.91  ? 25  ASN F CG    1 
ATOM   10136 O  OD1   . ASN H 3 10  ? 20.694  98.173  -12.845 1.00 20.91  ? 25  ASN F OD1   1 
ATOM   10137 N  ND2   . ASN H 3 10  ? 21.954  97.002  -14.300 1.00 20.91  ? 25  ASN F ND2   1 
ATOM   10138 N  N     . ILE H 3 11  ? 25.655  100.506 -12.266 1.00 33.36  ? 26  ILE F N     1 
ATOM   10139 C  CA    . ILE H 3 11  ? 26.603  101.125 -11.358 1.00 33.36  ? 26  ILE F CA    1 
ATOM   10140 C  C     . ILE H 3 11  ? 26.011  102.472 -10.938 1.00 33.36  ? 26  ILE F C     1 
ATOM   10141 O  O     . ILE H 3 11  ? 26.311  102.961 -9.860  1.00 33.36  ? 26  ILE F O     1 
ATOM   10142 C  CB    . ILE H 3 11  ? 27.984  101.342 -12.053 1.00 13.03  ? 26  ILE F CB    1 
ATOM   10143 C  CG1   . ILE H 3 11  ? 29.161  100.888 -11.159 1.00 13.03  ? 26  ILE F CG1   1 
ATOM   10144 C  CG2   . ILE H 3 11  ? 28.138  102.788 -12.525 1.00 13.03  ? 26  ILE F CG2   1 
ATOM   10145 C  CD1   . ILE H 3 11  ? 29.403  101.657 -9.887  1.00 13.03  ? 26  ILE F CD1   1 
ATOM   10146 N  N     . GLN H 3 12  ? 25.131  103.053 -11.753 1.00 28.86  ? 27  GLN F N     1 
ATOM   10147 C  CA    . GLN H 3 12  ? 24.549  104.351 -11.411 1.00 28.86  ? 27  GLN F CA    1 
ATOM   10148 C  C     . GLN H 3 12  ? 23.457  104.271 -10.347 1.00 28.86  ? 27  GLN F C     1 
ATOM   10149 O  O     . GLN H 3 12  ? 22.930  105.305 -9.919  1.00 28.86  ? 27  GLN F O     1 
ATOM   10150 C  CB    . GLN H 3 12  ? 24.037  105.070 -12.653 1.00 32.34  ? 27  GLN F CB    1 
ATOM   10151 C  CG    . GLN H 3 12  ? 25.091  105.316 -13.736 1.00 32.34  ? 27  GLN F CG    1 
ATOM   10152 C  CD    . GLN H 3 12  ? 26.225  106.240 -13.303 1.00 32.34  ? 27  GLN F CD    1 
ATOM   10153 O  OE1   . GLN H 3 12  ? 25.995  107.280 -12.680 1.00 32.34  ? 27  GLN F OE1   1 
ATOM   10154 N  NE2   . GLN H 3 12  ? 27.458  105.873 -13.656 1.00 32.34  ? 27  GLN F NE2   1 
ATOM   10155 N  N     . GLY H 3 13  ? 23.143  103.045 -9.908  1.00 26.28  ? 28  GLY F N     1 
ATOM   10156 C  CA    . GLY H 3 13  ? 22.154  102.821 -8.859  1.00 26.28  ? 28  GLY F CA    1 
ATOM   10157 C  C     . GLY H 3 13  ? 22.779  103.227 -7.533  1.00 26.28  ? 28  GLY F C     1 
ATOM   10158 O  O     . GLY H 3 13  ? 22.143  103.228 -6.463  1.00 26.28  ? 28  GLY F O     1 
ATOM   10159 N  N     . ILE H 3 14  ? 24.082  103.478 -7.599  1.00 22.58  ? 29  ILE F N     1 
ATOM   10160 C  CA    . ILE H 3 14  ? 24.832  103.924 -6.455  1.00 22.58  ? 29  ILE F CA    1 
ATOM   10161 C  C     . ILE H 3 14  ? 24.662  105.408 -6.624  1.00 22.58  ? 29  ILE F C     1 
ATOM   10162 O  O     . ILE H 3 14  ? 25.413  106.073 -7.337  1.00 22.58  ? 29  ILE F O     1 
ATOM   10163 C  CB    . ILE H 3 14  ? 26.313  103.526 -6.555  1.00 30.31  ? 29  ILE F CB    1 
ATOM   10164 C  CG1   . ILE H 3 14  ? 26.434  102.018 -6.845  1.00 30.31  ? 29  ILE F CG1   1 
ATOM   10165 C  CG2   . ILE H 3 14  ? 27.042  103.912 -5.275  1.00 30.31  ? 29  ILE F CG2   1 
ATOM   10166 C  CD1   . ILE H 3 14  ? 25.647  101.129 -5.908  1.00 30.31  ? 29  ILE F CD1   1 
ATOM   10167 N  N     . THR H 3 15  ? 23.566  105.885 -6.057  1.00 21.16  ? 30  THR F N     1 
ATOM   10168 C  CA    . THR H 3 15  ? 23.193  107.276 -6.124  1.00 21.16  ? 30  THR F CA    1 
ATOM   10169 C  C     . THR H 3 15  ? 24.086  108.232 -5.342  1.00 21.16  ? 30  THR F C     1 
ATOM   10170 O  O     . THR H 3 15  ? 24.708  107.856 -4.339  1.00 21.16  ? 30  THR F O     1 
ATOM   10171 C  CB    . THR H 3 15  ? 21.716  107.433 -5.689  1.00 29.66  ? 30  THR F CB    1 
ATOM   10172 O  OG1   . THR H 3 15  ? 21.512  106.908 -4.365  1.00 29.66  ? 30  THR F OG1   1 
ATOM   10173 C  CG2   . THR H 3 15  ? 20.845  106.673 -6.649  1.00 29.66  ? 30  THR F CG2   1 
ATOM   10174 N  N     . LYS H 3 16  ? 24.147  109.472 -5.829  1.00 26.39  ? 31  LYS F N     1 
ATOM   10175 C  CA    . LYS H 3 16  ? 24.905  110.536 -5.182  1.00 26.39  ? 31  LYS F CA    1 
ATOM   10176 C  C     . LYS H 3 16  ? 24.515  110.551 -3.680  1.00 26.39  ? 31  LYS F C     1 
ATOM   10177 O  O     . LYS H 3 16  ? 25.391  110.462 -2.816  1.00 26.39  ? 31  LYS F O     1 
ATOM   10178 C  CB    . LYS H 3 16  ? 24.604  111.863 -5.882  1.00 24.79  ? 31  LYS F CB    1 
ATOM   10179 C  CG    . LYS H 3 16  ? 25.421  113.035 -5.415  1.00 24.79  ? 31  LYS F CG    1 
ATOM   10180 C  CD    . LYS H 3 16  ? 24.990  114.293 -6.125  1.00 24.79  ? 31  LYS F CD    1 
ATOM   10181 C  CE    . LYS H 3 16  ? 25.504  115.531 -5.397  1.00 24.79  ? 31  LYS F CE    1 
ATOM   10182 N  NZ    . LYS H 3 16  ? 24.964  116.787 -6.019  1.00 24.79  ? 31  LYS F NZ    1 
ATOM   10183 N  N     . PRO H 3 17  ? 23.194  110.623 -3.351  1.00 26.78  ? 32  PRO F N     1 
ATOM   10184 C  CA    . PRO H 3 17  ? 22.777  110.621 -1.944  1.00 26.78  ? 32  PRO F CA    1 
ATOM   10185 C  C     . PRO H 3 17  ? 23.159  109.351 -1.178  1.00 26.78  ? 32  PRO F C     1 
ATOM   10186 O  O     . PRO H 3 17  ? 23.494  109.426 -0.011  1.00 26.78  ? 32  PRO F O     1 
ATOM   10187 C  CB    . PRO H 3 17  ? 21.258  110.789 -2.037  1.00 24.44  ? 32  PRO F CB    1 
ATOM   10188 C  CG    . PRO H 3 17  ? 20.914  110.372 -3.420  1.00 24.44  ? 32  PRO F CG    1 
ATOM   10189 C  CD    . PRO H 3 17  ? 22.034  110.972 -4.193  1.00 24.44  ? 32  PRO F CD    1 
ATOM   10190 N  N     . ALA H 3 18  ? 23.110  108.185 -1.808  1.00 17.28  ? 33  ALA F N     1 
ATOM   10191 C  CA    . ALA H 3 18  ? 23.504  106.983 -1.089  1.00 17.28  ? 33  ALA F CA    1 
ATOM   10192 C  C     . ALA H 3 18  ? 24.979  107.052 -0.693  1.00 17.28  ? 33  ALA F C     1 
ATOM   10193 O  O     . ALA H 3 18  ? 25.338  106.752 0.446   1.00 17.28  ? 33  ALA F O     1 
ATOM   10194 C  CB    . ALA H 3 18  ? 23.220  105.764 -1.907  1.00 5.00   ? 33  ALA F CB    1 
ATOM   10195 N  N     . ILE H 3 19  ? 25.834  107.472 -1.621  1.00 6.09   ? 34  ILE F N     1 
ATOM   10196 C  CA    . ILE H 3 19  ? 27.271  107.616 -1.326  1.00 6.09   ? 34  ILE F CA    1 
ATOM   10197 C  C     . ILE H 3 19  ? 27.508  108.706 -0.267  1.00 6.09   ? 34  ILE F C     1 
ATOM   10198 O  O     . ILE H 3 19  ? 28.433  108.605 0.549   1.00 6.09   ? 34  ILE F O     1 
ATOM   10199 C  CB    . ILE H 3 19  ? 28.054  108.069 -2.569  1.00 8.45   ? 34  ILE F CB    1 
ATOM   10200 C  CG1   . ILE H 3 19  ? 28.041  106.979 -3.647  1.00 8.45   ? 34  ILE F CG1   1 
ATOM   10201 C  CG2   . ILE H 3 19  ? 29.450  108.574 -2.169  1.00 8.45   ? 34  ILE F CG2   1 
ATOM   10202 C  CD1   . ILE H 3 19  ? 28.477  107.478 -4.992  1.00 8.45   ? 34  ILE F CD1   1 
ATOM   10203 N  N     . ARG H 3 20  ? 26.740  109.799 -0.345  1.00 17.00  ? 35  ARG F N     1 
ATOM   10204 C  CA    . ARG H 3 20  ? 26.884  110.890 0.627   1.00 17.00  ? 35  ARG F CA    1 
ATOM   10205 C  C     . ARG H 3 20  ? 26.536  110.379 2.030   1.00 17.00  ? 35  ARG F C     1 
ATOM   10206 O  O     . ARG H 3 20  ? 27.162  110.752 3.014   1.00 17.00  ? 35  ARG F O     1 
ATOM   10207 C  CB    . ARG H 3 20  ? 26.045  112.112 0.220   1.00 62.74  ? 35  ARG F CB    1 
ATOM   10208 C  CG    . ARG H 3 20  ? 26.516  113.417 0.867   1.00 62.74  ? 35  ARG F CG    1 
ATOM   10209 C  CD    . ARG H 3 20  ? 25.937  114.664 0.219   1.00 62.74  ? 35  ARG F CD    1 
ATOM   10210 N  NE    . ARG H 3 20  ? 24.487  114.649 0.316   1.00 62.74  ? 35  ARG F NE    1 
ATOM   10211 C  CZ    . ARG H 3 20  ? 23.671  114.785 -0.724  1.00 62.74  ? 35  ARG F CZ    1 
ATOM   10212 N  NH1   . ARG H 3 20  ? 24.162  114.965 -1.945  1.00 62.74  ? 35  ARG F NH1   1 
ATOM   10213 N  NH2   . ARG H 3 20  ? 22.363  114.656 -0.555  1.00 62.74  ? 35  ARG F NH2   1 
ATOM   10214 N  N     . ARG H 3 21  ? 25.571  109.471 2.108   1.00 12.74  ? 36  ARG F N     1 
ATOM   10215 C  CA    . ARG H 3 21  ? 25.188  108.885 3.382   1.00 12.74  ? 36  ARG F CA    1 
ATOM   10216 C  C     . ARG H 3 21  ? 26.345  108.071 3.926   1.00 12.74  ? 36  ARG F C     1 
ATOM   10217 O  O     . ARG H 3 21  ? 26.689  108.186 5.099   1.00 12.74  ? 36  ARG F O     1 
ATOM   10218 C  CB    . ARG H 3 21  ? 23.968  107.969 3.220   1.00 20.32  ? 36  ARG F CB    1 
ATOM   10219 C  CG    . ARG H 3 21  ? 22.630  108.678 3.176   1.00 20.32  ? 36  ARG F CG    1 
ATOM   10220 C  CD    . ARG H 3 21  ? 21.492  107.688 3.281   1.00 20.32  ? 36  ARG F CD    1 
ATOM   10221 N  NE    . ARG H 3 21  ? 21.263  106.880 2.079   1.00 20.32  ? 36  ARG F NE    1 
ATOM   10222 C  CZ    . ARG H 3 21  ? 20.668  107.308 0.959   1.00 20.32  ? 36  ARG F CZ    1 
ATOM   10223 N  NH1   . ARG H 3 21  ? 20.245  108.561 0.839   1.00 20.32  ? 36  ARG F NH1   1 
ATOM   10224 N  NH2   . ARG H 3 21  ? 20.446  106.447 -0.034  1.00 20.32  ? 36  ARG F NH2   1 
ATOM   10225 N  N     . LEU H 3 22  ? 26.915  107.214 3.078   1.00 18.40  ? 37  LEU F N     1 
ATOM   10226 C  CA    . LEU H 3 22  ? 28.053  106.378 3.467   1.00 18.40  ? 37  LEU F CA    1 
ATOM   10227 C  C     . LEU H 3 22  ? 29.188  107.218 4.073   1.00 18.40  ? 37  LEU F C     1 
ATOM   10228 O  O     . LEU H 3 22  ? 29.695  106.897 5.152   1.00 18.40  ? 37  LEU F O     1 
ATOM   10229 C  CB    . LEU H 3 22  ? 28.544  105.580 2.258   1.00 5.00   ? 37  LEU F CB    1 
ATOM   10230 C  CG    . LEU H 3 22  ? 27.663  104.375 1.937   1.00 5.00   ? 37  LEU F CG    1 
ATOM   10231 C  CD1   . LEU H 3 22  ? 27.677  103.991 0.476   1.00 5.00   ? 37  LEU F CD1   1 
ATOM   10232 C  CD2   . LEU H 3 22  ? 28.134  103.262 2.806   1.00 5.00   ? 37  LEU F CD2   1 
ATOM   10233 N  N     . ALA H 3 23  ? 29.536  108.321 3.399   1.00 17.35  ? 38  ALA F N     1 
ATOM   10234 C  CA    . ALA H 3 23  ? 30.571  109.260 3.858   1.00 17.35  ? 38  ALA F CA    1 
ATOM   10235 C  C     . ALA H 3 23  ? 30.269  109.797 5.263   1.00 17.35  ? 38  ALA F C     1 
ATOM   10236 O  O     . ALA H 3 23  ? 31.163  109.915 6.108   1.00 17.35  ? 38  ALA F O     1 
ATOM   10237 C  CB    . ALA H 3 23  ? 30.700  110.412 2.873   1.00 5.00   ? 38  ALA F CB    1 
ATOM   10238 N  N     . ARG H 3 24  ? 29.015  110.174 5.476   1.00 14.06  ? 39  ARG F N     1 
ATOM   10239 C  CA    . ARG H 3 24  ? 28.547  110.679 6.760   1.00 14.06  ? 39  ARG F CA    1 
ATOM   10240 C  C     . ARG H 3 24  ? 28.796  109.703 7.889   1.00 14.06  ? 39  ARG F C     1 
ATOM   10241 O  O     . ARG H 3 24  ? 29.216  110.108 8.970   1.00 14.06  ? 39  ARG F O     1 
ATOM   10242 C  CB    . ARG H 3 24  ? 27.054  110.955 6.693   1.00 11.94  ? 39  ARG F CB    1 
ATOM   10243 C  CG    . ARG H 3 24  ? 26.694  112.033 5.730   1.00 11.94  ? 39  ARG F CG    1 
ATOM   10244 C  CD    . ARG H 3 24  ? 27.337