data_1ARD
# 
_entry.id   1ARD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ARD         
WWPDB D_1000171163 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ARD 
_pdbx_database_status.recvd_initial_deposition_date   1993-10-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoffman, R.C.'  1 
'Xu, R.X.'       2 
'Horvath, S.J.'  3 
'Herriott, J.R.' 4 
'Klevit, R.E.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structures of DNA-binding mutant zinc finger domains: implications for DNA binding.'                                     
'Protein Sci.' 2   951 965 1993 PRCIEI US 0961-8368 0795 ? 8318900 ? 
1       'A Simple Method for the Refinement of Models Derived from NMR Data Demonstrated on a Zinc Finger Domain from Yeast Adr1' 
J.Magn.Reson.  102 61  ?   1993 JOMRA4 US 0022-2364 0624 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoffman, R.C.'  1 
primary 'Horvath, S.J.'  2 
primary 'Klevit, R.E.'   3 
1       'Hoffman, R.C.'  4 
1       'Xu, R.X.'       5 
1       'Klevit, R.E.'   6 
1       'Herriott, J.R.' 7 
# 
_cell.entry_id           1ARD 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ARD 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'YEAST TRANSCRIPTION FACTOR ADR1' 3600.103 1 ? ? ? ? 
2 non-polymer syn 'ZINC ION'                        65.409   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RSFVCEVCTRAFARQEHLKRHYRSHTNEK 
_entity_poly.pdbx_seq_one_letter_code_can   RSFVCEVCTRAFARQEHLKRHYRSHTNEK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  SER n 
1 3  PHE n 
1 4  VAL n 
1 5  CYS n 
1 6  GLU n 
1 7  VAL n 
1 8  CYS n 
1 9  THR n 
1 10 ARG n 
1 11 ALA n 
1 12 PHE n 
1 13 ALA n 
1 14 ARG n 
1 15 GLN n 
1 16 GLU n 
1 17 HIS n 
1 18 LEU n 
1 19 LYS n 
1 20 ARG n 
1 21 HIS n 
1 22 TYR n 
1 23 ARG n 
1 24 SER n 
1 25 HIS n 
1 26 THR n 
1 27 ASN n 
1 28 GLU n 
1 29 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADR1_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P07248 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MANVEKPNDCSGFPVVDLNSCFSNGFNNEKQEIEMETDDSPILLMSSSASRENSNTFSVIQRTPDGKIITTNNNMNSKIN
KQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLG
ETISHTKKVSRTITKARKNSASSVKFQTPTYGTPDNGNFLNRTTANTRRKASPEANVKRKYLKKLTRRASFSAQSASSYA
LPDQSSLEQHPKDRVKFSTPELVPLDLKNPELDSSFDLNMNLDLNLNLDSNFNIALNRSDSSGSTMNLDYKLPESANNYT
YSSGSPTRAYVGANTNSKNASFNDADLLSSSYWIKAYNDHLFSVSESDETSPMNSELNDTKLIVPDFKSTIHHLKDSRSS
SWTVAIDNNSNNNKVSDNQPDFVDFQELLDNDTLGNDLLETTAVLKEFELLHDDSVSATATSNEIDLSHLNLSNSPISPH
KLIYKNKEGTNDDMLISFGLDHPSNREDDLDKLCNMTRDVQAIFSQYLKGEESKRSLEDFLSTSNRKEKPDSGNYTFYGL
DCLTLSKISRALPASTVNNNQPSHSIESKLFNEPMRNMCIKVLRYYEKFSHDSSESVMDSNPNLLSKELLMPAVSELNEY
LDLFKNNFLPHFPIIHPSLLDLDLDSLQRYTNEDGYDDAENAQLFDRLSQGTDKEYDYEHYQILSISKIVCLPLFMATFG
SLHKFGYKSQTIELYEMSRRILHSFLETKRRCRSTTVNDSYQNIWLMQSLILSFMFALVADYLEKIDSSLMKRQLSALCS
TIRSNCLPTISANSEKSINNNNEPLTFGSPLQYIIFESKIRCTLMAYDFCQFLKCFFHIKFDLSIKEKDVETIYIPDNES
KWASESIICNGHVVQKQNFYDFRNFYYSFTYGHLHSIPEFLGSSMIYYEYDLRKGTKSHVFLDRIDTKRLERSLDTSSYG
NDNMAATNKNIAILIDDTIILKNNLMSMRFIKQIDRSFTEKVRKGQIAKIYDSFLNSVRLNFLKNYSVEVLCEFLVALNF
SIRNISSLYVEEESDCSQRMNSPELPRIHLNNQALSVFNLQGYYYCFILIIKFLLDFEATPNFKLLRIFIELRSLANSIL
LPTLSRLYPQEFSGFPDVVFTQQFINKDNGMLVPGLSANEHHNGASAAVKTKLAKKINVEGLAMFINEILVNSFNDTSFL
NMEDPIRNEFSFDNGHRAVTDLPRSAHFLSDTGLEGINFSGLNDSHQTVSTLNLLRYGENHSSKHKNGGKGQGFAEKYQL
SLKYVTIAKLFFTNVKENYIHCHMLDKMASDFHTLENHLKGNS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ARD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 29 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07248 
_struct_ref_seq.db_align_beg                  102 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  130 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       102 
_struct_ref_seq.pdbx_auth_seq_align_end       130 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_pdbx_nmr_ensemble.entry_id                             1ARD 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_exptl.entry_id          1ARD 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1ARD 
_struct.title                     'STRUCTURES OF DNA-BINDING MUTANT ZINC FINGER DOMAINS: IMPLICATIONS FOR DNA BINDING' 
_struct.pdbx_descriptor           
'YEAST TRANSCRIPTION FACTOR ADR1 (RESIDUES 102 - 130) (AMINO TERMINAL ZINC FINGER DOMAIN) (NMR, 10 STRUCTURES) (ADR1B)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ARD 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       AAA 
_struct_conf.beg_label_comp_id       GLN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        15 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       HIS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        25 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         116 
_struct_conf.end_auth_comp_id        HIS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         126 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 'ALPHA AND 3/10 HELICAL H-BONDS' 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 25 NE2 ? ? A ZN 1 A HIS 126 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 5  SG  ? ? A ZN 1 A CYS 106 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 8  SG  ? ? A ZN 1 A CYS 109 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 21 NE2 ? ? A ZN 1 A HIS 122 1_555 ? ? ? ? ? ? ? 1.990 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               BBB 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     BBB 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BBB 1 PHE A 3 ? CYS A 5  ? PHE A 104 CYS A 106 
BBB 2 THR A 9 ? PHE A 12 ? THR A 110 PHE A 113 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 CYS A 5  ? CYS A 106 . ? 1_555 ? 
2 AC1 5 VAL A 7  ? VAL A 108 . ? 1_555 ? 
3 AC1 5 CYS A 8  ? CYS A 109 . ? 1_555 ? 
4 AC1 5 HIS A 21 ? HIS A 122 . ? 1_555 ? 
5 AC1 5 HIS A 25 ? HIS A 126 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ARD 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ARD 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ARG A 1 1  ? 1.325   0.000   0.000  1.00 0.00 ? 102 ARG A N    1  
ATOM   2    C  CA   . ARG A 1 1  ? 2.073   0.000   -1.245 1.00 0.00 ? 102 ARG A CA   1  
ATOM   3    C  C    . ARG A 1 1  ? 2.769   -1.348  -1.446 1.00 0.00 ? 102 ARG A C    1  
ATOM   4    O  O    . ARG A 1 1  ? 3.420   -1.568  -2.467 1.00 0.00 ? 102 ARG A O    1  
ATOM   5    C  CB   . ARG A 1 1  ? 3.121   1.115   -1.258 1.00 0.00 ? 102 ARG A CB   1  
ATOM   6    C  CG   . ARG A 1 1  ? 4.310   0.759   -0.363 1.00 0.00 ? 102 ARG A CG   1  
ATOM   7    C  CD   . ARG A 1 1  ? 5.290   1.930   -0.263 1.00 0.00 ? 102 ARG A CD   1  
ATOM   8    N  NE   . ARG A 1 1  ? 5.303   2.690   -1.533 1.00 0.00 ? 102 ARG A NE   1  
ATOM   9    C  CZ   . ARG A 1 1  ? 6.153   2.453   -2.542 1.00 0.00 ? 102 ARG A CZ   1  
ATOM   10   N  NH1  . ARG A 1 1  ? 7.468   2.641   -2.368 1.00 0.00 ? 102 ARG A NH1  1  
ATOM   11   N  NH2  . ARG A 1 1  ? 5.688   2.028   -3.724 1.00 0.00 ? 102 ARG A NH2  1  
ATOM   12   H  H    . ARG A 1 1  ? 1.884   0.000   0.829  1.00 0.00 ? 102 ARG A H    1  
ATOM   13   H  HA   . ARG A 1 1  ? 1.326   0.175   -2.020 1.00 0.00 ? 102 ARG A HA   1  
ATOM   14   H  HB2  . ARG A 1 1  ? 3.467   1.282   -2.278 1.00 0.00 ? 102 ARG A HB2  1  
ATOM   15   H  HB3  . ARG A 1 1  ? 2.671   2.046   -0.917 1.00 0.00 ? 102 ARG A HB3  1  
ATOM   16   H  HG2  . ARG A 1 1  ? 3.954   0.493   0.632  1.00 0.00 ? 102 ARG A HG2  1  
ATOM   17   H  HG3  . ARG A 1 1  ? 4.823   -0.115  -0.763 1.00 0.00 ? 102 ARG A HG3  1  
ATOM   18   H  HD2  . ARG A 1 1  ? 5.004   2.586   0.559  1.00 0.00 ? 102 ARG A HD2  1  
ATOM   19   H  HD3  . ARG A 1 1  ? 6.291   1.559   -0.042 1.00 0.00 ? 102 ARG A HD3  1  
ATOM   20   H  HE   . ARG A 1 1  ? 4.635   3.426   -1.646 1.00 0.00 ? 102 ARG A HE   1  
ATOM   21   H  HH11 . ARG A 1 1  ? 8.035   1.902   -2.005 1.00 0.00 ? 102 ARG A HH11 1  
ATOM   22   H  HH12 . ARG A 1 1  ? 7.882   3.521   -2.601 1.00 0.00 ? 102 ARG A HH12 1  
ATOM   23   H  HH21 . ARG A 1 1  ? 4.745   1.703   -3.803 1.00 0.00 ? 102 ARG A HH21 1  
ATOM   24   H  HH22 . ARG A 1 1  ? 6.283   2.036   -4.528 1.00 0.00 ? 102 ARG A HH22 1  
ATOM   25   N  N    . SER A 1 2  ? 2.608   -2.214  -0.457 1.00 0.00 ? 103 SER A N    1  
ATOM   26   C  CA   . SER A 1 2  ? 3.213   -3.534  -0.512 1.00 0.00 ? 103 SER A CA   1  
ATOM   27   C  C    . SER A 1 2  ? 2.302   -4.556  0.169  1.00 0.00 ? 103 SER A C    1  
ATOM   28   O  O    . SER A 1 2  ? 1.811   -4.318  1.272  1.00 0.00 ? 103 SER A O    1  
ATOM   29   C  CB   . SER A 1 2  ? 4.595   -3.535  0.144  1.00 0.00 ? 103 SER A CB   1  
ATOM   30   O  OG   . SER A 1 2  ? 5.644   -3.597  -0.820 1.00 0.00 ? 103 SER A OG   1  
ATOM   31   H  H    . SER A 1 2  ? 2.077   -2.027  0.369  1.00 0.00 ? 103 SER A H    1  
ATOM   32   H  HA   . SER A 1 2  ? 3.315   -3.760  -1.574 1.00 0.00 ? 103 SER A HA   1  
ATOM   33   H  HB2  . SER A 1 2  ? 4.711   -2.634  0.747  1.00 0.00 ? 103 SER A HB2  1  
ATOM   34   H  HB3  . SER A 1 2  ? 4.675   -4.385  0.821  1.00 0.00 ? 103 SER A HB3  1  
ATOM   35   H  HG   . SER A 1 2  ? 5.523   -4.399  -1.405 1.00 0.00 ? 103 SER A HG   1  
ATOM   36   N  N    . PHE A 1 3  ? 2.103   -5.673  -0.515 1.00 0.00 ? 104 PHE A N    1  
ATOM   37   C  CA   . PHE A 1 3  ? 1.259   -6.733  0.011  1.00 0.00 ? 104 PHE A CA   1  
ATOM   38   C  C    . PHE A 1 3  ? 1.140   -6.635  1.533  1.00 0.00 ? 104 PHE A C    1  
ATOM   39   O  O    . PHE A 1 3  ? 2.131   -6.397  2.222  1.00 0.00 ? 104 PHE A O    1  
ATOM   40   C  CB   . PHE A 1 3  ? 1.928   -8.060  -0.353 1.00 0.00 ? 104 PHE A CB   1  
ATOM   41   C  CG   . PHE A 1 3  ? 2.331   -8.171  -1.825 1.00 0.00 ? 104 PHE A CG   1  
ATOM   42   C  CD1  . PHE A 1 3  ? 1.396   -8.474  -2.765 1.00 0.00 ? 104 PHE A CD1  1  
ATOM   43   C  CD2  . PHE A 1 3  ? 3.624   -7.967  -2.193 1.00 0.00 ? 104 PHE A CD2  1  
ATOM   44   C  CE1  . PHE A 1 3  ? 1.770   -8.577  -4.131 1.00 0.00 ? 104 PHE A CE1  1  
ATOM   45   C  CE2  . PHE A 1 3  ? 3.998   -8.070  -3.559 1.00 0.00 ? 104 PHE A CE2  1  
ATOM   46   C  CZ   . PHE A 1 3  ? 3.063   -8.373  -4.499 1.00 0.00 ? 104 PHE A CZ   1  
ATOM   47   H  H    . PHE A 1 3  ? 2.506   -5.859  -1.411 1.00 0.00 ? 104 PHE A H    1  
ATOM   48   H  HA   . PHE A 1 3  ? 0.272   -6.613  -0.437 1.00 0.00 ? 104 PHE A HA   1  
ATOM   49   H  HB2  . PHE A 1 3  ? 2.815   -8.189  0.267  1.00 0.00 ? 104 PHE A HB2  1  
ATOM   50   H  HB3  . PHE A 1 3  ? 1.248   -8.876  -0.110 1.00 0.00 ? 104 PHE A HB3  1  
ATOM   51   H  HD1  . PHE A 1 3  ? 0.359   -8.637  -2.470 1.00 0.00 ? 104 PHE A HD1  1  
ATOM   52   H  HD2  . PHE A 1 3  ? 4.373   -7.724  -1.440 1.00 0.00 ? 104 PHE A HD2  1  
ATOM   53   H  HE1  . PHE A 1 3  ? 1.020   -8.819  -4.884 1.00 0.00 ? 104 PHE A HE1  1  
ATOM   54   H  HE2  . PHE A 1 3  ? 5.034   -7.906  -3.854 1.00 0.00 ? 104 PHE A HE2  1  
ATOM   55   H  HZ   . PHE A 1 3  ? 3.350   -8.452  -5.548 1.00 0.00 ? 104 PHE A HZ   1  
ATOM   56   N  N    . VAL A 1 4  ? -0.080  -6.824  2.013  1.00 0.00 ? 105 VAL A N    1  
ATOM   57   C  CA   . VAL A 1 4  ? -0.340  -6.760  3.441  1.00 0.00 ? 105 VAL A CA   1  
ATOM   58   C  C    . VAL A 1 4  ? -1.370  -7.828  3.816  1.00 0.00 ? 105 VAL A C    1  
ATOM   59   O  O    . VAL A 1 4  ? -2.477  -7.843  3.280  1.00 0.00 ? 105 VAL A O    1  
ATOM   60   C  CB   . VAL A 1 4  ? -0.776  -5.346  3.831  1.00 0.00 ? 105 VAL A CB   1  
ATOM   61   C  CG1  . VAL A 1 4  ? -0.769  -5.169  5.351  1.00 0.00 ? 105 VAL A CG1  1  
ATOM   62   C  CG2  . VAL A 1 4  ? 0.103   -4.294  3.152  1.00 0.00 ? 105 VAL A CG2  1  
ATOM   63   H  H    . VAL A 1 4  ? -0.880  -7.017  1.446  1.00 0.00 ? 105 VAL A H    1  
ATOM   64   H  HA   . VAL A 1 4  ? 0.595   -6.979  3.956  1.00 0.00 ? 105 VAL A HA   1  
ATOM   65   H  HB   . VAL A 1 4  ? -1.799  -5.203  3.482  1.00 0.00 ? 105 VAL A HB   1  
ATOM   66   H  HG11 . VAL A 1 4  ? -0.892  -4.114  5.594  1.00 0.00 ? 105 VAL A HG11 1  
ATOM   67   H  HG12 . VAL A 1 4  ? -1.588  -5.741  5.787  1.00 0.00 ? 105 VAL A HG12 1  
ATOM   68   H  HG13 . VAL A 1 4  ? 0.179   -5.527  5.753  1.00 0.00 ? 105 VAL A HG13 1  
ATOM   69   H  HG21 . VAL A 1 4  ? -0.071  -3.323  3.614  1.00 0.00 ? 105 VAL A HG21 1  
ATOM   70   H  HG22 . VAL A 1 4  ? 1.152   -4.569  3.267  1.00 0.00 ? 105 VAL A HG22 1  
ATOM   71   H  HG23 . VAL A 1 4  ? -0.144  -4.243  2.092  1.00 0.00 ? 105 VAL A HG23 1  
ATOM   72   N  N    . CYS A 1 5  ? -0.969  -8.696  4.733  1.00 0.00 ? 106 CYS A N    1  
ATOM   73   C  CA   . CYS A 1 5  ? -1.843  -9.764  5.185  1.00 0.00 ? 106 CYS A CA   1  
ATOM   74   C  C    . CYS A 1 5  ? -3.103  -9.134  5.782  1.00 0.00 ? 106 CYS A C    1  
ATOM   75   O  O    . CYS A 1 5  ? -3.103  -8.713  6.938  1.00 0.00 ? 106 CYS A O    1  
ATOM   76   C  CB   . CYS A 1 5  ? -1.140  -10.687 6.182  1.00 0.00 ? 106 CYS A CB   1  
ATOM   77   S  SG   . CYS A 1 5  ? -2.149  -12.186 6.468  1.00 0.00 ? 106 CYS A SG   1  
ATOM   78   H  H    . CYS A 1 5  ? -0.067  -8.677  5.164  1.00 0.00 ? 106 CYS A H    1  
ATOM   79   H  HA   . CYS A 1 5  ? -2.088  -10.361 4.307  1.00 0.00 ? 106 CYS A HA   1  
ATOM   80   H  HB2  . CYS A 1 5  ? -0.158  -10.967 5.801  1.00 0.00 ? 106 CYS A HB2  1  
ATOM   81   H  HB3  . CYS A 1 5  ? -0.978  -10.163 7.124  1.00 0.00 ? 106 CYS A HB3  1  
ATOM   82   N  N    . GLU A 1 6  ? -4.147  -9.090  4.967  1.00 0.00 ? 107 GLU A N    1  
ATOM   83   C  CA   . GLU A 1 6  ? -5.411  -8.518  5.400  1.00 0.00 ? 107 GLU A CA   1  
ATOM   84   C  C    . GLU A 1 6  ? -5.864  -9.163  6.711  1.00 0.00 ? 107 GLU A C    1  
ATOM   85   O  O    . GLU A 1 6  ? -6.807  -8.693  7.345  1.00 0.00 ? 107 GLU A O    1  
ATOM   86   C  CB   . GLU A 1 6  ? -6.480  -8.668  4.317  1.00 0.00 ? 107 GLU A CB   1  
ATOM   87   C  CG   . GLU A 1 6  ? -5.989  -8.111  2.979  1.00 0.00 ? 107 GLU A CG   1  
ATOM   88   C  CD   . GLU A 1 6  ? -5.461  -6.684  3.141  1.00 0.00 ? 107 GLU A CD   1  
ATOM   89   O  OE1  . GLU A 1 6  ? -6.192  -5.875  3.752  1.00 0.00 ? 107 GLU A OE1  1  
ATOM   90   O  OE2  . GLU A 1 6  ? -4.339  -6.435  2.649  1.00 0.00 ? 107 GLU A OE2  1  
ATOM   91   H  H    . GLU A 1 6  ? -4.139  -9.434  4.029  1.00 0.00 ? 107 GLU A H    1  
ATOM   92   H  HA   . GLU A 1 6  ? -5.210  -7.458  5.559  1.00 0.00 ? 107 GLU A HA   1  
ATOM   93   H  HB2  . GLU A 1 6  ? -6.742  -9.721  4.202  1.00 0.00 ? 107 GLU A HB2  1  
ATOM   94   H  HB3  . GLU A 1 6  ? -7.387  -8.146  4.621  1.00 0.00 ? 107 GLU A HB3  1  
ATOM   95   H  HG2  . GLU A 1 6  ? -5.201  -8.751  2.582  1.00 0.00 ? 107 GLU A HG2  1  
ATOM   96   H  HG3  . GLU A 1 6  ? -6.803  -8.122  2.255  1.00 0.00 ? 107 GLU A HG3  1  
ATOM   97   N  N    . VAL A 1 7  ? -5.169  -10.230 7.080  1.00 0.00 ? 108 VAL A N    1  
ATOM   98   C  CA   . VAL A 1 7  ? -5.489  -10.945 8.304  1.00 0.00 ? 108 VAL A CA   1  
ATOM   99   C  C    . VAL A 1 7  ? -4.823  -10.241 9.488  1.00 0.00 ? 108 VAL A C    1  
ATOM   100  O  O    . VAL A 1 7  ? -5.498  -9.610  10.300 1.00 0.00 ? 108 VAL A O    1  
ATOM   101  C  CB   . VAL A 1 7  ? -5.080  -12.413 8.174  1.00 0.00 ? 108 VAL A CB   1  
ATOM   102  C  CG1  . VAL A 1 7  ? -5.173  -13.129 9.523  1.00 0.00 ? 108 VAL A CG1  1  
ATOM   103  C  CG2  . VAL A 1 7  ? -5.923  -13.126 7.115  1.00 0.00 ? 108 VAL A CG2  1  
ATOM   104  H  H    . VAL A 1 7  ? -4.403  -10.606 6.558  1.00 0.00 ? 108 VAL A H    1  
ATOM   105  H  HA   . VAL A 1 7  ? -6.570  -10.906 8.435  1.00 0.00 ? 108 VAL A HA   1  
ATOM   106  H  HB   . VAL A 1 7  ? -4.040  -12.444 7.850  1.00 0.00 ? 108 VAL A HB   1  
ATOM   107  H  HG11 . VAL A 1 7  ? -5.301  -14.199 9.358  1.00 0.00 ? 108 VAL A HG11 1  
ATOM   108  H  HG12 . VAL A 1 7  ? -4.259  -12.956 10.090 1.00 0.00 ? 108 VAL A HG12 1  
ATOM   109  H  HG13 . VAL A 1 7  ? -6.026  -12.743 10.081 1.00 0.00 ? 108 VAL A HG13 1  
ATOM   110  H  HG21 . VAL A 1 7  ? -5.295  -13.383 6.263  1.00 0.00 ? 108 VAL A HG21 1  
ATOM   111  H  HG22 . VAL A 1 7  ? -6.348  -14.035 7.541  1.00 0.00 ? 108 VAL A HG22 1  
ATOM   112  H  HG23 . VAL A 1 7  ? -6.728  -12.467 6.788  1.00 0.00 ? 108 VAL A HG23 1  
ATOM   113  N  N    . CYS A 1 8  ? -3.506  -10.373 9.549  1.00 0.00 ? 109 CYS A N    1  
ATOM   114  C  CA   . CYS A 1 8  ? -2.741  -9.757  10.621 1.00 0.00 ? 109 CYS A CA   1  
ATOM   115  C  C    . CYS A 1 8  ? -2.228  -8.403  10.128 1.00 0.00 ? 109 CYS A C    1  
ATOM   116  O  O    . CYS A 1 8  ? -1.449  -7.744  10.814 1.00 0.00 ? 109 CYS A O    1  
ATOM   117  C  CB   . CYS A 1 8  ? -1.601  -10.662 11.094 1.00 0.00 ? 109 CYS A CB   1  
ATOM   118  S  SG   . CYS A 1 8  ? -0.358  -10.848 9.764  1.00 0.00 ? 109 CYS A SG   1  
ATOM   119  H  H    . CYS A 1 8  ? -2.964  -10.887 8.885  1.00 0.00 ? 109 CYS A H    1  
ATOM   120  H  HA   . CYS A 1 8  ? -3.425  -9.630  11.460 1.00 0.00 ? 109 CYS A HA   1  
ATOM   121  H  HB2  . CYS A 1 8  ? -1.135  -10.238 11.983 1.00 0.00 ? 109 CYS A HB2  1  
ATOM   122  H  HB3  . CYS A 1 8  ? -1.994  -11.639 11.375 1.00 0.00 ? 109 CYS A HB3  1  
ATOM   123  N  N    . THR A 1 9  ? -2.687  -8.028  8.943  1.00 0.00 ? 110 THR A N    1  
ATOM   124  C  CA   . THR A 1 9  ? -2.284  -6.763  8.351  1.00 0.00 ? 110 THR A CA   1  
ATOM   125  C  C    . THR A 1 9  ? -0.758  -6.646  8.331  1.00 0.00 ? 110 THR A C    1  
ATOM   126  O  O    . THR A 1 9  ? -0.210  -5.588  8.635  1.00 0.00 ? 110 THR A O    1  
ATOM   127  C  CB   . THR A 1 9  ? -2.970  -5.638  9.127  1.00 0.00 ? 110 THR A CB   1  
ATOM   128  O  OG1  . THR A 1 9  ? -2.331  -5.655  10.401 1.00 0.00 ? 110 THR A OG1  1  
ATOM   129  C  CG2  . THR A 1 9  ? -4.434  -5.950  9.441  1.00 0.00 ? 110 THR A CG2  1  
ATOM   130  H  H    . THR A 1 9  ? -3.320  -8.570  8.392  1.00 0.00 ? 110 THR A H    1  
ATOM   131  H  HA   . THR A 1 9  ? -2.619  -6.747  7.314  1.00 0.00 ? 110 THR A HA   1  
ATOM   132  H  HB   . THR A 1 9  ? -2.879  -4.689  8.599  1.00 0.00 ? 110 THR A HB   1  
ATOM   133  H  HG1  . THR A 1 9  ? -2.530  -4.809  10.895 1.00 0.00 ? 110 THR A HG1  1  
ATOM   134  H  HG21 . THR A 1 9  ? -4.639  -6.997  9.215  1.00 0.00 ? 110 THR A HG21 1  
ATOM   135  H  HG22 . THR A 1 9  ? -4.628  -5.762  10.497 1.00 0.00 ? 110 THR A HG22 1  
ATOM   136  H  HG23 . THR A 1 9  ? -5.080  -5.315  8.834  1.00 0.00 ? 110 THR A HG23 1  
ATOM   137  N  N    . ARG A 1 10 ? -0.117  -7.747  7.969  1.00 0.00 ? 111 ARG A N    1  
ATOM   138  C  CA   . ARG A 1 10 ? 1.334   -7.781  7.905  1.00 0.00 ? 111 ARG A CA   1  
ATOM   139  C  C    . ARG A 1 10 ? 1.809   -7.506  6.477  1.00 0.00 ? 111 ARG A C    1  
ATOM   140  O  O    . ARG A 1 10 ? 1.296   -8.090  5.525  1.00 0.00 ? 111 ARG A O    1  
ATOM   141  C  CB   . ARG A 1 10 ? 1.874   -9.138  8.362  1.00 0.00 ? 111 ARG A CB   1  
ATOM   142  C  CG   . ARG A 1 10 ? 2.127   -9.148  9.871  1.00 0.00 ? 111 ARG A CG   1  
ATOM   143  C  CD   . ARG A 1 10 ? 2.741   -10.476 10.316 1.00 0.00 ? 111 ARG A CD   1  
ATOM   144  N  NE   . ARG A 1 10 ? 3.126   -10.404 11.743 1.00 0.00 ? 111 ARG A NE   1  
ATOM   145  C  CZ   . ARG A 1 10 ? 4.392   -10.364 12.179 1.00 0.00 ? 111 ARG A CZ   1  
ATOM   146  N  NH1  . ARG A 1 10 ? 5.355   -11.002 11.498 1.00 0.00 ? 111 ARG A NH1  1  
ATOM   147  N  NH2  . ARG A 1 10 ? 4.696   -9.687  13.294 1.00 0.00 ? 111 ARG A NH2  1  
ATOM   148  H  H    . ARG A 1 10 ? -0.571  -8.604  7.723  1.00 0.00 ? 111 ARG A H    1  
ATOM   149  H  HA   . ARG A 1 10 ? 1.662   -6.995  8.586  1.00 0.00 ? 111 ARG A HA   1  
ATOM   150  H  HB2  . ARG A 1 10 ? 1.163   -9.922  8.104  1.00 0.00 ? 111 ARG A HB2  1  
ATOM   151  H  HB3  . ARG A 1 10 ? 2.801   -9.361  7.833  1.00 0.00 ? 111 ARG A HB3  1  
ATOM   152  H  HG2  . ARG A 1 10 ? 2.794   -8.328  10.137 1.00 0.00 ? 111 ARG A HG2  1  
ATOM   153  H  HG3  . ARG A 1 10 ? 1.189   -8.981  10.401 1.00 0.00 ? 111 ARG A HG3  1  
ATOM   154  H  HD2  . ARG A 1 10 ? 2.027   -11.286 10.164 1.00 0.00 ? 111 ARG A HD2  1  
ATOM   155  H  HD3  . ARG A 1 10 ? 3.615   -10.705 9.706  1.00 0.00 ? 111 ARG A HD3  1  
ATOM   156  H  HE   . ARG A 1 10 ? 2.395   -10.383 12.425 1.00 0.00 ? 111 ARG A HE   1  
ATOM   157  H  HH11 . ARG A 1 10 ? 5.775   -10.568 10.701 1.00 0.00 ? 111 ARG A HH11 1  
ATOM   158  H  HH12 . ARG A 1 10 ? 5.653   -11.912 11.788 1.00 0.00 ? 111 ARG A HH12 1  
ATOM   159  H  HH21 . ARG A 1 10 ? 4.501   -10.086 14.190 1.00 0.00 ? 111 ARG A HH21 1  
ATOM   160  H  HH22 . ARG A 1 10 ? 5.119   -8.783  13.231 1.00 0.00 ? 111 ARG A HH22 1  
ATOM   161  N  N    . ALA A 1 11 ? 2.785   -6.615  6.374  1.00 0.00 ? 112 ALA A N    1  
ATOM   162  C  CA   . ALA A 1 11 ? 3.335   -6.255  5.078  1.00 0.00 ? 112 ALA A CA   1  
ATOM   163  C  C    . ALA A 1 11 ? 4.666   -6.981  4.874  1.00 0.00 ? 112 ALA A C    1  
ATOM   164  O  O    . ALA A 1 11 ? 5.464   -7.095  5.803  1.00 0.00 ? 112 ALA A O    1  
ATOM   165  C  CB   . ALA A 1 11 ? 3.481   -4.734  4.990  1.00 0.00 ? 112 ALA A CB   1  
ATOM   166  H  H    . ALA A 1 11 ? 3.197   -6.144  7.154  1.00 0.00 ? 112 ALA A H    1  
ATOM   167  H  HA   . ALA A 1 11 ? 2.630   -6.584  4.315  1.00 0.00 ? 112 ALA A HA   1  
ATOM   168  H  HB1  . ALA A 1 11 ? 4.510   -4.483  4.734  1.00 0.00 ? 112 ALA A HB1  1  
ATOM   169  H  HB2  . ALA A 1 11 ? 2.811   -4.349  4.221  1.00 0.00 ? 112 ALA A HB2  1  
ATOM   170  H  HB3  . ALA A 1 11 ? 3.226   -4.289  5.951  1.00 0.00 ? 112 ALA A HB3  1  
ATOM   171  N  N    . PHE A 1 12 ? 4.864   -7.455  3.653  1.00 0.00 ? 113 PHE A N    1  
ATOM   172  C  CA   . PHE A 1 12 ? 6.085   -8.167  3.315  1.00 0.00 ? 113 PHE A CA   1  
ATOM   173  C  C    . PHE A 1 12 ? 6.693   -7.629  2.018  1.00 0.00 ? 113 PHE A C    1  
ATOM   174  O  O    . PHE A 1 12 ? 5.995   -7.023  1.206  1.00 0.00 ? 113 PHE A O    1  
ATOM   175  C  CB   . PHE A 1 12 ? 5.705   -9.636  3.115  1.00 0.00 ? 113 PHE A CB   1  
ATOM   176  C  CG   . PHE A 1 12 ? 5.191   -10.323 4.381  1.00 0.00 ? 113 PHE A CG   1  
ATOM   177  C  CD1  . PHE A 1 12 ? 6.067   -10.720 5.343  1.00 0.00 ? 113 PHE A CD1  1  
ATOM   178  C  CD2  . PHE A 1 12 ? 3.858   -10.538 4.546  1.00 0.00 ? 113 PHE A CD2  1  
ATOM   179  C  CE1  . PHE A 1 12 ? 5.590   -11.358 6.518  1.00 0.00 ? 113 PHE A CE1  1  
ATOM   180  C  CE2  . PHE A 1 12 ? 3.381   -11.176 5.721  1.00 0.00 ? 113 PHE A CE2  1  
ATOM   181  C  CZ   . PHE A 1 12 ? 4.257   -11.573 6.683  1.00 0.00 ? 113 PHE A CZ   1  
ATOM   182  H  H    . PHE A 1 12 ? 4.210   -7.358  2.902  1.00 0.00 ? 113 PHE A H    1  
ATOM   183  H  HA   . PHE A 1 12 ? 6.787   -8.013  4.135  1.00 0.00 ? 113 PHE A HA   1  
ATOM   184  H  HB2  . PHE A 1 12 ? 4.939   -9.700  2.342  1.00 0.00 ? 113 PHE A HB2  1  
ATOM   185  H  HB3  . PHE A 1 12 ? 6.575   -10.179 2.747  1.00 0.00 ? 113 PHE A HB3  1  
ATOM   186  H  HD1  . PHE A 1 12 ? 7.135   -10.549 5.212  1.00 0.00 ? 113 PHE A HD1  1  
ATOM   187  H  HD2  . PHE A 1 12 ? 3.156   -10.219 3.775  1.00 0.00 ? 113 PHE A HD2  1  
ATOM   188  H  HE1  . PHE A 1 12 ? 6.292   -11.677 7.289  1.00 0.00 ? 113 PHE A HE1  1  
ATOM   189  H  HE2  . PHE A 1 12 ? 2.313   -11.347 5.853  1.00 0.00 ? 113 PHE A HE2  1  
ATOM   190  H  HZ   . PHE A 1 12 ? 3.891   -12.062 7.585  1.00 0.00 ? 113 PHE A HZ   1  
ATOM   191  N  N    . ALA A 1 13 ? 7.987   -7.869  1.864  1.00 0.00 ? 114 ALA A N    1  
ATOM   192  C  CA   . ALA A 1 13 ? 8.696   -7.417  0.680  1.00 0.00 ? 114 ALA A CA   1  
ATOM   193  C  C    . ALA A 1 13 ? 8.424   -8.384  -0.474 1.00 0.00 ? 114 ALA A C    1  
ATOM   194  O  O    . ALA A 1 13 ? 8.607   -8.033  -1.638 1.00 0.00 ? 114 ALA A O    1  
ATOM   195  C  CB   . ALA A 1 13 ? 10.188  -7.291  0.996  1.00 0.00 ? 114 ALA A CB   1  
ATOM   196  H  H    . ALA A 1 13 ? 8.547   -8.363  2.530  1.00 0.00 ? 114 ALA A H    1  
ATOM   197  H  HA   . ALA A 1 13 ? 8.309   -6.432  0.417  1.00 0.00 ? 114 ALA A HA   1  
ATOM   198  H  HB1  . ALA A 1 13 ? 10.769  -7.749  0.195  1.00 0.00 ? 114 ALA A HB1  1  
ATOM   199  H  HB2  . ALA A 1 13 ? 10.455  -6.238  1.081  1.00 0.00 ? 114 ALA A HB2  1  
ATOM   200  H  HB3  . ALA A 1 13 ? 10.404  -7.797  1.937  1.00 0.00 ? 114 ALA A HB3  1  
ATOM   201  N  N    . ARG A 1 14 ? 7.991   -9.582  -0.110 1.00 0.00 ? 115 ARG A N    1  
ATOM   202  C  CA   . ARG A 1 14 ? 7.691   -10.602 -1.100 1.00 0.00 ? 115 ARG A CA   1  
ATOM   203  C  C    . ARG A 1 14 ? 6.277   -11.146 -0.890 1.00 0.00 ? 115 ARG A C    1  
ATOM   204  O  O    . ARG A 1 14 ? 5.768   -11.148 0.230  1.00 0.00 ? 115 ARG A O    1  
ATOM   205  C  CB   . ARG A 1 14 ? 8.691   -11.757 -1.021 1.00 0.00 ? 115 ARG A CB   1  
ATOM   206  C  CG   . ARG A 1 14 ? 10.111  -11.237 -0.784 1.00 0.00 ? 115 ARG A CG   1  
ATOM   207  C  CD   . ARG A 1 14 ? 10.778  -10.843 -2.103 1.00 0.00 ? 115 ARG A CD   1  
ATOM   208  N  NE   . ARG A 1 14 ? 11.553  -9.595  -1.925 1.00 0.00 ? 115 ARG A NE   1  
ATOM   209  C  CZ   . ARG A 1 14 ? 12.732  -9.352  -2.516 1.00 0.00 ? 115 ARG A CZ   1  
ATOM   210  N  NH1  . ARG A 1 14 ? 12.869  -9.531  -3.836 1.00 0.00 ? 115 ARG A NH1  1  
ATOM   211  N  NH2  . ARG A 1 14 ? 13.773  -8.930  -1.785 1.00 0.00 ? 115 ARG A NH2  1  
ATOM   212  H  H    . ARG A 1 14 ? 7.844   -9.859  0.840  1.00 0.00 ? 115 ARG A H    1  
ATOM   213  H  HA   . ARG A 1 14 ? 7.777   -10.092 -2.060 1.00 0.00 ? 115 ARG A HA   1  
ATOM   214  H  HB2  . ARG A 1 14 ? 8.408   -12.433 -0.215 1.00 0.00 ? 115 ARG A HB2  1  
ATOM   215  H  HB3  . ARG A 1 14 ? 8.661   -12.333 -1.946 1.00 0.00 ? 115 ARG A HB3  1  
ATOM   216  H  HG2  . ARG A 1 14 ? 10.080  -10.376 -0.116 1.00 0.00 ? 115 ARG A HG2  1  
ATOM   217  H  HG3  . ARG A 1 14 ? 10.705  -12.004 -0.287 1.00 0.00 ? 115 ARG A HG3  1  
ATOM   218  H  HD2  . ARG A 1 14 ? 11.435  -11.644 -2.442 1.00 0.00 ? 115 ARG A HD2  1  
ATOM   219  H  HD3  . ARG A 1 14 ? 10.021  -10.704 -2.876 1.00 0.00 ? 115 ARG A HD3  1  
ATOM   220  H  HE   . ARG A 1 14 ? 11.174  -8.889  -1.327 1.00 0.00 ? 115 ARG A HE   1  
ATOM   221  H  HH11 . ARG A 1 14 ? 12.771  -10.445 -4.230 1.00 0.00 ? 115 ARG A HH11 1  
ATOM   222  H  HH12 . ARG A 1 14 ? 13.070  -8.751  -4.429 1.00 0.00 ? 115 ARG A HH12 1  
ATOM   223  H  HH21 . ARG A 1 14 ? 13.808  -7.984  -1.464 1.00 0.00 ? 115 ARG A HH21 1  
ATOM   224  H  HH22 . ARG A 1 14 ? 14.515  -9.562  -1.560 1.00 0.00 ? 115 ARG A HH22 1  
ATOM   225  N  N    . GLN A 1 15 ? 5.681   -11.595 -1.985 1.00 0.00 ? 116 GLN A N    1  
ATOM   226  C  CA   . GLN A 1 15 ? 4.335   -12.141 -1.935 1.00 0.00 ? 116 GLN A CA   1  
ATOM   227  C  C    . GLN A 1 15 ? 4.348   -13.526 -1.286 1.00 0.00 ? 116 GLN A C    1  
ATOM   228  O  O    . GLN A 1 15 ? 3.519   -13.821 -0.427 1.00 0.00 ? 116 GLN A O    1  
ATOM   229  C  CB   . GLN A 1 15 ? 3.714   -12.196 -3.332 1.00 0.00 ? 116 GLN A CB   1  
ATOM   230  C  CG   . GLN A 1 15 ? 4.302   -11.111 -4.237 1.00 0.00 ? 116 GLN A CG   1  
ATOM   231  C  CD   . GLN A 1 15 ? 5.373   -11.691 -5.162 1.00 0.00 ? 116 GLN A CD   1  
ATOM   232  O  OE1  . GLN A 1 15 ? 6.352   -12.278 -4.731 1.00 0.00 ? 116 GLN A OE1  1  
ATOM   233  N  NE2  . GLN A 1 15 ? 5.134   -11.495 -6.456 1.00 0.00 ? 116 GLN A NE2  1  
ATOM   234  H  H    . GLN A 1 15 ? 6.102   -11.590 -2.892 1.00 0.00 ? 116 GLN A H    1  
ATOM   235  H  HA   . GLN A 1 15 ? 3.765   -11.448 -1.317 1.00 0.00 ? 116 GLN A HA   1  
ATOM   236  H  HB2  . GLN A 1 15 ? 3.888   -13.177 -3.773 1.00 0.00 ? 116 GLN A HB2  1  
ATOM   237  H  HB3  . GLN A 1 15 ? 2.634   -12.067 -3.258 1.00 0.00 ? 116 GLN A HB3  1  
ATOM   238  H  HG2  . GLN A 1 15 ? 3.508   -10.659 -4.831 1.00 0.00 ? 116 GLN A HG2  1  
ATOM   239  H  HG3  . GLN A 1 15 ? 4.734   -10.318 -3.626 1.00 0.00 ? 116 GLN A HG3  1  
ATOM   240  H  HE21 . GLN A 1 15 ? 4.329   -10.975 -6.742 1.00 0.00 ? 116 GLN A HE21 1  
ATOM   241  H  HE22 . GLN A 1 15 ? 5.759   -11.868 -7.142 1.00 0.00 ? 116 GLN A HE22 1  
ATOM   242  N  N    . GLU A 1 16 ? 5.299   -14.340 -1.721 1.00 0.00 ? 117 GLU A N    1  
ATOM   243  C  CA   . GLU A 1 16 ? 5.431   -15.687 -1.193 1.00 0.00 ? 117 GLU A CA   1  
ATOM   244  C  C    . GLU A 1 16 ? 5.326   -15.672 0.333  1.00 0.00 ? 117 GLU A C    1  
ATOM   245  O  O    . GLU A 1 16 ? 4.632   -16.502 0.919  1.00 0.00 ? 117 GLU A O    1  
ATOM   246  C  CB   . GLU A 1 16 ? 6.745   -16.327 -1.646 1.00 0.00 ? 117 GLU A CB   1  
ATOM   247  C  CG   . GLU A 1 16 ? 7.049   -15.983 -3.105 1.00 0.00 ? 117 GLU A CG   1  
ATOM   248  C  CD   . GLU A 1 16 ? 5.759   -15.867 -3.921 1.00 0.00 ? 117 GLU A CD   1  
ATOM   249  O  OE1  . GLU A 1 16 ? 4.903   -16.763 -3.760 1.00 0.00 ? 117 GLU A OE1  1  
ATOM   250  O  OE2  . GLU A 1 16 ? 5.659   -14.885 -4.688 1.00 0.00 ? 117 GLU A OE2  1  
ATOM   251  H  H    . GLU A 1 16 ? 5.970   -14.092 -2.420 1.00 0.00 ? 117 GLU A H    1  
ATOM   252  H  HA   . GLU A 1 16 ? 4.597   -16.247 -1.616 1.00 0.00 ? 117 GLU A HA   1  
ATOM   253  H  HB2  . GLU A 1 16 ? 7.560   -15.982 -1.010 1.00 0.00 ? 117 GLU A HB2  1  
ATOM   254  H  HB3  . GLU A 1 16 ? 6.686   -17.410 -1.529 1.00 0.00 ? 117 GLU A HB3  1  
ATOM   255  H  HG2  . GLU A 1 16 ? 7.599   -15.043 -3.154 1.00 0.00 ? 117 GLU A HG2  1  
ATOM   256  H  HG3  . GLU A 1 16 ? 7.690   -16.750 -3.538 1.00 0.00 ? 117 GLU A HG3  1  
ATOM   257  N  N    . HIS A 1 17 ? 6.024   -14.719 0.933  1.00 0.00 ? 118 HIS A N    1  
ATOM   258  C  CA   . HIS A 1 17 ? 6.018   -14.585 2.380  1.00 0.00 ? 118 HIS A CA   1  
ATOM   259  C  C    . HIS A 1 17 ? 4.574   -14.540 2.885  1.00 0.00 ? 118 HIS A C    1  
ATOM   260  O  O    . HIS A 1 17 ? 4.216   -15.259 3.817  1.00 0.00 ? 118 HIS A O    1  
ATOM   261  C  CB   . HIS A 1 17 ? 6.836   -13.368 2.816  1.00 0.00 ? 118 HIS A CB   1  
ATOM   262  C  CG   . HIS A 1 17 ? 8.315   -13.490 2.536  1.00 0.00 ? 118 HIS A CG   1  
ATOM   263  N  ND1  . HIS A 1 17 ? 9.252   -12.615 3.057  1.00 0.00 ? 118 HIS A ND1  1  
ATOM   264  C  CD2  . HIS A 1 17 ? 9.008   -14.393 1.785  1.00 0.00 ? 118 HIS A CD2  1  
ATOM   265  C  CE1  . HIS A 1 17 ? 10.451  -12.983 2.632  1.00 0.00 ? 118 HIS A CE1  1  
ATOM   266  N  NE2  . HIS A 1 17 ? 10.298  -14.085 1.843  1.00 0.00 ? 118 HIS A NE2  1  
ATOM   267  H  H    . HIS A 1 17 ? 6.585   -14.048 0.449  1.00 0.00 ? 118 HIS A H    1  
ATOM   268  H  HA   . HIS A 1 17 ? 6.506   -15.474 2.778  1.00 0.00 ? 118 HIS A HA   1  
ATOM   269  H  HB2  . HIS A 1 17 ? 6.452   -12.483 2.307  1.00 0.00 ? 118 HIS A HB2  1  
ATOM   270  H  HB3  . HIS A 1 17 ? 6.691   -13.209 3.884  1.00 0.00 ? 118 HIS A HB3  1  
ATOM   271  H  HD1  . HIS A 1 17 ? 9.056   -11.836 3.654  1.00 0.00 ? 118 HIS A HD1  1  
ATOM   272  H  HD2  . HIS A 1 17 ? 8.576   -15.226 1.230  1.00 0.00 ? 118 HIS A HD2  1  
ATOM   273  H  HE1  . HIS A 1 17 ? 11.394  -12.492 2.871  1.00 0.00 ? 118 HIS A HE1  1  
ATOM   274  H  HE2  . HIS A 1 17 ? 11.041  -14.613 1.431  1.00 0.00 ? 118 HIS A HE2  1  
ATOM   275  N  N    . LEU A 1 18 ? 3.784   -13.689 2.247  1.00 0.00 ? 119 LEU A N    1  
ATOM   276  C  CA   . LEU A 1 18 ? 2.388   -13.542 2.620  1.00 0.00 ? 119 LEU A CA   1  
ATOM   277  C  C    . LEU A 1 18 ? 1.672   -14.882 2.443  1.00 0.00 ? 119 LEU A C    1  
ATOM   278  O  O    . LEU A 1 18 ? 1.166   -15.453 3.408  1.00 0.00 ? 119 LEU A O    1  
ATOM   279  C  CB   . LEU A 1 18 ? 1.743   -12.393 1.841  1.00 0.00 ? 119 LEU A CB   1  
ATOM   280  C  CG   . LEU A 1 18 ? 0.229   -12.483 1.643  1.00 0.00 ? 119 LEU A CG   1  
ATOM   281  C  CD1  . LEU A 1 18 ? -0.456  -13.031 2.897  1.00 0.00 ? 119 LEU A CD1  1  
ATOM   282  C  CD2  . LEU A 1 18 ? -0.350  -11.132 1.218  1.00 0.00 ? 119 LEU A CD2  1  
ATOM   283  H  H    . LEU A 1 18 ? 4.083   -13.108 1.490  1.00 0.00 ? 119 LEU A H    1  
ATOM   284  H  HA   . LEU A 1 18 ? 2.358   -13.272 3.676  1.00 0.00 ? 119 LEU A HA   1  
ATOM   285  H  HB2  . LEU A 1 18 ? 1.968   -11.460 2.357  1.00 0.00 ? 119 LEU A HB2  1  
ATOM   286  H  HB3  . LEU A 1 18 ? 2.215   -12.336 0.860  1.00 0.00 ? 119 LEU A HB3  1  
ATOM   287  H  HG   . LEU A 1 18 ? 0.031   -13.187 0.835  1.00 0.00 ? 119 LEU A HG   1  
ATOM   288  H  HD11 . LEU A 1 18 ? 0.033   -12.628 3.784  1.00 0.00 ? 119 LEU A HD11 1  
ATOM   289  H  HD12 . LEU A 1 18 ? -1.506  -12.737 2.895  1.00 0.00 ? 119 LEU A HD12 1  
ATOM   290  H  HD13 . LEU A 1 18 ? -0.383  -14.119 2.905  1.00 0.00 ? 119 LEU A HD13 1  
ATOM   291  H  HD21 . LEU A 1 18 ? 0.205   -10.753 0.360  1.00 0.00 ? 119 LEU A HD21 1  
ATOM   292  H  HD22 . LEU A 1 18 ? -1.398  -11.255 0.947  1.00 0.00 ? 119 LEU A HD22 1  
ATOM   293  H  HD23 . LEU A 1 18 ? -0.268  -10.426 2.045  1.00 0.00 ? 119 LEU A HD23 1  
ATOM   294  N  N    . LYS A 1 19 ? 1.653   -15.347 1.202  1.00 0.00 ? 120 LYS A N    1  
ATOM   295  C  CA   . LYS A 1 19 ? 1.009   -16.610 0.885  1.00 0.00 ? 120 LYS A CA   1  
ATOM   296  C  C    . LYS A 1 19 ? 1.386   -17.649 1.943  1.00 0.00 ? 120 LYS A C    1  
ATOM   297  O  O    . LYS A 1 19 ? 0.531   -18.109 2.699  1.00 0.00 ? 120 LYS A O    1  
ATOM   298  C  CB   . LYS A 1 19 ? 1.343   -17.039 -0.545 1.00 0.00 ? 120 LYS A CB   1  
ATOM   299  C  CG   . LYS A 1 19 ? 0.518   -18.259 -0.959 1.00 0.00 ? 120 LYS A CG   1  
ATOM   300  C  CD   . LYS A 1 19 ? -0.977  -17.931 -0.971 1.00 0.00 ? 120 LYS A CD   1  
ATOM   301  C  CE   . LYS A 1 19 ? -1.598  -18.257 -2.331 1.00 0.00 ? 120 LYS A CE   1  
ATOM   302  N  NZ   . LYS A 1 19 ? -1.227  -17.229 -3.329 1.00 0.00 ? 120 LYS A NZ   1  
ATOM   303  H  H    . LYS A 1 19 ? 2.068   -14.877 0.422  1.00 0.00 ? 120 LYS A H    1  
ATOM   304  H  HA   . LYS A 1 19 ? -0.068  -16.447 0.929  1.00 0.00 ? 120 LYS A HA   1  
ATOM   305  H  HB2  . LYS A 1 19 ? 1.149   -16.214 -1.231 1.00 0.00 ? 120 LYS A HB2  1  
ATOM   306  H  HB3  . LYS A 1 19 ? 2.405   -17.271 -0.620 1.00 0.00 ? 120 LYS A HB3  1  
ATOM   307  H  HG2  . LYS A 1 19 ? 0.829   -18.594 -1.948 1.00 0.00 ? 120 LYS A HG2  1  
ATOM   308  H  HG3  . LYS A 1 19 ? 0.708   -19.082 -0.269 1.00 0.00 ? 120 LYS A HG3  1  
ATOM   309  H  HD2  . LYS A 1 19 ? -1.483  -18.499 -0.191 1.00 0.00 ? 120 LYS A HD2  1  
ATOM   310  H  HD3  . LYS A 1 19 ? -1.123  -16.876 -0.743 1.00 0.00 ? 120 LYS A HD3  1  
ATOM   311  H  HE2  . LYS A 1 19 ? -1.260  -19.237 -2.667 1.00 0.00 ? 120 LYS A HE2  1  
ATOM   312  H  HE3  . LYS A 1 19 ? -2.683  -18.308 -2.239 1.00 0.00 ? 120 LYS A HE3  1  
ATOM   313  H  HZ1  . LYS A 1 19 ? -1.567  -17.501 -4.230 1.00 0.00 ? 120 LYS A HZ1  1  
ATOM   314  H  HZ2  . LYS A 1 19 ? -1.632  -16.352 -3.071 1.00 0.00 ? 120 LYS A HZ2  1  
ATOM   315  H  HZ3  . LYS A 1 19 ? -0.231  -17.140 -3.362 1.00 0.00 ? 120 LYS A HZ3  1  
ATOM   316  N  N    . ARG A 1 20 ? 2.666   -17.990 1.962  1.00 0.00 ? 121 ARG A N    1  
ATOM   317  C  CA   . ARG A 1 20 ? 3.167   -18.966 2.914  1.00 0.00 ? 121 ARG A CA   1  
ATOM   318  C  C    . ARG A 1 20 ? 2.718   -18.604 4.332  1.00 0.00 ? 121 ARG A C    1  
ATOM   319  O  O    . ARG A 1 20 ? 2.392   -19.483 5.127  1.00 0.00 ? 121 ARG A O    1  
ATOM   320  C  CB   . ARG A 1 20 ? 4.694   -19.042 2.874  1.00 0.00 ? 121 ARG A CB   1  
ATOM   321  C  CG   . ARG A 1 20 ? 5.184   -20.439 3.261  1.00 0.00 ? 121 ARG A CG   1  
ATOM   322  C  CD   . ARG A 1 20 ? 4.591   -21.504 2.336  1.00 0.00 ? 121 ARG A CD   1  
ATOM   323  N  NE   . ARG A 1 20 ? 4.606   -21.024 0.936  1.00 0.00 ? 121 ARG A NE   1  
ATOM   324  C  CZ   . ARG A 1 20 ? 3.631   -21.266 0.049  1.00 0.00 ? 121 ARG A CZ   1  
ATOM   325  N  NH1  . ARG A 1 20 ? 2.780   -22.281 0.249  1.00 0.00 ? 121 ARG A NH1  1  
ATOM   326  N  NH2  . ARG A 1 20 ? 3.509   -20.493 -1.039 1.00 0.00 ? 121 ARG A NH2  1  
ATOM   327  H  H    . ARG A 1 20 ? 3.355   -17.611 1.343  1.00 0.00 ? 121 ARG A H    1  
ATOM   328  H  HA   . ARG A 1 20 ? 2.732   -19.914 2.596  1.00 0.00 ? 121 ARG A HA   1  
ATOM   329  H  HB2  . ARG A 1 20 ? 5.048   -18.793 1.873  1.00 0.00 ? 121 ARG A HB2  1  
ATOM   330  H  HB3  . ARG A 1 20 ? 5.117   -18.303 3.555  1.00 0.00 ? 121 ARG A HB3  1  
ATOM   331  H  HG2  . ARG A 1 20 ? 6.272   -20.474 3.210  1.00 0.00 ? 121 ARG A HG2  1  
ATOM   332  H  HG3  . ARG A 1 20 ? 4.906   -20.653 4.293  1.00 0.00 ? 121 ARG A HG3  1  
ATOM   333  H  HD2  . ARG A 1 20 ? 5.163   -22.428 2.418  1.00 0.00 ? 121 ARG A HD2  1  
ATOM   334  H  HD3  . ARG A 1 20 ? 3.569   -21.733 2.640  1.00 0.00 ? 121 ARG A HD3  1  
ATOM   335  H  HE   . ARG A 1 20 ? 5.392   -20.485 0.634  1.00 0.00 ? 121 ARG A HE   1  
ATOM   336  H  HH11 . ARG A 1 20 ? 2.461   -22.491 1.173  1.00 0.00 ? 121 ARG A HH11 1  
ATOM   337  H  HH12 . ARG A 1 20 ? 2.463   -22.828 -0.526 1.00 0.00 ? 121 ARG A HH12 1  
ATOM   338  H  HH21 . ARG A 1 20 ? 3.040   -19.613 -0.977 1.00 0.00 ? 121 ARG A HH21 1  
ATOM   339  H  HH22 . ARG A 1 20 ? 3.887   -20.798 -1.914 1.00 0.00 ? 121 ARG A HH22 1  
ATOM   340  N  N    . HIS A 1 21 ? 2.716   -17.307 4.604  1.00 0.00 ? 122 HIS A N    1  
ATOM   341  C  CA   . HIS A 1 21 ? 2.313   -16.818 5.911  1.00 0.00 ? 122 HIS A CA   1  
ATOM   342  C  C    . HIS A 1 21 ? 0.871   -17.243 6.196  1.00 0.00 ? 122 HIS A C    1  
ATOM   343  O  O    . HIS A 1 21 ? 0.557   -17.685 7.300  1.00 0.00 ? 122 HIS A O    1  
ATOM   344  C  CB   . HIS A 1 21 ? 2.515   -15.304 6.010  1.00 0.00 ? 122 HIS A CB   1  
ATOM   345  C  CG   . HIS A 1 21 ? 1.675   -14.641 7.076  1.00 0.00 ? 122 HIS A CG   1  
ATOM   346  N  ND1  . HIS A 1 21 ? 2.006   -14.674 8.419  1.00 0.00 ? 122 HIS A ND1  1  
ATOM   347  C  CD2  . HIS A 1 21 ? 0.516   -13.928 6.982  1.00 0.00 ? 122 HIS A CD2  1  
ATOM   348  C  CE1  . HIS A 1 21 ? 1.080   -14.008 9.094  1.00 0.00 ? 122 HIS A CE1  1  
ATOM   349  N  NE2  . HIS A 1 21 ? 0.158   -13.547 8.202  1.00 0.00 ? 122 HIS A NE2  1  
ATOM   350  H  H    . HIS A 1 21 ? 2.982   -16.598 3.951  1.00 0.00 ? 122 HIS A H    1  
ATOM   351  H  HA   . HIS A 1 21 ? 2.973   -17.290 6.639  1.00 0.00 ? 122 HIS A HA   1  
ATOM   352  H  HB2  . HIS A 1 21 ? 3.566   -15.101 6.212  1.00 0.00 ? 122 HIS A HB2  1  
ATOM   353  H  HB3  . HIS A 1 21 ? 2.282   -14.853 5.046  1.00 0.00 ? 122 HIS A HB3  1  
ATOM   354  H  HD1  . HIS A 1 21 ? 2.807   -15.124 8.814  1.00 0.00 ? 122 HIS A HD1  1  
ATOM   355  H  HD2  . HIS A 1 21 ? -0.024  -13.709 6.061  1.00 0.00 ? 122 HIS A HD2  1  
ATOM   356  H  HE1  . HIS A 1 21 ? 1.060   -13.855 10.174 1.00 0.00 ? 122 HIS A HE1  1  
ATOM   357  N  N    . TYR A 1 22 ? 0.032   -17.095 5.181  1.00 0.00 ? 123 TYR A N    1  
ATOM   358  C  CA   . TYR A 1 22 ? -1.369  -17.459 5.309  1.00 0.00 ? 123 TYR A CA   1  
ATOM   359  C  C    . TYR A 1 22 ? -1.520  -18.935 5.683  1.00 0.00 ? 123 TYR A C    1  
ATOM   360  O  O    . TYR A 1 22 ? -2.330  -19.282 6.542  1.00 0.00 ? 123 TYR A O    1  
ATOM   361  C  CB   . TYR A 1 22 ? -1.992  -17.228 3.931  1.00 0.00 ? 123 TYR A CB   1  
ATOM   362  C  CG   . TYR A 1 22 ? -3.039  -16.113 3.901  1.00 0.00 ? 123 TYR A CG   1  
ATOM   363  C  CD1  . TYR A 1 22 ? -4.182  -16.219 4.667  1.00 0.00 ? 123 TYR A CD1  1  
ATOM   364  C  CD2  . TYR A 1 22 ? -2.841  -15.000 3.109  1.00 0.00 ? 123 TYR A CD2  1  
ATOM   365  C  CE1  . TYR A 1 22 ? -5.168  -15.170 4.639  1.00 0.00 ? 123 TYR A CE1  1  
ATOM   366  C  CE2  . TYR A 1 22 ? -3.827  -13.951 3.080  1.00 0.00 ? 123 TYR A CE2  1  
ATOM   367  C  CZ   . TYR A 1 22 ? -4.942  -14.088 3.847  1.00 0.00 ? 123 TYR A CZ   1  
ATOM   368  O  OH   . TYR A 1 22 ? -5.873  -13.097 3.820  1.00 0.00 ? 123 TYR A OH   1  
ATOM   369  H  H    . TYR A 1 22 ? 0.295   -16.735 4.286  1.00 0.00 ? 123 TYR A H    1  
ATOM   370  H  HA   . TYR A 1 22 ? -1.805  -16.846 6.098  1.00 0.00 ? 123 TYR A HA   1  
ATOM   371  H  HB2  . TYR A 1 22 ? -1.200  -16.987 3.221  1.00 0.00 ? 123 TYR A HB2  1  
ATOM   372  H  HB3  . TYR A 1 22 ? -2.453  -18.155 3.592  1.00 0.00 ? 123 TYR A HB3  1  
ATOM   373  H  HD1  . TYR A 1 22 ? -4.339  -17.098 5.293  1.00 0.00 ? 123 TYR A HD1  1  
ATOM   374  H  HD2  . TYR A 1 22 ? -1.938  -14.916 2.504  1.00 0.00 ? 123 TYR A HD2  1  
ATOM   375  H  HE1  . TYR A 1 22 ? -6.076  -15.241 5.239  1.00 0.00 ? 123 TYR A HE1  1  
ATOM   376  H  HE2  . TYR A 1 22 ? -3.682  -13.068 2.459  1.00 0.00 ? 123 TYR A HE2  1  
ATOM   377  H  HH   . TYR A 1 22 ? -5.482  -12.271 3.413  1.00 0.00 ? 123 TYR A HH   1  
ATOM   378  N  N    . ARG A 1 23 ? -0.729  -19.765 5.019  1.00 0.00 ? 124 ARG A N    1  
ATOM   379  C  CA   . ARG A 1 23 ? -0.765  -21.195 5.270  1.00 0.00 ? 124 ARG A CA   1  
ATOM   380  C  C    . ARG A 1 23 ? -1.197  -21.470 6.712  1.00 0.00 ? 124 ARG A C    1  
ATOM   381  O  O    . ARG A 1 23 ? -2.005  -22.363 6.962  1.00 0.00 ? 124 ARG A O    1  
ATOM   382  C  CB   . ARG A 1 23 ? 0.605   -21.832 5.025  1.00 0.00 ? 124 ARG A CB   1  
ATOM   383  C  CG   . ARG A 1 23 ? 1.273   -22.220 6.346  1.00 0.00 ? 124 ARG A CG   1  
ATOM   384  C  CD   . ARG A 1 23 ? 0.542   -23.390 7.008  1.00 0.00 ? 124 ARG A CD   1  
ATOM   385  N  NE   . ARG A 1 23 ? 1.472   -24.524 7.201  1.00 0.00 ? 124 ARG A NE   1  
ATOM   386  C  CZ   . ARG A 1 23 ? 1.870   -24.975 8.399  1.00 0.00 ? 124 ARG A CZ   1  
ATOM   387  N  NH1  . ARG A 1 23 ? 0.973   -25.478 9.257  1.00 0.00 ? 124 ARG A NH1  1  
ATOM   388  N  NH2  . ARG A 1 23 ? 3.165   -24.921 8.738  1.00 0.00 ? 124 ARG A NH2  1  
ATOM   389  H  H    . ARG A 1 23 ? -0.073  -19.474 4.322  1.00 0.00 ? 124 ARG A H    1  
ATOM   390  H  HA   . ARG A 1 23 ? -1.495  -21.585 4.561  1.00 0.00 ? 124 ARG A HA   1  
ATOM   391  H  HB2  . ARG A 1 23 ? 0.492   -22.716 4.398  1.00 0.00 ? 124 ARG A HB2  1  
ATOM   392  H  HB3  . ARG A 1 23 ? 1.242   -21.135 4.482  1.00 0.00 ? 124 ARG A HB3  1  
ATOM   393  H  HG2  . ARG A 1 23 ? 2.313   -22.492 6.165  1.00 0.00 ? 124 ARG A HG2  1  
ATOM   394  H  HG3  . ARG A 1 23 ? 1.281   -21.363 7.020  1.00 0.00 ? 124 ARG A HG3  1  
ATOM   395  H  HD2  . ARG A 1 23 ? 0.133   -23.077 7.969  1.00 0.00 ? 124 ARG A HD2  1  
ATOM   396  H  HD3  . ARG A 1 23 ? -0.300  -23.700 6.389  1.00 0.00 ? 124 ARG A HD3  1  
ATOM   397  H  HE   . ARG A 1 23 ? 1.826   -24.984 6.386  1.00 0.00 ? 124 ARG A HE   1  
ATOM   398  H  HH11 . ARG A 1 23 ? 0.038   -25.661 8.953  1.00 0.00 ? 124 ARG A HH11 1  
ATOM   399  H  HH12 . ARG A 1 23 ? 1.238   -25.671 10.202 1.00 0.00 ? 124 ARG A HH12 1  
ATOM   400  H  HH21 . ARG A 1 23 ? 3.865   -25.214 8.087  1.00 0.00 ? 124 ARG A HH21 1  
ATOM   401  H  HH22 . ARG A 1 23 ? 3.432   -24.588 9.642  1.00 0.00 ? 124 ARG A HH22 1  
ATOM   402  N  N    . SER A 1 24 ? -0.639  -20.686 7.623  1.00 0.00 ? 125 SER A N    1  
ATOM   403  C  CA   . SER A 1 24 ? -0.956  -20.833 9.033  1.00 0.00 ? 125 SER A CA   1  
ATOM   404  C  C    . SER A 1 24 ? -2.387  -20.361 9.300  1.00 0.00 ? 125 SER A C    1  
ATOM   405  O  O    . SER A 1 24 ? -3.189  -21.093 9.878  1.00 0.00 ? 125 SER A O    1  
ATOM   406  C  CB   . SER A 1 24 ? 0.031   -20.055 9.905  1.00 0.00 ? 125 SER A CB   1  
ATOM   407  O  OG   . SER A 1 24 ? 0.360   -18.789 9.338  1.00 0.00 ? 125 SER A OG   1  
ATOM   408  H  H    . SER A 1 24 ? 0.017   -19.962 7.411  1.00 0.00 ? 125 SER A H    1  
ATOM   409  H  HA   . SER A 1 24 ? -0.861  -21.899 9.241  1.00 0.00 ? 125 SER A HA   1  
ATOM   410  H  HB2  . SER A 1 24 ? -0.398  -19.907 10.896 1.00 0.00 ? 125 SER A HB2  1  
ATOM   411  H  HB3  . SER A 1 24 ? 0.940   -20.641 10.035 1.00 0.00 ? 125 SER A HB3  1  
ATOM   412  H  HG   . SER A 1 24 ? 0.206   -18.064 10.009 1.00 0.00 ? 125 SER A HG   1  
ATOM   413  N  N    . HIS A 1 25 ? -2.663  -19.140 8.866  1.00 0.00 ? 126 HIS A N    1  
ATOM   414  C  CA   . HIS A 1 25 ? -3.983  -18.561 9.050  1.00 0.00 ? 126 HIS A CA   1  
ATOM   415  C  C    . HIS A 1 25 ? -5.052  -19.618 8.763  1.00 0.00 ? 126 HIS A C    1  
ATOM   416  O  O    . HIS A 1 25 ? -6.156  -19.551 9.301  1.00 0.00 ? 126 HIS A O    1  
ATOM   417  C  CB   . HIS A 1 25 ? -4.149  -17.303 8.196  1.00 0.00 ? 126 HIS A CB   1  
ATOM   418  C  CG   . HIS A 1 25 ? -3.429  -16.092 8.739  1.00 0.00 ? 126 HIS A CG   1  
ATOM   419  N  ND1  . HIS A 1 25 ? -3.192  -15.904 10.090 1.00 0.00 ? 126 HIS A ND1  1  
ATOM   420  C  CD2  . HIS A 1 25 ? -2.897  -15.010 8.101  1.00 0.00 ? 126 HIS A CD2  1  
ATOM   421  C  CE1  . HIS A 1 25 ? -2.546  -14.758 10.246 1.00 0.00 ? 126 HIS A CE1  1  
ATOM   422  N  NE2  . HIS A 1 25 ? -2.365  -14.205 9.012  1.00 0.00 ? 126 HIS A NE2  1  
ATOM   423  H  H    . HIS A 1 25 ? -2.005  -18.551 8.397  1.00 0.00 ? 126 HIS A H    1  
ATOM   424  H  HA   . HIS A 1 25 ? -4.051  -18.263 10.097 1.00 0.00 ? 126 HIS A HA   1  
ATOM   425  H  HB2  . HIS A 1 25 ? -3.783  -17.509 7.189  1.00 0.00 ? 126 HIS A HB2  1  
ATOM   426  H  HB3  . HIS A 1 25 ? -5.211  -17.073 8.108  1.00 0.00 ? 126 HIS A HB3  1  
ATOM   427  H  HD1  . HIS A 1 25 ? -3.462  -16.528 10.823 1.00 0.00 ? 126 HIS A HD1  1  
ATOM   428  H  HD2  . HIS A 1 25 ? -2.907  -14.837 7.025  1.00 0.00 ? 126 HIS A HD2  1  
ATOM   429  H  HE1  . HIS A 1 25 ? -2.218  -14.332 11.194 1.00 0.00 ? 126 HIS A HE1  1  
ATOM   430  N  N    . THR A 1 26 ? -4.686  -20.569 7.916  1.00 0.00 ? 127 THR A N    1  
ATOM   431  C  CA   . THR A 1 26 ? -5.599  -21.638 7.551  1.00 0.00 ? 127 THR A CA   1  
ATOM   432  C  C    . THR A 1 26 ? -4.820  -22.905 7.192  1.00 0.00 ? 127 THR A C    1  
ATOM   433  O  O    . THR A 1 26 ? -3.916  -23.310 7.921  1.00 0.00 ? 127 THR A O    1  
ATOM   434  C  CB   . THR A 1 26 ? -6.491  -21.131 6.417  1.00 0.00 ? 127 THR A CB   1  
ATOM   435  O  OG1  . THR A 1 26 ? -7.384  -22.213 6.167  1.00 0.00 ? 127 THR A OG1  1  
ATOM   436  C  CG2  . THR A 1 26 ? -5.729  -20.966 5.101  1.00 0.00 ? 127 THR A CG2  1  
ATOM   437  H  H    . THR A 1 26 ? -3.786  -20.615 7.483  1.00 0.00 ? 127 THR A H    1  
ATOM   438  H  HA   . THR A 1 26 ? -6.214  -21.876 8.419  1.00 0.00 ? 127 THR A HA   1  
ATOM   439  H  HB   . THR A 1 26 ? -6.989  -20.202 6.698  1.00 0.00 ? 127 THR A HB   1  
ATOM   440  H  HG1  . THR A 1 26 ? -8.301  -21.983 6.494  1.00 0.00 ? 127 THR A HG1  1  
ATOM   441  H  HG21 . THR A 1 26 ? -6.226  -21.539 4.318  1.00 0.00 ? 127 THR A HG21 1  
ATOM   442  H  HG22 . THR A 1 26 ? -5.708  -19.912 4.822  1.00 0.00 ? 127 THR A HG22 1  
ATOM   443  H  HG23 . THR A 1 26 ? -4.708  -21.329 5.224  1.00 0.00 ? 127 THR A HG23 1  
ATOM   444  N  N    . ASN A 1 27 ? -5.200  -23.496 6.069  1.00 0.00 ? 128 ASN A N    1  
ATOM   445  C  CA   . ASN A 1 27 ? -4.549  -24.709 5.604  1.00 0.00 ? 128 ASN A CA   1  
ATOM   446  C  C    . ASN A 1 27 ? -4.872  -24.920 4.123  1.00 0.00 ? 128 ASN A C    1  
ATOM   447  O  O    . ASN A 1 27 ? -4.981  -26.056 3.664  1.00 0.00 ? 128 ASN A O    1  
ATOM   448  C  CB   . ASN A 1 27 ? -5.047  -25.932 6.376  1.00 0.00 ? 128 ASN A CB   1  
ATOM   449  C  CG   . ASN A 1 27 ? -4.090  -26.288 7.515  1.00 0.00 ? 128 ASN A CG   1  
ATOM   450  O  OD1  . ASN A 1 27 ? -4.222  -25.828 8.637  1.00 0.00 ? 128 ASN A OD1  1  
ATOM   451  N  ND2  . ASN A 1 27 ? -3.122  -27.131 7.165  1.00 0.00 ? 128 ASN A ND2  1  
ATOM   452  H  H    . ASN A 1 27 ? -5.937  -23.160 5.482  1.00 0.00 ? 128 ASN A H    1  
ATOM   453  H  HA   . ASN A 1 27 ? -3.485  -24.548 5.780  1.00 0.00 ? 128 ASN A HA   1  
ATOM   454  H  HB2  . ASN A 1 27 ? -6.040  -25.733 6.779  1.00 0.00 ? 128 ASN A HB2  1  
ATOM   455  H  HB3  . ASN A 1 27 ? -5.143  -26.780 5.698  1.00 0.00 ? 128 ASN A HB3  1  
ATOM   456  H  HD21 . ASN A 1 27 ? -3.038  -27.428 6.214  1.00 0.00 ? 128 ASN A HD21 1  
ATOM   457  H  HD22 . ASN A 1 27 ? -2.479  -27.467 7.853  1.00 0.00 ? 128 ASN A HD22 1  
ATOM   458  N  N    . GLU A 1 28 ? -5.015  -23.809 3.417  1.00 0.00 ? 129 GLU A N    1  
ATOM   459  C  CA   . GLU A 1 28 ? -5.323  -23.858 1.998  1.00 0.00 ? 129 GLU A CA   1  
ATOM   460  C  C    . GLU A 1 28 ? -4.036  -23.784 1.172  1.00 0.00 ? 129 GLU A C    1  
ATOM   461  O  O    . GLU A 1 28 ? -3.330  -22.777 1.207  1.00 0.00 ? 129 GLU A O    1  
ATOM   462  C  CB   . GLU A 1 28 ? -6.290  -22.739 1.607  1.00 0.00 ? 129 GLU A CB   1  
ATOM   463  C  CG   . GLU A 1 28 ? -7.684  -22.994 2.183  1.00 0.00 ? 129 GLU A CG   1  
ATOM   464  C  CD   . GLU A 1 28 ? -8.171  -24.403 1.839  1.00 0.00 ? 129 GLU A CD   1  
ATOM   465  O  OE1  . GLU A 1 28 ? -7.872  -25.317 2.636  1.00 0.00 ? 129 GLU A OE1  1  
ATOM   466  O  OE2  . GLU A 1 28 ? -8.832  -24.533 0.785  1.00 0.00 ? 129 GLU A OE2  1  
ATOM   467  H  H    . GLU A 1 28 ? -4.924  -22.888 3.798  1.00 0.00 ? 129 GLU A H    1  
ATOM   468  H  HA   . GLU A 1 28 ? -5.808  -24.821 1.840  1.00 0.00 ? 129 GLU A HA   1  
ATOM   469  H  HB2  . GLU A 1 28 ? -5.912  -21.783 1.970  1.00 0.00 ? 129 GLU A HB2  1  
ATOM   470  H  HB3  . GLU A 1 28 ? -6.349  -22.667 0.521  1.00 0.00 ? 129 GLU A HB3  1  
ATOM   471  H  HG2  . GLU A 1 28 ? -7.663  -22.867 3.266  1.00 0.00 ? 129 GLU A HG2  1  
ATOM   472  H  HG3  . GLU A 1 28 ? -8.385  -22.257 1.790  1.00 0.00 ? 129 GLU A HG3  1  
ATOM   473  N  N    . LYS A 1 29 ? -3.772  -24.862 0.449  1.00 0.00 ? 130 LYS A N    1  
ATOM   474  C  CA   . LYS A 1 29 ? -2.583  -24.931 -0.383 1.00 0.00 ? 130 LYS A CA   1  
ATOM   475  C  C    . LYS A 1 29 ? -2.947  -25.550 -1.734 1.00 0.00 ? 130 LYS A C    1  
ATOM   476  O  O    . LYS A 1 29 ? -4.124  -25.733 -2.040 1.00 0.00 ? 130 LYS A O    1  
ATOM   477  C  CB   . LYS A 1 29 ? -1.459  -25.668 0.348  1.00 0.00 ? 130 LYS A CB   1  
ATOM   478  C  CG   . LYS A 1 29 ? -1.960  -26.990 0.933  1.00 0.00 ? 130 LYS A CG   1  
ATOM   479  C  CD   . LYS A 1 29 ? -1.862  -28.118 -0.096 1.00 0.00 ? 130 LYS A CD   1  
ATOM   480  C  CE   . LYS A 1 29 ? -0.404  -28.404 -0.459 1.00 0.00 ? 130 LYS A CE   1  
ATOM   481  N  NZ   . LYS A 1 29 ? -0.234  -28.446 -1.929 1.00 0.00 ? 130 LYS A NZ   1  
ATOM   482  H  H    . LYS A 1 29 ? -4.352  -25.676 0.427  1.00 0.00 ? 130 LYS A H    1  
ATOM   483  H  HA   . LYS A 1 29 ? -2.242  -23.910 -0.552 1.00 0.00 ? 130 LYS A HA   1  
ATOM   484  H  HB2  . LYS A 1 29 ? -0.636  -25.861 -0.341 1.00 0.00 ? 130 LYS A HB2  1  
ATOM   485  H  HB3  . LYS A 1 29 ? -1.065  -25.039 1.146  1.00 0.00 ? 130 LYS A HB3  1  
ATOM   486  H  HG2  . LYS A 1 29 ? -1.374  -27.247 1.816  1.00 0.00 ? 130 LYS A HG2  1  
ATOM   487  H  HG3  . LYS A 1 29 ? -2.994  -26.879 1.259  1.00 0.00 ? 130 LYS A HG3  1  
ATOM   488  H  HD2  . LYS A 1 29 ? -2.325  -29.021 0.303  1.00 0.00 ? 130 LYS A HD2  1  
ATOM   489  H  HD3  . LYS A 1 29 ? -2.418  -27.845 -0.993 1.00 0.00 ? 130 LYS A HD3  1  
ATOM   490  H  HE2  . LYS A 1 29 ? 0.240   -27.634 -0.034 1.00 0.00 ? 130 LYS A HE2  1  
ATOM   491  H  HE3  . LYS A 1 29 ? -0.094  -29.354 -0.024 1.00 0.00 ? 130 LYS A HE3  1  
ATOM   492  H  HZ1  . LYS A 1 29 ? 0.367   -27.700 -2.216 1.00 0.00 ? 130 LYS A HZ1  1  
ATOM   493  H  HZ2  . LYS A 1 29 ? 0.171   -29.321 -2.193 1.00 0.00 ? 130 LYS A HZ2  1  
ATOM   494  H  HZ3  . LYS A 1 29 ? -1.126  -28.344 -2.370 1.00 0.00 ? 130 LYS A HZ3  1  
HETATM 495  ZN ZN   . ZN  B 2 .  ? -1.469  -12.489 8.641  1.00 0.00 ? 1   ZN  A ZN   1  
ATOM   496  N  N    . ARG A 1 1  ? -0.152  -0.674  -1.974 1.00 0.00 ? 102 ARG A N    2  
ATOM   497  C  CA   . ARG A 1 1  ? 0.969   -0.889  -1.077 1.00 0.00 ? 102 ARG A CA   2  
ATOM   498  C  C    . ARG A 1 1  ? 1.450   -2.339  -1.166 1.00 0.00 ? 102 ARG A C    2  
ATOM   499  O  O    . ARG A 1 1  ? 0.764   -3.191  -1.727 1.00 0.00 ? 102 ARG A O    2  
ATOM   500  C  CB   . ARG A 1 1  ? 0.586   -0.575  0.371  1.00 0.00 ? 102 ARG A CB   2  
ATOM   501  C  CG   . ARG A 1 1  ? 1.827   -0.303  1.222  1.00 0.00 ? 102 ARG A CG   2  
ATOM   502  C  CD   . ARG A 1 1  ? 1.524   0.708   2.329  1.00 0.00 ? 102 ARG A CD   2  
ATOM   503  N  NE   . ARG A 1 1  ? 2.787   1.217   2.909  1.00 0.00 ? 102 ARG A NE   2  
ATOM   504  C  CZ   . ARG A 1 1  ? 3.603   0.490   3.684  1.00 0.00 ? 102 ARG A CZ   2  
ATOM   505  N  NH1  . ARG A 1 1  ? 4.170   -0.623  3.202  1.00 0.00 ? 102 ARG A NH1  2  
ATOM   506  N  NH2  . ARG A 1 1  ? 3.851   0.877   4.944  1.00 0.00 ? 102 ARG A NH2  2  
ATOM   507  H  H    . ARG A 1 1  ? -0.638  -1.503  -2.251 1.00 0.00 ? 102 ARG A H    2  
ATOM   508  H  HA   . ARG A 1 1  ? 1.739   -0.199  -1.421 1.00 0.00 ? 102 ARG A HA   2  
ATOM   509  H  HB2  . ARG A 1 1  ? -0.073  0.293   0.395  1.00 0.00 ? 102 ARG A HB2  2  
ATOM   510  H  HB3  . ARG A 1 1  ? 0.027   -1.410  0.792  1.00 0.00 ? 102 ARG A HB3  2  
ATOM   511  H  HG2  . ARG A 1 1  ? 2.181   -1.235  1.664  1.00 0.00 ? 102 ARG A HG2  2  
ATOM   512  H  HG3  . ARG A 1 1  ? 2.630   0.074   0.589  1.00 0.00 ? 102 ARG A HG3  2  
ATOM   513  H  HD2  . ARG A 1 1  ? 0.940   1.536   1.925  1.00 0.00 ? 102 ARG A HD2  2  
ATOM   514  H  HD3  . ARG A 1 1  ? 0.919   0.240   3.104  1.00 0.00 ? 102 ARG A HD3  2  
ATOM   515  H  HE   . ARG A 1 1  ? 3.047   2.162   2.711  1.00 0.00 ? 102 ARG A HE   2  
ATOM   516  H  HH11 . ARG A 1 1  ? 4.398   -0.687  2.230  1.00 0.00 ? 102 ARG A HH11 2  
ATOM   517  H  HH12 . ARG A 1 1  ? 4.367   -1.390  3.812  1.00 0.00 ? 102 ARG A HH12 2  
ATOM   518  H  HH21 . ARG A 1 1  ? 3.585   1.792   5.246  1.00 0.00 ? 102 ARG A HH21 2  
ATOM   519  H  HH22 . ARG A 1 1  ? 4.303   0.250   5.579  1.00 0.00 ? 102 ARG A HH22 2  
ATOM   520  N  N    . SER A 1 2  ? 2.627   -2.575  -0.604 1.00 0.00 ? 103 SER A N    2  
ATOM   521  C  CA   . SER A 1 2  ? 3.207   -3.907  -0.613 1.00 0.00 ? 103 SER A CA   2  
ATOM   522  C  C    . SER A 1 2  ? 2.275   -4.888  0.100  1.00 0.00 ? 103 SER A C    2  
ATOM   523  O  O    . SER A 1 2  ? 1.899   -4.669  1.250  1.00 0.00 ? 103 SER A O    2  
ATOM   524  C  CB   . SER A 1 2  ? 4.587   -3.910  0.047  1.00 0.00 ? 103 SER A CB   2  
ATOM   525  O  OG   . SER A 1 2  ? 5.638   -3.981  -0.913 1.00 0.00 ? 103 SER A OG   2  
ATOM   526  H  H    . SER A 1 2  ? 3.180   -1.876  -0.150 1.00 0.00 ? 103 SER A H    2  
ATOM   527  H  HA   . SER A 1 2  ? 3.308   -4.170  -1.666 1.00 0.00 ? 103 SER A HA   2  
ATOM   528  H  HB2  . SER A 1 2  ? 4.704   -3.009  0.648  1.00 0.00 ? 103 SER A HB2  2  
ATOM   529  H  HB3  . SER A 1 2  ? 4.661   -4.759  0.729  1.00 0.00 ? 103 SER A HB3  2  
ATOM   530  H  HG   . SER A 1 2  ? 5.344   -3.564  -1.773 1.00 0.00 ? 103 SER A HG   2  
ATOM   531  N  N    . PHE A 1 3  ? 1.929   -5.951  -0.613 1.00 0.00 ? 104 PHE A N    2  
ATOM   532  C  CA   . PHE A 1 3  ? 1.049   -6.967  -0.062 1.00 0.00 ? 104 PHE A CA   2  
ATOM   533  C  C    . PHE A 1 3  ? 1.012   -6.892  1.465  1.00 0.00 ? 104 PHE A C    2  
ATOM   534  O  O    . PHE A 1 3  ? 2.056   -6.829  2.112  1.00 0.00 ? 104 PHE A O    2  
ATOM   535  C  CB   . PHE A 1 3  ? 1.616   -8.325  -0.482 1.00 0.00 ? 104 PHE A CB   2  
ATOM   536  C  CG   . PHE A 1 3  ? 2.075   -8.385  -1.939 1.00 0.00 ? 104 PHE A CG   2  
ATOM   537  C  CD1  . PHE A 1 3  ? 1.179   -8.664  -2.924 1.00 0.00 ? 104 PHE A CD1  2  
ATOM   538  C  CD2  . PHE A 1 3  ? 3.379   -8.159  -2.251 1.00 0.00 ? 104 PHE A CD2  2  
ATOM   539  C  CE1  . PHE A 1 3  ? 1.605   -8.719  -4.277 1.00 0.00 ? 104 PHE A CE1  2  
ATOM   540  C  CE2  . PHE A 1 3  ? 3.806   -8.214  -3.605 1.00 0.00 ? 104 PHE A CE2  2  
ATOM   541  C  CZ   . PHE A 1 3  ? 2.909   -8.493  -4.590 1.00 0.00 ? 104 PHE A CZ   2  
ATOM   542  H  H    . PHE A 1 3  ? 2.240   -6.122  -1.548 1.00 0.00 ? 104 PHE A H    2  
ATOM   543  H  HA   . PHE A 1 3  ? 0.050   -6.778  -0.458 1.00 0.00 ? 104 PHE A HA   2  
ATOM   544  H  HB2  . PHE A 1 3  ? 2.459   -8.570  0.164  1.00 0.00 ? 104 PHE A HB2  2  
ATOM   545  H  HB3  . PHE A 1 3  ? 0.857   -9.090  -0.319 1.00 0.00 ? 104 PHE A HB3  2  
ATOM   546  H  HD1  . PHE A 1 3  ? 0.133   -8.845  -2.674 1.00 0.00 ? 104 PHE A HD1  2  
ATOM   547  H  HD2  . PHE A 1 3  ? 4.098   -7.934  -1.463 1.00 0.00 ? 104 PHE A HD2  2  
ATOM   548  H  HE1  . PHE A 1 3  ? 0.887   -8.943  -5.066 1.00 0.00 ? 104 PHE A HE1  2  
ATOM   549  H  HE2  . PHE A 1 3  ? 4.851   -8.033  -3.856 1.00 0.00 ? 104 PHE A HE2  2  
ATOM   550  H  HZ   . PHE A 1 3  ? 3.236   -8.536  -5.628 1.00 0.00 ? 104 PHE A HZ   2  
ATOM   551  N  N    . VAL A 1 4  ? -0.203  -6.901  1.997  1.00 0.00 ? 105 VAL A N    2  
ATOM   552  C  CA   . VAL A 1 4  ? -0.388  -6.835  3.436  1.00 0.00 ? 105 VAL A CA   2  
ATOM   553  C  C    . VAL A 1 4  ? -1.449  -7.855  3.856  1.00 0.00 ? 105 VAL A C    2  
ATOM   554  O  O    . VAL A 1 4  ? -2.599  -7.773  3.427  1.00 0.00 ? 105 VAL A O    2  
ATOM   555  C  CB   . VAL A 1 4  ? -0.737  -5.405  3.853  1.00 0.00 ? 105 VAL A CB   2  
ATOM   556  C  CG1  . VAL A 1 4  ? -0.613  -5.231  5.369  1.00 0.00 ? 105 VAL A CG1  2  
ATOM   557  C  CG2  . VAL A 1 4  ? 0.136   -4.390  3.112  1.00 0.00 ? 105 VAL A CG2  2  
ATOM   558  H  H    . VAL A 1 4  ? -1.046  -6.953  1.464  1.00 0.00 ? 105 VAL A H    2  
ATOM   559  H  HA   . VAL A 1 4  ? 0.559   -7.102  3.903  1.00 0.00 ? 105 VAL A HA   2  
ATOM   560  H  HB   . VAL A 1 4  ? -1.775  -5.219  3.579  1.00 0.00 ? 105 VAL A HB   2  
ATOM   561  H  HG11 . VAL A 1 4  ? 0.275   -5.757  5.723  1.00 0.00 ? 105 VAL A HG11 2  
ATOM   562  H  HG12 . VAL A 1 4  ? -0.526  -4.171  5.607  1.00 0.00 ? 105 VAL A HG12 2  
ATOM   563  H  HG13 . VAL A 1 4  ? -1.497  -5.642  5.855  1.00 0.00 ? 105 VAL A HG13 2  
ATOM   564  H  HG21 . VAL A 1 4  ? -0.074  -4.444  2.044  1.00 0.00 ? 105 VAL A HG21 2  
ATOM   565  H  HG22 . VAL A 1 4  ? -0.086  -3.387  3.476  1.00 0.00 ? 105 VAL A HG22 2  
ATOM   566  H  HG23 . VAL A 1 4  ? 1.187   -4.617  3.288  1.00 0.00 ? 105 VAL A HG23 2  
ATOM   567  N  N    . CYS A 1 5  ? -1.025  -8.794  4.689  1.00 0.00 ? 106 CYS A N    2  
ATOM   568  C  CA   . CYS A 1 5  ? -1.923  -9.829  5.172  1.00 0.00 ? 106 CYS A CA   2  
ATOM   569  C  C    . CYS A 1 5  ? -3.101  -9.152  5.875  1.00 0.00 ? 106 CYS A C    2  
ATOM   570  O  O    . CYS A 1 5  ? -3.076  -8.957  7.090  1.00 0.00 ? 106 CYS A O    2  
ATOM   571  C  CB   . CYS A 1 5  ? -1.205  -10.819 6.089  1.00 0.00 ? 106 CYS A CB   2  
ATOM   572  S  SG   . CYS A 1 5  ? -2.261  -12.286 6.376  1.00 0.00 ? 106 CYS A SG   2  
ATOM   573  H  H    . CYS A 1 5  ? -0.087  -8.853  5.033  1.00 0.00 ? 106 CYS A H    2  
ATOM   574  H  HA   . CYS A 1 5  ? -2.262  -10.383 4.296  1.00 0.00 ? 106 CYS A HA   2  
ATOM   575  H  HB2  . CYS A 1 5  ? -0.259  -11.124 5.639  1.00 0.00 ? 106 CYS A HB2  2  
ATOM   576  H  HB3  . CYS A 1 5  ? -0.966  -10.341 7.038  1.00 0.00 ? 106 CYS A HB3  2  
ATOM   577  N  N    . GLU A 1 6  ? -4.107  -8.811  5.081  1.00 0.00 ? 107 GLU A N    2  
ATOM   578  C  CA   . GLU A 1 6  ? -5.292  -8.160  5.613  1.00 0.00 ? 107 GLU A CA   2  
ATOM   579  C  C    . GLU A 1 6  ? -5.747  -8.853  6.898  1.00 0.00 ? 107 GLU A C    2  
ATOM   580  O  O    . GLU A 1 6  ? -6.449  -8.257  7.715  1.00 0.00 ? 107 GLU A O    2  
ATOM   581  C  CB   . GLU A 1 6  ? -6.416  -8.136  4.576  1.00 0.00 ? 107 GLU A CB   2  
ATOM   582  C  CG   . GLU A 1 6  ? -6.305  -9.326  3.620  1.00 0.00 ? 107 GLU A CG   2  
ATOM   583  C  CD   . GLU A 1 6  ? -5.925  -10.601 4.374  1.00 0.00 ? 107 GLU A CD   2  
ATOM   584  O  OE1  . GLU A 1 6  ? -6.795  -11.100 5.120  1.00 0.00 ? 107 GLU A OE1  2  
ATOM   585  O  OE2  . GLU A 1 6  ? -4.774  -11.050 4.186  1.00 0.00 ? 107 GLU A OE2  2  
ATOM   586  H  H    . GLU A 1 6  ? -4.120  -8.972  4.095  1.00 0.00 ? 107 GLU A H    2  
ATOM   587  H  HA   . GLU A 1 6  ? -4.987  -7.137  5.832  1.00 0.00 ? 107 GLU A HA   2  
ATOM   588  H  HB2  . GLU A 1 6  ? -7.382  -8.159  5.080  1.00 0.00 ? 107 GLU A HB2  2  
ATOM   589  H  HB3  . GLU A 1 6  ? -6.374  -7.206  4.009  1.00 0.00 ? 107 GLU A HB3  2  
ATOM   590  H  HG2  . GLU A 1 6  ? -7.255  -9.473  3.105  1.00 0.00 ? 107 GLU A HG2  2  
ATOM   591  H  HG3  . GLU A 1 6  ? -5.557  -9.115  2.855  1.00 0.00 ? 107 GLU A HG3  2  
ATOM   592  N  N    . VAL A 1 7  ? -5.330  -10.103 7.039  1.00 0.00 ? 108 VAL A N    2  
ATOM   593  C  CA   . VAL A 1 7  ? -5.686  -10.884 8.212  1.00 0.00 ? 108 VAL A CA   2  
ATOM   594  C  C    . VAL A 1 7  ? -5.026  -10.269 9.448  1.00 0.00 ? 108 VAL A C    2  
ATOM   595  O  O    . VAL A 1 7  ? -5.700  -9.654  10.273 1.00 0.00 ? 108 VAL A O    2  
ATOM   596  C  CB   . VAL A 1 7  ? -5.306  -12.351 7.999  1.00 0.00 ? 108 VAL A CB   2  
ATOM   597  C  CG1  . VAL A 1 7  ? -5.436  -13.145 9.300  1.00 0.00 ? 108 VAL A CG1  2  
ATOM   598  C  CG2  . VAL A 1 7  ? -6.145  -12.979 6.885  1.00 0.00 ? 108 VAL A CG2  2  
ATOM   599  H  H    . VAL A 1 7  ? -4.759  -10.580 6.371  1.00 0.00 ? 108 VAL A H    2  
ATOM   600  H  HA   . VAL A 1 7  ? -6.769  -10.829 8.327  1.00 0.00 ? 108 VAL A HA   2  
ATOM   601  H  HB   . VAL A 1 7  ? -4.260  -12.384 7.689  1.00 0.00 ? 108 VAL A HB   2  
ATOM   602  H  HG11 . VAL A 1 7  ? -6.379  -12.893 9.785  1.00 0.00 ? 108 VAL A HG11 2  
ATOM   603  H  HG12 . VAL A 1 7  ? -5.417  -14.212 9.077  1.00 0.00 ? 108 VAL A HG12 2  
ATOM   604  H  HG13 . VAL A 1 7  ? -4.608  -12.896 9.963  1.00 0.00 ? 108 VAL A HG13 2  
ATOM   605  H  HG21 . VAL A 1 7  ? -5.614  -12.894 5.938  1.00 0.00 ? 108 VAL A HG21 2  
ATOM   606  H  HG22 . VAL A 1 7  ? -6.320  -14.030 7.111  1.00 0.00 ? 108 VAL A HG22 2  
ATOM   607  H  HG23 . VAL A 1 7  ? -7.101  -12.459 6.813  1.00 0.00 ? 108 VAL A HG23 2  
ATOM   608  N  N    . CYS A 1 8  ? -3.718  -10.456 9.537  1.00 0.00 ? 109 CYS A N    2  
ATOM   609  C  CA   . CYS A 1 8  ? -2.961  -9.927  10.659 1.00 0.00 ? 109 CYS A CA   2  
ATOM   610  C  C    . CYS A 1 8  ? -2.500  -8.512  10.304 1.00 0.00 ? 109 CYS A C    2  
ATOM   611  O  O    . CYS A 1 8  ? -2.102  -7.747  11.179 1.00 0.00 ? 109 CYS A O    2  
ATOM   612  C  CB   . CYS A 1 8  ? -1.785  -10.834 11.026 1.00 0.00 ? 109 CYS A CB   2  
ATOM   613  S  SG   . CYS A 1 8  ? -0.583  -10.890 9.646  1.00 0.00 ? 109 CYS A SG   2  
ATOM   614  H  H    . CYS A 1 8  ? -3.178  -10.958 8.861  1.00 0.00 ? 109 CYS A H    2  
ATOM   615  H  HA   . CYS A 1 8  ? -3.638  -9.911  11.513 1.00 0.00 ? 109 CYS A HA   2  
ATOM   616  H  HB2  . CYS A 1 8  ? -1.298  -10.466 11.928 1.00 0.00 ? 109 CYS A HB2  2  
ATOM   617  H  HB3  . CYS A 1 8  ? -2.145  -11.840 11.245 1.00 0.00 ? 109 CYS A HB3  2  
ATOM   618  N  N    . THR A 1 9  ? -2.572  -8.207  9.016  1.00 0.00 ? 110 THR A N    2  
ATOM   619  C  CA   . THR A 1 9  ? -2.167  -6.897  8.533  1.00 0.00 ? 110 THR A CA   2  
ATOM   620  C  C    . THR A 1 9  ? -0.641  -6.794  8.488  1.00 0.00 ? 110 THR A C    2  
ATOM   621  O  O    . THR A 1 9  ? -0.076  -5.754  8.826  1.00 0.00 ? 110 THR A O    2  
ATOM   622  C  CB   . THR A 1 9  ? -2.821  -5.842  9.427  1.00 0.00 ? 110 THR A CB   2  
ATOM   623  O  OG1  . THR A 1 9  ? -1.937  -5.730  10.538 1.00 0.00 ? 110 THR A OG1  2  
ATOM   624  C  CG2  . THR A 1 9  ? -4.134  -6.329  10.044 1.00 0.00 ? 110 THR A CG2  2  
ATOM   625  H  H    . THR A 1 9  ? -2.897  -8.836  8.309  1.00 0.00 ? 110 THR A H    2  
ATOM   626  H  HA   . THR A 1 9  ? -2.526  -6.782  7.511  1.00 0.00 ? 110 THR A HA   2  
ATOM   627  H  HB   . THR A 1 9  ? -2.969  -4.909  8.883  1.00 0.00 ? 110 THR A HB   2  
ATOM   628  H  HG1  . THR A 1 9  ? -2.451  -5.800  11.393 1.00 0.00 ? 110 THR A HG1  2  
ATOM   629  H  HG21 . THR A 1 9  ? -4.865  -5.521  10.028 1.00 0.00 ? 110 THR A HG21 2  
ATOM   630  H  HG22 . THR A 1 9  ? -4.515  -7.173  9.468  1.00 0.00 ? 110 THR A HG22 2  
ATOM   631  H  HG23 . THR A 1 9  ? -3.959  -6.641  11.073 1.00 0.00 ? 110 THR A HG23 2  
ATOM   632  N  N    . ARG A 1 10 ? -0.018  -7.885  8.068  1.00 0.00 ? 111 ARG A N    2  
ATOM   633  C  CA   . ARG A 1 10 ? 1.431   -7.930  7.975  1.00 0.00 ? 111 ARG A CA   2  
ATOM   634  C  C    . ARG A 1 10 ? 1.879   -7.652  6.538  1.00 0.00 ? 111 ARG A C    2  
ATOM   635  O  O    . ARG A 1 10 ? 1.340   -8.227  5.594  1.00 0.00 ? 111 ARG A O    2  
ATOM   636  C  CB   . ARG A 1 10 ? 1.970   -9.292  8.415  1.00 0.00 ? 111 ARG A CB   2  
ATOM   637  C  CG   . ARG A 1 10 ? 2.242   -9.314  9.920  1.00 0.00 ? 111 ARG A CG   2  
ATOM   638  C  CD   . ARG A 1 10 ? 3.332   -10.332 10.266 1.00 0.00 ? 111 ARG A CD   2  
ATOM   639  N  NE   . ARG A 1 10 ? 4.662   -9.684  10.222 1.00 0.00 ? 111 ARG A NE   2  
ATOM   640  C  CZ   . ARG A 1 10 ? 5.206   -9.017  11.248 1.00 0.00 ? 111 ARG A CZ   2  
ATOM   641  N  NH1  . ARG A 1 10 ? 5.085   -9.492  12.496 1.00 0.00 ? 111 ARG A NH1  2  
ATOM   642  N  NH2  . ARG A 1 10 ? 5.872   -7.876  11.027 1.00 0.00 ? 111 ARG A NH2  2  
ATOM   643  H  H    . ARG A 1 10 ? -0.486  -8.725  7.796  1.00 0.00 ? 111 ARG A H    2  
ATOM   644  H  HA   . ARG A 1 10 ? 1.778   -7.149  8.651  1.00 0.00 ? 111 ARG A HA   2  
ATOM   645  H  HB2  . ARG A 1 10 ? 1.251   -10.071 8.160  1.00 0.00 ? 111 ARG A HB2  2  
ATOM   646  H  HB3  . ARG A 1 10 ? 2.888   -9.517  7.873  1.00 0.00 ? 111 ARG A HB3  2  
ATOM   647  H  HG2  . ARG A 1 10 ? 2.548   -8.322  10.252 1.00 0.00 ? 111 ARG A HG2  2  
ATOM   648  H  HG3  . ARG A 1 10 ? 1.326   -9.561  10.456 1.00 0.00 ? 111 ARG A HG3  2  
ATOM   649  H  HD2  . ARG A 1 10 ? 3.151   -10.746 11.258 1.00 0.00 ? 111 ARG A HD2  2  
ATOM   650  H  HD3  . ARG A 1 10 ? 3.299   -11.163 9.562  1.00 0.00 ? 111 ARG A HD3  2  
ATOM   651  H  HE   . ARG A 1 10 ? 5.186   -9.748  9.373  1.00 0.00 ? 111 ARG A HE   2  
ATOM   652  H  HH11 . ARG A 1 10 ? 4.517   -10.295 12.672 1.00 0.00 ? 111 ARG A HH11 2  
ATOM   653  H  HH12 . ARG A 1 10 ? 5.561   -9.040  13.251 1.00 0.00 ? 111 ARG A HH12 2  
ATOM   654  H  HH21 . ARG A 1 10 ? 5.384   -7.003  11.029 1.00 0.00 ? 111 ARG A HH21 2  
ATOM   655  H  HH22 . ARG A 1 10 ? 6.858   -7.896  10.862 1.00 0.00 ? 111 ARG A HH22 2  
ATOM   656  N  N    . ALA A 1 11 ? 2.861   -6.771  6.418  1.00 0.00 ? 112 ALA A N    2  
ATOM   657  C  CA   . ALA A 1 11 ? 3.387   -6.410  5.113  1.00 0.00 ? 112 ALA A CA   2  
ATOM   658  C  C    . ALA A 1 11 ? 4.732   -7.109  4.898  1.00 0.00 ? 112 ALA A C    2  
ATOM   659  O  O    . ALA A 1 11 ? 5.476   -7.336  5.850  1.00 0.00 ? 112 ALA A O    2  
ATOM   660  C  CB   . ALA A 1 11 ? 3.499   -4.888  5.011  1.00 0.00 ? 112 ALA A CB   2  
ATOM   661  H  H    . ALA A 1 11 ? 3.294   -6.308  7.191  1.00 0.00 ? 112 ALA A H    2  
ATOM   662  H  HA   . ALA A 1 11 ? 2.680   -6.761  4.361  1.00 0.00 ? 112 ALA A HA   2  
ATOM   663  H  HB1  . ALA A 1 11 ? 3.361   -4.582  3.973  1.00 0.00 ? 112 ALA A HB1  2  
ATOM   664  H  HB2  . ALA A 1 11 ? 2.732   -4.424  5.631  1.00 0.00 ? 112 ALA A HB2  2  
ATOM   665  H  HB3  . ALA A 1 11 ? 4.484   -4.572  5.354  1.00 0.00 ? 112 ALA A HB3  2  
ATOM   666  N  N    . PHE A 1 12 ? 5.000   -7.432  3.642  1.00 0.00 ? 113 PHE A N    2  
ATOM   667  C  CA   . PHE A 1 12 ? 6.242   -8.100  3.291  1.00 0.00 ? 113 PHE A CA   2  
ATOM   668  C  C    . PHE A 1 12 ? 6.818   -7.539  1.989  1.00 0.00 ? 113 PHE A C    2  
ATOM   669  O  O    . PHE A 1 12 ? 6.135   -6.813  1.266  1.00 0.00 ? 113 PHE A O    2  
ATOM   670  C  CB   . PHE A 1 12 ? 5.911   -9.581  3.091  1.00 0.00 ? 113 PHE A CB   2  
ATOM   671  C  CG   . PHE A 1 12 ? 5.325   -10.260 4.331  1.00 0.00 ? 113 PHE A CG   2  
ATOM   672  C  CD1  . PHE A 1 12 ? 6.147   -10.667 5.335  1.00 0.00 ? 113 PHE A CD1  2  
ATOM   673  C  CD2  . PHE A 1 12 ? 3.983   -10.456 4.428  1.00 0.00 ? 113 PHE A CD2  2  
ATOM   674  C  CE1  . PHE A 1 12 ? 5.604   -11.298 6.485  1.00 0.00 ? 113 PHE A CE1  2  
ATOM   675  C  CE2  . PHE A 1 12 ? 3.440   -11.087 5.578  1.00 0.00 ? 113 PHE A CE2  2  
ATOM   676  C  CZ   . PHE A 1 12 ? 4.261   -11.494 6.583  1.00 0.00 ? 113 PHE A CZ   2  
ATOM   677  H  H    . PHE A 1 12 ? 4.389   -7.243  2.873  1.00 0.00 ? 113 PHE A H    2  
ATOM   678  H  HA   . PHE A 1 12 ? 6.946   -7.924  4.103  1.00 0.00 ? 113 PHE A HA   2  
ATOM   679  H  HB2  . PHE A 1 12 ? 5.202   -9.677  2.268  1.00 0.00 ? 113 PHE A HB2  2  
ATOM   680  H  HB3  . PHE A 1 12 ? 6.817   -10.109 2.795  1.00 0.00 ? 113 PHE A HB3  2  
ATOM   681  H  HD1  . PHE A 1 12 ? 7.223   -10.510 5.257  1.00 0.00 ? 113 PHE A HD1  2  
ATOM   682  H  HD2  . PHE A 1 12 ? 3.325   -10.130 3.624  1.00 0.00 ? 113 PHE A HD2  2  
ATOM   683  H  HE1  . PHE A 1 12 ? 6.262   -11.624 7.290  1.00 0.00 ? 113 PHE A HE1  2  
ATOM   684  H  HE2  . PHE A 1 12 ? 2.364   -11.245 5.657  1.00 0.00 ? 113 PHE A HE2  2  
ATOM   685  H  HZ   . PHE A 1 12 ? 3.844   -11.978 7.466  1.00 0.00 ? 113 PHE A HZ   2  
ATOM   686  N  N    . ALA A 1 13 ? 8.067   -7.895  1.730  1.00 0.00 ? 114 ALA A N    2  
ATOM   687  C  CA   . ALA A 1 13 ? 8.743   -7.436  0.528  1.00 0.00 ? 114 ALA A CA   2  
ATOM   688  C  C    . ALA A 1 13 ? 8.437   -8.397  -0.623 1.00 0.00 ? 114 ALA A C    2  
ATOM   689  O  O    . ALA A 1 13 ? 8.544   -8.027  -1.790 1.00 0.00 ? 114 ALA A O    2  
ATOM   690  C  CB   . ALA A 1 13 ? 10.243  -7.312  0.801  1.00 0.00 ? 114 ALA A CB   2  
ATOM   691  H  H    . ALA A 1 13 ? 8.615   -8.485  2.323  1.00 0.00 ? 114 ALA A H    2  
ATOM   692  H  HA   . ALA A 1 13 ? 8.347   -6.451  0.282  1.00 0.00 ? 114 ALA A HA   2  
ATOM   693  H  HB1  . ALA A 1 13 ? 10.693  -8.305  0.817  1.00 0.00 ? 114 ALA A HB1  2  
ATOM   694  H  HB2  . ALA A 1 13 ? 10.707  -6.715  0.016  1.00 0.00 ? 114 ALA A HB2  2  
ATOM   695  H  HB3  . ALA A 1 13 ? 10.397  -6.827  1.766  1.00 0.00 ? 114 ALA A HB3  2  
ATOM   696  N  N    . ARG A 1 14 ? 8.062   -9.613  -0.252 1.00 0.00 ? 115 ARG A N    2  
ATOM   697  C  CA   . ARG A 1 14 ? 7.741   -10.630 -1.238 1.00 0.00 ? 115 ARG A CA   2  
ATOM   698  C  C    . ARG A 1 14 ? 6.313   -11.139 -1.031 1.00 0.00 ? 115 ARG A C    2  
ATOM   699  O  O    . ARG A 1 14 ? 5.780   -11.070 0.077  1.00 0.00 ? 115 ARG A O    2  
ATOM   700  C  CB   . ARG A 1 14 ? 8.712   -11.808 -1.151 1.00 0.00 ? 115 ARG A CB   2  
ATOM   701  C  CG   . ARG A 1 14 ? 10.140  -11.325 -0.890 1.00 0.00 ? 115 ARG A CG   2  
ATOM   702  C  CD   . ARG A 1 14 ? 11.143  -12.470 -1.042 1.00 0.00 ? 115 ARG A CD   2  
ATOM   703  N  NE   . ARG A 1 14 ? 10.729  -13.363 -2.146 1.00 0.00 ? 115 ARG A NE   2  
ATOM   704  C  CZ   . ARG A 1 14 ? 10.788  -13.032 -3.443 1.00 0.00 ? 115 ARG A CZ   2  
ATOM   705  N  NH1  . ARG A 1 14 ? 11.774  -12.242 -3.889 1.00 0.00 ? 115 ARG A NH1  2  
ATOM   706  N  NH2  . ARG A 1 14 ? 9.859   -13.490 -4.295 1.00 0.00 ? 115 ARG A NH2  2  
ATOM   707  H  H    . ARG A 1 14 ? 7.978   -9.906  0.701  1.00 0.00 ? 115 ARG A H    2  
ATOM   708  H  HA   . ARG A 1 14 ? 7.841   -10.127 -2.200 1.00 0.00 ? 115 ARG A HA   2  
ATOM   709  H  HB2  . ARG A 1 14 ? 8.401   -12.482 -0.352 1.00 0.00 ? 115 ARG A HB2  2  
ATOM   710  H  HB3  . ARG A 1 14 ? 8.681   -12.380 -2.079 1.00 0.00 ? 115 ARG A HB3  2  
ATOM   711  H  HG2  . ARG A 1 14 ? 10.388  -10.525 -1.587 1.00 0.00 ? 115 ARG A HG2  2  
ATOM   712  H  HG3  . ARG A 1 14 ? 10.208  -10.906 0.114  1.00 0.00 ? 115 ARG A HG3  2  
ATOM   713  H  HD2  . ARG A 1 14 ? 12.136  -12.070 -1.240 1.00 0.00 ? 115 ARG A HD2  2  
ATOM   714  H  HD3  . ARG A 1 14 ? 11.207  -13.034 -0.111 1.00 0.00 ? 115 ARG A HD3  2  
ATOM   715  H  HE   . ARG A 1 14 ? 10.383  -14.272 -1.910 1.00 0.00 ? 115 ARG A HE   2  
ATOM   716  H  HH11 . ARG A 1 14 ? 12.728  -12.482 -3.707 1.00 0.00 ? 115 ARG A HH11 2  
ATOM   717  H  HH12 . ARG A 1 14 ? 11.556  -11.411 -4.402 1.00 0.00 ? 115 ARG A HH12 2  
ATOM   718  H  HH21 . ARG A 1 14 ? 8.969   -13.038 -4.354 1.00 0.00 ? 115 ARG A HH21 2  
ATOM   719  H  HH22 . ARG A 1 14 ? 10.057  -14.283 -4.870 1.00 0.00 ? 115 ARG A HH22 2  
ATOM   720  N  N    . GLN A 1 15 ? 5.732   -11.636 -2.112 1.00 0.00 ? 116 GLN A N    2  
ATOM   721  C  CA   . GLN A 1 15 ? 4.376   -12.156 -2.063 1.00 0.00 ? 116 GLN A CA   2  
ATOM   722  C  C    . GLN A 1 15 ? 4.358   -13.528 -1.385 1.00 0.00 ? 116 GLN A C    2  
ATOM   723  O  O    . GLN A 1 15 ? 3.493   -13.803 -0.555 1.00 0.00 ? 116 GLN A O    2  
ATOM   724  C  CB   . GLN A 1 15 ? 3.764   -12.227 -3.463 1.00 0.00 ? 116 GLN A CB   2  
ATOM   725  C  CG   . GLN A 1 15 ? 4.377   -11.170 -4.384 1.00 0.00 ? 116 GLN A CG   2  
ATOM   726  C  CD   . GLN A 1 15 ? 5.446   -11.786 -5.289 1.00 0.00 ? 116 GLN A CD   2  
ATOM   727  O  OE1  . GLN A 1 15 ? 6.598   -11.385 -5.295 1.00 0.00 ? 116 GLN A OE1  2  
ATOM   728  N  NE2  . GLN A 1 15 ? 5.002   -12.780 -6.053 1.00 0.00 ? 116 GLN A NE2  2  
ATOM   729  H  H    . GLN A 1 15 ? 6.172   -11.689 -3.009 1.00 0.00 ? 116 GLN A H    2  
ATOM   730  H  HA   . GLN A 1 15 ? 3.813   -11.440 -1.463 1.00 0.00 ? 116 GLN A HA   2  
ATOM   731  H  HB2  . GLN A 1 15 ? 3.926   -13.220 -3.884 1.00 0.00 ? 116 GLN A HB2  2  
ATOM   732  H  HB3  . GLN A 1 15 ? 2.686   -12.079 -3.401 1.00 0.00 ? 116 GLN A HB3  2  
ATOM   733  H  HG2  . GLN A 1 15 ? 3.597   -10.717 -4.993 1.00 0.00 ? 116 GLN A HG2  2  
ATOM   734  H  HG3  . GLN A 1 15 ? 4.818   -10.374 -3.785 1.00 0.00 ? 116 GLN A HG3  2  
ATOM   735  H  HE21 . GLN A 1 15 ? 5.025   -13.720 -5.713 1.00 0.00 ? 116 GLN A HE21 2  
ATOM   736  H  HE22 . GLN A 1 15 ? 4.644   -12.587 -6.967 1.00 0.00 ? 116 GLN A HE22 2  
ATOM   737  N  N    . GLU A 1 16 ? 5.323   -14.353 -1.765 1.00 0.00 ? 117 GLU A N    2  
ATOM   738  C  CA   . GLU A 1 16 ? 5.428   -15.689 -1.206 1.00 0.00 ? 117 GLU A CA   2  
ATOM   739  C  C    . GLU A 1 16 ? 5.335   -15.634 0.320  1.00 0.00 ? 117 GLU A C    2  
ATOM   740  O  O    . GLU A 1 16 ? 4.696   -16.486 0.938  1.00 0.00 ? 117 GLU A O    2  
ATOM   741  C  CB   . GLU A 1 16 ? 6.724   -16.369 -1.652 1.00 0.00 ? 117 GLU A CB   2  
ATOM   742  C  CG   . GLU A 1 16 ? 6.976   -16.144 -3.144 1.00 0.00 ? 117 GLU A CG   2  
ATOM   743  C  CD   . GLU A 1 16 ? 5.659   -15.961 -3.901 1.00 0.00 ? 117 GLU A CD   2  
ATOM   744  O  OE1  . GLU A 1 16 ? 4.926   -16.966 -4.016 1.00 0.00 ? 117 GLU A OE1  2  
ATOM   745  O  OE2  . GLU A 1 16 ? 5.416   -14.818 -4.348 1.00 0.00 ? 117 GLU A OE2  2  
ATOM   746  H  H    . GLU A 1 16 ? 6.022   -14.121 -2.441 1.00 0.00 ? 117 GLU A H    2  
ATOM   747  H  HA   . GLU A 1 16 ? 4.578   -16.240 -1.609 1.00 0.00 ? 117 GLU A HA   2  
ATOM   748  H  HB2  . GLU A 1 16 ? 7.561   -15.979 -1.074 1.00 0.00 ? 117 GLU A HB2  2  
ATOM   749  H  HB3  . GLU A 1 16 ? 6.666   -17.439 -1.447 1.00 0.00 ? 117 GLU A HB3  2  
ATOM   750  H  HG2  . GLU A 1 16 ? 7.604   -15.264 -3.281 1.00 0.00 ? 117 GLU A HG2  2  
ATOM   751  H  HG3  . GLU A 1 16 ? 7.521   -16.993 -3.557 1.00 0.00 ? 117 GLU A HG3  2  
ATOM   752  N  N    . HIS A 1 17 ? 5.980   -14.624 0.885  1.00 0.00 ? 118 HIS A N    2  
ATOM   753  C  CA   . HIS A 1 17 ? 5.979   -14.447 2.328  1.00 0.00 ? 118 HIS A CA   2  
ATOM   754  C  C    . HIS A 1 17 ? 4.537   -14.436 2.841  1.00 0.00 ? 118 HIS A C    2  
ATOM   755  O  O    . HIS A 1 17 ? 4.215   -15.123 3.809  1.00 0.00 ? 118 HIS A O    2  
ATOM   756  C  CB   . HIS A 1 17 ? 6.758   -13.191 2.721  1.00 0.00 ? 118 HIS A CB   2  
ATOM   757  C  CG   . HIS A 1 17 ? 8.240   -13.275 2.444  1.00 0.00 ? 118 HIS A CG   2  
ATOM   758  N  ND1  . HIS A 1 17 ? 9.134   -12.296 2.841  1.00 0.00 ? 118 HIS A ND1  2  
ATOM   759  C  CD2  . HIS A 1 17 ? 8.975   -14.233 1.807  1.00 0.00 ? 118 HIS A CD2  2  
ATOM   760  C  CE1  . HIS A 1 17 ? 10.348  -12.657 2.454  1.00 0.00 ? 118 HIS A CE1  2  
ATOM   761  N  NE2  . HIS A 1 17 ? 10.248  -13.856 1.813  1.00 0.00 ? 118 HIS A NE2  2  
ATOM   762  H  H    . HIS A 1 17 ? 6.497   -13.936 0.375  1.00 0.00 ? 118 HIS A H    2  
ATOM   763  H  HA   . HIS A 1 17 ? 6.499   -15.308 2.749  1.00 0.00 ? 118 HIS A HA   2  
ATOM   764  H  HB2  . HIS A 1 17 ? 6.346   -12.337 2.184  1.00 0.00 ? 118 HIS A HB2  2  
ATOM   765  H  HB3  . HIS A 1 17 ? 6.607   -13.001 3.783  1.00 0.00 ? 118 HIS A HB3  2  
ATOM   766  H  HD1  . HIS A 1 17 ? 8.902   -11.458 3.335  1.00 0.00 ? 118 HIS A HD1  2  
ATOM   767  H  HD2  . HIS A 1 17 ? 8.582   -15.150 1.368  1.00 0.00 ? 118 HIS A HD2  2  
ATOM   768  H  HE1  . HIS A 1 17 ? 11.267  -12.094 2.619  1.00 0.00 ? 118 HIS A HE1  2  
ATOM   769  H  HE2  . HIS A 1 17 ? 11.014  -14.395 1.464  1.00 0.00 ? 118 HIS A HE2  2  
ATOM   770  N  N    . LEU A 1 18 ? 3.709   -13.650 2.169  1.00 0.00 ? 119 LEU A N    2  
ATOM   771  C  CA   . LEU A 1 18 ? 2.310   -13.541 2.546  1.00 0.00 ? 119 LEU A CA   2  
ATOM   772  C  C    . LEU A 1 18 ? 1.638   -14.907 2.395  1.00 0.00 ? 119 LEU A C    2  
ATOM   773  O  O    . LEU A 1 18 ? 1.179   -15.489 3.376  1.00 0.00 ? 119 LEU A O    2  
ATOM   774  C  CB   . LEU A 1 18 ? 1.627   -12.428 1.750  1.00 0.00 ? 119 LEU A CB   2  
ATOM   775  C  CG   . LEU A 1 18 ? 0.113   -12.563 1.572  1.00 0.00 ? 119 LEU A CG   2  
ATOM   776  C  CD1  . LEU A 1 18 ? -0.549  -13.060 2.858  1.00 0.00 ? 119 LEU A CD1  2  
ATOM   777  C  CD2  . LEU A 1 18 ? -0.501  -11.250 1.082  1.00 0.00 ? 119 LEU A CD2  2  
ATOM   778  H  H    . LEU A 1 18 ? 3.980   -13.095 1.383  1.00 0.00 ? 119 LEU A H    2  
ATOM   779  H  HA   . LEU A 1 18 ? 2.276   -13.254 3.596  1.00 0.00 ? 119 LEU A HA   2  
ATOM   780  H  HB2  . LEU A 1 18 ? 1.830   -11.477 2.244  1.00 0.00 ? 119 LEU A HB2  2  
ATOM   781  H  HB3  . LEU A 1 18 ? 2.086   -12.378 0.763  1.00 0.00 ? 119 LEU A HB3  2  
ATOM   782  H  HG   . LEU A 1 18 ? -0.074  -13.313 0.802  1.00 0.00 ? 119 LEU A HG   2  
ATOM   783  H  HD11 . LEU A 1 18 ? -0.136  -12.521 3.710  1.00 0.00 ? 119 LEU A HD11 2  
ATOM   784  H  HD12 . LEU A 1 18 ? -1.624  -12.887 2.805  1.00 0.00 ? 119 LEU A HD12 2  
ATOM   785  H  HD13 . LEU A 1 18 ? -0.359  -14.127 2.976  1.00 0.00 ? 119 LEU A HD13 2  
ATOM   786  H  HD21 . LEU A 1 18 ? -0.977  -11.410 0.114  1.00 0.00 ? 119 LEU A HD21 2  
ATOM   787  H  HD22 . LEU A 1 18 ? -1.244  -10.907 1.800  1.00 0.00 ? 119 LEU A HD22 2  
ATOM   788  H  HD23 . LEU A 1 18 ? 0.282   -10.498 0.981  1.00 0.00 ? 119 LEU A HD23 2  
ATOM   789  N  N    . LYS A 1 19 ? 1.602   -15.379 1.157  1.00 0.00 ? 120 LYS A N    2  
ATOM   790  C  CA   . LYS A 1 19 ? 0.993   -16.665 0.865  1.00 0.00 ? 120 LYS A CA   2  
ATOM   791  C  C    . LYS A 1 19 ? 1.463   -17.694 1.895  1.00 0.00 ? 120 LYS A C    2  
ATOM   792  O  O    . LYS A 1 19 ? 0.653   -18.262 2.625  1.00 0.00 ? 120 LYS A O    2  
ATOM   793  C  CB   . LYS A 1 19 ? 1.273   -17.074 -0.583 1.00 0.00 ? 120 LYS A CB   2  
ATOM   794  C  CG   . LYS A 1 19 ? 0.268   -18.124 -1.060 1.00 0.00 ? 120 LYS A CG   2  
ATOM   795  C  CD   . LYS A 1 19 ? -0.162  -19.035 0.092  1.00 0.00 ? 120 LYS A CD   2  
ATOM   796  C  CE   . LYS A 1 19 ? -1.128  -20.118 -0.395 1.00 0.00 ? 120 LYS A CE   2  
ATOM   797  N  NZ   . LYS A 1 19 ? -0.711  -21.446 0.105  1.00 0.00 ? 120 LYS A NZ   2  
ATOM   798  H  H    . LYS A 1 19 ? 1.977   -14.899 0.364  1.00 0.00 ? 120 LYS A H    2  
ATOM   799  H  HA   . LYS A 1 19 ? -0.086  -16.546 0.963  1.00 0.00 ? 120 LYS A HA   2  
ATOM   800  H  HB2  . LYS A 1 19 ? 1.221   -16.197 -1.229 1.00 0.00 ? 120 LYS A HB2  2  
ATOM   801  H  HB3  . LYS A 1 19 ? 2.285   -17.469 -0.665 1.00 0.00 ? 120 LYS A HB3  2  
ATOM   802  H  HG2  . LYS A 1 19 ? -0.606  -17.630 -1.484 1.00 0.00 ? 120 LYS A HG2  2  
ATOM   803  H  HG3  . LYS A 1 19 ? 0.712   -18.723 -1.856 1.00 0.00 ? 120 LYS A HG3  2  
ATOM   804  H  HD2  . LYS A 1 19 ? 0.716   -19.500 0.540  1.00 0.00 ? 120 LYS A HD2  2  
ATOM   805  H  HD3  . LYS A 1 19 ? -0.640  -18.440 0.871  1.00 0.00 ? 120 LYS A HD3  2  
ATOM   806  H  HE2  . LYS A 1 19 ? -2.137  -19.893 -0.053 1.00 0.00 ? 120 LYS A HE2  2  
ATOM   807  H  HE3  . LYS A 1 19 ? -1.155  -20.125 -1.486 1.00 0.00 ? 120 LYS A HE3  2  
ATOM   808  H  HZ1  . LYS A 1 19 ? 0.251   -21.601 -0.119 1.00 0.00 ? 120 LYS A HZ1  2  
ATOM   809  H  HZ2  . LYS A 1 19 ? -0.833  -21.482 1.097  1.00 0.00 ? 120 LYS A HZ2  2  
ATOM   810  H  HZ3  . LYS A 1 19 ? -1.272  -22.155 -0.325 1.00 0.00 ? 120 LYS A HZ3  2  
ATOM   811  N  N    . ARG A 1 20 ? 2.772   -17.901 1.922  1.00 0.00 ? 121 ARG A N    2  
ATOM   812  C  CA   . ARG A 1 20 ? 3.360   -18.851 2.851  1.00 0.00 ? 121 ARG A CA   2  
ATOM   813  C  C    . ARG A 1 20 ? 2.926   -18.531 4.283  1.00 0.00 ? 121 ARG A C    2  
ATOM   814  O  O    . ARG A 1 20 ? 2.711   -19.437 5.086  1.00 0.00 ? 121 ARG A O    2  
ATOM   815  C  CB   . ARG A 1 20 ? 4.888   -18.825 2.771  1.00 0.00 ? 121 ARG A CB   2  
ATOM   816  C  CG   . ARG A 1 20 ? 5.491   -20.092 3.381  1.00 0.00 ? 121 ARG A CG   2  
ATOM   817  C  CD   . ARG A 1 20 ? 6.031   -19.820 4.787  1.00 0.00 ? 121 ARG A CD   2  
ATOM   818  N  NE   . ARG A 1 20 ? 6.367   -21.097 5.456  1.00 0.00 ? 121 ARG A NE   2  
ATOM   819  C  CZ   . ARG A 1 20 ? 7.065   -21.186 6.596  1.00 0.00 ? 121 ARG A CZ   2  
ATOM   820  N  NH1  . ARG A 1 20 ? 8.094   -20.357 6.819  1.00 0.00 ? 121 ARG A NH1  2  
ATOM   821  N  NH2  . ARG A 1 20 ? 6.734   -22.105 7.514  1.00 0.00 ? 121 ARG A NH2  2  
ATOM   822  H  H    . ARG A 1 20 ? 3.424   -17.434 1.325  1.00 0.00 ? 121 ARG A H    2  
ATOM   823  H  HA   . ARG A 1 20 ? 2.981   -19.822 2.533  1.00 0.00 ? 121 ARG A HA   2  
ATOM   824  H  HB2  . ARG A 1 20 ? 5.200   -18.734 1.730  1.00 0.00 ? 121 ARG A HB2  2  
ATOM   825  H  HB3  . ARG A 1 20 ? 5.268   -17.949 3.295  1.00 0.00 ? 121 ARG A HB3  2  
ATOM   826  H  HG2  . ARG A 1 20 ? 4.733   -20.874 3.425  1.00 0.00 ? 121 ARG A HG2  2  
ATOM   827  H  HG3  . ARG A 1 20 ? 6.294   -20.461 2.744  1.00 0.00 ? 121 ARG A HG3  2  
ATOM   828  H  HD2  . ARG A 1 20 ? 6.916   -19.187 4.728  1.00 0.00 ? 121 ARG A HD2  2  
ATOM   829  H  HD3  . ARG A 1 20 ? 5.289   -19.277 5.372  1.00 0.00 ? 121 ARG A HD3  2  
ATOM   830  H  HE   . ARG A 1 20 ? 6.054   -21.945 5.031  1.00 0.00 ? 121 ARG A HE   2  
ATOM   831  H  HH11 . ARG A 1 20 ? 8.079   -19.430 6.444  1.00 0.00 ? 121 ARG A HH11 2  
ATOM   832  H  HH12 . ARG A 1 20 ? 8.877   -20.665 7.360  1.00 0.00 ? 121 ARG A HH12 2  
ATOM   833  H  HH21 . ARG A 1 20 ? 6.244   -22.932 7.239  1.00 0.00 ? 121 ARG A HH21 2  
ATOM   834  H  HH22 . ARG A 1 20 ? 6.977   -21.963 8.473  1.00 0.00 ? 121 ARG A HH22 2  
ATOM   835  N  N    . HIS A 1 21 ? 2.810   -17.240 4.558  1.00 0.00 ? 122 HIS A N    2  
ATOM   836  C  CA   . HIS A 1 21 ? 2.405   -16.790 5.879  1.00 0.00 ? 122 HIS A CA   2  
ATOM   837  C  C    . HIS A 1 21 ? 0.973   -17.246 6.159  1.00 0.00 ? 122 HIS A C    2  
ATOM   838  O  O    . HIS A 1 21 ? 0.669   -17.713 7.256  1.00 0.00 ? 122 HIS A O    2  
ATOM   839  C  CB   . HIS A 1 21 ? 2.584   -15.277 6.016  1.00 0.00 ? 122 HIS A CB   2  
ATOM   840  C  CG   . HIS A 1 21 ? 1.695   -14.645 7.060  1.00 0.00 ? 122 HIS A CG   2  
ATOM   841  N  ND1  . HIS A 1 21 ? 1.998   -14.656 8.410  1.00 0.00 ? 122 HIS A ND1  2  
ATOM   842  C  CD2  . HIS A 1 21 ? 0.508   -13.983 6.937  1.00 0.00 ? 122 HIS A CD2  2  
ATOM   843  C  CE1  . HIS A 1 21 ? 1.031   -14.028 9.062  1.00 0.00 ? 122 HIS A CE1  2  
ATOM   844  N  NE2  . HIS A 1 21 ? 0.109   -13.612 8.148  1.00 0.00 ? 122 HIS A NE2  2  
ATOM   845  H  H    . HIS A 1 21 ? 2.988   -16.510 3.899  1.00 0.00 ? 122 HIS A H    2  
ATOM   846  H  HA   . HIS A 1 21 ? 3.077   -17.270 6.592  1.00 0.00 ? 122 HIS A HA   2  
ATOM   847  H  HB2  . HIS A 1 21 ? 3.624   -15.065 6.263  1.00 0.00 ? 122 HIS A HB2  2  
ATOM   848  H  HB3  . HIS A 1 21 ? 2.384   -14.810 5.052  1.00 0.00 ? 122 HIS A HB3  2  
ATOM   849  H  HD1  . HIS A 1 21 ? 2.811   -15.069 8.823  1.00 0.00 ? 122 HIS A HD1  2  
ATOM   850  H  HD2  . HIS A 1 21 ? -0.022  -13.793 6.005  1.00 0.00 ? 122 HIS A HD2  2  
ATOM   851  H  HE1  . HIS A 1 21 ? 0.982   -13.870 10.139 1.00 0.00 ? 122 HIS A HE1  2  
ATOM   852  N  N    . TYR A 1 22 ? 0.129   -17.095 5.149  1.00 0.00 ? 123 TYR A N    2  
ATOM   853  C  CA   . TYR A 1 22 ? -1.265  -17.484 5.273  1.00 0.00 ? 123 TYR A CA   2  
ATOM   854  C  C    . TYR A 1 22 ? -1.389  -18.939 5.730  1.00 0.00 ? 123 TYR A C    2  
ATOM   855  O  O    . TYR A 1 22 ? -2.325  -19.292 6.447  1.00 0.00 ? 123 TYR A O    2  
ATOM   856  C  CB   . TYR A 1 22 ? -1.867  -17.349 3.872  1.00 0.00 ? 123 TYR A CB   2  
ATOM   857  C  CG   . TYR A 1 22 ? -3.005  -16.331 3.779  1.00 0.00 ? 123 TYR A CG   2  
ATOM   858  C  CD1  . TYR A 1 22 ? -4.200  -16.571 4.429  1.00 0.00 ? 123 TYR A CD1  2  
ATOM   859  C  CD2  . TYR A 1 22 ? -2.838  -15.174 3.048  1.00 0.00 ? 123 TYR A CD2  2  
ATOM   860  C  CE1  . TYR A 1 22 ? -5.271  -15.612 4.341  1.00 0.00 ? 123 TYR A CE1  2  
ATOM   861  C  CE2  . TYR A 1 22 ? -3.908  -14.215 2.961  1.00 0.00 ? 123 TYR A CE2  2  
ATOM   862  C  CZ   . TYR A 1 22 ? -5.073  -14.482 3.612  1.00 0.00 ? 123 TYR A CZ   2  
ATOM   863  O  OH   . TYR A 1 22 ? -6.084  -13.576 3.529  1.00 0.00 ? 123 TYR A OH   2  
ATOM   864  H  H    . TYR A 1 22 ? 0.384   -16.714 4.260  1.00 0.00 ? 123 TYR A H    2  
ATOM   865  H  HA   . TYR A 1 22 ? -1.731  -16.837 6.016  1.00 0.00 ? 123 TYR A HA   2  
ATOM   866  H  HB2  . TYR A 1 22 ? -1.079  -17.063 3.176  1.00 0.00 ? 123 TYR A HB2  2  
ATOM   867  H  HB3  . TYR A 1 22 ? -2.238  -18.323 3.551  1.00 0.00 ? 123 TYR A HB3  2  
ATOM   868  H  HD1  . TYR A 1 22 ? -4.332  -17.485 5.006  1.00 0.00 ? 123 TYR A HD1  2  
ATOM   869  H  HD2  . TYR A 1 22 ? -1.894  -14.984 2.536  1.00 0.00 ? 123 TYR A HD2  2  
ATOM   870  H  HE1  . TYR A 1 22 ? -6.219  -15.788 4.848  1.00 0.00 ? 123 TYR A HE1  2  
ATOM   871  H  HE2  . TYR A 1 22 ? -3.790  -13.296 2.386  1.00 0.00 ? 123 TYR A HE2  2  
ATOM   872  H  HH   . TYR A 1 22 ? -6.042  -13.095 2.653  1.00 0.00 ? 123 TYR A HH   2  
ATOM   873  N  N    . ARG A 1 23 ? -0.431  -19.746 5.297  1.00 0.00 ? 124 ARG A N    2  
ATOM   874  C  CA   . ARG A 1 23 ? -0.421  -21.155 5.652  1.00 0.00 ? 124 ARG A CA   2  
ATOM   875  C  C    . ARG A 1 23 ? -0.932  -21.344 7.083  1.00 0.00 ? 124 ARG A C    2  
ATOM   876  O  O    . ARG A 1 23 ? -1.485  -22.392 7.414  1.00 0.00 ? 124 ARG A O    2  
ATOM   877  C  CB   . ARG A 1 23 ? 0.987   -21.742 5.539  1.00 0.00 ? 124 ARG A CB   2  
ATOM   878  C  CG   . ARG A 1 23 ? 1.698   -21.727 6.893  1.00 0.00 ? 124 ARG A CG   2  
ATOM   879  C  CD   . ARG A 1 23 ? 1.915   -20.293 7.383  1.00 0.00 ? 124 ARG A CD   2  
ATOM   880  N  NE   . ARG A 1 23 ? 3.363   -19.990 7.434  1.00 0.00 ? 124 ARG A NE   2  
ATOM   881  C  CZ   . ARG A 1 23 ? 4.043   -19.763 8.565  1.00 0.00 ? 124 ARG A CZ   2  
ATOM   882  N  NH1  . ARG A 1 23 ? 4.129   -18.521 9.060  1.00 0.00 ? 124 ARG A NH1  2  
ATOM   883  N  NH2  . ARG A 1 23 ? 4.639   -20.781 9.203  1.00 0.00 ? 124 ARG A NH2  2  
ATOM   884  H  H    . ARG A 1 23 ? 0.326   -19.452 4.714  1.00 0.00 ? 124 ARG A H    2  
ATOM   885  H  HA   . ARG A 1 23 ? -1.088  -21.628 4.932  1.00 0.00 ? 124 ARG A HA   2  
ATOM   886  H  HB2  . ARG A 1 23 ? 0.930   -22.764 5.165  1.00 0.00 ? 124 ARG A HB2  2  
ATOM   887  H  HB3  . ARG A 1 23 ? 1.566   -21.169 4.814  1.00 0.00 ? 124 ARG A HB3  2  
ATOM   888  H  HG2  . ARG A 1 23 ? 1.108   -22.278 7.624  1.00 0.00 ? 124 ARG A HG2  2  
ATOM   889  H  HG3  . ARG A 1 23 ? 2.659   -22.235 6.810  1.00 0.00 ? 124 ARG A HG3  2  
ATOM   890  H  HD2  . ARG A 1 23 ? 1.411   -19.593 6.717  1.00 0.00 ? 124 ARG A HD2  2  
ATOM   891  H  HD3  . ARG A 1 23 ? 1.473   -20.167 8.372  1.00 0.00 ? 124 ARG A HD3  2  
ATOM   892  H  HE   . ARG A 1 23 ? 3.864   -19.950 6.569  1.00 0.00 ? 124 ARG A HE   2  
ATOM   893  H  HH11 . ARG A 1 23 ? 4.368   -17.759 8.458  1.00 0.00 ? 124 ARG A HH11 2  
ATOM   894  H  HH12 . ARG A 1 23 ? 3.953   -18.355 10.031 1.00 0.00 ? 124 ARG A HH12 2  
ATOM   895  H  HH21 . ARG A 1 23 ? 4.680   -21.683 8.776  1.00 0.00 ? 124 ARG A HH21 2  
ATOM   896  H  HH22 . ARG A 1 23 ? 5.043   -20.637 10.106 1.00 0.00 ? 124 ARG A HH22 2  
ATOM   897  N  N    . SER A 1 24 ? -0.727  -20.315 7.891  1.00 0.00 ? 125 SER A N    2  
ATOM   898  C  CA   . SER A 1 24 ? -1.159  -20.356 9.278  1.00 0.00 ? 125 SER A CA   2  
ATOM   899  C  C    . SER A 1 24 ? -2.659  -20.063 9.367  1.00 0.00 ? 125 SER A C    2  
ATOM   900  O  O    . SER A 1 24 ? -3.414  -20.845 9.943  1.00 0.00 ? 125 SER A O    2  
ATOM   901  C  CB   . SER A 1 24 ? -0.373  -19.358 10.130 1.00 0.00 ? 125 SER A CB   2  
ATOM   902  O  OG   . SER A 1 24 ? -0.181  -18.117 9.457  1.00 0.00 ? 125 SER A OG   2  
ATOM   903  H  H    . SER A 1 24 ? -0.276  -19.467 7.614  1.00 0.00 ? 125 SER A H    2  
ATOM   904  H  HA   . SER A 1 24 ? -0.946  -21.369 9.618  1.00 0.00 ? 125 SER A HA   2  
ATOM   905  H  HB2  . SER A 1 24 ? -0.902  -19.185 11.066 1.00 0.00 ? 125 SER A HB2  2  
ATOM   906  H  HB3  . SER A 1 24 ? 0.597   -19.785 10.385 1.00 0.00 ? 125 SER A HB3  2  
ATOM   907  H  HG   . SER A 1 24 ? 0.425   -17.527 9.992  1.00 0.00 ? 125 SER A HG   2  
ATOM   908  N  N    . HIS A 1 25 ? -3.045  -18.936 8.788  1.00 0.00 ? 126 HIS A N    2  
ATOM   909  C  CA   . HIS A 1 25 ? -4.440  -18.531 8.795  1.00 0.00 ? 126 HIS A CA   2  
ATOM   910  C  C    . HIS A 1 25 ? -5.306  -19.664 8.241  1.00 0.00 ? 126 HIS A C    2  
ATOM   911  O  O    . HIS A 1 25 ? -6.517  -19.688 8.457  1.00 0.00 ? 126 HIS A O    2  
ATOM   912  C  CB   . HIS A 1 25 ? -4.628  -17.216 8.037  1.00 0.00 ? 126 HIS A CB   2  
ATOM   913  C  CG   . HIS A 1 25 ? -3.830  -16.064 8.598  1.00 0.00 ? 126 HIS A CG   2  
ATOM   914  N  ND1  . HIS A 1 25 ? -3.631  -15.880 9.956  1.00 0.00 ? 126 HIS A ND1  2  
ATOM   915  C  CD2  . HIS A 1 25 ? -3.182  -15.039 7.973  1.00 0.00 ? 126 HIS A CD2  2  
ATOM   916  C  CE1  . HIS A 1 25 ? -2.898  -14.790 10.128 1.00 0.00 ? 126 HIS A CE1  2  
ATOM   917  N  NE2  . HIS A 1 25 ? -2.621  -14.271 8.898  1.00 0.00 ? 126 HIS A NE2  2  
ATOM   918  H  H    . HIS A 1 25 ? -2.424  -18.306 8.322  1.00 0.00 ? 126 HIS A H    2  
ATOM   919  H  HA   . HIS A 1 25 ? -4.710  -18.355 9.837  1.00 0.00 ? 126 HIS A HA   2  
ATOM   920  H  HB2  . HIS A 1 25 ? -4.346  -17.366 6.995  1.00 0.00 ? 126 HIS A HB2  2  
ATOM   921  H  HB3  . HIS A 1 25 ? -5.686  -16.951 8.046  1.00 0.00 ? 126 HIS A HB3  2  
ATOM   922  H  HD1  . HIS A 1 25 ? -3.983  -16.470 10.683 1.00 0.00 ? 126 HIS A HD1  2  
ATOM   923  H  HD2  . HIS A 1 25 ? -3.135  -14.878 6.896  1.00 0.00 ? 126 HIS A HD2  2  
ATOM   924  H  HE1  . HIS A 1 25 ? -2.572  -14.382 11.085 1.00 0.00 ? 126 HIS A HE1  2  
ATOM   925  N  N    . THR A 1 26 ? -4.652  -20.576 7.537  1.00 0.00 ? 127 THR A N    2  
ATOM   926  C  CA   . THR A 1 26 ? -5.347  -21.709 6.951  1.00 0.00 ? 127 THR A CA   2  
ATOM   927  C  C    . THR A 1 26 ? -4.421  -22.925 6.882  1.00 0.00 ? 127 THR A C    2  
ATOM   928  O  O    . THR A 1 26 ? -3.644  -23.171 7.804  1.00 0.00 ? 127 THR A O    2  
ATOM   929  C  CB   . THR A 1 26 ? -5.886  -21.278 5.585  1.00 0.00 ? 127 THR A CB   2  
ATOM   930  O  OG1  . THR A 1 26 ? -6.777  -22.327 5.216  1.00 0.00 ? 127 THR A OG1  2  
ATOM   931  C  CG2  . THR A 1 26 ? -4.810  -21.303 4.496  1.00 0.00 ? 127 THR A CG2  2  
ATOM   932  H  H    . THR A 1 26 ? -3.667  -20.550 7.367  1.00 0.00 ? 127 THR A H    2  
ATOM   933  H  HA   . THR A 1 26 ? -6.178  -21.977 7.602  1.00 0.00 ? 127 THR A HA   2  
ATOM   934  H  HB   . THR A 1 26 ? -6.356  -20.296 5.644  1.00 0.00 ? 127 THR A HB   2  
ATOM   935  H  HG1  . THR A 1 26 ? -7.109  -22.182 4.284  1.00 0.00 ? 127 THR A HG1  2  
ATOM   936  H  HG21 . THR A 1 26 ? -4.691  -20.303 4.080  1.00 0.00 ? 127 THR A HG21 2  
ATOM   937  H  HG22 . THR A 1 26 ? -3.864  -21.633 4.928  1.00 0.00 ? 127 THR A HG22 2  
ATOM   938  H  HG23 . THR A 1 26 ? -5.109  -21.993 3.707  1.00 0.00 ? 127 THR A HG23 2  
ATOM   939  N  N    . ASN A 1 27 ? -4.536  -23.655 5.783  1.00 0.00 ? 128 ASN A N    2  
ATOM   940  C  CA   . ASN A 1 27 ? -3.719  -24.840 5.581  1.00 0.00 ? 128 ASN A CA   2  
ATOM   941  C  C    . ASN A 1 27 ? -3.302  -24.923 4.112  1.00 0.00 ? 128 ASN A C    2  
ATOM   942  O  O    . ASN A 1 27 ? -3.952  -24.342 3.245  1.00 0.00 ? 128 ASN A O    2  
ATOM   943  C  CB   . ASN A 1 27 ? -4.498  -26.111 5.926  1.00 0.00 ? 128 ASN A CB   2  
ATOM   944  C  CG   . ASN A 1 27 ? -5.589  -25.822 6.958  1.00 0.00 ? 128 ASN A CG   2  
ATOM   945  O  OD1  . ASN A 1 27 ? -5.347  -25.270 8.018  1.00 0.00 ? 128 ASN A OD1  2  
ATOM   946  N  ND2  . ASN A 1 27 ? -6.802  -26.226 6.590  1.00 0.00 ? 128 ASN A ND2  2  
ATOM   947  H  H    . ASN A 1 27 ? -5.171  -23.448 5.038  1.00 0.00 ? 128 ASN A H    2  
ATOM   948  H  HA   . ASN A 1 27 ? -2.867  -24.717 6.250  1.00 0.00 ? 128 ASN A HA   2  
ATOM   949  H  HB2  . ASN A 1 27 ? -4.947  -26.522 5.022  1.00 0.00 ? 128 ASN A HB2  2  
ATOM   950  H  HB3  . ASN A 1 27 ? -3.815  -26.866 6.315  1.00 0.00 ? 128 ASN A HB3  2  
ATOM   951  H  HD21 . ASN A 1 27 ? -6.916  -26.775 5.762  1.00 0.00 ? 128 ASN A HD21 2  
ATOM   952  H  HD22 . ASN A 1 27 ? -7.599  -25.981 7.141  1.00 0.00 ? 128 ASN A HD22 2  
ATOM   953  N  N    . GLU A 1 28 ? -2.221  -25.653 3.877  1.00 0.00 ? 129 GLU A N    2  
ATOM   954  C  CA   . GLU A 1 28 ? -1.710  -25.821 2.527  1.00 0.00 ? 129 GLU A CA   2  
ATOM   955  C  C    . GLU A 1 28 ? -2.807  -26.359 1.607  1.00 0.00 ? 129 GLU A C    2  
ATOM   956  O  O    . GLU A 1 28 ? -3.553  -27.261 1.988  1.00 0.00 ? 129 GLU A O    2  
ATOM   957  C  CB   . GLU A 1 28 ? -0.485  -26.736 2.515  1.00 0.00 ? 129 GLU A CB   2  
ATOM   958  C  CG   . GLU A 1 28 ? 0.793   -25.946 2.804  1.00 0.00 ? 129 GLU A CG   2  
ATOM   959  C  CD   . GLU A 1 28 ? 0.533   -24.837 3.824  1.00 0.00 ? 129 GLU A CD   2  
ATOM   960  O  OE1  . GLU A 1 28 ? 0.174   -23.727 3.376  1.00 0.00 ? 129 GLU A OE1  2  
ATOM   961  O  OE2  . GLU A 1 28 ? 0.701   -25.124 5.029  1.00 0.00 ? 129 GLU A OE2  2  
ATOM   962  H  H    . GLU A 1 28 ? -1.698  -26.122 4.588  1.00 0.00 ? 129 GLU A H    2  
ATOM   963  H  HA   . GLU A 1 28 ? -1.413  -24.823 2.204  1.00 0.00 ? 129 GLU A HA   2  
ATOM   964  H  HB2  . GLU A 1 28 ? -0.607  -27.523 3.259  1.00 0.00 ? 129 GLU A HB2  2  
ATOM   965  H  HB3  . GLU A 1 28 ? -0.402  -27.226 1.545  1.00 0.00 ? 129 GLU A HB3  2  
ATOM   966  H  HG2  . GLU A 1 28 ? 1.564   -26.619 3.180  1.00 0.00 ? 129 GLU A HG2  2  
ATOM   967  H  HG3  . GLU A 1 28 ? 1.174   -25.513 1.879  1.00 0.00 ? 129 GLU A HG3  2  
ATOM   968  N  N    . LYS A 1 29 ? -2.871  -25.785 0.416  1.00 0.00 ? 130 LYS A N    2  
ATOM   969  C  CA   . LYS A 1 29 ? -3.865  -26.196 -0.561 1.00 0.00 ? 130 LYS A CA   2  
ATOM   970  C  C    . LYS A 1 29 ? -3.411  -25.765 -1.958 1.00 0.00 ? 130 LYS A C    2  
ATOM   971  O  O    . LYS A 1 29 ? -3.150  -24.586 -2.193 1.00 0.00 ? 130 LYS A O    2  
ATOM   972  C  CB   . LYS A 1 29 ? -5.248  -25.668 -0.174 1.00 0.00 ? 130 LYS A CB   2  
ATOM   973  C  CG   . LYS A 1 29 ? -5.216  -24.152 0.038  1.00 0.00 ? 130 LYS A CG   2  
ATOM   974  C  CD   . LYS A 1 29 ? -6.190  -23.733 1.141  1.00 0.00 ? 130 LYS A CD   2  
ATOM   975  C  CE   . LYS A 1 29 ? -7.256  -22.780 0.598  1.00 0.00 ? 130 LYS A CE   2  
ATOM   976  N  NZ   . LYS A 1 29 ? -6.631  -21.536 0.095  1.00 0.00 ? 130 LYS A NZ   2  
ATOM   977  H  H    . LYS A 1 29 ? -2.261  -25.052 0.115  1.00 0.00 ? 130 LYS A H    2  
ATOM   978  H  HA   . LYS A 1 29 ? -3.917  -27.285 -0.536 1.00 0.00 ? 130 LYS A HA   2  
ATOM   979  H  HB2  . LYS A 1 29 ? -5.967  -25.914 -0.955 1.00 0.00 ? 130 LYS A HB2  2  
ATOM   980  H  HB3  . LYS A 1 29 ? -5.587  -26.159 0.738  1.00 0.00 ? 130 LYS A HB3  2  
ATOM   981  H  HG2  . LYS A 1 29 ? -4.206  -23.840 0.301  1.00 0.00 ? 130 LYS A HG2  2  
ATOM   982  H  HG3  . LYS A 1 29 ? -5.474  -23.647 -0.892 1.00 0.00 ? 130 LYS A HG3  2  
ATOM   983  H  HD2  . LYS A 1 29 ? -6.669  -24.617 1.564  1.00 0.00 ? 130 LYS A HD2  2  
ATOM   984  H  HD3  . LYS A 1 29 ? -5.642  -23.250 1.949  1.00 0.00 ? 130 LYS A HD3  2  
ATOM   985  H  HE2  . LYS A 1 29 ? -7.811  -23.265 -0.205 1.00 0.00 ? 130 LYS A HE2  2  
ATOM   986  H  HE3  . LYS A 1 29 ? -7.974  -22.542 1.382  1.00 0.00 ? 130 LYS A HE3  2  
ATOM   987  H  HZ1  . LYS A 1 29 ? -6.111  -21.735 -0.736 1.00 0.00 ? 130 LYS A HZ1  2  
ATOM   988  H  HZ2  . LYS A 1 29 ? -7.343  -20.865 -0.111 1.00 0.00 ? 130 LYS A HZ2  2  
ATOM   989  H  HZ3  . LYS A 1 29 ? -6.016  -21.167 0.792  1.00 0.00 ? 130 LYS A HZ3  2  
HETATM 990  ZN ZN   . ZN  B 2 .  ? -1.571  -12.629 8.546  1.00 0.00 ? 1   ZN  A ZN   2  
ATOM   991  N  N    . ARG A 1 1  ? 1.819   0.327   -1.322 1.00 0.00 ? 102 ARG A N    3  
ATOM   992  C  CA   . ARG A 1 1  ? 1.162   -0.615  -2.210 1.00 0.00 ? 102 ARG A CA   3  
ATOM   993  C  C    . ARG A 1 1  ? 1.860   -1.976  -2.151 1.00 0.00 ? 102 ARG A C    3  
ATOM   994  O  O    . ARG A 1 1  ? 2.055   -2.623  -3.179 1.00 0.00 ? 102 ARG A O    3  
ATOM   995  C  CB   . ARG A 1 1  ? 1.168   -0.109  -3.654 1.00 0.00 ? 102 ARG A CB   3  
ATOM   996  C  CG   . ARG A 1 1  ? 2.595   -0.040  -4.204 1.00 0.00 ? 102 ARG A CG   3  
ATOM   997  C  CD   . ARG A 1 1  ? 2.948   1.385   -4.632 1.00 0.00 ? 102 ARG A CD   3  
ATOM   998  N  NE   . ARG A 1 1  ? 1.833   1.972   -5.409 1.00 0.00 ? 102 ARG A NE   3  
ATOM   999  C  CZ   . ARG A 1 1  ? 1.426   1.515   -6.601 1.00 0.00 ? 102 ARG A CZ   3  
ATOM   1000 N  NH1  . ARG A 1 1  ? 1.330   0.195   -6.815 1.00 0.00 ? 102 ARG A NH1  3  
ATOM   1001 N  NH2  . ARG A 1 1  ? 1.115   2.376   -7.579 1.00 0.00 ? 102 ARG A NH2  3  
ATOM   1002 H  H    . ARG A 1 1  ? 2.384   1.014   -1.778 1.00 0.00 ? 102 ARG A H    3  
ATOM   1003 H  HA   . ARG A 1 1  ? 0.139   -0.683  -1.838 1.00 0.00 ? 102 ARG A HA   3  
ATOM   1004 H  HB2  . ARG A 1 1  ? 0.565   -0.770  -4.277 1.00 0.00 ? 102 ARG A HB2  3  
ATOM   1005 H  HB3  . ARG A 1 1  ? 0.709   0.879   -3.698 1.00 0.00 ? 102 ARG A HB3  3  
ATOM   1006 H  HG2  . ARG A 1 1  ? 3.298   -0.381  -3.444 1.00 0.00 ? 102 ARG A HG2  3  
ATOM   1007 H  HG3  . ARG A 1 1  ? 2.693   -0.715  -5.054 1.00 0.00 ? 102 ARG A HG3  3  
ATOM   1008 H  HD2  . ARG A 1 1  ? 3.152   1.999   -3.754 1.00 0.00 ? 102 ARG A HD2  3  
ATOM   1009 H  HD3  . ARG A 1 1  ? 3.857   1.378   -5.234 1.00 0.00 ? 102 ARG A HD3  3  
ATOM   1010 H  HE   . ARG A 1 1  ? 1.354   2.759   -5.021 1.00 0.00 ? 102 ARG A HE   3  
ATOM   1011 H  HH11 . ARG A 1 1  ? 0.761   -0.368  -6.217 1.00 0.00 ? 102 ARG A HH11 3  
ATOM   1012 H  HH12 . ARG A 1 1  ? 1.828   -0.226  -7.573 1.00 0.00 ? 102 ARG A HH12 3  
ATOM   1013 H  HH21 . ARG A 1 1  ? 1.069   3.357   -7.386 1.00 0.00 ? 102 ARG A HH21 3  
ATOM   1014 H  HH22 . ARG A 1 1  ? 0.927   2.039   -8.502 1.00 0.00 ? 102 ARG A HH22 3  
ATOM   1015 N  N    . SER A 1 2  ? 2.219   -2.369  -0.938 1.00 0.00 ? 103 SER A N    3  
ATOM   1016 C  CA   . SER A 1 2  ? 2.891   -3.641  -0.732 1.00 0.00 ? 103 SER A CA   3  
ATOM   1017 C  C    . SER A 1 2  ? 1.952   -4.621  -0.026 1.00 0.00 ? 103 SER A C    3  
ATOM   1018 O  O    . SER A 1 2  ? 1.329   -4.276  0.977  1.00 0.00 ? 103 SER A O    3  
ATOM   1019 C  CB   . SER A 1 2  ? 4.175   -3.459  0.080  1.00 0.00 ? 103 SER A CB   3  
ATOM   1020 O  OG   . SER A 1 2  ? 5.309   -3.247  -0.756 1.00 0.00 ? 103 SER A OG   3  
ATOM   1021 H  H    . SER A 1 2  ? 2.056   -1.837  -0.107 1.00 0.00 ? 103 SER A H    3  
ATOM   1022 H  HA   . SER A 1 2  ? 3.141   -4.000  -1.730 1.00 0.00 ? 103 SER A HA   3  
ATOM   1023 H  HB2  . SER A 1 2  ? 4.061   -2.612  0.756  1.00 0.00 ? 103 SER A HB2  3  
ATOM   1024 H  HB3  . SER A 1 2  ? 4.341   -4.341  0.698  1.00 0.00 ? 103 SER A HB3  3  
ATOM   1025 H  HG   . SER A 1 2  ? 5.443   -4.034  -1.358 1.00 0.00 ? 103 SER A HG   3  
ATOM   1026 N  N    . PHE A 1 3  ? 1.880   -5.823  -0.579 1.00 0.00 ? 104 PHE A N    3  
ATOM   1027 C  CA   . PHE A 1 3  ? 1.027   -6.855  -0.015 1.00 0.00 ? 104 PHE A CA   3  
ATOM   1028 C  C    . PHE A 1 3  ? 1.000   -6.771  1.513  1.00 0.00 ? 104 PHE A C    3  
ATOM   1029 O  O    . PHE A 1 3  ? 2.045   -6.661  2.150  1.00 0.00 ? 104 PHE A O    3  
ATOM   1030 C  CB   . PHE A 1 3  ? 1.623   -8.203  -0.428 1.00 0.00 ? 104 PHE A CB   3  
ATOM   1031 C  CG   . PHE A 1 3  ? 2.121   -8.246  -1.874 1.00 0.00 ? 104 PHE A CG   3  
ATOM   1032 C  CD1  . PHE A 1 3  ? 1.239   -8.434  -2.892 1.00 0.00 ? 104 PHE A CD1  3  
ATOM   1033 C  CD2  . PHE A 1 3  ? 3.446   -8.095  -2.142 1.00 0.00 ? 104 PHE A CD2  3  
ATOM   1034 C  CE1  . PHE A 1 3  ? 1.701   -8.473  -4.234 1.00 0.00 ? 104 PHE A CE1  3  
ATOM   1035 C  CE2  . PHE A 1 3  ? 3.908   -8.135  -3.484 1.00 0.00 ? 104 PHE A CE2  3  
ATOM   1036 C  CZ   . PHE A 1 3  ? 3.026   -8.323  -4.501 1.00 0.00 ? 104 PHE A CZ   3  
ATOM   1037 H  H    . PHE A 1 3  ? 2.390   -6.095  -1.395 1.00 0.00 ? 104 PHE A H    3  
ATOM   1038 H  HA   . PHE A 1 3  ? 0.022   -6.693  -0.404 1.00 0.00 ? 104 PHE A HA   3  
ATOM   1039 H  HB2  . PHE A 1 3  ? 2.452   -8.442  0.238  1.00 0.00 ? 104 PHE A HB2  3  
ATOM   1040 H  HB3  . PHE A 1 3  ? 0.870   -8.979  -0.291 1.00 0.00 ? 104 PHE A HB3  3  
ATOM   1041 H  HD1  . PHE A 1 3  ? 0.177   -8.554  -2.678 1.00 0.00 ? 104 PHE A HD1  3  
ATOM   1042 H  HD2  . PHE A 1 3  ? 4.153   -7.944  -1.326 1.00 0.00 ? 104 PHE A HD2  3  
ATOM   1043 H  HE1  . PHE A 1 3  ? 0.994   -8.624  -5.050 1.00 0.00 ? 104 PHE A HE1  3  
ATOM   1044 H  HE2  . PHE A 1 3  ? 4.970   -8.015  -3.698 1.00 0.00 ? 104 PHE A HE2  3  
ATOM   1045 H  HZ   . PHE A 1 3  ? 3.381   -8.354  -5.531 1.00 0.00 ? 104 PHE A HZ   3  
ATOM   1046 N  N    . VAL A 1 4  ? -0.208  -6.825  2.055  1.00 0.00 ? 105 VAL A N    3  
ATOM   1047 C  CA   . VAL A 1 4  ? -0.386  -6.756  3.495  1.00 0.00 ? 105 VAL A CA   3  
ATOM   1048 C  C    . VAL A 1 4  ? -1.465  -7.754  3.920  1.00 0.00 ? 105 VAL A C    3  
ATOM   1049 O  O    . VAL A 1 4  ? -2.635  -7.592  3.576  1.00 0.00 ? 105 VAL A O    3  
ATOM   1050 C  CB   . VAL A 1 4  ? -0.702  -5.318  3.915  1.00 0.00 ? 105 VAL A CB   3  
ATOM   1051 C  CG1  . VAL A 1 4  ? -0.615  -5.159  5.434  1.00 0.00 ? 105 VAL A CG1  3  
ATOM   1052 C  CG2  . VAL A 1 4  ? 0.221   -4.324  3.206  1.00 0.00 ? 105 VAL A CG2  3  
ATOM   1053 H  H    . VAL A 1 4  ? -1.054  -6.914  1.528  1.00 0.00 ? 105 VAL A H    3  
ATOM   1054 H  HA   . VAL A 1 4  ? 0.559   -7.042  3.957  1.00 0.00 ? 105 VAL A HA   3  
ATOM   1055 H  HB   . VAL A 1 4  ? -1.726  -5.098  3.613  1.00 0.00 ? 105 VAL A HB   3  
ATOM   1056 H  HG11 . VAL A 1 4  ? -0.218  -4.173  5.674  1.00 0.00 ? 105 VAL A HG11 3  
ATOM   1057 H  HG12 . VAL A 1 4  ? -1.609  -5.267  5.868  1.00 0.00 ? 105 VAL A HG12 3  
ATOM   1058 H  HG13 . VAL A 1 4  ? 0.044   -5.925  5.842  1.00 0.00 ? 105 VAL A HG13 3  
ATOM   1059 H  HG21 . VAL A 1 4  ? 1.159   -4.818  2.952  1.00 0.00 ? 105 VAL A HG21 3  
ATOM   1060 H  HG22 . VAL A 1 4  ? -0.261  -3.968  2.295  1.00 0.00 ? 105 VAL A HG22 3  
ATOM   1061 H  HG23 . VAL A 1 4  ? 0.420   -3.480  3.865  1.00 0.00 ? 105 VAL A HG23 3  
ATOM   1062 N  N    . CYS A 1 5  ? -1.033  -8.763  4.663  1.00 0.00 ? 106 CYS A N    3  
ATOM   1063 C  CA   . CYS A 1 5  ? -1.947  -9.787  5.139  1.00 0.00 ? 106 CYS A CA   3  
ATOM   1064 C  C    . CYS A 1 5  ? -3.132  -9.096  5.815  1.00 0.00 ? 106 CYS A C    3  
ATOM   1065 O  O    . CYS A 1 5  ? -3.056  -8.726  6.985  1.00 0.00 ? 106 CYS A O    3  
ATOM   1066 C  CB   . CYS A 1 5  ? -1.251  -10.774 6.077  1.00 0.00 ? 106 CYS A CB   3  
ATOM   1067 S  SG   . CYS A 1 5  ? -2.410  -12.109 6.552  1.00 0.00 ? 106 CYS A SG   3  
ATOM   1068 H  H    . CYS A 1 5  ? -0.080  -8.886  4.937  1.00 0.00 ? 106 CYS A H    3  
ATOM   1069 H  HA   . CYS A 1 5  ? -2.274  -10.346 4.262  1.00 0.00 ? 106 CYS A HA   3  
ATOM   1070 H  HB2  . CYS A 1 5  ? -0.376  -11.200 5.587  1.00 0.00 ? 106 CYS A HB2  3  
ATOM   1071 H  HB3  . CYS A 1 5  ? -0.897  -10.255 6.967  1.00 0.00 ? 106 CYS A HB3  3  
ATOM   1072 N  N    . GLU A 1 6  ? -4.203  -8.942  5.048  1.00 0.00 ? 107 GLU A N    3  
ATOM   1073 C  CA   . GLU A 1 6  ? -5.404  -8.302  5.559  1.00 0.00 ? 107 GLU A CA   3  
ATOM   1074 C  C    . GLU A 1 6  ? -5.890  -9.016  6.822  1.00 0.00 ? 107 GLU A C    3  
ATOM   1075 O  O    . GLU A 1 6  ? -6.651  -8.450  7.605  1.00 0.00 ? 107 GLU A O    3  
ATOM   1076 C  CB   . GLU A 1 6  ? -6.500  -8.264  4.493  1.00 0.00 ? 107 GLU A CB   3  
ATOM   1077 C  CG   . GLU A 1 6  ? -7.123  -9.646  4.298  1.00 0.00 ? 107 GLU A CG   3  
ATOM   1078 C  CD   . GLU A 1 6  ? -8.505  -9.539  3.649  1.00 0.00 ? 107 GLU A CD   3  
ATOM   1079 O  OE1  . GLU A 1 6  ? -9.143  -8.481  3.844  1.00 0.00 ? 107 GLU A OE1  3  
ATOM   1080 O  OE2  . GLU A 1 6  ? -8.892  -10.516 2.973  1.00 0.00 ? 107 GLU A OE2  3  
ATOM   1081 H  H    . GLU A 1 6  ? -4.258  -9.245  4.098  1.00 0.00 ? 107 GLU A H    3  
ATOM   1082 H  HA   . GLU A 1 6  ? -5.106  -7.282  5.802  1.00 0.00 ? 107 GLU A HA   3  
ATOM   1083 H  HB2  . GLU A 1 6  ? -7.271  -7.551  4.785  1.00 0.00 ? 107 GLU A HB2  3  
ATOM   1084 H  HB3  . GLU A 1 6  ? -6.083  -7.912  3.549  1.00 0.00 ? 107 GLU A HB3  3  
ATOM   1085 H  HG2  . GLU A 1 6  ? -6.472  -10.259 3.674  1.00 0.00 ? 107 GLU A HG2  3  
ATOM   1086 H  HG3  . GLU A 1 6  ? -7.209  -10.150 5.260  1.00 0.00 ? 107 GLU A HG3  3  
ATOM   1087 N  N    . VAL A 1 7  ? -5.432  -10.250 6.978  1.00 0.00 ? 108 VAL A N    3  
ATOM   1088 C  CA   . VAL A 1 7  ? -5.811  -11.048 8.132  1.00 0.00 ? 108 VAL A CA   3  
ATOM   1089 C  C    . VAL A 1 7  ? -5.201  -10.434 9.394  1.00 0.00 ? 108 VAL A C    3  
ATOM   1090 O  O    . VAL A 1 7  ? -5.921  -9.933  10.256 1.00 0.00 ? 108 VAL A O    3  
ATOM   1091 C  CB   . VAL A 1 7  ? -5.401  -12.505 7.917  1.00 0.00 ? 108 VAL A CB   3  
ATOM   1092 C  CG1  . VAL A 1 7  ? -5.455  -13.289 9.230  1.00 0.00 ? 108 VAL A CG1  3  
ATOM   1093 C  CG2  . VAL A 1 7  ? -6.271  -13.168 6.848  1.00 0.00 ? 108 VAL A CG2  3  
ATOM   1094 H  H    . VAL A 1 7  ? -4.813  -10.703 6.336  1.00 0.00 ? 108 VAL A H    3  
ATOM   1095 H  HA   . VAL A 1 7  ? -6.897  -11.011 8.214  1.00 0.00 ? 108 VAL A HA   3  
ATOM   1096 H  HB   . VAL A 1 7  ? -4.371  -12.516 7.563  1.00 0.00 ? 108 VAL A HB   3  
ATOM   1097 H  HG11 . VAL A 1 7  ? -6.194  -12.838 9.893  1.00 0.00 ? 108 VAL A HG11 3  
ATOM   1098 H  HG12 . VAL A 1 7  ? -5.733  -14.323 9.026  1.00 0.00 ? 108 VAL A HG12 3  
ATOM   1099 H  HG13 . VAL A 1 7  ? -4.475  -13.265 9.709  1.00 0.00 ? 108 VAL A HG13 3  
ATOM   1100 H  HG21 . VAL A 1 7  ? -5.805  -13.042 5.871  1.00 0.00 ? 108 VAL A HG21 3  
ATOM   1101 H  HG22 . VAL A 1 7  ? -6.373  -14.231 7.068  1.00 0.00 ? 108 VAL A HG22 3  
ATOM   1102 H  HG23 . VAL A 1 7  ? -7.257  -12.703 6.842  1.00 0.00 ? 108 VAL A HG23 3  
ATOM   1103 N  N    . CYS A 1 8  ? -3.879  -10.494 9.463  1.00 0.00 ? 109 CYS A N    3  
ATOM   1104 C  CA   . CYS A 1 8  ? -3.163  -9.952  10.605 1.00 0.00 ? 109 CYS A CA   3  
ATOM   1105 C  C    . CYS A 1 8  ? -2.751  -8.516  10.275 1.00 0.00 ? 109 CYS A C    3  
ATOM   1106 O  O    . CYS A 1 8  ? -2.713  -7.659  11.157 1.00 0.00 ? 109 CYS A O    3  
ATOM   1107 C  CB   . CYS A 1 8  ? -1.961  -10.818 10.983 1.00 0.00 ? 109 CYS A CB   3  
ATOM   1108 S  SG   . CYS A 1 8  ? -0.684  -10.721 9.676  1.00 0.00 ? 109 CYS A SG   3  
ATOM   1109 H  H    . CYS A 1 8  ? -3.301  -10.904 8.758  1.00 0.00 ? 109 CYS A H    3  
ATOM   1110 H  HA   . CYS A 1 8  ? -3.856  -9.972  11.447 1.00 0.00 ? 109 CYS A HA   3  
ATOM   1111 H  HB2  . CYS A 1 8  ? -1.545  -10.484 11.934 1.00 0.00 ? 109 CYS A HB2  3  
ATOM   1112 H  HB3  . CYS A 1 8  ? -2.276  -11.853 11.119 1.00 0.00 ? 109 CYS A HB3  3  
ATOM   1113 N  N    . THR A 1 9  ? -2.452  -8.297  9.002  1.00 0.00 ? 110 THR A N    3  
ATOM   1114 C  CA   . THR A 1 9  ? -2.044  -6.980  8.546  1.00 0.00 ? 110 THR A CA   3  
ATOM   1115 C  C    . THR A 1 9  ? -0.519  -6.874  8.519  1.00 0.00 ? 110 THR A C    3  
ATOM   1116 O  O    . THR A 1 9  ? 0.040   -5.822  8.829  1.00 0.00 ? 110 THR A O    3  
ATOM   1117 C  CB   . THR A 1 9  ? -2.710  -5.939  9.447  1.00 0.00 ? 110 THR A CB   3  
ATOM   1118 O  OG1  . THR A 1 9  ? -2.062  -6.104  10.706 1.00 0.00 ? 110 THR A OG1  3  
ATOM   1119 C  CG2  . THR A 1 9  ? -4.177  -6.267  9.738  1.00 0.00 ? 110 THR A CG2  3  
ATOM   1120 H  H    . THR A 1 9  ? -2.485  -9.000  8.292  1.00 0.00 ? 110 THR A H    3  
ATOM   1121 H  HA   . THR A 1 9  ? -2.392  -6.849  7.521  1.00 0.00 ? 110 THR A HA   3  
ATOM   1122 H  HB   . THR A 1 9  ? -2.611  -4.938  9.027  1.00 0.00 ? 110 THR A HB   3  
ATOM   1123 H  HG1  . THR A 1 9  ? -1.400  -5.369  10.848 1.00 0.00 ? 110 THR A HG1  3  
ATOM   1124 H  HG21 . THR A 1 9  ? -4.346  -6.253  10.814 1.00 0.00 ? 110 THR A HG21 3  
ATOM   1125 H  HG22 . THR A 1 9  ? -4.816  -5.527  9.259  1.00 0.00 ? 110 THR A HG22 3  
ATOM   1126 H  HG23 . THR A 1 9  ? -4.411  -7.258  9.347  1.00 0.00 ? 110 THR A HG23 3  
ATOM   1127 N  N    . ARG A 1 10 ? 0.114   -7.977  8.146  1.00 0.00 ? 111 ARG A N    3  
ATOM   1128 C  CA   . ARG A 1 10 ? 1.564   -8.021  8.075  1.00 0.00 ? 111 ARG A CA   3  
ATOM   1129 C  C    . ARG A 1 10 ? 2.033   -7.788  6.638  1.00 0.00 ? 111 ARG A C    3  
ATOM   1130 O  O    . ARG A 1 10 ? 1.611   -8.493  5.721  1.00 0.00 ? 111 ARG A O    3  
ATOM   1131 C  CB   . ARG A 1 10 ? 2.099   -9.368  8.567  1.00 0.00 ? 111 ARG A CB   3  
ATOM   1132 C  CG   . ARG A 1 10 ? 2.205   -9.391  10.093 1.00 0.00 ? 111 ARG A CG   3  
ATOM   1133 C  CD   . ARG A 1 10 ? 2.933   -10.649 10.573 1.00 0.00 ? 111 ARG A CD   3  
ATOM   1134 N  NE   . ARG A 1 10 ? 3.127   -10.594 12.038 1.00 0.00 ? 111 ARG A NE   3  
ATOM   1135 C  CZ   . ARG A 1 10 ? 3.298   -11.672 12.815 1.00 0.00 ? 111 ARG A CZ   3  
ATOM   1136 N  NH1  . ARG A 1 10 ? 2.800   -12.857 12.435 1.00 0.00 ? 111 ARG A NH1  3  
ATOM   1137 N  NH2  . ARG A 1 10 ? 3.968   -11.566 13.970 1.00 0.00 ? 111 ARG A NH2  3  
ATOM   1138 H  H    . ARG A 1 10 ? -0.348  -8.828  7.896  1.00 0.00 ? 111 ARG A H    3  
ATOM   1139 H  HA   . ARG A 1 10 ? 1.900   -7.218  8.732  1.00 0.00 ? 111 ARG A HA   3  
ATOM   1140 H  HB2  . ARG A 1 10 ? 1.440   -10.169 8.232  1.00 0.00 ? 111 ARG A HB2  3  
ATOM   1141 H  HB3  . ARG A 1 10 ? 3.079   -9.556  8.128  1.00 0.00 ? 111 ARG A HB3  3  
ATOM   1142 H  HG2  . ARG A 1 10 ? 2.737   -8.505  10.438 1.00 0.00 ? 111 ARG A HG2  3  
ATOM   1143 H  HG3  . ARG A 1 10 ? 1.208   -9.356  10.531 1.00 0.00 ? 111 ARG A HG3  3  
ATOM   1144 H  HD2  . ARG A 1 10 ? 2.358   -11.536 10.306 1.00 0.00 ? 111 ARG A HD2  3  
ATOM   1145 H  HD3  . ARG A 1 10 ? 3.899   -10.733 10.074 1.00 0.00 ? 111 ARG A HD3  3  
ATOM   1146 H  HE   . ARG A 1 10 ? 3.128   -9.695  12.478 1.00 0.00 ? 111 ARG A HE   3  
ATOM   1147 H  HH11 . ARG A 1 10 ? 3.294   -13.417 11.769 1.00 0.00 ? 111 ARG A HH11 3  
ATOM   1148 H  HH12 . ARG A 1 10 ? 1.936   -13.182 12.817 1.00 0.00 ? 111 ARG A HH12 3  
ATOM   1149 H  HH21 . ARG A 1 10 ? 3.948   -10.708 14.483 1.00 0.00 ? 111 ARG A HH21 3  
ATOM   1150 H  HH22 . ARG A 1 10 ? 4.489   -12.345 14.321 1.00 0.00 ? 111 ARG A HH22 3  
ATOM   1151 N  N    . ALA A 1 11 ? 2.898   -6.797  6.485  1.00 0.00 ? 112 ALA A N    3  
ATOM   1152 C  CA   . ALA A 1 11 ? 3.429   -6.462  5.174  1.00 0.00 ? 112 ALA A CA   3  
ATOM   1153 C  C    . ALA A 1 11 ? 4.751   -7.201  4.960  1.00 0.00 ? 112 ALA A C    3  
ATOM   1154 O  O    . ALA A 1 11 ? 5.447   -7.527  5.921  1.00 0.00 ? 112 ALA A O    3  
ATOM   1155 C  CB   . ALA A 1 11 ? 3.583   -4.945  5.058  1.00 0.00 ? 112 ALA A CB   3  
ATOM   1156 H  H    . ALA A 1 11 ? 3.237   -6.229  7.234  1.00 0.00 ? 112 ALA A H    3  
ATOM   1157 H  HA   . ALA A 1 11 ? 2.709   -6.800  4.428  1.00 0.00 ? 112 ALA A HA   3  
ATOM   1158 H  HB1  . ALA A 1 11 ? 3.018   -4.587  4.198  1.00 0.00 ? 112 ALA A HB1  3  
ATOM   1159 H  HB2  . ALA A 1 11 ? 3.207   -4.471  5.964  1.00 0.00 ? 112 ALA A HB2  3  
ATOM   1160 H  HB3  . ALA A 1 11 ? 4.637   -4.696  4.928  1.00 0.00 ? 112 ALA A HB3  3  
ATOM   1161 N  N    . PHE A 1 12 ? 5.059   -7.445  3.694  1.00 0.00 ? 113 PHE A N    3  
ATOM   1162 C  CA   . PHE A 1 12 ? 6.285   -8.139  3.342  1.00 0.00 ? 113 PHE A CA   3  
ATOM   1163 C  C    . PHE A 1 12 ? 6.877   -7.583  2.045  1.00 0.00 ? 113 PHE A C    3  
ATOM   1164 O  O    . PHE A 1 12 ? 6.243   -6.779  1.364  1.00 0.00 ? 113 PHE A O    3  
ATOM   1165 C  CB   . PHE A 1 12 ? 5.922   -9.610  3.132  1.00 0.00 ? 113 PHE A CB   3  
ATOM   1166 C  CG   . PHE A 1 12 ? 5.326   -10.286 4.369  1.00 0.00 ? 113 PHE A CG   3  
ATOM   1167 C  CD1  . PHE A 1 12 ? 6.138   -10.684 5.385  1.00 0.00 ? 113 PHE A CD1  3  
ATOM   1168 C  CD2  . PHE A 1 12 ? 3.983   -10.487 4.452  1.00 0.00 ? 113 PHE A CD2  3  
ATOM   1169 C  CE1  . PHE A 1 12 ? 5.583   -11.311 6.533  1.00 0.00 ? 113 PHE A CE1  3  
ATOM   1170 C  CE2  . PHE A 1 12 ? 3.429   -11.114 5.600  1.00 0.00 ? 113 PHE A CE2  3  
ATOM   1171 C  CZ   . PHE A 1 12 ? 4.241   -11.513 6.615  1.00 0.00 ? 113 PHE A CZ   3  
ATOM   1172 H  H    . PHE A 1 12 ? 4.487   -7.176  2.918  1.00 0.00 ? 113 PHE A H    3  
ATOM   1173 H  HA   . PHE A 1 12 ? 6.991   -7.983  4.157  1.00 0.00 ? 113 PHE A HA   3  
ATOM   1174 H  HB2  . PHE A 1 12 ? 5.210   -9.686  2.311  1.00 0.00 ? 113 PHE A HB2  3  
ATOM   1175 H  HB3  . PHE A 1 12 ? 6.816   -10.155 2.829  1.00 0.00 ? 113 PHE A HB3  3  
ATOM   1176 H  HD1  . PHE A 1 12 ? 7.213   -10.522 5.318  1.00 0.00 ? 113 PHE A HD1  3  
ATOM   1177 H  HD2  . PHE A 1 12 ? 3.332   -10.168 3.639  1.00 0.00 ? 113 PHE A HD2  3  
ATOM   1178 H  HE1  . PHE A 1 12 ? 6.235   -11.630 7.347  1.00 0.00 ? 113 PHE A HE1  3  
ATOM   1179 H  HE2  . PHE A 1 12 ? 2.354   -11.276 5.668  1.00 0.00 ? 113 PHE A HE2  3  
ATOM   1180 H  HZ   . PHE A 1 12 ? 3.816   -11.993 7.497  1.00 0.00 ? 113 PHE A HZ   3  
ATOM   1181 N  N    . ALA A 1 13 ? 8.086   -8.034  1.742  1.00 0.00 ? 114 ALA A N    3  
ATOM   1182 C  CA   . ALA A 1 13 ? 8.770   -7.591  0.539  1.00 0.00 ? 114 ALA A CA   3  
ATOM   1183 C  C    . ALA A 1 13 ? 8.378   -8.500  -0.629 1.00 0.00 ? 114 ALA A C    3  
ATOM   1184 O  O    . ALA A 1 13 ? 8.220   -8.034  -1.756 1.00 0.00 ? 114 ALA A O    3  
ATOM   1185 C  CB   . ALA A 1 13 ? 10.280  -7.578  0.787  1.00 0.00 ? 114 ALA A CB   3  
ATOM   1186 H  H    . ALA A 1 13 ? 8.595   -8.688  2.302  1.00 0.00 ? 114 ALA A H    3  
ATOM   1187 H  HA   . ALA A 1 13 ? 8.440   -6.575  0.325  1.00 0.00 ? 114 ALA A HA   3  
ATOM   1188 H  HB1  . ALA A 1 13 ? 10.774  -8.222  0.059  1.00 0.00 ? 114 ALA A HB1  3  
ATOM   1189 H  HB2  . ALA A 1 13 ? 10.656  -6.560  0.684  1.00 0.00 ? 114 ALA A HB2  3  
ATOM   1190 H  HB3  . ALA A 1 13 ? 10.486  -7.942  1.793  1.00 0.00 ? 114 ALA A HB3  3  
ATOM   1191 N  N    . ARG A 1 14 ? 8.234   -9.779  -0.318 1.00 0.00 ? 115 ARG A N    3  
ATOM   1192 C  CA   . ARG A 1 14 ? 7.863   -10.757 -1.328 1.00 0.00 ? 115 ARG A CA   3  
ATOM   1193 C  C    . ARG A 1 14 ? 6.420   -11.218 -1.115 1.00 0.00 ? 115 ARG A C    3  
ATOM   1194 O  O    . ARG A 1 14 ? 5.902   -11.158 -0.002 1.00 0.00 ? 115 ARG A O    3  
ATOM   1195 C  CB   . ARG A 1 14 ? 8.791   -11.973 -1.283 1.00 0.00 ? 115 ARG A CB   3  
ATOM   1196 C  CG   . ARG A 1 14 ? 10.236  -11.550 -1.011 1.00 0.00 ? 115 ARG A CG   3  
ATOM   1197 C  CD   . ARG A 1 14 ? 11.220  -12.429 -1.786 1.00 0.00 ? 115 ARG A CD   3  
ATOM   1198 N  NE   . ARG A 1 14 ? 11.655  -11.737 -3.020 1.00 0.00 ? 115 ARG A NE   3  
ATOM   1199 C  CZ   . ARG A 1 14 ? 12.361  -12.319 -3.998 1.00 0.00 ? 115 ARG A CZ   3  
ATOM   1200 N  NH1  . ARG A 1 14 ? 11.808  -13.292 -4.735 1.00 0.00 ? 115 ARG A NH1  3  
ATOM   1201 N  NH2  . ARG A 1 14 ? 13.619  -11.929 -4.240 1.00 0.00 ? 115 ARG A NH2  3  
ATOM   1202 H  H    . ARG A 1 14 ? 8.364   -10.150 0.601  1.00 0.00 ? 115 ARG A H    3  
ATOM   1203 H  HA   . ARG A 1 14 ? 7.973   -10.232 -2.276 1.00 0.00 ? 115 ARG A HA   3  
ATOM   1204 H  HB2  . ARG A 1 14 ? 8.457   -12.661 -0.506 1.00 0.00 ? 115 ARG A HB2  3  
ATOM   1205 H  HB3  . ARG A 1 14 ? 8.737   -12.510 -2.230 1.00 0.00 ? 115 ARG A HB3  3  
ATOM   1206 H  HG2  . ARG A 1 14 ? 10.374  -10.507 -1.296 1.00 0.00 ? 115 ARG A HG2  3  
ATOM   1207 H  HG3  . ARG A 1 14 ? 10.444  -11.618 0.056  1.00 0.00 ? 115 ARG A HG3  3  
ATOM   1208 H  HD2  . ARG A 1 14 ? 12.084  -12.658 -1.163 1.00 0.00 ? 115 ARG A HD2  3  
ATOM   1209 H  HD3  . ARG A 1 14 ? 10.749  -13.379 -2.039 1.00 0.00 ? 115 ARG A HD3  3  
ATOM   1210 H  HE   . ARG A 1 14 ? 11.407  -10.774 -3.129 1.00 0.00 ? 115 ARG A HE   3  
ATOM   1211 H  HH11 . ARG A 1 14 ? 11.161  -13.930 -4.318 1.00 0.00 ? 115 ARG A HH11 3  
ATOM   1212 H  HH12 . ARG A 1 14 ? 12.042  -13.380 -5.704 1.00 0.00 ? 115 ARG A HH12 3  
ATOM   1213 H  HH21 . ARG A 1 14 ? 14.378  -12.346 -3.740 1.00 0.00 ? 115 ARG A HH21 3  
ATOM   1214 H  HH22 . ARG A 1 14 ? 13.801  -11.218 -4.922 1.00 0.00 ? 115 ARG A HH22 3  
ATOM   1215 N  N    . GLN A 1 15 ? 5.810   -11.667 -2.203 1.00 0.00 ? 116 GLN A N    3  
ATOM   1216 C  CA   . GLN A 1 15 ? 4.437   -12.137 -2.151 1.00 0.00 ? 116 GLN A CA   3  
ATOM   1217 C  C    . GLN A 1 15 ? 4.372   -13.514 -1.485 1.00 0.00 ? 116 GLN A C    3  
ATOM   1218 O  O    . GLN A 1 15 ? 3.429   -13.810 -0.753 1.00 0.00 ? 116 GLN A O    3  
ATOM   1219 C  CB   . GLN A 1 15 ? 3.816   -12.175 -3.549 1.00 0.00 ? 116 GLN A CB   3  
ATOM   1220 C  CG   . GLN A 1 15 ? 4.427   -11.099 -4.449 1.00 0.00 ? 116 GLN A CG   3  
ATOM   1221 C  CD   . GLN A 1 15 ? 5.399   -11.715 -5.458 1.00 0.00 ? 116 GLN A CD   3  
ATOM   1222 O  OE1  . GLN A 1 15 ? 6.593   -11.468 -5.438 1.00 0.00 ? 116 GLN A OE1  3  
ATOM   1223 N  NE2  . GLN A 1 15 ? 4.821   -12.526 -6.339 1.00 0.00 ? 116 GLN A NE2  3  
ATOM   1224 H  H    . GLN A 1 15 ? 6.238   -11.712 -3.106 1.00 0.00 ? 116 GLN A H    3  
ATOM   1225 H  HA   . GLN A 1 15 ? 3.904   -11.407 -1.542 1.00 0.00 ? 116 GLN A HA   3  
ATOM   1226 H  HB2  . GLN A 1 15 ? 3.972   -13.158 -3.994 1.00 0.00 ? 116 GLN A HB2  3  
ATOM   1227 H  HB3  . GLN A 1 15 ? 2.739   -12.026 -3.477 1.00 0.00 ? 116 GLN A HB3  3  
ATOM   1228 H  HG2  . GLN A 1 15 ? 3.634   -10.570 -4.978 1.00 0.00 ? 116 GLN A HG2  3  
ATOM   1229 H  HG3  . GLN A 1 15 ? 4.949   -10.362 -3.838 1.00 0.00 ? 116 GLN A HG3  3  
ATOM   1230 H  HE21 . GLN A 1 15 ? 3.926   -12.295 -6.720 1.00 0.00 ? 116 GLN A HE21 3  
ATOM   1231 H  HE22 . GLN A 1 15 ? 5.282   -13.368 -6.620 1.00 0.00 ? 116 GLN A HE22 3  
ATOM   1232 N  N    . GLU A 1 16 ? 5.387   -14.319 -1.763 1.00 0.00 ? 117 GLU A N    3  
ATOM   1233 C  CA   . GLU A 1 16 ? 5.458   -15.656 -1.200 1.00 0.00 ? 117 GLU A CA   3  
ATOM   1234 C  C    . GLU A 1 16 ? 5.349   -15.597 0.325  1.00 0.00 ? 117 GLU A C    3  
ATOM   1235 O  O    . GLU A 1 16 ? 4.711   -16.449 0.939  1.00 0.00 ? 117 GLU A O    3  
ATOM   1236 C  CB   . GLU A 1 16 ? 6.742   -16.366 -1.632 1.00 0.00 ? 117 GLU A CB   3  
ATOM   1237 C  CG   . GLU A 1 16 ? 7.044   -16.103 -3.109 1.00 0.00 ? 117 GLU A CG   3  
ATOM   1238 C  CD   . GLU A 1 16 ? 5.756   -15.868 -3.898 1.00 0.00 ? 117 GLU A CD   3  
ATOM   1239 O  OE1  . GLU A 1 16 ? 4.874   -16.751 -3.823 1.00 0.00 ? 117 GLU A OE1  3  
ATOM   1240 O  OE2  . GLU A 1 16 ? 5.680   -14.810 -4.560 1.00 0.00 ? 117 GLU A OE2  3  
ATOM   1241 H  H    . GLU A 1 16 ? 6.151   -14.070 -2.360 1.00 0.00 ? 117 GLU A H    3  
ATOM   1242 H  HA   . GLU A 1 16 ? 4.600   -16.189 -1.611 1.00 0.00 ? 117 GLU A HA   3  
ATOM   1243 H  HB2  . GLU A 1 16 ? 7.576   -16.021 -1.019 1.00 0.00 ? 117 GLU A HB2  3  
ATOM   1244 H  HB3  . GLU A 1 16 ? 6.645   -17.438 -1.462 1.00 0.00 ? 117 GLU A HB3  3  
ATOM   1245 H  HG2  . GLU A 1 16 ? 7.696   -15.233 -3.201 1.00 0.00 ? 117 GLU A HG2  3  
ATOM   1246 H  HG3  . GLU A 1 16 ? 7.584   -16.951 -3.530 1.00 0.00 ? 117 GLU A HG3  3  
ATOM   1247 N  N    . HIS A 1 17 ? 5.985   -14.581 0.892  1.00 0.00 ? 118 HIS A N    3  
ATOM   1248 C  CA   . HIS A 1 17 ? 5.968   -14.399 2.334  1.00 0.00 ? 118 HIS A CA   3  
ATOM   1249 C  C    . HIS A 1 17 ? 4.522   -14.387 2.833  1.00 0.00 ? 118 HIS A C    3  
ATOM   1250 O  O    . HIS A 1 17 ? 4.188   -15.077 3.796  1.00 0.00 ? 118 HIS A O    3  
ATOM   1251 C  CB   . HIS A 1 17 ? 6.743   -13.141 2.732  1.00 0.00 ? 118 HIS A CB   3  
ATOM   1252 C  CG   . HIS A 1 17 ? 8.223   -13.213 2.437  1.00 0.00 ? 118 HIS A CG   3  
ATOM   1253 N  ND1  . HIS A 1 17 ? 9.103   -12.197 2.768  1.00 0.00 ? 118 HIS A ND1  3  
ATOM   1254 C  CD2  . HIS A 1 17 ? 8.967   -14.188 1.839  1.00 0.00 ? 118 HIS A CD2  3  
ATOM   1255 C  CE1  . HIS A 1 17 ? 10.318  -12.555 2.383  1.00 0.00 ? 118 HIS A CE1  3  
ATOM   1256 N  NE2  . HIS A 1 17 ? 10.233  -13.789 1.806  1.00 0.00 ? 118 HIS A NE2  3  
ATOM   1257 H  H    . HIS A 1 17 ? 6.502   -13.892 0.385  1.00 0.00 ? 118 HIS A H    3  
ATOM   1258 H  HA   . HIS A 1 17 ? 6.485   -15.258 2.763  1.00 0.00 ? 118 HIS A HA   3  
ATOM   1259 H  HB2  . HIS A 1 17 ? 6.320   -12.285 2.207  1.00 0.00 ? 118 HIS A HB2  3  
ATOM   1260 H  HB3  . HIS A 1 17 ? 6.604   -12.964 3.797  1.00 0.00 ? 118 HIS A HB3  3  
ATOM   1261 H  HD1  . HIS A 1 17 ? 8.862   -11.340 3.221  1.00 0.00 ? 118 HIS A HD1  3  
ATOM   1262 H  HD2  . HIS A 1 17 ? 8.586   -15.134 1.455  1.00 0.00 ? 118 HIS A HD2  3  
ATOM   1263 H  HE1  . HIS A 1 17 ? 11.229  -11.967 2.504  1.00 0.00 ? 118 HIS A HE1  3  
ATOM   1264 H  HE2  . HIS A 1 17 ? 11.004  -14.331 1.475  1.00 0.00 ? 118 HIS A HE2  3  
ATOM   1265 N  N    . LEU A 1 18 ? 3.703   -13.598 2.155  1.00 0.00 ? 119 LEU A N    3  
ATOM   1266 C  CA   . LEU A 1 18 ? 2.299   -13.487 2.518  1.00 0.00 ? 119 LEU A CA   3  
ATOM   1267 C  C    . LEU A 1 18 ? 1.628   -14.853 2.359  1.00 0.00 ? 119 LEU A C    3  
ATOM   1268 O  O    . LEU A 1 18 ? 1.137   -15.424 3.332  1.00 0.00 ? 119 LEU A O    3  
ATOM   1269 C  CB   . LEU A 1 18 ? 1.625   -12.373 1.716  1.00 0.00 ? 119 LEU A CB   3  
ATOM   1270 C  CG   . LEU A 1 18 ? 0.115   -12.511 1.514  1.00 0.00 ? 119 LEU A CG   3  
ATOM   1271 C  CD1  . LEU A 1 18 ? -0.558  -13.067 2.771  1.00 0.00 ? 119 LEU A CD1  3  
ATOM   1272 C  CD2  . LEU A 1 18 ? -0.503  -11.183 1.072  1.00 0.00 ? 119 LEU A CD2  3  
ATOM   1273 H  H    . LEU A 1 18 ? 3.982   -13.041 1.373  1.00 0.00 ? 119 LEU A H    3  
ATOM   1274 H  HA   . LEU A 1 18 ? 2.255   -13.201 3.568  1.00 0.00 ? 119 LEU A HA   3  
ATOM   1275 H  HB2  . LEU A 1 18 ? 1.819   -11.424 2.216  1.00 0.00 ? 119 LEU A HB2  3  
ATOM   1276 H  HB3  . LEU A 1 18 ? 2.099   -12.319 0.735  1.00 0.00 ? 119 LEU A HB3  3  
ATOM   1277 H  HG   . LEU A 1 18 ? -0.058  -13.229 0.712  1.00 0.00 ? 119 LEU A HG   3  
ATOM   1278 H  HD11 . LEU A 1 18 ? -0.089  -12.634 3.655  1.00 0.00 ? 119 LEU A HD11 3  
ATOM   1279 H  HD12 . LEU A 1 18 ? -1.617  -12.809 2.760  1.00 0.00 ? 119 LEU A HD12 3  
ATOM   1280 H  HD13 . LEU A 1 18 ? -0.447  -14.150 2.794  1.00 0.00 ? 119 LEU A HD13 3  
ATOM   1281 H  HD21 . LEU A 1 18 ? -1.511  -11.099 1.478  1.00 0.00 ? 119 LEU A HD21 3  
ATOM   1282 H  HD22 . LEU A 1 18 ? 0.107   -10.358 1.440  1.00 0.00 ? 119 LEU A HD22 3  
ATOM   1283 H  HD23 . LEU A 1 18 ? -0.546  -11.146 -0.017 1.00 0.00 ? 119 LEU A HD23 3  
ATOM   1284 N  N    . LYS A 1 19 ? 1.625   -15.336 1.126  1.00 0.00 ? 120 LYS A N    3  
ATOM   1285 C  CA   . LYS A 1 19 ? 1.021   -16.623 0.827  1.00 0.00 ? 120 LYS A CA   3  
ATOM   1286 C  C    . LYS A 1 19 ? 1.485   -17.651 1.860  1.00 0.00 ? 120 LYS A C    3  
ATOM   1287 O  O    . LYS A 1 19 ? 0.694   -18.112 2.681  1.00 0.00 ? 120 LYS A O    3  
ATOM   1288 C  CB   . LYS A 1 19 ? 1.312   -17.029 -0.620 1.00 0.00 ? 120 LYS A CB   3  
ATOM   1289 C  CG   . LYS A 1 19 ? 0.497   -18.261 -1.018 1.00 0.00 ? 120 LYS A CG   3  
ATOM   1290 C  CD   . LYS A 1 19 ? -1.001  -18.008 -0.841 1.00 0.00 ? 120 LYS A CD   3  
ATOM   1291 C  CE   . LYS A 1 19 ? -1.796  -18.573 -2.020 1.00 0.00 ? 120 LYS A CE   3  
ATOM   1292 N  NZ   . LYS A 1 19 ? -3.004  -17.755 -2.271 1.00 0.00 ? 120 LYS A NZ   3  
ATOM   1293 H  H    . LYS A 1 19 ? 2.025   -14.864 0.339  1.00 0.00 ? 120 LYS A H    3  
ATOM   1294 H  HA   . LYS A 1 19 ? -0.059  -16.505 0.917  1.00 0.00 ? 120 LYS A HA   3  
ATOM   1295 H  HB2  . LYS A 1 19 ? 1.077   -16.201 -1.288 1.00 0.00 ? 120 LYS A HB2  3  
ATOM   1296 H  HB3  . LYS A 1 19 ? 2.376   -17.238 -0.735 1.00 0.00 ? 120 LYS A HB3  3  
ATOM   1297 H  HG2  . LYS A 1 19 ? 0.705   -18.519 -2.056 1.00 0.00 ? 120 LYS A HG2  3  
ATOM   1298 H  HG3  . LYS A 1 19 ? 0.800   -19.113 -0.411 1.00 0.00 ? 120 LYS A HG3  3  
ATOM   1299 H  HD2  . LYS A 1 19 ? -1.344  -18.467 0.086  1.00 0.00 ? 120 LYS A HD2  3  
ATOM   1300 H  HD3  . LYS A 1 19 ? -1.186  -16.937 -0.753 1.00 0.00 ? 120 LYS A HD3  3  
ATOM   1301 H  HE2  . LYS A 1 19 ? -1.170  -18.592 -2.912 1.00 0.00 ? 120 LYS A HE2  3  
ATOM   1302 H  HE3  . LYS A 1 19 ? -2.085  -19.602 -1.811 1.00 0.00 ? 120 LYS A HE3  3  
ATOM   1303 H  HZ1  . LYS A 1 19 ? -2.745  -16.918 -2.755 1.00 0.00 ? 120 LYS A HZ1  3  
ATOM   1304 H  HZ2  . LYS A 1 19 ? -3.650  -18.277 -2.828 1.00 0.00 ? 120 LYS A HZ2  3  
ATOM   1305 H  HZ3  . LYS A 1 19 ? -3.431  -17.516 -1.399 1.00 0.00 ? 120 LYS A HZ3  3  
ATOM   1306 N  N    . ARG A 1 20 ? 2.766   -17.982 1.784  1.00 0.00 ? 121 ARG A N    3  
ATOM   1307 C  CA   . ARG A 1 20 ? 3.345   -18.947 2.703  1.00 0.00 ? 121 ARG A CA   3  
ATOM   1308 C  C    . ARG A 1 20 ? 2.928   -18.629 4.140  1.00 0.00 ? 121 ARG A C    3  
ATOM   1309 O  O    . ARG A 1 20 ? 2.733   -19.536 4.948  1.00 0.00 ? 121 ARG A O    3  
ATOM   1310 C  CB   . ARG A 1 20 ? 4.873   -18.947 2.611  1.00 0.00 ? 121 ARG A CB   3  
ATOM   1311 C  CG   . ARG A 1 20 ? 5.438   -20.343 2.880  1.00 0.00 ? 121 ARG A CG   3  
ATOM   1312 C  CD   . ARG A 1 20 ? 5.132   -21.293 1.721  1.00 0.00 ? 121 ARG A CD   3  
ATOM   1313 N  NE   . ARG A 1 20 ? 5.730   -20.774 0.470  1.00 0.00 ? 121 ARG A NE   3  
ATOM   1314 C  CZ   . ARG A 1 20 ? 5.732   -21.438 -0.693 1.00 0.00 ? 121 ARG A CZ   3  
ATOM   1315 N  NH1  . ARG A 1 20 ? 4.583   -21.635 -1.354 1.00 0.00 ? 121 ARG A NH1  3  
ATOM   1316 N  NH2  . ARG A 1 20 ? 6.883   -21.905 -1.196 1.00 0.00 ? 121 ARG A NH2  3  
ATOM   1317 H  H    . ARG A 1 20 ? 3.402   -17.602 1.113  1.00 0.00 ? 121 ARG A H    3  
ATOM   1318 H  HA   . ARG A 1 20 ? 2.948   -19.911 2.382  1.00 0.00 ? 121 ARG A HA   3  
ATOM   1319 H  HB2  . ARG A 1 20 ? 5.180   -18.612 1.620  1.00 0.00 ? 121 ARG A HB2  3  
ATOM   1320 H  HB3  . ARG A 1 20 ? 5.284   -18.239 3.330  1.00 0.00 ? 121 ARG A HB3  3  
ATOM   1321 H  HG2  . ARG A 1 20 ? 6.516   -20.281 3.029  1.00 0.00 ? 121 ARG A HG2  3  
ATOM   1322 H  HG3  . ARG A 1 20 ? 5.012   -20.740 3.802  1.00 0.00 ? 121 ARG A HG3  3  
ATOM   1323 H  HD2  . ARG A 1 20 ? 5.527   -22.285 1.938  1.00 0.00 ? 121 ARG A HD2  3  
ATOM   1324 H  HD3  . ARG A 1 20 ? 4.053   -21.398 1.600  1.00 0.00 ? 121 ARG A HD3  3  
ATOM   1325 H  HE   . ARG A 1 20 ? 6.161   -19.872 0.496  1.00 0.00 ? 121 ARG A HE   3  
ATOM   1326 H  HH11 . ARG A 1 20 ? 3.727   -21.268 -0.990 1.00 0.00 ? 121 ARG A HH11 3  
ATOM   1327 H  HH12 . ARG A 1 20 ? 4.581   -22.151 -2.212 1.00 0.00 ? 121 ARG A HH12 3  
ATOM   1328 H  HH21 . ARG A 1 20 ? 7.654   -21.284 -1.340 1.00 0.00 ? 121 ARG A HH21 3  
ATOM   1329 H  HH22 . ARG A 1 20 ? 6.971   -22.873 -1.429 1.00 0.00 ? 121 ARG A HH22 3  
ATOM   1330 N  N    . HIS A 1 21 ? 2.802   -17.340 4.414  1.00 0.00 ? 122 HIS A N    3  
ATOM   1331 C  CA   . HIS A 1 21 ? 2.412   -16.891 5.740  1.00 0.00 ? 122 HIS A CA   3  
ATOM   1332 C  C    . HIS A 1 21 ? 0.979   -17.338 6.031  1.00 0.00 ? 122 HIS A C    3  
ATOM   1333 O  O    . HIS A 1 21 ? 0.714   -17.959 7.060  1.00 0.00 ? 122 HIS A O    3  
ATOM   1334 C  CB   . HIS A 1 21 ? 2.601   -15.379 5.880  1.00 0.00 ? 122 HIS A CB   3  
ATOM   1335 C  CG   . HIS A 1 21 ? 1.753   -14.751 6.960  1.00 0.00 ? 122 HIS A CG   3  
ATOM   1336 N  ND1  . HIS A 1 21 ? 2.046   -14.871 8.307  1.00 0.00 ? 122 HIS A ND1  3  
ATOM   1337 C  CD2  . HIS A 1 21 ? 0.619   -13.996 6.877  1.00 0.00 ? 122 HIS A CD2  3  
ATOM   1338 C  CE1  . HIS A 1 21 ? 1.122   -14.215 8.995  1.00 0.00 ? 122 HIS A CE1  3  
ATOM   1339 N  NE2  . HIS A 1 21 ? 0.239   -13.675 8.107  1.00 0.00 ? 122 HIS A NE2  3  
ATOM   1340 H  H    . HIS A 1 21 ? 2.963   -16.608 3.751  1.00 0.00 ? 122 HIS A H    3  
ATOM   1341 H  HA   . HIS A 1 21 ? 3.086   -17.377 6.446  1.00 0.00 ? 122 HIS A HA   3  
ATOM   1342 H  HB2  . HIS A 1 21 ? 3.651   -15.173 6.090  1.00 0.00 ? 122 HIS A HB2  3  
ATOM   1343 H  HB3  . HIS A 1 21 ? 2.368   -14.904 4.927  1.00 0.00 ? 122 HIS A HB3  3  
ATOM   1344 H  HD1  . HIS A 1 21 ? 2.821   -15.368 8.695  1.00 0.00 ? 122 HIS A HD1  3  
ATOM   1345 H  HD2  . HIS A 1 21 ? 0.112   -13.708 5.957  1.00 0.00 ? 122 HIS A HD2  3  
ATOM   1346 H  HE1  . HIS A 1 21 ? 1.077   -14.124 10.080 1.00 0.00 ? 122 HIS A HE1  3  
ATOM   1347 N  N    . TYR A 1 22 ? 0.089   -17.006 5.107  1.00 0.00 ? 123 TYR A N    3  
ATOM   1348 C  CA   . TYR A 1 22 ? -1.311  -17.366 5.251  1.00 0.00 ? 123 TYR A CA   3  
ATOM   1349 C  C    . TYR A 1 22 ? -1.458  -18.790 5.792  1.00 0.00 ? 123 TYR A C    3  
ATOM   1350 O  O    . TYR A 1 22 ? -2.328  -19.057 6.619  1.00 0.00 ? 123 TYR A O    3  
ATOM   1351 C  CB   . TYR A 1 22 ? -1.910  -17.304 3.845  1.00 0.00 ? 123 TYR A CB   3  
ATOM   1352 C  CG   . TYR A 1 22 ? -3.052  -16.296 3.700  1.00 0.00 ? 123 TYR A CG   3  
ATOM   1353 C  CD1  . TYR A 1 22 ? -4.255  -16.519 4.339  1.00 0.00 ? 123 TYR A CD1  3  
ATOM   1354 C  CD2  . TYR A 1 22 ? -2.880  -15.164 2.929  1.00 0.00 ? 123 TYR A CD2  3  
ATOM   1355 C  CE1  . TYR A 1 22 ? -5.330  -15.572 4.203  1.00 0.00 ? 123 TYR A CE1  3  
ATOM   1356 C  CE2  . TYR A 1 22 ? -3.956  -14.216 2.792  1.00 0.00 ? 123 TYR A CE2  3  
ATOM   1357 C  CZ   . TYR A 1 22 ? -5.128  -14.467 3.436  1.00 0.00 ? 123 TYR A CZ   3  
ATOM   1358 O  OH   . TYR A 1 22 ? -6.143  -13.572 3.307  1.00 0.00 ? 123 TYR A OH   3  
ATOM   1359 H  H    . TYR A 1 22 ? 0.312   -16.501 4.272  1.00 0.00 ? 123 TYR A H    3  
ATOM   1360 H  HA   . TYR A 1 22 ? -1.766  -16.669 5.955  1.00 0.00 ? 123 TYR A HA   3  
ATOM   1361 H  HB2  . TYR A 1 22 ? -1.121  -17.048 3.136  1.00 0.00 ? 123 TYR A HB2  3  
ATOM   1362 H  HB3  . TYR A 1 22 ? -2.275  -18.293 3.572  1.00 0.00 ? 123 TYR A HB3  3  
ATOM   1363 H  HD1  . TYR A 1 22 ? -4.390  -17.414 4.948  1.00 0.00 ? 123 TYR A HD1  3  
ATOM   1364 H  HD2  . TYR A 1 22 ? -1.931  -14.987 2.423  1.00 0.00 ? 123 TYR A HD2  3  
ATOM   1365 H  HE1  . TYR A 1 22 ? -6.285  -15.736 4.702  1.00 0.00 ? 123 TYR A HE1  3  
ATOM   1366 H  HE2  . TYR A 1 22 ? -3.834  -13.318 2.187  1.00 0.00 ? 123 TYR A HE2  3  
ATOM   1367 H  HH   . TYR A 1 22 ? -5.805  -12.727 2.891  1.00 0.00 ? 123 TYR A HH   3  
ATOM   1368 N  N    . ARG A 1 23 ? -0.594  -19.667 5.303  1.00 0.00 ? 124 ARG A N    3  
ATOM   1369 C  CA   . ARG A 1 23 ? -0.617  -21.057 5.726  1.00 0.00 ? 124 ARG A CA   3  
ATOM   1370 C  C    . ARG A 1 23 ? -1.073  -21.160 7.183  1.00 0.00 ? 124 ARG A C    3  
ATOM   1371 O  O    . ARG A 1 23 ? -1.845  -22.052 7.534  1.00 0.00 ? 124 ARG A O    3  
ATOM   1372 C  CB   . ARG A 1 23 ? 0.766   -21.698 5.585  1.00 0.00 ? 124 ARG A CB   3  
ATOM   1373 C  CG   . ARG A 1 23 ? 1.421   -21.893 6.954  1.00 0.00 ? 124 ARG A CG   3  
ATOM   1374 C  CD   . ARG A 1 23 ? 2.316   -20.704 7.308  1.00 0.00 ? 124 ARG A CD   3  
ATOM   1375 N  NE   . ARG A 1 23 ? 3.655   -20.881 6.705  1.00 0.00 ? 124 ARG A NE   3  
ATOM   1376 C  CZ   . ARG A 1 23 ? 4.572   -21.749 7.151  1.00 0.00 ? 124 ARG A CZ   3  
ATOM   1377 N  NH1  . ARG A 1 23 ? 4.268   -22.588 8.151  1.00 0.00 ? 124 ARG A NH1  3  
ATOM   1378 N  NH2  . ARG A 1 23 ? 5.792   -21.780 6.598  1.00 0.00 ? 124 ARG A NH2  3  
ATOM   1379 H  H    . ARG A 1 23 ? 0.111   -19.442 4.630  1.00 0.00 ? 124 ARG A H    3  
ATOM   1380 H  HA   . ARG A 1 23 ? -1.328  -21.540 5.057  1.00 0.00 ? 124 ARG A HA   3  
ATOM   1381 H  HB2  . ARG A 1 23 ? 0.674   -22.660 5.081  1.00 0.00 ? 124 ARG A HB2  3  
ATOM   1382 H  HB3  . ARG A 1 23 ? 1.400   -21.070 4.960  1.00 0.00 ? 124 ARG A HB3  3  
ATOM   1383 H  HG2  . ARG A 1 23 ? 0.652   -22.015 7.716  1.00 0.00 ? 124 ARG A HG2  3  
ATOM   1384 H  HG3  . ARG A 1 23 ? 2.012   -22.809 6.950  1.00 0.00 ? 124 ARG A HG3  3  
ATOM   1385 H  HD2  . ARG A 1 23 ? 1.864   -19.779 6.948  1.00 0.00 ? 124 ARG A HD2  3  
ATOM   1386 H  HD3  . ARG A 1 23 ? 2.404   -20.615 8.391  1.00 0.00 ? 124 ARG A HD3  3  
ATOM   1387 H  HE   . ARG A 1 23 ? 3.892   -20.315 5.914  1.00 0.00 ? 124 ARG A HE   3  
ATOM   1388 H  HH11 . ARG A 1 23 ? 3.324   -22.664 8.472  1.00 0.00 ? 124 ARG A HH11 3  
ATOM   1389 H  HH12 . ARG A 1 23 ? 4.986   -23.139 8.577  1.00 0.00 ? 124 ARG A HH12 3  
ATOM   1390 H  HH21 . ARG A 1 23 ? 5.925   -21.456 5.661  1.00 0.00 ? 124 ARG A HH21 3  
ATOM   1391 H  HH22 . ARG A 1 23 ? 6.570   -22.126 7.123  1.00 0.00 ? 124 ARG A HH22 3  
ATOM   1392 N  N    . SER A 1 24 ? -0.577  -20.236 7.992  1.00 0.00 ? 125 SER A N    3  
ATOM   1393 C  CA   . SER A 1 24 ? -0.924  -20.211 9.403  1.00 0.00 ? 125 SER A CA   3  
ATOM   1394 C  C    . SER A 1 24 ? -2.410  -19.886 9.571  1.00 0.00 ? 125 SER A C    3  
ATOM   1395 O  O    . SER A 1 24 ? -3.102  -20.519 10.366 1.00 0.00 ? 125 SER A O    3  
ATOM   1396 C  CB   . SER A 1 24 ? -0.069  -19.196 10.163 1.00 0.00 ? 125 SER A CB   3  
ATOM   1397 O  OG   . SER A 1 24 ? 0.134   -18.001 9.414  1.00 0.00 ? 125 SER A OG   3  
ATOM   1398 H  H    . SER A 1 24 ? 0.050   -19.513 7.699  1.00 0.00 ? 125 SER A H    3  
ATOM   1399 H  HA   . SER A 1 24 ? -0.709  -21.214 9.770  1.00 0.00 ? 125 SER A HA   3  
ATOM   1400 H  HB2  . SER A 1 24 ? -0.551  -18.953 11.111 1.00 0.00 ? 125 SER A HB2  3  
ATOM   1401 H  HB3  . SER A 1 24 ? 0.896   -19.642 10.403 1.00 0.00 ? 125 SER A HB3  3  
ATOM   1402 H  HG   . SER A 1 24 ? -0.739  -17.668 9.059  1.00 0.00 ? 125 SER A HG   3  
ATOM   1403 N  N    . HIS A 1 25 ? -2.856  -18.898 8.808  1.00 0.00 ? 126 HIS A N    3  
ATOM   1404 C  CA   . HIS A 1 25 ? -4.246  -18.481 8.862  1.00 0.00 ? 126 HIS A CA   3  
ATOM   1405 C  C    . HIS A 1 25 ? -5.142  -19.611 8.350  1.00 0.00 ? 126 HIS A C    3  
ATOM   1406 O  O    . HIS A 1 25 ? -6.365  -19.534 8.456  1.00 0.00 ? 126 HIS A O    3  
ATOM   1407 C  CB   . HIS A 1 25 ? -4.451  -17.171 8.097  1.00 0.00 ? 126 HIS A CB   3  
ATOM   1408 C  CG   . HIS A 1 25 ? -3.655  -16.010 8.646  1.00 0.00 ? 126 HIS A CG   3  
ATOM   1409 N  ND1  . HIS A 1 25 ? -3.479  -15.796 10.002 1.00 0.00 ? 126 HIS A ND1  3  
ATOM   1410 C  CD2  . HIS A 1 25 ? -2.991  -15.004 8.008  1.00 0.00 ? 126 HIS A CD2  3  
ATOM   1411 C  CE1  . HIS A 1 25 ? -2.742  -14.706 10.161 1.00 0.00 ? 126 HIS A CE1  3  
ATOM   1412 N  NE2  . HIS A 1 25 ? -2.441  -14.216 8.924  1.00 0.00 ? 126 HIS A NE2  3  
ATOM   1413 H  H    . HIS A 1 25 ? -2.287  -18.388 8.163  1.00 0.00 ? 126 HIS A H    3  
ATOM   1414 H  HA   . HIS A 1 25 ? -4.476  -18.293 9.911  1.00 0.00 ? 126 HIS A HA   3  
ATOM   1415 H  HB2  . HIS A 1 25 ? -4.177  -17.324 7.054  1.00 0.00 ? 126 HIS A HB2  3  
ATOM   1416 H  HB3  . HIS A 1 25 ? -5.510  -16.913 8.115  1.00 0.00 ? 126 HIS A HB3  3  
ATOM   1417 H  HD1  . HIS A 1 25 ? -3.846  -16.366 10.736 1.00 0.00 ? 126 HIS A HD1  3  
ATOM   1418 H  HD2  . HIS A 1 25 ? -2.925  -14.869 6.928  1.00 0.00 ? 126 HIS A HD2  3  
ATOM   1419 H  HE1  . HIS A 1 25 ? -2.430  -14.277 11.113 1.00 0.00 ? 126 HIS A HE1  3  
ATOM   1420 N  N    . THR A 1 26 ? -4.498  -20.633 7.808  1.00 0.00 ? 127 THR A N    3  
ATOM   1421 C  CA   . THR A 1 26 ? -5.221  -21.779 7.281  1.00 0.00 ? 127 THR A CA   3  
ATOM   1422 C  C    . THR A 1 26 ? -4.665  -23.077 7.869  1.00 0.00 ? 127 THR A C    3  
ATOM   1423 O  O    . THR A 1 26 ? -3.560  -23.495 7.527  1.00 0.00 ? 127 THR A O    3  
ATOM   1424 C  CB   . THR A 1 26 ? -5.146  -21.722 5.754  1.00 0.00 ? 127 THR A CB   3  
ATOM   1425 O  OG1  . THR A 1 26 ? -3.776  -21.986 5.463  1.00 0.00 ? 127 THR A OG1  3  
ATOM   1426 C  CG2  . THR A 1 26 ? -5.377  -20.312 5.208  1.00 0.00 ? 127 THR A CG2  3  
ATOM   1427 H  H    . THR A 1 26 ? -3.503  -20.688 7.727  1.00 0.00 ? 127 THR A H    3  
ATOM   1428 H  HA   . THR A 1 26 ? -6.261  -21.704 7.597  1.00 0.00 ? 127 THR A HA   3  
ATOM   1429 H  HB   . THR A 1 26 ? -5.839  -22.433 5.304  1.00 0.00 ? 127 THR A HB   3  
ATOM   1430 H  HG1  . THR A 1 26 ? -3.707  -22.635 4.706  1.00 0.00 ? 127 THR A HG1  3  
ATOM   1431 H  HG21 . THR A 1 26 ? -4.550  -19.666 5.506  1.00 0.00 ? 127 THR A HG21 3  
ATOM   1432 H  HG22 . THR A 1 26 ? -5.436  -20.348 4.120  1.00 0.00 ? 127 THR A HG22 3  
ATOM   1433 H  HG23 . THR A 1 26 ? -6.310  -19.915 5.610  1.00 0.00 ? 127 THR A HG23 3  
ATOM   1434 N  N    . ASN A 1 27 ? -5.458  -23.679 8.743  1.00 0.00 ? 128 ASN A N    3  
ATOM   1435 C  CA   . ASN A 1 27 ? -5.060  -24.923 9.382  1.00 0.00 ? 128 ASN A CA   3  
ATOM   1436 C  C    . ASN A 1 27 ? -4.571  -25.905 8.316  1.00 0.00 ? 128 ASN A C    3  
ATOM   1437 O  O    . ASN A 1 27 ? -3.746  -26.773 8.598  1.00 0.00 ? 128 ASN A O    3  
ATOM   1438 C  CB   . ASN A 1 27 ? -6.238  -25.568 10.115 1.00 0.00 ? 128 ASN A CB   3  
ATOM   1439 C  CG   . ASN A 1 27 ? -7.108  -24.508 10.793 1.00 0.00 ? 128 ASN A CG   3  
ATOM   1440 O  OD1  . ASN A 1 27 ? -6.776  -23.335 10.846 1.00 0.00 ? 128 ASN A OD1  3  
ATOM   1441 N  ND2  . ASN A 1 27 ? -8.238  -24.985 11.308 1.00 0.00 ? 128 ASN A ND2  3  
ATOM   1442 H  H    . ASN A 1 27 ? -6.356  -23.333 9.016  1.00 0.00 ? 128 ASN A H    3  
ATOM   1443 H  HA   . ASN A 1 27 ? -4.274  -24.644 10.085 1.00 0.00 ? 128 ASN A HA   3  
ATOM   1444 H  HB2  . ASN A 1 27 ? -6.840  -26.140 9.410  1.00 0.00 ? 128 ASN A HB2  3  
ATOM   1445 H  HB3  . ASN A 1 27 ? -5.866  -26.270 10.860 1.00 0.00 ? 128 ASN A HB3  3  
ATOM   1446 H  HD21 . ASN A 1 27 ? -8.221  -25.493 12.168 1.00 0.00 ? 128 ASN A HD21 3  
ATOM   1447 H  HD22 . ASN A 1 27 ? -9.106  -24.834 10.833 1.00 0.00 ? 128 ASN A HD22 3  
ATOM   1448 N  N    . GLU A 1 28 ? -5.099  -25.735 7.114  1.00 0.00 ? 129 GLU A N    3  
ATOM   1449 C  CA   . GLU A 1 28 ? -4.727  -26.596 6.004  1.00 0.00 ? 129 GLU A CA   3  
ATOM   1450 C  C    . GLU A 1 28 ? -3.339  -26.217 5.480  1.00 0.00 ? 129 GLU A C    3  
ATOM   1451 O  O    . GLU A 1 28 ? -3.201  -25.269 4.709  1.00 0.00 ? 129 GLU A O    3  
ATOM   1452 C  CB   . GLU A 1 28 ? -5.770  -26.532 4.887  1.00 0.00 ? 129 GLU A CB   3  
ATOM   1453 C  CG   . GLU A 1 28 ? -7.167  -26.858 5.421  1.00 0.00 ? 129 GLU A CG   3  
ATOM   1454 C  CD   . GLU A 1 28 ? -7.879  -25.590 5.898  1.00 0.00 ? 129 GLU A CD   3  
ATOM   1455 O  OE1  . GLU A 1 28 ? -7.533  -24.511 5.371  1.00 0.00 ? 129 GLU A OE1  3  
ATOM   1456 O  OE2  . GLU A 1 28 ? -8.755  -25.730 6.779  1.00 0.00 ? 129 GLU A OE2  3  
ATOM   1457 H  H    . GLU A 1 28 ? -5.769  -25.025 6.892  1.00 0.00 ? 129 GLU A H    3  
ATOM   1458 H  HA   . GLU A 1 28 ? -4.704  -27.605 6.414  1.00 0.00 ? 129 GLU A HA   3  
ATOM   1459 H  HB2  . GLU A 1 28 ? -5.770  -25.537 4.439  1.00 0.00 ? 129 GLU A HB2  3  
ATOM   1460 H  HB3  . GLU A 1 28 ? -5.506  -27.236 4.097  1.00 0.00 ? 129 GLU A HB3  3  
ATOM   1461 H  HG2  . GLU A 1 28 ? -7.756  -27.338 4.640  1.00 0.00 ? 129 GLU A HG2  3  
ATOM   1462 H  HG3  . GLU A 1 28 ? -7.089  -27.567 6.244  1.00 0.00 ? 129 GLU A HG3  3  
ATOM   1463 N  N    . LYS A 1 29 ? -2.348  -26.978 5.920  1.00 0.00 ? 130 LYS A N    3  
ATOM   1464 C  CA   . LYS A 1 29 ? -0.977  -26.734 5.506  1.00 0.00 ? 130 LYS A CA   3  
ATOM   1465 C  C    . LYS A 1 29 ? -0.915  -26.669 3.979  1.00 0.00 ? 130 LYS A C    3  
ATOM   1466 O  O    . LYS A 1 29 ? -0.379  -25.715 3.417  1.00 0.00 ? 130 LYS A O    3  
ATOM   1467 C  CB   . LYS A 1 29 ? -0.040  -27.779 6.117  1.00 0.00 ? 130 LYS A CB   3  
ATOM   1468 C  CG   . LYS A 1 29 ? 1.212   -27.118 6.698  1.00 0.00 ? 130 LYS A CG   3  
ATOM   1469 C  CD   . LYS A 1 29 ? 2.016   -26.412 5.607  1.00 0.00 ? 130 LYS A CD   3  
ATOM   1470 C  CE   . LYS A 1 29 ? 3.428   -26.078 6.095  1.00 0.00 ? 130 LYS A CE   3  
ATOM   1471 N  NZ   . LYS A 1 29 ? 3.412   -24.854 6.927  1.00 0.00 ? 130 LYS A NZ   3  
ATOM   1472 H  H    . LYS A 1 29 ? -2.471  -27.748 6.548  1.00 0.00 ? 130 LYS A H    3  
ATOM   1473 H  HA   . LYS A 1 29 ? -0.683  -25.765 5.906  1.00 0.00 ? 130 LYS A HA   3  
ATOM   1474 H  HB2  . LYS A 1 29 ? -0.562  -28.330 6.899  1.00 0.00 ? 130 LYS A HB2  3  
ATOM   1475 H  HB3  . LYS A 1 29 ? 0.248   -28.503 5.355  1.00 0.00 ? 130 LYS A HB3  3  
ATOM   1476 H  HG2  . LYS A 1 29 ? 0.924   -26.400 7.467  1.00 0.00 ? 130 LYS A HG2  3  
ATOM   1477 H  HG3  . LYS A 1 29 ? 1.832   -27.871 7.184  1.00 0.00 ? 130 LYS A HG3  3  
ATOM   1478 H  HD2  . LYS A 1 29 ? 2.075   -27.047 4.723  1.00 0.00 ? 130 LYS A HD2  3  
ATOM   1479 H  HD3  . LYS A 1 29 ? 1.506   -25.496 5.308  1.00 0.00 ? 130 LYS A HD3  3  
ATOM   1480 H  HE2  . LYS A 1 29 ? 3.827   -26.912 6.672  1.00 0.00 ? 130 LYS A HE2  3  
ATOM   1481 H  HE3  . LYS A 1 29 ? 4.090   -25.936 5.241  1.00 0.00 ? 130 LYS A HE3  3  
ATOM   1482 H  HZ1  . LYS A 1 29 ? 3.588   -24.056 6.350  1.00 0.00 ? 130 LYS A HZ1  3  
ATOM   1483 H  HZ2  . LYS A 1 29 ? 2.518   -24.758 7.364  1.00 0.00 ? 130 LYS A HZ2  3  
ATOM   1484 H  HZ3  . LYS A 1 29 ? 4.121   -24.919 7.629  1.00 0.00 ? 130 LYS A HZ3  3  
HETATM 1485 ZN ZN   . ZN  B 2 .  ? -1.367  -12.594 8.557  1.00 0.00 ? 1   ZN  A ZN   3  
ATOM   1486 N  N    . ARG A 1 1  ? 1.734   0.059   0.932  1.00 0.00 ? 102 ARG A N    4  
ATOM   1487 C  CA   . ARG A 1 1  ? 1.971   0.010   -0.500 1.00 0.00 ? 102 ARG A CA   4  
ATOM   1488 C  C    . ARG A 1 1  ? 2.525   -1.359  -0.900 1.00 0.00 ? 102 ARG A C    4  
ATOM   1489 O  O    . ARG A 1 1  ? 2.649   -1.660  -2.086 1.00 0.00 ? 102 ARG A O    4  
ATOM   1490 C  CB   . ARG A 1 1  ? 2.956   1.098   -0.934 1.00 0.00 ? 102 ARG A CB   4  
ATOM   1491 C  CG   . ARG A 1 1  ? 3.962   1.400   0.178  1.00 0.00 ? 102 ARG A CG   4  
ATOM   1492 C  CD   . ARG A 1 1  ? 4.730   0.139   0.581  1.00 0.00 ? 102 ARG A CD   4  
ATOM   1493 N  NE   . ARG A 1 1  ? 6.094   0.497   1.028  1.00 0.00 ? 102 ARG A NE   4  
ATOM   1494 C  CZ   . ARG A 1 1  ? 6.943   -0.361  1.611  1.00 0.00 ? 102 ARG A CZ   4  
ATOM   1495 N  NH1  . ARG A 1 1  ? 6.476   -1.318  2.423  1.00 0.00 ? 102 ARG A NH1  4  
ATOM   1496 N  NH2  . ARG A 1 1  ? 8.259   -0.260  1.382  1.00 0.00 ? 102 ARG A NH2  4  
ATOM   1497 H  H    . ARG A 1 1  ? 1.577   0.974   1.304  1.00 0.00 ? 102 ARG A H    4  
ATOM   1498 H  HA   . ARG A 1 1  ? 0.994   0.184   -0.950 1.00 0.00 ? 102 ARG A HA   4  
ATOM   1499 H  HB2  . ARG A 1 1  ? 3.485   0.779   -1.831 1.00 0.00 ? 102 ARG A HB2  4  
ATOM   1500 H  HB3  . ARG A 1 1  ? 2.410   2.006   -1.192 1.00 0.00 ? 102 ARG A HB3  4  
ATOM   1501 H  HG2  . ARG A 1 1  ? 4.663   2.164   -0.159 1.00 0.00 ? 102 ARG A HG2  4  
ATOM   1502 H  HG3  . ARG A 1 1  ? 3.441   1.805   1.046  1.00 0.00 ? 102 ARG A HG3  4  
ATOM   1503 H  HD2  . ARG A 1 1  ? 4.200   -0.380  1.380  1.00 0.00 ? 102 ARG A HD2  4  
ATOM   1504 H  HD3  . ARG A 1 1  ? 4.784   -0.548  -0.264 1.00 0.00 ? 102 ARG A HD3  4  
ATOM   1505 H  HE   . ARG A 1 1  ? 6.402   1.439   0.888  1.00 0.00 ? 102 ARG A HE   4  
ATOM   1506 H  HH11 . ARG A 1 1  ? 5.994   -1.070  3.263  1.00 0.00 ? 102 ARG A HH11 4  
ATOM   1507 H  HH12 . ARG A 1 1  ? 6.609   -2.282  2.189  1.00 0.00 ? 102 ARG A HH12 4  
ATOM   1508 H  HH21 . ARG A 1 1  ? 8.591   -0.006  0.473  1.00 0.00 ? 102 ARG A HH21 4  
ATOM   1509 H  HH22 . ARG A 1 1  ? 8.910   -0.440  2.119  1.00 0.00 ? 102 ARG A HH22 4  
ATOM   1510 N  N    . SER A 1 2  ? 2.845   -2.151  0.112  1.00 0.00 ? 103 SER A N    4  
ATOM   1511 C  CA   . SER A 1 2  ? 3.383   -3.480  -0.119 1.00 0.00 ? 103 SER A CA   4  
ATOM   1512 C  C    . SER A 1 2  ? 2.460   -4.533  0.497  1.00 0.00 ? 103 SER A C    4  
ATOM   1513 O  O    . SER A 1 2  ? 2.005   -4.379  1.630  1.00 0.00 ? 103 SER A O    4  
ATOM   1514 C  CB   . SER A 1 2  ? 4.795   -3.611  0.456  1.00 0.00 ? 103 SER A CB   4  
ATOM   1515 O  OG   . SER A 1 2  ? 5.776   -3.757  -0.566 1.00 0.00 ? 103 SER A OG   4  
ATOM   1516 H  H    . SER A 1 2  ? 2.741   -1.898  1.074  1.00 0.00 ? 103 SER A H    4  
ATOM   1517 H  HA   . SER A 1 2  ? 3.422   -3.593  -1.202 1.00 0.00 ? 103 SER A HA   4  
ATOM   1518 H  HB2  . SER A 1 2  ? 5.025   -2.730  1.057  1.00 0.00 ? 103 SER A HB2  4  
ATOM   1519 H  HB3  . SER A 1 2  ? 4.837   -4.471  1.124  1.00 0.00 ? 103 SER A HB3  4  
ATOM   1520 H  HG   . SER A 1 2  ? 6.666   -3.444  -0.234 1.00 0.00 ? 103 SER A HG   4  
ATOM   1521 N  N    . PHE A 1 3  ? 2.211   -5.580  -0.275 1.00 0.00 ? 104 PHE A N    4  
ATOM   1522 C  CA   . PHE A 1 3  ? 1.350   -6.658  0.181  1.00 0.00 ? 104 PHE A CA   4  
ATOM   1523 C  C    . PHE A 1 3  ? 1.245   -6.669  1.707  1.00 0.00 ? 104 PHE A C    4  
ATOM   1524 O  O    . PHE A 1 3  ? 2.246   -6.511  2.403  1.00 0.00 ? 104 PHE A O    4  
ATOM   1525 C  CB   . PHE A 1 3  ? 1.991   -7.969  -0.283 1.00 0.00 ? 104 PHE A CB   4  
ATOM   1526 C  CG   . PHE A 1 3  ? 2.370   -7.986  -1.765 1.00 0.00 ? 104 PHE A CG   4  
ATOM   1527 C  CD1  . PHE A 1 3  ? 1.416   -8.216  -2.707 1.00 0.00 ? 104 PHE A CD1  4  
ATOM   1528 C  CD2  . PHE A 1 3  ? 3.658   -7.771  -2.139 1.00 0.00 ? 104 PHE A CD2  4  
ATOM   1529 C  CE1  . PHE A 1 3  ? 1.769   -8.232  -4.083 1.00 0.00 ? 104 PHE A CE1  4  
ATOM   1530 C  CE2  . PHE A 1 3  ? 4.011   -7.788  -3.515 1.00 0.00 ? 104 PHE A CE2  4  
ATOM   1531 C  CZ   . PHE A 1 3  ? 3.058   -8.018  -4.458 1.00 0.00 ? 104 PHE A CZ   4  
ATOM   1532 H  H    . PHE A 1 3  ? 2.586   -5.699  -1.195 1.00 0.00 ? 104 PHE A H    4  
ATOM   1533 H  HA   . PHE A 1 3  ? 0.363   -6.488  -0.249 1.00 0.00 ? 104 PHE A HA   4  
ATOM   1534 H  HB2  . PHE A 1 3  ? 2.885   -8.155  0.313  1.00 0.00 ? 104 PHE A HB2  4  
ATOM   1535 H  HB3  . PHE A 1 3  ? 1.300   -8.789  -0.085 1.00 0.00 ? 104 PHE A HB3  4  
ATOM   1536 H  HD1  . PHE A 1 3  ? 0.383   -8.388  -2.407 1.00 0.00 ? 104 PHE A HD1  4  
ATOM   1537 H  HD2  . PHE A 1 3  ? 4.422   -7.588  -1.383 1.00 0.00 ? 104 PHE A HD2  4  
ATOM   1538 H  HE1  . PHE A 1 3  ? 1.005   -8.417  -4.839 1.00 0.00 ? 104 PHE A HE1  4  
ATOM   1539 H  HE2  . PHE A 1 3  ? 5.045   -7.616  -3.815 1.00 0.00 ? 104 PHE A HE2  4  
ATOM   1540 H  HZ   . PHE A 1 3  ? 3.328   -8.030  -5.514 1.00 0.00 ? 104 PHE A HZ   4  
ATOM   1541 N  N    . VAL A 1 4  ? 0.022   -6.854  2.182  1.00 0.00 ? 105 VAL A N    4  
ATOM   1542 C  CA   . VAL A 1 4  ? -0.227  -6.886  3.614  1.00 0.00 ? 105 VAL A CA   4  
ATOM   1543 C  C    . VAL A 1 4  ? -1.283  -7.952  3.919  1.00 0.00 ? 105 VAL A C    4  
ATOM   1544 O  O    . VAL A 1 4  ? -2.364  -7.944  3.335  1.00 0.00 ? 105 VAL A O    4  
ATOM   1545 C  CB   . VAL A 1 4  ? -0.624  -5.494  4.107  1.00 0.00 ? 105 VAL A CB   4  
ATOM   1546 C  CG1  . VAL A 1 4  ? -0.518  -5.401  5.630  1.00 0.00 ? 105 VAL A CG1  4  
ATOM   1547 C  CG2  . VAL A 1 4  ? 0.222   -4.412  3.432  1.00 0.00 ? 105 VAL A CG2  4  
ATOM   1548 H  H    . VAL A 1 4  ? -0.787  -6.981  1.609  1.00 0.00 ? 105 VAL A H    4  
ATOM   1549 H  HA   . VAL A 1 4  ? 0.705   -7.165  4.104  1.00 0.00 ? 105 VAL A HA   4  
ATOM   1550 H  HB   . VAL A 1 4  ? -1.665  -5.325  3.833  1.00 0.00 ? 105 VAL A HB   4  
ATOM   1551 H  HG11 . VAL A 1 4  ? -1.494  -5.593  6.075  1.00 0.00 ? 105 VAL A HG11 4  
ATOM   1552 H  HG12 . VAL A 1 4  ? 0.197   -6.140  5.991  1.00 0.00 ? 105 VAL A HG12 4  
ATOM   1553 H  HG13 . VAL A 1 4  ? -0.180  -4.403  5.911  1.00 0.00 ? 105 VAL A HG13 4  
ATOM   1554 H  HG21 . VAL A 1 4  ? 0.034   -4.421  2.358  1.00 0.00 ? 105 VAL A HG21 4  
ATOM   1555 H  HG22 . VAL A 1 4  ? -0.045  -3.436  3.839  1.00 0.00 ? 105 VAL A HG22 4  
ATOM   1556 H  HG23 . VAL A 1 4  ? 1.277   -4.607  3.618  1.00 0.00 ? 105 VAL A HG23 4  
ATOM   1557 N  N    . CYS A 1 5  ? -0.931  -8.842  4.836  1.00 0.00 ? 106 CYS A N    4  
ATOM   1558 C  CA   . CYS A 1 5  ? -1.833  -9.910  5.226  1.00 0.00 ? 106 CYS A CA   4  
ATOM   1559 C  C    . CYS A 1 5  ? -3.139  -9.281  5.719  1.00 0.00 ? 106 CYS A C    4  
ATOM   1560 O  O    . CYS A 1 5  ? -3.193  -8.743  6.823  1.00 0.00 ? 106 CYS A O    4  
ATOM   1561 C  CB   . CYS A 1 5  ? -1.206  -10.824 6.281  1.00 0.00 ? 106 CYS A CB   4  
ATOM   1562 S  SG   . CYS A 1 5  ? -2.250  -12.308 6.525  1.00 0.00 ? 106 CYS A SG   4  
ATOM   1563 H  H    . CYS A 1 5  ? -0.049  -8.840  5.307  1.00 0.00 ? 106 CYS A H    4  
ATOM   1564 H  HA   . CYS A 1 5  ? -2.007  -10.515 4.335  1.00 0.00 ? 106 CYS A HA   4  
ATOM   1565 H  HB2  . CYS A 1 5  ? -0.205  -11.121 5.967  1.00 0.00 ? 106 CYS A HB2  4  
ATOM   1566 H  HB3  . CYS A 1 5  ? -1.099  -10.286 7.223  1.00 0.00 ? 106 CYS A HB3  4  
ATOM   1567 N  N    . GLU A 1 6  ? -4.157  -9.371  4.877  1.00 0.00 ? 107 GLU A N    4  
ATOM   1568 C  CA   . GLU A 1 6  ? -5.457  -8.817  5.212  1.00 0.00 ? 107 GLU A CA   4  
ATOM   1569 C  C    . GLU A 1 6  ? -5.992  -9.459  6.494  1.00 0.00 ? 107 GLU A C    4  
ATOM   1570 O  O    . GLU A 1 6  ? -7.038  -9.060  7.003  1.00 0.00 ? 107 GLU A O    4  
ATOM   1571 C  CB   . GLU A 1 6  ? -6.444  -8.995  4.058  1.00 0.00 ? 107 GLU A CB   4  
ATOM   1572 C  CG   . GLU A 1 6  ? -5.742  -8.838  2.707  1.00 0.00 ? 107 GLU A CG   4  
ATOM   1573 C  CD   . GLU A 1 6  ? -5.425  -10.203 2.091  1.00 0.00 ? 107 GLU A CD   4  
ATOM   1574 O  OE1  . GLU A 1 6  ? -5.193  -11.142 2.883  1.00 0.00 ? 107 GLU A OE1  4  
ATOM   1575 O  OE2  . GLU A 1 6  ? -5.423  -10.276 0.844  1.00 0.00 ? 107 GLU A OE2  4  
ATOM   1576 H  H    . GLU A 1 6  ? -4.104  -9.811  3.980  1.00 0.00 ? 107 GLU A H    4  
ATOM   1577 H  HA   . GLU A 1 6  ? -5.286  -7.753  5.375  1.00 0.00 ? 107 GLU A HA   4  
ATOM   1578 H  HB2  . GLU A 1 6  ? -6.907  -9.981  4.118  1.00 0.00 ? 107 GLU A HB2  4  
ATOM   1579 H  HB3  . GLU A 1 6  ? -7.245  -8.261  4.142  1.00 0.00 ? 107 GLU A HB3  4  
ATOM   1580 H  HG2  . GLU A 1 6  ? -6.376  -8.268  2.028  1.00 0.00 ? 107 GLU A HG2  4  
ATOM   1581 H  HG3  . GLU A 1 6  ? -4.821  -8.271  2.837  1.00 0.00 ? 107 GLU A HG3  4  
ATOM   1582 N  N    . VAL A 1 7  ? -5.249  -10.443 6.980  1.00 0.00 ? 108 VAL A N    4  
ATOM   1583 C  CA   . VAL A 1 7  ? -5.636  -11.144 8.193  1.00 0.00 ? 108 VAL A CA   4  
ATOM   1584 C  C    . VAL A 1 7  ? -5.006  -10.447 9.402  1.00 0.00 ? 108 VAL A C    4  
ATOM   1585 O  O    . VAL A 1 7  ? -5.705  -9.817  10.193 1.00 0.00 ? 108 VAL A O    4  
ATOM   1586 C  CB   . VAL A 1 7  ? -5.253  -12.622 8.089  1.00 0.00 ? 108 VAL A CB   4  
ATOM   1587 C  CG1  . VAL A 1 7  ? -5.350  -13.311 9.450  1.00 0.00 ? 108 VAL A CG1  4  
ATOM   1588 C  CG2  . VAL A 1 7  ? -6.115  -13.339 7.047  1.00 0.00 ? 108 VAL A CG2  4  
ATOM   1589 H  H    . VAL A 1 7  ? -4.399  -10.761 6.561  1.00 0.00 ? 108 VAL A H    4  
ATOM   1590 H  HA   . VAL A 1 7  ? -6.720  -11.081 8.278  1.00 0.00 ? 108 VAL A HA   4  
ATOM   1591 H  HB   . VAL A 1 7  ? -4.215  -12.677 7.758  1.00 0.00 ? 108 VAL A HB   4  
ATOM   1592 H  HG11 . VAL A 1 7  ? -5.470  -14.385 9.306  1.00 0.00 ? 108 VAL A HG11 4  
ATOM   1593 H  HG12 . VAL A 1 7  ? -4.441  -13.120 10.020 1.00 0.00 ? 108 VAL A HG12 4  
ATOM   1594 H  HG13 . VAL A 1 7  ? -6.210  -12.920 9.995  1.00 0.00 ? 108 VAL A HG13 4  
ATOM   1595 H  HG21 . VAL A 1 7  ? -7.168  -13.179 7.276  1.00 0.00 ? 108 VAL A HG21 4  
ATOM   1596 H  HG22 . VAL A 1 7  ? -5.894  -12.942 6.056  1.00 0.00 ? 108 VAL A HG22 4  
ATOM   1597 H  HG23 . VAL A 1 7  ? -5.897  -14.406 7.067  1.00 0.00 ? 108 VAL A HG23 4  
ATOM   1598 N  N    . CYS A 1 8  ? -3.693  -10.586 9.506  1.00 0.00 ? 109 CYS A N    4  
ATOM   1599 C  CA   . CYS A 1 8  ? -2.961  -9.979  10.605 1.00 0.00 ? 109 CYS A CA   4  
ATOM   1600 C  C    . CYS A 1 8  ? -2.568  -8.559  10.193 1.00 0.00 ? 109 CYS A C    4  
ATOM   1601 O  O    . CYS A 1 8  ? -2.346  -7.700  11.046 1.00 0.00 ? 109 CYS A O    4  
ATOM   1602 C  CB   . CYS A 1 8  ? -1.744  -10.815 11.005 1.00 0.00 ? 109 CYS A CB   4  
ATOM   1603 S  SG   . CYS A 1 8  ? -0.558  -10.900 9.614  1.00 0.00 ? 109 CYS A SG   4  
ATOM   1604 H  H    . CYS A 1 8  ? -3.132  -11.101 8.859  1.00 0.00 ? 109 CYS A H    4  
ATOM   1605 H  HA   . CYS A 1 8  ? -3.638  -9.960  11.459 1.00 0.00 ? 109 CYS A HA   4  
ATOM   1606 H  HB2  . CYS A 1 8  ? -1.262  -10.376 11.879 1.00 0.00 ? 109 CYS A HB2  4  
ATOM   1607 H  HB3  . CYS A 1 8  ? -2.059  -11.819 11.287 1.00 0.00 ? 109 CYS A HB3  4  
ATOM   1608 N  N    . THR A 1 9  ? -2.494  -8.355  8.886  1.00 0.00 ? 110 THR A N    4  
ATOM   1609 C  CA   . THR A 1 9  ? -2.131  -7.053  8.350  1.00 0.00 ? 110 THR A CA   4  
ATOM   1610 C  C    . THR A 1 9  ? -0.610  -6.908  8.289  1.00 0.00 ? 110 THR A C    4  
ATOM   1611 O  O    . THR A 1 9  ? -0.084  -5.800  8.387  1.00 0.00 ? 110 THR A O    4  
ATOM   1612 C  CB   . THR A 1 9  ? -2.810  -5.984  9.208  1.00 0.00 ? 110 THR A CB   4  
ATOM   1613 O  OG1  . THR A 1 9  ? -1.995  -5.904  10.374 1.00 0.00 ? 110 THR A OG1  4  
ATOM   1614 C  CG2  . THR A 1 9  ? -4.173  -6.435  9.737  1.00 0.00 ? 110 THR A CG2  4  
ATOM   1615 H  H    . THR A 1 9  ? -2.676  -9.059  8.199  1.00 0.00 ? 110 THR A H    4  
ATOM   1616 H  HA   . THR A 1 9  ? -2.500  -6.988  7.328  1.00 0.00 ? 110 THR A HA   4  
ATOM   1617 H  HB   . THR A 1 9  ? -2.895  -5.044  8.662  1.00 0.00 ? 110 THR A HB   4  
ATOM   1618 H  HG1  . THR A 1 9  ? -1.688  -4.963  10.513 1.00 0.00 ? 110 THR A HG1  4  
ATOM   1619 H  HG21 . THR A 1 9  ? -4.427  -7.404  9.306  1.00 0.00 ? 110 THR A HG21 4  
ATOM   1620 H  HG22 . THR A 1 9  ? -4.131  -6.520  10.823 1.00 0.00 ? 110 THR A HG22 4  
ATOM   1621 H  HG23 . THR A 1 9  ? -4.930  -5.703  9.459  1.00 0.00 ? 110 THR A HG23 4  
ATOM   1622 N  N    . ARG A 1 10 ? 0.056   -8.042  8.127  1.00 0.00 ? 111 ARG A N    4  
ATOM   1623 C  CA   . ARG A 1 10 ? 1.507   -8.055  8.052  1.00 0.00 ? 111 ARG A CA   4  
ATOM   1624 C  C    . ARG A 1 10 ? 1.966   -7.770  6.620  1.00 0.00 ? 111 ARG A C    4  
ATOM   1625 O  O    . ARG A 1 10 ? 1.472   -8.380  5.673  1.00 0.00 ? 111 ARG A O    4  
ATOM   1626 C  CB   . ARG A 1 10 ? 2.071   -9.404  8.502  1.00 0.00 ? 111 ARG A CB   4  
ATOM   1627 C  CG   . ARG A 1 10 ? 2.228   -9.452  10.023 1.00 0.00 ? 111 ARG A CG   4  
ATOM   1628 C  CD   . ARG A 1 10 ? 2.395   -10.892 10.512 1.00 0.00 ? 111 ARG A CD   4  
ATOM   1629 N  NE   . ARG A 1 10 ? 1.665   -11.084 11.785 1.00 0.00 ? 111 ARG A NE   4  
ATOM   1630 C  CZ   . ARG A 1 10 ? 1.436   -12.278 12.348 1.00 0.00 ? 111 ARG A CZ   4  
ATOM   1631 N  NH1  . ARG A 1 10 ? 2.369   -13.238 12.286 1.00 0.00 ? 111 ARG A NH1  4  
ATOM   1632 N  NH2  . ARG A 1 10 ? 0.274   -12.513 12.971 1.00 0.00 ? 111 ARG A NH2  4  
ATOM   1633 H  H    . ARG A 1 10 ? -0.379  -8.940  8.049  1.00 0.00 ? 111 ARG A H    4  
ATOM   1634 H  HA   . ARG A 1 10 ? 1.828   -7.265  8.731  1.00 0.00 ? 111 ARG A HA   4  
ATOM   1635 H  HB2  . ARG A 1 10 ? 1.409   -10.206 8.176  1.00 0.00 ? 111 ARG A HB2  4  
ATOM   1636 H  HB3  . ARG A 1 10 ? 3.036   -9.575  8.028  1.00 0.00 ? 111 ARG A HB3  4  
ATOM   1637 H  HG2  . ARG A 1 10 ? 3.093   -8.861  10.322 1.00 0.00 ? 111 ARG A HG2  4  
ATOM   1638 H  HG3  . ARG A 1 10 ? 1.354   -9.003  10.497 1.00 0.00 ? 111 ARG A HG3  4  
ATOM   1639 H  HD2  . ARG A 1 10 ? 2.019   -11.587 9.759  1.00 0.00 ? 111 ARG A HD2  4  
ATOM   1640 H  HD3  . ARG A 1 10 ? 3.453   -11.117 10.652 1.00 0.00 ? 111 ARG A HD3  4  
ATOM   1641 H  HE   . ARG A 1 10 ? 1.321   -10.271 12.255 1.00 0.00 ? 111 ARG A HE   4  
ATOM   1642 H  HH11 . ARG A 1 10 ? 3.205   -13.159 12.831 1.00 0.00 ? 111 ARG A HH11 4  
ATOM   1643 H  HH12 . ARG A 1 10 ? 2.231   -14.033 11.696 1.00 0.00 ? 111 ARG A HH12 4  
ATOM   1644 H  HH21 . ARG A 1 10 ? -0.530  -11.959 12.755 1.00 0.00 ? 111 ARG A HH21 4  
ATOM   1645 H  HH22 . ARG A 1 10 ? 0.210   -13.242 13.652 1.00 0.00 ? 111 ARG A HH22 4  
ATOM   1646 N  N    . ALA A 1 11 ? 2.906   -6.843  6.508  1.00 0.00 ? 112 ALA A N    4  
ATOM   1647 C  CA   . ALA A 1 11 ? 3.438   -6.470  5.208  1.00 0.00 ? 112 ALA A CA   4  
ATOM   1648 C  C    . ALA A 1 11 ? 4.764   -7.198  4.977  1.00 0.00 ? 112 ALA A C    4  
ATOM   1649 O  O    . ALA A 1 11 ? 5.559   -7.357  5.902  1.00 0.00 ? 112 ALA A O    4  
ATOM   1650 C  CB   . ALA A 1 11 ? 3.587   -4.950  5.134  1.00 0.00 ? 112 ALA A CB   4  
ATOM   1651 H  H    . ALA A 1 11 ? 3.304   -6.353  7.284  1.00 0.00 ? 112 ALA A H    4  
ATOM   1652 H  HA   . ALA A 1 11 ? 2.721   -6.791  4.452  1.00 0.00 ? 112 ALA A HA   4  
ATOM   1653 H  HB1  . ALA A 1 11 ? 2.746   -4.478  5.643  1.00 0.00 ? 112 ALA A HB1  4  
ATOM   1654 H  HB2  . ALA A 1 11 ? 4.517   -4.652  5.616  1.00 0.00 ? 112 ALA A HB2  4  
ATOM   1655 H  HB3  . ALA A 1 11 ? 3.602   -4.637  4.090  1.00 0.00 ? 112 ALA A HB3  4  
ATOM   1656 N  N    . PHE A 1 12 ? 4.963   -7.619  3.736  1.00 0.00 ? 113 PHE A N    4  
ATOM   1657 C  CA   . PHE A 1 12 ? 6.179   -8.325  3.372  1.00 0.00 ? 113 PHE A CA   4  
ATOM   1658 C  C    . PHE A 1 12 ? 6.790   -7.743  2.095  1.00 0.00 ? 113 PHE A C    4  
ATOM   1659 O  O    . PHE A 1 12 ? 6.094   -7.107  1.305  1.00 0.00 ? 113 PHE A O    4  
ATOM   1660 C  CB   . PHE A 1 12 ? 5.790   -9.783  3.118  1.00 0.00 ? 113 PHE A CB   4  
ATOM   1661 C  CG   . PHE A 1 12 ? 5.203   -10.492 4.340  1.00 0.00 ? 113 PHE A CG   4  
ATOM   1662 C  CD1  . PHE A 1 12 ? 6.029   -11.041 5.271  1.00 0.00 ? 113 PHE A CD1  4  
ATOM   1663 C  CD2  . PHE A 1 12 ? 3.854   -10.575 4.495  1.00 0.00 ? 113 PHE A CD2  4  
ATOM   1664 C  CE1  . PHE A 1 12 ? 5.483   -11.699 6.404  1.00 0.00 ? 113 PHE A CE1  4  
ATOM   1665 C  CE2  . PHE A 1 12 ? 3.308   -11.233 5.628  1.00 0.00 ? 113 PHE A CE2  4  
ATOM   1666 C  CZ   . PHE A 1 12 ? 4.135   -11.780 6.559  1.00 0.00 ? 113 PHE A CZ   4  
ATOM   1667 H  H    . PHE A 1 12 ? 4.311   -7.486  2.990  1.00 0.00 ? 113 PHE A H    4  
ATOM   1668 H  HA   . PHE A 1 12 ? 6.883   -8.206  4.196  1.00 0.00 ? 113 PHE A HA   4  
ATOM   1669 H  HB2  . PHE A 1 12 ? 5.065   -9.820  2.306  1.00 0.00 ? 113 PHE A HB2  4  
ATOM   1670 H  HB3  . PHE A 1 12 ? 6.671   -10.330 2.782  1.00 0.00 ? 113 PHE A HB3  4  
ATOM   1671 H  HD1  . PHE A 1 12 ? 7.110   -10.974 5.146  1.00 0.00 ? 113 PHE A HD1  4  
ATOM   1672 H  HD2  . PHE A 1 12 ? 3.192   -10.135 3.749  1.00 0.00 ? 113 PHE A HD2  4  
ATOM   1673 H  HE1  . PHE A 1 12 ? 6.145   -12.138 7.151  1.00 0.00 ? 113 PHE A HE1  4  
ATOM   1674 H  HE2  . PHE A 1 12 ? 2.227   -11.298 5.752  1.00 0.00 ? 113 PHE A HE2  4  
ATOM   1675 H  HZ   . PHE A 1 12 ? 3.715   -12.286 7.430  1.00 0.00 ? 113 PHE A HZ   4  
ATOM   1676 N  N    . ALA A 1 13 ? 8.083   -7.982  1.934  1.00 0.00 ? 114 ALA A N    4  
ATOM   1677 C  CA   . ALA A 1 13 ? 8.794   -7.489  0.766  1.00 0.00 ? 114 ALA A CA   4  
ATOM   1678 C  C    . ALA A 1 13 ? 8.466   -8.374  -0.438 1.00 0.00 ? 114 ALA A C    4  
ATOM   1679 O  O    . ALA A 1 13 ? 8.631   -7.957  -1.583 1.00 0.00 ? 114 ALA A O    4  
ATOM   1680 C  CB   . ALA A 1 13 ? 10.294  -7.443  1.064  1.00 0.00 ? 114 ALA A CB   4  
ATOM   1681 H  H    . ALA A 1 13 ? 8.641   -8.501  2.581  1.00 0.00 ? 114 ALA A H    4  
ATOM   1682 H  HA   . ALA A 1 13 ? 8.445   -6.476  0.568  1.00 0.00 ? 114 ALA A HA   4  
ATOM   1683 H  HB1  . ALA A 1 13 ? 10.495  -6.662  1.799  1.00 0.00 ? 114 ALA A HB1  4  
ATOM   1684 H  HB2  . ALA A 1 13 ? 10.615  -8.406  1.462  1.00 0.00 ? 114 ALA A HB2  4  
ATOM   1685 H  HB3  . ALA A 1 13 ? 10.841  -7.228  0.147  1.00 0.00 ? 114 ALA A HB3  4  
ATOM   1686 N  N    . ARG A 1 14 ? 8.008   -9.580  -0.137 1.00 0.00 ? 115 ARG A N    4  
ATOM   1687 C  CA   . ARG A 1 14 ? 7.655   -10.528 -1.181 1.00 0.00 ? 115 ARG A CA   4  
ATOM   1688 C  C    . ARG A 1 14 ? 6.243   -11.070 -0.949 1.00 0.00 ? 115 ARG A C    4  
ATOM   1689 O  O    . ARG A 1 14 ? 5.780   -11.143 0.187  1.00 0.00 ? 115 ARG A O    4  
ATOM   1690 C  CB   . ARG A 1 14 ? 8.642   -11.697 -1.219 1.00 0.00 ? 115 ARG A CB   4  
ATOM   1691 C  CG   . ARG A 1 14 ? 10.074  -11.212 -0.988 1.00 0.00 ? 115 ARG A CG   4  
ATOM   1692 C  CD   . ARG A 1 14 ? 10.581  -11.637 0.392  1.00 0.00 ? 115 ARG A CD   4  
ATOM   1693 N  NE   . ARG A 1 14 ? 11.795  -12.472 0.250  1.00 0.00 ? 115 ARG A NE   4  
ATOM   1694 C  CZ   . ARG A 1 14 ? 13.036  -11.980 0.128  1.00 0.00 ? 115 ARG A CZ   4  
ATOM   1695 N  NH1  . ARG A 1 14 ? 13.457  -11.509 -1.054 1.00 0.00 ? 115 ARG A NH1  4  
ATOM   1696 N  NH2  . ARG A 1 14 ? 13.855  -11.959 1.188  1.00 0.00 ? 115 ARG A NH2  4  
ATOM   1697 H  H    . ARG A 1 14 ? 7.876   -9.913  0.797  1.00 0.00 ? 115 ARG A H    4  
ATOM   1698 H  HA   . ARG A 1 14 ? 7.710   -9.957  -2.106 1.00 0.00 ? 115 ARG A HA   4  
ATOM   1699 H  HB2  . ARG A 1 14 ? 8.375   -12.429 -0.457 1.00 0.00 ? 115 ARG A HB2  4  
ATOM   1700 H  HB3  . ARG A 1 14 ? 8.575   -12.202 -2.183 1.00 0.00 ? 115 ARG A HB3  4  
ATOM   1701 H  HG2  . ARG A 1 14 ? 10.728  -11.618 -1.760 1.00 0.00 ? 115 ARG A HG2  4  
ATOM   1702 H  HG3  . ARG A 1 14 ? 10.113  -10.127 -1.076 1.00 0.00 ? 115 ARG A HG3  4  
ATOM   1703 H  HD2  . ARG A 1 14 ? 10.805  -10.756 0.993  1.00 0.00 ? 115 ARG A HD2  4  
ATOM   1704 H  HD3  . ARG A 1 14 ? 9.806   -12.194 0.917  1.00 0.00 ? 115 ARG A HD3  4  
ATOM   1705 H  HE   . ARG A 1 14 ? 11.683  -13.466 0.244  1.00 0.00 ? 115 ARG A HE   4  
ATOM   1706 H  HH11 . ARG A 1 14 ? 13.224  -10.577 -1.332 1.00 0.00 ? 115 ARG A HH11 4  
ATOM   1707 H  HH12 . ARG A 1 14 ? 14.003  -12.089 -1.657 1.00 0.00 ? 115 ARG A HH12 4  
ATOM   1708 H  HH21 . ARG A 1 14 ? 13.962  -12.777 1.753  1.00 0.00 ? 115 ARG A HH21 4  
ATOM   1709 H  HH22 . ARG A 1 14 ? 14.359  -11.126 1.414  1.00 0.00 ? 115 ARG A HH22 4  
ATOM   1710 N  N    . GLN A 1 15 ? 5.597   -11.436 -2.047 1.00 0.00 ? 116 GLN A N    4  
ATOM   1711 C  CA   . GLN A 1 15 ? 4.247   -11.969 -1.980 1.00 0.00 ? 116 GLN A CA   4  
ATOM   1712 C  C    . GLN A 1 15 ? 4.262   -13.376 -1.380 1.00 0.00 ? 116 GLN A C    4  
ATOM   1713 O  O    . GLN A 1 15 ? 3.454   -13.691 -0.508 1.00 0.00 ? 116 GLN A O    4  
ATOM   1714 C  CB   . GLN A 1 15 ? 3.587   -11.968 -3.359 1.00 0.00 ? 116 GLN A CB   4  
ATOM   1715 C  CG   . GLN A 1 15 ? 4.115   -10.817 -4.219 1.00 0.00 ? 116 GLN A CG   4  
ATOM   1716 C  CD   . GLN A 1 15 ? 5.146   -11.318 -5.233 1.00 0.00 ? 116 GLN A CD   4  
ATOM   1717 O  OE1  . GLN A 1 15 ? 5.340   -12.506 -5.424 1.00 0.00 ? 116 GLN A OE1  4  
ATOM   1718 N  NE2  . GLN A 1 15 ? 5.793   -10.346 -5.871 1.00 0.00 ? 116 GLN A NE2  4  
ATOM   1719 H  H    . GLN A 1 15 ? 5.981   -11.373 -2.969 1.00 0.00 ? 116 GLN A H    4  
ATOM   1720 H  HA   . GLN A 1 15 ? 3.702   -11.293 -1.322 1.00 0.00 ? 116 GLN A HA   4  
ATOM   1721 H  HB2  . GLN A 1 15 ? 3.780   -12.917 -3.860 1.00 0.00 ? 116 GLN A HB2  4  
ATOM   1722 H  HB3  . GLN A 1 15 ? 2.506   -11.879 -3.250 1.00 0.00 ? 116 GLN A HB3  4  
ATOM   1723 H  HG2  . GLN A 1 15 ? 3.286   -10.340 -4.743 1.00 0.00 ? 116 GLN A HG2  4  
ATOM   1724 H  HG3  . GLN A 1 15 ? 4.567   -10.059 -3.580 1.00 0.00 ? 116 GLN A HG3  4  
ATOM   1725 H  HE21 . GLN A 1 15 ? 5.397   -9.936  -6.692 1.00 0.00 ? 116 GLN A HE21 4  
ATOM   1726 H  HE22 . GLN A 1 15 ? 6.677   -10.025 -5.528 1.00 0.00 ? 116 GLN A HE22 4  
ATOM   1727 N  N    . GLU A 1 16 ? 5.190   -14.185 -1.871 1.00 0.00 ? 117 GLU A N    4  
ATOM   1728 C  CA   . GLU A 1 16 ? 5.320   -15.551 -1.395 1.00 0.00 ? 117 GLU A CA   4  
ATOM   1729 C  C    . GLU A 1 16 ? 5.234   -15.591 0.133  1.00 0.00 ? 117 GLU A C    4  
ATOM   1730 O  O    . GLU A 1 16 ? 4.524   -16.423 0.697  1.00 0.00 ? 117 GLU A O    4  
ATOM   1731 C  CB   . GLU A 1 16 ? 6.624   -16.182 -1.887 1.00 0.00 ? 117 GLU A CB   4  
ATOM   1732 C  CG   . GLU A 1 16 ? 6.885   -15.827 -3.353 1.00 0.00 ? 117 GLU A CG   4  
ATOM   1733 C  CD   . GLU A 1 16 ? 5.579   -15.783 -4.147 1.00 0.00 ? 117 GLU A CD   4  
ATOM   1734 O  OE1  . GLU A 1 16 ? 4.745   -16.687 -3.921 1.00 0.00 ? 117 GLU A OE1  4  
ATOM   1735 O  OE2  . GLU A 1 16 ? 5.442   -14.845 -4.963 1.00 0.00 ? 117 GLU A OE2  4  
ATOM   1736 H  H    . GLU A 1 16 ? 5.843   -13.921 -2.580 1.00 0.00 ? 117 GLU A H    4  
ATOM   1737 H  HA   . GLU A 1 16 ? 4.477   -16.091 -1.826 1.00 0.00 ? 117 GLU A HA   4  
ATOM   1738 H  HB2  . GLU A 1 16 ? 7.454   -15.836 -1.271 1.00 0.00 ? 117 GLU A HB2  4  
ATOM   1739 H  HB3  . GLU A 1 16 ? 6.573   -17.265 -1.775 1.00 0.00 ? 117 GLU A HB3  4  
ATOM   1740 H  HG2  . GLU A 1 16 ? 7.384   -14.860 -3.412 1.00 0.00 ? 117 GLU A HG2  4  
ATOM   1741 H  HG3  . GLU A 1 16 ? 7.558   -16.562 -3.793 1.00 0.00 ? 117 GLU A HG3  4  
ATOM   1742 N  N    . HIS A 1 17 ? 5.967   -14.683 0.758  1.00 0.00 ? 118 HIS A N    4  
ATOM   1743 C  CA   . HIS A 1 17 ? 5.983   -14.603 2.209  1.00 0.00 ? 118 HIS A CA   4  
ATOM   1744 C  C    . HIS A 1 17 ? 4.547   -14.559 2.736  1.00 0.00 ? 118 HIS A C    4  
ATOM   1745 O  O    . HIS A 1 17 ? 4.189   -15.316 3.637  1.00 0.00 ? 118 HIS A O    4  
ATOM   1746 C  CB   . HIS A 1 17 ? 6.824   -13.415 2.680  1.00 0.00 ? 118 HIS A CB   4  
ATOM   1747 C  CG   . HIS A 1 17 ? 8.313   -13.615 2.521  1.00 0.00 ? 118 HIS A CG   4  
ATOM   1748 N  ND1  . HIS A 1 17 ? 9.248   -12.888 3.237  1.00 0.00 ? 118 HIS A ND1  4  
ATOM   1749 C  CD2  . HIS A 1 17 ? 9.017   -14.468 1.723  1.00 0.00 ? 118 HIS A CD2  4  
ATOM   1750 C  CE1  . HIS A 1 17 ? 10.457  -13.293 2.877  1.00 0.00 ? 118 HIS A CE1  4  
ATOM   1751 N  NE2  . HIS A 1 17 ? 10.311  -14.271 1.938  1.00 0.00 ? 118 HIS A NE2  4  
ATOM   1752 H  H    . HIS A 1 17 ? 6.541   -14.010 0.292  1.00 0.00 ? 118 HIS A H    4  
ATOM   1753 H  HA   . HIS A 1 17 ? 6.464   -15.513 2.567  1.00 0.00 ? 118 HIS A HA   4  
ATOM   1754 H  HB2  . HIS A 1 17 ? 6.526   -12.528 2.121  1.00 0.00 ? 118 HIS A HB2  4  
ATOM   1755 H  HB3  . HIS A 1 17 ? 6.604   -13.220 3.729  1.00 0.00 ? 118 HIS A HB3  4  
ATOM   1756 H  HD1  . HIS A 1 17 ? 9.044   -12.178 3.911  1.00 0.00 ? 118 HIS A HD1  4  
ATOM   1757 H  HD2  . HIS A 1 17 ? 8.589   -15.188 1.026  1.00 0.00 ? 118 HIS A HD2  4  
ATOM   1758 H  HE1  . HIS A 1 17 ? 11.402  -12.910 3.263  1.00 0.00 ? 118 HIS A HE1  4  
ATOM   1759 H  HE2  . HIS A 1 17 ? 11.056  -14.799 1.528  1.00 0.00 ? 118 HIS A HE2  4  
ATOM   1760 N  N    . LEU A 1 18 ? 3.765   -13.664 2.153  1.00 0.00 ? 119 LEU A N    4  
ATOM   1761 C  CA   . LEU A 1 18 ? 2.376   -13.510 2.553  1.00 0.00 ? 119 LEU A CA   4  
ATOM   1762 C  C    . LEU A 1 18 ? 1.643   -14.838 2.354  1.00 0.00 ? 119 LEU A C    4  
ATOM   1763 O  O    . LEU A 1 18 ? 1.152   -15.429 3.315  1.00 0.00 ? 119 LEU A O    4  
ATOM   1764 C  CB   . LEU A 1 18 ? 1.732   -12.335 1.813  1.00 0.00 ? 119 LEU A CB   4  
ATOM   1765 C  CG   . LEU A 1 18 ? 0.214   -12.405 1.637  1.00 0.00 ? 119 LEU A CG   4  
ATOM   1766 C  CD1  . LEU A 1 18 ? -0.463  -12.912 2.912  1.00 0.00 ? 119 LEU A CD1  4  
ATOM   1767 C  CD2  . LEU A 1 18 ? -0.349  -11.054 1.188  1.00 0.00 ? 119 LEU A CD2  4  
ATOM   1768 H  H    . LEU A 1 18 ? 4.064   -13.050 1.422  1.00 0.00 ? 119 LEU A H    4  
ATOM   1769 H  HA   . LEU A 1 18 ? 2.367   -13.265 3.615  1.00 0.00 ? 119 LEU A HA   4  
ATOM   1770 H  HB2  . LEU A 1 18 ? 1.974   -11.417 2.350  1.00 0.00 ? 119 LEU A HB2  4  
ATOM   1771 H  HB3  . LEU A 1 18 ? 2.189   -12.258 0.827  1.00 0.00 ? 119 LEU A HB3  4  
ATOM   1772 H  HG   . LEU A 1 18 ? -0.006  -13.123 0.848  1.00 0.00 ? 119 LEU A HG   4  
ATOM   1773 H  HD11 . LEU A 1 18 ? 0.003   -12.447 3.781  1.00 0.00 ? 119 LEU A HD11 4  
ATOM   1774 H  HD12 . LEU A 1 18 ? -1.522  -12.656 2.889  1.00 0.00 ? 119 LEU A HD12 4  
ATOM   1775 H  HD13 . LEU A 1 18 ? -0.353  -13.995 2.976  1.00 0.00 ? 119 LEU A HD13 4  
ATOM   1776 H  HD21 . LEU A 1 18 ? 0.440   -10.302 1.226  1.00 0.00 ? 119 LEU A HD21 4  
ATOM   1777 H  HD22 . LEU A 1 18 ? -0.723  -11.138 0.168  1.00 0.00 ? 119 LEU A HD22 4  
ATOM   1778 H  HD23 . LEU A 1 18 ? -1.162  -10.761 1.852  1.00 0.00 ? 119 LEU A HD23 4  
ATOM   1779 N  N    . LYS A 1 19 ? 1.591   -15.267 1.102  1.00 0.00 ? 120 LYS A N    4  
ATOM   1780 C  CA   . LYS A 1 19 ? 0.927   -16.515 0.766  1.00 0.00 ? 120 LYS A CA   4  
ATOM   1781 C  C    . LYS A 1 19 ? 1.361   -17.601 1.752  1.00 0.00 ? 120 LYS A C    4  
ATOM   1782 O  O    . LYS A 1 19 ? 0.536   -18.141 2.488  1.00 0.00 ? 120 LYS A O    4  
ATOM   1783 C  CB   . LYS A 1 19 ? 1.179   -16.877 -0.700 1.00 0.00 ? 120 LYS A CB   4  
ATOM   1784 C  CG   . LYS A 1 19 ? -0.121  -16.835 -1.506 1.00 0.00 ? 120 LYS A CG   4  
ATOM   1785 C  CD   . LYS A 1 19 ? -0.946  -15.595 -1.153 1.00 0.00 ? 120 LYS A CD   4  
ATOM   1786 C  CE   . LYS A 1 19 ? -1.672  -15.050 -2.383 1.00 0.00 ? 120 LYS A CE   4  
ATOM   1787 N  NZ   . LYS A 1 19 ? -2.340  -13.769 -2.066 1.00 0.00 ? 120 LYS A NZ   4  
ATOM   1788 H  H    . LYS A 1 19 ? 1.993   -14.780 0.327  1.00 0.00 ? 120 LYS A H    4  
ATOM   1789 H  HA   . LYS A 1 19 ? -0.145  -16.354 0.878  1.00 0.00 ? 120 LYS A HA   4  
ATOM   1790 H  HB2  . LYS A 1 19 ? 1.901   -16.185 -1.131 1.00 0.00 ? 120 LYS A HB2  4  
ATOM   1791 H  HB3  . LYS A 1 19 ? 1.616   -17.874 -0.761 1.00 0.00 ? 120 LYS A HB3  4  
ATOM   1792 H  HG2  . LYS A 1 19 ? 0.108   -16.831 -2.572 1.00 0.00 ? 120 LYS A HG2  4  
ATOM   1793 H  HG3  . LYS A 1 19 ? -0.706  -17.733 -1.308 1.00 0.00 ? 120 LYS A HG3  4  
ATOM   1794 H  HD2  . LYS A 1 19 ? -1.672  -15.846 -0.379 1.00 0.00 ? 120 LYS A HD2  4  
ATOM   1795 H  HD3  . LYS A 1 19 ? -0.293  -14.826 -0.739 1.00 0.00 ? 120 LYS A HD3  4  
ATOM   1796 H  HE2  . LYS A 1 19 ? -0.961  -14.904 -3.197 1.00 0.00 ? 120 LYS A HE2  4  
ATOM   1797 H  HE3  . LYS A 1 19 ? -2.408  -15.775 -2.729 1.00 0.00 ? 120 LYS A HE3  4  
ATOM   1798 H  HZ1  . LYS A 1 19 ? -3.124  -13.940 -1.468 1.00 0.00 ? 120 LYS A HZ1  4  
ATOM   1799 H  HZ2  . LYS A 1 19 ? -1.694  -13.162 -1.602 1.00 0.00 ? 120 LYS A HZ2  4  
ATOM   1800 H  HZ3  . LYS A 1 19 ? -2.654  -13.337 -2.912 1.00 0.00 ? 120 LYS A HZ3  4  
ATOM   1801 N  N    . ARG A 1 20 ? 2.654   -17.890 1.732  1.00 0.00 ? 121 ARG A N    4  
ATOM   1802 C  CA   . ARG A 1 20 ? 3.207   -18.902 2.615  1.00 0.00 ? 121 ARG A CA   4  
ATOM   1803 C  C    . ARG A 1 20 ? 2.783   -18.635 4.062  1.00 0.00 ? 121 ARG A C    4  
ATOM   1804 O  O    . ARG A 1 20 ? 2.525   -19.570 4.819  1.00 0.00 ? 121 ARG A O    4  
ATOM   1805 C  CB   . ARG A 1 20 ? 4.734   -18.928 2.536  1.00 0.00 ? 121 ARG A CB   4  
ATOM   1806 C  CG   . ARG A 1 20 ? 5.274   -20.337 2.789  1.00 0.00 ? 121 ARG A CG   4  
ATOM   1807 C  CD   . ARG A 1 20 ? 4.809   -21.306 1.700  1.00 0.00 ? 121 ARG A CD   4  
ATOM   1808 N  NE   . ARG A 1 20 ? 3.699   -22.141 2.207  1.00 0.00 ? 121 ARG A NE   4  
ATOM   1809 C  CZ   . ARG A 1 20 ? 3.554   -23.444 1.931  1.00 0.00 ? 121 ARG A CZ   4  
ATOM   1810 N  NH1  . ARG A 1 20 ? 4.081   -23.955 0.810  1.00 0.00 ? 121 ARG A NH1  4  
ATOM   1811 N  NH2  . ARG A 1 20 ? 2.880   -24.237 2.777  1.00 0.00 ? 121 ARG A NH2  4  
ATOM   1812 H  H    . ARG A 1 20 ? 3.317   -17.446 1.131  1.00 0.00 ? 121 ARG A H    4  
ATOM   1813 H  HA   . ARG A 1 20 ? 2.794   -19.844 2.253  1.00 0.00 ? 121 ARG A HA   4  
ATOM   1814 H  HB2  . ARG A 1 20 ? 5.057   -18.581 1.555  1.00 0.00 ? 121 ARG A HB2  4  
ATOM   1815 H  HB3  . ARG A 1 20 ? 5.152   -18.237 3.270  1.00 0.00 ? 121 ARG A HB3  4  
ATOM   1816 H  HG2  . ARG A 1 20 ? 6.363   -20.312 2.819  1.00 0.00 ? 121 ARG A HG2  4  
ATOM   1817 H  HG3  . ARG A 1 20 ? 4.936   -20.690 3.763  1.00 0.00 ? 121 ARG A HG3  4  
ATOM   1818 H  HD2  . ARG A 1 20 ? 4.485   -20.748 0.821  1.00 0.00 ? 121 ARG A HD2  4  
ATOM   1819 H  HD3  . ARG A 1 20 ? 5.639   -21.939 1.387  1.00 0.00 ? 121 ARG A HD3  4  
ATOM   1820 H  HE   . ARG A 1 20 ? 3.014   -21.707 2.791  1.00 0.00 ? 121 ARG A HE   4  
ATOM   1821 H  HH11 . ARG A 1 20 ? 4.948   -23.601 0.459  1.00 0.00 ? 121 ARG A HH11 4  
ATOM   1822 H  HH12 . ARG A 1 20 ? 3.609   -24.692 0.325  1.00 0.00 ? 121 ARG A HH12 4  
ATOM   1823 H  HH21 . ARG A 1 20 ? 2.784   -23.976 3.737  1.00 0.00 ? 121 ARG A HH21 4  
ATOM   1824 H  HH22 . ARG A 1 20 ? 2.475   -25.090 2.447  1.00 0.00 ? 121 ARG A HH22 4  
ATOM   1825 N  N    . HIS A 1 21 ? 2.722   -17.355 4.400  1.00 0.00 ? 122 HIS A N    4  
ATOM   1826 C  CA   . HIS A 1 21 ? 2.333   -16.954 5.741  1.00 0.00 ? 122 HIS A CA   4  
ATOM   1827 C  C    . HIS A 1 21 ? 0.889   -17.384 6.007  1.00 0.00 ? 122 HIS A C    4  
ATOM   1828 O  O    . HIS A 1 21 ? 0.614   -18.076 6.986  1.00 0.00 ? 122 HIS A O    4  
ATOM   1829 C  CB   . HIS A 1 21 ? 2.552   -15.454 5.944  1.00 0.00 ? 122 HIS A CB   4  
ATOM   1830 C  CG   . HIS A 1 21 ? 1.692   -14.848 7.027  1.00 0.00 ? 122 HIS A CG   4  
ATOM   1831 N  ND1  . HIS A 1 21 ? 1.985   -14.973 8.374  1.00 0.00 ? 122 HIS A ND1  4  
ATOM   1832 C  CD2  . HIS A 1 21 ? 0.545   -14.114 6.949  1.00 0.00 ? 122 HIS A CD2  4  
ATOM   1833 C  CE1  . HIS A 1 21 ? 1.049   -14.338 9.067  1.00 0.00 ? 122 HIS A CE1  4  
ATOM   1834 N  NE2  . HIS A 1 21 ? 0.159   -13.807 8.182  1.00 0.00 ? 122 HIS A NE2  4  
ATOM   1835 H  H    . HIS A 1 21 ? 2.932   -16.602 3.777  1.00 0.00 ? 122 HIS A H    4  
ATOM   1836 H  HA   . HIS A 1 21 ? 2.993   -17.482 6.429  1.00 0.00 ? 122 HIS A HA   4  
ATOM   1837 H  HB2  . HIS A 1 21 ? 3.600   -15.279 6.186  1.00 0.00 ? 122 HIS A HB2  4  
ATOM   1838 H  HB3  . HIS A 1 21 ? 2.351   -14.938 5.004  1.00 0.00 ? 122 HIS A HB3  4  
ATOM   1839 H  HD1  . HIS A 1 21 ? 2.769   -15.460 8.760  1.00 0.00 ? 122 HIS A HD1  4  
ATOM   1840 H  HD2  . HIS A 1 21 ? 0.034   -13.827 6.030  1.00 0.00 ? 122 HIS A HD2  4  
ATOM   1841 H  HE1  . HIS A 1 21 ? 1.002   -14.255 10.151 1.00 0.00 ? 122 HIS A HE1  4  
ATOM   1842 N  N    . TYR A 1 22 ? 0.004   -16.956 5.118  1.00 0.00 ? 123 TYR A N    4  
ATOM   1843 C  CA   . TYR A 1 22 ? -1.405  -17.287 5.245  1.00 0.00 ? 123 TYR A CA   4  
ATOM   1844 C  C    . TYR A 1 22 ? -1.587  -18.700 5.804  1.00 0.00 ? 123 TYR A C    4  
ATOM   1845 O  O    . TYR A 1 22 ? -2.428  -18.924 6.673  1.00 0.00 ? 123 TYR A O    4  
ATOM   1846 C  CB   . TYR A 1 22 ? -1.979  -17.234 3.828  1.00 0.00 ? 123 TYR A CB   4  
ATOM   1847 C  CG   . TYR A 1 22 ? -3.125  -16.234 3.658  1.00 0.00 ? 123 TYR A CG   4  
ATOM   1848 C  CD1  . TYR A 1 22 ? -4.377  -16.530 4.156  1.00 0.00 ? 123 TYR A CD1  4  
ATOM   1849 C  CD2  . TYR A 1 22 ? -2.906  -15.038 3.007  1.00 0.00 ? 123 TYR A CD2  4  
ATOM   1850 C  CE1  . TYR A 1 22 ? -5.456  -15.589 3.997  1.00 0.00 ? 123 TYR A CE1  4  
ATOM   1851 C  CE2  . TYR A 1 22 ? -3.984  -14.097 2.847  1.00 0.00 ? 123 TYR A CE2  4  
ATOM   1852 C  CZ   . TYR A 1 22 ? -5.206  -14.419 3.350  1.00 0.00 ? 123 TYR A CZ   4  
ATOM   1853 O  OH   . TYR A 1 22 ? -6.224  -13.530 3.199  1.00 0.00 ? 123 TYR A OH   4  
ATOM   1854 H  H    . TYR A 1 22 ? 0.236   -16.393 4.326  1.00 0.00 ? 123 TYR A H    4  
ATOM   1855 H  HA   . TYR A 1 22 ? -1.858  -16.572 5.931  1.00 0.00 ? 123 TYR A HA   4  
ATOM   1856 H  HB2  . TYR A 1 22 ? -1.180  -16.977 3.133  1.00 0.00 ? 123 TYR A HB2  4  
ATOM   1857 H  HB3  . TYR A 1 22 ? -2.334  -18.228 3.553  1.00 0.00 ? 123 TYR A HB3  4  
ATOM   1858 H  HD1  . TYR A 1 22 ? -4.550  -17.475 4.672  1.00 0.00 ? 123 TYR A HD1  4  
ATOM   1859 H  HD2  . TYR A 1 22 ? -1.916  -14.805 2.613  1.00 0.00 ? 123 TYR A HD2  4  
ATOM   1860 H  HE1  . TYR A 1 22 ? -6.450  -15.809 4.386  1.00 0.00 ? 123 TYR A HE1  4  
ATOM   1861 H  HE2  . TYR A 1 22 ? -3.825  -13.149 2.335  1.00 0.00 ? 123 TYR A HE2  4  
ATOM   1862 H  HH   . TYR A 1 22 ? -6.251  -13.198 2.257  1.00 0.00 ? 123 TYR A HH   4  
ATOM   1863 N  N    . ARG A 1 23 ? -0.785  -19.617 5.282  1.00 0.00 ? 124 ARG A N    4  
ATOM   1864 C  CA   . ARG A 1 23 ? -0.847  -21.001 5.718  1.00 0.00 ? 124 ARG A CA   4  
ATOM   1865 C  C    . ARG A 1 23 ? -1.066  -21.072 7.230  1.00 0.00 ? 124 ARG A C    4  
ATOM   1866 O  O    . ARG A 1 23 ? -1.646  -22.034 7.733  1.00 0.00 ? 124 ARG A O    4  
ATOM   1867 C  CB   . ARG A 1 23 ? 0.438   -21.750 5.359  1.00 0.00 ? 124 ARG A CB   4  
ATOM   1868 C  CG   . ARG A 1 23 ? 1.374   -21.841 6.565  1.00 0.00 ? 124 ARG A CG   4  
ATOM   1869 C  CD   . ARG A 1 23 ? 2.830   -21.991 6.119  1.00 0.00 ? 124 ARG A CD   4  
ATOM   1870 N  NE   . ARG A 1 23 ? 3.427   -23.196 6.739  1.00 0.00 ? 124 ARG A NE   4  
ATOM   1871 C  CZ   . ARG A 1 23 ? 4.182   -23.176 7.845  1.00 0.00 ? 124 ARG A CZ   4  
ATOM   1872 N  NH1  . ARG A 1 23 ? 3.973   -22.241 8.781  1.00 0.00 ? 124 ARG A NH1  4  
ATOM   1873 N  NH2  . ARG A 1 23 ? 5.146   -24.091 8.015  1.00 0.00 ? 124 ARG A NH2  4  
ATOM   1874 H  H    . ARG A 1 23 ? -0.103  -19.426 4.575  1.00 0.00 ? 124 ARG A H    4  
ATOM   1875 H  HA   . ARG A 1 23 ? -1.695  -21.424 5.179  1.00 0.00 ? 124 ARG A HA   4  
ATOM   1876 H  HB2  . ARG A 1 23 ? 0.193   -22.752 5.008  1.00 0.00 ? 124 ARG A HB2  4  
ATOM   1877 H  HB3  . ARG A 1 23 ? 0.943   -21.240 4.539  1.00 0.00 ? 124 ARG A HB3  4  
ATOM   1878 H  HG2  . ARG A 1 23 ? 1.269   -20.947 7.180  1.00 0.00 ? 124 ARG A HG2  4  
ATOM   1879 H  HG3  . ARG A 1 23 ? 1.091   -22.691 7.187  1.00 0.00 ? 124 ARG A HG3  4  
ATOM   1880 H  HD2  . ARG A 1 23 ? 2.879   -22.068 5.033  1.00 0.00 ? 124 ARG A HD2  4  
ATOM   1881 H  HD3  . ARG A 1 23 ? 3.399   -21.106 6.402  1.00 0.00 ? 124 ARG A HD3  4  
ATOM   1882 H  HE   . ARG A 1 23 ? 3.256   -24.081 6.303  1.00 0.00 ? 124 ARG A HE   4  
ATOM   1883 H  HH11 . ARG A 1 23 ? 4.432   -21.355 8.715  1.00 0.00 ? 124 ARG A HH11 4  
ATOM   1884 H  HH12 . ARG A 1 23 ? 3.357   -22.428 9.547  1.00 0.00 ? 124 ARG A HH12 4  
ATOM   1885 H  HH21 . ARG A 1 23 ? 5.234   -24.850 7.371  1.00 0.00 ? 124 ARG A HH21 4  
ATOM   1886 H  HH22 . ARG A 1 23 ? 5.778   -24.014 8.786  1.00 0.00 ? 124 ARG A HH22 4  
ATOM   1887 N  N    . SER A 1 24 ? -0.589  -20.042 7.914  1.00 0.00 ? 125 SER A N    4  
ATOM   1888 C  CA   . SER A 1 24 ? -0.725  -19.976 9.359  1.00 0.00 ? 125 SER A CA   4  
ATOM   1889 C  C    . SER A 1 24 ? -2.052  -19.311 9.730  1.00 0.00 ? 125 SER A C    4  
ATOM   1890 O  O    . SER A 1 24 ? -2.211  -18.812 10.843 1.00 0.00 ? 125 SER A O    4  
ATOM   1891 C  CB   . SER A 1 24 ? 0.444   -19.215 9.987  1.00 0.00 ? 125 SER A CB   4  
ATOM   1892 O  OG   . SER A 1 24 ? 0.667   -17.959 9.351  1.00 0.00 ? 125 SER A OG   4  
ATOM   1893 H  H    . SER A 1 24 ? -0.119  -19.265 7.497  1.00 0.00 ? 125 SER A H    4  
ATOM   1894 H  HA   . SER A 1 24 ? -0.707  -21.011 9.699  1.00 0.00 ? 125 SER A HA   4  
ATOM   1895 H  HB2  . SER A 1 24 ? 0.243   -19.053 11.047 1.00 0.00 ? 125 SER A HB2  4  
ATOM   1896 H  HB3  . SER A 1 24 ? 1.348   -19.820 9.922  1.00 0.00 ? 125 SER A HB3  4  
ATOM   1897 H  HG   . SER A 1 24 ? 0.603   -17.220 10.021 1.00 0.00 ? 125 SER A HG   4  
ATOM   1898 N  N    . HIS A 1 25 ? -2.971  -19.325 8.776  1.00 0.00 ? 126 HIS A N    4  
ATOM   1899 C  CA   . HIS A 1 25 ? -4.280  -18.731 8.989  1.00 0.00 ? 126 HIS A CA   4  
ATOM   1900 C  C    . HIS A 1 25 ? -5.369  -19.758 8.674  1.00 0.00 ? 126 HIS A C    4  
ATOM   1901 O  O    . HIS A 1 25 ? -6.557  -19.462 8.783  1.00 0.00 ? 126 HIS A O    4  
ATOM   1902 C  CB   . HIS A 1 25 ? -4.429  -17.442 8.177  1.00 0.00 ? 126 HIS A CB   4  
ATOM   1903 C  CG   . HIS A 1 25 ? -3.649  -16.274 8.731  1.00 0.00 ? 126 HIS A CG   4  
ATOM   1904 N  ND1  . HIS A 1 25 ? -3.422  -16.098 10.084 1.00 0.00 ? 126 HIS A ND1  4  
ATOM   1905 C  CD2  . HIS A 1 25 ? -3.046  -15.226 8.101  1.00 0.00 ? 126 HIS A CD2  4  
ATOM   1906 C  CE1  . HIS A 1 25 ? -2.714  -14.990 10.250 1.00 0.00 ? 126 HIS A CE1  4  
ATOM   1907 N  NE2  . HIS A 1 25 ? -2.482  -14.450 9.019  1.00 0.00 ? 126 HIS A NE2  4  
ATOM   1908 H  H    . HIS A 1 25 ? -2.834  -19.733 7.873  1.00 0.00 ? 126 HIS A H    4  
ATOM   1909 H  HA   . HIS A 1 25 ? -4.335  -18.466 10.045 1.00 0.00 ? 126 HIS A HA   4  
ATOM   1910 H  HB2  . HIS A 1 25 ? -4.104  -17.630 7.154  1.00 0.00 ? 126 HIS A HB2  4  
ATOM   1911 H  HB3  . HIS A 1 25 ? -5.484  -17.173 8.133  1.00 0.00 ? 126 HIS A HB3  4  
ATOM   1912 H  HD1  . HIS A 1 25 ? -3.739  -16.704 10.815 1.00 0.00 ? 126 HIS A HD1  4  
ATOM   1913 H  HD2  . HIS A 1 25 ? -3.030  -15.053 7.024  1.00 0.00 ? 126 HIS A HD2  4  
ATOM   1914 H  HE1  . HIS A 1 25 ? -2.377  -14.582 11.202 1.00 0.00 ? 126 HIS A HE1  4  
ATOM   1915 N  N    . THR A 1 26 ? -4.923  -20.946 8.290  1.00 0.00 ? 127 THR A N    4  
ATOM   1916 C  CA   . THR A 1 26 ? -5.844  -22.020 7.959  1.00 0.00 ? 127 THR A CA   4  
ATOM   1917 C  C    . THR A 1 26 ? -5.360  -23.342 8.558  1.00 0.00 ? 127 THR A C    4  
ATOM   1918 O  O    . THR A 1 26 ? -4.413  -23.945 8.056  1.00 0.00 ? 127 THR A O    4  
ATOM   1919 C  CB   . THR A 1 26 ? -5.995  -22.061 6.437  1.00 0.00 ? 127 THR A CB   4  
ATOM   1920 O  OG1  . THR A 1 26 ? -4.804  -22.701 5.988  1.00 0.00 ? 127 THR A OG1  4  
ATOM   1921 C  CG2  . THR A 1 26 ? -5.933  -20.669 5.805  1.00 0.00 ? 127 THR A CG2  4  
ATOM   1922 H  H    . THR A 1 26 ? -3.954  -21.179 8.204  1.00 0.00 ? 127 THR A H    4  
ATOM   1923 H  HA   . THR A 1 26 ? -6.809  -21.797 8.415  1.00 0.00 ? 127 THR A HA   4  
ATOM   1924 H  HB   . THR A 1 26 ? -6.911  -22.579 6.151  1.00 0.00 ? 127 THR A HB   4  
ATOM   1925 H  HG1  . THR A 1 26 ? -4.019  -22.096 6.124  1.00 0.00 ? 127 THR A HG1  4  
ATOM   1926 H  HG21 . THR A 1 26 ? -6.758  -20.062 6.179  1.00 0.00 ? 127 THR A HG21 4  
ATOM   1927 H  HG22 . THR A 1 26 ? -4.986  -20.195 6.064  1.00 0.00 ? 127 THR A HG22 4  
ATOM   1928 H  HG23 . THR A 1 26 ? -6.010  -20.759 4.721  1.00 0.00 ? 127 THR A HG23 4  
ATOM   1929 N  N    . ASN A 1 27 ? -6.033  -23.754 9.623  1.00 0.00 ? 128 ASN A N    4  
ATOM   1930 C  CA   . ASN A 1 27 ? -5.682  -24.994 10.295 1.00 0.00 ? 128 ASN A CA   4  
ATOM   1931 C  C    . ASN A 1 27 ? -6.588  -26.118 9.789  1.00 0.00 ? 128 ASN A C    4  
ATOM   1932 O  O    . ASN A 1 27 ? -6.235  -27.292 9.876  1.00 0.00 ? 128 ASN A O    4  
ATOM   1933 C  CB   . ASN A 1 27 ? -5.878  -24.874 11.808 1.00 0.00 ? 128 ASN A CB   4  
ATOM   1934 C  CG   . ASN A 1 27 ? -5.733  -23.422 12.266 1.00 0.00 ? 128 ASN A CG   4  
ATOM   1935 O  OD1  . ASN A 1 27 ? -6.395  -22.520 11.777 1.00 0.00 ? 128 ASN A OD1  4  
ATOM   1936 N  ND2  . ASN A 1 27 ? -4.834  -23.245 13.230 1.00 0.00 ? 128 ASN A ND2  4  
ATOM   1937 H  H    . ASN A 1 27 ? -6.802  -23.258 10.024 1.00 0.00 ? 128 ASN A H    4  
ATOM   1938 H  HA   . ASN A 1 27 ? -4.633  -25.164 10.054 1.00 0.00 ? 128 ASN A HA   4  
ATOM   1939 H  HB2  . ASN A 1 27 ? -6.863  -25.249 12.082 1.00 0.00 ? 128 ASN A HB2  4  
ATOM   1940 H  HB3  . ASN A 1 27 ? -5.145  -25.495 12.323 1.00 0.00 ? 128 ASN A HB3  4  
ATOM   1941 H  HD21 . ASN A 1 27 ? -3.871  -23.106 12.996 1.00 0.00 ? 128 ASN A HD21 4  
ATOM   1942 H  HD22 . ASN A 1 27 ? -5.120  -23.250 14.188 1.00 0.00 ? 128 ASN A HD22 4  
ATOM   1943 N  N    . GLU A 1 28 ? -7.740  -25.716 9.271  1.00 0.00 ? 129 GLU A N    4  
ATOM   1944 C  CA   . GLU A 1 28 ? -8.701  -26.675 8.750  1.00 0.00 ? 129 GLU A CA   4  
ATOM   1945 C  C    . GLU A 1 28 ? -7.984  -27.757 7.939  1.00 0.00 ? 129 GLU A C    4  
ATOM   1946 O  O    . GLU A 1 28 ? -7.197  -27.448 7.046  1.00 0.00 ? 129 GLU A O    4  
ATOM   1947 C  CB   . GLU A 1 28 ? -9.771  -25.977 7.909  1.00 0.00 ? 129 GLU A CB   4  
ATOM   1948 C  CG   . GLU A 1 28 ? -10.945 -25.527 8.780  1.00 0.00 ? 129 GLU A CG   4  
ATOM   1949 C  CD   . GLU A 1 28 ? -11.747 -26.728 9.285  1.00 0.00 ? 129 GLU A CD   4  
ATOM   1950 O  OE1  . GLU A 1 28 ? -12.545 -27.256 8.482  1.00 0.00 ? 129 GLU A OE1  4  
ATOM   1951 O  OE2  . GLU A 1 28 ? -11.541 -27.092 10.463 1.00 0.00 ? 129 GLU A OE2  4  
ATOM   1952 H  H    . GLU A 1 28 ? -8.021  -24.759 9.203  1.00 0.00 ? 129 GLU A H    4  
ATOM   1953 H  HA   . GLU A 1 28 ? -9.170  -27.120 9.627  1.00 0.00 ? 129 GLU A HA   4  
ATOM   1954 H  HB2  . GLU A 1 28 ? -9.336  -25.116 7.403  1.00 0.00 ? 129 GLU A HB2  4  
ATOM   1955 H  HB3  . GLU A 1 28 ? -10.128 -26.655 7.134  1.00 0.00 ? 129 GLU A HB3  4  
ATOM   1956 H  HG2  . GLU A 1 28 ? -10.574 -24.950 9.627  1.00 0.00 ? 129 GLU A HG2  4  
ATOM   1957 H  HG3  . GLU A 1 28 ? -11.596 -24.867 8.206  1.00 0.00 ? 129 GLU A HG3  4  
ATOM   1958 N  N    . LYS A 1 29 ? -8.283  -29.003 8.279  1.00 0.00 ? 130 LYS A N    4  
ATOM   1959 C  CA   . LYS A 1 29 ? -7.678  -30.131 7.594  1.00 0.00 ? 130 LYS A CA   4  
ATOM   1960 C  C    . LYS A 1 29 ? -7.760  -29.909 6.083  1.00 0.00 ? 130 LYS A C    4  
ATOM   1961 O  O    . LYS A 1 29 ? -7.275  -30.728 5.303  1.00 0.00 ? 130 LYS A O    4  
ATOM   1962 C  CB   . LYS A 1 29 ? -8.313  -31.443 8.057  1.00 0.00 ? 130 LYS A CB   4  
ATOM   1963 C  CG   . LYS A 1 29 ? -9.740  -31.580 7.524  1.00 0.00 ? 130 LYS A CG   4  
ATOM   1964 C  CD   . LYS A 1 29 ? -10.495 -32.692 8.254  1.00 0.00 ? 130 LYS A CD   4  
ATOM   1965 C  CE   . LYS A 1 29 ? -11.927 -32.262 8.578  1.00 0.00 ? 130 LYS A CE   4  
ATOM   1966 N  NZ   . LYS A 1 29 ? -12.153 -32.274 10.041 1.00 0.00 ? 130 LYS A NZ   4  
ATOM   1967 H  H    . LYS A 1 29 ? -8.925  -29.244 9.007  1.00 0.00 ? 130 LYS A H    4  
ATOM   1968 H  HA   . LYS A 1 29 ? -6.626  -30.162 7.882  1.00 0.00 ? 130 LYS A HA   4  
ATOM   1969 H  HB2  . LYS A 1 29 ? -7.711  -32.285 7.716  1.00 0.00 ? 130 LYS A HB2  4  
ATOM   1970 H  HB3  . LYS A 1 29 ? -8.323  -31.482 9.147  1.00 0.00 ? 130 LYS A HB3  4  
ATOM   1971 H  HG2  . LYS A 1 29 ? -10.270 -30.636 7.645  1.00 0.00 ? 130 LYS A HG2  4  
ATOM   1972 H  HG3  . LYS A 1 29 ? -9.713  -31.795 6.455  1.00 0.00 ? 130 LYS A HG3  4  
ATOM   1973 H  HD2  . LYS A 1 29 ? -10.513 -33.591 7.637  1.00 0.00 ? 130 LYS A HD2  4  
ATOM   1974 H  HD3  . LYS A 1 29 ? -9.971  -32.948 9.175  1.00 0.00 ? 130 LYS A HD3  4  
ATOM   1975 H  HE2  . LYS A 1 29 ? -12.110 -31.262 8.185  1.00 0.00 ? 130 LYS A HE2  4  
ATOM   1976 H  HE3  . LYS A 1 29 ? -12.634 -32.932 8.090  1.00 0.00 ? 130 LYS A HE3  4  
ATOM   1977 H  HZ1  . LYS A 1 29 ? -11.687 -31.493 10.457 1.00 0.00 ? 130 LYS A HZ1  4  
ATOM   1978 H  HZ2  . LYS A 1 29 ? -13.133 -32.215 10.227 1.00 0.00 ? 130 LYS A HZ2  4  
ATOM   1979 H  HZ3  . LYS A 1 29 ? -11.790 -33.122 10.427 1.00 0.00 ? 130 LYS A HZ3  4  
HETATM 1980 ZN ZN   . ZN  B 2 .  ? -1.472  -12.768 8.651  1.00 0.00 ? 1   ZN  A ZN   4  
ATOM   1981 N  N    . ARG A 1 1  ? 1.546   0.094   -2.852 1.00 0.00 ? 102 ARG A N    5  
ATOM   1982 C  CA   . ARG A 1 1  ? 2.066   0.163   -1.497 1.00 0.00 ? 102 ARG A CA   5  
ATOM   1983 C  C    . ARG A 1 1  ? 2.907   -1.077  -1.186 1.00 0.00 ? 102 ARG A C    5  
ATOM   1984 O  O    . ARG A 1 1  ? 4.111   -1.094  -1.436 1.00 0.00 ? 102 ARG A O    5  
ATOM   1985 C  CB   . ARG A 1 1  ? 0.931   0.270   -0.476 1.00 0.00 ? 102 ARG A CB   5  
ATOM   1986 C  CG   . ARG A 1 1  ? -0.333  -0.423  -0.988 1.00 0.00 ? 102 ARG A CG   5  
ATOM   1987 C  CD   . ARG A 1 1  ? -1.322  0.594   -1.561 1.00 0.00 ? 102 ARG A CD   5  
ATOM   1988 N  NE   . ARG A 1 1  ? -1.563  1.675   -0.579 1.00 0.00 ? 102 ARG A NE   5  
ATOM   1989 C  CZ   . ARG A 1 1  ? -2.188  1.498   0.593  1.00 0.00 ? 102 ARG A CZ   5  
ATOM   1990 N  NH1  . ARG A 1 1  ? -3.240  0.673   0.675  1.00 0.00 ? 102 ARG A NH1  5  
ATOM   1991 N  NH2  . ARG A 1 1  ? -1.761  2.148   1.684  1.00 0.00 ? 102 ARG A NH2  5  
ATOM   1992 H  H    . ARG A 1 1  ? 1.385   -0.831  -3.196 1.00 0.00 ? 102 ARG A H    5  
ATOM   1993 H  HA   . ARG A 1 1  ? 2.677   1.065   -1.478 1.00 0.00 ? 102 ARG A HA   5  
ATOM   1994 H  HB2  . ARG A 1 1  ? 1.242   -0.181  0.467  1.00 0.00 ? 102 ARG A HB2  5  
ATOM   1995 H  HB3  . ARG A 1 1  ? 0.718   1.319   -0.272 1.00 0.00 ? 102 ARG A HB3  5  
ATOM   1996 H  HG2  . ARG A 1 1  ? -0.069  -1.151  -1.754 1.00 0.00 ? 102 ARG A HG2  5  
ATOM   1997 H  HG3  . ARG A 1 1  ? -0.804  -0.975  -0.174 1.00 0.00 ? 102 ARG A HG3  5  
ATOM   1998 H  HD2  . ARG A 1 1  ? -0.929  1.013   -2.487 1.00 0.00 ? 102 ARG A HD2  5  
ATOM   1999 H  HD3  . ARG A 1 1  ? -2.261  0.100   -1.808 1.00 0.00 ? 102 ARG A HD3  5  
ATOM   2000 H  HE   . ARG A 1 1  ? -1.240  2.594   -0.805 1.00 0.00 ? 102 ARG A HE   5  
ATOM   2001 H  HH11 . ARG A 1 1  ? -3.097  -0.312  0.772  1.00 0.00 ? 102 ARG A HH11 5  
ATOM   2002 H  HH12 . ARG A 1 1  ? -4.169  1.042   0.638  1.00 0.00 ? 102 ARG A HH12 5  
ATOM   2003 H  HH21 . ARG A 1 1  ? -0.806  2.066   1.974  1.00 0.00 ? 102 ARG A HH21 5  
ATOM   2004 H  HH22 . ARG A 1 1  ? -2.394  2.717   2.209  1.00 0.00 ? 102 ARG A HH22 5  
ATOM   2005 N  N    . SER A 1 2  ? 2.239   -2.086  -0.647 1.00 0.00 ? 103 SER A N    5  
ATOM   2006 C  CA   . SER A 1 2  ? 2.909   -3.328  -0.300 1.00 0.00 ? 103 SER A CA   5  
ATOM   2007 C  C    . SER A 1 2  ? 1.886   -4.357  0.184  1.00 0.00 ? 103 SER A C    5  
ATOM   2008 O  O    . SER A 1 2  ? 0.886   -3.999  0.804  1.00 0.00 ? 103 SER A O    5  
ATOM   2009 C  CB   . SER A 1 2  ? 3.977   -3.096  0.770  1.00 0.00 ? 103 SER A CB   5  
ATOM   2010 O  OG   . SER A 1 2  ? 5.289   -3.353  0.278  1.00 0.00 ? 103 SER A OG   5  
ATOM   2011 H  H    . SER A 1 2  ? 1.259   -2.064  -0.447 1.00 0.00 ? 103 SER A H    5  
ATOM   2012 H  HA   . SER A 1 2  ? 3.385   -3.665  -1.221 1.00 0.00 ? 103 SER A HA   5  
ATOM   2013 H  HB2  . SER A 1 2  ? 3.918   -2.068  1.125  1.00 0.00 ? 103 SER A HB2  5  
ATOM   2014 H  HB3  . SER A 1 2  ? 3.778   -3.741  1.627  1.00 0.00 ? 103 SER A HB3  5  
ATOM   2015 H  HG   . SER A 1 2  ? 5.392   -2.969  -0.639 1.00 0.00 ? 103 SER A HG   5  
ATOM   2016 N  N    . PHE A 1 3  ? 2.172   -5.615  -0.117 1.00 0.00 ? 104 PHE A N    5  
ATOM   2017 C  CA   . PHE A 1 3  ? 1.289   -6.699  0.281  1.00 0.00 ? 104 PHE A CA   5  
ATOM   2018 C  C    . PHE A 1 3  ? 1.207   -6.808  1.805  1.00 0.00 ? 104 PHE A C    5  
ATOM   2019 O  O    . PHE A 1 3  ? 2.225   -6.970  2.475  1.00 0.00 ? 104 PHE A O    5  
ATOM   2020 C  CB   . PHE A 1 3  ? 1.887   -7.991  -0.280 1.00 0.00 ? 104 PHE A CB   5  
ATOM   2021 C  CG   . PHE A 1 3  ? 2.128   -7.961  -1.790 1.00 0.00 ? 104 PHE A CG   5  
ATOM   2022 C  CD1  . PHE A 1 3  ? 1.072   -7.962  -2.648 1.00 0.00 ? 104 PHE A CD1  5  
ATOM   2023 C  CD2  . PHE A 1 3  ? 3.398   -7.935  -2.276 1.00 0.00 ? 104 PHE A CD2  5  
ATOM   2024 C  CE1  . PHE A 1 3  ? 1.296   -7.933  -4.049 1.00 0.00 ? 104 PHE A CE1  5  
ATOM   2025 C  CE2  . PHE A 1 3  ? 3.621   -7.908  -3.678 1.00 0.00 ? 104 PHE A CE2  5  
ATOM   2026 C  CZ   . PHE A 1 3  ? 2.565   -7.907  -4.535 1.00 0.00 ? 104 PHE A CZ   5  
ATOM   2027 H  H    . PHE A 1 3  ? 2.988   -5.898  -0.621 1.00 0.00 ? 104 PHE A H    5  
ATOM   2028 H  HA   . PHE A 1 3  ? 0.300   -6.474  -0.120 1.00 0.00 ? 104 PHE A HA   5  
ATOM   2029 H  HB2  . PHE A 1 3  ? 2.832   -8.191  0.225  1.00 0.00 ? 104 PHE A HB2  5  
ATOM   2030 H  HB3  . PHE A 1 3  ? 1.219   -8.820  -0.045 1.00 0.00 ? 104 PHE A HB3  5  
ATOM   2031 H  HD1  . PHE A 1 3  ? 0.054   -7.982  -2.258 1.00 0.00 ? 104 PHE A HD1  5  
ATOM   2032 H  HD2  . PHE A 1 3  ? 4.244   -7.935  -1.589 1.00 0.00 ? 104 PHE A HD2  5  
ATOM   2033 H  HE1  . PHE A 1 3  ? 0.449   -7.934  -4.736 1.00 0.00 ? 104 PHE A HE1  5  
ATOM   2034 H  HE2  . PHE A 1 3  ? 4.639   -7.886  -4.067 1.00 0.00 ? 104 PHE A HE2  5  
ATOM   2035 H  HZ   . PHE A 1 3  ? 2.737   -7.886  -5.612 1.00 0.00 ? 104 PHE A HZ   5  
ATOM   2036 N  N    . VAL A 1 4  ? -0.015  -6.716  2.308  1.00 0.00 ? 105 VAL A N    5  
ATOM   2037 C  CA   . VAL A 1 4  ? -0.244  -6.802  3.739  1.00 0.00 ? 105 VAL A CA   5  
ATOM   2038 C  C    . VAL A 1 4  ? -1.309  -7.865  4.018  1.00 0.00 ? 105 VAL A C    5  
ATOM   2039 O  O    . VAL A 1 4  ? -2.399  -7.821  3.448  1.00 0.00 ? 105 VAL A O    5  
ATOM   2040 C  CB   . VAL A 1 4  ? -0.615  -5.425  4.294  1.00 0.00 ? 105 VAL A CB   5  
ATOM   2041 C  CG1  . VAL A 1 4  ? -0.383  -5.362  5.806  1.00 0.00 ? 105 VAL A CG1  5  
ATOM   2042 C  CG2  . VAL A 1 4  ? 0.160   -4.318  3.576  1.00 0.00 ? 105 VAL A CG2  5  
ATOM   2043 H  H    . VAL A 1 4  ? -0.838  -6.584  1.755  1.00 0.00 ? 105 VAL A H    5  
ATOM   2044 H  HA   . VAL A 1 4  ? 0.691   -7.113  4.204  1.00 0.00 ? 105 VAL A HA   5  
ATOM   2045 H  HB   . VAL A 1 4  ? -1.677  -5.263  4.111  1.00 0.00 ? 105 VAL A HB   5  
ATOM   2046 H  HG11 . VAL A 1 4  ? 0.024   -4.387  6.071  1.00 0.00 ? 105 VAL A HG11 5  
ATOM   2047 H  HG12 . VAL A 1 4  ? -1.331  -5.515  6.324  1.00 0.00 ? 105 VAL A HG12 5  
ATOM   2048 H  HG13 . VAL A 1 4  ? 0.320   -6.143  6.098  1.00 0.00 ? 105 VAL A HG13 5  
ATOM   2049 H  HG21 . VAL A 1 4  ? 0.441   -3.547  4.293  1.00 0.00 ? 105 VAL A HG21 5  
ATOM   2050 H  HG22 . VAL A 1 4  ? 1.059   -4.739  3.124  1.00 0.00 ? 105 VAL A HG22 5  
ATOM   2051 H  HG23 . VAL A 1 4  ? -0.468  -3.882  2.799  1.00 0.00 ? 105 VAL A HG23 5  
ATOM   2052 N  N    . CYS A 1 5  ? -0.959  -8.793  4.895  1.00 0.00 ? 106 CYS A N    5  
ATOM   2053 C  CA   . CYS A 1 5  ? -1.870  -9.865  5.257  1.00 0.00 ? 106 CYS A CA   5  
ATOM   2054 C  C    . CYS A 1 5  ? -3.136  -9.240  5.847  1.00 0.00 ? 106 CYS A C    5  
ATOM   2055 O  O    . CYS A 1 5  ? -3.190  -8.952  7.042  1.00 0.00 ? 106 CYS A O    5  
ATOM   2056 C  CB   . CYS A 1 5  ? -1.221  -10.859 6.222  1.00 0.00 ? 106 CYS A CB   5  
ATOM   2057 S  SG   . CYS A 1 5  ? -2.320  -12.302 6.466  1.00 0.00 ? 106 CYS A SG   5  
ATOM   2058 H  H    . CYS A 1 5  ? -0.070  -8.821  5.355  1.00 0.00 ? 106 CYS A H    5  
ATOM   2059 H  HA   . CYS A 1 5  ? -2.098  -10.405 4.338  1.00 0.00 ? 106 CYS A HA   5  
ATOM   2060 H  HB2  . CYS A 1 5  ? -0.259  -11.186 5.826  1.00 0.00 ? 106 CYS A HB2  5  
ATOM   2061 H  HB3  . CYS A 1 5  ? -1.024  -10.375 7.178  1.00 0.00 ? 106 CYS A HB3  5  
ATOM   2062 N  N    . GLU A 1 6  ? -4.121  -9.048  4.984  1.00 0.00 ? 107 GLU A N    5  
ATOM   2063 C  CA   . GLU A 1 6  ? -5.383  -8.462  5.405  1.00 0.00 ? 107 GLU A CA   5  
ATOM   2064 C  C    . GLU A 1 6  ? -5.873  -9.128  6.693  1.00 0.00 ? 107 GLU A C    5  
ATOM   2065 O  O    . GLU A 1 6  ? -6.717  -8.576  7.398  1.00 0.00 ? 107 GLU A O    5  
ATOM   2066 C  CB   . GLU A 1 6  ? -6.434  -8.569  4.299  1.00 0.00 ? 107 GLU A CB   5  
ATOM   2067 C  CG   . GLU A 1 6  ? -6.598  -10.019 3.837  1.00 0.00 ? 107 GLU A CG   5  
ATOM   2068 C  CD   . GLU A 1 6  ? -7.244  -10.083 2.451  1.00 0.00 ? 107 GLU A CD   5  
ATOM   2069 O  OE1  . GLU A 1 6  ? -6.563  -9.672  1.487  1.00 0.00 ? 107 GLU A OE1  5  
ATOM   2070 O  OE2  . GLU A 1 6  ? -8.406  -10.541 2.387  1.00 0.00 ? 107 GLU A OE2  5  
ATOM   2071 H  H    . GLU A 1 6  ? -4.069  -9.285  4.014  1.00 0.00 ? 107 GLU A H    5  
ATOM   2072 H  HA   . GLU A 1 6  ? -5.166  -7.410  5.591  1.00 0.00 ? 107 GLU A HA   5  
ATOM   2073 H  HB2  . GLU A 1 6  ? -7.389  -8.190  4.661  1.00 0.00 ? 107 GLU A HB2  5  
ATOM   2074 H  HB3  . GLU A 1 6  ? -6.143  -7.945  3.454  1.00 0.00 ? 107 GLU A HB3  5  
ATOM   2075 H  HG2  . GLU A 1 6  ? -5.624  -10.508 3.810  1.00 0.00 ? 107 GLU A HG2  5  
ATOM   2076 H  HG3  . GLU A 1 6  ? -7.210  -10.566 4.553  1.00 0.00 ? 107 GLU A HG3  5  
ATOM   2077 N  N    . VAL A 1 7  ? -5.322  -10.302 6.961  1.00 0.00 ? 108 VAL A N    5  
ATOM   2078 C  CA   . VAL A 1 7  ? -5.693  -11.049 8.152  1.00 0.00 ? 108 VAL A CA   5  
ATOM   2079 C  C    . VAL A 1 7  ? -5.037  -10.404 9.376  1.00 0.00 ? 108 VAL A C    5  
ATOM   2080 O  O    . VAL A 1 7  ? -5.715  -9.780  10.191 1.00 0.00 ? 108 VAL A O    5  
ATOM   2081 C  CB   . VAL A 1 7  ? -5.322  -12.523 7.982  1.00 0.00 ? 108 VAL A CB   5  
ATOM   2082 C  CG1  . VAL A 1 7  ? -5.441  -13.275 9.309  1.00 0.00 ? 108 VAL A CG1  5  
ATOM   2083 C  CG2  . VAL A 1 7  ? -6.179  -13.182 6.899  1.00 0.00 ? 108 VAL A CG2  5  
ATOM   2084 H  H    . VAL A 1 7  ? -4.636  -10.743 6.383  1.00 0.00 ? 108 VAL A H    5  
ATOM   2085 H  HA   . VAL A 1 7  ? -6.774  -10.982 8.258  1.00 0.00 ? 108 VAL A HA   5  
ATOM   2086 H  HB   . VAL A 1 7  ? -4.281  -12.572 7.662  1.00 0.00 ? 108 VAL A HB   5  
ATOM   2087 H  HG11 . VAL A 1 7  ? -6.485  -13.293 9.622  1.00 0.00 ? 108 VAL A HG11 5  
ATOM   2088 H  HG12 . VAL A 1 7  ? -5.081  -14.296 9.182  1.00 0.00 ? 108 VAL A HG12 5  
ATOM   2089 H  HG13 . VAL A 1 7  ? -4.843  -12.770 10.068 1.00 0.00 ? 108 VAL A HG13 5  
ATOM   2090 H  HG21 . VAL A 1 7  ? -7.172  -12.733 6.899  1.00 0.00 ? 108 VAL A HG21 5  
ATOM   2091 H  HG22 . VAL A 1 7  ? -5.713  -13.031 5.926  1.00 0.00 ? 108 VAL A HG22 5  
ATOM   2092 H  HG23 . VAL A 1 7  ? -6.262  -14.250 7.101  1.00 0.00 ? 108 VAL A HG23 5  
ATOM   2093 N  N    . CYS A 1 8  ? -3.727  -10.580 9.467  1.00 0.00 ? 109 CYS A N    5  
ATOM   2094 C  CA   . CYS A 1 8  ? -2.973  -10.023 10.577 1.00 0.00 ? 109 CYS A CA   5  
ATOM   2095 C  C    . CYS A 1 8  ? -2.541  -8.604  10.202 1.00 0.00 ? 109 CYS A C    5  
ATOM   2096 O  O    . CYS A 1 8  ? -2.268  -7.783  11.077 1.00 0.00 ? 109 CYS A O    5  
ATOM   2097 C  CB   . CYS A 1 8  ? -1.777  -10.905 10.946 1.00 0.00 ? 109 CYS A CB   5  
ATOM   2098 S  SG   . CYS A 1 8  ? -0.596  -10.974 9.551  1.00 0.00 ? 109 CYS A SG   5  
ATOM   2099 H  H    . CYS A 1 8  ? -3.183  -11.088 8.799  1.00 0.00 ? 109 CYS A H    5  
ATOM   2100 H  HA   . CYS A 1 8  ? -3.644  -10.010 11.436 1.00 0.00 ? 109 CYS A HA   5  
ATOM   2101 H  HB2  . CYS A 1 8  ? -1.283  -10.507 11.833 1.00 0.00 ? 109 CYS A HB2  5  
ATOM   2102 H  HB3  . CYS A 1 8  ? -2.119  -11.909 11.196 1.00 0.00 ? 109 CYS A HB3  5  
ATOM   2103 N  N    . THR A 1 9  ? -2.494  -8.358  8.901  1.00 0.00 ? 110 THR A N    5  
ATOM   2104 C  CA   . THR A 1 9  ? -2.100  -7.052  8.401  1.00 0.00 ? 110 THR A CA   5  
ATOM   2105 C  C    . THR A 1 9  ? -0.575  -6.935  8.358  1.00 0.00 ? 110 THR A C    5  
ATOM   2106 O  O    . THR A 1 9  ? -0.026  -5.854  8.568  1.00 0.00 ? 110 THR A O    5  
ATOM   2107 C  CB   . THR A 1 9  ? -2.768  -5.990  9.276  1.00 0.00 ? 110 THR A CB   5  
ATOM   2108 O  OG1  . THR A 1 9  ? -1.936  -5.919  10.431 1.00 0.00 ? 110 THR A OG1  5  
ATOM   2109 C  CG2  . THR A 1 9  ? -4.123  -6.445  9.820  1.00 0.00 ? 110 THR A CG2  5  
ATOM   2110 H  H    . THR A 1 9  ? -2.717  -9.032  8.196  1.00 0.00 ? 110 THR A H    5  
ATOM   2111 H  HA   . THR A 1 9  ? -2.457  -6.957  7.375  1.00 0.00 ? 110 THR A HA   5  
ATOM   2112 H  HB   . THR A 1 9  ? -2.860  -5.045  8.739  1.00 0.00 ? 110 THR A HB   5  
ATOM   2113 H  HG1  . THR A 1 9  ? -1.064  -5.488  10.199 1.00 0.00 ? 110 THR A HG1  5  
ATOM   2114 H  HG21 . THR A 1 9  ? -4.400  -7.392  9.356  1.00 0.00 ? 110 THR A HG21 5  
ATOM   2115 H  HG22 . THR A 1 9  ? -4.056  -6.576  10.900 1.00 0.00 ? 110 THR A HG22 5  
ATOM   2116 H  HG23 . THR A 1 9  ? -4.878  -5.694  9.590  1.00 0.00 ? 110 THR A HG23 5  
ATOM   2117 N  N    . ARG A 1 10 ? 0.066   -8.062  8.085  1.00 0.00 ? 111 ARG A N    5  
ATOM   2118 C  CA   . ARG A 1 10 ? 1.517   -8.098  8.012  1.00 0.00 ? 111 ARG A CA   5  
ATOM   2119 C  C    . ARG A 1 10 ? 1.985   -7.785  6.589  1.00 0.00 ? 111 ARG A C    5  
ATOM   2120 O  O    . ARG A 1 10 ? 1.562   -8.436  5.635  1.00 0.00 ? 111 ARG A O    5  
ATOM   2121 C  CB   . ARG A 1 10 ? 2.054   -9.469  8.428  1.00 0.00 ? 111 ARG A CB   5  
ATOM   2122 C  CG   . ARG A 1 10 ? 2.247   -9.545  9.944  1.00 0.00 ? 111 ARG A CG   5  
ATOM   2123 C  CD   . ARG A 1 10 ? 2.623   -10.964 10.378 1.00 0.00 ? 111 ARG A CD   5  
ATOM   2124 N  NE   . ARG A 1 10 ? 2.291   -11.160 11.808 1.00 0.00 ? 111 ARG A NE   5  
ATOM   2125 C  CZ   . ARG A 1 10 ? 3.169   -11.010 12.809 1.00 0.00 ? 111 ARG A CZ   5  
ATOM   2126 N  NH1  . ARG A 1 10 ? 3.386   -9.798  13.335 1.00 0.00 ? 111 ARG A NH1  5  
ATOM   2127 N  NH2  . ARG A 1 10 ? 3.830   -12.075 13.286 1.00 0.00 ? 111 ARG A NH2  5  
ATOM   2128 H  H    . ARG A 1 10 ? -0.388  -8.936  7.915  1.00 0.00 ? 111 ARG A H    5  
ATOM   2129 H  HA   . ARG A 1 10 ? 1.851   -7.333  8.713  1.00 0.00 ? 111 ARG A HA   5  
ATOM   2130 H  HB2  . ARG A 1 10 ? 1.363   -10.248 8.106  1.00 0.00 ? 111 ARG A HB2  5  
ATOM   2131 H  HB3  . ARG A 1 10 ? 3.003   -9.659  7.927  1.00 0.00 ? 111 ARG A HB3  5  
ATOM   2132 H  HG2  . ARG A 1 10 ? 3.027   -8.849  10.251 1.00 0.00 ? 111 ARG A HG2  5  
ATOM   2133 H  HG3  . ARG A 1 10 ? 1.330   -9.238  10.447 1.00 0.00 ? 111 ARG A HG3  5  
ATOM   2134 H  HD2  . ARG A 1 10 ? 2.088   -11.693 9.769  1.00 0.00 ? 111 ARG A HD2  5  
ATOM   2135 H  HD3  . ARG A 1 10 ? 3.687   -11.133 10.217 1.00 0.00 ? 111 ARG A HD3  5  
ATOM   2136 H  HE   . ARG A 1 10 ? 1.354   -11.420 12.040 1.00 0.00 ? 111 ARG A HE   5  
ATOM   2137 H  HH11 . ARG A 1 10 ? 3.757   -9.064  12.764 1.00 0.00 ? 111 ARG A HH11 5  
ATOM   2138 H  HH12 . ARG A 1 10 ? 3.177   -9.624  14.297 1.00 0.00 ? 111 ARG A HH12 5  
ATOM   2139 H  HH21 . ARG A 1 10 ? 3.362   -12.953 13.379 1.00 0.00 ? 111 ARG A HH21 5  
ATOM   2140 H  HH22 . ARG A 1 10 ? 4.791   -11.991 13.547 1.00 0.00 ? 111 ARG A HH22 5  
ATOM   2141 N  N    . ALA A 1 11 ? 2.852   -6.788  6.493  1.00 0.00 ? 112 ALA A N    5  
ATOM   2142 C  CA   . ALA A 1 11 ? 3.382   -6.380  5.203  1.00 0.00 ? 112 ALA A CA   5  
ATOM   2143 C  C    . ALA A 1 11 ? 4.699   -7.114  4.943  1.00 0.00 ? 112 ALA A C    5  
ATOM   2144 O  O    . ALA A 1 11 ? 5.505   -7.292  5.855  1.00 0.00 ? 112 ALA A O    5  
ATOM   2145 C  CB   . ALA A 1 11 ? 3.547   -4.859  5.177  1.00 0.00 ? 112 ALA A CB   5  
ATOM   2146 H  H    . ALA A 1 11 ? 3.191   -6.263  7.274  1.00 0.00 ? 112 ALA A H    5  
ATOM   2147 H  HA   . ALA A 1 11 ? 2.658   -6.668  4.441  1.00 0.00 ? 112 ALA A HA   5  
ATOM   2148 H  HB1  . ALA A 1 11 ? 2.821   -4.427  4.488  1.00 0.00 ? 112 ALA A HB1  5  
ATOM   2149 H  HB2  . ALA A 1 11 ? 3.383   -4.459  6.177  1.00 0.00 ? 112 ALA A HB2  5  
ATOM   2150 H  HB3  . ALA A 1 11 ? 4.555   -4.609  4.845  1.00 0.00 ? 112 ALA A HB3  5  
ATOM   2151 N  N    . PHE A 1 12 ? 4.876   -7.520  3.693  1.00 0.00 ? 113 PHE A N    5  
ATOM   2152 C  CA   . PHE A 1 12 ? 6.082   -8.230  3.302  1.00 0.00 ? 113 PHE A CA   5  
ATOM   2153 C  C    . PHE A 1 12 ? 6.692   -7.621  2.039  1.00 0.00 ? 113 PHE A C    5  
ATOM   2154 O  O    . PHE A 1 12 ? 6.048   -6.826  1.356  1.00 0.00 ? 113 PHE A O    5  
ATOM   2155 C  CB   . PHE A 1 12 ? 5.674   -9.676  3.011  1.00 0.00 ? 113 PHE A CB   5  
ATOM   2156 C  CG   . PHE A 1 12 ? 5.138   -10.430 4.230  1.00 0.00 ? 113 PHE A CG   5  
ATOM   2157 C  CD1  . PHE A 1 12 ? 6.004   -10.972 5.128  1.00 0.00 ? 113 PHE A CD1  5  
ATOM   2158 C  CD2  . PHE A 1 12 ? 3.797   -10.557 4.416  1.00 0.00 ? 113 PHE A CD2  5  
ATOM   2159 C  CE1  . PHE A 1 12 ? 5.507   -11.672 6.260  1.00 0.00 ? 113 PHE A CE1  5  
ATOM   2160 C  CE2  . PHE A 1 12 ? 3.301   -11.256 5.547  1.00 0.00 ? 113 PHE A CE2  5  
ATOM   2161 C  CZ   . PHE A 1 12 ? 4.166   -11.798 6.445  1.00 0.00 ? 113 PHE A CZ   5  
ATOM   2162 H  H    . PHE A 1 12 ? 4.216   -7.371  2.959  1.00 0.00 ? 113 PHE A H    5  
ATOM   2163 H  HA   . PHE A 1 12 ? 6.791   -8.142  4.125  1.00 0.00 ? 113 PHE A HA   5  
ATOM   2164 H  HB2  . PHE A 1 12 ? 4.912   -9.678  2.231  1.00 0.00 ? 113 PHE A HB2  5  
ATOM   2165 H  HB3  . PHE A 1 12 ? 6.536   -10.213 2.614  1.00 0.00 ? 113 PHE A HB3  5  
ATOM   2166 H  HD1  . PHE A 1 12 ? 7.079   -10.871 4.978  1.00 0.00 ? 113 PHE A HD1  5  
ATOM   2167 H  HD2  . PHE A 1 12 ? 3.104   -10.122 3.696  1.00 0.00 ? 113 PHE A HD2  5  
ATOM   2168 H  HE1  . PHE A 1 12 ? 6.201   -12.106 6.979  1.00 0.00 ? 113 PHE A HE1  5  
ATOM   2169 H  HE2  . PHE A 1 12 ? 2.226   -11.358 5.696  1.00 0.00 ? 113 PHE A HE2  5  
ATOM   2170 H  HZ   . PHE A 1 12 ? 3.785   -12.336 7.314  1.00 0.00 ? 113 PHE A HZ   5  
ATOM   2171 N  N    . ALA A 1 13 ? 7.926   -8.016  1.767  1.00 0.00 ? 114 ALA A N    5  
ATOM   2172 C  CA   . ALA A 1 13 ? 8.630   -7.518  0.596  1.00 0.00 ? 114 ALA A CA   5  
ATOM   2173 C  C    . ALA A 1 13 ? 8.339   -8.430  -0.597 1.00 0.00 ? 114 ALA A C    5  
ATOM   2174 O  O    . ALA A 1 13 ? 8.587   -8.058  -1.742 1.00 0.00 ? 114 ALA A O    5  
ATOM   2175 C  CB   . ALA A 1 13 ? 10.126  -7.420  0.904  1.00 0.00 ? 114 ALA A CB   5  
ATOM   2176 H  H    . ALA A 1 13 ? 8.443   -8.662  2.326  1.00 0.00 ? 114 ALA A H    5  
ATOM   2177 H  HA   . ALA A 1 13 ? 8.251   -6.519  0.381  1.00 0.00 ? 114 ALA A HA   5  
ATOM   2178 H  HB1  . ALA A 1 13 ? 10.317  -7.809  1.904  1.00 0.00 ? 114 ALA A HB1  5  
ATOM   2179 H  HB2  . ALA A 1 13 ? 10.686  -8.005  0.174  1.00 0.00 ? 114 ALA A HB2  5  
ATOM   2180 H  HB3  . ALA A 1 13 ? 10.441  -6.378  0.852  1.00 0.00 ? 114 ALA A HB3  5  
ATOM   2181 N  N    . ARG A 1 14 ? 7.816   -9.607  -0.286 1.00 0.00 ? 115 ARG A N    5  
ATOM   2182 C  CA   . ARG A 1 14 ? 7.488   -10.576 -1.318 1.00 0.00 ? 115 ARG A CA   5  
ATOM   2183 C  C    . ARG A 1 14 ? 6.113   -11.192 -1.050 1.00 0.00 ? 115 ARG A C    5  
ATOM   2184 O  O    . ARG A 1 14 ? 5.681   -11.278 0.098  1.00 0.00 ? 115 ARG A O    5  
ATOM   2185 C  CB   . ARG A 1 14 ? 8.534   -11.691 -1.380 1.00 0.00 ? 115 ARG A CB   5  
ATOM   2186 C  CG   . ARG A 1 14 ? 9.944   -11.129 -1.187 1.00 0.00 ? 115 ARG A CG   5  
ATOM   2187 C  CD   . ARG A 1 14 ? 10.431  -10.420 -2.452 1.00 0.00 ? 115 ARG A CD   5  
ATOM   2188 N  NE   . ARG A 1 14 ? 11.682  -9.680  -2.168 1.00 0.00 ? 115 ARG A NE   5  
ATOM   2189 C  CZ   . ARG A 1 14 ? 12.864  -9.959  -2.733 1.00 0.00 ? 115 ARG A CZ   5  
ATOM   2190 N  NH1  . ARG A 1 14 ? 13.309  -11.223 -2.765 1.00 0.00 ? 115 ARG A NH1  5  
ATOM   2191 N  NH2  . ARG A 1 14 ? 13.601  -8.976  -3.265 1.00 0.00 ? 115 ARG A NH2  5  
ATOM   2192 H  H    . ARG A 1 14 ? 7.618   -9.902  0.649  1.00 0.00 ? 115 ARG A H    5  
ATOM   2193 H  HA   . ARG A 1 14 ? 7.488   -10.005 -2.246 1.00 0.00 ? 115 ARG A HA   5  
ATOM   2194 H  HB2  . ARG A 1 14 ? 8.326   -12.434 -0.611 1.00 0.00 ? 115 ARG A HB2  5  
ATOM   2195 H  HB3  . ARG A 1 14 ? 8.470   -12.200 -2.342 1.00 0.00 ? 115 ARG A HB3  5  
ATOM   2196 H  HG2  . ARG A 1 14 ? 9.951   -10.432 -0.349 1.00 0.00 ? 115 ARG A HG2  5  
ATOM   2197 H  HG3  . ARG A 1 14 ? 10.630  -11.939 -0.933 1.00 0.00 ? 115 ARG A HG3  5  
ATOM   2198 H  HD2  . ARG A 1 14 ? 10.601  -11.148 -3.245 1.00 0.00 ? 115 ARG A HD2  5  
ATOM   2199 H  HD3  . ARG A 1 14 ? 9.665   -9.731  -2.810 1.00 0.00 ? 115 ARG A HD3  5  
ATOM   2200 H  HE   . ARG A 1 14 ? 11.641  -8.925  -1.514 1.00 0.00 ? 115 ARG A HE   5  
ATOM   2201 H  HH11 . ARG A 1 14 ? 12.689  -11.977 -2.545 1.00 0.00 ? 115 ARG A HH11 5  
ATOM   2202 H  HH12 . ARG A 1 14 ? 14.260  -11.412 -3.009 1.00 0.00 ? 115 ARG A HH12 5  
ATOM   2203 H  HH21 . ARG A 1 14 ? 13.413  -8.023  -3.025 1.00 0.00 ? 115 ARG A HH21 5  
ATOM   2204 H  HH22 . ARG A 1 14 ? 14.339  -9.193  -3.904 1.00 0.00 ? 115 ARG A HH22 5  
ATOM   2205 N  N    . GLN A 1 15 ? 5.465   -11.605 -2.129 1.00 0.00 ? 116 GLN A N    5  
ATOM   2206 C  CA   . GLN A 1 15 ? 4.148   -12.210 -2.024 1.00 0.00 ? 116 GLN A CA   5  
ATOM   2207 C  C    . GLN A 1 15 ? 4.243   -13.577 -1.344 1.00 0.00 ? 116 GLN A C    5  
ATOM   2208 O  O    . GLN A 1 15 ? 3.464   -13.882 -0.443 1.00 0.00 ? 116 GLN A O    5  
ATOM   2209 C  CB   . GLN A 1 15 ? 3.488   -12.328 -3.400 1.00 0.00 ? 116 GLN A CB   5  
ATOM   2210 C  CG   . GLN A 1 15 ? 3.433   -10.969 -4.101 1.00 0.00 ? 116 GLN A CG   5  
ATOM   2211 C  CD   . GLN A 1 15 ? 1.987   -10.551 -4.375 1.00 0.00 ? 116 GLN A CD   5  
ATOM   2212 O  OE1  . GLN A 1 15 ? 1.173   -10.412 -3.476 1.00 0.00 ? 116 GLN A OE1  5  
ATOM   2213 N  NE2  . GLN A 1 15 ? 1.713   -10.360 -5.662 1.00 0.00 ? 116 GLN A NE2  5  
ATOM   2214 H  H    . GLN A 1 15 ? 5.824   -11.531 -3.060 1.00 0.00 ? 116 GLN A H    5  
ATOM   2215 H  HA   . GLN A 1 15 ? 3.563   -11.529 -1.406 1.00 0.00 ? 116 GLN A HA   5  
ATOM   2216 H  HB2  . GLN A 1 15 ? 4.044   -13.036 -4.014 1.00 0.00 ? 116 GLN A HB2  5  
ATOM   2217 H  HB3  . GLN A 1 15 ? 2.479   -12.726 -3.291 1.00 0.00 ? 116 GLN A HB3  5  
ATOM   2218 H  HG2  . GLN A 1 15 ? 3.922   -10.217 -3.481 1.00 0.00 ? 116 GLN A HG2  5  
ATOM   2219 H  HG3  . GLN A 1 15 ? 3.986   -11.018 -5.039 1.00 0.00 ? 116 GLN A HG3  5  
ATOM   2220 H  HE21 . GLN A 1 15 ? 2.447   -10.121 -6.298 1.00 0.00 ? 116 GLN A HE21 5  
ATOM   2221 H  HE22 . GLN A 1 15 ? 0.775   -10.455 -5.993 1.00 0.00 ? 116 GLN A HE22 5  
ATOM   2222 N  N    . GLU A 1 16 ? 5.208   -14.363 -1.800 1.00 0.00 ? 117 GLU A N    5  
ATOM   2223 C  CA   . GLU A 1 16 ? 5.416   -15.690 -1.246 1.00 0.00 ? 117 GLU A CA   5  
ATOM   2224 C  C    . GLU A 1 16 ? 5.344   -15.645 0.282  1.00 0.00 ? 117 GLU A C    5  
ATOM   2225 O  O    . GLU A 1 16 ? 4.699   -16.489 0.902  1.00 0.00 ? 117 GLU A O    5  
ATOM   2226 C  CB   . GLU A 1 16 ? 6.749   -16.277 -1.714 1.00 0.00 ? 117 GLU A CB   5  
ATOM   2227 C  CG   . GLU A 1 16 ? 7.006   -15.947 -3.186 1.00 0.00 ? 117 GLU A CG   5  
ATOM   2228 C  CD   . GLU A 1 16 ? 5.697   -15.915 -3.977 1.00 0.00 ? 117 GLU A CD   5  
ATOM   2229 O  OE1  . GLU A 1 16 ? 4.877   -16.832 -3.757 1.00 0.00 ? 117 GLU A OE1  5  
ATOM   2230 O  OE2  . GLU A 1 16 ? 5.546   -14.973 -4.785 1.00 0.00 ? 117 GLU A OE2  5  
ATOM   2231 H  H    . GLU A 1 16 ? 5.838   -14.108 -2.533 1.00 0.00 ? 117 GLU A H    5  
ATOM   2232 H  HA   . GLU A 1 16 ? 4.601   -16.299 -1.637 1.00 0.00 ? 117 GLU A HA   5  
ATOM   2233 H  HB2  . GLU A 1 16 ? 7.560   -15.881 -1.103 1.00 0.00 ? 117 GLU A HB2  5  
ATOM   2234 H  HB3  . GLU A 1 16 ? 6.744   -17.358 -1.575 1.00 0.00 ? 117 GLU A HB3  5  
ATOM   2235 H  HG2  . GLU A 1 16 ? 7.506   -14.982 -3.264 1.00 0.00 ? 117 GLU A HG2  5  
ATOM   2236 H  HG3  . GLU A 1 16 ? 7.677   -16.690 -3.617 1.00 0.00 ? 117 GLU A HG3  5  
ATOM   2237 N  N    . HIS A 1 17 ? 6.014   -14.650 0.845  1.00 0.00 ? 118 HIS A N    5  
ATOM   2238 C  CA   . HIS A 1 17 ? 6.033   -14.483 2.288  1.00 0.00 ? 118 HIS A CA   5  
ATOM   2239 C  C    . HIS A 1 17 ? 4.599   -14.440 2.820  1.00 0.00 ? 118 HIS A C    5  
ATOM   2240 O  O    . HIS A 1 17 ? 4.286   -15.076 3.825  1.00 0.00 ? 118 HIS A O    5  
ATOM   2241 C  CB   . HIS A 1 17 ? 6.850   -13.251 2.682  1.00 0.00 ? 118 HIS A CB   5  
ATOM   2242 C  CG   . HIS A 1 17 ? 8.312   -13.340 2.316  1.00 0.00 ? 118 HIS A CG   5  
ATOM   2243 N  ND1  . HIS A 1 17 ? 9.246   -12.405 2.728  1.00 0.00 ? 118 HIS A ND1  5  
ATOM   2244 C  CD2  . HIS A 1 17 ? 8.991   -14.261 1.573  1.00 0.00 ? 118 HIS A CD2  5  
ATOM   2245 C  CE1  . HIS A 1 17 ? 10.430  -12.757 2.249  1.00 0.00 ? 118 HIS A CE1  5  
ATOM   2246 N  NE2  . HIS A 1 17 ? 10.269  -13.908 1.534  1.00 0.00 ? 118 HIS A NE2  5  
ATOM   2247 H  H    . HIS A 1 17 ? 6.536   -13.967 0.334  1.00 0.00 ? 118 HIS A H    5  
ATOM   2248 H  HA   . HIS A 1 17 ? 6.536   -15.359 2.697  1.00 0.00 ? 118 HIS A HA   5  
ATOM   2249 H  HB2  . HIS A 1 17 ? 6.417   -12.373 2.201  1.00 0.00 ? 118 HIS A HB2  5  
ATOM   2250 H  HB3  . HIS A 1 17 ? 6.763   -13.099 3.757  1.00 0.00 ? 118 HIS A HB3  5  
ATOM   2251 H  HD1  . HIS A 1 17 ? 9.059   -11.601 3.292  1.00 0.00 ? 118 HIS A HD1  5  
ATOM   2252 H  HD2  . HIS A 1 17 ? 8.556   -15.138 1.094  1.00 0.00 ? 118 HIS A HD2  5  
ATOM   2253 H  HE1  . HIS A 1 17 ? 11.367  -12.223 2.400  1.00 0.00 ? 118 HIS A HE1  5  
ATOM   2254 H  HE2  . HIS A 1 17 ? 11.004  -14.433 1.104  1.00 0.00 ? 118 HIS A HE2  5  
ATOM   2255 N  N    . LEU A 1 18 ? 3.767   -13.683 2.120  1.00 0.00 ? 119 LEU A N    5  
ATOM   2256 C  CA   . LEU A 1 18 ? 2.373   -13.548 2.509  1.00 0.00 ? 119 LEU A CA   5  
ATOM   2257 C  C    . LEU A 1 18 ? 1.658   -14.884 2.303  1.00 0.00 ? 119 LEU A C    5  
ATOM   2258 O  O    . LEU A 1 18 ? 1.175   -15.488 3.260  1.00 0.00 ? 119 LEU A O    5  
ATOM   2259 C  CB   . LEU A 1 18 ? 1.720   -12.380 1.766  1.00 0.00 ? 119 LEU A CB   5  
ATOM   2260 C  CG   . LEU A 1 18 ? 0.202   -12.460 1.593  1.00 0.00 ? 119 LEU A CG   5  
ATOM   2261 C  CD1  . LEU A 1 18 ? -0.468  -12.977 2.868  1.00 0.00 ? 119 LEU A CD1  5  
ATOM   2262 C  CD2  . LEU A 1 18 ? -0.371  -11.112 1.151  1.00 0.00 ? 119 LEU A CD2  5  
ATOM   2263 H  H    . LEU A 1 18 ? 4.029   -13.169 1.304  1.00 0.00 ? 119 LEU A H    5  
ATOM   2264 H  HA   . LEU A 1 18 ? 2.352   -13.305 3.572  1.00 0.00 ? 119 LEU A HA   5  
ATOM   2265 H  HB2  . LEU A 1 18 ? 1.958   -11.459 2.297  1.00 0.00 ? 119 LEU A HB2  5  
ATOM   2266 H  HB3  . LEU A 1 18 ? 2.175   -12.305 0.778  1.00 0.00 ? 119 LEU A HB3  5  
ATOM   2267 H  HG   . LEU A 1 18 ? -0.014  -13.177 0.802  1.00 0.00 ? 119 LEU A HG   5  
ATOM   2268 H  HD11 . LEU A 1 18 ? -1.539  -12.780 2.820  1.00 0.00 ? 119 LEU A HD11 5  
ATOM   2269 H  HD12 . LEU A 1 18 ? -0.299  -14.050 2.957  1.00 0.00 ? 119 LEU A HD12 5  
ATOM   2270 H  HD13 . LEU A 1 18 ? -0.043  -12.469 3.733  1.00 0.00 ? 119 LEU A HD13 5  
ATOM   2271 H  HD21 . LEU A 1 18 ? -0.683  -10.544 2.027  1.00 0.00 ? 119 LEU A HD21 5  
ATOM   2272 H  HD22 . LEU A 1 18 ? 0.392   -10.553 0.609  1.00 0.00 ? 119 LEU A HD22 5  
ATOM   2273 H  HD23 . LEU A 1 18 ? -1.229  -11.278 0.500  1.00 0.00 ? 119 LEU A HD23 5  
ATOM   2274 N  N    . LYS A 1 19 ? 1.615   -15.308 1.048  1.00 0.00 ? 120 LYS A N    5  
ATOM   2275 C  CA   . LYS A 1 19 ? 0.967   -16.563 0.704  1.00 0.00 ? 120 LYS A CA   5  
ATOM   2276 C  C    . LYS A 1 19 ? 1.426   -17.651 1.677  1.00 0.00 ? 120 LYS A C    5  
ATOM   2277 O  O    . LYS A 1 19 ? 0.605   -18.282 2.341  1.00 0.00 ? 120 LYS A O    5  
ATOM   2278 C  CB   . LYS A 1 19 ? 1.214   -16.908 -0.765 1.00 0.00 ? 120 LYS A CB   5  
ATOM   2279 C  CG   . LYS A 1 19 ? -0.058  -16.718 -1.594 1.00 0.00 ? 120 LYS A CG   5  
ATOM   2280 C  CD   . LYS A 1 19 ? -1.248  -17.428 -0.943 1.00 0.00 ? 120 LYS A CD   5  
ATOM   2281 C  CE   . LYS A 1 19 ? -2.196  -17.992 -2.003 1.00 0.00 ? 120 LYS A CE   5  
ATOM   2282 N  NZ   . LYS A 1 19 ? -1.608  -19.193 -2.637 1.00 0.00 ? 120 LYS A NZ   5  
ATOM   2283 H  H    . LYS A 1 19 ? 2.011   -14.812 0.276  1.00 0.00 ? 120 LYS A H    5  
ATOM   2284 H  HA   . LYS A 1 19 ? -0.106  -16.420 0.827  1.00 0.00 ? 120 LYS A HA   5  
ATOM   2285 H  HB2  . LYS A 1 19 ? 2.008   -16.276 -1.163 1.00 0.00 ? 120 LYS A HB2  5  
ATOM   2286 H  HB3  . LYS A 1 19 ? 1.556   -17.939 -0.848 1.00 0.00 ? 120 LYS A HB3  5  
ATOM   2287 H  HG2  . LYS A 1 19 ? -0.276  -15.655 -1.695 1.00 0.00 ? 120 LYS A HG2  5  
ATOM   2288 H  HG3  . LYS A 1 19 ? 0.097   -17.109 -2.599 1.00 0.00 ? 120 LYS A HG3  5  
ATOM   2289 H  HD2  . LYS A 1 19 ? -0.889  -18.235 -0.304 1.00 0.00 ? 120 LYS A HD2  5  
ATOM   2290 H  HD3  . LYS A 1 19 ? -1.786  -16.729 -0.303 1.00 0.00 ? 120 LYS A HD3  5  
ATOM   2291 H  HE2  . LYS A 1 19 ? -3.151  -18.247 -1.545 1.00 0.00 ? 120 LYS A HE2  5  
ATOM   2292 H  HE3  . LYS A 1 19 ? -2.397  -17.235 -2.760 1.00 0.00 ? 120 LYS A HE3  5  
ATOM   2293 H  HZ1  . LYS A 1 19 ? -2.102  -19.399 -3.482 1.00 0.00 ? 120 LYS A HZ1  5  
ATOM   2294 H  HZ2  . LYS A 1 19 ? -0.645  -19.021 -2.848 1.00 0.00 ? 120 LYS A HZ2  5  
ATOM   2295 H  HZ3  . LYS A 1 19 ? -1.678  -19.970 -2.012 1.00 0.00 ? 120 LYS A HZ3  5  
ATOM   2296 N  N    . ARG A 1 20 ? 2.737   -17.839 1.731  1.00 0.00 ? 121 ARG A N    5  
ATOM   2297 C  CA   . ARG A 1 20 ? 3.314   -18.840 2.611  1.00 0.00 ? 121 ARG A CA   5  
ATOM   2298 C  C    . ARG A 1 20 ? 2.898   -18.577 4.059  1.00 0.00 ? 121 ARG A C    5  
ATOM   2299 O  O    . ARG A 1 20 ? 2.671   -19.514 4.825  1.00 0.00 ? 121 ARG A O    5  
ATOM   2300 C  CB   . ARG A 1 20 ? 4.841   -18.841 2.518  1.00 0.00 ? 121 ARG A CB   5  
ATOM   2301 C  CG   . ARG A 1 20 ? 5.421   -20.156 3.039  1.00 0.00 ? 121 ARG A CG   5  
ATOM   2302 C  CD   . ARG A 1 20 ? 5.396   -20.199 4.569  1.00 0.00 ? 121 ARG A CD   5  
ATOM   2303 N  NE   . ARG A 1 20 ? 6.762   -20.424 5.092  1.00 0.00 ? 121 ARG A NE   5  
ATOM   2304 C  CZ   . ARG A 1 20 ? 7.181   -21.579 5.628  1.00 0.00 ? 121 ARG A CZ   5  
ATOM   2305 N  NH1  . ARG A 1 20 ? 6.813   -22.744 5.079  1.00 0.00 ? 121 ARG A NH1  5  
ATOM   2306 N  NH2  . ARG A 1 20 ? 7.966   -21.566 6.714  1.00 0.00 ? 121 ARG A NH2  5  
ATOM   2307 H  H    . ARG A 1 20 ? 3.398   -17.321 1.188  1.00 0.00 ? 121 ARG A H    5  
ATOM   2308 H  HA   . ARG A 1 20 ? 2.913   -19.789 2.254  1.00 0.00 ? 121 ARG A HA   5  
ATOM   2309 H  HB2  . ARG A 1 20 ? 5.145   -18.690 1.482  1.00 0.00 ? 121 ARG A HB2  5  
ATOM   2310 H  HB3  . ARG A 1 20 ? 5.244   -18.007 3.093  1.00 0.00 ? 121 ARG A HB3  5  
ATOM   2311 H  HG2  . ARG A 1 20 ? 4.851   -20.995 2.639  1.00 0.00 ? 121 ARG A HG2  5  
ATOM   2312 H  HG3  . ARG A 1 20 ? 6.446   -20.272 2.686  1.00 0.00 ? 121 ARG A HG3  5  
ATOM   2313 H  HD2  . ARG A 1 20 ? 4.997   -19.263 4.960  1.00 0.00 ? 121 ARG A HD2  5  
ATOM   2314 H  HD3  . ARG A 1 20 ? 4.733   -20.995 4.908  1.00 0.00 ? 121 ARG A HD3  5  
ATOM   2315 H  HE   . ARG A 1 20 ? 7.413   -19.667 5.041  1.00 0.00 ? 121 ARG A HE   5  
ATOM   2316 H  HH11 . ARG A 1 20 ? 7.170   -23.011 4.185  1.00 0.00 ? 121 ARG A HH11 5  
ATOM   2317 H  HH12 . ARG A 1 20 ? 6.181   -23.349 5.566  1.00 0.00 ? 121 ARG A HH12 5  
ATOM   2318 H  HH21 . ARG A 1 20 ? 7.823   -20.881 7.428  1.00 0.00 ? 121 ARG A HH21 5  
ATOM   2319 H  HH22 . ARG A 1 20 ? 8.695   -22.244 6.810  1.00 0.00 ? 121 ARG A HH22 5  
ATOM   2320 N  N    . HIS A 1 21 ? 2.811   -17.298 4.393  1.00 0.00 ? 122 HIS A N    5  
ATOM   2321 C  CA   . HIS A 1 21 ? 2.427   -16.899 5.737  1.00 0.00 ? 122 HIS A CA   5  
ATOM   2322 C  C    . HIS A 1 21 ? 0.994   -17.356 6.017  1.00 0.00 ? 122 HIS A C    5  
ATOM   2323 O  O    . HIS A 1 21 ? 0.714   -17.919 7.075  1.00 0.00 ? 122 HIS A O    5  
ATOM   2324 C  CB   . HIS A 1 21 ? 2.618   -15.394 5.932  1.00 0.00 ? 122 HIS A CB   5  
ATOM   2325 C  CG   . HIS A 1 21 ? 1.733   -14.796 7.001  1.00 0.00 ? 122 HIS A CG   5  
ATOM   2326 N  ND1  . HIS A 1 21 ? 2.042   -14.855 8.348  1.00 0.00 ? 122 HIS A ND1  5  
ATOM   2327 C  CD2  . HIS A 1 21 ? 0.549   -14.127 6.905  1.00 0.00 ? 122 HIS A CD2  5  
ATOM   2328 C  CE1  . HIS A 1 21 ? 1.079   -14.247 9.025  1.00 0.00 ? 122 HIS A CE1  5  
ATOM   2329 N  NE2  . HIS A 1 21 ? 0.154   -13.796 8.129  1.00 0.00 ? 122 HIS A NE2  5  
ATOM   2330 H  H    . HIS A 1 21 ? 2.996   -16.542 3.765  1.00 0.00 ? 122 HIS A H    5  
ATOM   2331 H  HA   . HIS A 1 21 ? 3.103   -17.412 6.420  1.00 0.00 ? 122 HIS A HA   5  
ATOM   2332 H  HB2  . HIS A 1 21 ? 3.660   -15.200 6.188  1.00 0.00 ? 122 HIS A HB2  5  
ATOM   2333 H  HB3  . HIS A 1 21 ? 2.422   -14.887 4.988  1.00 0.00 ? 122 HIS A HB3  5  
ATOM   2334 H  HD1  . HIS A 1 21 ? 2.854   -15.284 8.745  1.00 0.00 ? 122 HIS A HD1  5  
ATOM   2335 H  HD2  . HIS A 1 21 ? 0.017   -13.901 5.982  1.00 0.00 ? 122 HIS A HD2  5  
ATOM   2336 H  HE1  . HIS A 1 21 ? 1.034   -14.127 10.107 1.00 0.00 ? 122 HIS A HE1  5  
ATOM   2337 N  N    . TYR A 1 22 ? 0.125   -17.097 5.052  1.00 0.00 ? 123 TYR A N    5  
ATOM   2338 C  CA   . TYR A 1 22 ? -1.273  -17.476 5.182  1.00 0.00 ? 123 TYR A CA   5  
ATOM   2339 C  C    . TYR A 1 22 ? -1.407  -18.909 5.700  1.00 0.00 ? 123 TYR A C    5  
ATOM   2340 O  O    . TYR A 1 22 ? -2.450  -19.284 6.234  1.00 0.00 ? 123 TYR A O    5  
ATOM   2341 C  CB   . TYR A 1 22 ? -1.864  -17.398 3.773  1.00 0.00 ? 123 TYR A CB   5  
ATOM   2342 C  CG   . TYR A 1 22 ? -3.023  -16.409 3.638  1.00 0.00 ? 123 TYR A CG   5  
ATOM   2343 C  CD1  . TYR A 1 22 ? -4.265  -16.728 4.147  1.00 0.00 ? 123 TYR A CD1  5  
ATOM   2344 C  CD2  . TYR A 1 22 ? -2.826  -15.196 3.008  1.00 0.00 ? 123 TYR A CD2  5  
ATOM   2345 C  CE1  . TYR A 1 22 ? -5.356  -15.797 4.020  1.00 0.00 ? 123 TYR A CE1  5  
ATOM   2346 C  CE2  . TYR A 1 22 ? -3.917  -14.266 2.880  1.00 0.00 ? 123 TYR A CE2  5  
ATOM   2347 C  CZ   . TYR A 1 22 ? -5.129  -14.611 3.393  1.00 0.00 ? 123 TYR A CZ   5  
ATOM   2348 O  OH   . TYR A 1 22 ? -6.159  -13.732 3.272  1.00 0.00 ? 123 TYR A OH   5  
ATOM   2349 H  H    . TYR A 1 22 ? 0.360   -16.640 4.195  1.00 0.00 ? 123 TYR A H    5  
ATOM   2350 H  HA   . TYR A 1 22 ? -1.741  -16.795 5.893  1.00 0.00 ? 123 TYR A HA   5  
ATOM   2351 H  HB2  . TYR A 1 22 ? -1.076  -17.115 3.075  1.00 0.00 ? 123 TYR A HB2  5  
ATOM   2352 H  HB3  . TYR A 1 22 ? -2.210  -18.389 3.480  1.00 0.00 ? 123 TYR A HB3  5  
ATOM   2353 H  HD1  . TYR A 1 22 ? -4.421  -17.685 4.645  1.00 0.00 ? 123 TYR A HD1  5  
ATOM   2354 H  HD2  . TYR A 1 22 ? -1.845  -14.943 2.606  1.00 0.00 ? 123 TYR A HD2  5  
ATOM   2355 H  HE1  . TYR A 1 22 ? -6.344  -16.037 4.416  1.00 0.00 ? 123 TYR A HE1  5  
ATOM   2356 H  HE2  . TYR A 1 22 ? -3.776  -13.305 2.385  1.00 0.00 ? 123 TYR A HE2  5  
ATOM   2357 H  HH   . TYR A 1 22 ? -6.877  -14.124 2.698  1.00 0.00 ? 123 TYR A HH   5  
ATOM   2358 N  N    . ARG A 1 23 ? -0.337  -19.670 5.526  1.00 0.00 ? 124 ARG A N    5  
ATOM   2359 C  CA   . ARG A 1 23 ? -0.322  -21.053 5.968  1.00 0.00 ? 124 ARG A CA   5  
ATOM   2360 C  C    . ARG A 1 23 ? -0.680  -21.139 7.453  1.00 0.00 ? 124 ARG A C    5  
ATOM   2361 O  O    . ARG A 1 23 ? -0.846  -22.231 7.994  1.00 0.00 ? 124 ARG A O    5  
ATOM   2362 C  CB   . ARG A 1 23 ? 1.052   -21.688 5.746  1.00 0.00 ? 124 ARG A CB   5  
ATOM   2363 C  CG   . ARG A 1 23 ? 1.824   -21.801 7.061  1.00 0.00 ? 124 ARG A CG   5  
ATOM   2364 C  CD   . ARG A 1 23 ? 2.228   -20.420 7.580  1.00 0.00 ? 124 ARG A CD   5  
ATOM   2365 N  NE   . ARG A 1 23 ? 3.040   -20.557 8.809  1.00 0.00 ? 124 ARG A NE   5  
ATOM   2366 C  CZ   . ARG A 1 23 ? 4.241   -21.150 8.855  1.00 0.00 ? 124 ARG A CZ   5  
ATOM   2367 N  NH1  . ARG A 1 23 ? 4.941   -21.331 7.727  1.00 0.00 ? 124 ARG A NH1  5  
ATOM   2368 N  NH2  . ARG A 1 23 ? 4.741   -21.561 10.027 1.00 0.00 ? 124 ARG A NH2  5  
ATOM   2369 H  H    . ARG A 1 23 ? 0.507   -19.356 5.090  1.00 0.00 ? 124 ARG A H    5  
ATOM   2370 H  HA   . ARG A 1 23 ? -1.073  -21.551 5.354  1.00 0.00 ? 124 ARG A HA   5  
ATOM   2371 H  HB2  . ARG A 1 23 ? 0.932   -22.678 5.304  1.00 0.00 ? 124 ARG A HB2  5  
ATOM   2372 H  HB3  . ARG A 1 23 ? 1.622   -21.091 5.035  1.00 0.00 ? 124 ARG A HB3  5  
ATOM   2373 H  HG2  . ARG A 1 23 ? 1.210   -22.307 7.806  1.00 0.00 ? 124 ARG A HG2  5  
ATOM   2374 H  HG3  . ARG A 1 23 ? 2.714   -22.412 6.914  1.00 0.00 ? 124 ARG A HG3  5  
ATOM   2375 H  HD2  . ARG A 1 23 ? 2.796   -19.888 6.817  1.00 0.00 ? 124 ARG A HD2  5  
ATOM   2376 H  HD3  . ARG A 1 23 ? 1.338   -19.824 7.786  1.00 0.00 ? 124 ARG A HD3  5  
ATOM   2377 H  HE   . ARG A 1 23 ? 2.668   -20.186 9.660  1.00 0.00 ? 124 ARG A HE   5  
ATOM   2378 H  HH11 . ARG A 1 23 ? 4.469   -21.563 6.877  1.00 0.00 ? 124 ARG A HH11 5  
ATOM   2379 H  HH12 . ARG A 1 23 ? 5.937   -21.233 7.736  1.00 0.00 ? 124 ARG A HH12 5  
ATOM   2380 H  HH21 . ARG A 1 23 ? 5.106   -20.894 10.677 1.00 0.00 ? 124 ARG A HH21 5  
ATOM   2381 H  HH22 . ARG A 1 23 ? 4.749   -22.536 10.253 1.00 0.00 ? 124 ARG A HH22 5  
ATOM   2382 N  N    . SER A 1 24 ? -0.790  -19.972 8.071  1.00 0.00 ? 125 SER A N    5  
ATOM   2383 C  CA   . SER A 1 24 ? -1.127  -19.901 9.483  1.00 0.00 ? 125 SER A CA   5  
ATOM   2384 C  C    . SER A 1 24 ? -2.505  -19.263 9.662  1.00 0.00 ? 125 SER A C    5  
ATOM   2385 O  O    . SER A 1 24 ? -2.852  -18.823 10.757 1.00 0.00 ? 125 SER A O    5  
ATOM   2386 C  CB   . SER A 1 24 ? -0.072  -19.112 10.261 1.00 0.00 ? 125 SER A CB   5  
ATOM   2387 O  OG   . SER A 1 24 ? -0.142  -17.715 9.989  1.00 0.00 ? 125 SER A OG   5  
ATOM   2388 H  H    . SER A 1 24 ? -0.654  -19.088 7.625  1.00 0.00 ? 125 SER A H    5  
ATOM   2389 H  HA   . SER A 1 24 ? -1.135  -20.934 9.830  1.00 0.00 ? 125 SER A HA   5  
ATOM   2390 H  HB2  . SER A 1 24 ? -0.209  -19.280 11.330 1.00 0.00 ? 125 SER A HB2  5  
ATOM   2391 H  HB3  . SER A 1 24 ? 0.920   -19.483 10.005 1.00 0.00 ? 125 SER A HB3  5  
ATOM   2392 H  HG   . SER A 1 24 ? 0.751   -17.382 9.681  1.00 0.00 ? 125 SER A HG   5  
ATOM   2393 N  N    . HIS A 1 25 ? -3.254  -19.233 8.568  1.00 0.00 ? 126 HIS A N    5  
ATOM   2394 C  CA   . HIS A 1 25 ? -4.587  -18.656 8.591  1.00 0.00 ? 126 HIS A CA   5  
ATOM   2395 C  C    . HIS A 1 25 ? -5.600  -19.684 8.081  1.00 0.00 ? 126 HIS A C    5  
ATOM   2396 O  O    . HIS A 1 25 ? -6.803  -19.426 8.077  1.00 0.00 ? 126 HIS A O    5  
ATOM   2397 C  CB   . HIS A 1 25 ? -4.625  -17.345 7.803  1.00 0.00 ? 126 HIS A CB   5  
ATOM   2398 C  CG   . HIS A 1 25 ? -3.823  -16.229 8.427  1.00 0.00 ? 126 HIS A CG   5  
ATOM   2399 N  ND1  . HIS A 1 25 ? -3.639  -16.112 9.794  1.00 0.00 ? 126 HIS A ND1  5  
ATOM   2400 C  CD2  . HIS A 1 25 ? -3.158  -15.184 7.858  1.00 0.00 ? 126 HIS A CD2  5  
ATOM   2401 C  CE1  . HIS A 1 25 ? -2.896  -15.040 10.026 1.00 0.00 ? 126 HIS A CE1  5  
ATOM   2402 N  NE2  . HIS A 1 25 ? -2.598  -14.466 8.824  1.00 0.00 ? 126 HIS A NE2  5  
ATOM   2403 H  H    . HIS A 1 25 ? -2.964  -19.594 7.682  1.00 0.00 ? 126 HIS A H    5  
ATOM   2404 H  HA   . HIS A 1 25 ? -4.811  -18.424 9.631  1.00 0.00 ? 126 HIS A HA   5  
ATOM   2405 H  HB2  . HIS A 1 25 ? -4.252  -17.529 6.795  1.00 0.00 ? 126 HIS A HB2  5  
ATOM   2406 H  HB3  . HIS A 1 25 ? -5.662  -17.023 7.704  1.00 0.00 ? 126 HIS A HB3  5  
ATOM   2407 H  HD1  . HIS A 1 25 ? -4.005  -16.731 10.488 1.00 0.00 ? 126 HIS A HD1  5  
ATOM   2408 H  HD2  . HIS A 1 25 ? -3.094  -14.973 6.791  1.00 0.00 ? 126 HIS A HD2  5  
ATOM   2409 H  HE1  . HIS A 1 25 ? -2.577  -14.680 11.004 1.00 0.00 ? 126 HIS A HE1  5  
ATOM   2410 N  N    . THR A 1 26 ? -5.076  -20.827 7.664  1.00 0.00 ? 127 THR A N    5  
ATOM   2411 C  CA   . THR A 1 26 ? -5.919  -21.894 7.154  1.00 0.00 ? 127 THR A CA   5  
ATOM   2412 C  C    . THR A 1 26 ? -5.410  -23.253 7.640  1.00 0.00 ? 127 THR A C    5  
ATOM   2413 O  O    . THR A 1 26 ? -4.995  -23.390 8.789  1.00 0.00 ? 127 THR A O    5  
ATOM   2414 C  CB   . THR A 1 26 ? -5.965  -21.773 5.630  1.00 0.00 ? 127 THR A CB   5  
ATOM   2415 O  OG1  . THR A 1 26 ? -6.990  -22.683 5.240  1.00 0.00 ? 127 THR A OG1  5  
ATOM   2416 C  CG2  . THR A 1 26 ? -4.704  -22.323 4.960  1.00 0.00 ? 127 THR A CG2  5  
ATOM   2417 H  H    . THR A 1 26 ? -4.097  -21.028 7.672  1.00 0.00 ? 127 THR A H    5  
ATOM   2418 H  HA   . THR A 1 26 ? -6.922  -21.765 7.561  1.00 0.00 ? 127 THR A HA   5  
ATOM   2419 H  HB   . THR A 1 26 ? -6.149  -20.742 5.327  1.00 0.00 ? 127 THR A HB   5  
ATOM   2420 H  HG1  . THR A 1 26 ? -7.296  -22.476 4.311  1.00 0.00 ? 127 THR A HG1  5  
ATOM   2421 H  HG21 . THR A 1 26 ? -4.065  -22.785 5.712  1.00 0.00 ? 127 THR A HG21 5  
ATOM   2422 H  HG22 . THR A 1 26 ? -4.983  -23.066 4.213  1.00 0.00 ? 127 THR A HG22 5  
ATOM   2423 H  HG23 . THR A 1 26 ? -4.165  -21.508 4.476  1.00 0.00 ? 127 THR A HG23 5  
ATOM   2424 N  N    . ASN A 1 27 ? -5.461  -24.224 6.739  1.00 0.00 ? 128 ASN A N    5  
ATOM   2425 C  CA   . ASN A 1 27 ? -5.011  -25.568 7.062  1.00 0.00 ? 128 ASN A CA   5  
ATOM   2426 C  C    . ASN A 1 27 ? -3.955  -25.496 8.167  1.00 0.00 ? 128 ASN A C    5  
ATOM   2427 O  O    . ASN A 1 27 ? -4.242  -25.791 9.326  1.00 0.00 ? 128 ASN A O    5  
ATOM   2428 C  CB   . ASN A 1 27 ? -4.378  -26.243 5.845  1.00 0.00 ? 128 ASN A CB   5  
ATOM   2429 C  CG   . ASN A 1 27 ? -4.425  -25.326 4.621  1.00 0.00 ? 128 ASN A CG   5  
ATOM   2430 O  OD1  . ASN A 1 27 ? -5.444  -25.173 3.967  1.00 0.00 ? 128 ASN A OD1  5  
ATOM   2431 N  ND2  . ASN A 1 27 ? -3.269  -24.725 4.350  1.00 0.00 ? 128 ASN A ND2  5  
ATOM   2432 H  H    . ASN A 1 27 ? -5.801  -24.105 5.807  1.00 0.00 ? 128 ASN A H    5  
ATOM   2433 H  HA   . ASN A 1 27 ? -5.908  -26.102 7.376  1.00 0.00 ? 128 ASN A HA   5  
ATOM   2434 H  HB2  . ASN A 1 27 ? -3.344  -26.506 6.067  1.00 0.00 ? 128 ASN A HB2  5  
ATOM   2435 H  HB3  . ASN A 1 27 ? -4.902  -27.174 5.626  1.00 0.00 ? 128 ASN A HB3  5  
ATOM   2436 H  HD21 . ASN A 1 27 ? -2.840  -24.136 5.034  1.00 0.00 ? 128 ASN A HD21 5  
ATOM   2437 H  HD22 . ASN A 1 27 ? -2.830  -24.865 3.463  1.00 0.00 ? 128 ASN A HD22 5  
ATOM   2438 N  N    . GLU A 1 28 ? -2.754  -25.103 7.767  1.00 0.00 ? 129 GLU A N    5  
ATOM   2439 C  CA   . GLU A 1 28 ? -1.653  -24.990 8.709  1.00 0.00 ? 129 GLU A CA   5  
ATOM   2440 C  C    . GLU A 1 28 ? -1.923  -23.861 9.706  1.00 0.00 ? 129 GLU A C    5  
ATOM   2441 O  O    . GLU A 1 28 ? -2.629  -22.905 9.392  1.00 0.00 ? 129 GLU A O    5  
ATOM   2442 C  CB   . GLU A 1 28 ? -0.327  -24.769 7.978  1.00 0.00 ? 129 GLU A CB   5  
ATOM   2443 C  CG   . GLU A 1 28 ? 0.322   -26.103 7.604  1.00 0.00 ? 129 GLU A CG   5  
ATOM   2444 C  CD   . GLU A 1 28 ? 0.506   -26.988 8.838  1.00 0.00 ? 129 GLU A CD   5  
ATOM   2445 O  OE1  . GLU A 1 28 ? 1.428   -26.681 9.624  1.00 0.00 ? 129 GLU A OE1  5  
ATOM   2446 O  OE2  . GLU A 1 28 ? -0.279  -27.952 8.967  1.00 0.00 ? 129 GLU A OE2  5  
ATOM   2447 H  H    . GLU A 1 28 ? -2.528  -24.866 6.822  1.00 0.00 ? 129 GLU A H    5  
ATOM   2448 H  HA   . GLU A 1 28 ? -1.618  -25.945 9.231  1.00 0.00 ? 129 GLU A HA   5  
ATOM   2449 H  HB2  . GLU A 1 28 ? -0.498  -24.178 7.078  1.00 0.00 ? 129 GLU A HB2  5  
ATOM   2450 H  HB3  . GLU A 1 28 ? 0.351   -24.196 8.611  1.00 0.00 ? 129 GLU A HB3  5  
ATOM   2451 H  HG2  . GLU A 1 28 ? -0.299  -26.620 6.870  1.00 0.00 ? 129 GLU A HG2  5  
ATOM   2452 H  HG3  . GLU A 1 28 ? 1.288   -25.923 7.133  1.00 0.00 ? 129 GLU A HG3  5  
ATOM   2453 N  N    . LYS A 1 29 ? -1.346  -24.011 10.890 1.00 0.00 ? 130 LYS A N    5  
ATOM   2454 C  CA   . LYS A 1 29 ? -1.515  -23.017 11.936 1.00 0.00 ? 130 LYS A CA   5  
ATOM   2455 C  C    . LYS A 1 29 ? -0.260  -22.146 12.014 1.00 0.00 ? 130 LYS A C    5  
ATOM   2456 O  O    . LYS A 1 29 ? -0.339  -20.963 12.343 1.00 0.00 ? 130 LYS A O    5  
ATOM   2457 C  CB   . LYS A 1 29 ? -1.879  -23.690 13.261 1.00 0.00 ? 130 LYS A CB   5  
ATOM   2458 C  CG   . LYS A 1 29 ? -0.626  -24.006 14.079 1.00 0.00 ? 130 LYS A CG   5  
ATOM   2459 C  CD   . LYS A 1 29 ? -0.900  -25.115 15.097 1.00 0.00 ? 130 LYS A CD   5  
ATOM   2460 C  CE   . LYS A 1 29 ? -1.875  -24.639 16.176 1.00 0.00 ? 130 LYS A CE   5  
ATOM   2461 N  NZ   . LYS A 1 29 ? -3.273  -24.818 15.727 1.00 0.00 ? 130 LYS A NZ   5  
ATOM   2462 H  H    . LYS A 1 29 ? -0.772  -24.791 11.138 1.00 0.00 ? 130 LYS A H    5  
ATOM   2463 H  HA   . LYS A 1 29 ? -2.357  -22.385 11.653 1.00 0.00 ? 130 LYS A HA   5  
ATOM   2464 H  HB2  . LYS A 1 29 ? -2.539  -23.039 13.835 1.00 0.00 ? 130 LYS A HB2  5  
ATOM   2465 H  HB3  . LYS A 1 29 ? -2.432  -24.609 13.066 1.00 0.00 ? 130 LYS A HB3  5  
ATOM   2466 H  HG2  . LYS A 1 29 ? 0.181   -24.311 13.412 1.00 0.00 ? 130 LYS A HG2  5  
ATOM   2467 H  HG3  . LYS A 1 29 ? -0.289  -23.108 14.596 1.00 0.00 ? 130 LYS A HG3  5  
ATOM   2468 H  HD2  . LYS A 1 29 ? -1.312  -25.986 14.588 1.00 0.00 ? 130 LYS A HD2  5  
ATOM   2469 H  HD3  . LYS A 1 29 ? 0.035   -25.429 15.560 1.00 0.00 ? 130 LYS A HD3  5  
ATOM   2470 H  HE2  . LYS A 1 29 ? -1.708  -25.198 17.097 1.00 0.00 ? 130 LYS A HE2  5  
ATOM   2471 H  HE3  . LYS A 1 29 ? -1.692  -23.589 16.403 1.00 0.00 ? 130 LYS A HE3  5  
ATOM   2472 H  HZ1  . LYS A 1 29 ? -3.771  -23.958 15.834 1.00 0.00 ? 130 LYS A HZ1  5  
ATOM   2473 H  HZ2  . LYS A 1 29 ? -3.282  -25.091 14.765 1.00 0.00 ? 130 LYS A HZ2  5  
ATOM   2474 H  HZ3  . LYS A 1 29 ? -3.713  -25.527 16.279 1.00 0.00 ? 130 LYS A HZ3  5  
HETATM 2475 ZN ZN   . ZN  B 2 .  ? -1.520  -12.821 8.564  1.00 0.00 ? 1   ZN  A ZN   5  
ATOM   2476 N  N    . ARG A 1 1  ? 1.070   0.088   -1.331 1.00 0.00 ? 102 ARG A N    6  
ATOM   2477 C  CA   . ARG A 1 1  ? 2.303   0.044   -0.565 1.00 0.00 ? 102 ARG A CA   6  
ATOM   2478 C  C    . ARG A 1 1  ? 3.054   -1.261  -0.842 1.00 0.00 ? 102 ARG A C    6  
ATOM   2479 O  O    . ARG A 1 1  ? 3.916   -1.311  -1.717 1.00 0.00 ? 102 ARG A O    6  
ATOM   2480 C  CB   . ARG A 1 1  ? 2.023   0.154   0.936  1.00 0.00 ? 102 ARG A CB   6  
ATOM   2481 C  CG   . ARG A 1 1  ? 3.279   -0.159  1.752  1.00 0.00 ? 102 ARG A CG   6  
ATOM   2482 C  CD   . ARG A 1 1  ? 3.586   0.970   2.738  1.00 0.00 ? 102 ARG A CD   6  
ATOM   2483 N  NE   . ARG A 1 1  ? 3.715   2.254   2.014  1.00 0.00 ? 102 ARG A NE   6  
ATOM   2484 C  CZ   . ARG A 1 1  ? 4.862   2.713   1.497  1.00 0.00 ? 102 ARG A CZ   6  
ATOM   2485 N  NH1  . ARG A 1 1  ? 5.918   2.926   2.293  1.00 0.00 ? 102 ARG A NH1  6  
ATOM   2486 N  NH2  . ARG A 1 1  ? 4.953   2.960   0.183  1.00 0.00 ? 102 ARG A NH2  6  
ATOM   2487 H  H    . ARG A 1 1  ? 0.377   -0.578  -1.056 1.00 0.00 ? 102 ARG A H    6  
ATOM   2488 H  HA   . ARG A 1 1  ? 2.876   0.906   -0.906 1.00 0.00 ? 102 ARG A HA   6  
ATOM   2489 H  HB2  . ARG A 1 1  ? 1.672   1.159   1.171  1.00 0.00 ? 102 ARG A HB2  6  
ATOM   2490 H  HB3  . ARG A 1 1  ? 1.224   -0.535  1.212  1.00 0.00 ? 102 ARG A HB3  6  
ATOM   2491 H  HG2  . ARG A 1 1  ? 3.140   -1.093  2.296  1.00 0.00 ? 102 ARG A HG2  6  
ATOM   2492 H  HG3  . ARG A 1 1  ? 4.126   -0.302  1.083  1.00 0.00 ? 102 ARG A HG3  6  
ATOM   2493 H  HD2  . ARG A 1 1  ? 2.793   1.040   3.482  1.00 0.00 ? 102 ARG A HD2  6  
ATOM   2494 H  HD3  . ARG A 1 1  ? 4.509   0.752   3.276  1.00 0.00 ? 102 ARG A HD3  6  
ATOM   2495 H  HE   . ARG A 1 1  ? 2.894   2.814   1.904  1.00 0.00 ? 102 ARG A HE   6  
ATOM   2496 H  HH11 . ARG A 1 1  ? 5.995   3.783   2.803  1.00 0.00 ? 102 ARG A HH11 6  
ATOM   2497 H  HH12 . ARG A 1 1  ? 6.630   2.228   2.377  1.00 0.00 ? 102 ARG A HH12 6  
ATOM   2498 H  HH21 . ARG A 1 1  ? 4.204   3.422   -0.293 1.00 0.00 ? 102 ARG A HH21 6  
ATOM   2499 H  HH22 . ARG A 1 1  ? 5.770   2.683   -0.323 1.00 0.00 ? 102 ARG A HH22 6  
ATOM   2500 N  N    . SER A 1 2  ? 2.699   -2.284  -0.079 1.00 0.00 ? 103 SER A N    6  
ATOM   2501 C  CA   . SER A 1 2  ? 3.328   -3.585  -0.231 1.00 0.00 ? 103 SER A CA   6  
ATOM   2502 C  C    . SER A 1 2  ? 2.464   -4.664  0.424  1.00 0.00 ? 103 SER A C    6  
ATOM   2503 O  O    . SER A 1 2  ? 2.020   -4.504  1.560  1.00 0.00 ? 103 SER A O    6  
ATOM   2504 C  CB   . SER A 1 2  ? 4.734   -3.591  0.372  1.00 0.00 ? 103 SER A CB   6  
ATOM   2505 O  OG   . SER A 1 2  ? 5.745   -3.623  -0.631 1.00 0.00 ? 103 SER A OG   6  
ATOM   2506 H  H    . SER A 1 2  ? 1.996   -2.235  0.631  1.00 0.00 ? 103 SER A H    6  
ATOM   2507 H  HA   . SER A 1 2  ? 3.394   -3.749  -1.307 1.00 0.00 ? 103 SER A HA   6  
ATOM   2508 H  HB2  . SER A 1 2  ? 4.866   -2.704  0.992  1.00 0.00 ? 103 SER A HB2  6  
ATOM   2509 H  HB3  . SER A 1 2  ? 4.844   -4.456  1.025  1.00 0.00 ? 103 SER A HB3  6  
ATOM   2510 H  HG   . SER A 1 2  ? 6.374   -2.855  -0.507 1.00 0.00 ? 103 SER A HG   6  
ATOM   2511 N  N    . PHE A 1 3  ? 2.251   -5.740  -0.320 1.00 0.00 ? 104 PHE A N    6  
ATOM   2512 C  CA   . PHE A 1 3  ? 1.448   -6.845  0.174  1.00 0.00 ? 104 PHE A CA   6  
ATOM   2513 C  C    . PHE A 1 3  ? 1.272   -6.759  1.692  1.00 0.00 ? 104 PHE A C    6  
ATOM   2514 O  O    . PHE A 1 3  ? 2.234   -6.513  2.419  1.00 0.00 ? 104 PHE A O    6  
ATOM   2515 C  CB   . PHE A 1 3  ? 2.201   -8.132  -0.167 1.00 0.00 ? 104 PHE A CB   6  
ATOM   2516 C  CG   . PHE A 1 3  ? 2.841   -8.128  -1.557 1.00 0.00 ? 104 PHE A CG   6  
ATOM   2517 C  CD1  . PHE A 1 3  ? 2.119   -8.526  -2.639 1.00 0.00 ? 104 PHE A CD1  6  
ATOM   2518 C  CD2  . PHE A 1 3  ? 4.132   -7.730  -1.710 1.00 0.00 ? 104 PHE A CD2  6  
ATOM   2519 C  CE1  . PHE A 1 3  ? 2.713   -8.522  -3.928 1.00 0.00 ? 104 PHE A CE1  6  
ATOM   2520 C  CE2  . PHE A 1 3  ? 4.726   -7.727  -3.000 1.00 0.00 ? 104 PHE A CE2  6  
ATOM   2521 C  CZ   . PHE A 1 3  ? 4.004   -8.123  -4.082 1.00 0.00 ? 104 PHE A CZ   6  
ATOM   2522 H  H    . PHE A 1 3  ? 2.616   -5.861  -1.243 1.00 0.00 ? 104 PHE A H    6  
ATOM   2523 H  HA   . PHE A 1 3  ? 0.473   -6.777  -0.307 1.00 0.00 ? 104 PHE A HA   6  
ATOM   2524 H  HB2  . PHE A 1 3  ? 2.978   -8.296  0.579  1.00 0.00 ? 104 PHE A HB2  6  
ATOM   2525 H  HB3  . PHE A 1 3  ? 1.511   -8.974  -0.098 1.00 0.00 ? 104 PHE A HB3  6  
ATOM   2526 H  HD1  . PHE A 1 3  ? 1.084   -8.844  -2.517 1.00 0.00 ? 104 PHE A HD1  6  
ATOM   2527 H  HD2  . PHE A 1 3  ? 4.711   -7.412  -0.843 1.00 0.00 ? 104 PHE A HD2  6  
ATOM   2528 H  HE1  . PHE A 1 3  ? 2.134   -8.840  -4.796 1.00 0.00 ? 104 PHE A HE1  6  
ATOM   2529 H  HE2  . PHE A 1 3  ? 5.761   -7.407  -3.122 1.00 0.00 ? 104 PHE A HE2  6  
ATOM   2530 H  HZ   . PHE A 1 3  ? 4.461   -8.120  -5.072 1.00 0.00 ? 104 PHE A HZ   6  
ATOM   2531 N  N    . VAL A 1 4  ? 0.037   -6.965  2.125  1.00 0.00 ? 105 VAL A N    6  
ATOM   2532 C  CA   . VAL A 1 4  ? -0.277  -6.914  3.542  1.00 0.00 ? 105 VAL A CA   6  
ATOM   2533 C  C    . VAL A 1 4  ? -1.315  -7.990  3.870  1.00 0.00 ? 105 VAL A C    6  
ATOM   2534 O  O    . VAL A 1 4  ? -2.401  -8.005  3.291  1.00 0.00 ? 105 VAL A O    6  
ATOM   2535 C  CB   . VAL A 1 4  ? -0.734  -5.505  3.926  1.00 0.00 ? 105 VAL A CB   6  
ATOM   2536 C  CG1  . VAL A 1 4  ? -0.695  -5.310  5.444  1.00 0.00 ? 105 VAL A CG1  6  
ATOM   2537 C  CG2  . VAL A 1 4  ? 0.107   -4.443  3.215  1.00 0.00 ? 105 VAL A CG2  6  
ATOM   2538 H  H    . VAL A 1 4  ? -0.739  -7.165  1.526  1.00 0.00 ? 105 VAL A H    6  
ATOM   2539 H  HA   . VAL A 1 4  ? 0.639   -7.133  4.091  1.00 0.00 ? 105 VAL A HA   6  
ATOM   2540 H  HB   . VAL A 1 4  ? -1.768  -5.388  3.601  1.00 0.00 ? 105 VAL A HB   6  
ATOM   2541 H  HG11 . VAL A 1 4  ? 0.212   -4.772  5.718  1.00 0.00 ? 105 VAL A HG11 6  
ATOM   2542 H  HG12 . VAL A 1 4  ? -1.567  -4.737  5.759  1.00 0.00 ? 105 VAL A HG12 6  
ATOM   2543 H  HG13 . VAL A 1 4  ? -0.703  -6.284  5.935  1.00 0.00 ? 105 VAL A HG13 6  
ATOM   2544 H  HG21 . VAL A 1 4  ? 1.156   -4.577  3.475  1.00 0.00 ? 105 VAL A HG21 6  
ATOM   2545 H  HG22 . VAL A 1 4  ? -0.016  -4.545  2.137  1.00 0.00 ? 105 VAL A HG22 6  
ATOM   2546 H  HG23 . VAL A 1 4  ? -0.222  -3.451  3.527  1.00 0.00 ? 105 VAL A HG23 6  
ATOM   2547 N  N    . CYS A 1 5  ? -0.945  -8.862  4.795  1.00 0.00 ? 106 CYS A N    6  
ATOM   2548 C  CA   . CYS A 1 5  ? -1.831  -9.938  5.206  1.00 0.00 ? 106 CYS A CA   6  
ATOM   2549 C  C    . CYS A 1 5  ? -3.114  -9.319  5.762  1.00 0.00 ? 106 CYS A C    6  
ATOM   2550 O  O    . CYS A 1 5  ? -3.177  -8.963  6.938  1.00 0.00 ? 106 CYS A O    6  
ATOM   2551 C  CB   . CYS A 1 5  ? -1.160  -10.867 6.220  1.00 0.00 ? 106 CYS A CB   6  
ATOM   2552 S  SG   . CYS A 1 5  ? -2.199  -12.349 6.495  1.00 0.00 ? 106 CYS A SG   6  
ATOM   2553 H  H    . CYS A 1 5  ? -0.060  -8.843  5.260  1.00 0.00 ? 106 CYS A H    6  
ATOM   2554 H  HA   . CYS A 1 5  ? -2.041  -10.528 4.314  1.00 0.00 ? 106 CYS A HA   6  
ATOM   2555 H  HB2  . CYS A 1 5  ? -0.176  -11.165 5.858  1.00 0.00 ? 106 CYS A HB2  6  
ATOM   2556 H  HB3  . CYS A 1 5  ? -1.007  -10.341 7.162  1.00 0.00 ? 106 CYS A HB3  6  
ATOM   2557 N  N    . GLU A 1 6  ? -4.106  -9.209  4.891  1.00 0.00 ? 107 GLU A N    6  
ATOM   2558 C  CA   . GLU A 1 6  ? -5.384  -8.637  5.280  1.00 0.00 ? 107 GLU A CA   6  
ATOM   2559 C  C    . GLU A 1 6  ? -5.850  -9.236  6.609  1.00 0.00 ? 107 GLU A C    6  
ATOM   2560 O  O    . GLU A 1 6  ? -6.726  -8.681  7.271  1.00 0.00 ? 107 GLU A O    6  
ATOM   2561 C  CB   . GLU A 1 6  ? -6.434  -8.846  4.186  1.00 0.00 ? 107 GLU A CB   6  
ATOM   2562 C  CG   . GLU A 1 6  ? -5.802  -8.755  2.796  1.00 0.00 ? 107 GLU A CG   6  
ATOM   2563 C  CD   . GLU A 1 6  ? -5.436  -10.144 2.268  1.00 0.00 ? 107 GLU A CD   6  
ATOM   2564 O  OE1  . GLU A 1 6  ? -5.694  -11.119 3.007  1.00 0.00 ? 107 GLU A OE1  6  
ATOM   2565 O  OE2  . GLU A 1 6  ? -4.906  -10.200 1.137  1.00 0.00 ? 107 GLU A OE2  6  
ATOM   2566 H  H    . GLU A 1 6  ? -4.047  -9.500  3.937  1.00 0.00 ? 107 GLU A H    6  
ATOM   2567 H  HA   . GLU A 1 6  ? -5.201  -7.570  5.400  1.00 0.00 ? 107 GLU A HA   6  
ATOM   2568 H  HB2  . GLU A 1 6  ? -6.907  -9.821  4.312  1.00 0.00 ? 107 GLU A HB2  6  
ATOM   2569 H  HB3  . GLU A 1 6  ? -7.219  -8.096  4.283  1.00 0.00 ? 107 GLU A HB3  6  
ATOM   2570 H  HG2  . GLU A 1 6  ? -6.496  -8.272  2.108  1.00 0.00 ? 107 GLU A HG2  6  
ATOM   2571 H  HG3  . GLU A 1 6  ? -4.910  -8.132  2.838  1.00 0.00 ? 107 GLU A HG3  6  
ATOM   2572 N  N    . VAL A 1 7  ? -5.245  -10.361 6.958  1.00 0.00 ? 108 VAL A N    6  
ATOM   2573 C  CA   . VAL A 1 7  ? -5.587  -11.042 8.196  1.00 0.00 ? 108 VAL A CA   6  
ATOM   2574 C  C    . VAL A 1 7  ? -4.912  -10.327 9.370  1.00 0.00 ? 108 VAL A C    6  
ATOM   2575 O  O    . VAL A 1 7  ? -5.575  -9.643  10.148 1.00 0.00 ? 108 VAL A O    6  
ATOM   2576 C  CB   . VAL A 1 7  ? -5.211  -12.522 8.101  1.00 0.00 ? 108 VAL A CB   6  
ATOM   2577 C  CG1  . VAL A 1 7  ? -5.349  -13.211 9.460  1.00 0.00 ? 108 VAL A CG1  6  
ATOM   2578 C  CG2  . VAL A 1 7  ? -6.049  -13.233 7.038  1.00 0.00 ? 108 VAL A CG2  6  
ATOM   2579 H  H    . VAL A 1 7  ? -4.534  -10.807 6.415  1.00 0.00 ? 108 VAL A H    6  
ATOM   2580 H  HA   . VAL A 1 7  ? -6.668  -10.976 8.320  1.00 0.00 ? 108 VAL A HA   6  
ATOM   2581 H  HB   . VAL A 1 7  ? -4.166  -12.583 7.800  1.00 0.00 ? 108 VAL A HB   6  
ATOM   2582 H  HG11 . VAL A 1 7  ? -5.920  -14.133 9.344  1.00 0.00 ? 108 VAL A HG11 6  
ATOM   2583 H  HG12 . VAL A 1 7  ? -4.360  -13.444 9.852  1.00 0.00 ? 108 VAL A HG12 6  
ATOM   2584 H  HG13 . VAL A 1 7  ? -5.867  -12.548 10.153 1.00 0.00 ? 108 VAL A HG13 6  
ATOM   2585 H  HG21 . VAL A 1 7  ? -6.800  -13.857 7.523  1.00 0.00 ? 108 VAL A HG21 6  
ATOM   2586 H  HG22 . VAL A 1 7  ? -6.543  -12.493 6.410  1.00 0.00 ? 108 VAL A HG22 6  
ATOM   2587 H  HG23 . VAL A 1 7  ? -5.401  -13.858 6.422  1.00 0.00 ? 108 VAL A HG23 6  
ATOM   2588 N  N    . CYS A 1 8  ? -3.604  -10.511 9.458  1.00 0.00 ? 109 CYS A N    6  
ATOM   2589 C  CA   . CYS A 1 8  ? -2.832  -9.893  10.523 1.00 0.00 ? 109 CYS A CA   6  
ATOM   2590 C  C    . CYS A 1 8  ? -2.305  -8.548  10.016 1.00 0.00 ? 109 CYS A C    6  
ATOM   2591 O  O    . CYS A 1 8  ? -1.498  -7.902  10.683 1.00 0.00 ? 109 CYS A O    6  
ATOM   2592 C  CB   . CYS A 1 8  ? -1.701  -10.804 11.004 1.00 0.00 ? 109 CYS A CB   6  
ATOM   2593 S  SG   . CYS A 1 8  ? -0.441  -10.986 9.690  1.00 0.00 ? 109 CYS A SG   6  
ATOM   2594 H  H    . CYS A 1 8  ? -3.072  -11.069 8.820  1.00 0.00 ? 109 CYS A H    6  
ATOM   2595 H  HA   . CYS A 1 8  ? -3.513  -9.750  11.362 1.00 0.00 ? 109 CYS A HA   6  
ATOM   2596 H  HB2  . CYS A 1 8  ? -1.244  -10.387 11.902 1.00 0.00 ? 109 CYS A HB2  6  
ATOM   2597 H  HB3  . CYS A 1 8  ? -2.101  -11.781 11.275 1.00 0.00 ? 109 CYS A HB3  6  
ATOM   2598 N  N    . THR A 1 9  ? -2.783  -8.167  8.841  1.00 0.00 ? 110 THR A N    6  
ATOM   2599 C  CA   . THR A 1 9  ? -2.370  -6.911  8.237  1.00 0.00 ? 110 THR A CA   6  
ATOM   2600 C  C    . THR A 1 9  ? -0.845  -6.795  8.239  1.00 0.00 ? 110 THR A C    6  
ATOM   2601 O  O    . THR A 1 9  ? -0.301  -5.716  8.471  1.00 0.00 ? 110 THR A O    6  
ATOM   2602 C  CB   . THR A 1 9  ? -3.067  -5.775  8.987  1.00 0.00 ? 110 THR A CB   6  
ATOM   2603 O  OG1  . THR A 1 9  ? -2.445  -5.770  10.268 1.00 0.00 ? 110 THR A OG1  6  
ATOM   2604 C  CG2  . THR A 1 9  ? -4.535  -6.085  9.286  1.00 0.00 ? 110 THR A CG2  6  
ATOM   2605 H  H    . THR A 1 9  ? -3.439  -8.698  8.305  1.00 0.00 ? 110 THR A H    6  
ATOM   2606 H  HA   . THR A 1 9  ? -2.690  -6.910  7.195  1.00 0.00 ? 110 THR A HA   6  
ATOM   2607 H  HB   . THR A 1 9  ? -2.971  -4.835  8.443  1.00 0.00 ? 110 THR A HB   6  
ATOM   2608 H  HG1  . THR A 1 9  ? -2.594  -4.890  10.718 1.00 0.00 ? 110 THR A HG1  6  
ATOM   2609 H  HG21 . THR A 1 9  ? -5.050  -5.168  9.574  1.00 0.00 ? 110 THR A HG21 6  
ATOM   2610 H  HG22 . THR A 1 9  ? -5.007  -6.503  8.397  1.00 0.00 ? 110 THR A HG22 6  
ATOM   2611 H  HG23 . THR A 1 9  ? -4.595  -6.806  10.102 1.00 0.00 ? 110 THR A HG23 6  
ATOM   2612 N  N    . ARG A 1 10 ? -0.197  -7.921  7.977  1.00 0.00 ? 111 ARG A N    6  
ATOM   2613 C  CA   . ARG A 1 10 ? 1.255   -7.958  7.947  1.00 0.00 ? 111 ARG A CA   6  
ATOM   2614 C  C    . ARG A 1 10 ? 1.764   -7.660  6.535  1.00 0.00 ? 111 ARG A C    6  
ATOM   2615 O  O    . ARG A 1 10 ? 1.283   -8.238  5.562  1.00 0.00 ? 111 ARG A O    6  
ATOM   2616 C  CB   . ARG A 1 10 ? 1.782   -9.325  8.392  1.00 0.00 ? 111 ARG A CB   6  
ATOM   2617 C  CG   . ARG A 1 10 ? 1.967   -9.372  9.910  1.00 0.00 ? 111 ARG A CG   6  
ATOM   2618 C  CD   . ARG A 1 10 ? 2.358   -10.777 10.371 1.00 0.00 ? 111 ARG A CD   6  
ATOM   2619 N  NE   . ARG A 1 10 ? 1.680   -11.099 11.646 1.00 0.00 ? 111 ARG A NE   6  
ATOM   2620 C  CZ   . ARG A 1 10 ? 1.479   -10.216 12.634 1.00 0.00 ? 111 ARG A CZ   6  
ATOM   2621 N  NH1  . ARG A 1 10 ? 2.209   -9.094  12.687 1.00 0.00 ? 111 ARG A NH1  6  
ATOM   2622 N  NH2  . ARG A 1 10 ? 0.548   -10.456 13.567 1.00 0.00 ? 111 ARG A NH2  6  
ATOM   2623 H  H    . ARG A 1 10 ? -0.646  -8.794  7.790  1.00 0.00 ? 111 ARG A H    6  
ATOM   2624 H  HA   . ARG A 1 10 ? 1.570   -7.185  8.649  1.00 0.00 ? 111 ARG A HA   6  
ATOM   2625 H  HB2  . ARG A 1 10 ? 1.086   -10.104 8.083  1.00 0.00 ? 111 ARG A HB2  6  
ATOM   2626 H  HB3  . ARG A 1 10 ? 2.731   -9.531  7.899  1.00 0.00 ? 111 ARG A HB3  6  
ATOM   2627 H  HG2  . ARG A 1 10 ? 2.735   -8.660  10.209 1.00 0.00 ? 111 ARG A HG2  6  
ATOM   2628 H  HG3  . ARG A 1 10 ? 1.043   -9.069  10.403 1.00 0.00 ? 111 ARG A HG3  6  
ATOM   2629 H  HD2  . ARG A 1 10 ? 2.085   -11.507 9.610  1.00 0.00 ? 111 ARG A HD2  6  
ATOM   2630 H  HD3  . ARG A 1 10 ? 3.439   -10.839 10.499 1.00 0.00 ? 111 ARG A HD3  6  
ATOM   2631 H  HE   . ARG A 1 10 ? 1.353   -12.034 11.780 1.00 0.00 ? 111 ARG A HE   6  
ATOM   2632 H  HH11 . ARG A 1 10 ? 1.936   -8.294  12.154 1.00 0.00 ? 111 ARG A HH11 6  
ATOM   2633 H  HH12 . ARG A 1 10 ? 3.026   -9.056  13.263 1.00 0.00 ? 111 ARG A HH12 6  
ATOM   2634 H  HH21 . ARG A 1 10 ? 0.704   -11.161 14.259 1.00 0.00 ? 111 ARG A HH21 6  
ATOM   2635 H  HH22 . ARG A 1 10 ? -0.302  -9.929  13.572 1.00 0.00 ? 111 ARG A HH22 6  
ATOM   2636 N  N    . ALA A 1 11 ? 2.731   -6.756  6.468  1.00 0.00 ? 112 ALA A N    6  
ATOM   2637 C  CA   . ALA A 1 11 ? 3.311   -6.375  5.191  1.00 0.00 ? 112 ALA A CA   6  
ATOM   2638 C  C    . ALA A 1 11 ? 4.658   -7.078  5.016  1.00 0.00 ? 112 ALA A C    6  
ATOM   2639 O  O    . ALA A 1 11 ? 5.426   -7.202  5.969  1.00 0.00 ? 112 ALA A O    6  
ATOM   2640 C  CB   . ALA A 1 11 ? 3.436   -4.851  5.123  1.00 0.00 ? 112 ALA A CB   6  
ATOM   2641 H  H    . ALA A 1 11 ? 3.118   -6.291  7.264  1.00 0.00 ? 112 ALA A H    6  
ATOM   2642 H  HA   . ALA A 1 11 ? 2.632   -6.705  4.406  1.00 0.00 ? 112 ALA A HA   6  
ATOM   2643 H  HB1  . ALA A 1 11 ? 3.198   -4.511  4.115  1.00 0.00 ? 112 ALA A HB1  6  
ATOM   2644 H  HB2  . ALA A 1 11 ? 2.744   -4.397  5.832  1.00 0.00 ? 112 ALA A HB2  6  
ATOM   2645 H  HB3  . ALA A 1 11 ? 4.457   -4.559  5.374  1.00 0.00 ? 112 ALA A HB3  6  
ATOM   2646 N  N    . PHE A 1 12 ? 4.904   -7.520  3.791  1.00 0.00 ? 113 PHE A N    6  
ATOM   2647 C  CA   . PHE A 1 12 ? 6.144   -8.208  3.479  1.00 0.00 ? 113 PHE A CA   6  
ATOM   2648 C  C    . PHE A 1 12 ? 6.802   -7.613  2.233  1.00 0.00 ? 113 PHE A C    6  
ATOM   2649 O  O    . PHE A 1 12 ? 6.173   -6.859  1.493  1.00 0.00 ? 113 PHE A O    6  
ATOM   2650 C  CB   . PHE A 1 12 ? 5.788   -9.670  3.203  1.00 0.00 ? 113 PHE A CB   6  
ATOM   2651 C  CG   . PHE A 1 12 ? 5.235   -10.416 4.419  1.00 0.00 ? 113 PHE A CG   6  
ATOM   2652 C  CD1  . PHE A 1 12 ? 6.086   -10.918 5.354  1.00 0.00 ? 113 PHE A CD1  6  
ATOM   2653 C  CD2  . PHE A 1 12 ? 3.893   -10.577 4.566  1.00 0.00 ? 113 PHE A CD2  6  
ATOM   2654 C  CE1  . PHE A 1 12 ? 5.573   -11.609 6.484  1.00 0.00 ? 113 PHE A CE1  6  
ATOM   2655 C  CE2  . PHE A 1 12 ? 3.379   -11.268 5.696  1.00 0.00 ? 113 PHE A CE2  6  
ATOM   2656 C  CZ   . PHE A 1 12 ? 4.231   -11.770 6.630  1.00 0.00 ? 113 PHE A CZ   6  
ATOM   2657 H  H    . PHE A 1 12 ? 4.274   -7.415  3.021  1.00 0.00 ? 113 PHE A H    6  
ATOM   2658 H  HA   . PHE A 1 12 ? 6.809   -8.082  4.333  1.00 0.00 ? 113 PHE A HA   6  
ATOM   2659 H  HB2  . PHE A 1 12 ? 5.051   -9.710  2.401  1.00 0.00 ? 113 PHE A HB2  6  
ATOM   2660 H  HB3  . PHE A 1 12 ? 6.677   -10.190 2.845  1.00 0.00 ? 113 PHE A HB3  6  
ATOM   2661 H  HD1  . PHE A 1 12 ? 7.162   -10.789 5.237  1.00 0.00 ? 113 PHE A HD1  6  
ATOM   2662 H  HD2  . PHE A 1 12 ? 3.210   -10.175 3.818  1.00 0.00 ? 113 PHE A HD2  6  
ATOM   2663 H  HE1  . PHE A 1 12 ? 6.256   -12.011 7.233  1.00 0.00 ? 113 PHE A HE1  6  
ATOM   2664 H  HE2  . PHE A 1 12 ? 2.304   -11.397 5.813  1.00 0.00 ? 113 PHE A HE2  6  
ATOM   2665 H  HZ   . PHE A 1 12 ? 3.837   -12.301 7.497  1.00 0.00 ? 113 PHE A HZ   6  
ATOM   2666 N  N    . ALA A 1 13 ? 8.063   -7.976  2.038  1.00 0.00 ? 114 ALA A N    6  
ATOM   2667 C  CA   . ALA A 1 13 ? 8.813   -7.486  0.894  1.00 0.00 ? 114 ALA A CA   6  
ATOM   2668 C  C    . ALA A 1 13 ? 8.529   -8.377  -0.316 1.00 0.00 ? 114 ALA A C    6  
ATOM   2669 O  O    . ALA A 1 13 ? 8.805   -7.995  -1.453 1.00 0.00 ? 114 ALA A O    6  
ATOM   2670 C  CB   . ALA A 1 13 ? 10.302  -7.436  1.244  1.00 0.00 ? 114 ALA A CB   6  
ATOM   2671 H  H    . ALA A 1 13 ? 8.568   -8.589  2.644  1.00 0.00 ? 114 ALA A H    6  
ATOM   2672 H  HA   . ALA A 1 13 ? 8.469   -6.474  0.679  1.00 0.00 ? 114 ALA A HA   6  
ATOM   2673 H  HB1  . ALA A 1 13 ? 10.890  -7.418  0.327  1.00 0.00 ? 114 ALA A HB1  6  
ATOM   2674 H  HB2  . ALA A 1 13 ? 10.508  -6.539  1.826  1.00 0.00 ? 114 ALA A HB2  6  
ATOM   2675 H  HB3  . ALA A 1 13 ? 10.568  -8.317  1.828  1.00 0.00 ? 114 ALA A HB3  6  
ATOM   2676 N  N    . ARG A 1 14 ? 7.979   -9.549  -0.032 1.00 0.00 ? 115 ARG A N    6  
ATOM   2677 C  CA   . ARG A 1 14 ? 7.654   -10.498 -1.083 1.00 0.00 ? 115 ARG A CA   6  
ATOM   2678 C  C    . ARG A 1 14 ? 6.231   -11.030 -0.897 1.00 0.00 ? 115 ARG A C    6  
ATOM   2679 O  O    . ARG A 1 14 ? 5.724   -11.077 0.223  1.00 0.00 ? 115 ARG A O    6  
ATOM   2680 C  CB   . ARG A 1 14 ? 8.634   -11.673 -1.087 1.00 0.00 ? 115 ARG A CB   6  
ATOM   2681 C  CG   . ARG A 1 14 ? 10.063  -11.196 -0.823 1.00 0.00 ? 115 ARG A CG   6  
ATOM   2682 C  CD   . ARG A 1 14 ? 10.620  -10.439 -2.030 1.00 0.00 ? 115 ARG A CD   6  
ATOM   2683 N  NE   . ARG A 1 14 ? 11.413  -11.355 -2.881 1.00 0.00 ? 115 ARG A NE   6  
ATOM   2684 C  CZ   . ARG A 1 14 ? 11.202  -12.676 -2.963 1.00 0.00 ? 115 ARG A CZ   6  
ATOM   2685 N  NH1  . ARG A 1 14 ? 11.751  -13.499 -2.060 1.00 0.00 ? 115 ARG A NH1  6  
ATOM   2686 N  NH2  . ARG A 1 14 ? 10.441  -13.173 -3.947 1.00 0.00 ? 115 ARG A NH2  6  
ATOM   2687 H  H    . ARG A 1 14 ? 7.757   -9.853  0.895  1.00 0.00 ? 115 ARG A H    6  
ATOM   2688 H  HA   . ARG A 1 14 ? 7.742   -9.930  -2.009 1.00 0.00 ? 115 ARG A HA   6  
ATOM   2689 H  HB2  . ARG A 1 14 ? 8.342   -12.397 -0.326 1.00 0.00 ? 115 ARG A HB2  6  
ATOM   2690 H  HB3  . ARG A 1 14 ? 8.589   -12.185 -2.048 1.00 0.00 ? 115 ARG A HB3  6  
ATOM   2691 H  HG2  . ARG A 1 14 ? 10.078  -10.550 0.055  1.00 0.00 ? 115 ARG A HG2  6  
ATOM   2692 H  HG3  . ARG A 1 14 ? 10.700  -12.052 -0.600 1.00 0.00 ? 115 ARG A HG3  6  
ATOM   2693 H  HD2  . ARG A 1 14 ? 9.802   -10.009 -2.609 1.00 0.00 ? 115 ARG A HD2  6  
ATOM   2694 H  HD3  . ARG A 1 14 ? 11.243  -9.610  -1.695 1.00 0.00 ? 115 ARG A HD3  6  
ATOM   2695 H  HE   . ARG A 1 14 ? 12.152  -10.964 -3.428 1.00 0.00 ? 115 ARG A HE   6  
ATOM   2696 H  HH11 . ARG A 1 14 ? 12.597  -13.239 -1.594 1.00 0.00 ? 115 ARG A HH11 6  
ATOM   2697 H  HH12 . ARG A 1 14 ? 11.315  -14.375 -1.851 1.00 0.00 ? 115 ARG A HH12 6  
ATOM   2698 H  HH21 . ARG A 1 14 ? 9.447   -13.061 -3.917 1.00 0.00 ? 115 ARG A HH21 6  
ATOM   2699 H  HH22 . ARG A 1 14 ? 10.867  -13.655 -4.713 1.00 0.00 ? 115 ARG A HH22 6  
ATOM   2700 N  N    . GLN A 1 15 ? 5.627   -11.416 -2.011 1.00 0.00 ? 116 GLN A N    6  
ATOM   2701 C  CA   . GLN A 1 15 ? 4.273   -11.942 -1.985 1.00 0.00 ? 116 GLN A CA   6  
ATOM   2702 C  C    . GLN A 1 15 ? 4.266   -13.360 -1.410 1.00 0.00 ? 116 GLN A C    6  
ATOM   2703 O  O    . GLN A 1 15 ? 3.439   -13.685 -0.559 1.00 0.00 ? 116 GLN A O    6  
ATOM   2704 C  CB   . GLN A 1 15 ? 3.646   -11.912 -3.380 1.00 0.00 ? 116 GLN A CB   6  
ATOM   2705 C  CG   . GLN A 1 15 ? 2.151   -12.231 -3.316 1.00 0.00 ? 116 GLN A CG   6  
ATOM   2706 C  CD   . GLN A 1 15 ? 1.919   -13.722 -3.062 1.00 0.00 ? 116 GLN A CD   6  
ATOM   2707 O  OE1  . GLN A 1 15 ? 2.737   -14.568 -3.384 1.00 0.00 ? 116 GLN A OE1  6  
ATOM   2708 N  NE2  . GLN A 1 15 ? 0.760   -13.995 -2.468 1.00 0.00 ? 116 GLN A NE2  6  
ATOM   2709 H  H    . GLN A 1 15 ? 6.047   -11.374 -2.918 1.00 0.00 ? 116 GLN A H    6  
ATOM   2710 H  HA   . GLN A 1 15 ? 3.715   -11.274 -1.328 1.00 0.00 ? 116 GLN A HA   6  
ATOM   2711 H  HB2  . GLN A 1 15 ? 3.793   -10.930 -3.827 1.00 0.00 ? 116 GLN A HB2  6  
ATOM   2712 H  HB3  . GLN A 1 15 ? 4.148   -12.635 -4.023 1.00 0.00 ? 116 GLN A HB3  6  
ATOM   2713 H  HG2  . GLN A 1 15 ? 1.684   -11.647 -2.522 1.00 0.00 ? 116 GLN A HG2  6  
ATOM   2714 H  HG3  . GLN A 1 15 ? 1.672   -11.938 -4.251 1.00 0.00 ? 116 GLN A HG3  6  
ATOM   2715 H  HE21 . GLN A 1 15 ? 0.172   -13.251 -2.151 1.00 0.00 ? 116 GLN A HE21 6  
ATOM   2716 H  HE22 . GLN A 1 15 ? 0.476   -14.945 -2.340 1.00 0.00 ? 116 GLN A HE22 6  
ATOM   2717 N  N    . GLU A 1 16 ? 5.197   -14.167 -1.898 1.00 0.00 ? 117 GLU A N    6  
ATOM   2718 C  CA   . GLU A 1 16 ? 5.308   -15.543 -1.443 1.00 0.00 ? 117 GLU A CA   6  
ATOM   2719 C  C    . GLU A 1 16 ? 5.257   -15.602 0.085  1.00 0.00 ? 117 GLU A C    6  
ATOM   2720 O  O    . GLU A 1 16 ? 4.568   -16.446 0.654  1.00 0.00 ? 117 GLU A O    6  
ATOM   2721 C  CB   . GLU A 1 16 ? 6.585   -16.194 -1.975 1.00 0.00 ? 117 GLU A CB   6  
ATOM   2722 C  CG   . GLU A 1 16 ? 6.857   -15.768 -3.420 1.00 0.00 ? 117 GLU A CG   6  
ATOM   2723 C  CD   . GLU A 1 16 ? 5.549   -15.557 -4.184 1.00 0.00 ? 117 GLU A CD   6  
ATOM   2724 O  OE1  . GLU A 1 16 ? 4.707   -16.480 -4.134 1.00 0.00 ? 117 GLU A OE1  6  
ATOM   2725 O  OE2  . GLU A 1 16 ? 5.421   -14.477 -4.802 1.00 0.00 ? 117 GLU A OE2  6  
ATOM   2726 H  H    . GLU A 1 16 ? 5.866   -13.895 -2.590 1.00 0.00 ? 117 GLU A H    6  
ATOM   2727 H  HA   . GLU A 1 16 ? 4.443   -16.056 -1.863 1.00 0.00 ? 117 GLU A HA   6  
ATOM   2728 H  HB2  . GLU A 1 16 ? 7.430   -15.916 -1.346 1.00 0.00 ? 117 GLU A HB2  6  
ATOM   2729 H  HB3  . GLU A 1 16 ? 6.494   -17.279 -1.924 1.00 0.00 ? 117 GLU A HB3  6  
ATOM   2730 H  HG2  . GLU A 1 16 ? 7.441   -14.848 -3.428 1.00 0.00 ? 117 GLU A HG2  6  
ATOM   2731 H  HG3  . GLU A 1 16 ? 7.456   -16.529 -3.920 1.00 0.00 ? 117 GLU A HG3  6  
ATOM   2732 N  N    . HIS A 1 17 ? 5.998   -14.696 0.706  1.00 0.00 ? 118 HIS A N    6  
ATOM   2733 C  CA   . HIS A 1 17 ? 6.047   -14.635 2.157  1.00 0.00 ? 118 HIS A CA   6  
ATOM   2734 C  C    . HIS A 1 17 ? 4.624   -14.615 2.717  1.00 0.00 ? 118 HIS A C    6  
ATOM   2735 O  O    . HIS A 1 17 ? 4.301   -15.372 3.632  1.00 0.00 ? 118 HIS A O    6  
ATOM   2736 C  CB   . HIS A 1 17 ? 6.885   -13.443 2.622  1.00 0.00 ? 118 HIS A CB   6  
ATOM   2737 C  CG   . HIS A 1 17 ? 8.355   -13.560 2.297  1.00 0.00 ? 118 HIS A CG   6  
ATOM   2738 N  ND1  . HIS A 1 17 ? 9.308   -12.700 2.812  1.00 0.00 ? 118 HIS A ND1  6  
ATOM   2739 C  CD2  . HIS A 1 17 ? 9.024   -14.446 1.505  1.00 0.00 ? 118 HIS A CD2  6  
ATOM   2740 C  CE1  . HIS A 1 17 ? 10.494  -13.060 2.343  1.00 0.00 ? 118 HIS A CE1  6  
ATOM   2741 N  NE2  . HIS A 1 17 ? 10.316  -14.143 1.533  1.00 0.00 ? 118 HIS A NE2  6  
ATOM   2742 H  H    . HIS A 1 17 ? 6.557   -14.012 0.235  1.00 0.00 ? 118 HIS A H    6  
ATOM   2743 H  HA   . HIS A 1 17 ? 6.547   -15.543 2.491  1.00 0.00 ? 118 HIS A HA   6  
ATOM   2744 H  HB2  . HIS A 1 17 ? 6.494   -12.535 2.164  1.00 0.00 ? 118 HIS A HB2  6  
ATOM   2745 H  HB3  . HIS A 1 17 ? 6.770   -13.330 3.701  1.00 0.00 ? 118 HIS A HB3  6  
ATOM   2746 H  HD1  . HIS A 1 17 ? 9.132   -11.935 3.432  1.00 0.00 ? 118 HIS A HD1  6  
ATOM   2747 H  HD2  . HIS A 1 17 ? 8.574   -15.265 0.943  1.00 0.00 ? 118 HIS A HD2  6  
ATOM   2748 H  HE1  . HIS A 1 17 ? 11.445  -12.576 2.566  1.00 0.00 ? 118 HIS A HE1  6  
ATOM   2749 H  HE2  . HIS A 1 17 ? 11.045  -14.661 1.087  1.00 0.00 ? 118 HIS A HE2  6  
ATOM   2750 N  N    . LEU A 1 18 ? 3.809   -13.740 2.145  1.00 0.00 ? 119 LEU A N    6  
ATOM   2751 C  CA   . LEU A 1 18 ? 2.428   -13.611 2.576  1.00 0.00 ? 119 LEU A CA   6  
ATOM   2752 C  C    . LEU A 1 18 ? 1.705   -14.942 2.363  1.00 0.00 ? 119 LEU A C    6  
ATOM   2753 O  O    . LEU A 1 18 ? 1.242   -15.561 3.320  1.00 0.00 ? 119 LEU A O    6  
ATOM   2754 C  CB   . LEU A 1 18 ? 1.756   -12.428 1.876  1.00 0.00 ? 119 LEU A CB   6  
ATOM   2755 C  CG   . LEU A 1 18 ? 0.243   -12.538 1.674  1.00 0.00 ? 119 LEU A CG   6  
ATOM   2756 C  CD1  . LEU A 1 18 ? -0.445  -13.031 2.949  1.00 0.00 ? 119 LEU A CD1  6  
ATOM   2757 C  CD2  . LEU A 1 18 ? -0.342  -11.212 1.183  1.00 0.00 ? 119 LEU A CD2  6  
ATOM   2758 H  H    . LEU A 1 18 ? 4.079   -13.127 1.402  1.00 0.00 ? 119 LEU A H    6  
ATOM   2759 H  HA   . LEU A 1 18 ? 2.437   -13.389 3.644  1.00 0.00 ? 119 LEU A HA   6  
ATOM   2760 H  HB2  . LEU A 1 18 ? 1.961   -11.525 2.453  1.00 0.00 ? 119 LEU A HB2  6  
ATOM   2761 H  HB3  . LEU A 1 18 ? 2.224   -12.295 0.901  1.00 0.00 ? 119 LEU A HB3  6  
ATOM   2762 H  HG   . LEU A 1 18 ? 0.056   -13.281 0.899  1.00 0.00 ? 119 LEU A HG   6  
ATOM   2763 H  HD11 . LEU A 1 18 ? -0.027  -12.513 3.812  1.00 0.00 ? 119 LEU A HD11 6  
ATOM   2764 H  HD12 . LEU A 1 18 ? -1.514  -12.827 2.886  1.00 0.00 ? 119 LEU A HD12 6  
ATOM   2765 H  HD13 . LEU A 1 18 ? -0.285  -14.104 3.056  1.00 0.00 ? 119 LEU A HD13 6  
ATOM   2766 H  HD21 . LEU A 1 18 ? 0.338   -10.761 0.461  1.00 0.00 ? 119 LEU A HD21 6  
ATOM   2767 H  HD22 . LEU A 1 18 ? -1.307  -11.395 0.709  1.00 0.00 ? 119 LEU A HD22 6  
ATOM   2768 H  HD23 . LEU A 1 18 ? -0.476  -10.538 2.029  1.00 0.00 ? 119 LEU A HD23 6  
ATOM   2769 N  N    . LYS A 1 19 ? 1.630   -15.343 1.103  1.00 0.00 ? 120 LYS A N    6  
ATOM   2770 C  CA   . LYS A 1 19 ? 0.972   -16.590 0.753  1.00 0.00 ? 120 LYS A CA   6  
ATOM   2771 C  C    . LYS A 1 19 ? 1.314   -17.654 1.797  1.00 0.00 ? 120 LYS A C    6  
ATOM   2772 O  O    . LYS A 1 19 ? 0.443   -18.099 2.543  1.00 0.00 ? 120 LYS A O    6  
ATOM   2773 C  CB   . LYS A 1 19 ? 1.325   -16.998 -0.679 1.00 0.00 ? 120 LYS A CB   6  
ATOM   2774 C  CG   . LYS A 1 19 ? 1.303   -18.520 -0.836 1.00 0.00 ? 120 LYS A CG   6  
ATOM   2775 C  CD   . LYS A 1 19 ? 1.419   -18.920 -2.309 1.00 0.00 ? 120 LYS A CD   6  
ATOM   2776 C  CE   . LYS A 1 19 ? 0.120   -18.628 -3.061 1.00 0.00 ? 120 LYS A CE   6  
ATOM   2777 N  NZ   . LYS A 1 19 ? -0.930  -19.598 -2.677 1.00 0.00 ? 120 LYS A NZ   6  
ATOM   2778 H  H    . LYS A 1 19 ? 2.009   -14.834 0.331  1.00 0.00 ? 120 LYS A H    6  
ATOM   2779 H  HA   . LYS A 1 19 ? -0.103  -16.411 0.781  1.00 0.00 ? 120 LYS A HA   6  
ATOM   2780 H  HB2  . LYS A 1 19 ? 0.617   -16.547 -1.376 1.00 0.00 ? 120 LYS A HB2  6  
ATOM   2781 H  HB3  . LYS A 1 19 ? 2.313   -16.616 -0.937 1.00 0.00 ? 120 LYS A HB3  6  
ATOM   2782 H  HG2  . LYS A 1 19 ? 2.123   -18.959 -0.270 1.00 0.00 ? 120 LYS A HG2  6  
ATOM   2783 H  HG3  . LYS A 1 19 ? 0.378   -18.920 -0.420 1.00 0.00 ? 120 LYS A HG3  6  
ATOM   2784 H  HD2  . LYS A 1 19 ? 2.243   -18.377 -2.773 1.00 0.00 ? 120 LYS A HD2  6  
ATOM   2785 H  HD3  . LYS A 1 19 ? 1.657   -19.981 -2.383 1.00 0.00 ? 120 LYS A HD3  6  
ATOM   2786 H  HE2  . LYS A 1 19 ? -0.215  -17.615 -2.842 1.00 0.00 ? 120 LYS A HE2  6  
ATOM   2787 H  HE3  . LYS A 1 19 ? 0.295   -18.681 -4.136 1.00 0.00 ? 120 LYS A HE3  6  
ATOM   2788 H  HZ1  . LYS A 1 19 ? -1.308  -20.024 -3.499 1.00 0.00 ? 120 LYS A HZ1  6  
ATOM   2789 H  HZ2  . LYS A 1 19 ? -0.534  -20.302 -2.088 1.00 0.00 ? 120 LYS A HZ2  6  
ATOM   2790 H  HZ3  . LYS A 1 19 ? -1.658  -19.123 -2.184 1.00 0.00 ? 120 LYS A HZ3  6  
ATOM   2791 N  N    . ARG A 1 20 ? 2.584   -18.031 1.817  1.00 0.00 ? 121 ARG A N    6  
ATOM   2792 C  CA   . ARG A 1 20 ? 3.052   -19.034 2.758  1.00 0.00 ? 121 ARG A CA   6  
ATOM   2793 C  C    . ARG A 1 20 ? 2.555   -18.712 4.170  1.00 0.00 ? 121 ARG A C    6  
ATOM   2794 O  O    . ARG A 1 20 ? 2.047   -19.587 4.868  1.00 0.00 ? 121 ARG A O    6  
ATOM   2795 C  CB   . ARG A 1 20 ? 4.580   -19.109 2.769  1.00 0.00 ? 121 ARG A CB   6  
ATOM   2796 C  CG   . ARG A 1 20 ? 5.075   -20.064 3.858  1.00 0.00 ? 121 ARG A CG   6  
ATOM   2797 C  CD   . ARG A 1 20 ? 5.404   -19.303 5.144  1.00 0.00 ? 121 ARG A CD   6  
ATOM   2798 N  NE   . ARG A 1 20 ? 6.856   -19.380 5.420  1.00 0.00 ? 121 ARG A NE   6  
ATOM   2799 C  CZ   . ARG A 1 20 ? 7.565   -18.397 5.988  1.00 0.00 ? 121 ARG A CZ   6  
ATOM   2800 N  NH1  . ARG A 1 20 ? 7.048   -17.701 7.011  1.00 0.00 ? 121 ARG A NH1  6  
ATOM   2801 N  NH2  . ARG A 1 20 ? 8.793   -18.108 5.537  1.00 0.00 ? 121 ARG A NH2  6  
ATOM   2802 H  H    . ARG A 1 20 ? 3.286   -17.663 1.208  1.00 0.00 ? 121 ARG A H    6  
ATOM   2803 H  HA   . ARG A 1 20 ? 2.629   -19.972 2.399  1.00 0.00 ? 121 ARG A HA   6  
ATOM   2804 H  HB2  . ARG A 1 20 ? 4.937   -19.446 1.796  1.00 0.00 ? 121 ARG A HB2  6  
ATOM   2805 H  HB3  . ARG A 1 20 ? 4.996   -18.116 2.934  1.00 0.00 ? 121 ARG A HB3  6  
ATOM   2806 H  HG2  . ARG A 1 20 ? 4.313   -20.817 4.060  1.00 0.00 ? 121 ARG A HG2  6  
ATOM   2807 H  HG3  . ARG A 1 20 ? 5.961   -20.593 3.507  1.00 0.00 ? 121 ARG A HG3  6  
ATOM   2808 H  HD2  . ARG A 1 20 ? 5.098   -18.263 5.049  1.00 0.00 ? 121 ARG A HD2  6  
ATOM   2809 H  HD3  . ARG A 1 20 ? 4.844   -19.726 5.979  1.00 0.00 ? 121 ARG A HD3  6  
ATOM   2810 H  HE   . ARG A 1 20 ? 7.338   -20.220 5.166  1.00 0.00 ? 121 ARG A HE   6  
ATOM   2811 H  HH11 . ARG A 1 20 ? 6.087   -17.424 6.990  1.00 0.00 ? 121 ARG A HH11 6  
ATOM   2812 H  HH12 . ARG A 1 20 ? 7.622   -17.460 7.794  1.00 0.00 ? 121 ARG A HH12 6  
ATOM   2813 H  HH21 . ARG A 1 20 ? 9.042   -18.325 4.592  1.00 0.00 ? 121 ARG A HH21 6  
ATOM   2814 H  HH22 . ARG A 1 20 ? 9.461   -17.676 6.143  1.00 0.00 ? 121 ARG A HH22 6  
ATOM   2815 N  N    . HIS A 1 21 ? 2.719   -17.452 4.546  1.00 0.00 ? 122 HIS A N    6  
ATOM   2816 C  CA   . HIS A 1 21 ? 2.293   -17.003 5.861  1.00 0.00 ? 122 HIS A CA   6  
ATOM   2817 C  C    . HIS A 1 21 ? 0.825   -17.375 6.080  1.00 0.00 ? 122 HIS A C    6  
ATOM   2818 O  O    . HIS A 1 21 ? 0.470   -17.936 7.114  1.00 0.00 ? 122 HIS A O    6  
ATOM   2819 C  CB   . HIS A 1 21 ? 2.559   -15.506 6.037  1.00 0.00 ? 122 HIS A CB   6  
ATOM   2820 C  CG   . HIS A 1 21 ? 1.704   -14.851 7.095  1.00 0.00 ? 122 HIS A CG   6  
ATOM   2821 N  ND1  . HIS A 1 21 ? 2.019   -14.887 8.442  1.00 0.00 ? 122 HIS A ND1  6  
ATOM   2822 C  CD2  . HIS A 1 21 ? 0.544   -14.142 6.989  1.00 0.00 ? 122 HIS A CD2  6  
ATOM   2823 C  CE1  . HIS A 1 21 ? 1.083   -14.227 9.108  1.00 0.00 ? 122 HIS A CE1  6  
ATOM   2824 N  NE2  . HIS A 1 21 ? 0.169   -13.767 8.207  1.00 0.00 ? 122 HIS A NE2  6  
ATOM   2825 H  H    . HIS A 1 21 ? 3.134   -16.746 3.972  1.00 0.00 ? 122 HIS A H    6  
ATOM   2826 H  HA   . HIS A 1 21 ? 2.907   -17.538 6.588  1.00 0.00 ? 122 HIS A HA   6  
ATOM   2827 H  HB2  . HIS A 1 21 ? 3.609   -15.362 6.292  1.00 0.00 ? 122 HIS A HB2  6  
ATOM   2828 H  HB3  . HIS A 1 21 ? 2.390   -15.004 5.084  1.00 0.00 ? 122 HIS A HB3  6  
ATOM   2829 H  HD1  . HIS A 1 21 ? 2.818   -15.335 8.844  1.00 0.00 ? 122 HIS A HD1  6  
ATOM   2830 H  HD2  . HIS A 1 21 ? 0.014   -13.921 6.063  1.00 0.00 ? 122 HIS A HD2  6  
ATOM   2831 H  HE1  . HIS A 1 21 ? 1.049   -14.078 10.187 1.00 0.00 ? 122 HIS A HE1  6  
ATOM   2832 N  N    . TYR A 1 22 ? 0.011   -17.044 5.088  1.00 0.00 ? 123 TYR A N    6  
ATOM   2833 C  CA   . TYR A 1 22 ? -1.411  -17.336 5.158  1.00 0.00 ? 123 TYR A CA   6  
ATOM   2834 C  C    . TYR A 1 22 ? -1.654  -18.775 5.617  1.00 0.00 ? 123 TYR A C    6  
ATOM   2835 O  O    . TYR A 1 22 ? -2.546  -19.032 6.423  1.00 0.00 ? 123 TYR A O    6  
ATOM   2836 C  CB   . TYR A 1 22 ? -1.947  -17.169 3.735  1.00 0.00 ? 123 TYR A CB   6  
ATOM   2837 C  CG   . TYR A 1 22 ? -3.080  -16.148 3.612  1.00 0.00 ? 123 TYR A CG   6  
ATOM   2838 C  CD1  . TYR A 1 22 ? -4.301  -16.399 4.204  1.00 0.00 ? 123 TYR A CD1  6  
ATOM   2839 C  CD2  . TYR A 1 22 ? -2.881  -14.977 2.909  1.00 0.00 ? 123 TYR A CD2  6  
ATOM   2840 C  CE1  . TYR A 1 22 ? -5.368  -15.438 4.089  1.00 0.00 ? 123 TYR A CE1  6  
ATOM   2841 C  CE2  . TYR A 1 22 ? -3.947  -14.017 2.794  1.00 0.00 ? 123 TYR A CE2  6  
ATOM   2842 C  CZ   . TYR A 1 22 ? -5.139  -14.294 3.389  1.00 0.00 ? 123 TYR A CZ   6  
ATOM   2843 O  OH   . TYR A 1 22 ? -6.145  -13.387 3.279  1.00 0.00 ? 123 TYR A OH   6  
ATOM   2844 H  H    . TYR A 1 22 ? 0.307   -16.587 4.249  1.00 0.00 ? 123 TYR A H    6  
ATOM   2845 H  HA   . TYR A 1 22 ? -1.859  -16.652 5.880  1.00 0.00 ? 123 TYR A HA   6  
ATOM   2846 H  HB2  . TYR A 1 22 ? -1.128  -16.867 3.082  1.00 0.00 ? 123 TYR A HB2  6  
ATOM   2847 H  HB3  . TYR A 1 22 ? -2.301  -18.135 3.376  1.00 0.00 ? 123 TYR A HB3  6  
ATOM   2848 H  HD1  . TYR A 1 22 ? -4.458  -17.323 4.760  1.00 0.00 ? 123 TYR A HD1  6  
ATOM   2849 H  HD2  . TYR A 1 22 ? -1.917  -14.780 2.442  1.00 0.00 ? 123 TYR A HD2  6  
ATOM   2850 H  HE1  . TYR A 1 22 ? -6.337  -15.623 4.552  1.00 0.00 ? 123 TYR A HE1  6  
ATOM   2851 H  HE2  . TYR A 1 22 ? -3.804  -13.088 2.241  1.00 0.00 ? 123 TYR A HE2  6  
ATOM   2852 H  HH   . TYR A 1 22 ? -6.003  -12.639 3.927  1.00 0.00 ? 123 TYR A HH   6  
ATOM   2853 N  N    . ARG A 1 23 ? -0.842  -19.676 5.083  1.00 0.00 ? 124 ARG A N    6  
ATOM   2854 C  CA   . ARG A 1 23 ? -0.958  -21.083 5.428  1.00 0.00 ? 124 ARG A CA   6  
ATOM   2855 C  C    . ARG A 1 23 ? -0.972  -21.258 6.947  1.00 0.00 ? 124 ARG A C    6  
ATOM   2856 O  O    . ARG A 1 23 ? -1.191  -22.361 7.447  1.00 0.00 ? 124 ARG A O    6  
ATOM   2857 C  CB   . ARG A 1 23 ? 0.201   -21.891 4.839  1.00 0.00 ? 124 ARG A CB   6  
ATOM   2858 C  CG   . ARG A 1 23 ? 1.025   -22.555 5.945  1.00 0.00 ? 124 ARG A CG   6  
ATOM   2859 C  CD   . ARG A 1 23 ? 0.442   -23.918 6.320  1.00 0.00 ? 124 ARG A CD   6  
ATOM   2860 N  NE   . ARG A 1 23 ? 0.660   -24.183 7.760  1.00 0.00 ? 124 ARG A NE   6  
ATOM   2861 C  CZ   . ARG A 1 23 ? 1.000   -25.378 8.261  1.00 0.00 ? 124 ARG A CZ   6  
ATOM   2862 N  NH1  . ARG A 1 23 ? 1.833   -26.178 7.580  1.00 0.00 ? 124 ARG A NH1  6  
ATOM   2863 N  NH2  . ARG A 1 23 ? 0.507   -25.775 9.443  1.00 0.00 ? 124 ARG A NH2  6  
ATOM   2864 H  H    . ARG A 1 23 ? -0.118  -19.459 4.429  1.00 0.00 ? 124 ARG A H    6  
ATOM   2865 H  HA   . ARG A 1 23 ? -1.902  -21.401 4.987  1.00 0.00 ? 124 ARG A HA   6  
ATOM   2866 H  HB2  . ARG A 1 23 ? -0.188  -22.653 4.164  1.00 0.00 ? 124 ARG A HB2  6  
ATOM   2867 H  HB3  . ARG A 1 23 ? 0.841   -21.237 4.246  1.00 0.00 ? 124 ARG A HB3  6  
ATOM   2868 H  HG2  . ARG A 1 23 ? 2.056   -22.674 5.613  1.00 0.00 ? 124 ARG A HG2  6  
ATOM   2869 H  HG3  . ARG A 1 23 ? 1.046   -21.909 6.824  1.00 0.00 ? 124 ARG A HG3  6  
ATOM   2870 H  HD2  . ARG A 1 23 ? -0.624  -23.942 6.095  1.00 0.00 ? 124 ARG A HD2  6  
ATOM   2871 H  HD3  . ARG A 1 23 ? 0.911   -24.700 5.723  1.00 0.00 ? 124 ARG A HD3  6  
ATOM   2872 H  HE   . ARG A 1 23 ? 0.547   -23.422 8.399  1.00 0.00 ? 124 ARG A HE   6  
ATOM   2873 H  HH11 . ARG A 1 23 ? 1.511   -26.653 6.761  1.00 0.00 ? 124 ARG A HH11 6  
ATOM   2874 H  HH12 . ARG A 1 23 ? 2.775   -26.299 7.891  1.00 0.00 ? 124 ARG A HH12 6  
ATOM   2875 H  HH21 . ARG A 1 23 ? -0.293  -25.317 9.829  1.00 0.00 ? 124 ARG A HH21 6  
ATOM   2876 H  HH22 . ARG A 1 23 ? 0.941   -26.528 9.938  1.00 0.00 ? 124 ARG A HH22 6  
ATOM   2877 N  N    . SER A 1 24 ? -0.736  -20.155 7.641  1.00 0.00 ? 125 SER A N    6  
ATOM   2878 C  CA   . SER A 1 24 ? -0.719  -20.172 9.094  1.00 0.00 ? 125 SER A CA   6  
ATOM   2879 C  C    . SER A 1 24 ? -1.957  -19.459 9.639  1.00 0.00 ? 125 SER A C    6  
ATOM   2880 O  O    . SER A 1 24 ? -1.977  -19.041 10.797 1.00 0.00 ? 125 SER A O    6  
ATOM   2881 C  CB   . SER A 1 24 ? 0.553   -19.519 9.638  1.00 0.00 ? 125 SER A CB   6  
ATOM   2882 O  OG   . SER A 1 24 ? 0.543   -18.105 9.465  1.00 0.00 ? 125 SER A OG   6  
ATOM   2883 H  H    . SER A 1 24 ? -0.558  -19.262 7.227  1.00 0.00 ? 125 SER A H    6  
ATOM   2884 H  HA   . SER A 1 24 ? -0.732  -21.226 9.369  1.00 0.00 ? 125 SER A HA   6  
ATOM   2885 H  HB2  . SER A 1 24 ? 0.657   -19.755 10.697 1.00 0.00 ? 125 SER A HB2  6  
ATOM   2886 H  HB3  . SER A 1 24 ? 1.422   -19.939 9.131  1.00 0.00 ? 125 SER A HB3  6  
ATOM   2887 H  HG   . SER A 1 24 ? 0.017   -17.674 10.200 1.00 0.00 ? 125 SER A HG   6  
ATOM   2888 N  N    . HIS A 1 25 ? -2.959  -19.341 8.782  1.00 0.00 ? 126 HIS A N    6  
ATOM   2889 C  CA   . HIS A 1 25 ? -4.199  -18.685 9.164  1.00 0.00 ? 126 HIS A CA   6  
ATOM   2890 C  C    . HIS A 1 25 ? -5.362  -19.672 9.039  1.00 0.00 ? 126 HIS A C    6  
ATOM   2891 O  O    . HIS A 1 25 ? -6.414  -19.478 9.645  1.00 0.00 ? 126 HIS A O    6  
ATOM   2892 C  CB   . HIS A 1 25 ? -4.413  -17.409 8.348  1.00 0.00 ? 126 HIS A CB   6  
ATOM   2893 C  CG   . HIS A 1 25 ? -3.633  -16.220 8.852  1.00 0.00 ? 126 HIS A CG   6  
ATOM   2894 N  ND1  . HIS A 1 25 ? -3.406  -15.988 10.198 1.00 0.00 ? 126 HIS A ND1  6  
ATOM   2895 C  CD2  . HIS A 1 25 ? -3.028  -15.199 8.178  1.00 0.00 ? 126 HIS A CD2  6  
ATOM   2896 C  CE1  . HIS A 1 25 ? -2.698  -14.874 10.317 1.00 0.00 ? 126 HIS A CE1  6  
ATOM   2897 N  NE2  . HIS A 1 25 ? -2.464  -14.387 9.065  1.00 0.00 ? 126 HIS A NE2  6  
ATOM   2898 H  H    . HIS A 1 25 ? -2.935  -19.684 7.843  1.00 0.00 ? 126 HIS A H    6  
ATOM   2899 H  HA   . HIS A 1 25 ? -4.090  -18.397 10.210 1.00 0.00 ? 126 HIS A HA   6  
ATOM   2900 H  HB2  . HIS A 1 25 ? -4.132  -17.602 7.312  1.00 0.00 ? 126 HIS A HB2  6  
ATOM   2901 H  HB3  . HIS A 1 25 ? -5.474  -17.163 8.350  1.00 0.00 ? 126 HIS A HB3  6  
ATOM   2902 H  HD1  . HIS A 1 25 ? -3.724  -16.561 10.953 1.00 0.00 ? 126 HIS A HD1  6  
ATOM   2903 H  HD2  . HIS A 1 25 ? -3.011  -15.072 7.096  1.00 0.00 ? 126 HIS A HD2  6  
ATOM   2904 H  HE1  . HIS A 1 25 ? -2.360  -14.426 11.252 1.00 0.00 ? 126 HIS A HE1  6  
ATOM   2905 N  N    . THR A 1 26 ? -5.133  -20.709 8.246  1.00 0.00 ? 127 THR A N    6  
ATOM   2906 C  CA   . THR A 1 26 ? -6.148  -21.726 8.032  1.00 0.00 ? 127 THR A CA   6  
ATOM   2907 C  C    . THR A 1 26 ? -5.498  -23.099 7.847  1.00 0.00 ? 127 THR A C    6  
ATOM   2908 O  O    . THR A 1 26 ? -4.562  -23.448 8.566  1.00 0.00 ? 127 THR A O    6  
ATOM   2909 C  CB   . THR A 1 26 ? -7.006  -21.295 6.841  1.00 0.00 ? 127 THR A CB   6  
ATOM   2910 O  OG1  . THR A 1 26 ? -8.135  -22.162 6.895  1.00 0.00 ? 127 THR A OG1  6  
ATOM   2911 C  CG2  . THR A 1 26 ? -6.349  -21.621 5.498  1.00 0.00 ? 127 THR A CG2  6  
ATOM   2912 H  H    . THR A 1 26 ? -4.274  -20.860 7.755  1.00 0.00 ? 127 THR A H    6  
ATOM   2913 H  HA   . THR A 1 26 ? -6.769  -21.785 8.926  1.00 0.00 ? 127 THR A HA   6  
ATOM   2914 H  HB   . THR A 1 26 ? -7.257  -20.236 6.906  1.00 0.00 ? 127 THR A HB   6  
ATOM   2915 H  HG1  . THR A 1 26 ? -7.906  -22.992 7.404  1.00 0.00 ? 127 THR A HG1  6  
ATOM   2916 H  HG21 . THR A 1 26 ? -6.214  -20.702 4.928  1.00 0.00 ? 127 THR A HG21 6  
ATOM   2917 H  HG22 . THR A 1 26 ? -5.379  -22.088 5.672  1.00 0.00 ? 127 THR A HG22 6  
ATOM   2918 H  HG23 . THR A 1 26 ? -6.987  -22.305 4.938  1.00 0.00 ? 127 THR A HG23 6  
ATOM   2919 N  N    . ASN A 1 27 ? -6.019  -23.840 6.882  1.00 0.00 ? 128 ASN A N    6  
ATOM   2920 C  CA   . ASN A 1 27 ? -5.500  -25.166 6.593  1.00 0.00 ? 128 ASN A CA   6  
ATOM   2921 C  C    . ASN A 1 27 ? -6.334  -25.804 5.479  1.00 0.00 ? 128 ASN A C    6  
ATOM   2922 O  O    . ASN A 1 27 ? -7.170  -26.666 5.742  1.00 0.00 ? 128 ASN A O    6  
ATOM   2923 C  CB   . ASN A 1 27 ? -5.586  -26.071 7.824  1.00 0.00 ? 128 ASN A CB   6  
ATOM   2924 C  CG   . ASN A 1 27 ? -4.885  -27.406 7.572  1.00 0.00 ? 128 ASN A CG   6  
ATOM   2925 O  OD1  . ASN A 1 27 ? -3.754  -27.630 7.972  1.00 0.00 ? 128 ASN A OD1  6  
ATOM   2926 N  ND2  . ASN A 1 27 ? -5.617  -28.281 6.888  1.00 0.00 ? 128 ASN A ND2  6  
ATOM   2927 H  H    . ASN A 1 27 ? -6.780  -23.548 6.302  1.00 0.00 ? 128 ASN A H    6  
ATOM   2928 H  HA   . ASN A 1 27 ? -4.462  -25.010 6.299  1.00 0.00 ? 128 ASN A HA   6  
ATOM   2929 H  HB2  . ASN A 1 27 ? -5.128  -25.571 8.678  1.00 0.00 ? 128 ASN A HB2  6  
ATOM   2930 H  HB3  . ASN A 1 27 ? -6.631  -26.246 8.079  1.00 0.00 ? 128 ASN A HB3  6  
ATOM   2931 H  HD21 . ASN A 1 27 ? -6.608  -28.163 6.827  1.00 0.00 ? 128 ASN A HD21 6  
ATOM   2932 H  HD22 . ASN A 1 27 ? -5.176  -29.055 6.434  1.00 0.00 ? 128 ASN A HD22 6  
ATOM   2933 N  N    . GLU A 1 28 ? -6.077  -25.354 4.260  1.00 0.00 ? 129 GLU A N    6  
ATOM   2934 C  CA   . GLU A 1 28 ? -6.793  -25.871 3.106  1.00 0.00 ? 129 GLU A CA   6  
ATOM   2935 C  C    . GLU A 1 28 ? -5.834  -26.616 2.176  1.00 0.00 ? 129 GLU A C    6  
ATOM   2936 O  O    . GLU A 1 28 ? -4.786  -26.088 1.806  1.00 0.00 ? 129 GLU A O    6  
ATOM   2937 C  CB   . GLU A 1 28 ? -7.515  -24.746 2.361  1.00 0.00 ? 129 GLU A CB   6  
ATOM   2938 C  CG   . GLU A 1 28 ? -8.711  -24.235 3.166  1.00 0.00 ? 129 GLU A CG   6  
ATOM   2939 C  CD   . GLU A 1 28 ? -10.030 -24.599 2.482  1.00 0.00 ? 129 GLU A CD   6  
ATOM   2940 O  OE1  . GLU A 1 28 ? -10.286 -24.026 1.402  1.00 0.00 ? 129 GLU A OE1  6  
ATOM   2941 O  OE2  . GLU A 1 28 ? -10.752 -25.444 3.055  1.00 0.00 ? 129 GLU A OE2  6  
ATOM   2942 H  H    . GLU A 1 28 ? -5.394  -24.653 4.054  1.00 0.00 ? 129 GLU A H    6  
ATOM   2943 H  HA   . GLU A 1 28 ? -7.531  -26.564 3.508  1.00 0.00 ? 129 GLU A HA   6  
ATOM   2944 H  HB2  . GLU A 1 28 ? -6.822  -23.926 2.172  1.00 0.00 ? 129 GLU A HB2  6  
ATOM   2945 H  HB3  . GLU A 1 28 ? -7.855  -25.107 1.390  1.00 0.00 ? 129 GLU A HB3  6  
ATOM   2946 H  HG2  . GLU A 1 28 ? -8.688  -24.662 4.169  1.00 0.00 ? 129 GLU A HG2  6  
ATOM   2947 H  HG3  . GLU A 1 28 ? -8.643  -23.153 3.279  1.00 0.00 ? 129 GLU A HG3  6  
ATOM   2948 N  N    . LYS A 1 29 ? -6.226  -27.831 1.824  1.00 0.00 ? 130 LYS A N    6  
ATOM   2949 C  CA   . LYS A 1 29 ? -5.414  -28.655 0.944  1.00 0.00 ? 130 LYS A CA   6  
ATOM   2950 C  C    . LYS A 1 29 ? -4.932  -27.810 -0.237 1.00 0.00 ? 130 LYS A C    6  
ATOM   2951 O  O    . LYS A 1 29 ? -4.156  -28.282 -1.066 1.00 0.00 ? 130 LYS A O    6  
ATOM   2952 C  CB   . LYS A 1 29 ? -6.181  -29.912 0.528  1.00 0.00 ? 130 LYS A CB   6  
ATOM   2953 C  CG   . LYS A 1 29 ? -6.271  -30.907 1.687  1.00 0.00 ? 130 LYS A CG   6  
ATOM   2954 C  CD   . LYS A 1 29 ? -7.578  -31.700 1.628  1.00 0.00 ? 130 LYS A CD   6  
ATOM   2955 C  CE   . LYS A 1 29 ? -7.850  -32.204 0.208  1.00 0.00 ? 130 LYS A CE   6  
ATOM   2956 N  NZ   . LYS A 1 29 ? -8.995  -31.478 -0.387 1.00 0.00 ? 130 LYS A NZ   6  
ATOM   2957 H  H    . LYS A 1 29 ? -7.080  -28.253 2.129  1.00 0.00 ? 130 LYS A H    6  
ATOM   2958 H  HA   . LYS A 1 29 ? -4.544  -28.982 1.513  1.00 0.00 ? 130 LYS A HA   6  
ATOM   2959 H  HB2  . LYS A 1 29 ? -7.184  -29.639 0.200  1.00 0.00 ? 130 LYS A HB2  6  
ATOM   2960 H  HB3  . LYS A 1 29 ? -5.684  -30.382 -0.321 1.00 0.00 ? 130 LYS A HB3  6  
ATOM   2961 H  HG2  . LYS A 1 29 ? -5.424  -31.593 1.648  1.00 0.00 ? 130 LYS A HG2  6  
ATOM   2962 H  HG3  . LYS A 1 29 ? -6.207  -30.374 2.635  1.00 0.00 ? 130 LYS A HG3  6  
ATOM   2963 H  HD2  . LYS A 1 29 ? -7.526  -32.546 2.313  1.00 0.00 ? 130 LYS A HD2  6  
ATOM   2964 H  HD3  . LYS A 1 29 ? -8.404  -31.072 1.959  1.00 0.00 ? 130 LYS A HD3  6  
ATOM   2965 H  HE2  . LYS A 1 29 ? -6.963  -32.066 -0.409 1.00 0.00 ? 130 LYS A HE2  6  
ATOM   2966 H  HE3  . LYS A 1 29 ? -8.061  -33.273 0.229  1.00 0.00 ? 130 LYS A HE3  6  
ATOM   2967 H  HZ1  . LYS A 1 29 ? -8.868  -31.413 -1.378 1.00 0.00 ? 130 LYS A HZ1  6  
ATOM   2968 H  HZ2  . LYS A 1 29 ? -9.842  -31.973 -0.191 1.00 0.00 ? 130 LYS A HZ2  6  
ATOM   2969 H  HZ3  . LYS A 1 29 ? -9.046  -30.559 0.003  1.00 0.00 ? 130 LYS A HZ3  6  
HETATM 2970 ZN ZN   . ZN  B 2 .  ? -1.464  -12.730 8.634  1.00 0.00 ? 1   ZN  A ZN   6  
ATOM   2971 N  N    . ARG A 1 1  ? 1.163   -0.326  -0.562 1.00 0.00 ? 102 ARG A N    7  
ATOM   2972 C  CA   . ARG A 1 1  ? 0.269   -1.348  -1.079 1.00 0.00 ? 102 ARG A CA   7  
ATOM   2973 C  C    . ARG A 1 1  ? 0.976   -2.704  -1.115 1.00 0.00 ? 102 ARG A C    7  
ATOM   2974 O  O    . ARG A 1 1  ? 0.416   -3.689  -1.591 1.00 0.00 ? 102 ARG A O    7  
ATOM   2975 C  CB   . ARG A 1 1  ? -0.215  -0.995  -2.487 1.00 0.00 ? 102 ARG A CB   7  
ATOM   2976 C  CG   . ARG A 1 1  ? 0.966   -0.746  -3.427 1.00 0.00 ? 102 ARG A CG   7  
ATOM   2977 C  CD   . ARG A 1 1  ? 0.485   -0.477  -4.854 1.00 0.00 ? 102 ARG A CD   7  
ATOM   2978 N  NE   . ARG A 1 1  ? 0.844   0.899   -5.259 1.00 0.00 ? 102 ARG A NE   7  
ATOM   2979 C  CZ   . ARG A 1 1  ? 0.599   1.414   -6.471 1.00 0.00 ? 102 ARG A CZ   7  
ATOM   2980 N  NH1  . ARG A 1 1  ? -0.270  0.809   -7.293 1.00 0.00 ? 102 ARG A NH1  7  
ATOM   2981 N  NH2  . ARG A 1 1  ? 1.221   2.535   -6.863 1.00 0.00 ? 102 ARG A NH2  7  
ATOM   2982 H  H    . ARG A 1 1  ? 1.066   0.574   -0.987 1.00 0.00 ? 102 ARG A H    7  
ATOM   2983 H  HA   . ARG A 1 1  ? -0.571  -1.363  -0.383 1.00 0.00 ? 102 ARG A HA   7  
ATOM   2984 H  HB2  . ARG A 1 1  ? -0.830  -1.806  -2.878 1.00 0.00 ? 102 ARG A HB2  7  
ATOM   2985 H  HB3  . ARG A 1 1  ? -0.846  -0.108  -2.447 1.00 0.00 ? 102 ARG A HB3  7  
ATOM   2986 H  HG2  . ARG A 1 1  ? 1.545   0.105   -3.069 1.00 0.00 ? 102 ARG A HG2  7  
ATOM   2987 H  HG3  . ARG A 1 1  ? 1.630   -1.609  -3.419 1.00 0.00 ? 102 ARG A HG3  7  
ATOM   2988 H  HD2  . ARG A 1 1  ? 0.933   -1.196  -5.540 1.00 0.00 ? 102 ARG A HD2  7  
ATOM   2989 H  HD3  . ARG A 1 1  ? -0.596  -0.612  -4.913 1.00 0.00 ? 102 ARG A HD3  7  
ATOM   2990 H  HE   . ARG A 1 1  ? 1.301   1.482   -4.586 1.00 0.00 ? 102 ARG A HE   7  
ATOM   2991 H  HH11 . ARG A 1 1  ? -1.250  0.830   -7.089 1.00 0.00 ? 102 ARG A HH11 7  
ATOM   2992 H  HH12 . ARG A 1 1  ? 0.061   0.336   -8.109 1.00 0.00 ? 102 ARG A HH12 7  
ATOM   2993 H  HH21 . ARG A 1 1  ? 2.091   2.794   -6.446 1.00 0.00 ? 102 ARG A HH21 7  
ATOM   2994 H  HH22 . ARG A 1 1  ? 0.814   3.111   -7.572 1.00 0.00 ? 102 ARG A HH22 7  
ATOM   2995 N  N    . SER A 1 2  ? 2.200   -2.711  -0.606 1.00 0.00 ? 103 SER A N    7  
ATOM   2996 C  CA   . SER A 1 2  ? 2.991   -3.929  -0.574 1.00 0.00 ? 103 SER A CA   7  
ATOM   2997 C  C    . SER A 1 2  ? 2.202   -5.047  0.110  1.00 0.00 ? 103 SER A C    7  
ATOM   2998 O  O    . SER A 1 2  ? 1.836   -4.928  1.278  1.00 0.00 ? 103 SER A O    7  
ATOM   2999 C  CB   . SER A 1 2  ? 4.323   -3.703  0.145  1.00 0.00 ? 103 SER A CB   7  
ATOM   3000 O  OG   . SER A 1 2  ? 5.390   -3.473  -0.770 1.00 0.00 ? 103 SER A OG   7  
ATOM   3001 H  H    . SER A 1 2  ? 2.650   -1.904  -0.221 1.00 0.00 ? 103 SER A H    7  
ATOM   3002 H  HA   . SER A 1 2  ? 3.180   -4.178  -1.619 1.00 0.00 ? 103 SER A HA   7  
ATOM   3003 H  HB2  . SER A 1 2  ? 4.231   -2.850  0.817  1.00 0.00 ? 103 SER A HB2  7  
ATOM   3004 H  HB3  . SER A 1 2  ? 4.554   -4.572  0.761  1.00 0.00 ? 103 SER A HB3  7  
ATOM   3005 H  HG   . SER A 1 2  ? 5.415   -2.508  -1.032 1.00 0.00 ? 103 SER A HG   7  
ATOM   3006 N  N    . PHE A 1 3  ? 1.963   -6.108  -0.648 1.00 0.00 ? 104 PHE A N    7  
ATOM   3007 C  CA   . PHE A 1 3  ? 1.224   -7.246  -0.128 1.00 0.00 ? 104 PHE A CA   7  
ATOM   3008 C  C    . PHE A 1 3  ? 1.140   -7.196  1.398  1.00 0.00 ? 104 PHE A C    7  
ATOM   3009 O  O    . PHE A 1 3  ? 2.163   -7.193  2.080  1.00 0.00 ? 104 PHE A O    7  
ATOM   3010 C  CB   . PHE A 1 3  ? 1.991   -8.504  -0.544 1.00 0.00 ? 104 PHE A CB   7  
ATOM   3011 C  CG   . PHE A 1 3  ? 2.599   -8.427  -1.946 1.00 0.00 ? 104 PHE A CG   7  
ATOM   3012 C  CD1  . PHE A 1 3  ? 1.879   -8.839  -3.023 1.00 0.00 ? 104 PHE A CD1  7  
ATOM   3013 C  CD2  . PHE A 1 3  ? 3.861   -7.947  -2.114 1.00 0.00 ? 104 PHE A CD2  7  
ATOM   3014 C  CE1  . PHE A 1 3  ? 2.443   -8.767  -4.324 1.00 0.00 ? 104 PHE A CE1  7  
ATOM   3015 C  CE2  . PHE A 1 3  ? 4.425   -7.876  -3.415 1.00 0.00 ? 104 PHE A CE2  7  
ATOM   3016 C  CZ   . PHE A 1 3  ? 3.705   -8.288  -4.492 1.00 0.00 ? 104 PHE A CZ   7  
ATOM   3017 H  H    . PHE A 1 3  ? 2.264   -6.196  -1.597 1.00 0.00 ? 104 PHE A H    7  
ATOM   3018 H  HA   . PHE A 1 3  ? 0.219   -7.198  -0.548 1.00 0.00 ? 104 PHE A HA   7  
ATOM   3019 H  HB2  . PHE A 1 3  ? 2.787   -8.687  0.177  1.00 0.00 ? 104 PHE A HB2  7  
ATOM   3020 H  HB3  . PHE A 1 3  ? 1.317   -9.360  -0.498 1.00 0.00 ? 104 PHE A HB3  7  
ATOM   3021 H  HD1  . PHE A 1 3  ? 0.868   -9.223  -2.889 1.00 0.00 ? 104 PHE A HD1  7  
ATOM   3022 H  HD2  . PHE A 1 3  ? 4.438   -7.618  -1.250 1.00 0.00 ? 104 PHE A HD2  7  
ATOM   3023 H  HE1  . PHE A 1 3  ? 1.866   -9.097  -5.188 1.00 0.00 ? 104 PHE A HE1  7  
ATOM   3024 H  HE2  . PHE A 1 3  ? 5.437   -7.493  -3.549 1.00 0.00 ? 104 PHE A HE2  7  
ATOM   3025 H  HZ   . PHE A 1 3  ? 4.139   -8.233  -5.491 1.00 0.00 ? 104 PHE A HZ   7  
ATOM   3026 N  N    . VAL A 1 4  ? -0.090  -7.158  1.890  1.00 0.00 ? 105 VAL A N    7  
ATOM   3027 C  CA   . VAL A 1 4  ? -0.322  -7.107  3.323  1.00 0.00 ? 105 VAL A CA   7  
ATOM   3028 C  C    . VAL A 1 4  ? -1.336  -8.185  3.710  1.00 0.00 ? 105 VAL A C    7  
ATOM   3029 O  O    . VAL A 1 4  ? -2.396  -8.293  3.096  1.00 0.00 ? 105 VAL A O    7  
ATOM   3030 C  CB   . VAL A 1 4  ? -0.759  -5.700  3.734  1.00 0.00 ? 105 VAL A CB   7  
ATOM   3031 C  CG1  . VAL A 1 4  ? -1.055  -5.633  5.233  1.00 0.00 ? 105 VAL A CG1  7  
ATOM   3032 C  CG2  . VAL A 1 4  ? 0.291   -4.661  3.335  1.00 0.00 ? 105 VAL A CG2  7  
ATOM   3033 H  H    . VAL A 1 4  ? -0.918  -7.160  1.328  1.00 0.00 ? 105 VAL A H    7  
ATOM   3034 H  HA   . VAL A 1 4  ? 0.626   -7.323  3.817  1.00 0.00 ? 105 VAL A HA   7  
ATOM   3035 H  HB   . VAL A 1 4  ? -1.680  -5.467  3.200  1.00 0.00 ? 105 VAL A HB   7  
ATOM   3036 H  HG11 . VAL A 1 4  ? -2.065  -5.998  5.421  1.00 0.00 ? 105 VAL A HG11 7  
ATOM   3037 H  HG12 . VAL A 1 4  ? -0.338  -6.252  5.773  1.00 0.00 ? 105 VAL A HG12 7  
ATOM   3038 H  HG13 . VAL A 1 4  ? -0.973  -4.601  5.575  1.00 0.00 ? 105 VAL A HG13 7  
ATOM   3039 H  HG21 . VAL A 1 4  ? 0.276   -3.837  4.049  1.00 0.00 ? 105 VAL A HG21 7  
ATOM   3040 H  HG22 . VAL A 1 4  ? 1.278   -5.124  3.335  1.00 0.00 ? 105 VAL A HG22 7  
ATOM   3041 H  HG23 . VAL A 1 4  ? 0.068   -4.283  2.338  1.00 0.00 ? 105 VAL A HG23 7  
ATOM   3042 N  N    . CYS A 1 5  ? -0.975  -8.955  4.726  1.00 0.00 ? 106 CYS A N    7  
ATOM   3043 C  CA   . CYS A 1 5  ? -1.841  -10.021 5.202  1.00 0.00 ? 106 CYS A CA   7  
ATOM   3044 C  C    . CYS A 1 5  ? -3.069  -9.386  5.856  1.00 0.00 ? 106 CYS A C    7  
ATOM   3045 O  O    . CYS A 1 5  ? -3.103  -9.199  7.071  1.00 0.00 ? 106 CYS A O    7  
ATOM   3046 C  CB   . CYS A 1 5  ? -1.106  -10.961 6.160  1.00 0.00 ? 106 CYS A CB   7  
ATOM   3047 S  SG   . CYS A 1 5  ? -2.138  -12.432 6.507  1.00 0.00 ? 106 CYS A SG   7  
ATOM   3048 H  H    . CYS A 1 5  ? -0.110  -8.861  5.220  1.00 0.00 ? 106 CYS A H    7  
ATOM   3049 H  HA   . CYS A 1 5  ? -2.126  -10.606 4.327  1.00 0.00 ? 106 CYS A HA   7  
ATOM   3050 H  HB2  . CYS A 1 5  ? -0.155  -11.268 5.723  1.00 0.00 ? 106 CYS A HB2  7  
ATOM   3051 H  HB3  . CYS A 1 5  ? -0.876  -10.440 7.089  1.00 0.00 ? 106 CYS A HB3  7  
ATOM   3052 N  N    . GLU A 1 6  ? -4.049  -9.072  5.021  1.00 0.00 ? 107 GLU A N    7  
ATOM   3053 C  CA   . GLU A 1 6  ? -5.277  -8.462  5.502  1.00 0.00 ? 107 GLU A CA   7  
ATOM   3054 C  C    . GLU A 1 6  ? -5.732  -9.138  6.797  1.00 0.00 ? 107 GLU A C    7  
ATOM   3055 O  O    . GLU A 1 6  ? -6.410  -8.521  7.618  1.00 0.00 ? 107 GLU A O    7  
ATOM   3056 C  CB   . GLU A 1 6  ? -6.372  -8.521  4.437  1.00 0.00 ? 107 GLU A CB   7  
ATOM   3057 C  CG   . GLU A 1 6  ? -6.320  -7.293  3.527  1.00 0.00 ? 107 GLU A CG   7  
ATOM   3058 C  CD   . GLU A 1 6  ? -6.327  -6.001  4.348  1.00 0.00 ? 107 GLU A CD   7  
ATOM   3059 O  OE1  . GLU A 1 6  ? -7.087  -5.964  5.339  1.00 0.00 ? 107 GLU A OE1  7  
ATOM   3060 O  OE2  . GLU A 1 6  ? -5.572  -5.082  3.965  1.00 0.00 ? 107 GLU A OE2  7  
ATOM   3061 H  H    . GLU A 1 6  ? -4.013  -9.227  4.033  1.00 0.00 ? 107 GLU A H    7  
ATOM   3062 H  HA   . GLU A 1 6  ? -5.024  -7.419  5.698  1.00 0.00 ? 107 GLU A HA   7  
ATOM   3063 H  HB2  . GLU A 1 6  ? -6.257  -9.426  3.841  1.00 0.00 ? 107 GLU A HB2  7  
ATOM   3064 H  HB3  . GLU A 1 6  ? -7.349  -8.581  4.918  1.00 0.00 ? 107 GLU A HB3  7  
ATOM   3065 H  HG2  . GLU A 1 6  ? -5.422  -7.331  2.910  1.00 0.00 ? 107 GLU A HG2  7  
ATOM   3066 H  HG3  . GLU A 1 6  ? -7.173  -7.301  2.848  1.00 0.00 ? 107 GLU A HG3  7  
ATOM   3067 N  N    . VAL A 1 7  ? -5.342  -10.396 6.939  1.00 0.00 ? 108 VAL A N    7  
ATOM   3068 C  CA   . VAL A 1 7  ? -5.703  -11.163 8.119  1.00 0.00 ? 108 VAL A CA   7  
ATOM   3069 C  C    . VAL A 1 7  ? -5.079  -10.511 9.356  1.00 0.00 ? 108 VAL A C    7  
ATOM   3070 O  O    . VAL A 1 7  ? -5.788  -9.974  10.204 1.00 0.00 ? 108 VAL A O    7  
ATOM   3071 C  CB   . VAL A 1 7  ? -5.289  -12.625 7.941  1.00 0.00 ? 108 VAL A CB   7  
ATOM   3072 C  CG1  . VAL A 1 7  ? -5.472  -13.409 9.243  1.00 0.00 ? 108 VAL A CG1  7  
ATOM   3073 C  CG2  . VAL A 1 7  ? -6.063  -13.277 6.794  1.00 0.00 ? 108 VAL A CG2  7  
ATOM   3074 H  H    . VAL A 1 7  ? -4.792  -10.890 6.267  1.00 0.00 ? 108 VAL A H    7  
ATOM   3075 H  HA   . VAL A 1 7  ? -6.788  -11.128 8.216  1.00 0.00 ? 108 VAL A HA   7  
ATOM   3076 H  HB   . VAL A 1 7  ? -4.230  -12.644 7.684  1.00 0.00 ? 108 VAL A HB   7  
ATOM   3077 H  HG11 . VAL A 1 7  ? -6.241  -12.932 9.849  1.00 0.00 ? 108 VAL A HG11 7  
ATOM   3078 H  HG12 . VAL A 1 7  ? -5.773  -14.430 9.011  1.00 0.00 ? 108 VAL A HG12 7  
ATOM   3079 H  HG13 . VAL A 1 7  ? -4.530  -13.423 9.793  1.00 0.00 ? 108 VAL A HG13 7  
ATOM   3080 H  HG21 . VAL A 1 7  ? -7.027  -12.781 6.679  1.00 0.00 ? 108 VAL A HG21 7  
ATOM   3081 H  HG22 . VAL A 1 7  ? -5.493  -13.182 5.871  1.00 0.00 ? 108 VAL A HG22 7  
ATOM   3082 H  HG23 . VAL A 1 7  ? -6.221  -14.332 7.017  1.00 0.00 ? 108 VAL A HG23 7  
ATOM   3083 N  N    . CYS A 1 8  ? -3.757  -10.581 9.418  1.00 0.00 ? 109 CYS A N    7  
ATOM   3084 C  CA   . CYS A 1 8  ? -3.029  -10.004 10.535 1.00 0.00 ? 109 CYS A CA   7  
ATOM   3085 C  C    . CYS A 1 8  ? -2.346  -8.722  10.053 1.00 0.00 ? 109 CYS A C    7  
ATOM   3086 O  O    . CYS A 1 8  ? -1.324  -8.314  10.604 1.00 0.00 ? 109 CYS A O    7  
ATOM   3087 C  CB   . CYS A 1 8  ? -2.026  -10.996 11.129 1.00 0.00 ? 109 CYS A CB   7  
ATOM   3088 S  SG   . CYS A 1 8  ? -0.551  -11.115 10.053 1.00 0.00 ? 109 CYS A SG   7  
ATOM   3089 H  H    . CYS A 1 8  ? -3.186  -11.019 8.723  1.00 0.00 ? 109 CYS A H    7  
ATOM   3090 H  HA   . CYS A 1 8  ? -3.765  -9.783  11.308 1.00 0.00 ? 109 CYS A HA   7  
ATOM   3091 H  HB2  . CYS A 1 8  ? -1.733  -10.674 12.129 1.00 0.00 ? 109 CYS A HB2  7  
ATOM   3092 H  HB3  . CYS A 1 8  ? -2.491  -11.976 11.233 1.00 0.00 ? 109 CYS A HB3  7  
ATOM   3093 N  N    . THR A 1 9  ? -2.938  -8.122  9.031  1.00 0.00 ? 110 THR A N    7  
ATOM   3094 C  CA   . THR A 1 9  ? -2.399  -6.896  8.470  1.00 0.00 ? 110 THR A CA   7  
ATOM   3095 C  C    . THR A 1 9  ? -0.873  -6.885  8.574  1.00 0.00 ? 110 THR A C    7  
ATOM   3096 O  O    . THR A 1 9  ? -0.297  -6.012  9.220  1.00 0.00 ? 110 THR A O    7  
ATOM   3097 C  CB   . THR A 1 9  ? -3.065  -5.717  9.184  1.00 0.00 ? 110 THR A CB   7  
ATOM   3098 O  OG1  . THR A 1 9  ? -2.578  -5.801  10.520 1.00 0.00 ? 110 THR A OG1  7  
ATOM   3099 C  CG2  . THR A 1 9  ? -4.578  -5.897  9.326  1.00 0.00 ? 110 THR A CG2  7  
ATOM   3100 H  H    . THR A 1 9  ? -3.768  -8.461  8.588  1.00 0.00 ? 110 THR A H    7  
ATOM   3101 H  HA   . THR A 1 9  ? -2.647  -6.865  7.409  1.00 0.00 ? 110 THR A HA   7  
ATOM   3102 H  HB   . THR A 1 9  ? -2.830  -4.777  8.685  1.00 0.00 ? 110 THR A HB   7  
ATOM   3103 H  HG1  . THR A 1 9  ? -3.042  -5.128  11.096 1.00 0.00 ? 110 THR A HG1  7  
ATOM   3104 H  HG21 . THR A 1 9  ? -4.974  -5.127  9.987  1.00 0.00 ? 110 THR A HG21 7  
ATOM   3105 H  HG22 . THR A 1 9  ? -5.047  -5.812  8.346  1.00 0.00 ? 110 THR A HG22 7  
ATOM   3106 H  HG23 . THR A 1 9  ? -4.788  -6.880  9.747  1.00 0.00 ? 110 THR A HG23 7  
ATOM   3107 N  N    . ARG A 1 10 ? -0.262  -7.867  7.929  1.00 0.00 ? 111 ARG A N    7  
ATOM   3108 C  CA   . ARG A 1 10 ? 1.187   -7.984  7.941  1.00 0.00 ? 111 ARG A CA   7  
ATOM   3109 C  C    . ARG A 1 10 ? 1.748   -7.773  6.533  1.00 0.00 ? 111 ARG A C    7  
ATOM   3110 O  O    . ARG A 1 10 ? 1.288   -8.396  5.578  1.00 0.00 ? 111 ARG A O    7  
ATOM   3111 C  CB   . ARG A 1 10 ? 1.625   -9.356  8.458  1.00 0.00 ? 111 ARG A CB   7  
ATOM   3112 C  CG   . ARG A 1 10 ? 1.964   -9.297  9.949  1.00 0.00 ? 111 ARG A CG   7  
ATOM   3113 C  CD   . ARG A 1 10 ? 2.836   -10.485 10.359 1.00 0.00 ? 111 ARG A CD   7  
ATOM   3114 N  NE   . ARG A 1 10 ? 2.209   -11.207 11.490 1.00 0.00 ? 111 ARG A NE   7  
ATOM   3115 C  CZ   . ARG A 1 10 ? 2.538   -11.019 12.775 1.00 0.00 ? 111 ARG A CZ   7  
ATOM   3116 N  NH1  . ARG A 1 10 ? 3.743   -10.529 13.094 1.00 0.00 ? 111 ARG A NH1  7  
ATOM   3117 N  NH2  . ARG A 1 10 ? 1.661   -11.324 13.741 1.00 0.00 ? 111 ARG A NH2  7  
ATOM   3118 H  H    . ARG A 1 10 ? -0.737  -8.575  7.407  1.00 0.00 ? 111 ARG A H    7  
ATOM   3119 H  HA   . ARG A 1 10 ? 1.524   -7.199  8.619  1.00 0.00 ? 111 ARG A HA   7  
ATOM   3120 H  HB2  . ARG A 1 10 ? 0.832   -10.082 8.290  1.00 0.00 ? 111 ARG A HB2  7  
ATOM   3121 H  HB3  . ARG A 1 10 ? 2.495   -9.698  7.897  1.00 0.00 ? 111 ARG A HB3  7  
ATOM   3122 H  HG2  . ARG A 1 10 ? 2.485   -8.365  10.171 1.00 0.00 ? 111 ARG A HG2  7  
ATOM   3123 H  HG3  . ARG A 1 10 ? 1.046   -9.297  10.534 1.00 0.00 ? 111 ARG A HG3  7  
ATOM   3124 H  HD2  . ARG A 1 10 ? 2.967   -11.161 9.514  1.00 0.00 ? 111 ARG A HD2  7  
ATOM   3125 H  HD3  . ARG A 1 10 ? 3.829   -10.137 10.646 1.00 0.00 ? 111 ARG A HD3  7  
ATOM   3126 H  HE   . ARG A 1 10 ? 1.496   -11.875 11.280 1.00 0.00 ? 111 ARG A HE   7  
ATOM   3127 H  HH11 . ARG A 1 10 ? 4.490   -10.565 12.430 1.00 0.00 ? 111 ARG A HH11 7  
ATOM   3128 H  HH12 . ARG A 1 10 ? 3.895   -10.126 13.997 1.00 0.00 ? 111 ARG A HH12 7  
ATOM   3129 H  HH21 . ARG A 1 10 ? 0.685   -11.374 13.533 1.00 0.00 ? 111 ARG A HH21 7  
ATOM   3130 H  HH22 . ARG A 1 10 ? 1.983   -11.500 14.672 1.00 0.00 ? 111 ARG A HH22 7  
ATOM   3131 N  N    . ALA A 1 11 ? 2.734   -6.893  6.451  1.00 0.00 ? 112 ALA A N    7  
ATOM   3132 C  CA   . ALA A 1 11 ? 3.363   -6.591  5.175  1.00 0.00 ? 112 ALA A CA   7  
ATOM   3133 C  C    . ALA A 1 11 ? 4.590   -7.489  4.992  1.00 0.00 ? 112 ALA A C    7  
ATOM   3134 O  O    . ALA A 1 11 ? 5.017   -8.160  5.930  1.00 0.00 ? 112 ALA A O    7  
ATOM   3135 C  CB   . ALA A 1 11 ? 3.716   -5.104  5.118  1.00 0.00 ? 112 ALA A CB   7  
ATOM   3136 H  H    . ALA A 1 11 ? 3.103   -6.390  7.232  1.00 0.00 ? 112 ALA A H    7  
ATOM   3137 H  HA   . ALA A 1 11 ? 2.642   -6.812  4.389  1.00 0.00 ? 112 ALA A HA   7  
ATOM   3138 H  HB1  . ALA A 1 11 ? 4.589   -4.962  4.480  1.00 0.00 ? 112 ALA A HB1  7  
ATOM   3139 H  HB2  . ALA A 1 11 ? 2.873   -4.547  4.708  1.00 0.00 ? 112 ALA A HB2  7  
ATOM   3140 H  HB3  . ALA A 1 11 ? 3.936   -4.744  6.122  1.00 0.00 ? 112 ALA A HB3  7  
ATOM   3141 N  N    . PHE A 1 12 ? 5.121   -7.470  3.779  1.00 0.00 ? 113 PHE A N    7  
ATOM   3142 C  CA   . PHE A 1 12 ? 6.289   -8.274  3.461  1.00 0.00 ? 113 PHE A CA   7  
ATOM   3143 C  C    . PHE A 1 12 ? 7.056   -7.680  2.276  1.00 0.00 ? 113 PHE A C    7  
ATOM   3144 O  O    . PHE A 1 12 ? 6.509   -6.889  1.511  1.00 0.00 ? 113 PHE A O    7  
ATOM   3145 C  CB   . PHE A 1 12 ? 5.784   -9.667  3.080  1.00 0.00 ? 113 PHE A CB   7  
ATOM   3146 C  CG   . PHE A 1 12 ? 5.239   -10.474 4.259  1.00 0.00 ? 113 PHE A CG   7  
ATOM   3147 C  CD1  . PHE A 1 12 ? 6.098   -11.064 5.135  1.00 0.00 ? 113 PHE A CD1  7  
ATOM   3148 C  CD2  . PHE A 1 12 ? 3.897   -10.603 4.433  1.00 0.00 ? 113 PHE A CD2  7  
ATOM   3149 C  CE1  . PHE A 1 12 ? 5.592   -11.813 6.230  1.00 0.00 ? 113 PHE A CE1  7  
ATOM   3150 C  CE2  . PHE A 1 12 ? 3.391   -11.354 5.527  1.00 0.00 ? 113 PHE A CE2  7  
ATOM   3151 C  CZ   . PHE A 1 12 ? 4.249   -11.943 6.402  1.00 0.00 ? 113 PHE A CZ   7  
ATOM   3152 H  H    . PHE A 1 12 ? 4.768   -6.920  3.022  1.00 0.00 ? 113 PHE A H    7  
ATOM   3153 H  HA   . PHE A 1 12 ? 6.931   -8.275  4.342  1.00 0.00 ? 113 PHE A HA   7  
ATOM   3154 H  HB2  . PHE A 1 12 ? 5.001   -9.565  2.329  1.00 0.00 ? 113 PHE A HB2  7  
ATOM   3155 H  HB3  . PHE A 1 12 ? 6.599   -10.223 2.617  1.00 0.00 ? 113 PHE A HB3  7  
ATOM   3156 H  HD1  . PHE A 1 12 ? 7.174   -10.960 4.996  1.00 0.00 ? 113 PHE A HD1  7  
ATOM   3157 H  HD2  . PHE A 1 12 ? 3.209   -10.132 3.731  1.00 0.00 ? 113 PHE A HD2  7  
ATOM   3158 H  HE1  . PHE A 1 12 ? 6.280   -12.285 6.931  1.00 0.00 ? 113 PHE A HE1  7  
ATOM   3159 H  HE2  . PHE A 1 12 ? 2.315   -11.457 5.666  1.00 0.00 ? 113 PHE A HE2  7  
ATOM   3160 H  HZ   . PHE A 1 12 ? 3.861   -12.518 7.243  1.00 0.00 ? 113 PHE A HZ   7  
ATOM   3161 N  N    . ALA A 1 13 ? 8.312   -8.087  2.164  1.00 0.00 ? 114 ALA A N    7  
ATOM   3162 C  CA   . ALA A 1 13 ? 9.160   -7.607  1.086  1.00 0.00 ? 114 ALA A CA   7  
ATOM   3163 C  C    . ALA A 1 13 ? 8.820   -8.362  -0.201 1.00 0.00 ? 114 ALA A C    7  
ATOM   3164 O  O    . ALA A 1 13 ? 9.300   -8.010  -1.277 1.00 0.00 ? 114 ALA A O    7  
ATOM   3165 C  CB   . ALA A 1 13 ? 10.630  -7.764  1.483  1.00 0.00 ? 114 ALA A CB   7  
ATOM   3166 H  H    . ALA A 1 13 ? 8.751   -8.732  2.791  1.00 0.00 ? 114 ALA A H    7  
ATOM   3167 H  HA   . ALA A 1 13 ? 8.947   -6.547  0.944  1.00 0.00 ? 114 ALA A HA   7  
ATOM   3168 H  HB1  . ALA A 1 13 ? 11.121  -8.451  0.795  1.00 0.00 ? 114 ALA A HB1  7  
ATOM   3169 H  HB2  . ALA A 1 13 ? 11.124  -6.793  1.442  1.00 0.00 ? 114 ALA A HB2  7  
ATOM   3170 H  HB3  . ALA A 1 13 ? 10.691  -8.160  2.497  1.00 0.00 ? 114 ALA A HB3  7  
ATOM   3171 N  N    . ARG A 1 14 ? 7.993   -9.385  -0.047 1.00 0.00 ? 115 ARG A N    7  
ATOM   3172 C  CA   . ARG A 1 14 ? 7.584   -10.193 -1.183 1.00 0.00 ? 115 ARG A CA   7  
ATOM   3173 C  C    . ARG A 1 14 ? 6.206   -10.808 -0.927 1.00 0.00 ? 115 ARG A C    7  
ATOM   3174 O  O    . ARG A 1 14 ? 5.801   -10.977 0.222  1.00 0.00 ? 115 ARG A O    7  
ATOM   3175 C  CB   . ARG A 1 14 ? 8.591   -11.312 -1.455 1.00 0.00 ? 115 ARG A CB   7  
ATOM   3176 C  CG   . ARG A 1 14 ? 10.005  -10.750 -1.614 1.00 0.00 ? 115 ARG A CG   7  
ATOM   3177 C  CD   . ARG A 1 14 ? 10.941  -11.788 -2.237 1.00 0.00 ? 115 ARG A CD   7  
ATOM   3178 N  NE   . ARG A 1 14 ? 10.525  -12.073 -3.629 1.00 0.00 ? 115 ARG A NE   7  
ATOM   3179 C  CZ   . ARG A 1 14 ? 11.353  -12.043 -4.681 1.00 0.00 ? 115 ARG A CZ   7  
ATOM   3180 N  NH1  . ARG A 1 14 ? 12.477  -12.771 -4.670 1.00 0.00 ? 115 ARG A NH1  7  
ATOM   3181 N  NH2  . ARG A 1 14 ? 11.056  -11.284 -5.745 1.00 0.00 ? 115 ARG A NH2  7  
ATOM   3182 H  H    . ARG A 1 14 ? 7.608   -9.666  0.832  1.00 0.00 ? 115 ARG A H    7  
ATOM   3183 H  HA   . ARG A 1 14 ? 7.553   -9.499  -2.022 1.00 0.00 ? 115 ARG A HA   7  
ATOM   3184 H  HB2  . ARG A 1 14 ? 8.571   -12.032 -0.636 1.00 0.00 ? 115 ARG A HB2  7  
ATOM   3185 H  HB3  . ARG A 1 14 ? 8.306   -11.851 -2.360 1.00 0.00 ? 115 ARG A HB3  7  
ATOM   3186 H  HG2  . ARG A 1 14 ? 9.978   -9.859  -2.239 1.00 0.00 ? 115 ARG A HG2  7  
ATOM   3187 H  HG3  . ARG A 1 14 ? 10.391  -10.447 -0.640 1.00 0.00 ? 115 ARG A HG3  7  
ATOM   3188 H  HD2  . ARG A 1 14 ? 11.966  -11.420 -2.224 1.00 0.00 ? 115 ARG A HD2  7  
ATOM   3189 H  HD3  . ARG A 1 14 ? 10.924  -12.706 -1.648 1.00 0.00 ? 115 ARG A HD3  7  
ATOM   3190 H  HE   . ARG A 1 14 ? 9.566   -12.303 -3.793 1.00 0.00 ? 115 ARG A HE   7  
ATOM   3191 H  HH11 . ARG A 1 14 ? 12.729  -13.291 -3.854 1.00 0.00 ? 115 ARG A HH11 7  
ATOM   3192 H  HH12 . ARG A 1 14 ? 13.066  -12.795 -5.479 1.00 0.00 ? 115 ARG A HH12 7  
ATOM   3193 H  HH21 . ARG A 1 14 ? 10.102  -11.127 -5.998 1.00 0.00 ? 115 ARG A HH21 7  
ATOM   3194 H  HH22 . ARG A 1 14 ? 11.791  -10.874 -6.287 1.00 0.00 ? 115 ARG A HH22 7  
ATOM   3195 N  N    . GLN A 1 15 ? 5.523   -11.125 -2.018 1.00 0.00 ? 116 GLN A N    7  
ATOM   3196 C  CA   . GLN A 1 15 ? 4.200   -11.718 -1.926 1.00 0.00 ? 116 GLN A CA   7  
ATOM   3197 C  C    . GLN A 1 15 ? 4.290   -13.135 -1.357 1.00 0.00 ? 116 GLN A C    7  
ATOM   3198 O  O    . GLN A 1 15 ? 3.769   -13.407 -0.277 1.00 0.00 ? 116 GLN A O    7  
ATOM   3199 C  CB   . GLN A 1 15 ? 3.504   -11.717 -3.289 1.00 0.00 ? 116 GLN A CB   7  
ATOM   3200 C  CG   . GLN A 1 15 ? 4.407   -12.321 -4.366 1.00 0.00 ? 116 GLN A CG   7  
ATOM   3201 C  CD   . GLN A 1 15 ? 4.196   -11.625 -5.712 1.00 0.00 ? 116 GLN A CD   7  
ATOM   3202 O  OE1  . GLN A 1 15 ? 3.147   -11.070 -5.995 1.00 0.00 ? 116 GLN A OE1  7  
ATOM   3203 N  NE2  . GLN A 1 15 ? 5.249   -11.686 -6.523 1.00 0.00 ? 116 GLN A NE2  7  
ATOM   3204 H  H    . GLN A 1 15 ? 5.860   -10.984 -2.949 1.00 0.00 ? 116 GLN A H    7  
ATOM   3205 H  HA   . GLN A 1 15 ? 3.643   -11.078 -1.241 1.00 0.00 ? 116 GLN A HA   7  
ATOM   3206 H  HB2  . GLN A 1 15 ? 2.576   -12.286 -3.227 1.00 0.00 ? 116 GLN A HB2  7  
ATOM   3207 H  HB3  . GLN A 1 15 ? 3.235   -10.698 -3.564 1.00 0.00 ? 116 GLN A HB3  7  
ATOM   3208 H  HG2  . GLN A 1 15 ? 5.450   -12.229 -4.064 1.00 0.00 ? 116 GLN A HG2  7  
ATOM   3209 H  HG3  . GLN A 1 15 ? 4.197   -13.386 -4.466 1.00 0.00 ? 116 GLN A HG3  7  
ATOM   3210 H  HE21 . GLN A 1 15 ? 6.173   -11.705 -6.142 1.00 0.00 ? 116 GLN A HE21 7  
ATOM   3211 H  HE22 . GLN A 1 15 ? 5.115   -11.713 -7.513 1.00 0.00 ? 116 GLN A HE22 7  
ATOM   3212 N  N    . GLU A 1 16 ? 4.956   -13.998 -2.109 1.00 0.00 ? 117 GLU A N    7  
ATOM   3213 C  CA   . GLU A 1 16 ? 5.121   -15.381 -1.692 1.00 0.00 ? 117 GLU A CA   7  
ATOM   3214 C  C    . GLU A 1 16 ? 5.148   -15.476 -0.165 1.00 0.00 ? 117 GLU A C    7  
ATOM   3215 O  O    . GLU A 1 16 ? 4.602   -16.415 0.412  1.00 0.00 ? 117 GLU A O    7  
ATOM   3216 C  CB   . GLU A 1 16 ? 6.385   -15.989 -2.302 1.00 0.00 ? 117 GLU A CB   7  
ATOM   3217 C  CG   . GLU A 1 16 ? 7.324   -14.898 -2.820 1.00 0.00 ? 117 GLU A CG   7  
ATOM   3218 C  CD   . GLU A 1 16 ? 7.784   -13.985 -1.682 1.00 0.00 ? 117 GLU A CD   7  
ATOM   3219 O  OE1  . GLU A 1 16 ? 6.926   -13.226 -1.182 1.00 0.00 ? 117 GLU A OE1  7  
ATOM   3220 O  OE2  . GLU A 1 16 ? 8.982   -14.066 -1.338 1.00 0.00 ? 117 GLU A OE2  7  
ATOM   3221 H  H    . GLU A 1 16 ? 5.376   -13.768 -2.986 1.00 0.00 ? 117 GLU A H    7  
ATOM   3222 H  HA   . GLU A 1 16 ? 4.248   -15.907 -2.080 1.00 0.00 ? 117 GLU A HA   7  
ATOM   3223 H  HB2  . GLU A 1 16 ? 6.900   -16.592 -1.553 1.00 0.00 ? 117 GLU A HB2  7  
ATOM   3224 H  HB3  . GLU A 1 16 ? 6.114   -16.659 -3.118 1.00 0.00 ? 117 GLU A HB3  7  
ATOM   3225 H  HG2  . GLU A 1 16 ? 8.191   -15.356 -3.297 1.00 0.00 ? 117 GLU A HG2  7  
ATOM   3226 H  HG3  . GLU A 1 16 ? 6.815   -14.308 -3.583 1.00 0.00 ? 117 GLU A HG3  7  
ATOM   3227 N  N    . HIS A 1 17 ? 5.788   -14.489 0.446  1.00 0.00 ? 118 HIS A N    7  
ATOM   3228 C  CA   . HIS A 1 17 ? 5.893   -14.450 1.894  1.00 0.00 ? 118 HIS A CA   7  
ATOM   3229 C  C    . HIS A 1 17 ? 4.494   -14.502 2.512  1.00 0.00 ? 118 HIS A C    7  
ATOM   3230 O  O    . HIS A 1 17 ? 4.245   -15.285 3.427  1.00 0.00 ? 118 HIS A O    7  
ATOM   3231 C  CB   . HIS A 1 17 ? 6.696   -13.229 2.347  1.00 0.00 ? 118 HIS A CB   7  
ATOM   3232 C  CG   . HIS A 1 17 ? 8.155   -13.275 1.960  1.00 0.00 ? 118 HIS A CG   7  
ATOM   3233 N  ND1  . HIS A 1 17 ? 9.089   -12.378 2.447  1.00 0.00 ? 118 HIS A ND1  7  
ATOM   3234 C  CD2  . HIS A 1 17 ? 8.830   -14.119 1.128  1.00 0.00 ? 118 HIS A CD2  7  
ATOM   3235 C  CE1  . HIS A 1 17 ? 10.269  -12.677 1.924  1.00 0.00 ? 118 HIS A CE1  7  
ATOM   3236 N  NE2  . HIS A 1 17 ? 10.107  -13.757 1.107  1.00 0.00 ? 118 HIS A NE2  7  
ATOM   3237 H  H    . HIS A 1 17 ? 6.229   -13.730 -0.031 1.00 0.00 ? 118 HIS A H    7  
ATOM   3238 H  HA   . HIS A 1 17 ? 6.446   -15.341 2.192  1.00 0.00 ? 118 HIS A HA   7  
ATOM   3239 H  HB2  . HIS A 1 17 ? 6.246   -12.332 1.922  1.00 0.00 ? 118 HIS A HB2  7  
ATOM   3240 H  HB3  . HIS A 1 17 ? 6.621   -13.140 3.431  1.00 0.00 ? 118 HIS A HB3  7  
ATOM   3241 H  HD1  . HIS A 1 17 ? 8.904   -11.630 3.085  1.00 0.00 ? 118 HIS A HD1  7  
ATOM   3242 H  HD2  . HIS A 1 17 ? 8.395   -14.951 0.575  1.00 0.00 ? 118 HIS A HD2  7  
ATOM   3243 H  HE1  . HIS A 1 17 ? 11.206  -12.153 2.116  1.00 0.00 ? 118 HIS A HE1  7  
ATOM   3244 H  HE2  . HIS A 1 17 ? 10.839  -14.236 0.624  1.00 0.00 ? 118 HIS A HE2  7  
ATOM   3245 N  N    . LEU A 1 18 ? 3.619   -13.658 1.987  1.00 0.00 ? 119 LEU A N    7  
ATOM   3246 C  CA   . LEU A 1 18 ? 2.251   -13.598 2.475  1.00 0.00 ? 119 LEU A CA   7  
ATOM   3247 C  C    . LEU A 1 18 ? 1.597   -14.973 2.318  1.00 0.00 ? 119 LEU A C    7  
ATOM   3248 O  O    . LEU A 1 18 ? 1.223   -15.602 3.306  1.00 0.00 ? 119 LEU A O    7  
ATOM   3249 C  CB   . LEU A 1 18 ? 1.485   -12.470 1.783  1.00 0.00 ? 119 LEU A CB   7  
ATOM   3250 C  CG   . LEU A 1 18 ? -0.023  -12.680 1.628  1.00 0.00 ? 119 LEU A CG   7  
ATOM   3251 C  CD1  . LEU A 1 18 ? -0.647  -13.164 2.939  1.00 0.00 ? 119 LEU A CD1  7  
ATOM   3252 C  CD2  . LEU A 1 18 ? -0.703  -11.414 1.104  1.00 0.00 ? 119 LEU A CD2  7  
ATOM   3253 H  H    . LEU A 1 18 ? 3.830   -13.024 1.242  1.00 0.00 ? 119 LEU A H    7  
ATOM   3254 H  HA   . LEU A 1 18 ? 2.294   -13.355 3.537  1.00 0.00 ? 119 LEU A HA   7  
ATOM   3255 H  HB2  . LEU A 1 18 ? 1.647   -11.549 2.344  1.00 0.00 ? 119 LEU A HB2  7  
ATOM   3256 H  HB3  . LEU A 1 18 ? 1.914   -12.319 0.793  1.00 0.00 ? 119 LEU A HB3  7  
ATOM   3257 H  HG   . LEU A 1 18 ? -0.185  -13.462 0.887  1.00 0.00 ? 119 LEU A HG   7  
ATOM   3258 H  HD11 . LEU A 1 18 ? -1.729  -13.047 2.892  1.00 0.00 ? 119 LEU A HD11 7  
ATOM   3259 H  HD12 . LEU A 1 18 ? -0.401  -14.215 3.092  1.00 0.00 ? 119 LEU A HD12 7  
ATOM   3260 H  HD13 . LEU A 1 18 ? -0.254  -12.574 3.768  1.00 0.00 ? 119 LEU A HD13 7  
ATOM   3261 H  HD21 . LEU A 1 18 ? -0.886  -10.730 1.932  1.00 0.00 ? 119 LEU A HD21 7  
ATOM   3262 H  HD22 . LEU A 1 18 ? -0.055  -10.931 0.371  1.00 0.00 ? 119 LEU A HD22 7  
ATOM   3263 H  HD23 . LEU A 1 18 ? -1.651  -11.677 0.634  1.00 0.00 ? 119 LEU A HD23 7  
ATOM   3264 N  N    . LYS A 1 19 ? 1.481   -15.398 1.069  1.00 0.00 ? 120 LYS A N    7  
ATOM   3265 C  CA   . LYS A 1 19 ? 0.880   -16.686 0.770  1.00 0.00 ? 120 LYS A CA   7  
ATOM   3266 C  C    . LYS A 1 19 ? 1.375   -17.722 1.780  1.00 0.00 ? 120 LYS A C    7  
ATOM   3267 O  O    . LYS A 1 19 ? 0.585   -18.281 2.540  1.00 0.00 ? 120 LYS A O    7  
ATOM   3268 C  CB   . LYS A 1 19 ? 1.140   -17.075 -0.687 1.00 0.00 ? 120 LYS A CB   7  
ATOM   3269 C  CG   . LYS A 1 19 ? 0.197   -18.194 -1.133 1.00 0.00 ? 120 LYS A CG   7  
ATOM   3270 C  CD   . LYS A 1 19 ? -1.239  -17.683 -1.261 1.00 0.00 ? 120 LYS A CD   7  
ATOM   3271 C  CE   . LYS A 1 19 ? -1.652  -17.570 -2.730 1.00 0.00 ? 120 LYS A CE   7  
ATOM   3272 N  NZ   . LYS A 1 19 ? -1.020  -16.388 -3.358 1.00 0.00 ? 120 LYS A NZ   7  
ATOM   3273 H  H    . LYS A 1 19 ? 1.789   -14.880 0.271  1.00 0.00 ? 120 LYS A H    7  
ATOM   3274 H  HA   . LYS A 1 19 ? -0.199  -16.578 0.887  1.00 0.00 ? 120 LYS A HA   7  
ATOM   3275 H  HB2  . LYS A 1 19 ? 1.005   -16.203 -1.329 1.00 0.00 ? 120 LYS A HB2  7  
ATOM   3276 H  HB3  . LYS A 1 19 ? 2.175   -17.398 -0.802 1.00 0.00 ? 120 LYS A HB3  7  
ATOM   3277 H  HG2  . LYS A 1 19 ? 0.531   -18.595 -2.090 1.00 0.00 ? 120 LYS A HG2  7  
ATOM   3278 H  HG3  . LYS A 1 19 ? 0.233   -19.013 -0.415 1.00 0.00 ? 120 LYS A HG3  7  
ATOM   3279 H  HD2  . LYS A 1 19 ? -1.917  -18.359 -0.740 1.00 0.00 ? 120 LYS A HD2  7  
ATOM   3280 H  HD3  . LYS A 1 19 ? -1.327  -16.708 -0.780 1.00 0.00 ? 120 LYS A HD3  7  
ATOM   3281 H  HE2  . LYS A 1 19 ? -1.360  -18.473 -3.266 1.00 0.00 ? 120 LYS A HE2  7  
ATOM   3282 H  HE3  . LYS A 1 19 ? -2.737  -17.492 -2.804 1.00 0.00 ? 120 LYS A HE3  7  
ATOM   3283 H  HZ1  . LYS A 1 19 ? -0.056  -16.582 -3.537 1.00 0.00 ? 120 LYS A HZ1  7  
ATOM   3284 H  HZ2  . LYS A 1 19 ? -1.485  -16.180 -4.218 1.00 0.00 ? 120 LYS A HZ2  7  
ATOM   3285 H  HZ3  . LYS A 1 19 ? -1.094  -15.604 -2.740 1.00 0.00 ? 120 LYS A HZ3  7  
ATOM   3286 N  N    . ARG A 1 20 ? 2.681   -17.948 1.756  1.00 0.00 ? 121 ARG A N    7  
ATOM   3287 C  CA   . ARG A 1 20 ? 3.291   -18.908 2.661  1.00 0.00 ? 121 ARG A CA   7  
ATOM   3288 C  C    . ARG A 1 20 ? 2.897   -18.599 4.107  1.00 0.00 ? 121 ARG A C    7  
ATOM   3289 O  O    . ARG A 1 20 ? 2.750   -19.509 4.921  1.00 0.00 ? 121 ARG A O    7  
ATOM   3290 C  CB   . ARG A 1 20 ? 4.816   -18.885 2.540  1.00 0.00 ? 121 ARG A CB   7  
ATOM   3291 C  CG   . ARG A 1 20 ? 5.406   -20.275 2.790  1.00 0.00 ? 121 ARG A CG   7  
ATOM   3292 C  CD   . ARG A 1 20 ? 5.143   -21.205 1.604  1.00 0.00 ? 121 ARG A CD   7  
ATOM   3293 N  NE   . ARG A 1 20 ? 6.316   -22.080 1.377  1.00 0.00 ? 121 ARG A NE   7  
ATOM   3294 C  CZ   . ARG A 1 20 ? 7.108   -22.008 0.299  1.00 0.00 ? 121 ARG A CZ   7  
ATOM   3295 N  NH1  . ARG A 1 20 ? 6.669   -21.410 -0.817 1.00 0.00 ? 121 ARG A NH1  7  
ATOM   3296 N  NH2  . ARG A 1 20 ? 8.340   -22.533 0.337  1.00 0.00 ? 121 ARG A NH2  7  
ATOM   3297 H  H    . ARG A 1 20 ? 3.316   -17.489 1.135  1.00 0.00 ? 121 ARG A H    7  
ATOM   3298 H  HA   . ARG A 1 20 ? 2.901   -19.875 2.346  1.00 0.00 ? 121 ARG A HA   7  
ATOM   3299 H  HB2  . ARG A 1 20 ? 5.101   -18.540 1.545  1.00 0.00 ? 121 ARG A HB2  7  
ATOM   3300 H  HB3  . ARG A 1 20 ? 5.231   -18.176 3.255  1.00 0.00 ? 121 ARG A HB3  7  
ATOM   3301 H  HG2  . ARG A 1 20 ? 6.479   -20.192 2.961  1.00 0.00 ? 121 ARG A HG2  7  
ATOM   3302 H  HG3  . ARG A 1 20 ? 4.971   -20.701 3.694  1.00 0.00 ? 121 ARG A HG3  7  
ATOM   3303 H  HD2  . ARG A 1 20 ? 4.258   -21.812 1.796  1.00 0.00 ? 121 ARG A HD2  7  
ATOM   3304 H  HD3  . ARG A 1 20 ? 4.939   -20.617 0.709  1.00 0.00 ? 121 ARG A HD3  7  
ATOM   3305 H  HE   . ARG A 1 20 ? 6.529   -22.767 2.071  1.00 0.00 ? 121 ARG A HE   7  
ATOM   3306 H  HH11 . ARG A 1 20 ? 6.280   -20.491 -0.772 1.00 0.00 ? 121 ARG A HH11 7  
ATOM   3307 H  HH12 . ARG A 1 20 ? 6.730   -21.885 -1.696 1.00 0.00 ? 121 ARG A HH12 7  
ATOM   3308 H  HH21 . ARG A 1 20 ? 8.465   -23.499 0.569  1.00 0.00 ? 121 ARG A HH21 7  
ATOM   3309 H  HH22 . ARG A 1 20 ? 9.135   -21.961 0.135  1.00 0.00 ? 121 ARG A HH22 7  
ATOM   3310 N  N    . HIS A 1 21 ? 2.738   -17.313 4.381  1.00 0.00 ? 122 HIS A N    7  
ATOM   3311 C  CA   . HIS A 1 21 ? 2.363   -16.874 5.715  1.00 0.00 ? 122 HIS A CA   7  
ATOM   3312 C  C    . HIS A 1 21 ? 0.912   -17.267 5.997  1.00 0.00 ? 122 HIS A C    7  
ATOM   3313 O  O    . HIS A 1 21 ? 0.619   -17.874 7.025  1.00 0.00 ? 122 HIS A O    7  
ATOM   3314 C  CB   . HIS A 1 21 ? 2.614   -15.374 5.883  1.00 0.00 ? 122 HIS A CB   7  
ATOM   3315 C  CG   . HIS A 1 21 ? 1.794   -14.733 6.978  1.00 0.00 ? 122 HIS A CG   7  
ATOM   3316 N  ND1  . HIS A 1 21 ? 2.197   -14.714 8.302  1.00 0.00 ? 122 HIS A ND1  7  
ATOM   3317 C  CD2  . HIS A 1 21 ? 0.594   -14.088 6.930  1.00 0.00 ? 122 HIS A CD2  7  
ATOM   3318 C  CE1  . HIS A 1 21 ? 1.271   -14.084 9.010  1.00 0.00 ? 122 HIS A CE1  7  
ATOM   3319 N  NE2  . HIS A 1 21 ? 0.279   -13.697 8.159  1.00 0.00 ? 122 HIS A NE2  7  
ATOM   3320 H  H    . HIS A 1 21 ? 2.859   -16.579 3.713  1.00 0.00 ? 122 HIS A H    7  
ATOM   3321 H  HA   . HIS A 1 21 ? 3.015   -17.399 6.412  1.00 0.00 ? 122 HIS A HA   7  
ATOM   3322 H  HB2  . HIS A 1 21 ? 3.671   -15.214 6.094  1.00 0.00 ? 122 HIS A HB2  7  
ATOM   3323 H  HB3  . HIS A 1 21 ? 2.398   -14.872 4.940  1.00 0.00 ? 122 HIS A HB3  7  
ATOM   3324 H  HD1  . HIS A 1 21 ? 3.042   -15.108 8.662  1.00 0.00 ? 122 HIS A HD1  7  
ATOM   3325 H  HD2  . HIS A 1 21 ? -0.006  -13.922 6.035  1.00 0.00 ? 122 HIS A HD2  7  
ATOM   3326 H  HE1  . HIS A 1 21 ? 1.298   -13.907 10.086 1.00 0.00 ? 122 HIS A HE1  7  
ATOM   3327 N  N    . TYR A 1 22 ? 0.043   -16.905 5.064  1.00 0.00 ? 123 TYR A N    7  
ATOM   3328 C  CA   . TYR A 1 22 ? -1.371  -17.213 5.199  1.00 0.00 ? 123 TYR A CA   7  
ATOM   3329 C  C    . TYR A 1 22 ? -1.574  -18.589 5.838  1.00 0.00 ? 123 TYR A C    7  
ATOM   3330 O  O    . TYR A 1 22 ? -2.492  -18.777 6.635  1.00 0.00 ? 123 TYR A O    7  
ATOM   3331 C  CB   . TYR A 1 22 ? -1.935  -17.235 3.777  1.00 0.00 ? 123 TYR A CB   7  
ATOM   3332 C  CG   . TYR A 1 22 ? -3.123  -16.295 3.564  1.00 0.00 ? 123 TYR A CG   7  
ATOM   3333 C  CD1  . TYR A 1 22 ? -4.340  -16.578 4.147  1.00 0.00 ? 123 TYR A CD1  7  
ATOM   3334 C  CD2  . TYR A 1 22 ? -2.976  -15.163 2.788  1.00 0.00 ? 123 TYR A CD2  7  
ATOM   3335 C  CE1  . TYR A 1 22 ? -5.458  -15.693 3.947  1.00 0.00 ? 123 TYR A CE1  7  
ATOM   3336 C  CE2  . TYR A 1 22 ? -4.094  -14.277 2.588  1.00 0.00 ? 123 TYR A CE2  7  
ATOM   3337 C  CZ   . TYR A 1 22 ? -5.280  -14.586 3.177  1.00 0.00 ? 123 TYR A CZ   7  
ATOM   3338 O  OH   . TYR A 1 22 ? -6.336  -13.749 2.987  1.00 0.00 ? 123 TYR A OH   7  
ATOM   3339 H  H    . TYR A 1 22 ? 0.290   -16.412 4.231  1.00 0.00 ? 123 TYR A H    7  
ATOM   3340 H  HA   . TYR A 1 22 ? -1.821  -16.453 5.838  1.00 0.00 ? 123 TYR A HA   7  
ATOM   3341 H  HB2  . TYR A 1 22 ? -1.143  -16.967 3.078  1.00 0.00 ? 123 TYR A HB2  7  
ATOM   3342 H  HB3  . TYR A 1 22 ? -2.243  -18.253 3.536  1.00 0.00 ? 123 TYR A HB3  7  
ATOM   3343 H  HD1  . TYR A 1 22 ? -4.457  -17.472 4.760  1.00 0.00 ? 123 TYR A HD1  7  
ATOM   3344 H  HD2  . TYR A 1 22 ? -2.013  -14.938 2.328  1.00 0.00 ? 123 TYR A HD2  7  
ATOM   3345 H  HE1  . TYR A 1 22 ? -6.426  -15.904 4.401  1.00 0.00 ? 123 TYR A HE1  7  
ATOM   3346 H  HE2  . TYR A 1 22 ? -3.991  -13.380 1.978  1.00 0.00 ? 123 TYR A HE2  7  
ATOM   3347 H  HH   . TYR A 1 22 ? -6.598  -13.328 3.855  1.00 0.00 ? 123 TYR A HH   7  
ATOM   3348 N  N    . ARG A 1 23 ? -0.702  -19.514 5.463  1.00 0.00 ? 124 ARG A N    7  
ATOM   3349 C  CA   . ARG A 1 23 ? -0.775  -20.866 5.989  1.00 0.00 ? 124 ARG A CA   7  
ATOM   3350 C  C    . ARG A 1 23 ? -1.097  -20.837 7.485  1.00 0.00 ? 124 ARG A C    7  
ATOM   3351 O  O    . ARG A 1 23 ? -1.835  -21.688 7.981  1.00 0.00 ? 124 ARG A O    7  
ATOM   3352 C  CB   . ARG A 1 23 ? 0.543   -21.612 5.772  1.00 0.00 ? 124 ARG A CB   7  
ATOM   3353 C  CG   . ARG A 1 23 ? 1.107   -22.126 7.099  1.00 0.00 ? 124 ARG A CG   7  
ATOM   3354 C  CD   . ARG A 1 23 ? 2.472   -22.787 6.895  1.00 0.00 ? 124 ARG A CD   7  
ATOM   3355 N  NE   . ARG A 1 23 ? 3.141   -22.211 5.708  1.00 0.00 ? 124 ARG A NE   7  
ATOM   3356 C  CZ   . ARG A 1 23 ? 3.265   -22.846 4.534  1.00 0.00 ? 124 ARG A CZ   7  
ATOM   3357 N  NH1  . ARG A 1 23 ? 4.028   -23.943 4.443  1.00 0.00 ? 124 ARG A NH1  7  
ATOM   3358 N  NH2  . ARG A 1 23 ? 2.626   -22.383 3.451  1.00 0.00 ? 124 ARG A NH2  7  
ATOM   3359 H  H    . ARG A 1 23 ? 0.040   -19.352 4.814  1.00 0.00 ? 124 ARG A H    7  
ATOM   3360 H  HA   . ARG A 1 23 ? -1.577  -21.342 5.425  1.00 0.00 ? 124 ARG A HA   7  
ATOM   3361 H  HB2  . ARG A 1 23 ? 0.384   -22.449 5.093  1.00 0.00 ? 124 ARG A HB2  7  
ATOM   3362 H  HB3  . ARG A 1 23 ? 1.267   -20.950 5.298  1.00 0.00 ? 124 ARG A HB3  7  
ATOM   3363 H  HG2  . ARG A 1 23 ? 1.200   -21.299 7.803  1.00 0.00 ? 124 ARG A HG2  7  
ATOM   3364 H  HG3  . ARG A 1 23 ? 0.414   -22.844 7.540  1.00 0.00 ? 124 ARG A HG3  7  
ATOM   3365 H  HD2  . ARG A 1 23 ? 3.092   -22.639 7.779  1.00 0.00 ? 124 ARG A HD2  7  
ATOM   3366 H  HD3  . ARG A 1 23 ? 2.350   -23.863 6.768  1.00 0.00 ? 124 ARG A HD3  7  
ATOM   3367 H  HE   . ARG A 1 23 ? 3.524   -21.291 5.785  1.00 0.00 ? 124 ARG A HE   7  
ATOM   3368 H  HH11 . ARG A 1 23 ? 4.900   -23.987 4.931  1.00 0.00 ? 124 ARG A HH11 7  
ATOM   3369 H  HH12 . ARG A 1 23 ? 3.726   -24.718 3.889  1.00 0.00 ? 124 ARG A HH12 7  
ATOM   3370 H  HH21 . ARG A 1 23 ? 2.010   -21.600 3.531  1.00 0.00 ? 124 ARG A HH21 7  
ATOM   3371 H  HH22 . ARG A 1 23 ? 2.767   -22.821 2.563  1.00 0.00 ? 124 ARG A HH22 7  
ATOM   3372 N  N    . SER A 1 24 ? -0.528  -19.850 8.161  1.00 0.00 ? 125 SER A N    7  
ATOM   3373 C  CA   . SER A 1 24 ? -0.745  -19.701 9.590  1.00 0.00 ? 125 SER A CA   7  
ATOM   3374 C  C    . SER A 1 24 ? -2.176  -19.230 9.855  1.00 0.00 ? 125 SER A C    7  
ATOM   3375 O  O    . SER A 1 24 ? -2.570  -19.044 11.006 1.00 0.00 ? 125 SER A O    7  
ATOM   3376 C  CB   . SER A 1 24 ? 0.257   -18.718 10.200 1.00 0.00 ? 125 SER A CB   7  
ATOM   3377 O  OG   . SER A 1 24 ? 0.493   -17.599 9.349  1.00 0.00 ? 125 SER A OG   7  
ATOM   3378 H  H    . SER A 1 24 ? 0.071   -19.164 7.750  1.00 0.00 ? 125 SER A H    7  
ATOM   3379 H  HA   . SER A 1 24 ? -0.584  -20.692 10.013 1.00 0.00 ? 125 SER A HA   7  
ATOM   3380 H  HB2  . SER A 1 24 ? -0.117  -18.370 11.162 1.00 0.00 ? 125 SER A HB2  7  
ATOM   3381 H  HB3  . SER A 1 24 ? 1.200   -19.233 10.390 1.00 0.00 ? 125 SER A HB3  7  
ATOM   3382 H  HG   . SER A 1 24 ? 0.402   -16.750 9.868  1.00 0.00 ? 125 SER A HG   7  
ATOM   3383 N  N    . HIS A 1 25 ? -2.917  -19.051 8.771  1.00 0.00 ? 126 HIS A N    7  
ATOM   3384 C  CA   . HIS A 1 25 ? -4.297  -18.606 8.872  1.00 0.00 ? 126 HIS A CA   7  
ATOM   3385 C  C    . HIS A 1 25 ? -5.229  -19.710 8.372  1.00 0.00 ? 126 HIS A C    7  
ATOM   3386 O  O    . HIS A 1 25 ? -6.449  -19.604 8.501  1.00 0.00 ? 126 HIS A O    7  
ATOM   3387 C  CB   . HIS A 1 25 ? -4.496  -17.282 8.131  1.00 0.00 ? 126 HIS A CB   7  
ATOM   3388 C  CG   . HIS A 1 25 ? -3.697  -16.134 8.701  1.00 0.00 ? 126 HIS A CG   7  
ATOM   3389 N  ND1  . HIS A 1 25 ? -3.520  -15.945 10.060 1.00 0.00 ? 126 HIS A ND1  7  
ATOM   3390 C  CD2  . HIS A 1 25 ? -3.029  -15.119 8.081  1.00 0.00 ? 126 HIS A CD2  7  
ATOM   3391 C  CE1  . HIS A 1 25 ? -2.778  -14.862 10.238 1.00 0.00 ? 126 HIS A CE1  7  
ATOM   3392 N  NE2  . HIS A 1 25 ? -2.476  -14.351 9.010  1.00 0.00 ? 126 HIS A NE2  7  
ATOM   3393 H  H    . HIS A 1 25 ? -2.589  -19.204 7.839  1.00 0.00 ? 126 HIS A H    7  
ATOM   3394 H  HA   . HIS A 1 25 ? -4.491  -18.428 9.929  1.00 0.00 ? 126 HIS A HA   7  
ATOM   3395 H  HB2  . HIS A 1 25 ? -4.222  -17.418 7.085  1.00 0.00 ? 126 HIS A HB2  7  
ATOM   3396 H  HB3  . HIS A 1 25 ? -5.553  -17.020 8.154  1.00 0.00 ? 126 HIS A HB3  7  
ATOM   3397 H  HD1  . HIS A 1 25 ? -3.888  -16.527 10.784 1.00 0.00 ? 126 HIS A HD1  7  
ATOM   3398 H  HD2  . HIS A 1 25 ? -2.963  -14.965 7.003  1.00 0.00 ? 126 HIS A HD2  7  
ATOM   3399 H  HE1  . HIS A 1 25 ? -2.465  -14.450 11.199 1.00 0.00 ? 126 HIS A HE1  7  
ATOM   3400 N  N    . THR A 1 26 ? -4.622  -20.747 7.813  1.00 0.00 ? 127 THR A N    7  
ATOM   3401 C  CA   . THR A 1 26 ? -5.384  -21.870 7.294  1.00 0.00 ? 127 THR A CA   7  
ATOM   3402 C  C    . THR A 1 26 ? -4.801  -23.190 7.804  1.00 0.00 ? 127 THR A C    7  
ATOM   3403 O  O    . THR A 1 26 ? -3.733  -23.612 7.365  1.00 0.00 ? 127 THR A O    7  
ATOM   3404 C  CB   . THR A 1 26 ? -5.403  -21.764 5.769  1.00 0.00 ? 127 THR A CB   7  
ATOM   3405 O  OG1  . THR A 1 26 ? -4.057  -22.034 5.385  1.00 0.00 ? 127 THR A OG1  7  
ATOM   3406 C  CG2  . THR A 1 26 ? -5.648  -20.333 5.285  1.00 0.00 ? 127 THR A CG2  7  
ATOM   3407 H  H    . THR A 1 26 ? -3.631  -20.826 7.713  1.00 0.00 ? 127 THR A H    7  
ATOM   3408 H  HA   . THR A 1 26 ? -6.402  -21.801 7.677  1.00 0.00 ? 127 THR A HA   7  
ATOM   3409 H  HB   . THR A 1 26 ? -6.133  -22.451 5.339  1.00 0.00 ? 127 THR A HB   7  
ATOM   3410 H  HG1  . THR A 1 26 ? -3.948  -21.896 4.399  1.00 0.00 ? 127 THR A HG1  7  
ATOM   3411 H  HG21 . THR A 1 26 ? -6.442  -19.879 5.878  1.00 0.00 ? 127 THR A HG21 7  
ATOM   3412 H  HG22 . THR A 1 26 ? -4.734  -19.750 5.395  1.00 0.00 ? 127 THR A HG22 7  
ATOM   3413 H  HG23 . THR A 1 26 ? -5.944  -20.350 4.235  1.00 0.00 ? 127 THR A HG23 7  
ATOM   3414 N  N    . ASN A 1 27 ? -5.530  -23.805 8.725  1.00 0.00 ? 128 ASN A N    7  
ATOM   3415 C  CA   . ASN A 1 27 ? -5.099  -25.068 9.298  1.00 0.00 ? 128 ASN A CA   7  
ATOM   3416 C  C    . ASN A 1 27 ? -6.140  -25.544 10.314 1.00 0.00 ? 128 ASN A C    7  
ATOM   3417 O  O    . ASN A 1 27 ? -6.792  -26.565 10.108 1.00 0.00 ? 128 ASN A O    7  
ATOM   3418 C  CB   . ASN A 1 27 ? -3.762  -24.915 10.027 1.00 0.00 ? 128 ASN A CB   7  
ATOM   3419 C  CG   . ASN A 1 27 ? -3.273  -26.261 10.564 1.00 0.00 ? 128 ASN A CG   7  
ATOM   3420 O  OD1  . ASN A 1 27 ? -2.575  -27.009 9.898  1.00 0.00 ? 128 ASN A OD1  7  
ATOM   3421 N  ND2  . ASN A 1 27 ? -3.677  -26.529 11.803 1.00 0.00 ? 128 ASN A ND2  7  
ATOM   3422 H  H    . ASN A 1 27 ? -6.398  -23.455 9.076  1.00 0.00 ? 128 ASN A H    7  
ATOM   3423 H  HA   . ASN A 1 27 ? -5.000  -25.749 8.452  1.00 0.00 ? 128 ASN A HA   7  
ATOM   3424 H  HB2  . ASN A 1 27 ? -3.019  -24.499 9.347  1.00 0.00 ? 128 ASN A HB2  7  
ATOM   3425 H  HB3  . ASN A 1 27 ? -3.872  -24.209 10.850 1.00 0.00 ? 128 ASN A HB3  7  
ATOM   3426 H  HD21 . ASN A 1 27 ? -3.142  -26.207 12.584 1.00 0.00 ? 128 ASN A HD21 7  
ATOM   3427 H  HD22 . ASN A 1 27 ? -4.516  -27.053 11.952 1.00 0.00 ? 128 ASN A HD22 7  
ATOM   3428 N  N    . GLU A 1 28 ? -6.263  -24.779 11.390 1.00 0.00 ? 129 GLU A N    7  
ATOM   3429 C  CA   . GLU A 1 28 ? -7.213  -25.108 12.438 1.00 0.00 ? 129 GLU A CA   7  
ATOM   3430 C  C    . GLU A 1 28 ? -8.616  -24.635 12.051 1.00 0.00 ? 129 GLU A C    7  
ATOM   3431 O  O    . GLU A 1 28 ? -8.811  -23.467 11.719 1.00 0.00 ? 129 GLU A O    7  
ATOM   3432 C  CB   . GLU A 1 28 ? -6.782  -24.507 13.777 1.00 0.00 ? 129 GLU A CB   7  
ATOM   3433 C  CG   . GLU A 1 28 ? -5.511  -25.181 14.297 1.00 0.00 ? 129 GLU A CG   7  
ATOM   3434 C  CD   . GLU A 1 28 ? -5.785  -25.942 15.595 1.00 0.00 ? 129 GLU A CD   7  
ATOM   3435 O  OE1  . GLU A 1 28 ? -6.555  -25.403 16.418 1.00 0.00 ? 129 GLU A OE1  7  
ATOM   3436 O  OE2  . GLU A 1 28 ? -5.217  -27.048 15.736 1.00 0.00 ? 129 GLU A OE2  7  
ATOM   3437 H  H    . GLU A 1 28 ? -5.728  -23.949 11.549 1.00 0.00 ? 129 GLU A H    7  
ATOM   3438 H  HA   . GLU A 1 28 ? -7.196  -26.195 12.512 1.00 0.00 ? 129 GLU A HA   7  
ATOM   3439 H  HB2  . GLU A 1 28 ? -6.609  -23.437 13.661 1.00 0.00 ? 129 GLU A HB2  7  
ATOM   3440 H  HB3  . GLU A 1 28 ? -7.583  -24.623 14.507 1.00 0.00 ? 129 GLU A HB3  7  
ATOM   3441 H  HG2  . GLU A 1 28 ? -5.124  -25.868 13.543 1.00 0.00 ? 129 GLU A HG2  7  
ATOM   3442 H  HG3  . GLU A 1 28 ? -4.740  -24.429 14.468 1.00 0.00 ? 129 GLU A HG3  7  
ATOM   3443 N  N    . LYS A 1 29 ? -9.555  -25.568 12.104 1.00 0.00 ? 130 LYS A N    7  
ATOM   3444 C  CA   . LYS A 1 29 ? -10.934 -25.261 11.764 1.00 0.00 ? 130 LYS A CA   7  
ATOM   3445 C  C    . LYS A 1 29 ? -11.850 -26.344 12.339 1.00 0.00 ? 130 LYS A C    7  
ATOM   3446 O  O    . LYS A 1 29 ? -12.951 -26.048 12.802 1.00 0.00 ? 130 LYS A O    7  
ATOM   3447 C  CB   . LYS A 1 29 ? -11.082 -25.069 10.253 1.00 0.00 ? 130 LYS A CB   7  
ATOM   3448 C  CG   . LYS A 1 29 ? -11.478 -23.630 9.919  1.00 0.00 ? 130 LYS A CG   7  
ATOM   3449 C  CD   . LYS A 1 29 ? -11.907 -23.503 8.456  1.00 0.00 ? 130 LYS A CD   7  
ATOM   3450 C  CE   . LYS A 1 29 ? -10.790 -23.962 7.516  1.00 0.00 ? 130 LYS A CE   7  
ATOM   3451 N  NZ   . LYS A 1 29 ? -10.823 -23.185 6.256  1.00 0.00 ? 130 LYS A NZ   7  
ATOM   3452 H  H    . LYS A 1 29 ? -9.387  -26.516 12.374 1.00 0.00 ? 130 LYS A H    7  
ATOM   3453 H  HA   . LYS A 1 29 ? -11.183 -24.311 12.235 1.00 0.00 ? 130 LYS A HA   7  
ATOM   3454 H  HB2  . LYS A 1 29 ? -10.145 -25.317 9.757  1.00 0.00 ? 130 LYS A HB2  7  
ATOM   3455 H  HB3  . LYS A 1 29 ? -11.837 -25.756 9.868  1.00 0.00 ? 130 LYS A HB3  7  
ATOM   3456 H  HG2  . LYS A 1 29 ? -12.292 -23.313 10.570 1.00 0.00 ? 130 LYS A HG2  7  
ATOM   3457 H  HG3  . LYS A 1 29 ? -10.637 -22.963 10.114 1.00 0.00 ? 130 LYS A HG3  7  
ATOM   3458 H  HD2  . LYS A 1 29 ? -12.802 -24.102 8.284  1.00 0.00 ? 130 LYS A HD2  7  
ATOM   3459 H  HD3  . LYS A 1 29 ? -12.170 -22.469 8.238  1.00 0.00 ? 130 LYS A HD3  7  
ATOM   3460 H  HE2  . LYS A 1 29 ? -9.823  -23.837 8.003  1.00 0.00 ? 130 LYS A HE2  7  
ATOM   3461 H  HE3  . LYS A 1 29 ? -10.903 -25.024 7.298  1.00 0.00 ? 130 LYS A HE3  7  
ATOM   3462 H  HZ1  . LYS A 1 29 ? -11.459 -22.421 6.352  1.00 0.00 ? 130 LYS A HZ1  7  
ATOM   3463 H  HZ2  . LYS A 1 29 ? -9.908  -22.835 6.057  1.00 0.00 ? 130 LYS A HZ2  7  
ATOM   3464 H  HZ3  . LYS A 1 29 ? -11.123 -23.778 5.508  1.00 0.00 ? 130 LYS A HZ3  7  
HETATM 3465 ZN ZN   . ZN  B 2 .  ? -1.392  -12.720 8.666  1.00 0.00 ? 1   ZN  A ZN   7  
ATOM   3466 N  N    . ARG A 1 1  ? 0.604   -0.141  -1.401 1.00 0.00 ? 102 ARG A N    8  
ATOM   3467 C  CA   . ARG A 1 1  ? 0.523   -0.937  -0.189 1.00 0.00 ? 102 ARG A CA   8  
ATOM   3468 C  C    . ARG A 1 1  ? 1.090   -2.337  -0.434 1.00 0.00 ? 102 ARG A C    8  
ATOM   3469 O  O    . ARG A 1 1  ? 0.354   -3.256  -0.790 1.00 0.00 ? 102 ARG A O    8  
ATOM   3470 C  CB   . ARG A 1 1  ? -0.924  -1.059  0.294  1.00 0.00 ? 102 ARG A CB   8  
ATOM   3471 C  CG   . ARG A 1 1  ? -0.986  -1.183  1.818  1.00 0.00 ? 102 ARG A CG   8  
ATOM   3472 C  CD   . ARG A 1 1  ? -2.424  -1.056  2.321  1.00 0.00 ? 102 ARG A CD   8  
ATOM   3473 N  NE   . ARG A 1 1  ? -3.248  -2.164  1.789  1.00 0.00 ? 102 ARG A NE   8  
ATOM   3474 C  CZ   . ARG A 1 1  ? -4.508  -2.025  1.360  1.00 0.00 ? 102 ARG A CZ   8  
ATOM   3475 N  NH1  . ARG A 1 1  ? -4.835  -1.002  0.558  1.00 0.00 ? 102 ARG A NH1  8  
ATOM   3476 N  NH2  . ARG A 1 1  ? -5.446  -2.908  1.732  1.00 0.00 ? 102 ARG A NH2  8  
ATOM   3477 H  H    . ARG A 1 1  ? -0.276  0.144   -1.780 1.00 0.00 ? 102 ARG A H    8  
ATOM   3478 H  HA   . ARG A 1 1  ? 1.121   -0.395  0.543  1.00 0.00 ? 102 ARG A HA   8  
ATOM   3479 H  HB2  . ARG A 1 1  ? -1.492  -0.186  -0.027 1.00 0.00 ? 102 ARG A HB2  8  
ATOM   3480 H  HB3  . ARG A 1 1  ? -1.393  -1.930  -0.164 1.00 0.00 ? 102 ARG A HB3  8  
ATOM   3481 H  HG2  . ARG A 1 1  ? -0.573  -2.144  2.125  1.00 0.00 ? 102 ARG A HG2  8  
ATOM   3482 H  HG3  . ARG A 1 1  ? -0.366  -0.410  2.274  1.00 0.00 ? 102 ARG A HG3  8  
ATOM   3483 H  HD2  . ARG A 1 1  ? -2.440  -1.071  3.411  1.00 0.00 ? 102 ARG A HD2  8  
ATOM   3484 H  HD3  . ARG A 1 1  ? -2.843  -0.099  2.009  1.00 0.00 ? 102 ARG A HD3  8  
ATOM   3485 H  HE   . ARG A 1 1  ? -2.836  -3.075  1.747  1.00 0.00 ? 102 ARG A HE   8  
ATOM   3486 H  HH11 . ARG A 1 1  ? -5.014  -0.098  0.947  1.00 0.00 ? 102 ARG A HH11 8  
ATOM   3487 H  HH12 . ARG A 1 1  ? -4.897  -1.142  -0.431 1.00 0.00 ? 102 ARG A HH12 8  
ATOM   3488 H  HH21 . ARG A 1 1  ? -5.794  -2.902  2.670  1.00 0.00 ? 102 ARG A HH21 8  
ATOM   3489 H  HH22 . ARG A 1 1  ? -5.796  -3.573  1.073  1.00 0.00 ? 102 ARG A HH22 8  
ATOM   3490 N  N    . SER A 1 2  ? 2.394   -2.456  -0.234 1.00 0.00 ? 103 SER A N    8  
ATOM   3491 C  CA   . SER A 1 2  ? 3.069   -3.727  -0.430 1.00 0.00 ? 103 SER A CA   8  
ATOM   3492 C  C    . SER A 1 2  ? 2.279   -4.849  0.248  1.00 0.00 ? 103 SER A C    8  
ATOM   3493 O  O    . SER A 1 2  ? 2.022   -4.793  1.450  1.00 0.00 ? 103 SER A O    8  
ATOM   3494 C  CB   . SER A 1 2  ? 4.499   -3.682  0.114  1.00 0.00 ? 103 SER A CB   8  
ATOM   3495 O  OG   . SER A 1 2  ? 5.465   -3.613  -0.930 1.00 0.00 ? 103 SER A OG   8  
ATOM   3496 H  H    . SER A 1 2  ? 2.987   -1.703  0.056  1.00 0.00 ? 103 SER A H    8  
ATOM   3497 H  HA   . SER A 1 2  ? 3.097   -3.877  -1.509 1.00 0.00 ? 103 SER A HA   8  
ATOM   3498 H  HB2  . SER A 1 2  ? 4.610   -2.817  0.769  1.00 0.00 ? 103 SER A HB2  8  
ATOM   3499 H  HB3  . SER A 1 2  ? 4.684   -4.567  0.722  1.00 0.00 ? 103 SER A HB3  8  
ATOM   3500 H  HG   . SER A 1 2  ? 6.380   -3.776  -0.561 1.00 0.00 ? 103 SER A HG   8  
ATOM   3501 N  N    . PHE A 1 3  ? 1.915   -5.840  -0.551 1.00 0.00 ? 104 PHE A N    8  
ATOM   3502 C  CA   . PHE A 1 3  ? 1.160   -6.972  -0.043 1.00 0.00 ? 104 PHE A CA   8  
ATOM   3503 C  C    . PHE A 1 3  ? 1.094   -6.946  1.485  1.00 0.00 ? 104 PHE A C    8  
ATOM   3504 O  O    . PHE A 1 3  ? 2.125   -6.961  2.155  1.00 0.00 ? 104 PHE A O    8  
ATOM   3505 C  CB   . PHE A 1 3  ? 1.896   -8.237  -0.489 1.00 0.00 ? 104 PHE A CB   8  
ATOM   3506 C  CG   . PHE A 1 3  ? 2.449   -8.167  -1.914 1.00 0.00 ? 104 PHE A CG   8  
ATOM   3507 C  CD1  . PHE A 1 3  ? 3.701   -7.683  -2.135 1.00 0.00 ? 104 PHE A CD1  8  
ATOM   3508 C  CD2  . PHE A 1 3  ? 1.689   -8.590  -2.959 1.00 0.00 ? 104 PHE A CD2  8  
ATOM   3509 C  CE1  . PHE A 1 3  ? 4.214   -7.616  -3.457 1.00 0.00 ? 104 PHE A CE1  8  
ATOM   3510 C  CE2  . PHE A 1 3  ? 2.202   -8.524  -4.281 1.00 0.00 ? 104 PHE A CE2  8  
ATOM   3511 C  CZ   . PHE A 1 3  ? 3.453   -8.039  -4.503 1.00 0.00 ? 104 PHE A CZ   8  
ATOM   3512 H  H    . PHE A 1 3  ? 2.129   -5.878  -1.528 1.00 0.00 ? 104 PHE A H    8  
ATOM   3513 H  HA   . PHE A 1 3  ? 0.152   -6.897  -0.450 1.00 0.00 ? 104 PHE A HA   8  
ATOM   3514 H  HB2  . PHE A 1 3  ? 2.720   -8.428  0.200  1.00 0.00 ? 104 PHE A HB2  8  
ATOM   3515 H  HB3  . PHE A 1 3  ? 1.216   -9.086  -0.416 1.00 0.00 ? 104 PHE A HB3  8  
ATOM   3516 H  HD1  . PHE A 1 3  ? 4.309   -7.344  -1.297 1.00 0.00 ? 104 PHE A HD1  8  
ATOM   3517 H  HD2  . PHE A 1 3  ? 0.687   -8.978  -2.783 1.00 0.00 ? 104 PHE A HD2  8  
ATOM   3518 H  HE1  . PHE A 1 3  ? 5.216   -7.228  -3.633 1.00 0.00 ? 104 PHE A HE1  8  
ATOM   3519 H  HE2  . PHE A 1 3  ? 1.592   -8.862  -5.120 1.00 0.00 ? 104 PHE A HE2  8  
ATOM   3520 H  HZ   . PHE A 1 3  ? 3.847   -7.989  -5.518 1.00 0.00 ? 104 PHE A HZ   8  
ATOM   3521 N  N    . VAL A 1 4  ? -0.130  -6.908  1.992  1.00 0.00 ? 105 VAL A N    8  
ATOM   3522 C  CA   . VAL A 1 4  ? -0.344  -6.880  3.429  1.00 0.00 ? 105 VAL A CA   8  
ATOM   3523 C  C    . VAL A 1 4  ? -1.390  -7.931  3.805  1.00 0.00 ? 105 VAL A C    8  
ATOM   3524 O  O    . VAL A 1 4  ? -2.523  -7.884  3.326  1.00 0.00 ? 105 VAL A O    8  
ATOM   3525 C  CB   . VAL A 1 4  ? -0.729  -5.467  3.873  1.00 0.00 ? 105 VAL A CB   8  
ATOM   3526 C  CG1  . VAL A 1 4  ? -0.696  -5.344  5.397  1.00 0.00 ? 105 VAL A CG1  8  
ATOM   3527 C  CG2  . VAL A 1 4  ? 0.176   -4.421  3.219  1.00 0.00 ? 105 VAL A CG2  8  
ATOM   3528 H  H    . VAL A 1 4  ? -0.963  -6.896  1.440  1.00 0.00 ? 105 VAL A H    8  
ATOM   3529 H  HA   . VAL A 1 4  ? 0.601   -7.138  3.907  1.00 0.00 ? 105 VAL A HA   8  
ATOM   3530 H  HB   . VAL A 1 4  ? -1.750  -5.280  3.543  1.00 0.00 ? 105 VAL A HB   8  
ATOM   3531 H  HG11 . VAL A 1 4  ? -0.497  -6.322  5.837  1.00 0.00 ? 105 VAL A HG11 8  
ATOM   3532 H  HG12 . VAL A 1 4  ? 0.090   -4.647  5.690  1.00 0.00 ? 105 VAL A HG12 8  
ATOM   3533 H  HG13 . VAL A 1 4  ? -1.659  -4.976  5.752  1.00 0.00 ? 105 VAL A HG13 8  
ATOM   3534 H  HG21 . VAL A 1 4  ? -0.068  -3.434  3.610  1.00 0.00 ? 105 VAL A HG21 8  
ATOM   3535 H  HG22 . VAL A 1 4  ? 1.218   -4.653  3.439  1.00 0.00 ? 105 VAL A HG22 8  
ATOM   3536 H  HG23 . VAL A 1 4  ? 0.022   -4.432  2.140  1.00 0.00 ? 105 VAL A HG23 8  
ATOM   3537 N  N    . CYS A 1 5  ? -0.974  -8.854  4.659  1.00 0.00 ? 106 CYS A N    8  
ATOM   3538 C  CA   . CYS A 1 5  ? -1.861  -9.915  5.105  1.00 0.00 ? 106 CYS A CA   8  
ATOM   3539 C  C    . CYS A 1 5  ? -3.077  -9.274  5.779  1.00 0.00 ? 106 CYS A C    8  
ATOM   3540 O  O    . CYS A 1 5  ? -3.059  -9.012  6.981  1.00 0.00 ? 106 CYS A O    8  
ATOM   3541 C  CB   . CYS A 1 5  ? -1.146  -10.898 6.035  1.00 0.00 ? 106 CYS A CB   8  
ATOM   3542 S  SG   . CYS A 1 5  ? -2.180  -12.386 6.286  1.00 0.00 ? 106 CYS A SG   8  
ATOM   3543 H  H    . CYS A 1 5  ? -0.052  -8.885  5.045  1.00 0.00 ? 106 CYS A H    8  
ATOM   3544 H  HA   . CYS A 1 5  ? -2.160  -10.469 4.215  1.00 0.00 ? 106 CYS A HA   8  
ATOM   3545 H  HB2  . CYS A 1 5  ? -0.185  -11.180 5.608  1.00 0.00 ? 106 CYS A HB2  8  
ATOM   3546 H  HB3  . CYS A 1 5  ? -0.941  -10.421 6.993  1.00 0.00 ? 106 CYS A HB3  8  
ATOM   3547 N  N    . GLU A 1 6  ? -4.104  -9.038  4.975  1.00 0.00 ? 107 GLU A N    8  
ATOM   3548 C  CA   . GLU A 1 6  ? -5.324  -8.432  5.478  1.00 0.00 ? 107 GLU A CA   8  
ATOM   3549 C  C    . GLU A 1 6  ? -5.761  -9.116  6.775  1.00 0.00 ? 107 GLU A C    8  
ATOM   3550 O  O    . GLU A 1 6  ? -6.492  -8.533  7.574  1.00 0.00 ? 107 GLU A O    8  
ATOM   3551 C  CB   . GLU A 1 6  ? -6.437  -8.486  4.429  1.00 0.00 ? 107 GLU A CB   8  
ATOM   3552 C  CG   . GLU A 1 6  ? -6.852  -9.931  4.145  1.00 0.00 ? 107 GLU A CG   8  
ATOM   3553 C  CD   . GLU A 1 6  ? -7.091  -10.149 2.649  1.00 0.00 ? 107 GLU A CD   8  
ATOM   3554 O  OE1  . GLU A 1 6  ? -8.159  -9.702  2.174  1.00 0.00 ? 107 GLU A OE1  8  
ATOM   3555 O  OE2  . GLU A 1 6  ? -6.203  -10.756 2.015  1.00 0.00 ? 107 GLU A OE2  8  
ATOM   3556 H  H    . GLU A 1 6  ? -4.110  -9.254  3.998  1.00 0.00 ? 107 GLU A H    8  
ATOM   3557 H  HA   . GLU A 1 6  ? -5.071  -7.391  5.676  1.00 0.00 ? 107 GLU A HA   8  
ATOM   3558 H  HB2  . GLU A 1 6  ? -7.299  -7.918  4.777  1.00 0.00 ? 107 GLU A HB2  8  
ATOM   3559 H  HB3  . GLU A 1 6  ? -6.095  -8.015  3.507  1.00 0.00 ? 107 GLU A HB3  8  
ATOM   3560 H  HG2  . GLU A 1 6  ? -6.076  -10.612 4.495  1.00 0.00 ? 107 GLU A HG2  8  
ATOM   3561 H  HG3  . GLU A 1 6  ? -7.759  -10.169 4.700  1.00 0.00 ? 107 GLU A HG3  8  
ATOM   3562 N  N    . VAL A 1 7  ? -5.294  -10.345 6.945  1.00 0.00 ? 108 VAL A N    8  
ATOM   3563 C  CA   . VAL A 1 7  ? -5.627  -11.115 8.131  1.00 0.00 ? 108 VAL A CA   8  
ATOM   3564 C  C    . VAL A 1 7  ? -4.952  -10.483 9.350  1.00 0.00 ? 108 VAL A C    8  
ATOM   3565 O  O    . VAL A 1 7  ? -5.616  -9.867  10.183 1.00 0.00 ? 108 VAL A O    8  
ATOM   3566 C  CB   . VAL A 1 7  ? -5.242  -12.582 7.929  1.00 0.00 ? 108 VAL A CB   8  
ATOM   3567 C  CG1  . VAL A 1 7  ? -5.413  -13.378 9.224  1.00 0.00 ? 108 VAL A CG1  8  
ATOM   3568 C  CG2  . VAL A 1 7  ? -6.050  -13.208 6.790  1.00 0.00 ? 108 VAL A CG2  8  
ATOM   3569 H  H    . VAL A 1 7  ? -4.700  -10.813 6.291  1.00 0.00 ? 108 VAL A H    8  
ATOM   3570 H  HA   . VAL A 1 7  ? -6.707  -11.064 8.263  1.00 0.00 ? 108 VAL A HA   8  
ATOM   3571 H  HB   . VAL A 1 7  ? -4.189  -12.617 7.650  1.00 0.00 ? 108 VAL A HB   8  
ATOM   3572 H  HG11 . VAL A 1 7  ? -6.242  -12.964 9.798  1.00 0.00 ? 108 VAL A HG11 8  
ATOM   3573 H  HG12 . VAL A 1 7  ? -5.619  -14.421 8.985  1.00 0.00 ? 108 VAL A HG12 8  
ATOM   3574 H  HG13 . VAL A 1 7  ? -4.497  -13.314 9.812  1.00 0.00 ? 108 VAL A HG13 8  
ATOM   3575 H  HG21 . VAL A 1 7  ? -6.825  -12.511 6.468  1.00 0.00 ? 108 VAL A HG21 8  
ATOM   3576 H  HG22 . VAL A 1 7  ? -5.388  -13.428 5.953  1.00 0.00 ? 108 VAL A HG22 8  
ATOM   3577 H  HG23 . VAL A 1 7  ? -6.514  -14.131 7.138  1.00 0.00 ? 108 VAL A HG23 8  
ATOM   3578 N  N    . CYS A 1 8  ? -3.640  -10.657 9.417  1.00 0.00 ? 109 CYS A N    8  
ATOM   3579 C  CA   . CYS A 1 8  ? -2.868  -10.111 10.520 1.00 0.00 ? 109 CYS A CA   8  
ATOM   3580 C  C    . CYS A 1 8  ? -2.251  -8.786  10.066 1.00 0.00 ? 109 CYS A C    8  
ATOM   3581 O  O    . CYS A 1 8  ? -1.292  -8.305  10.668 1.00 0.00 ? 109 CYS A O    8  
ATOM   3582 C  CB   . CYS A 1 8  ? -1.805  -11.097 11.009 1.00 0.00 ? 109 CYS A CB   8  
ATOM   3583 S  SG   . CYS A 1 8  ? -0.462  -11.232 9.775  1.00 0.00 ? 109 CYS A SG   8  
ATOM   3584 H  H    . CYS A 1 8  ? -3.107  -11.158 8.735  1.00 0.00 ? 109 CYS A H    8  
ATOM   3585 H  HA   . CYS A 1 8  ? -3.565  -9.952  11.342 1.00 0.00 ? 109 CYS A HA   8  
ATOM   3586 H  HB2  . CYS A 1 8  ? -1.400  -10.764 11.965 1.00 0.00 ? 109 CYS A HB2  8  
ATOM   3587 H  HB3  . CYS A 1 8  ? -2.255  -12.076 11.178 1.00 0.00 ? 109 CYS A HB3  8  
ATOM   3588 N  N    . THR A 1 9  ? -2.826  -8.235  9.007  1.00 0.00 ? 110 THR A N    8  
ATOM   3589 C  CA   . THR A 1 9  ? -2.345  -6.976  8.466  1.00 0.00 ? 110 THR A CA   8  
ATOM   3590 C  C    . THR A 1 9  ? -0.818  -6.913  8.537  1.00 0.00 ? 110 THR A C    8  
ATOM   3591 O  O    . THR A 1 9  ? -0.258  -5.997  9.136  1.00 0.00 ? 110 THR A O    8  
ATOM   3592 C  CB   . THR A 1 9  ? -3.036  -5.840  9.224  1.00 0.00 ? 110 THR A CB   8  
ATOM   3593 O  OG1  . THR A 1 9  ? -2.497  -5.924  10.540 1.00 0.00 ? 110 THR A OG1  8  
ATOM   3594 C  CG2  . THR A 1 9  ? -4.533  -6.090  9.417  1.00 0.00 ? 110 THR A CG2  8  
ATOM   3595 H  H    . THR A 1 9  ? -3.605  -8.634  8.523  1.00 0.00 ? 110 THR A H    8  
ATOM   3596 H  HA   . THR A 1 9  ? -2.619  -6.928  7.412  1.00 0.00 ? 110 THR A HA   8  
ATOM   3597 H  HB   . THR A 1 9  ? -2.861  -4.882  8.735  1.00 0.00 ? 110 THR A HB   8  
ATOM   3598 H  HG1  . THR A 1 9  ? -2.934  -6.670  11.043 1.00 0.00 ? 110 THR A HG1  8  
ATOM   3599 H  HG21 . THR A 1 9  ? -5.001  -6.254  8.447  1.00 0.00 ? 110 THR A HG21 8  
ATOM   3600 H  HG22 . THR A 1 9  ? -4.676  -6.971  10.043 1.00 0.00 ? 110 THR A HG22 8  
ATOM   3601 H  HG23 . THR A 1 9  ? -4.987  -5.224  9.900  1.00 0.00 ? 110 THR A HG23 8  
ATOM   3602 N  N    . ARG A 1 10 ? -0.188  -7.899  7.916  1.00 0.00 ? 111 ARG A N    8  
ATOM   3603 C  CA   . ARG A 1 10 ? 1.264   -7.968  7.900  1.00 0.00 ? 111 ARG A CA   8  
ATOM   3604 C  C    . ARG A 1 10 ? 1.792   -7.722  6.485  1.00 0.00 ? 111 ARG A C    8  
ATOM   3605 O  O    . ARG A 1 10 ? 1.323   -8.337  5.529  1.00 0.00 ? 111 ARG A O    8  
ATOM   3606 C  CB   . ARG A 1 10 ? 1.755   -9.331  8.391  1.00 0.00 ? 111 ARG A CB   8  
ATOM   3607 C  CG   . ARG A 1 10 ? 1.846   -9.363  9.919  1.00 0.00 ? 111 ARG A CG   8  
ATOM   3608 C  CD   . ARG A 1 10 ? 2.535   -10.641 10.399 1.00 0.00 ? 111 ARG A CD   8  
ATOM   3609 N  NE   . ARG A 1 10 ? 2.384   -10.776 11.866 1.00 0.00 ? 111 ARG A NE   8  
ATOM   3610 C  CZ   . ARG A 1 10 ? 2.853   -11.811 12.577 1.00 0.00 ? 111 ARG A CZ   8  
ATOM   3611 N  NH1  . ARG A 1 10 ? 2.747   -13.057 12.097 1.00 0.00 ? 111 ARG A NH1  8  
ATOM   3612 N  NH2  . ARG A 1 10 ? 3.428   -11.600 13.769 1.00 0.00 ? 111 ARG A NH2  8  
ATOM   3613 H  H    . ARG A 1 10 ? -0.651  -8.640  7.429  1.00 0.00 ? 111 ARG A H    8  
ATOM   3614 H  HA   . ARG A 1 10 ? 1.587   -7.181  8.582  1.00 0.00 ? 111 ARG A HA   8  
ATOM   3615 H  HB2  . ARG A 1 10 ? 1.078   -10.112 8.047  1.00 0.00 ? 111 ARG A HB2  8  
ATOM   3616 H  HB3  . ARG A 1 10 ? 2.733   -9.546  7.961  1.00 0.00 ? 111 ARG A HB3  8  
ATOM   3617 H  HG2  . ARG A 1 10 ? 2.398   -8.493  10.273 1.00 0.00 ? 111 ARG A HG2  8  
ATOM   3618 H  HG3  . ARG A 1 10 ? 0.845   -9.303  10.347 1.00 0.00 ? 111 ARG A HG3  8  
ATOM   3619 H  HD2  . ARG A 1 10 ? 2.103   -11.508 9.901  1.00 0.00 ? 111 ARG A HD2  8  
ATOM   3620 H  HD3  . ARG A 1 10 ? 3.593   -10.616 10.135 1.00 0.00 ? 111 ARG A HD3  8  
ATOM   3621 H  HE   . ARG A 1 10 ? 1.903   -10.050 12.356 1.00 0.00 ? 111 ARG A HE   8  
ATOM   3622 H  HH11 . ARG A 1 10 ? 2.126   -13.249 11.336 1.00 0.00 ? 111 ARG A HH11 8  
ATOM   3623 H  HH12 . ARG A 1 10 ? 3.288   -13.796 12.498 1.00 0.00 ? 111 ARG A HH12 8  
ATOM   3624 H  HH21 . ARG A 1 10 ? 4.159   -10.924 13.858 1.00 0.00 ? 111 ARG A HH21 8  
ATOM   3625 H  HH22 . ARG A 1 10 ? 3.125   -12.118 14.569 1.00 0.00 ? 111 ARG A HH22 8  
ATOM   3626 N  N    . ALA A 1 11 ? 2.761   -6.823  6.398  1.00 0.00 ? 112 ALA A N    8  
ATOM   3627 C  CA   . ALA A 1 11 ? 3.358   -6.489  5.116  1.00 0.00 ? 112 ALA A CA   8  
ATOM   3628 C  C    . ALA A 1 11 ? 4.661   -7.271  4.946  1.00 0.00 ? 112 ALA A C    8  
ATOM   3629 O  O    . ALA A 1 11 ? 5.287   -7.664  5.930  1.00 0.00 ? 112 ALA A O    8  
ATOM   3630 C  CB   . ALA A 1 11 ? 3.570   -4.976  5.031  1.00 0.00 ? 112 ALA A CB   8  
ATOM   3631 H  H    . ALA A 1 11 ? 3.136   -6.328  7.181  1.00 0.00 ? 112 ALA A H    8  
ATOM   3632 H  HA   . ALA A 1 11 ? 2.659   -6.789  4.336  1.00 0.00 ? 112 ALA A HA   8  
ATOM   3633 H  HB1  . ALA A 1 11 ? 4.537   -4.719  5.466  1.00 0.00 ? 112 ALA A HB1  8  
ATOM   3634 H  HB2  . ALA A 1 11 ? 3.547   -4.663  3.987  1.00 0.00 ? 112 ALA A HB2  8  
ATOM   3635 H  HB3  . ALA A 1 11 ? 2.778   -4.466  5.581  1.00 0.00 ? 112 ALA A HB3  8  
ATOM   3636 N  N    . PHE A 1 12 ? 5.033   -7.474  3.691  1.00 0.00 ? 113 PHE A N    8  
ATOM   3637 C  CA   . PHE A 1 12 ? 6.252   -8.201  3.380  1.00 0.00 ? 113 PHE A CA   8  
ATOM   3638 C  C    . PHE A 1 12 ? 6.916   -7.644  2.119  1.00 0.00 ? 113 PHE A C    8  
ATOM   3639 O  O    . PHE A 1 12 ? 6.258   -7.014  1.292  1.00 0.00 ? 113 PHE A O    8  
ATOM   3640 C  CB   . PHE A 1 12 ? 5.851   -9.657  3.130  1.00 0.00 ? 113 PHE A CB   8  
ATOM   3641 C  CG   . PHE A 1 12 ? 5.294   -10.369 4.364  1.00 0.00 ? 113 PHE A CG   8  
ATOM   3642 C  CD1  . PHE A 1 12 ? 6.136   -10.798 5.341  1.00 0.00 ? 113 PHE A CD1  8  
ATOM   3643 C  CD2  . PHE A 1 12 ? 3.954   -10.572 4.485  1.00 0.00 ? 113 PHE A CD2  8  
ATOM   3644 C  CE1  . PHE A 1 12 ? 5.618   -11.459 6.486  1.00 0.00 ? 113 PHE A CE1  8  
ATOM   3645 C  CE2  . PHE A 1 12 ? 3.436   -11.233 5.629  1.00 0.00 ? 113 PHE A CE2  8  
ATOM   3646 C  CZ   . PHE A 1 12 ? 4.280   -11.663 6.606  1.00 0.00 ? 113 PHE A CZ   8  
ATOM   3647 H  H    . PHE A 1 12 ? 4.519   -7.150  2.896  1.00 0.00 ? 113 PHE A H    8  
ATOM   3648 H  HA   . PHE A 1 12 ? 6.926   -8.080  4.227  1.00 0.00 ? 113 PHE A HA   8  
ATOM   3649 H  HB2  . PHE A 1 12 ? 5.104   -9.687  2.337  1.00 0.00 ? 113 PHE A HB2  8  
ATOM   3650 H  HB3  . PHE A 1 12 ? 6.721   -10.205 2.768  1.00 0.00 ? 113 PHE A HB3  8  
ATOM   3651 H  HD1  . PHE A 1 12 ? 7.209   -10.634 5.245  1.00 0.00 ? 113 PHE A HD1  8  
ATOM   3652 H  HD2  . PHE A 1 12 ? 3.278   -10.229 3.702  1.00 0.00 ? 113 PHE A HD2  8  
ATOM   3653 H  HE1  . PHE A 1 12 ? 6.294   -11.802 7.269  1.00 0.00 ? 113 PHE A HE1  8  
ATOM   3654 H  HE2  . PHE A 1 12 ? 2.363   -11.397 5.726  1.00 0.00 ? 113 PHE A HE2  8  
ATOM   3655 H  HZ   . PHE A 1 12 ? 3.883   -12.170 7.485  1.00 0.00 ? 113 PHE A HZ   8  
ATOM   3656 N  N    . ALA A 1 13 ? 8.212   -7.898  2.011  1.00 0.00 ? 114 ALA A N    8  
ATOM   3657 C  CA   . ALA A 1 13 ? 8.973   -7.430  0.865  1.00 0.00 ? 114 ALA A CA   8  
ATOM   3658 C  C    . ALA A 1 13 ? 8.717   -8.357  -0.325 1.00 0.00 ? 114 ALA A C    8  
ATOM   3659 O  O    . ALA A 1 13 ? 9.217   -8.117  -1.422 1.00 0.00 ? 114 ALA A O    8  
ATOM   3660 C  CB   . ALA A 1 13 ? 10.455  -7.351  1.234  1.00 0.00 ? 114 ALA A CB   8  
ATOM   3661 H  H    . ALA A 1 13 ? 8.740   -8.411  2.687  1.00 0.00 ? 114 ALA A H    8  
ATOM   3662 H  HA   . ALA A 1 13 ? 8.619   -6.429  0.617  1.00 0.00 ? 114 ALA A HA   8  
ATOM   3663 H  HB1  . ALA A 1 13 ? 10.875  -6.419  0.853  1.00 0.00 ? 114 ALA A HB1  8  
ATOM   3664 H  HB2  . ALA A 1 13 ? 10.563  -7.381  2.318  1.00 0.00 ? 114 ALA A HB2  8  
ATOM   3665 H  HB3  . ALA A 1 13 ? 10.985  -8.196  0.794  1.00 0.00 ? 114 ALA A HB3  8  
ATOM   3666 N  N    . ARG A 1 14 ? 7.938   -9.397  -0.067 1.00 0.00 ? 115 ARG A N    8  
ATOM   3667 C  CA   . ARG A 1 14 ? 7.610   -10.361 -1.103 1.00 0.00 ? 115 ARG A CA   8  
ATOM   3668 C  C    . ARG A 1 14 ? 6.195   -10.906 -0.892 1.00 0.00 ? 115 ARG A C    8  
ATOM   3669 O  O    . ARG A 1 14 ? 5.700   -10.939 0.234  1.00 0.00 ? 115 ARG A O    8  
ATOM   3670 C  CB   . ARG A 1 14 ? 8.602   -11.526 -1.106 1.00 0.00 ? 115 ARG A CB   8  
ATOM   3671 C  CG   . ARG A 1 14 ? 10.027  -11.032 -0.847 1.00 0.00 ? 115 ARG A CG   8  
ATOM   3672 C  CD   . ARG A 1 14 ? 11.052  -12.118 -1.178 1.00 0.00 ? 115 ARG A CD   8  
ATOM   3673 N  NE   . ARG A 1 14 ? 12.206  -11.525 -1.891 1.00 0.00 ? 115 ARG A NE   8  
ATOM   3674 C  CZ   . ARG A 1 14 ? 12.115  -10.880 -3.061 1.00 0.00 ? 115 ARG A CZ   8  
ATOM   3675 N  NH1  . ARG A 1 14 ? 12.114  -11.571 -4.209 1.00 0.00 ? 115 ARG A NH1  8  
ATOM   3676 N  NH2  . ARG A 1 14 ? 12.023  -9.543  -3.083 1.00 0.00 ? 115 ARG A NH2  8  
ATOM   3677 H  H    . ARG A 1 14 ? 7.535   -9.586  0.829  1.00 0.00 ? 115 ARG A H    8  
ATOM   3678 H  HA   . ARG A 1 14 ? 7.679   -9.802  -2.036 1.00 0.00 ? 115 ARG A HA   8  
ATOM   3679 H  HB2  . ARG A 1 14 ? 8.320   -12.252 -0.344 1.00 0.00 ? 115 ARG A HB2  8  
ATOM   3680 H  HB3  . ARG A 1 14 ? 8.562   -12.040 -2.067 1.00 0.00 ? 115 ARG A HB3  8  
ATOM   3681 H  HG2  . ARG A 1 14 ? 10.224  -10.146 -1.449 1.00 0.00 ? 115 ARG A HG2  8  
ATOM   3682 H  HG3  . ARG A 1 14 ? 10.129  -10.738 0.198  1.00 0.00 ? 115 ARG A HG3  8  
ATOM   3683 H  HD2  . ARG A 1 14 ? 11.390  -12.603 -0.262 1.00 0.00 ? 115 ARG A HD2  8  
ATOM   3684 H  HD3  . ARG A 1 14 ? 10.591  -12.890 -1.794 1.00 0.00 ? 115 ARG A HD3  8  
ATOM   3685 H  HE   . ARG A 1 14 ? 13.110  -11.612 -1.472 1.00 0.00 ? 115 ARG A HE   8  
ATOM   3686 H  HH11 . ARG A 1 14 ? 12.974  -11.911 -4.588 1.00 0.00 ? 115 ARG A HH11 8  
ATOM   3687 H  HH12 . ARG A 1 14 ? 11.252  -11.746 -4.686 1.00 0.00 ? 115 ARG A HH12 8  
ATOM   3688 H  HH21 . ARG A 1 14 ? 12.850  -8.984  -3.013 1.00 0.00 ? 115 ARG A HH21 8  
ATOM   3689 H  HH22 . ARG A 1 14 ? 11.129  -9.104  -3.171 1.00 0.00 ? 115 ARG A HH22 8  
ATOM   3690 N  N    . GLN A 1 15 ? 5.585   -11.322 -1.992 1.00 0.00 ? 116 GLN A N    8  
ATOM   3691 C  CA   . GLN A 1 15 ? 4.238   -11.864 -1.942 1.00 0.00 ? 116 GLN A CA   8  
ATOM   3692 C  C    . GLN A 1 15 ? 4.257   -13.278 -1.360 1.00 0.00 ? 116 GLN A C    8  
ATOM   3693 O  O    . GLN A 1 15 ? 3.435   -13.614 -0.507 1.00 0.00 ? 116 GLN A O    8  
ATOM   3694 C  CB   . GLN A 1 15 ? 3.589   -11.850 -3.327 1.00 0.00 ? 116 GLN A CB   8  
ATOM   3695 C  CG   . GLN A 1 15 ? 2.097   -12.178 -3.238 1.00 0.00 ? 116 GLN A CG   8  
ATOM   3696 C  CD   . GLN A 1 15 ? 1.316   -11.489 -4.357 1.00 0.00 ? 116 GLN A CD   8  
ATOM   3697 O  OE1  . GLN A 1 15 ? 0.414   -10.701 -4.125 1.00 0.00 ? 116 GLN A OE1  8  
ATOM   3698 N  NE2  . GLN A 1 15 ? 1.710   -11.829 -5.581 1.00 0.00 ? 116 GLN A NE2  8  
ATOM   3699 H  H    . GLN A 1 15 ? 5.995   -11.292 -2.904 1.00 0.00 ? 116 GLN A H    8  
ATOM   3700 H  HA   . GLN A 1 15 ? 3.682   -11.198 -1.281 1.00 0.00 ? 116 GLN A HA   8  
ATOM   3701 H  HB2  . GLN A 1 15 ? 3.722   -10.869 -3.785 1.00 0.00 ? 116 GLN A HB2  8  
ATOM   3702 H  HB3  . GLN A 1 15 ? 4.087   -12.573 -3.973 1.00 0.00 ? 116 GLN A HB3  8  
ATOM   3703 H  HG2  . GLN A 1 15 ? 1.955   -13.257 -3.300 1.00 0.00 ? 116 GLN A HG2  8  
ATOM   3704 H  HG3  . GLN A 1 15 ? 1.710   -11.861 -2.269 1.00 0.00 ? 116 GLN A HG3  8  
ATOM   3705 H  HE21 . GLN A 1 15 ? 2.525   -11.408 -5.979 1.00 0.00 ? 116 GLN A HE21 8  
ATOM   3706 H  HE22 . GLN A 1 15 ? 1.192   -12.507 -6.103 1.00 0.00 ? 116 GLN A HE22 8  
ATOM   3707 N  N    . GLU A 1 16 ? 5.202   -14.071 -1.842 1.00 0.00 ? 117 GLU A N    8  
ATOM   3708 C  CA   . GLU A 1 16 ? 5.339   -15.442 -1.381 1.00 0.00 ? 117 GLU A CA   8  
ATOM   3709 C  C    . GLU A 1 16 ? 5.231   -15.501 0.145  1.00 0.00 ? 117 GLU A C    8  
ATOM   3710 O  O    . GLU A 1 16 ? 4.531   -16.353 0.688  1.00 0.00 ? 117 GLU A O    8  
ATOM   3711 C  CB   . GLU A 1 16 ? 6.657   -16.053 -1.861 1.00 0.00 ? 117 GLU A CB   8  
ATOM   3712 C  CG   . GLU A 1 16 ? 6.811   -15.904 -3.375 1.00 0.00 ? 117 GLU A CG   8  
ATOM   3713 C  CD   . GLU A 1 16 ? 5.472   -16.119 -4.086 1.00 0.00 ? 117 GLU A CD   8  
ATOM   3714 O  OE1  . GLU A 1 16 ? 4.597   -15.241 -3.926 1.00 0.00 ? 117 GLU A OE1  8  
ATOM   3715 O  OE2  . GLU A 1 16 ? 5.355   -17.155 -4.775 1.00 0.00 ? 117 GLU A OE2  8  
ATOM   3716 H  H    . GLU A 1 16 ? 5.867   -13.790 -2.535 1.00 0.00 ? 117 GLU A H    8  
ATOM   3717 H  HA   . GLU A 1 16 ? 4.509   -15.983 -1.832 1.00 0.00 ? 117 GLU A HA   8  
ATOM   3718 H  HB2  . GLU A 1 16 ? 7.492   -15.568 -1.357 1.00 0.00 ? 117 GLU A HB2  8  
ATOM   3719 H  HB3  . GLU A 1 16 ? 6.691   -17.108 -1.590 1.00 0.00 ? 117 GLU A HB3  8  
ATOM   3720 H  HG2  . GLU A 1 16 ? 7.196   -14.912 -3.610 1.00 0.00 ? 117 GLU A HG2  8  
ATOM   3721 H  HG3  . GLU A 1 16 ? 7.541   -16.624 -3.743 1.00 0.00 ? 117 GLU A HG3  8  
ATOM   3722 N  N    . HIS A 1 17 ? 5.934   -14.584 0.792  1.00 0.00 ? 118 HIS A N    8  
ATOM   3723 C  CA   . HIS A 1 17 ? 5.926   -14.521 2.244  1.00 0.00 ? 118 HIS A CA   8  
ATOM   3724 C  C    . HIS A 1 17 ? 4.482   -14.539 2.750  1.00 0.00 ? 118 HIS A C    8  
ATOM   3725 O  O    . HIS A 1 17 ? 4.149   -15.301 3.657  1.00 0.00 ? 118 HIS A O    8  
ATOM   3726 C  CB   . HIS A 1 17 ? 6.712   -13.305 2.740  1.00 0.00 ? 118 HIS A CB   8  
ATOM   3727 C  CG   . HIS A 1 17 ? 8.206   -13.423 2.552  1.00 0.00 ? 118 HIS A CG   8  
ATOM   3728 N  ND1  . HIS A 1 17 ? 9.110   -12.608 3.212  1.00 0.00 ? 118 HIS A ND1  8  
ATOM   3729 C  CD2  . HIS A 1 17 ? 8.944   -14.265 1.773  1.00 0.00 ? 118 HIS A CD2  8  
ATOM   3730 C  CE1  . HIS A 1 17 ? 10.334  -12.955 2.838  1.00 0.00 ? 118 HIS A CE1  8  
ATOM   3731 N  NE2  . HIS A 1 17 ? 10.228  -13.980 1.946  1.00 0.00 ? 118 HIS A NE2  8  
ATOM   3732 H  H    . HIS A 1 17 ? 6.501   -13.893 0.342  1.00 0.00 ? 118 HIS A H    8  
ATOM   3733 H  HA   . HIS A 1 17 ? 6.438   -15.415 2.598  1.00 0.00 ? 118 HIS A HA   8  
ATOM   3734 H  HB2  . HIS A 1 17 ? 6.358   -12.418 2.215  1.00 0.00 ? 118 HIS A HB2  8  
ATOM   3735 H  HB3  . HIS A 1 17 ? 6.501   -13.155 3.798  1.00 0.00 ? 118 HIS A HB3  8  
ATOM   3736 H  HD1  . HIS A 1 17 ? 8.880   -11.883 3.860  1.00 0.00 ? 118 HIS A HD1  8  
ATOM   3737 H  HD2  . HIS A 1 17 ? 8.545   -15.040 1.119  1.00 0.00 ? 118 HIS A HD2  8  
ATOM   3738 H  HE1  . HIS A 1 17 ? 11.262  -12.499 3.185  1.00 0.00 ? 118 HIS A HE1  8  
ATOM   3739 H  HE2  . HIS A 1 17 ? 10.994  -14.480 1.541  1.00 0.00 ? 118 HIS A HE2  8  
ATOM   3740 N  N    . LEU A 1 18 ? 3.665   -13.693 2.142  1.00 0.00 ? 119 LEU A N    8  
ATOM   3741 C  CA   . LEU A 1 18 ? 2.265   -13.602 2.520  1.00 0.00 ? 119 LEU A CA   8  
ATOM   3742 C  C    . LEU A 1 18 ? 1.600   -14.968 2.329  1.00 0.00 ? 119 LEU A C    8  
ATOM   3743 O  O    . LEU A 1 18 ? 1.137   -15.577 3.292  1.00 0.00 ? 119 LEU A O    8  
ATOM   3744 C  CB   . LEU A 1 18 ? 1.575   -12.471 1.755  1.00 0.00 ? 119 LEU A CB   8  
ATOM   3745 C  CG   . LEU A 1 18 ? 0.069   -12.629 1.536  1.00 0.00 ? 119 LEU A CG   8  
ATOM   3746 C  CD1  . LEU A 1 18 ? -0.622  -13.112 2.813  1.00 0.00 ? 119 LEU A CD1  8  
ATOM   3747 C  CD2  . LEU A 1 18 ? -0.547  -11.334 1.006  1.00 0.00 ? 119 LEU A CD2  8  
ATOM   3748 H  H    . LEU A 1 18 ? 3.944   -13.077 1.406  1.00 0.00 ? 119 LEU A H    8  
ATOM   3749 H  HA   . LEU A 1 18 ? 2.228   -13.347 3.578  1.00 0.00 ? 119 LEU A HA   8  
ATOM   3750 H  HB2  . LEU A 1 18 ? 1.748   -11.539 2.293  1.00 0.00 ? 119 LEU A HB2  8  
ATOM   3751 H  HB3  . LEU A 1 18 ? 2.055   -12.372 0.782  1.00 0.00 ? 119 LEU A HB3  8  
ATOM   3752 H  HG   . LEU A 1 18 ? -0.087  -13.395 0.776  1.00 0.00 ? 119 LEU A HG   8  
ATOM   3753 H  HD11 . LEU A 1 18 ? -0.252  -12.542 3.665  1.00 0.00 ? 119 LEU A HD11 8  
ATOM   3754 H  HD12 . LEU A 1 18 ? -1.699  -12.969 2.719  1.00 0.00 ? 119 LEU A HD12 8  
ATOM   3755 H  HD13 . LEU A 1 18 ? -0.410  -14.171 2.964  1.00 0.00 ? 119 LEU A HD13 8  
ATOM   3756 H  HD21 . LEU A 1 18 ? -1.421  -11.075 1.605  1.00 0.00 ? 119 LEU A HD21 8  
ATOM   3757 H  HD22 . LEU A 1 18 ? 0.187   -10.529 1.068  1.00 0.00 ? 119 LEU A HD22 8  
ATOM   3758 H  HD23 . LEU A 1 18 ? -0.847  -11.472 -0.033 1.00 0.00 ? 119 LEU A HD23 8  
ATOM   3759 N  N    . LYS A 1 19 ? 1.575   -15.408 1.078  1.00 0.00 ? 120 LYS A N    8  
ATOM   3760 C  CA   . LYS A 1 19 ? 0.975   -16.690 0.749  1.00 0.00 ? 120 LYS A CA   8  
ATOM   3761 C  C    . LYS A 1 19 ? 1.430   -17.738 1.767  1.00 0.00 ? 120 LYS A C    8  
ATOM   3762 O  O    . LYS A 1 19 ? 0.621   -18.255 2.535  1.00 0.00 ? 120 LYS A O    8  
ATOM   3763 C  CB   . LYS A 1 19 ? 1.281   -17.067 -0.701 1.00 0.00 ? 120 LYS A CB   8  
ATOM   3764 C  CG   . LYS A 1 19 ? 0.554   -18.353 -1.100 1.00 0.00 ? 120 LYS A CG   8  
ATOM   3765 C  CD   . LYS A 1 19 ? -0.946  -18.105 -1.268 1.00 0.00 ? 120 LYS A CD   8  
ATOM   3766 C  CE   . LYS A 1 19 ? -1.757  -18.964 -0.297 1.00 0.00 ? 120 LYS A CE   8  
ATOM   3767 N  NZ   . LYS A 1 19 ? -2.907  -18.198 0.236  1.00 0.00 ? 120 LYS A NZ   8  
ATOM   3768 H  H    . LYS A 1 19 ? 1.954   -14.906 0.301  1.00 0.00 ? 120 LYS A H    8  
ATOM   3769 H  HA   . LYS A 1 19 ? -0.106  -16.575 0.831  1.00 0.00 ? 120 LYS A HA   8  
ATOM   3770 H  HB2  . LYS A 1 19 ? 0.981   -16.256 -1.364 1.00 0.00 ? 120 LYS A HB2  8  
ATOM   3771 H  HB3  . LYS A 1 19 ? 2.356   -17.199 -0.827 1.00 0.00 ? 120 LYS A HB3  8  
ATOM   3772 H  HG2  . LYS A 1 19 ? 0.970   -18.737 -2.030 1.00 0.00 ? 120 LYS A HG2  8  
ATOM   3773 H  HG3  . LYS A 1 19 ? 0.716   -19.117 -0.338 1.00 0.00 ? 120 LYS A HG3  8  
ATOM   3774 H  HD2  . LYS A 1 19 ? -1.165  -17.050 -1.098 1.00 0.00 ? 120 LYS A HD2  8  
ATOM   3775 H  HD3  . LYS A 1 19 ? -1.242  -18.330 -2.294 1.00 0.00 ? 120 LYS A HD3  8  
ATOM   3776 H  HE2  . LYS A 1 19 ? -2.114  -19.860 -0.805 1.00 0.00 ? 120 LYS A HE2  8  
ATOM   3777 H  HE3  . LYS A 1 19 ? -1.122  -19.294 0.524  1.00 0.00 ? 120 LYS A HE3  8  
ATOM   3778 H  HZ1  . LYS A 1 19 ? -2.573  -17.465 0.828  1.00 0.00 ? 120 LYS A HZ1  8  
ATOM   3779 H  HZ2  . LYS A 1 19 ? -3.426  -17.805 -0.524 1.00 0.00 ? 120 LYS A HZ2  8  
ATOM   3780 H  HZ3  . LYS A 1 19 ? -3.499  -18.809 0.763  1.00 0.00 ? 120 LYS A HZ3  8  
ATOM   3781 N  N    . ARG A 1 20 ? 2.724   -18.021 1.739  1.00 0.00 ? 121 ARG A N    8  
ATOM   3782 C  CA   . ARG A 1 20 ? 3.297   -18.997 2.649  1.00 0.00 ? 121 ARG A CA   8  
ATOM   3783 C  C    . ARG A 1 20 ? 2.861   -18.704 4.086  1.00 0.00 ? 121 ARG A C    8  
ATOM   3784 O  O    . ARG A 1 20 ? 2.647   -19.624 4.874  1.00 0.00 ? 121 ARG A O    8  
ATOM   3785 C  CB   . ARG A 1 20 ? 4.825   -18.990 2.575  1.00 0.00 ? 121 ARG A CB   8  
ATOM   3786 C  CG   . ARG A 1 20 ? 5.412   -20.236 3.241  1.00 0.00 ? 121 ARG A CG   8  
ATOM   3787 C  CD   . ARG A 1 20 ? 5.961   -19.908 4.631  1.00 0.00 ? 121 ARG A CD   8  
ATOM   3788 N  NE   . ARG A 1 20 ? 6.963   -20.921 5.031  1.00 0.00 ? 121 ARG A NE   8  
ATOM   3789 C  CZ   . ARG A 1 20 ? 8.289   -20.731 4.968  1.00 0.00 ? 121 ARG A CZ   8  
ATOM   3790 N  NH1  . ARG A 1 20 ? 8.883   -19.865 5.800  1.00 0.00 ? 121 ARG A NH1  8  
ATOM   3791 N  NH2  . ARG A 1 20 ? 9.020   -21.410 4.073  1.00 0.00 ? 121 ARG A NH2  8  
ATOM   3792 H  H    . ARG A 1 20 ? 3.376   -17.596 1.110  1.00 0.00 ? 121 ARG A H    8  
ATOM   3793 H  HA   . ARG A 1 20 ? 2.906   -19.957 2.309  1.00 0.00 ? 121 ARG A HA   8  
ATOM   3794 H  HB2  . ARG A 1 20 ? 5.142   -18.946 1.533  1.00 0.00 ? 121 ARG A HB2  8  
ATOM   3795 H  HB3  . ARG A 1 20 ? 5.211   -18.096 3.064  1.00 0.00 ? 121 ARG A HB3  8  
ATOM   3796 H  HG2  . ARG A 1 20 ? 4.644   -21.006 3.322  1.00 0.00 ? 121 ARG A HG2  8  
ATOM   3797 H  HG3  . ARG A 1 20 ? 6.208   -20.644 2.618  1.00 0.00 ? 121 ARG A HG3  8  
ATOM   3798 H  HD2  . ARG A 1 20 ? 6.414   -18.917 4.627  1.00 0.00 ? 121 ARG A HD2  8  
ATOM   3799 H  HD3  . ARG A 1 20 ? 5.148   -19.884 5.356  1.00 0.00 ? 121 ARG A HD3  8  
ATOM   3800 H  HE   . ARG A 1 20 ? 6.631   -21.801 5.369  1.00 0.00 ? 121 ARG A HE   8  
ATOM   3801 H  HH11 . ARG A 1 20 ? 8.355   -19.433 6.531  1.00 0.00 ? 121 ARG A HH11 8  
ATOM   3802 H  HH12 . ARG A 1 20 ? 9.853   -19.651 5.689  1.00 0.00 ? 121 ARG A HH12 8  
ATOM   3803 H  HH21 . ARG A 1 20 ? 8.638   -22.216 3.623  1.00 0.00 ? 121 ARG A HH21 8  
ATOM   3804 H  HH22 . ARG A 1 20 ? 9.948   -21.109 3.855  1.00 0.00 ? 121 ARG A HH22 8  
ATOM   3805 N  N    . HIS A 1 21 ? 2.742   -17.418 4.382  1.00 0.00 ? 122 HIS A N    8  
ATOM   3806 C  CA   . HIS A 1 21 ? 2.335   -16.991 5.711  1.00 0.00 ? 122 HIS A CA   8  
ATOM   3807 C  C    . HIS A 1 21 ? 0.884   -17.407 5.962  1.00 0.00 ? 122 HIS A C    8  
ATOM   3808 O  O    . HIS A 1 21 ? 0.584   -18.050 6.967  1.00 0.00 ? 122 HIS A O    8  
ATOM   3809 C  CB   . HIS A 1 21 ? 2.561   -15.488 5.892  1.00 0.00 ? 122 HIS A CB   8  
ATOM   3810 C  CG   . HIS A 1 21 ? 1.682   -14.858 6.945  1.00 0.00 ? 122 HIS A CG   8  
ATOM   3811 N  ND1  . HIS A 1 21 ? 1.960   -14.938 8.299  1.00 0.00 ? 122 HIS A ND1  8  
ATOM   3812 C  CD2  . HIS A 1 21 ? 0.531   -14.136 6.831  1.00 0.00 ? 122 HIS A CD2  8  
ATOM   3813 C  CE1  . HIS A 1 21 ? 1.011   -14.292 8.960  1.00 0.00 ? 122 HIS A CE1  8  
ATOM   3814 N  NE2  . HIS A 1 21 ? 0.126   -13.796 8.048  1.00 0.00 ? 122 HIS A NE2  8  
ATOM   3815 H  H    . HIS A 1 21 ? 2.918   -16.676 3.736  1.00 0.00 ? 122 HIS A H    8  
ATOM   3816 H  HA   . HIS A 1 21 ? 2.981   -17.512 6.418  1.00 0.00 ? 122 HIS A HA   8  
ATOM   3817 H  HB2  . HIS A 1 21 ? 3.605   -15.317 6.154  1.00 0.00 ? 122 HIS A HB2  8  
ATOM   3818 H  HB3  . HIS A 1 21 ? 2.385   -14.988 4.940  1.00 0.00 ? 122 HIS A HB3  8  
ATOM   3819 H  HD1  . HIS A 1 21 ? 2.743   -15.405 8.709  1.00 0.00 ? 122 HIS A HD1  8  
ATOM   3820 H  HD2  . HIS A 1 21 ? 0.028   -13.883 5.897  1.00 0.00 ? 122 HIS A HD2  8  
ATOM   3821 H  HE1  . HIS A 1 21 ? 0.948   -14.175 10.042 1.00 0.00 ? 122 HIS A HE1  8  
ATOM   3822 N  N    . TYR A 1 22 ? 0.023   -17.023 5.032  1.00 0.00 ? 123 TYR A N    8  
ATOM   3823 C  CA   . TYR A 1 22 ? -1.389  -17.349 5.140  1.00 0.00 ? 123 TYR A CA   8  
ATOM   3824 C  C    . TYR A 1 22 ? -1.586  -18.741 5.741  1.00 0.00 ? 123 TYR A C    8  
ATOM   3825 O  O    . TYR A 1 22 ? -2.549  -18.976 6.470  1.00 0.00 ? 123 TYR A O    8  
ATOM   3826 C  CB   . TYR A 1 22 ? -1.934  -17.342 3.710  1.00 0.00 ? 123 TYR A CB   8  
ATOM   3827 C  CG   . TYR A 1 22 ? -3.120  -16.399 3.501  1.00 0.00 ? 123 TYR A CG   8  
ATOM   3828 C  CD1  . TYR A 1 22 ? -4.360  -16.726 4.010  1.00 0.00 ? 123 TYR A CD1  8  
ATOM   3829 C  CD2  . TYR A 1 22 ? -2.950  -15.221 2.800  1.00 0.00 ? 123 TYR A CD2  8  
ATOM   3830 C  CE1  . TYR A 1 22 ? -5.476  -15.838 3.813  1.00 0.00 ? 123 TYR A CE1  8  
ATOM   3831 C  CE2  . TYR A 1 22 ? -4.067  -14.333 2.603  1.00 0.00 ? 123 TYR A CE2  8  
ATOM   3832 C  CZ   . TYR A 1 22 ? -5.274  -14.686 3.119  1.00 0.00 ? 123 TYR A CZ   8  
ATOM   3833 O  OH   . TYR A 1 22 ? -6.329  -13.847 2.932  1.00 0.00 ? 123 TYR A OH   8  
ATOM   3834 H  H    . TYR A 1 22 ? 0.275   -16.500 4.217  1.00 0.00 ? 123 TYR A H    8  
ATOM   3835 H  HA   . TYR A 1 22 ? -1.855  -16.610 5.791  1.00 0.00 ? 123 TYR A HA   8  
ATOM   3836 H  HB2  . TYR A 1 22 ? -1.132  -17.058 3.028  1.00 0.00 ? 123 TYR A HB2  8  
ATOM   3837 H  HB3  . TYR A 1 22 ? -2.236  -18.355 3.442  1.00 0.00 ? 123 TYR A HB3  8  
ATOM   3838 H  HD1  . TYR A 1 22 ? -4.494  -17.655 4.563  1.00 0.00 ? 123 TYR A HD1  8  
ATOM   3839 H  HD2  . TYR A 1 22 ? -1.971  -14.964 2.397  1.00 0.00 ? 123 TYR A HD2  8  
ATOM   3840 H  HE1  . TYR A 1 22 ? -6.460  -16.084 4.211  1.00 0.00 ? 123 TYR A HE1  8  
ATOM   3841 H  HE2  . TYR A 1 22 ? -3.946  -13.401 2.053  1.00 0.00 ? 123 TYR A HE2  8  
ATOM   3842 H  HH   . TYR A 1 22 ? -6.006  -12.960 2.606  1.00 0.00 ? 123 TYR A HH   8  
ATOM   3843 N  N    . ARG A 1 23 ? -0.660  -19.630 5.414  1.00 0.00 ? 124 ARG A N    8  
ATOM   3844 C  CA   . ARG A 1 23 ? -0.720  -20.993 5.912  1.00 0.00 ? 124 ARG A CA   8  
ATOM   3845 C  C    . ARG A 1 23 ? -1.023  -20.996 7.412  1.00 0.00 ? 124 ARG A C    8  
ATOM   3846 O  O    . ARG A 1 23 ? -1.619  -21.942 7.926  1.00 0.00 ? 124 ARG A O    8  
ATOM   3847 C  CB   . ARG A 1 23 ? 0.598   -21.729 5.664  1.00 0.00 ? 124 ARG A CB   8  
ATOM   3848 C  CG   . ARG A 1 23 ? 1.363   -21.939 6.973  1.00 0.00 ? 124 ARG A CG   8  
ATOM   3849 C  CD   . ARG A 1 23 ? 1.981   -20.628 7.463  1.00 0.00 ? 124 ARG A CD   8  
ATOM   3850 N  NE   . ARG A 1 23 ? 3.449   -20.774 7.582  1.00 0.00 ? 124 ARG A NE   8  
ATOM   3851 C  CZ   . ARG A 1 23 ? 4.196   -21.538 6.774  1.00 0.00 ? 124 ARG A CZ   8  
ATOM   3852 N  NH1  . ARG A 1 23 ? 3.811   -21.752 5.509  1.00 0.00 ? 124 ARG A NH1  8  
ATOM   3853 N  NH2  . ARG A 1 23 ? 5.330   -22.088 7.232  1.00 0.00 ? 124 ARG A NH2  8  
ATOM   3854 H  H    . ARG A 1 23 ? 0.120   -19.431 4.820  1.00 0.00 ? 124 ARG A H    8  
ATOM   3855 H  HA   . ARG A 1 23 ? -1.526  -21.461 5.348  1.00 0.00 ? 124 ARG A HA   8  
ATOM   3856 H  HB2  . ARG A 1 23 ? 0.399   -22.693 5.197  1.00 0.00 ? 124 ARG A HB2  8  
ATOM   3857 H  HB3  . ARG A 1 23 ? 1.212   -21.158 4.968  1.00 0.00 ? 124 ARG A HB3  8  
ATOM   3858 H  HG2  . ARG A 1 23 ? 0.690   -22.334 7.733  1.00 0.00 ? 124 ARG A HG2  8  
ATOM   3859 H  HG3  . ARG A 1 23 ? 2.148   -22.682 6.824  1.00 0.00 ? 124 ARG A HG3  8  
ATOM   3860 H  HD2  . ARG A 1 23 ? 1.743   -19.822 6.769  1.00 0.00 ? 124 ARG A HD2  8  
ATOM   3861 H  HD3  . ARG A 1 23 ? 1.555   -20.355 8.428  1.00 0.00 ? 124 ARG A HD3  8  
ATOM   3862 H  HE   . ARG A 1 23 ? 3.912   -20.271 8.313  1.00 0.00 ? 124 ARG A HE   8  
ATOM   3863 H  HH11 . ARG A 1 23 ? 3.134   -21.151 5.085  1.00 0.00 ? 124 ARG A HH11 8  
ATOM   3864 H  HH12 . ARG A 1 23 ? 4.200   -22.512 4.989  1.00 0.00 ? 124 ARG A HH12 8  
ATOM   3865 H  HH21 . ARG A 1 23 ? 5.722   -21.778 8.097  1.00 0.00 ? 124 ARG A HH21 8  
ATOM   3866 H  HH22 . ARG A 1 23 ? 5.782   -22.809 6.707  1.00 0.00 ? 124 ARG A HH22 8  
ATOM   3867 N  N    . SER A 1 24 ? -0.600  -19.928 8.071  1.00 0.00 ? 125 SER A N    8  
ATOM   3868 C  CA   . SER A 1 24 ? -0.819  -19.796 9.502  1.00 0.00 ? 125 SER A CA   8  
ATOM   3869 C  C    . SER A 1 24 ? -2.223  -19.247 9.767  1.00 0.00 ? 125 SER A C    8  
ATOM   3870 O  O    . SER A 1 24 ? -2.560  -18.920 10.904 1.00 0.00 ? 125 SER A O    8  
ATOM   3871 C  CB   . SER A 1 24 ? 0.234   -18.888 10.139 1.00 0.00 ? 125 SER A CB   8  
ATOM   3872 O  OG   . SER A 1 24 ? 0.512   -17.746 9.333  1.00 0.00 ? 125 SER A OG   8  
ATOM   3873 H  H    . SER A 1 24 ? -0.117  -19.163 7.645  1.00 0.00 ? 125 SER A H    8  
ATOM   3874 H  HA   . SER A 1 24 ? -0.721  -20.805 9.903  1.00 0.00 ? 125 SER A HA   8  
ATOM   3875 H  HB2  . SER A 1 24 ? -0.112  -18.564 11.120 1.00 0.00 ? 125 SER A HB2  8  
ATOM   3876 H  HB3  . SER A 1 24 ? 1.152   -19.454 10.296 1.00 0.00 ? 125 SER A HB3  8  
ATOM   3877 H  HG   . SER A 1 24 ? 1.477   -17.740 9.070  1.00 0.00 ? 125 SER A HG   8  
ATOM   3878 N  N    . HIS A 1 25 ? -3.004  -19.166 8.700  1.00 0.00 ? 126 HIS A N    8  
ATOM   3879 C  CA   . HIS A 1 25 ? -4.363  -18.663 8.804  1.00 0.00 ? 126 HIS A CA   8  
ATOM   3880 C  C    . HIS A 1 25 ? -5.348  -19.754 8.379  1.00 0.00 ? 126 HIS A C    8  
ATOM   3881 O  O    . HIS A 1 25 ? -6.550  -19.634 8.607  1.00 0.00 ? 126 HIS A O    8  
ATOM   3882 C  CB   . HIS A 1 25 ? -4.528  -17.371 8.001  1.00 0.00 ? 126 HIS A CB   8  
ATOM   3883 C  CG   . HIS A 1 25 ? -3.738  -16.205 8.547  1.00 0.00 ? 126 HIS A CG   8  
ATOM   3884 N  ND1  . HIS A 1 25 ? -3.532  -16.007 9.901  1.00 0.00 ? 126 HIS A ND1  8  
ATOM   3885 C  CD2  . HIS A 1 25 ? -3.108  -15.178 7.907  1.00 0.00 ? 126 HIS A CD2  8  
ATOM   3886 C  CE1  . HIS A 1 25 ? -2.809  -14.908 10.058 1.00 0.00 ? 126 HIS A CE1  8  
ATOM   3887 N  NE2  . HIS A 1 25 ? -2.548  -14.395 8.822  1.00 0.00 ? 126 HIS A NE2  8  
ATOM   3888 H  H    . HIS A 1 25 ? -2.722  -19.435 7.780  1.00 0.00 ? 126 HIS A H    8  
ATOM   3889 H  HA   . HIS A 1 25 ? -4.530  -18.425 9.854  1.00 0.00 ? 126 HIS A HA   8  
ATOM   3890 H  HB2  . HIS A 1 25 ? -4.220  -17.553 6.971  1.00 0.00 ? 126 HIS A HB2  8  
ATOM   3891 H  HB3  . HIS A 1 25 ? -5.583  -17.102 7.977  1.00 0.00 ? 126 HIS A HB3  8  
ATOM   3892 H  HD1  . HIS A 1 25 ? -3.870  -16.595 10.636 1.00 0.00 ? 126 HIS A HD1  8  
ATOM   3893 H  HD2  . HIS A 1 25 ? -3.070  -15.026 6.829  1.00 0.00 ? 126 HIS A HD2  8  
ATOM   3894 H  HE1  . HIS A 1 25 ? -2.481  -14.487 11.009 1.00 0.00 ? 126 HIS A HE1  8  
ATOM   3895 N  N    . THR A 1 26 ? -4.801  -20.795 7.768  1.00 0.00 ? 127 THR A N    8  
ATOM   3896 C  CA   . THR A 1 26 ? -5.615  -21.907 7.308  1.00 0.00 ? 127 THR A CA   8  
ATOM   3897 C  C    . THR A 1 26 ? -4.746  -23.143 7.070  1.00 0.00 ? 127 THR A C    8  
ATOM   3898 O  O    . THR A 1 26 ? -3.872  -23.457 7.876  1.00 0.00 ? 127 THR A O    8  
ATOM   3899 C  CB   . THR A 1 26 ? -6.379  -21.451 6.064  1.00 0.00 ? 127 THR A CB   8  
ATOM   3900 O  OG1  . THR A 1 26 ? -7.238  -22.547 5.763  1.00 0.00 ? 127 THR A OG1  8  
ATOM   3901 C  CG2  . THR A 1 26 ? -5.477  -21.336 4.833  1.00 0.00 ? 127 THR A CG2  8  
ATOM   3902 H  H    . THR A 1 26 ? -3.821  -20.885 7.586  1.00 0.00 ? 127 THR A H    8  
ATOM   3903 H  HA   . THR A 1 26 ? -6.324  -22.162 8.096  1.00 0.00 ? 127 THR A HA   8  
ATOM   3904 H  HB   . THR A 1 26 ? -6.905  -20.514 6.250  1.00 0.00 ? 127 THR A HB   8  
ATOM   3905 H  HG1  . THR A 1 26 ? -7.865  -22.710 6.524  1.00 0.00 ? 127 THR A HG1  8  
ATOM   3906 H  HG21 . THR A 1 26 ? -5.468  -20.302 4.484  1.00 0.00 ? 127 THR A HG21 8  
ATOM   3907 H  HG22 . THR A 1 26 ? -4.463  -21.637 5.096  1.00 0.00 ? 127 THR A HG22 8  
ATOM   3908 H  HG23 . THR A 1 26 ? -5.856  -21.984 4.042  1.00 0.00 ? 127 THR A HG23 8  
ATOM   3909 N  N    . ASN A 1 27 ? -5.015  -23.810 5.957  1.00 0.00 ? 128 ASN A N    8  
ATOM   3910 C  CA   . ASN A 1 27 ? -4.269  -25.005 5.602  1.00 0.00 ? 128 ASN A CA   8  
ATOM   3911 C  C    . ASN A 1 27 ? -2.809  -24.833 6.026  1.00 0.00 ? 128 ASN A C    8  
ATOM   3912 O  O    . ASN A 1 27 ? -2.088  -24.010 5.464  1.00 0.00 ? 128 ASN A O    8  
ATOM   3913 C  CB   . ASN A 1 27 ? -4.297  -25.243 4.091  1.00 0.00 ? 128 ASN A CB   8  
ATOM   3914 C  CG   . ASN A 1 27 ? -5.710  -25.059 3.533  1.00 0.00 ? 128 ASN A CG   8  
ATOM   3915 O  OD1  . ASN A 1 27 ? -5.917  -24.501 2.468  1.00 0.00 ? 128 ASN A OD1  8  
ATOM   3916 N  ND2  . ASN A 1 27 ? -6.668  -25.556 4.311  1.00 0.00 ? 128 ASN A ND2  8  
ATOM   3917 H  H    . ASN A 1 27 ? -5.728  -23.548 5.307  1.00 0.00 ? 128 ASN A H    8  
ATOM   3918 H  HA   . ASN A 1 27 ? -4.764  -25.820 6.130  1.00 0.00 ? 128 ASN A HA   8  
ATOM   3919 H  HB2  . ASN A 1 27 ? -3.615  -24.552 3.597  1.00 0.00 ? 128 ASN A HB2  8  
ATOM   3920 H  HB3  . ASN A 1 27 ? -3.945  -26.251 3.871  1.00 0.00 ? 128 ASN A HB3  8  
ATOM   3921 H  HD21 . ASN A 1 27 ? -6.581  -26.479 4.683  1.00 0.00 ? 128 ASN A HD21 8  
ATOM   3922 H  HD22 . ASN A 1 27 ? -7.475  -25.004 4.524  1.00 0.00 ? 128 ASN A HD22 8  
ATOM   3923 N  N    . GLU A 1 28 ? -2.416  -25.623 7.015  1.00 0.00 ? 129 GLU A N    8  
ATOM   3924 C  CA   . GLU A 1 28 ? -1.055  -25.569 7.520  1.00 0.00 ? 129 GLU A CA   8  
ATOM   3925 C  C    . GLU A 1 28 ? -0.151  -26.501 6.711  1.00 0.00 ? 129 GLU A C    8  
ATOM   3926 O  O    . GLU A 1 28 ? -0.217  -27.720 6.862  1.00 0.00 ? 129 GLU A O    8  
ATOM   3927 C  CB   . GLU A 1 28 ? -1.009  -25.917 9.009  1.00 0.00 ? 129 GLU A CB   8  
ATOM   3928 C  CG   . GLU A 1 28 ? -1.107  -24.656 9.870  1.00 0.00 ? 129 GLU A CG   8  
ATOM   3929 C  CD   . GLU A 1 28 ? 0.272   -24.032 10.088 1.00 0.00 ? 129 GLU A CD   8  
ATOM   3930 O  OE1  . GLU A 1 28 ? 1.046   -24.009 9.106  1.00 0.00 ? 129 GLU A OE1  8  
ATOM   3931 O  OE2  . GLU A 1 28 ? 0.523   -23.591 11.231 1.00 0.00 ? 129 GLU A OE2  8  
ATOM   3932 H  H    . GLU A 1 28 ? -3.009  -26.290 7.466  1.00 0.00 ? 129 GLU A H    8  
ATOM   3933 H  HA   . GLU A 1 28 ? -0.737  -24.535 7.386  1.00 0.00 ? 129 GLU A HA   8  
ATOM   3934 H  HB2  . GLU A 1 28 ? -1.828  -26.594 9.254  1.00 0.00 ? 129 GLU A HB2  8  
ATOM   3935 H  HB3  . GLU A 1 28 ? -0.083  -26.444 9.235  1.00 0.00 ? 129 GLU A HB3  8  
ATOM   3936 H  HG2  . GLU A 1 28 ? -1.767  -23.933 9.389  1.00 0.00 ? 129 GLU A HG2  8  
ATOM   3937 H  HG3  . GLU A 1 28 ? -1.555  -24.903 10.833 1.00 0.00 ? 129 GLU A HG3  8  
ATOM   3938 N  N    . LYS A 1 29 ? 0.673   -25.892 5.871  1.00 0.00 ? 130 LYS A N    8  
ATOM   3939 C  CA   . LYS A 1 29 ? 1.590   -26.652 5.039  1.00 0.00 ? 130 LYS A CA   8  
ATOM   3940 C  C    . LYS A 1 29 ? 2.959   -25.970 5.041  1.00 0.00 ? 130 LYS A C    8  
ATOM   3941 O  O    . LYS A 1 29 ? 3.986   -26.630 5.193  1.00 0.00 ? 130 LYS A O    8  
ATOM   3942 C  CB   . LYS A 1 29 ? 1.004   -26.850 3.639  1.00 0.00 ? 130 LYS A CB   8  
ATOM   3943 C  CG   . LYS A 1 29 ? 0.652   -25.506 2.997  1.00 0.00 ? 130 LYS A CG   8  
ATOM   3944 C  CD   . LYS A 1 29 ? -0.709  -25.571 2.300  1.00 0.00 ? 130 LYS A CD   8  
ATOM   3945 C  CE   . LYS A 1 29 ? -1.068  -24.222 1.674  1.00 0.00 ? 130 LYS A CE   8  
ATOM   3946 N  NZ   . LYS A 1 29 ? 0.155   -23.500 1.259  1.00 0.00 ? 130 LYS A NZ   8  
ATOM   3947 H  H    . LYS A 1 29 ? 0.721   -24.899 5.755  1.00 0.00 ? 130 LYS A H    8  
ATOM   3948 H  HA   . LYS A 1 29 ? 1.695   -27.640 5.487  1.00 0.00 ? 130 LYS A HA   8  
ATOM   3949 H  HB2  . LYS A 1 29 ? 1.720   -27.379 3.012  1.00 0.00 ? 130 LYS A HB2  8  
ATOM   3950 H  HB3  . LYS A 1 29 ? 0.111   -27.473 3.700  1.00 0.00 ? 130 LYS A HB3  8  
ATOM   3951 H  HG2  . LYS A 1 29 ? 0.637   -24.727 3.760  1.00 0.00 ? 130 LYS A HG2  8  
ATOM   3952 H  HG3  . LYS A 1 29 ? 1.421   -25.231 2.276  1.00 0.00 ? 130 LYS A HG3  8  
ATOM   3953 H  HD2  . LYS A 1 29 ? -0.690  -26.341 1.529  1.00 0.00 ? 130 LYS A HD2  8  
ATOM   3954 H  HD3  . LYS A 1 29 ? -1.476  -25.858 3.018  1.00 0.00 ? 130 LYS A HD3  8  
ATOM   3955 H  HE2  . LYS A 1 29 ? -1.717  -24.376 0.811  1.00 0.00 ? 130 LYS A HE2  8  
ATOM   3956 H  HE3  . LYS A 1 29 ? -1.628  -23.619 2.389  1.00 0.00 ? 130 LYS A HE3  8  
ATOM   3957 H  HZ1  . LYS A 1 29 ? -0.092  -22.746 0.651  1.00 0.00 ? 130 LYS A HZ1  8  
ATOM   3958 H  HZ2  . LYS A 1 29 ? 0.619   -23.139 2.068  1.00 0.00 ? 130 LYS A HZ2  8  
ATOM   3959 H  HZ3  . LYS A 1 29 ? 0.766   -24.129 0.777  1.00 0.00 ? 130 LYS A HZ3  8  
HETATM 3960 ZN ZN   . ZN  B 2 .  ? -1.515  -12.750 8.453  1.00 0.00 ? 1   ZN  A ZN   8  
ATOM   3961 N  N    . ARG A 1 1  ? 1.386   0.301   -1.213 1.00 0.00 ? 102 ARG A N    9  
ATOM   3962 C  CA   . ARG A 1 1  ? 1.985   -0.307  -2.388 1.00 0.00 ? 102 ARG A CA   9  
ATOM   3963 C  C    . ARG A 1 1  ? 2.785   -1.550  -1.993 1.00 0.00 ? 102 ARG A C    9  
ATOM   3964 O  O    . ARG A 1 1  ? 3.778   -1.885  -2.636 1.00 0.00 ? 102 ARG A O    9  
ATOM   3965 C  CB   . ARG A 1 1  ? 2.910   0.676   -3.108 1.00 0.00 ? 102 ARG A CB   9  
ATOM   3966 C  CG   . ARG A 1 1  ? 3.727   1.494   -2.106 1.00 0.00 ? 102 ARG A CG   9  
ATOM   3967 C  CD   . ARG A 1 1  ? 3.371   2.980   -2.190 1.00 0.00 ? 102 ARG A CD   9  
ATOM   3968 N  NE   . ARG A 1 1  ? 1.917   3.164   -1.985 1.00 0.00 ? 102 ARG A NE   9  
ATOM   3969 C  CZ   . ARG A 1 1  ? 1.065   3.544   -2.947 1.00 0.00 ? 102 ARG A CZ   9  
ATOM   3970 N  NH1  . ARG A 1 1  ? 1.462   4.410   -3.889 1.00 0.00 ? 102 ARG A NH1  9  
ATOM   3971 N  NH2  . ARG A 1 1  ? -0.184  3.058   -2.966 1.00 0.00 ? 102 ARG A NH2  9  
ATOM   3972 H  H    . ARG A 1 1  ? 1.780   0.013   -0.340 1.00 0.00 ? 102 ARG A H    9  
ATOM   3973 H  HA   . ARG A 1 1  ? 1.142   -0.571  -3.027 1.00 0.00 ? 102 ARG A HA   9  
ATOM   3974 H  HB2  . ARG A 1 1  ? 3.580   0.132   -3.772 1.00 0.00 ? 102 ARG A HB2  9  
ATOM   3975 H  HB3  . ARG A 1 1  ? 2.318   1.346   -3.733 1.00 0.00 ? 102 ARG A HB3  9  
ATOM   3976 H  HG2  . ARG A 1 1  ? 3.542   1.129   -1.095 1.00 0.00 ? 102 ARG A HG2  9  
ATOM   3977 H  HG3  . ARG A 1 1  ? 4.791   1.359   -2.303 1.00 0.00 ? 102 ARG A HG3  9  
ATOM   3978 H  HD2  . ARG A 1 1  ? 3.926   3.539   -1.436 1.00 0.00 ? 102 ARG A HD2  9  
ATOM   3979 H  HD3  . ARG A 1 1  ? 3.663   3.377   -3.162 1.00 0.00 ? 102 ARG A HD3  9  
ATOM   3980 H  HE   . ARG A 1 1  ? 1.547   2.994   -1.072 1.00 0.00 ? 102 ARG A HE   9  
ATOM   3981 H  HH11 . ARG A 1 1  ? 2.092   4.114   -4.608 1.00 0.00 ? 102 ARG A HH11 9  
ATOM   3982 H  HH12 . ARG A 1 1  ? 1.128   5.352   -3.876 1.00 0.00 ? 102 ARG A HH12 9  
ATOM   3983 H  HH21 . ARG A 1 1  ? -0.336  2.075   -3.072 1.00 0.00 ? 102 ARG A HH21 9  
ATOM   3984 H  HH22 . ARG A 1 1  ? -0.963  3.677   -2.875 1.00 0.00 ? 102 ARG A HH22 9  
ATOM   3985 N  N    . SER A 1 2  ? 2.321   -2.202  -0.936 1.00 0.00 ? 103 SER A N    9  
ATOM   3986 C  CA   . SER A 1 2  ? 2.980   -3.401  -0.448 1.00 0.00 ? 103 SER A CA   9  
ATOM   3987 C  C    . SER A 1 2  ? 1.937   -4.442  -0.038 1.00 0.00 ? 103 SER A C    9  
ATOM   3988 O  O    . SER A 1 2  ? 0.827   -4.091  0.358  1.00 0.00 ? 103 SER A O    9  
ATOM   3989 C  CB   . SER A 1 2  ? 3.902   -3.081  0.731  1.00 0.00 ? 103 SER A CB   9  
ATOM   3990 O  OG   . SER A 1 2  ? 5.263   -3.389  0.443  1.00 0.00 ? 103 SER A OG   9  
ATOM   3991 H  H    . SER A 1 2  ? 1.512   -1.924  -0.419 1.00 0.00 ? 103 SER A H    9  
ATOM   3992 H  HA   . SER A 1 2  ? 3.575   -3.765  -1.285 1.00 0.00 ? 103 SER A HA   9  
ATOM   3993 H  HB2  . SER A 1 2  ? 3.815   -2.024  0.984  1.00 0.00 ? 103 SER A HB2  9  
ATOM   3994 H  HB3  . SER A 1 2  ? 3.580   -3.645  1.607  1.00 0.00 ? 103 SER A HB3  9  
ATOM   3995 H  HG   . SER A 1 2  ? 5.314   -4.049  -0.306 1.00 0.00 ? 103 SER A HG   9  
ATOM   3996 N  N    . PHE A 1 3  ? 2.330   -5.702  -0.148 1.00 0.00 ? 104 PHE A N    9  
ATOM   3997 C  CA   . PHE A 1 3  ? 1.443   -6.797  0.207  1.00 0.00 ? 104 PHE A CA   9  
ATOM   3998 C  C    . PHE A 1 3  ? 1.300   -6.918  1.725  1.00 0.00 ? 104 PHE A C    9  
ATOM   3999 O  O    . PHE A 1 3  ? 2.278   -7.174  2.425  1.00 0.00 ? 104 PHE A O    9  
ATOM   4000 C  CB   . PHE A 1 3  ? 2.074   -8.080  -0.338 1.00 0.00 ? 104 PHE A CB   9  
ATOM   4001 C  CG   . PHE A 1 3  ? 2.408   -8.023  -1.831 1.00 0.00 ? 104 PHE A CG   9  
ATOM   4002 C  CD1  . PHE A 1 3  ? 1.409   -8.069  -2.753 1.00 0.00 ? 104 PHE A CD1  9  
ATOM   4003 C  CD2  . PHE A 1 3  ? 3.703   -7.927  -2.235 1.00 0.00 ? 104 PHE A CD2  9  
ATOM   4004 C  CE1  . PHE A 1 3  ? 1.719   -8.017  -4.138 1.00 0.00 ? 104 PHE A CE1  9  
ATOM   4005 C  CE2  . PHE A 1 3  ? 4.013   -7.876  -3.620 1.00 0.00 ? 104 PHE A CE2  9  
ATOM   4006 C  CZ   . PHE A 1 3  ? 3.013   -7.921  -4.542 1.00 0.00 ? 104 PHE A CZ   9  
ATOM   4007 H  H    . PHE A 1 3  ? 3.235   -5.980  -0.471 1.00 0.00 ? 104 PHE A H    9  
ATOM   4008 H  HA   . PHE A 1 3  ? 0.468   -6.578  -0.231 1.00 0.00 ? 104 PHE A HA   9  
ATOM   4009 H  HB2  . PHE A 1 3  ? 2.986   -8.289  0.219  1.00 0.00 ? 104 PHE A HB2  9  
ATOM   4010 H  HB3  . PHE A 1 3  ? 1.394   -8.912  -0.161 1.00 0.00 ? 104 PHE A HB3  9  
ATOM   4011 H  HD1  . PHE A 1 3  ? 0.371   -8.146  -2.429 1.00 0.00 ? 104 PHE A HD1  9  
ATOM   4012 H  HD2  . PHE A 1 3  ? 4.503   -7.892  -1.496 1.00 0.00 ? 104 PHE A HD2  9  
ATOM   4013 H  HE1  . PHE A 1 3  ? 0.918   -8.053  -4.877 1.00 0.00 ? 104 PHE A HE1  9  
ATOM   4014 H  HE2  . PHE A 1 3  ? 5.051   -7.799  -3.944 1.00 0.00 ? 104 PHE A HE2  9  
ATOM   4015 H  HZ   . PHE A 1 3  ? 3.252   -7.882  -5.605 1.00 0.00 ? 104 PHE A HZ   9  
ATOM   4016 N  N    . VAL A 1 4  ? 0.074   -6.729  2.189  1.00 0.00 ? 105 VAL A N    9  
ATOM   4017 C  CA   . VAL A 1 4  ? -0.209  -6.813  3.612  1.00 0.00 ? 105 VAL A CA   9  
ATOM   4018 C  C    . VAL A 1 4  ? -1.258  -7.901  3.855  1.00 0.00 ? 105 VAL A C    9  
ATOM   4019 O  O    . VAL A 1 4  ? -2.270  -7.959  3.159  1.00 0.00 ? 105 VAL A O    9  
ATOM   4020 C  CB   . VAL A 1 4  ? -0.635  -5.443  4.143  1.00 0.00 ? 105 VAL A CB   9  
ATOM   4021 C  CG1  . VAL A 1 4  ? -0.431  -5.355  5.658  1.00 0.00 ? 105 VAL A CG1  9  
ATOM   4022 C  CG2  . VAL A 1 4  ? 0.113   -4.320  3.423  1.00 0.00 ? 105 VAL A CG2  9  
ATOM   4023 H  H    . VAL A 1 4  ? -0.716  -6.521  1.613  1.00 0.00 ? 105 VAL A H    9  
ATOM   4024 H  HA   . VAL A 1 4  ? 0.715   -7.098  4.115  1.00 0.00 ? 105 VAL A HA   9  
ATOM   4025 H  HB   . VAL A 1 4  ? -1.698  -5.321  3.941  1.00 0.00 ? 105 VAL A HB   9  
ATOM   4026 H  HG11 . VAL A 1 4  ? -0.907  -6.210  6.138  1.00 0.00 ? 105 VAL A HG11 9  
ATOM   4027 H  HG12 . VAL A 1 4  ? 0.635   -5.361  5.882  1.00 0.00 ? 105 VAL A HG12 9  
ATOM   4028 H  HG13 . VAL A 1 4  ? -0.876  -4.433  6.031  1.00 0.00 ? 105 VAL A HG13 9  
ATOM   4029 H  HG21 . VAL A 1 4  ? -0.362  -4.125  2.462  1.00 0.00 ? 105 VAL A HG21 9  
ATOM   4030 H  HG22 . VAL A 1 4  ? 0.084   -3.416  4.032  1.00 0.00 ? 105 VAL A HG22 9  
ATOM   4031 H  HG23 . VAL A 1 4  ? 1.149   -4.617  3.263  1.00 0.00 ? 105 VAL A HG23 9  
ATOM   4032 N  N    . CYS A 1 5  ? -0.979  -8.736  4.845  1.00 0.00 ? 106 CYS A N    9  
ATOM   4033 C  CA   . CYS A 1 5  ? -1.885  -9.819  5.188  1.00 0.00 ? 106 CYS A CA   9  
ATOM   4034 C  C    . CYS A 1 5  ? -3.190  -9.207  5.702  1.00 0.00 ? 106 CYS A C    9  
ATOM   4035 O  O    . CYS A 1 5  ? -3.236  -8.672  6.808  1.00 0.00 ? 106 CYS A O    9  
ATOM   4036 C  CB   . CYS A 1 5  ? -1.263  -10.775 6.208  1.00 0.00 ? 106 CYS A CB   9  
ATOM   4037 S  SG   . CYS A 1 5  ? -2.315  -12.261 6.394  1.00 0.00 ? 106 CYS A SG   9  
ATOM   4038 H  H    . CYS A 1 5  ? -0.153  -8.682  5.407  1.00 0.00 ? 106 CYS A H    9  
ATOM   4039 H  HA   . CYS A 1 5  ? -2.056  -10.386 4.274  1.00 0.00 ? 106 CYS A HA   9  
ATOM   4040 H  HB2  . CYS A 1 5  ? -0.263  -11.065 5.884  1.00 0.00 ? 106 CYS A HB2  9  
ATOM   4041 H  HB3  . CYS A 1 5  ? -1.155  -10.274 7.169  1.00 0.00 ? 106 CYS A HB3  9  
ATOM   4042 N  N    . GLU A 1 6  ? -4.220  -9.308  4.874  1.00 0.00 ? 107 GLU A N    9  
ATOM   4043 C  CA   . GLU A 1 6  ? -5.522  -8.772  5.230  1.00 0.00 ? 107 GLU A CA   9  
ATOM   4044 C  C    . GLU A 1 6  ? -6.021  -9.410  6.527  1.00 0.00 ? 107 GLU A C    9  
ATOM   4045 O  O    . GLU A 1 6  ? -7.072  -9.033  7.044  1.00 0.00 ? 107 GLU A O    9  
ATOM   4046 C  CB   . GLU A 1 6  ? -6.528  -8.978  4.096  1.00 0.00 ? 107 GLU A CB   9  
ATOM   4047 C  CG   . GLU A 1 6  ? -5.860  -8.803  2.730  1.00 0.00 ? 107 GLU A CG   9  
ATOM   4048 C  CD   . GLU A 1 6  ? -5.516  -10.159 2.111  1.00 0.00 ? 107 GLU A CD   9  
ATOM   4049 O  OE1  . GLU A 1 6  ? -5.291  -11.102 2.898  1.00 0.00 ? 107 GLU A OE1  9  
ATOM   4050 O  OE2  . GLU A 1 6  ? -5.485  -10.220 0.862  1.00 0.00 ? 107 GLU A OE2  9  
ATOM   4051 H  H    . GLU A 1 6  ? -4.173  -9.746  3.975  1.00 0.00 ? 107 GLU A H    9  
ATOM   4052 H  HA   . GLU A 1 6  ? -5.366  -7.704  5.378  1.00 0.00 ? 107 GLU A HA   9  
ATOM   4053 H  HB2  . GLU A 1 6  ? -6.963  -9.975  4.166  1.00 0.00 ? 107 GLU A HB2  9  
ATOM   4054 H  HB3  . GLU A 1 6  ? -7.348  -8.266  4.197  1.00 0.00 ? 107 GLU A HB3  9  
ATOM   4055 H  HG2  . GLU A 1 6  ? -6.524  -8.252  2.064  1.00 0.00 ? 107 GLU A HG2  9  
ATOM   4056 H  HG3  . GLU A 1 6  ? -4.953  -8.208  2.839  1.00 0.00 ? 107 GLU A HG3  9  
ATOM   4057 N  N    . VAL A 1 7  ? -5.244  -10.364 7.018  1.00 0.00 ? 108 VAL A N    9  
ATOM   4058 C  CA   . VAL A 1 7  ? -5.594  -11.057 8.247  1.00 0.00 ? 108 VAL A CA   9  
ATOM   4059 C  C    . VAL A 1 7  ? -4.881  -10.389 9.424  1.00 0.00 ? 108 VAL A C    9  
ATOM   4060 O  O    . VAL A 1 7  ? -5.521  -9.757  10.264 1.00 0.00 ? 108 VAL A O    9  
ATOM   4061 C  CB   . VAL A 1 7  ? -5.271  -12.546 8.118  1.00 0.00 ? 108 VAL A CB   9  
ATOM   4062 C  CG1  . VAL A 1 7  ? -5.390  -13.252 9.470  1.00 0.00 ? 108 VAL A CG1  9  
ATOM   4063 C  CG2  . VAL A 1 7  ? -6.164  -13.213 7.070  1.00 0.00 ? 108 VAL A CG2  9  
ATOM   4064 H  H    . VAL A 1 7  ? -4.391  -10.664 6.592  1.00 0.00 ? 108 VAL A H    9  
ATOM   4065 H  HA   . VAL A 1 7  ? -6.670  -10.956 8.385  1.00 0.00 ? 108 VAL A HA   9  
ATOM   4066 H  HB   . VAL A 1 7  ? -4.237  -12.637 7.783  1.00 0.00 ? 108 VAL A HB   9  
ATOM   4067 H  HG11 . VAL A 1 7  ? -4.769  -12.740 10.203 1.00 0.00 ? 108 VAL A HG11 9  
ATOM   4068 H  HG12 . VAL A 1 7  ? -6.430  -13.235 9.798  1.00 0.00 ? 108 VAL A HG12 9  
ATOM   4069 H  HG13 . VAL A 1 7  ? -5.058  -14.286 9.370  1.00 0.00 ? 108 VAL A HG13 9  
ATOM   4070 H  HG21 . VAL A 1 7  ? -6.809  -12.463 6.614  1.00 0.00 ? 108 VAL A HG21 9  
ATOM   4071 H  HG22 . VAL A 1 7  ? -5.541  -13.672 6.301  1.00 0.00 ? 108 VAL A HG22 9  
ATOM   4072 H  HG23 . VAL A 1 7  ? -6.775  -13.978 7.547  1.00 0.00 ? 108 VAL A HG23 9  
ATOM   4073 N  N    . CYS A 1 8  ? -3.566  -10.554 9.449  1.00 0.00 ? 109 CYS A N    9  
ATOM   4074 C  CA   . CYS A 1 8  ? -2.760  -9.975  10.510 1.00 0.00 ? 109 CYS A CA   9  
ATOM   4075 C  C    . CYS A 1 8  ? -2.130  -8.684  9.985  1.00 0.00 ? 109 CYS A C    9  
ATOM   4076 O  O    . CYS A 1 8  ? -1.096  -8.244  10.486 1.00 0.00 ? 109 CYS A O    9  
ATOM   4077 C  CB   . CYS A 1 8  ? -1.705  -10.959 11.018 1.00 0.00 ? 109 CYS A CB   9  
ATOM   4078 S  SG   . CYS A 1 8  ? -0.425  -11.223 9.737  1.00 0.00 ? 109 CYS A SG   9  
ATOM   4079 H  H    . CYS A 1 8  ? -3.055  -11.069 8.762  1.00 0.00 ? 109 CYS A H    9  
ATOM   4080 H  HA   . CYS A 1 8  ? -3.436  -9.767  11.339 1.00 0.00 ? 109 CYS A HA   9  
ATOM   4081 H  HB2  . CYS A 1 8  ? -1.246  -10.574 11.929 1.00 0.00 ? 109 CYS A HB2  9  
ATOM   4082 H  HB3  . CYS A 1 8  ? -2.175  -11.908 11.276 1.00 0.00 ? 109 CYS A HB3  9  
ATOM   4083 N  N    . THR A 1 9  ? -2.779  -8.112  8.981  1.00 0.00 ? 110 THR A N    9  
ATOM   4084 C  CA   . THR A 1 9  ? -2.296  -6.879  8.382  1.00 0.00 ? 110 THR A CA   9  
ATOM   4085 C  C    . THR A 1 9  ? -0.769  -6.809  8.465  1.00 0.00 ? 110 THR A C    9  
ATOM   4086 O  O    . THR A 1 9  ? -0.216  -5.857  9.012  1.00 0.00 ? 110 THR A O    9  
ATOM   4087 C  CB   . THR A 1 9  ? -2.995  -5.709  9.078  1.00 0.00 ? 110 THR A CB   9  
ATOM   4088 O  OG1  . THR A 1 9  ? -2.421  -5.687  10.382 1.00 0.00 ? 110 THR A OG1  9  
ATOM   4089 C  CG2  . THR A 1 9  ? -4.480  -5.980  9.328  1.00 0.00 ? 110 THR A CG2  9  
ATOM   4090 H  H    . THR A 1 9  ? -3.620  -8.475  8.580  1.00 0.00 ? 110 THR A H    9  
ATOM   4091 H  HA   . THR A 1 9  ? -2.559  -6.884  7.325  1.00 0.00 ? 110 THR A HA   9  
ATOM   4092 H  HB   . THR A 1 9  ? -2.857  -4.784  8.517  1.00 0.00 ? 110 THR A HB   9  
ATOM   4093 H  HG1  . THR A 1 9  ? -2.451  -4.758  10.753 1.00 0.00 ? 110 THR A HG1  9  
ATOM   4094 H  HG21 . THR A 1 9  ? -4.920  -5.132  9.853  1.00 0.00 ? 110 THR A HG21 9  
ATOM   4095 H  HG22 . THR A 1 9  ? -4.989  -6.123  8.375  1.00 0.00 ? 110 THR A HG22 9  
ATOM   4096 H  HG23 . THR A 1 9  ? -4.587  -6.879  9.936  1.00 0.00 ? 110 THR A HG23 9  
ATOM   4097 N  N    . ARG A 1 10 ? -0.132  -7.832  7.912  1.00 0.00 ? 111 ARG A N    9  
ATOM   4098 C  CA   . ARG A 1 10 ? 1.319   -7.899  7.917  1.00 0.00 ? 111 ARG A CA   9  
ATOM   4099 C  C    . ARG A 1 10 ? 1.867   -7.643  6.511  1.00 0.00 ? 111 ARG A C    9  
ATOM   4100 O  O    . ARG A 1 10 ? 1.524   -8.354  5.568  1.00 0.00 ? 111 ARG A O    9  
ATOM   4101 C  CB   . ARG A 1 10 ? 1.807   -9.264  8.405  1.00 0.00 ? 111 ARG A CB   9  
ATOM   4102 C  CG   . ARG A 1 10 ? 1.923   -9.292  9.931  1.00 0.00 ? 111 ARG A CG   9  
ATOM   4103 C  CD   . ARG A 1 10 ? 2.582   -10.588 10.407 1.00 0.00 ? 111 ARG A CD   9  
ATOM   4104 N  NE   . ARG A 1 10 ? 4.037   -10.543 10.140 1.00 0.00 ? 111 ARG A NE   9  
ATOM   4105 C  CZ   . ARG A 1 10 ? 4.901   -11.492 10.524 1.00 0.00 ? 111 ARG A CZ   9  
ATOM   4106 N  NH1  . ARG A 1 10 ? 4.651   -12.779 10.246 1.00 0.00 ? 111 ARG A NH1  9  
ATOM   4107 N  NH2  . ARG A 1 10 ? 6.016   -11.156 11.186 1.00 0.00 ? 111 ARG A NH2  9  
ATOM   4108 H  H    . ARG A 1 10 ? -0.589  -8.603  7.470  1.00 0.00 ? 111 ARG A H    9  
ATOM   4109 H  HA   . ARG A 1 10 ? 1.633   -7.116  8.608  1.00 0.00 ? 111 ARG A HA   9  
ATOM   4110 H  HB2  . ARG A 1 10 ? 1.116   -10.040 8.075  1.00 0.00 ? 111 ARG A HB2  9  
ATOM   4111 H  HB3  . ARG A 1 10 ? 2.775   -9.490  7.959  1.00 0.00 ? 111 ARG A HB3  9  
ATOM   4112 H  HG2  . ARG A 1 10 ? 2.507   -8.436  10.269 1.00 0.00 ? 111 ARG A HG2  9  
ATOM   4113 H  HG3  . ARG A 1 10 ? 0.932   -9.199  10.376 1.00 0.00 ? 111 ARG A HG3  9  
ATOM   4114 H  HD2  . ARG A 1 10 ? 2.404   -10.725 11.473 1.00 0.00 ? 111 ARG A HD2  9  
ATOM   4115 H  HD3  . ARG A 1 10 ? 2.137   -11.441 9.896  1.00 0.00 ? 111 ARG A HD3  9  
ATOM   4116 H  HE   . ARG A 1 10 ? 4.399   -9.755  9.641  1.00 0.00 ? 111 ARG A HE   9  
ATOM   4117 H  HH11 . ARG A 1 10 ? 3.726   -13.064 9.988  1.00 0.00 ? 111 ARG A HH11 9  
ATOM   4118 H  HH12 . ARG A 1 10 ? 5.386   -13.454 10.296 1.00 0.00 ? 111 ARG A HH12 9  
ATOM   4119 H  HH21 . ARG A 1 10 ? 6.602   -10.422 10.839 1.00 0.00 ? 111 ARG A HH21 9  
ATOM   4120 H  HH22 . ARG A 1 10 ? 6.264   -11.637 12.027 1.00 0.00 ? 111 ARG A HH22 9  
ATOM   4121 N  N    . ALA A 1 11 ? 2.708   -6.623  6.415  1.00 0.00 ? 112 ALA A N    9  
ATOM   4122 C  CA   . ALA A 1 11 ? 3.306   -6.265  5.140  1.00 0.00 ? 112 ALA A CA   9  
ATOM   4123 C  C    . ALA A 1 11 ? 4.613   -7.040  4.958  1.00 0.00 ? 112 ALA A C    9  
ATOM   4124 O  O    . ALA A 1 11 ? 5.372   -7.216  5.910  1.00 0.00 ? 112 ALA A O    9  
ATOM   4125 C  CB   . ALA A 1 11 ? 3.514   -4.750  5.082  1.00 0.00 ? 112 ALA A CB   9  
ATOM   4126 H  H    . ALA A 1 11 ? 2.983   -6.049  7.187  1.00 0.00 ? 112 ALA A H    9  
ATOM   4127 H  HA   . ALA A 1 11 ? 2.610   -6.553  4.354  1.00 0.00 ? 112 ALA A HA   9  
ATOM   4128 H  HB1  . ALA A 1 11 ? 4.404   -4.527  4.493  1.00 0.00 ? 112 ALA A HB1  9  
ATOM   4129 H  HB2  . ALA A 1 11 ? 2.646   -4.282  4.619  1.00 0.00 ? 112 ALA A HB2  9  
ATOM   4130 H  HB3  . ALA A 1 11 ? 3.641   -4.362  6.093  1.00 0.00 ? 112 ALA A HB3  9  
ATOM   4131 N  N    . PHE A 1 12 ? 4.836   -7.481  3.729  1.00 0.00 ? 113 PHE A N    9  
ATOM   4132 C  CA   . PHE A 1 12 ? 6.038   -8.234  3.410  1.00 0.00 ? 113 PHE A CA   9  
ATOM   4133 C  C    . PHE A 1 12 ? 6.749   -7.639  2.193  1.00 0.00 ? 113 PHE A C    9  
ATOM   4134 O  O    . PHE A 1 12 ? 6.187   -6.804  1.487  1.00 0.00 ? 113 PHE A O    9  
ATOM   4135 C  CB   . PHE A 1 12 ? 5.598   -9.661  3.083  1.00 0.00 ? 113 PHE A CB   9  
ATOM   4136 C  CG   . PHE A 1 12 ? 5.068   -10.441 4.289  1.00 0.00 ? 113 PHE A CG   9  
ATOM   4137 C  CD1  . PHE A 1 12 ? 5.937   -11.045 5.144  1.00 0.00 ? 113 PHE A CD1  9  
ATOM   4138 C  CD2  . PHE A 1 12 ? 3.728   -10.531 4.504  1.00 0.00 ? 113 PHE A CD2  9  
ATOM   4139 C  CE1  . PHE A 1 12 ? 5.446   -11.768 6.262  1.00 0.00 ? 113 PHE A CE1  9  
ATOM   4140 C  CE2  . PHE A 1 12 ? 3.237   -11.254 5.623  1.00 0.00 ? 113 PHE A CE2  9  
ATOM   4141 C  CZ   . PHE A 1 12 ? 4.106   -11.858 6.478  1.00 0.00 ? 113 PHE A CZ   9  
ATOM   4142 H  H    . PHE A 1 12 ? 4.213   -7.333  2.961  1.00 0.00 ? 113 PHE A H    9  
ATOM   4143 H  HA   . PHE A 1 12 ? 6.695   -8.174  4.277  1.00 0.00 ? 113 PHE A HA   9  
ATOM   4144 H  HB2  . PHE A 1 12 ? 4.824   -9.626  2.317  1.00 0.00 ? 113 PHE A HB2  9  
ATOM   4145 H  HB3  . PHE A 1 12 ? 6.442   -10.203 2.656  1.00 0.00 ? 113 PHE A HB3  9  
ATOM   4146 H  HD1  . PHE A 1 12 ? 7.011   -10.972 4.970  1.00 0.00 ? 113 PHE A HD1  9  
ATOM   4147 H  HD2  . PHE A 1 12 ? 3.032   -10.047 3.820  1.00 0.00 ? 113 PHE A HD2  9  
ATOM   4148 H  HE1  . PHE A 1 12 ? 6.142   -12.252 6.947  1.00 0.00 ? 113 PHE A HE1  9  
ATOM   4149 H  HE2  . PHE A 1 12 ? 2.162   -11.326 5.797  1.00 0.00 ? 113 PHE A HE2  9  
ATOM   4150 H  HZ   . PHE A 1 12 ? 3.728   -12.413 7.337  1.00 0.00 ? 113 PHE A HZ   9  
ATOM   4151 N  N    . ALA A 1 13 ? 7.975   -8.095  1.983  1.00 0.00 ? 114 ALA A N    9  
ATOM   4152 C  CA   . ALA A 1 13 ? 8.769   -7.619  0.863  1.00 0.00 ? 114 ALA A CA   9  
ATOM   4153 C  C    . ALA A 1 13 ? 8.507   -8.507  -0.356 1.00 0.00 ? 114 ALA A C    9  
ATOM   4154 O  O    . ALA A 1 13 ? 8.814   -8.125  -1.483 1.00 0.00 ? 114 ALA A O    9  
ATOM   4155 C  CB   . ALA A 1 13 ? 10.247  -7.595  1.259  1.00 0.00 ? 114 ALA A CB   9  
ATOM   4156 H  H    . ALA A 1 13 ? 8.425   -8.775  2.561  1.00 0.00 ? 114 ALA A H    9  
ATOM   4157 H  HA   . ALA A 1 13 ? 8.449   -6.603  0.637  1.00 0.00 ? 114 ALA A HA   9  
ATOM   4158 H  HB1  . ALA A 1 13 ? 10.863  -7.724  0.370  1.00 0.00 ? 114 ALA A HB1  9  
ATOM   4159 H  HB2  . ALA A 1 13 ? 10.481  -6.639  1.727  1.00 0.00 ? 114 ALA A HB2  9  
ATOM   4160 H  HB3  . ALA A 1 13 ? 10.448  -8.403  1.961  1.00 0.00 ? 114 ALA A HB3  9  
ATOM   4161 N  N    . ARG A 1 14 ? 7.941   -9.675  -0.086 1.00 0.00 ? 115 ARG A N    9  
ATOM   4162 C  CA   . ARG A 1 14 ? 7.633   -10.619 -1.147 1.00 0.00 ? 115 ARG A CA   9  
ATOM   4163 C  C    . ARG A 1 14 ? 6.216   -11.168 -0.976 1.00 0.00 ? 115 ARG A C    9  
ATOM   4164 O  O    . ARG A 1 14 ? 5.699   -11.224 0.140  1.00 0.00 ? 115 ARG A O    9  
ATOM   4165 C  CB   . ARG A 1 14 ? 8.626   -11.783 -1.152 1.00 0.00 ? 115 ARG A CB   9  
ATOM   4166 C  CG   . ARG A 1 14 ? 10.055  -11.287 -0.920 1.00 0.00 ? 115 ARG A CG   9  
ATOM   4167 C  CD   . ARG A 1 14 ? 10.620  -10.633 -2.184 1.00 0.00 ? 115 ARG A CD   9  
ATOM   4168 N  NE   . ARG A 1 14 ? 11.232  -11.662 -3.055 1.00 0.00 ? 115 ARG A NE   9  
ATOM   4169 C  CZ   . ARG A 1 14 ? 11.922  -11.387 -4.171 1.00 0.00 ? 115 ARG A CZ   9  
ATOM   4170 N  NH1  . ARG A 1 14 ? 12.738  -10.325 -4.209 1.00 0.00 ? 115 ARG A NH1  9  
ATOM   4171 N  NH2  . ARG A 1 14 ? 11.796  -12.175 -5.246 1.00 0.00 ? 115 ARG A NH2  9  
ATOM   4172 H  H    . ARG A 1 14 ? 7.694   -9.977  0.834  1.00 0.00 ? 115 ARG A H    9  
ATOM   4173 H  HA   . ARG A 1 14 ? 7.722   -10.043 -2.068 1.00 0.00 ? 115 ARG A HA   9  
ATOM   4174 H  HB2  . ARG A 1 14 ? 8.357   -12.499 -0.377 1.00 0.00 ? 115 ARG A HB2  9  
ATOM   4175 H  HB3  . ARG A 1 14 ? 8.571   -12.309 -2.106 1.00 0.00 ? 115 ARG A HB3  9  
ATOM   4176 H  HG2  . ARG A 1 14 ? 10.066  -10.569 -0.100 1.00 0.00 ? 115 ARG A HG2  9  
ATOM   4177 H  HG3  . ARG A 1 14 ? 10.690  -12.121 -0.623 1.00 0.00 ? 115 ARG A HG3  9  
ATOM   4178 H  HD2  . ARG A 1 14 ? 9.826   -10.115 -2.721 1.00 0.00 ? 115 ARG A HD2  9  
ATOM   4179 H  HD3  . ARG A 1 14 ? 11.364  -9.885  -1.914 1.00 0.00 ? 115 ARG A HD3  9  
ATOM   4180 H  HE   . ARG A 1 14 ? 11.122  -12.621 -2.796 1.00 0.00 ? 115 ARG A HE   9  
ATOM   4181 H  HH11 . ARG A 1 14 ? 13.541  -10.290 -3.616 1.00 0.00 ? 115 ARG A HH11 9  
ATOM   4182 H  HH12 . ARG A 1 14 ? 12.542  -9.567  -4.832 1.00 0.00 ? 115 ARG A HH12 9  
ATOM   4183 H  HH21 . ARG A 1 14 ? 11.573  -13.144 -5.134 1.00 0.00 ? 115 ARG A HH21 9  
ATOM   4184 H  HH22 . ARG A 1 14 ? 11.926  -11.795 -6.163 1.00 0.00 ? 115 ARG A HH22 9  
ATOM   4185 N  N    . GLN A 1 15 ? 5.627   -11.559 -2.096 1.00 0.00 ? 116 GLN A N    9  
ATOM   4186 C  CA   . GLN A 1 15 ? 4.279   -12.101 -2.083 1.00 0.00 ? 116 GLN A CA   9  
ATOM   4187 C  C    . GLN A 1 15 ? 4.265   -13.473 -1.405 1.00 0.00 ? 116 GLN A C    9  
ATOM   4188 O  O    . GLN A 1 15 ? 3.429   -13.734 -0.542 1.00 0.00 ? 116 GLN A O    9  
ATOM   4189 C  CB   . GLN A 1 15 ? 3.707   -12.183 -3.500 1.00 0.00 ? 116 GLN A CB   9  
ATOM   4190 C  CG   . GLN A 1 15 ? 4.248   -11.050 -4.375 1.00 0.00 ? 116 GLN A CG   9  
ATOM   4191 C  CD   . GLN A 1 15 ? 5.344   -11.558 -5.314 1.00 0.00 ? 116 GLN A CD   9  
ATOM   4192 O  OE1  . GLN A 1 15 ? 5.146   -12.461 -6.110 1.00 0.00 ? 116 GLN A OE1  9  
ATOM   4193 N  NE2  . GLN A 1 15 ? 6.508   -10.930 -5.175 1.00 0.00 ? 116 GLN A NE2  9  
ATOM   4194 H  H    . GLN A 1 15 ? 6.054   -11.510 -2.998 1.00 0.00 ? 116 GLN A H    9  
ATOM   4195 H  HA   . GLN A 1 15 ? 3.688   -11.395 -1.500 1.00 0.00 ? 116 GLN A HA   9  
ATOM   4196 H  HB2  . GLN A 1 15 ? 3.963   -13.145 -3.944 1.00 0.00 ? 116 GLN A HB2  9  
ATOM   4197 H  HB3  . GLN A 1 15 ? 2.620   -12.130 -3.460 1.00 0.00 ? 116 GLN A HB3  9  
ATOM   4198 H  HG2  . GLN A 1 15 ? 3.435   -10.620 -4.959 1.00 0.00 ? 116 GLN A HG2  9  
ATOM   4199 H  HG3  . GLN A 1 15 ? 4.644   -10.255 -3.744 1.00 0.00 ? 116 GLN A HG3  9  
ATOM   4200 H  HE21 . GLN A 1 15 ? 7.183   -11.266 -4.517 1.00 0.00 ? 116 GLN A HE21 9  
ATOM   4201 H  HE22 . GLN A 1 15 ? 6.709   -10.122 -5.729 1.00 0.00 ? 116 GLN A HE22 9  
ATOM   4202 N  N    . GLU A 1 16 ? 5.201   -14.313 -1.823 1.00 0.00 ? 117 GLU A N    9  
ATOM   4203 C  CA   . GLU A 1 16 ? 5.307   -15.652 -1.268 1.00 0.00 ? 117 GLU A CA   9  
ATOM   4204 C  C    . GLU A 1 16 ? 5.230   -15.601 0.260  1.00 0.00 ? 117 GLU A C    9  
ATOM   4205 O  O    . GLU A 1 16 ? 4.535   -16.407 0.877  1.00 0.00 ? 117 GLU A O    9  
ATOM   4206 C  CB   . GLU A 1 16 ? 6.595   -16.336 -1.729 1.00 0.00 ? 117 GLU A CB   9  
ATOM   4207 C  CG   . GLU A 1 16 ? 6.898   -16.007 -3.193 1.00 0.00 ? 117 GLU A CG   9  
ATOM   4208 C  CD   . GLU A 1 16 ? 5.606   -15.879 -4.003 1.00 0.00 ? 117 GLU A CD   9  
ATOM   4209 O  OE1  . GLU A 1 16 ? 4.805   -16.837 -3.950 1.00 0.00 ? 117 GLU A OE1  9  
ATOM   4210 O  OE2  . GLU A 1 16 ? 5.450   -14.825 -4.658 1.00 0.00 ? 117 GLU A OE2  9  
ATOM   4211 H  H    . GLU A 1 16 ? 5.876   -14.093 -2.527 1.00 0.00 ? 117 GLU A H    9  
ATOM   4212 H  HA   . GLU A 1 16 ? 4.450   -16.198 -1.663 1.00 0.00 ? 117 GLU A HA   9  
ATOM   4213 H  HB2  . GLU A 1 16 ? 7.426   -16.016 -1.101 1.00 0.00 ? 117 GLU A HB2  9  
ATOM   4214 H  HB3  . GLU A 1 16 ? 6.501   -17.415 -1.608 1.00 0.00 ? 117 GLU A HB3  9  
ATOM   4215 H  HG2  . GLU A 1 16 ? 7.461   -15.076 -3.250 1.00 0.00 ? 117 GLU A HG2  9  
ATOM   4216 H  HG3  . GLU A 1 16 ? 7.525   -16.787 -3.622 1.00 0.00 ? 117 GLU A HG3  9  
ATOM   4217 N  N    . HIS A 1 17 ? 5.952   -14.644 0.824  1.00 0.00 ? 118 HIS A N    9  
ATOM   4218 C  CA   . HIS A 1 17 ? 5.974   -14.477 2.267  1.00 0.00 ? 118 HIS A CA   9  
ATOM   4219 C  C    . HIS A 1 17 ? 4.541   -14.432 2.801  1.00 0.00 ? 118 HIS A C    9  
ATOM   4220 O  O    . HIS A 1 17 ? 4.211   -15.123 3.765  1.00 0.00 ? 118 HIS A O    9  
ATOM   4221 C  CB   . HIS A 1 17 ? 6.790   -13.244 2.660  1.00 0.00 ? 118 HIS A CB   9  
ATOM   4222 C  CG   . HIS A 1 17 ? 8.264   -13.361 2.353  1.00 0.00 ? 118 HIS A CG   9  
ATOM   4223 N  ND1  . HIS A 1 17 ? 9.195   -12.427 2.777  1.00 0.00 ? 118 HIS A ND1  9  
ATOM   4224 C  CD2  . HIS A 1 17 ? 8.959   -14.311 1.663  1.00 0.00 ? 118 HIS A CD2  9  
ATOM   4225 C  CE1  . HIS A 1 17 ? 10.391  -12.808 2.354  1.00 0.00 ? 118 HIS A CE1  9  
ATOM   4226 N  NE2  . HIS A 1 17 ? 10.243  -13.975 1.664  1.00 0.00 ? 118 HIS A NE2  9  
ATOM   4227 H  H    . HIS A 1 17 ? 6.514   -13.992 0.315  1.00 0.00 ? 118 HIS A H    9  
ATOM   4228 H  HA   . HIS A 1 17 ? 6.477   -15.353 2.677  1.00 0.00 ? 118 HIS A HA   9  
ATOM   4229 H  HB2  . HIS A 1 17 ? 6.390   -12.375 2.138  1.00 0.00 ? 118 HIS A HB2  9  
ATOM   4230 H  HB3  . HIS A 1 17 ? 6.664   -13.062 3.727  1.00 0.00 ? 118 HIS A HB3  9  
ATOM   4231 H  HD1  . HIS A 1 17 ? 8.997   -11.606 3.310  1.00 0.00 ? 118 HIS A HD1  9  
ATOM   4232 H  HD2  . HIS A 1 17 ? 8.531   -15.196 1.191  1.00 0.00 ? 118 HIS A HD2  9  
ATOM   4233 H  HE1  . HIS A 1 17 ? 11.330  -12.281 2.527  1.00 0.00 ? 118 HIS A HE1  9  
ATOM   4234 H  HE2  . HIS A 1 17 ? 10.987  -14.521 1.278  1.00 0.00 ? 118 HIS A HE2  9  
ATOM   4235 N  N    . LEU A 1 18 ? 3.727   -13.614 2.151  1.00 0.00 ? 119 LEU A N    9  
ATOM   4236 C  CA   . LEU A 1 18 ? 2.336   -13.470 2.549  1.00 0.00 ? 119 LEU A CA   9  
ATOM   4237 C  C    . LEU A 1 18 ? 1.611   -14.801 2.342  1.00 0.00 ? 119 LEU A C    9  
ATOM   4238 O  O    . LEU A 1 18 ? 1.123   -15.401 3.297  1.00 0.00 ? 119 LEU A O    9  
ATOM   4239 C  CB   . LEU A 1 18 ? 1.687   -12.295 1.813  1.00 0.00 ? 119 LEU A CB   9  
ATOM   4240 C  CG   . LEU A 1 18 ? 0.175   -12.391 1.600  1.00 0.00 ? 119 LEU A CG   9  
ATOM   4241 C  CD1  . LEU A 1 18 ? -0.532  -12.842 2.879  1.00 0.00 ? 119 LEU A CD1  9  
ATOM   4242 C  CD2  . LEU A 1 18 ? -0.388  -11.071 1.068  1.00 0.00 ? 119 LEU A CD2  9  
ATOM   4243 H  H    . LEU A 1 18 ? 4.002   -13.055 1.369  1.00 0.00 ? 119 LEU A H    9  
ATOM   4244 H  HA   . LEU A 1 18 ? 2.322   -13.231 3.612  1.00 0.00 ? 119 LEU A HA   9  
ATOM   4245 H  HB2  . LEU A 1 18 ? 1.899   -11.382 2.369  1.00 0.00 ? 119 LEU A HB2  9  
ATOM   4246 H  HB3  . LEU A 1 18 ? 2.166   -12.194 0.839  1.00 0.00 ? 119 LEU A HB3  9  
ATOM   4247 H  HG   . LEU A 1 18 ? -0.016  -13.150 0.842  1.00 0.00 ? 119 LEU A HG   9  
ATOM   4248 H  HD11 . LEU A 1 18 ? -0.319  -13.895 3.060  1.00 0.00 ? 119 LEU A HD11 9  
ATOM   4249 H  HD12 . LEU A 1 18 ? -0.173  -12.249 3.721  1.00 0.00 ? 119 LEU A HD12 9  
ATOM   4250 H  HD13 . LEU A 1 18 ? -1.607  -12.701 2.769  1.00 0.00 ? 119 LEU A HD13 9  
ATOM   4251 H  HD21 . LEU A 1 18 ? -0.514  -10.370 1.895  1.00 0.00 ? 119 LEU A HD21 9  
ATOM   4252 H  HD22 . LEU A 1 18 ? 0.302   -10.650 0.337  1.00 0.00 ? 119 LEU A HD22 9  
ATOM   4253 H  HD23 . LEU A 1 18 ? -1.352  -11.251 0.595  1.00 0.00 ? 119 LEU A HD23 9  
ATOM   4254 N  N    . LYS A 1 19 ? 1.564   -15.224 1.087  1.00 0.00 ? 120 LYS A N    9  
ATOM   4255 C  CA   . LYS A 1 19 ? 0.907   -16.473 0.742  1.00 0.00 ? 120 LYS A CA   9  
ATOM   4256 C  C    . LYS A 1 19 ? 1.341   -17.562 1.726  1.00 0.00 ? 120 LYS A C    9  
ATOM   4257 O  O    . LYS A 1 19 ? 0.516   -18.107 2.457  1.00 0.00 ? 120 LYS A O    9  
ATOM   4258 C  CB   . LYS A 1 19 ? 1.168   -16.829 -0.723 1.00 0.00 ? 120 LYS A CB   9  
ATOM   4259 C  CG   . LYS A 1 19 ? 0.777   -18.280 -1.012 1.00 0.00 ? 120 LYS A CG   9  
ATOM   4260 C  CD   . LYS A 1 19 ? -0.182  -18.363 -2.202 1.00 0.00 ? 120 LYS A CD   9  
ATOM   4261 C  CE   . LYS A 1 19 ? 0.587   -18.373 -3.525 1.00 0.00 ? 120 LYS A CE   9  
ATOM   4262 N  NZ   . LYS A 1 19 ? -0.192  -17.689 -4.582 1.00 0.00 ? 120 LYS A NZ   9  
ATOM   4263 H  H    . LYS A 1 19 ? 1.964   -14.730 0.315  1.00 0.00 ? 120 LYS A H    9  
ATOM   4264 H  HA   . LYS A 1 19 ? -0.166  -16.318 0.850  1.00 0.00 ? 120 LYS A HA   9  
ATOM   4265 H  HB2  . LYS A 1 19 ? 0.601   -16.161 -1.370 1.00 0.00 ? 120 LYS A HB2  9  
ATOM   4266 H  HB3  . LYS A 1 19 ? 2.223   -16.680 -0.955 1.00 0.00 ? 120 LYS A HB3  9  
ATOM   4267 H  HG2  . LYS A 1 19 ? 1.671   -18.867 -1.220 1.00 0.00 ? 120 LYS A HG2  9  
ATOM   4268 H  HG3  . LYS A 1 19 ? 0.306   -18.716 -0.131 1.00 0.00 ? 120 LYS A HG3  9  
ATOM   4269 H  HD2  . LYS A 1 19 ? -0.789  -19.264 -2.123 1.00 0.00 ? 120 LYS A HD2  9  
ATOM   4270 H  HD3  . LYS A 1 19 ? -0.866  -17.514 -2.182 1.00 0.00 ? 120 LYS A HD3  9  
ATOM   4271 H  HE2  . LYS A 1 19 ? 1.550   -17.879 -3.397 1.00 0.00 ? 120 LYS A HE2  9  
ATOM   4272 H  HE3  . LYS A 1 19 ? 0.793   -19.401 -3.825 1.00 0.00 ? 120 LYS A HE3  9  
ATOM   4273 H  HZ1  . LYS A 1 19 ? -0.232  -16.710 -4.385 1.00 0.00 ? 120 LYS A HZ1  9  
ATOM   4274 H  HZ2  . LYS A 1 19 ? 0.250   -17.833 -5.468 1.00 0.00 ? 120 LYS A HZ2  9  
ATOM   4275 H  HZ3  . LYS A 1 19 ? -1.119  -18.063 -4.608 1.00 0.00 ? 120 LYS A HZ3  9  
ATOM   4276 N  N    . ARG A 1 20 ? 2.636   -17.844 1.713  1.00 0.00 ? 121 ARG A N    9  
ATOM   4277 C  CA   . ARG A 1 20 ? 3.190   -18.857 2.595  1.00 0.00 ? 121 ARG A CA   9  
ATOM   4278 C  C    . ARG A 1 20 ? 2.765   -18.591 4.041  1.00 0.00 ? 121 ARG A C    9  
ATOM   4279 O  O    . ARG A 1 20 ? 2.556   -19.527 4.812  1.00 0.00 ? 121 ARG A O    9  
ATOM   4280 C  CB   . ARG A 1 20 ? 4.717   -18.882 2.515  1.00 0.00 ? 121 ARG A CB   9  
ATOM   4281 C  CG   . ARG A 1 20 ? 5.256   -20.294 2.750  1.00 0.00 ? 121 ARG A CG   9  
ATOM   4282 C  CD   . ARG A 1 20 ? 4.916   -21.214 1.576  1.00 0.00 ? 121 ARG A CD   9  
ATOM   4283 N  NE   . ARG A 1 20 ? 6.045   -21.252 0.619  1.00 0.00 ? 121 ARG A NE   9  
ATOM   4284 C  CZ   . ARG A 1 20 ? 7.334   -21.319 0.981  1.00 0.00 ? 121 ARG A CZ   9  
ATOM   4285 N  NH1  . ARG A 1 20 ? 7.844   -22.473 1.431  1.00 0.00 ? 121 ARG A NH1  9  
ATOM   4286 N  NH2  . ARG A 1 20 ? 8.112   -20.232 0.893  1.00 0.00 ? 121 ARG A NH2  9  
ATOM   4287 H  H    . ARG A 1 20 ? 3.300   -17.396 1.115  1.00 0.00 ? 121 ARG A H    9  
ATOM   4288 H  HA   . ARG A 1 20 ? 2.776   -19.799 2.233  1.00 0.00 ? 121 ARG A HA   9  
ATOM   4289 H  HB2  . ARG A 1 20 ? 5.039   -18.525 1.537  1.00 0.00 ? 121 ARG A HB2  9  
ATOM   4290 H  HB3  . ARG A 1 20 ? 5.135   -18.201 3.257  1.00 0.00 ? 121 ARG A HB3  9  
ATOM   4291 H  HG2  . ARG A 1 20 ? 6.336   -20.257 2.887  1.00 0.00 ? 121 ARG A HG2  9  
ATOM   4292 H  HG3  . ARG A 1 20 ? 4.832   -20.700 3.669  1.00 0.00 ? 121 ARG A HG3  9  
ATOM   4293 H  HD2  . ARG A 1 20 ? 4.703   -22.219 1.939  1.00 0.00 ? 121 ARG A HD2  9  
ATOM   4294 H  HD3  . ARG A 1 20 ? 4.016   -20.859 1.074  1.00 0.00 ? 121 ARG A HD3  9  
ATOM   4295 H  HE   . ARG A 1 20 ? 5.833   -21.226 -0.358 1.00 0.00 ? 121 ARG A HE   9  
ATOM   4296 H  HH11 . ARG A 1 20 ? 7.579   -23.338 1.003  1.00 0.00 ? 121 ARG A HH11 9  
ATOM   4297 H  HH12 . ARG A 1 20 ? 8.492   -22.470 2.193  1.00 0.00 ? 121 ARG A HH12 9  
ATOM   4298 H  HH21 . ARG A 1 20 ? 7.702   -19.320 0.926  1.00 0.00 ? 121 ARG A HH21 9  
ATOM   4299 H  HH22 . ARG A 1 20 ? 9.102   -20.331 0.796  1.00 0.00 ? 121 ARG A HH22 9  
ATOM   4300 N  N    . HIS A 1 21 ? 2.652   -17.311 4.365  1.00 0.00 ? 122 HIS A N    9  
ATOM   4301 C  CA   . HIS A 1 21 ? 2.257   -16.910 5.704  1.00 0.00 ? 122 HIS A CA   9  
ATOM   4302 C  C    . HIS A 1 21 ? 0.813   -17.343 5.965  1.00 0.00 ? 122 HIS A C    9  
ATOM   4303 O  O    . HIS A 1 21 ? 0.533   -18.024 6.949  1.00 0.00 ? 122 HIS A O    9  
ATOM   4304 C  CB   . HIS A 1 21 ? 2.472   -15.410 5.907  1.00 0.00 ? 122 HIS A CB   9  
ATOM   4305 C  CG   . HIS A 1 21 ? 1.592   -14.802 6.974  1.00 0.00 ? 122 HIS A CG   9  
ATOM   4306 N  ND1  . HIS A 1 21 ? 1.871   -14.905 8.325  1.00 0.00 ? 122 HIS A ND1  9  
ATOM   4307 C  CD2  . HIS A 1 21 ? 0.437   -14.084 6.873  1.00 0.00 ? 122 HIS A CD2  9  
ATOM   4308 C  CE1  . HIS A 1 21 ? 0.921   -14.274 8.999  1.00 0.00 ? 122 HIS A CE1  9  
ATOM   4309 N  NE2  . HIS A 1 21 ? 0.032   -13.766 8.097  1.00 0.00 ? 122 HIS A NE2  9  
ATOM   4310 H  H    . HIS A 1 21 ? 2.824   -16.557 3.731  1.00 0.00 ? 122 HIS A H    9  
ATOM   4311 H  HA   . HIS A 1 21 ? 2.915   -17.438 6.395  1.00 0.00 ? 122 HIS A HA   9  
ATOM   4312 H  HB2  . HIS A 1 21 ? 3.515   -15.235 6.170  1.00 0.00 ? 122 HIS A HB2  9  
ATOM   4313 H  HB3  . HIS A 1 21 ? 2.289   -14.896 4.964  1.00 0.00 ? 122 HIS A HB3  9  
ATOM   4314 H  HD1  . HIS A 1 21 ? 2.658   -15.375 8.726  1.00 0.00 ? 122 HIS A HD1  9  
ATOM   4315 H  HD2  . HIS A 1 21 ? -0.069  -13.817 5.945  1.00 0.00 ? 122 HIS A HD2  9  
ATOM   4316 H  HE1  . HIS A 1 21 ? 0.859   -14.178 10.082 1.00 0.00 ? 122 HIS A HE1  9  
ATOM   4317 N  N    . TYR A 1 22 ? -0.066  -16.930 5.063  1.00 0.00 ? 123 TYR A N    9  
ATOM   4318 C  CA   . TYR A 1 22 ? -1.474  -17.267 5.183  1.00 0.00 ? 123 TYR A CA   9  
ATOM   4319 C  C    . TYR A 1 22 ? -1.655  -18.686 5.726  1.00 0.00 ? 123 TYR A C    9  
ATOM   4320 O  O    . TYR A 1 22 ? -2.581  -18.949 6.492  1.00 0.00 ? 123 TYR A O    9  
ATOM   4321 C  CB   . TYR A 1 22 ? -2.047  -17.198 3.766  1.00 0.00 ? 123 TYR A CB   9  
ATOM   4322 C  CG   . TYR A 1 22 ? -3.177  -16.180 3.600  1.00 0.00 ? 123 TYR A CG   9  
ATOM   4323 C  CD1  . TYR A 1 22 ? -4.443  -16.474 4.065  1.00 0.00 ? 123 TYR A CD1  9  
ATOM   4324 C  CD2  . TYR A 1 22 ? -2.931  -14.970 2.983  1.00 0.00 ? 123 TYR A CD2  9  
ATOM   4325 C  CE1  . TYR A 1 22 ? -5.507  -15.516 3.909  1.00 0.00 ? 123 TYR A CE1  9  
ATOM   4326 C  CE2  . TYR A 1 22 ? -3.995  -14.014 2.826  1.00 0.00 ? 123 TYR A CE2  9  
ATOM   4327 C  CZ   . TYR A 1 22 ? -5.231  -14.333 3.296  1.00 0.00 ? 123 TYR A CZ   9  
ATOM   4328 O  OH   . TYR A 1 22 ? -6.235  -13.428 3.148  1.00 0.00 ? 123 TYR A OH   9  
ATOM   4329 H  H    . TYR A 1 22 ? 0.170   -16.376 4.265  1.00 0.00 ? 123 TYR A H    9  
ATOM   4330 H  HA   . TYR A 1 22 ? -1.932  -16.561 5.876  1.00 0.00 ? 123 TYR A HA   9  
ATOM   4331 H  HB2  . TYR A 1 22 ? -1.243  -16.950 3.072  1.00 0.00 ? 123 TYR A HB2  9  
ATOM   4332 H  HB3  . TYR A 1 22 ? -2.416  -18.186 3.486  1.00 0.00 ? 123 TYR A HB3  9  
ATOM   4333 H  HD1  . TYR A 1 22 ? -4.637  -17.429 4.552  1.00 0.00 ? 123 TYR A HD1  9  
ATOM   4334 H  HD2  . TYR A 1 22 ? -1.931  -14.740 2.615  1.00 0.00 ? 123 TYR A HD2  9  
ATOM   4335 H  HE1  . TYR A 1 22 ? -6.511  -15.733 4.272  1.00 0.00 ? 123 TYR A HE1  9  
ATOM   4336 H  HE2  . TYR A 1 22 ? -3.814  -13.053 2.341  1.00 0.00 ? 123 TYR A HE2  9  
ATOM   4337 H  HH   . TYR A 1 22 ? -6.920  -13.558 3.866  1.00 0.00 ? 123 TYR A HH   9  
ATOM   4338 N  N    . ARG A 1 23 ? -0.757  -19.564 5.306  1.00 0.00 ? 124 ARG A N    9  
ATOM   4339 C  CA   . ARG A 1 23 ? -0.804  -20.950 5.740  1.00 0.00 ? 124 ARG A CA   9  
ATOM   4340 C  C    . ARG A 1 23 ? -1.038  -21.026 7.250  1.00 0.00 ? 124 ARG A C    9  
ATOM   4341 O  O    . ARG A 1 23 ? -1.673  -21.959 7.738  1.00 0.00 ? 124 ARG A O    9  
ATOM   4342 C  CB   . ARG A 1 23 ? 0.493   -21.681 5.393  1.00 0.00 ? 124 ARG A CB   9  
ATOM   4343 C  CG   . ARG A 1 23 ? 1.232   -22.117 6.662  1.00 0.00 ? 124 ARG A CG   9  
ATOM   4344 C  CD   . ARG A 1 23 ? 0.513   -23.284 7.340  1.00 0.00 ? 124 ARG A CD   9  
ATOM   4345 N  NE   . ARG A 1 23 ? 1.420   -24.450 7.438  1.00 0.00 ? 124 ARG A NE   9  
ATOM   4346 C  CZ   . ARG A 1 23 ? 1.332   -25.393 8.386  1.00 0.00 ? 124 ARG A CZ   9  
ATOM   4347 N  NH1  . ARG A 1 23 ? 0.157   -25.636 8.982  1.00 0.00 ? 124 ARG A NH1  9  
ATOM   4348 N  NH2  . ARG A 1 23 ? 2.420   -26.093 8.736  1.00 0.00 ? 124 ARG A NH2  9  
ATOM   4349 H  H    . ARG A 1 23 ? -0.007  -19.343 4.682  1.00 0.00 ? 124 ARG A H    9  
ATOM   4350 H  HA   . ARG A 1 23 ? -1.641  -21.384 5.192  1.00 0.00 ? 124 ARG A HA   9  
ATOM   4351 H  HB2  . ARG A 1 23 ? 0.271   -22.554 4.780  1.00 0.00 ? 124 ARG A HB2  9  
ATOM   4352 H  HB3  . ARG A 1 23 ? 1.135   -21.030 4.801  1.00 0.00 ? 124 ARG A HB3  9  
ATOM   4353 H  HG2  . ARG A 1 23 ? 2.251   -22.410 6.410  1.00 0.00 ? 124 ARG A HG2  9  
ATOM   4354 H  HG3  . ARG A 1 23 ? 1.303   -21.277 7.353  1.00 0.00 ? 124 ARG A HG3  9  
ATOM   4355 H  HD2  . ARG A 1 23 ? 0.180   -22.988 8.335  1.00 0.00 ? 124 ARG A HD2  9  
ATOM   4356 H  HD3  . ARG A 1 23 ? -0.378  -23.553 6.774  1.00 0.00 ? 124 ARG A HD3  9  
ATOM   4357 H  HE   . ARG A 1 23 ? 2.144   -24.539 6.753  1.00 0.00 ? 124 ARG A HE   9  
ATOM   4358 H  HH11 . ARG A 1 23 ? -0.662  -25.785 8.430  1.00 0.00 ? 124 ARG A HH11 9  
ATOM   4359 H  HH12 . ARG A 1 23 ? 0.101   -25.668 9.980  1.00 0.00 ? 124 ARG A HH12 9  
ATOM   4360 H  HH21 . ARG A 1 23 ? 3.235   -25.618 9.068  1.00 0.00 ? 124 ARG A HH21 9  
ATOM   4361 H  HH22 . ARG A 1 23 ? 2.416   -27.091 8.667  1.00 0.00 ? 124 ARG A HH22 9  
ATOM   4362 N  N    . SER A 1 24 ? -0.510  -20.031 7.948  1.00 0.00 ? 125 SER A N    9  
ATOM   4363 C  CA   . SER A 1 24 ? -0.653  -19.973 9.394  1.00 0.00 ? 125 SER A CA   9  
ATOM   4364 C  C    . SER A 1 24 ? -2.082  -19.571 9.763  1.00 0.00 ? 125 SER A C    9  
ATOM   4365 O  O    . SER A 1 24 ? -2.463  -19.623 10.931 1.00 0.00 ? 125 SER A O    9  
ATOM   4366 C  CB   . SER A 1 24 ? 0.349   -18.993 10.007 1.00 0.00 ? 125 SER A CB   9  
ATOM   4367 O  OG   . SER A 1 24 ? 0.393   -17.758 9.296  1.00 0.00 ? 125 SER A OG   9  
ATOM   4368 H  H    . SER A 1 24 ? 0.005   -19.275 7.545  1.00 0.00 ? 125 SER A H    9  
ATOM   4369 H  HA   . SER A 1 24 ? -0.436  -20.981 9.745  1.00 0.00 ? 125 SER A HA   9  
ATOM   4370 H  HB2  . SER A 1 24 ? 0.080   -18.802 11.046 1.00 0.00 ? 125 SER A HB2  9  
ATOM   4371 H  HB3  . SER A 1 24 ? 1.341   -19.444 10.012 1.00 0.00 ? 125 SER A HB3  9  
ATOM   4372 H  HG   . SER A 1 24 ? 1.120   -17.785 8.610  1.00 0.00 ? 125 SER A HG   9  
ATOM   4373 N  N    . HIS A 1 25 ? -2.835  -19.180 8.744  1.00 0.00 ? 126 HIS A N    9  
ATOM   4374 C  CA   . HIS A 1 25 ? -4.214  -18.769 8.947  1.00 0.00 ? 126 HIS A CA   9  
ATOM   4375 C  C    . HIS A 1 25 ? -5.153  -19.907 8.542  1.00 0.00 ? 126 HIS A C    9  
ATOM   4376 O  O    . HIS A 1 25 ? -6.358  -19.835 8.776  1.00 0.00 ? 126 HIS A O    9  
ATOM   4377 C  CB   . HIS A 1 25 ? -4.508  -17.465 8.203  1.00 0.00 ? 126 HIS A CB   9  
ATOM   4378 C  CG   . HIS A 1 25 ? -3.733  -16.276 8.718  1.00 0.00 ? 126 HIS A CG   9  
ATOM   4379 N  ND1  . HIS A 1 25 ? -3.467  -16.080 10.062 1.00 0.00 ? 126 HIS A ND1  9  
ATOM   4380 C  CD2  . HIS A 1 25 ? -3.168  -15.226 8.057  1.00 0.00 ? 126 HIS A CD2  9  
ATOM   4381 C  CE1  . HIS A 1 25 ? -2.774  -14.957 10.192 1.00 0.00 ? 126 HIS A CE1  9  
ATOM   4382 N  NE2  . HIS A 1 25 ? -2.591  -14.429 8.947  1.00 0.00 ? 126 HIS A NE2  9  
ATOM   4383 H  H    . HIS A 1 25 ? -2.517  -19.140 7.797  1.00 0.00 ? 126 HIS A H    9  
ATOM   4384 H  HA   . HIS A 1 25 ? -4.330  -18.577 10.014 1.00 0.00 ? 126 HIS A HA   9  
ATOM   4385 H  HB2  . HIS A 1 25 ? -4.281  -17.603 7.146  1.00 0.00 ? 126 HIS A HB2  9  
ATOM   4386 H  HB3  . HIS A 1 25 ? -5.574  -17.250 8.276  1.00 0.00 ? 126 HIS A HB3  9  
ATOM   4387 H  HD1  . HIS A 1 25 ? -3.750  -16.682 10.808 1.00 0.00 ? 126 HIS A HD1  9  
ATOM   4388 H  HD2  . HIS A 1 25 ? -3.189  -15.067 6.978  1.00 0.00 ? 126 HIS A HD2  9  
ATOM   4389 H  HE1  . HIS A 1 25 ? -2.415  -14.531 11.128 1.00 0.00 ? 126 HIS A HE1  9  
ATOM   4390 N  N    . THR A 1 26 ? -4.564  -20.933 7.943  1.00 0.00 ? 127 THR A N    9  
ATOM   4391 C  CA   . THR A 1 26 ? -5.333  -22.084 7.504  1.00 0.00 ? 127 THR A CA   9  
ATOM   4392 C  C    . THR A 1 26 ? -5.959  -22.798 8.704  1.00 0.00 ? 127 THR A C    9  
ATOM   4393 O  O    . THR A 1 26 ? -6.645  -23.806 8.543  1.00 0.00 ? 127 THR A O    9  
ATOM   4394 C  CB   . THR A 1 26 ? -4.409  -22.982 6.678  1.00 0.00 ? 127 THR A CB   9  
ATOM   4395 O  OG1  . THR A 1 26 ? -3.543  -22.068 6.010  1.00 0.00 ? 127 THR A OG1  9  
ATOM   4396 C  CG2  . THR A 1 26 ? -5.147  -23.694 5.542  1.00 0.00 ? 127 THR A CG2  9  
ATOM   4397 H  H    . THR A 1 26 ? -3.583  -20.983 7.757  1.00 0.00 ? 127 THR A H    9  
ATOM   4398 H  HA   . THR A 1 26 ? -6.153  -21.732 6.878  1.00 0.00 ? 127 THR A HA   9  
ATOM   4399 H  HB   . THR A 1 26 ? -3.891  -23.699 7.315  1.00 0.00 ? 127 THR A HB   9  
ATOM   4400 H  HG1  . THR A 1 26 ? -4.049  -21.570 5.306  1.00 0.00 ? 127 THR A HG1  9  
ATOM   4401 H  HG21 . THR A 1 26 ? -5.835  -24.429 5.960  1.00 0.00 ? 127 THR A HG21 9  
ATOM   4402 H  HG22 . THR A 1 26 ? -5.706  -22.964 4.958  1.00 0.00 ? 127 THR A HG22 9  
ATOM   4403 H  HG23 . THR A 1 26 ? -4.425  -24.197 4.899  1.00 0.00 ? 127 THR A HG23 9  
ATOM   4404 N  N    . ASN A 1 27 ? -5.701  -22.246 9.880  1.00 0.00 ? 128 ASN A N    9  
ATOM   4405 C  CA   . ASN A 1 27 ? -6.230  -22.816 11.107 1.00 0.00 ? 128 ASN A CA   9  
ATOM   4406 C  C    . ASN A 1 27 ? -6.795  -21.695 11.983 1.00 0.00 ? 128 ASN A C    9  
ATOM   4407 O  O    . ASN A 1 27 ? -6.043  -20.974 12.636 1.00 0.00 ? 128 ASN A O    9  
ATOM   4408 C  CB   . ASN A 1 27 ? -5.133  -23.529 11.901 1.00 0.00 ? 128 ASN A CB   9  
ATOM   4409 C  CG   . ASN A 1 27 ? -3.778  -22.851 11.693 1.00 0.00 ? 128 ASN A CG   9  
ATOM   4410 O  OD1  . ASN A 1 27 ? -3.619  -21.655 11.874 1.00 0.00 ? 128 ASN A OD1  9  
ATOM   4411 N  ND2  . ASN A 1 27 ? -2.813  -23.680 11.306 1.00 0.00 ? 128 ASN A ND2  9  
ATOM   4412 H  H    . ASN A 1 27 ? -5.142  -21.425 10.002 1.00 0.00 ? 128 ASN A H    9  
ATOM   4413 H  HA   . ASN A 1 27 ? -6.996  -23.522 10.788 1.00 0.00 ? 128 ASN A HA   9  
ATOM   4414 H  HB2  . ASN A 1 27 ? -5.387  -23.526 12.961 1.00 0.00 ? 128 ASN A HB2  9  
ATOM   4415 H  HB3  . ASN A 1 27 ? -5.074  -24.572 11.590 1.00 0.00 ? 128 ASN A HB3  9  
ATOM   4416 H  HD21 . ASN A 1 27 ? -2.943  -24.255 10.498 1.00 0.00 ? 128 ASN A HD21 9  
ATOM   4417 H  HD22 . ASN A 1 27 ? -1.958  -23.728 11.822 1.00 0.00 ? 128 ASN A HD22 9  
ATOM   4418 N  N    . GLU A 1 28 ? -8.116  -21.585 11.968 1.00 0.00 ? 129 GLU A N    9  
ATOM   4419 C  CA   . GLU A 1 28 ? -8.791  -20.565 12.753 1.00 0.00 ? 129 GLU A CA   9  
ATOM   4420 C  C    . GLU A 1 28 ? -8.811  -20.959 14.231 1.00 0.00 ? 129 GLU A C    9  
ATOM   4421 O  O    . GLU A 1 28 ? -9.051  -22.119 14.564 1.00 0.00 ? 129 GLU A O    9  
ATOM   4422 C  CB   . GLU A 1 28 ? -10.207 -20.319 12.231 1.00 0.00 ? 129 GLU A CB   9  
ATOM   4423 C  CG   . GLU A 1 28 ? -10.199 -19.326 11.067 1.00 0.00 ? 129 GLU A CG   9  
ATOM   4424 C  CD   . GLU A 1 28 ? -10.663 -17.942 11.523 1.00 0.00 ? 129 GLU A CD   9  
ATOM   4425 O  OE1  . GLU A 1 28 ? -11.843 -17.844 11.928 1.00 0.00 ? 129 GLU A OE1  9  
ATOM   4426 O  OE2  . GLU A 1 28 ? -9.830  -17.014 11.459 1.00 0.00 ? 129 GLU A OE2  9  
ATOM   4427 H  H    . GLU A 1 28 ? -8.720  -22.175 11.434 1.00 0.00 ? 129 GLU A H    9  
ATOM   4428 H  HA   . GLU A 1 28 ? -8.199  -19.659 12.620 1.00 0.00 ? 129 GLU A HA   9  
ATOM   4429 H  HB2  . GLU A 1 28 ? -10.647 -21.262 11.906 1.00 0.00 ? 129 GLU A HB2  9  
ATOM   4430 H  HB3  . GLU A 1 28 ? -10.834 -19.937 13.035 1.00 0.00 ? 129 GLU A HB3  9  
ATOM   4431 H  HG2  . GLU A 1 28 ? -9.194  -19.257 10.650 1.00 0.00 ? 129 GLU A HG2  9  
ATOM   4432 H  HG3  . GLU A 1 28 ? -10.849 -19.688 10.270 1.00 0.00 ? 129 GLU A HG3  9  
ATOM   4433 N  N    . LYS A 1 29 ? -8.556  -19.973 15.078 1.00 0.00 ? 130 LYS A N    9  
ATOM   4434 C  CA   . LYS A 1 29 ? -8.542  -20.202 16.512 1.00 0.00 ? 130 LYS A CA   9  
ATOM   4435 C  C    . LYS A 1 29 ? -9.018  -18.939 17.231 1.00 0.00 ? 130 LYS A C    9  
ATOM   4436 O  O    . LYS A 1 29 ? -8.408  -18.509 18.208 1.00 0.00 ? 130 LYS A O    9  
ATOM   4437 C  CB   . LYS A 1 29 ? -7.162  -20.684 16.965 1.00 0.00 ? 130 LYS A CB   9  
ATOM   4438 C  CG   . LYS A 1 29 ? -7.094  -22.213 16.982 1.00 0.00 ? 130 LYS A CG   9  
ATOM   4439 C  CD   . LYS A 1 29 ? -6.078  -22.727 15.960 1.00 0.00 ? 130 LYS A CD   9  
ATOM   4440 C  CE   . LYS A 1 29 ? -4.657  -22.673 16.526 1.00 0.00 ? 130 LYS A CE   9  
ATOM   4441 N  NZ   . LYS A 1 29 ? -4.366  -23.893 17.312 1.00 0.00 ? 130 LYS A NZ   9  
ATOM   4442 H  H    . LYS A 1 29 ? -8.361  -19.032 14.798 1.00 0.00 ? 130 LYS A H    9  
ATOM   4443 H  HA   . LYS A 1 29 ? -9.248  -21.005 16.721 1.00 0.00 ? 130 LYS A HA   9  
ATOM   4444 H  HB2  . LYS A 1 29 ? -6.398  -20.289 16.296 1.00 0.00 ? 130 LYS A HB2  9  
ATOM   4445 H  HB3  . LYS A 1 29 ? -6.946  -20.295 17.960 1.00 0.00 ? 130 LYS A HB3  9  
ATOM   4446 H  HG2  . LYS A 1 29 ? -6.818  -22.555 17.979 1.00 0.00 ? 130 LYS A HG2  9  
ATOM   4447 H  HG3  . LYS A 1 29 ? -8.078  -22.626 16.763 1.00 0.00 ? 130 LYS A HG3  9  
ATOM   4448 H  HD2  . LYS A 1 29 ? -6.324  -23.752 15.682 1.00 0.00 ? 130 LYS A HD2  9  
ATOM   4449 H  HD3  . LYS A 1 29 ? -6.135  -22.129 15.052 1.00 0.00 ? 130 LYS A HD3  9  
ATOM   4450 H  HE2  . LYS A 1 29 ? -3.939  -22.579 15.712 1.00 0.00 ? 130 LYS A HE2  9  
ATOM   4451 H  HE3  . LYS A 1 29 ? -4.543  -21.791 17.156 1.00 0.00 ? 130 LYS A HE3  9  
ATOM   4452 H  HZ1  . LYS A 1 29 ? -5.221  -24.281 17.654 1.00 0.00 ? 130 LYS A HZ1  9  
ATOM   4453 H  HZ2  . LYS A 1 29 ? -3.904  -24.563 16.730 1.00 0.00 ? 130 LYS A HZ2  9  
ATOM   4454 H  HZ3  . LYS A 1 29 ? -3.774  -23.659 18.084 1.00 0.00 ? 130 LYS A HZ3  9  
HETATM 4455 ZN ZN   . ZN  B 2 .  ? -1.623  -12.743 8.531  1.00 0.00 ? 1   ZN  A ZN   9  
ATOM   4456 N  N    . ARG A 1 1  ? 2.162   1.015   -1.079 1.00 0.00 ? 102 ARG A N    10 
ATOM   4457 C  CA   . ARG A 1 1  ? 1.482   -0.049  -1.796 1.00 0.00 ? 102 ARG A CA   10 
ATOM   4458 C  C    . ARG A 1 1  ? 2.304   -1.338  -1.740 1.00 0.00 ? 102 ARG A C    10 
ATOM   4459 O  O    . ARG A 1 1  ? 3.107   -1.606  -2.633 1.00 0.00 ? 102 ARG A O    10 
ATOM   4460 C  CB   . ARG A 1 1  ? 1.248   0.335   -3.258 1.00 0.00 ? 102 ARG A CB   10 
ATOM   4461 C  CG   . ARG A 1 1  ? 0.340   -0.682  -3.954 1.00 0.00 ? 102 ARG A CG   10 
ATOM   4462 C  CD   . ARG A 1 1  ? 1.134   -1.912  -4.398 1.00 0.00 ? 102 ARG A CD   10 
ATOM   4463 N  NE   . ARG A 1 1  ? 0.475   -2.546  -5.563 1.00 0.00 ? 102 ARG A NE   10 
ATOM   4464 C  CZ   . ARG A 1 1  ? 1.127   -3.224  -6.517 1.00 0.00 ? 102 ARG A CZ   10 
ATOM   4465 N  NH1  . ARG A 1 1  ? 2.398   -3.599  -6.322 1.00 0.00 ? 102 ARG A NH1  10 
ATOM   4466 N  NH2  . ARG A 1 1  ? 0.507   -3.529  -7.665 1.00 0.00 ? 102 ARG A NH2  10 
ATOM   4467 H  H    . ARG A 1 1  ? 2.369   1.827   -1.624 1.00 0.00 ? 102 ARG A H    10 
ATOM   4468 H  HA   . ARG A 1 1  ? 0.530   -0.170  -1.280 1.00 0.00 ? 102 ARG A HA   10 
ATOM   4469 H  HB2  . ARG A 1 1  ? 0.797   1.325   -3.311 1.00 0.00 ? 102 ARG A HB2  10 
ATOM   4470 H  HB3  . ARG A 1 1  ? 2.203   0.391   -3.781 1.00 0.00 ? 102 ARG A HB3  10 
ATOM   4471 H  HG2  . ARG A 1 1  ? -0.459  -0.984  -3.277 1.00 0.00 ? 102 ARG A HG2  10 
ATOM   4472 H  HG3  . ARG A 1 1  ? -0.135  -0.218  -4.820 1.00 0.00 ? 102 ARG A HG3  10 
ATOM   4473 H  HD2  . ARG A 1 1  ? 2.151   -1.624  -4.658 1.00 0.00 ? 102 ARG A HD2  10 
ATOM   4474 H  HD3  . ARG A 1 1  ? 1.204   -2.625  -3.577 1.00 0.00 ? 102 ARG A HD3  10 
ATOM   4475 H  HE   . ARG A 1 1  ? -0.519  -2.463  -5.642 1.00 0.00 ? 102 ARG A HE   10 
ATOM   4476 H  HH11 . ARG A 1 1  ? 2.602   -4.424  -5.795 1.00 0.00 ? 102 ARG A HH11 10 
ATOM   4477 H  HH12 . ARG A 1 1  ? 3.145   -3.053  -6.704 1.00 0.00 ? 102 ARG A HH12 10 
ATOM   4478 H  HH21 . ARG A 1 1  ? -0.484  -3.662  -7.678 1.00 0.00 ? 102 ARG A HH21 10 
ATOM   4479 H  HH22 . ARG A 1 1  ? 1.035   -3.621  -8.509 1.00 0.00 ? 102 ARG A HH22 10 
ATOM   4480 N  N    . SER A 1 2  ? 2.078   -2.102  -0.681 1.00 0.00 ? 103 SER A N    10 
ATOM   4481 C  CA   . SER A 1 2  ? 2.788   -3.356  -0.497 1.00 0.00 ? 103 SER A CA   10 
ATOM   4482 C  C    . SER A 1 2  ? 1.846   -4.410  0.085  1.00 0.00 ? 103 SER A C    10 
ATOM   4483 O  O    . SER A 1 2  ? 0.966   -4.090  0.883  1.00 0.00 ? 103 SER A O    10 
ATOM   4484 C  CB   . SER A 1 2  ? 4.004   -3.171  0.413  1.00 0.00 ? 103 SER A CB   10 
ATOM   4485 O  OG   . SER A 1 2  ? 5.230   -3.308  -0.300 1.00 0.00 ? 103 SER A OG   10 
ATOM   4486 H  H    . SER A 1 2  ? 1.424   -1.877  0.041  1.00 0.00 ? 103 SER A H    10 
ATOM   4487 H  HA   . SER A 1 2  ? 3.121   -3.647  -1.492 1.00 0.00 ? 103 SER A HA   10 
ATOM   4488 H  HB2  . SER A 1 2  ? 3.964   -2.185  0.877  1.00 0.00 ? 103 SER A HB2  10 
ATOM   4489 H  HB3  . SER A 1 2  ? 3.970   -3.904  1.219  1.00 0.00 ? 103 SER A HB3  10 
ATOM   4490 H  HG   . SER A 1 2  ? 5.847   -2.556  -0.070 1.00 0.00 ? 103 SER A HG   10 
ATOM   4491 N  N    . PHE A 1 3  ? 2.061   -5.648  -0.336 1.00 0.00 ? 104 PHE A N    10 
ATOM   4492 C  CA   . PHE A 1 3  ? 1.241   -6.752  0.135  1.00 0.00 ? 104 PHE A CA   10 
ATOM   4493 C  C    . PHE A 1 3  ? 1.140   -6.749  1.661  1.00 0.00 ? 104 PHE A C    10 
ATOM   4494 O  O    . PHE A 1 3  ? 2.155   -6.674  2.354  1.00 0.00 ? 104 PHE A O    10 
ATOM   4495 C  CB   . PHE A 1 3  ? 1.928   -8.042  -0.317 1.00 0.00 ? 104 PHE A CB   10 
ATOM   4496 C  CG   . PHE A 1 3  ? 2.273   -8.075  -1.808 1.00 0.00 ? 104 PHE A CG   10 
ATOM   4497 C  CD1  . PHE A 1 3  ? 1.283   -8.207  -2.732 1.00 0.00 ? 104 PHE A CD1  10 
ATOM   4498 C  CD2  . PHE A 1 3  ? 3.568   -7.973  -2.208 1.00 0.00 ? 104 PHE A CD2  10 
ATOM   4499 C  CE1  . PHE A 1 3  ? 1.603   -8.238  -4.115 1.00 0.00 ? 104 PHE A CE1  10 
ATOM   4500 C  CE2  . PHE A 1 3  ? 3.888   -8.004  -3.591 1.00 0.00 ? 104 PHE A CE2  10 
ATOM   4501 C  CZ   . PHE A 1 3  ? 2.899   -8.136  -4.515 1.00 0.00 ? 104 PHE A CZ   10 
ATOM   4502 H  H    . PHE A 1 3  ? 2.778   -5.901  -0.984 1.00 0.00 ? 104 PHE A H    10 
ATOM   4503 H  HA   . PHE A 1 3  ? 0.247   -6.622  -0.294 1.00 0.00 ? 104 PHE A HA   10 
ATOM   4504 H  HB2  . PHE A 1 3  ? 2.843   -8.177  0.260  1.00 0.00 ? 104 PHE A HB2  10 
ATOM   4505 H  HB3  . PHE A 1 3  ? 1.278   -8.887  -0.086 1.00 0.00 ? 104 PHE A HB3  10 
ATOM   4506 H  HD1  . PHE A 1 3  ? 0.245   -8.290  -2.410 1.00 0.00 ? 104 PHE A HD1  10 
ATOM   4507 H  HD2  . PHE A 1 3  ? 4.361   -7.867  -1.468 1.00 0.00 ? 104 PHE A HD2  10 
ATOM   4508 H  HE1  . PHE A 1 3  ? 0.810   -8.345  -4.855 1.00 0.00 ? 104 PHE A HE1  10 
ATOM   4509 H  HE2  . PHE A 1 3  ? 4.926   -7.921  -3.913 1.00 0.00 ? 104 PHE A HE2  10 
ATOM   4510 H  HZ   . PHE A 1 3  ? 3.144   -8.159  -5.577 1.00 0.00 ? 104 PHE A HZ   10 
ATOM   4511 N  N    . VAL A 1 4  ? -0.091  -6.831  2.141  1.00 0.00 ? 105 VAL A N    10 
ATOM   4512 C  CA   . VAL A 1 4  ? -0.338  -6.840  3.573  1.00 0.00 ? 105 VAL A CA   10 
ATOM   4513 C  C    . VAL A 1 4  ? -1.371  -7.918  3.903  1.00 0.00 ? 105 VAL A C    10 
ATOM   4514 O  O    . VAL A 1 4  ? -2.472  -7.916  3.354  1.00 0.00 ? 105 VAL A O    10 
ATOM   4515 C  CB   . VAL A 1 4  ? -0.761  -5.445  4.039  1.00 0.00 ? 105 VAL A CB   10 
ATOM   4516 C  CG1  . VAL A 1 4  ? -0.624  -5.308  5.556  1.00 0.00 ? 105 VAL A CG1  10 
ATOM   4517 C  CG2  . VAL A 1 4  ? 0.040   -4.359  3.317  1.00 0.00 ? 105 VAL A CG2  10 
ATOM   4518 H  H    . VAL A 1 4  ? -0.911  -6.892  1.571  1.00 0.00 ? 105 VAL A H    10 
ATOM   4519 H  HA   . VAL A 1 4  ? 0.601   -7.089  4.067  1.00 0.00 ? 105 VAL A HA   10 
ATOM   4520 H  HB   . VAL A 1 4  ? -1.812  -5.310  3.784  1.00 0.00 ? 105 VAL A HB   10 
ATOM   4521 H  HG11 . VAL A 1 4  ? -0.695  -4.257  5.835  1.00 0.00 ? 105 VAL A HG11 10 
ATOM   4522 H  HG12 . VAL A 1 4  ? -1.422  -5.868  6.045  1.00 0.00 ? 105 VAL A HG12 10 
ATOM   4523 H  HG13 . VAL A 1 4  ? 0.342   -5.703  5.871  1.00 0.00 ? 105 VAL A HG13 10 
ATOM   4524 H  HG21 . VAL A 1 4  ? -0.542  -3.977  2.477  1.00 0.00 ? 105 VAL A HG21 10 
ATOM   4525 H  HG22 . VAL A 1 4  ? 0.256   -3.545  4.009  1.00 0.00 ? 105 VAL A HG22 10 
ATOM   4526 H  HG23 . VAL A 1 4  ? 0.974   -4.781  2.949  1.00 0.00 ? 105 VAL A HG23 10 
ATOM   4527 N  N    . CYS A 1 5  ? -0.979  -8.814  4.796  1.00 0.00 ? 106 CYS A N    10 
ATOM   4528 C  CA   . CYS A 1 5  ? -1.858  -9.897  5.206  1.00 0.00 ? 106 CYS A CA   10 
ATOM   4529 C  C    . CYS A 1 5  ? -3.108  -9.286  5.841  1.00 0.00 ? 106 CYS A C    10 
ATOM   4530 O  O    . CYS A 1 5  ? -3.134  -9.028  7.043  1.00 0.00 ? 106 CYS A O    10 
ATOM   4531 C  CB   . CYS A 1 5  ? -1.153  -10.870 6.152  1.00 0.00 ? 106 CYS A CB   10 
ATOM   4532 S  SG   . CYS A 1 5  ? -2.183  -12.363 6.396  1.00 0.00 ? 106 CYS A SG   10 
ATOM   4533 H  H    . CYS A 1 5  ? -0.082  -8.808  5.238  1.00 0.00 ? 106 CYS A H    10 
ATOM   4534 H  HA   . CYS A 1 5  ? -2.114  -10.451 4.302  1.00 0.00 ? 106 CYS A HA   10 
ATOM   4535 H  HB2  . CYS A 1 5  ? -0.183  -11.151 5.743  1.00 0.00 ? 106 CYS A HB2  10 
ATOM   4536 H  HB3  . CYS A 1 5  ? -0.967  -10.387 7.111  1.00 0.00 ? 106 CYS A HB3  10 
ATOM   4537 N  N    . GLU A 1 6  ? -4.115  -9.075  5.007  1.00 0.00 ? 107 GLU A N    10 
ATOM   4538 C  CA   . GLU A 1 6  ? -5.365  -8.500  5.472  1.00 0.00 ? 107 GLU A CA   10 
ATOM   4539 C  C    . GLU A 1 6  ? -5.803  -9.168  6.778  1.00 0.00 ? 107 GLU A C    10 
ATOM   4540 O  O    . GLU A 1 6  ? -6.591  -8.603  7.534  1.00 0.00 ? 107 GLU A O    10 
ATOM   4541 C  CB   . GLU A 1 6  ? -6.455  -8.619  4.404  1.00 0.00 ? 107 GLU A CB   10 
ATOM   4542 C  CG   . GLU A 1 6  ? -6.613  -10.068 3.941  1.00 0.00 ? 107 GLU A CG   10 
ATOM   4543 C  CD   . GLU A 1 6  ? -7.300  -10.135 2.576  1.00 0.00 ? 107 GLU A CD   10 
ATOM   4544 O  OE1  . GLU A 1 6  ? -7.263  -9.104  1.871  1.00 0.00 ? 107 GLU A OE1  10 
ATOM   4545 O  OE2  . GLU A 1 6  ? -7.847  -11.217 2.268  1.00 0.00 ? 107 GLU A OE2  10 
ATOM   4546 H  H    . GLU A 1 6  ? -4.086  -9.289  4.031  1.00 0.00 ? 107 GLU A H    10 
ATOM   4547 H  HA   . GLU A 1 6  ? -5.152  -7.446  5.649  1.00 0.00 ? 107 GLU A HA   10 
ATOM   4548 H  HB2  . GLU A 1 6  ? -7.402  -8.255  4.804  1.00 0.00 ? 107 GLU A HB2  10 
ATOM   4549 H  HB3  . GLU A 1 6  ? -6.204  -7.986  3.553  1.00 0.00 ? 107 GLU A HB3  10 
ATOM   4550 H  HG2  . GLU A 1 6  ? -5.634  -10.544 3.884  1.00 0.00 ? 107 GLU A HG2  10 
ATOM   4551 H  HG3  . GLU A 1 6  ? -7.197  -10.626 4.673  1.00 0.00 ? 107 GLU A HG3  10 
ATOM   4552 N  N    . VAL A 1 7  ? -5.272  -10.361 7.002  1.00 0.00 ? 108 VAL A N    10 
ATOM   4553 C  CA   . VAL A 1 7  ? -5.598  -11.111 8.203  1.00 0.00 ? 108 VAL A CA   10 
ATOM   4554 C  C    . VAL A 1 7  ? -4.905  -10.466 9.405  1.00 0.00 ? 108 VAL A C    10 
ATOM   4555 O  O    . VAL A 1 7  ? -5.560  -9.864  10.254 1.00 0.00 ? 108 VAL A O    10 
ATOM   4556 C  CB   . VAL A 1 7  ? -5.225  -12.584 8.017  1.00 0.00 ? 108 VAL A CB   10 
ATOM   4557 C  CG1  . VAL A 1 7  ? -5.369  -13.355 9.331  1.00 0.00 ? 108 VAL A CG1  10 
ATOM   4558 C  CG2  . VAL A 1 7  ? -6.064  -13.225 6.909  1.00 0.00 ? 108 VAL A CG2  10 
ATOM   4559 H  H    . VAL A 1 7  ? -4.632  -10.813 6.382  1.00 0.00 ? 108 VAL A H    10 
ATOM   4560 H  HA   . VAL A 1 7  ? -6.677  -11.051 8.346  1.00 0.00 ? 108 VAL A HA   10 
ATOM   4561 H  HB   . VAL A 1 7  ? -4.180  -12.629 7.715  1.00 0.00 ? 108 VAL A HB   10 
ATOM   4562 H  HG11 . VAL A 1 7  ? -5.706  -14.371 9.119  1.00 0.00 ? 108 VAL A HG11 10 
ATOM   4563 H  HG12 . VAL A 1 7  ? -4.407  -13.390 9.839  1.00 0.00 ? 108 VAL A HG12 10 
ATOM   4564 H  HG13 . VAL A 1 7  ? -6.100  -12.856 9.967  1.00 0.00 ? 108 VAL A HG13 10 
ATOM   4565 H  HG21 . VAL A 1 7  ? -6.272  -12.485 6.136  1.00 0.00 ? 108 VAL A HG21 10 
ATOM   4566 H  HG22 . VAL A 1 7  ? -5.513  -14.059 6.474  1.00 0.00 ? 108 VAL A HG22 10 
ATOM   4567 H  HG23 . VAL A 1 7  ? -7.003  -13.588 7.328  1.00 0.00 ? 108 VAL A HG23 10 
ATOM   4568 N  N    . CYS A 1 8  ? -3.589  -10.617 9.440  1.00 0.00 ? 109 CYS A N    10 
ATOM   4569 C  CA   . CYS A 1 8  ? -2.800  -10.057 10.524 1.00 0.00 ? 109 CYS A CA   10 
ATOM   4570 C  C    . CYS A 1 8  ? -2.187  -8.741  10.042 1.00 0.00 ? 109 CYS A C    10 
ATOM   4571 O  O    . CYS A 1 8  ? -1.200  -8.268  10.606 1.00 0.00 ? 109 CYS A O    10 
ATOM   4572 C  CB   . CYS A 1 8  ? -1.733  -11.039 11.013 1.00 0.00 ? 109 CYS A CB   10 
ATOM   4573 S  SG   . CYS A 1 8  ? -0.400  -11.186 9.766  1.00 0.00 ? 109 CYS A SG   10 
ATOM   4574 H  H    . CYS A 1 8  ? -3.063  -11.109 8.746  1.00 0.00 ? 109 CYS A H    10 
ATOM   4575 H  HA   . CYS A 1 8  ? -3.485  -9.884  11.354 1.00 0.00 ? 109 CYS A HA   10 
ATOM   4576 H  HB2  . CYS A 1 8  ? -1.318  -10.697 11.961 1.00 0.00 ? 109 CYS A HB2  10 
ATOM   4577 H  HB3  . CYS A 1 8  ? -2.180  -12.015 11.194 1.00 0.00 ? 109 CYS A HB3  10 
ATOM   4578 N  N    . THR A 1 9  ? -2.796  -8.185  9.005  1.00 0.00 ? 110 THR A N    10 
ATOM   4579 C  CA   . THR A 1 9  ? -2.324  -6.933  8.442  1.00 0.00 ? 110 THR A CA   10 
ATOM   4580 C  C    . THR A 1 9  ? -0.796  -6.864  8.502  1.00 0.00 ? 110 THR A C    10 
ATOM   4581 O  O    . THR A 1 9  ? -0.236  -5.926  9.068  1.00 0.00 ? 110 THR A O    10 
ATOM   4582 C  CB   . THR A 1 9  ? -3.013  -5.788  9.187  1.00 0.00 ? 110 THR A CB   10 
ATOM   4583 O  OG1  . THR A 1 9  ? -2.473  -5.855  10.503 1.00 0.00 ? 110 THR A OG1  10 
ATOM   4584 C  CG2  . THR A 1 9  ? -4.510  -6.037  9.385  1.00 0.00 ? 110 THR A CG2  10 
ATOM   4585 H  H    . THR A 1 9  ? -3.599  -8.576  8.553  1.00 0.00 ? 110 THR A H    10 
ATOM   4586 H  HA   . THR A 1 9  ? -2.603  -6.902  7.389  1.00 0.00 ? 110 THR A HA   10 
ATOM   4587 H  HB   . THR A 1 9  ? -2.841  -4.837  8.684  1.00 0.00 ? 110 THR A HB   10 
ATOM   4588 H  HG1  . THR A 1 9  ? -2.717  -5.031  11.015 1.00 0.00 ? 110 THR A HG1  10 
ATOM   4589 H  HG21 . THR A 1 9  ? -4.778  -7.002  8.953  1.00 0.00 ? 110 THR A HG21 10 
ATOM   4590 H  HG22 . THR A 1 9  ? -4.739  -6.041  10.451 1.00 0.00 ? 110 THR A HG22 10 
ATOM   4591 H  HG23 . THR A 1 9  ? -5.078  -5.248  8.894  1.00 0.00 ? 110 THR A HG23 10 
ATOM   4592 N  N    . ARG A 1 10 ? -0.166  -7.869  7.912  1.00 0.00 ? 111 ARG A N    10 
ATOM   4593 C  CA   . ARG A 1 10 ? 1.285   -7.934  7.892  1.00 0.00 ? 111 ARG A CA   10 
ATOM   4594 C  C    . ARG A 1 10 ? 1.809   -7.660  6.481  1.00 0.00 ? 111 ARG A C    10 
ATOM   4595 O  O    . ARG A 1 10 ? 1.431   -8.343  5.530  1.00 0.00 ? 111 ARG A O    10 
ATOM   4596 C  CB   . ARG A 1 10 ? 1.781   -9.305  8.356  1.00 0.00 ? 111 ARG A CB   10 
ATOM   4597 C  CG   . ARG A 1 10 ? 1.960   -9.339  9.874  1.00 0.00 ? 111 ARG A CG   10 
ATOM   4598 C  CD   . ARG A 1 10 ? 2.588   -10.659 10.324 1.00 0.00 ? 111 ARG A CD   10 
ATOM   4599 N  NE   . ARG A 1 10 ? 4.005   -10.445 10.694 1.00 0.00 ? 111 ARG A NE   10 
ATOM   4600 C  CZ   . ARG A 1 10 ? 4.725   -11.298 11.436 1.00 0.00 ? 111 ARG A CZ   10 
ATOM   4601 N  NH1  . ARG A 1 10 ? 4.457   -12.609 11.399 1.00 0.00 ? 111 ARG A NH1  10 
ATOM   4602 N  NH2  . ARG A 1 10 ? 5.712   -10.838 12.216 1.00 0.00 ? 111 ARG A NH2  10 
ATOM   4603 H  H    . ARG A 1 10 ? -0.630  -8.628  7.454  1.00 0.00 ? 111 ARG A H    10 
ATOM   4604 H  HA   . ARG A 1 10 ? 1.609   -7.160  8.588  1.00 0.00 ? 111 ARG A HA   10 
ATOM   4605 H  HB2  . ARG A 1 10 ? 1.071   -10.074 8.052  1.00 0.00 ? 111 ARG A HB2  10 
ATOM   4606 H  HB3  . ARG A 1 10 ? 2.729   -9.537  7.869  1.00 0.00 ? 111 ARG A HB3  10 
ATOM   4607 H  HG2  . ARG A 1 10 ? 2.589   -8.507  10.190 1.00 0.00 ? 111 ARG A HG2  10 
ATOM   4608 H  HG3  . ARG A 1 10 ? 0.992   -9.209  10.361 1.00 0.00 ? 111 ARG A HG3  10 
ATOM   4609 H  HD2  . ARG A 1 10 ? 2.038   -11.063 11.174 1.00 0.00 ? 111 ARG A HD2  10 
ATOM   4610 H  HD3  . ARG A 1 10 ? 2.521   -11.395 9.521  1.00 0.00 ? 111 ARG A HD3  10 
ATOM   4611 H  HE   . ARG A 1 10 ? 4.453   -9.612  10.371 1.00 0.00 ? 111 ARG A HE   10 
ATOM   4612 H  HH11 . ARG A 1 10 ? 3.639   -12.940 10.926 1.00 0.00 ? 111 ARG A HH11 10 
ATOM   4613 H  HH12 . ARG A 1 10 ? 5.074   -13.259 11.844 1.00 0.00 ? 111 ARG A HH12 10 
ATOM   4614 H  HH21 . ARG A 1 10 ? 5.530   -10.109 12.878 1.00 0.00 ? 111 ARG A HH21 10 
ATOM   4615 H  HH22 . ARG A 1 10 ? 6.632   -11.222 12.137 1.00 0.00 ? 111 ARG A HH22 10 
ATOM   4616 N  N    . ALA A 1 11 ? 2.673   -6.658  6.390  1.00 0.00 ? 112 ALA A N    10 
ATOM   4617 C  CA   . ALA A 1 11 ? 3.254   -6.286  5.111  1.00 0.00 ? 112 ALA A CA   10 
ATOM   4618 C  C    . ALA A 1 11 ? 4.587   -7.014  4.928  1.00 0.00 ? 112 ALA A C    10 
ATOM   4619 O  O    . ALA A 1 11 ? 5.355   -7.154  5.878  1.00 0.00 ? 112 ALA A O    10 
ATOM   4620 C  CB   . ALA A 1 11 ? 3.405   -4.765  5.043  1.00 0.00 ? 112 ALA A CB   10 
ATOM   4621 H  H    . ALA A 1 11 ? 2.976   -6.108  7.167  1.00 0.00 ? 112 ALA A H    10 
ATOM   4622 H  HA   . ALA A 1 11 ? 2.564   -6.605  4.328  1.00 0.00 ? 112 ALA A HA   10 
ATOM   4623 H  HB1  . ALA A 1 11 ? 4.408   -4.486  5.365  1.00 0.00 ? 112 ALA A HB1  10 
ATOM   4624 H  HB2  . ALA A 1 11 ? 3.246   -4.429  4.018  1.00 0.00 ? 112 ALA A HB2  10 
ATOM   4625 H  HB3  . ALA A 1 11 ? 2.670   -4.297  5.697  1.00 0.00 ? 112 ALA A HB3  10 
ATOM   4626 N  N    . PHE A 1 12 ? 4.819   -7.458  3.702  1.00 0.00 ? 113 PHE A N    10 
ATOM   4627 C  CA   . PHE A 1 12 ? 6.047   -8.167  3.384  1.00 0.00 ? 113 PHE A CA   10 
ATOM   4628 C  C    . PHE A 1 12 ? 6.712   -7.580  2.137  1.00 0.00 ? 113 PHE A C    10 
ATOM   4629 O  O    . PHE A 1 12 ? 6.082   -6.840  1.383  1.00 0.00 ? 113 PHE A O    10 
ATOM   4630 C  CB   . PHE A 1 12 ? 5.662   -9.622  3.104  1.00 0.00 ? 113 PHE A CB   10 
ATOM   4631 C  CG   . PHE A 1 12 ? 5.165   -10.381 4.336  1.00 0.00 ? 113 PHE A CG   10 
ATOM   4632 C  CD1  . PHE A 1 12 ? 6.054   -10.838 5.258  1.00 0.00 ? 113 PHE A CD1  10 
ATOM   4633 C  CD2  . PHE A 1 12 ? 3.834   -10.600 4.508  1.00 0.00 ? 113 PHE A CD2  10 
ATOM   4634 C  CE1  . PHE A 1 12 ? 5.593   -11.542 6.402  1.00 0.00 ? 113 PHE A CE1  10 
ATOM   4635 C  CE2  . PHE A 1 12 ? 3.373   -11.305 5.651  1.00 0.00 ? 113 PHE A CE2  10 
ATOM   4636 C  CZ   . PHE A 1 12 ? 4.261   -11.761 6.573  1.00 0.00 ? 113 PHE A CZ   10 
ATOM   4637 H  H    . PHE A 1 12 ? 4.188   -7.339  2.936  1.00 0.00 ? 113 PHE A H    10 
ATOM   4638 H  HA   . PHE A 1 12 ? 6.715   -8.056  4.237  1.00 0.00 ? 113 PHE A HA   10 
ATOM   4639 H  HB2  . PHE A 1 12 ? 4.886   -9.641  2.340  1.00 0.00 ? 113 PHE A HB2  10 
ATOM   4640 H  HB3  . PHE A 1 12 ? 6.527   -10.143 2.694  1.00 0.00 ? 113 PHE A HB3  10 
ATOM   4641 H  HD1  . PHE A 1 12 ? 7.121   -10.662 5.120  1.00 0.00 ? 113 PHE A HD1  10 
ATOM   4642 H  HD2  . PHE A 1 12 ? 3.121   -10.235 3.769  1.00 0.00 ? 113 PHE A HD2  10 
ATOM   4643 H  HE1  . PHE A 1 12 ? 6.306   -11.908 7.141  1.00 0.00 ? 113 PHE A HE1  10 
ATOM   4644 H  HE2  . PHE A 1 12 ? 2.305   -11.481 5.789  1.00 0.00 ? 113 PHE A HE2  10 
ATOM   4645 H  HZ   . PHE A 1 12 ? 3.907   -12.302 7.451  1.00 0.00 ? 113 PHE A HZ   10 
ATOM   4646 N  N    . ALA A 1 13 ? 7.978   -7.931  1.960  1.00 0.00 ? 114 ALA A N    10 
ATOM   4647 C  CA   . ALA A 1 13 ? 8.735   -7.448  0.818  1.00 0.00 ? 114 ALA A CA   10 
ATOM   4648 C  C    . ALA A 1 13 ? 8.495   -8.373  -0.377 1.00 0.00 ? 114 ALA A C    10 
ATOM   4649 O  O    . ALA A 1 13 ? 8.815   -8.024  -1.512 1.00 0.00 ? 114 ALA A O    10 
ATOM   4650 C  CB   . ALA A 1 13 ? 10.216  -7.350  1.192  1.00 0.00 ? 114 ALA A CB   10 
ATOM   4651 H  H    . ALA A 1 13 ? 8.482   -8.533  2.578  1.00 0.00 ? 114 ALA A H    10 
ATOM   4652 H  HA   . ALA A 1 13 ? 8.368   -6.451  0.574  1.00 0.00 ? 114 ALA A HA   10 
ATOM   4653 H  HB1  . ALA A 1 13 ? 10.503  -8.230  1.768  1.00 0.00 ? 114 ALA A HB1  10 
ATOM   4654 H  HB2  . ALA A 1 13 ? 10.816  -7.297  0.285  1.00 0.00 ? 114 ALA A HB2  10 
ATOM   4655 H  HB3  . ALA A 1 13 ? 10.381  -6.455  1.790  1.00 0.00 ? 114 ALA A HB3  10 
ATOM   4656 N  N    . ARG A 1 14 ? 7.934   -9.536  -0.080 1.00 0.00 ? 115 ARG A N    10 
ATOM   4657 C  CA   . ARG A 1 14 ? 7.647   -10.515 -1.115 1.00 0.00 ? 115 ARG A CA   10 
ATOM   4658 C  C    . ARG A 1 14 ? 6.238   -11.082 -0.933 1.00 0.00 ? 115 ARG A C    10 
ATOM   4659 O  O    . ARG A 1 14 ? 5.691   -11.057 0.169  1.00 0.00 ? 115 ARG A O    10 
ATOM   4660 C  CB   . ARG A 1 14 ? 8.659   -11.661 -1.085 1.00 0.00 ? 115 ARG A CB   10 
ATOM   4661 C  CG   . ARG A 1 14 ? 10.091  -11.126 -1.013 1.00 0.00 ? 115 ARG A CG   10 
ATOM   4662 C  CD   . ARG A 1 14 ? 11.091  -12.164 -1.529 1.00 0.00 ? 115 ARG A CD   10 
ATOM   4663 N  NE   . ARG A 1 14 ? 12.469  -11.636 -1.421 1.00 0.00 ? 115 ARG A NE   10 
ATOM   4664 C  CZ   . ARG A 1 14 ? 13.055  -11.298 -0.265 1.00 0.00 ? 115 ARG A CZ   10 
ATOM   4665 N  NH1  . ARG A 1 14 ? 12.520  -10.337 0.501  1.00 0.00 ? 115 ARG A NH1  10 
ATOM   4666 N  NH2  . ARG A 1 14 ? 14.176  -11.919 0.125  1.00 0.00 ? 115 ARG A NH2  10 
ATOM   4667 H  H    . ARG A 1 14 ? 7.676   -9.813  0.846  1.00 0.00 ? 115 ARG A H    10 
ATOM   4668 H  HA   . ARG A 1 14 ? 7.729   -9.963  -2.051 1.00 0.00 ? 115 ARG A HA   10 
ATOM   4669 H  HB2  . ARG A 1 14 ? 8.464   -12.302 -0.225 1.00 0.00 ? 115 ARG A HB2  10 
ATOM   4670 H  HB3  . ARG A 1 14 ? 8.542   -12.279 -1.976 1.00 0.00 ? 115 ARG A HB3  10 
ATOM   4671 H  HG2  . ARG A 1 14 ? 10.172  -10.214 -1.604 1.00 0.00 ? 115 ARG A HG2  10 
ATOM   4672 H  HG3  . ARG A 1 14 ? 10.334  -10.863 0.015  1.00 0.00 ? 115 ARG A HG3  10 
ATOM   4673 H  HD2  . ARG A 1 14 ? 10.998  -13.086 -0.955 1.00 0.00 ? 115 ARG A HD2  10 
ATOM   4674 H  HD3  . ARG A 1 14 ? 10.867  -12.412 -2.567 1.00 0.00 ? 115 ARG A HD3  10 
ATOM   4675 H  HE   . ARG A 1 14 ? 12.996  -11.526 -2.264 1.00 0.00 ? 115 ARG A HE   10 
ATOM   4676 H  HH11 . ARG A 1 14 ? 12.144  -9.513  0.080  1.00 0.00 ? 115 ARG A HH11 10 
ATOM   4677 H  HH12 . ARG A 1 14 ? 12.496  -10.446 1.495  1.00 0.00 ? 115 ARG A HH12 10 
ATOM   4678 H  HH21 . ARG A 1 14 ? 14.349  -12.863 -0.156 1.00 0.00 ? 115 ARG A HH21 10 
ATOM   4679 H  HH22 . ARG A 1 14 ? 14.840  -11.439 0.698  1.00 0.00 ? 115 ARG A HH22 10 
ATOM   4680 N  N    . GLN A 1 15 ? 5.690   -11.584 -2.031 1.00 0.00 ? 116 GLN A N    10 
ATOM   4681 C  CA   . GLN A 1 15 ? 4.355   -12.157 -2.006 1.00 0.00 ? 116 GLN A CA   10 
ATOM   4682 C  C    . GLN A 1 15 ? 4.382   -13.537 -1.345 1.00 0.00 ? 116 GLN A C    10 
ATOM   4683 O  O    . GLN A 1 15 ? 3.675   -13.775 -0.368 1.00 0.00 ? 116 GLN A O    10 
ATOM   4684 C  CB   . GLN A 1 15 ? 3.767   -12.236 -3.416 1.00 0.00 ? 116 GLN A CB   10 
ATOM   4685 C  CG   . GLN A 1 15 ? 4.120   -10.989 -4.229 1.00 0.00 ? 116 GLN A CG   10 
ATOM   4686 C  CD   . GLN A 1 15 ? 4.861   -11.364 -5.513 1.00 0.00 ? 116 GLN A CD   10 
ATOM   4687 O  OE1  . GLN A 1 15 ? 6.006   -11.783 -5.500 1.00 0.00 ? 116 GLN A OE1  10 
ATOM   4688 N  NE2  . GLN A 1 15 ? 4.144   -11.190 -6.621 1.00 0.00 ? 116 GLN A NE2  10 
ATOM   4689 H  H    . GLN A 1 15 ? 6.141   -11.602 -2.922 1.00 0.00 ? 116 GLN A H    10 
ATOM   4690 H  HA   . GLN A 1 15 ? 3.756   -11.472 -1.406 1.00 0.00 ? 116 GLN A HA   10 
ATOM   4691 H  HB2  . GLN A 1 15 ? 4.144   -13.124 -3.923 1.00 0.00 ? 116 GLN A HB2  10 
ATOM   4692 H  HB3  . GLN A 1 15 ? 2.683   -12.340 -3.356 1.00 0.00 ? 116 GLN A HB3  10 
ATOM   4693 H  HG2  . GLN A 1 15 ? 3.210   -10.441 -4.475 1.00 0.00 ? 116 GLN A HG2  10 
ATOM   4694 H  HG3  . GLN A 1 15 ? 4.740   -10.324 -3.628 1.00 0.00 ? 116 GLN A HG3  10 
ATOM   4695 H  HE21 . GLN A 1 15 ? 3.930   -10.267 -6.938 1.00 0.00 ? 116 GLN A HE21 10 
ATOM   4696 H  HE22 . GLN A 1 15 ? 3.821   -11.984 -7.136 1.00 0.00 ? 116 GLN A HE22 10 
ATOM   4697 N  N    . GLU A 1 16 ? 5.207   -14.410 -1.905 1.00 0.00 ? 117 GLU A N    10 
ATOM   4698 C  CA   . GLU A 1 16 ? 5.336   -15.760 -1.383 1.00 0.00 ? 117 GLU A CA   10 
ATOM   4699 C  C    . GLU A 1 16 ? 5.287   -15.744 0.146  1.00 0.00 ? 117 GLU A C    10 
ATOM   4700 O  O    . GLU A 1 16 ? 4.650   -16.599 0.760  1.00 0.00 ? 117 GLU A O    10 
ATOM   4701 C  CB   . GLU A 1 16 ? 6.622   -16.421 -1.883 1.00 0.00 ? 117 GLU A CB   10 
ATOM   4702 C  CG   . GLU A 1 16 ? 7.585   -15.381 -2.458 1.00 0.00 ? 117 GLU A CG   10 
ATOM   4703 C  CD   . GLU A 1 16 ? 7.934   -14.320 -1.413 1.00 0.00 ? 117 GLU A CD   10 
ATOM   4704 O  OE1  . GLU A 1 16 ? 7.015   -13.554 -1.053 1.00 0.00 ? 117 GLU A OE1  10 
ATOM   4705 O  OE2  . GLU A 1 16 ? 9.114   -14.298 -0.998 1.00 0.00 ? 117 GLU A OE2  10 
ATOM   4706 H  H    . GLU A 1 16 ? 5.779   -14.209 -2.700 1.00 0.00 ? 117 GLU A H    10 
ATOM   4707 H  HA   . GLU A 1 16 ? 4.477   -16.305 -1.775 1.00 0.00 ? 117 GLU A HA   10 
ATOM   4708 H  HB2  . GLU A 1 16 ? 7.104   -16.954 -1.063 1.00 0.00 ? 117 GLU A HB2  10 
ATOM   4709 H  HB3  . GLU A 1 16 ? 6.381   -17.161 -2.647 1.00 0.00 ? 117 GLU A HB3  10 
ATOM   4710 H  HG2  . GLU A 1 16 ? 8.496   -15.873 -2.800 1.00 0.00 ? 117 GLU A HG2  10 
ATOM   4711 H  HG3  . GLU A 1 16 ? 7.134   -14.905 -3.329 1.00 0.00 ? 117 GLU A HG3  10 
ATOM   4712 N  N    . HIS A 1 17 ? 5.968   -14.761 0.718  1.00 0.00 ? 118 HIS A N    10 
ATOM   4713 C  CA   . HIS A 1 17 ? 6.009   -14.623 2.164  1.00 0.00 ? 118 HIS A CA   10 
ATOM   4714 C  C    . HIS A 1 17 ? 4.583   -14.570 2.716  1.00 0.00 ? 118 HIS A C    10 
ATOM   4715 O  O    . HIS A 1 17 ? 4.259   -15.267 3.675  1.00 0.00 ? 118 HIS A O    10 
ATOM   4716 C  CB   . HIS A 1 17 ? 6.848   -13.409 2.569  1.00 0.00 ? 118 HIS A CB   10 
ATOM   4717 C  CG   . HIS A 1 17 ? 8.316   -13.540 2.245  1.00 0.00 ? 118 HIS A CG   10 
ATOM   4718 N  ND1  . HIS A 1 17 ? 9.272   -12.663 2.727  1.00 0.00 ? 118 HIS A ND1  10 
ATOM   4719 C  CD2  . HIS A 1 17 ? 8.983   -14.455 1.483  1.00 0.00 ? 118 HIS A CD2  10 
ATOM   4720 C  CE1  . HIS A 1 17 ? 10.457  -13.043 2.270  1.00 0.00 ? 118 HIS A CE1  10 
ATOM   4721 N  NE2  . HIS A 1 17 ? 10.275  -14.152 1.498  1.00 0.00 ? 118 HIS A NE2  10 
ATOM   4722 H  H    . HIS A 1 17 ? 6.483   -14.069 0.212  1.00 0.00 ? 118 HIS A H    10 
ATOM   4723 H  HA   . HIS A 1 17 ? 6.506   -15.513 2.549  1.00 0.00 ? 118 HIS A HA   10 
ATOM   4724 H  HB2  . HIS A 1 17 ? 6.453   -12.524 2.068  1.00 0.00 ? 118 HIS A HB2  10 
ATOM   4725 H  HB3  . HIS A 1 17 ? 6.736   -13.244 3.640  1.00 0.00 ? 118 HIS A HB3  10 
ATOM   4726 H  HD1  . HIS A 1 17 ? 9.099   -11.878 3.321  1.00 0.00 ? 118 HIS A HD1  10 
ATOM   4727 H  HD2  . HIS A 1 17 ? 8.530   -15.292 0.952  1.00 0.00 ? 118 HIS A HD2  10 
ATOM   4728 H  HE1  . HIS A 1 17 ? 11.409  -12.553 2.474  1.00 0.00 ? 118 HIS A HE1  10 
ATOM   4729 H  HE2  . HIS A 1 17 ? 11.002  -14.688 1.070  1.00 0.00 ? 118 HIS A HE2  10 
ATOM   4730 N  N    . LEU A 1 18 ? 3.770   -13.734 2.087  1.00 0.00 ? 119 LEU A N    10 
ATOM   4731 C  CA   . LEU A 1 18 ? 2.387   -13.582 2.503  1.00 0.00 ? 119 LEU A CA   10 
ATOM   4732 C  C    . LEU A 1 18 ? 1.653   -14.912 2.321  1.00 0.00 ? 119 LEU A C    10 
ATOM   4733 O  O    . LEU A 1 18 ? 1.172   -15.497 3.291  1.00 0.00 ? 119 LEU A O    10 
ATOM   4734 C  CB   . LEU A 1 18 ? 1.731   -12.413 1.764  1.00 0.00 ? 119 LEU A CB   10 
ATOM   4735 C  CG   . LEU A 1 18 ? 0.212   -12.493 1.594  1.00 0.00 ? 119 LEU A CG   10 
ATOM   4736 C  CD1  . LEU A 1 18 ? -0.456  -13.009 2.870  1.00 0.00 ? 119 LEU A CD1  10 
ATOM   4737 C  CD2  . LEU A 1 18 ? -0.362  -11.146 1.150  1.00 0.00 ? 119 LEU A CD2  10 
ATOM   4738 H  H    . LEU A 1 18 ? 4.042   -13.170 1.307  1.00 0.00 ? 119 LEU A H    10 
ATOM   4739 H  HA   . LEU A 1 18 ? 2.391   -13.331 3.564  1.00 0.00 ? 119 LEU A HA   10 
ATOM   4740 H  HB2  . LEU A 1 18 ? 1.969   -11.492 2.298  1.00 0.00 ? 119 LEU A HB2  10 
ATOM   4741 H  HB3  . LEU A 1 18 ? 2.184   -12.333 0.777  1.00 0.00 ? 119 LEU A HB3  10 
ATOM   4742 H  HG   . LEU A 1 18 ? -0.005  -13.212 0.804  1.00 0.00 ? 119 LEU A HG   10 
ATOM   4743 H  HD11 . LEU A 1 18 ? 0.026   -12.561 3.739  1.00 0.00 ? 119 LEU A HD11 10 
ATOM   4744 H  HD12 . LEU A 1 18 ? -1.512  -12.740 2.862  1.00 0.00 ? 119 LEU A HD12 10 
ATOM   4745 H  HD13 . LEU A 1 18 ? -0.357  -14.094 2.919  1.00 0.00 ? 119 LEU A HD13 10 
ATOM   4746 H  HD21 . LEU A 1 18 ? -1.407  -11.080 1.453  1.00 0.00 ? 119 LEU A HD21 10 
ATOM   4747 H  HD22 . LEU A 1 18 ? 0.204   -10.339 1.616  1.00 0.00 ? 119 LEU A HD22 10 
ATOM   4748 H  HD23 . LEU A 1 18 ? -0.292  -11.061 0.066  1.00 0.00 ? 119 LEU A HD23 10 
ATOM   4749 N  N    . LYS A 1 19 ? 1.591   -15.351 1.073  1.00 0.00 ? 120 LYS A N    10 
ATOM   4750 C  CA   . LYS A 1 19 ? 0.924   -16.602 0.752  1.00 0.00 ? 120 LYS A CA   10 
ATOM   4751 C  C    . LYS A 1 19 ? 1.393   -17.687 1.722  1.00 0.00 ? 120 LYS A C    10 
ATOM   4752 O  O    . LYS A 1 19 ? 0.589   -18.253 2.462  1.00 0.00 ? 120 LYS A O    10 
ATOM   4753 C  CB   . LYS A 1 19 ? 1.137   -16.960 -0.721 1.00 0.00 ? 120 LYS A CB   10 
ATOM   4754 C  CG   . LYS A 1 19 ? 0.180   -18.070 -1.159 1.00 0.00 ? 120 LYS A CG   10 
ATOM   4755 C  CD   . LYS A 1 19 ? -1.274  -17.602 -1.083 1.00 0.00 ? 120 LYS A CD   10 
ATOM   4756 C  CE   . LYS A 1 19 ? -2.208  -18.599 -1.775 1.00 0.00 ? 120 LYS A CE   10 
ATOM   4757 N  NZ   . LYS A 1 19 ? -3.302  -17.887 -2.471 1.00 0.00 ? 120 LYS A NZ   10 
ATOM   4758 H  H    . LYS A 1 19 ? 1.985   -14.868 0.289  1.00 0.00 ? 120 LYS A H    10 
ATOM   4759 H  HA   . LYS A 1 19 ? -0.145  -16.448 0.895  1.00 0.00 ? 120 LYS A HA   10 
ATOM   4760 H  HB2  . LYS A 1 19 ? 0.982   -16.075 -1.340 1.00 0.00 ? 120 LYS A HB2  10 
ATOM   4761 H  HB3  . LYS A 1 19 ? 2.167   -17.279 -0.876 1.00 0.00 ? 120 LYS A HB3  10 
ATOM   4762 H  HG2  . LYS A 1 19 ? 0.416   -18.376 -2.178 1.00 0.00 ? 120 LYS A HG2  10 
ATOM   4763 H  HG3  . LYS A 1 19 ? 0.317   -18.945 -0.523 1.00 0.00 ? 120 LYS A HG3  10 
ATOM   4764 H  HD2  . LYS A 1 19 ? -1.570  -17.485 -0.041 1.00 0.00 ? 120 LYS A HD2  10 
ATOM   4765 H  HD3  . LYS A 1 19 ? -1.370  -16.624 -1.553 1.00 0.00 ? 120 LYS A HD3  10 
ATOM   4766 H  HE2  . LYS A 1 19 ? -1.644  -19.198 -2.489 1.00 0.00 ? 120 LYS A HE2  10 
ATOM   4767 H  HE3  . LYS A 1 19 ? -2.624  -19.286 -1.038 1.00 0.00 ? 120 LYS A HE3  10 
ATOM   4768 H  HZ1  . LYS A 1 19 ? -3.755  -17.265 -1.832 1.00 0.00 ? 120 LYS A HZ1  10 
ATOM   4769 H  HZ2  . LYS A 1 19 ? -2.926  -17.364 -3.236 1.00 0.00 ? 120 LYS A HZ2  10 
ATOM   4770 H  HZ3  . LYS A 1 19 ? -3.966  -18.552 -2.816 1.00 0.00 ? 120 LYS A HZ3  10 
ATOM   4771 N  N    . ARG A 1 20 ? 2.692   -17.948 1.687  1.00 0.00 ? 121 ARG A N    10 
ATOM   4772 C  CA   . ARG A 1 20 ? 3.277   -18.956 2.554  1.00 0.00 ? 121 ARG A CA   10 
ATOM   4773 C  C    . ARG A 1 20 ? 2.906   -18.682 4.013  1.00 0.00 ? 121 ARG A C    10 
ATOM   4774 O  O    . ARG A 1 20 ? 2.795   -19.610 4.813  1.00 0.00 ? 121 ARG A O    10 
ATOM   4775 C  CB   . ARG A 1 20 ? 4.800   -18.981 2.419  1.00 0.00 ? 121 ARG A CB   10 
ATOM   4776 C  CG   . ARG A 1 20 ? 5.341   -20.405 2.572  1.00 0.00 ? 121 ARG A CG   10 
ATOM   4777 C  CD   . ARG A 1 20 ? 4.953   -21.271 1.372  1.00 0.00 ? 121 ARG A CD   10 
ATOM   4778 N  NE   . ARG A 1 20 ? 4.825   -22.685 1.789  1.00 0.00 ? 121 ARG A NE   10 
ATOM   4779 C  CZ   . ARG A 1 20 ? 5.778   -23.610 1.610  1.00 0.00 ? 121 ARG A CZ   10 
ATOM   4780 N  NH1  . ARG A 1 20 ? 6.998   -23.243 1.195  1.00 0.00 ? 121 ARG A NH1  10 
ATOM   4781 N  NH2  . ARG A 1 20 ? 5.511   -24.901 1.847  1.00 0.00 ? 121 ARG A NH2  10 
ATOM   4782 H  H    . ARG A 1 20 ? 3.339   -17.484 1.082  1.00 0.00 ? 121 ARG A H    10 
ATOM   4783 H  HA   . ARG A 1 20 ? 2.852   -19.900 2.210  1.00 0.00 ? 121 ARG A HA   10 
ATOM   4784 H  HB2  . ARG A 1 20 ? 5.091   -18.582 1.447  1.00 0.00 ? 121 ARG A HB2  10 
ATOM   4785 H  HB3  . ARG A 1 20 ? 5.247   -18.336 3.175  1.00 0.00 ? 121 ARG A HB3  10 
ATOM   4786 H  HG2  . ARG A 1 20 ? 6.426   -20.377 2.669  1.00 0.00 ? 121 ARG A HG2  10 
ATOM   4787 H  HG3  . ARG A 1 20 ? 4.950   -20.850 3.487  1.00 0.00 ? 121 ARG A HG3  10 
ATOM   4788 H  HD2  . ARG A 1 20 ? 4.010   -20.921 0.950  1.00 0.00 ? 121 ARG A HD2  10 
ATOM   4789 H  HD3  . ARG A 1 20 ? 5.707   -21.181 0.589  1.00 0.00 ? 121 ARG A HD3  10 
ATOM   4790 H  HE   . ARG A 1 20 ? 3.974   -22.969 2.230  1.00 0.00 ? 121 ARG A HE   10 
ATOM   4791 H  HH11 . ARG A 1 20 ? 7.134   -22.931 0.254  1.00 0.00 ? 121 ARG A HH11 10 
ATOM   4792 H  HH12 . ARG A 1 20 ? 7.774   -23.282 1.825  1.00 0.00 ? 121 ARG A HH12 10 
ATOM   4793 H  HH21 . ARG A 1 20 ? 4.898   -25.156 2.595  1.00 0.00 ? 121 ARG A HH21 10 
ATOM   4794 H  HH22 . ARG A 1 20 ? 5.926   -25.611 1.278  1.00 0.00 ? 121 ARG A HH22 10 
ATOM   4795 N  N    . HIS A 1 21 ? 2.722   -17.405 4.313  1.00 0.00 ? 122 HIS A N    10 
ATOM   4796 C  CA   . HIS A 1 21 ? 2.364   -16.998 5.661  1.00 0.00 ? 122 HIS A CA   10 
ATOM   4797 C  C    . HIS A 1 21 ? 0.922   -17.409 5.957  1.00 0.00 ? 122 HIS A C    10 
ATOM   4798 O  O    . HIS A 1 21 ? 0.644   -18.020 6.988  1.00 0.00 ? 122 HIS A O    10 
ATOM   4799 C  CB   . HIS A 1 21 ? 2.606   -15.500 5.858  1.00 0.00 ? 122 HIS A CB   10 
ATOM   4800 C  CG   . HIS A 1 21 ? 1.749   -14.876 6.934  1.00 0.00 ? 122 HIS A CG   10 
ATOM   4801 N  ND1  . HIS A 1 21 ? 2.062   -14.952 8.280  1.00 0.00 ? 122 HIS A ND1  10 
ATOM   4802 C  CD2  . HIS A 1 21 ? 0.589   -14.163 6.847  1.00 0.00 ? 122 HIS A CD2  10 
ATOM   4803 C  CE1  . HIS A 1 21 ? 1.125   -14.312 8.964  1.00 0.00 ? 122 HIS A CE1  10 
ATOM   4804 N  NE2  . HIS A 1 21 ? 0.213   -13.825 8.075  1.00 0.00 ? 122 HIS A NE2  10 
ATOM   4805 H  H    . HIS A 1 21 ? 2.813   -16.658 3.655  1.00 0.00 ? 122 HIS A H    10 
ATOM   4806 H  HA   . HIS A 1 21 ? 3.031   -17.534 6.337  1.00 0.00 ? 122 HIS A HA   10 
ATOM   4807 H  HB2  . HIS A 1 21 ? 3.655   -15.341 6.106  1.00 0.00 ? 122 HIS A HB2  10 
ATOM   4808 H  HB3  . HIS A 1 21 ? 2.420   -14.985 4.916  1.00 0.00 ? 122 HIS A HB3  10 
ATOM   4809 H  HD1  . HIS A 1 21 ? 2.860   -15.412 8.670  1.00 0.00 ? 122 HIS A HD1  10 
ATOM   4810 H  HD2  . HIS A 1 21 ? 0.061   -13.915 5.927  1.00 0.00 ? 122 HIS A HD2  10 
ATOM   4811 H  HE1  . HIS A 1 21 ? 1.089   -14.195 10.047 1.00 0.00 ? 122 HIS A HE1  10 
ATOM   4812 N  N    . TYR A 1 22 ? 0.038   -17.058 5.033  1.00 0.00 ? 123 TYR A N    10 
ATOM   4813 C  CA   . TYR A 1 22 ? -1.370  -17.384 5.181  1.00 0.00 ? 123 TYR A CA   10 
ATOM   4814 C  C    . TYR A 1 22 ? -1.550  -18.789 5.761  1.00 0.00 ? 123 TYR A C    10 
ATOM   4815 O  O    . TYR A 1 22 ? -2.563  -19.077 6.396  1.00 0.00 ? 123 TYR A O    10 
ATOM   4816 C  CB   . TYR A 1 22 ? -1.962  -17.347 3.771  1.00 0.00 ? 123 TYR A CB   10 
ATOM   4817 C  CG   . TYR A 1 22 ? -3.111  -16.352 3.604  1.00 0.00 ? 123 TYR A CG   10 
ATOM   4818 C  CD1  . TYR A 1 22 ? -4.359  -16.645 4.118  1.00 0.00 ? 123 TYR A CD1  10 
ATOM   4819 C  CD2  . TYR A 1 22 ? -2.902  -15.160 2.941  1.00 0.00 ? 123 TYR A CD2  10 
ATOM   4820 C  CE1  . TYR A 1 22 ? -5.440  -15.707 3.961  1.00 0.00 ? 123 TYR A CE1  10 
ATOM   4821 C  CE2  . TYR A 1 22 ? -3.984  -14.222 2.784  1.00 0.00 ? 123 TYR A CE2  10 
ATOM   4822 C  CZ   . TYR A 1 22 ? -5.200  -14.543 3.303  1.00 0.00 ? 123 TYR A CZ   10 
ATOM   4823 O  OH   . TYR A 1 22 ? -6.222  -13.658 3.154  1.00 0.00 ? 123 TYR A OH   10 
ATOM   4824 H  H    . TYR A 1 22 ? 0.271   -16.562 4.197  1.00 0.00 ? 123 TYR A H    10 
ATOM   4825 H  HA   . TYR A 1 22 ? -1.813  -16.658 5.863  1.00 0.00 ? 123 TYR A HA   10 
ATOM   4826 H  HB2  . TYR A 1 22 ? -1.172  -17.096 3.063  1.00 0.00 ? 123 TYR A HB2  10 
ATOM   4827 H  HB3  . TYR A 1 22 ? -2.317  -18.344 3.511  1.00 0.00 ? 123 TYR A HB3  10 
ATOM   4828 H  HD1  . TYR A 1 22 ? -4.524  -17.586 4.642  1.00 0.00 ? 123 TYR A HD1  10 
ATOM   4829 H  HD2  . TYR A 1 22 ? -1.917  -14.927 2.536  1.00 0.00 ? 123 TYR A HD2  10 
ATOM   4830 H  HE1  . TYR A 1 22 ? -6.430  -15.927 4.363  1.00 0.00 ? 123 TYR A HE1  10 
ATOM   4831 H  HE2  . TYR A 1 22 ? -3.832  -13.278 2.262  1.00 0.00 ? 123 TYR A HE2  10 
ATOM   4832 H  HH   . TYR A 1 22 ? -6.048  -13.063 2.370  1.00 0.00 ? 123 TYR A HH   10 
ATOM   4833 N  N    . ARG A 1 23 ? -0.551  -19.625 5.522  1.00 0.00 ? 124 ARG A N    10 
ATOM   4834 C  CA   . ARG A 1 23 ? -0.587  -20.992 6.012  1.00 0.00 ? 124 ARG A CA   10 
ATOM   4835 C  C    . ARG A 1 23 ? -1.008  -21.019 7.483  1.00 0.00 ? 124 ARG A C    10 
ATOM   4836 O  O    . ARG A 1 23 ? -1.665  -21.959 7.927  1.00 0.00 ? 124 ARG A O    10 
ATOM   4837 C  CB   . ARG A 1 23 ? 0.782   -21.664 5.869  1.00 0.00 ? 124 ARG A CB   10 
ATOM   4838 C  CG   . ARG A 1 23 ? 1.563   -21.601 7.182  1.00 0.00 ? 124 ARG A CG   10 
ATOM   4839 C  CD   . ARG A 1 23 ? 2.390   -20.315 7.267  1.00 0.00 ? 124 ARG A CD   10 
ATOM   4840 N  NE   . ARG A 1 23 ? 2.442   -19.839 8.667  1.00 0.00 ? 124 ARG A NE   10 
ATOM   4841 C  CZ   . ARG A 1 23 ? 3.159   -20.427 9.635  1.00 0.00 ? 124 ARG A CZ   10 
ATOM   4842 N  NH1  . ARG A 1 23 ? 3.053   -21.747 9.839  1.00 0.00 ? 124 ARG A NH1  10 
ATOM   4843 N  NH2  . ARG A 1 23 ? 3.982   -19.694 10.397 1.00 0.00 ? 124 ARG A NH2  10 
ATOM   4844 H  H    . ARG A 1 23 ? 0.270   -19.383 5.005  1.00 0.00 ? 124 ARG A H    10 
ATOM   4845 H  HA   . ARG A 1 23 ? -1.322  -21.495 5.384  1.00 0.00 ? 124 ARG A HA   10 
ATOM   4846 H  HB2  . ARG A 1 23 ? 0.650   -22.704 5.570  1.00 0.00 ? 124 ARG A HB2  10 
ATOM   4847 H  HB3  . ARG A 1 23 ? 1.350   -21.175 5.078  1.00 0.00 ? 124 ARG A HB3  10 
ATOM   4848 H  HG2  . ARG A 1 23 ? 0.872   -21.649 8.024  1.00 0.00 ? 124 ARG A HG2  10 
ATOM   4849 H  HG3  . ARG A 1 23 ? 2.222   -22.467 7.259  1.00 0.00 ? 124 ARG A HG3  10 
ATOM   4850 H  HD2  . ARG A 1 23 ? 3.399   -20.498 6.898  1.00 0.00 ? 124 ARG A HD2  10 
ATOM   4851 H  HD3  . ARG A 1 23 ? 1.951   -19.549 6.628  1.00 0.00 ? 124 ARG A HD3  10 
ATOM   4852 H  HE   . ARG A 1 23 ? 1.909   -19.028 8.906  1.00 0.00 ? 124 ARG A HE   10 
ATOM   4853 H  HH11 . ARG A 1 23 ? 2.781   -22.349 9.088  1.00 0.00 ? 124 ARG A HH11 10 
ATOM   4854 H  HH12 . ARG A 1 23 ? 3.246   -22.129 10.742 1.00 0.00 ? 124 ARG A HH12 10 
ATOM   4855 H  HH21 . ARG A 1 23 ? 3.960   -18.696 10.341 1.00 0.00 ? 124 ARG A HH21 10 
ATOM   4856 H  HH22 . ARG A 1 23 ? 4.618   -20.147 11.023 1.00 0.00 ? 124 ARG A HH22 10 
ATOM   4857 N  N    . SER A 1 24 ? -0.614  -19.974 8.197  1.00 0.00 ? 125 SER A N    10 
ATOM   4858 C  CA   . SER A 1 24 ? -0.943  -19.866 9.607  1.00 0.00 ? 125 SER A CA   10 
ATOM   4859 C  C    . SER A 1 24 ? -2.348  -19.286 9.774  1.00 0.00 ? 125 SER A C    10 
ATOM   4860 O  O    . SER A 1 24 ? -2.752  -18.935 10.882 1.00 0.00 ? 125 SER A O    10 
ATOM   4861 C  CB   . SER A 1 24 ? 0.080   -19.000 10.347 1.00 0.00 ? 125 SER A CB   10 
ATOM   4862 O  OG   . SER A 1 24 ? 0.360   -17.791 9.647  1.00 0.00 ? 125 SER A OG   10 
ATOM   4863 H  H    . SER A 1 24 ? -0.080  -19.214 7.827  1.00 0.00 ? 125 SER A H    10 
ATOM   4864 H  HA   . SER A 1 24 ? -0.901  -20.885 9.993  1.00 0.00 ? 125 SER A HA   10 
ATOM   4865 H  HB2  . SER A 1 24 ? -0.297  -18.765 11.342 1.00 0.00 ? 125 SER A HB2  10 
ATOM   4866 H  HB3  . SER A 1 24 ? 1.003   -19.564 10.481 1.00 0.00 ? 125 SER A HB3  10 
ATOM   4867 H  HG   . SER A 1 24 ? -0.305  -17.659 8.912  1.00 0.00 ? 125 SER A HG   10 
ATOM   4868 N  N    . HIS A 1 25 ? -3.055  -19.202 8.656  1.00 0.00 ? 126 HIS A N    10 
ATOM   4869 C  CA   . HIS A 1 25 ? -4.408  -18.670 8.664  1.00 0.00 ? 126 HIS A CA   10 
ATOM   4870 C  C    . HIS A 1 25 ? -5.381  -19.735 8.155  1.00 0.00 ? 126 HIS A C    10 
ATOM   4871 O  O    . HIS A 1 25 ? -6.566  -19.461 7.970  1.00 0.00 ? 126 HIS A O    10 
ATOM   4872 C  CB   . HIS A 1 25 ? -4.483  -17.367 7.866  1.00 0.00 ? 126 HIS A CB   10 
ATOM   4873 C  CG   . HIS A 1 25 ? -3.688  -16.232 8.465  1.00 0.00 ? 126 HIS A CG   10 
ATOM   4874 N  ND1  . HIS A 1 25 ? -3.487  -16.096 9.828  1.00 0.00 ? 126 HIS A ND1  10 
ATOM   4875 C  CD2  . HIS A 1 25 ? -3.044  -15.186 7.873  1.00 0.00 ? 126 HIS A CD2  10 
ATOM   4876 C  CE1  . HIS A 1 25 ? -2.754  -15.011 10.035 1.00 0.00 ? 126 HIS A CE1  10 
ATOM   4877 N  NE2  . HIS A 1 25 ? -2.482  -14.448 8.824  1.00 0.00 ? 126 HIS A NE2  10 
ATOM   4878 H  H    . HIS A 1 25 ? -2.720  -19.490 7.760  1.00 0.00 ? 126 HIS A H    10 
ATOM   4879 H  HA   . HIS A 1 25 ? -4.647  -18.439 9.702  1.00 0.00 ? 126 HIS A HA   10 
ATOM   4880 H  HB2  . HIS A 1 25 ? -4.127  -17.552 6.853  1.00 0.00 ? 126 HIS A HB2  10 
ATOM   4881 H  HB3  . HIS A 1 25 ? -5.528  -17.063 7.787  1.00 0.00 ? 126 HIS A HB3  10 
ATOM   4882 H  HD1  . HIS A 1 25 ? -3.834  -16.711 10.535 1.00 0.00 ? 126 HIS A HD1  10 
ATOM   4883 H  HD2  . HIS A 1 25 ? -2.999  -14.988 6.802  1.00 0.00 ? 126 HIS A HD2  10 
ATOM   4884 H  HE1  . HIS A 1 25 ? -2.428  -14.634 11.004 1.00 0.00 ? 126 HIS A HE1  10 
ATOM   4885 N  N    . THR A 1 26 ? -4.845  -20.928 7.943  1.00 0.00 ? 127 THR A N    10 
ATOM   4886 C  CA   . THR A 1 26 ? -5.651  -22.036 7.458  1.00 0.00 ? 127 THR A CA   10 
ATOM   4887 C  C    . THR A 1 26 ? -4.761  -23.228 7.103  1.00 0.00 ? 127 THR A C    10 
ATOM   4888 O  O    . THR A 1 26 ? -3.682  -23.056 6.538  1.00 0.00 ? 127 THR A O    10 
ATOM   4889 C  CB   . THR A 1 26 ? -6.489  -21.531 6.281  1.00 0.00 ? 127 THR A CB   10 
ATOM   4890 O  OG1  . THR A 1 26 ? -6.677  -22.687 5.469  1.00 0.00 ? 127 THR A OG1  10 
ATOM   4891 C  CG2  . THR A 1 26 ? -5.714  -20.566 5.382  1.00 0.00 ? 127 THR A CG2  10 
ATOM   4892 H  H    . THR A 1 26 ? -3.881  -21.143 8.095  1.00 0.00 ? 127 THR A H    10 
ATOM   4893 H  HA   . THR A 1 26 ? -6.311  -22.358 8.264  1.00 0.00 ? 127 THR A HA   10 
ATOM   4894 H  HB   . THR A 1 26 ? -7.417  -21.079 6.630  1.00 0.00 ? 127 THR A HB   10 
ATOM   4895 H  HG1  . THR A 1 26 ? -7.623  -23.003 5.538  1.00 0.00 ? 127 THR A HG1  10 
ATOM   4896 H  HG21 . THR A 1 26 ? -4.666  -20.552 5.682  1.00 0.00 ? 127 THR A HG21 10 
ATOM   4897 H  HG22 . THR A 1 26 ? -5.791  -20.892 4.346  1.00 0.00 ? 127 THR A HG22 10 
ATOM   4898 H  HG23 . THR A 1 26 ? -6.133  -19.563 5.479  1.00 0.00 ? 127 THR A HG23 10 
ATOM   4899 N  N    . ASN A 1 27 ? -5.246  -24.411 7.450  1.00 0.00 ? 128 ASN A N    10 
ATOM   4900 C  CA   . ASN A 1 27 ? -4.508  -25.632 7.176  1.00 0.00 ? 128 ASN A CA   10 
ATOM   4901 C  C    . ASN A 1 27 ? -5.134  -26.343 5.974  1.00 0.00 ? 128 ASN A C    10 
ATOM   4902 O  O    . ASN A 1 27 ? -5.298  -27.562 5.986  1.00 0.00 ? 128 ASN A O    10 
ATOM   4903 C  CB   . ASN A 1 27 ? -4.559  -26.588 8.370  1.00 0.00 ? 128 ASN A CB   10 
ATOM   4904 C  CG   . ASN A 1 27 ? -6.004  -26.898 8.761  1.00 0.00 ? 128 ASN A CG   10 
ATOM   4905 O  OD1  . ASN A 1 27 ? -6.902  -26.084 8.619  1.00 0.00 ? 128 ASN A OD1  10 
ATOM   4906 N  ND2  . ASN A 1 27 ? -6.180  -28.118 9.261  1.00 0.00 ? 128 ASN A ND2  10 
ATOM   4907 H  H    . ASN A 1 27 ? -6.124  -24.543 7.910  1.00 0.00 ? 128 ASN A H    10 
ATOM   4908 H  HA   . ASN A 1 27 ? -3.483  -25.311 6.983  1.00 0.00 ? 128 ASN A HA   10 
ATOM   4909 H  HB2  . ASN A 1 27 ? -4.038  -27.513 8.122  1.00 0.00 ? 128 ASN A HB2  10 
ATOM   4910 H  HB3  . ASN A 1 27 ? -4.036  -26.145 9.217  1.00 0.00 ? 128 ASN A HB3  10 
ATOM   4911 H  HD21 . ASN A 1 27 ? -5.802  -28.351 10.158 1.00 0.00 ? 128 ASN A HD21 10 
ATOM   4912 H  HD22 . ASN A 1 27 ? -6.689  -28.804 8.741  1.00 0.00 ? 128 ASN A HD22 10 
ATOM   4913 N  N    . GLU A 1 28 ? -5.468  -25.550 4.967  1.00 0.00 ? 129 GLU A N    10 
ATOM   4914 C  CA   . GLU A 1 28 ? -6.073  -26.088 3.759  1.00 0.00 ? 129 GLU A CA   10 
ATOM   4915 C  C    . GLU A 1 28 ? -5.467  -27.452 3.425  1.00 0.00 ? 129 GLU A C    10 
ATOM   4916 O  O    . GLU A 1 28 ? -4.246  -27.598 3.377  1.00 0.00 ? 129 GLU A O    10 
ATOM   4917 C  CB   . GLU A 1 28 ? -5.917  -25.116 2.588  1.00 0.00 ? 129 GLU A CB   10 
ATOM   4918 C  CG   . GLU A 1 28 ? -7.258  -24.476 2.225  1.00 0.00 ? 129 GLU A CG   10 
ATOM   4919 C  CD   . GLU A 1 28 ? -8.156  -25.468 1.482  1.00 0.00 ? 129 GLU A CD   10 
ATOM   4920 O  OE1  . GLU A 1 28 ? -7.635  -26.117 0.549  1.00 0.00 ? 129 GLU A OE1  10 
ATOM   4921 O  OE2  . GLU A 1 28 ? -9.343  -25.556 1.865  1.00 0.00 ? 129 GLU A OE2  10 
ATOM   4922 H  H    . GLU A 1 28 ? -5.330  -24.559 4.965  1.00 0.00 ? 129 GLU A H    10 
ATOM   4923 H  HA   . GLU A 1 28 ? -7.132  -26.201 3.992  1.00 0.00 ? 129 GLU A HA   10 
ATOM   4924 H  HB2  . GLU A 1 28 ? -5.198  -24.340 2.848  1.00 0.00 ? 129 GLU A HB2  10 
ATOM   4925 H  HB3  . GLU A 1 28 ? -5.516  -25.645 1.724  1.00 0.00 ? 129 GLU A HB3  10 
ATOM   4926 H  HG2  . GLU A 1 28 ? -7.759  -24.134 3.130  1.00 0.00 ? 129 GLU A HG2  10 
ATOM   4927 H  HG3  . GLU A 1 28 ? -7.089  -23.597 1.602  1.00 0.00 ? 129 GLU A HG3  10 
ATOM   4928 N  N    . LYS A 1 29 ? -6.347  -28.417 3.201  1.00 0.00 ? 130 LYS A N    10 
ATOM   4929 C  CA   . LYS A 1 29 ? -5.914  -29.764 2.872  1.00 0.00 ? 130 LYS A CA   10 
ATOM   4930 C  C    . LYS A 1 29 ? -6.977  -30.438 2.003  1.00 0.00 ? 130 LYS A C    10 
ATOM   4931 O  O    . LYS A 1 29 ? -8.151  -30.477 2.370  1.00 0.00 ? 130 LYS A O    10 
ATOM   4932 C  CB   . LYS A 1 29 ? -5.574  -30.543 4.144  1.00 0.00 ? 130 LYS A CB   10 
ATOM   4933 C  CG   . LYS A 1 29 ? -6.647  -30.339 5.216  1.00 0.00 ? 130 LYS A CG   10 
ATOM   4934 C  CD   . LYS A 1 29 ? -6.730  -31.550 6.147  1.00 0.00 ? 130 LYS A CD   10 
ATOM   4935 C  CE   . LYS A 1 29 ? -7.216  -32.789 5.393  1.00 0.00 ? 130 LYS A CE   10 
ATOM   4936 N  NZ   . LYS A 1 29 ? -8.340  -32.441 4.494  1.00 0.00 ? 130 LYS A NZ   10 
ATOM   4937 H  H    . LYS A 1 29 ? -7.338  -28.289 3.242  1.00 0.00 ? 130 LYS A H    10 
ATOM   4938 H  HA   . LYS A 1 29 ? -4.997  -29.680 2.291  1.00 0.00 ? 130 LYS A HA   10 
ATOM   4939 H  HB2  . LYS A 1 29 ? -5.484  -31.605 3.912  1.00 0.00 ? 130 LYS A HB2  10 
ATOM   4940 H  HB3  . LYS A 1 29 ? -4.607  -30.218 4.526  1.00 0.00 ? 130 LYS A HB3  10 
ATOM   4941 H  HG2  . LYS A 1 29 ? -6.421  -29.445 5.796  1.00 0.00 ? 130 LYS A HG2  10 
ATOM   4942 H  HG3  . LYS A 1 29 ? -7.614  -30.174 4.741  1.00 0.00 ? 130 LYS A HG3  10 
ATOM   4943 H  HD2  . LYS A 1 29 ? -5.749  -31.747 6.581  1.00 0.00 ? 130 LYS A HD2  10 
ATOM   4944 H  HD3  . LYS A 1 29 ? -7.407  -31.333 6.973  1.00 0.00 ? 130 LYS A HD3  10 
ATOM   4945 H  HE2  . LYS A 1 29 ? -6.397  -33.215 4.813  1.00 0.00 ? 130 LYS A HE2  10 
ATOM   4946 H  HE3  . LYS A 1 29 ? -7.534  -33.552 6.103  1.00 0.00 ? 130 LYS A HE3  10 
ATOM   4947 H  HZ1  . LYS A 1 29 ? -7.979  -32.093 3.629  1.00 0.00 ? 130 LYS A HZ1  10 
ATOM   4948 H  HZ2  . LYS A 1 29 ? -8.893  -33.256 4.321  1.00 0.00 ? 130 LYS A HZ2  10 
ATOM   4949 H  HZ3  . LYS A 1 29 ? -8.907  -31.739 4.926  1.00 0.00 ? 130 LYS A HZ3  10 
HETATM 4950 ZN ZN   . ZN  B 2 .  ? -1.428  -12.797 8.525  1.00 0.00 ? 1   ZN  A ZN   10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  102 102 ARG ARG A . n 
A 1 2  SER 2  103 103 SER SER A . n 
A 1 3  PHE 3  104 104 PHE PHE A . n 
A 1 4  VAL 4  105 105 VAL VAL A . n 
A 1 5  CYS 5  106 106 CYS CYS A . n 
A 1 6  GLU 6  107 107 GLU GLU A . n 
A 1 7  VAL 7  108 108 VAL VAL A . n 
A 1 8  CYS 8  109 109 CYS CYS A . n 
A 1 9  THR 9  110 110 THR THR A . n 
A 1 10 ARG 10 111 111 ARG ARG A . n 
A 1 11 ALA 11 112 112 ALA ALA A . n 
A 1 12 PHE 12 113 113 PHE PHE A . n 
A 1 13 ALA 13 114 114 ALA ALA A . n 
A 1 14 ARG 14 115 115 ARG ARG A . n 
A 1 15 GLN 15 116 116 GLN GLN A . n 
A 1 16 GLU 16 117 117 GLU GLU A . n 
A 1 17 HIS 17 118 118 HIS HIS A . n 
A 1 18 LEU 18 119 119 LEU LEU A . n 
A 1 19 LYS 19 120 120 LYS LYS A . n 
A 1 20 ARG 20 121 121 ARG ARG A . n 
A 1 21 HIS 21 122 122 HIS HIS A . n 
A 1 22 TYR 22 123 123 TYR TYR A . n 
A 1 23 ARG 23 124 124 ARG ARG A . n 
A 1 24 SER 24 125 125 SER SER A . n 
A 1 25 HIS 25 126 126 HIS HIS A . n 
A 1 26 THR 26 127 127 THR THR A . n 
A 1 27 ASN 27 128 128 ASN ASN A . n 
A 1 28 GLU 28 129 129 GLU GLU A . n 
A 1 29 LYS 29 130 130 LYS LYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     1 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG  ? A CYS 5  ? A CYS 106 ? 1_555 99.1  ? 
2 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG  ? A CYS 8  ? A CYS 109 ? 1_555 139.1 ? 
3 SG  ? A CYS 5  ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG  ? A CYS 8  ? A CYS 109 ? 1_555 121.0 ? 
4 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 87.2  ? 
5 SG  ? A CYS 5  ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 95.9  ? 
6 SG  ? A CYS 8  ? A CYS 109 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 95.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status  
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
4 4 'Structure model' struct_conf           
5 4 'Structure model' struct_conf_type      
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O   A CYS 106 ? ? H   A THR 110 ? ? 1.48 
2  1  H   A CYS 106 ? ? O   A ARG 111 ? ? 1.53 
3  1  O   A CYS 106 ? ? N   A THR 110 ? ? 2.16 
4  2  O   A CYS 106 ? ? H   A THR 110 ? ? 1.24 
5  2  O   A CYS 106 ? ? N   A THR 110 ? ? 2.13 
6  3  O   A CYS 106 ? ? H   A THR 110 ? ? 1.45 
7  3  O   A CYS 109 ? ? OG1 A THR 110 ? ? 1.75 
8  3  O   A CYS 106 ? ? N   A THR 110 ? ? 2.15 
9  4  O   A HIS 122 ? ? H   A SER 125 ? ? 1.49 
10 4  O   A TYR 123 ? ? H   A HIS 126 ? ? 1.50 
11 4  O   A CYS 106 ? ? H   A THR 110 ? ? 1.50 
12 5  O   A CYS 106 ? ? H   A THR 110 ? ? 1.25 
13 5  O   A TYR 123 ? ? H   A HIS 126 ? ? 1.57 
14 5  O   A GLU 117 ? ? H   A ARG 121 ? ? 1.57 
15 5  O   A CYS 106 ? ? N   A THR 110 ? ? 2.07 
16 6  O   A CYS 106 ? ? H   A THR 110 ? ? 1.42 
17 6  H   A CYS 106 ? ? O   A ARG 111 ? ? 1.50 
18 6  O   A CYS 106 ? ? N   A THR 110 ? ? 2.10 
19 7  O   A TYR 123 ? ? H   A HIS 126 ? ? 1.28 
20 7  OE1 A GLU 117 ? ? H   A HIS 118 ? ? 1.44 
21 7  H   A CYS 106 ? ? O   A ARG 111 ? ? 1.52 
22 7  O   A LEU 119 ? ? H   A TYR 123 ? ? 1.54 
23 7  O   A GLN 116 ? ? H   A LEU 119 ? ? 1.57 
24 7  O   A HIS 122 ? ? H   A SER 125 ? ? 1.58 
25 8  O   A TYR 123 ? ? H   A HIS 126 ? ? 1.40 
26 8  O   A HIS 122 ? ? H   A SER 125 ? ? 1.48 
27 8  H   A CYS 106 ? ? O   A ARG 111 ? ? 1.56 
28 8  O   A LEU 119 ? ? H   A TYR 123 ? ? 1.57 
29 8  O   A CYS 106 ? ? N   A THR 110 ? ? 2.18 
30 9  O   A TYR 123 ? ? H   A HIS 126 ? ? 1.32 
31 9  O   A HIS 122 ? ? H   A SER 125 ? ? 1.48 
32 9  O   A GLU 117 ? ? H   A ARG 121 ? ? 1.60 
33 10 O   A TYR 123 ? ? H   A HIS 126 ? ? 1.43 
34 10 OE1 A GLU 117 ? ? H   A HIS 118 ? ? 1.47 
35 10 O   A CYS 106 ? ? N   A THR 110 ? ? 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  PHE A 104 ? ? -22.21  136.97  
2  1  CYS A 106 ? ? -59.67  98.39   
3  1  VAL A 108 ? ? -83.16  -71.59  
4  1  ARG A 124 ? ? -28.41  -43.09  
5  1  THR A 127 ? ? -151.42 -132.55 
6  1  ASN A 128 ? ? -162.68 32.92   
7  2  PHE A 104 ? ? -19.37  131.46  
8  2  CYS A 106 ? ? -57.84  86.94   
9  2  VAL A 108 ? ? -66.09  -72.88  
10 2  THR A 110 ? ? 76.36   39.75   
11 2  ARG A 124 ? ? -36.10  -28.20  
12 2  THR A 127 ? ? -149.24 -140.87 
13 3  PHE A 104 ? ? -35.70  132.48  
14 3  CYS A 106 ? ? -51.15  96.95   
15 3  THR A 110 ? ? 95.28   36.79   
16 4  PHE A 104 ? ? -20.82  136.28  
17 4  CYS A 106 ? ? -57.14  105.09  
18 4  GLU A 107 ? ? -59.01  -5.19   
19 4  VAL A 108 ? ? -90.88  -70.40  
20 4  THR A 110 ? ? 85.01   28.94   
21 4  ARG A 124 ? ? -39.21  -28.39  
22 5  SER A 103 ? ? -174.97 146.76  
23 5  CYS A 106 ? ? -59.59  94.29   
24 5  GLU A 107 ? ? -46.62  -18.47  
25 5  VAL A 108 ? ? -75.48  -71.83  
26 5  THR A 110 ? ? 82.69   33.29   
27 5  ARG A 124 ? ? -54.83  -6.79   
28 5  THR A 127 ? ? -140.33 -140.13 
29 5  ASN A 128 ? ? -26.89  -76.49  
30 6  PHE A 104 ? ? -16.15  134.53  
31 6  CYS A 106 ? ? -59.82  95.07   
32 6  GLU A 107 ? ? -46.47  -17.32  
33 6  VAL A 108 ? ? -78.35  -73.01  
34 6  ARG A 124 ? ? -50.99  -6.91   
35 6  THR A 127 ? ? -146.25 -137.57 
36 6  ASN A 128 ? ? 177.44  76.67   
37 7  PHE A 104 ? ? -15.46  120.60  
38 7  CYS A 106 ? ? -68.84  85.19   
39 7  THR A 110 ? ? 32.79   60.80   
40 7  GLU A 117 ? ? -30.10  -38.21  
41 7  TYR A 123 ? ? -37.29  -37.70  
42 7  ASN A 128 ? ? -179.35 -65.95  
43 8  PHE A 104 ? ? -9.79   121.34  
44 8  CYS A 106 ? ? -58.99  91.59   
45 8  VAL A 108 ? ? -68.56  -72.60  
46 8  THR A 110 ? ? 38.07   57.17   
47 8  TYR A 123 ? ? -36.81  -34.22  
48 8  THR A 127 ? ? -161.41 -136.63 
49 8  ASN A 128 ? ? -36.21  112.02  
50 9  GLU A 107 ? ? -58.24  -4.26   
51 9  VAL A 108 ? ? -95.24  -69.25  
52 9  THR A 110 ? ? 30.91   56.48   
53 9  TYR A 123 ? ? -37.30  -36.38  
54 9  THR A 127 ? ? -63.80  0.51    
55 10 CYS A 106 ? ? -61.06  92.04   
56 10 VAL A 108 ? ? -73.11  -70.78  
57 10 THR A 110 ? ? 35.91   56.06   
58 10 TYR A 123 ? ? -39.91  -26.20  
59 10 THR A 127 ? ? 171.62  139.82  
60 10 ASN A 128 ? ? -103.47 42.82   
61 10 GLU A 129 ? ? -36.52  129.40  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 102 ? ? 0.268 'SIDE CHAIN' 
2  1  ARG A 111 ? ? 0.157 'SIDE CHAIN' 
3  1  ARG A 115 ? ? 0.228 'SIDE CHAIN' 
4  1  ARG A 121 ? ? 0.100 'SIDE CHAIN' 
5  1  ARG A 124 ? ? 0.264 'SIDE CHAIN' 
6  2  ARG A 102 ? ? 0.261 'SIDE CHAIN' 
7  2  ARG A 111 ? ? 0.192 'SIDE CHAIN' 
8  2  ARG A 115 ? ? 0.164 'SIDE CHAIN' 
9  2  ARG A 121 ? ? 0.181 'SIDE CHAIN' 
10 2  ARG A 124 ? ? 0.300 'SIDE CHAIN' 
11 3  ARG A 102 ? ? 0.197 'SIDE CHAIN' 
12 3  ARG A 111 ? ? 0.130 'SIDE CHAIN' 
13 3  ARG A 115 ? ? 0.274 'SIDE CHAIN' 
14 3  ARG A 121 ? ? 0.278 'SIDE CHAIN' 
15 4  ARG A 102 ? ? 0.165 'SIDE CHAIN' 
16 4  ARG A 111 ? ? 0.178 'SIDE CHAIN' 
17 4  ARG A 115 ? ? 0.294 'SIDE CHAIN' 
18 4  ARG A 121 ? ? 0.126 'SIDE CHAIN' 
19 4  ARG A 124 ? ? 0.148 'SIDE CHAIN' 
20 5  ARG A 102 ? ? 0.182 'SIDE CHAIN' 
21 5  ARG A 111 ? ? 0.299 'SIDE CHAIN' 
22 5  ARG A 115 ? ? 0.221 'SIDE CHAIN' 
23 5  ARG A 121 ? ? 0.191 'SIDE CHAIN' 
24 5  ARG A 124 ? ? 0.092 'SIDE CHAIN' 
25 6  ARG A 102 ? ? 0.255 'SIDE CHAIN' 
26 6  ARG A 111 ? ? 0.096 'SIDE CHAIN' 
27 6  ARG A 115 ? ? 0.298 'SIDE CHAIN' 
28 6  ARG A 121 ? ? 0.191 'SIDE CHAIN' 
29 6  ARG A 124 ? ? 0.175 'SIDE CHAIN' 
30 7  ARG A 102 ? ? 0.079 'SIDE CHAIN' 
31 7  ARG A 111 ? ? 0.116 'SIDE CHAIN' 
32 7  ARG A 115 ? ? 0.240 'SIDE CHAIN' 
33 7  ARG A 121 ? ? 0.098 'SIDE CHAIN' 
34 7  ARG A 124 ? ? 0.273 'SIDE CHAIN' 
35 8  ARG A 102 ? ? 0.210 'SIDE CHAIN' 
36 8  ARG A 111 ? ? 0.193 'SIDE CHAIN' 
37 8  ARG A 115 ? ? 0.298 'SIDE CHAIN' 
38 8  ARG A 121 ? ? 0.279 'SIDE CHAIN' 
39 8  ARG A 124 ? ? 0.142 'SIDE CHAIN' 
40 9  ARG A 102 ? ? 0.168 'SIDE CHAIN' 
41 9  ARG A 111 ? ? 0.228 'SIDE CHAIN' 
42 9  ARG A 115 ? ? 0.183 'SIDE CHAIN' 
43 9  ARG A 121 ? ? 0.289 'SIDE CHAIN' 
44 9  ARG A 124 ? ? 0.127 'SIDE CHAIN' 
45 10 ARG A 111 ? ? 0.147 'SIDE CHAIN' 
46 10 ARG A 115 ? ? 0.258 'SIDE CHAIN' 
47 10 ARG A 124 ? ? 0.228 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#