data_1ARE
# 
_entry.id   1ARE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ARE         
WWPDB D_1000171164 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ARE 
_pdbx_database_status.recvd_initial_deposition_date   1993-10-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoffman, R.C.'  1 
'Xu, R.X.'       2 
'Horvath, S.J.'  3 
'Herriott, J.R.' 4 
'Klevit, R.E.'   5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structures of DNA-binding mutant zinc finger domains: implications for DNA binding.'                                     
'Protein Sci.' 2   951 965 1993 PRCIEI US 0961-8368 0795 ? 8318900 ? 
1       'A Simple Method for the Refinement of Models Derived from NMR Data Demonstrated on a Zinc-Finger Domain from Yeast Adr1' 
J.Magn.Reson.  102 61  ?   1993 JOMRA4 US 0022-2364 0624 ? ?       ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoffman, R.C.'  1 
primary 'Horvath, S.J.'  2 
primary 'Klevit, R.E.'   3 
1       'Hoffman, R.C.'  4 
1       'Xu, R.X.'       5 
1       'Klevit, R.E.'   6 
1       'Herriott, J.R.' 7 
# 
_cell.entry_id           1ARE 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ARE 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'YEAST TRANSCRIPTION FACTOR ADR1' 3533.034 1 ? ? ? ? 
2 non-polymer syn 'ZINC ION'                        65.409   1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       RSFVCEVCTRAFARQEALKRHYRSHTNEK 
_entity_poly.pdbx_seq_one_letter_code_can   RSFVCEVCTRAFARQEALKRHYRSHTNEK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ARG n 
1 2  SER n 
1 3  PHE n 
1 4  VAL n 
1 5  CYS n 
1 6  GLU n 
1 7  VAL n 
1 8  CYS n 
1 9  THR n 
1 10 ARG n 
1 11 ALA n 
1 12 PHE n 
1 13 ALA n 
1 14 ARG n 
1 15 GLN n 
1 16 GLU n 
1 17 ALA n 
1 18 LEU n 
1 19 LYS n 
1 20 ARG n 
1 21 HIS n 
1 22 TYR n 
1 23 ARG n 
1 24 SER n 
1 25 HIS n 
1 26 THR n 
1 27 ASN n 
1 28 GLU n 
1 29 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADR1_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P07248 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MANVEKPNDCSGFPVVDLNSCFSNGFNNEKQEIEMETDDSPILLMSSSASRENSNTFSVIQRTPDGKIITTNNNMNSKIN
KQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRHAQKIHSGNLG
ETISHTKKVSRTITKARKNSASSVKFQTPTYGTPDNGNFLNRTTANTRRKASPEANVKRKYLKKLTRRASFSAQSASSYA
LPDQSSLEQHPKDRVKFSTPELVPLDLKNPELDSSFDLNMNLDLNLNLDSNFNIALNRSDSSGSTMNLDYKLPESANNYT
YSSGSPTRAYVGANTNSKNASFNDADLLSSSYWIKAYNDHLFSVSESDETSPMNSELNDTKLIVPDFKSTIHHLKDSRSS
SWTVAIDNNSNNNKVSDNQPDFVDFQELLDNDTLGNDLLETTAVLKEFELLHDDSVSATATSNEIDLSHLNLSNSPISPH
KLIYKNKEGTNDDMLISFGLDHPSNREDDLDKLCNMTRDVQAIFSQYLKGEESKRSLEDFLSTSNRKEKPDSGNYTFYGL
DCLTLSKISRALPASTVNNNQPSHSIESKLFNEPMRNMCIKVLRYYEKFSHDSSESVMDSNPNLLSKELLMPAVSELNEY
LDLFKNNFLPHFPIIHPSLLDLDLDSLQRYTNEDGYDDAENAQLFDRLSQGTDKEYDYEHYQILSISKIVCLPLFMATFG
SLHKFGYKSQTIELYEMSRRILHSFLETKRRCRSTTVNDSYQNIWLMQSLILSFMFALVADYLEKIDSSLMKRQLSALCS
TIRSNCLPTISANSEKSINNNNEPLTFGSPLQYIIFESKIRCTLMAYDFCQFLKCFFHIKFDLSIKEKDVETIYIPDNES
KWASESIICNGHVVQKQNFYDFRNFYYSFTYGHLHSIPEFLGSSMIYYEYDLRKGTKSHVFLDRIDTKRLERSLDTSSYG
NDNMAATNKNIAILIDDTIILKNNLMSMRFIKQIDRSFTEKVRKGQIAKIYDSFLNSVRLNFLKNYSVEVLCEFLVALNF
SIRNISSLYVEEESDCSQRMNSPELPRIHLNNQALSVFNLQGYYYCFILIIKFLLDFEATPNFKLLRIFIELRSLANSIL
LPTLSRLYPQEFSGFPDVVFTQQFINKDNGMLVPGLSANEHHNGASAAVKTKLAKKINVEGLAMFINEILVNSFNDTSFL
NMEDPIRNEFSFDNGHRAVTDLPRSAHFLSDTGLEGINFSGLNDSHQTVSTLNLLRYGENHSSKHKNGGKGQGFAEKYQL
SLKYVTIAKLFFTNVKENYIHCHMLDKMASDFHTLENHLKGNS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ARE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 29 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P07248 
_struct_ref_seq.db_align_beg                  102 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  130 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       102 
_struct_ref_seq.pdbx_auth_seq_align_end       130 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1ARE 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      17 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P07248 
_struct_ref_seq_dif.db_mon_id                    HIS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          118 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            118 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_pdbx_nmr_ensemble.entry_id                             1ARE 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    10 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_exptl.entry_id          1ARE 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1ARE 
_struct.title                     'STRUCTURES OF DNA-BINDING MUTANT ZINC FINGER DOMAINS: IMPLICATIONS FOR DNA BINDING' 
_struct.pdbx_descriptor           
;YEAST TRANSCRIPTION FACTOR ADR1 (RESIDUES 102 - 130) (AMINO TERMINAL ZINC FINGER DOMAIN) MUTANT WITH HIS 118 REPLACED BY ALA (H118A) (ADR1B:H118A) (NMR, 10 STRUCTURES)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ARE 
_struct_keywords.pdbx_keywords   'TRANSCRIPTION REGULATION' 
_struct_keywords.text            'TRANSCRIPTION REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A Y N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       AAA 
_struct_conf.beg_label_comp_id       GLN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        15 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       HIS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        25 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         116 
_struct_conf.end_auth_comp_id        HIS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         126 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 'ALPHA AND 3/10 HELICAL H-BONDS' 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 5  SG  ? ? A ZN 1 A CYS 106 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 21 NE2 ? ? A ZN 1 A HIS 122 1_555 ? ? ? ? ? ? ? 2.002 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 8  SG  ? ? A ZN 1 A CYS 109 1_555 ? ? ? ? ? ? ? 2.305 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 25 NE2 ? ? A ZN 1 A HIS 126 1_555 ? ? ? ? ? ? ? 2.007 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               BBB 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     BBB 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BBB 1 PHE A 3 ? CYS A 5  ? PHE A 104 CYS A 106 
BBB 2 THR A 9 ? PHE A 12 ? THR A 110 PHE A 113 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 5  ? CYS A 106 . ? 1_555 ? 
2 AC1 4 CYS A 8  ? CYS A 109 . ? 1_555 ? 
3 AC1 4 HIS A 21 ? HIS A 122 . ? 1_555 ? 
4 AC1 4 HIS A 25 ? HIS A 126 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ARE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ARE 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ARG A 1 1  ? -0.407  0.202   -3.534 1.00 0.00 ? 102 ARG A N    1  
ATOM   2    C  CA   . ARG A 1 1  ? -0.576  -1.222  -3.304 1.00 0.00 ? 102 ARG A CA   1  
ATOM   3    C  C    . ARG A 1 1  ? 0.592   -1.768  -2.478 1.00 0.00 ? 102 ARG A C    1  
ATOM   4    O  O    . ARG A 1 1  ? 1.612   -1.099  -2.322 1.00 0.00 ? 102 ARG A O    1  
ATOM   5    C  CB   . ARG A 1 1  ? -0.658  -1.988  -4.626 1.00 0.00 ? 102 ARG A CB   1  
ATOM   6    C  CG   . ARG A 1 1  ? -1.432  -1.188  -5.676 1.00 0.00 ? 102 ARG A CG   1  
ATOM   7    C  CD   . ARG A 1 1  ? -2.886  -0.980  -5.244 1.00 0.00 ? 102 ARG A CD   1  
ATOM   8    N  NE   . ARG A 1 1  ? -3.338  0.376   -5.630 1.00 0.00 ? 102 ARG A NE   1  
ATOM   9    C  CZ   . ARG A 1 1  ? -3.891  1.252   -4.780 1.00 0.00 ? 102 ARG A CZ   1  
ATOM   10   N  NH1  . ARG A 1 1  ? -3.134  1.852   -3.851 1.00 0.00 ? 102 ARG A NH1  1  
ATOM   11   N  NH2  . ARG A 1 1  ? -5.199  1.529   -4.859 1.00 0.00 ? 102 ARG A NH2  1  
ATOM   12   H  H    . ARG A 1 1  ? 0.469   0.465   -3.939 1.00 0.00 ? 102 ARG A H    1  
ATOM   13   H  HA   . ARG A 1 1  ? -1.515  -1.307  -2.759 1.00 0.00 ? 102 ARG A HA   1  
ATOM   14   H  HB2  . ARG A 1 1  ? 0.347   -2.199  -4.992 1.00 0.00 ? 102 ARG A HB2  1  
ATOM   15   H  HB3  . ARG A 1 1  ? -1.146  -2.949  -4.464 1.00 0.00 ? 102 ARG A HB3  1  
ATOM   16   H  HG2  . ARG A 1 1  ? -0.952  -0.221  -5.827 1.00 0.00 ? 102 ARG A HG2  1  
ATOM   17   H  HG3  . ARG A 1 1  ? -1.404  -1.711  -6.632 1.00 0.00 ? 102 ARG A HG3  1  
ATOM   18   H  HD2  . ARG A 1 1  ? -3.523  -1.731  -5.711 1.00 0.00 ? 102 ARG A HD2  1  
ATOM   19   H  HD3  . ARG A 1 1  ? -2.976  -1.110  -4.167 1.00 0.00 ? 102 ARG A HD3  1  
ATOM   20   H  HE   . ARG A 1 1  ? -3.225  0.654   -6.583 1.00 0.00 ? 102 ARG A HE   1  
ATOM   21   H  HH11 . ARG A 1 1  ? -2.617  2.676   -4.082 1.00 0.00 ? 102 ARG A HH11 1  
ATOM   22   H  HH12 . ARG A 1 1  ? -3.087  1.476   -2.925 1.00 0.00 ? 102 ARG A HH12 1  
ATOM   23   H  HH21 . ARG A 1 1  ? -5.572  1.952   -5.685 1.00 0.00 ? 102 ARG A HH21 1  
ATOM   24   H  HH22 . ARG A 1 1  ? -5.804  1.312   -4.093 1.00 0.00 ? 102 ARG A HH22 1  
ATOM   25   N  N    . SER A 1 2  ? 0.402   -2.977  -1.972 1.00 0.00 ? 103 SER A N    1  
ATOM   26   C  CA   . SER A 1 2  ? 1.425   -3.621  -1.167 1.00 0.00 ? 103 SER A CA   1  
ATOM   27   C  C    . SER A 1 2  ? 0.955   -5.011  -0.733 1.00 0.00 ? 103 SER A C    1  
ATOM   28   O  O    . SER A 1 2  ? -0.234  -5.319  -0.810 1.00 0.00 ? 103 SER A O    1  
ATOM   29   C  CB   . SER A 1 2  ? 1.776   -2.773  0.059  1.00 0.00 ? 103 SER A CB   1  
ATOM   30   O  OG   . SER A 1 2  ? 2.952   -1.996  -0.149 1.00 0.00 ? 103 SER A OG   1  
ATOM   31   H  H    . SER A 1 2  ? -0.432  -3.515  -2.104 1.00 0.00 ? 103 SER A H    1  
ATOM   32   H  HA   . SER A 1 2  ? 2.297   -3.697  -1.815 1.00 0.00 ? 103 SER A HA   1  
ATOM   33   H  HB2  . SER A 1 2  ? 0.941   -2.112  0.293  1.00 0.00 ? 103 SER A HB2  1  
ATOM   34   H  HB3  . SER A 1 2  ? 1.919   -3.424  0.921  1.00 0.00 ? 103 SER A HB3  1  
ATOM   35   H  HG   . SER A 1 2  ? 3.512   -2.408  -0.868 1.00 0.00 ? 103 SER A HG   1  
ATOM   36   N  N    . PHE A 1 3  ? 1.910   -5.811  -0.286 1.00 0.00 ? 104 PHE A N    1  
ATOM   37   C  CA   . PHE A 1 3  ? 1.608   -7.161  0.161  1.00 0.00 ? 104 PHE A CA   1  
ATOM   38   C  C    . PHE A 1 3  ? 1.379   -7.200  1.672  1.00 0.00 ? 104 PHE A C    1  
ATOM   39   O  O    . PHE A 1 3  ? 2.293   -7.514  2.434  1.00 0.00 ? 104 PHE A O    1  
ATOM   40   C  CB   . PHE A 1 3  ? 2.821   -8.027  -0.183 1.00 0.00 ? 104 PHE A CB   1  
ATOM   41   C  CG   . PHE A 1 3  ? 3.343   -7.832  -1.607 1.00 0.00 ? 104 PHE A CG   1  
ATOM   42   C  CD1  . PHE A 1 3  ? 2.530   -8.079  -2.670 1.00 0.00 ? 104 PHE A CD1  1  
ATOM   43   C  CD2  . PHE A 1 3  ? 4.620   -7.411  -1.813 1.00 0.00 ? 104 PHE A CD2  1  
ATOM   44   C  CE1  . PHE A 1 3  ? 3.013   -7.898  -3.992 1.00 0.00 ? 104 PHE A CE1  1  
ATOM   45   C  CE2  . PHE A 1 3  ? 5.104   -7.230  -3.135 1.00 0.00 ? 104 PHE A CE2  1  
ATOM   46   C  CZ   . PHE A 1 3  ? 4.290   -7.477  -4.198 1.00 0.00 ? 104 PHE A CZ   1  
ATOM   47   H  H    . PHE A 1 3  ? 2.874   -5.552  -0.225 1.00 0.00 ? 104 PHE A H    1  
ATOM   48   H  HA   . PHE A 1 3  ? 0.699   -7.474  -0.352 1.00 0.00 ? 104 PHE A HA   1  
ATOM   49   H  HB2  . PHE A 1 3  ? 3.624   -7.805  0.521  1.00 0.00 ? 104 PHE A HB2  1  
ATOM   50   H  HB3  . PHE A 1 3  ? 2.558   -9.076  -0.044 1.00 0.00 ? 104 PHE A HB3  1  
ATOM   51   H  HD1  . PHE A 1 3  ? 1.506   -8.416  -2.505 1.00 0.00 ? 104 PHE A HD1  1  
ATOM   52   H  HD2  . PHE A 1 3  ? 5.272   -7.214  -0.962 1.00 0.00 ? 104 PHE A HD2  1  
ATOM   53   H  HE1  . PHE A 1 3  ? 2.362   -8.096  -4.843 1.00 0.00 ? 104 PHE A HE1  1  
ATOM   54   H  HE2  . PHE A 1 3  ? 6.127   -6.893  -3.300 1.00 0.00 ? 104 PHE A HE2  1  
ATOM   55   H  HZ   . PHE A 1 3  ? 4.662   -7.339  -5.212 1.00 0.00 ? 104 PHE A HZ   1  
ATOM   56   N  N    . VAL A 1 4  ? 0.154   -6.877  2.062  1.00 0.00 ? 105 VAL A N    1  
ATOM   57   C  CA   . VAL A 1 4  ? -0.206  -6.872  3.470  1.00 0.00 ? 105 VAL A CA   1  
ATOM   58   C  C    . VAL A 1 4  ? -1.190  -8.012  3.744  1.00 0.00 ? 105 VAL A C    1  
ATOM   59   O  O    . VAL A 1 4  ? -1.986  -8.370  2.878  1.00 0.00 ? 105 VAL A O    1  
ATOM   60   C  CB   . VAL A 1 4  ? -0.755  -5.500  3.864  1.00 0.00 ? 105 VAL A CB   1  
ATOM   61   C  CG1  . VAL A 1 4  ? -1.436  -5.554  5.233  1.00 0.00 ? 105 VAL A CG1  1  
ATOM   62   C  CG2  . VAL A 1 4  ? 0.348   -4.440  3.842  1.00 0.00 ? 105 VAL A CG2  1  
ATOM   63   H  H    . VAL A 1 4  ? -0.583  -6.623  1.436  1.00 0.00 ? 105 VAL A H    1  
ATOM   64   H  HA   . VAL A 1 4  ? 0.704   -7.048  4.043  1.00 0.00 ? 105 VAL A HA   1  
ATOM   65   H  HB   . VAL A 1 4  ? -1.507  -5.215  3.127  1.00 0.00 ? 105 VAL A HB   1  
ATOM   66   H  HG11 . VAL A 1 4  ? -1.780  -6.570  5.428  1.00 0.00 ? 105 VAL A HG11 1  
ATOM   67   H  HG12 . VAL A 1 4  ? -0.724  -5.257  6.004  1.00 0.00 ? 105 VAL A HG12 1  
ATOM   68   H  HG13 . VAL A 1 4  ? -2.288  -4.874  5.243  1.00 0.00 ? 105 VAL A HG13 1  
ATOM   69   H  HG21 . VAL A 1 4  ? 0.654   -4.256  2.812  1.00 0.00 ? 105 VAL A HG21 1  
ATOM   70   H  HG22 . VAL A 1 4  ? -0.027  -3.515  4.280  1.00 0.00 ? 105 VAL A HG22 1  
ATOM   71   H  HG23 . VAL A 1 4  ? 1.203   -4.794  4.417  1.00 0.00 ? 105 VAL A HG23 1  
ATOM   72   N  N    . CYS A 1 5  ? -1.102  -8.547  4.952  1.00 0.00 ? 106 CYS A N    1  
ATOM   73   C  CA   . CYS A 1 5  ? -1.975  -9.639  5.351  1.00 0.00 ? 106 CYS A CA   1  
ATOM   74   C  C    . CYS A 1 5  ? -3.273  -9.041  5.895  1.00 0.00 ? 106 CYS A C    1  
ATOM   75   O  O    . CYS A 1 5  ? -3.277  -8.415  6.955  1.00 0.00 ? 106 CYS A O    1  
ATOM   76   C  CB   . CYS A 1 5  ? -1.300  -10.559 6.369  1.00 0.00 ? 106 CYS A CB   1  
ATOM   77   S  SG   . CYS A 1 5  ? -2.440  -11.908 6.847  1.00 0.00 ? 106 CYS A SG   1  
ATOM   78   H  H    . CYS A 1 5  ? -0.451  -8.250  5.651  1.00 0.00 ? 106 CYS A H    1  
ATOM   79   H  HA   . CYS A 1 5  ? -2.166  -10.230 4.456  1.00 0.00 ? 106 CYS A HA   1  
ATOM   80   H  HB2  . CYS A 1 5  ? -0.386  -10.977 5.946  1.00 0.00 ? 106 CYS A HB2  1  
ATOM   81   H  HB3  . CYS A 1 5  ? -1.009  -9.988  7.252  1.00 0.00 ? 106 CYS A HB3  1  
ATOM   82   N  N    . GLU A 1 6  ? -4.345  -9.254  5.146  1.00 0.00 ? 107 GLU A N    1  
ATOM   83   C  CA   . GLU A 1 6  ? -5.648  -8.744  5.540  1.00 0.00 ? 107 GLU A CA   1  
ATOM   84   C  C    . GLU A 1 6  ? -6.107  -9.409  6.839  1.00 0.00 ? 107 GLU A C    1  
ATOM   85   O  O    . GLU A 1 6  ? -6.904  -8.839  7.583  1.00 0.00 ? 107 GLU A O    1  
ATOM   86   C  CB   . GLU A 1 6  ? -6.676  -8.947  4.427  1.00 0.00 ? 107 GLU A CB   1  
ATOM   87   C  CG   . GLU A 1 6  ? -6.372  -8.046  3.227  1.00 0.00 ? 107 GLU A CG   1  
ATOM   88   C  CD   . GLU A 1 6  ? -7.027  -6.674  3.393  1.00 0.00 ? 107 GLU A CD   1  
ATOM   89   O  OE1  . GLU A 1 6  ? -8.275  -6.630  3.334  1.00 0.00 ? 107 GLU A OE1  1  
ATOM   90   O  OE2  . GLU A 1 6  ? -6.265  -5.700  3.575  1.00 0.00 ? 107 GLU A OE2  1  
ATOM   91   H  H    . GLU A 1 6  ? -4.334  -9.764  4.287  1.00 0.00 ? 107 GLU A H    1  
ATOM   92   H  HA   . GLU A 1 6  ? -5.503  -7.676  5.702  1.00 0.00 ? 107 GLU A HA   1  
ATOM   93   H  HB2  . GLU A 1 6  ? -6.674  -9.991  4.111  1.00 0.00 ? 107 GLU A HB2  1  
ATOM   94   H  HB3  . GLU A 1 6  ? -7.675  -8.731  4.804  1.00 0.00 ? 107 GLU A HB3  1  
ATOM   95   H  HG2  . GLU A 1 6  ? -5.294  -7.928  3.122  1.00 0.00 ? 107 GLU A HG2  1  
ATOM   96   H  HG3  . GLU A 1 6  ? -6.732  -8.517  2.313  1.00 0.00 ? 107 GLU A HG3  1  
ATOM   97   N  N    . VAL A 1 7  ? -5.586  -10.604 7.072  1.00 0.00 ? 108 VAL A N    1  
ATOM   98   C  CA   . VAL A 1 7  ? -5.932  -11.352 8.268  1.00 0.00 ? 108 VAL A CA   1  
ATOM   99   C  C    . VAL A 1 7  ? -5.449  -10.586 9.501  1.00 0.00 ? 108 VAL A C    1  
ATOM   100  O  O    . VAL A 1 7  ? -6.256  -10.153 10.322 1.00 0.00 ? 108 VAL A O    1  
ATOM   101  C  CB   . VAL A 1 7  ? -5.361  -12.770 8.183  1.00 0.00 ? 108 VAL A CB   1  
ATOM   102  C  CG1  . VAL A 1 7  ? -5.355  -13.442 9.558  1.00 0.00 ? 108 VAL A CG1  1  
ATOM   103  C  CG2  . VAL A 1 7  ? -6.132  -13.611 7.163  1.00 0.00 ? 108 VAL A CG2  1  
ATOM   104  H  H    . VAL A 1 7  ? -4.938  -11.059 6.461  1.00 0.00 ? 108 VAL A H    1  
ATOM   105  H  HA   . VAL A 1 7  ? -7.019  -11.428 8.305  1.00 0.00 ? 108 VAL A HA   1  
ATOM   106  H  HB   . VAL A 1 7  ? -4.328  -12.695 7.841  1.00 0.00 ? 108 VAL A HB   1  
ATOM   107  H  HG11 . VAL A 1 7  ? -6.279  -13.203 10.082 1.00 0.00 ? 108 VAL A HG11 1  
ATOM   108  H  HG12 . VAL A 1 7  ? -5.276  -14.521 9.433  1.00 0.00 ? 108 VAL A HG12 1  
ATOM   109  H  HG13 . VAL A 1 7  ? -4.505  -13.080 10.135 1.00 0.00 ? 108 VAL A HG13 1  
ATOM   110  H  HG21 . VAL A 1 7  ? -5.441  -14.003 6.418  1.00 0.00 ? 108 VAL A HG21 1  
ATOM   111  H  HG22 . VAL A 1 7  ? -6.624  -14.439 7.675  1.00 0.00 ? 108 VAL A HG22 1  
ATOM   112  H  HG23 . VAL A 1 7  ? -6.881  -12.990 6.673  1.00 0.00 ? 108 VAL A HG23 1  
ATOM   113  N  N    . CYS A 1 8  ? -4.135  -10.444 9.593  1.00 0.00 ? 109 CYS A N    1  
ATOM   114  C  CA   . CYS A 1 8  ? -3.535  -9.738  10.712 1.00 0.00 ? 109 CYS A CA   1  
ATOM   115  C  C    . CYS A 1 8  ? -3.103  -8.351  10.231 1.00 0.00 ? 109 CYS A C    1  
ATOM   116  O  O    . CYS A 1 8  ? -3.481  -7.340  10.821 1.00 0.00 ? 109 CYS A O    1  
ATOM   117  C  CB   . CYS A 1 8  ? -2.367  -10.521 11.314 1.00 0.00 ? 109 CYS A CB   1  
ATOM   118  S  SG   . CYS A 1 8  ? -0.927  -10.464 10.187 1.00 0.00 ? 109 CYS A SG   1  
ATOM   119  H  H    . CYS A 1 8  ? -3.486  -10.800 8.921  1.00 0.00 ? 109 CYS A H    1  
ATOM   120  H  HA   . CYS A 1 8  ? -4.304  -9.659  11.481 1.00 0.00 ? 109 CYS A HA   1  
ATOM   121  H  HB2  . CYS A 1 8  ? -2.097  -10.102 12.284 1.00 0.00 ? 109 CYS A HB2  1  
ATOM   122  H  HB3  . CYS A 1 8  ? -2.663  -11.556 11.487 1.00 0.00 ? 109 CYS A HB3  1  
ATOM   123  N  N    . THR A 1 9  ? -2.318  -8.349  9.163  1.00 0.00 ? 110 THR A N    1  
ATOM   124  C  CA   . THR A 1 9  ? -1.832  -7.103  8.595  1.00 0.00 ? 110 THR A CA   1  
ATOM   125  C  C    . THR A 1 9  ? -0.344  -7.215  8.259  1.00 0.00 ? 110 THR A C    1  
ATOM   126  O  O    . THR A 1 9  ? 0.217   -6.335  7.609  1.00 0.00 ? 110 THR A O    1  
ATOM   127  C  CB   . THR A 1 9  ? -2.149  -5.978  9.582  1.00 0.00 ? 110 THR A CB   1  
ATOM   128  O  OG1  . THR A 1 9  ? -1.738  -4.794  8.904  1.00 0.00 ? 110 THR A OG1  1  
ATOM   129  C  CG2  . THR A 1 9  ? -1.260  -6.023  10.827 1.00 0.00 ? 110 THR A CG2  1  
ATOM   130  H  H    . THR A 1 9  ? -2.016  -9.176  8.689  1.00 0.00 ? 110 THR A H    1  
ATOM   131  H  HA   . THR A 1 9  ? -2.359  -6.924  7.657  1.00 0.00 ? 110 THR A HA   1  
ATOM   132  H  HB   . THR A 1 9  ? -3.204  -5.987  9.857  1.00 0.00 ? 110 THR A HB   1  
ATOM   133  H  HG1  . THR A 1 9  ? -2.354  -4.040  9.129  1.00 0.00 ? 110 THR A HG1  1  
ATOM   134  H  HG21 . THR A 1 9  ? -1.774  -6.565  11.620 1.00 0.00 ? 110 THR A HG21 1  
ATOM   135  H  HG22 . THR A 1 9  ? -0.325  -6.528  10.587 1.00 0.00 ? 110 THR A HG22 1  
ATOM   136  H  HG23 . THR A 1 9  ? -1.050  -5.006  11.160 1.00 0.00 ? 110 THR A HG23 1  
ATOM   137  N  N    . ARG A 1 10 ? 0.253   -8.306  8.718  1.00 0.00 ? 111 ARG A N    1  
ATOM   138  C  CA   . ARG A 1 10 ? 1.665   -8.544  8.475  1.00 0.00 ? 111 ARG A CA   1  
ATOM   139  C  C    . ARG A 1 10 ? 2.005   -8.268  7.009  1.00 0.00 ? 111 ARG A C    1  
ATOM   140  O  O    . ARG A 1 10 ? 1.460   -8.908  6.111  1.00 0.00 ? 111 ARG A O    1  
ATOM   141  C  CB   . ARG A 1 10 ? 2.047   -9.985  8.817  1.00 0.00 ? 111 ARG A CB   1  
ATOM   142  C  CG   . ARG A 1 10 ? 2.557   -10.091 10.256 1.00 0.00 ? 111 ARG A CG   1  
ATOM   143  C  CD   . ARG A 1 10 ? 3.972   -10.669 10.295 1.00 0.00 ? 111 ARG A CD   1  
ATOM   144  N  NE   . ARG A 1 10 ? 4.873   -9.751  11.029 1.00 0.00 ? 111 ARG A NE   1  
ATOM   145  C  CZ   . ARG A 1 10 ? 6.177   -9.982  11.233 1.00 0.00 ? 111 ARG A CZ   1  
ATOM   146  N  NH1  . ARG A 1 10 ? 7.080   -9.557  10.338 1.00 0.00 ? 111 ARG A NH1  1  
ATOM   147  N  NH2  . ARG A 1 10 ? 6.579   -10.639 12.329 1.00 0.00 ? 111 ARG A NH2  1  
ATOM   148  H  H    . ARG A 1 10 ? -0.211  -9.016  9.247  1.00 0.00 ? 111 ARG A H    1  
ATOM   149  H  HA   . ARG A 1 10 ? 2.183   -7.848  9.136  1.00 0.00 ? 111 ARG A HA   1  
ATOM   150  H  HB2  . ARG A 1 10 ? 1.182   -10.636 8.686  1.00 0.00 ? 111 ARG A HB2  1  
ATOM   151  H  HB3  . ARG A 1 10 ? 2.817   -10.335 8.129  1.00 0.00 ? 111 ARG A HB3  1  
ATOM   152  H  HG2  . ARG A 1 10 ? 2.549   -9.105  10.721 1.00 0.00 ? 111 ARG A HG2  1  
ATOM   153  H  HG3  . ARG A 1 10 ? 1.885   -10.723 10.838 1.00 0.00 ? 111 ARG A HG3  1  
ATOM   154  H  HD2  . ARG A 1 10 ? 3.962   -11.646 10.779 1.00 0.00 ? 111 ARG A HD2  1  
ATOM   155  H  HD3  . ARG A 1 10 ? 4.341   -10.819 9.281  1.00 0.00 ? 111 ARG A HD3  1  
ATOM   156  H  HE   . ARG A 1 10 ? 4.484   -8.906  11.397 1.00 0.00 ? 111 ARG A HE   1  
ATOM   157  H  HH11 . ARG A 1 10 ? 6.899   -9.654  9.360  1.00 0.00 ? 111 ARG A HH11 1  
ATOM   158  H  HH12 . ARG A 1 10 ? 7.934   -9.140  10.650 1.00 0.00 ? 111 ARG A HH12 1  
ATOM   159  H  HH21 . ARG A 1 10 ? 6.266   -10.344 13.232 1.00 0.00 ? 111 ARG A HH21 1  
ATOM   160  H  HH22 . ARG A 1 10 ? 7.192   -11.425 12.245 1.00 0.00 ? 111 ARG A HH22 1  
ATOM   161  N  N    . ALA A 1 11 ? 2.903   -7.314  6.812  1.00 0.00 ? 112 ALA A N    1  
ATOM   162  C  CA   . ALA A 1 11 ? 3.322   -6.946  5.471  1.00 0.00 ? 112 ALA A CA   1  
ATOM   163  C  C    . ALA A 1 11 ? 4.588   -7.723  5.104  1.00 0.00 ? 112 ALA A C    1  
ATOM   164  O  O    . ALA A 1 11 ? 5.402   -8.036  5.972  1.00 0.00 ? 112 ALA A O    1  
ATOM   165  C  CB   . ALA A 1 11 ? 3.527   -5.431  5.397  1.00 0.00 ? 112 ALA A CB   1  
ATOM   166  H  H    . ALA A 1 11 ? 3.341   -6.799  7.548  1.00 0.00 ? 112 ALA A H    1  
ATOM   167  H  HA   . ALA A 1 11 ? 2.523   -7.225  4.785  1.00 0.00 ? 112 ALA A HA   1  
ATOM   168  H  HB1  . ALA A 1 11 ? 3.672   -5.134  4.359  1.00 0.00 ? 112 ALA A HB1  1  
ATOM   169  H  HB2  . ALA A 1 11 ? 2.650   -4.926  5.802  1.00 0.00 ? 112 ALA A HB2  1  
ATOM   170  H  HB3  . ALA A 1 11 ? 4.406   -5.155  5.980  1.00 0.00 ? 112 ALA A HB3  1  
ATOM   171  N  N    . PHE A 1 12 ? 4.715   -8.015  3.818  1.00 0.00 ? 113 PHE A N    1  
ATOM   172  C  CA   . PHE A 1 12 ? 5.867   -8.750  3.327  1.00 0.00 ? 113 PHE A CA   1  
ATOM   173  C  C    . PHE A 1 12 ? 6.385   -8.148  2.019  1.00 0.00 ? 113 PHE A C    1  
ATOM   174  O  O    . PHE A 1 12 ? 5.598   -7.741  1.165  1.00 0.00 ? 113 PHE A O    1  
ATOM   175  C  CB   . PHE A 1 12 ? 5.404   -10.185 3.066  1.00 0.00 ? 113 PHE A CB   1  
ATOM   176  C  CG   . PHE A 1 12 ? 5.016   -10.952 4.331  1.00 0.00 ? 113 PHE A CG   1  
ATOM   177  C  CD1  . PHE A 1 12 ? 5.978   -11.534 5.096  1.00 0.00 ? 113 PHE A CD1  1  
ATOM   178  C  CD2  . PHE A 1 12 ? 3.708   -11.053 4.691  1.00 0.00 ? 113 PHE A CD2  1  
ATOM   179  C  CE1  . PHE A 1 12 ? 5.618   -12.247 6.270  1.00 0.00 ? 113 PHE A CE1  1  
ATOM   180  C  CE2  . PHE A 1 12 ? 3.348   -11.766 5.865  1.00 0.00 ? 113 PHE A CE2  1  
ATOM   181  C  CZ   . PHE A 1 12 ? 4.310   -12.348 6.630  1.00 0.00 ? 113 PHE A CZ   1  
ATOM   182  H  H    . PHE A 1 12 ? 4.048   -7.757  3.119  1.00 0.00 ? 113 PHE A H    1  
ATOM   183  H  HA   . PHE A 1 12 ? 6.644   -8.680  4.089  1.00 0.00 ? 113 PHE A HA   1  
ATOM   184  H  HB2  . PHE A 1 12 ? 4.550   -10.163 2.390  1.00 0.00 ? 113 PHE A HB2  1  
ATOM   185  H  HB3  . PHE A 1 12 ? 6.202   -10.725 2.556  1.00 0.00 ? 113 PHE A HB3  1  
ATOM   186  H  HD1  . PHE A 1 12 ? 7.027   -11.454 4.808  1.00 0.00 ? 113 PHE A HD1  1  
ATOM   187  H  HD2  . PHE A 1 12 ? 2.937   -10.588 4.077  1.00 0.00 ? 113 PHE A HD2  1  
ATOM   188  H  HE1  . PHE A 1 12 ? 6.390   -12.714 6.883  1.00 0.00 ? 113 PHE A HE1  1  
ATOM   189  H  HE2  . PHE A 1 12 ? 2.300   -11.848 6.153  1.00 0.00 ? 113 PHE A HE2  1  
ATOM   190  H  HZ   . PHE A 1 12 ? 4.033   -12.895 7.531  1.00 0.00 ? 113 PHE A HZ   1  
ATOM   191  N  N    . ALA A 1 13 ? 7.704   -8.109  1.903  1.00 0.00 ? 114 ALA A N    1  
ATOM   192  C  CA   . ALA A 1 13 ? 8.335   -7.564  0.713  1.00 0.00 ? 114 ALA A CA   1  
ATOM   193  C  C    . ALA A 1 13 ? 8.145   -8.537  -0.452 1.00 0.00 ? 114 ALA A C    1  
ATOM   194  O  O    . ALA A 1 13 ? 7.983   -8.116  -1.596 1.00 0.00 ? 114 ALA A O    1  
ATOM   195  C  CB   . ALA A 1 13 ? 9.811   -7.283  1.002  1.00 0.00 ? 114 ALA A CB   1  
ATOM   196  H  H    . ALA A 1 13 ? 8.337   -8.442  2.603  1.00 0.00 ? 114 ALA A H    1  
ATOM   197  H  HA   . ALA A 1 13 ? 7.839   -6.623  0.476  1.00 0.00 ? 114 ALA A HA   1  
ATOM   198  H  HB1  . ALA A 1 13 ? 10.073  -7.684  1.982  1.00 0.00 ? 114 ALA A HB1  1  
ATOM   199  H  HB2  . ALA A 1 13 ? 10.428  -7.757  0.239  1.00 0.00 ? 114 ALA A HB2  1  
ATOM   200  H  HB3  . ALA A 1 13 ? 9.984   -6.206  0.992  1.00 0.00 ? 114 ALA A HB3  1  
ATOM   201  N  N    . ARG A 1 14 ? 8.170   -9.820  -0.120 1.00 0.00 ? 115 ARG A N    1  
ATOM   202  C  CA   . ARG A 1 14 ? 8.002   -10.856 -1.125 1.00 0.00 ? 115 ARG A CA   1  
ATOM   203  C  C    . ARG A 1 14 ? 6.610   -11.482 -1.014 1.00 0.00 ? 115 ARG A C    1  
ATOM   204  O  O    . ARG A 1 14 ? 6.254   -12.031 0.028  1.00 0.00 ? 115 ARG A O    1  
ATOM   205  C  CB   . ARG A 1 14 ? 9.060   -11.950 -0.969 1.00 0.00 ? 115 ARG A CB   1  
ATOM   206  C  CG   . ARG A 1 14 ? 10.370  -11.373 -0.431 1.00 0.00 ? 115 ARG A CG   1  
ATOM   207  C  CD   . ARG A 1 14 ? 10.897  -10.264 -1.344 1.00 0.00 ? 115 ARG A CD   1  
ATOM   208  N  NE   . ARG A 1 14 ? 10.676  -10.627 -2.762 1.00 0.00 ? 115 ARG A NE   1  
ATOM   209  C  CZ   . ARG A 1 14 ? 11.089  -11.775 -3.316 1.00 0.00 ? 115 ARG A CZ   1  
ATOM   210  N  NH1  . ARG A 1 14 ? 12.361  -12.170 -3.172 1.00 0.00 ? 115 ARG A NH1  1  
ATOM   211  N  NH2  . ARG A 1 14 ? 10.229  -12.530 -4.015 1.00 0.00 ? 115 ARG A NH2  1  
ATOM   212  H  H    . ARG A 1 14 ? 8.302   -10.153 0.813  1.00 0.00 ? 115 ARG A H    1  
ATOM   213  H  HA   . ARG A 1 14 ? 8.126   -10.343 -2.079 1.00 0.00 ? 115 ARG A HA   1  
ATOM   214  H  HB2  . ARG A 1 14 ? 8.693   -12.722 -0.293 1.00 0.00 ? 115 ARG A HB2  1  
ATOM   215  H  HB3  . ARG A 1 14 ? 9.237   -12.429 -1.933 1.00 0.00 ? 115 ARG A HB3  1  
ATOM   216  H  HG2  . ARG A 1 14 ? 10.214  -10.978 0.573  1.00 0.00 ? 115 ARG A HG2  1  
ATOM   217  H  HG3  . ARG A 1 14 ? 11.115  -12.166 -0.349 1.00 0.00 ? 115 ARG A HG3  1  
ATOM   218  H  HD2  . ARG A 1 14 ? 10.393  -9.325  -1.118 1.00 0.00 ? 115 ARG A HD2  1  
ATOM   219  H  HD3  . ARG A 1 14 ? 11.961  -10.106 -1.163 1.00 0.00 ? 115 ARG A HD3  1  
ATOM   220  H  HE   . ARG A 1 14 ? 10.187  -9.976  -3.342 1.00 0.00 ? 115 ARG A HE   1  
ATOM   221  H  HH11 . ARG A 1 14 ? 12.860  -11.951 -2.334 1.00 0.00 ? 115 ARG A HH11 1  
ATOM   222  H  HH12 . ARG A 1 14 ? 12.811  -12.683 -3.902 1.00 0.00 ? 115 ARG A HH12 1  
ATOM   223  H  HH21 . ARG A 1 14 ? 9.950   -12.248 -4.935 1.00 0.00 ? 115 ARG A HH21 1  
ATOM   224  H  HH22 . ARG A 1 14 ? 9.865   -13.371 -3.618 1.00 0.00 ? 115 ARG A HH22 1  
ATOM   225  N  N    . GLN A 1 15 ? 5.861   -11.380 -2.101 1.00 0.00 ? 116 GLN A N    1  
ATOM   226  C  CA   . GLN A 1 15 ? 4.517   -11.929 -2.140 1.00 0.00 ? 116 GLN A CA   1  
ATOM   227  C  C    . GLN A 1 15 ? 4.506   -13.344 -1.558 1.00 0.00 ? 116 GLN A C    1  
ATOM   228  O  O    . GLN A 1 15 ? 3.698   -13.652 -0.681 1.00 0.00 ? 116 GLN A O    1  
ATOM   229  C  CB   . GLN A 1 15 ? 3.960   -11.918 -3.565 1.00 0.00 ? 116 GLN A CB   1  
ATOM   230  C  CG   . GLN A 1 15 ? 3.251   -10.595 -3.866 1.00 0.00 ? 116 GLN A CG   1  
ATOM   231  C  CD   . GLN A 1 15 ? 1.874   -10.840 -4.485 1.00 0.00 ? 116 GLN A CD   1  
ATOM   232  O  OE1  . GLN A 1 15 ? 1.678   -10.744 -5.685 1.00 0.00 ? 116 GLN A OE1  1  
ATOM   233  N  NE2  . GLN A 1 15 ? 0.933   -11.161 -3.602 1.00 0.00 ? 116 GLN A NE2  1  
ATOM   234  H  H    . GLN A 1 15 ? 6.159   -10.932 -2.945 1.00 0.00 ? 116 GLN A H    1  
ATOM   235  H  HA   . GLN A 1 15 ? 3.916   -11.268 -1.516 1.00 0.00 ? 116 GLN A HA   1  
ATOM   236  H  HB2  . GLN A 1 15 ? 4.770   -12.071 -4.277 1.00 0.00 ? 116 GLN A HB2  1  
ATOM   237  H  HB3  . GLN A 1 15 ? 3.262   -12.746 -3.693 1.00 0.00 ? 116 GLN A HB3  1  
ATOM   238  H  HG2  . GLN A 1 15 ? 3.145   -10.018 -2.947 1.00 0.00 ? 116 GLN A HG2  1  
ATOM   239  H  HG3  . GLN A 1 15 ? 3.860   -10.000 -4.546 1.00 0.00 ? 116 GLN A HG3  1  
ATOM   240  H  HE21 . GLN A 1 15 ? 1.150   -11.772 -2.840 1.00 0.00 ? 116 GLN A HE21 1  
ATOM   241  H  HE22 . GLN A 1 15 ? 0.010   -10.789 -3.698 1.00 0.00 ? 116 GLN A HE22 1  
ATOM   242  N  N    . GLU A 1 16 ? 5.410   -14.167 -2.069 1.00 0.00 ? 117 GLU A N    1  
ATOM   243  C  CA   . GLU A 1 16 ? 5.513   -15.542 -1.610 1.00 0.00 ? 117 GLU A CA   1  
ATOM   244  C  C    . GLU A 1 16 ? 5.575   -15.589 -0.082 1.00 0.00 ? 117 GLU A C    1  
ATOM   245  O  O    . GLU A 1 16 ? 5.045   -16.510 0.536  1.00 0.00 ? 117 GLU A O    1  
ATOM   246  C  CB   . GLU A 1 16 ? 6.727   -16.236 -2.230 1.00 0.00 ? 117 GLU A CB   1  
ATOM   247  C  CG   . GLU A 1 16 ? 7.233   -17.365 -1.329 1.00 0.00 ? 117 GLU A CG   1  
ATOM   248  C  CD   . GLU A 1 16 ? 7.793   -18.521 -2.160 1.00 0.00 ? 117 GLU A CD   1  
ATOM   249  O  OE1  . GLU A 1 16 ? 8.932   -18.368 -2.651 1.00 0.00 ? 117 GLU A OE1  1  
ATOM   250  O  OE2  . GLU A 1 16 ? 7.069   -19.532 -2.287 1.00 0.00 ? 117 GLU A OE2  1  
ATOM   251  H  H    . GLU A 1 16 ? 6.061   -13.908 -2.780 1.00 0.00 ? 117 GLU A H    1  
ATOM   252  H  HA   . GLU A 1 16 ? 4.605   -16.033 -1.958 1.00 0.00 ? 117 GLU A HA   1  
ATOM   253  H  HB2  . GLU A 1 16 ? 6.461   -16.638 -3.207 1.00 0.00 ? 117 GLU A HB2  1  
ATOM   254  H  HB3  . GLU A 1 16 ? 7.524   -15.510 -2.391 1.00 0.00 ? 117 GLU A HB3  1  
ATOM   255  H  HG2  . GLU A 1 16 ? 8.007   -16.983 -0.662 1.00 0.00 ? 117 GLU A HG2  1  
ATOM   256  H  HG3  . GLU A 1 16 ? 6.419   -17.725 -0.699 1.00 0.00 ? 117 GLU A HG3  1  
ATOM   257  N  N    . ALA A 1 17 ? 6.228   -14.584 0.484  1.00 0.00 ? 118 ALA A N    1  
ATOM   258  C  CA   . ALA A 1 17 ? 6.367   -14.499 1.927  1.00 0.00 ? 118 ALA A CA   1  
ATOM   259  C  C    . ALA A 1 17 ? 4.987   -14.297 2.557  1.00 0.00 ? 118 ALA A C    1  
ATOM   260  O  O    . ALA A 1 17 ? 4.763   -14.678 3.704  1.00 0.00 ? 118 ALA A O    1  
ATOM   261  C  CB   . ALA A 1 17 ? 7.340   -13.372 2.281  1.00 0.00 ? 118 ALA A CB   1  
ATOM   262  H  H    . ALA A 1 17 ? 6.657   -13.838 -0.027 1.00 0.00 ? 118 ALA A H    1  
ATOM   263  H  HA   . ALA A 1 17 ? 6.782   -15.444 2.276  1.00 0.00 ? 118 ALA A HA   1  
ATOM   264  H  HB1  . ALA A 1 17 ? 8.325   -13.604 1.878  1.00 0.00 ? 118 ALA A HB1  1  
ATOM   265  H  HB2  . ALA A 1 17 ? 6.982   -12.435 1.853  1.00 0.00 ? 118 ALA A HB2  1  
ATOM   266  H  HB3  . ALA A 1 17 ? 7.404   -13.276 3.365  1.00 0.00 ? 118 ALA A HB3  1  
ATOM   267  N  N    . LEU A 1 18 ? 4.098   -13.698 1.777  1.00 0.00 ? 119 LEU A N    1  
ATOM   268  C  CA   . LEU A 1 18 ? 2.746   -13.441 2.244  1.00 0.00 ? 119 LEU A CA   1  
ATOM   269  C  C    . LEU A 1 18 ? 1.926   -14.729 2.152  1.00 0.00 ? 119 LEU A C    1  
ATOM   270  O  O    . LEU A 1 18 ? 1.495   -15.269 3.169  1.00 0.00 ? 119 LEU A O    1  
ATOM   271  C  CB   . LEU A 1 18 ? 2.132   -12.264 1.484  1.00 0.00 ? 119 LEU A CB   1  
ATOM   272  C  CG   . LEU A 1 18 ? 0.606   -12.160 1.528  1.00 0.00 ? 119 LEU A CG   1  
ATOM   273  C  CD1  . LEU A 1 18 ? 0.095   -12.207 2.970  1.00 0.00 ? 119 LEU A CD1  1  
ATOM   274  C  CD2  . LEU A 1 18 ? 0.120   -10.913 0.788  1.00 0.00 ? 119 LEU A CD2  1  
ATOM   275  H  H    . LEU A 1 18 ? 4.289   -13.391 0.844  1.00 0.00 ? 119 LEU A H    1  
ATOM   276  H  HA   . LEU A 1 18 ? 2.813   -13.149 3.292  1.00 0.00 ? 119 LEU A HA   1  
ATOM   277  H  HB2  . LEU A 1 18 ? 2.551   -11.340 1.883  1.00 0.00 ? 119 LEU A HB2  1  
ATOM   278  H  HB3  . LEU A 1 18 ? 2.441   -12.330 0.440  1.00 0.00 ? 119 LEU A HB3  1  
ATOM   279  H  HG   . LEU A 1 18 ? 0.189   -13.025 1.011  1.00 0.00 ? 119 LEU A HG   1  
ATOM   280  H  HD11 . LEU A 1 18 ? -0.448  -11.289 3.193  1.00 0.00 ? 119 LEU A HD11 1  
ATOM   281  H  HD12 . LEU A 1 18 ? -0.569  -13.062 3.093  1.00 0.00 ? 119 LEU A HD12 1  
ATOM   282  H  HD13 . LEU A 1 18 ? 0.940   -12.304 3.652  1.00 0.00 ? 119 LEU A HD13 1  
ATOM   283  H  HD21 . LEU A 1 18 ? 0.194   -11.076 -0.287 1.00 0.00 ? 119 LEU A HD21 1  
ATOM   284  H  HD22 . LEU A 1 18 ? -0.919  -10.714 1.054  1.00 0.00 ? 119 LEU A HD22 1  
ATOM   285  H  HD23 . LEU A 1 18 ? 0.736   -10.059 1.070  1.00 0.00 ? 119 LEU A HD23 1  
ATOM   286  N  N    . LYS A 1 19 ? 1.736   -15.184 0.922  1.00 0.00 ? 120 LYS A N    1  
ATOM   287  C  CA   . LYS A 1 19 ? 0.974   -16.399 0.683  1.00 0.00 ? 120 LYS A CA   1  
ATOM   288  C  C    . LYS A 1 19 ? 1.350   -17.446 1.733  1.00 0.00 ? 120 LYS A C    1  
ATOM   289  O  O    . LYS A 1 19 ? 0.476   -18.050 2.353  1.00 0.00 ? 120 LYS A O    1  
ATOM   290  C  CB   . LYS A 1 19 ? 1.166   -16.877 -0.758 1.00 0.00 ? 120 LYS A CB   1  
ATOM   291  C  CG   . LYS A 1 19 ? -0.152  -16.819 -1.534 1.00 0.00 ? 120 LYS A CG   1  
ATOM   292  C  CD   . LYS A 1 19 ? -0.133  -17.786 -2.719 1.00 0.00 ? 120 LYS A CD   1  
ATOM   293  C  CE   . LYS A 1 19 ? -0.269  -17.034 -4.044 1.00 0.00 ? 120 LYS A CE   1  
ATOM   294  N  NZ   . LYS A 1 19 ? -1.671  -17.072 -4.519 1.00 0.00 ? 120 LYS A NZ   1  
ATOM   295  H  H    . LYS A 1 19 ? 2.090   -14.739 0.099  1.00 0.00 ? 120 LYS A H    1  
ATOM   296  H  HA   . LYS A 1 19 ? -0.080  -16.152 0.804  1.00 0.00 ? 120 LYS A HA   1  
ATOM   297  H  HB2  . LYS A 1 19 ? 1.912   -16.257 -1.255 1.00 0.00 ? 120 LYS A HB2  1  
ATOM   298  H  HB3  . LYS A 1 19 ? 1.548   -17.898 -0.758 1.00 0.00 ? 120 LYS A HB3  1  
ATOM   299  H  HG2  . LYS A 1 19 ? -0.980  -17.066 -0.870 1.00 0.00 ? 120 LYS A HG2  1  
ATOM   300  H  HG3  . LYS A 1 19 ? -0.323  -15.803 -1.892 1.00 0.00 ? 120 LYS A HG3  1  
ATOM   301  H  HD2  . LYS A 1 19 ? 0.797   -18.355 -2.714 1.00 0.00 ? 120 LYS A HD2  1  
ATOM   302  H  HD3  . LYS A 1 19 ? -0.946  -18.506 -2.619 1.00 0.00 ? 120 LYS A HD3  1  
ATOM   303  H  HE2  . LYS A 1 19 ? 0.050   -16.000 -3.916 1.00 0.00 ? 120 LYS A HE2  1  
ATOM   304  H  HE3  . LYS A 1 19 ? 0.387   -17.480 -4.791 1.00 0.00 ? 120 LYS A HE3  1  
ATOM   305  H  HZ1  . LYS A 1 19 ? -2.284  -16.828 -3.767 1.00 0.00 ? 120 LYS A HZ1  1  
ATOM   306  H  HZ2  . LYS A 1 19 ? -1.787  -16.420 -5.268 1.00 0.00 ? 120 LYS A HZ2  1  
ATOM   307  H  HZ3  . LYS A 1 19 ? -1.889  -17.993 -4.842 1.00 0.00 ? 120 LYS A HZ3  1  
ATOM   308  N  N    . ARG A 1 20 ? 2.652   -17.628 1.901  1.00 0.00 ? 121 ARG A N    1  
ATOM   309  C  CA   . ARG A 1 20 ? 3.154   -18.592 2.866  1.00 0.00 ? 121 ARG A CA   1  
ATOM   310  C  C    . ARG A 1 20 ? 2.679   -18.230 4.274  1.00 0.00 ? 121 ARG A C    1  
ATOM   311  O  O    . ARG A 1 20 ? 2.448   -19.111 5.101  1.00 0.00 ? 121 ARG A O    1  
ATOM   312  C  CB   . ARG A 1 20 ? 4.683   -18.643 2.849  1.00 0.00 ? 121 ARG A CB   1  
ATOM   313  C  CG   . ARG A 1 20 ? 5.195   -19.970 3.412  1.00 0.00 ? 121 ARG A CG   1  
ATOM   314  C  CD   . ARG A 1 20 ? 6.677   -19.876 3.777  1.00 0.00 ? 121 ARG A CD   1  
ATOM   315  N  NE   . ARG A 1 20 ? 6.880   -18.834 4.809  1.00 0.00 ? 121 ARG A NE   1  
ATOM   316  C  CZ   . ARG A 1 20 ? 8.076   -18.491 5.305  1.00 0.00 ? 121 ARG A CZ   1  
ATOM   317  N  NH1  . ARG A 1 20 ? 9.171   -19.181 4.954  1.00 0.00 ? 121 ARG A NH1  1  
ATOM   318  N  NH2  . ARG A 1 20 ? 8.178   -17.458 6.153  1.00 0.00 ? 121 ARG A NH2  1  
ATOM   319  H  H    . ARG A 1 20 ? 3.356   -17.133 1.393  1.00 0.00 ? 121 ARG A H    1  
ATOM   320  H  HA   . ARG A 1 20 ? 2.741   -19.548 2.545  1.00 0.00 ? 121 ARG A HA   1  
ATOM   321  H  HB2  . ARG A 1 20 ? 5.044   -18.514 1.827  1.00 0.00 ? 121 ARG A HB2  1  
ATOM   322  H  HB3  . ARG A 1 20 ? 5.085   -17.816 3.433  1.00 0.00 ? 121 ARG A HB3  1  
ATOM   323  H  HG2  . ARG A 1 20 ? 4.616   -20.241 4.296  1.00 0.00 ? 121 ARG A HG2  1  
ATOM   324  H  HG3  . ARG A 1 20 ? 5.046   -20.762 2.678  1.00 0.00 ? 121 ARG A HG3  1  
ATOM   325  H  HD2  . ARG A 1 20 ? 7.031   -20.839 4.146  1.00 0.00 ? 121 ARG A HD2  1  
ATOM   326  H  HD3  . ARG A 1 20 ? 7.264   -19.639 2.889  1.00 0.00 ? 121 ARG A HD3  1  
ATOM   327  H  HE   . ARG A 1 20 ? 6.073   -18.357 5.158  1.00 0.00 ? 121 ARG A HE   1  
ATOM   328  H  HH11 . ARG A 1 20 ? 9.402   -20.029 5.430  1.00 0.00 ? 121 ARG A HH11 1  
ATOM   329  H  HH12 . ARG A 1 20 ? 9.756   -18.847 4.214  1.00 0.00 ? 121 ARG A HH12 1  
ATOM   330  H  HH21 . ARG A 1 20 ? 7.642   -17.449 6.996  1.00 0.00 ? 121 ARG A HH21 1  
ATOM   331  H  HH22 . ARG A 1 20 ? 8.792   -16.698 5.942  1.00 0.00 ? 121 ARG A HH22 1  
ATOM   332  N  N    . HIS A 1 21 ? 2.546   -16.932 4.505  1.00 0.00 ? 122 HIS A N    1  
ATOM   333  C  CA   . HIS A 1 21 ? 2.102   -16.443 5.799  1.00 0.00 ? 122 HIS A CA   1  
ATOM   334  C  C    . HIS A 1 21 ? 0.633   -16.810 6.009  1.00 0.00 ? 122 HIS A C    1  
ATOM   335  O  O    . HIS A 1 21 ? 0.277   -17.408 7.023  1.00 0.00 ? 122 HIS A O    1  
ATOM   336  C  CB   . HIS A 1 21 ? 2.365   -14.942 5.932  1.00 0.00 ? 122 HIS A CB   1  
ATOM   337  C  CG   . HIS A 1 21 ? 1.612   -14.284 7.063  1.00 0.00 ? 122 HIS A CG   1  
ATOM   338  N  ND1  . HIS A 1 21 ? 2.119   -14.193 8.348  1.00 0.00 ? 122 HIS A ND1  1  
ATOM   339  C  CD2  . HIS A 1 21 ? 0.386   -13.687 7.090  1.00 0.00 ? 122 HIS A CD2  1  
ATOM   340  C  CE1  . HIS A 1 21 ? 1.231   -13.567 9.105  1.00 0.00 ? 122 HIS A CE1  1  
ATOM   341  N  NE2  . HIS A 1 21 ? 0.156   -13.256 8.324  1.00 0.00 ? 122 HIS A NE2  1  
ATOM   342  H  H    . HIS A 1 21 ? 2.736   -16.222 3.827  1.00 0.00 ? 122 HIS A H    1  
ATOM   343  H  HA   . HIS A 1 21 ? 2.706   -16.953 6.550  1.00 0.00 ? 122 HIS A HA   1  
ATOM   344  H  HB2  . HIS A 1 21 ? 3.433   -14.780 6.077  1.00 0.00 ? 122 HIS A HB2  1  
ATOM   345  H  HB3  . HIS A 1 21 ? 2.093   -14.452 4.996  1.00 0.00 ? 122 HIS A HB3  1  
ATOM   346  H  HD1  . HIS A 1 21 ? 3.007   -14.539 8.652  1.00 0.00 ? 122 HIS A HD1  1  
ATOM   347  H  HD2  . HIS A 1 21 ? -0.291  -13.583 6.242  1.00 0.00 ? 122 HIS A HD2  1  
ATOM   348  H  HE1  . HIS A 1 21 ? 1.338   -13.341 10.166 1.00 0.00 ? 122 HIS A HE1  1  
ATOM   349  N  N    . TYR A 1 22 ? -0.183  -16.435 5.035  1.00 0.00 ? 123 TYR A N    1  
ATOM   350  C  CA   . TYR A 1 22 ? -1.606  -16.716 5.100  1.00 0.00 ? 123 TYR A CA   1  
ATOM   351  C  C    . TYR A 1 22 ? -1.860  -18.176 5.480  1.00 0.00 ? 123 TYR A C    1  
ATOM   352  O  O    . TYR A 1 22 ? -2.912  -18.505 6.027  1.00 0.00 ? 123 TYR A O    1  
ATOM   353  C  CB   . TYR A 1 22 ? -2.152  -16.466 3.693  1.00 0.00 ? 123 TYR A CB   1  
ATOM   354  C  CG   . TYR A 1 22 ? -3.219  -15.372 3.624  1.00 0.00 ? 123 TYR A CG   1  
ATOM   355  C  CD1  . TYR A 1 22 ? -4.442  -15.562 4.233  1.00 0.00 ? 123 TYR A CD1  1  
ATOM   356  C  CD2  . TYR A 1 22 ? -2.957  -14.194 2.952  1.00 0.00 ? 123 TYR A CD2  1  
ATOM   357  C  CE1  . TYR A 1 22 ? -5.446  -14.531 4.168  1.00 0.00 ? 123 TYR A CE1  1  
ATOM   358  C  CE2  . TYR A 1 22 ? -3.962  -13.164 2.887  1.00 0.00 ? 123 TYR A CE2  1  
ATOM   359  C  CZ   . TYR A 1 22 ? -5.157  -13.383 3.498  1.00 0.00 ? 123 TYR A CZ   1  
ATOM   360  O  OH   . TYR A 1 22 ? -6.106  -12.411 3.437  1.00 0.00 ? 123 TYR A OH   1  
ATOM   361  H  H    . TYR A 1 22 ? 0.114   -15.948 4.213  1.00 0.00 ? 123 TYR A H    1  
ATOM   362  H  HA   . TYR A 1 22 ? -2.043  -16.069 5.862  1.00 0.00 ? 123 TYR A HA   1  
ATOM   363  H  HB2  . TYR A 1 22 ? -1.324  -16.194 3.037  1.00 0.00 ? 123 TYR A HB2  1  
ATOM   364  H  HB3  . TYR A 1 22 ? -2.573  -17.395 3.306  1.00 0.00 ? 123 TYR A HB3  1  
ATOM   365  H  HD1  . TYR A 1 22 ? -4.648  -16.491 4.764  1.00 0.00 ? 123 TYR A HD1  1  
ATOM   366  H  HD2  . TYR A 1 22 ? -1.991  -14.044 2.470  1.00 0.00 ? 123 TYR A HD2  1  
ATOM   367  H  HE1  . TYR A 1 22 ? -6.417  -14.668 4.645  1.00 0.00 ? 123 TYR A HE1  1  
ATOM   368  H  HE2  . TYR A 1 22 ? -3.769  -12.230 2.360  1.00 0.00 ? 123 TYR A HE2  1  
ATOM   369  H  HH   . TYR A 1 22 ? -7.013  -12.823 3.356  1.00 0.00 ? 123 TYR A HH   1  
ATOM   370  N  N    . ARG A 1 23 ? -0.878  -19.013 5.176  1.00 0.00 ? 124 ARG A N    1  
ATOM   371  C  CA   . ARG A 1 23 ? -0.982  -20.429 5.478  1.00 0.00 ? 124 ARG A CA   1  
ATOM   372  C  C    . ARG A 1 23 ? -1.038  -20.646 6.992  1.00 0.00 ? 124 ARG A C    1  
ATOM   373  O  O    . ARG A 1 23 ? -1.611  -21.629 7.461  1.00 0.00 ? 124 ARG A O    1  
ATOM   374  C  CB   . ARG A 1 23 ? 0.206   -21.204 4.903  1.00 0.00 ? 124 ARG A CB   1  
ATOM   375  C  CG   . ARG A 1 23 ? -0.257  -22.228 3.865  1.00 0.00 ? 124 ARG A CG   1  
ATOM   376  C  CD   . ARG A 1 23 ? -1.440  -23.045 4.392  1.00 0.00 ? 124 ARG A CD   1  
ATOM   377  N  NE   . ARG A 1 23 ? -1.086  -24.482 4.429  1.00 0.00 ? 124 ARG A NE   1  
ATOM   378  C  CZ   . ARG A 1 23 ? -1.959  -25.463 4.693  1.00 0.00 ? 124 ARG A CZ   1  
ATOM   379  N  NH1  . ARG A 1 23 ? -3.276  -25.219 4.648  1.00 0.00 ? 124 ARG A NH1  1  
ATOM   380  N  NH2  . ARG A 1 23 ? -1.515  -26.689 5.002  1.00 0.00 ? 124 ARG A NH2  1  
ATOM   381  H  H    . ARG A 1 23 ? -0.026  -18.736 4.731  1.00 0.00 ? 124 ARG A H    1  
ATOM   382  H  HA   . ARG A 1 23 ? -1.908  -20.750 5.002  1.00 0.00 ? 124 ARG A HA   1  
ATOM   383  H  HB2  . ARG A 1 23 ? 0.910   -20.509 4.444  1.00 0.00 ? 124 ARG A HB2  1  
ATOM   384  H  HB3  . ARG A 1 23 ? 0.738   -21.711 5.707  1.00 0.00 ? 124 ARG A HB3  1  
ATOM   385  H  HG2  . ARG A 1 23 ? -0.545  -21.717 2.946  1.00 0.00 ? 124 ARG A HG2  1  
ATOM   386  H  HG3  . ARG A 1 23 ? 0.567   -22.896 3.615  1.00 0.00 ? 124 ARG A HG3  1  
ATOM   387  H  HD2  . ARG A 1 23 ? -1.713  -22.703 5.390  1.00 0.00 ? 124 ARG A HD2  1  
ATOM   388  H  HD3  . ARG A 1 23 ? -2.310  -22.893 3.754  1.00 0.00 ? 124 ARG A HD3  1  
ATOM   389  H  HE   . ARG A 1 23 ? -0.136  -24.735 4.246  1.00 0.00 ? 124 ARG A HE   1  
ATOM   390  H  HH11 . ARG A 1 23 ? -3.746  -24.863 5.456  1.00 0.00 ? 124 ARG A HH11 1  
ATOM   391  H  HH12 . ARG A 1 23 ? -3.788  -25.394 3.807  1.00 0.00 ? 124 ARG A HH12 1  
ATOM   392  H  HH21 . ARG A 1 23 ? -0.533  -26.874 5.026  1.00 0.00 ? 124 ARG A HH21 1  
ATOM   393  H  HH22 . ARG A 1 23 ? -2.166  -27.419 5.209  1.00 0.00 ? 124 ARG A HH22 1  
ATOM   394  N  N    . SER A 1 24 ? -0.436  -19.713 7.714  1.00 0.00 ? 125 SER A N    1  
ATOM   395  C  CA   . SER A 1 24 ? -0.410  -19.790 9.165  1.00 0.00 ? 125 SER A CA   1  
ATOM   396  C  C    . SER A 1 24 ? -1.795  -19.467 9.730  1.00 0.00 ? 125 SER A C    1  
ATOM   397  O  O    . SER A 1 24 ? -2.117  -19.856 10.852 1.00 0.00 ? 125 SER A O    1  
ATOM   398  C  CB   . SER A 1 24 ? 0.637   -18.839 9.748  1.00 0.00 ? 125 SER A CB   1  
ATOM   399  O  OG   . SER A 1 24 ? 0.357   -17.478 9.432  1.00 0.00 ? 125 SER A OG   1  
ATOM   400  H  H    . SER A 1 24 ? 0.028   -18.918 7.325  1.00 0.00 ? 125 SER A H    1  
ATOM   401  H  HA   . SER A 1 24 ? -0.134  -20.819 9.394  1.00 0.00 ? 125 SER A HA   1  
ATOM   402  H  HB2  . SER A 1 24 ? 0.673   -18.960 10.831 1.00 0.00 ? 125 SER A HB2  1  
ATOM   403  H  HB3  . SER A 1 24 ? 1.622   -19.105 9.365  1.00 0.00 ? 125 SER A HB3  1  
ATOM   404  H  HG   . SER A 1 24 ? 1.064   -17.115 8.826  1.00 0.00 ? 125 SER A HG   1  
ATOM   405  N  N    . HIS A 1 25 ? -2.576  -18.759 8.928  1.00 0.00 ? 126 HIS A N    1  
ATOM   406  C  CA   . HIS A 1 25 ? -3.918  -18.380 9.335  1.00 0.00 ? 126 HIS A CA   1  
ATOM   407  C  C    . HIS A 1 25 ? -4.882  -19.537 9.067  1.00 0.00 ? 126 HIS A C    1  
ATOM   408  O  O    . HIS A 1 25 ? -6.088  -19.405 9.270  1.00 0.00 ? 126 HIS A O    1  
ATOM   409  C  CB   . HIS A 1 25 ? -4.347  -17.081 8.649  1.00 0.00 ? 126 HIS A CB   1  
ATOM   410  C  CG   . HIS A 1 25 ? -3.626  -15.853 9.153  1.00 0.00 ? 126 HIS A CG   1  
ATOM   411  N  ND1  . HIS A 1 25 ? -3.506  -15.554 10.499 1.00 0.00 ? 126 HIS A ND1  1  
ATOM   412  C  CD2  . HIS A 1 25 ? -2.988  -14.854 8.479  1.00 0.00 ? 126 HIS A CD2  1  
ATOM   413  C  CE1  . HIS A 1 25 ? -2.826  -14.424 10.618 1.00 0.00 ? 126 HIS A CE1  1  
ATOM   414  N  NE2  . HIS A 1 25 ? -2.507  -13.991 9.365  1.00 0.00 ? 126 HIS A NE2  1  
ATOM   415  H  H    . HIS A 1 25 ? -2.306  -18.447 8.017  1.00 0.00 ? 126 HIS A H    1  
ATOM   416  H  HA   . HIS A 1 25 ? -3.878  -18.192 10.407 1.00 0.00 ? 126 HIS A HA   1  
ATOM   417  H  HB2  . HIS A 1 25 ? -4.176  -17.175 7.577  1.00 0.00 ? 126 HIS A HB2  1  
ATOM   418  H  HB3  . HIS A 1 25 ? -5.419  -16.944 8.791  1.00 0.00 ? 126 HIS A HB3  1  
ATOM   419  H  HD1  . HIS A 1 25 ? -3.871  -16.100 11.254 1.00 0.00 ? 126 HIS A HD1  1  
ATOM   420  H  HD2  . HIS A 1 25 ? -2.891  -14.778 7.396  1.00 0.00 ? 126 HIS A HD2  1  
ATOM   421  H  HE1  . HIS A 1 25 ? -2.567  -13.926 11.553 1.00 0.00 ? 126 HIS A HE1  1  
ATOM   422  N  N    . THR A 1 26 ? -4.314  -20.646 8.616  1.00 0.00 ? 127 THR A N    1  
ATOM   423  C  CA   . THR A 1 26 ? -5.108  -21.825 8.318  1.00 0.00 ? 127 THR A CA   1  
ATOM   424  C  C    . THR A 1 26 ? -4.478  -23.067 8.955  1.00 0.00 ? 127 THR A C    1  
ATOM   425  O  O    . THR A 1 26 ? -4.916  -23.517 10.013 1.00 0.00 ? 127 THR A O    1  
ATOM   426  C  CB   . THR A 1 26 ? -5.251  -21.929 6.799  1.00 0.00 ? 127 THR A CB   1  
ATOM   427  O  OG1  . THR A 1 26 ? -3.989  -21.492 6.301  1.00 0.00 ? 127 THR A OG1  1  
ATOM   428  C  CG2  . THR A 1 26 ? -6.246  -20.912 6.234  1.00 0.00 ? 127 THR A CG2  1  
ATOM   429  H  H    . THR A 1 26 ? -3.332  -20.745 8.454  1.00 0.00 ? 127 THR A H    1  
ATOM   430  H  HA   . THR A 1 26 ? -6.093  -21.700 8.769  1.00 0.00 ? 127 THR A HA   1  
ATOM   431  H  HB   . THR A 1 26 ? -5.519  -22.942 6.501  1.00 0.00 ? 127 THR A HB   1  
ATOM   432  H  HG1  . THR A 1 26 ? -3.820  -21.893 5.400  1.00 0.00 ? 127 THR A HG1  1  
ATOM   433  H  HG21 . THR A 1 26 ? -7.169  -20.948 6.813  1.00 0.00 ? 127 THR A HG21 1  
ATOM   434  H  HG22 . THR A 1 26 ? -5.818  -19.912 6.296  1.00 0.00 ? 127 THR A HG22 1  
ATOM   435  H  HG23 . THR A 1 26 ? -6.461  -21.153 5.193  1.00 0.00 ? 127 THR A HG23 1  
ATOM   436  N  N    . ASN A 1 27 ? -3.461  -23.585 8.283  1.00 0.00 ? 128 ASN A N    1  
ATOM   437  C  CA   . ASN A 1 27 ? -2.766  -24.764 8.769  1.00 0.00 ? 128 ASN A CA   1  
ATOM   438  C  C    . ASN A 1 27 ? -1.325  -24.751 8.255  1.00 0.00 ? 128 ASN A C    1  
ATOM   439  O  O    . ASN A 1 27 ? -1.062  -25.155 7.124  1.00 0.00 ? 128 ASN A O    1  
ATOM   440  C  CB   . ASN A 1 27 ? -3.436  -26.045 8.265  1.00 0.00 ? 128 ASN A CB   1  
ATOM   441  C  CG   . ASN A 1 27 ? -2.992  -27.257 9.087  1.00 0.00 ? 128 ASN A CG   1  
ATOM   442  O  OD1  . ASN A 1 27 ? -2.005  -27.225 9.804  1.00 0.00 ? 128 ASN A OD1  1  
ATOM   443  N  ND2  . ASN A 1 27 ? -3.774  -28.323 8.945  1.00 0.00 ? 128 ASN A ND2  1  
ATOM   444  H  H    . ASN A 1 27 ? -3.110  -23.213 7.423  1.00 0.00 ? 128 ASN A H    1  
ATOM   445  H  HA   . ASN A 1 27 ? -2.822  -24.703 9.856  1.00 0.00 ? 128 ASN A HA   1  
ATOM   446  H  HB2  . ASN A 1 27 ? -4.519  -25.939 8.321  1.00 0.00 ? 128 ASN A HB2  1  
ATOM   447  H  HB3  . ASN A 1 27 ? -3.185  -26.202 7.215  1.00 0.00 ? 128 ASN A HB3  1  
ATOM   448  H  HD21 . ASN A 1 27 ? -3.809  -28.804 8.068  1.00 0.00 ? 128 ASN A HD21 1  
ATOM   449  H  HD22 . ASN A 1 27 ? -4.327  -28.644 9.713  1.00 0.00 ? 128 ASN A HD22 1  
ATOM   450  N  N    . GLU A 1 28 ? -0.430  -24.282 9.112  1.00 0.00 ? 129 GLU A N    1  
ATOM   451  C  CA   . GLU A 1 28 ? 0.978   -24.211 8.759  1.00 0.00 ? 129 GLU A CA   1  
ATOM   452  C  C    . GLU A 1 28 ? 1.810   -23.798 9.975  1.00 0.00 ? 129 GLU A C    1  
ATOM   453  O  O    . GLU A 1 28 ? 2.140   -22.624 10.136 1.00 0.00 ? 129 GLU A O    1  
ATOM   454  C  CB   . GLU A 1 28 ? 1.202   -23.250 7.589  1.00 0.00 ? 129 GLU A CB   1  
ATOM   455  C  CG   . GLU A 1 28 ? 1.690   -24.001 6.349  1.00 0.00 ? 129 GLU A CG   1  
ATOM   456  C  CD   . GLU A 1 28 ? 3.153   -23.669 6.047  1.00 0.00 ? 129 GLU A CD   1  
ATOM   457  O  OE1  . GLU A 1 28 ? 3.845   -23.241 6.996  1.00 0.00 ? 129 GLU A OE1  1  
ATOM   458  O  OE2  . GLU A 1 28 ? 3.545   -23.850 4.874  1.00 0.00 ? 129 GLU A OE2  1  
ATOM   459  H  H    . GLU A 1 28 ? -0.652  -23.955 10.031 1.00 0.00 ? 129 GLU A H    1  
ATOM   460  H  HA   . GLU A 1 28 ? 1.250   -25.220 8.450  1.00 0.00 ? 129 GLU A HA   1  
ATOM   461  H  HB2  . GLU A 1 28 ? 0.273   -22.727 7.360  1.00 0.00 ? 129 GLU A HB2  1  
ATOM   462  H  HB3  . GLU A 1 28 ? 1.933   -22.492 7.871  1.00 0.00 ? 129 GLU A HB3  1  
ATOM   463  H  HG2  . GLU A 1 28 ? 1.582   -25.075 6.504  1.00 0.00 ? 129 GLU A HG2  1  
ATOM   464  H  HG3  . GLU A 1 28 ? 1.069   -23.738 5.492  1.00 0.00 ? 129 GLU A HG3  1  
ATOM   465  N  N    . LYS A 1 29 ? 2.125   -24.786 10.799 1.00 0.00 ? 130 LYS A N    1  
ATOM   466  C  CA   . LYS A 1 29 ? 2.912   -24.539 11.996 1.00 0.00 ? 130 LYS A CA   1  
ATOM   467  C  C    . LYS A 1 29 ? 4.045   -23.566 11.665 1.00 0.00 ? 130 LYS A C    1  
ATOM   468  O  O    . LYS A 1 29 ? 4.031   -22.418 12.107 1.00 0.00 ? 130 LYS A O    1  
ATOM   469  C  CB   . LYS A 1 29 ? 3.393   -25.859 12.602 1.00 0.00 ? 130 LYS A CB   1  
ATOM   470  C  CG   . LYS A 1 29 ? 4.431   -26.531 11.699 1.00 0.00 ? 130 LYS A CG   1  
ATOM   471  C  CD   . LYS A 1 29 ? 3.801   -27.672 10.897 1.00 0.00 ? 130 LYS A CD   1  
ATOM   472  C  CE   . LYS A 1 29 ? 4.103   -29.027 11.540 1.00 0.00 ? 130 LYS A CE   1  
ATOM   473  N  NZ   . LYS A 1 29 ? 2.923   -29.523 12.282 1.00 0.00 ? 130 LYS A NZ   1  
ATOM   474  H  H    . LYS A 1 29 ? 1.853   -25.737 10.662 1.00 0.00 ? 130 LYS A H    1  
ATOM   475  H  HA   . LYS A 1 29 ? 2.255   -24.070 12.728 1.00 0.00 ? 130 LYS A HA   1  
ATOM   476  H  HB2  . LYS A 1 29 ? 3.827   -25.677 13.585 1.00 0.00 ? 130 LYS A HB2  1  
ATOM   477  H  HB3  . LYS A 1 29 ? 2.545   -26.528 12.748 1.00 0.00 ? 130 LYS A HB3  1  
ATOM   478  H  HG2  . LYS A 1 29 ? 4.857   -25.795 11.018 1.00 0.00 ? 130 LYS A HG2  1  
ATOM   479  H  HG3  . LYS A 1 29 ? 5.250   -26.917 12.305 1.00 0.00 ? 130 LYS A HG3  1  
ATOM   480  H  HD2  . LYS A 1 29 ? 2.722   -27.527 10.836 1.00 0.00 ? 130 LYS A HD2  1  
ATOM   481  H  HD3  . LYS A 1 29 ? 4.183   -27.657 9.875  1.00 0.00 ? 130 LYS A HD3  1  
ATOM   482  H  HE2  . LYS A 1 29 ? 4.386   -29.746 10.771 1.00 0.00 ? 130 LYS A HE2  1  
ATOM   483  H  HE3  . LYS A 1 29 ? 4.952   -28.933 12.218 1.00 0.00 ? 130 LYS A HE3  1  
ATOM   484  H  HZ1  . LYS A 1 29 ? 3.224   -30.101 13.040 1.00 0.00 ? 130 LYS A HZ1  1  
ATOM   485  H  HZ2  . LYS A 1 29 ? 2.403   -28.747 12.638 1.00 0.00 ? 130 LYS A HZ2  1  
ATOM   486  H  HZ3  . LYS A 1 29 ? 2.344   -30.058 11.665 1.00 0.00 ? 130 LYS A HZ3  1  
HETATM 487  ZN ZN   . ZN  B 2 .  ? -1.500  -12.310 8.932  1.00 0.00 ? 1   ZN  A ZN   1  
ATOM   488  N  N    . ARG A 1 1  ? -2.027  -1.366  -1.828 1.00 0.00 ? 102 ARG A N    2  
ATOM   489  C  CA   . ARG A 1 1  ? -1.306  -1.734  -3.034 1.00 0.00 ? 102 ARG A CA   2  
ATOM   490  C  C    . ARG A 1 1  ? 0.047   -2.353  -2.675 1.00 0.00 ? 102 ARG A C    2  
ATOM   491  O  O    . ARG A 1 1  ? 1.064   -2.027  -3.284 1.00 0.00 ? 102 ARG A O    2  
ATOM   492  C  CB   . ARG A 1 1  ? -1.078  -0.517  -3.933 1.00 0.00 ? 102 ARG A CB   2  
ATOM   493  C  CG   . ARG A 1 1  ? -2.396  0.207   -4.220 1.00 0.00 ? 102 ARG A CG   2  
ATOM   494  C  CD   . ARG A 1 1  ? -3.529  -0.793  -4.463 1.00 0.00 ? 102 ARG A CD   2  
ATOM   495  N  NE   . ARG A 1 1  ? -3.144  -1.743  -5.532 1.00 0.00 ? 102 ARG A NE   2  
ATOM   496  C  CZ   . ARG A 1 1  ? -3.647  -2.979  -5.655 1.00 0.00 ? 102 ARG A CZ   2  
ATOM   497  N  NH1  . ARG A 1 1  ? -3.797  -3.753  -4.571 1.00 0.00 ? 102 ARG A NH1  2  
ATOM   498  N  NH2  . ARG A 1 1  ? -4.003  -3.439  -6.861 1.00 0.00 ? 102 ARG A NH2  2  
ATOM   499  H  H    . ARG A 1 1  ? -1.474  -1.340  -0.996 1.00 0.00 ? 102 ARG A H    2  
ATOM   500  H  HA   . ARG A 1 1  ? -1.949  -2.459  -3.534 1.00 0.00 ? 102 ARG A HA   2  
ATOM   501  H  HB2  . ARG A 1 1  ? -0.379  0.169   -3.454 1.00 0.00 ? 102 ARG A HB2  2  
ATOM   502  H  HB3  . ARG A 1 1  ? -0.621  -0.833  -4.872 1.00 0.00 ? 102 ARG A HB3  2  
ATOM   503  H  HG2  . ARG A 1 1  ? -2.650  0.853   -3.379 1.00 0.00 ? 102 ARG A HG2  2  
ATOM   504  H  HG3  . ARG A 1 1  ? -2.279  0.850   -5.092 1.00 0.00 ? 102 ARG A HG3  2  
ATOM   505  H  HD2  . ARG A 1 1  ? -3.750  -1.335  -3.545 1.00 0.00 ? 102 ARG A HD2  2  
ATOM   506  H  HD3  . ARG A 1 1  ? -4.437  -0.263  -4.748 1.00 0.00 ? 102 ARG A HD3  2  
ATOM   507  H  HE   . ARG A 1 1  ? -2.464  -1.445  -6.202 1.00 0.00 ? 102 ARG A HE   2  
ATOM   508  H  HH11 . ARG A 1 1  ? -4.351  -3.435  -3.802 1.00 0.00 ? 102 ARG A HH11 2  
ATOM   509  H  HH12 . ARG A 1 1  ? -3.353  -4.648  -4.532 1.00 0.00 ? 102 ARG A HH12 2  
ATOM   510  H  HH21 . ARG A 1 1  ? -3.300  -3.680  -7.531 1.00 0.00 ? 102 ARG A HH21 2  
ATOM   511  H  HH22 . ARG A 1 1  ? -4.970  -3.544  -7.092 1.00 0.00 ? 102 ARG A HH22 2  
ATOM   512  N  N    . SER A 1 2  ? 0.013   -3.237  -1.688 1.00 0.00 ? 103 SER A N    2  
ATOM   513  C  CA   . SER A 1 2  ? 1.224   -3.905  -1.241 1.00 0.00 ? 103 SER A CA   2  
ATOM   514  C  C    . SER A 1 2  ? 0.876   -5.264  -0.631 1.00 0.00 ? 103 SER A C    2  
ATOM   515  O  O    . SER A 1 2  ? -0.286  -5.536  -0.334 1.00 0.00 ? 103 SER A O    2  
ATOM   516  C  CB   . SER A 1 2  ? 1.984   -3.047  -0.228 1.00 0.00 ? 103 SER A CB   2  
ATOM   517  O  OG   . SER A 1 2  ? 3.166   -2.481  -0.787 1.00 0.00 ? 103 SER A OG   2  
ATOM   518  H  H    . SER A 1 2  ? -0.818  -3.496  -1.198 1.00 0.00 ? 103 SER A H    2  
ATOM   519  H  HA   . SER A 1 2  ? 1.832   -4.032  -2.137 1.00 0.00 ? 103 SER A HA   2  
ATOM   520  H  HB2  . SER A 1 2  ? 1.335   -2.248  0.131  1.00 0.00 ? 103 SER A HB2  2  
ATOM   521  H  HB3  . SER A 1 2  ? 2.248   -3.656  0.637  1.00 0.00 ? 103 SER A HB3  2  
ATOM   522  H  HG   . SER A 1 2  ? 3.936   -2.609  -0.162 1.00 0.00 ? 103 SER A HG   2  
ATOM   523  N  N    . PHE A 1 3  ? 1.905   -6.081  -0.460 1.00 0.00 ? 104 PHE A N    2  
ATOM   524  C  CA   . PHE A 1 3  ? 1.723   -7.405  0.109  1.00 0.00 ? 104 PHE A CA   2  
ATOM   525  C  C    . PHE A 1 3  ? 1.452   -7.323  1.612  1.00 0.00 ? 104 PHE A C    2  
ATOM   526  O  O    . PHE A 1 3  ? 2.381   -7.358  2.418  1.00 0.00 ? 104 PHE A O    2  
ATOM   527  C  CB   . PHE A 1 3  ? 3.026   -8.175  -0.121 1.00 0.00 ? 104 PHE A CB   2  
ATOM   528  C  CG   . PHE A 1 3  ? 3.637   -7.962  -1.507 1.00 0.00 ? 104 PHE A CG   2  
ATOM   529  C  CD1  . PHE A 1 3  ? 2.895   -8.198  -2.622 1.00 0.00 ? 104 PHE A CD1  2  
ATOM   530  C  CD2  . PHE A 1 3  ? 4.924   -7.536  -1.624 1.00 0.00 ? 104 PHE A CD2  2  
ATOM   531  C  CE1  . PHE A 1 3  ? 3.463   -8.001  -3.908 1.00 0.00 ? 104 PHE A CE1  2  
ATOM   532  C  CE2  . PHE A 1 3  ? 5.491   -7.338  -2.910 1.00 0.00 ? 104 PHE A CE2  2  
ATOM   533  C  CZ   . PHE A 1 3  ? 4.749   -7.575  -4.025 1.00 0.00 ? 104 PHE A CZ   2  
ATOM   534  H  H    . PHE A 1 3  ? 2.847   -5.852  -0.704 1.00 0.00 ? 104 PHE A H    2  
ATOM   535  H  HA   . PHE A 1 3  ? 0.864   -7.857  -0.388 1.00 0.00 ? 104 PHE A HA   2  
ATOM   536  H  HB2  . PHE A 1 3  ? 3.750   -7.875  0.635  1.00 0.00 ? 104 PHE A HB2  2  
ATOM   537  H  HB3  . PHE A 1 3  ? 2.837   -9.239  0.023  1.00 0.00 ? 104 PHE A HB3  2  
ATOM   538  H  HD1  . PHE A 1 3  ? 1.864   -8.539  -2.528 1.00 0.00 ? 104 PHE A HD1  2  
ATOM   539  H  HD2  . PHE A 1 3  ? 5.518   -7.347  -0.731 1.00 0.00 ? 104 PHE A HD2  2  
ATOM   540  H  HE1  . PHE A 1 3  ? 2.868   -8.191  -4.801 1.00 0.00 ? 104 PHE A HE1  2  
ATOM   541  H  HE2  . PHE A 1 3  ? 6.523   -6.997  -3.004 1.00 0.00 ? 104 PHE A HE2  2  
ATOM   542  H  HZ   . PHE A 1 3  ? 5.185   -7.423  -5.012 1.00 0.00 ? 104 PHE A HZ   2  
ATOM   543  N  N    . VAL A 1 4  ? 0.174   -7.215  1.946  1.00 0.00 ? 105 VAL A N    2  
ATOM   544  C  CA   . VAL A 1 4  ? -0.231  -7.127  3.339  1.00 0.00 ? 105 VAL A CA   2  
ATOM   545  C  C    . VAL A 1 4  ? -1.178  -8.283  3.664  1.00 0.00 ? 105 VAL A C    2  
ATOM   546  O  O    . VAL A 1 4  ? -1.911  -8.753  2.796  1.00 0.00 ? 105 VAL A O    2  
ATOM   547  C  CB   . VAL A 1 4  ? -0.845  -5.754  3.620  1.00 0.00 ? 105 VAL A CB   2  
ATOM   548  C  CG1  . VAL A 1 4  ? -1.574  -5.744  4.965  1.00 0.00 ? 105 VAL A CG1  2  
ATOM   549  C  CG2  . VAL A 1 4  ? 0.219   -4.655  3.565  1.00 0.00 ? 105 VAL A CG2  2  
ATOM   550  H  H    . VAL A 1 4  ? -0.576  -7.187  1.285  1.00 0.00 ? 105 VAL A H    2  
ATOM   551  H  HA   . VAL A 1 4  ? 0.667   -7.226  3.950  1.00 0.00 ? 105 VAL A HA   2  
ATOM   552  H  HB   . VAL A 1 4  ? -1.579  -5.549  2.840  1.00 0.00 ? 105 VAL A HB   2  
ATOM   553  H  HG11 . VAL A 1 4  ? -1.525  -4.745  5.398  1.00 0.00 ? 105 VAL A HG11 2  
ATOM   554  H  HG12 . VAL A 1 4  ? -2.616  -6.025  4.816  1.00 0.00 ? 105 VAL A HG12 2  
ATOM   555  H  HG13 . VAL A 1 4  ? -1.099  -6.455  5.641  1.00 0.00 ? 105 VAL A HG13 2  
ATOM   556  H  HG21 . VAL A 1 4  ? 0.864   -4.818  2.700  1.00 0.00 ? 105 VAL A HG21 2  
ATOM   557  H  HG22 . VAL A 1 4  ? -0.267  -3.684  3.478  1.00 0.00 ? 105 VAL A HG22 2  
ATOM   558  H  HG23 . VAL A 1 4  ? 0.817   -4.683  4.475  1.00 0.00 ? 105 VAL A HG23 2  
ATOM   559  N  N    . CYS A 1 5  ? -1.133  -8.709  4.918  1.00 0.00 ? 106 CYS A N    2  
ATOM   560  C  CA   . CYS A 1 5  ? -1.978  -9.802  5.369  1.00 0.00 ? 106 CYS A CA   2  
ATOM   561  C  C    . CYS A 1 5  ? -3.235  -9.206  6.005  1.00 0.00 ? 106 CYS A C    2  
ATOM   562  O  O    . CYS A 1 5  ? -3.238  -8.872  7.188  1.00 0.00 ? 106 CYS A O    2  
ATOM   563  C  CB   . CYS A 1 5  ? -1.237  -10.730 6.332  1.00 0.00 ? 106 CYS A CB   2  
ATOM   564  S  SG   . CYS A 1 5  ? -2.345  -12.080 6.879  1.00 0.00 ? 106 CYS A SG   2  
ATOM   565  H  H    . CYS A 1 5  ? -0.534  -8.322  5.618  1.00 0.00 ? 106 CYS A H    2  
ATOM   566  H  HA   . CYS A 1 5  ? -2.232  -10.387 4.485  1.00 0.00 ? 106 CYS A HA   2  
ATOM   567  H  HB2  . CYS A 1 5  ? -0.356  -11.147 5.843  1.00 0.00 ? 106 CYS A HB2  2  
ATOM   568  H  HB3  . CYS A 1 5  ? -0.884  -10.166 7.195  1.00 0.00 ? 106 CYS A HB3  2  
ATOM   569  N  N    . GLU A 1 6  ? -4.274  -9.090  5.190  1.00 0.00 ? 107 GLU A N    2  
ATOM   570  C  CA   . GLU A 1 6  ? -5.535  -8.540  5.658  1.00 0.00 ? 107 GLU A CA   2  
ATOM   571  C  C    . GLU A 1 6  ? -5.969  -9.233  6.952  1.00 0.00 ? 107 GLU A C    2  
ATOM   572  O  O    . GLU A 1 6  ? -6.626  -8.625  7.795  1.00 0.00 ? 107 GLU A O    2  
ATOM   573  C  CB   . GLU A 1 6  ? -6.617  -8.658  4.584  1.00 0.00 ? 107 GLU A CB   2  
ATOM   574  C  CG   . GLU A 1 6  ? -6.229  -7.879  3.326  1.00 0.00 ? 107 GLU A CG   2  
ATOM   575  C  CD   . GLU A 1 6  ? -5.470  -8.771  2.340  1.00 0.00 ? 107 GLU A CD   2  
ATOM   576  O  OE1  . GLU A 1 6  ? -5.638  -10.005 2.447  1.00 0.00 ? 107 GLU A OE1  2  
ATOM   577  O  OE2  . GLU A 1 6  ? -4.741  -8.198  1.502  1.00 0.00 ? 107 GLU A OE2  2  
ATOM   578  H  H    . GLU A 1 6  ? -4.264  -9.364  4.229  1.00 0.00 ? 107 GLU A H    2  
ATOM   579  H  HA   . GLU A 1 6  ? -5.337  -7.486  5.852  1.00 0.00 ? 107 GLU A HA   2  
ATOM   580  H  HB2  . GLU A 1 6  ? -6.772  -9.707  4.332  1.00 0.00 ? 107 GLU A HB2  2  
ATOM   581  H  HB3  . GLU A 1 6  ? -7.563  -8.281  4.972  1.00 0.00 ? 107 GLU A HB3  2  
ATOM   582  H  HG2  . GLU A 1 6  ? -7.124  -7.482  2.848  1.00 0.00 ? 107 GLU A HG2  2  
ATOM   583  H  HG3  . GLU A 1 6  ? -5.609  -7.024  3.600  1.00 0.00 ? 107 GLU A HG3  2  
ATOM   584  N  N    . VAL A 1 7  ? -5.583  -10.496 7.067  1.00 0.00 ? 108 VAL A N    2  
ATOM   585  C  CA   . VAL A 1 7  ? -5.923  -11.277 8.244  1.00 0.00 ? 108 VAL A CA   2  
ATOM   586  C  C    . VAL A 1 7  ? -5.438  -10.545 9.496  1.00 0.00 ? 108 VAL A C    2  
ATOM   587  O  O    . VAL A 1 7  ? -6.243  -10.110 10.317 1.00 0.00 ? 108 VAL A O    2  
ATOM   588  C  CB   . VAL A 1 7  ? -5.351  -12.690 8.116  1.00 0.00 ? 108 VAL A CB   2  
ATOM   589  C  CG1  . VAL A 1 7  ? -5.385  -13.418 9.462  1.00 0.00 ? 108 VAL A CG1  2  
ATOM   590  C  CG2  . VAL A 1 7  ? -6.091  -13.488 7.042  1.00 0.00 ? 108 VAL A CG2  2  
ATOM   591  H  H    . VAL A 1 7  ? -5.049  -10.983 6.376  1.00 0.00 ? 108 VAL A H    2  
ATOM   592  H  HA   . VAL A 1 7  ? -7.011  -11.356 8.283  1.00 0.00 ? 108 VAL A HA   2  
ATOM   593  H  HB   . VAL A 1 7  ? -4.308  -12.603 7.811  1.00 0.00 ? 108 VAL A HB   2  
ATOM   594  H  HG11 . VAL A 1 7  ? -4.471  -13.204 10.014 1.00 0.00 ? 108 VAL A HG11 2  
ATOM   595  H  HG12 . VAL A 1 7  ? -6.246  -13.078 10.037 1.00 0.00 ? 108 VAL A HG12 2  
ATOM   596  H  HG13 . VAL A 1 7  ? -5.464  -14.492 9.292  1.00 0.00 ? 108 VAL A HG13 2  
ATOM   597  H  HG21 . VAL A 1 7  ? -7.164  -13.325 7.143  1.00 0.00 ? 108 VAL A HG21 2  
ATOM   598  H  HG22 . VAL A 1 7  ? -5.765  -13.158 6.055  1.00 0.00 ? 108 VAL A HG22 2  
ATOM   599  H  HG23 . VAL A 1 7  ? -5.872  -14.549 7.162  1.00 0.00 ? 108 VAL A HG23 2  
ATOM   600  N  N    . CYS A 1 8  ? -4.122  -10.430 9.603  1.00 0.00 ? 109 CYS A N    2  
ATOM   601  C  CA   . CYS A 1 8  ? -3.519  -9.758  10.741 1.00 0.00 ? 109 CYS A CA   2  
ATOM   602  C  C    . CYS A 1 8  ? -3.086  -8.359  10.298 1.00 0.00 ? 109 CYS A C    2  
ATOM   603  O  O    . CYS A 1 8  ? -3.315  -7.381  11.008 1.00 0.00 ? 109 CYS A O    2  
ATOM   604  C  CB   . CYS A 1 8  ? -2.351  -10.561 11.318 1.00 0.00 ? 109 CYS A CB   2  
ATOM   605  S  SG   . CYS A 1 8  ? -0.901  -10.442 10.209 1.00 0.00 ? 109 CYS A SG   2  
ATOM   606  H  H    . CYS A 1 8  ? -3.473  -10.787 8.930  1.00 0.00 ? 109 CYS A H    2  
ATOM   607  H  HA   . CYS A 1 8  ? -4.286  -9.701  11.512 1.00 0.00 ? 109 CYS A HA   2  
ATOM   608  H  HB2  . CYS A 1 8  ? -2.094  -10.184 12.308 1.00 0.00 ? 109 CYS A HB2  2  
ATOM   609  H  HB3  . CYS A 1 8  ? -2.641  -11.604 11.440 1.00 0.00 ? 109 CYS A HB3  2  
ATOM   610  N  N    . THR A 1 9  ? -2.468  -8.308  9.127  1.00 0.00 ? 110 THR A N    2  
ATOM   611  C  CA   . THR A 1 9  ? -2.001  -7.046  8.582  1.00 0.00 ? 110 THR A CA   2  
ATOM   612  C  C    . THR A 1 9  ? -0.484  -7.078  8.384  1.00 0.00 ? 110 THR A C    2  
ATOM   613  O  O    . THR A 1 9  ? 0.139   -6.042  8.157  1.00 0.00 ? 110 THR A O    2  
ATOM   614  C  CB   . THR A 1 9  ? -2.468  -5.926  9.514  1.00 0.00 ? 110 THR A CB   2  
ATOM   615  O  OG1  . THR A 1 9  ? -2.177  -4.731  8.795  1.00 0.00 ? 110 THR A OG1  2  
ATOM   616  C  CG2  . THR A 1 9  ? -1.610  -5.819  10.777 1.00 0.00 ? 110 THR A CG2  2  
ATOM   617  H  H    . THR A 1 9  ? -2.286  -9.108  8.556  1.00 0.00 ? 110 THR A H    2  
ATOM   618  H  HA   . THR A 1 9  ? -2.448  -6.910  7.597  1.00 0.00 ? 110 THR A HA   2  
ATOM   619  H  HB   . THR A 1 9  ? -3.521  -6.046  9.769  1.00 0.00 ? 110 THR A HB   2  
ATOM   620  H  HG1  . THR A 1 9  ? -1.188  -4.613  8.712  1.00 0.00 ? 110 THR A HG1  2  
ATOM   621  H  HG21 . THR A 1 9  ? -1.136  -6.781  10.977 1.00 0.00 ? 110 THR A HG21 2  
ATOM   622  H  HG22 . THR A 1 9  ? -0.842  -5.059  10.631 1.00 0.00 ? 110 THR A HG22 2  
ATOM   623  H  HG23 . THR A 1 9  ? -2.239  -5.541  11.622 1.00 0.00 ? 110 THR A HG23 2  
ATOM   624  N  N    . ARG A 1 10 ? 0.067   -8.279  8.478  1.00 0.00 ? 111 ARG A N    2  
ATOM   625  C  CA   . ARG A 1 10 ? 1.499   -8.461  8.312  1.00 0.00 ? 111 ARG A CA   2  
ATOM   626  C  C    . ARG A 1 10 ? 1.911   -8.151  6.871  1.00 0.00 ? 111 ARG A C    2  
ATOM   627  O  O    . ARG A 1 10 ? 1.448   -8.802  5.937  1.00 0.00 ? 111 ARG A O    2  
ATOM   628  C  CB   . ARG A 1 10 ? 1.917   -9.892  8.658  1.00 0.00 ? 111 ARG A CB   2  
ATOM   629  C  CG   . ARG A 1 10 ? 2.364   -9.995  10.117 1.00 0.00 ? 111 ARG A CG   2  
ATOM   630  C  CD   . ARG A 1 10 ? 3.826   -10.435 10.213 1.00 0.00 ? 111 ARG A CD   2  
ATOM   631  N  NE   . ARG A 1 10 ? 4.625   -9.394  10.897 1.00 0.00 ? 111 ARG A NE   2  
ATOM   632  C  CZ   . ARG A 1 10 ? 5.941   -9.490  11.131 1.00 0.00 ? 111 ARG A CZ   2  
ATOM   633  N  NH1  . ARG A 1 10 ? 6.720   -10.189 10.297 1.00 0.00 ? 111 ARG A NH1  2  
ATOM   634  N  NH2  . ARG A 1 10 ? 6.477   -8.886  12.200 1.00 0.00 ? 111 ARG A NH2  2  
ATOM   635  H  H    . ARG A 1 10 ? -0.446  -9.118  8.663  1.00 0.00 ? 111 ARG A H    2  
ATOM   636  H  HA   . ARG A 1 10 ? 1.952   -7.756  9.010  1.00 0.00 ? 111 ARG A HA   2  
ATOM   637  H  HB2  . ARG A 1 10 ? 1.083   -10.570 8.481  1.00 0.00 ? 111 ARG A HB2  2  
ATOM   638  H  HB3  . ARG A 1 10 ? 2.728   -10.206 8.002  1.00 0.00 ? 111 ARG A HB3  2  
ATOM   639  H  HG2  . ARG A 1 10 ? 2.239   -9.030  10.609 1.00 0.00 ? 111 ARG A HG2  2  
ATOM   640  H  HG3  . ARG A 1 10 ? 1.730   -10.706 10.647 1.00 0.00 ? 111 ARG A HG3  2  
ATOM   641  H  HD2  . ARG A 1 10 ? 3.895   -11.376 10.760 1.00 0.00 ? 111 ARG A HD2  2  
ATOM   642  H  HD3  . ARG A 1 10 ? 4.226   -10.616 9.215  1.00 0.00 ? 111 ARG A HD3  2  
ATOM   643  H  HE   . ARG A 1 10 ? 4.153   -8.567  11.203 1.00 0.00 ? 111 ARG A HE   2  
ATOM   644  H  HH11 . ARG A 1 10 ? 6.556   -11.166 10.159 1.00 0.00 ? 111 ARG A HH11 2  
ATOM   645  H  HH12 . ARG A 1 10 ? 7.468   -9.735  9.810  1.00 0.00 ? 111 ARG A HH12 2  
ATOM   646  H  HH21 . ARG A 1 10 ? 5.926   -8.254  12.746 1.00 0.00 ? 111 ARG A HH21 2  
ATOM   647  H  HH22 . ARG A 1 10 ? 7.427   -9.067  12.453 1.00 0.00 ? 111 ARG A HH22 2  
ATOM   648  N  N    . ALA A 1 11 ? 2.775   -7.157  6.737  1.00 0.00 ? 112 ALA A N    2  
ATOM   649  C  CA   . ALA A 1 11 ? 3.254   -6.752  5.427  1.00 0.00 ? 112 ALA A CA   2  
ATOM   650  C  C    . ALA A 1 11 ? 4.546   -7.507  5.105  1.00 0.00 ? 112 ALA A C    2  
ATOM   651  O  O    . ALA A 1 11 ? 5.361   -7.756  5.991  1.00 0.00 ? 112 ALA A O    2  
ATOM   652  C  CB   . ALA A 1 11 ? 3.444   -5.235  5.397  1.00 0.00 ? 112 ALA A CB   2  
ATOM   653  H  H    . ALA A 1 11 ? 3.148   -6.632  7.503  1.00 0.00 ? 112 ALA A H    2  
ATOM   654  H  HA   . ALA A 1 11 ? 2.493   -7.025  4.697  1.00 0.00 ? 112 ALA A HA   2  
ATOM   655  H  HB1  . ALA A 1 11 ? 2.622   -4.756  5.930  1.00 0.00 ? 112 ALA A HB1  2  
ATOM   656  H  HB2  . ALA A 1 11 ? 4.387   -4.977  5.879  1.00 0.00 ? 112 ALA A HB2  2  
ATOM   657  H  HB3  . ALA A 1 11 ? 3.457   -4.890  4.364  1.00 0.00 ? 112 ALA A HB3  2  
ATOM   658  N  N    . PHE A 1 12 ? 4.691   -7.852  3.834  1.00 0.00 ? 113 PHE A N    2  
ATOM   659  C  CA   . PHE A 1 12 ? 5.869   -8.574  3.384  1.00 0.00 ? 113 PHE A CA   2  
ATOM   660  C  C    . PHE A 1 12 ? 6.441   -7.950  2.109  1.00 0.00 ? 113 PHE A C    2  
ATOM   661  O  O    . PHE A 1 12 ? 5.732   -7.257  1.381  1.00 0.00 ? 113 PHE A O    2  
ATOM   662  C  CB   . PHE A 1 12 ? 5.427   -10.007 3.082  1.00 0.00 ? 113 PHE A CB   2  
ATOM   663  C  CG   . PHE A 1 12 ? 5.043   -10.815 4.324  1.00 0.00 ? 113 PHE A CG   2  
ATOM   664  C  CD1  . PHE A 1 12 ? 6.011   -11.380 5.094  1.00 0.00 ? 113 PHE A CD1  2  
ATOM   665  C  CD2  . PHE A 1 12 ? 3.734   -10.968 4.657  1.00 0.00 ? 113 PHE A CD2  2  
ATOM   666  C  CE1  . PHE A 1 12 ? 5.655   -12.128 6.246  1.00 0.00 ? 113 PHE A CE1  2  
ATOM   667  C  CE2  . PHE A 1 12 ? 3.377   -11.717 5.809  1.00 0.00 ? 113 PHE A CE2  2  
ATOM   668  C  CZ   . PHE A 1 12 ? 4.345   -12.282 6.580  1.00 0.00 ? 113 PHE A CZ   2  
ATOM   669  H  H    . PHE A 1 12 ? 4.023   -7.646  3.119  1.00 0.00 ? 113 PHE A H    2  
ATOM   670  H  HA   . PHE A 1 12 ? 6.610   -8.511  4.181  1.00 0.00 ? 113 PHE A HA   2  
ATOM   671  H  HB2  . PHE A 1 12 ? 4.576   -9.978  2.402  1.00 0.00 ? 113 PHE A HB2  2  
ATOM   672  H  HB3  . PHE A 1 12 ? 6.234   -10.523 2.561  1.00 0.00 ? 113 PHE A HB3  2  
ATOM   673  H  HD1  . PHE A 1 12 ? 7.061   -11.256 4.828  1.00 0.00 ? 113 PHE A HD1  2  
ATOM   674  H  HD2  . PHE A 1 12 ? 2.958   -10.515 4.040  1.00 0.00 ? 113 PHE A HD2  2  
ATOM   675  H  HE1  . PHE A 1 12 ? 6.430   -12.581 6.864  1.00 0.00 ? 113 PHE A HE1  2  
ATOM   676  H  HE2  . PHE A 1 12 ? 2.327   -11.839 6.076  1.00 0.00 ? 113 PHE A HE2  2  
ATOM   677  H  HZ   . PHE A 1 12 ? 4.071   -12.856 7.464  1.00 0.00 ? 113 PHE A HZ   2  
ATOM   678  N  N    . ALA A 1 13 ? 7.718   -8.218  1.880  1.00 0.00 ? 114 ALA A N    2  
ATOM   679  C  CA   . ALA A 1 13 ? 8.393   -7.691  0.706  1.00 0.00 ? 114 ALA A CA   2  
ATOM   680  C  C    . ALA A 1 13 ? 8.172   -8.641  -0.473 1.00 0.00 ? 114 ALA A C    2  
ATOM   681  O  O    . ALA A 1 13 ? 7.947   -8.197  -1.598 1.00 0.00 ? 114 ALA A O    2  
ATOM   682  C  CB   . ALA A 1 13 ? 9.876   -7.486  1.019  1.00 0.00 ? 114 ALA A CB   2  
ATOM   683  H  H    . ALA A 1 13 ? 8.288   -8.782  2.476  1.00 0.00 ? 114 ALA A H    2  
ATOM   684  H  HA   . ALA A 1 13 ? 7.947   -6.725  0.471  1.00 0.00 ? 114 ALA A HA   2  
ATOM   685  H  HB1  . ALA A 1 13 ? 10.414  -8.420  0.858  1.00 0.00 ? 114 ALA A HB1  2  
ATOM   686  H  HB2  . ALA A 1 13 ? 10.283  -6.716  0.364  1.00 0.00 ? 114 ALA A HB2  2  
ATOM   687  H  HB3  . ALA A 1 13 ? 9.989   -7.176  2.058  1.00 0.00 ? 114 ALA A HB3  2  
ATOM   688  N  N    . ARG A 1 14 ? 8.245   -9.929  -0.176 1.00 0.00 ? 115 ARG A N    2  
ATOM   689  C  CA   . ARG A 1 14 ? 8.055   -10.946 -1.198 1.00 0.00 ? 115 ARG A CA   2  
ATOM   690  C  C    . ARG A 1 14 ? 6.664   -11.570 -1.073 1.00 0.00 ? 115 ARG A C    2  
ATOM   691  O  O    . ARG A 1 14 ? 6.302   -12.084 -0.016 1.00 0.00 ? 115 ARG A O    2  
ATOM   692  C  CB   . ARG A 1 14 ? 9.112   -12.045 -1.082 1.00 0.00 ? 115 ARG A CB   2  
ATOM   693  C  CG   . ARG A 1 14 ? 10.435  -11.483 -0.558 1.00 0.00 ? 115 ARG A CG   2  
ATOM   694  C  CD   . ARG A 1 14 ? 10.925  -10.327 -1.435 1.00 0.00 ? 115 ARG A CD   2  
ATOM   695  N  NE   . ARG A 1 14 ? 12.232  -9.838  -0.943 1.00 0.00 ? 115 ARG A NE   2  
ATOM   696  C  CZ   . ARG A 1 14 ? 12.879  -8.783  -1.455 1.00 0.00 ? 115 ARG A CZ   2  
ATOM   697  N  NH1  . ARG A 1 14 ? 12.691  -8.438  -2.737 1.00 0.00 ? 115 ARG A NH1  2  
ATOM   698  N  NH2  . ARG A 1 14 ? 13.717  -8.073  -0.687 1.00 0.00 ? 115 ARG A NH2  2  
ATOM   699  H  H    . ARG A 1 14 ? 8.429   -10.282 0.741  1.00 0.00 ? 115 ARG A H    2  
ATOM   700  H  HA   . ARG A 1 14 ? 8.164   -10.414 -2.143 1.00 0.00 ? 115 ARG A HA   2  
ATOM   701  H  HB2  . ARG A 1 14 ? 8.756   -12.829 -0.413 1.00 0.00 ? 115 ARG A HB2  2  
ATOM   702  H  HB3  . ARG A 1 14 ? 9.271   -12.507 -2.058 1.00 0.00 ? 115 ARG A HB3  2  
ATOM   703  H  HG2  . ARG A 1 14 ? 10.307  -11.138 0.467  1.00 0.00 ? 115 ARG A HG2  2  
ATOM   704  H  HG3  . ARG A 1 14 ? 11.187  -12.272 -0.538 1.00 0.00 ? 115 ARG A HG3  2  
ATOM   705  H  HD2  . ARG A 1 14 ? 11.016  -10.658 -2.469 1.00 0.00 ? 115 ARG A HD2  2  
ATOM   706  H  HD3  . ARG A 1 14 ? 10.195  -9.517  -1.422 1.00 0.00 ? 115 ARG A HD3  2  
ATOM   707  H  HE   . ARG A 1 14 ? 12.658  -10.325 -0.180 1.00 0.00 ? 115 ARG A HE   2  
ATOM   708  H  HH11 . ARG A 1 14 ? 13.201  -8.902  -3.460 1.00 0.00 ? 115 ARG A HH11 2  
ATOM   709  H  HH12 . ARG A 1 14 ? 12.038  -7.716  -2.968 1.00 0.00 ? 115 ARG A HH12 2  
ATOM   710  H  HH21 . ARG A 1 14 ? 14.309  -8.540  -0.029 1.00 0.00 ? 115 ARG A HH21 2  
ATOM   711  H  HH22 . ARG A 1 14 ? 13.751  -7.078  -0.771 1.00 0.00 ? 115 ARG A HH22 2  
ATOM   712  N  N    . GLN A 1 15 ? 5.922   -11.504 -2.168 1.00 0.00 ? 116 GLN A N    2  
ATOM   713  C  CA   . GLN A 1 15 ? 4.578   -12.056 -2.196 1.00 0.00 ? 116 GLN A CA   2  
ATOM   714  C  C    . GLN A 1 15 ? 4.550   -13.419 -1.502 1.00 0.00 ? 116 GLN A C    2  
ATOM   715  O  O    . GLN A 1 15 ? 3.786   -13.625 -0.560 1.00 0.00 ? 116 GLN A O    2  
ATOM   716  C  CB   . GLN A 1 15 ? 4.057   -12.161 -3.631 1.00 0.00 ? 116 GLN A CB   2  
ATOM   717  C  CG   . GLN A 1 15 ? 3.652   -10.788 -4.169 1.00 0.00 ? 116 GLN A CG   2  
ATOM   718  C  CD   . GLN A 1 15 ? 4.816   -10.122 -4.904 1.00 0.00 ? 116 GLN A CD   2  
ATOM   719  O  OE1  . GLN A 1 15 ? 5.858   -9.834  -4.338 1.00 0.00 ? 116 GLN A OE1  2  
ATOM   720  N  NE2  . GLN A 1 15 ? 4.582   -9.893  -6.193 1.00 0.00 ? 116 GLN A NE2  2  
ATOM   721  H  H    . GLN A 1 15 ? 6.223   -11.084 -3.024 1.00 0.00 ? 116 GLN A H    2  
ATOM   722  H  HA   . GLN A 1 15 ? 3.962   -11.347 -1.644 1.00 0.00 ? 116 GLN A HA   2  
ATOM   723  H  HB2  . GLN A 1 15 ? 4.827   -12.594 -4.270 1.00 0.00 ? 116 GLN A HB2  2  
ATOM   724  H  HB3  . GLN A 1 15 ? 3.201   -12.835 -3.663 1.00 0.00 ? 116 GLN A HB3  2  
ATOM   725  H  HG2  . GLN A 1 15 ? 2.803   -10.894 -4.845 1.00 0.00 ? 116 GLN A HG2  2  
ATOM   726  H  HG3  . GLN A 1 15 ? 3.326   -10.152 -3.346 1.00 0.00 ? 116 GLN A HG3  2  
ATOM   727  H  HE21 . GLN A 1 15 ? 4.514   -10.659 -6.833 1.00 0.00 ? 116 GLN A HE21 2  
ATOM   728  H  HE22 . GLN A 1 15 ? 4.475   -8.955  -6.524 1.00 0.00 ? 116 GLN A HE22 2  
ATOM   729  N  N    . GLU A 1 16 ? 5.393   -14.316 -1.993 1.00 0.00 ? 117 GLU A N    2  
ATOM   730  C  CA   . GLU A 1 16 ? 5.474   -15.654 -1.433 1.00 0.00 ? 117 GLU A CA   2  
ATOM   731  C  C    . GLU A 1 16 ? 5.447   -15.590 0.096  1.00 0.00 ? 117 GLU A C    2  
ATOM   732  O  O    . GLU A 1 16 ? 4.760   -16.380 0.741  1.00 0.00 ? 117 GLU A O    2  
ATOM   733  C  CB   . GLU A 1 16 ? 6.725   -16.382 -1.929 1.00 0.00 ? 117 GLU A CB   2  
ATOM   734  C  CG   . GLU A 1 16 ? 7.275   -17.321 -0.855 1.00 0.00 ? 117 GLU A CG   2  
ATOM   735  C  CD   . GLU A 1 16 ? 8.113   -18.438 -1.481 1.00 0.00 ? 117 GLU A CD   2  
ATOM   736  O  OE1  . GLU A 1 16 ? 7.712   -18.909 -2.568 1.00 0.00 ? 117 GLU A OE1  2  
ATOM   737  O  OE2  . GLU A 1 16 ? 9.135   -18.798 -0.858 1.00 0.00 ? 117 GLU A OE2  2  
ATOM   738  H  H    . GLU A 1 16 ? 6.010   -14.141 -2.760 1.00 0.00 ? 117 GLU A H    2  
ATOM   739  H  HA   . GLU A 1 16 ? 4.588   -16.175 -1.797 1.00 0.00 ? 117 GLU A HA   2  
ATOM   740  H  HB2  . GLU A 1 16 ? 6.486   -16.951 -2.828 1.00 0.00 ? 117 GLU A HB2  2  
ATOM   741  H  HB3  . GLU A 1 16 ? 7.487   -15.654 -2.207 1.00 0.00 ? 117 GLU A HB3  2  
ATOM   742  H  HG2  . GLU A 1 16 ? 7.885   -16.756 -0.150 1.00 0.00 ? 117 GLU A HG2  2  
ATOM   743  H  HG3  . GLU A 1 16 ? 6.451   -17.754 -0.288 1.00 0.00 ? 117 GLU A HG3  2  
ATOM   744  N  N    . ALA A 1 17 ? 6.206   -14.645 0.630  1.00 0.00 ? 118 ALA A N    2  
ATOM   745  C  CA   . ALA A 1 17 ? 6.278   -14.468 2.071  1.00 0.00 ? 118 ALA A CA   2  
ATOM   746  C  C    . ALA A 1 17 ? 4.866   -14.286 2.630  1.00 0.00 ? 118 ALA A C    2  
ATOM   747  O  O    . ALA A 1 17 ? 4.561   -14.757 3.724  1.00 0.00 ? 118 ALA A O    2  
ATOM   748  C  CB   . ALA A 1 17 ? 7.190   -13.283 2.394  1.00 0.00 ? 118 ALA A CB   2  
ATOM   749  H  H    . ALA A 1 17 ? 6.763   -14.007 0.098  1.00 0.00 ? 118 ALA A H    2  
ATOM   750  H  HA   . ALA A 1 17 ? 6.714   -15.372 2.494  1.00 0.00 ? 118 ALA A HA   2  
ATOM   751  H  HB1  . ALA A 1 17 ? 7.695   -12.954 1.487  1.00 0.00 ? 118 ALA A HB1  2  
ATOM   752  H  HB2  . ALA A 1 17 ? 6.593   -12.464 2.797  1.00 0.00 ? 118 ALA A HB2  2  
ATOM   753  H  HB3  . ALA A 1 17 ? 7.933   -13.587 3.133  1.00 0.00 ? 118 ALA A HB3  2  
ATOM   754  N  N    . LEU A 1 18 ? 4.040   -13.602 1.852  1.00 0.00 ? 119 LEU A N    2  
ATOM   755  C  CA   . LEU A 1 18 ? 2.666   -13.351 2.255  1.00 0.00 ? 119 LEU A CA   2  
ATOM   756  C  C    . LEU A 1 18 ? 1.867   -14.654 2.164  1.00 0.00 ? 119 LEU A C    2  
ATOM   757  O  O    . LEU A 1 18 ? 1.403   -15.174 3.178  1.00 0.00 ? 119 LEU A O    2  
ATOM   758  C  CB   . LEU A 1 18 ? 2.068   -12.205 1.439  1.00 0.00 ? 119 LEU A CB   2  
ATOM   759  C  CG   . LEU A 1 18 ? 0.540   -12.141 1.391  1.00 0.00 ? 119 LEU A CG   2  
ATOM   760  C  CD1  . LEU A 1 18 ? -0.056  -12.215 2.798  1.00 0.00 ? 119 LEU A CD1  2  
ATOM   761  C  CD2  . LEU A 1 18 ? 0.067   -10.900 0.633  1.00 0.00 ? 119 LEU A CD2  2  
ATOM   762  H  H    . LEU A 1 18 ? 4.294   -13.222 0.963  1.00 0.00 ? 119 LEU A H    2  
ATOM   763  H  HA   . LEU A 1 18 ? 2.685   -13.030 3.296  1.00 0.00 ? 119 LEU A HA   2  
ATOM   764  H  HB2  . LEU A 1 18 ? 2.439   -11.264 1.844  1.00 0.00 ? 119 LEU A HB2  2  
ATOM   765  H  HB3  . LEU A 1 18 ? 2.440   -12.280 0.417  1.00 0.00 ? 119 LEU A HB3  2  
ATOM   766  H  HG   . LEU A 1 18 ? 0.178   -13.011 0.843  1.00 0.00 ? 119 LEU A HG   2  
ATOM   767  H  HD11 . LEU A 1 18 ? -0.231  -13.257 3.064  1.00 0.00 ? 119 LEU A HD11 2  
ATOM   768  H  HD12 . LEU A 1 18 ? 0.639   -11.771 3.511  1.00 0.00 ? 119 LEU A HD12 2  
ATOM   769  H  HD13 . LEU A 1 18 ? -0.999  -11.670 2.823  1.00 0.00 ? 119 LEU A HD13 2  
ATOM   770  H  HD21 . LEU A 1 18 ? -0.634  -11.196 -0.147 1.00 0.00 ? 119 LEU A HD21 2  
ATOM   771  H  HD22 . LEU A 1 18 ? -0.427  -10.217 1.326  1.00 0.00 ? 119 LEU A HD22 2  
ATOM   772  H  HD23 . LEU A 1 18 ? 0.924   -10.401 0.181  1.00 0.00 ? 119 LEU A HD23 2  
ATOM   773  N  N    . LYS A 1 19 ? 1.733   -15.144 0.941  1.00 0.00 ? 120 LYS A N    2  
ATOM   774  C  CA   . LYS A 1 19 ? 0.999   -16.375 0.704  1.00 0.00 ? 120 LYS A CA   2  
ATOM   775  C  C    . LYS A 1 19 ? 1.382   -17.405 1.768  1.00 0.00 ? 120 LYS A C    2  
ATOM   776  O  O    . LYS A 1 19 ? 0.517   -17.942 2.458  1.00 0.00 ? 120 LYS A O    2  
ATOM   777  C  CB   . LYS A 1 19 ? 1.216   -16.861 -0.730 1.00 0.00 ? 120 LYS A CB   2  
ATOM   778  C  CG   . LYS A 1 19 ? -0.120  -17.122 -1.430 1.00 0.00 ? 120 LYS A CG   2  
ATOM   779  C  CD   . LYS A 1 19 ? -0.019  -16.833 -2.928 1.00 0.00 ? 120 LYS A CD   2  
ATOM   780  C  CE   . LYS A 1 19 ? -1.251  -17.352 -3.672 1.00 0.00 ? 120 LYS A CE   2  
ATOM   781  N  NZ   . LYS A 1 19 ? -1.588  -18.722 -3.222 1.00 0.00 ? 120 LYS A NZ   2  
ATOM   782  H  H    . LYS A 1 19 ? 2.114   -14.715 0.121  1.00 0.00 ? 120 LYS A H    2  
ATOM   783  H  HA   . LYS A 1 19 ? -0.063  -16.148 0.810  1.00 0.00 ? 120 LYS A HA   2  
ATOM   784  H  HB2  . LYS A 1 19 ? 1.784   -16.118 -1.289 1.00 0.00 ? 120 LYS A HB2  2  
ATOM   785  H  HB3  . LYS A 1 19 ? 1.811   -17.775 -0.721 1.00 0.00 ? 120 LYS A HB3  2  
ATOM   786  H  HG2  . LYS A 1 19 ? -0.419  -18.158 -1.275 1.00 0.00 ? 120 LYS A HG2  2  
ATOM   787  H  HG3  . LYS A 1 19 ? -0.894  -16.496 -0.986 1.00 0.00 ? 120 LYS A HG3  2  
ATOM   788  H  HD2  . LYS A 1 19 ? 0.082   -15.760 -3.090 1.00 0.00 ? 120 LYS A HD2  2  
ATOM   789  H  HD3  . LYS A 1 19 ? 0.878   -17.302 -3.333 1.00 0.00 ? 120 LYS A HD3  2  
ATOM   790  H  HE2  . LYS A 1 19 ? -2.097  -16.687 -3.495 1.00 0.00 ? 120 LYS A HE2  2  
ATOM   791  H  HE3  . LYS A 1 19 ? -1.063  -17.352 -4.745 1.00 0.00 ? 120 LYS A HE3  2  
ATOM   792  H  HZ1  . LYS A 1 19 ? -2.006  -19.227 -3.976 1.00 0.00 ? 120 LYS A HZ1  2  
ATOM   793  H  HZ2  . LYS A 1 19 ? -0.755  -19.191 -2.927 1.00 0.00 ? 120 LYS A HZ2  2  
ATOM   794  H  HZ3  . LYS A 1 19 ? -2.231  -18.673 -2.457 1.00 0.00 ? 120 LYS A HZ3  2  
ATOM   795  N  N    . ARG A 1 20 ? 2.681   -17.650 1.868  1.00 0.00 ? 121 ARG A N    2  
ATOM   796  C  CA   . ARG A 1 20 ? 3.189   -18.606 2.836  1.00 0.00 ? 121 ARG A CA   2  
ATOM   797  C  C    . ARG A 1 20 ? 2.707   -18.246 4.243  1.00 0.00 ? 121 ARG A C    2  
ATOM   798  O  O    . ARG A 1 20 ? 2.457   -19.129 5.062  1.00 0.00 ? 121 ARG A O    2  
ATOM   799  C  CB   . ARG A 1 20 ? 4.719   -18.641 2.825  1.00 0.00 ? 121 ARG A CB   2  
ATOM   800  C  CG   . ARG A 1 20 ? 5.233   -19.918 2.156  1.00 0.00 ? 121 ARG A CG   2  
ATOM   801  C  CD   . ARG A 1 20 ? 6.706   -20.158 2.493  1.00 0.00 ? 121 ARG A CD   2  
ATOM   802  N  NE   . ARG A 1 20 ? 7.350   -20.941 1.415  1.00 0.00 ? 121 ARG A NE   2  
ATOM   803  C  CZ   . ARG A 1 20 ? 7.193   -22.261 1.248  1.00 0.00 ? 121 ARG A CZ   2  
ATOM   804  N  NH1  . ARG A 1 20 ? 6.658   -23.002 2.230  1.00 0.00 ? 121 ARG A NH1  2  
ATOM   805  N  NH2  . ARG A 1 20 ? 7.570   -22.841 0.100  1.00 0.00 ? 121 ARG A NH2  2  
ATOM   806  H  H    . ARG A 1 20 ? 3.378   -17.209 1.304  1.00 0.00 ? 121 ARG A H    2  
ATOM   807  H  HA   . ARG A 1 20 ? 2.787   -19.567 2.517  1.00 0.00 ? 121 ARG A HA   2  
ATOM   808  H  HB2  . ARG A 1 20 ? 5.102   -17.770 2.293  1.00 0.00 ? 121 ARG A HB2  2  
ATOM   809  H  HB3  . ARG A 1 20 ? 5.097   -18.584 3.845  1.00 0.00 ? 121 ARG A HB3  2  
ATOM   810  H  HG2  . ARG A 1 20 ? 4.638   -20.770 2.487  1.00 0.00 ? 121 ARG A HG2  2  
ATOM   811  H  HG3  . ARG A 1 20 ? 5.111   -19.843 1.076  1.00 0.00 ? 121 ARG A HG3  2  
ATOM   812  H  HD2  . ARG A 1 20 ? 7.219   -19.205 2.618  1.00 0.00 ? 121 ARG A HD2  2  
ATOM   813  H  HD3  . ARG A 1 20 ? 6.789   -20.692 3.440  1.00 0.00 ? 121 ARG A HD3  2  
ATOM   814  H  HE   . ARG A 1 20 ? 7.940   -20.455 0.771  1.00 0.00 ? 121 ARG A HE   2  
ATOM   815  H  HH11 . ARG A 1 20 ? 6.379   -22.569 3.087  1.00 0.00 ? 121 ARG A HH11 2  
ATOM   816  H  HH12 . ARG A 1 20 ? 6.538   -23.986 2.104  1.00 0.00 ? 121 ARG A HH12 2  
ATOM   817  H  HH21 . ARG A 1 20 ? 8.539   -22.898 -0.136 1.00 0.00 ? 121 ARG A HH21 2  
ATOM   818  H  HH22 . ARG A 1 20 ? 6.881   -23.219 -0.519 1.00 0.00 ? 121 ARG A HH22 2  
ATOM   819  N  N    . HIS A 1 21 ? 2.587   -16.947 4.478  1.00 0.00 ? 122 HIS A N    2  
ATOM   820  C  CA   . HIS A 1 21 ? 2.138   -16.460 5.771  1.00 0.00 ? 122 HIS A CA   2  
ATOM   821  C  C    . HIS A 1 21 ? 0.658   -16.800 5.962  1.00 0.00 ? 122 HIS A C    2  
ATOM   822  O  O    . HIS A 1 21 ? 0.281   -17.408 6.963  1.00 0.00 ? 122 HIS A O    2  
ATOM   823  C  CB   . HIS A 1 21 ? 2.426   -14.964 5.918  1.00 0.00 ? 122 HIS A CB   2  
ATOM   824  C  CG   . HIS A 1 21 ? 1.691   -14.307 7.062  1.00 0.00 ? 122 HIS A CG   2  
ATOM   825  N  ND1  . HIS A 1 21 ? 2.215   -14.220 8.339  1.00 0.00 ? 122 HIS A ND1  2  
ATOM   826  C  CD2  . HIS A 1 21 ? 0.467   -13.705 7.106  1.00 0.00 ? 122 HIS A CD2  2  
ATOM   827  C  CE1  . HIS A 1 21 ? 1.338   -13.593 9.109  1.00 0.00 ? 122 HIS A CE1  2  
ATOM   828  N  NE2  . HIS A 1 21 ? 0.255   -13.276 8.344  1.00 0.00 ? 122 HIS A NE2  2  
ATOM   829  H  H    . HIS A 1 21 ? 2.791   -16.236 3.807  1.00 0.00 ? 122 HIS A H    2  
ATOM   830  H  HA   . HIS A 1 21 ? 2.723   -16.987 6.525  1.00 0.00 ? 122 HIS A HA   2  
ATOM   831  H  HB2  . HIS A 1 21 ? 3.497   -14.824 6.060  1.00 0.00 ? 122 HIS A HB2  2  
ATOM   832  H  HB3  . HIS A 1 21 ? 2.157   -14.461 4.989  1.00 0.00 ? 122 HIS A HB3  2  
ATOM   833  H  HD1  . HIS A 1 21 ? 3.105   -14.570 8.630  1.00 0.00 ? 122 HIS A HD1  2  
ATOM   834  H  HD2  . HIS A 1 21 ? -0.220  -13.596 6.267  1.00 0.00 ? 122 HIS A HD2  2  
ATOM   835  H  HE1  . HIS A 1 21 ? 1.461   -13.370 10.170 1.00 0.00 ? 122 HIS A HE1  2  
ATOM   836  N  N    . TYR A 1 22 ? -0.141  -16.393 4.987  1.00 0.00 ? 123 TYR A N    2  
ATOM   837  C  CA   . TYR A 1 22 ? -1.570  -16.648 5.034  1.00 0.00 ? 123 TYR A CA   2  
ATOM   838  C  C    . TYR A 1 22 ? -1.856  -18.108 5.393  1.00 0.00 ? 123 TYR A C    2  
ATOM   839  O  O    . TYR A 1 22 ? -2.880  -18.412 6.003  1.00 0.00 ? 123 TYR A O    2  
ATOM   840  C  CB   . TYR A 1 22 ? -2.096  -16.369 3.625  1.00 0.00 ? 123 TYR A CB   2  
ATOM   841  C  CG   . TYR A 1 22 ? -3.176  -15.288 3.565  1.00 0.00 ? 123 TYR A CG   2  
ATOM   842  C  CD1  . TYR A 1 22 ? -4.394  -15.496 4.181  1.00 0.00 ? 123 TYR A CD1  2  
ATOM   843  C  CD2  . TYR A 1 22 ? -2.934  -14.105 2.897  1.00 0.00 ? 123 TYR A CD2  2  
ATOM   844  C  CE1  . TYR A 1 22 ? -5.411  -14.479 4.125  1.00 0.00 ? 123 TYR A CE1  2  
ATOM   845  C  CE2  . TYR A 1 22 ? -3.951  -13.088 2.841  1.00 0.00 ? 123 TYR A CE2  2  
ATOM   846  C  CZ   . TYR A 1 22 ? -5.141  -13.325 3.458  1.00 0.00 ? 123 TYR A CZ   2  
ATOM   847  O  OH   . TYR A 1 22 ? -6.101  -12.364 3.405  1.00 0.00 ? 123 TYR A OH   2  
ATOM   848  H  H    . TYR A 1 22 ? 0.174   -15.900 4.176  1.00 0.00 ? 123 TYR A H    2  
ATOM   849  H  HA   . TYR A 1 22 ? -2.001  -16.002 5.799  1.00 0.00 ? 123 TYR A HA   2  
ATOM   850  H  HB2  . TYR A 1 22 ? -1.261  -16.070 2.990  1.00 0.00 ? 123 TYR A HB2  2  
ATOM   851  H  HB3  . TYR A 1 22 ? -2.497  -17.293 3.208  1.00 0.00 ? 123 TYR A HB3  2  
ATOM   852  H  HD1  . TYR A 1 22 ? -4.586  -16.431 4.708  1.00 0.00 ? 123 TYR A HD1  2  
ATOM   853  H  HD2  . TYR A 1 22 ? -1.972  -13.941 2.411  1.00 0.00 ? 123 TYR A HD2  2  
ATOM   854  H  HE1  . TYR A 1 22 ? -6.378  -14.630 4.607  1.00 0.00 ? 123 TYR A HE1  2  
ATOM   855  H  HE2  . TYR A 1 22 ? -3.773  -12.149 2.317  1.00 0.00 ? 123 TYR A HE2  2  
ATOM   856  H  HH   . TYR A 1 22 ? -6.475  -12.305 2.480  1.00 0.00 ? 123 TYR A HH   2  
ATOM   857  N  N    . ARG A 1 23 ? -0.932  -18.972 4.998  1.00 0.00 ? 124 ARG A N    2  
ATOM   858  C  CA   . ARG A 1 23 ? -1.072  -20.392 5.271  1.00 0.00 ? 124 ARG A CA   2  
ATOM   859  C  C    . ARG A 1 23 ? -1.081  -20.645 6.780  1.00 0.00 ? 124 ARG A C    2  
ATOM   860  O  O    . ARG A 1 23 ? -1.594  -21.664 7.239  1.00 0.00 ? 124 ARG A O    2  
ATOM   861  C  CB   . ARG A 1 23 ? 0.068   -21.190 4.634  1.00 0.00 ? 124 ARG A CB   2  
ATOM   862  C  CG   . ARG A 1 23 ? 0.480   -22.365 5.525  1.00 0.00 ? 124 ARG A CG   2  
ATOM   863  C  CD   . ARG A 1 23 ? 1.542   -21.936 6.538  1.00 0.00 ? 124 ARG A CD   2  
ATOM   864  N  NE   . ARG A 1 23 ? 2.823   -21.670 5.847  1.00 0.00 ? 124 ARG A NE   2  
ATOM   865  C  CZ   . ARG A 1 23 ? 3.950   -21.296 6.469  1.00 0.00 ? 124 ARG A CZ   2  
ATOM   866  N  NH1  . ARG A 1 23 ? 4.021   -21.338 7.806  1.00 0.00 ? 124 ARG A NH1  2  
ATOM   867  N  NH2  . ARG A 1 23 ? 5.005   -20.882 5.754  1.00 0.00 ? 124 ARG A NH2  2  
ATOM   868  H  H    . ARG A 1 23 ? -0.102  -18.717 4.503  1.00 0.00 ? 124 ARG A H    2  
ATOM   869  H  HA   . ARG A 1 23 ? -2.025  -20.670 4.821  1.00 0.00 ? 124 ARG A HA   2  
ATOM   870  H  HB2  . ARG A 1 23 ? -0.245  -21.561 3.657  1.00 0.00 ? 124 ARG A HB2  2  
ATOM   871  H  HB3  . ARG A 1 23 ? 0.925   -20.537 4.467  1.00 0.00 ? 124 ARG A HB3  2  
ATOM   872  H  HG2  . ARG A 1 23 ? -0.394  -22.752 6.049  1.00 0.00 ? 124 ARG A HG2  2  
ATOM   873  H  HG3  . ARG A 1 23 ? 0.866   -23.175 4.907  1.00 0.00 ? 124 ARG A HG3  2  
ATOM   874  H  HD2  . ARG A 1 23 ? 1.213   -21.043 7.068  1.00 0.00 ? 124 ARG A HD2  2  
ATOM   875  H  HD3  . ARG A 1 23 ? 1.679   -22.718 7.286  1.00 0.00 ? 124 ARG A HD3  2  
ATOM   876  H  HE   . ARG A 1 23 ? 2.850   -21.773 4.853  1.00 0.00 ? 124 ARG A HE   2  
ATOM   877  H  HH11 . ARG A 1 23 ? 3.315   -20.893 8.359  1.00 0.00 ? 124 ARG A HH11 2  
ATOM   878  H  HH12 . ARG A 1 23 ? 4.781   -21.811 8.253  1.00 0.00 ? 124 ARG A HH12 2  
ATOM   879  H  HH21 . ARG A 1 23 ? 4.937   -20.808 4.759  1.00 0.00 ? 124 ARG A HH21 2  
ATOM   880  H  HH22 . ARG A 1 23 ? 5.860   -20.648 6.216  1.00 0.00 ? 124 ARG A HH22 2  
ATOM   881  N  N    . SER A 1 24 ? -0.506  -19.700 7.510  1.00 0.00 ? 125 SER A N    2  
ATOM   882  C  CA   . SER A 1 24 ? -0.441  -19.808 8.957  1.00 0.00 ? 125 SER A CA   2  
ATOM   883  C  C    . SER A 1 24 ? -1.816  -19.525 9.565  1.00 0.00 ? 125 SER A C    2  
ATOM   884  O  O    . SER A 1 24 ? -2.151  -20.054 10.623 1.00 0.00 ? 125 SER A O    2  
ATOM   885  C  CB   . SER A 1 24 ? 0.602   -18.849 9.534  1.00 0.00 ? 125 SER A CB   2  
ATOM   886  O  OG   . SER A 1 24 ? 0.232   -17.485 9.353  1.00 0.00 ? 125 SER A OG   2  
ATOM   887  H  H    . SER A 1 24 ? -0.090  -18.874 7.127  1.00 0.00 ? 125 SER A H    2  
ATOM   888  H  HA   . SER A 1 24 ? -0.138  -20.835 9.156  1.00 0.00 ? 125 SER A HA   2  
ATOM   889  H  HB2  . SER A 1 24 ? 0.731   -19.051 10.597 1.00 0.00 ? 125 SER A HB2  2  
ATOM   890  H  HB3  . SER A 1 24 ? 1.565   -19.030 9.056  1.00 0.00 ? 125 SER A HB3  2  
ATOM   891  H  HG   . SER A 1 24 ? 0.655   -16.918 10.059 1.00 0.00 ? 125 SER A HG   2  
ATOM   892  N  N    . HIS A 1 25 ? -2.575  -18.691 8.869  1.00 0.00 ? 126 HIS A N    2  
ATOM   893  C  CA   . HIS A 1 25 ? -3.907  -18.333 9.327  1.00 0.00 ? 126 HIS A CA   2  
ATOM   894  C  C    . HIS A 1 25 ? -4.876  -19.480 9.037  1.00 0.00 ? 126 HIS A C    2  
ATOM   895  O  O    . HIS A 1 25 ? -5.688  -19.840 9.888  1.00 0.00 ? 126 HIS A O    2  
ATOM   896  C  CB   . HIS A 1 25 ? -4.355  -17.007 8.707  1.00 0.00 ? 126 HIS A CB   2  
ATOM   897  C  CG   . HIS A 1 25 ? -3.589  -15.805 9.207  1.00 0.00 ? 126 HIS A CG   2  
ATOM   898  N  ND1  . HIS A 1 25 ? -3.429  -15.525 10.552 1.00 0.00 ? 126 HIS A ND1  2  
ATOM   899  C  CD2  . HIS A 1 25 ? -2.942  -14.816 8.527  1.00 0.00 ? 126 HIS A CD2  2  
ATOM   900  C  CE1  . HIS A 1 25 ? -2.716  -14.414 10.666 1.00 0.00 ? 126 HIS A CE1  2  
ATOM   901  N  NE2  . HIS A 1 25 ? -2.415  -13.976 9.410  1.00 0.00 ? 126 HIS A NE2  2  
ATOM   902  H  H    . HIS A 1 25 ? -2.296  -18.265 8.009  1.00 0.00 ? 126 HIS A H    2  
ATOM   903  H  HA   . HIS A 1 25 ? -3.838  -18.188 10.405 1.00 0.00 ? 126 HIS A HA   2  
ATOM   904  H  HB2  . HIS A 1 25 ? -4.247  -17.069 7.624  1.00 0.00 ? 126 HIS A HB2  2  
ATOM   905  H  HB3  . HIS A 1 25 ? -5.415  -16.861 8.914  1.00 0.00 ? 126 HIS A HB3  2  
ATOM   906  H  HD1  . HIS A 1 25 ? -3.789  -16.069 11.310 1.00 0.00 ? 126 HIS A HD1  2  
ATOM   907  H  HD2  . HIS A 1 25 ? -2.869  -14.729 7.443  1.00 0.00 ? 126 HIS A HD2  2  
ATOM   908  H  HE1  . HIS A 1 25 ? -2.421  -13.935 11.600 1.00 0.00 ? 126 HIS A HE1  2  
ATOM   909  N  N    . THR A 1 26 ? -4.759  -20.022 7.834  1.00 0.00 ? 127 THR A N    2  
ATOM   910  C  CA   . THR A 1 26 ? -5.615  -21.121 7.422  1.00 0.00 ? 127 THR A CA   2  
ATOM   911  C  C    . THR A 1 26 ? -5.937  -22.023 8.616  1.00 0.00 ? 127 THR A C    2  
ATOM   912  O  O    . THR A 1 26 ? -7.045  -22.548 8.720  1.00 0.00 ? 127 THR A O    2  
ATOM   913  C  CB   . THR A 1 26 ? -4.920  -21.858 6.275  1.00 0.00 ? 127 THR A CB   2  
ATOM   914  O  OG1  . THR A 1 26 ? -4.511  -20.817 5.391  1.00 0.00 ? 127 THR A OG1  2  
ATOM   915  C  CG2  . THR A 1 26 ? -5.893  -22.694 5.441  1.00 0.00 ? 127 THR A CG2  2  
ATOM   916  H  H    . THR A 1 26 ? -4.096  -19.723 7.148  1.00 0.00 ? 127 THR A H    2  
ATOM   917  H  HA   . THR A 1 26 ? -6.560  -20.707 7.070  1.00 0.00 ? 127 THR A HA   2  
ATOM   918  H  HB   . THR A 1 26 ? -4.099  -22.471 6.647  1.00 0.00 ? 127 THR A HB   2  
ATOM   919  H  HG1  . THR A 1 26 ? -4.199  -21.207 4.525  1.00 0.00 ? 127 THR A HG1  2  
ATOM   920  H  HG21 . THR A 1 26 ? -5.924  -23.711 5.832  1.00 0.00 ? 127 THR A HG21 2  
ATOM   921  H  HG22 . THR A 1 26 ? -6.888  -22.253 5.494  1.00 0.00 ? 127 THR A HG22 2  
ATOM   922  H  HG23 . THR A 1 26 ? -5.559  -22.714 4.404  1.00 0.00 ? 127 THR A HG23 2  
ATOM   923  N  N    . ASN A 1 27 ? -4.950  -22.174 9.486  1.00 0.00 ? 128 ASN A N    2  
ATOM   924  C  CA   . ASN A 1 27 ? -5.114  -23.002 10.668 1.00 0.00 ? 128 ASN A CA   2  
ATOM   925  C  C    . ASN A 1 27 ? -3.840  -22.939 11.512 1.00 0.00 ? 128 ASN A C    2  
ATOM   926  O  O    . ASN A 1 27 ? -2.837  -23.569 11.178 1.00 0.00 ? 128 ASN A O    2  
ATOM   927  C  CB   . ASN A 1 27 ? -5.356  -24.464 10.287 1.00 0.00 ? 128 ASN A CB   2  
ATOM   928  C  CG   . ASN A 1 27 ? -6.537  -25.046 11.066 1.00 0.00 ? 128 ASN A CG   2  
ATOM   929  O  OD1  . ASN A 1 27 ? -6.408  -25.993 11.826 1.00 0.00 ? 128 ASN A OD1  2  
ATOM   930  N  ND2  . ASN A 1 27 ? -7.693  -24.430 10.837 1.00 0.00 ? 128 ASN A ND2  2  
ATOM   931  H  H    . ASN A 1 27 ? -4.052  -21.743 9.394  1.00 0.00 ? 128 ASN A H    2  
ATOM   932  H  HA   . ASN A 1 27 ? -5.979  -22.592 11.188 1.00 0.00 ? 128 ASN A HA   2  
ATOM   933  H  HB2  . ASN A 1 27 ? -5.550  -24.538 9.217  1.00 0.00 ? 128 ASN A HB2  2  
ATOM   934  H  HB3  . ASN A 1 27 ? -4.459  -25.050 10.488 1.00 0.00 ? 128 ASN A HB3  2  
ATOM   935  H  HD21 . ASN A 1 27 ? -7.932  -24.146 9.908  1.00 0.00 ? 128 ASN A HD21 2  
ATOM   936  H  HD22 . ASN A 1 27 ? -8.323  -24.252 11.592 1.00 0.00 ? 128 ASN A HD22 2  
ATOM   937  N  N    . GLU A 1 28 ? -3.919  -22.172 12.589 1.00 0.00 ? 129 GLU A N    2  
ATOM   938  C  CA   . GLU A 1 28 ? -2.784  -22.018 13.484 1.00 0.00 ? 129 GLU A CA   2  
ATOM   939  C  C    . GLU A 1 28 ? -2.415  -23.363 14.111 1.00 0.00 ? 129 GLU A C    2  
ATOM   940  O  O    . GLU A 1 28 ? -2.793  -23.647 15.247 1.00 0.00 ? 129 GLU A O    2  
ATOM   941  C  CB   . GLU A 1 28 ? -3.074  -20.971 14.561 1.00 0.00 ? 129 GLU A CB   2  
ATOM   942  C  CG   . GLU A 1 28 ? -2.846  -19.556 14.027 1.00 0.00 ? 129 GLU A CG   2  
ATOM   943  C  CD   . GLU A 1 28 ? -4.140  -18.970 13.458 1.00 0.00 ? 129 GLU A CD   2  
ATOM   944  O  OE1  . GLU A 1 28 ? -4.677  -19.591 12.515 1.00 0.00 ? 129 GLU A OE1  2  
ATOM   945  O  OE2  . GLU A 1 28 ? -4.562  -17.915 13.977 1.00 0.00 ? 129 GLU A OE2  2  
ATOM   946  H  H    . GLU A 1 28 ? -4.738  -21.663 12.854 1.00 0.00 ? 129 GLU A H    2  
ATOM   947  H  HA   . GLU A 1 28 ? -1.966  -21.666 12.855 1.00 0.00 ? 129 GLU A HA   2  
ATOM   948  H  HB2  . GLU A 1 28 ? -4.103  -21.073 14.905 1.00 0.00 ? 129 GLU A HB2  2  
ATOM   949  H  HB3  . GLU A 1 28 ? -2.431  -21.146 15.424 1.00 0.00 ? 129 GLU A HB3  2  
ATOM   950  H  HG2  . GLU A 1 28 ? -2.475  -18.916 14.827 1.00 0.00 ? 129 GLU A HG2  2  
ATOM   951  H  HG3  . GLU A 1 28 ? -2.079  -19.574 13.253 1.00 0.00 ? 129 GLU A HG3  2  
ATOM   952  N  N    . LYS A 1 29 ? -1.683  -24.157 13.343 1.00 0.00 ? 130 LYS A N    2  
ATOM   953  C  CA   . LYS A 1 29 ? -1.260  -25.467 13.810 1.00 0.00 ? 130 LYS A CA   2  
ATOM   954  C  C    . LYS A 1 29 ? -0.235  -26.045 12.831 1.00 0.00 ? 130 LYS A C    2  
ATOM   955  O  O    . LYS A 1 29 ? 0.009   -27.250 12.823 1.00 0.00 ? 130 LYS A O    2  
ATOM   956  C  CB   . LYS A 1 29 ? -2.471  -26.372 14.038 1.00 0.00 ? 130 LYS A CB   2  
ATOM   957  C  CG   . LYS A 1 29 ? -3.358  -26.425 12.792 1.00 0.00 ? 130 LYS A CG   2  
ATOM   958  C  CD   . LYS A 1 29 ? -2.969  -27.600 11.891 1.00 0.00 ? 130 LYS A CD   2  
ATOM   959  C  CE   . LYS A 1 29 ? -4.125  -28.591 11.753 1.00 0.00 ? 130 LYS A CE   2  
ATOM   960  N  NZ   . LYS A 1 29 ? -4.070  -29.606 12.829 1.00 0.00 ? 130 LYS A NZ   2  
ATOM   961  H  H    . LYS A 1 29 ? -1.380  -23.919 12.420 1.00 0.00 ? 130 LYS A H    2  
ATOM   962  H  HA   . LYS A 1 29 ? -0.774  -25.328 14.777 1.00 0.00 ? 130 LYS A HA   2  
ATOM   963  H  HB2  . LYS A 1 29 ? -2.136  -27.377 14.293 1.00 0.00 ? 130 LYS A HB2  2  
ATOM   964  H  HB3  . LYS A 1 29 ? -3.050  -26.005 14.885 1.00 0.00 ? 130 LYS A HB3  2  
ATOM   965  H  HG2  . LYS A 1 29 ? -4.403  -26.520 13.089 1.00 0.00 ? 130 LYS A HG2  2  
ATOM   966  H  HG3  . LYS A 1 29 ? -3.268  -25.491 12.237 1.00 0.00 ? 130 LYS A HG3  2  
ATOM   967  H  HD2  . LYS A 1 29 ? -2.683  -27.228 10.907 1.00 0.00 ? 130 LYS A HD2  2  
ATOM   968  H  HD3  . LYS A 1 29 ? -2.098  -28.107 12.305 1.00 0.00 ? 130 LYS A HD3  2  
ATOM   969  H  HE2  . LYS A 1 29 ? -5.076  -28.059 11.795 1.00 0.00 ? 130 LYS A HE2  2  
ATOM   970  H  HE3  . LYS A 1 29 ? -4.078  -29.081 10.780 1.00 0.00 ? 130 LYS A HE3  2  
ATOM   971  H  HZ1  . LYS A 1 29 ? -4.527  -30.441 12.523 1.00 0.00 ? 130 LYS A HZ1  2  
ATOM   972  H  HZ2  . LYS A 1 29 ? -3.115  -29.809 13.047 1.00 0.00 ? 130 LYS A HZ2  2  
ATOM   973  H  HZ3  . LYS A 1 29 ? -4.530  -29.253 13.644 1.00 0.00 ? 130 LYS A HZ3  2  
HETATM 974  ZN ZN   . ZN  B 2 .  ? -1.380  -12.331 8.972  1.00 0.00 ? 1   ZN  A ZN   2  
ATOM   975  N  N    . ARG A 1 1  ? 2.103   -1.962  -5.853 1.00 0.00 ? 102 ARG A N    3  
ATOM   976  C  CA   . ARG A 1 1  ? 1.496   -1.878  -4.536 1.00 0.00 ? 102 ARG A CA   3  
ATOM   977  C  C    . ARG A 1 1  ? 2.367   -2.597  -3.503 1.00 0.00 ? 102 ARG A C    3  
ATOM   978  O  O    . ARG A 1 1  ? 3.492   -2.994  -3.802 1.00 0.00 ? 102 ARG A O    3  
ATOM   979  C  CB   . ARG A 1 1  ? 0.097   -2.498  -4.534 1.00 0.00 ? 102 ARG A CB   3  
ATOM   980  C  CG   . ARG A 1 1  ? -0.875  -1.654  -3.706 1.00 0.00 ? 102 ARG A CG   3  
ATOM   981  C  CD   . ARG A 1 1  ? -2.251  -1.589  -4.375 1.00 0.00 ? 102 ARG A CD   3  
ATOM   982  N  NE   . ARG A 1 1  ? -3.120  -0.635  -3.650 1.00 0.00 ? 102 ARG A NE   3  
ATOM   983  C  CZ   . ARG A 1 1  ? -2.693  0.521   -3.125 1.00 0.00 ? 102 ARG A CZ   3  
ATOM   984  N  NH1  . ARG A 1 1  ? -2.031  0.523   -1.959 1.00 0.00 ? 102 ARG A NH1  3  
ATOM   985  N  NH2  . ARG A 1 1  ? -2.929  1.674   -3.764 1.00 0.00 ? 102 ARG A NH2  3  
ATOM   986  H  H    . ARG A 1 1  ? 2.994   -2.416  -5.879 1.00 0.00 ? 102 ARG A H    3  
ATOM   987  H  HA   . ARG A 1 1  ? 1.436   -0.811  -4.324 1.00 0.00 ? 102 ARG A HA   3  
ATOM   988  H  HB2  . ARG A 1 1  ? -0.269  -2.582  -5.557 1.00 0.00 ? 102 ARG A HB2  3  
ATOM   989  H  HB3  . ARG A 1 1  ? 0.144   -3.508  -4.127 1.00 0.00 ? 102 ARG A HB3  3  
ATOM   990  H  HG2  . ARG A 1 1  ? -0.972  -2.079  -2.708 1.00 0.00 ? 102 ARG A HG2  3  
ATOM   991  H  HG3  . ARG A 1 1  ? -0.477  -0.646  -3.586 1.00 0.00 ? 102 ARG A HG3  3  
ATOM   992  H  HD2  . ARG A 1 1  ? -2.143  -1.279  -5.414 1.00 0.00 ? 102 ARG A HD2  3  
ATOM   993  H  HD3  . ARG A 1 1  ? -2.708  -2.578  -4.383 1.00 0.00 ? 102 ARG A HD3  3  
ATOM   994  H  HE   . ARG A 1 1  ? -4.086  -0.869  -3.546 1.00 0.00 ? 102 ARG A HE   3  
ATOM   995  H  HH11 . ARG A 1 1  ? -2.485  0.210   -1.125 1.00 0.00 ? 102 ARG A HH11 3  
ATOM   996  H  HH12 . ARG A 1 1  ? -1.083  0.839   -1.924 1.00 0.00 ? 102 ARG A HH12 3  
ATOM   997  H  HH21 . ARG A 1 1  ? -3.224  1.666   -4.719 1.00 0.00 ? 102 ARG A HH21 3  
ATOM   998  H  HH22 . ARG A 1 1  ? -2.810  2.545   -3.285 1.00 0.00 ? 102 ARG A HH22 3  
ATOM   999  N  N    . SER A 1 2  ? 1.812   -2.743  -2.308 1.00 0.00 ? 103 SER A N    3  
ATOM   1000 C  CA   . SER A 1 2  ? 2.524   -3.408  -1.229 1.00 0.00 ? 103 SER A CA   3  
ATOM   1001 C  C    . SER A 1 2  ? 1.798   -4.697  -0.840 1.00 0.00 ? 103 SER A C    3  
ATOM   1002 O  O    . SER A 1 2  ? 0.626   -4.877  -1.165 1.00 0.00 ? 103 SER A O    3  
ATOM   1003 C  CB   . SER A 1 2  ? 2.664   -2.489  -0.014 1.00 0.00 ? 103 SER A CB   3  
ATOM   1004 O  OG   . SER A 1 2  ? 3.784   -1.616  -0.131 1.00 0.00 ? 103 SER A OG   3  
ATOM   1005 H  H    . SER A 1 2  ? 0.896   -2.418  -2.073 1.00 0.00 ? 103 SER A H    3  
ATOM   1006 H  HA   . SER A 1 2  ? 3.512   -3.631  -1.630 1.00 0.00 ? 103 SER A HA   3  
ATOM   1007 H  HB2  . SER A 1 2  ? 1.754   -1.899  0.100  1.00 0.00 ? 103 SER A HB2  3  
ATOM   1008 H  HB3  . SER A 1 2  ? 2.766   -3.093  0.887  1.00 0.00 ? 103 SER A HB3  3  
ATOM   1009 H  HG   . SER A 1 2  ? 3.487   -0.722  -0.469 1.00 0.00 ? 103 SER A HG   3  
ATOM   1010 N  N    . PHE A 1 3  ? 2.526   -5.562  -0.149 1.00 0.00 ? 104 PHE A N    3  
ATOM   1011 C  CA   . PHE A 1 3  ? 1.967   -6.830  0.288  1.00 0.00 ? 104 PHE A CA   3  
ATOM   1012 C  C    . PHE A 1 3  ? 1.619   -6.791  1.778  1.00 0.00 ? 104 PHE A C    3  
ATOM   1013 O  O    . PHE A 1 3  ? 2.500   -6.635  2.621  1.00 0.00 ? 104 PHE A O    3  
ATOM   1014 C  CB   . PHE A 1 3  ? 3.039   -7.896  0.055  1.00 0.00 ? 104 PHE A CB   3  
ATOM   1015 C  CG   . PHE A 1 3  ? 3.673   -7.846  -1.336 1.00 0.00 ? 104 PHE A CG   3  
ATOM   1016 C  CD1  . PHE A 1 3  ? 2.978   -8.292  -2.418 1.00 0.00 ? 104 PHE A CD1  3  
ATOM   1017 C  CD2  . PHE A 1 3  ? 4.932   -7.356  -1.492 1.00 0.00 ? 104 PHE A CD2  3  
ATOM   1018 C  CE1  . PHE A 1 3  ? 3.568   -8.246  -3.708 1.00 0.00 ? 104 PHE A CE1  3  
ATOM   1019 C  CE2  . PHE A 1 3  ? 5.521   -7.309  -2.783 1.00 0.00 ? 104 PHE A CE2  3  
ATOM   1020 C  CZ   . PHE A 1 3  ? 4.827   -7.755  -3.863 1.00 0.00 ? 104 PHE A CZ   3  
ATOM   1021 H  H    . PHE A 1 3  ? 3.479   -5.409  0.111  1.00 0.00 ? 104 PHE A H    3  
ATOM   1022 H  HA   . PHE A 1 3  ? 1.059   -6.999  -0.291 1.00 0.00 ? 104 PHE A HA   3  
ATOM   1023 H  HB2  . PHE A 1 3  ? 3.821   -7.780  0.805  1.00 0.00 ? 104 PHE A HB2  3  
ATOM   1024 H  HB3  . PHE A 1 3  ? 2.595   -8.881  0.206  1.00 0.00 ? 104 PHE A HB3  3  
ATOM   1025 H  HD1  . PHE A 1 3  ? 1.970   -8.685  -2.292 1.00 0.00 ? 104 PHE A HD1  3  
ATOM   1026 H  HD2  . PHE A 1 3  ? 5.489   -6.999  -0.626 1.00 0.00 ? 104 PHE A HD2  3  
ATOM   1027 H  HE1  . PHE A 1 3  ? 3.011   -8.602  -4.575 1.00 0.00 ? 104 PHE A HE1  3  
ATOM   1028 H  HE2  . PHE A 1 3  ? 6.530   -6.917  -2.908 1.00 0.00 ? 104 PHE A HE2  3  
ATOM   1029 H  HZ   . PHE A 1 3  ? 5.279   -7.720  -4.855 1.00 0.00 ? 104 PHE A HZ   3  
ATOM   1030 N  N    . VAL A 1 4  ? 0.331   -6.935  2.056  1.00 0.00 ? 105 VAL A N    3  
ATOM   1031 C  CA   . VAL A 1 4  ? -0.144  -6.919  3.430  1.00 0.00 ? 105 VAL A CA   3  
ATOM   1032 C  C    . VAL A 1 4  ? -1.140  -8.062  3.633  1.00 0.00 ? 105 VAL A C    3  
ATOM   1033 O  O    . VAL A 1 4  ? -1.836  -8.459  2.700  1.00 0.00 ? 105 VAL A O    3  
ATOM   1034 C  CB   . VAL A 1 4  ? -0.733  -5.546  3.762  1.00 0.00 ? 105 VAL A CB   3  
ATOM   1035 C  CG1  . VAL A 1 4  ? -1.335  -5.535  5.169  1.00 0.00 ? 105 VAL A CG1  3  
ATOM   1036 C  CG2  . VAL A 1 4  ? 0.320   -4.447  3.609  1.00 0.00 ? 105 VAL A CG2  3  
ATOM   1037 H  H    . VAL A 1 4  ? -0.379  -7.061  1.365  1.00 0.00 ? 105 VAL A H    3  
ATOM   1038 H  HA   . VAL A 1 4  ? 0.717   -7.083  4.078  1.00 0.00 ? 105 VAL A HA   3  
ATOM   1039 H  HB   . VAL A 1 4  ? -1.535  -5.344  3.053  1.00 0.00 ? 105 VAL A HB   3  
ATOM   1040 H  HG11 . VAL A 1 4  ? -1.933  -6.435  5.315  1.00 0.00 ? 105 VAL A HG11 3  
ATOM   1041 H  HG12 . VAL A 1 4  ? -0.534  -5.507  5.908  1.00 0.00 ? 105 VAL A HG12 3  
ATOM   1042 H  HG13 . VAL A 1 4  ? -1.968  -4.656  5.286  1.00 0.00 ? 105 VAL A HG13 3  
ATOM   1043 H  HG21 . VAL A 1 4  ? -0.016  -3.723  2.865  1.00 0.00 ? 105 VAL A HG21 3  
ATOM   1044 H  HG22 . VAL A 1 4  ? 0.462   -3.943  4.565  1.00 0.00 ? 105 VAL A HG22 3  
ATOM   1045 H  HG23 . VAL A 1 4  ? 1.263   -4.888  3.285  1.00 0.00 ? 105 VAL A HG23 3  
ATOM   1046 N  N    . CYS A 1 5  ? -1.177  -8.560  4.861  1.00 0.00 ? 106 CYS A N    3  
ATOM   1047 C  CA   . CYS A 1 5  ? -2.077  -9.650  5.200  1.00 0.00 ? 106 CYS A CA   3  
ATOM   1048 C  C    . CYS A 1 5  ? -3.401  -9.049  5.674  1.00 0.00 ? 106 CYS A C    3  
ATOM   1049 O  O    . CYS A 1 5  ? -3.432  -8.291  6.642  1.00 0.00 ? 106 CYS A O    3  
ATOM   1050 C  CB   . CYS A 1 5  ? -1.465  -10.583 6.247  1.00 0.00 ? 106 CYS A CB   3  
ATOM   1051 S  SG   . CYS A 1 5  ? -2.611  -11.966 6.598  1.00 0.00 ? 106 CYS A SG   3  
ATOM   1052 H  H    . CYS A 1 5  ? -0.608  -8.232  5.614  1.00 0.00 ? 106 CYS A H    3  
ATOM   1053 H  HA   . CYS A 1 5  ? -2.219  -10.232 4.290  1.00 0.00 ? 106 CYS A HA   3  
ATOM   1054 H  HB2  . CYS A 1 5  ? -0.512  -10.971 5.888  1.00 0.00 ? 106 CYS A HB2  3  
ATOM   1055 H  HB3  . CYS A 1 5  ? -1.258  -10.029 7.163  1.00 0.00 ? 106 CYS A HB3  3  
ATOM   1056 N  N    . GLU A 1 6  ? -4.463  -9.412  4.971  1.00 0.00 ? 107 GLU A N    3  
ATOM   1057 C  CA   . GLU A 1 6  ? -5.788  -8.919  5.308  1.00 0.00 ? 107 GLU A CA   3  
ATOM   1058 C  C    . GLU A 1 6  ? -6.296  -9.591  6.585  1.00 0.00 ? 107 GLU A C    3  
ATOM   1059 O  O    . GLU A 1 6  ? -7.341  -9.217  7.114  1.00 0.00 ? 107 GLU A O    3  
ATOM   1060 C  CB   . GLU A 1 6  ? -6.765  -9.134  4.150  1.00 0.00 ? 107 GLU A CB   3  
ATOM   1061 C  CG   . GLU A 1 6  ? -6.086  -8.872  2.804  1.00 0.00 ? 107 GLU A CG   3  
ATOM   1062 C  CD   . GLU A 1 6  ? -5.933  -10.169 2.005  1.00 0.00 ? 107 GLU A CD   3  
ATOM   1063 O  OE1  . GLU A 1 6  ? -6.916  -10.941 1.986  1.00 0.00 ? 107 GLU A OE1  3  
ATOM   1064 O  OE2  . GLU A 1 6  ? -4.839  -10.358 1.432  1.00 0.00 ? 107 GLU A OE2  3  
ATOM   1065 H  H    . GLU A 1 6  ? -4.430  -10.030 4.185  1.00 0.00 ? 107 GLU A H    3  
ATOM   1066 H  HA   . GLU A 1 6  ? -5.665  -7.849  5.477  1.00 0.00 ? 107 GLU A HA   3  
ATOM   1067 H  HB2  . GLU A 1 6  ? -7.147  -10.154 4.176  1.00 0.00 ? 107 GLU A HB2  3  
ATOM   1068 H  HB3  . GLU A 1 6  ? -7.621  -8.470  4.263  1.00 0.00 ? 107 GLU A HB3  3  
ATOM   1069 H  HG2  . GLU A 1 6  ? -6.671  -8.154  2.230  1.00 0.00 ? 107 GLU A HG2  3  
ATOM   1070 H  HG3  . GLU A 1 6  ? -5.104  -8.425  2.968  1.00 0.00 ? 107 GLU A HG3  3  
ATOM   1071 N  N    . VAL A 1 7  ? -5.532  -10.572 7.043  1.00 0.00 ? 108 VAL A N    3  
ATOM   1072 C  CA   . VAL A 1 7  ? -5.891  -11.300 8.248  1.00 0.00 ? 108 VAL A CA   3  
ATOM   1073 C  C    . VAL A 1 7  ? -5.363  -10.547 9.470  1.00 0.00 ? 108 VAL A C    3  
ATOM   1074 O  O    . VAL A 1 7  ? -6.140  -9.998  10.250 1.00 0.00 ? 108 VAL A O    3  
ATOM   1075 C  CB   . VAL A 1 7  ? -5.377  -12.738 8.164  1.00 0.00 ? 108 VAL A CB   3  
ATOM   1076 C  CG1  . VAL A 1 7  ? -5.376  -13.403 9.541  1.00 0.00 ? 108 VAL A CG1  3  
ATOM   1077 C  CG2  . VAL A 1 7  ? -6.196  -13.555 7.161  1.00 0.00 ? 108 VAL A CG2  3  
ATOM   1078 H  H    . VAL A 1 7  ? -4.684  -10.871 6.606  1.00 0.00 ? 108 VAL A H    3  
ATOM   1079 H  HA   . VAL A 1 7  ? -6.979  -11.334 8.300  1.00 0.00 ? 108 VAL A HA   3  
ATOM   1080 H  HB   . VAL A 1 7  ? -4.348  -12.706 7.807  1.00 0.00 ? 108 VAL A HB   3  
ATOM   1081 H  HG11 . VAL A 1 7  ? -5.357  -14.486 9.423  1.00 0.00 ? 108 VAL A HG11 3  
ATOM   1082 H  HG12 . VAL A 1 7  ? -4.495  -13.083 10.098 1.00 0.00 ? 108 VAL A HG12 3  
ATOM   1083 H  HG13 . VAL A 1 7  ? -6.274  -13.112 10.086 1.00 0.00 ? 108 VAL A HG13 3  
ATOM   1084 H  HG21 . VAL A 1 7  ? -5.799  -13.404 6.158  1.00 0.00 ? 108 VAL A HG21 3  
ATOM   1085 H  HG22 . VAL A 1 7  ? -6.137  -14.613 7.421  1.00 0.00 ? 108 VAL A HG22 3  
ATOM   1086 H  HG23 . VAL A 1 7  ? -7.237  -13.232 7.193  1.00 0.00 ? 108 VAL A HG23 3  
ATOM   1087 N  N    . CYS A 1 8  ? -4.043  -10.546 9.600  1.00 0.00 ? 109 CYS A N    3  
ATOM   1088 C  CA   . CYS A 1 8  ? -3.402  -9.870  10.713 1.00 0.00 ? 109 CYS A CA   3  
ATOM   1089 C  C    . CYS A 1 8  ? -3.067  -8.441  10.280 1.00 0.00 ? 109 CYS A C    3  
ATOM   1090 O  O    . CYS A 1 8  ? -3.517  -7.479  10.900 1.00 0.00 ? 109 CYS A O    3  
ATOM   1091 C  CB   . CYS A 1 8  ? -2.162  -10.626 11.196 1.00 0.00 ? 109 CYS A CB   3  
ATOM   1092 S  SG   . CYS A 1 8  ? -0.894  -10.654 9.876  1.00 0.00 ? 109 CYS A SG   3  
ATOM   1093 H  H    . CYS A 1 8  ? -3.419  -10.996 8.961  1.00 0.00 ? 109 CYS A H    3  
ATOM   1094 H  HA   . CYS A 1 8  ? -4.119  -9.868  11.535 1.00 0.00 ? 109 CYS A HA   3  
ATOM   1095 H  HB2  . CYS A 1 8  ? -1.758  -10.148 12.089 1.00 0.00 ? 109 CYS A HB2  3  
ATOM   1096 H  HB3  . CYS A 1 8  ? -2.432  -11.645 11.473 1.00 0.00 ? 109 CYS A HB3  3  
ATOM   1097 N  N    . THR A 1 9  ? -2.279  -8.349  9.219  1.00 0.00 ? 110 THR A N    3  
ATOM   1098 C  CA   . THR A 1 9  ? -1.878  -7.054  8.695  1.00 0.00 ? 110 THR A CA   3  
ATOM   1099 C  C    . THR A 1 9  ? -0.359  -6.995  8.522  1.00 0.00 ? 110 THR A C    3  
ATOM   1100 O  O    . THR A 1 9  ? 0.221   -5.912  8.464  1.00 0.00 ? 110 THR A O    3  
ATOM   1101 C  CB   . THR A 1 9  ? -2.426  -5.975  9.633  1.00 0.00 ? 110 THR A CB   3  
ATOM   1102 O  OG1  . THR A 1 9  ? -1.897  -4.760  9.108  1.00 0.00 ? 110 THR A OG1  3  
ATOM   1103 C  CG2  . THR A 1 9  ? -1.830  -6.064  11.039 1.00 0.00 ? 110 THR A CG2  3  
ATOM   1104 H  H    . THR A 1 9  ? -1.916  -9.136  8.721  1.00 0.00 ? 110 THR A H    3  
ATOM   1105 H  HA   . THR A 1 9  ? -2.318  -6.933  7.705  1.00 0.00 ? 110 THR A HA   3  
ATOM   1106 H  HB   . THR A 1 9  ? -3.514  -6.006  9.669  1.00 0.00 ? 110 THR A HB   3  
ATOM   1107 H  HG1  . THR A 1 9  ? -2.058  -4.011  9.752  1.00 0.00 ? 110 THR A HG1  3  
ATOM   1108 H  HG21 . THR A 1 9  ? -2.601  -5.843  11.775 1.00 0.00 ? 110 THR A HG21 3  
ATOM   1109 H  HG22 . THR A 1 9  ? -1.444  -7.070  11.208 1.00 0.00 ? 110 THR A HG22 3  
ATOM   1110 H  HG23 . THR A 1 9  ? -1.017  -5.343  11.136 1.00 0.00 ? 110 THR A HG23 3  
ATOM   1111 N  N    . ARG A 1 10 ? 0.241   -8.174  8.445  1.00 0.00 ? 111 ARG A N    3  
ATOM   1112 C  CA   . ARG A 1 10 ? 1.681   -8.270  8.280  1.00 0.00 ? 111 ARG A CA   3  
ATOM   1113 C  C    . ARG A 1 10 ? 2.073   -7.952  6.835  1.00 0.00 ? 111 ARG A C    3  
ATOM   1114 O  O    . ARG A 1 10 ? 1.529   -8.536  5.899  1.00 0.00 ? 111 ARG A O    3  
ATOM   1115 C  CB   . ARG A 1 10 ? 2.185   -9.669  8.642  1.00 0.00 ? 111 ARG A CB   3  
ATOM   1116 C  CG   . ARG A 1 10 ? 2.304   -9.833  10.158 1.00 0.00 ? 111 ARG A CG   3  
ATOM   1117 C  CD   . ARG A 1 10 ? 3.709   -10.293 10.551 1.00 0.00 ? 111 ARG A CD   3  
ATOM   1118 N  NE   . ARG A 1 10 ? 4.247   -9.421  11.619 1.00 0.00 ? 111 ARG A NE   3  
ATOM   1119 C  CZ   . ARG A 1 10 ? 5.458   -9.571  12.173 1.00 0.00 ? 111 ARG A CZ   3  
ATOM   1120 N  NH1  . ARG A 1 10 ? 6.336   -10.431 11.642 1.00 0.00 ? 111 ARG A NH1  3  
ATOM   1121 N  NH2  . ARG A 1 10 ? 5.790   -8.858  13.258 1.00 0.00 ? 111 ARG A NH2  3  
ATOM   1122 H  H    . ARG A 1 10 ? -0.238  -9.050  8.493  1.00 0.00 ? 111 ARG A H    3  
ATOM   1123 H  HA   . ARG A 1 10 ? 2.092   -7.531  8.969  1.00 0.00 ? 111 ARG A HA   3  
ATOM   1124 H  HB2  . ARG A 1 10 ? 1.502   -10.419 8.243  1.00 0.00 ? 111 ARG A HB2  3  
ATOM   1125 H  HB3  . ARG A 1 10 ? 3.156   -9.841  8.176  1.00 0.00 ? 111 ARG A HB3  3  
ATOM   1126 H  HG2  . ARG A 1 10 ? 2.076   -8.888  10.649 1.00 0.00 ? 111 ARG A HG2  3  
ATOM   1127 H  HG3  . ARG A 1 10 ? 1.569   -10.559 10.507 1.00 0.00 ? 111 ARG A HG3  3  
ATOM   1128 H  HD2  . ARG A 1 10 ? 3.680   -11.326 10.895 1.00 0.00 ? 111 ARG A HD2  3  
ATOM   1129 H  HD3  . ARG A 1 10 ? 4.366   -10.265 9.682  1.00 0.00 ? 111 ARG A HD3  3  
ATOM   1130 H  HE   . ARG A 1 10 ? 3.670   -8.672  11.947 1.00 0.00 ? 111 ARG A HE   3  
ATOM   1131 H  HH11 . ARG A 1 10 ? 6.019   -11.304 11.271 1.00 0.00 ? 111 ARG A HH11 3  
ATOM   1132 H  HH12 . ARG A 1 10 ? 7.308   -10.202 11.616 1.00 0.00 ? 111 ARG A HH12 3  
ATOM   1133 H  HH21 . ARG A 1 10 ? 5.077   -8.429  13.812 1.00 0.00 ? 111 ARG A HH21 3  
ATOM   1134 H  HH22 . ARG A 1 10 ? 6.752   -8.756  13.514 1.00 0.00 ? 111 ARG A HH22 3  
ATOM   1135 N  N    . ALA A 1 11 ? 3.012   -7.028  6.699  1.00 0.00 ? 112 ALA A N    3  
ATOM   1136 C  CA   . ALA A 1 11 ? 3.483   -6.627  5.385  1.00 0.00 ? 112 ALA A CA   3  
ATOM   1137 C  C    . ALA A 1 11 ? 4.783   -7.365  5.065  1.00 0.00 ? 112 ALA A C    3  
ATOM   1138 O  O    . ALA A 1 11 ? 5.585   -7.634  5.959  1.00 0.00 ? 112 ALA A O    3  
ATOM   1139 C  CB   . ALA A 1 11 ? 3.651   -5.106  5.345  1.00 0.00 ? 112 ALA A CB   3  
ATOM   1140 H  H    . ALA A 1 11 ? 3.450   -6.559  7.466  1.00 0.00 ? 112 ALA A H    3  
ATOM   1141 H  HA   . ALA A 1 11 ? 2.723   -6.915  4.658  1.00 0.00 ? 112 ALA A HA   3  
ATOM   1142 H  HB1  . ALA A 1 11 ? 3.317   -4.729  4.378  1.00 0.00 ? 112 ALA A HB1  3  
ATOM   1143 H  HB2  . ALA A 1 11 ? 3.054   -4.654  6.137  1.00 0.00 ? 112 ALA A HB2  3  
ATOM   1144 H  HB3  . ALA A 1 11 ? 4.700   -4.853  5.492  1.00 0.00 ? 112 ALA A HB3  3  
ATOM   1145 N  N    . PHE A 1 12 ? 4.954   -7.672  3.787  1.00 0.00 ? 113 PHE A N    3  
ATOM   1146 C  CA   . PHE A 1 12 ? 6.144   -8.375  3.339  1.00 0.00 ? 113 PHE A CA   3  
ATOM   1147 C  C    . PHE A 1 12 ? 6.694   -7.756  2.052  1.00 0.00 ? 113 PHE A C    3  
ATOM   1148 O  O    . PHE A 1 12 ? 6.051   -6.899  1.447  1.00 0.00 ? 113 PHE A O    3  
ATOM   1149 C  CB   . PHE A 1 12 ? 5.731   -9.822  3.059  1.00 0.00 ? 113 PHE A CB   3  
ATOM   1150 C  CG   . PHE A 1 12 ? 5.157   -10.551 4.276  1.00 0.00 ? 113 PHE A CG   3  
ATOM   1151 C  CD1  . PHE A 1 12 ? 5.990   -11.188 5.141  1.00 0.00 ? 113 PHE A CD1  3  
ATOM   1152 C  CD2  . PHE A 1 12 ? 3.815   -10.562 4.491  1.00 0.00 ? 113 PHE A CD2  3  
ATOM   1153 C  CE1  . PHE A 1 12 ? 5.458   -11.865 6.270  1.00 0.00 ? 113 PHE A CE1  3  
ATOM   1154 C  CE2  . PHE A 1 12 ? 3.282   -11.238 5.620  1.00 0.00 ? 113 PHE A CE2  3  
ATOM   1155 C  CZ   . PHE A 1 12 ? 4.114   -11.876 6.486  1.00 0.00 ? 113 PHE A CZ   3  
ATOM   1156 H  H    . PHE A 1 12 ? 4.298   -7.450  3.067  1.00 0.00 ? 113 PHE A H    3  
ATOM   1157 H  HA   . PHE A 1 12 ? 6.889   -8.287  4.129  1.00 0.00 ? 113 PHE A HA   3  
ATOM   1158 H  HB2  . PHE A 1 12 ? 4.989   -9.829  2.260  1.00 0.00 ? 113 PHE A HB2  3  
ATOM   1159 H  HB3  . PHE A 1 12 ? 6.598   -10.372 2.694  1.00 0.00 ? 113 PHE A HB3  3  
ATOM   1160 H  HD1  . PHE A 1 12 ? 7.066   -11.179 4.969  1.00 0.00 ? 113 PHE A HD1  3  
ATOM   1161 H  HD2  . PHE A 1 12 ? 3.147   -10.050 3.797  1.00 0.00 ? 113 PHE A HD2  3  
ATOM   1162 H  HE1  . PHE A 1 12 ? 6.125   -12.376 6.965  1.00 0.00 ? 113 PHE A HE1  3  
ATOM   1163 H  HE2  . PHE A 1 12 ? 2.206   -11.247 5.793  1.00 0.00 ? 113 PHE A HE2  3  
ATOM   1164 H  HZ   . PHE A 1 12 ? 3.706   -12.396 7.352  1.00 0.00 ? 113 PHE A HZ   3  
ATOM   1165 N  N    . ALA A 1 13 ? 7.877   -8.214  1.671  1.00 0.00 ? 114 ALA A N    3  
ATOM   1166 C  CA   . ALA A 1 13 ? 8.521   -7.717  0.467  1.00 0.00 ? 114 ALA A CA   3  
ATOM   1167 C  C    . ALA A 1 13 ? 8.180   -8.638  -0.706 1.00 0.00 ? 114 ALA A C    3  
ATOM   1168 O  O    . ALA A 1 13 ? 7.951   -8.171  -1.821 1.00 0.00 ? 114 ALA A O    3  
ATOM   1169 C  CB   . ALA A 1 13 ? 10.029  -7.605  0.702  1.00 0.00 ? 114 ALA A CB   3  
ATOM   1170 H  H    . ALA A 1 13 ? 8.394   -8.911  2.169  1.00 0.00 ? 114 ALA A H    3  
ATOM   1171 H  HA   . ALA A 1 13 ? 8.122   -6.722  0.265  1.00 0.00 ? 114 ALA A HA   3  
ATOM   1172 H  HB1  . ALA A 1 13 ? 10.532  -7.430  -0.248 1.00 0.00 ? 114 ALA A HB1  3  
ATOM   1173 H  HB2  . ALA A 1 13 ? 10.230  -6.774  1.379  1.00 0.00 ? 114 ALA A HB2  3  
ATOM   1174 H  HB3  . ALA A 1 13 ? 10.396  -8.531  1.144  1.00 0.00 ? 114 ALA A HB3  3  
ATOM   1175 N  N    . ARG A 1 14 ? 8.157   -9.931  -0.415 1.00 0.00 ? 115 ARG A N    3  
ATOM   1176 C  CA   . ARG A 1 14 ? 7.848   -10.921 -1.432 1.00 0.00 ? 115 ARG A CA   3  
ATOM   1177 C  C    . ARG A 1 14 ? 6.448   -11.496 -1.204 1.00 0.00 ? 115 ARG A C    3  
ATOM   1178 O  O    . ARG A 1 14 ? 6.148   -11.999 -0.123 1.00 0.00 ? 115 ARG A O    3  
ATOM   1179 C  CB   . ARG A 1 14 ? 8.869   -12.061 -1.418 1.00 0.00 ? 115 ARG A CB   3  
ATOM   1180 C  CG   . ARG A 1 14 ? 10.258  -11.557 -1.812 1.00 0.00 ? 115 ARG A CG   3  
ATOM   1181 C  CD   . ARG A 1 14 ? 10.202  -10.761 -3.117 1.00 0.00 ? 115 ARG A CD   3  
ATOM   1182 N  NE   . ARG A 1 14 ? 10.278  -9.311  -2.828 1.00 0.00 ? 115 ARG A NE   3  
ATOM   1183 C  CZ   . ARG A 1 14 ? 11.423  -8.620  -2.743 1.00 0.00 ? 115 ARG A CZ   3  
ATOM   1184 N  NH1  . ARG A 1 14 ? 12.071  -8.541  -1.573 1.00 0.00 ? 115 ARG A NH1  3  
ATOM   1185 N  NH2  . ARG A 1 14 ? 11.919  -8.009  -3.827 1.00 0.00 ? 115 ARG A NH2  3  
ATOM   1186 H  H    . ARG A 1 14 ? 8.343   -10.302 0.495  1.00 0.00 ? 115 ARG A H    3  
ATOM   1187 H  HA   . ARG A 1 14 ? 7.901   -10.378 -2.375 1.00 0.00 ? 115 ARG A HA   3  
ATOM   1188 H  HB2  . ARG A 1 14 ? 8.908   -12.506 -0.423 1.00 0.00 ? 115 ARG A HB2  3  
ATOM   1189 H  HB3  . ARG A 1 14 ? 8.553   -12.845 -2.105 1.00 0.00 ? 115 ARG A HB3  3  
ATOM   1190 H  HG2  . ARG A 1 14 ? 10.662  -10.931 -1.016 1.00 0.00 ? 115 ARG A HG2  3  
ATOM   1191 H  HG3  . ARG A 1 14 ? 10.937  -12.403 -1.927 1.00 0.00 ? 115 ARG A HG3  3  
ATOM   1192 H  HD2  . ARG A 1 14 ? 11.028  -11.053 -3.767 1.00 0.00 ? 115 ARG A HD2  3  
ATOM   1193 H  HD3  . ARG A 1 14 ? 9.280   -10.986 -3.652 1.00 0.00 ? 115 ARG A HD3  3  
ATOM   1194 H  HE   . ARG A 1 14 ? 9.420   -8.816  -2.688 1.00 0.00 ? 115 ARG A HE   3  
ATOM   1195 H  HH11 . ARG A 1 14 ? 11.960  -9.262  -0.890 1.00 0.00 ? 115 ARG A HH11 3  
ATOM   1196 H  HH12 . ARG A 1 14 ? 12.667  -7.760  -1.384 1.00 0.00 ? 115 ARG A HH12 3  
ATOM   1197 H  HH21 . ARG A 1 14 ? 11.841  -8.442  -4.726 1.00 0.00 ? 115 ARG A HH21 3  
ATOM   1198 H  HH22 . ARG A 1 14 ? 12.367  -7.119  -3.739 1.00 0.00 ? 115 ARG A HH22 3  
ATOM   1199 N  N    . GLN A 1 15 ? 5.630   -11.403 -2.242 1.00 0.00 ? 116 GLN A N    3  
ATOM   1200 C  CA   . GLN A 1 15 ? 4.269   -11.907 -2.170 1.00 0.00 ? 116 GLN A CA   3  
ATOM   1201 C  C    . GLN A 1 15 ? 4.263   -13.341 -1.635 1.00 0.00 ? 116 GLN A C    3  
ATOM   1202 O  O    . GLN A 1 15 ? 3.333   -13.743 -0.938 1.00 0.00 ? 116 GLN A O    3  
ATOM   1203 C  CB   . GLN A 1 15 ? 3.581   -11.827 -3.533 1.00 0.00 ? 116 GLN A CB   3  
ATOM   1204 C  CG   . GLN A 1 15 ? 2.195   -11.191 -3.413 1.00 0.00 ? 116 GLN A CG   3  
ATOM   1205 C  CD   . GLN A 1 15 ? 1.203   -11.853 -4.370 1.00 0.00 ? 116 GLN A CD   3  
ATOM   1206 O  OE1  . GLN A 1 15 ? 1.434   -12.926 -4.902 1.00 0.00 ? 116 GLN A OE1  3  
ATOM   1207 N  NE2  . GLN A 1 15 ? 0.087   -11.155 -4.559 1.00 0.00 ? 116 GLN A NE2  3  
ATOM   1208 H  H    . GLN A 1 15 ? 5.882   -10.992 -3.118 1.00 0.00 ? 116 GLN A H    3  
ATOM   1209 H  HA   . GLN A 1 15 ? 3.753   -11.250 -1.470 1.00 0.00 ? 116 GLN A HA   3  
ATOM   1210 H  HB2  . GLN A 1 15 ? 4.195   -11.244 -4.221 1.00 0.00 ? 116 GLN A HB2  3  
ATOM   1211 H  HB3  . GLN A 1 15 ? 3.491   -12.827 -3.959 1.00 0.00 ? 116 GLN A HB3  3  
ATOM   1212 H  HG2  . GLN A 1 15 ? 1.836   -11.285 -2.387 1.00 0.00 ? 116 GLN A HG2  3  
ATOM   1213 H  HG3  . GLN A 1 15 ? 2.261   -10.125 -3.631 1.00 0.00 ? 116 GLN A HG3  3  
ATOM   1214 H  HE21 . GLN A 1 15 ? -0.445  -10.838 -3.774 1.00 0.00 ? 116 GLN A HE21 3  
ATOM   1215 H  HE22 . GLN A 1 15 ? -0.223  -10.948 -5.488 1.00 0.00 ? 116 GLN A HE22 3  
ATOM   1216 N  N    . GLU A 1 16 ? 5.310   -14.073 -1.983 1.00 0.00 ? 117 GLU A N    3  
ATOM   1217 C  CA   . GLU A 1 16 ? 5.437   -15.454 -1.547 1.00 0.00 ? 117 GLU A CA   3  
ATOM   1218 C  C    . GLU A 1 16 ? 5.485   -15.525 -0.019 1.00 0.00 ? 117 GLU A C    3  
ATOM   1219 O  O    . GLU A 1 16 ? 4.864   -16.398 0.585  1.00 0.00 ? 117 GLU A O    3  
ATOM   1220 C  CB   . GLU A 1 16 ? 6.671   -16.113 -2.166 1.00 0.00 ? 117 GLU A CB   3  
ATOM   1221 C  CG   . GLU A 1 16 ? 7.247   -17.181 -1.235 1.00 0.00 ? 117 GLU A CG   3  
ATOM   1222 C  CD   . GLU A 1 16 ? 7.976   -18.267 -2.029 1.00 0.00 ? 117 GLU A CD   3  
ATOM   1223 O  OE1  . GLU A 1 16 ? 9.009   -17.923 -2.643 1.00 0.00 ? 117 GLU A OE1  3  
ATOM   1224 O  OE2  . GLU A 1 16 ? 7.483   -19.415 -2.005 1.00 0.00 ? 117 GLU A OE2  3  
ATOM   1225 H  H    . GLU A 1 16 ? 6.063   -13.738 -2.551 1.00 0.00 ? 117 GLU A H    3  
ATOM   1226 H  HA   . GLU A 1 16 ? 4.542   -15.956 -1.913 1.00 0.00 ? 117 GLU A HA   3  
ATOM   1227 H  HB2  . GLU A 1 16 ? 6.406   -16.563 -3.122 1.00 0.00 ? 117 GLU A HB2  3  
ATOM   1228 H  HB3  . GLU A 1 16 ? 7.430   -15.356 -2.369 1.00 0.00 ? 117 GLU A HB3  3  
ATOM   1229 H  HG2  . GLU A 1 16 ? 7.936   -16.720 -0.527 1.00 0.00 ? 117 GLU A HG2  3  
ATOM   1230 H  HG3  . GLU A 1 16 ? 6.444   -17.631 -0.650 1.00 0.00 ? 117 GLU A HG3  3  
ATOM   1231 N  N    . ALA A 1 17 ? 6.228   -14.595 0.562  1.00 0.00 ? 118 ALA A N    3  
ATOM   1232 C  CA   . ALA A 1 17 ? 6.365   -14.542 2.008  1.00 0.00 ? 118 ALA A CA   3  
ATOM   1233 C  C    . ALA A 1 17 ? 4.984   -14.351 2.640  1.00 0.00 ? 118 ALA A C    3  
ATOM   1234 O  O    . ALA A 1 17 ? 4.760   -14.752 3.780  1.00 0.00 ? 118 ALA A O    3  
ATOM   1235 C  CB   . ALA A 1 17 ? 7.340   -13.426 2.387  1.00 0.00 ? 118 ALA A CB   3  
ATOM   1236 H  H    . ALA A 1 17 ? 6.729   -13.888 0.064  1.00 0.00 ? 118 ALA A H    3  
ATOM   1237 H  HA   . ALA A 1 17 ? 6.777   -15.495 2.337  1.00 0.00 ? 118 ALA A HA   3  
ATOM   1238 H  HB1  . ALA A 1 17 ? 7.392   -13.342 3.474  1.00 0.00 ? 118 ALA A HB1  3  
ATOM   1239 H  HB2  . ALA A 1 17 ? 8.329   -13.657 1.993  1.00 0.00 ? 118 ALA A HB2  3  
ATOM   1240 H  HB3  . ALA A 1 17 ? 6.993   -12.481 1.967  1.00 0.00 ? 118 ALA A HB3  3  
ATOM   1241 N  N    . LEU A 1 18 ? 4.097   -13.738 1.870  1.00 0.00 ? 119 LEU A N    3  
ATOM   1242 C  CA   . LEU A 1 18 ? 2.744   -13.489 2.341  1.00 0.00 ? 119 LEU A CA   3  
ATOM   1243 C  C    . LEU A 1 18 ? 1.940   -14.790 2.282  1.00 0.00 ? 119 LEU A C    3  
ATOM   1244 O  O    . LEU A 1 18 ? 1.566   -15.339 3.317  1.00 0.00 ? 119 LEU A O    3  
ATOM   1245 C  CB   . LEU A 1 18 ? 2.109   -12.338 1.558  1.00 0.00 ? 119 LEU A CB   3  
ATOM   1246 C  CG   . LEU A 1 18 ? 0.580   -12.278 1.576  1.00 0.00 ? 119 LEU A CG   3  
ATOM   1247 C  CD1  . LEU A 1 18 ? 0.052   -12.186 3.010  1.00 0.00 ? 119 LEU A CD1  3  
ATOM   1248 C  CD2  . LEU A 1 18 ? 0.066   -11.133 0.702  1.00 0.00 ? 119 LEU A CD2  3  
ATOM   1249 H  H    . LEU A 1 18 ? 4.288   -13.415 0.943  1.00 0.00 ? 119 LEU A H    3  
ATOM   1250 H  HA   . LEU A 1 18 ? 2.814   -13.172 3.381  1.00 0.00 ? 119 LEU A HA   3  
ATOM   1251 H  HB2  . LEU A 1 18 ? 2.494   -11.399 1.956  1.00 0.00 ? 119 LEU A HB2  3  
ATOM   1252 H  HB3  . LEU A 1 18 ? 2.438   -12.404 0.522  1.00 0.00 ? 119 LEU A HB3  3  
ATOM   1253 H  HG   . LEU A 1 18 ? 0.197   -13.206 1.151  1.00 0.00 ? 119 LEU A HG   3  
ATOM   1254 H  HD11 . LEU A 1 18 ? -1.032  -12.083 2.992  1.00 0.00 ? 119 LEU A HD11 3  
ATOM   1255 H  HD12 . LEU A 1 18 ? 0.321   -13.091 3.555  1.00 0.00 ? 119 LEU A HD12 3  
ATOM   1256 H  HD13 . LEU A 1 18 ? 0.491   -11.320 3.505  1.00 0.00 ? 119 LEU A HD13 3  
ATOM   1257 H  HD21 . LEU A 1 18 ? 0.889   -10.460 0.463  1.00 0.00 ? 119 LEU A HD21 3  
ATOM   1258 H  HD22 . LEU A 1 18 ? -0.351  -11.539 -0.220 1.00 0.00 ? 119 LEU A HD22 3  
ATOM   1259 H  HD23 . LEU A 1 18 ? -0.708  -10.584 1.240  1.00 0.00 ? 119 LEU A HD23 3  
ATOM   1260 N  N    . LYS A 1 19 ? 1.700   -15.245 1.061  1.00 0.00 ? 120 LYS A N    3  
ATOM   1261 C  CA   . LYS A 1 19 ? 0.948   -16.471 0.854  1.00 0.00 ? 120 LYS A CA   3  
ATOM   1262 C  C    . LYS A 1 19 ? 1.298   -17.471 1.957  1.00 0.00 ? 120 LYS A C    3  
ATOM   1263 O  O    . LYS A 1 19 ? 0.417   -17.950 2.669  1.00 0.00 ? 120 LYS A O    3  
ATOM   1264 C  CB   . LYS A 1 19 ? 1.178   -17.009 -0.560 1.00 0.00 ? 120 LYS A CB   3  
ATOM   1265 C  CG   . LYS A 1 19 ? 0.304   -18.235 -0.829 1.00 0.00 ? 120 LYS A CG   3  
ATOM   1266 C  CD   . LYS A 1 19 ? 0.448   -18.702 -2.279 1.00 0.00 ? 120 LYS A CD   3  
ATOM   1267 C  CE   . LYS A 1 19 ? 0.167   -20.201 -2.401 1.00 0.00 ? 120 LYS A CE   3  
ATOM   1268 N  NZ   . LYS A 1 19 ? 1.179   -20.850 -3.264 1.00 0.00 ? 120 LYS A NZ   3  
ATOM   1269 H  H    . LYS A 1 19 ? 2.009   -14.792 0.225  1.00 0.00 ? 120 LYS A H    3  
ATOM   1270 H  HA   . LYS A 1 19 ? -0.110  -16.222 0.936  1.00 0.00 ? 120 LYS A HA   3  
ATOM   1271 H  HB2  . LYS A 1 19 ? 0.955   -16.230 -1.290 1.00 0.00 ? 120 LYS A HB2  3  
ATOM   1272 H  HB3  . LYS A 1 19 ? 2.229   -17.270 -0.686 1.00 0.00 ? 120 LYS A HB3  3  
ATOM   1273 H  HG2  . LYS A 1 19 ? 0.585   -19.042 -0.153 1.00 0.00 ? 120 LYS A HG2  3  
ATOM   1274 H  HG3  . LYS A 1 19 ? -0.739  -17.994 -0.622 1.00 0.00 ? 120 LYS A HG3  3  
ATOM   1275 H  HD2  . LYS A 1 19 ? -0.243  -18.146 -2.914 1.00 0.00 ? 120 LYS A HD2  3  
ATOM   1276 H  HD3  . LYS A 1 19 ? 1.454   -18.487 -2.636 1.00 0.00 ? 120 LYS A HD3  3  
ATOM   1277 H  HE2  . LYS A 1 19 ? 0.174   -20.660 -1.413 1.00 0.00 ? 120 LYS A HE2  3  
ATOM   1278 H  HE3  . LYS A 1 19 ? -0.829  -20.358 -2.818 1.00 0.00 ? 120 LYS A HE3  3  
ATOM   1279 H  HZ1  . LYS A 1 19 ? 2.015   -20.300 -3.268 1.00 0.00 ? 120 LYS A HZ1  3  
ATOM   1280 H  HZ2  . LYS A 1 19 ? 1.381   -21.763 -2.912 1.00 0.00 ? 120 LYS A HZ2  3  
ATOM   1281 H  HZ3  . LYS A 1 19 ? 0.825   -20.923 -4.196 1.00 0.00 ? 120 LYS A HZ3  3  
ATOM   1282 N  N    . ARG A 1 20 ? 2.588   -17.757 2.065  1.00 0.00 ? 121 ARG A N    3  
ATOM   1283 C  CA   . ARG A 1 20 ? 3.066   -18.692 3.069  1.00 0.00 ? 121 ARG A CA   3  
ATOM   1284 C  C    . ARG A 1 20 ? 2.513   -18.320 4.447  1.00 0.00 ? 121 ARG A C    3  
ATOM   1285 O  O    . ARG A 1 20 ? 1.984   -19.172 5.159  1.00 0.00 ? 121 ARG A O    3  
ATOM   1286 C  CB   . ARG A 1 20 ? 4.594   -18.705 3.127  1.00 0.00 ? 121 ARG A CB   3  
ATOM   1287 C  CG   . ARG A 1 20 ? 5.120   -20.109 3.432  1.00 0.00 ? 121 ARG A CG   3  
ATOM   1288 C  CD   . ARG A 1 20 ? 5.432   -20.870 2.142  1.00 0.00 ? 121 ARG A CD   3  
ATOM   1289 N  NE   . ARG A 1 20 ? 6.517   -21.847 2.381  1.00 0.00 ? 121 ARG A NE   3  
ATOM   1290 C  CZ   . ARG A 1 20 ? 7.160   -22.508 1.409  1.00 0.00 ? 121 ARG A CZ   3  
ATOM   1291 N  NH1  . ARG A 1 20 ? 8.001   -21.853 0.597  1.00 0.00 ? 121 ARG A NH1  3  
ATOM   1292 N  NH2  . ARG A 1 20 ? 6.963   -23.824 1.249  1.00 0.00 ? 121 ARG A NH2  3  
ATOM   1293 H  H    . ARG A 1 20 ? 3.299   -17.363 1.483  1.00 0.00 ? 121 ARG A H    3  
ATOM   1294 H  HA   . ARG A 1 20 ? 2.692   -19.663 2.746  1.00 0.00 ? 121 ARG A HA   3  
ATOM   1295 H  HB2  . ARG A 1 20 ? 5.001   -18.359 2.177  1.00 0.00 ? 121 ARG A HB2  3  
ATOM   1296 H  HB3  . ARG A 1 20 ? 4.939   -18.010 3.892  1.00 0.00 ? 121 ARG A HB3  3  
ATOM   1297 H  HG2  . ARG A 1 20 ? 6.019   -20.039 4.044  1.00 0.00 ? 121 ARG A HG2  3  
ATOM   1298 H  HG3  . ARG A 1 20 ? 4.380   -20.659 4.014  1.00 0.00 ? 121 ARG A HG3  3  
ATOM   1299 H  HD2  . ARG A 1 20 ? 4.538   -21.385 1.789  1.00 0.00 ? 121 ARG A HD2  3  
ATOM   1300 H  HD3  . ARG A 1 20 ? 5.726   -20.171 1.360  1.00 0.00 ? 121 ARG A HD3  3  
ATOM   1301 H  HE   . ARG A 1 20 ? 6.787   -22.027 3.328  1.00 0.00 ? 121 ARG A HE   3  
ATOM   1302 H  HH11 . ARG A 1 20 ? 8.944   -21.685 0.883  1.00 0.00 ? 121 ARG A HH11 3  
ATOM   1303 H  HH12 . ARG A 1 20 ? 7.685   -21.533 -0.296 1.00 0.00 ? 121 ARG A HH12 3  
ATOM   1304 H  HH21 . ARG A 1 20 ? 6.815   -24.408 2.047  1.00 0.00 ? 121 ARG A HH21 3  
ATOM   1305 H  HH22 . ARG A 1 20 ? 6.963   -24.222 0.331  1.00 0.00 ? 121 ARG A HH22 3  
ATOM   1306 N  N    . HIS A 1 21 ? 2.655   -17.046 4.781  1.00 0.00 ? 122 HIS A N    3  
ATOM   1307 C  CA   . HIS A 1 21 ? 2.177   -16.550 6.060  1.00 0.00 ? 122 HIS A CA   3  
ATOM   1308 C  C    . HIS A 1 21 ? 0.698   -16.904 6.228  1.00 0.00 ? 122 HIS A C    3  
ATOM   1309 O  O    . HIS A 1 21 ? 0.293   -17.416 7.271  1.00 0.00 ? 122 HIS A O    3  
ATOM   1310 C  CB   . HIS A 1 21 ? 2.447   -15.050 6.197  1.00 0.00 ? 122 HIS A CB   3  
ATOM   1311 C  CG   . HIS A 1 21 ? 1.578   -14.361 7.223  1.00 0.00 ? 122 HIS A CG   3  
ATOM   1312 N  ND1  . HIS A 1 21 ? 1.976   -14.168 8.534  1.00 0.00 ? 122 HIS A ND1  3  
ATOM   1313 C  CD2  . HIS A 1 21 ? 0.330   -13.822 7.116  1.00 0.00 ? 122 HIS A CD2  3  
ATOM   1314 C  CE1  . HIS A 1 21 ? 1.003   -13.539 9.178  1.00 0.00 ? 122 HIS A CE1  3  
ATOM   1315 N  NE2  . HIS A 1 21 ? -0.016  -13.327 8.298  1.00 0.00 ? 122 HIS A NE2  3  
ATOM   1316 H  H    . HIS A 1 21 ? 3.086   -16.359 4.196  1.00 0.00 ? 122 HIS A H    3  
ATOM   1317 H  HA   . HIS A 1 21 ? 2.753   -17.063 6.830  1.00 0.00 ? 122 HIS A HA   3  
ATOM   1318 H  HB2  . HIS A 1 21 ? 3.493   -14.902 6.464  1.00 0.00 ? 122 HIS A HB2  3  
ATOM   1319 H  HB3  . HIS A 1 21 ? 2.294   -14.574 5.229  1.00 0.00 ? 122 HIS A HB3  3  
ATOM   1320 H  HD1  . HIS A 1 21 ? 2.850   -14.453 8.928  1.00 0.00 ? 122 HIS A HD1  3  
ATOM   1321 H  HD2  . HIS A 1 21 ? -0.280  -13.801 6.213  1.00 0.00 ? 122 HIS A HD2  3  
ATOM   1322 H  HE1  . HIS A 1 21 ? 1.016   -13.246 10.227 1.00 0.00 ? 122 HIS A HE1  3  
ATOM   1323 N  N    . TYR A 1 22 ? -0.068  -16.617 5.186  1.00 0.00 ? 123 TYR A N    3  
ATOM   1324 C  CA   . TYR A 1 22 ? -1.494  -16.899 5.204  1.00 0.00 ? 123 TYR A CA   3  
ATOM   1325 C  C    . TYR A 1 22 ? -1.760  -18.351 5.607  1.00 0.00 ? 123 TYR A C    3  
ATOM   1326 O  O    . TYR A 1 22 ? -2.646  -18.621 6.416  1.00 0.00 ? 123 TYR A O    3  
ATOM   1327 C  CB   . TYR A 1 22 ? -1.984  -16.680 3.772  1.00 0.00 ? 123 TYR A CB   3  
ATOM   1328 C  CG   . TYR A 1 22 ? -3.111  -15.652 3.650  1.00 0.00 ? 123 TYR A CG   3  
ATOM   1329 C  CD1  . TYR A 1 22 ? -4.387  -15.974 4.065  1.00 0.00 ? 123 TYR A CD1  3  
ATOM   1330 C  CD2  . TYR A 1 22 ? -2.850  -14.402 3.125  1.00 0.00 ? 123 TYR A CD2  3  
ATOM   1331 C  CE1  . TYR A 1 22 ? -5.447  -15.005 3.951  1.00 0.00 ? 123 TYR A CE1  3  
ATOM   1332 C  CE2  . TYR A 1 22 ? -3.910  -13.434 3.010  1.00 0.00 ? 123 TYR A CE2  3  
ATOM   1333 C  CZ   . TYR A 1 22 ? -5.156  -13.784 3.429  1.00 0.00 ? 123 TYR A CZ   3  
ATOM   1334 O  OH   . TYR A 1 22 ? -6.157  -12.869 3.320  1.00 0.00 ? 123 TYR A OH   3  
ATOM   1335 H  H    . TYR A 1 22 ? 0.269   -16.200 4.342  1.00 0.00 ? 123 TYR A H    3  
ATOM   1336 H  HA   . TYR A 1 22 ? -1.958  -16.235 5.934  1.00 0.00 ? 123 TYR A HA   3  
ATOM   1337 H  HB2  . TYR A 1 22 ? -1.145  -16.359 3.155  1.00 0.00 ? 123 TYR A HB2  3  
ATOM   1338 H  HB3  . TYR A 1 22 ? -2.330  -17.632 3.369  1.00 0.00 ? 123 TYR A HB3  3  
ATOM   1339 H  HD1  . TYR A 1 22 ? -4.593  -16.960 4.480  1.00 0.00 ? 123 TYR A HD1  3  
ATOM   1340 H  HD2  . TYR A 1 22 ? -1.842  -14.149 2.797  1.00 0.00 ? 123 TYR A HD2  3  
ATOM   1341 H  HE1  . TYR A 1 22 ? -6.459  -15.247 4.275  1.00 0.00 ? 123 TYR A HE1  3  
ATOM   1342 H  HE2  . TYR A 1 22 ? -3.718  -12.444 2.597  1.00 0.00 ? 123 TYR A HE2  3  
ATOM   1343 H  HH   . TYR A 1 22 ? -6.421  -12.542 4.228  1.00 0.00 ? 123 TYR A HH   3  
ATOM   1344 N  N    . ARG A 1 23 ? -0.978  -19.245 5.023  1.00 0.00 ? 124 ARG A N    3  
ATOM   1345 C  CA   . ARG A 1 23 ? -1.118  -20.663 5.311  1.00 0.00 ? 124 ARG A CA   3  
ATOM   1346 C  C    . ARG A 1 23 ? -1.175  -20.895 6.822  1.00 0.00 ? 124 ARG A C    3  
ATOM   1347 O  O    . ARG A 1 23 ? -1.716  -21.900 7.280  1.00 0.00 ? 124 ARG A O    3  
ATOM   1348 C  CB   . ARG A 1 23 ? 0.047   -21.462 4.723  1.00 0.00 ? 124 ARG A CB   3  
ATOM   1349 C  CG   . ARG A 1 23 ? 1.072   -21.813 5.803  1.00 0.00 ? 124 ARG A CG   3  
ATOM   1350 C  CD   . ARG A 1 23 ? 2.275   -22.542 5.201  1.00 0.00 ? 124 ARG A CD   3  
ATOM   1351 N  NE   . ARG A 1 23 ? 1.852   -23.323 4.017  1.00 0.00 ? 124 ARG A NE   3  
ATOM   1352 C  CZ   . ARG A 1 23 ? 2.569   -23.422 2.888  1.00 0.00 ? 124 ARG A CZ   3  
ATOM   1353 N  NH1  . ARG A 1 23 ? 3.901   -23.285 2.925  1.00 0.00 ? 124 ARG A NH1  3  
ATOM   1354 N  NH2  . ARG A 1 23 ? 1.952   -23.657 1.721  1.00 0.00 ? 124 ARG A NH2  3  
ATOM   1355 H  H    . ARG A 1 23 ? -0.260  -19.017 4.366  1.00 0.00 ? 124 ARG A H    3  
ATOM   1356 H  HA   . ARG A 1 23 ? -2.054  -20.953 4.834  1.00 0.00 ? 124 ARG A HA   3  
ATOM   1357 H  HB2  . ARG A 1 23 ? -0.330  -22.377 4.264  1.00 0.00 ? 124 ARG A HB2  3  
ATOM   1358 H  HB3  . ARG A 1 23 ? 0.527   -20.884 3.933  1.00 0.00 ? 124 ARG A HB3  3  
ATOM   1359 H  HG2  . ARG A 1 23 ? 1.406   -20.903 6.301  1.00 0.00 ? 124 ARG A HG2  3  
ATOM   1360 H  HG3  . ARG A 1 23 ? 0.605   -22.440 6.563  1.00 0.00 ? 124 ARG A HG3  3  
ATOM   1361 H  HD2  . ARG A 1 23 ? 3.043   -21.823 4.918  1.00 0.00 ? 124 ARG A HD2  3  
ATOM   1362 H  HD3  . ARG A 1 23 ? 2.718   -23.205 5.945  1.00 0.00 ? 124 ARG A HD3  3  
ATOM   1363 H  HE   . ARG A 1 23 ? 0.978   -23.807 4.061  1.00 0.00 ? 124 ARG A HE   3  
ATOM   1364 H  HH11 . ARG A 1 23 ? 4.311   -22.511 3.410  1.00 0.00 ? 124 ARG A HH11 3  
ATOM   1365 H  HH12 . ARG A 1 23 ? 4.486   -23.955 2.468  1.00 0.00 ? 124 ARG A HH12 3  
ATOM   1366 H  HH21 . ARG A 1 23 ? 1.319   -24.427 1.637  1.00 0.00 ? 124 ARG A HH21 3  
ATOM   1367 H  HH22 . ARG A 1 23 ? 2.125   -23.064 0.936  1.00 0.00 ? 124 ARG A HH22 3  
ATOM   1368 N  N    . SER A 1 24 ? -0.608  -19.948 7.555  1.00 0.00 ? 125 SER A N    3  
ATOM   1369 C  CA   . SER A 1 24 ? -0.587  -20.037 9.005  1.00 0.00 ? 125 SER A CA   3  
ATOM   1370 C  C    . SER A 1 24 ? -2.000  -19.843 9.562  1.00 0.00 ? 125 SER A C    3  
ATOM   1371 O  O    . SER A 1 24 ? -2.428  -20.580 10.449 1.00 0.00 ? 125 SER A O    3  
ATOM   1372 C  CB   . SER A 1 24 ? 0.366   -19.003 9.607  1.00 0.00 ? 125 SER A CB   3  
ATOM   1373 O  OG   . SER A 1 24 ? -0.176  -17.685 9.561  1.00 0.00 ? 125 SER A OG   3  
ATOM   1374 H  H    . SER A 1 24 ? -0.170  -19.134 7.176  1.00 0.00 ? 125 SER A H    3  
ATOM   1375 H  HA   . SER A 1 24 ? -0.222  -21.039 9.229  1.00 0.00 ? 125 SER A HA   3  
ATOM   1376 H  HB2  . SER A 1 24 ? 0.584   -19.268 10.641 1.00 0.00 ? 125 SER A HB2  3  
ATOM   1377 H  HB3  . SER A 1 24 ? 1.312   -19.024 9.066  1.00 0.00 ? 125 SER A HB3  3  
ATOM   1378 H  HG   . SER A 1 24 ? 0.512   -17.021 9.851  1.00 0.00 ? 125 SER A HG   3  
ATOM   1379 N  N    . HIS A 1 25 ? -2.684  -18.849 9.017  1.00 0.00 ? 126 HIS A N    3  
ATOM   1380 C  CA   . HIS A 1 25 ? -4.040  -18.549 9.448  1.00 0.00 ? 126 HIS A CA   3  
ATOM   1381 C  C    . HIS A 1 25 ? -4.944  -19.752 9.172  1.00 0.00 ? 126 HIS A C    3  
ATOM   1382 O  O    . HIS A 1 25 ? -5.913  -19.984 9.894  1.00 0.00 ? 126 HIS A O    3  
ATOM   1383 C  CB   . HIS A 1 25 ? -4.548  -17.264 8.791  1.00 0.00 ? 126 HIS A CB   3  
ATOM   1384 C  CG   . HIS A 1 25 ? -3.789  -16.024 9.200  1.00 0.00 ? 126 HIS A CG   3  
ATOM   1385 N  ND1  . HIS A 1 25 ? -3.509  -15.718 10.521 1.00 0.00 ? 126 HIS A ND1  3  
ATOM   1386 C  CD2  . HIS A 1 25 ? -3.256  -15.017 8.450  1.00 0.00 ? 126 HIS A CD2  3  
ATOM   1387 C  CE1  . HIS A 1 25 ? -2.838  -14.576 10.553 1.00 0.00 ? 126 HIS A CE1  3  
ATOM   1388 N  NE2  . HIS A 1 25 ? -2.683  -14.143 9.269  1.00 0.00 ? 126 HIS A NE2  3  
ATOM   1389 H  H    . HIS A 1 25 ? -2.329  -18.254 8.296  1.00 0.00 ? 126 HIS A H    3  
ATOM   1390 H  HA   . HIS A 1 25 ? -3.995  -18.378 10.523 1.00 0.00 ? 126 HIS A HA   3  
ATOM   1391 H  HB2  . HIS A 1 25 ? -4.487  -17.374 7.707  1.00 0.00 ? 126 HIS A HB2  3  
ATOM   1392 H  HB3  . HIS A 1 25 ? -5.600  -17.133 9.039  1.00 0.00 ? 126 HIS A HB3  3  
ATOM   1393 H  HD1  . HIS A 1 25 ? -3.769  -16.267 11.316 1.00 0.00 ? 126 HIS A HD1  3  
ATOM   1394 H  HD2  . HIS A 1 25 ? -3.294  -14.943 7.364  1.00 0.00 ? 126 HIS A HD2  3  
ATOM   1395 H  HE1  . HIS A 1 25 ? -2.474  -14.073 11.448 1.00 0.00 ? 126 HIS A HE1  3  
ATOM   1396 N  N    . THR A 1 26 ? -4.593  -20.488 8.128  1.00 0.00 ? 127 THR A N    3  
ATOM   1397 C  CA   . THR A 1 26 ? -5.361  -21.662 7.748  1.00 0.00 ? 127 THR A CA   3  
ATOM   1398 C  C    . THR A 1 26 ? -5.802  -22.436 8.992  1.00 0.00 ? 127 THR A C    3  
ATOM   1399 O  O    . THR A 1 26 ? -6.825  -23.118 8.973  1.00 0.00 ? 127 THR A O    3  
ATOM   1400 C  CB   . THR A 1 26 ? -4.510  -22.492 6.785  1.00 0.00 ? 127 THR A CB   3  
ATOM   1401 O  OG1  . THR A 1 26 ? -3.737  -21.524 6.081  1.00 0.00 ? 127 THR A OG1  3  
ATOM   1402 C  CG2  . THR A 1 26 ? -5.346  -23.166 5.695  1.00 0.00 ? 127 THR A CG2  3  
ATOM   1403 H  H    . THR A 1 26 ? -3.804  -20.294 7.546  1.00 0.00 ? 127 THR A H    3  
ATOM   1404 H  HA   . THR A 1 26 ? -6.267  -21.331 7.240  1.00 0.00 ? 127 THR A HA   3  
ATOM   1405 H  HB   . THR A 1 26 ? -3.913  -23.226 7.327  1.00 0.00 ? 127 THR A HB   3  
ATOM   1406 H  HG1  . THR A 1 26 ? -4.316  -21.033 5.430  1.00 0.00 ? 127 THR A HG1  3  
ATOM   1407 H  HG21 . THR A 1 26 ? -5.824  -22.402 5.081  1.00 0.00 ? 127 THR A HG21 3  
ATOM   1408 H  HG22 . THR A 1 26 ? -4.701  -23.783 5.071  1.00 0.00 ? 127 THR A HG22 3  
ATOM   1409 H  HG23 . THR A 1 26 ? -6.110  -23.791 6.158  1.00 0.00 ? 127 THR A HG23 3  
ATOM   1410 N  N    . ASN A 1 27 ? -5.006  -22.305 10.043 1.00 0.00 ? 128 ASN A N    3  
ATOM   1411 C  CA   . ASN A 1 27 ? -5.301  -22.985 11.294 1.00 0.00 ? 128 ASN A CA   3  
ATOM   1412 C  C    . ASN A 1 27 ? -5.129  -22.003 12.455 1.00 0.00 ? 128 ASN A C    3  
ATOM   1413 O  O    . ASN A 1 27 ? -6.000  -21.896 13.317 1.00 0.00 ? 128 ASN A O    3  
ATOM   1414 C  CB   . ASN A 1 27 ? -4.347  -24.159 11.521 1.00 0.00 ? 128 ASN A CB   3  
ATOM   1415 C  CG   . ASN A 1 27 ? -2.946  -23.837 10.997 1.00 0.00 ? 128 ASN A CG   3  
ATOM   1416 O  OD1  . ASN A 1 27 ? -2.349  -22.825 11.328 1.00 0.00 ? 128 ASN A OD1  3  
ATOM   1417 N  ND2  . ASN A 1 27 ? -2.457  -24.750 10.164 1.00 0.00 ? 128 ASN A ND2  3  
ATOM   1418 H  H    . ASN A 1 27 ? -4.176  -21.749 10.050 1.00 0.00 ? 128 ASN A H    3  
ATOM   1419 H  HA   . ASN A 1 27 ? -6.328  -23.335 11.193 1.00 0.00 ? 128 ASN A HA   3  
ATOM   1420 H  HB2  . ASN A 1 27 ? -4.297  -24.390 12.586 1.00 0.00 ? 128 ASN A HB2  3  
ATOM   1421 H  HB3  . ASN A 1 27 ? -4.732  -25.046 11.020 1.00 0.00 ? 128 ASN A HB3  3  
ATOM   1422 H  HD21 . ASN A 1 27 ? -3.078  -25.306 9.611  1.00 0.00 ? 128 ASN A HD21 3  
ATOM   1423 H  HD22 . ASN A 1 27 ? -1.469  -24.882 10.091 1.00 0.00 ? 128 ASN A HD22 3  
ATOM   1424 N  N    . GLU A 1 28 ? -3.998  -21.311 12.440 1.00 0.00 ? 129 GLU A N    3  
ATOM   1425 C  CA   . GLU A 1 28 ? -3.700  -20.344 13.482 1.00 0.00 ? 129 GLU A CA   3  
ATOM   1426 C  C    . GLU A 1 28 ? -4.965  -19.574 13.869 1.00 0.00 ? 129 GLU A C    3  
ATOM   1427 O  O    . GLU A 1 28 ? -5.163  -19.247 15.038 1.00 0.00 ? 129 GLU A O    3  
ATOM   1428 C  CB   . GLU A 1 28 ? -2.591  -19.387 13.039 1.00 0.00 ? 129 GLU A CB   3  
ATOM   1429 C  CG   . GLU A 1 28 ? -2.015  -18.624 14.235 1.00 0.00 ? 129 GLU A CG   3  
ATOM   1430 C  CD   . GLU A 1 28 ? -2.539  -17.188 14.273 1.00 0.00 ? 129 GLU A CD   3  
ATOM   1431 O  OE1  . GLU A 1 28 ? -3.693  -16.993 13.837 1.00 0.00 ? 129 GLU A OE1  3  
ATOM   1432 O  OE2  . GLU A 1 28 ? -1.773  -16.317 14.738 1.00 0.00 ? 129 GLU A OE2  3  
ATOM   1433 H  H    . GLU A 1 28 ? -3.294  -21.405 11.736 1.00 0.00 ? 129 GLU A H    3  
ATOM   1434 H  HA   . GLU A 1 28 ? -3.349  -20.929 14.331 1.00 0.00 ? 129 GLU A HA   3  
ATOM   1435 H  HB2  . GLU A 1 28 ? -1.798  -19.947 12.545 1.00 0.00 ? 129 GLU A HB2  3  
ATOM   1436 H  HB3  . GLU A 1 28 ? -2.985  -18.680 12.309 1.00 0.00 ? 129 GLU A HB3  3  
ATOM   1437 H  HG2  . GLU A 1 28 ? -2.280  -19.138 15.159 1.00 0.00 ? 129 GLU A HG2  3  
ATOM   1438 H  HG3  . GLU A 1 28 ? -0.926  -18.617 14.175 1.00 0.00 ? 129 GLU A HG3  3  
ATOM   1439 N  N    . LYS A 1 29 ? -5.788  -19.308 12.865 1.00 0.00 ? 130 LYS A N    3  
ATOM   1440 C  CA   . LYS A 1 29 ? -7.028  -18.584 13.086 1.00 0.00 ? 130 LYS A CA   3  
ATOM   1441 C  C    . LYS A 1 29 ? -8.139  -19.577 13.432 1.00 0.00 ? 130 LYS A C    3  
ATOM   1442 O  O    . LYS A 1 29 ? -7.983  -20.400 14.333 1.00 0.00 ? 130 LYS A O    3  
ATOM   1443 C  CB   . LYS A 1 29 ? -7.351  -17.694 11.883 1.00 0.00 ? 130 LYS A CB   3  
ATOM   1444 C  CG   . LYS A 1 29 ? -8.610  -16.864 12.138 1.00 0.00 ? 130 LYS A CG   3  
ATOM   1445 C  CD   . LYS A 1 29 ? -9.508  -16.836 10.900 1.00 0.00 ? 130 LYS A CD   3  
ATOM   1446 C  CE   . LYS A 1 29 ? -9.913  -18.252 10.485 1.00 0.00 ? 130 LYS A CE   3  
ATOM   1447 N  NZ   . LYS A 1 29 ? -11.209 -18.232 9.770  1.00 0.00 ? 130 LYS A NZ   3  
ATOM   1448 H  H    . LYS A 1 29 ? -5.619  -19.577 11.917 1.00 0.00 ? 130 LYS A H    3  
ATOM   1449 H  HA   . LYS A 1 29 ? -6.874  -17.926 13.942 1.00 0.00 ? 130 LYS A HA   3  
ATOM   1450 H  HB2  . LYS A 1 29 ? -6.509  -17.031 11.680 1.00 0.00 ? 130 LYS A HB2  3  
ATOM   1451 H  HB3  . LYS A 1 29 ? -7.491  -18.312 10.996 1.00 0.00 ? 130 LYS A HB3  3  
ATOM   1452 H  HG2  . LYS A 1 29 ? -9.160  -17.280 12.982 1.00 0.00 ? 130 LYS A HG2  3  
ATOM   1453 H  HG3  . LYS A 1 29 ? -8.331  -15.846 12.411 1.00 0.00 ? 130 LYS A HG3  3  
ATOM   1454 H  HD2  . LYS A 1 29 ? -10.400 -16.245 11.106 1.00 0.00 ? 130 LYS A HD2  3  
ATOM   1455 H  HD3  . LYS A 1 29 ? -8.985  -16.348 10.077 1.00 0.00 ? 130 LYS A HD3  3  
ATOM   1456 H  HE2  . LYS A 1 29 ? -9.144  -18.684 9.844  1.00 0.00 ? 130 LYS A HE2  3  
ATOM   1457 H  HE3  . LYS A 1 29 ? -9.987  -18.889 11.366 1.00 0.00 ? 130 LYS A HE3  3  
ATOM   1458 H  HZ1  . LYS A 1 29 ? -11.420 -19.152 9.438  1.00 0.00 ? 130 LYS A HZ1  3  
ATOM   1459 H  HZ2  . LYS A 1 29 ? -11.929 -17.930 10.396 1.00 0.00 ? 130 LYS A HZ2  3  
ATOM   1460 H  HZ3  . LYS A 1 29 ? -11.154 -17.602 8.997  1.00 0.00 ? 130 LYS A HZ3  3  
HETATM 1461 ZN ZN   . ZN  B 2 .  ? -1.762  -12.443 8.712  1.00 0.00 ? 1   ZN  A ZN   3  
ATOM   1462 N  N    . ARG A 1 1  ? 2.859   0.401   -3.649 1.00 0.00 ? 102 ARG A N    4  
ATOM   1463 C  CA   . ARG A 1 1  ? 2.344   -0.947  -3.485 1.00 0.00 ? 102 ARG A CA   4  
ATOM   1464 C  C    . ARG A 1 1  ? 3.041   -1.643  -2.315 1.00 0.00 ? 102 ARG A C    4  
ATOM   1465 O  O    . ARG A 1 1  ? 4.063   -1.165  -1.823 1.00 0.00 ? 102 ARG A O    4  
ATOM   1466 C  CB   . ARG A 1 1  ? 2.549   -1.774  -4.756 1.00 0.00 ? 102 ARG A CB   4  
ATOM   1467 C  CG   . ARG A 1 1  ? 1.296   -1.750  -5.633 1.00 0.00 ? 102 ARG A CG   4  
ATOM   1468 C  CD   . ARG A 1 1  ? 1.161   -0.412  -6.362 1.00 0.00 ? 102 ARG A CD   4  
ATOM   1469 N  NE   . ARG A 1 1  ? 0.290   -0.565  -7.547 1.00 0.00 ? 102 ARG A NE   4  
ATOM   1470 C  CZ   . ARG A 1 1  ? 0.655   -0.243  -8.796 1.00 0.00 ? 102 ARG A CZ   4  
ATOM   1471 N  NH1  . ARG A 1 1  ? 1.522   -1.019  -9.462 1.00 0.00 ? 102 ARG A NH1  4  
ATOM   1472 N  NH2  . ARG A 1 1  ? 0.154   0.855   -9.378 1.00 0.00 ? 102 ARG A NH2  4  
ATOM   1473 H  H    . ARG A 1 1  ? 3.853   0.466   -3.742 1.00 0.00 ? 102 ARG A H    4  
ATOM   1474 H  HA   . ARG A 1 1  ? 1.280   -0.817  -3.287 1.00 0.00 ? 102 ARG A HA   4  
ATOM   1475 H  HB2  . ARG A 1 1  ? 3.397   -1.381  -5.316 1.00 0.00 ? 102 ARG A HB2  4  
ATOM   1476 H  HB3  . ARG A 1 1  ? 2.791   -2.802  -4.490 1.00 0.00 ? 102 ARG A HB3  4  
ATOM   1477 H  HG2  . ARG A 1 1  ? 1.341   -2.560  -6.361 1.00 0.00 ? 102 ARG A HG2  4  
ATOM   1478 H  HG3  . ARG A 1 1  ? 0.412   -1.923  -5.018 1.00 0.00 ? 102 ARG A HG3  4  
ATOM   1479 H  HD2  . ARG A 1 1  ? 0.744   0.338   -5.689 1.00 0.00 ? 102 ARG A HD2  4  
ATOM   1480 H  HD3  . ARG A 1 1  ? 2.145   -0.054  -6.667 1.00 0.00 ? 102 ARG A HD3  4  
ATOM   1481 H  HE   . ARG A 1 1  ? -0.630  -0.933  -7.409 1.00 0.00 ? 102 ARG A HE   4  
ATOM   1482 H  HH11 . ARG A 1 1  ? 1.192   -1.814  -9.970 1.00 0.00 ? 102 ARG A HH11 4  
ATOM   1483 H  HH12 . ARG A 1 1  ? 2.498   -0.801  -9.451 1.00 0.00 ? 102 ARG A HH12 4  
ATOM   1484 H  HH21 . ARG A 1 1  ? -0.828  0.928   -9.548 1.00 0.00 ? 102 ARG A HH21 4  
ATOM   1485 H  HH22 . ARG A 1 1  ? 0.763   1.603   -9.643 1.00 0.00 ? 102 ARG A HH22 4  
ATOM   1486 N  N    . SER A 1 2  ? 2.462   -2.762  -1.902 1.00 0.00 ? 103 SER A N    4  
ATOM   1487 C  CA   . SER A 1 2  ? 3.015   -3.528  -0.799 1.00 0.00 ? 103 SER A CA   4  
ATOM   1488 C  C    . SER A 1 2  ? 2.210   -4.813  -0.600 1.00 0.00 ? 103 SER A C    4  
ATOM   1489 O  O    . SER A 1 2  ? 1.107   -4.948  -1.127 1.00 0.00 ? 103 SER A O    4  
ATOM   1490 C  CB   . SER A 1 2  ? 3.029   -2.705  0.491  1.00 0.00 ? 103 SER A CB   4  
ATOM   1491 O  OG   . SER A 1 2  ? 4.288   -2.073  0.708  1.00 0.00 ? 103 SER A OG   4  
ATOM   1492 H  H    . SER A 1 2  ? 1.631   -3.142  -2.308 1.00 0.00 ? 103 SER A H    4  
ATOM   1493 H  HA   . SER A 1 2  ? 4.039   -3.759  -1.092 1.00 0.00 ? 103 SER A HA   4  
ATOM   1494 H  HB2  . SER A 1 2  ? 2.247   -1.947  0.446  1.00 0.00 ? 103 SER A HB2  4  
ATOM   1495 H  HB3  . SER A 1 2  ? 2.797   -3.352  1.337  1.00 0.00 ? 103 SER A HB3  4  
ATOM   1496 H  HG   . SER A 1 2  ? 5.004   -2.557  0.206  1.00 0.00 ? 103 SER A HG   4  
ATOM   1497 N  N    . PHE A 1 3  ? 2.793   -5.726  0.164  1.00 0.00 ? 104 PHE A N    4  
ATOM   1498 C  CA   . PHE A 1 3  ? 2.144   -6.997  0.440  1.00 0.00 ? 104 PHE A CA   4  
ATOM   1499 C  C    . PHE A 1 3  ? 1.729   -7.093  1.909  1.00 0.00 ? 104 PHE A C    4  
ATOM   1500 O  O    . PHE A 1 3  ? 2.514   -7.526  2.752  1.00 0.00 ? 104 PHE A O    4  
ATOM   1501 C  CB   . PHE A 1 3  ? 3.164   -8.096  0.136  1.00 0.00 ? 104 PHE A CB   4  
ATOM   1502 C  CG   . PHE A 1 3  ? 3.734   -8.043  -1.283 1.00 0.00 ? 104 PHE A CG   4  
ATOM   1503 C  CD1  . PHE A 1 3  ? 2.987   -8.485  -2.331 1.00 0.00 ? 104 PHE A CD1  4  
ATOM   1504 C  CD2  . PHE A 1 3  ? 4.984   -7.553  -1.497 1.00 0.00 ? 104 PHE A CD2  4  
ATOM   1505 C  CE1  . PHE A 1 3  ? 3.515   -8.436  -3.648 1.00 0.00 ? 104 PHE A CE1  4  
ATOM   1506 C  CE2  . PHE A 1 3  ? 5.511   -7.504  -2.814 1.00 0.00 ? 104 PHE A CE2  4  
ATOM   1507 C  CZ   . PHE A 1 3  ? 4.766   -7.947  -3.862 1.00 0.00 ? 104 PHE A CZ   4  
ATOM   1508 H  H    . PHE A 1 3  ? 3.690   -5.609  0.589  1.00 0.00 ? 104 PHE A H    4  
ATOM   1509 H  HA   . PHE A 1 3  ? 1.256   -7.049  -0.191 1.00 0.00 ? 104 PHE A HA   4  
ATOM   1510 H  HB2  . PHE A 1 3  ? 3.985   -8.020  0.849  1.00 0.00 ? 104 PHE A HB2  4  
ATOM   1511 H  HB3  . PHE A 1 3  ? 2.694   -9.067  0.292  1.00 0.00 ? 104 PHE A HB3  4  
ATOM   1512 H  HD1  . PHE A 1 3  ? 1.985   -8.877  -2.159 1.00 0.00 ? 104 PHE A HD1  4  
ATOM   1513 H  HD2  . PHE A 1 3  ? 5.582   -7.199  -0.656 1.00 0.00 ? 104 PHE A HD2  4  
ATOM   1514 H  HE1  . PHE A 1 3  ? 2.917   -8.790  -4.488 1.00 0.00 ? 104 PHE A HE1  4  
ATOM   1515 H  HE2  . PHE A 1 3  ? 6.514   -7.112  -2.986 1.00 0.00 ? 104 PHE A HE2  4  
ATOM   1516 H  HZ   . PHE A 1 3  ? 5.171   -7.909  -4.874 1.00 0.00 ? 104 PHE A HZ   4  
ATOM   1517 N  N    . VAL A 1 4  ? 0.498   -6.683  2.171  1.00 0.00 ? 105 VAL A N    4  
ATOM   1518 C  CA   . VAL A 1 4  ? -0.031  -6.717  3.525  1.00 0.00 ? 105 VAL A CA   4  
ATOM   1519 C  C    . VAL A 1 4  ? -1.024  -7.875  3.650  1.00 0.00 ? 105 VAL A C    4  
ATOM   1520 O  O    . VAL A 1 4  ? -1.670  -8.253  2.674  1.00 0.00 ? 105 VAL A O    4  
ATOM   1521 C  CB   . VAL A 1 4  ? -0.645  -5.362  3.882  1.00 0.00 ? 105 VAL A CB   4  
ATOM   1522 C  CG1  . VAL A 1 4  ? -1.351  -5.420  5.237  1.00 0.00 ? 105 VAL A CG1  4  
ATOM   1523 C  CG2  . VAL A 1 4  ? 0.415   -4.258  3.862  1.00 0.00 ? 105 VAL A CG2  4  
ATOM   1524 H  H    . VAL A 1 4  ? -0.134  -6.332  1.480  1.00 0.00 ? 105 VAL A H    4  
ATOM   1525 H  HA   . VAL A 1 4  ? 0.805   -6.898  4.199  1.00 0.00 ? 105 VAL A HA   4  
ATOM   1526 H  HB   . VAL A 1 4  ? -1.392  -5.123  3.125  1.00 0.00 ? 105 VAL A HB   4  
ATOM   1527 H  HG11 . VAL A 1 4  ? -2.270  -5.997  5.144  1.00 0.00 ? 105 VAL A HG11 4  
ATOM   1528 H  HG12 . VAL A 1 4  ? -0.696  -5.895  5.968  1.00 0.00 ? 105 VAL A HG12 4  
ATOM   1529 H  HG13 . VAL A 1 4  ? -1.588  -4.409  5.567  1.00 0.00 ? 105 VAL A HG13 4  
ATOM   1530 H  HG21 . VAL A 1 4  ? 0.737   -4.083  2.835  1.00 0.00 ? 105 VAL A HG21 4  
ATOM   1531 H  HG22 . VAL A 1 4  ? -0.008  -3.341  4.272  1.00 0.00 ? 105 VAL A HG22 4  
ATOM   1532 H  HG23 . VAL A 1 4  ? 1.270   -4.565  4.463  1.00 0.00 ? 105 VAL A HG23 4  
ATOM   1533 N  N    . CYS A 1 5  ? -1.115  -8.405  4.861  1.00 0.00 ? 106 CYS A N    4  
ATOM   1534 C  CA   . CYS A 1 5  ? -2.018  -9.512  5.126  1.00 0.00 ? 106 CYS A CA   4  
ATOM   1535 C  C    . CYS A 1 5  ? -3.372  -8.936  5.547  1.00 0.00 ? 106 CYS A C    4  
ATOM   1536 O  O    . CYS A 1 5  ? -3.437  -8.047  6.394  1.00 0.00 ? 106 CYS A O    4  
ATOM   1537 C  CB   . CYS A 1 5  ? -1.451  -10.464 6.182  1.00 0.00 ? 106 CYS A CB   4  
ATOM   1538 S  SG   . CYS A 1 5  ? -2.633  -11.826 6.496  1.00 0.00 ? 106 CYS A SG   4  
ATOM   1539 H  H    . CYS A 1 5  ? -0.587  -8.092  5.650  1.00 0.00 ? 106 CYS A H    4  
ATOM   1540 H  HA   . CYS A 1 5  ? -2.108  -10.073 4.197  1.00 0.00 ? 106 CYS A HA   4  
ATOM   1541 H  HB2  . CYS A 1 5  ? -0.498  -10.870 5.841  1.00 0.00 ? 106 CYS A HB2  4  
ATOM   1542 H  HB3  . CYS A 1 5  ? -1.254  -9.921  7.105  1.00 0.00 ? 106 CYS A HB3  4  
ATOM   1543 N  N    . GLU A 1 6  ? -4.421  -9.468  4.936  1.00 0.00 ? 107 GLU A N    4  
ATOM   1544 C  CA   . GLU A 1 6  ? -5.769  -9.018  5.235  1.00 0.00 ? 107 GLU A CA   4  
ATOM   1545 C  C    . GLU A 1 6  ? -6.296  -9.719  6.489  1.00 0.00 ? 107 GLU A C    4  
ATOM   1546 O  O    . GLU A 1 6  ? -7.383  -9.404  6.971  1.00 0.00 ? 107 GLU A O    4  
ATOM   1547 C  CB   . GLU A 1 6  ? -6.702  -9.250  4.045  1.00 0.00 ? 107 GLU A CB   4  
ATOM   1548 C  CG   . GLU A 1 6  ? -6.226  -8.473  2.816  1.00 0.00 ? 107 GLU A CG   4  
ATOM   1549 C  CD   . GLU A 1 6  ? -6.783  -7.048  2.818  1.00 0.00 ? 107 GLU A CD   4  
ATOM   1550 O  OE1  . GLU A 1 6  ? -7.982  -6.907  3.143  1.00 0.00 ? 107 GLU A OE1  4  
ATOM   1551 O  OE2  . GLU A 1 6  ? -5.998  -6.131  2.495  1.00 0.00 ? 107 GLU A OE2  4  
ATOM   1552 H  H    . GLU A 1 6  ? -4.360  -10.191 4.247  1.00 0.00 ? 107 GLU A H    4  
ATOM   1553 H  HA   . GLU A 1 6  ? -5.684  -7.947  5.419  1.00 0.00 ? 107 GLU A HA   4  
ATOM   1554 H  HB2  . GLU A 1 6  ? -6.744  -10.314 3.813  1.00 0.00 ? 107 GLU A HB2  4  
ATOM   1555 H  HB3  . GLU A 1 6  ? -7.714  -8.940  4.305  1.00 0.00 ? 107 GLU A HB3  4  
ATOM   1556 H  HG2  . GLU A 1 6  ? -5.136  -8.441  2.800  1.00 0.00 ? 107 GLU A HG2  4  
ATOM   1557 H  HG3  . GLU A 1 6  ? -6.542  -8.989  1.910  1.00 0.00 ? 107 GLU A HG3  4  
ATOM   1558 N  N    . VAL A 1 7  ? -5.501  -10.658 6.982  1.00 0.00 ? 108 VAL A N    4  
ATOM   1559 C  CA   . VAL A 1 7  ? -5.873  -11.405 8.170  1.00 0.00 ? 108 VAL A CA   4  
ATOM   1560 C  C    . VAL A 1 7  ? -5.377  -10.662 9.413  1.00 0.00 ? 108 VAL A C    4  
ATOM   1561 O  O    . VAL A 1 7  ? -6.178  -10.176 10.210 1.00 0.00 ? 108 VAL A O    4  
ATOM   1562 C  CB   . VAL A 1 7  ? -5.338  -12.837 8.078  1.00 0.00 ? 108 VAL A CB   4  
ATOM   1563 C  CG1  . VAL A 1 7  ? -5.333  -13.510 9.451  1.00 0.00 ? 108 VAL A CG1  4  
ATOM   1564 C  CG2  . VAL A 1 7  ? -6.141  -13.657 7.067  1.00 0.00 ? 108 VAL A CG2  4  
ATOM   1565 H  H    . VAL A 1 7  ? -4.618  -10.908 6.585  1.00 0.00 ? 108 VAL A H    4  
ATOM   1566 H  HA   . VAL A 1 7  ? -6.962  -11.454 8.201  1.00 0.00 ? 108 VAL A HA   4  
ATOM   1567 H  HB   . VAL A 1 7  ? -4.308  -12.786 7.725  1.00 0.00 ? 108 VAL A HB   4  
ATOM   1568 H  HG11 . VAL A 1 7  ? -6.251  -13.260 9.982  1.00 0.00 ? 108 VAL A HG11 4  
ATOM   1569 H  HG12 . VAL A 1 7  ? -5.269  -14.591 9.325  1.00 0.00 ? 108 VAL A HG12 4  
ATOM   1570 H  HG13 . VAL A 1 7  ? -4.475  -13.160 10.024 1.00 0.00 ? 108 VAL A HG13 4  
ATOM   1571 H  HG21 . VAL A 1 7  ? -5.479  -14.004 6.273  1.00 0.00 ? 108 VAL A HG21 4  
ATOM   1572 H  HG22 . VAL A 1 7  ? -6.588  -14.516 7.569  1.00 0.00 ? 108 VAL A HG22 4  
ATOM   1573 H  HG23 . VAL A 1 7  ? -6.928  -13.036 6.637  1.00 0.00 ? 108 VAL A HG23 4  
ATOM   1574 N  N    . CYS A 1 8  ? -4.059  -10.596 9.537  1.00 0.00 ? 109 CYS A N    4  
ATOM   1575 C  CA   . CYS A 1 8  ? -3.448  -9.920  10.669 1.00 0.00 ? 109 CYS A CA   4  
ATOM   1576 C  C    . CYS A 1 8  ? -3.113  -8.488  10.248 1.00 0.00 ? 109 CYS A C    4  
ATOM   1577 O  O    . CYS A 1 8  ? -3.590  -7.530  10.856 1.00 0.00 ? 109 CYS A O    4  
ATOM   1578 C  CB   . CYS A 1 8  ? -2.215  -10.670 11.176 1.00 0.00 ? 109 CYS A CB   4  
ATOM   1579 S  SG   . CYS A 1 8  ? -0.909  -10.668 9.894  1.00 0.00 ? 109 CYS A SG   4  
ATOM   1580 H  H    . CYS A 1 8  ? -3.416  -10.994 8.884  1.00 0.00 ? 109 CYS A H    4  
ATOM   1581 H  HA   . CYS A 1 8  ? -4.184  -9.926  11.472 1.00 0.00 ? 109 CYS A HA   4  
ATOM   1582 H  HB2  . CYS A 1 8  ? -1.842  -10.200 12.087 1.00 0.00 ? 109 CYS A HB2  4  
ATOM   1583 H  HB3  . CYS A 1 8  ? -2.482  -11.695 11.433 1.00 0.00 ? 109 CYS A HB3  4  
ATOM   1584 N  N    . THR A 1 9  ? -2.293  -8.386  9.212  1.00 0.00 ? 110 THR A N    4  
ATOM   1585 C  CA   . THR A 1 9  ? -1.888  -7.087  8.703  1.00 0.00 ? 110 THR A CA   4  
ATOM   1586 C  C    . THR A 1 9  ? -0.371  -7.035  8.520  1.00 0.00 ? 110 THR A C    4  
ATOM   1587 O  O    . THR A 1 9  ? 0.206   -5.957  8.387  1.00 0.00 ? 110 THR A O    4  
ATOM   1588 C  CB   . THR A 1 9  ? -2.422  -6.018  9.658  1.00 0.00 ? 110 THR A CB   4  
ATOM   1589 O  OG1  . THR A 1 9  ? -1.859  -4.803  9.170  1.00 0.00 ? 110 THR A OG1  4  
ATOM   1590 C  CG2  . THR A 1 9  ? -1.848  -6.154  11.070 1.00 0.00 ? 110 THR A CG2  4  
ATOM   1591 H  H    . THR A 1 9  ? -1.910  -9.170  8.722  1.00 0.00 ? 110 THR A H    4  
ATOM   1592 H  HA   . THR A 1 9  ? -2.334  -6.950  7.717  1.00 0.00 ? 110 THR A HA   4  
ATOM   1593 H  HB   . THR A 1 9  ? -3.512  -6.023  9.678  1.00 0.00 ? 110 THR A HB   4  
ATOM   1594 H  HG1  . THR A 1 9  ? -2.497  -4.048  9.314  1.00 0.00 ? 110 THR A HG1  4  
ATOM   1595 H  HG21 . THR A 1 9  ? -2.631  -5.949  11.801 1.00 0.00 ? 110 THR A HG21 4  
ATOM   1596 H  HG22 . THR A 1 9  ? -1.473  -7.168  11.213 1.00 0.00 ? 110 THR A HG22 4  
ATOM   1597 H  HG23 . THR A 1 9  ? -1.033  -5.443  11.200 1.00 0.00 ? 110 THR A HG23 4  
ATOM   1598 N  N    . ARG A 1 10 ? 0.234   -8.215  8.519  1.00 0.00 ? 111 ARG A N    4  
ATOM   1599 C  CA   . ARG A 1 10 ? 1.674   -8.317  8.356  1.00 0.00 ? 111 ARG A CA   4  
ATOM   1600 C  C    . ARG A 1 10 ? 2.071   -7.974  6.918  1.00 0.00 ? 111 ARG A C    4  
ATOM   1601 O  O    . ARG A 1 10 ? 1.519   -8.528  5.969  1.00 0.00 ? 111 ARG A O    4  
ATOM   1602 C  CB   . ARG A 1 10 ? 2.167   -9.726  8.691  1.00 0.00 ? 111 ARG A CB   4  
ATOM   1603 C  CG   . ARG A 1 10 ? 2.300   -9.916  10.203 1.00 0.00 ? 111 ARG A CG   4  
ATOM   1604 C  CD   . ARG A 1 10 ? 3.688   -10.439 10.571 1.00 0.00 ? 111 ARG A CD   4  
ATOM   1605 N  NE   . ARG A 1 10 ? 4.215   -9.700  11.740 1.00 0.00 ? 111 ARG A NE   4  
ATOM   1606 C  CZ   . ARG A 1 10 ? 5.411   -9.931  12.299 1.00 0.00 ? 111 ARG A CZ   4  
ATOM   1607 N  NH1  . ARG A 1 10 ? 5.637   -11.083 12.947 1.00 0.00 ? 111 ARG A NH1  4  
ATOM   1608 N  NH2  . ARG A 1 10 ? 6.380   -9.011  12.211 1.00 0.00 ? 111 ARG A NH2  4  
ATOM   1609 H  H    . ARG A 1 10 ? -0.242  -9.087  8.628  1.00 0.00 ? 111 ARG A H    4  
ATOM   1610 H  HA   . ARG A 1 10 ? 2.087   -7.595  9.060  1.00 0.00 ? 111 ARG A HA   4  
ATOM   1611 H  HB2  . ARG A 1 10 ? 1.474   -10.464 8.287  1.00 0.00 ? 111 ARG A HB2  4  
ATOM   1612 H  HB3  . ARG A 1 10 ? 3.132   -9.901  8.213  1.00 0.00 ? 111 ARG A HB3  4  
ATOM   1613 H  HG2  . ARG A 1 10 ? 2.118   -8.968  10.709 1.00 0.00 ? 111 ARG A HG2  4  
ATOM   1614 H  HG3  . ARG A 1 10 ? 1.539   -10.614 10.554 1.00 0.00 ? 111 ARG A HG3  4  
ATOM   1615 H  HD2  . ARG A 1 10 ? 3.637   -11.505 10.797 1.00 0.00 ? 111 ARG A HD2  4  
ATOM   1616 H  HD3  . ARG A 1 10 ? 4.365   -10.326 9.725  1.00 0.00 ? 111 ARG A HD3  4  
ATOM   1617 H  HE   . ARG A 1 10 ? 3.642   -8.984  12.139 1.00 0.00 ? 111 ARG A HE   4  
ATOM   1618 H  HH11 . ARG A 1 10 ? 5.060   -11.343 13.720 1.00 0.00 ? 111 ARG A HH11 4  
ATOM   1619 H  HH12 . ARG A 1 10 ? 6.383   -11.681 12.656 1.00 0.00 ? 111 ARG A HH12 4  
ATOM   1620 H  HH21 . ARG A 1 10 ? 6.533   -8.527  11.348 1.00 0.00 ? 111 ARG A HH21 4  
ATOM   1621 H  HH22 . ARG A 1 10 ? 6.952   -8.808  13.005 1.00 0.00 ? 111 ARG A HH22 4  
ATOM   1622 N  N    . ALA A 1 11 ? 3.025   -7.062  6.804  1.00 0.00 ? 112 ALA A N    4  
ATOM   1623 C  CA   . ALA A 1 11 ? 3.501   -6.638  5.498  1.00 0.00 ? 112 ALA A CA   4  
ATOM   1624 C  C    . ALA A 1 11 ? 4.754   -7.437  5.133  1.00 0.00 ? 112 ALA A C    4  
ATOM   1625 O  O    . ALA A 1 11 ? 5.504   -7.859  6.012  1.00 0.00 ? 112 ALA A O    4  
ATOM   1626 C  CB   . ALA A 1 11 ? 3.756   -5.129  5.512  1.00 0.00 ? 112 ALA A CB   4  
ATOM   1627 H  H    . ALA A 1 11 ? 3.469   -6.616  7.580  1.00 0.00 ? 112 ALA A H    4  
ATOM   1628 H  HA   . ALA A 1 11 ? 2.718   -6.856  4.772  1.00 0.00 ? 112 ALA A HA   4  
ATOM   1629 H  HB1  . ALA A 1 11 ? 3.800   -4.759  4.488  1.00 0.00 ? 112 ALA A HB1  4  
ATOM   1630 H  HB2  . ALA A 1 11 ? 2.947   -4.630  6.044  1.00 0.00 ? 112 ALA A HB2  4  
ATOM   1631 H  HB3  . ALA A 1 11 ? 4.703   -4.926  6.013  1.00 0.00 ? 112 ALA A HB3  4  
ATOM   1632 N  N    . PHE A 1 12 ? 4.942   -7.622  3.835  1.00 0.00 ? 113 PHE A N    4  
ATOM   1633 C  CA   . PHE A 1 12 ? 6.090   -8.364  3.342  1.00 0.00 ? 113 PHE A CA   4  
ATOM   1634 C  C    . PHE A 1 12 ? 6.637   -7.738  2.057  1.00 0.00 ? 113 PHE A C    4  
ATOM   1635 O  O    . PHE A 1 12 ? 5.979   -6.903  1.440  1.00 0.00 ? 113 PHE A O    4  
ATOM   1636 C  CB   . PHE A 1 12 ? 5.609   -9.784  3.040  1.00 0.00 ? 113 PHE A CB   4  
ATOM   1637 C  CG   . PHE A 1 12 ? 5.070   -10.532 4.261  1.00 0.00 ? 113 PHE A CG   4  
ATOM   1638 C  CD1  . PHE A 1 12 ? 5.928   -11.174 5.098  1.00 0.00 ? 113 PHE A CD1  4  
ATOM   1639 C  CD2  . PHE A 1 12 ? 3.734   -10.555 4.508  1.00 0.00 ? 113 PHE A CD2  4  
ATOM   1640 C  CE1  . PHE A 1 12 ? 5.428   -11.868 6.232  1.00 0.00 ? 113 PHE A CE1  4  
ATOM   1641 C  CE2  . PHE A 1 12 ? 3.233   -11.249 5.642  1.00 0.00 ? 113 PHE A CE2  4  
ATOM   1642 C  CZ   . PHE A 1 12 ? 4.090   -11.890 6.479  1.00 0.00 ? 113 PHE A CZ   4  
ATOM   1643 H  H    . PHE A 1 12 ? 4.328   -7.276  3.125  1.00 0.00 ? 113 PHE A H    4  
ATOM   1644 H  HA   . PHE A 1 12 ? 6.856   -8.325  4.117  1.00 0.00 ? 113 PHE A HA   4  
ATOM   1645 H  HB2  . PHE A 1 12 ? 4.829   -9.739  2.280  1.00 0.00 ? 113 PHE A HB2  4  
ATOM   1646 H  HB3  . PHE A 1 12 ? 6.436   -10.354 2.614  1.00 0.00 ? 113 PHE A HB3  4  
ATOM   1647 H  HD1  . PHE A 1 12 ? 7.000   -11.155 4.900  1.00 0.00 ? 113 PHE A HD1  4  
ATOM   1648 H  HD2  . PHE A 1 12 ? 3.046   -10.041 3.836  1.00 0.00 ? 113 PHE A HD2  4  
ATOM   1649 H  HE1  . PHE A 1 12 ? 6.115   -12.382 6.904  1.00 0.00 ? 113 PHE A HE1  4  
ATOM   1650 H  HE2  . PHE A 1 12 ? 2.161   -11.267 5.840  1.00 0.00 ? 113 PHE A HE2  4  
ATOM   1651 H  HZ   . PHE A 1 12 ? 3.706   -12.423 7.349  1.00 0.00 ? 113 PHE A HZ   4  
ATOM   1652 N  N    . ALA A 1 13 ? 7.836   -8.167  1.693  1.00 0.00 ? 114 ALA A N    4  
ATOM   1653 C  CA   . ALA A 1 13 ? 8.480   -7.660  0.492  1.00 0.00 ? 114 ALA A CA   4  
ATOM   1654 C  C    . ALA A 1 13 ? 8.154   -8.582  -0.685 1.00 0.00 ? 114 ALA A C    4  
ATOM   1655 O  O    . ALA A 1 13 ? 7.980   -8.119  -1.811 1.00 0.00 ? 114 ALA A O    4  
ATOM   1656 C  CB   . ALA A 1 13 ? 9.985   -7.533  0.734  1.00 0.00 ? 114 ALA A CB   4  
ATOM   1657 H  H    . ALA A 1 13 ? 8.366   -8.847  2.200  1.00 0.00 ? 114 ALA A H    4  
ATOM   1658 H  HA   . ALA A 1 13 ? 8.072   -6.669  0.291  1.00 0.00 ? 114 ALA A HA   4  
ATOM   1659 H  HB1  . ALA A 1 13 ? 10.238  -7.979  1.696  1.00 0.00 ? 114 ALA A HB1  4  
ATOM   1660 H  HB2  . ALA A 1 13 ? 10.525  -8.049  -0.059 1.00 0.00 ? 114 ALA A HB2  4  
ATOM   1661 H  HB3  . ALA A 1 13 ? 10.265  -6.479  0.738  1.00 0.00 ? 114 ALA A HB3  4  
ATOM   1662 N  N    . ARG A 1 14 ? 8.081   -9.870  -0.383 1.00 0.00 ? 115 ARG A N    4  
ATOM   1663 C  CA   . ARG A 1 14 ? 7.779   -10.861 -1.402 1.00 0.00 ? 115 ARG A CA   4  
ATOM   1664 C  C    . ARG A 1 14 ? 6.370   -11.420 -1.197 1.00 0.00 ? 115 ARG A C    4  
ATOM   1665 O  O    . ARG A 1 14 ? 5.989   -11.759 -0.077 1.00 0.00 ? 115 ARG A O    4  
ATOM   1666 C  CB   . ARG A 1 14 ? 8.787   -12.012 -1.366 1.00 0.00 ? 115 ARG A CB   4  
ATOM   1667 C  CG   . ARG A 1 14 ? 10.209  -11.502 -1.607 1.00 0.00 ? 115 ARG A CG   4  
ATOM   1668 C  CD   . ARG A 1 14 ? 10.219  -10.364 -2.629 1.00 0.00 ? 115 ARG A CD   4  
ATOM   1669 N  NE   . ARG A 1 14 ? 11.602  -10.108 -3.089 1.00 0.00 ? 115 ARG A NE   4  
ATOM   1670 C  CZ   . ARG A 1 14 ? 12.695  -10.360 -2.359 1.00 0.00 ? 115 ARG A CZ   4  
ATOM   1671 N  NH1  . ARG A 1 14 ? 12.831  -9.810  -1.144 1.00 0.00 ? 115 ARG A NH1  4  
ATOM   1672 N  NH2  . ARG A 1 14 ? 13.654  -11.162 -2.841 1.00 0.00 ? 115 ARG A NH2  4  
ATOM   1673 H  H    . ARG A 1 14 ? 8.224   -10.238 0.536  1.00 0.00 ? 115 ARG A H    4  
ATOM   1674 H  HA   . ARG A 1 14 ? 7.853   -10.322 -2.346 1.00 0.00 ? 115 ARG A HA   4  
ATOM   1675 H  HB2  . ARG A 1 14 ? 8.736   -12.516 -0.401 1.00 0.00 ? 115 ARG A HB2  4  
ATOM   1676 H  HB3  . ARG A 1 14 ? 8.528   -12.749 -2.126 1.00 0.00 ? 115 ARG A HB3  4  
ATOM   1677 H  HG2  . ARG A 1 14 ? 10.639  -11.155 -0.666 1.00 0.00 ? 115 ARG A HG2  4  
ATOM   1678 H  HG3  . ARG A 1 14 ? 10.837  -12.319 -1.961 1.00 0.00 ? 115 ARG A HG3  4  
ATOM   1679 H  HD2  . ARG A 1 14 ? 9.585   -10.621 -3.478 1.00 0.00 ? 115 ARG A HD2  4  
ATOM   1680 H  HD3  . ARG A 1 14 ? 9.802   -9.460  -2.183 1.00 0.00 ? 115 ARG A HD3  4  
ATOM   1681 H  HE   . ARG A 1 14 ? 11.728  -9.724  -4.004 1.00 0.00 ? 115 ARG A HE   4  
ATOM   1682 H  HH11 . ARG A 1 14 ? 12.026  -9.665  -0.568 1.00 0.00 ? 115 ARG A HH11 4  
ATOM   1683 H  HH12 . ARG A 1 14 ? 13.737  -9.544  -0.814 1.00 0.00 ? 115 ARG A HH12 4  
ATOM   1684 H  HH21 . ARG A 1 14 ? 14.292  -10.820 -3.531 1.00 0.00 ? 115 ARG A HH21 4  
ATOM   1685 H  HH22 . ARG A 1 14 ? 13.732  -12.103 -2.512 1.00 0.00 ? 115 ARG A HH22 4  
ATOM   1686 N  N    . GLN A 1 15 ? 5.634   -11.500 -2.295 1.00 0.00 ? 116 GLN A N    4  
ATOM   1687 C  CA   . GLN A 1 15 ? 4.275   -12.012 -2.250 1.00 0.00 ? 116 GLN A CA   4  
ATOM   1688 C  C    . GLN A 1 15 ? 4.258   -13.422 -1.655 1.00 0.00 ? 116 GLN A C    4  
ATOM   1689 O  O    . GLN A 1 15 ? 3.338   -13.780 -0.922 1.00 0.00 ? 116 GLN A O    4  
ATOM   1690 C  CB   . GLN A 1 15 ? 3.636   -11.996 -3.641 1.00 0.00 ? 116 GLN A CB   4  
ATOM   1691 C  CG   . GLN A 1 15 ? 2.237   -11.379 -3.594 1.00 0.00 ? 116 GLN A CG   4  
ATOM   1692 C  CD   . GLN A 1 15 ? 1.574   -11.419 -4.972 1.00 0.00 ? 116 GLN A CD   4  
ATOM   1693 O  OE1  . GLN A 1 15 ? 0.905   -10.490 -5.396 1.00 0.00 ? 116 GLN A OE1  4  
ATOM   1694 N  NE2  . GLN A 1 15 ? 1.796   -12.544 -5.647 1.00 0.00 ? 116 GLN A NE2  4  
ATOM   1695 H  H    . GLN A 1 15 ? 5.950   -11.222 -3.202 1.00 0.00 ? 116 GLN A H    4  
ATOM   1696 H  HA   . GLN A 1 15 ? 3.729   -11.330 -1.598 1.00 0.00 ? 116 GLN A HA   4  
ATOM   1697 H  HB2  . GLN A 1 15 ? 4.265   -11.429 -4.327 1.00 0.00 ? 116 GLN A HB2  4  
ATOM   1698 H  HB3  . GLN A 1 15 ? 3.576   -13.013 -4.029 1.00 0.00 ? 116 GLN A HB3  4  
ATOM   1699 H  HG2  . GLN A 1 15 ? 1.621   -11.918 -2.875 1.00 0.00 ? 116 GLN A HG2  4  
ATOM   1700 H  HG3  . GLN A 1 15 ? 2.302   -10.348 -3.248 1.00 0.00 ? 116 GLN A HG3  4  
ATOM   1701 H  HE21 . GLN A 1 15 ? 2.679   -13.007 -5.570 1.00 0.00 ? 116 GLN A HE21 4  
ATOM   1702 H  HE22 . GLN A 1 15 ? 1.081   -12.925 -6.232 1.00 0.00 ? 116 GLN A HE22 4  
ATOM   1703 N  N    . GLU A 1 16 ? 5.288   -14.184 -1.993 1.00 0.00 ? 117 GLU A N    4  
ATOM   1704 C  CA   . GLU A 1 16 ? 5.404   -15.546 -1.502 1.00 0.00 ? 117 GLU A CA   4  
ATOM   1705 C  C    . GLU A 1 16 ? 5.460   -15.556 0.026  1.00 0.00 ? 117 GLU A C    4  
ATOM   1706 O  O    . GLU A 1 16 ? 4.872   -16.426 0.668  1.00 0.00 ? 117 GLU A O    4  
ATOM   1707 C  CB   . GLU A 1 16 ? 6.627   -16.244 -2.101 1.00 0.00 ? 117 GLU A CB   4  
ATOM   1708 C  CG   . GLU A 1 16 ? 7.215   -17.258 -1.118 1.00 0.00 ? 117 GLU A CG   4  
ATOM   1709 C  CD   . GLU A 1 16 ? 7.921   -18.394 -1.861 1.00 0.00 ? 117 GLU A CD   4  
ATOM   1710 O  OE1  . GLU A 1 16 ? 8.438   -18.117 -2.964 1.00 0.00 ? 117 GLU A OE1  4  
ATOM   1711 O  OE2  . GLU A 1 16 ? 7.926   -19.516 -1.309 1.00 0.00 ? 117 GLU A OE2  4  
ATOM   1712 H  H    . GLU A 1 16 ? 6.033   -13.885 -2.590 1.00 0.00 ? 117 GLU A H    4  
ATOM   1713 H  HA   . GLU A 1 16 ? 4.501   -16.054 -1.842 1.00 0.00 ? 117 GLU A HA   4  
ATOM   1714 H  HB2  . GLU A 1 16 ? 6.347   -16.747 -3.025 1.00 0.00 ? 117 GLU A HB2  4  
ATOM   1715 H  HB3  . GLU A 1 16 ? 7.383   -15.501 -2.359 1.00 0.00 ? 117 GLU A HB3  4  
ATOM   1716 H  HG2  . GLU A 1 16 ? 7.921   -16.760 -0.454 1.00 0.00 ? 117 GLU A HG2  4  
ATOM   1717 H  HG3  . GLU A 1 16 ? 6.422   -17.666 -0.492 1.00 0.00 ? 117 GLU A HG3  4  
ATOM   1718 N  N    . ALA A 1 17 ? 6.173   -14.579 0.567  1.00 0.00 ? 118 ALA A N    4  
ATOM   1719 C  CA   . ALA A 1 17 ? 6.315   -14.465 2.009  1.00 0.00 ? 118 ALA A CA   4  
ATOM   1720 C  C    . ALA A 1 17 ? 4.934   -14.277 2.639  1.00 0.00 ? 118 ALA A C    4  
ATOM   1721 O  O    . ALA A 1 17 ? 4.726   -14.615 3.802  1.00 0.00 ? 118 ALA A O    4  
ATOM   1722 C  CB   . ALA A 1 17 ? 7.267   -13.314 2.339  1.00 0.00 ? 118 ALA A CB   4  
ATOM   1723 H  H    . ALA A 1 17 ? 6.648   -13.876 0.039  1.00 0.00 ? 118 ALA A H    4  
ATOM   1724 H  HA   . ALA A 1 17 ? 6.748   -15.395 2.374  1.00 0.00 ? 118 ALA A HA   4  
ATOM   1725 H  HB1  . ALA A 1 17 ? 8.249   -13.521 1.914  1.00 0.00 ? 118 ALA A HB1  4  
ATOM   1726 H  HB2  . ALA A 1 17 ? 6.878   -12.387 1.917  1.00 0.00 ? 118 ALA A HB2  4  
ATOM   1727 H  HB3  . ALA A 1 17 ? 7.353   -13.212 3.420  1.00 0.00 ? 118 ALA A HB3  4  
ATOM   1728 N  N    . LEU A 1 18 ? 4.022   -13.738 1.842  1.00 0.00 ? 119 LEU A N    4  
ATOM   1729 C  CA   . LEU A 1 18 ? 2.666   -13.500 2.306  1.00 0.00 ? 119 LEU A CA   4  
ATOM   1730 C  C    . LEU A 1 18 ? 1.863   -14.799 2.206  1.00 0.00 ? 119 LEU A C    4  
ATOM   1731 O  O    . LEU A 1 18 ? 1.499   -15.387 3.223  1.00 0.00 ? 119 LEU A O    4  
ATOM   1732 C  CB   . LEU A 1 18 ? 2.038   -12.329 1.550  1.00 0.00 ? 119 LEU A CB   4  
ATOM   1733 C  CG   . LEU A 1 18 ? 0.512   -12.231 1.613  1.00 0.00 ? 119 LEU A CG   4  
ATOM   1734 C  CD1  . LEU A 1 18 ? 0.029   -12.118 3.060  1.00 0.00 ? 119 LEU A CD1  4  
ATOM   1735 C  CD2  . LEU A 1 18 ? 0.000   -11.078 0.747  1.00 0.00 ? 119 LEU A CD2  4  
ATOM   1736 H  H    . LEU A 1 18 ? 4.198   -13.465 0.896  1.00 0.00 ? 119 LEU A H    4  
ATOM   1737 H  HA   . LEU A 1 18 ? 2.727   -13.211 3.355  1.00 0.00 ? 119 LEU A HA   4  
ATOM   1738 H  HB2  . LEU A 1 18 ? 2.458   -11.402 1.941  1.00 0.00 ? 119 LEU A HB2  4  
ATOM   1739 H  HB3  . LEU A 1 18 ? 2.334   -12.396 0.503  1.00 0.00 ? 119 LEU A HB3  4  
ATOM   1740 H  HG   . LEU A 1 18 ? 0.094   -13.150 1.205  1.00 0.00 ? 119 LEU A HG   4  
ATOM   1741 H  HD11 . LEU A 1 18 ? -0.364  -11.117 3.236  1.00 0.00 ? 119 LEU A HD11 4  
ATOM   1742 H  HD12 . LEU A 1 18 ? -0.755  -12.853 3.240  1.00 0.00 ? 119 LEU A HD12 4  
ATOM   1743 H  HD13 . LEU A 1 18 ? 0.864   -12.304 3.738  1.00 0.00 ? 119 LEU A HD13 4  
ATOM   1744 H  HD21 . LEU A 1 18 ? 0.044   -11.366 -0.304 1.00 0.00 ? 119 LEU A HD21 4  
ATOM   1745 H  HD22 . LEU A 1 18 ? -1.030  -10.849 1.019  1.00 0.00 ? 119 LEU A HD22 4  
ATOM   1746 H  HD23 . LEU A 1 18 ? 0.622   -10.198 0.909  1.00 0.00 ? 119 LEU A HD23 4  
ATOM   1747 N  N    . LYS A 1 19 ? 1.612   -15.208 0.971  1.00 0.00 ? 120 LYS A N    4  
ATOM   1748 C  CA   . LYS A 1 19 ? 0.860   -16.426 0.725  1.00 0.00 ? 120 LYS A CA   4  
ATOM   1749 C  C    . LYS A 1 19 ? 1.188   -17.453 1.811  1.00 0.00 ? 120 LYS A C    4  
ATOM   1750 O  O    . LYS A 1 19 ? 0.290   -17.977 2.467  1.00 0.00 ? 120 LYS A O    4  
ATOM   1751 C  CB   . LYS A 1 19 ? 1.110   -16.933 -0.697 1.00 0.00 ? 120 LYS A CB   4  
ATOM   1752 C  CG   . LYS A 1 19 ? -0.199  -17.035 -1.481 1.00 0.00 ? 120 LYS A CG   4  
ATOM   1753 C  CD   . LYS A 1 19 ? -0.053  -17.985 -2.672 1.00 0.00 ? 120 LYS A CD   4  
ATOM   1754 C  CE   . LYS A 1 19 ? -0.287  -17.249 -3.993 1.00 0.00 ? 120 LYS A CE   4  
ATOM   1755 N  NZ   . LYS A 1 19 ? -1.672  -17.468 -4.469 1.00 0.00 ? 120 LYS A NZ   4  
ATOM   1756 H  H    . LYS A 1 19 ? 1.912   -14.723 0.150  1.00 0.00 ? 120 LYS A H    4  
ATOM   1757 H  HA   . LYS A 1 19 ? -0.199  -16.176 0.796  1.00 0.00 ? 120 LYS A HA   4  
ATOM   1758 H  HB2  . LYS A 1 19 ? 1.795   -16.260 -1.211 1.00 0.00 ? 120 LYS A HB2  4  
ATOM   1759 H  HB3  . LYS A 1 19 ? 1.592   -17.909 -0.659 1.00 0.00 ? 120 LYS A HB3  4  
ATOM   1760 H  HG2  . LYS A 1 19 ? -0.995  -17.389 -0.825 1.00 0.00 ? 120 LYS A HG2  4  
ATOM   1761 H  HG3  . LYS A 1 19 ? -0.494  -16.047 -1.834 1.00 0.00 ? 120 LYS A HG3  4  
ATOM   1762 H  HD2  . LYS A 1 19 ? 0.944   -18.426 -2.669 1.00 0.00 ? 120 LYS A HD2  4  
ATOM   1763 H  HD3  . LYS A 1 19 ? -0.765  -18.805 -2.576 1.00 0.00 ? 120 LYS A HD3  4  
ATOM   1764 H  HE2  . LYS A 1 19 ? -0.107  -16.182 -3.858 1.00 0.00 ? 120 LYS A HE2  4  
ATOM   1765 H  HE3  . LYS A 1 19 ? 0.421   -17.601 -4.742 1.00 0.00 ? 120 LYS A HE3  4  
ATOM   1766 H  HZ1  . LYS A 1 19 ? -2.312  -17.311 -3.717 1.00 0.00 ? 120 LYS A HZ1  4  
ATOM   1767 H  HZ2  . LYS A 1 19 ? -1.872  -16.832 -5.214 1.00 0.00 ? 120 LYS A HZ2  4  
ATOM   1768 H  HZ3  . LYS A 1 19 ? -1.766  -18.407 -4.797 1.00 0.00 ? 120 LYS A HZ3  4  
ATOM   1769 N  N    . ARG A 1 20 ? 2.479   -17.708 1.967  1.00 0.00 ? 121 ARG A N    4  
ATOM   1770 C  CA   . ARG A 1 20 ? 2.937   -18.662 2.961  1.00 0.00 ? 121 ARG A CA   4  
ATOM   1771 C  C    . ARG A 1 20 ? 2.399   -18.288 4.344  1.00 0.00 ? 121 ARG A C    4  
ATOM   1772 O  O    . ARG A 1 20 ? 1.833   -19.129 5.041  1.00 0.00 ? 121 ARG A O    4  
ATOM   1773 C  CB   . ARG A 1 20 ? 4.466   -18.712 3.013  1.00 0.00 ? 121 ARG A CB   4  
ATOM   1774 C  CG   . ARG A 1 20 ? 4.947   -19.678 4.098  1.00 0.00 ? 121 ARG A CG   4  
ATOM   1775 C  CD   . ARG A 1 20 ? 5.320   -21.035 3.497  1.00 0.00 ? 121 ARG A CD   4  
ATOM   1776 N  NE   . ARG A 1 20 ? 6.285   -20.851 2.391  1.00 0.00 ? 121 ARG A NE   4  
ATOM   1777 C  CZ   . ARG A 1 20 ? 6.738   -21.845 1.615  1.00 0.00 ? 121 ARG A CZ   4  
ATOM   1778 N  NH1  . ARG A 1 20 ? 6.447   -23.117 1.919  1.00 0.00 ? 121 ARG A NH1  4  
ATOM   1779 N  NH2  . ARG A 1 20 ? 7.480   -21.567 0.535  1.00 0.00 ? 121 ARG A NH2  4  
ATOM   1780 H  H    . ARG A 1 20 ? 3.204   -17.278 1.428  1.00 0.00 ? 121 ARG A H    4  
ATOM   1781 H  HA   . ARG A 1 20 ? 2.539   -19.622 2.631  1.00 0.00 ? 121 ARG A HA   4  
ATOM   1782 H  HB2  . ARG A 1 20 ? 4.857   -19.024 2.044  1.00 0.00 ? 121 ARG A HB2  4  
ATOM   1783 H  HB3  . ARG A 1 20 ? 4.859   -17.714 3.209  1.00 0.00 ? 121 ARG A HB3  4  
ATOM   1784 H  HG2  . ARG A 1 20 ? 5.811   -19.254 4.611  1.00 0.00 ? 121 ARG A HG2  4  
ATOM   1785 H  HG3  . ARG A 1 20 ? 4.164   -19.810 4.846  1.00 0.00 ? 121 ARG A HG3  4  
ATOM   1786 H  HD2  . ARG A 1 20 ? 5.752   -21.675 4.265  1.00 0.00 ? 121 ARG A HD2  4  
ATOM   1787 H  HD3  . ARG A 1 20 ? 4.425   -21.537 3.129  1.00 0.00 ? 121 ARG A HD3  4  
ATOM   1788 H  HE   . ARG A 1 20 ? 6.622   -19.926 2.212  1.00 0.00 ? 121 ARG A HE   4  
ATOM   1789 H  HH11 . ARG A 1 20 ? 7.006   -23.612 2.586  1.00 0.00 ? 121 ARG A HH11 4  
ATOM   1790 H  HH12 . ARG A 1 20 ? 5.673   -23.573 1.480  1.00 0.00 ? 121 ARG A HH12 4  
ATOM   1791 H  HH21 . ARG A 1 20 ? 8.324   -21.038 0.630  1.00 0.00 ? 121 ARG A HH21 4  
ATOM   1792 H  HH22 . ARG A 1 20 ? 7.191   -21.889 -0.367 1.00 0.00 ? 121 ARG A HH22 4  
ATOM   1793 N  N    . HIS A 1 21 ? 2.595   -17.027 4.699  1.00 0.00 ? 122 HIS A N    4  
ATOM   1794 C  CA   . HIS A 1 21 ? 2.136   -16.532 5.985  1.00 0.00 ? 122 HIS A CA   4  
ATOM   1795 C  C    . HIS A 1 21 ? 0.663   -16.898 6.180  1.00 0.00 ? 122 HIS A C    4  
ATOM   1796 O  O    . HIS A 1 21 ? 0.283   -17.418 7.227  1.00 0.00 ? 122 HIS A O    4  
ATOM   1797 C  CB   . HIS A 1 21 ? 2.396   -15.029 6.113  1.00 0.00 ? 122 HIS A CB   4  
ATOM   1798 C  CG   . HIS A 1 21 ? 1.525   -14.341 7.136  1.00 0.00 ? 122 HIS A CG   4  
ATOM   1799 N  ND1  . HIS A 1 21 ? 1.903   -14.183 8.458  1.00 0.00 ? 122 HIS A ND1  4  
ATOM   1800 C  CD2  . HIS A 1 21 ? 0.293   -13.769 7.018  1.00 0.00 ? 122 HIS A CD2  4  
ATOM   1801 C  CE1  . HIS A 1 21 ? 0.934   -13.545 9.097  1.00 0.00 ? 122 HIS A CE1  4  
ATOM   1802 N  NE2  . HIS A 1 21 ? -0.064  -13.290 8.203  1.00 0.00 ? 122 HIS A NE2  4  
ATOM   1803 H  H    . HIS A 1 21 ? 3.058   -16.351 4.125  1.00 0.00 ? 122 HIS A H    4  
ATOM   1804 H  HA   . HIS A 1 21 ? 2.731   -17.037 6.746  1.00 0.00 ? 122 HIS A HA   4  
ATOM   1805 H  HB2  . HIS A 1 21 ? 3.442   -14.874 6.376  1.00 0.00 ? 122 HIS A HB2  4  
ATOM   1806 H  HB3  . HIS A 1 21 ? 2.238   -14.560 5.142  1.00 0.00 ? 122 HIS A HB3  4  
ATOM   1807 H  HD1  . HIS A 1 21 ? 2.762   -14.498 8.862  1.00 0.00 ? 122 HIS A HD1  4  
ATOM   1808 H  HD2  . HIS A 1 21 ? -0.299  -13.715 6.103  1.00 0.00 ? 122 HIS A HD2  4  
ATOM   1809 H  HE1  . HIS A 1 21 ? 0.932   -13.273 10.153 1.00 0.00 ? 122 HIS A HE1  4  
ATOM   1810 N  N    . TYR A 1 22 ? -0.125  -16.612 5.154  1.00 0.00 ? 123 TYR A N    4  
ATOM   1811 C  CA   . TYR A 1 22 ? -1.548  -16.904 5.199  1.00 0.00 ? 123 TYR A CA   4  
ATOM   1812 C  C    . TYR A 1 22 ? -1.797  -18.345 5.646  1.00 0.00 ? 123 TYR A C    4  
ATOM   1813 O  O    . TYR A 1 22 ? -2.694  -18.605 6.447  1.00 0.00 ? 123 TYR A O    4  
ATOM   1814 C  CB   . TYR A 1 22 ? -2.060  -16.730 3.769  1.00 0.00 ? 123 TYR A CB   4  
ATOM   1815 C  CG   . TYR A 1 22 ? -3.181  -15.697 3.629  1.00 0.00 ? 123 TYR A CG   4  
ATOM   1816 C  CD1  . TYR A 1 22 ? -4.460  -16.006 4.046  1.00 0.00 ? 123 TYR A CD1  4  
ATOM   1817 C  CD2  . TYR A 1 22 ? -2.912  -14.456 3.089  1.00 0.00 ? 123 TYR A CD2  4  
ATOM   1818 C  CE1  . TYR A 1 22 ? -5.514  -15.036 3.915  1.00 0.00 ? 123 TYR A CE1  4  
ATOM   1819 C  CE2  . TYR A 1 22 ? -3.967  -13.485 2.958  1.00 0.00 ? 123 TYR A CE2  4  
ATOM   1820 C  CZ   . TYR A 1 22 ? -5.216  -13.822 3.378  1.00 0.00 ? 123 TYR A CZ   4  
ATOM   1821 O  OH   . TYR A 1 22 ? -6.212  -12.904 3.254  1.00 0.00 ? 123 TYR A OH   4  
ATOM   1822 H  H    . TYR A 1 22 ? 0.192   -16.188 4.306  1.00 0.00 ? 123 TYR A H    4  
ATOM   1823 H  HA   . TYR A 1 22 ? -2.008  -16.223 5.917  1.00 0.00 ? 123 TYR A HA   4  
ATOM   1824 H  HB2  . TYR A 1 22 ? -1.227  -16.435 3.129  1.00 0.00 ? 123 TYR A HB2  4  
ATOM   1825 H  HB3  . TYR A 1 22 ? -2.419  -17.691 3.402  1.00 0.00 ? 123 TYR A HB3  4  
ATOM   1826 H  HD1  . TYR A 1 22 ? -4.671  -16.987 4.472  1.00 0.00 ? 123 TYR A HD1  4  
ATOM   1827 H  HD2  . TYR A 1 22 ? -1.902  -14.211 2.760  1.00 0.00 ? 123 TYR A HD2  4  
ATOM   1828 H  HE1  . TYR A 1 22 ? -6.529  -15.267 4.239  1.00 0.00 ? 123 TYR A HE1  4  
ATOM   1829 H  HE2  . TYR A 1 22 ? -3.769  -12.500 2.533  1.00 0.00 ? 123 TYR A HE2  4  
ATOM   1830 H  HH   . TYR A 1 22 ? -7.075  -13.363 3.039  1.00 0.00 ? 123 TYR A HH   4  
ATOM   1831 N  N    . ARG A 1 23 ? -0.988  -19.246 5.110  1.00 0.00 ? 124 ARG A N    4  
ATOM   1832 C  CA   . ARG A 1 23 ? -1.109  -20.655 5.442  1.00 0.00 ? 124 ARG A CA   4  
ATOM   1833 C  C    . ARG A 1 23 ? -1.112  -20.843 6.961  1.00 0.00 ? 124 ARG A C    4  
ATOM   1834 O  O    . ARG A 1 23 ? -1.699  -21.796 7.471  1.00 0.00 ? 124 ARG A O    4  
ATOM   1835 C  CB   . ARG A 1 23 ? 0.038   -21.465 4.836  1.00 0.00 ? 124 ARG A CB   4  
ATOM   1836 C  CG   . ARG A 1 23 ? 1.117   -21.755 5.883  1.00 0.00 ? 124 ARG A CG   4  
ATOM   1837 C  CD   . ARG A 1 23 ? 2.324   -22.450 5.248  1.00 0.00 ? 124 ARG A CD   4  
ATOM   1838 N  NE   . ARG A 1 23 ? 1.878   -23.337 4.150  1.00 0.00 ? 124 ARG A NE   4  
ATOM   1839 C  CZ   . ARG A 1 23 ? 2.603   -23.600 3.056  1.00 0.00 ? 124 ARG A CZ   4  
ATOM   1840 N  NH1  . ARG A 1 23 ? 3.846   -24.088 3.177  1.00 0.00 ? 124 ARG A NH1  4  
ATOM   1841 N  NH2  . ARG A 1 23 ? 2.088   -23.376 1.840  1.00 0.00 ? 124 ARG A NH2  4  
ATOM   1842 H  H    . ARG A 1 23 ? -0.260  -19.027 4.458  1.00 0.00 ? 124 ARG A H    4  
ATOM   1843 H  HA   . ARG A 1 23 ? -2.061  -20.963 5.007  1.00 0.00 ? 124 ARG A HA   4  
ATOM   1844 H  HB2  . ARG A 1 23 ? -0.346  -22.403 4.436  1.00 0.00 ? 124 ARG A HB2  4  
ATOM   1845 H  HB3  . ARG A 1 23 ? 0.475   -20.916 4.002  1.00 0.00 ? 124 ARG A HB3  4  
ATOM   1846 H  HG2  . ARG A 1 23 ? 1.434   -20.823 6.351  1.00 0.00 ? 124 ARG A HG2  4  
ATOM   1847 H  HG3  . ARG A 1 23 ? 0.704   -22.384 6.671  1.00 0.00 ? 124 ARG A HG3  4  
ATOM   1848 H  HD2  . ARG A 1 23 ? 3.022   -21.706 4.864  1.00 0.00 ? 124 ARG A HD2  4  
ATOM   1849 H  HD3  . ARG A 1 23 ? 2.857   -23.030 6.001  1.00 0.00 ? 124 ARG A HD3  4  
ATOM   1850 H  HE   . ARG A 1 23 ? 0.978   -23.767 4.232  1.00 0.00 ? 124 ARG A HE   4  
ATOM   1851 H  HH11 . ARG A 1 23 ? 4.615   -23.466 3.322  1.00 0.00 ? 124 ARG A HH11 4  
ATOM   1852 H  HH12 . ARG A 1 23 ? 4.003   -25.074 3.122  1.00 0.00 ? 124 ARG A HH12 4  
ATOM   1853 H  HH21 . ARG A 1 23 ? 1.178   -22.971 1.750  1.00 0.00 ? 124 ARG A HH21 4  
ATOM   1854 H  HH22 . ARG A 1 23 ? 2.613   -23.614 1.022  1.00 0.00 ? 124 ARG A HH22 4  
ATOM   1855 N  N    . SER A 1 24 ? -0.448  -19.919 7.640  1.00 0.00 ? 125 SER A N    4  
ATOM   1856 C  CA   . SER A 1 24 ? -0.366  -19.972 9.090  1.00 0.00 ? 125 SER A CA   4  
ATOM   1857 C  C    . SER A 1 24 ? -1.737  -19.677 9.702  1.00 0.00 ? 125 SER A C    4  
ATOM   1858 O  O    . SER A 1 24 ? -2.039  -20.133 10.804 1.00 0.00 ? 125 SER A O    4  
ATOM   1859 C  CB   . SER A 1 24 ? 0.675   -18.983 9.619  1.00 0.00 ? 125 SER A CB   4  
ATOM   1860 O  OG   . SER A 1 24 ? 0.211   -17.637 9.558  1.00 0.00 ? 125 SER A OG   4  
ATOM   1861 H  H    . SER A 1 24 ? 0.027   -19.147 7.218  1.00 0.00 ? 125 SER A H    4  
ATOM   1862 H  HA   . SER A 1 24 ? -0.053  -20.989 9.325  1.00 0.00 ? 125 SER A HA   4  
ATOM   1863 H  HB2  . SER A 1 24 ? 0.923   -19.235 10.650 1.00 0.00 ? 125 SER A HB2  4  
ATOM   1864 H  HB3  . SER A 1 24 ? 1.593   -19.077 9.039  1.00 0.00 ? 125 SER A HB3  4  
ATOM   1865 H  HG   . SER A 1 24 ? 0.772   -17.111 8.919  1.00 0.00 ? 125 SER A HG   4  
ATOM   1866 N  N    . HIS A 1 25 ? -2.530  -18.918 8.961  1.00 0.00 ? 126 HIS A N    4  
ATOM   1867 C  CA   . HIS A 1 25 ? -3.862  -18.558 9.418  1.00 0.00 ? 126 HIS A CA   4  
ATOM   1868 C  C    . HIS A 1 25 ? -4.801  -19.755 9.256  1.00 0.00 ? 126 HIS A C    4  
ATOM   1869 O  O    . HIS A 1 25 ? -5.990  -19.660 9.557  1.00 0.00 ? 126 HIS A O    4  
ATOM   1870 C  CB   . HIS A 1 25 ? -4.365  -17.308 8.693  1.00 0.00 ? 126 HIS A CB   4  
ATOM   1871 C  CG   . HIS A 1 25 ? -3.657  -16.037 9.098  1.00 0.00 ? 126 HIS A CG   4  
ATOM   1872 N  ND1  . HIS A 1 25 ? -3.371  -15.725 10.416 1.00 0.00 ? 126 HIS A ND1  4  
ATOM   1873 C  CD2  . HIS A 1 25 ? -3.181  -15.003 8.346  1.00 0.00 ? 126 HIS A CD2  4  
ATOM   1874 C  CE1  . HIS A 1 25 ? -2.751  -14.555 10.445 1.00 0.00 ? 126 HIS A CE1  4  
ATOM   1875 N  NE2  . HIS A 1 25 ? -2.635  -14.109 9.161  1.00 0.00 ? 126 HIS A NE2  4  
ATOM   1876 H  H    . HIS A 1 25 ? -2.277  -18.552 8.066  1.00 0.00 ? 126 HIS A H    4  
ATOM   1877 H  HA   . HIS A 1 25 ? -3.775  -18.315 10.477 1.00 0.00 ? 126 HIS A HA   4  
ATOM   1878 H  HB2  . HIS A 1 25 ? -4.247  -17.451 7.619  1.00 0.00 ? 126 HIS A HB2  4  
ATOM   1879 H  HB3  . HIS A 1 25 ? -5.431  -17.194 8.884  1.00 0.00 ? 126 HIS A HB3  4  
ATOM   1880 H  HD1  . HIS A 1 25 ? -3.594  -16.288 11.212 1.00 0.00 ? 126 HIS A HD1  4  
ATOM   1881 H  HD2  . HIS A 1 25 ? -3.238  -14.925 7.260  1.00 0.00 ? 126 HIS A HD2  4  
ATOM   1882 H  HE1  . HIS A 1 25 ? -2.396  -14.039 11.337 1.00 0.00 ? 126 HIS A HE1  4  
ATOM   1883 N  N    . THR A 1 26 ? -4.232  -20.853 8.781  1.00 0.00 ? 127 THR A N    4  
ATOM   1884 C  CA   . THR A 1 26 ? -5.004  -22.067 8.575  1.00 0.00 ? 127 THR A CA   4  
ATOM   1885 C  C    . THR A 1 26 ? -4.329  -23.252 9.270  1.00 0.00 ? 127 THR A C    4  
ATOM   1886 O  O    . THR A 1 26 ? -4.460  -23.422 10.480 1.00 0.00 ? 127 THR A O    4  
ATOM   1887 C  CB   . THR A 1 26 ? -5.180  -22.265 7.068  1.00 0.00 ? 127 THR A CB   4  
ATOM   1888 O  OG1  . THR A 1 26 ? -3.855  -22.197 6.551  1.00 0.00 ? 127 THR A OG1  4  
ATOM   1889 C  CG2  . THR A 1 26 ? -5.901  -21.091 6.404  1.00 0.00 ? 127 THR A CG2  4  
ATOM   1890 H  H    . THR A 1 26 ? -3.265  -20.921 8.538  1.00 0.00 ? 127 THR A H    4  
ATOM   1891 H  HA   . THR A 1 26 ? -5.980  -21.937 9.042  1.00 0.00 ? 127 THR A HA   4  
ATOM   1892 H  HB   . THR A 1 26 ? -5.690  -23.205 6.857  1.00 0.00 ? 127 THR A HB   4  
ATOM   1893 H  HG1  . THR A 1 26 ? -3.760  -22.811 5.769  1.00 0.00 ? 127 THR A HG1  4  
ATOM   1894 H  HG21 . THR A 1 26 ? -6.757  -20.799 7.011  1.00 0.00 ? 127 THR A HG21 4  
ATOM   1895 H  HG22 . THR A 1 26 ? -5.215  -20.249 6.313  1.00 0.00 ? 127 THR A HG22 4  
ATOM   1896 H  HG23 . THR A 1 26 ? -6.244  -21.389 5.413  1.00 0.00 ? 127 THR A HG23 4  
ATOM   1897 N  N    . ASN A 1 27 ? -3.622  -24.039 8.472  1.00 0.00 ? 128 ASN A N    4  
ATOM   1898 C  CA   . ASN A 1 27 ? -2.927  -25.203 8.995  1.00 0.00 ? 128 ASN A CA   4  
ATOM   1899 C  C    . ASN A 1 27 ? -2.254  -25.950 7.842  1.00 0.00 ? 128 ASN A C    4  
ATOM   1900 O  O    . ASN A 1 27 ? -2.889  -26.758 7.167  1.00 0.00 ? 128 ASN A O    4  
ATOM   1901 C  CB   . ASN A 1 27 ? -3.899  -26.165 9.679  1.00 0.00 ? 128 ASN A CB   4  
ATOM   1902 C  CG   . ASN A 1 27 ? -3.160  -27.108 10.630 1.00 0.00 ? 128 ASN A CG   4  
ATOM   1903 O  OD1  . ASN A 1 27 ? -1.946  -27.222 10.613 1.00 0.00 ? 128 ASN A OD1  4  
ATOM   1904 N  ND2  . ASN A 1 27 ? -3.959  -27.778 11.456 1.00 0.00 ? 128 ASN A ND2  4  
ATOM   1905 H  H    . ASN A 1 27 ? -3.521  -23.892 7.488  1.00 0.00 ? 128 ASN A H    4  
ATOM   1906 H  HA   . ASN A 1 27 ? -2.207  -24.808 9.712  1.00 0.00 ? 128 ASN A HA   4  
ATOM   1907 H  HB2  . ASN A 1 27 ? -4.649  -25.598 10.233 1.00 0.00 ? 128 ASN A HB2  4  
ATOM   1908 H  HB3  . ASN A 1 27 ? -4.432  -26.746 8.925  1.00 0.00 ? 128 ASN A HB3  4  
ATOM   1909 H  HD21 . ASN A 1 27 ? -4.586  -28.469 11.096 1.00 0.00 ? 128 ASN A HD21 4  
ATOM   1910 H  HD22 . ASN A 1 27 ? -3.932  -27.590 12.438 1.00 0.00 ? 128 ASN A HD22 4  
ATOM   1911 N  N    . GLU A 1 28 ? -0.976  -25.653 7.652  1.00 0.00 ? 129 GLU A N    4  
ATOM   1912 C  CA   . GLU A 1 28 ? -0.211  -26.288 6.592  1.00 0.00 ? 129 GLU A CA   4  
ATOM   1913 C  C    . GLU A 1 28 ? 1.288   -26.076 6.821  1.00 0.00 ? 129 GLU A C    4  
ATOM   1914 O  O    . GLU A 1 28 ? 1.885   -25.170 6.243  1.00 0.00 ? 129 GLU A O    4  
ATOM   1915 C  CB   . GLU A 1 28 ? -0.636  -25.763 5.219  1.00 0.00 ? 129 GLU A CB   4  
ATOM   1916 C  CG   . GLU A 1 28 ? -1.492  -26.792 4.479  1.00 0.00 ? 129 GLU A CG   4  
ATOM   1917 C  CD   . GLU A 1 28 ? -0.673  -27.519 3.411  1.00 0.00 ? 129 GLU A CD   4  
ATOM   1918 O  OE1  . GLU A 1 28 ? 0.546   -27.675 3.637  1.00 0.00 ? 129 GLU A OE1  4  
ATOM   1919 O  OE2  . GLU A 1 28 ? -1.285  -27.902 2.390  1.00 0.00 ? 129 GLU A OE2  4  
ATOM   1920 H  H    . GLU A 1 28 ? -0.467  -24.996 8.206  1.00 0.00 ? 129 GLU A H    4  
ATOM   1921 H  HA   . GLU A 1 28 ? -0.449  -27.349 6.658  1.00 0.00 ? 129 GLU A HA   4  
ATOM   1922 H  HB2  . GLU A 1 28 ? -1.196  -24.835 5.339  1.00 0.00 ? 129 GLU A HB2  4  
ATOM   1923 H  HB3  . GLU A 1 28 ? 0.249   -25.526 4.627  1.00 0.00 ? 129 GLU A HB3  4  
ATOM   1924 H  HG2  . GLU A 1 28 ? -1.892  -27.515 5.190  1.00 0.00 ? 129 GLU A HG2  4  
ATOM   1925 H  HG3  . GLU A 1 28 ? -2.344  -26.296 4.015  1.00 0.00 ? 129 GLU A HG3  4  
ATOM   1926 N  N    . LYS A 1 29 ? 1.851   -26.929 7.664  1.00 0.00 ? 130 LYS A N    4  
ATOM   1927 C  CA   . LYS A 1 29 ? 3.268   -26.847 7.976  1.00 0.00 ? 130 LYS A CA   4  
ATOM   1928 C  C    . LYS A 1 29 ? 4.079   -27.015 6.690  1.00 0.00 ? 130 LYS A C    4  
ATOM   1929 O  O    . LYS A 1 29 ? 4.509   -26.030 6.091  1.00 0.00 ? 130 LYS A O    4  
ATOM   1930 C  CB   . LYS A 1 29 ? 3.634   -27.852 9.070  1.00 0.00 ? 130 LYS A CB   4  
ATOM   1931 C  CG   . LYS A 1 29 ? 3.599   -29.285 8.533  1.00 0.00 ? 130 LYS A CG   4  
ATOM   1932 C  CD   . LYS A 1 29 ? 2.348   -30.020 9.018  1.00 0.00 ? 130 LYS A CD   4  
ATOM   1933 C  CE   . LYS A 1 29 ? 2.671   -30.922 10.211 1.00 0.00 ? 130 LYS A CE   4  
ATOM   1934 N  NZ   . LYS A 1 29 ? 2.219   -30.294 11.473 1.00 0.00 ? 130 LYS A NZ   4  
ATOM   1935 H  H    . LYS A 1 29 ? 1.357   -27.663 8.130  1.00 0.00 ? 130 LYS A H    4  
ATOM   1936 H  HA   . LYS A 1 29 ? 3.458   -25.851 8.377  1.00 0.00 ? 130 LYS A HA   4  
ATOM   1937 H  HB2  . LYS A 1 29 ? 4.630   -27.630 9.455  1.00 0.00 ? 130 LYS A HB2  4  
ATOM   1938 H  HB3  . LYS A 1 29 ? 2.941   -27.756 9.905  1.00 0.00 ? 130 LYS A HB3  4  
ATOM   1939 H  HG2  . LYS A 1 29 ? 3.616   -29.268 7.443  1.00 0.00 ? 130 LYS A HG2  4  
ATOM   1940 H  HG3  . LYS A 1 29 ? 4.490   -29.821 8.858  1.00 0.00 ? 130 LYS A HG3  4  
ATOM   1941 H  HD2  . LYS A 1 29 ? 1.582   -29.298 9.300  1.00 0.00 ? 130 LYS A HD2  4  
ATOM   1942 H  HD3  . LYS A 1 29 ? 1.937   -30.620 8.206  1.00 0.00 ? 130 LYS A HD3  4  
ATOM   1943 H  HE2  . LYS A 1 29 ? 2.185   -31.890 10.085 1.00 0.00 ? 130 LYS A HE2  4  
ATOM   1944 H  HE3  . LYS A 1 29 ? 3.744   -31.107 10.254 1.00 0.00 ? 130 LYS A HE3  4  
ATOM   1945 H  HZ1  . LYS A 1 29 ? 2.802   -30.599 12.225 1.00 0.00 ? 130 LYS A HZ1  4  
ATOM   1946 H  HZ2  . LYS A 1 29 ? 2.275   -29.299 11.388 1.00 0.00 ? 130 LYS A HZ2  4  
ATOM   1947 H  HZ3  . LYS A 1 29 ? 1.271   -30.559 11.656 1.00 0.00 ? 130 LYS A HZ3  4  
HETATM 1948 ZN ZN   . ZN  B 2 .  ? -1.799  -12.368 8.604  1.00 0.00 ? 1   ZN  A ZN   4  
ATOM   1949 N  N    . ARG A 1 1  ? -0.968  -1.152  -4.582 1.00 0.00 ? 102 ARG A N    5  
ATOM   1950 C  CA   . ARG A 1 1  ? -1.048  -1.608  -3.205 1.00 0.00 ? 102 ARG A CA   5  
ATOM   1951 C  C    . ARG A 1 1  ? 0.216   -2.385  -2.828 1.00 0.00 ? 102 ARG A C    5  
ATOM   1952 O  O    . ARG A 1 1  ? 1.128   -2.524  -3.641 1.00 0.00 ? 102 ARG A O    5  
ATOM   1953 C  CB   . ARG A 1 1  ? -2.271  -2.503  -2.991 1.00 0.00 ? 102 ARG A CB   5  
ATOM   1954 C  CG   . ARG A 1 1  ? -2.559  -3.345  -4.236 1.00 0.00 ? 102 ARG A CG   5  
ATOM   1955 C  CD   . ARG A 1 1  ? -3.383  -2.554  -5.253 1.00 0.00 ? 102 ARG A CD   5  
ATOM   1956 N  NE   . ARG A 1 1  ? -4.824  -2.830  -5.060 1.00 0.00 ? 102 ARG A NE   5  
ATOM   1957 C  CZ   . ARG A 1 1  ? -5.498  -2.553  -3.936 1.00 0.00 ? 102 ARG A CZ   5  
ATOM   1958 N  NH1  . ARG A 1 1  ? -5.488  -3.425  -2.918 1.00 0.00 ? 102 ARG A NH1  5  
ATOM   1959 N  NH2  . ARG A 1 1  ? -6.182  -1.406  -3.829 1.00 0.00 ? 102 ARG A NH2  5  
ATOM   1960 H  H    . ARG A 1 1  ? -0.526  -1.789  -5.213 1.00 0.00 ? 102 ARG A H    5  
ATOM   1961 H  HA   . ARG A 1 1  ? -1.139  -0.696  -2.614 1.00 0.00 ? 102 ARG A HA   5  
ATOM   1962 H  HB2  . ARG A 1 1  ? -2.101  -3.158  -2.136 1.00 0.00 ? 102 ARG A HB2  5  
ATOM   1963 H  HB3  . ARG A 1 1  ? -3.139  -1.888  -2.754 1.00 0.00 ? 102 ARG A HB3  5  
ATOM   1964 H  HG2  . ARG A 1 1  ? -1.619  -3.661  -4.690 1.00 0.00 ? 102 ARG A HG2  5  
ATOM   1965 H  HG3  . ARG A 1 1  ? -3.095  -4.249  -3.950 1.00 0.00 ? 102 ARG A HG3  5  
ATOM   1966 H  HD2  . ARG A 1 1  ? -3.190  -1.487  -5.140 1.00 0.00 ? 102 ARG A HD2  5  
ATOM   1967 H  HD3  . ARG A 1 1  ? -3.084  -2.826  -6.266 1.00 0.00 ? 102 ARG A HD3  5  
ATOM   1968 H  HE   . ARG A 1 1  ? -5.326  -3.247  -5.817 1.00 0.00 ? 102 ARG A HE   5  
ATOM   1969 H  HH11 . ARG A 1 1  ? -5.426  -4.406  -3.100 1.00 0.00 ? 102 ARG A HH11 5  
ATOM   1970 H  HH12 . ARG A 1 1  ? -5.541  -3.093  -1.975 1.00 0.00 ? 102 ARG A HH12 5  
ATOM   1971 H  HH21 . ARG A 1 1  ? -6.244  -0.786  -4.610 1.00 0.00 ? 102 ARG A HH21 5  
ATOM   1972 H  HH22 . ARG A 1 1  ? -6.631  -1.170  -2.966 1.00 0.00 ? 102 ARG A HH22 5  
ATOM   1973 N  N    . SER A 1 2  ? 0.229   -2.869  -1.595 1.00 0.00 ? 103 SER A N    5  
ATOM   1974 C  CA   . SER A 1 2  ? 1.365   -3.628  -1.101 1.00 0.00 ? 103 SER A CA   5  
ATOM   1975 C  C    . SER A 1 2  ? 0.903   -4.996  -0.596 1.00 0.00 ? 103 SER A C    5  
ATOM   1976 O  O    . SER A 1 2  ? -0.295  -5.230  -0.439 1.00 0.00 ? 103 SER A O    5  
ATOM   1977 C  CB   . SER A 1 2  ? 2.092   -2.869  0.011  1.00 0.00 ? 103 SER A CB   5  
ATOM   1978 O  OG   . SER A 1 2  ? 3.366   -2.390  -0.413 1.00 0.00 ? 103 SER A OG   5  
ATOM   1979 H  H    . SER A 1 2  ? -0.518  -2.752  -0.940 1.00 0.00 ? 103 SER A H    5  
ATOM   1980 H  HA   . SER A 1 2  ? 2.030   -3.742  -1.958 1.00 0.00 ? 103 SER A HA   5  
ATOM   1981 H  HB2  . SER A 1 2  ? 1.479   -2.029  0.337  1.00 0.00 ? 103 SER A HB2  5  
ATOM   1982 H  HB3  . SER A 1 2  ? 2.220   -3.525  0.873  1.00 0.00 ? 103 SER A HB3  5  
ATOM   1983 H  HG   . SER A 1 2  ? 3.284   -1.448  -0.740 1.00 0.00 ? 103 SER A HG   5  
ATOM   1984 N  N    . PHE A 1 3  ? 1.874   -5.863  -0.356 1.00 0.00 ? 104 PHE A N    5  
ATOM   1985 C  CA   . PHE A 1 3  ? 1.582   -7.201  0.128  1.00 0.00 ? 104 PHE A CA   5  
ATOM   1986 C  C    . PHE A 1 3  ? 1.357   -7.199  1.642  1.00 0.00 ? 104 PHE A C    5  
ATOM   1987 O  O    . PHE A 1 3  ? 2.294   -7.398  2.412  1.00 0.00 ? 104 PHE A O    5  
ATOM   1988 C  CB   . PHE A 1 3  ? 2.799   -8.071  -0.194 1.00 0.00 ? 104 PHE A CB   5  
ATOM   1989 C  CG   . PHE A 1 3  ? 3.350   -7.870  -1.607 1.00 0.00 ? 104 PHE A CG   5  
ATOM   1990 C  CD1  . PHE A 1 3  ? 2.553   -8.096  -2.686 1.00 0.00 ? 104 PHE A CD1  5  
ATOM   1991 C  CD2  . PHE A 1 3  ? 4.637   -7.467  -1.785 1.00 0.00 ? 104 PHE A CD2  5  
ATOM   1992 C  CE1  . PHE A 1 3  ? 3.065   -7.910  -3.998 1.00 0.00 ? 104 PHE A CE1  5  
ATOM   1993 C  CE2  . PHE A 1 3  ? 5.149   -7.281  -3.096 1.00 0.00 ? 104 PHE A CE2  5  
ATOM   1994 C  CZ   . PHE A 1 3  ? 4.352   -7.507  -4.174 1.00 0.00 ? 104 PHE A CZ   5  
ATOM   1995 H  H    . PHE A 1 3  ? 2.846   -5.665  -0.487 1.00 0.00 ? 104 PHE A H    5  
ATOM   1996 H  HA   . PHE A 1 3  ? 0.672   -7.534  -0.372 1.00 0.00 ? 104 PHE A HA   5  
ATOM   1997 H  HB2  . PHE A 1 3  ? 3.588   -7.853  0.527  1.00 0.00 ? 104 PHE A HB2  5  
ATOM   1998 H  HB3  . PHE A 1 3  ? 2.529   -9.119  -0.065 1.00 0.00 ? 104 PHE A HB3  5  
ATOM   1999 H  HD1  . PHE A 1 3  ? 1.523   -8.420  -2.544 1.00 0.00 ? 104 PHE A HD1  5  
ATOM   2000 H  HD2  . PHE A 1 3  ? 5.275   -7.285  -0.919 1.00 0.00 ? 104 PHE A HD2  5  
ATOM   2001 H  HE1  . PHE A 1 3  ? 2.427   -8.092  -4.862 1.00 0.00 ? 104 PHE A HE1  5  
ATOM   2002 H  HE2  . PHE A 1 3  ? 6.179   -6.957  -3.238 1.00 0.00 ? 104 PHE A HE2  5  
ATOM   2003 H  HZ   . PHE A 1 3  ? 4.745   -7.365  -5.182 1.00 0.00 ? 104 PHE A HZ   5  
ATOM   2004 N  N    . VAL A 1 4  ? 0.108   -6.973  2.022  1.00 0.00 ? 105 VAL A N    5  
ATOM   2005 C  CA   . VAL A 1 4  ? -0.252  -6.944  3.429  1.00 0.00 ? 105 VAL A CA   5  
ATOM   2006 C  C    . VAL A 1 4  ? -1.184  -8.117  3.738  1.00 0.00 ? 105 VAL A C    5  
ATOM   2007 O  O    . VAL A 1 4  ? -1.944  -8.554  2.875  1.00 0.00 ? 105 VAL A O    5  
ATOM   2008 C  CB   . VAL A 1 4  ? -0.863  -5.586  3.784  1.00 0.00 ? 105 VAL A CB   5  
ATOM   2009 C  CG1  . VAL A 1 4  ? -1.480  -5.611  5.184  1.00 0.00 ? 105 VAL A CG1  5  
ATOM   2010 C  CG2  . VAL A 1 4  ? 0.176   -4.469  3.663  1.00 0.00 ? 105 VAL A CG2  5  
ATOM   2011 H  H    . VAL A 1 4  ? -0.650  -6.813  1.388  1.00 0.00 ? 105 VAL A H    5  
ATOM   2012 H  HA   . VAL A 1 4  ? 0.664   -7.063  4.006  1.00 0.00 ? 105 VAL A HA   5  
ATOM   2013 H  HB   . VAL A 1 4  ? -1.660  -5.380  3.070  1.00 0.00 ? 105 VAL A HB   5  
ATOM   2014 H  HG11 . VAL A 1 4  ? -0.980  -6.369  5.787  1.00 0.00 ? 105 VAL A HG11 5  
ATOM   2015 H  HG12 . VAL A 1 4  ? -1.358  -4.635  5.653  1.00 0.00 ? 105 VAL A HG12 5  
ATOM   2016 H  HG13 . VAL A 1 4  ? -2.540  -5.849  5.109  1.00 0.00 ? 105 VAL A HG13 5  
ATOM   2017 H  HG21 . VAL A 1 4  ? -0.230  -3.548  4.082  1.00 0.00 ? 105 VAL A HG21 5  
ATOM   2018 H  HG22 . VAL A 1 4  ? 1.077   -4.751  4.209  1.00 0.00 ? 105 VAL A HG22 5  
ATOM   2019 H  HG23 . VAL A 1 4  ? 0.421   -4.313  2.612  1.00 0.00 ? 105 VAL A HG23 5  
ATOM   2020 N  N    . CYS A 1 5  ? -1.095  -8.594  4.971  1.00 0.00 ? 106 CYS A N    5  
ATOM   2021 C  CA   . CYS A 1 5  ? -1.921  -9.708  5.404  1.00 0.00 ? 106 CYS A CA   5  
ATOM   2022 C  C    . CYS A 1 5  ? -3.241  -9.149  5.937  1.00 0.00 ? 106 CYS A C    5  
ATOM   2023 O  O    . CYS A 1 5  ? -3.295  -8.630  7.051  1.00 0.00 ? 106 CYS A O    5  
ATOM   2024 C  CB   . CYS A 1 5  ? -1.204  -10.571 6.445  1.00 0.00 ? 106 CYS A CB   5  
ATOM   2025 S  SG   . CYS A 1 5  ? -2.289  -11.949 6.968  1.00 0.00 ? 106 CYS A SG   5  
ATOM   2026 H  H    . CYS A 1 5  ? -0.474  -8.232  5.667  1.00 0.00 ? 106 CYS A H    5  
ATOM   2027 H  HA   . CYS A 1 5  ? -2.090  -10.332 4.527  1.00 0.00 ? 106 CYS A HA   5  
ATOM   2028 H  HB2  . CYS A 1 5  ? -0.278  -10.965 6.027  1.00 0.00 ? 106 CYS A HB2  5  
ATOM   2029 H  HB3  . CYS A 1 5  ? -0.933  -9.964  7.308  1.00 0.00 ? 106 CYS A HB3  5  
ATOM   2030 N  N    . GLU A 1 6  ? -4.274  -9.273  5.116  1.00 0.00 ? 107 GLU A N    5  
ATOM   2031 C  CA   . GLU A 1 6  ? -5.591  -8.787  5.491  1.00 0.00 ? 107 GLU A CA   5  
ATOM   2032 C  C    . GLU A 1 6  ? -6.054  -9.454  6.786  1.00 0.00 ? 107 GLU A C    5  
ATOM   2033 O  O    . GLU A 1 6  ? -6.892  -8.911  7.504  1.00 0.00 ? 107 GLU A O    5  
ATOM   2034 C  CB   . GLU A 1 6  ? -6.600  -9.015  4.365  1.00 0.00 ? 107 GLU A CB   5  
ATOM   2035 C  CG   . GLU A 1 6  ? -6.331  -8.076  3.187  1.00 0.00 ? 107 GLU A CG   5  
ATOM   2036 C  CD   . GLU A 1 6  ? -6.989  -6.713  3.410  1.00 0.00 ? 107 GLU A CD   5  
ATOM   2037 O  OE1  . GLU A 1 6  ? -6.362  -5.887  4.106  1.00 0.00 ? 107 GLU A OE1  5  
ATOM   2038 O  OE2  . GLU A 1 6  ? -8.105  -6.529  2.879  1.00 0.00 ? 107 GLU A OE2  5  
ATOM   2039 H  H    . GLU A 1 6  ? -4.221  -9.695  4.212  1.00 0.00 ? 107 GLU A H    5  
ATOM   2040 H  HA   . GLU A 1 6  ? -5.469  -7.715  5.649  1.00 0.00 ? 107 GLU A HA   5  
ATOM   2041 H  HB2  . GLU A 1 6  ? -6.548  -10.051 4.028  1.00 0.00 ? 107 GLU A HB2  5  
ATOM   2042 H  HB3  . GLU A 1 6  ? -7.611  -8.853  4.739  1.00 0.00 ? 107 GLU A HB3  5  
ATOM   2043 H  HG2  . GLU A 1 6  ? -5.256  -7.948  3.059  1.00 0.00 ? 107 GLU A HG2  5  
ATOM   2044 H  HG3  . GLU A 1 6  ? -6.710  -8.521  2.268  1.00 0.00 ? 107 GLU A HG3  5  
ATOM   2045 N  N    . VAL A 1 7  ? -5.489  -10.624 7.047  1.00 0.00 ? 108 VAL A N    5  
ATOM   2046 C  CA   . VAL A 1 7  ? -5.834  -11.372 8.245  1.00 0.00 ? 108 VAL A CA   5  
ATOM   2047 C  C    . VAL A 1 7  ? -5.376  -10.591 9.478  1.00 0.00 ? 108 VAL A C    5  
ATOM   2048 O  O    . VAL A 1 7  ? -6.200  -10.118 10.259 1.00 0.00 ? 108 VAL A O    5  
ATOM   2049 C  CB   . VAL A 1 7  ? -5.237  -12.779 8.173  1.00 0.00 ? 108 VAL A CB   5  
ATOM   2050 C  CG1  . VAL A 1 7  ? -5.252  -13.451 9.547  1.00 0.00 ? 108 VAL A CG1  5  
ATOM   2051 C  CG2  . VAL A 1 7  ? -5.970  -13.633 7.136  1.00 0.00 ? 108 VAL A CG2  5  
ATOM   2052 H  H    . VAL A 1 7  ? -4.807  -11.060 6.459  1.00 0.00 ? 108 VAL A H    5  
ATOM   2053 H  HA   . VAL A 1 7  ? -6.919  -11.466 8.272  1.00 0.00 ? 108 VAL A HA   5  
ATOM   2054 H  HB   . VAL A 1 7  ? -4.198  -12.686 7.856  1.00 0.00 ? 108 VAL A HB   5  
ATOM   2055 H  HG11 . VAL A 1 7  ? -5.300  -14.533 9.421  1.00 0.00 ? 108 VAL A HG11 5  
ATOM   2056 H  HG12 . VAL A 1 7  ? -4.344  -13.188 10.090 1.00 0.00 ? 108 VAL A HG12 5  
ATOM   2057 H  HG13 . VAL A 1 7  ? -6.123  -13.113 10.108 1.00 0.00 ? 108 VAL A HG13 5  
ATOM   2058 H  HG21 . VAL A 1 7  ? -5.426  -13.603 6.191  1.00 0.00 ? 108 VAL A HG21 5  
ATOM   2059 H  HG22 . VAL A 1 7  ? -6.028  -14.663 7.489  1.00 0.00 ? 108 VAL A HG22 5  
ATOM   2060 H  HG23 . VAL A 1 7  ? -6.977  -13.241 6.988  1.00 0.00 ? 108 VAL A HG23 5  
ATOM   2061 N  N    . CYS A 1 8  ? -4.062  -10.480 9.615  1.00 0.00 ? 109 CYS A N    5  
ATOM   2062 C  CA   . CYS A 1 8  ? -3.485  -9.764  10.740 1.00 0.00 ? 109 CYS A CA   5  
ATOM   2063 C  C    . CYS A 1 8  ? -3.097  -8.361  10.270 1.00 0.00 ? 109 CYS A C    5  
ATOM   2064 O  O    . CYS A 1 8  ? -3.467  -7.368  10.895 1.00 0.00 ? 109 CYS A O    5  
ATOM   2065 C  CB   . CYS A 1 8  ? -2.294  -10.515 11.337 1.00 0.00 ? 109 CYS A CB   5  
ATOM   2066 S  SG   . CYS A 1 8  ? -0.848  -10.383 10.224 1.00 0.00 ? 109 CYS A SG   5  
ATOM   2067 H  H    . CYS A 1 8  ? -3.399  -10.867 8.976  1.00 0.00 ? 109 CYS A H    5  
ATOM   2068 H  HA   . CYS A 1 8  ? -4.257  -9.715  11.509 1.00 0.00 ? 109 CYS A HA   5  
ATOM   2069 H  HB2  . CYS A 1 8  ? -2.048  -10.105 12.317 1.00 0.00 ? 109 CYS A HB2  5  
ATOM   2070 H  HB3  . CYS A 1 8  ? -2.553  -11.564 11.488 1.00 0.00 ? 109 CYS A HB3  5  
ATOM   2071 N  N    . THR A 1 9  ? -2.356  -8.323  9.172  1.00 0.00 ? 110 THR A N    5  
ATOM   2072 C  CA   . THR A 1 9  ? -1.914  -7.059  8.609  1.00 0.00 ? 110 THR A CA   5  
ATOM   2073 C  C    . THR A 1 9  ? -0.410  -7.098  8.327  1.00 0.00 ? 110 THR A C    5  
ATOM   2074 O  O    . THR A 1 9  ? 0.162   -6.115  7.859  1.00 0.00 ? 110 THR A O    5  
ATOM   2075 C  CB   . THR A 1 9  ? -2.323  -5.944  9.575  1.00 0.00 ? 110 THR A CB   5  
ATOM   2076 O  OG1  . THR A 1 9  ? -1.768  -4.765  8.999  1.00 0.00 ? 110 THR A OG1  5  
ATOM   2077 C  CG2  . THR A 1 9  ? -1.625  -6.060  10.932 1.00 0.00 ? 110 THR A CG2  5  
ATOM   2078 H  H    . THR A 1 9  ? -2.059  -9.137  8.669  1.00 0.00 ? 110 THR A H    5  
ATOM   2079 H  HA   . THR A 1 9  ? -2.416  -6.914  7.653  1.00 0.00 ? 110 THR A HA   5  
ATOM   2080 H  HB   . THR A 1 9  ? -3.405  -5.912  9.696  1.00 0.00 ? 110 THR A HB   5  
ATOM   2081 H  HG1  . THR A 1 9  ? -0.770  -4.795  9.053  1.00 0.00 ? 110 THR A HG1  5  
ATOM   2082 H  HG21 . THR A 1 9  ? -0.755  -5.402  10.950 1.00 0.00 ? 110 THR A HG21 5  
ATOM   2083 H  HG22 . THR A 1 9  ? -2.316  -5.770  11.722 1.00 0.00 ? 110 THR A HG22 5  
ATOM   2084 H  HG23 . THR A 1 9  ? -1.304  -7.089  11.090 1.00 0.00 ? 110 THR A HG23 5  
ATOM   2085 N  N    . ARG A 1 10 ? 0.185   -8.243  8.624  1.00 0.00 ? 111 ARG A N    5  
ATOM   2086 C  CA   . ARG A 1 10 ? 1.611   -8.423  8.408  1.00 0.00 ? 111 ARG A CA   5  
ATOM   2087 C  C    . ARG A 1 10 ? 1.963   -8.157  6.943  1.00 0.00 ? 111 ARG A C    5  
ATOM   2088 O  O    . ARG A 1 10 ? 1.443   -8.818  6.046  1.00 0.00 ? 111 ARG A O    5  
ATOM   2089 C  CB   . ARG A 1 10 ? 2.050   -9.839  8.782  1.00 0.00 ? 111 ARG A CB   5  
ATOM   2090 C  CG   . ARG A 1 10 ? 2.570   -9.890  10.220 1.00 0.00 ? 111 ARG A CG   5  
ATOM   2091 C  CD   . ARG A 1 10 ? 4.045   -10.294 10.257 1.00 0.00 ? 111 ARG A CD   5  
ATOM   2092 N  NE   . ARG A 1 10 ? 4.814   -9.331  11.076 1.00 0.00 ? 111 ARG A NE   5  
ATOM   2093 C  CZ   . ARG A 1 10 ? 6.132   -9.416  11.296 1.00 0.00 ? 111 ARG A CZ   5  
ATOM   2094 N  NH1  . ARG A 1 10 ? 6.598   -10.196 12.281 1.00 0.00 ? 111 ARG A NH1  5  
ATOM   2095 N  NH2  . ARG A 1 10 ? 6.987   -8.722  10.532 1.00 0.00 ? 111 ARG A NH2  5  
ATOM   2096 H  H    . ARG A 1 10 ? -0.288  -9.038  9.005  1.00 0.00 ? 111 ARG A H    5  
ATOM   2097 H  HA   . ARG A 1 10 ? 2.086   -7.693  9.064  1.00 0.00 ? 111 ARG A HA   5  
ATOM   2098 H  HB2  . ARG A 1 10 ? 1.212   -10.525 8.670  1.00 0.00 ? 111 ARG A HB2  5  
ATOM   2099 H  HB3  . ARG A 1 10 ? 2.830   -10.174 8.098  1.00 0.00 ? 111 ARG A HB3  5  
ATOM   2100 H  HG2  . ARG A 1 10 ? 2.444   -8.916  10.691 1.00 0.00 ? 111 ARG A HG2  5  
ATOM   2101 H  HG3  . ARG A 1 10 ? 1.980   -10.602 10.798 1.00 0.00 ? 111 ARG A HG3  5  
ATOM   2102 H  HD2  . ARG A 1 10 ? 4.146   -11.297 10.670 1.00 0.00 ? 111 ARG A HD2  5  
ATOM   2103 H  HD3  . ARG A 1 10 ? 4.448   -10.324 9.244  1.00 0.00 ? 111 ARG A HD3  5  
ATOM   2104 H  HE   . ARG A 1 10 ? 4.318   -8.568  11.492 1.00 0.00 ? 111 ARG A HE   5  
ATOM   2105 H  HH11 . ARG A 1 10 ? 5.986   -10.500 13.011 1.00 0.00 ? 111 ARG A HH11 5  
ATOM   2106 H  HH12 . ARG A 1 10 ? 7.559   -10.474 12.288 1.00 0.00 ? 111 ARG A HH12 5  
ATOM   2107 H  HH21 . ARG A 1 10 ? 6.640   -8.152  9.786  1.00 0.00 ? 111 ARG A HH21 5  
ATOM   2108 H  HH22 . ARG A 1 10 ? 7.969   -8.774  10.706 1.00 0.00 ? 111 ARG A HH22 5  
ATOM   2109 N  N    . ALA A 1 11 ? 2.845   -7.187  6.746  1.00 0.00 ? 112 ALA A N    5  
ATOM   2110 C  CA   . ALA A 1 11 ? 3.273   -6.826  5.405  1.00 0.00 ? 112 ALA A CA   5  
ATOM   2111 C  C    . ALA A 1 11 ? 4.558   -7.583  5.063  1.00 0.00 ? 112 ALA A C    5  
ATOM   2112 O  O    . ALA A 1 11 ? 5.370   -7.863  5.944  1.00 0.00 ? 112 ALA A O    5  
ATOM   2113 C  CB   . ALA A 1 11 ? 3.448   -5.308  5.317  1.00 0.00 ? 112 ALA A CB   5  
ATOM   2114 H  H    . ALA A 1 11 ? 3.263   -6.654  7.481  1.00 0.00 ? 112 ALA A H    5  
ATOM   2115 H  HA   . ALA A 1 11 ? 2.487   -7.129  4.713  1.00 0.00 ? 112 ALA A HA   5  
ATOM   2116 H  HB1  . ALA A 1 11 ? 3.344   -4.990  4.279  1.00 0.00 ? 112 ALA A HB1  5  
ATOM   2117 H  HB2  . ALA A 1 11 ? 2.688   -4.819  5.925  1.00 0.00 ? 112 ALA A HB2  5  
ATOM   2118 H  HB3  . ALA A 1 11 ? 4.438   -5.035  5.683  1.00 0.00 ? 112 ALA A HB3  5  
ATOM   2119 N  N    . PHE A 1 12 ? 4.702   -7.892  3.783  1.00 0.00 ? 113 PHE A N    5  
ATOM   2120 C  CA   . PHE A 1 12 ? 5.875   -8.610  3.314  1.00 0.00 ? 113 PHE A CA   5  
ATOM   2121 C  C    . PHE A 1 12 ? 6.398   -8.011  2.008  1.00 0.00 ? 113 PHE A C    5  
ATOM   2122 O  O    . PHE A 1 12 ? 5.629   -7.462  1.219  1.00 0.00 ? 113 PHE A O    5  
ATOM   2123 C  CB   . PHE A 1 12 ? 5.442   -10.055 3.061  1.00 0.00 ? 113 PHE A CB   5  
ATOM   2124 C  CG   . PHE A 1 12 ? 5.062   -10.822 4.329  1.00 0.00 ? 113 PHE A CG   5  
ATOM   2125 C  CD1  . PHE A 1 12 ? 6.031   -11.388 5.098  1.00 0.00 ? 113 PHE A CD1  5  
ATOM   2126 C  CD2  . PHE A 1 12 ? 3.755   -10.939 4.688  1.00 0.00 ? 113 PHE A CD2  5  
ATOM   2127 C  CE1  . PHE A 1 12 ? 5.678   -12.099 6.275  1.00 0.00 ? 113 PHE A CE1  5  
ATOM   2128 C  CE2  . PHE A 1 12 ? 3.403   -11.651 5.865  1.00 0.00 ? 113 PHE A CE2  5  
ATOM   2129 C  CZ   . PHE A 1 12 ? 4.371   -12.215 6.634  1.00 0.00 ? 113 PHE A CZ   5  
ATOM   2130 H  H    . PHE A 1 12 ? 4.036   -7.660  3.074  1.00 0.00 ? 113 PHE A H    5  
ATOM   2131 H  HA   . PHE A 1 12 ? 6.640   -8.520  4.086  1.00 0.00 ? 113 PHE A HA   5  
ATOM   2132 H  HB2  . PHE A 1 12 ? 4.591   -10.055 2.380  1.00 0.00 ? 113 PHE A HB2  5  
ATOM   2133 H  HB3  . PHE A 1 12 ? 6.252   -10.584 2.559  1.00 0.00 ? 113 PHE A HB3  5  
ATOM   2134 H  HD1  . PHE A 1 12 ? 7.077   -11.294 4.811  1.00 0.00 ? 113 PHE A HD1  5  
ATOM   2135 H  HD2  . PHE A 1 12 ? 2.978   -10.486 4.071  1.00 0.00 ? 113 PHE A HD2  5  
ATOM   2136 H  HE1  . PHE A 1 12 ? 6.455   -12.552 6.892  1.00 0.00 ? 113 PHE A HE1  5  
ATOM   2137 H  HE2  . PHE A 1 12 ? 2.355   -11.744 6.152  1.00 0.00 ? 113 PHE A HE2  5  
ATOM   2138 H  HZ   . PHE A 1 12 ? 4.101   -12.762 7.538  1.00 0.00 ? 113 PHE A HZ   5  
ATOM   2139 N  N    . ALA A 1 13 ? 7.704   -8.136  1.818  1.00 0.00 ? 114 ALA A N    5  
ATOM   2140 C  CA   . ALA A 1 13 ? 8.340   -7.614  0.621  1.00 0.00 ? 114 ALA A CA   5  
ATOM   2141 C  C    . ALA A 1 13 ? 8.130   -8.596  -0.533 1.00 0.00 ? 114 ALA A C    5  
ATOM   2142 O  O    . ALA A 1 13 ? 7.934   -8.185  -1.676 1.00 0.00 ? 114 ALA A O    5  
ATOM   2143 C  CB   . ALA A 1 13 ? 9.821   -7.352  0.902  1.00 0.00 ? 114 ALA A CB   5  
ATOM   2144 H  H    . ALA A 1 13 ? 8.322   -8.583  2.464  1.00 0.00 ? 114 ALA A H    5  
ATOM   2145 H  HA   . ALA A 1 13 ? 7.857   -6.668  0.374  1.00 0.00 ? 114 ALA A HA   5  
ATOM   2146 H  HB1  . ALA A 1 13 ? 10.428  -8.065  0.345  1.00 0.00 ? 114 ALA A HB1  5  
ATOM   2147 H  HB2  . ALA A 1 13 ? 10.076  -6.339  0.592  1.00 0.00 ? 114 ALA A HB2  5  
ATOM   2148 H  HB3  . ALA A 1 13 ? 10.014  -7.465  1.968  1.00 0.00 ? 114 ALA A HB3  5  
ATOM   2149 N  N    . ARG A 1 14 ? 8.179   -9.876  -0.194 1.00 0.00 ? 115 ARG A N    5  
ATOM   2150 C  CA   . ARG A 1 14 ? 7.997   -10.921 -1.188 1.00 0.00 ? 115 ARG A CA   5  
ATOM   2151 C  C    . ARG A 1 14 ? 6.616   -11.563 -1.036 1.00 0.00 ? 115 ARG A C    5  
ATOM   2152 O  O    . ARG A 1 14 ? 6.294   -12.109 0.019  1.00 0.00 ? 115 ARG A O    5  
ATOM   2153 C  CB   . ARG A 1 14 ? 9.072   -12.001 -1.054 1.00 0.00 ? 115 ARG A CB   5  
ATOM   2154 C  CG   . ARG A 1 14 ? 10.393  -11.403 -0.570 1.00 0.00 ? 115 ARG A CG   5  
ATOM   2155 C  CD   . ARG A 1 14 ? 10.879  -10.306 -1.519 1.00 0.00 ? 115 ARG A CD   5  
ATOM   2156 N  NE   . ARG A 1 14 ? 10.742  -10.754 -2.922 1.00 0.00 ? 115 ARG A NE   5  
ATOM   2157 C  CZ   . ARG A 1 14 ? 11.758  -11.206 -3.670 1.00 0.00 ? 115 ARG A CZ   5  
ATOM   2158 N  NH1  . ARG A 1 14 ? 12.549  -12.182 -3.206 1.00 0.00 ? 115 ARG A NH1  5  
ATOM   2159 N  NH2  . ARG A 1 14 ? 11.984  -10.680 -4.882 1.00 0.00 ? 115 ARG A NH2  5  
ATOM   2160 H  H    . ARG A 1 14 ? 8.339   -10.202 0.738  1.00 0.00 ? 115 ARG A H    5  
ATOM   2161 H  HA   . ARG A 1 14 ? 8.088   -10.412 -2.147 1.00 0.00 ? 115 ARG A HA   5  
ATOM   2162 H  HB2  . ARG A 1 14 ? 8.737   -12.768 -0.355 1.00 0.00 ? 115 ARG A HB2  5  
ATOM   2163 H  HB3  . ARG A 1 14 ? 9.221   -12.491 -2.016 1.00 0.00 ? 115 ARG A HB3  5  
ATOM   2164 H  HG2  . ARG A 1 14 ? 10.265  -10.991 0.432  1.00 0.00 ? 115 ARG A HG2  5  
ATOM   2165 H  HG3  . ARG A 1 14 ? 11.147  -12.187 -0.497 1.00 0.00 ? 115 ARG A HG3  5  
ATOM   2166 H  HD2  . ARG A 1 14 ? 10.303  -9.395  -1.361 1.00 0.00 ? 115 ARG A HD2  5  
ATOM   2167 H  HD3  . ARG A 1 14 ? 11.921  -10.064 -1.306 1.00 0.00 ? 115 ARG A HD3  5  
ATOM   2168 H  HE   . ARG A 1 14 ? 9.834   -10.717 -3.339 1.00 0.00 ? 115 ARG A HE   5  
ATOM   2169 H  HH11 . ARG A 1 14 ? 12.186  -13.108 -3.093 1.00 0.00 ? 115 ARG A HH11 5  
ATOM   2170 H  HH12 . ARG A 1 14 ? 13.502  -11.987 -2.973 1.00 0.00 ? 115 ARG A HH12 5  
ATOM   2171 H  HH21 . ARG A 1 14 ? 11.694  -9.744  -5.083 1.00 0.00 ? 115 ARG A HH21 5  
ATOM   2172 H  HH22 . ARG A 1 14 ? 12.442  -11.224 -5.586 1.00 0.00 ? 115 ARG A HH22 5  
ATOM   2173 N  N    . GLN A 1 15 ? 5.837   -11.477 -2.104 1.00 0.00 ? 116 GLN A N    5  
ATOM   2174 C  CA   . GLN A 1 15 ? 4.499   -12.043 -2.102 1.00 0.00 ? 116 GLN A CA   5  
ATOM   2175 C  C    . GLN A 1 15 ? 4.515   -13.440 -1.481 1.00 0.00 ? 116 GLN A C    5  
ATOM   2176 O  O    . GLN A 1 15 ? 3.712   -13.740 -0.598 1.00 0.00 ? 116 GLN A O    5  
ATOM   2177 C  CB   . GLN A 1 15 ? 3.917   -12.077 -3.517 1.00 0.00 ? 116 GLN A CB   5  
ATOM   2178 C  CG   . GLN A 1 15 ? 3.116   -10.807 -3.811 1.00 0.00 ? 116 GLN A CG   5  
ATOM   2179 C  CD   . GLN A 1 15 ? 1.849   -11.130 -4.606 1.00 0.00 ? 116 GLN A CD   5  
ATOM   2180 O  OE1  . GLN A 1 15 ? 0.887   -11.680 -4.095 1.00 0.00 ? 116 GLN A OE1  5  
ATOM   2181 N  NE2  . GLN A 1 15 ? 1.902   -10.758 -5.882 1.00 0.00 ? 116 GLN A NE2  5  
ATOM   2182 H  H    . GLN A 1 15 ? 6.106   -11.031 -2.957 1.00 0.00 ? 116 GLN A H    5  
ATOM   2183 H  HA   . GLN A 1 15 ? 3.902   -11.371 -1.486 1.00 0.00 ? 116 GLN A HA   5  
ATOM   2184 H  HB2  . GLN A 1 15 ? 4.722   -12.180 -4.243 1.00 0.00 ? 116 GLN A HB2  5  
ATOM   2185 H  HB3  . GLN A 1 15 ? 3.274   -12.950 -3.628 1.00 0.00 ? 116 GLN A HB3  5  
ATOM   2186 H  HG2  . GLN A 1 15 ? 2.846   -10.317 -2.875 1.00 0.00 ? 116 GLN A HG2  5  
ATOM   2187 H  HG3  . GLN A 1 15 ? 3.733   -10.105 -4.373 1.00 0.00 ? 116 GLN A HG3  5  
ATOM   2188 H  HE21 . GLN A 1 15 ? 2.345   -9.898  -6.135 1.00 0.00 ? 116 GLN A HE21 5  
ATOM   2189 H  HE22 . GLN A 1 15 ? 1.497   -11.339 -6.589 1.00 0.00 ? 116 GLN A HE22 5  
ATOM   2190 N  N    . GLU A 1 16 ? 5.436   -14.259 -1.968 1.00 0.00 ? 117 GLU A N    5  
ATOM   2191 C  CA   . GLU A 1 16 ? 5.566   -15.619 -1.472 1.00 0.00 ? 117 GLU A CA   5  
ATOM   2192 C  C    . GLU A 1 16 ? 5.581   -15.626 0.058  1.00 0.00 ? 117 GLU A C    5  
ATOM   2193 O  O    . GLU A 1 16 ? 4.970   -16.490 0.685  1.00 0.00 ? 117 GLU A O    5  
ATOM   2194 C  CB   . GLU A 1 16 ? 6.819   -16.290 -2.036 1.00 0.00 ? 117 GLU A CB   5  
ATOM   2195 C  CG   . GLU A 1 16 ? 7.416   -17.275 -1.028 1.00 0.00 ? 117 GLU A CG   5  
ATOM   2196 C  CD   . GLU A 1 16 ? 6.842   -18.679 -1.228 1.00 0.00 ? 117 GLU A CD   5  
ATOM   2197 O  OE1  . GLU A 1 16 ? 5.604   -18.770 -1.373 1.00 0.00 ? 117 GLU A OE1  5  
ATOM   2198 O  OE2  . GLU A 1 16 ? 7.654   -19.629 -1.230 1.00 0.00 ? 117 GLU A OE2  5  
ATOM   2199 H  H    . GLU A 1 16 ? 6.084   -14.008 -2.687 1.00 0.00 ? 117 GLU A H    5  
ATOM   2200 H  HA   . GLU A 1 16 ? 4.683   -16.145 -1.836 1.00 0.00 ? 117 GLU A HA   5  
ATOM   2201 H  HB2  . GLU A 1 16 ? 6.571   -16.815 -2.959 1.00 0.00 ? 117 GLU A HB2  5  
ATOM   2202 H  HB3  . GLU A 1 16 ? 7.560   -15.531 -2.291 1.00 0.00 ? 117 GLU A HB3  5  
ATOM   2203 H  HG2  . GLU A 1 16 ? 8.500   -17.301 -1.138 1.00 0.00 ? 117 GLU A HG2  5  
ATOM   2204 H  HG3  . GLU A 1 16 ? 7.207   -16.933 -0.014 1.00 0.00 ? 117 GLU A HG3  5  
ATOM   2205 N  N    . ALA A 1 17 ? 6.287   -14.653 0.615  1.00 0.00 ? 118 ALA A N    5  
ATOM   2206 C  CA   . ALA A 1 17 ? 6.390   -14.537 2.060  1.00 0.00 ? 118 ALA A CA   5  
ATOM   2207 C  C    . ALA A 1 17 ? 4.996   -14.322 2.651  1.00 0.00 ? 118 ALA A C    5  
ATOM   2208 O  O    . ALA A 1 17 ? 4.726   -14.728 3.780  1.00 0.00 ? 118 ALA A O    5  
ATOM   2209 C  CB   . ALA A 1 17 ? 7.355   -13.403 2.414  1.00 0.00 ? 118 ALA A CB   5  
ATOM   2210 H  H    . ALA A 1 17 ? 6.782   -13.954 0.099  1.00 0.00 ? 118 ALA A H    5  
ATOM   2211 H  HA   . ALA A 1 17 ? 6.796   -15.474 2.441  1.00 0.00 ? 118 ALA A HA   5  
ATOM   2212 H  HB1  . ALA A 1 17 ? 8.194   -13.803 2.983  1.00 0.00 ? 118 ALA A HB1  5  
ATOM   2213 H  HB2  . ALA A 1 17 ? 7.723   -12.941 1.498  1.00 0.00 ? 118 ALA A HB2  5  
ATOM   2214 H  HB3  . ALA A 1 17 ? 6.833   -12.656 3.013  1.00 0.00 ? 118 ALA A HB3  5  
ATOM   2215 N  N    . LEU A 1 18 ? 4.145   -13.683 1.861  1.00 0.00 ? 119 LEU A N    5  
ATOM   2216 C  CA   . LEU A 1 18 ? 2.785   -13.408 2.292  1.00 0.00 ? 119 LEU A CA   5  
ATOM   2217 C  C    . LEU A 1 18 ? 1.953   -14.689 2.185  1.00 0.00 ? 119 LEU A C    5  
ATOM   2218 O  O    . LEU A 1 18 ? 1.476   -15.209 3.192  1.00 0.00 ? 119 LEU A O    5  
ATOM   2219 C  CB   . LEU A 1 18 ? 2.203   -12.230 1.510  1.00 0.00 ? 119 LEU A CB   5  
ATOM   2220 C  CG   . LEU A 1 18 ? 0.675   -12.136 1.476  1.00 0.00 ? 119 LEU A CG   5  
ATOM   2221 C  CD1  . LEU A 1 18 ? 0.093   -12.172 2.890  1.00 0.00 ? 119 LEU A CD1  5  
ATOM   2222 C  CD2  . LEU A 1 18 ? 0.219   -10.898 0.700  1.00 0.00 ? 119 LEU A CD2  5  
ATOM   2223 H  H    . LEU A 1 18 ? 4.372   -13.355 0.944  1.00 0.00 ? 119 LEU A H    5  
ATOM   2224 H  HA   . LEU A 1 18 ? 2.828   -13.111 3.339  1.00 0.00 ? 119 LEU A HA   5  
ATOM   2225 H  HB2  . LEU A 1 18 ? 2.594   -11.306 1.937  1.00 0.00 ? 119 LEU A HB2  5  
ATOM   2226 H  HB3  . LEU A 1 18 ? 2.566   -12.284 0.484  1.00 0.00 ? 119 LEU A HB3  5  
ATOM   2227 H  HG   . LEU A 1 18 ? 0.291   -13.008 0.947  1.00 0.00 ? 119 LEU A HG   5  
ATOM   2228 H  HD11 . LEU A 1 18 ? -0.991  -12.071 2.839  1.00 0.00 ? 119 LEU A HD11 5  
ATOM   2229 H  HD12 . LEU A 1 18 ? 0.348   -13.120 3.363  1.00 0.00 ? 119 LEU A HD12 5  
ATOM   2230 H  HD13 . LEU A 1 18 ? 0.507   -11.351 3.475  1.00 0.00 ? 119 LEU A HD13 5  
ATOM   2231 H  HD21 . LEU A 1 18 ? 1.058   -10.498 0.130  1.00 0.00 ? 119 LEU A HD21 5  
ATOM   2232 H  HD22 . LEU A 1 18 ? -0.586  -11.173 0.019  1.00 0.00 ? 119 LEU A HD22 5  
ATOM   2233 H  HD23 . LEU A 1 18 ? -0.139  -10.142 1.399  1.00 0.00 ? 119 LEU A HD23 5  
ATOM   2234 N  N    . LYS A 1 19 ? 1.805   -15.158 0.955  1.00 0.00 ? 120 LYS A N    5  
ATOM   2235 C  CA   . LYS A 1 19 ? 1.039   -16.368 0.704  1.00 0.00 ? 120 LYS A CA   5  
ATOM   2236 C  C    . LYS A 1 19 ? 1.361   -17.404 1.782  1.00 0.00 ? 120 LYS A C    5  
ATOM   2237 O  O    . LYS A 1 19 ? 0.459   -17.934 2.429  1.00 0.00 ? 120 LYS A O    5  
ATOM   2238 C  CB   . LYS A 1 19 ? 1.279   -16.868 -0.722 1.00 0.00 ? 120 LYS A CB   5  
ATOM   2239 C  CG   . LYS A 1 19 ? 0.713   -18.276 -0.912 1.00 0.00 ? 120 LYS A CG   5  
ATOM   2240 C  CD   . LYS A 1 19 ? 0.528   -18.597 -2.396 1.00 0.00 ? 120 LYS A CD   5  
ATOM   2241 C  CE   . LYS A 1 19 ? 1.843   -19.068 -3.023 1.00 0.00 ? 120 LYS A CE   5  
ATOM   2242 N  NZ   . LYS A 1 19 ? 1.926   -20.546 -3.002 1.00 0.00 ? 120 LYS A NZ   5  
ATOM   2243 H  H    . LYS A 1 19 ? 2.196   -14.730 0.142  1.00 0.00 ? 120 LYS A H    5  
ATOM   2244 H  HA   . LYS A 1 19 ? -0.017  -16.107 0.780  1.00 0.00 ? 120 LYS A HA   5  
ATOM   2245 H  HB2  . LYS A 1 19 ? 0.815   -16.186 -1.434 1.00 0.00 ? 120 LYS A HB2  5  
ATOM   2246 H  HB3  . LYS A 1 19 ? 2.349   -16.871 -0.935 1.00 0.00 ? 120 LYS A HB3  5  
ATOM   2247 H  HG2  . LYS A 1 19 ? 1.384   -19.006 -0.459 1.00 0.00 ? 120 LYS A HG2  5  
ATOM   2248 H  HG3  . LYS A 1 19 ? -0.244  -18.359 -0.397 1.00 0.00 ? 120 LYS A HG3  5  
ATOM   2249 H  HD2  . LYS A 1 19 ? -0.231  -19.370 -2.513 1.00 0.00 ? 120 LYS A HD2  5  
ATOM   2250 H  HD3  . LYS A 1 19 ? 0.167   -17.713 -2.922 1.00 0.00 ? 120 LYS A HD3  5  
ATOM   2251 H  HE2  . LYS A 1 19 ? 1.913   -18.707 -4.049 1.00 0.00 ? 120 LYS A HE2  5  
ATOM   2252 H  HE3  . LYS A 1 19 ? 2.685   -18.643 -2.478 1.00 0.00 ? 120 LYS A HE3  5  
ATOM   2253 H  HZ1  . LYS A 1 19 ? 2.840   -20.823 -2.704 1.00 0.00 ? 120 LYS A HZ1  5  
ATOM   2254 H  HZ2  . LYS A 1 19 ? 1.243   -20.909 -2.370 1.00 0.00 ? 120 LYS A HZ2  5  
ATOM   2255 H  HZ3  . LYS A 1 19 ? 1.753   -20.902 -3.921 1.00 0.00 ? 120 LYS A HZ3  5  
ATOM   2256 N  N    . ARG A 1 20 ? 2.652   -17.662 1.942  1.00 0.00 ? 121 ARG A N    5  
ATOM   2257 C  CA   . ARG A 1 20 ? 3.104   -18.626 2.931  1.00 0.00 ? 121 ARG A CA   5  
ATOM   2258 C  C    . ARG A 1 20 ? 2.608   -18.231 4.323  1.00 0.00 ? 121 ARG A C    5  
ATOM   2259 O  O    . ARG A 1 20 ? 2.191   -19.086 5.103  1.00 0.00 ? 121 ARG A O    5  
ATOM   2260 C  CB   . ARG A 1 20 ? 4.631   -18.720 2.949  1.00 0.00 ? 121 ARG A CB   5  
ATOM   2261 C  CG   . ARG A 1 20 ? 5.131   -19.260 4.290  1.00 0.00 ? 121 ARG A CG   5  
ATOM   2262 C  CD   . ARG A 1 20 ? 6.364   -20.146 4.098  1.00 0.00 ? 121 ARG A CD   5  
ATOM   2263 N  NE   . ARG A 1 20 ? 7.352   -19.877 5.167  1.00 0.00 ? 121 ARG A NE   5  
ATOM   2264 C  CZ   . ARG A 1 20 ? 7.517   -20.649 6.250  1.00 0.00 ? 121 ARG A CZ   5  
ATOM   2265 N  NH1  . ARG A 1 20 ? 6.541   -21.483 6.633  1.00 0.00 ? 121 ARG A NH1  5  
ATOM   2266 N  NH2  . ARG A 1 20 ? 8.658   -20.587 6.949  1.00 0.00 ? 121 ARG A NH2  5  
ATOM   2267 H  H    . ARG A 1 20 ? 3.379   -17.226 1.413  1.00 0.00 ? 121 ARG A H    5  
ATOM   2268 H  HA   . ARG A 1 20 ? 2.671   -19.575 2.614  1.00 0.00 ? 121 ARG A HA   5  
ATOM   2269 H  HB2  . ARG A 1 20 ? 4.969   -19.369 2.142  1.00 0.00 ? 121 ARG A HB2  5  
ATOM   2270 H  HB3  . ARG A 1 20 ? 5.062   -17.735 2.767  1.00 0.00 ? 121 ARG A HB3  5  
ATOM   2271 H  HG2  . ARG A 1 20 ? 5.375   -18.431 4.953  1.00 0.00 ? 121 ARG A HG2  5  
ATOM   2272 H  HG3  . ARG A 1 20 ? 4.339   -19.834 4.774  1.00 0.00 ? 121 ARG A HG3  5  
ATOM   2273 H  HD2  . ARG A 1 20 ? 6.074   -21.197 4.117  1.00 0.00 ? 121 ARG A HD2  5  
ATOM   2274 H  HD3  . ARG A 1 20 ? 6.811   -19.956 3.122  1.00 0.00 ? 121 ARG A HD3  5  
ATOM   2275 H  HE   . ARG A 1 20 ? 7.933   -19.067 5.075  1.00 0.00 ? 121 ARG A HE   5  
ATOM   2276 H  HH11 . ARG A 1 20 ? 5.680   -21.512 6.124  1.00 0.00 ? 121 ARG A HH11 5  
ATOM   2277 H  HH12 . ARG A 1 20 ? 6.673   -22.076 7.427  1.00 0.00 ? 121 ARG A HH12 5  
ATOM   2278 H  HH21 . ARG A 1 20 ? 9.368   -19.932 6.691  1.00 0.00 ? 121 ARG A HH21 5  
ATOM   2279 H  HH22 . ARG A 1 20 ? 8.800   -21.196 7.730  1.00 0.00 ? 121 ARG A HH22 5  
ATOM   2280 N  N    . HIS A 1 21 ? 2.669   -16.936 4.593  1.00 0.00 ? 122 HIS A N    5  
ATOM   2281 C  CA   . HIS A 1 21 ? 2.231   -16.418 5.878  1.00 0.00 ? 122 HIS A CA   5  
ATOM   2282 C  C    . HIS A 1 21 ? 0.742   -16.714 6.070  1.00 0.00 ? 122 HIS A C    5  
ATOM   2283 O  O    . HIS A 1 21 ? 0.343   -17.273 7.090  1.00 0.00 ? 122 HIS A O    5  
ATOM   2284 C  CB   . HIS A 1 21 ? 2.560   -14.929 6.005  1.00 0.00 ? 122 HIS A CB   5  
ATOM   2285 C  CG   . HIS A 1 21 ? 1.835   -14.232 7.131  1.00 0.00 ? 122 HIS A CG   5  
ATOM   2286 N  ND1  . HIS A 1 21 ? 2.399   -14.038 8.380  1.00 0.00 ? 122 HIS A ND1  5  
ATOM   2287 C  CD2  . HIS A 1 21 ? 0.586   -13.685 7.182  1.00 0.00 ? 122 HIS A CD2  5  
ATOM   2288 C  CE1  . HIS A 1 21 ? 1.521   -13.404 9.141  1.00 0.00 ? 122 HIS A CE1  5  
ATOM   2289 N  NE2  . HIS A 1 21 ? 0.397   -13.186 8.398  1.00 0.00 ? 122 HIS A NE2  5  
ATOM   2290 H  H    . HIS A 1 21 ? 3.010   -16.247 3.954  1.00 0.00 ? 122 HIS A H    5  
ATOM   2291 H  HA   . HIS A 1 21 ? 2.800   -16.950 6.640  1.00 0.00 ? 122 HIS A HA   5  
ATOM   2292 H  HB2  . HIS A 1 21 ? 3.635   -14.816 6.154  1.00 0.00 ? 122 HIS A HB2  5  
ATOM   2293 H  HB3  . HIS A 1 21 ? 2.315   -14.432 5.066  1.00 0.00 ? 122 HIS A HB3  5  
ATOM   2294 H  HD1  . HIS A 1 21 ? 3.314   -14.329 8.660  1.00 0.00 ? 122 HIS A HD1  5  
ATOM   2295 H  HD2  . HIS A 1 21 ? -0.133  -13.662 6.365  1.00 0.00 ? 122 HIS A HD2  5  
ATOM   2296 H  HE1  . HIS A 1 21 ? 1.668   -13.107 10.180 1.00 0.00 ? 122 HIS A HE1  5  
ATOM   2297 N  N    . TYR A 1 22 ? -0.039  -16.324 5.073  1.00 0.00 ? 123 TYR A N    5  
ATOM   2298 C  CA   . TYR A 1 22 ? -1.475  -16.541 5.119  1.00 0.00 ? 123 TYR A CA   5  
ATOM   2299 C  C    . TYR A 1 22 ? -1.800  -17.979 5.528  1.00 0.00 ? 123 TYR A C    5  
ATOM   2300 O  O    . TYR A 1 22 ? -2.674  -18.208 6.362  1.00 0.00 ? 123 TYR A O    5  
ATOM   2301 C  CB   . TYR A 1 22 ? -1.984  -16.300 3.696  1.00 0.00 ? 123 TYR A CB   5  
ATOM   2302 C  CG   . TYR A 1 22 ? -3.044  -15.202 3.592  1.00 0.00 ? 123 TYR A CG   5  
ATOM   2303 C  CD1  . TYR A 1 22 ? -4.293  -15.393 4.147  1.00 0.00 ? 123 TYR A CD1  5  
ATOM   2304 C  CD2  . TYR A 1 22 ? -2.751  -14.020 2.942  1.00 0.00 ? 123 TYR A CD2  5  
ATOM   2305 C  CE1  . TYR A 1 22 ? -5.291  -14.360 4.049  1.00 0.00 ? 123 TYR A CE1  5  
ATOM   2306 C  CE2  . TYR A 1 22 ? -3.750  -12.987 2.843  1.00 0.00 ? 123 TYR A CE2  5  
ATOM   2307 C  CZ   . TYR A 1 22 ? -4.970  -13.208 3.402  1.00 0.00 ? 123 TYR A CZ   5  
ATOM   2308 O  OH   . TYR A 1 22 ? -5.912  -12.232 3.309  1.00 0.00 ? 123 TYR A OH   5  
ATOM   2309 H  H    . TYR A 1 22 ? 0.293   -15.870 4.247  1.00 0.00 ? 123 TYR A H    5  
ATOM   2310 H  HA   . TYR A 1 22 ? -1.895  -15.858 5.857  1.00 0.00 ? 123 TYR A HA   5  
ATOM   2311 H  HB2  . TYR A 1 22 ? -1.140  -16.037 3.059  1.00 0.00 ? 123 TYR A HB2  5  
ATOM   2312 H  HB3  . TYR A 1 22 ? -2.399  -17.230 3.308  1.00 0.00 ? 123 TYR A HB3  5  
ATOM   2313 H  HD1  . TYR A 1 22 ? -4.524  -16.327 4.660  1.00 0.00 ? 123 TYR A HD1  5  
ATOM   2314 H  HD2  . TYR A 1 22 ? -1.765  -13.870 2.503  1.00 0.00 ? 123 TYR A HD2  5  
ATOM   2315 H  HE1  . TYR A 1 22 ? -6.280  -14.498 4.483  1.00 0.00 ? 123 TYR A HE1  5  
ATOM   2316 H  HE2  . TYR A 1 22 ? -3.532  -12.049 2.333  1.00 0.00 ? 123 TYR A HE2  5  
ATOM   2317 H  HH   . TYR A 1 22 ? -5.534  -11.435 2.837  1.00 0.00 ? 123 TYR A HH   5  
ATOM   2318 N  N    . ARG A 1 23 ? -1.079  -18.910 4.920  1.00 0.00 ? 124 ARG A N    5  
ATOM   2319 C  CA   . ARG A 1 23 ? -1.280  -20.319 5.211  1.00 0.00 ? 124 ARG A CA   5  
ATOM   2320 C  C    . ARG A 1 23 ? -1.396  -20.539 6.721  1.00 0.00 ? 124 ARG A C    5  
ATOM   2321 O  O    . ARG A 1 23 ? -2.310  -21.220 7.184  1.00 0.00 ? 124 ARG A O    5  
ATOM   2322 C  CB   . ARG A 1 23 ? -0.126  -21.163 4.666  1.00 0.00 ? 124 ARG A CB   5  
ATOM   2323 C  CG   . ARG A 1 23 ? 0.304   -22.224 5.683  1.00 0.00 ? 124 ARG A CG   5  
ATOM   2324 C  CD   . ARG A 1 23 ? 1.369   -23.149 5.091  1.00 0.00 ? 124 ARG A CD   5  
ATOM   2325 N  NE   . ARG A 1 23 ? 1.232   -23.204 3.618  1.00 0.00 ? 124 ARG A NE   5  
ATOM   2326 C  CZ   . ARG A 1 23 ? 0.493   -24.111 2.966  1.00 0.00 ? 124 ARG A CZ   5  
ATOM   2327 N  NH1  . ARG A 1 23 ? -0.305  -24.942 3.649  1.00 0.00 ? 124 ARG A NH1  5  
ATOM   2328 N  NH2  . ARG A 1 23 ? 0.555   -24.188 1.629  1.00 0.00 ? 124 ARG A NH2  5  
ATOM   2329 H  H    . ARG A 1 23 ? -0.371  -18.715 4.242  1.00 0.00 ? 124 ARG A H    5  
ATOM   2330 H  HA   . ARG A 1 23 ? -2.210  -20.579 4.704  1.00 0.00 ? 124 ARG A HA   5  
ATOM   2331 H  HB2  . ARG A 1 23 ? -0.429  -21.646 3.738  1.00 0.00 ? 124 ARG A HB2  5  
ATOM   2332 H  HB3  . ARG A 1 23 ? 0.721   -20.519 4.429  1.00 0.00 ? 124 ARG A HB3  5  
ATOM   2333 H  HG2  . ARG A 1 23 ? 0.696   -21.738 6.577  1.00 0.00 ? 124 ARG A HG2  5  
ATOM   2334 H  HG3  . ARG A 1 23 ? -0.562  -22.810 5.991  1.00 0.00 ? 124 ARG A HG3  5  
ATOM   2335 H  HD2  . ARG A 1 23 ? 2.364   -22.792 5.359  1.00 0.00 ? 124 ARG A HD2  5  
ATOM   2336 H  HD3  . ARG A 1 23 ? 1.267   -24.150 5.511  1.00 0.00 ? 124 ARG A HD3  5  
ATOM   2337 H  HE   . ARG A 1 23 ? 1.721   -22.520 3.077  1.00 0.00 ? 124 ARG A HE   5  
ATOM   2338 H  HH11 . ARG A 1 23 ? -0.716  -24.646 4.512  1.00 0.00 ? 124 ARG A HH11 5  
ATOM   2339 H  HH12 . ARG A 1 23 ? -0.492  -25.860 3.296  1.00 0.00 ? 124 ARG A HH12 5  
ATOM   2340 H  HH21 . ARG A 1 23 ? 1.411   -23.985 1.156  1.00 0.00 ? 124 ARG A HH21 5  
ATOM   2341 H  HH22 . ARG A 1 23 ? -0.257  -24.450 1.106  1.00 0.00 ? 124 ARG A HH22 5  
ATOM   2342 N  N    . SER A 1 24 ? -0.457  -19.949 7.446  1.00 0.00 ? 125 SER A N    5  
ATOM   2343 C  CA   . SER A 1 24 ? -0.443  -20.072 8.894  1.00 0.00 ? 125 SER A CA   5  
ATOM   2344 C  C    . SER A 1 24 ? -1.838  -19.789 9.456  1.00 0.00 ? 125 SER A C    5  
ATOM   2345 O  O    . SER A 1 24 ? -2.331  -20.530 10.305 1.00 0.00 ? 125 SER A O    5  
ATOM   2346 C  CB   . SER A 1 24 ? 0.583   -19.125 9.516  1.00 0.00 ? 125 SER A CB   5  
ATOM   2347 O  OG   . SER A 1 24 ? 0.200   -17.759 9.382  1.00 0.00 ? 125 SER A OG   5  
ATOM   2348 H  H    . SER A 1 24 ? 0.282   -19.397 7.062  1.00 0.00 ? 125 SER A H    5  
ATOM   2349 H  HA   . SER A 1 24 ? -0.153  -21.104 9.093  1.00 0.00 ? 125 SER A HA   5  
ATOM   2350 H  HB2  . SER A 1 24 ? 0.704   -19.365 10.573 1.00 0.00 ? 125 SER A HB2  5  
ATOM   2351 H  HB3  . SER A 1 24 ? 1.552   -19.277 9.043  1.00 0.00 ? 125 SER A HB3  5  
ATOM   2352 H  HG   . SER A 1 24 ? 0.891   -17.259 8.860  1.00 0.00 ? 125 SER A HG   5  
ATOM   2353 N  N    . HIS A 1 25 ? -2.433  -18.714 8.962  1.00 0.00 ? 126 HIS A N    5  
ATOM   2354 C  CA   . HIS A 1 25 ? -3.761  -18.323 9.405  1.00 0.00 ? 126 HIS A CA   5  
ATOM   2355 C  C    . HIS A 1 25 ? -4.745  -19.464 9.143  1.00 0.00 ? 126 HIS A C    5  
ATOM   2356 O  O    . HIS A 1 25 ? -5.586  -19.771 9.987  1.00 0.00 ? 126 HIS A O    5  
ATOM   2357 C  CB   . HIS A 1 25 ? -4.188  -17.009 8.748  1.00 0.00 ? 126 HIS A CB   5  
ATOM   2358 C  CG   . HIS A 1 25 ? -3.436  -15.799 9.249  1.00 0.00 ? 126 HIS A CG   5  
ATOM   2359 N  ND1  . HIS A 1 25 ? -3.273  -15.523 10.595 1.00 0.00 ? 126 HIS A ND1  5  
ATOM   2360 C  CD2  . HIS A 1 25 ? -2.805  -14.798 8.572  1.00 0.00 ? 126 HIS A CD2  5  
ATOM   2361 C  CE1  . HIS A 1 25 ? -2.575  -14.403 10.711 1.00 0.00 ? 126 HIS A CE1  5  
ATOM   2362 N  NE2  . HIS A 1 25 ? -2.286  -13.954 9.455  1.00 0.00 ? 126 HIS A NE2  5  
ATOM   2363 H  H    . HIS A 1 25 ? -2.024  -18.116 8.272  1.00 0.00 ? 126 HIS A H    5  
ATOM   2364 H  HA   . HIS A 1 25 ? -3.694  -18.151 10.479 1.00 0.00 ? 126 HIS A HA   5  
ATOM   2365 H  HB2  . HIS A 1 25 ? -4.047  -17.091 7.670  1.00 0.00 ? 126 HIS A HB2  5  
ATOM   2366 H  HB3  . HIS A 1 25 ? -5.254  -16.859 8.919  1.00 0.00 ? 126 HIS A HB3  5  
ATOM   2367 H  HD1  . HIS A 1 25 ? -3.623  -16.074 11.353 1.00 0.00 ? 126 HIS A HD1  5  
ATOM   2368 H  HD2  . HIS A 1 25 ? -2.738  -14.707 7.487  1.00 0.00 ? 126 HIS A HD2  5  
ATOM   2369 H  HE1  . HIS A 1 25 ? -2.282  -13.924 11.645 1.00 0.00 ? 126 HIS A HE1  5  
ATOM   2370 N  N    . THR A 1 26 ? -4.609  -20.063 7.968  1.00 0.00 ? 127 THR A N    5  
ATOM   2371 C  CA   . THR A 1 26 ? -5.477  -21.164 7.584  1.00 0.00 ? 127 THR A CA   5  
ATOM   2372 C  C    . THR A 1 26 ? -5.844  -22.006 8.809  1.00 0.00 ? 127 THR A C    5  
ATOM   2373 O  O    . THR A 1 26 ? -6.966  -22.499 8.912  1.00 0.00 ? 127 THR A O    5  
ATOM   2374 C  CB   . THR A 1 26 ? -4.769  -21.962 6.488  1.00 0.00 ? 127 THR A CB   5  
ATOM   2375 O  OG1  . THR A 1 26 ? -4.175  -20.965 5.662  1.00 0.00 ? 127 THR A OG1  5  
ATOM   2376 C  CG2  . THR A 1 26 ? -5.753  -22.678 5.558  1.00 0.00 ? 127 THR A CG2  5  
ATOM   2377 H  H    . THR A 1 26 ? -3.923  -19.808 7.288  1.00 0.00 ? 127 THR A H    5  
ATOM   2378 H  HA   . THR A 1 26 ? -6.405  -20.749 7.192  1.00 0.00 ? 127 THR A HA   5  
ATOM   2379 H  HB   . THR A 1 26 ? -4.057  -22.667 6.917  1.00 0.00 ? 127 THR A HB   5  
ATOM   2380 H  HG1  . THR A 1 26 ? -4.025  -21.328 4.742  1.00 0.00 ? 127 THR A HG1  5  
ATOM   2381 H  HG21 . THR A 1 26 ? -5.201  -23.322 4.873  1.00 0.00 ? 127 THR A HG21 5  
ATOM   2382 H  HG22 . THR A 1 26 ? -6.439  -23.282 6.152  1.00 0.00 ? 127 THR A HG22 5  
ATOM   2383 H  HG23 . THR A 1 26 ? -6.317  -21.940 4.989  1.00 0.00 ? 127 THR A HG23 5  
ATOM   2384 N  N    . ASN A 1 27 ? -4.877  -22.143 9.704  1.00 0.00 ? 128 ASN A N    5  
ATOM   2385 C  CA   . ASN A 1 27 ? -5.084  -22.916 10.916 1.00 0.00 ? 128 ASN A CA   5  
ATOM   2386 C  C    . ASN A 1 27 ? -3.785  -22.948 11.723 1.00 0.00 ? 128 ASN A C    5  
ATOM   2387 O  O    . ASN A 1 27 ? -2.807  -23.568 11.310 1.00 0.00 ? 128 ASN A O    5  
ATOM   2388 C  CB   . ASN A 1 27 ? -5.473  -24.360 10.590 1.00 0.00 ? 128 ASN A CB   5  
ATOM   2389 C  CG   . ASN A 1 27 ? -6.431  -24.921 11.642 1.00 0.00 ? 128 ASN A CG   5  
ATOM   2390 O  OD1  . ASN A 1 27 ? -7.641  -24.912 11.486 1.00 0.00 ? 128 ASN A OD1  5  
ATOM   2391 N  ND2  . ASN A 1 27 ? -5.823  -25.409 12.720 1.00 0.00 ? 128 ASN A ND2  5  
ATOM   2392 H  H    . ASN A 1 27 ? -3.967  -21.738 9.611  1.00 0.00 ? 128 ASN A H    5  
ATOM   2393 H  HA   . ASN A 1 27 ? -5.892  -22.410 11.445 1.00 0.00 ? 128 ASN A HA   5  
ATOM   2394 H  HB2  . ASN A 1 27 ? -5.943  -24.400 9.607  1.00 0.00 ? 128 ASN A HB2  5  
ATOM   2395 H  HB3  . ASN A 1 27 ? -4.577  -24.979 10.540 1.00 0.00 ? 128 ASN A HB3  5  
ATOM   2396 H  HD21 . ASN A 1 27 ? -5.107  -26.101 12.621 1.00 0.00 ? 128 ASN A HD21 5  
ATOM   2397 H  HD22 . ASN A 1 27 ? -6.083  -25.085 13.629 1.00 0.00 ? 128 ASN A HD22 5  
ATOM   2398 N  N    . GLU A 1 28 ? -3.818  -22.272 12.863 1.00 0.00 ? 129 GLU A N    5  
ATOM   2399 C  CA   . GLU A 1 28 ? -2.654  -22.215 13.732 1.00 0.00 ? 129 GLU A CA   5  
ATOM   2400 C  C    . GLU A 1 28 ? -2.389  -23.587 14.355 1.00 0.00 ? 129 GLU A C    5  
ATOM   2401 O  O    . GLU A 1 28 ? -1.351  -24.197 14.104 1.00 0.00 ? 129 GLU A O    5  
ATOM   2402 C  CB   . GLU A 1 28 ? -2.831  -21.147 14.814 1.00 0.00 ? 129 GLU A CB   5  
ATOM   2403 C  CG   . GLU A 1 28 ? -1.642  -21.141 15.778 1.00 0.00 ? 129 GLU A CG   5  
ATOM   2404 C  CD   . GLU A 1 28 ? -1.873  -22.109 16.940 1.00 0.00 ? 129 GLU A CD   5  
ATOM   2405 O  OE1  . GLU A 1 28 ? -3.042  -22.512 17.118 1.00 0.00 ? 129 GLU A OE1  5  
ATOM   2406 O  OE2  . GLU A 1 28 ? -0.876  -22.423 17.624 1.00 0.00 ? 129 GLU A OE2  5  
ATOM   2407 H  H    . GLU A 1 28 ? -4.617  -21.770 13.193 1.00 0.00 ? 129 GLU A H    5  
ATOM   2408 H  HA   . GLU A 1 28 ? -1.823  -21.935 13.086 1.00 0.00 ? 129 GLU A HA   5  
ATOM   2409 H  HB2  . GLU A 1 28 ? -2.931  -20.167 14.349 1.00 0.00 ? 129 GLU A HB2  5  
ATOM   2410 H  HB3  . GLU A 1 28 ? -3.751  -21.333 15.367 1.00 0.00 ? 129 GLU A HB3  5  
ATOM   2411 H  HG2  . GLU A 1 28 ? -0.734  -21.421 15.243 1.00 0.00 ? 129 GLU A HG2  5  
ATOM   2412 H  HG3  . GLU A 1 28 ? -1.487  -20.134 16.164 1.00 0.00 ? 129 GLU A HG3  5  
ATOM   2413 N  N    . LYS A 1 29 ? -3.347  -24.033 15.156 1.00 0.00 ? 130 LYS A N    5  
ATOM   2414 C  CA   . LYS A 1 29 ? -3.229  -25.322 15.816 1.00 0.00 ? 130 LYS A CA   5  
ATOM   2415 C  C    . LYS A 1 29 ? -3.455  -26.436 14.793 1.00 0.00 ? 130 LYS A C    5  
ATOM   2416 O  O    . LYS A 1 29 ? -4.591  -26.845 14.557 1.00 0.00 ? 130 LYS A O    5  
ATOM   2417 C  CB   . LYS A 1 29 ? -4.169  -25.394 17.022 1.00 0.00 ? 130 LYS A CB   5  
ATOM   2418 C  CG   . LYS A 1 29 ? -3.500  -26.112 18.195 1.00 0.00 ? 130 LYS A CG   5  
ATOM   2419 C  CD   . LYS A 1 29 ? -4.315  -27.334 18.626 1.00 0.00 ? 130 LYS A CD   5  
ATOM   2420 C  CE   . LYS A 1 29 ? -4.674  -28.205 17.421 1.00 0.00 ? 130 LYS A CE   5  
ATOM   2421 N  NZ   . LYS A 1 29 ? -4.769  -29.627 17.821 1.00 0.00 ? 130 LYS A NZ   5  
ATOM   2422 H  H    . LYS A 1 29 ? -4.188  -23.531 15.355 1.00 0.00 ? 130 LYS A H    5  
ATOM   2423 H  HA   . LYS A 1 29 ? -2.211  -25.403 16.196 1.00 0.00 ? 130 LYS A HA   5  
ATOM   2424 H  HB2  . LYS A 1 29 ? -4.456  -24.386 17.324 1.00 0.00 ? 130 LYS A HB2  5  
ATOM   2425 H  HB3  . LYS A 1 29 ? -5.084  -25.917 16.744 1.00 0.00 ? 130 LYS A HB3  5  
ATOM   2426 H  HG2  . LYS A 1 29 ? -2.495  -26.423 17.911 1.00 0.00 ? 130 LYS A HG2  5  
ATOM   2427 H  HG3  . LYS A 1 29 ? -3.396  -25.426 19.036 1.00 0.00 ? 130 LYS A HG3  5  
ATOM   2428 H  HD2  . LYS A 1 29 ? -3.745  -27.920 19.347 1.00 0.00 ? 130 LYS A HD2  5  
ATOM   2429 H  HD3  . LYS A 1 29 ? -5.226  -27.008 19.129 1.00 0.00 ? 130 LYS A HD3  5  
ATOM   2430 H  HE2  . LYS A 1 29 ? -5.622  -27.877 16.997 1.00 0.00 ? 130 LYS A HE2  5  
ATOM   2431 H  HE3  . LYS A 1 29 ? -3.920  -28.090 16.643 1.00 0.00 ? 130 LYS A HE3  5  
ATOM   2432 H  HZ1  . LYS A 1 29 ? -5.719  -29.932 17.747 1.00 0.00 ? 130 LYS A HZ1  5  
ATOM   2433 H  HZ2  . LYS A 1 29 ? -4.194  -30.182 17.220 1.00 0.00 ? 130 LYS A HZ2  5  
ATOM   2434 H  HZ3  . LYS A 1 29 ? -4.459  -29.730 18.766 1.00 0.00 ? 130 LYS A HZ3  5  
HETATM 2435 ZN ZN   . ZN  B 2 .  ? -1.270  -12.288 9.023  1.00 0.00 ? 1   ZN  A ZN   5  
ATOM   2436 N  N    . ARG A 1 1  ? -0.805  0.392   -2.382 1.00 0.00 ? 102 ARG A N    6  
ATOM   2437 C  CA   . ARG A 1 1  ? -0.768  -0.985  -2.842 1.00 0.00 ? 102 ARG A CA   6  
ATOM   2438 C  C    . ARG A 1 1  ? 0.506   -1.675  -2.351 1.00 0.00 ? 102 ARG A C    6  
ATOM   2439 O  O    . ARG A 1 1  ? 1.610   -1.175  -2.567 1.00 0.00 ? 102 ARG A O    6  
ATOM   2440 C  CB   . ARG A 1 1  ? -0.822  -1.058  -4.369 1.00 0.00 ? 102 ARG A CB   6  
ATOM   2441 C  CG   . ARG A 1 1  ? -0.705  -2.504  -4.855 1.00 0.00 ? 102 ARG A CG   6  
ATOM   2442 C  CD   . ARG A 1 1  ? -0.584  -2.562  -6.379 1.00 0.00 ? 102 ARG A CD   6  
ATOM   2443 N  NE   . ARG A 1 1  ? 0.721   -2.010  -6.806 1.00 0.00 ? 102 ARG A NE   6  
ATOM   2444 C  CZ   . ARG A 1 1  ? 1.844   -2.091  -6.080 1.00 0.00 ? 102 ARG A CZ   6  
ATOM   2445 N  NH1  . ARG A 1 1  ? 2.561   -3.223  -6.082 1.00 0.00 ? 102 ARG A NH1  6  
ATOM   2446 N  NH2  . ARG A 1 1  ? 2.252   -1.041  -5.355 1.00 0.00 ? 102 ARG A NH2  6  
ATOM   2447 H  H    . ARG A 1 1  ? -0.687  1.080   -3.097 1.00 0.00 ? 102 ARG A H    6  
ATOM   2448 H  HA   . ARG A 1 1  ? -1.655  -1.448  -2.410 1.00 0.00 ? 102 ARG A HA   6  
ATOM   2449 H  HB2  . ARG A 1 1  ? -1.758  -0.626  -4.725 1.00 0.00 ? 102 ARG A HB2  6  
ATOM   2450 H  HB3  . ARG A 1 1  ? -0.015  -0.461  -4.794 1.00 0.00 ? 102 ARG A HB3  6  
ATOM   2451 H  HG2  . ARG A 1 1  ? 0.167   -2.974  -4.399 1.00 0.00 ? 102 ARG A HG2  6  
ATOM   2452 H  HG3  . ARG A 1 1  ? -1.578  -3.071  -4.533 1.00 0.00 ? 102 ARG A HG3  6  
ATOM   2453 H  HD2  . ARG A 1 1  ? -0.680  -3.593  -6.720 1.00 0.00 ? 102 ARG A HD2  6  
ATOM   2454 H  HD3  . ARG A 1 1  ? -1.396  -1.998  -6.838 1.00 0.00 ? 102 ARG A HD3  6  
ATOM   2455 H  HE   . ARG A 1 1  ? 0.766   -1.545  -7.690 1.00 0.00 ? 102 ARG A HE   6  
ATOM   2456 H  HH11 . ARG A 1 1  ? 2.246   -4.015  -6.605 1.00 0.00 ? 102 ARG A HH11 6  
ATOM   2457 H  HH12 . ARG A 1 1  ? 3.412   -3.276  -5.559 1.00 0.00 ? 102 ARG A HH12 6  
ATOM   2458 H  HH21 . ARG A 1 1  ? 2.815   -0.330  -5.776 1.00 0.00 ? 102 ARG A HH21 6  
ATOM   2459 H  HH22 . ARG A 1 1  ? 1.991   -0.967  -4.392 1.00 0.00 ? 102 ARG A HH22 6  
ATOM   2460 N  N    . SER A 1 2  ? 0.312   -2.812  -1.699 1.00 0.00 ? 103 SER A N    6  
ATOM   2461 C  CA   . SER A 1 2  ? 1.433   -3.574  -1.175 1.00 0.00 ? 103 SER A CA   6  
ATOM   2462 C  C    . SER A 1 2  ? 0.944   -4.921  -0.638 1.00 0.00 ? 103 SER A C    6  
ATOM   2463 O  O    . SER A 1 2  ? -0.257  -5.128  -0.472 1.00 0.00 ? 103 SER A O    6  
ATOM   2464 C  CB   . SER A 1 2  ? 2.162   -2.798  -0.076 1.00 0.00 ? 103 SER A CB   6  
ATOM   2465 O  OG   . SER A 1 2  ? 3.426   -2.310  -0.516 1.00 0.00 ? 103 SER A OG   6  
ATOM   2466 H  H    . SER A 1 2  ? -0.588  -3.211  -1.526 1.00 0.00 ? 103 SER A H    6  
ATOM   2467 H  HA   . SER A 1 2  ? 2.104   -3.720  -2.021 1.00 0.00 ? 103 SER A HA   6  
ATOM   2468 H  HB2  . SER A 1 2  ? 1.543   -1.963  0.249  1.00 0.00 ? 103 SER A HB2  6  
ATOM   2469 H  HB3  . SER A 1 2  ? 2.305   -3.445  0.791  1.00 0.00 ? 103 SER A HB3  6  
ATOM   2470 H  HG   . SER A 1 2  ? 3.299   -1.500  -1.087 1.00 0.00 ? 103 SER A HG   6  
ATOM   2471 N  N    . PHE A 1 3  ? 1.900   -5.802  -0.382 1.00 0.00 ? 104 PHE A N    6  
ATOM   2472 C  CA   . PHE A 1 3  ? 1.581   -7.124  0.132  1.00 0.00 ? 104 PHE A CA   6  
ATOM   2473 C  C    . PHE A 1 3  ? 1.357   -7.084  1.645  1.00 0.00 ? 104 PHE A C    6  
ATOM   2474 O  O    . PHE A 1 3  ? 2.312   -7.119  2.419  1.00 0.00 ? 104 PHE A O    6  
ATOM   2475 C  CB   . PHE A 1 3  ? 2.782   -8.022  -0.171 1.00 0.00 ? 104 PHE A CB   6  
ATOM   2476 C  CG   . PHE A 1 3  ? 3.343   -7.856  -1.583 1.00 0.00 ? 104 PHE A CG   6  
ATOM   2477 C  CD1  . PHE A 1 3  ? 2.549   -8.083  -2.663 1.00 0.00 ? 104 PHE A CD1  6  
ATOM   2478 C  CD2  . PHE A 1 3  ? 4.639   -7.480  -1.760 1.00 0.00 ? 104 PHE A CD2  6  
ATOM   2479 C  CE1  . PHE A 1 3  ? 3.070   -7.927  -3.974 1.00 0.00 ? 104 PHE A CE1  6  
ATOM   2480 C  CE2  . PHE A 1 3  ? 5.160   -7.325  -3.071 1.00 0.00 ? 104 PHE A CE2  6  
ATOM   2481 C  CZ   . PHE A 1 3  ? 4.365   -7.553  -4.151 1.00 0.00 ? 104 PHE A CZ   6  
ATOM   2482 H  H    . PHE A 1 3  ? 2.874   -5.626  -0.519 1.00 0.00 ? 104 PHE A H    6  
ATOM   2483 H  HA   . PHE A 1 3  ? 0.665   -7.450  -0.361 1.00 0.00 ? 104 PHE A HA   6  
ATOM   2484 H  HB2  . PHE A 1 3  ? 3.571   -7.812  0.551  1.00 0.00 ? 104 PHE A HB2  6  
ATOM   2485 H  HB3  . PHE A 1 3  ? 2.488   -9.063  -0.028 1.00 0.00 ? 104 PHE A HB3  6  
ATOM   2486 H  HD1  . PHE A 1 3  ? 1.511   -8.384  -2.521 1.00 0.00 ? 104 PHE A HD1  6  
ATOM   2487 H  HD2  . PHE A 1 3  ? 5.276   -7.298  -0.895 1.00 0.00 ? 104 PHE A HD2  6  
ATOM   2488 H  HE1  . PHE A 1 3  ? 2.433   -8.110  -4.840 1.00 0.00 ? 104 PHE A HE1  6  
ATOM   2489 H  HE2  . PHE A 1 3  ? 6.199   -7.023  -3.213 1.00 0.00 ? 104 PHE A HE2  6  
ATOM   2490 H  HZ   . PHE A 1 3  ? 4.766   -7.433  -5.158 1.00 0.00 ? 104 PHE A HZ   6  
ATOM   2491 N  N    . VAL A 1 4  ? 0.089   -7.011  2.022  1.00 0.00 ? 105 VAL A N    6  
ATOM   2492 C  CA   . VAL A 1 4  ? -0.273  -6.966  3.428  1.00 0.00 ? 105 VAL A CA   6  
ATOM   2493 C  C    . VAL A 1 4  ? -1.203  -8.138  3.749  1.00 0.00 ? 105 VAL A C    6  
ATOM   2494 O  O    . VAL A 1 4  ? -1.982  -8.567  2.899  1.00 0.00 ? 105 VAL A O    6  
ATOM   2495 C  CB   . VAL A 1 4  ? -0.886  -5.606  3.768  1.00 0.00 ? 105 VAL A CB   6  
ATOM   2496 C  CG1  . VAL A 1 4  ? -1.396  -5.580  5.210  1.00 0.00 ? 105 VAL A CG1  6  
ATOM   2497 C  CG2  . VAL A 1 4  ? 0.114   -4.476  3.519  1.00 0.00 ? 105 VAL A CG2  6  
ATOM   2498 H  H    . VAL A 1 4  ? -0.682  -6.983  1.386  1.00 0.00 ? 105 VAL A H    6  
ATOM   2499 H  HA   . VAL A 1 4  ? 0.644   -7.077  4.007  1.00 0.00 ? 105 VAL A HA   6  
ATOM   2500 H  HB   . VAL A 1 4  ? -1.739  -5.449  3.108  1.00 0.00 ? 105 VAL A HB   6  
ATOM   2501 H  HG11 . VAL A 1 4  ? -0.733  -4.965  5.819  1.00 0.00 ? 105 VAL A HG11 6  
ATOM   2502 H  HG12 . VAL A 1 4  ? -2.401  -5.159  5.231  1.00 0.00 ? 105 VAL A HG12 6  
ATOM   2503 H  HG13 . VAL A 1 4  ? -1.417  -6.594  5.607  1.00 0.00 ? 105 VAL A HG13 6  
ATOM   2504 H  HG21 . VAL A 1 4  ? 1.101   -4.899  3.326  1.00 0.00 ? 105 VAL A HG21 6  
ATOM   2505 H  HG22 . VAL A 1 4  ? -0.205  -3.891  2.656  1.00 0.00 ? 105 VAL A HG22 6  
ATOM   2506 H  HG23 . VAL A 1 4  ? 0.161   -3.832  4.397  1.00 0.00 ? 105 VAL A HG23 6  
ATOM   2507 N  N    . CYS A 1 5  ? -1.090  -8.623  4.977  1.00 0.00 ? 106 CYS A N    6  
ATOM   2508 C  CA   . CYS A 1 5  ? -1.911  -9.736  5.421  1.00 0.00 ? 106 CYS A CA   6  
ATOM   2509 C  C    . CYS A 1 5  ? -3.231  -9.177  5.955  1.00 0.00 ? 106 CYS A C    6  
ATOM   2510 O  O    . CYS A 1 5  ? -3.292  -8.688  7.081  1.00 0.00 ? 106 CYS A O    6  
ATOM   2511 C  CB   . CYS A 1 5  ? -1.190  -10.590 6.464  1.00 0.00 ? 106 CYS A CB   6  
ATOM   2512 S  SG   . CYS A 1 5  ? -2.258  -11.983 6.981  1.00 0.00 ? 106 CYS A SG   6  
ATOM   2513 H  H    . CYS A 1 5  ? -0.454  -8.267  5.662  1.00 0.00 ? 106 CYS A H    6  
ATOM   2514 H  HA   . CYS A 1 5  ? -2.083  -10.366 4.548  1.00 0.00 ? 106 CYS A HA   6  
ATOM   2515 H  HB2  . CYS A 1 5  ? -0.255  -10.972 6.051  1.00 0.00 ? 106 CYS A HB2  6  
ATOM   2516 H  HB3  . CYS A 1 5  ? -0.929  -9.980  7.329  1.00 0.00 ? 106 CYS A HB3  6  
ATOM   2517 N  N    . GLU A 1 6  ? -4.257  -9.268  5.119  1.00 0.00 ? 107 GLU A N    6  
ATOM   2518 C  CA   . GLU A 1 6  ? -5.572  -8.777  5.494  1.00 0.00 ? 107 GLU A CA   6  
ATOM   2519 C  C    . GLU A 1 6  ? -6.039  -9.444  6.789  1.00 0.00 ? 107 GLU A C    6  
ATOM   2520 O  O    . GLU A 1 6  ? -6.860  -8.889  7.517  1.00 0.00 ? 107 GLU A O    6  
ATOM   2521 C  CB   . GLU A 1 6  ? -6.581  -9.000  4.366  1.00 0.00 ? 107 GLU A CB   6  
ATOM   2522 C  CG   . GLU A 1 6  ? -6.300  -8.069  3.186  1.00 0.00 ? 107 GLU A CG   6  
ATOM   2523 C  CD   . GLU A 1 6  ? -6.882  -6.676  3.436  1.00 0.00 ? 107 GLU A CD   6  
ATOM   2524 O  OE1  . GLU A 1 6  ? -7.356  -6.454  4.571  1.00 0.00 ? 107 GLU A OE1  6  
ATOM   2525 O  OE2  . GLU A 1 6  ? -6.837  -5.864  2.486  1.00 0.00 ? 107 GLU A OE2  6  
ATOM   2526 H  H    . GLU A 1 6  ? -4.199  -9.666  4.204  1.00 0.00 ? 107 GLU A H    6  
ATOM   2527 H  HA   . GLU A 1 6  ? -5.446  -7.706  5.654  1.00 0.00 ? 107 GLU A HA   6  
ATOM   2528 H  HB2  . GLU A 1 6  ? -6.537  -10.037 4.035  1.00 0.00 ? 107 GLU A HB2  6  
ATOM   2529 H  HB3  . GLU A 1 6  ? -7.592  -8.828  4.738  1.00 0.00 ? 107 GLU A HB3  6  
ATOM   2530 H  HG2  . GLU A 1 6  ? -5.225  -7.995  3.025  1.00 0.00 ? 107 GLU A HG2  6  
ATOM   2531 H  HG3  . GLU A 1 6  ? -6.730  -8.489  2.276  1.00 0.00 ? 107 GLU A HG3  6  
ATOM   2532 N  N    . VAL A 1 7  ? -5.496  -10.627 7.037  1.00 0.00 ? 108 VAL A N    6  
ATOM   2533 C  CA   . VAL A 1 7  ? -5.846  -11.377 8.231  1.00 0.00 ? 108 VAL A CA   6  
ATOM   2534 C  C    . VAL A 1 7  ? -5.387  -10.602 9.468  1.00 0.00 ? 108 VAL A C    6  
ATOM   2535 O  O    . VAL A 1 7  ? -6.210  -10.145 10.259 1.00 0.00 ? 108 VAL A O    6  
ATOM   2536 C  CB   . VAL A 1 7  ? -5.257  -12.787 8.156  1.00 0.00 ? 108 VAL A CB   6  
ATOM   2537 C  CG1  . VAL A 1 7  ? -5.254  -13.454 9.533  1.00 0.00 ? 108 VAL A CG1  6  
ATOM   2538 C  CG2  . VAL A 1 7  ? -6.010  -13.641 7.134  1.00 0.00 ? 108 VAL A CG2  6  
ATOM   2539 H  H    . VAL A 1 7  ? -4.828  -11.072 6.439  1.00 0.00 ? 108 VAL A H    6  
ATOM   2540 H  HA   . VAL A 1 7  ? -6.932  -11.465 8.256  1.00 0.00 ? 108 VAL A HA   6  
ATOM   2541 H  HB   . VAL A 1 7  ? -4.222  -12.700 7.824  1.00 0.00 ? 108 VAL A HB   6  
ATOM   2542 H  HG11 . VAL A 1 7  ? -4.339  -13.190 10.062 1.00 0.00 ? 108 VAL A HG11 6  
ATOM   2543 H  HG12 . VAL A 1 7  ? -6.116  -13.110 10.105 1.00 0.00 ? 108 VAL A HG12 6  
ATOM   2544 H  HG13 . VAL A 1 7  ? -5.305  -14.536 9.412  1.00 0.00 ? 108 VAL A HG13 6  
ATOM   2545 H  HG21 . VAL A 1 7  ? -7.081  -13.473 7.238  1.00 0.00 ? 108 VAL A HG21 6  
ATOM   2546 H  HG22 . VAL A 1 7  ? -5.694  -13.367 6.127  1.00 0.00 ? 108 VAL A HG22 6  
ATOM   2547 H  HG23 . VAL A 1 7  ? -5.789  -14.695 7.308  1.00 0.00 ? 108 VAL A HG23 6  
ATOM   2548 N  N    . CYS A 1 8  ? -4.073  -10.477 9.594  1.00 0.00 ? 109 CYS A N    6  
ATOM   2549 C  CA   . CYS A 1 8  ? -3.494  -9.766  10.721 1.00 0.00 ? 109 CYS A CA   6  
ATOM   2550 C  C    . CYS A 1 8  ? -3.095  -8.365  10.250 1.00 0.00 ? 109 CYS A C    6  
ATOM   2551 O  O    . CYS A 1 8  ? -3.457  -7.370  10.874 1.00 0.00 ? 109 CYS A O    6  
ATOM   2552 C  CB   . CYS A 1 8  ? -2.310  -10.525 11.322 1.00 0.00 ? 109 CYS A CB   6  
ATOM   2553 S  SG   . CYS A 1 8  ? -0.853  -10.382 10.225 1.00 0.00 ? 109 CYS A SG   6  
ATOM   2554 H  H    . CYS A 1 8  ? -3.411  -10.852 8.945  1.00 0.00 ? 109 CYS A H    6  
ATOM   2555 H  HA   . CYS A 1 8  ? -4.267  -9.709  11.487 1.00 0.00 ? 109 CYS A HA   6  
ATOM   2556 H  HB2  . CYS A 1 8  ? -2.074  -10.125 12.308 1.00 0.00 ? 109 CYS A HB2  6  
ATOM   2557 H  HB3  . CYS A 1 8  ? -2.573  -11.575 11.457 1.00 0.00 ? 109 CYS A HB3  6  
ATOM   2558 N  N    . THR A 1 9  ? -2.352  -8.334  9.153  1.00 0.00 ? 110 THR A N    6  
ATOM   2559 C  CA   . THR A 1 9  ? -1.899  -7.073  8.591  1.00 0.00 ? 110 THR A CA   6  
ATOM   2560 C  C    . THR A 1 9  ? -0.406  -7.141  8.265  1.00 0.00 ? 110 THR A C    6  
ATOM   2561 O  O    . THR A 1 9  ? 0.143   -6.221  7.659  1.00 0.00 ? 110 THR A O    6  
ATOM   2562 C  CB   . THR A 1 9  ? -2.255  -5.960  9.580  1.00 0.00 ? 110 THR A CB   6  
ATOM   2563 O  OG1  . THR A 1 9  ? -1.654  -4.795  9.022  1.00 0.00 ? 110 THR A OG1  6  
ATOM   2564 C  CG2  . THR A 1 9  ? -1.557  -6.131  10.930 1.00 0.00 ? 110 THR A CG2  6  
ATOM   2565 H  H    . THR A 1 9  ? -2.062  -9.149  8.651  1.00 0.00 ? 110 THR A H    6  
ATOM   2566 H  HA   . THR A 1 9  ? -2.425  -6.907  7.652  1.00 0.00 ? 110 THR A HA   6  
ATOM   2567 H  HB   . THR A 1 9  ? -3.336  -5.884  9.707  1.00 0.00 ? 110 THR A HB   6  
ATOM   2568 H  HG1  . THR A 1 9  ? -0.658  -4.866  9.075  1.00 0.00 ? 110 THR A HG1  6  
ATOM   2569 H  HG21 . THR A 1 9  ? -0.666  -5.503  10.960 1.00 0.00 ? 110 THR A HG21 6  
ATOM   2570 H  HG22 . THR A 1 9  ? -2.236  -5.836  11.730 1.00 0.00 ? 110 THR A HG22 6  
ATOM   2571 H  HG23 . THR A 1 9  ? -1.270  -7.174  11.062 1.00 0.00 ? 110 THR A HG23 6  
ATOM   2572 N  N    . ARG A 1 10 ? 0.209   -8.238  8.681  1.00 0.00 ? 111 ARG A N    6  
ATOM   2573 C  CA   . ARG A 1 10 ? 1.628   -8.437  8.441  1.00 0.00 ? 111 ARG A CA   6  
ATOM   2574 C  C    . ARG A 1 10 ? 1.963   -8.157  6.974  1.00 0.00 ? 111 ARG A C    6  
ATOM   2575 O  O    . ARG A 1 10 ? 1.402   -8.783  6.076  1.00 0.00 ? 111 ARG A O    6  
ATOM   2576 C  CB   . ARG A 1 10 ? 2.051   -9.866  8.789  1.00 0.00 ? 111 ARG A CB   6  
ATOM   2577 C  CG   . ARG A 1 10 ? 2.620   -9.939  10.207 1.00 0.00 ? 111 ARG A CG   6  
ATOM   2578 C  CD   . ARG A 1 10 ? 4.109   -10.289 10.182 1.00 0.00 ? 111 ARG A CD   6  
ATOM   2579 N  NE   . ARG A 1 10 ? 4.895   -9.202  10.809 1.00 0.00 ? 111 ARG A NE   6  
ATOM   2580 C  CZ   . ARG A 1 10 ? 6.229   -9.217  10.937 1.00 0.00 ? 111 ARG A CZ   6  
ATOM   2581 N  NH1  . ARG A 1 10 ? 6.914   -10.340 10.680 1.00 0.00 ? 111 ARG A NH1  6  
ATOM   2582 N  NH2  . ARG A 1 10 ? 6.878   -8.110  11.322 1.00 0.00 ? 111 ARG A NH2  6  
ATOM   2583 H  H    . ARG A 1 10 ? -0.244  -8.980  9.174  1.00 0.00 ? 111 ARG A H    6  
ATOM   2584 H  HA   . ARG A 1 10 ? 2.125   -7.725  9.100  1.00 0.00 ? 111 ARG A HA   6  
ATOM   2585 H  HB2  . ARG A 1 10 ? 1.193   -10.533 8.702  1.00 0.00 ? 111 ARG A HB2  6  
ATOM   2586 H  HB3  . ARG A 1 10 ? 2.797   -10.213 8.075  1.00 0.00 ? 111 ARG A HB3  6  
ATOM   2587 H  HG2  . ARG A 1 10 ? 2.475   -8.983  10.711 1.00 0.00 ? 111 ARG A HG2  6  
ATOM   2588 H  HG3  . ARG A 1 10 ? 2.077   -10.688 10.783 1.00 0.00 ? 111 ARG A HG3  6  
ATOM   2589 H  HD2  . ARG A 1 10 ? 4.281   -11.225 10.714 1.00 0.00 ? 111 ARG A HD2  6  
ATOM   2590 H  HD3  . ARG A 1 10 ? 4.438   -10.441 9.155  1.00 0.00 ? 111 ARG A HD3  6  
ATOM   2591 H  HE   . ARG A 1 10 ? 4.399   -8.407  11.159 1.00 0.00 ? 111 ARG A HE   6  
ATOM   2592 H  HH11 . ARG A 1 10 ? 6.801   -11.141 11.268 1.00 0.00 ? 111 ARG A HH11 6  
ATOM   2593 H  HH12 . ARG A 1 10 ? 7.539   -10.377 9.900  1.00 0.00 ? 111 ARG A HH12 6  
ATOM   2594 H  HH21 . ARG A 1 10 ? 6.364   -7.327  11.672 1.00 0.00 ? 111 ARG A HH21 6  
ATOM   2595 H  HH22 . ARG A 1 10 ? 7.874   -8.067  11.259 1.00 0.00 ? 111 ARG A HH22 6  
ATOM   2596 N  N    . ALA A 1 11 ? 2.874   -7.216  6.778  1.00 0.00 ? 112 ALA A N    6  
ATOM   2597 C  CA   . ALA A 1 11 ? 3.290   -6.845  5.436  1.00 0.00 ? 112 ALA A CA   6  
ATOM   2598 C  C    . ALA A 1 11 ? 4.580   -7.587  5.083  1.00 0.00 ? 112 ALA A C    6  
ATOM   2599 O  O    . ALA A 1 11 ? 5.417   -7.833  5.951  1.00 0.00 ? 112 ALA A O    6  
ATOM   2600 C  CB   . ALA A 1 11 ? 3.449   -5.326  5.352  1.00 0.00 ? 112 ALA A CB   6  
ATOM   2601 H  H    . ALA A 1 11 ? 3.325   -6.711  7.515  1.00 0.00 ? 112 ALA A H    6  
ATOM   2602 H  HA   . ALA A 1 11 ? 2.503   -7.153  4.748  1.00 0.00 ? 112 ALA A HA   6  
ATOM   2603 H  HB1  . ALA A 1 11 ? 4.394   -5.086  4.863  1.00 0.00 ? 112 ALA A HB1  6  
ATOM   2604 H  HB2  . ALA A 1 11 ? 2.625   -4.905  4.777  1.00 0.00 ? 112 ALA A HB2  6  
ATOM   2605 H  HB3  . ALA A 1 11 ? 3.443   -4.904  6.357  1.00 0.00 ? 112 ALA A HB3  6  
ATOM   2606 N  N    . PHE A 1 12 ? 4.702   -7.923  3.807  1.00 0.00 ? 113 PHE A N    6  
ATOM   2607 C  CA   . PHE A 1 12 ? 5.876   -8.632  3.328  1.00 0.00 ? 113 PHE A CA   6  
ATOM   2608 C  C    . PHE A 1 12 ? 6.388   -8.026  2.020  1.00 0.00 ? 113 PHE A C    6  
ATOM   2609 O  O    . PHE A 1 12 ? 5.611   -7.474  1.242  1.00 0.00 ? 113 PHE A O    6  
ATOM   2610 C  CB   . PHE A 1 12 ? 5.453   -10.080 3.075  1.00 0.00 ? 113 PHE A CB   6  
ATOM   2611 C  CG   . PHE A 1 12 ? 5.080   -10.851 4.343  1.00 0.00 ? 113 PHE A CG   6  
ATOM   2612 C  CD1  . PHE A 1 12 ? 6.053   -11.410 5.110  1.00 0.00 ? 113 PHE A CD1  6  
ATOM   2613 C  CD2  . PHE A 1 12 ? 3.775   -10.977 4.703  1.00 0.00 ? 113 PHE A CD2  6  
ATOM   2614 C  CE1  . PHE A 1 12 ? 5.707   -12.125 6.287  1.00 0.00 ? 113 PHE A CE1  6  
ATOM   2615 C  CE2  . PHE A 1 12 ? 3.428   -11.691 5.879  1.00 0.00 ? 113 PHE A CE2  6  
ATOM   2616 C  CZ   . PHE A 1 12 ? 4.401   -12.251 6.647  1.00 0.00 ? 113 PHE A CZ   6  
ATOM   2617 H  H    . PHE A 1 12 ? 4.017   -7.719  3.108  1.00 0.00 ? 113 PHE A H    6  
ATOM   2618 H  HA   . PHE A 1 12 ? 6.646   -8.539  4.096  1.00 0.00 ? 113 PHE A HA   6  
ATOM   2619 H  HB2  . PHE A 1 12 ? 4.600   -10.084 2.395  1.00 0.00 ? 113 PHE A HB2  6  
ATOM   2620 H  HB3  . PHE A 1 12 ? 6.265   -10.603 2.570  1.00 0.00 ? 113 PHE A HB3  6  
ATOM   2621 H  HD1  . PHE A 1 12 ? 7.100   -11.309 4.822  1.00 0.00 ? 113 PHE A HD1  6  
ATOM   2622 H  HD2  . PHE A 1 12 ? 2.993   -10.529 4.088  1.00 0.00 ? 113 PHE A HD2  6  
ATOM   2623 H  HE1  . PHE A 1 12 ? 6.487   -12.573 6.901  1.00 0.00 ? 113 PHE A HE1  6  
ATOM   2624 H  HE2  . PHE A 1 12 ? 2.382   -11.793 6.168  1.00 0.00 ? 113 PHE A HE2  6  
ATOM   2625 H  HZ   . PHE A 1 12 ? 4.136   -12.801 7.550  1.00 0.00 ? 113 PHE A HZ   6  
ATOM   2626 N  N    . ALA A 1 13 ? 7.691   -8.150  1.818  1.00 0.00 ? 114 ALA A N    6  
ATOM   2627 C  CA   . ALA A 1 13 ? 8.316   -7.621  0.617  1.00 0.00 ? 114 ALA A CA   6  
ATOM   2628 C  C    . ALA A 1 13 ? 8.106   -8.603  -0.537 1.00 0.00 ? 114 ALA A C    6  
ATOM   2629 O  O    . ALA A 1 13 ? 7.899   -8.191  -1.677 1.00 0.00 ? 114 ALA A O    6  
ATOM   2630 C  CB   . ALA A 1 13 ? 9.796   -7.348  0.889  1.00 0.00 ? 114 ALA A CB   6  
ATOM   2631 H  H    . ALA A 1 13 ? 8.316   -8.600  2.455  1.00 0.00 ? 114 ALA A H    6  
ATOM   2632 H  HA   . ALA A 1 13 ? 7.824   -6.678  0.375  1.00 0.00 ? 114 ALA A HA   6  
ATOM   2633 H  HB1  . ALA A 1 13 ? 10.395  -8.168  0.491  1.00 0.00 ? 114 ALA A HB1  6  
ATOM   2634 H  HB2  . ALA A 1 13 ? 10.089  -6.416  0.406  1.00 0.00 ? 114 ALA A HB2  6  
ATOM   2635 H  HB3  . ALA A 1 13 ? 9.960   -7.267  1.964  1.00 0.00 ? 114 ALA A HB3  6  
ATOM   2636 N  N    . ARG A 1 14 ? 8.166   -9.884  -0.200 1.00 0.00 ? 115 ARG A N    6  
ATOM   2637 C  CA   . ARG A 1 14 ? 7.985   -10.928 -1.193 1.00 0.00 ? 115 ARG A CA   6  
ATOM   2638 C  C    . ARG A 1 14 ? 6.598   -11.558 -1.054 1.00 0.00 ? 115 ARG A C    6  
ATOM   2639 O  O    . ARG A 1 14 ? 6.243   -12.056 0.013  1.00 0.00 ? 115 ARG A O    6  
ATOM   2640 C  CB   . ARG A 1 14 ? 9.050   -12.016 -1.048 1.00 0.00 ? 115 ARG A CB   6  
ATOM   2641 C  CG   . ARG A 1 14 ? 10.397  -11.415 -0.640 1.00 0.00 ? 115 ARG A CG   6  
ATOM   2642 C  CD   . ARG A 1 14 ? 10.883  -10.404 -1.680 1.00 0.00 ? 115 ARG A CD   6  
ATOM   2643 N  NE   . ARG A 1 14 ? 12.326  -10.602 -1.941 1.00 0.00 ? 115 ARG A NE   6  
ATOM   2644 C  CZ   . ARG A 1 14 ? 12.834  -11.659 -2.591 1.00 0.00 ? 115 ARG A CZ   6  
ATOM   2645 N  NH1  . ARG A 1 14 ? 12.119  -12.262 -3.551 1.00 0.00 ? 115 ARG A NH1  6  
ATOM   2646 N  NH2  . ARG A 1 14 ? 14.057  -12.112 -2.281 1.00 0.00 ? 115 ARG A NH2  6  
ATOM   2647 H  H    . ARG A 1 14 ? 8.334   -10.210 0.731  1.00 0.00 ? 115 ARG A H    6  
ATOM   2648 H  HA   . ARG A 1 14 ? 8.091   -10.421 -2.153 1.00 0.00 ? 115 ARG A HA   6  
ATOM   2649 H  HB2  . ARG A 1 14 ? 8.731   -12.745 -0.302 1.00 0.00 ? 115 ARG A HB2  6  
ATOM   2650 H  HB3  . ARG A 1 14 ? 9.158   -12.553 -1.992 1.00 0.00 ? 115 ARG A HB3  6  
ATOM   2651 H  HG2  . ARG A 1 14 ? 10.301  -10.928 0.330  1.00 0.00 ? 115 ARG A HG2  6  
ATOM   2652 H  HG3  . ARG A 1 14 ? 11.134  -12.211 -0.527 1.00 0.00 ? 115 ARG A HG3  6  
ATOM   2653 H  HD2  . ARG A 1 14 ? 10.318  -10.521 -2.605 1.00 0.00 ? 115 ARG A HD2  6  
ATOM   2654 H  HD3  . ARG A 1 14 ? 10.706  -9.389  -1.324 1.00 0.00 ? 115 ARG A HD3  6  
ATOM   2655 H  HE   . ARG A 1 14 ? 12.963  -9.904  -1.613 1.00 0.00 ? 115 ARG A HE   6  
ATOM   2656 H  HH11 . ARG A 1 14 ? 11.225  -12.655 -3.335 1.00 0.00 ? 115 ARG A HH11 6  
ATOM   2657 H  HH12 . ARG A 1 14 ? 12.479  -12.321 -4.481 1.00 0.00 ? 115 ARG A HH12 6  
ATOM   2658 H  HH21 . ARG A 1 14 ? 14.866  -11.679 -2.680 1.00 0.00 ? 115 ARG A HH21 6  
ATOM   2659 H  HH22 . ARG A 1 14 ? 14.160  -12.881 -1.651 1.00 0.00 ? 115 ARG A HH22 6  
ATOM   2660 N  N    . GLN A 1 15 ? 5.851   -11.517 -2.148 1.00 0.00 ? 116 GLN A N    6  
ATOM   2661 C  CA   . GLN A 1 15 ? 4.511   -12.078 -2.161 1.00 0.00 ? 116 GLN A CA   6  
ATOM   2662 C  C    . GLN A 1 15 ? 4.511   -13.468 -1.520 1.00 0.00 ? 116 GLN A C    6  
ATOM   2663 O  O    . GLN A 1 15 ? 3.708   -13.746 -0.631 1.00 0.00 ? 116 GLN A O    6  
ATOM   2664 C  CB   . GLN A 1 15 ? 3.952   -12.131 -3.584 1.00 0.00 ? 116 GLN A CB   6  
ATOM   2665 C  CG   . GLN A 1 15 ? 3.240   -10.825 -3.942 1.00 0.00 ? 116 GLN A CG   6  
ATOM   2666 C  CD   . GLN A 1 15 ? 3.427   -10.486 -5.422 1.00 0.00 ? 116 GLN A CD   6  
ATOM   2667 O  OE1  . GLN A 1 15 ? 3.940   -9.440  -5.786 1.00 0.00 ? 116 GLN A OE1  6  
ATOM   2668 N  NE2  . GLN A 1 15 ? 2.984   -11.426 -6.253 1.00 0.00 ? 116 GLN A NE2  6  
ATOM   2669 H  H    . GLN A 1 15 ? 6.147   -11.110 -3.012 1.00 0.00 ? 116 GLN A H    6  
ATOM   2670 H  HA   . GLN A 1 15 ? 3.905   -11.396 -1.564 1.00 0.00 ? 116 GLN A HA   6  
ATOM   2671 H  HB2  . GLN A 1 15 ? 4.763   -12.312 -4.290 1.00 0.00 ? 116 GLN A HB2  6  
ATOM   2672 H  HB3  . GLN A 1 15 ? 3.256   -12.965 -3.675 1.00 0.00 ? 116 GLN A HB3  6  
ATOM   2673 H  HG2  . GLN A 1 15 ? 2.176   -10.913 -3.717 1.00 0.00 ? 116 GLN A HG2  6  
ATOM   2674 H  HG3  . GLN A 1 15 ? 3.629   -10.013 -3.327 1.00 0.00 ? 116 GLN A HG3  6  
ATOM   2675 H  HE21 . GLN A 1 15 ? 2.010   -11.479 -6.474 1.00 0.00 ? 116 GLN A HE21 6  
ATOM   2676 H  HE22 . GLN A 1 15 ? 3.625   -12.079 -6.656 1.00 0.00 ? 116 GLN A HE22 6  
ATOM   2677 N  N    . GLU A 1 16 ? 5.422   -14.303 -1.997 1.00 0.00 ? 117 GLU A N    6  
ATOM   2678 C  CA   . GLU A 1 16 ? 5.537   -15.658 -1.482 1.00 0.00 ? 117 GLU A CA   6  
ATOM   2679 C  C    . GLU A 1 16 ? 5.577   -15.643 0.048  1.00 0.00 ? 117 GLU A C    6  
ATOM   2680 O  O    . GLU A 1 16 ? 4.990   -16.508 0.696  1.00 0.00 ? 117 GLU A O    6  
ATOM   2681 C  CB   . GLU A 1 16 ? 6.771   -16.358 -2.055 1.00 0.00 ? 117 GLU A CB   6  
ATOM   2682 C  CG   . GLU A 1 16 ? 7.375   -17.326 -1.034 1.00 0.00 ? 117 GLU A CG   6  
ATOM   2683 C  CD   . GLU A 1 16 ? 8.118   -18.466 -1.734 1.00 0.00 ? 117 GLU A CD   6  
ATOM   2684 O  OE1  . GLU A 1 16 ? 9.077   -18.152 -2.470 1.00 0.00 ? 117 GLU A OE1  6  
ATOM   2685 O  OE2  . GLU A 1 16 ? 7.709   -19.628 -1.515 1.00 0.00 ? 117 GLU A OE2  6  
ATOM   2686 H  H    . GLU A 1 16 ? 6.072   -14.070 -2.720 1.00 0.00 ? 117 GLU A H    6  
ATOM   2687 H  HA   . GLU A 1 16 ? 4.641   -16.175 -1.824 1.00 0.00 ? 117 GLU A HA   6  
ATOM   2688 H  HB2  . GLU A 1 16 ? 6.498   -16.902 -2.959 1.00 0.00 ? 117 GLU A HB2  6  
ATOM   2689 H  HB3  . GLU A 1 16 ? 7.515   -15.616 -2.343 1.00 0.00 ? 117 GLU A HB3  6  
ATOM   2690 H  HG2  . GLU A 1 16 ? 8.061   -16.787 -0.380 1.00 0.00 ? 117 GLU A HG2  6  
ATOM   2691 H  HG3  . GLU A 1 16 ? 6.586   -17.734 -0.403 1.00 0.00 ? 117 GLU A HG3  6  
ATOM   2692 N  N    . ALA A 1 17 ? 6.273   -14.649 0.580  1.00 0.00 ? 118 ALA A N    6  
ATOM   2693 C  CA   . ALA A 1 17 ? 6.396   -14.510 2.022  1.00 0.00 ? 118 ALA A CA   6  
ATOM   2694 C  C    . ALA A 1 17 ? 5.009   -14.283 2.627  1.00 0.00 ? 118 ALA A C    6  
ATOM   2695 O  O    . ALA A 1 17 ? 4.755   -14.675 3.765  1.00 0.00 ? 118 ALA A O    6  
ATOM   2696 C  CB   . ALA A 1 17 ? 7.367   -13.371 2.343  1.00 0.00 ? 118 ALA A CB   6  
ATOM   2697 H  H    . ALA A 1 17 ? 6.747   -13.949 0.045  1.00 0.00 ? 118 ALA A H    6  
ATOM   2698 H  HA   . ALA A 1 17 ? 6.806   -15.441 2.411  1.00 0.00 ? 118 ALA A HA   6  
ATOM   2699 H  HB1  . ALA A 1 17 ? 8.203   -13.759 2.925  1.00 0.00 ? 118 ALA A HB1  6  
ATOM   2700 H  HB2  . ALA A 1 17 ? 7.739   -12.939 1.415  1.00 0.00 ? 118 ALA A HB2  6  
ATOM   2701 H  HB3  . ALA A 1 17 ? 6.849   -12.604 2.919  1.00 0.00 ? 118 ALA A HB3  6  
ATOM   2702 N  N    . LEU A 1 18 ? 4.151   -13.652 1.841  1.00 0.00 ? 119 LEU A N    6  
ATOM   2703 C  CA   . LEU A 1 18 ? 2.797   -13.368 2.286  1.00 0.00 ? 119 LEU A CA   6  
ATOM   2704 C  C    . LEU A 1 18 ? 1.963   -14.649 2.217  1.00 0.00 ? 119 LEU A C    6  
ATOM   2705 O  O    . LEU A 1 18 ? 1.495   -15.146 3.240  1.00 0.00 ? 119 LEU A O    6  
ATOM   2706 C  CB   . LEU A 1 18 ? 2.203   -12.205 1.489  1.00 0.00 ? 119 LEU A CB   6  
ATOM   2707 C  CG   . LEU A 1 18 ? 0.677   -12.099 1.493  1.00 0.00 ? 119 LEU A CG   6  
ATOM   2708 C  CD1  . LEU A 1 18 ? 0.128   -12.139 2.920  1.00 0.00 ? 119 LEU A CD1  6  
ATOM   2709 C  CD2  . LEU A 1 18 ? 0.212   -10.854 0.734  1.00 0.00 ? 119 LEU A CD2  6  
ATOM   2710 H  H    . LEU A 1 18 ? 4.367   -13.336 0.917  1.00 0.00 ? 119 LEU A H    6  
ATOM   2711 H  HA   . LEU A 1 18 ? 2.855   -13.050 3.326  1.00 0.00 ? 119 LEU A HA   6  
ATOM   2712 H  HB2  . LEU A 1 18 ? 2.613   -11.274 1.883  1.00 0.00 ? 119 LEU A HB2  6  
ATOM   2713 H  HB3  . LEU A 1 18 ? 2.540   -12.289 0.456  1.00 0.00 ? 119 LEU A HB3  6  
ATOM   2714 H  HG   . LEU A 1 18 ? 0.274   -12.966 0.968  1.00 0.00 ? 119 LEU A HG   6  
ATOM   2715 H  HD11 . LEU A 1 18 ? -0.807  -11.580 2.965  1.00 0.00 ? 119 LEU A HD11 6  
ATOM   2716 H  HD12 . LEU A 1 18 ? -0.054  -13.174 3.210  1.00 0.00 ? 119 LEU A HD12 6  
ATOM   2717 H  HD13 . LEU A 1 18 ? 0.853   -11.693 3.601  1.00 0.00 ? 119 LEU A HD13 6  
ATOM   2718 H  HD21 . LEU A 1 18 ? 0.854   -10.696 -0.132 1.00 0.00 ? 119 LEU A HD21 6  
ATOM   2719 H  HD22 . LEU A 1 18 ? -0.817  -10.995 0.402  1.00 0.00 ? 119 LEU A HD22 6  
ATOM   2720 H  HD23 . LEU A 1 18 ? 0.268   -9.987  1.391  1.00 0.00 ? 119 LEU A HD23 6  
ATOM   2721 N  N    . LYS A 1 19 ? 1.804   -15.149 1.000  1.00 0.00 ? 120 LYS A N    6  
ATOM   2722 C  CA   . LYS A 1 19 ? 1.035   -16.363 0.784  1.00 0.00 ? 120 LYS A CA   6  
ATOM   2723 C  C    . LYS A 1 19 ? 1.378   -17.380 1.874  1.00 0.00 ? 120 LYS A C    6  
ATOM   2724 O  O    . LYS A 1 19 ? 0.499   -17.827 2.609  1.00 0.00 ? 120 LYS A O    6  
ATOM   2725 C  CB   . LYS A 1 19 ? 1.252   -16.888 -0.637 1.00 0.00 ? 120 LYS A CB   6  
ATOM   2726 C  CG   . LYS A 1 19 ? 0.286   -18.033 -0.951 1.00 0.00 ? 120 LYS A CG   6  
ATOM   2727 C  CD   . LYS A 1 19 ? -1.110  -17.498 -1.276 1.00 0.00 ? 120 LYS A CD   6  
ATOM   2728 C  CE   . LYS A 1 19 ? -2.194  -18.455 -0.778 1.00 0.00 ? 120 LYS A CE   6  
ATOM   2729 N  NZ   . LYS A 1 19 ? -3.012  -18.948 -1.909 1.00 0.00 ? 120 LYS A NZ   6  
ATOM   2730 H  H    . LYS A 1 19 ? 2.189   -14.740 0.173  1.00 0.00 ? 120 LYS A H    6  
ATOM   2731 H  HA   . LYS A 1 19 ? -0.019  -16.101 0.874  1.00 0.00 ? 120 LYS A HA   6  
ATOM   2732 H  HB2  . LYS A 1 19 ? 1.110   -16.080 -1.354 1.00 0.00 ? 120 LYS A HB2  6  
ATOM   2733 H  HB3  . LYS A 1 19 ? 2.280   -17.235 -0.747 1.00 0.00 ? 120 LYS A HB3  6  
ATOM   2734 H  HG2  . LYS A 1 19 ? 0.663   -18.610 -1.795 1.00 0.00 ? 120 LYS A HG2  6  
ATOM   2735 H  HG3  . LYS A 1 19 ? 0.230   -18.710 -0.100 1.00 0.00 ? 120 LYS A HG3  6  
ATOM   2736 H  HD2  . LYS A 1 19 ? -1.245  -16.519 -0.815 1.00 0.00 ? 120 LYS A HD2  6  
ATOM   2737 H  HD3  . LYS A 1 19 ? -1.209  -17.360 -2.352 1.00 0.00 ? 120 LYS A HD3  6  
ATOM   2738 H  HE2  . LYS A 1 19 ? -1.734  -19.297 -0.260 1.00 0.00 ? 120 LYS A HE2  6  
ATOM   2739 H  HE3  . LYS A 1 19 ? -2.833  -17.948 -0.054 1.00 0.00 ? 120 LYS A HE3  6  
ATOM   2740 H  HZ1  . LYS A 1 19 ? -3.310  -18.173 -2.466 1.00 0.00 ? 120 LYS A HZ1  6  
ATOM   2741 H  HZ2  . LYS A 1 19 ? -2.464  -19.569 -2.469 1.00 0.00 ? 120 LYS A HZ2  6  
ATOM   2742 H  HZ3  . LYS A 1 19 ? -3.811  -19.434 -1.556 1.00 0.00 ? 120 LYS A HZ3  6  
ATOM   2743 N  N    . ARG A 1 20 ? 2.658   -17.714 1.946  1.00 0.00 ? 121 ARG A N    6  
ATOM   2744 C  CA   . ARG A 1 20 ? 3.128   -18.669 2.935  1.00 0.00 ? 121 ARG A CA   6  
ATOM   2745 C  C    . ARG A 1 20 ? 2.638   -18.274 4.329  1.00 0.00 ? 121 ARG A C    6  
ATOM   2746 O  O    . ARG A 1 20 ? 2.244   -19.131 5.119  1.00 0.00 ? 121 ARG A O    6  
ATOM   2747 C  CB   . ARG A 1 20 ? 4.656   -18.748 2.942  1.00 0.00 ? 121 ARG A CB   6  
ATOM   2748 C  CG   . ARG A 1 20 ? 5.133   -20.175 2.659  1.00 0.00 ? 121 ARG A CG   6  
ATOM   2749 C  CD   . ARG A 1 20 ? 6.175   -20.192 1.539  1.00 0.00 ? 121 ARG A CD   6  
ATOM   2750 N  NE   . ARG A 1 20 ? 7.341   -19.362 1.920  1.00 0.00 ? 121 ARG A NE   6  
ATOM   2751 C  CZ   . ARG A 1 20 ? 8.449   -19.844 2.498  1.00 0.00 ? 121 ARG A CZ   6  
ATOM   2752 N  NH1  . ARG A 1 20 ? 9.168   -20.792 1.882  1.00 0.00 ? 121 ARG A NH1  6  
ATOM   2753 N  NH2  . ARG A 1 20 ? 8.839   -19.378 3.692  1.00 0.00 ? 121 ARG A NH2  6  
ATOM   2754 H  H    . ARG A 1 20 ? 3.367   -17.345 1.345  1.00 0.00 ? 121 ARG A H    6  
ATOM   2755 H  HA   . ARG A 1 20 ? 2.701   -19.623 2.625  1.00 0.00 ? 121 ARG A HA   6  
ATOM   2756 H  HB2  . ARG A 1 20 ? 5.062   -18.070 2.192  1.00 0.00 ? 121 ARG A HB2  6  
ATOM   2757 H  HB3  . ARG A 1 20 ? 5.036   -18.419 3.909  1.00 0.00 ? 121 ARG A HB3  6  
ATOM   2758 H  HG2  . ARG A 1 20 ? 5.559   -20.606 3.564  1.00 0.00 ? 121 ARG A HG2  6  
ATOM   2759 H  HG3  . ARG A 1 20 ? 4.283   -20.797 2.379  1.00 0.00 ? 121 ARG A HG3  6  
ATOM   2760 H  HD2  . ARG A 1 20 ? 6.495   -21.215 1.345  1.00 0.00 ? 121 ARG A HD2  6  
ATOM   2761 H  HD3  . ARG A 1 20 ? 5.736   -19.815 0.616  1.00 0.00 ? 121 ARG A HD3  6  
ATOM   2762 H  HE   . ARG A 1 20 ? 7.297   -18.381 1.734  1.00 0.00 ? 121 ARG A HE   6  
ATOM   2763 H  HH11 . ARG A 1 20 ? 8.829   -21.731 1.845  1.00 0.00 ? 121 ARG A HH11 6  
ATOM   2764 H  HH12 . ARG A 1 20 ? 10.044  -20.559 1.458  1.00 0.00 ? 121 ARG A HH12 6  
ATOM   2765 H  HH21 . ARG A 1 20 ? 9.395   -18.548 3.748  1.00 0.00 ? 121 ARG A HH21 6  
ATOM   2766 H  HH22 . ARG A 1 20 ? 8.574   -19.860 4.528  1.00 0.00 ? 121 ARG A HH22 6  
ATOM   2767 N  N    . HIS A 1 21 ? 2.678   -16.975 4.590  1.00 0.00 ? 122 HIS A N    6  
ATOM   2768 C  CA   . HIS A 1 21 ? 2.244   -16.456 5.875  1.00 0.00 ? 122 HIS A CA   6  
ATOM   2769 C  C    . HIS A 1 21 ? 0.753   -16.744 6.067  1.00 0.00 ? 122 HIS A C    6  
ATOM   2770 O  O    . HIS A 1 21 ? 0.353   -17.319 7.078  1.00 0.00 ? 122 HIS A O    6  
ATOM   2771 C  CB   . HIS A 1 21 ? 2.582   -14.970 6.004  1.00 0.00 ? 122 HIS A CB   6  
ATOM   2772 C  CG   . HIS A 1 21 ? 1.859   -14.270 7.129  1.00 0.00 ? 122 HIS A CG   6  
ATOM   2773 N  ND1  . HIS A 1 21 ? 2.423   -14.082 8.380  1.00 0.00 ? 122 HIS A ND1  6  
ATOM   2774 C  CD2  . HIS A 1 21 ? 0.614   -13.717 7.182  1.00 0.00 ? 122 HIS A CD2  6  
ATOM   2775 C  CE1  . HIS A 1 21 ? 1.548   -13.442 9.142  1.00 0.00 ? 122 HIS A CE1  6  
ATOM   2776 N  NE2  . HIS A 1 21 ? 0.427   -13.217 8.398  1.00 0.00 ? 122 HIS A NE2  6  
ATOM   2777 H  H    . HIS A 1 21 ? 3.001   -16.285 3.942  1.00 0.00 ? 122 HIS A H    6  
ATOM   2778 H  HA   . HIS A 1 21 ? 2.809   -16.993 6.638  1.00 0.00 ? 122 HIS A HA   6  
ATOM   2779 H  HB2  . HIS A 1 21 ? 3.656   -14.864 6.154  1.00 0.00 ? 122 HIS A HB2  6  
ATOM   2780 H  HB3  . HIS A 1 21 ? 2.340   -14.471 5.065  1.00 0.00 ? 122 HIS A HB3  6  
ATOM   2781 H  HD1  . HIS A 1 21 ? 3.337   -14.378 8.659  1.00 0.00 ? 122 HIS A HD1  6  
ATOM   2782 H  HD2  . HIS A 1 21 ? -0.105  -13.689 6.363  1.00 0.00 ? 122 HIS A HD2  6  
ATOM   2783 H  HE1  . HIS A 1 21 ? 1.697   -13.148 10.180 1.00 0.00 ? 122 HIS A HE1  6  
ATOM   2784 N  N    . TYR A 1 22 ? -0.028  -16.330 5.080  1.00 0.00 ? 123 TYR A N    6  
ATOM   2785 C  CA   . TYR A 1 22 ? -1.466  -16.536 5.128  1.00 0.00 ? 123 TYR A CA   6  
ATOM   2786 C  C    . TYR A 1 22 ? -1.801  -17.974 5.527  1.00 0.00 ? 123 TYR A C    6  
ATOM   2787 O  O    . TYR A 1 22 ? -2.691  -18.204 6.346  1.00 0.00 ? 123 TYR A O    6  
ATOM   2788 C  CB   . TYR A 1 22 ? -1.976  -16.281 3.709  1.00 0.00 ? 123 TYR A CB   6  
ATOM   2789 C  CG   . TYR A 1 22 ? -3.045  -15.190 3.617  1.00 0.00 ? 123 TYR A CG   6  
ATOM   2790 C  CD1  . TYR A 1 22 ? -4.291  -15.397 4.175  1.00 0.00 ? 123 TYR A CD1  6  
ATOM   2791 C  CD2  . TYR A 1 22 ? -2.765  -14.000 2.977  1.00 0.00 ? 123 TYR A CD2  6  
ATOM   2792 C  CE1  . TYR A 1 22 ? -5.296  -14.370 4.089  1.00 0.00 ? 123 TYR A CE1  6  
ATOM   2793 C  CE2  . TYR A 1 22 ? -3.770  -12.974 2.892  1.00 0.00 ? 123 TYR A CE2  6  
ATOM   2794 C  CZ   . TYR A 1 22 ? -4.987  -13.209 3.452  1.00 0.00 ? 123 TYR A CZ   6  
ATOM   2795 O  OH   . TYR A 1 22 ? -5.938  -12.240 3.371  1.00 0.00 ? 123 TYR A OH   6  
ATOM   2796 H  H    . TYR A 1 22 ? 0.305   -15.863 4.262  1.00 0.00 ? 123 TYR A H    6  
ATOM   2797 H  HA   . TYR A 1 22 ? -1.879  -15.855 5.872  1.00 0.00 ? 123 TYR A HA   6  
ATOM   2798 H  HB2  . TYR A 1 22 ? -1.133  -16.003 3.075  1.00 0.00 ? 123 TYR A HB2  6  
ATOM   2799 H  HB3  . TYR A 1 22 ? -2.383  -17.209 3.308  1.00 0.00 ? 123 TYR A HB3  6  
ATOM   2800 H  HD1  . TYR A 1 22 ? -4.512  -16.336 4.681  1.00 0.00 ? 123 TYR A HD1  6  
ATOM   2801 H  HD2  . TYR A 1 22 ? -1.780  -13.837 2.536  1.00 0.00 ? 123 TYR A HD2  6  
ATOM   2802 H  HE1  . TYR A 1 22 ? -6.284  -14.520 4.526  1.00 0.00 ? 123 TYR A HE1  6  
ATOM   2803 H  HE2  . TYR A 1 22 ? -3.562  -12.029 2.389  1.00 0.00 ? 123 TYR A HE2  6  
ATOM   2804 H  HH   . TYR A 1 22 ? -6.849  -12.651 3.404  1.00 0.00 ? 123 TYR A HH   6  
ATOM   2805 N  N    . ARG A 1 23 ? -1.071  -18.905 4.931  1.00 0.00 ? 124 ARG A N    6  
ATOM   2806 C  CA   . ARG A 1 23 ? -1.280  -20.315 5.213  1.00 0.00 ? 124 ARG A CA   6  
ATOM   2807 C  C    . ARG A 1 23 ? -1.401  -20.541 6.722  1.00 0.00 ? 124 ARG A C    6  
ATOM   2808 O  O    . ARG A 1 23 ? -2.307  -21.237 7.178  1.00 0.00 ? 124 ARG A O    6  
ATOM   2809 C  CB   . ARG A 1 23 ? -0.129  -21.162 4.668  1.00 0.00 ? 124 ARG A CB   6  
ATOM   2810 C  CG   . ARG A 1 23 ? 0.261   -22.260 5.660  1.00 0.00 ? 124 ARG A CG   6  
ATOM   2811 C  CD   . ARG A 1 23 ? 1.240   -23.250 5.024  1.00 0.00 ? 124 ARG A CD   6  
ATOM   2812 N  NE   . ARG A 1 23 ? 2.002   -22.584 3.943  1.00 0.00 ? 124 ARG A NE   6  
ATOM   2813 C  CZ   . ARG A 1 23 ? 1.855   -22.862 2.641  1.00 0.00 ? 124 ARG A CZ   6  
ATOM   2814 N  NH1  . ARG A 1 23 ? 1.726   -24.134 2.238  1.00 0.00 ? 124 ARG A NH1  6  
ATOM   2815 N  NH2  . ARG A 1 23 ? 1.839   -21.869 1.742  1.00 0.00 ? 124 ARG A NH2  6  
ATOM   2816 H  H    . ARG A 1 23 ? -0.351  -18.709 4.265  1.00 0.00 ? 124 ARG A H    6  
ATOM   2817 H  HA   . ARG A 1 23 ? -2.210  -20.566 4.703  1.00 0.00 ? 124 ARG A HA   6  
ATOM   2818 H  HB2  . ARG A 1 23 ? -0.421  -21.612 3.719  1.00 0.00 ? 124 ARG A HB2  6  
ATOM   2819 H  HB3  . ARG A 1 23 ? 0.732   -20.526 4.468  1.00 0.00 ? 124 ARG A HB3  6  
ATOM   2820 H  HG2  . ARG A 1 23 ? 0.713   -21.813 6.545  1.00 0.00 ? 124 ARG A HG2  6  
ATOM   2821 H  HG3  . ARG A 1 23 ? -0.632  -22.790 5.991  1.00 0.00 ? 124 ARG A HG3  6  
ATOM   2822 H  HD2  . ARG A 1 23 ? 1.925   -23.632 5.781  1.00 0.00 ? 124 ARG A HD2  6  
ATOM   2823 H  HD3  . ARG A 1 23 ? 0.697   -24.106 4.624  1.00 0.00 ? 124 ARG A HD3  6  
ATOM   2824 H  HE   . ARG A 1 23 ? 2.667   -21.884 4.202  1.00 0.00 ? 124 ARG A HE   6  
ATOM   2825 H  HH11 . ARG A 1 23 ? 2.415   -24.812 2.491  1.00 0.00 ? 124 ARG A HH11 6  
ATOM   2826 H  HH12 . ARG A 1 23 ? 0.940   -24.404 1.681  1.00 0.00 ? 124 ARG A HH12 6  
ATOM   2827 H  HH21 . ARG A 1 23 ? 1.404   -20.997 1.968  1.00 0.00 ? 124 ARG A HH21 6  
ATOM   2828 H  HH22 . ARG A 1 23 ? 2.263   -21.998 0.845  1.00 0.00 ? 124 ARG A HH22 6  
ATOM   2829 N  N    . SER A 1 24 ? -0.475  -19.941 7.454  1.00 0.00 ? 125 SER A N    6  
ATOM   2830 C  CA   . SER A 1 24 ? -0.466  -20.069 8.901  1.00 0.00 ? 125 SER A CA   6  
ATOM   2831 C  C    . SER A 1 24 ? -1.859  -19.773 9.461  1.00 0.00 ? 125 SER A C    6  
ATOM   2832 O  O    . SER A 1 24 ? -2.344  -20.488 10.337 1.00 0.00 ? 125 SER A O    6  
ATOM   2833 C  CB   . SER A 1 24 ? 0.568   -19.133 9.531  1.00 0.00 ? 125 SER A CB   6  
ATOM   2834 O  OG   . SER A 1 24 ? 0.212   -17.762 9.373  1.00 0.00 ? 125 SER A OG   6  
ATOM   2835 H  H    . SER A 1 24 ? 0.259   -19.377 7.075  1.00 0.00 ? 125 SER A H    6  
ATOM   2836 H  HA   . SER A 1 24 ? -0.186  -21.103 9.098  1.00 0.00 ? 125 SER A HA   6  
ATOM   2837 H  HB2  . SER A 1 24 ? 0.666   -19.362 10.592 1.00 0.00 ? 125 SER A HB2  6  
ATOM   2838 H  HB3  . SER A 1 24 ? 1.542   -19.309 9.074  1.00 0.00 ? 125 SER A HB3  6  
ATOM   2839 H  HG   . SER A 1 24 ? 0.491   -17.242 10.181 1.00 0.00 ? 125 SER A HG   6  
ATOM   2840 N  N    . HIS A 1 25 ? -2.464  -18.720 8.931  1.00 0.00 ? 126 HIS A N    6  
ATOM   2841 C  CA   . HIS A 1 25 ? -3.791  -18.322 9.367  1.00 0.00 ? 126 HIS A CA   6  
ATOM   2842 C  C    . HIS A 1 25 ? -4.783  -19.454 9.091  1.00 0.00 ? 126 HIS A C    6  
ATOM   2843 O  O    . HIS A 1 25 ? -5.616  -19.775 9.938  1.00 0.00 ? 126 HIS A O    6  
ATOM   2844 C  CB   . HIS A 1 25 ? -4.203  -17.001 8.716  1.00 0.00 ? 126 HIS A CB   6  
ATOM   2845 C  CG   . HIS A 1 25 ? -3.443  -15.800 9.227  1.00 0.00 ? 126 HIS A CG   6  
ATOM   2846 N  ND1  . HIS A 1 25 ? -3.291  -15.529 10.576 1.00 0.00 ? 126 HIS A ND1  6  
ATOM   2847 C  CD2  . HIS A 1 25 ? -2.795  -14.805 8.558  1.00 0.00 ? 126 HIS A CD2  6  
ATOM   2848 C  CE1  . HIS A 1 25 ? -2.581  -14.416 10.701 1.00 0.00 ? 126 HIS A CE1  6  
ATOM   2849 N  NE2  . HIS A 1 25 ? -2.275  -13.970 9.449  1.00 0.00 ? 126 HIS A NE2  6  
ATOM   2850 H  H    . HIS A 1 25 ? -2.062  -18.144 8.220  1.00 0.00 ? 126 HIS A H    6  
ATOM   2851 H  HA   . HIS A 1 25 ? -3.731  -18.158 10.444 1.00 0.00 ? 126 HIS A HA   6  
ATOM   2852 H  HB2  . HIS A 1 25 ? -4.058  -17.078 7.638  1.00 0.00 ? 126 HIS A HB2  6  
ATOM   2853 H  HB3  . HIS A 1 25 ? -5.269  -16.842 8.883  1.00 0.00 ? 126 HIS A HB3  6  
ATOM   2854 H  HD1  . HIS A 1 25 ? -3.655  -16.078 11.328 1.00 0.00 ? 126 HIS A HD1  6  
ATOM   2855 H  HD2  . HIS A 1 25 ? -2.716  -14.712 7.475  1.00 0.00 ? 126 HIS A HD2  6  
ATOM   2856 H  HE1  . HIS A 1 25 ? -2.293  -13.943 11.639 1.00 0.00 ? 126 HIS A HE1  6  
ATOM   2857 N  N    . THR A 1 26 ? -4.661  -20.028 7.904  1.00 0.00 ? 127 THR A N    6  
ATOM   2858 C  CA   . THR A 1 26 ? -5.536  -21.117 7.505  1.00 0.00 ? 127 THR A CA   6  
ATOM   2859 C  C    . THR A 1 26 ? -5.960  -21.936 8.726  1.00 0.00 ? 127 THR A C    6  
ATOM   2860 O  O    . THR A 1 26 ? -7.136  -22.259 8.884  1.00 0.00 ? 127 THR A O    6  
ATOM   2861 C  CB   . THR A 1 26 ? -4.809  -21.943 6.442  1.00 0.00 ? 127 THR A CB   6  
ATOM   2862 O  OG1  . THR A 1 26 ? -4.124  -20.972 5.656  1.00 0.00 ? 127 THR A OG1  6  
ATOM   2863 C  CG2  . THR A 1 26 ? -5.772  -22.608 5.457  1.00 0.00 ? 127 THR A CG2  6  
ATOM   2864 H  H    . THR A 1 26 ? -3.981  -19.761 7.221  1.00 0.00 ? 127 THR A H    6  
ATOM   2865 H  HA   . THR A 1 26 ? -6.443  -20.690 7.076  1.00 0.00 ? 127 THR A HA   6  
ATOM   2866 H  HB   . THR A 1 26 ? -4.154  -22.682 6.905  1.00 0.00 ? 127 THR A HB   6  
ATOM   2867 H  HG1  . THR A 1 26 ? -4.783  -20.368 5.207  1.00 0.00 ? 127 THR A HG1  6  
ATOM   2868 H  HG21 . THR A 1 26 ? -6.721  -22.807 5.955  1.00 0.00 ? 127 THR A HG21 6  
ATOM   2869 H  HG22 . THR A 1 26 ? -5.940  -21.944 4.608  1.00 0.00 ? 127 THR A HG22 6  
ATOM   2870 H  HG23 . THR A 1 26 ? -5.343  -23.546 5.105  1.00 0.00 ? 127 THR A HG23 6  
ATOM   2871 N  N    . ASN A 1 27 ? -4.977  -22.246 9.560  1.00 0.00 ? 128 ASN A N    6  
ATOM   2872 C  CA   . ASN A 1 27 ? -5.233  -23.021 10.762 1.00 0.00 ? 128 ASN A CA   6  
ATOM   2873 C  C    . ASN A 1 27 ? -6.499  -22.497 11.441 1.00 0.00 ? 128 ASN A C    6  
ATOM   2874 O  O    . ASN A 1 27 ? -7.466  -23.236 11.616 1.00 0.00 ? 128 ASN A O    6  
ATOM   2875 C  CB   . ASN A 1 27 ? -4.076  -22.894 11.755 1.00 0.00 ? 128 ASN A CB   6  
ATOM   2876 C  CG   . ASN A 1 27 ? -2.728  -22.895 11.031 1.00 0.00 ? 128 ASN A CG   6  
ATOM   2877 O  OD1  . ASN A 1 27 ? -2.632  -23.164 9.845  1.00 0.00 ? 128 ASN A OD1  6  
ATOM   2878 N  ND2  . ASN A 1 27 ? -1.696  -22.578 11.807 1.00 0.00 ? 128 ASN A ND2  6  
ATOM   2879 H  H    . ASN A 1 27 ? -4.023  -21.980 9.423  1.00 0.00 ? 128 ASN A H    6  
ATOM   2880 H  HA   . ASN A 1 27 ? -5.338  -24.051 10.422 1.00 0.00 ? 128 ASN A HA   6  
ATOM   2881 H  HB2  . ASN A 1 27 ? -4.184  -21.973 12.328 1.00 0.00 ? 128 ASN A HB2  6  
ATOM   2882 H  HB3  . ASN A 1 27 ? -4.110  -23.719 12.467 1.00 0.00 ? 128 ASN A HB3  6  
ATOM   2883 H  HD21 . ASN A 1 27 ? -1.848  -22.331 12.764 1.00 0.00 ? 128 ASN A HD21 6  
ATOM   2884 H  HD22 . ASN A 1 27 ? -0.768  -22.589 11.435 1.00 0.00 ? 128 ASN A HD22 6  
ATOM   2885 N  N    . GLU A 1 28 ? -6.452  -21.224 11.807 1.00 0.00 ? 129 GLU A N    6  
ATOM   2886 C  CA   . GLU A 1 28 ? -7.583  -20.593 12.464 1.00 0.00 ? 129 GLU A CA   6  
ATOM   2887 C  C    . GLU A 1 28 ? -7.989  -19.320 11.716 1.00 0.00 ? 129 GLU A C    6  
ATOM   2888 O  O    . GLU A 1 28 ? -7.878  -19.252 10.493 1.00 0.00 ? 129 GLU A O    6  
ATOM   2889 C  CB   . GLU A 1 28 ? -7.268  -20.289 13.930 1.00 0.00 ? 129 GLU A CB   6  
ATOM   2890 C  CG   . GLU A 1 28 ? -6.402  -21.391 14.543 1.00 0.00 ? 129 GLU A CG   6  
ATOM   2891 C  CD   . GLU A 1 28 ? -4.926  -20.986 14.555 1.00 0.00 ? 129 GLU A CD   6  
ATOM   2892 O  OE1  . GLU A 1 28 ? -4.625  -19.923 13.970 1.00 0.00 ? 129 GLU A OE1  6  
ATOM   2893 O  OE2  . GLU A 1 28 ? -4.132  -21.749 15.147 1.00 0.00 ? 129 GLU A OE2  6  
ATOM   2894 H  H    . GLU A 1 28 ? -5.661  -20.629 11.662 1.00 0.00 ? 129 GLU A H    6  
ATOM   2895 H  HA   . GLU A 1 28 ? -8.392  -21.322 12.416 1.00 0.00 ? 129 GLU A HA   6  
ATOM   2896 H  HB2  . GLU A 1 28 ? -6.752  -19.332 14.004 1.00 0.00 ? 129 GLU A HB2  6  
ATOM   2897 H  HB3  . GLU A 1 28 ? -8.196  -20.195 14.494 1.00 0.00 ? 129 GLU A HB3  6  
ATOM   2898 H  HG2  . GLU A 1 28 ? -6.734  -21.595 15.561 1.00 0.00 ? 129 GLU A HG2  6  
ATOM   2899 H  HG3  . GLU A 1 28 ? -6.525  -22.314 13.976 1.00 0.00 ? 129 GLU A HG3  6  
ATOM   2900 N  N    . LYS A 1 29 ? -8.451  -18.343 12.483 1.00 0.00 ? 130 LYS A N    6  
ATOM   2901 C  CA   . LYS A 1 29 ? -8.873  -17.077 11.908 1.00 0.00 ? 130 LYS A CA   6  
ATOM   2902 C  C    . LYS A 1 29 ? -8.763  -15.979 12.968 1.00 0.00 ? 130 LYS A C    6  
ATOM   2903 O  O    . LYS A 1 29 ? -9.303  -14.888 12.794 1.00 0.00 ? 130 LYS A O    6  
ATOM   2904 C  CB   . LYS A 1 29 ? -10.271 -17.205 11.299 1.00 0.00 ? 130 LYS A CB   6  
ATOM   2905 C  CG   . LYS A 1 29 ? -10.370 -16.424 9.986  1.00 0.00 ? 130 LYS A CG   6  
ATOM   2906 C  CD   . LYS A 1 29 ? -11.145 -15.120 10.182 1.00 0.00 ? 130 LYS A CD   6  
ATOM   2907 C  CE   . LYS A 1 29 ? -10.878 -14.145 9.033  1.00 0.00 ? 130 LYS A CE   6  
ATOM   2908 N  NZ   . LYS A 1 29 ? -11.638 -14.544 7.827  1.00 0.00 ? 130 LYS A NZ   6  
ATOM   2909 H  H    . LYS A 1 29 ? -8.538  -18.406 13.477 1.00 0.00 ? 130 LYS A H    6  
ATOM   2910 H  HA   . LYS A 1 29 ? -8.186  -16.843 11.094 1.00 0.00 ? 130 LYS A HA   6  
ATOM   2911 H  HB2  . LYS A 1 29 ? -10.498 -18.255 11.119 1.00 0.00 ? 130 LYS A HB2  6  
ATOM   2912 H  HB3  . LYS A 1 29 ? -11.014 -16.834 12.004 1.00 0.00 ? 130 LYS A HB3  6  
ATOM   2913 H  HG2  . LYS A 1 29 ? -9.370  -16.204 9.613  1.00 0.00 ? 130 LYS A HG2  6  
ATOM   2914 H  HG3  . LYS A 1 29 ? -10.865 -17.036 9.231  1.00 0.00 ? 130 LYS A HG3  6  
ATOM   2915 H  HD2  . LYS A 1 29 ? -12.213 -15.333 10.242 1.00 0.00 ? 130 LYS A HD2  6  
ATOM   2916 H  HD3  . LYS A 1 29 ? -10.859 -14.661 11.128 1.00 0.00 ? 130 LYS A HD3  6  
ATOM   2917 H  HE2  . LYS A 1 29 ? -11.161 -13.136 9.332  1.00 0.00 ? 130 LYS A HE2  6  
ATOM   2918 H  HE3  . LYS A 1 29 ? -9.812  -14.124 8.807  1.00 0.00 ? 130 LYS A HE3  6  
ATOM   2919 H  HZ1  . LYS A 1 29 ? -12.102 -15.413 7.999  1.00 0.00 ? 130 LYS A HZ1  6  
ATOM   2920 H  HZ2  . LYS A 1 29 ? -12.316 -13.840 7.614  1.00 0.00 ? 130 LYS A HZ2  6  
ATOM   2921 H  HZ3  . LYS A 1 29 ? -11.010 -14.648 7.057  1.00 0.00 ? 130 LYS A HZ3  6  
HETATM 2922 ZN ZN   . ZN  B 2 .  ? -1.235  -12.313 9.030  1.00 0.00 ? 1   ZN  A ZN   6  
ATOM   2923 N  N    . ARG A 1 1  ? 0.969   -1.947  -4.325 1.00 0.00 ? 102 ARG A N    7  
ATOM   2924 C  CA   . ARG A 1 1  ? 2.157   -1.182  -3.990 1.00 0.00 ? 102 ARG A CA   7  
ATOM   2925 C  C    . ARG A 1 1  ? 2.977   -1.912  -2.924 1.00 0.00 ? 102 ARG A C    7  
ATOM   2926 O  O    . ARG A 1 1  ? 4.180   -1.688  -2.799 1.00 0.00 ? 102 ARG A O    7  
ATOM   2927 C  CB   . ARG A 1 1  ? 1.788   0.211   -3.474 1.00 0.00 ? 102 ARG A CB   7  
ATOM   2928 C  CG   . ARG A 1 1  ? 1.227   0.137   -2.053 1.00 0.00 ? 102 ARG A CG   7  
ATOM   2929 C  CD   . ARG A 1 1  ? -0.048  0.974   -1.923 1.00 0.00 ? 102 ARG A CD   7  
ATOM   2930 N  NE   . ARG A 1 1  ? 0.177   2.328   -2.475 1.00 0.00 ? 102 ARG A NE   7  
ATOM   2931 C  CZ   . ARG A 1 1  ? -0.482  3.423   -2.071 1.00 0.00 ? 102 ARG A CZ   7  
ATOM   2932 N  NH1  . ARG A 1 1  ? -0.754  3.600   -0.771 1.00 0.00 ? 102 ARG A NH1  7  
ATOM   2933 N  NH2  . ARG A 1 1  ? -0.870  4.340   -2.968 1.00 0.00 ? 102 ARG A NH2  7  
ATOM   2934 H  H    . ARG A 1 1  ? 0.186   -1.798  -3.721 1.00 0.00 ? 102 ARG A H    7  
ATOM   2935 H  HA   . ARG A 1 1  ? 2.711   -1.103  -4.926 1.00 0.00 ? 102 ARG A HA   7  
ATOM   2936 H  HB2  . ARG A 1 1  ? 2.668   0.852   -3.489 1.00 0.00 ? 102 ARG A HB2  7  
ATOM   2937 H  HB3  . ARG A 1 1  ? 1.052   0.665   -4.137 1.00 0.00 ? 102 ARG A HB3  7  
ATOM   2938 H  HG2  . ARG A 1 1  ? 1.014   -0.900  -1.795 1.00 0.00 ? 102 ARG A HG2  7  
ATOM   2939 H  HG3  . ARG A 1 1  ? 1.975   0.495   -1.344 1.00 0.00 ? 102 ARG A HG3  7  
ATOM   2940 H  HD2  . ARG A 1 1  ? -0.866  0.487   -2.453 1.00 0.00 ? 102 ARG A HD2  7  
ATOM   2941 H  HD3  . ARG A 1 1  ? -0.342  1.043   -0.876 1.00 0.00 ? 102 ARG A HD3  7  
ATOM   2942 H  HE   . ARG A 1 1  ? 0.864   2.434   -3.194 1.00 0.00 ? 102 ARG A HE   7  
ATOM   2943 H  HH11 . ARG A 1 1  ? -1.225  2.885   -0.256 1.00 0.00 ? 102 ARG A HH11 7  
ATOM   2944 H  HH12 . ARG A 1 1  ? -0.484  4.449   -0.316 1.00 0.00 ? 102 ARG A HH12 7  
ATOM   2945 H  HH21 . ARG A 1 1  ? -0.922  4.101   -3.938 1.00 0.00 ? 102 ARG A HH21 7  
ATOM   2946 H  HH22 . ARG A 1 1  ? -1.109  5.263   -2.668 1.00 0.00 ? 102 ARG A HH22 7  
ATOM   2947 N  N    . SER A 1 2  ? 2.292   -2.772  -2.183 1.00 0.00 ? 103 SER A N    7  
ATOM   2948 C  CA   . SER A 1 2  ? 2.942   -3.537  -1.133 1.00 0.00 ? 103 SER A CA   7  
ATOM   2949 C  C    . SER A 1 2  ? 2.123   -4.790  -0.816 1.00 0.00 ? 103 SER A C    7  
ATOM   2950 O  O    . SER A 1 2  ? 0.963   -4.895  -1.210 1.00 0.00 ? 103 SER A O    7  
ATOM   2951 C  CB   . SER A 1 2  ? 3.130   -2.692  0.129  1.00 0.00 ? 103 SER A CB   7  
ATOM   2952 O  OG   . SER A 1 2  ? 4.408   -2.065  0.166  1.00 0.00 ? 103 SER A OG   7  
ATOM   2953 H  H    . SER A 1 2  ? 1.314   -2.949  -2.292 1.00 0.00 ? 103 SER A H    7  
ATOM   2954 H  HA   . SER A 1 2  ? 3.917   -3.810  -1.536 1.00 0.00 ? 103 SER A HA   7  
ATOM   2955 H  HB2  . SER A 1 2  ? 2.350   -1.930  0.173  1.00 0.00 ? 103 SER A HB2  7  
ATOM   2956 H  HB3  . SER A 1 2  ? 3.009   -3.323  1.009  1.00 0.00 ? 103 SER A HB3  7  
ATOM   2957 H  HG   . SER A 1 2  ? 4.998   -2.531  0.824  1.00 0.00 ? 103 SER A HG   7  
ATOM   2958 N  N    . PHE A 1 3  ? 2.759   -5.710  -0.106 1.00 0.00 ? 104 PHE A N    7  
ATOM   2959 C  CA   . PHE A 1 3  ? 2.104   -6.951  0.270  1.00 0.00 ? 104 PHE A CA   7  
ATOM   2960 C  C    . PHE A 1 3  ? 1.680   -6.925  1.739  1.00 0.00 ? 104 PHE A C    7  
ATOM   2961 O  O    . PHE A 1 3  ? 2.521   -6.994  2.634  1.00 0.00 ? 104 PHE A O    7  
ATOM   2962 C  CB   . PHE A 1 3  ? 3.124   -8.074  0.066  1.00 0.00 ? 104 PHE A CB   7  
ATOM   2963 C  CG   . PHE A 1 3  ? 3.764   -8.089  -1.323 1.00 0.00 ? 104 PHE A CG   7  
ATOM   2964 C  CD1  . PHE A 1 3  ? 3.036   -8.479  -2.404 1.00 0.00 ? 104 PHE A CD1  7  
ATOM   2965 C  CD2  . PHE A 1 3  ? 5.061   -7.712  -1.478 1.00 0.00 ? 104 PHE A CD2  7  
ATOM   2966 C  CE1  . PHE A 1 3  ? 3.630   -8.494  -3.694 1.00 0.00 ? 104 PHE A CE1  7  
ATOM   2967 C  CE2  . PHE A 1 3  ? 5.656   -7.725  -2.768 1.00 0.00 ? 104 PHE A CE2  7  
ATOM   2968 C  CZ   . PHE A 1 3  ? 4.927   -8.116  -3.848 1.00 0.00 ? 104 PHE A CZ   7  
ATOM   2969 H  H    . PHE A 1 3  ? 3.703   -5.617  0.211  1.00 0.00 ? 104 PHE A H    7  
ATOM   2970 H  HA   . PHE A 1 3  ? 1.221   -7.055  -0.360 1.00 0.00 ? 104 PHE A HA   7  
ATOM   2971 H  HB2  . PHE A 1 3  ? 3.910   -7.978  0.816  1.00 0.00 ? 104 PHE A HB2  7  
ATOM   2972 H  HB3  . PHE A 1 3  ? 2.633   -9.032  0.238  1.00 0.00 ? 104 PHE A HB3  7  
ATOM   2973 H  HD1  . PHE A 1 3  ? 1.996   -8.782  -2.280 1.00 0.00 ? 104 PHE A HD1  7  
ATOM   2974 H  HD2  . PHE A 1 3  ? 5.646   -7.398  -0.612 1.00 0.00 ? 104 PHE A HD2  7  
ATOM   2975 H  HE1  . PHE A 1 3  ? 3.047   -8.807  -4.559 1.00 0.00 ? 104 PHE A HE1  7  
ATOM   2976 H  HE2  . PHE A 1 3  ? 6.696   -7.423  -2.892 1.00 0.00 ? 104 PHE A HE2  7  
ATOM   2977 H  HZ   . PHE A 1 3  ? 5.384   -8.126  -4.838 1.00 0.00 ? 104 PHE A HZ   7  
ATOM   2978 N  N    . VAL A 1 4  ? 0.374   -6.825  1.942  1.00 0.00 ? 105 VAL A N    7  
ATOM   2979 C  CA   . VAL A 1 4  ? -0.173  -6.788  3.288  1.00 0.00 ? 105 VAL A CA   7  
ATOM   2980 C  C    . VAL A 1 4  ? -1.146  -7.954  3.470  1.00 0.00 ? 105 VAL A C    7  
ATOM   2981 O  O    . VAL A 1 4  ? -1.778  -8.396  2.511  1.00 0.00 ? 105 VAL A O    7  
ATOM   2982 C  CB   . VAL A 1 4  ? -0.816  -5.425  3.555  1.00 0.00 ? 105 VAL A CB   7  
ATOM   2983 C  CG1  . VAL A 1 4  ? -1.519  -5.408  4.913  1.00 0.00 ? 105 VAL A CG1  7  
ATOM   2984 C  CG2  . VAL A 1 4  ? 0.219   -4.302  3.458  1.00 0.00 ? 105 VAL A CG2  7  
ATOM   2985 H  H    . VAL A 1 4  ? -0.303  -6.768  1.209  1.00 0.00 ? 105 VAL A H    7  
ATOM   2986 H  HA   . VAL A 1 4  ? 0.656   -6.911  3.984  1.00 0.00 ? 105 VAL A HA   7  
ATOM   2987 H  HB   . VAL A 1 4  ? -1.569  -5.253  2.786  1.00 0.00 ? 105 VAL A HB   7  
ATOM   2988 H  HG11 . VAL A 1 4  ? -1.970  -4.428  5.076  1.00 0.00 ? 105 VAL A HG11 7  
ATOM   2989 H  HG12 . VAL A 1 4  ? -2.296  -6.172  4.931  1.00 0.00 ? 105 VAL A HG12 7  
ATOM   2990 H  HG13 . VAL A 1 4  ? -0.793  -5.608  5.701  1.00 0.00 ? 105 VAL A HG13 7  
ATOM   2991 H  HG21 . VAL A 1 4  ? 0.153   -3.671  4.344  1.00 0.00 ? 105 VAL A HG21 7  
ATOM   2992 H  HG22 . VAL A 1 4  ? 1.217   -4.734  3.393  1.00 0.00 ? 105 VAL A HG22 7  
ATOM   2993 H  HG23 . VAL A 1 4  ? 0.023   -3.703  2.569  1.00 0.00 ? 105 VAL A HG23 7  
ATOM   2994 N  N    . CYS A 1 5  ? -1.239  -8.419  4.707  1.00 0.00 ? 106 CYS A N    7  
ATOM   2995 C  CA   . CYS A 1 5  ? -2.125  -9.525  5.027  1.00 0.00 ? 106 CYS A CA   7  
ATOM   2996 C  C    . CYS A 1 5  ? -3.429  -8.950  5.584  1.00 0.00 ? 106 CYS A C    7  
ATOM   2997 O  O    . CYS A 1 5  ? -3.409  -8.130  6.501  1.00 0.00 ? 106 CYS A O    7  
ATOM   2998 C  CB   . CYS A 1 5  ? -1.473  -10.508 6.001  1.00 0.00 ? 106 CYS A CB   7  
ATOM   2999 S  SG   . CYS A 1 5  ? -2.641  -11.860 6.400  1.00 0.00 ? 106 CYS A SG   7  
ATOM   3000 H  H    . CYS A 1 5  ? -0.723  -8.053  5.482  1.00 0.00 ? 106 CYS A H    7  
ATOM   3001 H  HA   . CYS A 1 5  ? -2.305  -10.062 4.096  1.00 0.00 ? 106 CYS A HA   7  
ATOM   3002 H  HB2  . CYS A 1 5  ? -0.565  -10.920 5.562  1.00 0.00 ? 106 CYS A HB2  7  
ATOM   3003 H  HB3  . CYS A 1 5  ? -1.180  -9.990  6.913  1.00 0.00 ? 106 CYS A HB3  7  
ATOM   3004 N  N    . GLU A 1 6  ? -4.533  -9.404  5.006  1.00 0.00 ? 107 GLU A N    7  
ATOM   3005 C  CA   . GLU A 1 6  ? -5.843  -8.944  5.433  1.00 0.00 ? 107 GLU A CA   7  
ATOM   3006 C  C    . GLU A 1 6  ? -6.256  -9.648  6.727  1.00 0.00 ? 107 GLU A C    7  
ATOM   3007 O  O    . GLU A 1 6  ? -7.371  -9.460  7.212  1.00 0.00 ? 107 GLU A O    7  
ATOM   3008 C  CB   . GLU A 1 6  ? -6.885  -9.162  4.335  1.00 0.00 ? 107 GLU A CB   7  
ATOM   3009 C  CG   . GLU A 1 6  ? -6.495  -8.420  3.054  1.00 0.00 ? 107 GLU A CG   7  
ATOM   3010 C  CD   . GLU A 1 6  ? -7.024  -6.983  3.072  1.00 0.00 ? 107 GLU A CD   7  
ATOM   3011 O  OE1  . GLU A 1 6  ? -7.781  -6.668  4.015  1.00 0.00 ? 107 GLU A OE1  7  
ATOM   3012 O  OE2  . GLU A 1 6  ? -6.657  -6.233  2.142  1.00 0.00 ? 107 GLU A OE2  7  
ATOM   3013 H  H    . GLU A 1 6  ? -4.540  -10.070 4.261  1.00 0.00 ? 107 GLU A H    7  
ATOM   3014 H  HA   . GLU A 1 6  ? -5.731  -7.875  5.614  1.00 0.00 ? 107 GLU A HA   7  
ATOM   3015 H  HB2  . GLU A 1 6  ? -6.982  -10.228 4.126  1.00 0.00 ? 107 GLU A HB2  7  
ATOM   3016 H  HB3  . GLU A 1 6  ? -7.860  -8.815  4.678  1.00 0.00 ? 107 GLU A HB3  7  
ATOM   3017 H  HG2  . GLU A 1 6  ? -5.410  -8.411  2.951  1.00 0.00 ? 107 GLU A HG2  7  
ATOM   3018 H  HG3  . GLU A 1 6  ? -6.895  -8.947  2.188  1.00 0.00 ? 107 GLU A HG3  7  
ATOM   3019 N  N    . VAL A 1 7  ? -5.335  -10.444 7.251  1.00 0.00 ? 108 VAL A N    7  
ATOM   3020 C  CA   . VAL A 1 7  ? -5.590  -11.176 8.479  1.00 0.00 ? 108 VAL A CA   7  
ATOM   3021 C  C    . VAL A 1 7  ? -4.891  -10.470 9.644  1.00 0.00 ? 108 VAL A C    7  
ATOM   3022 O  O    . VAL A 1 7  ? -5.548  -9.893  10.509 1.00 0.00 ? 108 VAL A O    7  
ATOM   3023 C  CB   . VAL A 1 7  ? -5.155  -12.635 8.319  1.00 0.00 ? 108 VAL A CB   7  
ATOM   3024 C  CG1  . VAL A 1 7  ? -5.147  -13.356 9.667  1.00 0.00 ? 108 VAL A CG1  7  
ATOM   3025 C  CG2  . VAL A 1 7  ? -6.047  -13.365 7.313  1.00 0.00 ? 108 VAL A CG2  7  
ATOM   3026 H  H    . VAL A 1 7  ? -4.430  -10.591 6.851  1.00 0.00 ? 108 VAL A H    7  
ATOM   3027 H  HA   . VAL A 1 7  ? -6.665  -11.162 8.655  1.00 0.00 ? 108 VAL A HA   7  
ATOM   3028 H  HB   . VAL A 1 7  ? -4.137  -12.640 7.930  1.00 0.00 ? 108 VAL A HB   7  
ATOM   3029 H  HG11 . VAL A 1 7  ? -4.247  -13.084 10.220 1.00 0.00 ? 108 VAL A HG11 7  
ATOM   3030 H  HG12 . VAL A 1 7  ? -6.027  -13.065 10.242 1.00 0.00 ? 108 VAL A HG12 7  
ATOM   3031 H  HG13 . VAL A 1 7  ? -5.160  -14.433 9.504  1.00 0.00 ? 108 VAL A HG13 7  
ATOM   3032 H  HG21 . VAL A 1 7  ? -6.822  -12.686 6.955  1.00 0.00 ? 108 VAL A HG21 7  
ATOM   3033 H  HG22 . VAL A 1 7  ? -5.444  -13.703 6.470  1.00 0.00 ? 108 VAL A HG22 7  
ATOM   3034 H  HG23 . VAL A 1 7  ? -6.512  -14.225 7.795  1.00 0.00 ? 108 VAL A HG23 7  
ATOM   3035 N  N    . CYS A 1 8  ? -3.569  -10.538 9.627  1.00 0.00 ? 109 CYS A N    7  
ATOM   3036 C  CA   . CYS A 1 8  ? -2.774  -9.913  10.671 1.00 0.00 ? 109 CYS A CA   7  
ATOM   3037 C  C    . CYS A 1 8  ? -2.180  -8.618  10.111 1.00 0.00 ? 109 CYS A C    7  
ATOM   3038 O  O    . CYS A 1 8  ? -1.142  -8.153  10.580 1.00 0.00 ? 109 CYS A O    7  
ATOM   3039 C  CB   . CYS A 1 8  ? -1.691  -10.854 11.199 1.00 0.00 ? 109 CYS A CB   7  
ATOM   3040 S  SG   . CYS A 1 8  ? -0.410  -11.118 9.919  1.00 0.00 ? 109 CYS A SG   7  
ATOM   3041 H  H    . CYS A 1 8  ? -3.041  -11.009 8.920  1.00 0.00 ? 109 CYS A H    7  
ATOM   3042 H  HA   . CYS A 1 8  ? -3.453  -9.701  11.497 1.00 0.00 ? 109 CYS A HA   7  
ATOM   3043 H  HB2  . CYS A 1 8  ? -1.238  -10.434 12.097 1.00 0.00 ? 109 CYS A HB2  7  
ATOM   3044 H  HB3  . CYS A 1 8  ? -2.135  -11.809 11.483 1.00 0.00 ? 109 CYS A HB3  7  
ATOM   3045 N  N    . THR A 1 9  ? -2.864  -8.072  9.116  1.00 0.00 ? 110 THR A N    7  
ATOM   3046 C  CA   . THR A 1 9  ? -2.418  -6.840  8.488  1.00 0.00 ? 110 THR A CA   7  
ATOM   3047 C  C    . THR A 1 9  ? -0.892  -6.821  8.377  1.00 0.00 ? 110 THR A C    7  
ATOM   3048 O  O    . THR A 1 9  ? -0.280  -5.754  8.367  1.00 0.00 ? 110 THR A O    7  
ATOM   3049 C  CB   . THR A 1 9  ? -2.984  -5.668  9.291  1.00 0.00 ? 110 THR A CB   7  
ATOM   3050 O  OG1  . THR A 1 9  ? -2.105  -5.555  10.407 1.00 0.00 ? 110 THR A OG1  7  
ATOM   3051 C  CG2  . THR A 1 9  ? -4.343  -5.988  9.918  1.00 0.00 ? 110 THR A CG2  7  
ATOM   3052 H  H    . THR A 1 9  ? -3.708  -8.456  8.741  1.00 0.00 ? 110 THR A H    7  
ATOM   3053 H  HA   . THR A 1 9  ? -2.813  -6.810  7.472  1.00 0.00 ? 110 THR A HA   7  
ATOM   3054 H  HB   . THR A 1 9  ? -3.040  -4.768  8.679  1.00 0.00 ? 110 THR A HB   7  
ATOM   3055 H  HG1  . THR A 1 9  ? -2.200  -6.355  11.000 1.00 0.00 ? 110 THR A HG1  7  
ATOM   3056 H  HG21 . THR A 1 9  ? -4.198  -6.336  10.941 1.00 0.00 ? 110 THR A HG21 7  
ATOM   3057 H  HG22 . THR A 1 9  ? -4.961  -5.091  9.924  1.00 0.00 ? 110 THR A HG22 7  
ATOM   3058 H  HG23 . THR A 1 9  ? -4.836  -6.766  9.336  1.00 0.00 ? 110 THR A HG23 7  
ATOM   3059 N  N    . ARG A 1 10 ? -0.321  -8.013  8.298  1.00 0.00 ? 111 ARG A N    7  
ATOM   3060 C  CA   . ARG A 1 10 ? 1.122   -8.147  8.188  1.00 0.00 ? 111 ARG A CA   7  
ATOM   3061 C  C    . ARG A 1 10 ? 1.583   -7.775  6.778  1.00 0.00 ? 111 ARG A C    7  
ATOM   3062 O  O    . ARG A 1 10 ? 0.917   -8.100  5.797  1.00 0.00 ? 111 ARG A O    7  
ATOM   3063 C  CB   . ARG A 1 10 ? 1.568   -9.577  8.503  1.00 0.00 ? 111 ARG A CB   7  
ATOM   3064 C  CG   . ARG A 1 10 ? 2.177   -9.665  9.903  1.00 0.00 ? 111 ARG A CG   7  
ATOM   3065 C  CD   . ARG A 1 10 ? 3.688   -9.889  9.832  1.00 0.00 ? 111 ARG A CD   7  
ATOM   3066 N  NE   . ARG A 1 10 ? 4.393   -8.840  10.601 1.00 0.00 ? 111 ARG A NE   7  
ATOM   3067 C  CZ   . ARG A 1 10 ? 5.726   -8.767  10.725 1.00 0.00 ? 111 ARG A CZ   7  
ATOM   3068 N  NH1  . ARG A 1 10 ? 6.463   -9.885  10.700 1.00 0.00 ? 111 ARG A NH1  7  
ATOM   3069 N  NH2  . ARG A 1 10 ? 6.320   -7.575  10.876 1.00 0.00 ? 111 ARG A NH2  7  
ATOM   3070 H  H    . ARG A 1 10 ? -0.826  -8.877  8.307  1.00 0.00 ? 111 ARG A H    7  
ATOM   3071 H  HA   . ARG A 1 10 ? 1.522   -7.454  8.928  1.00 0.00 ? 111 ARG A HA   7  
ATOM   3072 H  HB2  . ARG A 1 10 ? 0.716   -10.252 8.429  1.00 0.00 ? 111 ARG A HB2  7  
ATOM   3073 H  HB3  . ARG A 1 10 ? 2.299   -9.904  7.763  1.00 0.00 ? 111 ARG A HB3  7  
ATOM   3074 H  HG2  . ARG A 1 10 ? 1.967   -8.748  10.453 1.00 0.00 ? 111 ARG A HG2  7  
ATOM   3075 H  HG3  . ARG A 1 10 ? 1.710   -10.481 10.456 1.00 0.00 ? 111 ARG A HG3  7  
ATOM   3076 H  HD2  . ARG A 1 10 ? 3.938   -10.873 10.229 1.00 0.00 ? 111 ARG A HD2  7  
ATOM   3077 H  HD3  . ARG A 1 10 ? 4.018   -9.873  8.792  1.00 0.00 ? 111 ARG A HD3  7  
ATOM   3078 H  HE   . ARG A 1 10 ? 3.841   -8.141  11.056 1.00 0.00 ? 111 ARG A HE   7  
ATOM   3079 H  HH11 . ARG A 1 10 ? 6.015   -10.779 10.680 1.00 0.00 ? 111 ARG A HH11 7  
ATOM   3080 H  HH12 . ARG A 1 10 ? 7.461   -9.825  10.703 1.00 0.00 ? 111 ARG A HH12 7  
ATOM   3081 H  HH21 . ARG A 1 10 ? 6.604   -7.054  10.071 1.00 0.00 ? 111 ARG A HH21 7  
ATOM   3082 H  HH22 . ARG A 1 10 ? 6.479   -7.208  11.792 1.00 0.00 ? 111 ARG A HH22 7  
ATOM   3083 N  N    . ALA A 1 11 ? 2.721   -7.097  6.722  1.00 0.00 ? 112 ALA A N    7  
ATOM   3084 C  CA   . ALA A 1 11 ? 3.279   -6.677  5.448  1.00 0.00 ? 112 ALA A CA   7  
ATOM   3085 C  C    . ALA A 1 11 ? 4.555   -7.474  5.168  1.00 0.00 ? 112 ALA A C    7  
ATOM   3086 O  O    . ALA A 1 11 ? 5.237   -7.906  6.095  1.00 0.00 ? 112 ALA A O    7  
ATOM   3087 C  CB   . ALA A 1 11 ? 3.529   -5.167  5.474  1.00 0.00 ? 112 ALA A CB   7  
ATOM   3088 H  H    . ALA A 1 11 ? 3.256   -6.836  7.526  1.00 0.00 ? 112 ALA A H    7  
ATOM   3089 H  HA   . ALA A 1 11 ? 2.545   -6.898  4.674  1.00 0.00 ? 112 ALA A HA   7  
ATOM   3090 H  HB1  . ALA A 1 11 ? 4.156   -4.917  6.330  1.00 0.00 ? 112 ALA A HB1  7  
ATOM   3091 H  HB2  . ALA A 1 11 ? 4.033   -4.867  4.555  1.00 0.00 ? 112 ALA A HB2  7  
ATOM   3092 H  HB3  . ALA A 1 11 ? 2.577   -4.643  5.554  1.00 0.00 ? 112 ALA A HB3  7  
ATOM   3093 N  N    . PHE A 1 12 ? 4.837   -7.645  3.885  1.00 0.00 ? 113 PHE A N    7  
ATOM   3094 C  CA   . PHE A 1 12 ? 6.018   -8.383  3.470  1.00 0.00 ? 113 PHE A CA   7  
ATOM   3095 C  C    . PHE A 1 12 ? 6.650   -7.753  2.228  1.00 0.00 ? 113 PHE A C    7  
ATOM   3096 O  O    . PHE A 1 12 ? 6.062   -6.869  1.607  1.00 0.00 ? 113 PHE A O    7  
ATOM   3097 C  CB   . PHE A 1 12 ? 5.562   -9.804  3.131  1.00 0.00 ? 113 PHE A CB   7  
ATOM   3098 C  CG   . PHE A 1 12 ? 4.943   -10.558 4.310  1.00 0.00 ? 113 PHE A CG   7  
ATOM   3099 C  CD1  . PHE A 1 12 ? 5.745   -11.165 5.225  1.00 0.00 ? 113 PHE A CD1  7  
ATOM   3100 C  CD2  . PHE A 1 12 ? 3.591   -10.619 4.444  1.00 0.00 ? 113 PHE A CD2  7  
ATOM   3101 C  CE1  . PHE A 1 12 ? 5.172   -11.865 6.318  1.00 0.00 ? 113 PHE A CE1  7  
ATOM   3102 C  CE2  . PHE A 1 12 ? 3.018   -11.318 5.539  1.00 0.00 ? 113 PHE A CE2  7  
ATOM   3103 C  CZ   . PHE A 1 12 ? 3.820   -11.927 6.453  1.00 0.00 ? 113 PHE A CZ   7  
ATOM   3104 H  H    . PHE A 1 12 ? 4.276   -7.290  3.136  1.00 0.00 ? 113 PHE A H    7  
ATOM   3105 H  HA   . PHE A 1 12 ? 6.729   -8.346  4.296  1.00 0.00 ? 113 PHE A HA   7  
ATOM   3106 H  HB2  . PHE A 1 12 ? 4.833   -9.757  2.321  1.00 0.00 ? 113 PHE A HB2  7  
ATOM   3107 H  HB3  . PHE A 1 12 ? 6.415   -10.370 2.759  1.00 0.00 ? 113 PHE A HB3  7  
ATOM   3108 H  HD1  . PHE A 1 12 ? 6.829   -11.116 5.117  1.00 0.00 ? 113 PHE A HD1  7  
ATOM   3109 H  HD2  . PHE A 1 12 ? 2.948   -10.132 3.712  1.00 0.00 ? 113 PHE A HD2  7  
ATOM   3110 H  HE1  . PHE A 1 12 ? 5.815   -12.352 7.052  1.00 0.00 ? 113 PHE A HE1  7  
ATOM   3111 H  HE2  . PHE A 1 12 ? 1.934   -11.368 5.647  1.00 0.00 ? 113 PHE A HE2  7  
ATOM   3112 H  HZ   . PHE A 1 12 ? 3.380   -12.463 7.293  1.00 0.00 ? 113 PHE A HZ   7  
ATOM   3113 N  N    . ALA A 1 13 ? 7.842   -8.232  1.902  1.00 0.00 ? 114 ALA A N    7  
ATOM   3114 C  CA   . ALA A 1 13 ? 8.561   -7.726  0.745  1.00 0.00 ? 114 ALA A CA   7  
ATOM   3115 C  C    . ALA A 1 13 ? 8.249   -8.605  -0.468 1.00 0.00 ? 114 ALA A C    7  
ATOM   3116 O  O    . ALA A 1 13 ? 8.119   -8.105  -1.584 1.00 0.00 ? 114 ALA A O    7  
ATOM   3117 C  CB   . ALA A 1 13 ? 10.058  -7.673  1.057  1.00 0.00 ? 114 ALA A CB   7  
ATOM   3118 H  H    . ALA A 1 13 ? 8.314   -8.950  2.412  1.00 0.00 ? 114 ALA A H    7  
ATOM   3119 H  HA   . ALA A 1 13 ? 8.207   -6.714  0.551  1.00 0.00 ? 114 ALA A HA   7  
ATOM   3120 H  HB1  . ALA A 1 13 ? 10.406  -6.642  0.993  1.00 0.00 ? 114 ALA A HB1  7  
ATOM   3121 H  HB2  . ALA A 1 13 ? 10.233  -8.054  2.063  1.00 0.00 ? 114 ALA A HB2  7  
ATOM   3122 H  HB3  . ALA A 1 13 ? 10.601  -8.285  0.337  1.00 0.00 ? 114 ALA A HB3  7  
ATOM   3123 N  N    . ARG A 1 14 ? 8.136   -9.900  -0.208 1.00 0.00 ? 115 ARG A N    7  
ATOM   3124 C  CA   . ARG A 1 14 ? 7.842   -10.852 -1.264 1.00 0.00 ? 115 ARG A CA   7  
ATOM   3125 C  C    . ARG A 1 14 ? 6.408   -11.367 -1.130 1.00 0.00 ? 115 ARG A C    7  
ATOM   3126 O  O    . ARG A 1 14 ? 5.875   -11.451 -0.025 1.00 0.00 ? 115 ARG A O    7  
ATOM   3127 C  CB   . ARG A 1 14 ? 8.808   -12.038 -1.222 1.00 0.00 ? 115 ARG A CB   7  
ATOM   3128 C  CG   . ARG A 1 14 ? 9.922   -11.875 -2.257 1.00 0.00 ? 115 ARG A CG   7  
ATOM   3129 C  CD   . ARG A 1 14 ? 10.330  -10.408 -2.399 1.00 0.00 ? 115 ARG A CD   7  
ATOM   3130 N  NE   . ARG A 1 14 ? 9.712   -9.825  -3.610 1.00 0.00 ? 115 ARG A NE   7  
ATOM   3131 C  CZ   . ARG A 1 14 ? 9.632   -10.455 -4.790 1.00 0.00 ? 115 ARG A CZ   7  
ATOM   3132 N  NH1  . ARG A 1 14 ? 10.674  -11.172 -5.238 1.00 0.00 ? 115 ARG A NH1  7  
ATOM   3133 N  NH2  . ARG A 1 14 ? 8.513   -10.371 -5.522 1.00 0.00 ? 115 ARG A NH2  7  
ATOM   3134 H  H    . ARG A 1 14 ? 8.243   -10.298 0.703  1.00 0.00 ? 115 ARG A H    7  
ATOM   3135 H  HA   . ARG A 1 14 ? 7.973   -10.292 -2.190 1.00 0.00 ? 115 ARG A HA   7  
ATOM   3136 H  HB2  . ARG A 1 14 ? 9.243   -12.123 -0.225 1.00 0.00 ? 115 ARG A HB2  7  
ATOM   3137 H  HB3  . ARG A 1 14 ? 8.263   -12.962 -1.410 1.00 0.00 ? 115 ARG A HB3  7  
ATOM   3138 H  HG2  . ARG A 1 14 ? 10.787  -12.470 -1.962 1.00 0.00 ? 115 ARG A HG2  7  
ATOM   3139 H  HG3  . ARG A 1 14 ? 9.587   -12.258 -3.221 1.00 0.00 ? 115 ARG A HG3  7  
ATOM   3140 H  HD2  . ARG A 1 14 ? 10.017  -9.849  -1.517 1.00 0.00 ? 115 ARG A HD2  7  
ATOM   3141 H  HD3  . ARG A 1 14 ? 11.415  -10.327 -2.459 1.00 0.00 ? 115 ARG A HD3  7  
ATOM   3142 H  HE   . ARG A 1 14 ? 9.329   -8.904  -3.545 1.00 0.00 ? 115 ARG A HE   7  
ATOM   3143 H  HH11 . ARG A 1 14 ? 11.515  -10.709 -5.517 1.00 0.00 ? 115 ARG A HH11 7  
ATOM   3144 H  HH12 . ARG A 1 14 ? 10.607  -12.167 -5.295 1.00 0.00 ? 115 ARG A HH12 7  
ATOM   3145 H  HH21 . ARG A 1 14 ? 8.384   -9.605  -6.151 1.00 0.00 ? 115 ARG A HH21 7  
ATOM   3146 H  HH22 . ARG A 1 14 ? 7.807   -11.073 -5.438 1.00 0.00 ? 115 ARG A HH22 7  
ATOM   3147 N  N    . GLN A 1 15 ? 5.822   -11.699 -2.272 1.00 0.00 ? 116 GLN A N    7  
ATOM   3148 C  CA   . GLN A 1 15 ? 4.460   -12.203 -2.296 1.00 0.00 ? 116 GLN A CA   7  
ATOM   3149 C  C    . GLN A 1 15 ? 4.390   -13.575 -1.623 1.00 0.00 ? 116 GLN A C    7  
ATOM   3150 O  O    . GLN A 1 15 ? 3.413   -13.887 -0.942 1.00 0.00 ? 116 GLN A O    7  
ATOM   3151 C  CB   . GLN A 1 15 ? 3.925   -12.267 -3.728 1.00 0.00 ? 116 GLN A CB   7  
ATOM   3152 C  CG   . GLN A 1 15 ? 3.194   -10.975 -4.098 1.00 0.00 ? 116 GLN A CG   7  
ATOM   3153 C  CD   . GLN A 1 15 ? 1.982   -11.266 -4.986 1.00 0.00 ? 116 GLN A CD   7  
ATOM   3154 O  OE1  . GLN A 1 15 ? 0.845   -11.289 -4.541 1.00 0.00 ? 116 GLN A OE1  7  
ATOM   3155 N  NE2  . GLN A 1 15 ? 2.285   -11.486 -6.261 1.00 0.00 ? 116 GLN A NE2  7  
ATOM   3156 H  H    . GLN A 1 15 ? 6.263   -11.628 -3.167 1.00 0.00 ? 116 GLN A H    7  
ATOM   3157 H  HA   . GLN A 1 15 ? 3.875   -11.481 -1.727 1.00 0.00 ? 116 GLN A HA   7  
ATOM   3158 H  HB2  . GLN A 1 15 ? 4.749   -12.434 -4.421 1.00 0.00 ? 116 GLN A HB2  7  
ATOM   3159 H  HB3  . GLN A 1 15 ? 3.246   -13.114 -3.829 1.00 0.00 ? 116 GLN A HB3  7  
ATOM   3160 H  HG2  . GLN A 1 15 ? 2.871   -10.463 -3.192 1.00 0.00 ? 116 GLN A HG2  7  
ATOM   3161 H  HG3  . GLN A 1 15 ? 3.877   -10.304 -4.618 1.00 0.00 ? 116 GLN A HG3  7  
ATOM   3162 H  HE21 . GLN A 1 15 ? 2.417   -10.715 -6.884 1.00 0.00 ? 116 GLN A HE21 7  
ATOM   3163 H  HE22 . GLN A 1 15 ? 2.382   -12.423 -6.598 1.00 0.00 ? 116 GLN A HE22 7  
ATOM   3164 N  N    . GLU A 1 16 ? 5.438   -14.357 -1.834 1.00 0.00 ? 117 GLU A N    7  
ATOM   3165 C  CA   . GLU A 1 16 ? 5.507   -15.688 -1.257 1.00 0.00 ? 117 GLU A CA   7  
ATOM   3166 C  C    . GLU A 1 16 ? 5.467   -15.607 0.271  1.00 0.00 ? 117 GLU A C    7  
ATOM   3167 O  O    . GLU A 1 16 ? 4.838   -16.438 0.924  1.00 0.00 ? 117 GLU A O    7  
ATOM   3168 C  CB   . GLU A 1 16 ? 6.759   -16.429 -1.733 1.00 0.00 ? 117 GLU A CB   7  
ATOM   3169 C  CG   . GLU A 1 16 ? 7.277   -17.381 -0.653 1.00 0.00 ? 117 GLU A CG   7  
ATOM   3170 C  CD   . GLU A 1 16 ? 8.018   -18.565 -1.276 1.00 0.00 ? 117 GLU A CD   7  
ATOM   3171 O  OE1  . GLU A 1 16 ? 7.326   -19.423 -1.862 1.00 0.00 ? 117 GLU A OE1  7  
ATOM   3172 O  OE2  . GLU A 1 16 ? 9.263   -18.584 -1.151 1.00 0.00 ? 117 GLU A OE2  7  
ATOM   3173 H  H    . GLU A 1 16 ? 6.227   -14.096 -2.390 1.00 0.00 ? 117 GLU A H    7  
ATOM   3174 H  HA   . GLU A 1 16 ? 4.623   -16.210 -1.623 1.00 0.00 ? 117 GLU A HA   7  
ATOM   3175 H  HB2  . GLU A 1 16 ? 6.530   -16.991 -2.638 1.00 0.00 ? 117 GLU A HB2  7  
ATOM   3176 H  HB3  . GLU A 1 16 ? 7.535   -15.709 -1.992 1.00 0.00 ? 117 GLU A HB3  7  
ATOM   3177 H  HG2  . GLU A 1 16 ? 7.943   -16.843 0.021  1.00 0.00 ? 117 GLU A HG2  7  
ATOM   3178 H  HG3  . GLU A 1 16 ? 6.443   -17.744 -0.053 1.00 0.00 ? 117 GLU A HG3  7  
ATOM   3179 N  N    . ALA A 1 17 ? 6.145   -14.597 0.796  1.00 0.00 ? 118 ALA A N    7  
ATOM   3180 C  CA   . ALA A 1 17 ? 6.194   -14.396 2.233  1.00 0.00 ? 118 ALA A CA   7  
ATOM   3181 C  C    . ALA A 1 17 ? 4.772   -14.211 2.768  1.00 0.00 ? 118 ALA A C    7  
ATOM   3182 O  O    . ALA A 1 17 ? 4.496   -14.521 3.926  1.00 0.00 ? 118 ALA A O    7  
ATOM   3183 C  CB   . ALA A 1 17 ? 7.096   -13.201 2.552  1.00 0.00 ? 118 ALA A CB   7  
ATOM   3184 H  H    . ALA A 1 17 ? 6.654   -13.925 0.258  1.00 0.00 ? 118 ALA A H    7  
ATOM   3185 H  HA   . ALA A 1 17 ? 6.628   -15.290 2.679  1.00 0.00 ? 118 ALA A HA   7  
ATOM   3186 H  HB1  . ALA A 1 17 ? 7.694   -13.422 3.435  1.00 0.00 ? 118 ALA A HB1  7  
ATOM   3187 H  HB2  . ALA A 1 17 ? 7.756   -13.008 1.705  1.00 0.00 ? 118 ALA A HB2  7  
ATOM   3188 H  HB3  . ALA A 1 17 ? 6.480   -12.321 2.739  1.00 0.00 ? 118 ALA A HB3  7  
ATOM   3189 N  N    . LEU A 1 18 ? 3.909   -13.708 1.898  1.00 0.00 ? 119 LEU A N    7  
ATOM   3190 C  CA   . LEU A 1 18 ? 2.523   -13.479 2.268  1.00 0.00 ? 119 LEU A CA   7  
ATOM   3191 C  C    . LEU A 1 18 ? 1.753   -14.798 2.187  1.00 0.00 ? 119 LEU A C    7  
ATOM   3192 O  O    . LEU A 1 18 ? 1.338   -15.344 3.208  1.00 0.00 ? 119 LEU A O    7  
ATOM   3193 C  CB   . LEU A 1 18 ? 1.918   -12.360 1.416  1.00 0.00 ? 119 LEU A CB   7  
ATOM   3194 C  CG   . LEU A 1 18 ? 0.391   -12.273 1.410  1.00 0.00 ? 119 LEU A CG   7  
ATOM   3195 C  CD1  . LEU A 1 18 ? -0.164  -12.267 2.837  1.00 0.00 ? 119 LEU A CD1  7  
ATOM   3196 C  CD2  . LEU A 1 18 ? -0.086  -11.062 0.604  1.00 0.00 ? 119 LEU A CD2  7  
ATOM   3197 H  H    . LEU A 1 18 ? 4.142   -13.458 0.959  1.00 0.00 ? 119 LEU A H    7  
ATOM   3198 H  HA   . LEU A 1 18 ? 2.512   -13.137 3.303  1.00 0.00 ? 119 LEU A HA   7  
ATOM   3199 H  HB2  . LEU A 1 18 ? 2.316   -11.408 1.767  1.00 0.00 ? 119 LEU A HB2  7  
ATOM   3200 H  HB3  . LEU A 1 18 ? 2.259   -12.490 0.389  1.00 0.00 ? 119 LEU A HB3  7  
ATOM   3201 H  HG   . LEU A 1 18 ? -0.001  -13.162 0.917  1.00 0.00 ? 119 LEU A HG   7  
ATOM   3202 H  HD11 . LEU A 1 18 ? -0.139  -13.279 3.240  1.00 0.00 ? 119 LEU A HD11 7  
ATOM   3203 H  HD12 . LEU A 1 18 ? 0.445   -11.611 3.459  1.00 0.00 ? 119 LEU A HD12 7  
ATOM   3204 H  HD13 . LEU A 1 18 ? -1.192  -11.904 2.824  1.00 0.00 ? 119 LEU A HD13 7  
ATOM   3205 H  HD21 . LEU A 1 18 ? 0.610   -10.874 -0.213 1.00 0.00 ? 119 LEU A HD21 7  
ATOM   3206 H  HD22 . LEU A 1 18 ? -1.077  -11.263 0.199  1.00 0.00 ? 119 LEU A HD22 7  
ATOM   3207 H  HD23 . LEU A 1 18 ? -0.129  -10.188 1.254  1.00 0.00 ? 119 LEU A HD23 7  
ATOM   3208 N  N    . LYS A 1 19 ? 1.584   -15.274 0.961  1.00 0.00 ? 120 LYS A N    7  
ATOM   3209 C  CA   . LYS A 1 19 ? 0.872   -16.519 0.733  1.00 0.00 ? 120 LYS A CA   7  
ATOM   3210 C  C    . LYS A 1 19 ? 1.223   -17.514 1.841  1.00 0.00 ? 120 LYS A C    7  
ATOM   3211 O  O    . LYS A 1 19 ? 0.348   -17.957 2.582  1.00 0.00 ? 120 LYS A O    7  
ATOM   3212 C  CB   . LYS A 1 19 ? 1.150   -17.045 -0.677 1.00 0.00 ? 120 LYS A CB   7  
ATOM   3213 C  CG   . LYS A 1 19 ? -0.101  -16.956 -1.553 1.00 0.00 ? 120 LYS A CG   7  
ATOM   3214 C  CD   . LYS A 1 19 ? 0.119   -17.656 -2.895 1.00 0.00 ? 120 LYS A CD   7  
ATOM   3215 C  CE   . LYS A 1 19 ? -0.709  -18.940 -2.986 1.00 0.00 ? 120 LYS A CE   7  
ATOM   3216 N  NZ   . LYS A 1 19 ? -0.504  -19.774 -1.781 1.00 0.00 ? 120 LYS A NZ   7  
ATOM   3217 H  H    . LYS A 1 19 ? 1.924   -14.824 0.135  1.00 0.00 ? 120 LYS A H    7  
ATOM   3218 H  HA   . LYS A 1 19 ? -0.195  -16.300 0.790  1.00 0.00 ? 120 LYS A HA   7  
ATOM   3219 H  HB2  . LYS A 1 19 ? 1.958   -16.471 -1.131 1.00 0.00 ? 120 LYS A HB2  7  
ATOM   3220 H  HB3  . LYS A 1 19 ? 1.487   -18.080 -0.622 1.00 0.00 ? 120 LYS A HB3  7  
ATOM   3221 H  HG2  . LYS A 1 19 ? -0.945  -17.410 -1.035 1.00 0.00 ? 120 LYS A HG2  7  
ATOM   3222 H  HG3  . LYS A 1 19 ? -0.357  -15.910 -1.722 1.00 0.00 ? 120 LYS A HG3  7  
ATOM   3223 H  HD2  . LYS A 1 19 ? -0.156  -16.984 -3.709 1.00 0.00 ? 120 LYS A HD2  7  
ATOM   3224 H  HD3  . LYS A 1 19 ? 1.175   -17.891 -3.018 1.00 0.00 ? 120 LYS A HD3  7  
ATOM   3225 H  HE2  . LYS A 1 19 ? -1.766  -18.693 -3.087 1.00 0.00 ? 120 LYS A HE2  7  
ATOM   3226 H  HE3  . LYS A 1 19 ? -0.426  -19.500 -3.877 1.00 0.00 ? 120 LYS A HE3  7  
ATOM   3227 H  HZ1  . LYS A 1 19 ? -0.859  -20.694 -1.948 1.00 0.00 ? 120 LYS A HZ1  7  
ATOM   3228 H  HZ2  . LYS A 1 19 ? 0.474   -19.827 -1.574 1.00 0.00 ? 120 LYS A HZ2  7  
ATOM   3229 H  HZ3  . LYS A 1 19 ? -0.986  -19.366 -1.006 1.00 0.00 ? 120 LYS A HZ3  7  
ATOM   3230 N  N    . ARG A 1 20 ? 2.507   -17.835 1.919  1.00 0.00 ? 121 ARG A N    7  
ATOM   3231 C  CA   . ARG A 1 20 ? 2.984   -18.768 2.924  1.00 0.00 ? 121 ARG A CA   7  
ATOM   3232 C  C    . ARG A 1 20 ? 2.474   -18.365 4.308  1.00 0.00 ? 121 ARG A C    7  
ATOM   3233 O  O    . ARG A 1 20 ? 1.976   -19.203 5.059  1.00 0.00 ? 121 ARG A O    7  
ATOM   3234 C  CB   . ARG A 1 20 ? 4.514   -18.818 2.947  1.00 0.00 ? 121 ARG A CB   7  
ATOM   3235 C  CG   . ARG A 1 20 ? 5.011   -20.090 3.636  1.00 0.00 ? 121 ARG A CG   7  
ATOM   3236 C  CD   . ARG A 1 20 ? 6.213   -20.680 2.897  1.00 0.00 ? 121 ARG A CD   7  
ATOM   3237 N  NE   . ARG A 1 20 ? 7.067   -21.436 3.841  1.00 0.00 ? 121 ARG A NE   7  
ATOM   3238 C  CZ   . ARG A 1 20 ? 6.602   -22.102 4.906  1.00 0.00 ? 121 ARG A CZ   7  
ATOM   3239 N  NH1  . ARG A 1 20 ? 5.302   -22.422 4.981  1.00 0.00 ? 121 ARG A NH1  7  
ATOM   3240 N  NH2  . ARG A 1 20 ? 7.435   -22.449 5.896  1.00 0.00 ? 121 ARG A NH2  7  
ATOM   3241 H  H    . ARG A 1 20 ? 3.212   -17.469 1.312  1.00 0.00 ? 121 ARG A H    7  
ATOM   3242 H  HA   . ARG A 1 20 ? 2.579   -19.734 2.622  1.00 0.00 ? 121 ARG A HA   7  
ATOM   3243 H  HB2  . ARG A 1 20 ? 4.897   -18.779 1.927  1.00 0.00 ? 121 ARG A HB2  7  
ATOM   3244 H  HB3  . ARG A 1 20 ? 4.901   -17.943 3.468  1.00 0.00 ? 121 ARG A HB3  7  
ATOM   3245 H  HG2  . ARG A 1 20 ? 5.286   -19.866 4.666  1.00 0.00 ? 121 ARG A HG2  7  
ATOM   3246 H  HG3  . ARG A 1 20 ? 4.207   -20.825 3.673  1.00 0.00 ? 121 ARG A HG3  7  
ATOM   3247 H  HD2  . ARG A 1 20 ? 5.873   -21.336 2.096  1.00 0.00 ? 121 ARG A HD2  7  
ATOM   3248 H  HD3  . ARG A 1 20 ? 6.791   -19.882 2.430  1.00 0.00 ? 121 ARG A HD3  7  
ATOM   3249 H  HE   . ARG A 1 20 ? 8.053   -21.448 3.674  1.00 0.00 ? 121 ARG A HE   7  
ATOM   3250 H  HH11 . ARG A 1 20 ? 4.650   -21.777 5.377  1.00 0.00 ? 121 ARG A HH11 7  
ATOM   3251 H  HH12 . ARG A 1 20 ? 4.985   -23.307 4.640  1.00 0.00 ? 121 ARG A HH12 7  
ATOM   3252 H  HH21 . ARG A 1 20 ? 7.897   -21.743 6.432  1.00 0.00 ? 121 ARG A HH21 7  
ATOM   3253 H  HH22 . ARG A 1 20 ? 7.595   -23.415 6.100  1.00 0.00 ? 121 ARG A HH22 7  
ATOM   3254 N  N    . HIS A 1 21 ? 2.614   -17.082 4.605  1.00 0.00 ? 122 HIS A N    7  
ATOM   3255 C  CA   . HIS A 1 21 ? 2.172   -16.557 5.887  1.00 0.00 ? 122 HIS A CA   7  
ATOM   3256 C  C    . HIS A 1 21 ? 0.698   -16.905 6.103  1.00 0.00 ? 122 HIS A C    7  
ATOM   3257 O  O    . HIS A 1 21 ? 0.317   -17.370 7.177  1.00 0.00 ? 122 HIS A O    7  
ATOM   3258 C  CB   . HIS A 1 21 ? 2.448   -15.056 5.983  1.00 0.00 ? 122 HIS A CB   7  
ATOM   3259 C  CG   . HIS A 1 21 ? 1.595   -14.339 7.003  1.00 0.00 ? 122 HIS A CG   7  
ATOM   3260 N  ND1  . HIS A 1 21 ? 2.008   -14.125 8.307  1.00 0.00 ? 122 HIS A ND1  7  
ATOM   3261 C  CD2  . HIS A 1 21 ? 0.351   -13.790 6.897  1.00 0.00 ? 122 HIS A CD2  7  
ATOM   3262 C  CE1  . HIS A 1 21 ? 1.047   -13.476 8.947  1.00 0.00 ? 122 HIS A CE1  7  
ATOM   3263 N  NE2  . HIS A 1 21 ? 0.021   -13.270 8.072  1.00 0.00 ? 122 HIS A NE2  7  
ATOM   3264 H  H    . HIS A 1 21 ? 3.019   -16.406 3.990  1.00 0.00 ? 122 HIS A H    7  
ATOM   3265 H  HA   . HIS A 1 21 ? 2.770   -17.054 6.650  1.00 0.00 ? 122 HIS A HA   7  
ATOM   3266 H  HB2  . HIS A 1 21 ? 3.498   -14.904 6.232  1.00 0.00 ? 122 HIS A HB2  7  
ATOM   3267 H  HB3  . HIS A 1 21 ? 2.284   -14.603 5.005  1.00 0.00 ? 122 HIS A HB3  7  
ATOM   3268 H  HD1  . HIS A 1 21 ? 2.882   -14.411 8.698  1.00 0.00 ? 122 HIS A HD1  7  
ATOM   3269 H  HD2  . HIS A 1 21 ? -0.266  -13.779 5.998  1.00 0.00 ? 122 HIS A HD2  7  
ATOM   3270 H  HE1  . HIS A 1 21 ? 1.072   -13.161 9.991  1.00 0.00 ? 122 HIS A HE1  7  
ATOM   3271 N  N    . TYR A 1 22 ? -0.091  -16.667 5.066  1.00 0.00 ? 123 TYR A N    7  
ATOM   3272 C  CA   . TYR A 1 22 ? -1.515  -16.949 5.130  1.00 0.00 ? 123 TYR A CA   7  
ATOM   3273 C  C    . TYR A 1 22 ? -1.768  -18.407 5.516  1.00 0.00 ? 123 TYR A C    7  
ATOM   3274 O  O    . TYR A 1 22 ? -2.660  -18.696 6.314  1.00 0.00 ? 123 TYR A O    7  
ATOM   3275 C  CB   . TYR A 1 22 ? -2.057  -16.706 3.719  1.00 0.00 ? 123 TYR A CB   7  
ATOM   3276 C  CG   . TYR A 1 22 ? -3.163  -15.652 3.650  1.00 0.00 ? 123 TYR A CG   7  
ATOM   3277 C  CD1  . TYR A 1 22 ? -4.438  -15.962 4.079  1.00 0.00 ? 123 TYR A CD1  7  
ATOM   3278 C  CD2  . TYR A 1 22 ? -2.887  -14.392 3.160  1.00 0.00 ? 123 TYR A CD2  7  
ATOM   3279 C  CE1  . TYR A 1 22 ? -5.480  -14.970 4.013  1.00 0.00 ? 123 TYR A CE1  7  
ATOM   3280 C  CE2  . TYR A 1 22 ? -3.929  -13.401 3.095  1.00 0.00 ? 123 TYR A CE2  7  
ATOM   3281 C  CZ   . TYR A 1 22 ? -5.174  -13.738 3.525  1.00 0.00 ? 123 TYR A CZ   7  
ATOM   3282 O  OH   . TYR A 1 22 ? -6.159  -12.802 3.464  1.00 0.00 ? 123 TYR A OH   7  
ATOM   3283 H  H    . TYR A 1 22 ? 0.226   -16.289 4.197  1.00 0.00 ? 123 TYR A H    7  
ATOM   3284 H  HA   . TYR A 1 22 ? -1.953  -16.299 5.887  1.00 0.00 ? 123 TYR A HA   7  
ATOM   3285 H  HB2  . TYR A 1 22 ? -1.234  -16.397 3.074  1.00 0.00 ? 123 TYR A HB2  7  
ATOM   3286 H  HB3  . TYR A 1 22 ? -2.438  -17.646 3.321  1.00 0.00 ? 123 TYR A HB3  7  
ATOM   3287 H  HD1  . TYR A 1 22 ? -4.656  -16.957 4.466  1.00 0.00 ? 123 TYR A HD1  7  
ATOM   3288 H  HD2  . TYR A 1 22 ? -1.880  -14.148 2.822  1.00 0.00 ? 123 TYR A HD2  7  
ATOM   3289 H  HE1  . TYR A 1 22 ? -6.492  -15.201 4.349  1.00 0.00 ? 123 TYR A HE1  7  
ATOM   3290 H  HE2  . TYR A 1 22 ? -3.725  -12.401 2.710  1.00 0.00 ? 123 TYR A HE2  7  
ATOM   3291 H  HH   . TYR A 1 22 ? -6.581  -12.690 4.363  1.00 0.00 ? 123 TYR A HH   7  
ATOM   3292 N  N    . ARG A 1 23 ? -0.968  -19.288 4.934  1.00 0.00 ? 124 ARG A N    7  
ATOM   3293 C  CA   . ARG A 1 23 ? -1.095  -20.709 5.207  1.00 0.00 ? 124 ARG A CA   7  
ATOM   3294 C  C    . ARG A 1 23 ? -1.071  -20.964 6.716  1.00 0.00 ? 124 ARG A C    7  
ATOM   3295 O  O    . ARG A 1 23 ? -1.469  -22.033 7.175  1.00 0.00 ? 124 ARG A O    7  
ATOM   3296 C  CB   . ARG A 1 23 ? 0.036   -21.500 4.547  1.00 0.00 ? 124 ARG A CB   7  
ATOM   3297 C  CG   . ARG A 1 23 ? -0.496  -22.369 3.406  1.00 0.00 ? 124 ARG A CG   7  
ATOM   3298 C  CD   . ARG A 1 23 ? -1.182  -23.626 3.947  1.00 0.00 ? 124 ARG A CD   7  
ATOM   3299 N  NE   . ARG A 1 23 ? -0.172  -24.670 4.229  1.00 0.00 ? 124 ARG A NE   7  
ATOM   3300 C  CZ   . ARG A 1 23 ? 0.303   -25.524 3.311  1.00 0.00 ? 124 ARG A CZ   7  
ATOM   3301 N  NH1  . ARG A 1 23 ? -0.534  -26.104 2.440  1.00 0.00 ? 124 ARG A NH1  7  
ATOM   3302 N  NH2  . ARG A 1 23 ? 1.613   -25.798 3.266  1.00 0.00 ? 124 ARG A NH2  7  
ATOM   3303 H  H    . ARG A 1 23 ? -0.245  -19.045 4.286  1.00 0.00 ? 124 ARG A H    7  
ATOM   3304 H  HA   . ARG A 1 23 ? -2.055  -20.992 4.777  1.00 0.00 ? 124 ARG A HA   7  
ATOM   3305 H  HB2  . ARG A 1 23 ? 0.790   -20.812 4.163  1.00 0.00 ? 124 ARG A HB2  7  
ATOM   3306 H  HB3  . ARG A 1 23 ? 0.527   -22.129 5.289  1.00 0.00 ? 124 ARG A HB3  7  
ATOM   3307 H  HG2  . ARG A 1 23 ? -1.203  -21.795 2.806  1.00 0.00 ? 124 ARG A HG2  7  
ATOM   3308 H  HG3  . ARG A 1 23 ? 0.324   -22.653 2.746  1.00 0.00 ? 124 ARG A HG3  7  
ATOM   3309 H  HD2  . ARG A 1 23 ? -1.732  -23.387 4.856  1.00 0.00 ? 124 ARG A HD2  7  
ATOM   3310 H  HD3  . ARG A 1 23 ? -1.907  -23.996 3.223  1.00 0.00 ? 124 ARG A HD3  7  
ATOM   3311 H  HE   . ARG A 1 23 ? 0.178   -24.745 5.163  1.00 0.00 ? 124 ARG A HE   7  
ATOM   3312 H  HH11 . ARG A 1 23 ? -1.099  -25.538 1.838  1.00 0.00 ? 124 ARG A HH11 7  
ATOM   3313 H  HH12 . ARG A 1 23 ? -0.594  -27.100 2.391  1.00 0.00 ? 124 ARG A HH12 7  
ATOM   3314 H  HH21 . ARG A 1 23 ? 2.256   -25.112 2.925  1.00 0.00 ? 124 ARG A HH21 7  
ATOM   3315 H  HH22 . ARG A 1 23 ? 1.949   -26.689 3.572  1.00 0.00 ? 124 ARG A HH22 7  
ATOM   3316 N  N    . SER A 1 24 ? -0.603  -19.963 7.446  1.00 0.00 ? 125 SER A N    7  
ATOM   3317 C  CA   . SER A 1 24 ? -0.522  -20.064 8.892  1.00 0.00 ? 125 SER A CA   7  
ATOM   3318 C  C    . SER A 1 24 ? -1.899  -19.811 9.512  1.00 0.00 ? 125 SER A C    7  
ATOM   3319 O  O    . SER A 1 24 ? -2.291  -20.489 10.461 1.00 0.00 ? 125 SER A O    7  
ATOM   3320 C  CB   . SER A 1 24 ? 0.503   -19.080 9.459  1.00 0.00 ? 125 SER A CB   7  
ATOM   3321 O  OG   . SER A 1 24 ? -0.007  -17.750 9.512  1.00 0.00 ? 125 SER A OG   7  
ATOM   3322 H  H    . SER A 1 24 ? -0.282  -19.095 7.064  1.00 0.00 ? 125 SER A H    7  
ATOM   3323 H  HA   . SER A 1 24 ? -0.195  -21.084 9.092  1.00 0.00 ? 125 SER A HA   7  
ATOM   3324 H  HB2  . SER A 1 24 ? 0.796   -19.397 10.460 1.00 0.00 ? 125 SER A HB2  7  
ATOM   3325 H  HB3  . SER A 1 24 ? 1.401   -19.099 8.842  1.00 0.00 ? 125 SER A HB3  7  
ATOM   3326 H  HG   . SER A 1 24 ? -0.363  -17.483 8.617  1.00 0.00 ? 125 SER A HG   7  
ATOM   3327 N  N    . HIS A 1 25 ? -2.594  -18.833 8.950  1.00 0.00 ? 126 HIS A N    7  
ATOM   3328 C  CA   . HIS A 1 25 ? -3.918  -18.482 9.436  1.00 0.00 ? 126 HIS A CA   7  
ATOM   3329 C  C    . HIS A 1 25 ? -4.864  -19.671 9.253  1.00 0.00 ? 126 HIS A C    7  
ATOM   3330 O  O    . HIS A 1 25 ? -5.837  -19.813 9.991  1.00 0.00 ? 126 HIS A O    7  
ATOM   3331 C  CB   . HIS A 1 25 ? -4.428  -17.211 8.754  1.00 0.00 ? 126 HIS A CB   7  
ATOM   3332 C  CG   . HIS A 1 25 ? -3.644  -15.968 9.109  1.00 0.00 ? 126 HIS A CG   7  
ATOM   3333 N  ND1  . HIS A 1 25 ? -3.237  -15.682 10.400 1.00 0.00 ? 126 HIS A ND1  7  
ATOM   3334 C  CD2  . HIS A 1 25 ? -3.200  -14.943 8.328  1.00 0.00 ? 126 HIS A CD2  7  
ATOM   3335 C  CE1  . HIS A 1 25 ? -2.578  -14.533 10.385 1.00 0.00 ? 126 HIS A CE1  7  
ATOM   3336 N  NE2  . HIS A 1 25 ? -2.556  -14.076 9.100  1.00 0.00 ? 126 HIS A NE2  7  
ATOM   3337 H  H    . HIS A 1 25 ? -2.268  -18.287 8.179  1.00 0.00 ? 126 HIS A H    7  
ATOM   3338 H  HA   . HIS A 1 25 ? -3.815  -18.270 10.500 1.00 0.00 ? 126 HIS A HA   7  
ATOM   3339 H  HB2  . HIS A 1 25 ? -4.395  -17.352 7.674  1.00 0.00 ? 126 HIS A HB2  7  
ATOM   3340 H  HB3  . HIS A 1 25 ? -5.472  -17.059 9.024  1.00 0.00 ? 126 HIS A HB3  7  
ATOM   3341 H  HD1  . HIS A 1 25 ? -3.411  -16.248 11.206 1.00 0.00 ? 126 HIS A HD1  7  
ATOM   3342 H  HD2  . HIS A 1 25 ? -3.348  -14.850 7.252  1.00 0.00 ? 126 HIS A HD2  7  
ATOM   3343 H  HE1  . HIS A 1 25 ? -2.132  -14.040 11.249 1.00 0.00 ? 126 HIS A HE1  7  
ATOM   3344 N  N    . THR A 1 26 ? -4.543  -20.496 8.267  1.00 0.00 ? 127 THR A N    7  
ATOM   3345 C  CA   . THR A 1 26 ? -5.351  -21.668 7.979  1.00 0.00 ? 127 THR A CA   7  
ATOM   3346 C  C    . THR A 1 26 ? -5.828  -22.320 9.278  1.00 0.00 ? 127 THR A C    7  
ATOM   3347 O  O    . THR A 1 26 ? -6.878  -22.960 9.306  1.00 0.00 ? 127 THR A O    7  
ATOM   3348 C  CB   . THR A 1 26 ? -4.525  -22.606 7.097  1.00 0.00 ? 127 THR A CB   7  
ATOM   3349 O  OG1  . THR A 1 26 ? -3.629  -21.738 6.410  1.00 0.00 ? 127 THR A OG1  7  
ATOM   3350 C  CG2  . THR A 1 26 ? -5.356  -23.244 5.980  1.00 0.00 ? 127 THR A CG2  7  
ATOM   3351 H  H    . THR A 1 26 ? -3.748  -20.374 7.672  1.00 0.00 ? 127 THR A H    7  
ATOM   3352 H  HA   . THR A 1 26 ? -6.239  -21.348 7.436  1.00 0.00 ? 127 THR A HA   7  
ATOM   3353 H  HB   . THR A 1 26 ? -4.029  -23.370 7.697  1.00 0.00 ? 127 THR A HB   7  
ATOM   3354 H  HG1  . THR A 1 26 ? -2.884  -22.267 6.004  1.00 0.00 ? 127 THR A HG1  7  
ATOM   3355 H  HG21 . THR A 1 26 ? -4.694  -23.759 5.284  1.00 0.00 ? 127 THR A HG21 7  
ATOM   3356 H  HG22 . THR A 1 26 ? -6.057  -23.958 6.412  1.00 0.00 ? 127 THR A HG22 7  
ATOM   3357 H  HG23 . THR A 1 26 ? -5.907  -22.468 5.450  1.00 0.00 ? 127 THR A HG23 7  
ATOM   3358 N  N    . ASN A 1 27 ? -5.035  -22.134 10.322 1.00 0.00 ? 128 ASN A N    7  
ATOM   3359 C  CA   . ASN A 1 27 ? -5.363  -22.695 11.622 1.00 0.00 ? 128 ASN A CA   7  
ATOM   3360 C  C    . ASN A 1 27 ? -6.874  -22.919 11.708 1.00 0.00 ? 128 ASN A C    7  
ATOM   3361 O  O    . ASN A 1 27 ? -7.326  -24.036 11.959 1.00 0.00 ? 128 ASN A O    7  
ATOM   3362 C  CB   . ASN A 1 27 ? -4.961  -21.744 12.750 1.00 0.00 ? 128 ASN A CB   7  
ATOM   3363 C  CG   . ASN A 1 27 ? -3.526  -21.247 12.563 1.00 0.00 ? 128 ASN A CG   7  
ATOM   3364 O  OD1  . ASN A 1 27 ? -3.246  -20.059 12.573 1.00 0.00 ? 128 ASN A OD1  7  
ATOM   3365 N  ND2  . ASN A 1 27 ? -2.634  -22.218 12.391 1.00 0.00 ? 128 ASN A ND2  7  
ATOM   3366 H  H    . ASN A 1 27 ? -4.182  -21.611 10.291 1.00 0.00 ? 128 ASN A H    7  
ATOM   3367 H  HA   . ASN A 1 27 ? -4.799  -23.626 11.682 1.00 0.00 ? 128 ASN A HA   7  
ATOM   3368 H  HB2  . ASN A 1 27 ? -5.643  -20.895 12.776 1.00 0.00 ? 128 ASN A HB2  7  
ATOM   3369 H  HB3  . ASN A 1 27 ? -5.050  -22.254 13.710 1.00 0.00 ? 128 ASN A HB3  7  
ATOM   3370 H  HD21 . ASN A 1 27 ? -2.672  -23.038 12.964 1.00 0.00 ? 128 ASN A HD21 7  
ATOM   3371 H  HD22 . ASN A 1 27 ? -1.927  -22.130 11.690 1.00 0.00 ? 128 ASN A HD22 7  
ATOM   3372 N  N    . GLU A 1 28 ? -7.613  -21.840 11.496 1.00 0.00 ? 129 GLU A N    7  
ATOM   3373 C  CA   . GLU A 1 28 ? -9.063  -21.905 11.547 1.00 0.00 ? 129 GLU A CA   7  
ATOM   3374 C  C    . GLU A 1 28 ? -9.675  -20.704 10.821 1.00 0.00 ? 129 GLU A C    7  
ATOM   3375 O  O    . GLU A 1 28 ? -9.000  -19.700 10.599 1.00 0.00 ? 129 GLU A O    7  
ATOM   3376 C  CB   . GLU A 1 28 ? -9.558  -21.982 12.993 1.00 0.00 ? 129 GLU A CB   7  
ATOM   3377 C  CG   . GLU A 1 28 ? -11.051 -22.313 13.045 1.00 0.00 ? 129 GLU A CG   7  
ATOM   3378 C  CD   . GLU A 1 28 ? -11.358 -23.583 12.248 1.00 0.00 ? 129 GLU A CD   7  
ATOM   3379 O  OE1  . GLU A 1 28 ? -10.682 -24.599 12.516 1.00 0.00 ? 129 GLU A OE1  7  
ATOM   3380 O  OE2  . GLU A 1 28 ? -12.262 -23.509 11.388 1.00 0.00 ? 129 GLU A OE2  7  
ATOM   3381 H  H    . GLU A 1 28 ? -7.237  -20.936 11.292 1.00 0.00 ? 129 GLU A H    7  
ATOM   3382 H  HA   . GLU A 1 28 ? -9.331  -22.826 11.029 1.00 0.00 ? 129 GLU A HA   7  
ATOM   3383 H  HB2  . GLU A 1 28 ? -8.994  -22.740 13.534 1.00 0.00 ? 129 GLU A HB2  7  
ATOM   3384 H  HB3  . GLU A 1 28 ? -9.376  -21.031 13.494 1.00 0.00 ? 129 GLU A HB3  7  
ATOM   3385 H  HG2  . GLU A 1 28 ? -11.362 -22.446 14.081 1.00 0.00 ? 129 GLU A HG2  7  
ATOM   3386 H  HG3  . GLU A 1 28 ? -11.627 -21.480 12.644 1.00 0.00 ? 129 GLU A HG3  7  
ATOM   3387 N  N    . LYS A 1 29 ? -10.944 -20.847 10.473 1.00 0.00 ? 130 LYS A N    7  
ATOM   3388 C  CA   . LYS A 1 29 ? -11.653 -19.788 9.776  1.00 0.00 ? 130 LYS A CA   7  
ATOM   3389 C  C    . LYS A 1 29 ? -13.150 -20.103 9.765  1.00 0.00 ? 130 LYS A C    7  
ATOM   3390 O  O    . LYS A 1 29 ? -13.566 -21.140 9.250  1.00 0.00 ? 130 LYS A O    7  
ATOM   3391 C  CB   . LYS A 1 29 ? -11.060 -19.571 8.383  1.00 0.00 ? 130 LYS A CB   7  
ATOM   3392 C  CG   . LYS A 1 29 ? -11.828 -18.488 7.622  1.00 0.00 ? 130 LYS A CG   7  
ATOM   3393 C  CD   . LYS A 1 29 ? -11.620 -17.116 8.265  1.00 0.00 ? 130 LYS A CD   7  
ATOM   3394 C  CE   . LYS A 1 29 ? -10.180 -16.634 8.078  1.00 0.00 ? 130 LYS A CE   7  
ATOM   3395 N  NZ   . LYS A 1 29 ? -9.748  -16.825 6.676  1.00 0.00 ? 130 LYS A NZ   7  
ATOM   3396 H  H    . LYS A 1 29 ? -11.485 -21.668 10.657 1.00 0.00 ? 130 LYS A H    7  
ATOM   3397 H  HA   . LYS A 1 29 ? -11.499 -18.867 10.339 1.00 0.00 ? 130 LYS A HA   7  
ATOM   3398 H  HB2  . LYS A 1 29 ? -10.012 -19.286 8.470  1.00 0.00 ? 130 LYS A HB2  7  
ATOM   3399 H  HB3  . LYS A 1 29 ? -11.091 -20.505 7.822  1.00 0.00 ? 130 LYS A HB3  7  
ATOM   3400 H  HG2  . LYS A 1 29 ? -11.494 -18.462 6.585  1.00 0.00 ? 130 LYS A HG2  7  
ATOM   3401 H  HG3  . LYS A 1 29 ? -12.890 -18.731 7.610  1.00 0.00 ? 130 LYS A HG3  7  
ATOM   3402 H  HD2  . LYS A 1 29 ? -12.309 -16.395 7.823  1.00 0.00 ? 130 LYS A HD2  7  
ATOM   3403 H  HD3  . LYS A 1 29 ? -11.854 -17.168 9.329  1.00 0.00 ? 130 LYS A HD3  7  
ATOM   3404 H  HE2  . LYS A 1 29 ? -10.104 -15.581 8.349  1.00 0.00 ? 130 LYS A HE2  7  
ATOM   3405 H  HE3  . LYS A 1 29 ? -9.517  -17.184 8.746  1.00 0.00 ? 130 LYS A HE3  7  
ATOM   3406 H  HZ1  . LYS A 1 29 ? -9.272  -17.700 6.588  1.00 0.00 ? 130 LYS A HZ1  7  
ATOM   3407 H  HZ2  . LYS A 1 29 ? -10.549 -16.820 6.076  1.00 0.00 ? 130 LYS A HZ2  7  
ATOM   3408 H  HZ3  . LYS A 1 29 ? -9.130  -16.082 6.413  1.00 0.00 ? 130 LYS A HZ3  7  
HETATM 3409 ZN ZN   . ZN  B 2 .  ? -1.717  -12.358 8.483  1.00 0.00 ? 1   ZN  A ZN   7  
ATOM   3410 N  N    . ARG A 1 1  ? -0.171  -0.858  -3.106 1.00 0.00 ? 102 ARG A N    8  
ATOM   3411 C  CA   . ARG A 1 1  ? 0.167   -1.996  -3.942 1.00 0.00 ? 102 ARG A CA   8  
ATOM   3412 C  C    . ARG A 1 1  ? 1.193   -2.886  -3.238 1.00 0.00 ? 102 ARG A C    8  
ATOM   3413 O  O    . ARG A 1 1  ? 1.925   -3.631  -3.889 1.00 0.00 ? 102 ARG A O    8  
ATOM   3414 C  CB   . ARG A 1 1  ? 0.735   -1.542  -5.288 1.00 0.00 ? 102 ARG A CB   8  
ATOM   3415 C  CG   . ARG A 1 1  ? 1.870   -0.535  -5.092 1.00 0.00 ? 102 ARG A CG   8  
ATOM   3416 C  CD   . ARG A 1 1  ? 1.674   0.693   -5.982 1.00 0.00 ? 102 ARG A CD   8  
ATOM   3417 N  NE   . ARG A 1 1  ? 2.441   1.838   -5.442 1.00 0.00 ? 102 ARG A NE   8  
ATOM   3418 C  CZ   . ARG A 1 1  ? 3.663   1.734   -4.901 1.00 0.00 ? 102 ARG A CZ   8  
ATOM   3419 N  NH1  . ARG A 1 1  ? 4.673   1.224   -5.618 1.00 0.00 ? 102 ARG A NH1  8  
ATOM   3420 N  NH2  . ARG A 1 1  ? 3.874   2.141   -3.642 1.00 0.00 ? 102 ARG A NH2  8  
ATOM   3421 H  H    . ARG A 1 1  ? 0.538   -0.586  -2.455 1.00 0.00 ? 102 ARG A H    8  
ATOM   3422 H  HA   . ARG A 1 1  ? -0.775  -2.525  -4.088 1.00 0.00 ? 102 ARG A HA   8  
ATOM   3423 H  HB2  . ARG A 1 1  ? 1.101   -2.406  -5.843 1.00 0.00 ? 102 ARG A HB2  8  
ATOM   3424 H  HB3  . ARG A 1 1  ? -0.057  -1.091  -5.888 1.00 0.00 ? 102 ARG A HB3  8  
ATOM   3425 H  HG2  . ARG A 1 1  ? 1.913   -0.229  -4.047 1.00 0.00 ? 102 ARG A HG2  8  
ATOM   3426 H  HG3  . ARG A 1 1  ? 2.824   -1.008  -5.324 1.00 0.00 ? 102 ARG A HG3  8  
ATOM   3427 H  HD2  . ARG A 1 1  ? 2.000   0.472   -6.998 1.00 0.00 ? 102 ARG A HD2  8  
ATOM   3428 H  HD3  . ARG A 1 1  ? 0.615   0.948   -6.036 1.00 0.00 ? 102 ARG A HD3  8  
ATOM   3429 H  HE   . ARG A 1 1  ? 2.023   2.745   -5.484 1.00 0.00 ? 102 ARG A HE   8  
ATOM   3430 H  HH11 . ARG A 1 1  ? 4.590   0.312   -6.021 1.00 0.00 ? 102 ARG A HH11 8  
ATOM   3431 H  HH12 . ARG A 1 1  ? 5.510   1.755   -5.751 1.00 0.00 ? 102 ARG A HH12 8  
ATOM   3432 H  HH21 . ARG A 1 1  ? 3.239   2.783   -3.210 1.00 0.00 ? 102 ARG A HH21 8  
ATOM   3433 H  HH22 . ARG A 1 1  ? 4.666   1.803   -3.133 1.00 0.00 ? 102 ARG A HH22 8  
ATOM   3434 N  N    . SER A 1 2  ? 1.214   -2.780  -1.917 1.00 0.00 ? 103 SER A N    8  
ATOM   3435 C  CA   . SER A 1 2  ? 2.139   -3.565  -1.117 1.00 0.00 ? 103 SER A CA   8  
ATOM   3436 C  C    . SER A 1 2  ? 1.487   -4.889  -0.713 1.00 0.00 ? 103 SER A C    8  
ATOM   3437 O  O    . SER A 1 2  ? 0.274   -5.051  -0.838 1.00 0.00 ? 103 SER A O    8  
ATOM   3438 C  CB   . SER A 1 2  ? 2.587   -2.793  0.124  1.00 0.00 ? 103 SER A CB   8  
ATOM   3439 O  OG   . SER A 1 2  ? 3.919   -2.301  -0.004 1.00 0.00 ? 103 SER A OG   8  
ATOM   3440 H  H    . SER A 1 2  ? 0.616   -2.171  -1.396 1.00 0.00 ? 103 SER A H    8  
ATOM   3441 H  HA   . SER A 1 2  ? 2.999   -3.744  -1.763 1.00 0.00 ? 103 SER A HA   8  
ATOM   3442 H  HB2  . SER A 1 2  ? 1.908   -1.958  0.297  1.00 0.00 ? 103 SER A HB2  8  
ATOM   3443 H  HB3  . SER A 1 2  ? 2.522   -3.440  0.998  1.00 0.00 ? 103 SER A HB3  8  
ATOM   3444 H  HG   . SER A 1 2  ? 4.154   -1.739  0.789  1.00 0.00 ? 103 SER A HG   8  
ATOM   3445 N  N    . PHE A 1 3  ? 2.320   -5.801  -0.235 1.00 0.00 ? 104 PHE A N    8  
ATOM   3446 C  CA   . PHE A 1 3  ? 1.840   -7.105  0.188  1.00 0.00 ? 104 PHE A CA   8  
ATOM   3447 C  C    . PHE A 1 3  ? 1.549   -7.121  1.690  1.00 0.00 ? 104 PHE A C    8  
ATOM   3448 O  O    . PHE A 1 3  ? 2.458   -7.293  2.501  1.00 0.00 ? 104 PHE A O    8  
ATOM   3449 C  CB   . PHE A 1 3  ? 2.952   -8.111  -0.114 1.00 0.00 ? 104 PHE A CB   8  
ATOM   3450 C  CG   . PHE A 1 3  ? 3.539   -7.986  -1.521 1.00 0.00 ? 104 PHE A CG   8  
ATOM   3451 C  CD1  . PHE A 1 3  ? 2.772   -8.279  -2.606 1.00 0.00 ? 104 PHE A CD1  8  
ATOM   3452 C  CD2  . PHE A 1 3  ? 4.827   -7.584  -1.688 1.00 0.00 ? 104 PHE A CD2  8  
ATOM   3453 C  CE1  . PHE A 1 3  ? 3.316   -8.164  -3.913 1.00 0.00 ? 104 PHE A CE1  8  
ATOM   3454 C  CE2  . PHE A 1 3  ? 5.372   -7.468  -2.994 1.00 0.00 ? 104 PHE A CE2  8  
ATOM   3455 C  CZ   . PHE A 1 3  ? 4.604   -7.760  -4.079 1.00 0.00 ? 104 PHE A CZ   8  
ATOM   3456 H  H    . PHE A 1 3  ? 3.306   -5.661  -0.137 1.00 0.00 ? 104 PHE A H    8  
ATOM   3457 H  HA   . PHE A 1 3  ? 0.919   -7.305  -0.360 1.00 0.00 ? 104 PHE A HA   8  
ATOM   3458 H  HB2  . PHE A 1 3  ? 3.753   -7.983  0.616  1.00 0.00 ? 104 PHE A HB2  8  
ATOM   3459 H  HB3  . PHE A 1 3  ? 2.561   -9.120  0.017  1.00 0.00 ? 104 PHE A HB3  8  
ATOM   3460 H  HD1  . PHE A 1 3  ? 1.740   -8.603  -2.472 1.00 0.00 ? 104 PHE A HD1  8  
ATOM   3461 H  HD2  . PHE A 1 3  ? 5.441   -7.349  -0.819 1.00 0.00 ? 104 PHE A HD2  8  
ATOM   3462 H  HE1  . PHE A 1 3  ? 2.702   -8.398  -4.781 1.00 0.00 ? 104 PHE A HE1  8  
ATOM   3463 H  HE2  . PHE A 1 3  ? 6.404   -7.144  -3.128 1.00 0.00 ? 104 PHE A HE2  8  
ATOM   3464 H  HZ   . PHE A 1 3  ? 5.023   -7.671  -5.081 1.00 0.00 ? 104 PHE A HZ   8  
ATOM   3465 N  N    . VAL A 1 4  ? 0.278   -6.937  2.016  1.00 0.00 ? 105 VAL A N    8  
ATOM   3466 C  CA   . VAL A 1 4  ? -0.144  -6.928  3.407  1.00 0.00 ? 105 VAL A CA   8  
ATOM   3467 C  C    . VAL A 1 4  ? -1.097  -8.099  3.654  1.00 0.00 ? 105 VAL A C    8  
ATOM   3468 O  O    . VAL A 1 4  ? -1.809  -8.527  2.747  1.00 0.00 ? 105 VAL A O    8  
ATOM   3469 C  CB   . VAL A 1 4  ? -0.760  -5.572  3.758  1.00 0.00 ? 105 VAL A CB   8  
ATOM   3470 C  CG1  . VAL A 1 4  ? -1.361  -5.590  5.164  1.00 0.00 ? 105 VAL A CG1  8  
ATOM   3471 C  CG2  . VAL A 1 4  ? 0.269   -4.448  3.615  1.00 0.00 ? 105 VAL A CG2  8  
ATOM   3472 H  H    . VAL A 1 4  ? -0.455  -6.797  1.351  1.00 0.00 ? 105 VAL A H    8  
ATOM   3473 H  HA   . VAL A 1 4  ? 0.745   -7.063  4.022  1.00 0.00 ? 105 VAL A HA   8  
ATOM   3474 H  HB   . VAL A 1 4  ? -1.567  -5.378  3.050  1.00 0.00 ? 105 VAL A HB   8  
ATOM   3475 H  HG11 . VAL A 1 4  ? -0.836  -6.325  5.774  1.00 0.00 ? 105 VAL A HG11 8  
ATOM   3476 H  HG12 . VAL A 1 4  ? -1.260  -4.604  5.615  1.00 0.00 ? 105 VAL A HG12 8  
ATOM   3477 H  HG13 . VAL A 1 4  ? -2.417  -5.856  5.105  1.00 0.00 ? 105 VAL A HG13 8  
ATOM   3478 H  HG21 . VAL A 1 4  ? 1.270   -4.877  3.563  1.00 0.00 ? 105 VAL A HG21 8  
ATOM   3479 H  HG22 . VAL A 1 4  ? 0.068   -3.885  2.705  1.00 0.00 ? 105 VAL A HG22 8  
ATOM   3480 H  HG23 . VAL A 1 4  ? 0.202   -3.784  4.476  1.00 0.00 ? 105 VAL A HG23 8  
ATOM   3481 N  N    . CYS A 1 5  ? -1.080  -8.585  4.887  1.00 0.00 ? 106 CYS A N    8  
ATOM   3482 C  CA   . CYS A 1 5  ? -1.932  -9.699  5.265  1.00 0.00 ? 106 CYS A CA   8  
ATOM   3483 C  C    . CYS A 1 5  ? -3.226  -9.134  5.856  1.00 0.00 ? 106 CYS A C    8  
ATOM   3484 O  O    . CYS A 1 5  ? -3.225  -8.604  6.967  1.00 0.00 ? 106 CYS A O    8  
ATOM   3485 C  CB   . CYS A 1 5  ? -1.227  -10.647 6.236  1.00 0.00 ? 106 CYS A CB   8  
ATOM   3486 S  SG   . CYS A 1 5  ? -2.361  -11.997 6.725  1.00 0.00 ? 106 CYS A SG   8  
ATOM   3487 H  H    . CYS A 1 5  ? -0.497  -8.232  5.618  1.00 0.00 ? 106 CYS A H    8  
ATOM   3488 H  HA   . CYS A 1 5  ? -2.137  -10.259 4.353  1.00 0.00 ? 106 CYS A HA   8  
ATOM   3489 H  HB2  . CYS A 1 5  ? -0.335  -11.063 5.768  1.00 0.00 ? 106 CYS A HB2  8  
ATOM   3490 H  HB3  . CYS A 1 5  ? -0.898  -10.099 7.119  1.00 0.00 ? 106 CYS A HB3  8  
ATOM   3491 N  N    . GLU A 1 6  ? -4.297  -9.266  5.089  1.00 0.00 ? 107 GLU A N    8  
ATOM   3492 C  CA   . GLU A 1 6  ? -5.594  -8.775  5.523  1.00 0.00 ? 107 GLU A CA   8  
ATOM   3493 C  C    . GLU A 1 6  ? -6.023  -9.479  6.812  1.00 0.00 ? 107 GLU A C    8  
ATOM   3494 O  O    . GLU A 1 6  ? -6.861  -8.968  7.554  1.00 0.00 ? 107 GLU A O    8  
ATOM   3495 C  CB   . GLU A 1 6  ? -6.644  -8.954  4.425  1.00 0.00 ? 107 GLU A CB   8  
ATOM   3496 C  CG   . GLU A 1 6  ? -6.261  -8.172  3.167  1.00 0.00 ? 107 GLU A CG   8  
ATOM   3497 C  CD   . GLU A 1 6  ? -5.340  -8.999  2.266  1.00 0.00 ? 107 GLU A CD   8  
ATOM   3498 O  OE1  . GLU A 1 6  ? -5.715  -10.156 1.982  1.00 0.00 ? 107 GLU A OE1  8  
ATOM   3499 O  OE2  . GLU A 1 6  ? -4.283  -8.453  1.883  1.00 0.00 ? 107 GLU A OE2  8  
ATOM   3500 H  H    . GLU A 1 6  ? -4.290  -9.698  4.186  1.00 0.00 ? 107 GLU A H    8  
ATOM   3501 H  HA   . GLU A 1 6  ? -5.453  -7.711  5.712  1.00 0.00 ? 107 GLU A HA   8  
ATOM   3502 H  HB2  . GLU A 1 6  ? -6.746  -10.012 4.182  1.00 0.00 ? 107 GLU A HB2  8  
ATOM   3503 H  HB3  . GLU A 1 6  ? -7.615  -8.616  4.787  1.00 0.00 ? 107 GLU A HB3  8  
ATOM   3504 H  HG2  . GLU A 1 6  ? -7.161  -7.897  2.618  1.00 0.00 ? 107 GLU A HG2  8  
ATOM   3505 H  HG3  . GLU A 1 6  ? -5.763  -7.244  3.449  1.00 0.00 ? 107 GLU A HG3  8  
ATOM   3506 N  N    . VAL A 1 7  ? -5.430  -10.642 7.040  1.00 0.00 ? 108 VAL A N    8  
ATOM   3507 C  CA   . VAL A 1 7  ? -5.741  -11.420 8.225  1.00 0.00 ? 108 VAL A CA   8  
ATOM   3508 C  C    . VAL A 1 7  ? -5.305  -10.644 9.469  1.00 0.00 ? 108 VAL A C    8  
ATOM   3509 O  O    . VAL A 1 7  ? -6.143  -10.194 10.250 1.00 0.00 ? 108 VAL A O    8  
ATOM   3510 C  CB   . VAL A 1 7  ? -5.093  -12.804 8.128  1.00 0.00 ? 108 VAL A CB   8  
ATOM   3511 C  CG1  . VAL A 1 7  ? -5.137  -13.527 9.476  1.00 0.00 ? 108 VAL A CG1  8  
ATOM   3512 C  CG2  . VAL A 1 7  ? -5.755  -13.644 7.033  1.00 0.00 ? 108 VAL A CG2  8  
ATOM   3513 H  H    . VAL A 1 7  ? -4.750  -11.051 6.431  1.00 0.00 ? 108 VAL A H    8  
ATOM   3514 H  HA   . VAL A 1 7  ? -6.821  -11.556 8.257  1.00 0.00 ? 108 VAL A HA   8  
ATOM   3515 H  HB   . VAL A 1 7  ? -4.046  -12.665 7.856  1.00 0.00 ? 108 VAL A HB   8  
ATOM   3516 H  HG11 . VAL A 1 7  ? -6.061  -13.272 9.994  1.00 0.00 ? 108 VAL A HG11 8  
ATOM   3517 H  HG12 . VAL A 1 7  ? -5.097  -14.604 9.312  1.00 0.00 ? 108 VAL A HG12 8  
ATOM   3518 H  HG13 . VAL A 1 7  ? -4.285  -13.220 10.081 1.00 0.00 ? 108 VAL A HG13 8  
ATOM   3519 H  HG21 . VAL A 1 7  ? -4.985  -14.125 6.429  1.00 0.00 ? 108 VAL A HG21 8  
ATOM   3520 H  HG22 . VAL A 1 7  ? -6.387  -14.405 7.491  1.00 0.00 ? 108 VAL A HG22 8  
ATOM   3521 H  HG23 . VAL A 1 7  ? -6.363  -12.998 6.399  1.00 0.00 ? 108 VAL A HG23 8  
ATOM   3522 N  N    . CYS A 1 8  ? -3.995  -10.509 9.616  1.00 0.00 ? 109 CYS A N    8  
ATOM   3523 C  CA   . CYS A 1 8  ? -3.439  -9.794  10.752 1.00 0.00 ? 109 CYS A CA   8  
ATOM   3524 C  C    . CYS A 1 8  ? -3.114  -8.366  10.308 1.00 0.00 ? 109 CYS A C    8  
ATOM   3525 O  O    . CYS A 1 8  ? -3.428  -7.408  11.011 1.00 0.00 ? 109 CYS A O    8  
ATOM   3526 C  CB   . CYS A 1 8  ? -2.211  -10.507 11.323 1.00 0.00 ? 109 CYS A CB   8  
ATOM   3527 S  SG   . CYS A 1 8  ? -0.829  -10.432 10.126 1.00 0.00 ? 109 CYS A SG   8  
ATOM   3528 H  H    . CYS A 1 8  ? -3.320  -10.879 8.977  1.00 0.00 ? 109 CYS A H    8  
ATOM   3529 H  HA   . CYS A 1 8  ? -4.204  -9.794  11.528 1.00 0.00 ? 109 CYS A HA   8  
ATOM   3530 H  HB2  . CYS A 1 8  ? -1.915  -10.042 12.263 1.00 0.00 ? 109 CYS A HB2  8  
ATOM   3531 H  HB3  . CYS A 1 8  ? -2.454  -11.547 11.544 1.00 0.00 ? 109 CYS A HB3  8  
ATOM   3532 N  N    . THR A 1 9  ? -2.487  -8.271  9.144  1.00 0.00 ? 110 THR A N    8  
ATOM   3533 C  CA   . THR A 1 9  ? -2.117  -6.976  8.598  1.00 0.00 ? 110 THR A CA   8  
ATOM   3534 C  C    . THR A 1 9  ? -0.600  -6.888  8.418  1.00 0.00 ? 110 THR A C    8  
ATOM   3535 O  O    . THR A 1 9  ? -0.046  -5.795  8.318  1.00 0.00 ? 110 THR A O    8  
ATOM   3536 C  CB   . THR A 1 9  ? -2.683  -5.895  9.521  1.00 0.00 ? 110 THR A CB   8  
ATOM   3537 O  OG1  . THR A 1 9  ? -2.282  -6.305  10.825 1.00 0.00 ? 110 THR A OG1  8  
ATOM   3538 C  CG2  . THR A 1 9  ? -4.212  -5.915  9.577  1.00 0.00 ? 110 THR A CG2  8  
ATOM   3539 H  H    . THR A 1 9  ? -2.236  -9.056  8.578  1.00 0.00 ? 110 THR A H    8  
ATOM   3540 H  HA   . THR A 1 9  ? -2.563  -6.880  7.608  1.00 0.00 ? 110 THR A HA   8  
ATOM   3541 H  HB   . THR A 1 9  ? -2.317  -4.909  9.235  1.00 0.00 ? 110 THR A HB   8  
ATOM   3542 H  HG1  . THR A 1 9  ? -3.052  -6.232  11.458 1.00 0.00 ? 110 THR A HG1  8  
ATOM   3543 H  HG21 . THR A 1 9  ? -4.572  -6.911  9.322  1.00 0.00 ? 110 THR A HG21 8  
ATOM   3544 H  HG22 . THR A 1 9  ? -4.542  -5.655  10.583 1.00 0.00 ? 110 THR A HG22 8  
ATOM   3545 H  HG23 . THR A 1 9  ? -4.611  -5.191  8.866  1.00 0.00 ? 110 THR A HG23 8  
ATOM   3546 N  N    . ARG A 1 10 ? 0.028   -8.055  8.382  1.00 0.00 ? 111 ARG A N    8  
ATOM   3547 C  CA   . ARG A 1 10 ? 1.470   -8.123  8.216  1.00 0.00 ? 111 ARG A CA   8  
ATOM   3548 C  C    . ARG A 1 10 ? 1.857   -7.745  6.784  1.00 0.00 ? 111 ARG A C    8  
ATOM   3549 O  O    . ARG A 1 10 ? 1.209   -8.169  5.829  1.00 0.00 ? 111 ARG A O    8  
ATOM   3550 C  CB   . ARG A 1 10 ? 1.994   -9.527  8.525  1.00 0.00 ? 111 ARG A CB   8  
ATOM   3551 C  CG   . ARG A 1 10 ? 2.470   -9.626  9.975  1.00 0.00 ? 111 ARG A CG   8  
ATOM   3552 C  CD   . ARG A 1 10 ? 3.665   -10.575 10.095 1.00 0.00 ? 111 ARG A CD   8  
ATOM   3553 N  NE   . ARG A 1 10 ? 3.301   -11.745 10.925 1.00 0.00 ? 111 ARG A NE   8  
ATOM   3554 C  CZ   . ARG A 1 10 ? 4.098   -12.804 11.122 1.00 0.00 ? 111 ARG A CZ   8  
ATOM   3555 N  NH1  . ARG A 1 10 ? 5.295   -12.862 10.523 1.00 0.00 ? 111 ARG A NH1  8  
ATOM   3556 N  NH2  . ARG A 1 10 ? 3.695   -13.806 11.915 1.00 0.00 ? 111 ARG A NH2  8  
ATOM   3557 H  H    . ARG A 1 10 ? -0.431  -8.939  8.464  1.00 0.00 ? 111 ARG A H    8  
ATOM   3558 H  HA   . ARG A 1 10 ? 1.868   -7.404  8.932  1.00 0.00 ? 111 ARG A HA   8  
ATOM   3559 H  HB2  . ARG A 1 10 ? 1.208   -10.260 8.346  1.00 0.00 ? 111 ARG A HB2  8  
ATOM   3560 H  HB3  . ARG A 1 10 ? 2.815   -9.769  7.851  1.00 0.00 ? 111 ARG A HB3  8  
ATOM   3561 H  HG2  . ARG A 1 10 ? 2.749   -8.637  10.339 1.00 0.00 ? 111 ARG A HG2  8  
ATOM   3562 H  HG3  . ARG A 1 10 ? 1.655   -9.980  10.606 1.00 0.00 ? 111 ARG A HG3  8  
ATOM   3563 H  HD2  . ARG A 1 10 ? 3.979   -10.904 9.106  1.00 0.00 ? 111 ARG A HD2  8  
ATOM   3564 H  HD3  . ARG A 1 10 ? 4.512   -10.052 10.541 1.00 0.00 ? 111 ARG A HD3  8  
ATOM   3565 H  HE   . ARG A 1 10 ? 2.404   -11.745 11.367 1.00 0.00 ? 111 ARG A HE   8  
ATOM   3566 H  HH11 . ARG A 1 10 ? 5.532   -12.198 9.814  1.00 0.00 ? 111 ARG A HH11 8  
ATOM   3567 H  HH12 . ARG A 1 10 ? 5.951   -13.568 10.787 1.00 0.00 ? 111 ARG A HH12 8  
ATOM   3568 H  HH21 . ARG A 1 10 ? 2.785   -13.784 12.329 1.00 0.00 ? 111 ARG A HH21 8  
ATOM   3569 H  HH22 . ARG A 1 10 ? 4.306   -14.578 12.094 1.00 0.00 ? 111 ARG A HH22 8  
ATOM   3570 N  N    . ALA A 1 11 ? 2.914   -6.952  6.680  1.00 0.00 ? 112 ALA A N    8  
ATOM   3571 C  CA   . ALA A 1 11 ? 3.395   -6.512  5.382  1.00 0.00 ? 112 ALA A CA   8  
ATOM   3572 C  C    . ALA A 1 11 ? 4.689   -7.256  5.045  1.00 0.00 ? 112 ALA A C    8  
ATOM   3573 O  O    . ALA A 1 11 ? 5.592   -7.345  5.875  1.00 0.00 ? 112 ALA A O    8  
ATOM   3574 C  CB   . ALA A 1 11 ? 3.581   -4.994  5.393  1.00 0.00 ? 112 ALA A CB   8  
ATOM   3575 H  H    . ALA A 1 11 ? 3.436   -6.611  7.463  1.00 0.00 ? 112 ALA A H    8  
ATOM   3576 H  HA   . ALA A 1 11 ? 2.636   -6.768  4.643  1.00 0.00 ? 112 ALA A HA   8  
ATOM   3577 H  HB1  . ALA A 1 11 ? 3.839   -4.667  6.400  1.00 0.00 ? 112 ALA A HB1  8  
ATOM   3578 H  HB2  . ALA A 1 11 ? 4.382   -4.720  4.706  1.00 0.00 ? 112 ALA A HB2  8  
ATOM   3579 H  HB3  . ALA A 1 11 ? 2.654   -4.512  5.081  1.00 0.00 ? 112 ALA A HB3  8  
ATOM   3580 N  N    . PHE A 1 12 ? 4.738   -7.770  3.824  1.00 0.00 ? 113 PHE A N    8  
ATOM   3581 C  CA   . PHE A 1 12 ? 5.906   -8.502  3.368  1.00 0.00 ? 113 PHE A CA   8  
ATOM   3582 C  C    . PHE A 1 12 ? 6.440   -7.921  2.057  1.00 0.00 ? 113 PHE A C    8  
ATOM   3583 O  O    . PHE A 1 12 ? 5.693   -7.308  1.296  1.00 0.00 ? 113 PHE A O    8  
ATOM   3584 C  CB   . PHE A 1 12 ? 5.464   -9.947  3.128  1.00 0.00 ? 113 PHE A CB   8  
ATOM   3585 C  CG   . PHE A 1 12 ? 5.064   -10.695 4.402  1.00 0.00 ? 113 PHE A CG   8  
ATOM   3586 C  CD1  . PHE A 1 12 ? 6.023   -11.162 5.245  1.00 0.00 ? 113 PHE A CD1  8  
ATOM   3587 C  CD2  . PHE A 1 12 ? 3.749   -10.893 4.690  1.00 0.00 ? 113 PHE A CD2  8  
ATOM   3588 C  CE1  . PHE A 1 12 ? 5.653   -11.855 6.427  1.00 0.00 ? 113 PHE A CE1  8  
ATOM   3589 C  CE2  . PHE A 1 12 ? 3.379   -11.587 5.872  1.00 0.00 ? 113 PHE A CE2  8  
ATOM   3590 C  CZ   . PHE A 1 12 ? 4.339   -12.054 6.716  1.00 0.00 ? 113 PHE A CZ   8  
ATOM   3591 H  H    . PHE A 1 12 ? 3.999   -7.693  3.156  1.00 0.00 ? 113 PHE A H    8  
ATOM   3592 H  HA   . PHE A 1 12 ? 6.669   -8.410  4.141  1.00 0.00 ? 113 PHE A HA   8  
ATOM   3593 H  HB2  . PHE A 1 12 ? 4.619   -9.948  2.439  1.00 0.00 ? 113 PHE A HB2  8  
ATOM   3594 H  HB3  . PHE A 1 12 ? 6.274   -10.489 2.640  1.00 0.00 ? 113 PHE A HB3  8  
ATOM   3595 H  HD1  . PHE A 1 12 ? 7.076   -11.003 5.014  1.00 0.00 ? 113 PHE A HD1  8  
ATOM   3596 H  HD2  . PHE A 1 12 ? 2.981   -10.519 4.014  1.00 0.00 ? 113 PHE A HD2  8  
ATOM   3597 H  HE1  . PHE A 1 12 ? 6.422   -12.229 7.104  1.00 0.00 ? 113 PHE A HE1  8  
ATOM   3598 H  HE2  . PHE A 1 12 ? 2.325   -11.746 6.103  1.00 0.00 ? 113 PHE A HE2  8  
ATOM   3599 H  HZ   . PHE A 1 12 ? 4.054   -12.586 7.624  1.00 0.00 ? 113 PHE A HZ   8  
ATOM   3600 N  N    . ALA A 1 13 ? 7.728   -8.134  1.833  1.00 0.00 ? 114 ALA A N    8  
ATOM   3601 C  CA   . ALA A 1 13 ? 8.370   -7.639  0.626  1.00 0.00 ? 114 ALA A CA   8  
ATOM   3602 C  C    . ALA A 1 13 ? 8.112   -8.617  -0.521 1.00 0.00 ? 114 ALA A C    8  
ATOM   3603 O  O    . ALA A 1 13 ? 7.832   -8.200  -1.645 1.00 0.00 ? 114 ALA A O    8  
ATOM   3604 C  CB   . ALA A 1 13 ? 9.863   -7.431  0.892  1.00 0.00 ? 114 ALA A CB   8  
ATOM   3605 H  H    . ALA A 1 13 ? 8.329   -8.633  2.457  1.00 0.00 ? 114 ALA A H    8  
ATOM   3606 H  HA   . ALA A 1 13 ? 7.920   -6.677  0.382  1.00 0.00 ? 114 ALA A HA   8  
ATOM   3607 H  HB1  . ALA A 1 13 ? 10.022  -6.437  1.308  1.00 0.00 ? 114 ALA A HB1  8  
ATOM   3608 H  HB2  . ALA A 1 13 ? 10.214  -8.182  1.598  1.00 0.00 ? 114 ALA A HB2  8  
ATOM   3609 H  HB3  . ALA A 1 13 ? 10.414  -7.526  -0.043 1.00 0.00 ? 114 ALA A HB3  8  
ATOM   3610 N  N    . ARG A 1 14 ? 8.215   -9.898  -0.200 1.00 0.00 ? 115 ARG A N    8  
ATOM   3611 C  CA   . ARG A 1 14 ? 7.998   -10.938 -1.190 1.00 0.00 ? 115 ARG A CA   8  
ATOM   3612 C  C    . ARG A 1 14 ? 6.603   -11.546 -1.024 1.00 0.00 ? 115 ARG A C    8  
ATOM   3613 O  O    . ARG A 1 14 ? 6.206   -11.901 0.085  1.00 0.00 ? 115 ARG A O    8  
ATOM   3614 C  CB   . ARG A 1 14 ? 9.046   -12.045 -1.068 1.00 0.00 ? 115 ARG A CB   8  
ATOM   3615 C  CG   . ARG A 1 14 ? 10.437  -11.456 -0.823 1.00 0.00 ? 115 ARG A CG   8  
ATOM   3616 C  CD   . ARG A 1 14 ? 10.843  -10.515 -1.958 1.00 0.00 ? 115 ARG A CD   8  
ATOM   3617 N  NE   . ARG A 1 14 ? 12.279  -10.684 -2.267 1.00 0.00 ? 115 ARG A NE   8  
ATOM   3618 C  CZ   . ARG A 1 14 ? 13.140  -9.668  -2.419 1.00 0.00 ? 115 ARG A CZ   8  
ATOM   3619 N  NH1  . ARG A 1 14 ? 13.409  -8.858  -1.387 1.00 0.00 ? 115 ARG A NH1  8  
ATOM   3620 N  NH2  . ARG A 1 14 ? 13.733  -9.463  -3.603 1.00 0.00 ? 115 ARG A NH2  8  
ATOM   3621 H  H    . ARG A 1 14 ? 8.443   -10.228 0.717  1.00 0.00 ? 115 ARG A H    8  
ATOM   3622 H  HA   . ARG A 1 14 ? 8.092   -10.432 -2.151 1.00 0.00 ? 115 ARG A HA   8  
ATOM   3623 H  HB2  . ARG A 1 14 ? 8.781   -12.713 -0.249 1.00 0.00 ? 115 ARG A HB2  8  
ATOM   3624 H  HB3  . ARG A 1 14 ? 9.056   -12.645 -1.978 1.00 0.00 ? 115 ARG A HB3  8  
ATOM   3625 H  HG2  . ARG A 1 14 ? 10.446  -10.916 0.124  1.00 0.00 ? 115 ARG A HG2  8  
ATOM   3626 H  HG3  . ARG A 1 14 ? 11.166  -12.262 -0.735 1.00 0.00 ? 115 ARG A HG3  8  
ATOM   3627 H  HD2  . ARG A 1 14 ? 10.244  -10.723 -2.846 1.00 0.00 ? 115 ARG A HD2  8  
ATOM   3628 H  HD3  . ARG A 1 14 ? 10.642  -9.482  -1.674 1.00 0.00 ? 115 ARG A HD3  8  
ATOM   3629 H  HE   . ARG A 1 14 ? 12.631  -11.615 -2.370 1.00 0.00 ? 115 ARG A HE   8  
ATOM   3630 H  HH11 . ARG A 1 14 ? 12.914  -8.966  -0.524 1.00 0.00 ? 115 ARG A HH11 8  
ATOM   3631 H  HH12 . ARG A 1 14 ? 14.103  -8.144  -1.478 1.00 0.00 ? 115 ARG A HH12 8  
ATOM   3632 H  HH21 . ARG A 1 14 ? 14.605  -9.907  -3.810 1.00 0.00 ? 115 ARG A HH21 8  
ATOM   3633 H  HH22 . ARG A 1 14 ? 13.303  -8.866  -4.280 1.00 0.00 ? 115 ARG A HH22 8  
ATOM   3634 N  N    . GLN A 1 15 ? 5.898   -11.647 -2.141 1.00 0.00 ? 116 GLN A N    8  
ATOM   3635 C  CA   . GLN A 1 15 ? 4.557   -12.205 -2.132 1.00 0.00 ? 116 GLN A CA   8  
ATOM   3636 C  C    . GLN A 1 15 ? 4.557   -13.575 -1.449 1.00 0.00 ? 116 GLN A C    8  
ATOM   3637 O  O    . GLN A 1 15 ? 3.745   -13.828 -0.560 1.00 0.00 ? 116 GLN A O    8  
ATOM   3638 C  CB   . GLN A 1 15 ? 3.994   -12.302 -3.551 1.00 0.00 ? 116 GLN A CB   8  
ATOM   3639 C  CG   . GLN A 1 15 ? 3.688   -10.913 -4.115 1.00 0.00 ? 116 GLN A CG   8  
ATOM   3640 C  CD   . GLN A 1 15 ? 4.944   -10.274 -4.712 1.00 0.00 ? 116 GLN A CD   8  
ATOM   3641 O  OE1  . GLN A 1 15 ? 5.891   -9.938  -4.018 1.00 0.00 ? 116 GLN A OE1  8  
ATOM   3642 N  NE2  . GLN A 1 15 ? 4.900   -10.125 -6.033 1.00 0.00 ? 116 GLN A NE2  8  
ATOM   3643 H  H    . GLN A 1 15 ? 6.230   -11.356 -3.039 1.00 0.00 ? 116 GLN A H    8  
ATOM   3644 H  HA   . GLN A 1 15 ? 3.955   -11.503 -1.556 1.00 0.00 ? 116 GLN A HA   8  
ATOM   3645 H  HB2  . GLN A 1 15 ? 4.710   -12.810 -4.197 1.00 0.00 ? 116 GLN A HB2  8  
ATOM   3646 H  HB3  . GLN A 1 15 ? 3.086   -12.904 -3.546 1.00 0.00 ? 116 GLN A HB3  8  
ATOM   3647 H  HG2  . GLN A 1 15 ? 2.916   -10.988 -4.880 1.00 0.00 ? 116 GLN A HG2  8  
ATOM   3648 H  HG3  . GLN A 1 15 ? 3.291   -10.274 -3.325 1.00 0.00 ? 116 GLN A HG3  8  
ATOM   3649 H  HE21 . GLN A 1 15 ? 4.073   -10.374 -6.536 1.00 0.00 ? 116 GLN A HE21 8  
ATOM   3650 H  HE22 . GLN A 1 15 ? 5.693   -9.763  -6.522 1.00 0.00 ? 116 GLN A HE22 8  
ATOM   3651 N  N    . GLU A 1 16 ? 5.476   -14.420 -1.889 1.00 0.00 ? 117 GLU A N    8  
ATOM   3652 C  CA   . GLU A 1 16 ? 5.593   -15.757 -1.331 1.00 0.00 ? 117 GLU A CA   8  
ATOM   3653 C  C    . GLU A 1 16 ? 5.578   -15.696 0.198  1.00 0.00 ? 117 GLU A C    8  
ATOM   3654 O  O    . GLU A 1 16 ? 4.946   -16.526 0.850  1.00 0.00 ? 117 GLU A O    8  
ATOM   3655 C  CB   . GLU A 1 16 ? 6.854   -16.456 -1.840 1.00 0.00 ? 117 GLU A CB   8  
ATOM   3656 C  CG   . GLU A 1 16 ? 7.511   -17.279 -0.730 1.00 0.00 ? 117 GLU A CG   8  
ATOM   3657 C  CD   . GLU A 1 16 ? 8.603   -18.189 -1.295 1.00 0.00 ? 117 GLU A CD   8  
ATOM   3658 O  OE1  . GLU A 1 16 ? 9.574   -17.632 -1.852 1.00 0.00 ? 117 GLU A OE1  8  
ATOM   3659 O  OE2  . GLU A 1 16 ? 8.442   -19.421 -1.157 1.00 0.00 ? 117 GLU A OE2  8  
ATOM   3660 H  H    . GLU A 1 16 ? 6.133   -14.206 -2.612 1.00 0.00 ? 117 GLU A H    8  
ATOM   3661 H  HA   . GLU A 1 16 ? 4.715   -16.297 -1.688 1.00 0.00 ? 117 GLU A HA   8  
ATOM   3662 H  HB2  . GLU A 1 16 ? 6.601   -17.107 -2.677 1.00 0.00 ? 117 GLU A HB2  8  
ATOM   3663 H  HB3  . GLU A 1 16 ? 7.559   -15.715 -2.214 1.00 0.00 ? 117 GLU A HB3  8  
ATOM   3664 H  HG2  . GLU A 1 16 ? 7.940   -16.611 0.017  1.00 0.00 ? 117 GLU A HG2  8  
ATOM   3665 H  HG3  . GLU A 1 16 ? 6.756   -17.882 -0.224 1.00 0.00 ? 117 GLU A HG3  8  
ATOM   3666 N  N    . ALA A 1 17 ? 6.283   -14.707 0.726  1.00 0.00 ? 118 ALA A N    8  
ATOM   3667 C  CA   . ALA A 1 17 ? 6.360   -14.527 2.166  1.00 0.00 ? 118 ALA A CA   8  
ATOM   3668 C  C    . ALA A 1 17 ? 4.951   -14.319 2.725  1.00 0.00 ? 118 ALA A C    8  
ATOM   3669 O  O    . ALA A 1 17 ? 4.682   -14.650 3.878  1.00 0.00 ? 118 ALA A O    8  
ATOM   3670 C  CB   . ALA A 1 17 ? 7.293   -13.358 2.486  1.00 0.00 ? 118 ALA A CB   8  
ATOM   3671 H  H    . ALA A 1 17 ? 6.795   -14.036 0.189  1.00 0.00 ? 118 ALA A H    8  
ATOM   3672 H  HA   . ALA A 1 17 ? 6.780   -15.437 2.592  1.00 0.00 ? 118 ALA A HA   8  
ATOM   3673 H  HB1  . ALA A 1 17 ? 6.930   -12.457 1.990  1.00 0.00 ? 118 ALA A HB1  8  
ATOM   3674 H  HB2  . ALA A 1 17 ? 7.315   -13.194 3.564  1.00 0.00 ? 118 ALA A HB2  8  
ATOM   3675 H  HB3  . ALA A 1 17 ? 8.299   -13.587 2.132  1.00 0.00 ? 118 ALA A HB3  8  
ATOM   3676 N  N    . LEU A 1 18 ? 4.089   -13.771 1.881  1.00 0.00 ? 119 LEU A N    8  
ATOM   3677 C  CA   . LEU A 1 18 ? 2.714   -13.514 2.277  1.00 0.00 ? 119 LEU A CA   8  
ATOM   3678 C  C    . LEU A 1 18 ? 1.904   -14.807 2.156  1.00 0.00 ? 119 LEU A C    8  
ATOM   3679 O  O    . LEU A 1 18 ? 1.423   -15.338 3.156  1.00 0.00 ? 119 LEU A O    8  
ATOM   3680 C  CB   . LEU A 1 18 ? 2.134   -12.348 1.475  1.00 0.00 ? 119 LEU A CB   8  
ATOM   3681 C  CG   . LEU A 1 18 ? 0.609   -12.235 1.462  1.00 0.00 ? 119 LEU A CG   8  
ATOM   3682 C  CD1  . LEU A 1 18 ? 0.043   -12.297 2.882  1.00 0.00 ? 119 LEU A CD1  8  
ATOM   3683 C  CD2  . LEU A 1 18 ? 0.158   -10.975 0.719  1.00 0.00 ? 119 LEU A CD2  8  
ATOM   3684 H  H    . LEU A 1 18 ? 4.316   -13.504 0.944  1.00 0.00 ? 119 LEU A H    8  
ATOM   3685 H  HA   . LEU A 1 18 ? 2.727   -13.210 3.324  1.00 0.00 ? 119 LEU A HA   8  
ATOM   3686 H  HB2  . LEU A 1 18 ? 2.545   -11.420 1.873  1.00 0.00 ? 119 LEU A HB2  8  
ATOM   3687 H  HB3  . LEU A 1 18 ? 2.481   -12.433 0.445  1.00 0.00 ? 119 LEU A HB3  8  
ATOM   3688 H  HG   . LEU A 1 18 ? 0.208   -13.090 0.918  1.00 0.00 ? 119 LEU A HG   8  
ATOM   3689 H  HD11 . LEU A 1 18 ? -1.043  -12.386 2.837  1.00 0.00 ? 119 LEU A HD11 8  
ATOM   3690 H  HD12 . LEU A 1 18 ? 0.457   -13.162 3.401  1.00 0.00 ? 119 LEU A HD12 8  
ATOM   3691 H  HD13 . LEU A 1 18 ? 0.311   -11.388 3.420  1.00 0.00 ? 119 LEU A HD13 8  
ATOM   3692 H  HD21 . LEU A 1 18 ? -0.766  -11.183 0.181  1.00 0.00 ? 119 LEU A HD21 8  
ATOM   3693 H  HD22 . LEU A 1 18 ? -0.011  -10.172 1.437  1.00 0.00 ? 119 LEU A HD22 8  
ATOM   3694 H  HD23 . LEU A 1 18 ? 0.931   -10.674 0.013  1.00 0.00 ? 119 LEU A HD23 8  
ATOM   3695 N  N    . LYS A 1 19 ? 1.778   -15.275 0.923  1.00 0.00 ? 120 LYS A N    8  
ATOM   3696 C  CA   . LYS A 1 19 ? 1.034   -16.495 0.659  1.00 0.00 ? 120 LYS A CA   8  
ATOM   3697 C  C    . LYS A 1 19 ? 1.241   -17.475 1.816  1.00 0.00 ? 120 LYS A C    8  
ATOM   3698 O  O    . LYS A 1 19 ? 0.283   -17.868 2.480  1.00 0.00 ? 120 LYS A O    8  
ATOM   3699 C  CB   . LYS A 1 19 ? 1.413   -17.068 -0.708 1.00 0.00 ? 120 LYS A CB   8  
ATOM   3700 C  CG   . LYS A 1 19 ? 0.300   -16.828 -1.731 1.00 0.00 ? 120 LYS A CG   8  
ATOM   3701 C  CD   . LYS A 1 19 ? -0.826  -17.850 -1.565 1.00 0.00 ? 120 LYS A CD   8  
ATOM   3702 C  CE   . LYS A 1 19 ? -0.291  -19.280 -1.668 1.00 0.00 ? 120 LYS A CE   8  
ATOM   3703 N  NZ   . LYS A 1 19 ? 0.661   -19.395 -2.794 1.00 0.00 ? 120 LYS A NZ   8  
ATOM   3704 H  H    . LYS A 1 19 ? 2.172   -14.838 0.115  1.00 0.00 ? 120 LYS A H    8  
ATOM   3705 H  HA   . LYS A 1 19 ? -0.023  -16.231 0.616  1.00 0.00 ? 120 LYS A HA   8  
ATOM   3706 H  HB2  . LYS A 1 19 ? 2.338   -16.608 -1.056 1.00 0.00 ? 120 LYS A HB2  8  
ATOM   3707 H  HB3  . LYS A 1 19 ? 1.604   -18.138 -0.617 1.00 0.00 ? 120 LYS A HB3  8  
ATOM   3708 H  HG2  . LYS A 1 19 ? -0.096  -15.821 -1.612 1.00 0.00 ? 120 LYS A HG2  8  
ATOM   3709 H  HG3  . LYS A 1 19 ? 0.709   -16.894 -2.739 1.00 0.00 ? 120 LYS A HG3  8  
ATOM   3710 H  HD2  . LYS A 1 19 ? -1.311  -17.708 -0.597 1.00 0.00 ? 120 LYS A HD2  8  
ATOM   3711 H  HD3  . LYS A 1 19 ? -1.587  -17.686 -2.328 1.00 0.00 ? 120 LYS A HD3  8  
ATOM   3712 H  HE2  . LYS A 1 19 ? 0.201   -19.559 -0.737 1.00 0.00 ? 120 LYS A HE2  8  
ATOM   3713 H  HE3  . LYS A 1 19 ? -1.119  -19.974 -1.812 1.00 0.00 ? 120 LYS A HE3  8  
ATOM   3714 H  HZ1  . LYS A 1 19 ? 1.436   -18.782 -2.640 1.00 0.00 ? 120 LYS A HZ1  8  
ATOM   3715 H  HZ2  . LYS A 1 19 ? 0.990   -20.338 -2.858 1.00 0.00 ? 120 LYS A HZ2  8  
ATOM   3716 H  HZ3  . LYS A 1 19 ? 0.203   -19.145 -3.647 1.00 0.00 ? 120 LYS A HZ3  8  
ATOM   3717 N  N    . ARG A 1 20 ? 2.498   -17.840 2.022  1.00 0.00 ? 121 ARG A N    8  
ATOM   3718 C  CA   . ARG A 1 20 ? 2.844   -18.766 3.087  1.00 0.00 ? 121 ARG A CA   8  
ATOM   3719 C  C    . ARG A 1 20 ? 2.272   -18.279 4.420  1.00 0.00 ? 121 ARG A C    8  
ATOM   3720 O  O    . ARG A 1 20 ? 1.629   -19.042 5.140  1.00 0.00 ? 121 ARG A O    8  
ATOM   3721 C  CB   . ARG A 1 20 ? 4.360   -18.917 3.215  1.00 0.00 ? 121 ARG A CB   8  
ATOM   3722 C  CG   . ARG A 1 20 ? 4.779   -20.383 3.085  1.00 0.00 ? 121 ARG A CG   8  
ATOM   3723 C  CD   . ARG A 1 20 ? 4.804   -21.069 4.453  1.00 0.00 ? 121 ARG A CD   8  
ATOM   3724 N  NE   . ARG A 1 20 ? 5.694   -20.328 5.374  1.00 0.00 ? 121 ARG A NE   8  
ATOM   3725 C  CZ   . ARG A 1 20 ? 5.743   -20.534 6.697  1.00 0.00 ? 121 ARG A CZ   8  
ATOM   3726 N  NH1  . ARG A 1 20 ? 4.617   -20.790 7.378  1.00 0.00 ? 121 ARG A NH1  8  
ATOM   3727 N  NH2  . ARG A 1 20 ? 6.918   -20.483 7.340  1.00 0.00 ? 121 ARG A NH2  8  
ATOM   3728 H  H    . ARG A 1 20 ? 3.271   -17.515 1.477  1.00 0.00 ? 121 ARG A H    8  
ATOM   3729 H  HA   . ARG A 1 20 ? 2.393   -19.712 2.790  1.00 0.00 ? 121 ARG A HA   8  
ATOM   3730 H  HB2  . ARG A 1 20 ? 4.855   -18.324 2.445  1.00 0.00 ? 121 ARG A HB2  8  
ATOM   3731 H  HB3  . ARG A 1 20 ? 4.688   -18.525 4.178  1.00 0.00 ? 121 ARG A HB3  8  
ATOM   3732 H  HG2  . ARG A 1 20 ? 4.086   -20.905 2.425  1.00 0.00 ? 121 ARG A HG2  8  
ATOM   3733 H  HG3  . ARG A 1 20 ? 5.765   -20.444 2.625  1.00 0.00 ? 121 ARG A HG3  8  
ATOM   3734 H  HD2  . ARG A 1 20 ? 3.796   -21.115 4.864  1.00 0.00 ? 121 ARG A HD2  8  
ATOM   3735 H  HD3  . ARG A 1 20 ? 5.151   -22.096 4.346  1.00 0.00 ? 121 ARG A HD3  8  
ATOM   3736 H  HE   . ARG A 1 20 ? 6.295   -19.630 4.985  1.00 0.00 ? 121 ARG A HE   8  
ATOM   3737 H  HH11 . ARG A 1 20 ? 4.191   -21.692 7.318  1.00 0.00 ? 121 ARG A HH11 8  
ATOM   3738 H  HH12 . ARG A 1 20 ? 4.204   -20.079 7.947  1.00 0.00 ? 121 ARG A HH12 8  
ATOM   3739 H  HH21 . ARG A 1 20 ? 7.764   -20.354 6.824  1.00 0.00 ? 121 ARG A HH21 8  
ATOM   3740 H  HH22 . ARG A 1 20 ? 6.947   -20.575 8.335  1.00 0.00 ? 121 ARG A HH22 8  
ATOM   3741 N  N    . HIS A 1 21 ? 2.527   -17.010 4.709  1.00 0.00 ? 122 HIS A N    8  
ATOM   3742 C  CA   . HIS A 1 21 ? 2.045   -16.413 5.943  1.00 0.00 ? 122 HIS A CA   8  
ATOM   3743 C  C    . HIS A 1 21 ? 0.553   -16.707 6.107  1.00 0.00 ? 122 HIS A C    8  
ATOM   3744 O  O    . HIS A 1 21 ? 0.121   -17.169 7.162  1.00 0.00 ? 122 HIS A O    8  
ATOM   3745 C  CB   . HIS A 1 21 ? 2.363   -14.916 5.981  1.00 0.00 ? 122 HIS A CB   8  
ATOM   3746 C  CG   . HIS A 1 21 ? 1.630   -14.161 7.063  1.00 0.00 ? 122 HIS A CG   8  
ATOM   3747 N  ND1  . HIS A 1 21 ? 2.216   -13.826 8.271  1.00 0.00 ? 122 HIS A ND1  8  
ATOM   3748 C  CD2  . HIS A 1 21 ? 0.354   -13.679 7.108  1.00 0.00 ? 122 HIS A CD2  8  
ATOM   3749 C  CE1  . HIS A 1 21 ? 1.324   -13.173 9.003  1.00 0.00 ? 122 HIS A CE1  8  
ATOM   3750 N  NE2  . HIS A 1 21 ? 0.171   -13.083 8.279  1.00 0.00 ? 122 HIS A NE2  8  
ATOM   3751 H  H    . HIS A 1 21 ? 3.050   -16.397 4.118  1.00 0.00 ? 122 HIS A H    8  
ATOM   3752 H  HA   . HIS A 1 21 ? 2.593   -16.889 6.755  1.00 0.00 ? 122 HIS A HA   8  
ATOM   3753 H  HB2  . HIS A 1 21 ? 3.435   -14.786 6.123  1.00 0.00 ? 122 HIS A HB2  8  
ATOM   3754 H  HB3  . HIS A 1 21 ? 2.113   -14.478 5.015  1.00 0.00 ? 122 HIS A HB3  8  
ATOM   3755 H  HD1  . HIS A 1 21 ? 3.154   -14.040 8.546  1.00 0.00 ? 122 HIS A HD1  8  
ATOM   3756 H  HD2  . HIS A 1 21 ? -0.388  -13.768 6.315  1.00 0.00 ? 122 HIS A HD2  8  
ATOM   3757 H  HE1  . HIS A 1 21 ? 1.484   -12.776 10.005 1.00 0.00 ? 122 HIS A HE1  8  
ATOM   3758 N  N    . TYR A 1 22 ? -0.194  -16.427 5.049  1.00 0.00 ? 123 TYR A N    8  
ATOM   3759 C  CA   . TYR A 1 22 ? -1.628  -16.656 5.064  1.00 0.00 ? 123 TYR A CA   8  
ATOM   3760 C  C    . TYR A 1 22 ? -1.949  -18.097 5.463  1.00 0.00 ? 123 TYR A C    8  
ATOM   3761 O  O    . TYR A 1 22 ? -2.642  -18.332 6.452  1.00 0.00 ? 123 TYR A O    8  
ATOM   3762 C  CB   . TYR A 1 22 ? -2.108  -16.418 3.631  1.00 0.00 ? 123 TYR A CB   8  
ATOM   3763 C  CG   . TYR A 1 22 ? -3.215  -15.369 3.510  1.00 0.00 ? 123 TYR A CG   8  
ATOM   3764 C  CD1  . TYR A 1 22 ? -4.432  -15.577 4.128  1.00 0.00 ? 123 TYR A CD1  8  
ATOM   3765 C  CD2  . TYR A 1 22 ? -2.998  -14.215 2.787  1.00 0.00 ? 123 TYR A CD2  8  
ATOM   3766 C  CE1  . TYR A 1 22 ? -5.474  -14.590 4.015  1.00 0.00 ? 123 TYR A CE1  8  
ATOM   3767 C  CE2  . TYR A 1 22 ? -4.040  -13.228 2.674  1.00 0.00 ? 123 TYR A CE2  8  
ATOM   3768 C  CZ   . TYR A 1 22 ? -5.227  -13.465 3.294  1.00 0.00 ? 123 TYR A CZ   8  
ATOM   3769 O  OH   . TYR A 1 22 ? -6.211  -12.532 3.187  1.00 0.00 ? 123 TYR A OH   8  
ATOM   3770 H  H    . TYR A 1 22 ? 0.166   -16.051 4.195  1.00 0.00 ? 123 TYR A H    8  
ATOM   3771 H  HA   . TYR A 1 22 ? -2.070  -15.977 5.793  1.00 0.00 ? 123 TYR A HA   8  
ATOM   3772 H  HB2  . TYR A 1 22 ? -1.259  -16.105 3.021  1.00 0.00 ? 123 TYR A HB2  8  
ATOM   3773 H  HB3  . TYR A 1 22 ? -2.467  -17.360 3.216  1.00 0.00 ? 123 TYR A HB3  8  
ATOM   3774 H  HD1  . TYR A 1 22 ? -4.603  -16.489 4.700  1.00 0.00 ? 123 TYR A HD1  8  
ATOM   3775 H  HD2  . TYR A 1 22 ? -2.036  -14.050 2.299  1.00 0.00 ? 123 TYR A HD2  8  
ATOM   3776 H  HE1  . TYR A 1 22 ? -6.441  -14.743 4.497  1.00 0.00 ? 123 TYR A HE1  8  
ATOM   3777 H  HE2  . TYR A 1 22 ? -3.881  -12.311 2.105  1.00 0.00 ? 123 TYR A HE2  8  
ATOM   3778 H  HH   . TYR A 1 22 ? -5.812  -11.616 3.142  1.00 0.00 ? 123 TYR A HH   8  
ATOM   3779 N  N    . ARG A 1 23 ? -1.430  -19.026 4.673  1.00 0.00 ? 124 ARG A N    8  
ATOM   3780 C  CA   . ARG A 1 23 ? -1.653  -20.439 4.932  1.00 0.00 ? 124 ARG A CA   8  
ATOM   3781 C  C    . ARG A 1 23 ? -1.497  -20.736 6.425  1.00 0.00 ? 124 ARG A C    8  
ATOM   3782 O  O    . ARG A 1 23 ? -2.242  -21.540 6.982  1.00 0.00 ? 124 ARG A O    8  
ATOM   3783 C  CB   . ARG A 1 23 ? -0.672  -21.305 4.141  1.00 0.00 ? 124 ARG A CB   8  
ATOM   3784 C  CG   . ARG A 1 23 ? 0.424   -21.864 5.051  1.00 0.00 ? 124 ARG A CG   8  
ATOM   3785 C  CD   . ARG A 1 23 ? 1.456   -22.656 4.246  1.00 0.00 ? 124 ARG A CD   8  
ATOM   3786 N  NE   . ARG A 1 23 ? 0.774   -23.477 3.219  1.00 0.00 ? 124 ARG A NE   8  
ATOM   3787 C  CZ   . ARG A 1 23 ? 0.255   -24.689 3.451  1.00 0.00 ? 124 ARG A CZ   8  
ATOM   3788 N  NH1  . ARG A 1 23 ? 0.967   -25.607 4.119  1.00 0.00 ? 124 ARG A NH1  8  
ATOM   3789 N  NH2  . ARG A 1 23 ? -0.977  -24.986 3.014  1.00 0.00 ? 124 ARG A NH2  8  
ATOM   3790 H  H    . ARG A 1 23 ? -0.868  -18.828 3.870  1.00 0.00 ? 124 ARG A H    8  
ATOM   3791 H  HA   . ARG A 1 23 ? -2.674  -20.626 4.599  1.00 0.00 ? 124 ARG A HA   8  
ATOM   3792 H  HB2  . ARG A 1 23 ? -1.208  -22.126 3.664  1.00 0.00 ? 124 ARG A HB2  8  
ATOM   3793 H  HB3  . ARG A 1 23 ? -0.220  -20.714 3.343  1.00 0.00 ? 124 ARG A HB3  8  
ATOM   3794 H  HG2  . ARG A 1 23 ? 0.917   -21.046 5.577  1.00 0.00 ? 124 ARG A HG2  8  
ATOM   3795 H  HG3  . ARG A 1 23 ? -0.022  -22.507 5.810  1.00 0.00 ? 124 ARG A HG3  8  
ATOM   3796 H  HD2  . ARG A 1 23 ? 2.159   -21.974 3.770  1.00 0.00 ? 124 ARG A HD2  8  
ATOM   3797 H  HD3  . ARG A 1 23 ? 2.034   -23.298 4.911  1.00 0.00 ? 124 ARG A HD3  8  
ATOM   3798 H  HE   . ARG A 1 23 ? 0.698   -23.102 2.296  1.00 0.00 ? 124 ARG A HE   8  
ATOM   3799 H  HH11 . ARG A 1 23 ? 1.691   -26.114 3.654  1.00 0.00 ? 124 ARG A HH11 8  
ATOM   3800 H  HH12 . ARG A 1 23 ? 0.773   -25.785 5.085  1.00 0.00 ? 124 ARG A HH12 8  
ATOM   3801 H  HH21 . ARG A 1 23 ? -1.347  -24.520 2.208  1.00 0.00 ? 124 ARG A HH21 8  
ATOM   3802 H  HH22 . ARG A 1 23 ? -1.526  -25.671 3.491  1.00 0.00 ? 124 ARG A HH22 8  
ATOM   3803 N  N    . SER A 1 24 ? -0.523  -20.071 7.029  1.00 0.00 ? 125 SER A N    8  
ATOM   3804 C  CA   . SER A 1 24 ? -0.260  -20.254 8.446  1.00 0.00 ? 125 SER A CA   8  
ATOM   3805 C  C    . SER A 1 24 ? -1.519  -19.941 9.257  1.00 0.00 ? 125 SER A C    8  
ATOM   3806 O  O    . SER A 1 24 ? -1.827  -20.635 10.225 1.00 0.00 ? 125 SER A O    8  
ATOM   3807 C  CB   . SER A 1 24 ? 0.902   -19.372 8.909  1.00 0.00 ? 125 SER A CB   8  
ATOM   3808 O  OG   . SER A 1 24 ? 0.487   -18.034 9.167  1.00 0.00 ? 125 SER A OG   8  
ATOM   3809 H  H    . SER A 1 24 ? 0.078   -19.418 6.568  1.00 0.00 ? 125 SER A H    8  
ATOM   3810 H  HA   . SER A 1 24 ? 0.015   -21.303 8.555  1.00 0.00 ? 125 SER A HA   8  
ATOM   3811 H  HB2  . SER A 1 24 ? 1.342   -19.796 9.811  1.00 0.00 ? 125 SER A HB2  8  
ATOM   3812 H  HB3  . SER A 1 24 ? 1.682   -19.369 8.146  1.00 0.00 ? 125 SER A HB3  8  
ATOM   3813 H  HG   . SER A 1 24 ? -0.208  -17.757 8.505  1.00 0.00 ? 125 SER A HG   8  
ATOM   3814 N  N    . HIS A 1 25 ? -2.213  -18.895 8.832  1.00 0.00 ? 126 HIS A N    8  
ATOM   3815 C  CA   . HIS A 1 25 ? -3.432  -18.482 9.507  1.00 0.00 ? 126 HIS A CA   8  
ATOM   3816 C  C    . HIS A 1 25 ? -4.427  -19.644 9.528  1.00 0.00 ? 126 HIS A C    8  
ATOM   3817 O  O    . HIS A 1 25 ? -5.039  -19.925 10.557 1.00 0.00 ? 126 HIS A O    8  
ATOM   3818 C  CB   . HIS A 1 25 ? -4.008  -17.219 8.863  1.00 0.00 ? 126 HIS A CB   8  
ATOM   3819 C  CG   . HIS A 1 25 ? -3.327  -15.942 9.297  1.00 0.00 ? 126 HIS A CG   8  
ATOM   3820 N  ND1  . HIS A 1 25 ? -3.067  -15.645 10.623 1.00 0.00 ? 126 HIS A ND1  8  
ATOM   3821 C  CD2  . HIS A 1 25 ? -2.854  -14.892 8.567  1.00 0.00 ? 126 HIS A CD2  8  
ATOM   3822 C  CE1  . HIS A 1 25 ? -2.466  -14.466 10.677 1.00 0.00 ? 126 HIS A CE1  8  
ATOM   3823 N  NE2  . HIS A 1 25 ? -2.336  -14.000 9.402  1.00 0.00 ? 126 HIS A NE2  8  
ATOM   3824 H  H    . HIS A 1 25 ? -1.955  -18.336 8.045  1.00 0.00 ? 126 HIS A H    8  
ATOM   3825 H  HA   . HIS A 1 25 ? -3.153  -18.235 10.531 1.00 0.00 ? 126 HIS A HA   8  
ATOM   3826 H  HB2  . HIS A 1 25 ? -3.931  -17.309 7.779  1.00 0.00 ? 126 HIS A HB2  8  
ATOM   3827 H  HB3  . HIS A 1 25 ? -5.068  -17.152 9.104  1.00 0.00 ? 126 HIS A HB3  8  
ATOM   3828 H  HD1  . HIS A 1 25 ? -3.295  -16.222 11.408 1.00 0.00 ? 126 HIS A HD1  8  
ATOM   3829 H  HD2  . HIS A 1 25 ? -2.896  -14.800 7.481  1.00 0.00 ? 126 HIS A HD2  8  
ATOM   3830 H  HE1  . HIS A 1 25 ? -2.135  -13.956 11.582 1.00 0.00 ? 126 HIS A HE1  8  
ATOM   3831 N  N    . THR A 1 26 ? -4.557  -20.288 8.377  1.00 0.00 ? 127 THR A N    8  
ATOM   3832 C  CA   . THR A 1 26 ? -5.468  -21.414 8.250  1.00 0.00 ? 127 THR A CA   8  
ATOM   3833 C  C    . THR A 1 26 ? -5.543  -22.191 9.566  1.00 0.00 ? 127 THR A C    8  
ATOM   3834 O  O    . THR A 1 26 ? -6.631  -22.532 10.028 1.00 0.00 ? 127 THR A O    8  
ATOM   3835 C  CB   . THR A 1 26 ? -5.004  -22.266 7.067  1.00 0.00 ? 127 THR A CB   8  
ATOM   3836 O  OG1  . THR A 1 26 ? -4.439  -21.323 6.160  1.00 0.00 ? 127 THR A OG1  8  
ATOM   3837 C  CG2  . THR A 1 26 ? -6.172  -22.876 6.291  1.00 0.00 ? 127 THR A CG2  8  
ATOM   3838 H  H    . THR A 1 26 ? -4.056  -20.054 7.544  1.00 0.00 ? 127 THR A H    8  
ATOM   3839 H  HA   . THR A 1 26 ? -6.467  -21.026 8.049  1.00 0.00 ? 127 THR A HA   8  
ATOM   3840 H  HB   . THR A 1 26 ? -4.308  -23.038 7.393  1.00 0.00 ? 127 THR A HB   8  
ATOM   3841 H  HG1  . THR A 1 26 ? -3.461  -21.501 6.045  1.00 0.00 ? 127 THR A HG1  8  
ATOM   3842 H  HG21 . THR A 1 26 ? -5.867  -23.060 5.260  1.00 0.00 ? 127 THR A HG21 8  
ATOM   3843 H  HG22 . THR A 1 26 ? -6.467  -23.817 6.756  1.00 0.00 ? 127 THR A HG22 8  
ATOM   3844 H  HG23 . THR A 1 26 ? -7.016  -22.186 6.302  1.00 0.00 ? 127 THR A HG23 8  
ATOM   3845 N  N    . ASN A 1 27 ? -4.373  -22.447 10.133 1.00 0.00 ? 128 ASN A N    8  
ATOM   3846 C  CA   . ASN A 1 27 ? -4.293  -23.177 11.386 1.00 0.00 ? 128 ASN A CA   8  
ATOM   3847 C  C    . ASN A 1 27 ? -3.559  -22.323 12.422 1.00 0.00 ? 128 ASN A C    8  
ATOM   3848 O  O    . ASN A 1 27 ? -3.169  -21.192 12.136 1.00 0.00 ? 128 ASN A O    8  
ATOM   3849 C  CB   . ASN A 1 27 ? -3.516  -24.484 11.213 1.00 0.00 ? 128 ASN A CB   8  
ATOM   3850 C  CG   . ASN A 1 27 ? -2.091  -24.214 10.726 1.00 0.00 ? 128 ASN A CG   8  
ATOM   3851 O  OD1  . ASN A 1 27 ? -1.637  -23.084 10.649 1.00 0.00 ? 128 ASN A OD1  8  
ATOM   3852 N  ND2  . ASN A 1 27 ? -1.413  -25.312 10.403 1.00 0.00 ? 128 ASN A ND2  8  
ATOM   3853 H  H    . ASN A 1 27 ? -3.493  -22.166 9.750  1.00 0.00 ? 128 ASN A H    8  
ATOM   3854 H  HA   . ASN A 1 27 ? -5.327  -23.377 11.668 1.00 0.00 ? 128 ASN A HA   8  
ATOM   3855 H  HB2  . ASN A 1 27 ? -3.485  -25.020 12.162 1.00 0.00 ? 128 ASN A HB2  8  
ATOM   3856 H  HB3  . ASN A 1 27 ? -4.032  -25.127 10.501 1.00 0.00 ? 128 ASN A HB3  8  
ATOM   3857 H  HD21 . ASN A 1 27 ? -1.900  -26.124 10.083 1.00 0.00 ? 128 ASN A HD21 8  
ATOM   3858 H  HD22 . ASN A 1 27 ? -0.416  -25.324 10.480 1.00 0.00 ? 128 ASN A HD22 8  
ATOM   3859 N  N    . GLU A 1 28 ? -3.392  -22.899 13.604 1.00 0.00 ? 129 GLU A N    8  
ATOM   3860 C  CA   . GLU A 1 28 ? -2.712  -22.204 14.684 1.00 0.00 ? 129 GLU A CA   8  
ATOM   3861 C  C    . GLU A 1 28 ? -1.238  -22.612 14.733 1.00 0.00 ? 129 GLU A C    8  
ATOM   3862 O  O    . GLU A 1 28 ? -0.629  -22.627 15.801 1.00 0.00 ? 129 GLU A O    8  
ATOM   3863 C  CB   . GLU A 1 28 ? -3.398  -22.470 16.026 1.00 0.00 ? 129 GLU A CB   8  
ATOM   3864 C  CG   . GLU A 1 28 ? -2.885  -21.513 17.104 1.00 0.00 ? 129 GLU A CG   8  
ATOM   3865 C  CD   . GLU A 1 28 ? -2.854  -20.073 16.590 1.00 0.00 ? 129 GLU A CD   8  
ATOM   3866 O  OE1  . GLU A 1 28 ? -3.919  -19.614 16.124 1.00 0.00 ? 129 GLU A OE1  8  
ATOM   3867 O  OE2  . GLU A 1 28 ? -1.766  -19.463 16.675 1.00 0.00 ? 129 GLU A OE2  8  
ATOM   3868 H  H    . GLU A 1 28 ? -3.713  -23.819 13.828 1.00 0.00 ? 129 GLU A H    8  
ATOM   3869 H  HA   . GLU A 1 28 ? -2.794  -21.144 14.445 1.00 0.00 ? 129 GLU A HA   8  
ATOM   3870 H  HB2  . GLU A 1 28 ? -4.476  -22.353 15.915 1.00 0.00 ? 129 GLU A HB2  8  
ATOM   3871 H  HB3  . GLU A 1 28 ? -3.219  -23.500 16.332 1.00 0.00 ? 129 GLU A HB3  8  
ATOM   3872 H  HG2  . GLU A 1 28 ? -3.523  -21.576 17.985 1.00 0.00 ? 129 GLU A HG2  8  
ATOM   3873 H  HG3  . GLU A 1 28 ? -1.884  -21.814 17.413 1.00 0.00 ? 129 GLU A HG3  8  
ATOM   3874 N  N    . LYS A 1 29 ? -0.708  -22.937 13.562 1.00 0.00 ? 130 LYS A N    8  
ATOM   3875 C  CA   . LYS A 1 29 ? 0.682   -23.344 13.458 1.00 0.00 ? 130 LYS A CA   8  
ATOM   3876 C  C    . LYS A 1 29 ? 1.044   -23.534 11.983 1.00 0.00 ? 130 LYS A C    8  
ATOM   3877 O  O    . LYS A 1 29 ? 1.218   -22.559 11.253 1.00 0.00 ? 130 LYS A O    8  
ATOM   3878 C  CB   . LYS A 1 29 ? 0.944   -24.582 14.319 1.00 0.00 ? 130 LYS A CB   8  
ATOM   3879 C  CG   . LYS A 1 29 ? 0.493   -25.855 13.600 1.00 0.00 ? 130 LYS A CG   8  
ATOM   3880 C  CD   . LYS A 1 29 ? -1.033  -25.928 13.522 1.00 0.00 ? 130 LYS A CD   8  
ATOM   3881 C  CE   . LYS A 1 29 ? -1.487  -27.243 12.884 1.00 0.00 ? 130 LYS A CE   8  
ATOM   3882 N  NZ   . LYS A 1 29 ? -2.643  -27.804 13.620 1.00 0.00 ? 130 LYS A NZ   8  
ATOM   3883 H  H    . LYS A 1 29 ? -1.211  -22.922 12.698 1.00 0.00 ? 130 LYS A H    8  
ATOM   3884 H  HA   . LYS A 1 29 ? 1.292   -22.536 13.862 1.00 0.00 ? 130 LYS A HA   8  
ATOM   3885 H  HB2  . LYS A 1 29 ? 2.006   -24.649 14.553 1.00 0.00 ? 130 LYS A HB2  8  
ATOM   3886 H  HB3  . LYS A 1 29 ? 0.414   -24.487 15.267 1.00 0.00 ? 130 LYS A HB3  8  
ATOM   3887 H  HG2  . LYS A 1 29 ? 0.913   -25.878 12.595 1.00 0.00 ? 130 LYS A HG2  8  
ATOM   3888 H  HG3  . LYS A 1 29 ? 0.876   -26.729 14.127 1.00 0.00 ? 130 LYS A HG3  8  
ATOM   3889 H  HD2  . LYS A 1 29 ? -1.457  -25.840 14.522 1.00 0.00 ? 130 LYS A HD2  8  
ATOM   3890 H  HD3  . LYS A 1 29 ? -1.412  -25.088 12.939 1.00 0.00 ? 130 LYS A HD3  8  
ATOM   3891 H  HE2  . LYS A 1 29 ? -1.758  -27.075 11.843 1.00 0.00 ? 130 LYS A HE2  8  
ATOM   3892 H  HE3  . LYS A 1 29 ? -0.664  -27.959 12.888 1.00 0.00 ? 130 LYS A HE3  8  
ATOM   3893 H  HZ1  . LYS A 1 29 ? -2.927  -27.163 14.333 1.00 0.00 ? 130 LYS A HZ1  8  
ATOM   3894 H  HZ2  . LYS A 1 29 ? -3.402  -27.953 12.984 1.00 0.00 ? 130 LYS A HZ2  8  
ATOM   3895 H  HZ3  . LYS A 1 29 ? -2.383  -28.674 14.036 1.00 0.00 ? 130 LYS A HZ3  8  
HETATM 3896 ZN ZN   . ZN  B 2 .  ? -1.517  -12.231 8.871  1.00 0.00 ? 1   ZN  A ZN   8  
ATOM   3897 N  N    . ARG A 1 1  ? -1.505  -1.988  -3.375 1.00 0.00 ? 102 ARG A N    9  
ATOM   3898 C  CA   . ARG A 1 1  ? -0.334  -1.962  -4.235 1.00 0.00 ? 102 ARG A CA   9  
ATOM   3899 C  C    . ARG A 1 1  ? 0.844   -2.659  -3.551 1.00 0.00 ? 102 ARG A C    9  
ATOM   3900 O  O    . ARG A 1 1  ? 1.869   -2.917  -4.180 1.00 0.00 ? 102 ARG A O    9  
ATOM   3901 C  CB   . ARG A 1 1  ? 0.063   -0.526  -4.582 1.00 0.00 ? 102 ARG A CB   9  
ATOM   3902 C  CG   . ARG A 1 1  ? -1.137  0.262   -5.109 1.00 0.00 ? 102 ARG A CG   9  
ATOM   3903 C  CD   . ARG A 1 1  ? -0.992  1.753   -4.799 1.00 0.00 ? 102 ARG A CD   9  
ATOM   3904 N  NE   . ARG A 1 1  ? 0.234   2.287   -5.435 1.00 0.00 ? 102 ARG A NE   9  
ATOM   3905 C  CZ   . ARG A 1 1  ? 0.891   3.371   -5.004 1.00 0.00 ? 102 ARG A CZ   9  
ATOM   3906 N  NH1  . ARG A 1 1  ? 1.854   3.249   -4.081 1.00 0.00 ? 102 ARG A NH1  9  
ATOM   3907 N  NH2  . ARG A 1 1  ? 0.587   4.579   -5.499 1.00 0.00 ? 102 ARG A NH2  9  
ATOM   3908 H  H    . ARG A 1 1  ? -1.763  -1.104  -2.987 1.00 0.00 ? 102 ARG A H    9  
ATOM   3909 H  HA   . ARG A 1 1  ? -0.637  -2.498  -5.135 1.00 0.00 ? 102 ARG A HA   9  
ATOM   3910 H  HB2  . ARG A 1 1  ? 0.467   -0.033  -3.698 1.00 0.00 ? 102 ARG A HB2  9  
ATOM   3911 H  HB3  . ARG A 1 1  ? 0.855   -0.534  -5.331 1.00 0.00 ? 102 ARG A HB3  9  
ATOM   3912 H  HG2  . ARG A 1 1  ? -1.227  0.119   -6.187 1.00 0.00 ? 102 ARG A HG2  9  
ATOM   3913 H  HG3  . ARG A 1 1  ? -2.054  -0.119  -4.659 1.00 0.00 ? 102 ARG A HG3  9  
ATOM   3914 H  HD2  . ARG A 1 1  ? -1.866  2.296   -5.163 1.00 0.00 ? 102 ARG A HD2  9  
ATOM   3915 H  HD3  . ARG A 1 1  ? -0.949  1.907   -3.720 1.00 0.00 ? 102 ARG A HD3  9  
ATOM   3916 H  HE   . ARG A 1 1  ? 0.593   1.807   -6.234 1.00 0.00 ? 102 ARG A HE   9  
ATOM   3917 H  HH11 . ARG A 1 1  ? 1.663   2.781   -3.219 1.00 0.00 ? 102 ARG A HH11 9  
ATOM   3918 H  HH12 . ARG A 1 1  ? 2.764   3.627   -4.254 1.00 0.00 ? 102 ARG A HH12 9  
ATOM   3919 H  HH21 . ARG A 1 1  ? -0.370  4.838   -5.632 1.00 0.00 ? 102 ARG A HH21 9  
ATOM   3920 H  HH22 . ARG A 1 1  ? 1.316   5.222   -5.735 1.00 0.00 ? 102 ARG A HH22 9  
ATOM   3921 N  N    . SER A 1 2  ? 0.658   -2.942  -2.270 1.00 0.00 ? 103 SER A N    9  
ATOM   3922 C  CA   . SER A 1 2  ? 1.693   -3.603  -1.492 1.00 0.00 ? 103 SER A CA   9  
ATOM   3923 C  C    . SER A 1 2  ? 1.169   -4.935  -0.950 1.00 0.00 ? 103 SER A C    9  
ATOM   3924 O  O    . SER A 1 2  ? -0.036  -5.181  -0.955 1.00 0.00 ? 103 SER A O    9  
ATOM   3925 C  CB   . SER A 1 2  ? 2.170   -2.714  -0.343 1.00 0.00 ? 103 SER A CB   9  
ATOM   3926 O  OG   . SER A 1 2  ? 3.409   -2.075  -0.642 1.00 0.00 ? 103 SER A OG   9  
ATOM   3927 H  H    . SER A 1 2  ? -0.178  -2.729  -1.765 1.00 0.00 ? 103 SER A H    9  
ATOM   3928 H  HA   . SER A 1 2  ? 2.514   -3.770  -2.188 1.00 0.00 ? 103 SER A HA   9  
ATOM   3929 H  HB2  . SER A 1 2  ? 1.414   -1.958  -0.131 1.00 0.00 ? 103 SER A HB2  9  
ATOM   3930 H  HB3  . SER A 1 2  ? 2.281   -3.315  0.560  1.00 0.00 ? 103 SER A HB3  9  
ATOM   3931 H  HG   . SER A 1 2  ? 3.918   -1.904  0.202  1.00 0.00 ? 103 SER A HG   9  
ATOM   3932 N  N    . PHE A 1 3  ? 2.102   -5.761  -0.496 1.00 0.00 ? 104 PHE A N    9  
ATOM   3933 C  CA   . PHE A 1 3  ? 1.749   -7.061  0.048  1.00 0.00 ? 104 PHE A CA   9  
ATOM   3934 C  C    . PHE A 1 3  ? 1.446   -6.965  1.544  1.00 0.00 ? 104 PHE A C    9  
ATOM   3935 O  O    . PHE A 1 3  ? 2.350   -6.759  2.353  1.00 0.00 ? 104 PHE A O    9  
ATOM   3936 C  CB   . PHE A 1 3  ? 2.958   -7.974  -0.158 1.00 0.00 ? 104 PHE A CB   9  
ATOM   3937 C  CG   . PHE A 1 3  ? 3.575   -7.886  -1.556 1.00 0.00 ? 104 PHE A CG   9  
ATOM   3938 C  CD1  . PHE A 1 3  ? 2.832   -8.210  -2.648 1.00 0.00 ? 104 PHE A CD1  9  
ATOM   3939 C  CD2  . PHE A 1 3  ? 4.865   -7.483  -1.707 1.00 0.00 ? 104 PHE A CD2  9  
ATOM   3940 C  CE1  . PHE A 1 3  ? 3.404   -8.128  -3.945 1.00 0.00 ? 104 PHE A CE1  9  
ATOM   3941 C  CE2  . PHE A 1 3  ? 5.437   -7.401  -3.003 1.00 0.00 ? 104 PHE A CE2  9  
ATOM   3942 C  CZ   . PHE A 1 3  ? 4.694   -7.725  -4.096 1.00 0.00 ? 104 PHE A CZ   9  
ATOM   3943 H  H    . PHE A 1 3  ? 3.079   -5.552  -0.495 1.00 0.00 ? 104 PHE A H    9  
ATOM   3944 H  HA   . PHE A 1 3  ? 0.859   -7.402  -0.480 1.00 0.00 ? 104 PHE A HA   9  
ATOM   3945 H  HB2  . PHE A 1 3  ? 3.720   -7.723  0.580  1.00 0.00 ? 104 PHE A HB2  9  
ATOM   3946 H  HB3  . PHE A 1 3  ? 2.659   -9.005  0.032  1.00 0.00 ? 104 PHE A HB3  9  
ATOM   3947 H  HD1  . PHE A 1 3  ? 1.798   -8.533  -2.528 1.00 0.00 ? 104 PHE A HD1  9  
ATOM   3948 H  HD2  . PHE A 1 3  ? 5.461   -7.223  -0.831 1.00 0.00 ? 104 PHE A HD2  9  
ATOM   3949 H  HE1  . PHE A 1 3  ? 2.808   -8.388  -4.821 1.00 0.00 ? 104 PHE A HE1  9  
ATOM   3950 H  HE2  . PHE A 1 3  ? 6.471   -7.078  -3.124 1.00 0.00 ? 104 PHE A HE2  9  
ATOM   3951 H  HZ   . PHE A 1 3  ? 5.132   -7.661  -5.092 1.00 0.00 ? 104 PHE A HZ   9  
ATOM   3952 N  N    . VAL A 1 4  ? 0.170   -7.119  1.868  1.00 0.00 ? 105 VAL A N    9  
ATOM   3953 C  CA   . VAL A 1 4  ? -0.263  -7.053  3.253  1.00 0.00 ? 105 VAL A CA   9  
ATOM   3954 C  C    . VAL A 1 4  ? -1.192  -8.231  3.549  1.00 0.00 ? 105 VAL A C    9  
ATOM   3955 O  O    . VAL A 1 4  ? -1.892  -8.714  2.660  1.00 0.00 ? 105 VAL A O    9  
ATOM   3956 C  CB   . VAL A 1 4  ? -0.911  -5.695  3.535  1.00 0.00 ? 105 VAL A CB   9  
ATOM   3957 C  CG1  . VAL A 1 4  ? -1.500  -5.652  4.946  1.00 0.00 ? 105 VAL A CG1  9  
ATOM   3958 C  CG2  . VAL A 1 4  ? 0.089   -4.557  3.322  1.00 0.00 ? 105 VAL A CG2  9  
ATOM   3959 H  H    . VAL A 1 4  ? -0.559  -7.285  1.205  1.00 0.00 ? 105 VAL A H    9  
ATOM   3960 H  HA   . VAL A 1 4  ? 0.624   -7.139  3.881  1.00 0.00 ? 105 VAL A HA   9  
ATOM   3961 H  HB   . VAL A 1 4  ? -1.728  -5.560  2.826  1.00 0.00 ? 105 VAL A HB   9  
ATOM   3962 H  HG11 . VAL A 1 4  ? -2.538  -5.985  4.916  1.00 0.00 ? 105 VAL A HG11 9  
ATOM   3963 H  HG12 . VAL A 1 4  ? -0.927  -6.306  5.600  1.00 0.00 ? 105 VAL A HG12 9  
ATOM   3964 H  HG13 . VAL A 1 4  ? -1.458  -4.630  5.325  1.00 0.00 ? 105 VAL A HG13 9  
ATOM   3965 H  HG21 . VAL A 1 4  ? 0.507   -4.623  2.318  1.00 0.00 ? 105 VAL A HG21 9  
ATOM   3966 H  HG22 . VAL A 1 4  ? -0.420  -3.600  3.442  1.00 0.00 ? 105 VAL A HG22 9  
ATOM   3967 H  HG23 . VAL A 1 4  ? 0.890   -4.635  4.056  1.00 0.00 ? 105 VAL A HG23 9  
ATOM   3968 N  N    . CYS A 1 5  ? -1.171  -8.661  4.804  1.00 0.00 ? 106 CYS A N    9  
ATOM   3969 C  CA   . CYS A 1 5  ? -2.002  -9.773  5.228  1.00 0.00 ? 106 CYS A CA   9  
ATOM   3970 C  C    . CYS A 1 5  ? -3.258  -9.208  5.895  1.00 0.00 ? 106 CYS A C    9  
ATOM   3971 O  O    . CYS A 1 5  ? -3.228  -8.838  7.068  1.00 0.00 ? 106 CYS A O    9  
ATOM   3972 C  CB   . CYS A 1 5  ? -1.244  -10.727 6.153  1.00 0.00 ? 106 CYS A CB   9  
ATOM   3973 S  SG   . CYS A 1 5  ? -2.350  -12.076 6.705  1.00 0.00 ? 106 CYS A SG   9  
ATOM   3974 H  H    . CYS A 1 5  ? -0.599  -8.262  5.521  1.00 0.00 ? 106 CYS A H    9  
ATOM   3975 H  HA   . CYS A 1 5  ? -2.261  -10.332 4.328  1.00 0.00 ? 106 CYS A HA   9  
ATOM   3976 H  HB2  . CYS A 1 5  ? -0.381  -11.143 5.633  1.00 0.00 ? 106 CYS A HB2  9  
ATOM   3977 H  HB3  . CYS A 1 5  ? -0.862  -10.181 7.016  1.00 0.00 ? 106 CYS A HB3  9  
ATOM   3978 N  N    . GLU A 1 6  ? -4.331  -9.158  5.119  1.00 0.00 ? 107 GLU A N    9  
ATOM   3979 C  CA   . GLU A 1 6  ? -5.594  -8.644  5.622  1.00 0.00 ? 107 GLU A CA   9  
ATOM   3980 C  C    . GLU A 1 6  ? -5.977  -9.354  6.921  1.00 0.00 ? 107 GLU A C    9  
ATOM   3981 O  O    . GLU A 1 6  ? -6.806  -8.858  7.683  1.00 0.00 ? 107 GLU A O    9  
ATOM   3982 C  CB   . GLU A 1 6  ? -6.698  -8.786  4.573  1.00 0.00 ? 107 GLU A CB   9  
ATOM   3983 C  CG   . GLU A 1 6  ? -6.451  -7.853  3.386  1.00 0.00 ? 107 GLU A CG   9  
ATOM   3984 C  CD   . GLU A 1 6  ? -6.673  -6.391  3.781  1.00 0.00 ? 107 GLU A CD   9  
ATOM   3985 O  OE1  . GLU A 1 6  ? -7.833  -6.062  4.109  1.00 0.00 ? 107 GLU A OE1  9  
ATOM   3986 O  OE2  . GLU A 1 6  ? -5.677  -5.637  3.749  1.00 0.00 ? 107 GLU A OE2  9  
ATOM   3987 H  H    . GLU A 1 6  ? -4.347  -9.462  4.167  1.00 0.00 ? 107 GLU A H    9  
ATOM   3988 H  HA   . GLU A 1 6  ? -5.419  -7.586  5.816  1.00 0.00 ? 107 GLU A HA   9  
ATOM   3989 H  HB2  . GLU A 1 6  ? -6.745  -9.818  4.226  1.00 0.00 ? 107 GLU A HB2  9  
ATOM   3990 H  HB3  . GLU A 1 6  ? -7.664  -8.558  5.025  1.00 0.00 ? 107 GLU A HB3  9  
ATOM   3991 H  HG2  . GLU A 1 6  ? -5.433  -7.984  3.022  1.00 0.00 ? 107 GLU A HG2  9  
ATOM   3992 H  HG3  . GLU A 1 6  ? -7.121  -8.117  2.567  1.00 0.00 ? 107 GLU A HG3  9  
ATOM   3993 N  N    . VAL A 1 7  ? -5.355  -10.504 7.136  1.00 0.00 ? 108 VAL A N    9  
ATOM   3994 C  CA   . VAL A 1 7  ? -5.621  -11.287 8.331  1.00 0.00 ? 108 VAL A CA   9  
ATOM   3995 C  C    . VAL A 1 7  ? -5.118  -10.523 9.558  1.00 0.00 ? 108 VAL A C    9  
ATOM   3996 O  O    . VAL A 1 7  ? -5.914  -9.993  10.332 1.00 0.00 ? 108 VAL A O    9  
ATOM   3997 C  CB   . VAL A 1 7  ? -4.996  -12.677 8.196  1.00 0.00 ? 108 VAL A CB   9  
ATOM   3998 C  CG1  . VAL A 1 7  ? -5.058  -13.438 9.522  1.00 0.00 ? 108 VAL A CG1  9  
ATOM   3999 C  CG2  . VAL A 1 7  ? -5.667  -13.473 7.074  1.00 0.00 ? 108 VAL A CG2  9  
ATOM   4000 H  H    . VAL A 1 7  ? -4.682  -10.900 6.512  1.00 0.00 ? 108 VAL A H    9  
ATOM   4001 H  HA   . VAL A 1 7  ? -6.700  -11.408 8.411  1.00 0.00 ? 108 VAL A HA   9  
ATOM   4002 H  HB   . VAL A 1 7  ? -3.945  -12.548 7.932  1.00 0.00 ? 108 VAL A HB   9  
ATOM   4003 H  HG11 . VAL A 1 7  ? -4.200  -13.163 10.138 1.00 0.00 ? 108 VAL A HG11 9  
ATOM   4004 H  HG12 . VAL A 1 7  ? -5.979  -13.181 10.045 1.00 0.00 ? 108 VAL A HG12 9  
ATOM   4005 H  HG13 . VAL A 1 7  ? -5.037  -14.510 9.326  1.00 0.00 ? 108 VAL A HG13 9  
ATOM   4006 H  HG21 . VAL A 1 7  ? -5.105  -13.343 6.150  1.00 0.00 ? 108 VAL A HG21 9  
ATOM   4007 H  HG22 . VAL A 1 7  ? -5.688  -14.530 7.342  1.00 0.00 ? 108 VAL A HG22 9  
ATOM   4008 H  HG23 . VAL A 1 7  ? -6.686  -13.114 6.934  1.00 0.00 ? 108 VAL A HG23 9  
ATOM   4009 N  N    . CYS A 1 8  ? -3.801  -10.492 9.698  1.00 0.00 ? 109 CYS A N    9  
ATOM   4010 C  CA   . CYS A 1 8  ? -3.184  -9.801  10.817 1.00 0.00 ? 109 CYS A CA   9  
ATOM   4011 C  C    . CYS A 1 8  ? -2.801  -8.393  10.361 1.00 0.00 ? 109 CYS A C    9  
ATOM   4012 O  O    . CYS A 1 8  ? -2.674  -7.484  11.181 1.00 0.00 ? 109 CYS A O    9  
ATOM   4013 C  CB   . CYS A 1 8  ? -1.980  -10.573 11.363 1.00 0.00 ? 109 CYS A CB   9  
ATOM   4014 S  SG   . CYS A 1 8  ? -0.622  -10.560 10.137 1.00 0.00 ? 109 CYS A SG   9  
ATOM   4015 H  H    . CYS A 1 8  ? -3.161  -10.926 9.064  1.00 0.00 ? 109 CYS A H    9  
ATOM   4016 H  HA   . CYS A 1 8  ? -3.930  -9.762  11.611 1.00 0.00 ? 109 CYS A HA   9  
ATOM   4017 H  HB2  . CYS A 1 8  ? -1.642  -10.123 12.297 1.00 0.00 ? 109 CYS A HB2  9  
ATOM   4018 H  HB3  . CYS A 1 8  ? -2.267  -11.599 11.590 1.00 0.00 ? 109 CYS A HB3  9  
ATOM   4019 N  N    . THR A 1 9  ? -2.624  -8.255  9.055  1.00 0.00 ? 110 THR A N    9  
ATOM   4020 C  CA   . THR A 1 9  ? -2.258  -6.973  8.481  1.00 0.00 ? 110 THR A CA   9  
ATOM   4021 C  C    . THR A 1 9  ? -0.738  -6.862  8.348  1.00 0.00 ? 110 THR A C    9  
ATOM   4022 O  O    . THR A 1 9  ? -0.194  -5.761  8.284  1.00 0.00 ? 110 THR A O    9  
ATOM   4023 C  CB   . THR A 1 9  ? -2.873  -5.873  9.348  1.00 0.00 ? 110 THR A CB   9  
ATOM   4024 O  OG1  . THR A 1 9  ? -2.108  -5.908  10.550 1.00 0.00 ? 110 THR A OG1  9  
ATOM   4025 C  CG2  . THR A 1 9  ? -4.295  -6.211  9.800  1.00 0.00 ? 110 THR A CG2  9  
ATOM   4026 H  H    . THR A 1 9  ? -2.729  -9.000  8.396  1.00 0.00 ? 110 THR A H    9  
ATOM   4027 H  HA   . THR A 1 9  ? -2.671  -6.916  7.474  1.00 0.00 ? 110 THR A HA   9  
ATOM   4028 H  HB   . THR A 1 9  ? -2.846  -4.911  8.834  1.00 0.00 ? 110 THR A HB   9  
ATOM   4029 H  HG1  . THR A 1 9  ? -1.417  -5.187  10.537 1.00 0.00 ? 110 THR A HG1  9  
ATOM   4030 H  HG21 . THR A 1 9  ? -4.351  -6.165  10.889 1.00 0.00 ? 110 THR A HG21 9  
ATOM   4031 H  HG22 . THR A 1 9  ? -4.994  -5.493  9.371  1.00 0.00 ? 110 THR A HG22 9  
ATOM   4032 H  HG23 . THR A 1 9  ? -4.554  -7.214  9.466  1.00 0.00 ? 110 THR A HG23 9  
ATOM   4033 N  N    . ARG A 1 10 ? -0.094  -8.020  8.310  1.00 0.00 ? 111 ARG A N    9  
ATOM   4034 C  CA   . ARG A 1 10 ? 1.353   -8.067  8.186  1.00 0.00 ? 111 ARG A CA   9  
ATOM   4035 C  C    . ARG A 1 10 ? 1.770   -7.816  6.735  1.00 0.00 ? 111 ARG A C    9  
ATOM   4036 O  O    . ARG A 1 10 ? 1.256   -8.454  5.819  1.00 0.00 ? 111 ARG A O    9  
ATOM   4037 C  CB   . ARG A 1 10 ? 1.901   -9.422  8.638  1.00 0.00 ? 111 ARG A CB   9  
ATOM   4038 C  CG   . ARG A 1 10 ? 2.359   -9.369  10.098 1.00 0.00 ? 111 ARG A CG   9  
ATOM   4039 C  CD   . ARG A 1 10 ? 3.847   -9.702  10.217 1.00 0.00 ? 111 ARG A CD   9  
ATOM   4040 N  NE   . ARG A 1 10 ? 4.559   -8.602  10.906 1.00 0.00 ? 111 ARG A NE   9  
ATOM   4041 C  CZ   . ARG A 1 10 ? 5.875   -8.601  11.161 1.00 0.00 ? 111 ARG A CZ   9  
ATOM   4042 N  NH1  . ARG A 1 10 ? 6.441   -9.655  11.764 1.00 0.00 ? 111 ARG A NH1  9  
ATOM   4043 N  NH2  . ARG A 1 10 ? 6.624   -7.547  10.810 1.00 0.00 ? 111 ARG A NH2  9  
ATOM   4044 H  H    . ARG A 1 10 ? -0.543  -8.912  8.362  1.00 0.00 ? 111 ARG A H    9  
ATOM   4045 H  HA   . ARG A 1 10 ? 1.715   -7.276  8.841  1.00 0.00 ? 111 ARG A HA   9  
ATOM   4046 H  HB2  . ARG A 1 10 ? 1.132   -10.186 8.524  1.00 0.00 ? 111 ARG A HB2  9  
ATOM   4047 H  HB3  . ARG A 1 10 ? 2.736   -9.713  8.002  1.00 0.00 ? 111 ARG A HB3  9  
ATOM   4048 H  HG2  . ARG A 1 10 ? 2.172   -8.376  10.505 1.00 0.00 ? 111 ARG A HG2  9  
ATOM   4049 H  HG3  . ARG A 1 10 ? 1.776   -10.072 10.692 1.00 0.00 ? 111 ARG A HG3  9  
ATOM   4050 H  HD2  . ARG A 1 10 ? 3.977   -10.633 10.771 1.00 0.00 ? 111 ARG A HD2  9  
ATOM   4051 H  HD3  . ARG A 1 10 ? 4.274   -9.858  9.226  1.00 0.00 ? 111 ARG A HD3  9  
ATOM   4052 H  HE   . ARG A 1 10 ? 4.025   -7.810  11.200 1.00 0.00 ? 111 ARG A HE   9  
ATOM   4053 H  HH11 . ARG A 1 10 ? 5.918   -10.497 11.893 1.00 0.00 ? 111 ARG A HH11 9  
ATOM   4054 H  HH12 . ARG A 1 10 ? 7.386   -9.598  12.086 1.00 0.00 ? 111 ARG A HH12 9  
ATOM   4055 H  HH21 . ARG A 1 10 ? 6.268   -6.874  10.161 1.00 0.00 ? 111 ARG A HH21 9  
ATOM   4056 H  HH22 . ARG A 1 10 ? 7.539   -7.433  11.197 1.00 0.00 ? 111 ARG A HH22 9  
ATOM   4057 N  N    . ALA A 1 11 ? 2.698   -6.884  6.573  1.00 0.00 ? 112 ALA A N    9  
ATOM   4058 C  CA   . ALA A 1 11 ? 3.190   -6.540  5.250  1.00 0.00 ? 112 ALA A CA   9  
ATOM   4059 C  C    . ALA A 1 11 ? 4.512   -7.268  4.996  1.00 0.00 ? 112 ALA A C    9  
ATOM   4060 O  O    . ALA A 1 11 ? 5.349   -7.373  5.892  1.00 0.00 ? 112 ALA A O    9  
ATOM   4061 C  CB   . ALA A 1 11 ? 3.331   -5.021  5.136  1.00 0.00 ? 112 ALA A CB   9  
ATOM   4062 H  H    . ALA A 1 11 ? 3.111   -6.370  7.324  1.00 0.00 ? 112 ALA A H    9  
ATOM   4063 H  HA   . ALA A 1 11 ? 2.452   -6.880  4.523  1.00 0.00 ? 112 ALA A HA   9  
ATOM   4064 H  HB1  . ALA A 1 11 ? 2.604   -4.539  5.790  1.00 0.00 ? 112 ALA A HB1  9  
ATOM   4065 H  HB2  . ALA A 1 11 ? 4.337   -4.726  5.432  1.00 0.00 ? 112 ALA A HB2  9  
ATOM   4066 H  HB3  . ALA A 1 11 ? 3.150   -4.716  4.106  1.00 0.00 ? 112 ALA A HB3  9  
ATOM   4067 N  N    . PHE A 1 12 ? 4.658   -7.755  3.773  1.00 0.00 ? 113 PHE A N    9  
ATOM   4068 C  CA   . PHE A 1 12 ? 5.863   -8.470  3.391  1.00 0.00 ? 113 PHE A CA   9  
ATOM   4069 C  C    . PHE A 1 12 ? 6.449   -7.904  2.095  1.00 0.00 ? 113 PHE A C    9  
ATOM   4070 O  O    . PHE A 1 12 ? 5.744   -7.261  1.319  1.00 0.00 ? 113 PHE A O    9  
ATOM   4071 C  CB   . PHE A 1 12 ? 5.463   -9.929  3.160  1.00 0.00 ? 113 PHE A CB   9  
ATOM   4072 C  CG   . PHE A 1 12 ? 5.049   -10.668 4.435  1.00 0.00 ? 113 PHE A CG   9  
ATOM   4073 C  CD1  . PHE A 1 12 ? 6.000   -11.167 5.270  1.00 0.00 ? 113 PHE A CD1  9  
ATOM   4074 C  CD2  . PHE A 1 12 ? 3.731   -10.827 4.731  1.00 0.00 ? 113 PHE A CD2  9  
ATOM   4075 C  CE1  . PHE A 1 12 ? 5.615   -11.854 6.452  1.00 0.00 ? 113 PHE A CE1  9  
ATOM   4076 C  CE2  . PHE A 1 12 ? 3.348   -11.513 5.913  1.00 0.00 ? 113 PHE A CE2  9  
ATOM   4077 C  CZ   . PHE A 1 12 ? 4.297   -12.012 6.749  1.00 0.00 ? 113 PHE A CZ   9  
ATOM   4078 H  H    . PHE A 1 12 ? 3.972   -7.666  3.050  1.00 0.00 ? 113 PHE A H    9  
ATOM   4079 H  HA   . PHE A 1 12 ? 6.583   -8.344  4.199  1.00 0.00 ? 113 PHE A HA   9  
ATOM   4080 H  HB2  . PHE A 1 12 ? 4.638   -9.961  2.449  1.00 0.00 ? 113 PHE A HB2  9  
ATOM   4081 H  HB3  . PHE A 1 12 ? 6.299   -10.456 2.702  1.00 0.00 ? 113 PHE A HB3  9  
ATOM   4082 H  HD1  . PHE A 1 12 ? 7.055   -11.041 5.033  1.00 0.00 ? 113 PHE A HD1  9  
ATOM   4083 H  HD2  . PHE A 1 12 ? 2.970   -10.427 4.061  1.00 0.00 ? 113 PHE A HD2  9  
ATOM   4084 H  HE1  . PHE A 1 12 ? 6.376   -12.254 7.122  1.00 0.00 ? 113 PHE A HE1  9  
ATOM   4085 H  HE2  . PHE A 1 12 ? 2.291   -11.640 6.151  1.00 0.00 ? 113 PHE A HE2  9  
ATOM   4086 H  HZ   . PHE A 1 12 ? 4.002   -12.539 7.657  1.00 0.00 ? 113 PHE A HZ   9  
ATOM   4087 N  N    . ALA A 1 13 ? 7.733   -8.164  1.901  1.00 0.00 ? 114 ALA A N    9  
ATOM   4088 C  CA   . ALA A 1 13 ? 8.422   -7.689  0.714  1.00 0.00 ? 114 ALA A CA   9  
ATOM   4089 C  C    . ALA A 1 13 ? 8.164   -8.657  -0.442 1.00 0.00 ? 114 ALA A C    9  
ATOM   4090 O  O    . ALA A 1 13 ? 7.898   -8.233  -1.566 1.00 0.00 ? 114 ALA A O    9  
ATOM   4091 C  CB   . ALA A 1 13 ? 9.913   -7.527  1.018  1.00 0.00 ? 114 ALA A CB   9  
ATOM   4092 H  H    . ALA A 1 13 ? 8.300   -8.688  2.538  1.00 0.00 ? 114 ALA A H    9  
ATOM   4093 H  HA   . ALA A 1 13 ? 8.009   -6.714  0.458  1.00 0.00 ? 114 ALA A HA   9  
ATOM   4094 H  HB1  . ALA A 1 13 ? 10.487  -7.664  0.102  1.00 0.00 ? 114 ALA A HB1  9  
ATOM   4095 H  HB2  . ALA A 1 13 ? 10.096  -6.530  1.417  1.00 0.00 ? 114 ALA A HB2  9  
ATOM   4096 H  HB3  . ALA A 1 13 ? 10.217  -8.274  1.752  1.00 0.00 ? 114 ALA A HB3  9  
ATOM   4097 N  N    . ARG A 1 14 ? 8.253   -9.942  -0.127 1.00 0.00 ? 115 ARG A N    9  
ATOM   4098 C  CA   . ARG A 1 14 ? 8.033   -10.975 -1.126 1.00 0.00 ? 115 ARG A CA   9  
ATOM   4099 C  C    . ARG A 1 14 ? 6.646   -11.595 -0.948 1.00 0.00 ? 115 ARG A C    9  
ATOM   4100 O  O    . ARG A 1 14 ? 6.304   -12.062 0.137  1.00 0.00 ? 115 ARG A O    9  
ATOM   4101 C  CB   . ARG A 1 14 ? 9.093   -12.073 -1.025 1.00 0.00 ? 115 ARG A CB   9  
ATOM   4102 C  CG   . ARG A 1 14 ? 10.261  -11.628 -0.140 1.00 0.00 ? 115 ARG A CG   9  
ATOM   4103 C  CD   . ARG A 1 14 ? 9.958   -11.884 1.337  1.00 0.00 ? 115 ARG A CD   9  
ATOM   4104 N  NE   . ARG A 1 14 ? 10.750  -13.036 1.824  1.00 0.00 ? 115 ARG A NE   9  
ATOM   4105 C  CZ   . ARG A 1 14 ? 11.028  -14.121 1.088  1.00 0.00 ? 115 ARG A CZ   9  
ATOM   4106 N  NH1  . ARG A 1 14 ? 10.033  -14.874 0.601  1.00 0.00 ? 115 ARG A NH1  9  
ATOM   4107 N  NH2  . ARG A 1 14 ? 12.303  -14.453 0.841  1.00 0.00 ? 115 ARG A NH2  9  
ATOM   4108 H  H    . ARG A 1 14 ? 8.471   -10.279 0.789  1.00 0.00 ? 115 ARG A H    9  
ATOM   4109 H  HA   . ARG A 1 14 ? 8.113   -10.458 -2.082 1.00 0.00 ? 115 ARG A HA   9  
ATOM   4110 H  HB2  . ARG A 1 14 ? 8.646   -12.979 -0.615 1.00 0.00 ? 115 ARG A HB2  9  
ATOM   4111 H  HB3  . ARG A 1 14 ? 9.461   -12.321 -2.021 1.00 0.00 ? 115 ARG A HB3  9  
ATOM   4112 H  HG2  . ARG A 1 14 ? 11.164  -12.165 -0.429 1.00 0.00 ? 115 ARG A HG2  9  
ATOM   4113 H  HG3  . ARG A 1 14 ? 10.457  -10.568 -0.297 1.00 0.00 ? 115 ARG A HG3  9  
ATOM   4114 H  HD2  . ARG A 1 14 ? 10.193  -10.997 1.924  1.00 0.00 ? 115 ARG A HD2  9  
ATOM   4115 H  HD3  . ARG A 1 14 ? 8.894   -12.082 1.470  1.00 0.00 ? 115 ARG A HD3  9  
ATOM   4116 H  HE   . ARG A 1 14 ? 11.098  -13.003 2.760  1.00 0.00 ? 115 ARG A HE   9  
ATOM   4117 H  HH11 . ARG A 1 14 ? 9.449   -15.394 1.223  1.00 0.00 ? 115 ARG A HH11 9  
ATOM   4118 H  HH12 . ARG A 1 14 ? 9.874   -14.916 -0.386 1.00 0.00 ? 115 ARG A HH12 9  
ATOM   4119 H  HH21 . ARG A 1 14 ? 12.995  -13.739 0.740  1.00 0.00 ? 115 ARG A HH21 9  
ATOM   4120 H  HH22 . ARG A 1 14 ? 12.562  -15.415 0.757  1.00 0.00 ? 115 ARG A HH22 9  
ATOM   4121 N  N    . GLN A 1 15 ? 5.885   -11.583 -2.033 1.00 0.00 ? 116 GLN A N    9  
ATOM   4122 C  CA   . GLN A 1 15 ? 4.543   -12.140 -2.011 1.00 0.00 ? 116 GLN A CA   9  
ATOM   4123 C  C    . GLN A 1 15 ? 4.557   -13.535 -1.383 1.00 0.00 ? 116 GLN A C    9  
ATOM   4124 O  O    . GLN A 1 15 ? 3.678   -13.872 -0.591 1.00 0.00 ? 116 GLN A O    9  
ATOM   4125 C  CB   . GLN A 1 15 ? 3.943   -12.178 -3.418 1.00 0.00 ? 116 GLN A CB   9  
ATOM   4126 C  CG   . GLN A 1 15 ? 2.896   -11.076 -3.597 1.00 0.00 ? 116 GLN A CG   9  
ATOM   4127 C  CD   . GLN A 1 15 ? 1.532   -11.669 -3.961 1.00 0.00 ? 116 GLN A CD   9  
ATOM   4128 O  OE1  . GLN A 1 15 ? 0.493   -11.228 -3.500 1.00 0.00 ? 116 GLN A OE1  9  
ATOM   4129 N  NE2  . GLN A 1 15 ? 1.596   -12.691 -4.809 1.00 0.00 ? 116 GLN A NE2  9  
ATOM   4130 H  H    . GLN A 1 15 ? 6.170   -11.202 -2.912 1.00 0.00 ? 116 GLN A H    9  
ATOM   4131 H  HA   . GLN A 1 15 ? 3.957   -11.461 -1.391 1.00 0.00 ? 116 GLN A HA   9  
ATOM   4132 H  HB2  . GLN A 1 15 ? 4.733   -12.057 -4.159 1.00 0.00 ? 116 GLN A HB2  9  
ATOM   4133 H  HB3  . GLN A 1 15 ? 3.485   -13.151 -3.596 1.00 0.00 ? 116 GLN A HB3  9  
ATOM   4134 H  HG2  . GLN A 1 15 ? 2.811   -10.497 -2.678 1.00 0.00 ? 116 GLN A HG2  9  
ATOM   4135 H  HG3  . GLN A 1 15 ? 3.217   -10.388 -4.379 1.00 0.00 ? 116 GLN A HG3  9  
ATOM   4136 H  HE21 . GLN A 1 15 ? 1.802   -13.609 -4.471 1.00 0.00 ? 116 GLN A HE21 9  
ATOM   4137 H  HE22 . GLN A 1 15 ? 1.437   -12.541 -5.785 1.00 0.00 ? 116 GLN A HE22 9  
ATOM   4138 N  N    . GLU A 1 16 ? 5.564   -14.308 -1.761 1.00 0.00 ? 117 GLU A N    9  
ATOM   4139 C  CA   . GLU A 1 16 ? 5.704   -15.660 -1.245 1.00 0.00 ? 117 GLU A CA   9  
ATOM   4140 C  C    . GLU A 1 16 ? 5.650   -15.651 0.284  1.00 0.00 ? 117 GLU A C    9  
ATOM   4141 O  O    . GLU A 1 16 ? 4.991   -16.494 0.890  1.00 0.00 ? 117 GLU A O    9  
ATOM   4142 C  CB   . GLU A 1 16 ? 6.997   -16.306 -1.744 1.00 0.00 ? 117 GLU A CB   9  
ATOM   4143 C  CG   . GLU A 1 16 ? 7.539   -17.309 -0.724 1.00 0.00 ? 117 GLU A CG   9  
ATOM   4144 C  CD   . GLU A 1 16 ? 8.330   -18.422 -1.415 1.00 0.00 ? 117 GLU A CD   9  
ATOM   4145 O  OE1  . GLU A 1 16 ? 7.747   -19.052 -2.323 1.00 0.00 ? 117 GLU A OE1  9  
ATOM   4146 O  OE2  . GLU A 1 16 ? 9.499   -18.616 -1.020 1.00 0.00 ? 117 GLU A OE2  9  
ATOM   4147 H  H    . GLU A 1 16 ? 6.275   -14.027 -2.406 1.00 0.00 ? 117 GLU A H    9  
ATOM   4148 H  HA   . GLU A 1 16 ? 4.852   -16.211 -1.642 1.00 0.00 ? 117 GLU A HA   9  
ATOM   4149 H  HB2  . GLU A 1 16 ? 6.813   -16.811 -2.693 1.00 0.00 ? 117 GLU A HB2  9  
ATOM   4150 H  HB3  . GLU A 1 16 ? 7.745   -15.536 -1.934 1.00 0.00 ? 117 GLU A HB3  9  
ATOM   4151 H  HG2  . GLU A 1 16 ? 8.179   -16.795 -0.007 1.00 0.00 ? 117 GLU A HG2  9  
ATOM   4152 H  HG3  . GLU A 1 16 ? 6.713   -17.741 -0.160 1.00 0.00 ? 117 GLU A HG3  9  
ATOM   4153 N  N    . ALA A 1 17 ? 6.353   -14.690 0.865  1.00 0.00 ? 118 ALA A N    9  
ATOM   4154 C  CA   . ALA A 1 17 ? 6.394   -14.561 2.311  1.00 0.00 ? 118 ALA A CA   9  
ATOM   4155 C  C    . ALA A 1 17 ? 4.973   -14.355 2.841  1.00 0.00 ? 118 ALA A C    9  
ATOM   4156 O  O    . ALA A 1 17 ? 4.678   -14.695 3.985  1.00 0.00 ? 118 ALA A O    9  
ATOM   4157 C  CB   . ALA A 1 17 ? 7.332   -13.415 2.695  1.00 0.00 ? 118 ALA A CB   9  
ATOM   4158 H  H    . ALA A 1 17 ? 6.887   -14.009 0.365  1.00 0.00 ? 118 ALA A H    9  
ATOM   4159 H  HA   . ALA A 1 17 ? 6.792   -15.492 2.716  1.00 0.00 ? 118 ALA A HA   9  
ATOM   4160 H  HB1  . ALA A 1 17 ? 8.360   -13.693 2.462  1.00 0.00 ? 118 ALA A HB1  9  
ATOM   4161 H  HB2  . ALA A 1 17 ? 7.061   -12.521 2.135  1.00 0.00 ? 118 ALA A HB2  9  
ATOM   4162 H  HB3  . ALA A 1 17 ? 7.242   -13.216 3.764  1.00 0.00 ? 118 ALA A HB3  9  
ATOM   4163 N  N    . LEU A 1 18 ? 4.131   -13.798 1.983  1.00 0.00 ? 119 LEU A N    9  
ATOM   4164 C  CA   . LEU A 1 18 ? 2.749   -13.543 2.349  1.00 0.00 ? 119 LEU A CA   9  
ATOM   4165 C  C    . LEU A 1 18 ? 1.938   -14.830 2.194  1.00 0.00 ? 119 LEU A C    9  
ATOM   4166 O  O    . LEU A 1 18 ? 1.450   -15.384 3.179  1.00 0.00 ? 119 LEU A O    9  
ATOM   4167 C  CB   . LEU A 1 18 ? 2.191   -12.364 1.548  1.00 0.00 ? 119 LEU A CB   9  
ATOM   4168 C  CG   . LEU A 1 18 ? 0.666   -12.256 1.489  1.00 0.00 ? 119 LEU A CG   9  
ATOM   4169 C  CD1  . LEU A 1 18 ? 0.066   -12.183 2.894  1.00 0.00 ? 119 LEU A CD1  9  
ATOM   4170 C  CD2  . LEU A 1 18 ? 0.234   -11.073 0.620  1.00 0.00 ? 119 LEU A CD2  9  
ATOM   4171 H  H    . LEU A 1 18 ? 4.380   -13.525 1.054  1.00 0.00 ? 119 LEU A H    9  
ATOM   4172 H  HA   . LEU A 1 18 ? 2.738   -13.253 3.400  1.00 0.00 ? 119 LEU A HA   9  
ATOM   4173 H  HB2  . LEU A 1 18 ? 2.585   -11.442 1.976  1.00 0.00 ? 119 LEU A HB2  9  
ATOM   4174 H  HB3  . LEU A 1 18 ? 2.571   -12.432 0.530  1.00 0.00 ? 119 LEU A HB3  9  
ATOM   4175 H  HG   . LEU A 1 18 ? 0.277   -13.159 1.019  1.00 0.00 ? 119 LEU A HG   9  
ATOM   4176 H  HD11 . LEU A 1 18 ? 0.867   -12.094 3.628  1.00 0.00 ? 119 LEU A HD11 9  
ATOM   4177 H  HD12 . LEU A 1 18 ? -0.589  -11.315 2.965  1.00 0.00 ? 119 LEU A HD12 9  
ATOM   4178 H  HD13 . LEU A 1 18 ? -0.508  -13.088 3.092  1.00 0.00 ? 119 LEU A HD13 9  
ATOM   4179 H  HD21 . LEU A 1 18 ? -0.613  -11.368 0.001  1.00 0.00 ? 119 LEU A HD21 9  
ATOM   4180 H  HD22 . LEU A 1 18 ? -0.055  -10.240 1.259  1.00 0.00 ? 119 LEU A HD22 9  
ATOM   4181 H  HD23 . LEU A 1 18 ? 1.064   -10.770 -0.020 1.00 0.00 ? 119 LEU A HD23 9  
ATOM   4182 N  N    . LYS A 1 19 ? 1.818   -15.271 0.950  1.00 0.00 ? 120 LYS A N    9  
ATOM   4183 C  CA   . LYS A 1 19 ? 1.075   -16.483 0.652  1.00 0.00 ? 120 LYS A CA   9  
ATOM   4184 C  C    . LYS A 1 19 ? 1.253   -17.480 1.800  1.00 0.00 ? 120 LYS A C    9  
ATOM   4185 O  O    . LYS A 1 19 ? 0.283   -17.859 2.454  1.00 0.00 ? 120 LYS A O    9  
ATOM   4186 C  CB   . LYS A 1 19 ? 1.481   -17.039 -0.713 1.00 0.00 ? 120 LYS A CB   9  
ATOM   4187 C  CG   . LYS A 1 19 ? 1.300   -18.558 -0.763 1.00 0.00 ? 120 LYS A CG   9  
ATOM   4188 C  CD   . LYS A 1 19 ? 1.444   -19.081 -2.193 1.00 0.00 ? 120 LYS A CD   9  
ATOM   4189 C  CE   . LYS A 1 19 ? 2.913   -19.340 -2.537 1.00 0.00 ? 120 LYS A CE   9  
ATOM   4190 N  NZ   . LYS A 1 19 ? 3.512   -20.286 -1.571 1.00 0.00 ? 120 LYS A NZ   9  
ATOM   4191 H  H    . LYS A 1 19 ? 2.219   -14.814 0.154  1.00 0.00 ? 120 LYS A H    9  
ATOM   4192 H  HA   . LYS A 1 19 ? 0.021   -16.213 0.591  1.00 0.00 ? 120 LYS A HA   9  
ATOM   4193 H  HB2  . LYS A 1 19 ? 0.879   -16.572 -1.493 1.00 0.00 ? 120 LYS A HB2  9  
ATOM   4194 H  HB3  . LYS A 1 19 ? 2.521   -16.786 -0.919 1.00 0.00 ? 120 LYS A HB3  9  
ATOM   4195 H  HG2  . LYS A 1 19 ? 2.040   -19.037 -0.121 1.00 0.00 ? 120 LYS A HG2  9  
ATOM   4196 H  HG3  . LYS A 1 19 ? 0.318   -18.823 -0.372 1.00 0.00 ? 120 LYS A HG3  9  
ATOM   4197 H  HD2  . LYS A 1 19 ? 0.873   -20.002 -2.307 1.00 0.00 ? 120 LYS A HD2  9  
ATOM   4198 H  HD3  . LYS A 1 19 ? 1.026   -18.357 -2.893 1.00 0.00 ? 120 LYS A HD3  9  
ATOM   4199 H  HE2  . LYS A 1 19 ? 2.990   -19.743 -3.547 1.00 0.00 ? 120 LYS A HE2  9  
ATOM   4200 H  HE3  . LYS A 1 19 ? 3.466   -18.400 -2.526 1.00 0.00 ? 120 LYS A HE3  9  
ATOM   4201 H  HZ1  . LYS A 1 19 ? 3.728   -19.805 -0.722 1.00 0.00 ? 120 LYS A HZ1  9  
ATOM   4202 H  HZ2  . LYS A 1 19 ? 2.864   -21.023 -1.380 1.00 0.00 ? 120 LYS A HZ2  9  
ATOM   4203 H  HZ3  . LYS A 1 19 ? 4.350   -20.672 -1.958 1.00 0.00 ? 120 LYS A HZ3  9  
ATOM   4204 N  N    . ARG A 1 20 ? 2.500   -17.876 2.008  1.00 0.00 ? 121 ARG A N    9  
ATOM   4205 C  CA   . ARG A 1 20 ? 2.819   -18.820 3.066  1.00 0.00 ? 121 ARG A CA   9  
ATOM   4206 C  C    . ARG A 1 20 ? 2.262   -18.329 4.403  1.00 0.00 ? 121 ARG A C    9  
ATOM   4207 O  O    . ARG A 1 20 ? 1.628   -19.090 5.133  1.00 0.00 ? 121 ARG A O    9  
ATOM   4208 C  CB   . ARG A 1 20 ? 4.330   -19.017 3.192  1.00 0.00 ? 121 ARG A CB   9  
ATOM   4209 C  CG   . ARG A 1 20 ? 4.711   -20.486 2.997  1.00 0.00 ? 121 ARG A CG   9  
ATOM   4210 C  CD   . ARG A 1 20 ? 4.595   -21.261 4.312  1.00 0.00 ? 121 ARG A CD   9  
ATOM   4211 N  NE   . ARG A 1 20 ? 3.869   -22.531 4.088  1.00 0.00 ? 121 ARG A NE   9  
ATOM   4212 C  CZ   . ARG A 1 20 ? 2.583   -22.728 4.409  1.00 0.00 ? 121 ARG A CZ   9  
ATOM   4213 N  NH1  . ARG A 1 20 ? 2.196   -22.666 5.690  1.00 0.00 ? 121 ARG A NH1  9  
ATOM   4214 N  NH2  . ARG A 1 20 ? 1.685   -22.988 3.450  1.00 0.00 ? 121 ARG A NH2  9  
ATOM   4215 H  H    . ARG A 1 20 ? 3.284   -17.563 1.472  1.00 0.00 ? 121 ARG A H    9  
ATOM   4216 H  HA   . ARG A 1 20 ? 2.341   -19.751 2.760  1.00 0.00 ? 121 ARG A HA   9  
ATOM   4217 H  HB2  . ARG A 1 20 ? 4.844   -18.404 2.452  1.00 0.00 ? 121 ARG A HB2  9  
ATOM   4218 H  HB3  . ARG A 1 20 ? 4.664   -18.678 4.173  1.00 0.00 ? 121 ARG A HB3  9  
ATOM   4219 H  HG2  . ARG A 1 20 ? 4.062   -20.938 2.247  1.00 0.00 ? 121 ARG A HG2  9  
ATOM   4220 H  HG3  . ARG A 1 20 ? 5.731   -20.554 2.619  1.00 0.00 ? 121 ARG A HG3  9  
ATOM   4221 H  HD2  . ARG A 1 20 ? 5.589   -21.466 4.711  1.00 0.00 ? 121 ARG A HD2  9  
ATOM   4222 H  HD3  . ARG A 1 20 ? 4.072   -20.659 5.054  1.00 0.00 ? 121 ARG A HD3  9  
ATOM   4223 H  HE   . ARG A 1 20 ? 4.370   -23.291 3.671  1.00 0.00 ? 121 ARG A HE   9  
ATOM   4224 H  HH11 . ARG A 1 20 ? 2.315   -21.819 6.208  1.00 0.00 ? 121 ARG A HH11 9  
ATOM   4225 H  HH12 . ARG A 1 20 ? 1.787   -23.466 6.129  1.00 0.00 ? 121 ARG A HH12 9  
ATOM   4226 H  HH21 . ARG A 1 20 ? 1.776   -22.559 2.551  1.00 0.00 ? 121 ARG A HH21 9  
ATOM   4227 H  HH22 . ARG A 1 20 ? 0.923   -23.609 3.632  1.00 0.00 ? 121 ARG A HH22 9  
ATOM   4228 N  N    . HIS A 1 21 ? 2.516   -17.060 4.683  1.00 0.00 ? 122 HIS A N    9  
ATOM   4229 C  CA   . HIS A 1 21 ? 2.049   -16.458 5.920  1.00 0.00 ? 122 HIS A CA   9  
ATOM   4230 C  C    . HIS A 1 21 ? 0.551   -16.724 6.086  1.00 0.00 ? 122 HIS A C    9  
ATOM   4231 O  O    . HIS A 1 21 ? 0.109   -17.158 7.149  1.00 0.00 ? 122 HIS A O    9  
ATOM   4232 C  CB   . HIS A 1 21 ? 2.392   -14.967 5.963  1.00 0.00 ? 122 HIS A CB   9  
ATOM   4233 C  CG   . HIS A 1 21 ? 1.664   -14.200 7.040  1.00 0.00 ? 122 HIS A CG   9  
ATOM   4234 N  ND1  . HIS A 1 21 ? 2.250   -13.863 8.248  1.00 0.00 ? 122 HIS A ND1  9  
ATOM   4235 C  CD2  . HIS A 1 21 ? 0.393   -13.706 7.078  1.00 0.00 ? 122 HIS A CD2  9  
ATOM   4236 C  CE1  . HIS A 1 21 ? 1.363   -13.198 8.972  1.00 0.00 ? 122 HIS A CE1  9  
ATOM   4237 N  NE2  . HIS A 1 21 ? 0.212   -13.102 8.246  1.00 0.00 ? 122 HIS A NE2  9  
ATOM   4238 H  H    . HIS A 1 21 ? 3.032   -16.448 4.084  1.00 0.00 ? 122 HIS A H    9  
ATOM   4239 H  HA   . HIS A 1 21 ? 2.588   -16.947 6.730  1.00 0.00 ? 122 HIS A HA   9  
ATOM   4240 H  HB2  . HIS A 1 21 ? 3.467   -14.857 6.115  1.00 0.00 ? 122 HIS A HB2  9  
ATOM   4241 H  HB3  . HIS A 1 21 ? 2.161   -14.523 4.995  1.00 0.00 ? 122 HIS A HB3  9  
ATOM   4242 H  HD1  . HIS A 1 21 ? 3.185   -14.085 8.526  1.00 0.00 ? 122 HIS A HD1  9  
ATOM   4243 H  HD2  . HIS A 1 21 ? -0.348  -13.793 6.284  1.00 0.00 ? 122 HIS A HD2  9  
ATOM   4244 H  HE1  . HIS A 1 21 ? 1.524   -12.797 9.973  1.00 0.00 ? 122 HIS A HE1  9  
ATOM   4245 N  N    . TYR A 1 22 ? -0.188  -16.456 5.019  1.00 0.00 ? 123 TYR A N    9  
ATOM   4246 C  CA   . TYR A 1 22 ? -1.626  -16.661 5.034  1.00 0.00 ? 123 TYR A CA   9  
ATOM   4247 C  C    . TYR A 1 22 ? -1.969  -18.107 5.403  1.00 0.00 ? 123 TYR A C    9  
ATOM   4248 O  O    . TYR A 1 22 ? -2.679  -18.351 6.378  1.00 0.00 ? 123 TYR A O    9  
ATOM   4249 C  CB   . TYR A 1 22 ? -2.106  -16.384 3.609  1.00 0.00 ? 123 TYR A CB   9  
ATOM   4250 C  CG   . TYR A 1 22 ? -3.195  -15.314 3.517  1.00 0.00 ? 123 TYR A CG   9  
ATOM   4251 C  CD1  . TYR A 1 22 ? -4.408  -15.506 4.145  1.00 0.00 ? 123 TYR A CD1  9  
ATOM   4252 C  CD2  . TYR A 1 22 ? -2.963  -14.154 2.804  1.00 0.00 ? 123 TYR A CD2  9  
ATOM   4253 C  CE1  . TYR A 1 22 ? -5.432  -14.499 4.058  1.00 0.00 ? 123 TYR A CE1  9  
ATOM   4254 C  CE2  . TYR A 1 22 ? -3.989  -13.146 2.717  1.00 0.00 ? 123 TYR A CE2  9  
ATOM   4255 C  CZ   . TYR A 1 22 ? -5.172  -13.368 3.348  1.00 0.00 ? 123 TYR A CZ   9  
ATOM   4256 O  OH   . TYR A 1 22 ? -6.140  -12.417 3.265  1.00 0.00 ? 123 TYR A OH   9  
ATOM   4257 H  H    . TYR A 1 22 ? 0.180   -16.104 4.160  1.00 0.00 ? 123 TYR A H    9  
ATOM   4258 H  HA   . TYR A 1 22 ? -2.054  -15.993 5.780  1.00 0.00 ? 123 TYR A HA   9  
ATOM   4259 H  HB2  . TYR A 1 22 ? -1.254  -16.075 3.003  1.00 0.00 ? 123 TYR A HB2  9  
ATOM   4260 H  HB3  . TYR A 1 22 ? -2.484  -17.311 3.176  1.00 0.00 ? 123 TYR A HB3  9  
ATOM   4261 H  HD1  . TYR A 1 22 ? -4.591  -16.422 4.707  1.00 0.00 ? 123 TYR A HD1  9  
ATOM   4262 H  HD2  . TYR A 1 22 ? -2.005  -14.002 2.307  1.00 0.00 ? 123 TYR A HD2  9  
ATOM   4263 H  HE1  . TYR A 1 22 ? -6.396  -14.638 4.550  1.00 0.00 ? 123 TYR A HE1  9  
ATOM   4264 H  HE2  . TYR A 1 22 ? -3.819  -12.227 2.158  1.00 0.00 ? 123 TYR A HE2  9  
ATOM   4265 H  HH   . TYR A 1 22 ? -5.842  -11.585 3.733  1.00 0.00 ? 123 TYR A HH   9  
ATOM   4266 N  N    . ARG A 1 23 ? -1.448  -19.027 4.604  1.00 0.00 ? 124 ARG A N    9  
ATOM   4267 C  CA   . ARG A 1 23 ? -1.691  -20.440 4.834  1.00 0.00 ? 124 ARG A CA   9  
ATOM   4268 C  C    . ARG A 1 23 ? -1.498  -20.779 6.314  1.00 0.00 ? 124 ARG A C    9  
ATOM   4269 O  O    . ARG A 1 23 ? -2.156  -21.673 6.842  1.00 0.00 ? 124 ARG A O    9  
ATOM   4270 C  CB   . ARG A 1 23 ? -0.749  -21.305 3.993  1.00 0.00 ? 124 ARG A CB   9  
ATOM   4271 C  CG   . ARG A 1 23 ? -1.530  -22.127 2.965  1.00 0.00 ? 124 ARG A CG   9  
ATOM   4272 C  CD   . ARG A 1 23 ? -2.177  -23.350 3.619  1.00 0.00 ? 124 ARG A CD   9  
ATOM   4273 N  NE   . ARG A 1 23 ? -1.164  -24.410 3.825  1.00 0.00 ? 124 ARG A NE   9  
ATOM   4274 C  CZ   . ARG A 1 23 ? -0.813  -25.303 2.891  1.00 0.00 ? 124 ARG A CZ   9  
ATOM   4275 N  NH1  . ARG A 1 23 ? -1.129  -25.091 1.607  1.00 0.00 ? 124 ARG A NH1  9  
ATOM   4276 N  NH2  . ARG A 1 23 ? -0.144  -26.411 3.241  1.00 0.00 ? 124 ARG A NH2  9  
ATOM   4277 H  H    . ARG A 1 23 ? -0.872  -18.820 3.813  1.00 0.00 ? 124 ARG A H    9  
ATOM   4278 H  HA   . ARG A 1 23 ? -2.725  -20.600 4.528  1.00 0.00 ? 124 ARG A HA   9  
ATOM   4279 H  HB2  . ARG A 1 23 ? -0.026  -20.669 3.482  1.00 0.00 ? 124 ARG A HB2  9  
ATOM   4280 H  HB3  . ARG A 1 23 ? -0.183  -21.972 4.643  1.00 0.00 ? 124 ARG A HB3  9  
ATOM   4281 H  HG2  . ARG A 1 23 ? -2.299  -21.506 2.506  1.00 0.00 ? 124 ARG A HG2  9  
ATOM   4282 H  HG3  . ARG A 1 23 ? -0.860  -22.448 2.167  1.00 0.00 ? 124 ARG A HG3  9  
ATOM   4283 H  HD2  . ARG A 1 23 ? -2.622  -23.069 4.575  1.00 0.00 ? 124 ARG A HD2  9  
ATOM   4284 H  HD3  . ARG A 1 23 ? -2.984  -23.724 2.990  1.00 0.00 ? 124 ARG A HD3  9  
ATOM   4285 H  HE   . ARG A 1 23 ? -0.715  -24.461 4.717  1.00 0.00 ? 124 ARG A HE   9  
ATOM   4286 H  HH11 . ARG A 1 23 ? -1.543  -24.222 1.330  1.00 0.00 ? 124 ARG A HH11 9  
ATOM   4287 H  HH12 . ARG A 1 23 ? -0.952  -25.799 0.923  1.00 0.00 ? 124 ARG A HH12 9  
ATOM   4288 H  HH21 . ARG A 1 23 ? 0.419   -26.414 4.067  1.00 0.00 ? 124 ARG A HH21 9  
ATOM   4289 H  HH22 . ARG A 1 23 ? -0.208  -27.233 2.677  1.00 0.00 ? 124 ARG A HH22 9  
ATOM   4290 N  N    . SER A 1 24 ? -0.590  -20.045 6.942  1.00 0.00 ? 125 SER A N    9  
ATOM   4291 C  CA   . SER A 1 24 ? -0.302  -20.256 8.350  1.00 0.00 ? 125 SER A CA   9  
ATOM   4292 C  C    . SER A 1 24 ? -1.539  -19.937 9.192  1.00 0.00 ? 125 SER A C    9  
ATOM   4293 O  O    . SER A 1 24 ? -1.830  -20.632 10.163 1.00 0.00 ? 125 SER A O    9  
ATOM   4294 C  CB   . SER A 1 24 ? 0.884   -19.401 8.803  1.00 0.00 ? 125 SER A CB   9  
ATOM   4295 O  OG   . SER A 1 24 ? 0.496   -18.060 9.089  1.00 0.00 ? 125 SER A OG   9  
ATOM   4296 H  H    . SER A 1 24 ? -0.058  -19.319 6.506  1.00 0.00 ? 125 SER A H    9  
ATOM   4297 H  HA   . SER A 1 24 ? -0.042  -21.311 8.437  1.00 0.00 ? 125 SER A HA   9  
ATOM   4298 H  HB2  . SER A 1 24 ? 1.332   -19.846 9.691  1.00 0.00 ? 125 SER A HB2  9  
ATOM   4299 H  HB3  . SER A 1 24 ? 1.648   -19.400 8.026  1.00 0.00 ? 125 SER A HB3  9  
ATOM   4300 H  HG   . SER A 1 24 ? -0.224  -17.770 8.459  1.00 0.00 ? 125 SER A HG   9  
ATOM   4301 N  N    . HIS A 1 25 ? -2.233  -18.883 8.788  1.00 0.00 ? 126 HIS A N    9  
ATOM   4302 C  CA   . HIS A 1 25 ? -3.433  -18.462 9.492  1.00 0.00 ? 126 HIS A CA   9  
ATOM   4303 C  C    . HIS A 1 25 ? -4.439  -19.615 9.526  1.00 0.00 ? 126 HIS A C    9  
ATOM   4304 O  O    . HIS A 1 25 ? -5.093  -19.843 10.542 1.00 0.00 ? 126 HIS A O    9  
ATOM   4305 C  CB   . HIS A 1 25 ? -4.010  -17.189 8.871  1.00 0.00 ? 126 HIS A CB   9  
ATOM   4306 C  CG   . HIS A 1 25 ? -3.303  -15.924 9.294  1.00 0.00 ? 126 HIS A CG   9  
ATOM   4307 N  ND1  . HIS A 1 25 ? -3.005  -15.638 10.615 1.00 0.00 ? 126 HIS A ND1  9  
ATOM   4308 C  CD2  . HIS A 1 25 ? -2.838  -14.874 8.559  1.00 0.00 ? 126 HIS A CD2  9  
ATOM   4309 C  CE1  . HIS A 1 25 ? -2.389  -14.466 10.661 1.00 0.00 ? 126 HIS A CE1  9  
ATOM   4310 N  NE2  . HIS A 1 25 ? -2.286  -13.994 9.386  1.00 0.00 ? 126 HIS A NE2  9  
ATOM   4311 H  H    . HIS A 1 25 ? -1.990  -18.322 7.996  1.00 0.00 ? 126 HIS A H    9  
ATOM   4312 H  HA   . HIS A 1 25 ? -3.130  -18.226 10.512 1.00 0.00 ? 126 HIS A HA   9  
ATOM   4313 H  HB2  . HIS A 1 25 ? -3.963  -17.273 7.785  1.00 0.00 ? 126 HIS A HB2  9  
ATOM   4314 H  HB3  . HIS A 1 25 ? -5.064  -17.111 9.139  1.00 0.00 ? 126 HIS A HB3  9  
ATOM   4315 H  HD1  . HIS A 1 25 ? -3.218  -16.218 11.402 1.00 0.00 ? 126 HIS A HD1  9  
ATOM   4316 H  HD2  . HIS A 1 25 ? -2.906  -14.775 7.476  1.00 0.00 ? 126 HIS A HD2  9  
ATOM   4317 H  HE1  . HIS A 1 25 ? -2.028  -13.966 11.560 1.00 0.00 ? 126 HIS A HE1  9  
ATOM   4318 N  N    . THR A 1 26 ? -4.531  -20.310 8.401  1.00 0.00 ? 127 THR A N    9  
ATOM   4319 C  CA   . THR A 1 26 ? -5.447  -21.433 8.289  1.00 0.00 ? 127 THR A CA   9  
ATOM   4320 C  C    . THR A 1 26 ? -5.514  -22.201 9.610  1.00 0.00 ? 127 THR A C    9  
ATOM   4321 O  O    . THR A 1 26 ? -6.599  -22.523 10.091 1.00 0.00 ? 127 THR A O    9  
ATOM   4322 C  CB   . THR A 1 26 ? -4.995  -22.294 7.109  1.00 0.00 ? 127 THR A CB   9  
ATOM   4323 O  OG1  . THR A 1 26 ? -4.369  -21.370 6.222  1.00 0.00 ? 127 THR A OG1  9  
ATOM   4324 C  CG2  . THR A 1 26 ? -6.172  -22.845 6.301  1.00 0.00 ? 127 THR A CG2  9  
ATOM   4325 H  H    . THR A 1 26 ? -3.996  -20.117 7.579  1.00 0.00 ? 127 THR A H    9  
ATOM   4326 H  HA   . THR A 1 26 ? -6.446  -21.043 8.094  1.00 0.00 ? 127 THR A HA   9  
ATOM   4327 H  HB   . THR A 1 26 ? -4.342  -23.100 7.441  1.00 0.00 ? 127 THR A HB   9  
ATOM   4328 H  HG1  . THR A 1 26 ? -3.561  -21.787 5.807  1.00 0.00 ? 127 THR A HG1  9  
ATOM   4329 H  HG21 . THR A 1 26 ? -6.740  -22.016 5.876  1.00 0.00 ? 127 THR A HG21 9  
ATOM   4330 H  HG22 . THR A 1 26 ? -5.797  -23.478 5.497  1.00 0.00 ? 127 THR A HG22 9  
ATOM   4331 H  HG23 . THR A 1 26 ? -6.820  -23.430 6.954  1.00 0.00 ? 127 THR A HG23 9  
ATOM   4332 N  N    . ASN A 1 27 ? -4.339  -22.472 10.161 1.00 0.00 ? 128 ASN A N    9  
ATOM   4333 C  CA   . ASN A 1 27 ? -4.251  -23.195 11.418 1.00 0.00 ? 128 ASN A CA   9  
ATOM   4334 C  C    . ASN A 1 27 ? -4.129  -22.195 12.569 1.00 0.00 ? 128 ASN A C    9  
ATOM   4335 O  O    . ASN A 1 27 ? -4.967  -22.176 13.471 1.00 0.00 ? 128 ASN A O    9  
ATOM   4336 C  CB   . ASN A 1 27 ? -3.019  -24.101 11.446 1.00 0.00 ? 128 ASN A CB   9  
ATOM   4337 C  CG   . ASN A 1 27 ? -1.831  -23.433 10.750 1.00 0.00 ? 128 ASN A CG   9  
ATOM   4338 O  OD1  . ASN A 1 27 ? -1.637  -23.546 9.552  1.00 0.00 ? 128 ASN A OD1  9  
ATOM   4339 N  ND2  . ASN A 1 27 ? -1.049  -22.734 11.567 1.00 0.00 ? 128 ASN A ND2  9  
ATOM   4340 H  H    . ASN A 1 27 ? -3.461  -22.206 9.764  1.00 0.00 ? 128 ASN A H    9  
ATOM   4341 H  HA   . ASN A 1 27 ? -5.166  -23.786 11.473 1.00 0.00 ? 128 ASN A HA   9  
ATOM   4342 H  HB2  . ASN A 1 27 ? -2.757  -24.333 12.479 1.00 0.00 ? 128 ASN A HB2  9  
ATOM   4343 H  HB3  . ASN A 1 27 ? -3.248  -25.047 10.955 1.00 0.00 ? 128 ASN A HB3  9  
ATOM   4344 H  HD21 . ASN A 1 27 ? -1.028  -22.947 12.544 1.00 0.00 ? 128 ASN A HD21 9  
ATOM   4345 H  HD22 . ASN A 1 27 ? -0.483  -21.993 11.205 1.00 0.00 ? 128 ASN A HD22 9  
ATOM   4346 N  N    . GLU A 1 28 ? -3.081  -21.388 12.503 1.00 0.00 ? 129 GLU A N    9  
ATOM   4347 C  CA   . GLU A 1 28 ? -2.839  -20.389 13.529 1.00 0.00 ? 129 GLU A CA   9  
ATOM   4348 C  C    . GLU A 1 28 ? -3.648  -19.123 13.238 1.00 0.00 ? 129 GLU A C    9  
ATOM   4349 O  O    . GLU A 1 28 ? -3.080  -18.049 13.049 1.00 0.00 ? 129 GLU A O    9  
ATOM   4350 C  CB   . GLU A 1 28 ? -1.347  -20.071 13.645 1.00 0.00 ? 129 GLU A CB   9  
ATOM   4351 C  CG   . GLU A 1 28 ? -0.835  -19.375 12.383 1.00 0.00 ? 129 GLU A CG   9  
ATOM   4352 C  CD   . GLU A 1 28 ? -0.040  -18.116 12.736 1.00 0.00 ? 129 GLU A CD   9  
ATOM   4353 O  OE1  . GLU A 1 28 ? -0.601  -17.281 13.480 1.00 0.00 ? 129 GLU A OE1  9  
ATOM   4354 O  OE2  . GLU A 1 28 ? 1.109   -18.016 12.255 1.00 0.00 ? 129 GLU A OE2  9  
ATOM   4355 H  H    . GLU A 1 28 ? -2.404  -21.411 11.767 1.00 0.00 ? 129 GLU A H    9  
ATOM   4356 H  HA   . GLU A 1 28 ? -3.181  -20.840 14.460 1.00 0.00 ? 129 GLU A HA   9  
ATOM   4357 H  HB2  . GLU A 1 28 ? -1.173  -19.435 14.512 1.00 0.00 ? 129 GLU A HB2  9  
ATOM   4358 H  HB3  . GLU A 1 28 ? -0.787  -20.993 13.809 1.00 0.00 ? 129 GLU A HB3  9  
ATOM   4359 H  HG2  . GLU A 1 28 ? -0.205  -20.059 11.815 1.00 0.00 ? 129 GLU A HG2  9  
ATOM   4360 H  HG3  . GLU A 1 28 ? -1.677  -19.110 11.742 1.00 0.00 ? 129 GLU A HG3  9  
ATOM   4361 N  N    . LYS A 1 29 ? -4.961  -19.291 13.210 1.00 0.00 ? 130 LYS A N    9  
ATOM   4362 C  CA   . LYS A 1 29 ? -5.854  -18.176 12.945 1.00 0.00 ? 130 LYS A CA   9  
ATOM   4363 C  C    . LYS A 1 29 ? -7.233  -18.481 13.533 1.00 0.00 ? 130 LYS A C    9  
ATOM   4364 O  O    . LYS A 1 29 ? -8.252  -18.061 12.986 1.00 0.00 ? 130 LYS A O    9  
ATOM   4365 C  CB   . LYS A 1 29 ? -5.880  -17.855 11.449 1.00 0.00 ? 130 LYS A CB   9  
ATOM   4366 C  CG   . LYS A 1 29 ? -6.712  -16.601 11.172 1.00 0.00 ? 130 LYS A CG   9  
ATOM   4367 C  CD   . LYS A 1 29 ? -7.922  -16.927 10.295 1.00 0.00 ? 130 LYS A CD   9  
ATOM   4368 C  CE   . LYS A 1 29 ? -8.765  -15.676 10.036 1.00 0.00 ? 130 LYS A CE   9  
ATOM   4369 N  NZ   . LYS A 1 29 ? -7.897  -14.485 9.907  1.00 0.00 ? 130 LYS A NZ   9  
ATOM   4370 H  H    . LYS A 1 29 ? -5.416  -20.169 13.365 1.00 0.00 ? 130 LYS A H    9  
ATOM   4371 H  HA   . LYS A 1 29 ? -5.446  -17.303 13.455 1.00 0.00 ? 130 LYS A HA   9  
ATOM   4372 H  HB2  . LYS A 1 29 ? -4.863  -17.710 11.087 1.00 0.00 ? 130 LYS A HB2  9  
ATOM   4373 H  HB3  . LYS A 1 29 ? -6.297  -18.700 10.900 1.00 0.00 ? 130 LYS A HB3  9  
ATOM   4374 H  HG2  . LYS A 1 29 ? -7.048  -16.168 12.115 1.00 0.00 ? 130 LYS A HG2  9  
ATOM   4375 H  HG3  . LYS A 1 29 ? -6.093  -15.852 10.680 1.00 0.00 ? 130 LYS A HG3  9  
ATOM   4376 H  HD2  . LYS A 1 29 ? -7.585  -17.346 9.346  1.00 0.00 ? 130 LYS A HD2  9  
ATOM   4377 H  HD3  . LYS A 1 29 ? -8.532  -17.688 10.780 1.00 0.00 ? 130 LYS A HD3  9  
ATOM   4378 H  HE2  . LYS A 1 29 ? -9.350  -15.808 9.127  1.00 0.00 ? 130 LYS A HE2  9  
ATOM   4379 H  HE3  . LYS A 1 29 ? -9.472  -15.533 10.853 1.00 0.00 ? 130 LYS A HE3  9  
ATOM   4380 H  HZ1  . LYS A 1 29 ? -8.451  -13.699 9.630  1.00 0.00 ? 130 LYS A HZ1  9  
ATOM   4381 H  HZ2  . LYS A 1 29 ? -7.461  -14.293 10.786 1.00 0.00 ? 130 LYS A HZ2  9  
ATOM   4382 H  HZ3  . LYS A 1 29 ? -7.194  -14.657 9.217  1.00 0.00 ? 130 LYS A HZ3  9  
HETATM 4383 ZN ZN   . ZN  B 2 .  ? -1.467  -12.237 8.834  1.00 0.00 ? 1   ZN  A ZN   9  
ATOM   4384 N  N    . ARG A 1 1  ? -1.806  -1.311  -2.794 1.00 0.00 ? 102 ARG A N    10 
ATOM   4385 C  CA   . ARG A 1 1  ? -0.863  -1.692  -3.831 1.00 0.00 ? 102 ARG A CA   10 
ATOM   4386 C  C    . ARG A 1 1  ? 0.403   -2.283  -3.207 1.00 0.00 ? 102 ARG A C    10 
ATOM   4387 O  O    . ARG A 1 1  ? 1.515   -1.956  -3.622 1.00 0.00 ? 102 ARG A O    10 
ATOM   4388 C  CB   . ARG A 1 1  ? -0.483  -0.491  -4.699 1.00 0.00 ? 102 ARG A CB   10 
ATOM   4389 C  CG   . ARG A 1 1  ? -1.730  0.220   -5.227 1.00 0.00 ? 102 ARG A CG   10 
ATOM   4390 C  CD   . ARG A 1 1  ? -2.792  -0.789  -5.669 1.00 0.00 ? 102 ARG A CD   10 
ATOM   4391 N  NE   . ARG A 1 1  ? -2.240  -1.679  -6.713 1.00 0.00 ? 102 ARG A NE   10 
ATOM   4392 C  CZ   . ARG A 1 1  ? -2.743  -2.884  -7.016 1.00 0.00 ? 102 ARG A CZ   10 
ATOM   4393 N  NH1  . ARG A 1 1  ? -3.125  -3.716  -6.038 1.00 0.00 ? 102 ARG A NH1  10 
ATOM   4394 N  NH2  . ARG A 1 1  ? -2.864  -3.257  -8.298 1.00 0.00 ? 102 ARG A NH2  10 
ATOM   4395 H  H    . ARG A 1 1  ? -1.417  -1.234  -1.877 1.00 0.00 ? 102 ARG A H    10 
ATOM   4396 H  HA   . ARG A 1 1  ? -1.390  -2.438  -4.427 1.00 0.00 ? 102 ARG A HA   10 
ATOM   4397 H  HB2  . ARG A 1 1  ? 0.120   0.207   -4.117 1.00 0.00 ? 102 ARG A HB2  10 
ATOM   4398 H  HB3  . ARG A 1 1  ? 0.132   -0.822  -5.536 1.00 0.00 ? 102 ARG A HB3  10 
ATOM   4399 H  HG2  . ARG A 1 1  ? -2.139  0.868   -4.452 1.00 0.00 ? 102 ARG A HG2  10 
ATOM   4400 H  HG3  . ARG A 1 1  ? -1.460  0.861   -6.067 1.00 0.00 ? 102 ARG A HG3  10 
ATOM   4401 H  HD2  . ARG A 1 1  ? -3.122  -1.379  -4.813 1.00 0.00 ? 102 ARG A HD2  10 
ATOM   4402 H  HD3  . ARG A 1 1  ? -3.668  -0.264  -6.051 1.00 0.00 ? 102 ARG A HD3  10 
ATOM   4403 H  HE   . ARG A 1 1  ? -1.442  -1.363  -7.226 1.00 0.00 ? 102 ARG A HE   10 
ATOM   4404 H  HH11 . ARG A 1 1  ? -3.813  -3.423  -5.373 1.00 0.00 ? 102 ARG A HH11 10 
ATOM   4405 H  HH12 . ARG A 1 1  ? -2.723  -4.629  -5.972 1.00 0.00 ? 102 ARG A HH12 10 
ATOM   4406 H  HH21 . ARG A 1 1  ? -2.049  -3.484  -8.831 1.00 0.00 ? 102 ARG A HH21 10 
ATOM   4407 H  HH22 . ARG A 1 1  ? -3.769  -3.308  -8.721 1.00 0.00 ? 102 ARG A HH22 10 
ATOM   4408 N  N    . SER A 1 2  ? 0.193   -3.141  -2.220 1.00 0.00 ? 103 SER A N    10 
ATOM   4409 C  CA   . SER A 1 2  ? 1.303   -3.778  -1.534 1.00 0.00 ? 103 SER A CA   10 
ATOM   4410 C  C    . SER A 1 2  ? 0.859   -5.123  -0.956 1.00 0.00 ? 103 SER A C    10 
ATOM   4411 O  O    . SER A 1 2  ? -0.337  -5.396  -0.857 1.00 0.00 ? 103 SER A O    10 
ATOM   4412 C  CB   . SER A 1 2  ? 1.855   -2.881  -0.424 1.00 0.00 ? 103 SER A CB   10 
ATOM   4413 O  OG   . SER A 1 2  ? 3.030   -2.188  -0.833 1.00 0.00 ? 103 SER A OG   10 
ATOM   4414 H  H    . SER A 1 2  ? -0.713  -3.400  -1.889 1.00 0.00 ? 103 SER A H    10 
ATOM   4415 H  HA   . SER A 1 2  ? 2.069   -3.924  -2.297 1.00 0.00 ? 103 SER A HA   10 
ATOM   4416 H  HB2  . SER A 1 2  ? 1.092   -2.160  -0.129 1.00 0.00 ? 103 SER A HB2  10 
ATOM   4417 H  HB3  . SER A 1 2  ? 2.078   -3.487  0.454  1.00 0.00 ? 103 SER A HB3  10 
ATOM   4418 H  HG   . SER A 1 2  ? 3.733   -2.259  -0.125 1.00 0.00 ? 103 SER A HG   10 
ATOM   4419 N  N    . PHE A 1 3  ? 1.845   -5.930  -0.591 1.00 0.00 ? 104 PHE A N    10 
ATOM   4420 C  CA   . PHE A 1 3  ? 1.569   -7.240  -0.026 1.00 0.00 ? 104 PHE A CA   10 
ATOM   4421 C  C    . PHE A 1 3  ? 1.306   -7.144  1.478  1.00 0.00 ? 104 PHE A C    10 
ATOM   4422 O  O    . PHE A 1 3  ? 2.237   -6.990  2.267  1.00 0.00 ? 104 PHE A O    10 
ATOM   4423 C  CB   . PHE A 1 3  ? 2.814   -8.099  -0.261 1.00 0.00 ? 104 PHE A CB   10 
ATOM   4424 C  CG   . PHE A 1 3  ? 3.455   -7.902  -1.635 1.00 0.00 ? 104 PHE A CG   10 
ATOM   4425 C  CD1  . PHE A 1 3  ? 2.722   -8.103  -2.763 1.00 0.00 ? 104 PHE A CD1  10 
ATOM   4426 C  CD2  . PHE A 1 3  ? 4.760   -7.527  -1.730 1.00 0.00 ? 104 PHE A CD2  10 
ATOM   4427 C  CE1  . PHE A 1 3  ? 3.318   -7.921  -4.039 1.00 0.00 ? 104 PHE A CE1  10 
ATOM   4428 C  CE2  . PHE A 1 3  ? 5.355   -7.345  -3.006 1.00 0.00 ? 104 PHE A CE2  10 
ATOM   4429 C  CZ   . PHE A 1 3  ? 4.622   -7.545  -4.133 1.00 0.00 ? 104 PHE A CZ   10 
ATOM   4430 H  H    . PHE A 1 3  ? 2.814   -5.701  -0.675 1.00 0.00 ? 104 PHE A H    10 
ATOM   4431 H  HA   . PHE A 1 3  ? 0.681   -7.627  -0.524 1.00 0.00 ? 104 PHE A HA   10 
ATOM   4432 H  HB2  . PHE A 1 3  ? 3.551   -7.870  0.510  1.00 0.00 ? 104 PHE A HB2  10 
ATOM   4433 H  HB3  . PHE A 1 3  ? 2.546   -9.148  -0.143 1.00 0.00 ? 104 PHE A HB3  10 
ATOM   4434 H  HD1  . PHE A 1 3  ? 1.677   -8.403  -2.687 1.00 0.00 ? 104 PHE A HD1  10 
ATOM   4435 H  HD2  . PHE A 1 3  ? 5.347   -7.367  -0.826 1.00 0.00 ? 104 PHE A HD2  10 
ATOM   4436 H  HE1  . PHE A 1 3  ? 2.730   -8.081  -4.943 1.00 0.00 ? 104 PHE A HE1  10 
ATOM   4437 H  HE2  . PHE A 1 3  ? 6.400   -7.043  -3.082 1.00 0.00 ? 104 PHE A HE2  10 
ATOM   4438 H  HZ   . PHE A 1 3  ? 5.079   -7.405  -5.113 1.00 0.00 ? 104 PHE A HZ   10 
ATOM   4439 N  N    . VAL A 1 4  ? 0.033   -7.240  1.830  1.00 0.00 ? 105 VAL A N    10 
ATOM   4440 C  CA   . VAL A 1 4  ? -0.365  -7.167  3.227  1.00 0.00 ? 105 VAL A CA   10 
ATOM   4441 C  C    . VAL A 1 4  ? -1.269  -8.355  3.559  1.00 0.00 ? 105 VAL A C    10 
ATOM   4442 O  O    . VAL A 1 4  ? -1.997  -8.847  2.696  1.00 0.00 ? 105 VAL A O    10 
ATOM   4443 C  CB   . VAL A 1 4  ? -1.026  -5.816  3.512  1.00 0.00 ? 105 VAL A CB   10 
ATOM   4444 C  CG1  . VAL A 1 4  ? -1.606  -5.777  4.927  1.00 0.00 ? 105 VAL A CG1  10 
ATOM   4445 C  CG2  . VAL A 1 4  ? -0.039  -4.666  3.292  1.00 0.00 ? 105 VAL A CG2  10 
ATOM   4446 H  H    . VAL A 1 4  ? -0.720  -7.366  1.184  1.00 0.00 ? 105 VAL A H    10 
ATOM   4447 H  HA   . VAL A 1 4  ? 0.540   -7.234  3.830  1.00 0.00 ? 105 VAL A HA   10 
ATOM   4448 H  HB   . VAL A 1 4  ? -1.848  -5.690  2.809  1.00 0.00 ? 105 VAL A HB   10 
ATOM   4449 H  HG11 . VAL A 1 4  ? -1.686  -4.742  5.259  1.00 0.00 ? 105 VAL A HG11 10 
ATOM   4450 H  HG12 . VAL A 1 4  ? -2.594  -6.236  4.927  1.00 0.00 ? 105 VAL A HG12 10 
ATOM   4451 H  HG13 . VAL A 1 4  ? -0.950  -6.326  5.603  1.00 0.00 ? 105 VAL A HG13 10 
ATOM   4452 H  HG21 . VAL A 1 4  ? 0.482   -4.811  2.345  1.00 0.00 ? 105 VAL A HG21 10 
ATOM   4453 H  HG22 . VAL A 1 4  ? -0.583  -3.722  3.266  1.00 0.00 ? 105 VAL A HG22 10 
ATOM   4454 H  HG23 . VAL A 1 4  ? 0.684   -4.647  4.107  1.00 0.00 ? 105 VAL A HG23 10 
ATOM   4455 N  N    . CYS A 1 5  ? -1.193  -8.784  4.810  1.00 0.00 ? 106 CYS A N    10 
ATOM   4456 C  CA   . CYS A 1 5  ? -1.996  -9.907  5.266  1.00 0.00 ? 106 CYS A CA   10 
ATOM   4457 C  C    . CYS A 1 5  ? -3.236  -9.355  5.971  1.00 0.00 ? 106 CYS A C    10 
ATOM   4458 O  O    . CYS A 1 5  ? -3.230  -9.161  7.186  1.00 0.00 ? 106 CYS A O    10 
ATOM   4459 C  CB   . CYS A 1 5  ? -1.194  -10.843 6.171  1.00 0.00 ? 106 CYS A CB   10 
ATOM   4460 S  SG   . CYS A 1 5  ? -2.295  -12.120 6.884  1.00 0.00 ? 106 CYS A SG   10 
ATOM   4461 H  H    . CYS A 1 5  ? -0.598  -8.379  5.505  1.00 0.00 ? 106 CYS A H    10 
ATOM   4462 H  HA   . CYS A 1 5  ? -2.275  -10.474 4.379  1.00 0.00 ? 106 CYS A HA   10 
ATOM   4463 H  HB2  . CYS A 1 5  ? -0.395  -11.318 5.602  1.00 0.00 ? 106 CYS A HB2  10 
ATOM   4464 H  HB3  . CYS A 1 5  ? -0.721  -10.273 6.971  1.00 0.00 ? 106 CYS A HB3  10 
ATOM   4465 N  N    . GLU A 1 6  ? -4.271  -9.117  5.179  1.00 0.00 ? 107 GLU A N    10 
ATOM   4466 C  CA   . GLU A 1 6  ? -5.517  -8.592  5.712  1.00 0.00 ? 107 GLU A CA   10 
ATOM   4467 C  C    . GLU A 1 6  ? -5.860  -9.279  7.035  1.00 0.00 ? 107 GLU A C    10 
ATOM   4468 O  O    . GLU A 1 6  ? -6.528  -8.696  7.887  1.00 0.00 ? 107 GLU A O    10 
ATOM   4469 C  CB   . GLU A 1 6  ? -6.655  -8.748  4.702  1.00 0.00 ? 107 GLU A CB   10 
ATOM   4470 C  CG   . GLU A 1 6  ? -6.524  -7.730  3.566  1.00 0.00 ? 107 GLU A CG   10 
ATOM   4471 C  CD   . GLU A 1 6  ? -6.586  -6.299  4.103  1.00 0.00 ? 107 GLU A CD   10 
ATOM   4472 O  OE1  . GLU A 1 6  ? -5.515  -5.798  4.509  1.00 0.00 ? 107 GLU A OE1  10 
ATOM   4473 O  OE2  . GLU A 1 6  ? -7.703  -5.739  4.096  1.00 0.00 ? 107 GLU A OE2  10 
ATOM   4474 H  H    . GLU A 1 6  ? -4.268  -9.278  4.191  1.00 0.00 ? 107 GLU A H    10 
ATOM   4475 H  HA   . GLU A 1 6  ? -5.334  -7.531  5.882  1.00 0.00 ? 107 GLU A HA   10 
ATOM   4476 H  HB2  . GLU A 1 6  ? -6.646  -9.758  4.291  1.00 0.00 ? 107 GLU A HB2  10 
ATOM   4477 H  HB3  . GLU A 1 6  ? -7.613  -8.617  5.204  1.00 0.00 ? 107 GLU A HB3  10 
ATOM   4478 H  HG2  . GLU A 1 6  ? -5.581  -7.885  3.041  1.00 0.00 ? 107 GLU A HG2  10 
ATOM   4479 H  HG3  . GLU A 1 6  ? -7.322  -7.886  2.840  1.00 0.00 ? 107 GLU A HG3  10 
ATOM   4480 N  N    . VAL A 1 7  ? -5.387  -10.511 7.165  1.00 0.00 ? 108 VAL A N    10 
ATOM   4481 C  CA   . VAL A 1 7  ? -5.636  -11.284 8.370  1.00 0.00 ? 108 VAL A CA   10 
ATOM   4482 C  C    . VAL A 1 7  ? -5.129  -10.505 9.585  1.00 0.00 ? 108 VAL A C    10 
ATOM   4483 O  O    . VAL A 1 7  ? -5.921  -9.974  10.362 1.00 0.00 ? 108 VAL A O    10 
ATOM   4484 C  CB   . VAL A 1 7  ? -5.002  -12.670 8.242  1.00 0.00 ? 108 VAL A CB   10 
ATOM   4485 C  CG1  . VAL A 1 7  ? -5.101  -13.443 9.559  1.00 0.00 ? 108 VAL A CG1  10 
ATOM   4486 C  CG2  . VAL A 1 7  ? -5.636  -13.459 7.094  1.00 0.00 ? 108 VAL A CG2  10 
ATOM   4487 H  H    . VAL A 1 7  ? -4.845  -10.979 6.468  1.00 0.00 ? 108 VAL A H    10 
ATOM   4488 H  HA   . VAL A 1 7  ? -6.714  -11.413 8.461  1.00 0.00 ? 108 VAL A HA   10 
ATOM   4489 H  HB   . VAL A 1 7  ? -3.945  -12.536 8.012  1.00 0.00 ? 108 VAL A HB   10 
ATOM   4490 H  HG11 . VAL A 1 7  ? -4.220  -13.240 10.167 1.00 0.00 ? 108 VAL A HG11 10 
ATOM   4491 H  HG12 . VAL A 1 7  ? -5.995  -13.128 10.098 1.00 0.00 ? 108 VAL A HG12 10 
ATOM   4492 H  HG13 . VAL A 1 7  ? -5.161  -14.511 9.350  1.00 0.00 ? 108 VAL A HG13 10 
ATOM   4493 H  HG21 . VAL A 1 7  ? -6.720  -13.363 7.143  1.00 0.00 ? 108 VAL A HG21 10 
ATOM   4494 H  HG22 . VAL A 1 7  ? -5.278  -13.067 6.143  1.00 0.00 ? 108 VAL A HG22 10 
ATOM   4495 H  HG23 . VAL A 1 7  ? -5.360  -14.511 7.180  1.00 0.00 ? 108 VAL A HG23 10 
ATOM   4496 N  N    . CYS A 1 8  ? -3.811  -10.461 9.711  1.00 0.00 ? 109 CYS A N    10 
ATOM   4497 C  CA   . CYS A 1 8  ? -3.188  -9.754  10.818 1.00 0.00 ? 109 CYS A CA   10 
ATOM   4498 C  C    . CYS A 1 8  ? -2.647  -8.423  10.296 1.00 0.00 ? 109 CYS A C    10 
ATOM   4499 O  O    . CYS A 1 8  ? -2.105  -7.626  11.060 1.00 0.00 ? 109 CYS A O    10 
ATOM   4500 C  CB   . CYS A 1 8  ? -2.094  -10.595 11.481 1.00 0.00 ? 109 CYS A CB   10 
ATOM   4501 S  SG   . CYS A 1 8  ? -0.576  -10.565 10.459 1.00 0.00 ? 109 CYS A SG   10 
ATOM   4502 H  H    . CYS A 1 8  ? -3.172  -10.895 9.075  1.00 0.00 ? 109 CYS A H    10 
ATOM   4503 H  HA   . CYS A 1 8  ? -3.967  -9.591  11.563 1.00 0.00 ? 109 CYS A HA   10 
ATOM   4504 H  HB2  . CYS A 1 8  ? -1.879  -10.206 12.477 1.00 0.00 ? 109 CYS A HB2  10 
ATOM   4505 H  HB3  . CYS A 1 8  ? -2.438  -11.621 11.606 1.00 0.00 ? 109 CYS A HB3  10 
ATOM   4506 N  N    . THR A 1 9  ? -2.813  -8.222  8.997  1.00 0.00 ? 110 THR A N    10 
ATOM   4507 C  CA   . THR A 1 9  ? -2.349  -7.000  8.363  1.00 0.00 ? 110 THR A CA   10 
ATOM   4508 C  C    . THR A 1 9  ? -0.823  -7.009  8.240  1.00 0.00 ? 110 THR A C    10 
ATOM   4509 O  O    . THR A 1 9  ? -0.199  -5.956  8.125  1.00 0.00 ? 110 THR A O    10 
ATOM   4510 C  CB   . THR A 1 9  ? -2.885  -5.815  9.169  1.00 0.00 ? 110 THR A CB   10 
ATOM   4511 O  OG1  . THR A 1 9  ? -1.896  -5.601  10.172 1.00 0.00 ? 110 THR A OG1  10 
ATOM   4512 C  CG2  . THR A 1 9  ? -4.147  -6.168  9.959  1.00 0.00 ? 110 THR A CG2  10 
ATOM   4513 H  H    . THR A 1 9  ? -3.255  -8.875  8.382  1.00 0.00 ? 110 THR A H    10 
ATOM   4514 H  HA   . THR A 1 9  ? -2.750  -6.963  7.351  1.00 0.00 ? 110 THR A HA   10 
ATOM   4515 H  HB   . THR A 1 9  ? -3.058  -4.953  8.525  1.00 0.00 ? 110 THR A HB   10 
ATOM   4516 H  HG1  . THR A 1 9  ? -1.100  -5.144  9.776  1.00 0.00 ? 110 THR A HG1  10 
ATOM   4517 H  HG21 . THR A 1 9  ? -3.875  -6.425  10.983 1.00 0.00 ? 110 THR A HG21 10 
ATOM   4518 H  HG22 . THR A 1 9  ? -4.822  -5.313  9.965  1.00 0.00 ? 110 THR A HG22 10 
ATOM   4519 H  HG23 . THR A 1 9  ? -4.643  -7.019  9.491  1.00 0.00 ? 110 THR A HG23 10 
ATOM   4520 N  N    . ARG A 1 10 ? -0.267  -8.212  8.267  1.00 0.00 ? 111 ARG A N    10 
ATOM   4521 C  CA   . ARG A 1 10 ? 1.173   -8.373  8.161  1.00 0.00 ? 111 ARG A CA   10 
ATOM   4522 C  C    . ARG A 1 10 ? 1.639   -8.050  6.740  1.00 0.00 ? 111 ARG A C    10 
ATOM   4523 O  O    . ARG A 1 10 ? 1.136   -8.620  5.773  1.00 0.00 ? 111 ARG A O    10 
ATOM   4524 C  CB   . ARG A 1 10 ? 1.596   -9.799  8.516  1.00 0.00 ? 111 ARG A CB   10 
ATOM   4525 C  CG   . ARG A 1 10 ? 2.232   -9.853  9.907  1.00 0.00 ? 111 ARG A CG   10 
ATOM   4526 C  CD   . ARG A 1 10 ? 3.755   -9.957  9.809  1.00 0.00 ? 111 ARG A CD   10 
ATOM   4527 N  NE   . ARG A 1 10 ? 4.369   -8.629  10.033 1.00 0.00 ? 111 ARG A NE   10 
ATOM   4528 C  CZ   . ARG A 1 10 ? 5.688   -8.397  10.011 1.00 0.00 ? 111 ARG A CZ   10 
ATOM   4529 N  NH1  . ARG A 1 10 ? 6.497   -9.198  9.304  1.00 0.00 ? 111 ARG A NH1  10 
ATOM   4530 N  NH2  . ARG A 1 10 ? 6.200   -7.364  10.694 1.00 0.00 ? 111 ARG A NH2  10 
ATOM   4531 H  H    . ARG A 1 10 ? -0.782  -9.064  8.362  1.00 0.00 ? 111 ARG A H    10 
ATOM   4532 H  HA   . ARG A 1 10 ? 1.587   -7.666  8.880  1.00 0.00 ? 111 ARG A HA   10 
ATOM   4533 H  HB2  . ARG A 1 10 ? 0.728   -10.458 8.485  1.00 0.00 ? 111 ARG A HB2  10 
ATOM   4534 H  HB3  . ARG A 1 10 ? 2.303   -10.169 7.774  1.00 0.00 ? 111 ARG A HB3  10 
ATOM   4535 H  HG2  . ARG A 1 10 ? 1.960   -8.959  10.469 1.00 0.00 ? 111 ARG A HG2  10 
ATOM   4536 H  HG3  . ARG A 1 10 ? 1.840   -10.707 10.458 1.00 0.00 ? 111 ARG A HG3  10 
ATOM   4537 H  HD2  . ARG A 1 10 ? 4.128   -10.667 10.546 1.00 0.00 ? 111 ARG A HD2  10 
ATOM   4538 H  HD3  . ARG A 1 10 ? 4.040   -10.336 8.828  1.00 0.00 ? 111 ARG A HD3  10 
ATOM   4539 H  HE   . ARG A 1 10 ? 3.760   -7.856  10.213 1.00 0.00 ? 111 ARG A HE   10 
ATOM   4540 H  HH11 . ARG A 1 10 ? 6.568   -10.169 9.537  1.00 0.00 ? 111 ARG A HH11 10 
ATOM   4541 H  HH12 . ARG A 1 10 ? 7.030   -8.827  8.544  1.00 0.00 ? 111 ARG A HH12 10 
ATOM   4542 H  HH21 . ARG A 1 10 ? 5.591   -6.678  11.093 1.00 0.00 ? 111 ARG A HH21 10 
ATOM   4543 H  HH22 . ARG A 1 10 ? 7.190   -7.279  10.805 1.00 0.00 ? 111 ARG A HH22 10 
ATOM   4544 N  N    . ALA A 1 11 ? 2.595   -7.136  6.658  1.00 0.00 ? 112 ALA A N    10 
ATOM   4545 C  CA   . ALA A 1 11 ? 3.135   -6.730  5.372  1.00 0.00 ? 112 ALA A CA   10 
ATOM   4546 C  C    . ALA A 1 11 ? 4.454   -7.464  5.122  1.00 0.00 ? 112 ALA A C    10 
ATOM   4547 O  O    . ALA A 1 11 ? 5.258   -7.630  6.038  1.00 0.00 ? 112 ALA A O    10 
ATOM   4548 C  CB   . ALA A 1 11 ? 3.300   -5.209  5.345  1.00 0.00 ? 112 ALA A CB   10 
ATOM   4549 H  H    . ALA A 1 11 ? 2.998   -6.676  7.451  1.00 0.00 ? 112 ALA A H    10 
ATOM   4550 H  HA   . ALA A 1 11 ? 2.416   -7.018  4.604  1.00 0.00 ? 112 ALA A HA   10 
ATOM   4551 H  HB1  . ALA A 1 11 ? 2.419   -4.740  5.782  1.00 0.00 ? 112 ALA A HB1  10 
ATOM   4552 H  HB2  . ALA A 1 11 ? 4.184   -4.929  5.918  1.00 0.00 ? 112 ALA A HB2  10 
ATOM   4553 H  HB3  . ALA A 1 11 ? 3.415   -4.875  4.314  1.00 0.00 ? 112 ALA A HB3  10 
ATOM   4554 N  N    . PHE A 1 12 ? 4.635   -7.883  3.878  1.00 0.00 ? 113 PHE A N    10 
ATOM   4555 C  CA   . PHE A 1 12 ? 5.842   -8.595  3.497  1.00 0.00 ? 113 PHE A CA   10 
ATOM   4556 C  C    . PHE A 1 12 ? 6.454   -7.997  2.229  1.00 0.00 ? 113 PHE A C    10 
ATOM   4557 O  O    . PHE A 1 12 ? 5.754   -7.376  1.431  1.00 0.00 ? 113 PHE A O    10 
ATOM   4558 C  CB   . PHE A 1 12 ? 5.438   -10.044 3.220  1.00 0.00 ? 113 PHE A CB   10 
ATOM   4559 C  CG   . PHE A 1 12 ? 4.997   -10.816 4.466  1.00 0.00 ? 113 PHE A CG   10 
ATOM   4560 C  CD1  . PHE A 1 12 ? 5.928   -11.296 5.333  1.00 0.00 ? 113 PHE A CD1  10 
ATOM   4561 C  CD2  . PHE A 1 12 ? 3.674   -11.023 4.705  1.00 0.00 ? 113 PHE A CD2  10 
ATOM   4562 C  CE1  . PHE A 1 12 ? 5.519   -12.011 6.490  1.00 0.00 ? 113 PHE A CE1  10 
ATOM   4563 C  CE2  . PHE A 1 12 ? 3.266   -11.739 5.861  1.00 0.00 ? 113 PHE A CE2  10 
ATOM   4564 C  CZ   . PHE A 1 12 ? 4.196   -12.218 6.729  1.00 0.00 ? 113 PHE A CZ   10 
ATOM   4565 H  H    . PHE A 1 12 ? 3.975   -7.742  3.140  1.00 0.00 ? 113 PHE A H    10 
ATOM   4566 H  HA   . PHE A 1 12 ? 6.550   -8.497  4.320  1.00 0.00 ? 113 PHE A HA   10 
ATOM   4567 H  HB2  . PHE A 1 12 ? 4.625   -10.052 2.494  1.00 0.00 ? 113 PHE A HB2  10 
ATOM   4568 H  HB3  . PHE A 1 12 ? 6.279   -10.565 2.762  1.00 0.00 ? 113 PHE A HB3  10 
ATOM   4569 H  HD1  . PHE A 1 12 ? 6.989   -11.129 5.142  1.00 0.00 ? 113 PHE A HD1  10 
ATOM   4570 H  HD2  . PHE A 1 12 ? 2.928   -10.639 4.010  1.00 0.00 ? 113 PHE A HD2  10 
ATOM   4571 H  HE1  . PHE A 1 12 ? 6.266   -12.396 7.185  1.00 0.00 ? 113 PHE A HE1  10 
ATOM   4572 H  HE2  . PHE A 1 12 ? 2.205   -11.905 6.053  1.00 0.00 ? 113 PHE A HE2  10 
ATOM   4573 H  HZ   . PHE A 1 12 ? 3.882   -12.768 7.616  1.00 0.00 ? 113 PHE A HZ   10 
ATOM   4574 N  N    . ALA A 1 13 ? 7.753   -8.207  2.081  1.00 0.00 ? 114 ALA A N    10 
ATOM   4575 C  CA   . ALA A 1 13 ? 8.467   -7.697  0.922  1.00 0.00 ? 114 ALA A CA   10 
ATOM   4576 C  C    . ALA A 1 13 ? 8.292   -8.668  -0.247 1.00 0.00 ? 114 ALA A C    10 
ATOM   4577 O  O    . ALA A 1 13 ? 8.148   -8.245  -1.393 1.00 0.00 ? 114 ALA A O    10 
ATOM   4578 C  CB   . ALA A 1 13 ? 9.938   -7.477  1.284  1.00 0.00 ? 114 ALA A CB   10 
ATOM   4579 H  H    . ALA A 1 13 ? 8.316   -8.713  2.734  1.00 0.00 ? 114 ALA A H    10 
ATOM   4580 H  HA   . ALA A 1 13 ? 8.024   -6.737  0.657  1.00 0.00 ? 114 ALA A HA   10 
ATOM   4581 H  HB1  . ALA A 1 13 ? 10.467  -8.429  1.243  1.00 0.00 ? 114 ALA A HB1  10 
ATOM   4582 H  HB2  . ALA A 1 13 ? 10.386  -6.781  0.575  1.00 0.00 ? 114 ALA A HB2  10 
ATOM   4583 H  HB3  . ALA A 1 13 ? 10.007  -7.067  2.291  1.00 0.00 ? 114 ALA A HB3  10 
ATOM   4584 N  N    . ARG A 1 14 ? 8.312   -9.950  0.083  1.00 0.00 ? 115 ARG A N    10 
ATOM   4585 C  CA   . ARG A 1 14 ? 8.158   -10.985 -0.926 1.00 0.00 ? 115 ARG A CA   10 
ATOM   4586 C  C    . ARG A 1 14 ? 6.753   -11.587 -0.859 1.00 0.00 ? 115 ARG A C    10 
ATOM   4587 O  O    . ARG A 1 14 ? 6.339   -12.090 0.185  1.00 0.00 ? 115 ARG A O    10 
ATOM   4588 C  CB   . ARG A 1 14 ? 9.192   -12.096 -0.737 1.00 0.00 ? 115 ARG A CB   10 
ATOM   4589 C  CG   . ARG A 1 14 ? 10.539  -11.523 -0.290 1.00 0.00 ? 115 ARG A CG   10 
ATOM   4590 C  CD   . ARG A 1 14 ? 10.994  -10.402 -1.225 1.00 0.00 ? 115 ARG A CD   10 
ATOM   4591 N  NE   . ARG A 1 14 ? 12.468  -10.420 -1.357 1.00 0.00 ? 115 ARG A NE   10 
ATOM   4592 C  CZ   . ARG A 1 14 ? 13.207  -9.349  -1.677 1.00 0.00 ? 115 ARG A CZ   10 
ATOM   4593 N  NH1  . ARG A 1 14 ? 12.871  -8.594  -2.733 1.00 0.00 ? 115 ARG A NH1  10 
ATOM   4594 N  NH2  . ARG A 1 14 ? 14.282  -9.032  -0.942 1.00 0.00 ? 115 ARG A NH2  10 
ATOM   4595 H  H    . ARG A 1 14 ? 8.431   -10.286 1.018  1.00 0.00 ? 115 ARG A H    10 
ATOM   4596 H  HA   . ARG A 1 14 ? 8.320   -10.474 -1.876 1.00 0.00 ? 115 ARG A HA   10 
ATOM   4597 H  HB2  . ARG A 1 14 ? 8.832   -12.811 0.004  1.00 0.00 ? 115 ARG A HB2  10 
ATOM   4598 H  HB3  . ARG A 1 14 ? 9.318   -12.644 -1.672 1.00 0.00 ? 115 ARG A HB3  10 
ATOM   4599 H  HG2  . ARG A 1 14 ? 10.455  -11.143 0.728  1.00 0.00 ? 115 ARG A HG2  10 
ATOM   4600 H  HG3  . ARG A 1 14 ? 11.287  -12.315 -0.275 1.00 0.00 ? 115 ARG A HG3  10 
ATOM   4601 H  HD2  . ARG A 1 14 ? 10.531  -10.522 -2.204 1.00 0.00 ? 115 ARG A HD2  10 
ATOM   4602 H  HD3  . ARG A 1 14 ? 10.668  -9.438  -0.835 1.00 0.00 ? 115 ARG A HD3  10 
ATOM   4603 H  HE   . ARG A 1 14 ? 12.942  -11.286 -1.198 1.00 0.00 ? 115 ARG A HE   10 
ATOM   4604 H  HH11 . ARG A 1 14 ? 13.155  -8.866  -3.652 1.00 0.00 ? 115 ARG A HH11 10 
ATOM   4605 H  HH12 . ARG A 1 14 ? 12.337  -7.760  -2.601 1.00 0.00 ? 115 ARG A HH12 10 
ATOM   4606 H  HH21 . ARG A 1 14 ? 14.845  -9.756  -0.544 1.00 0.00 ? 115 ARG A HH21 10 
ATOM   4607 H  HH22 . ARG A 1 14 ? 14.519  -8.072  -0.792 1.00 0.00 ? 115 ARG A HH22 10 
ATOM   4608 N  N    . GLN A 1 15 ? 6.059   -11.516 -1.985 1.00 0.00 ? 116 GLN A N    10 
ATOM   4609 C  CA   . GLN A 1 15 ? 4.709   -12.049 -2.066 1.00 0.00 ? 116 GLN A CA   10 
ATOM   4610 C  C    . GLN A 1 15 ? 4.649   -13.444 -1.441 1.00 0.00 ? 116 GLN A C    10 
ATOM   4611 O  O    . GLN A 1 15 ? 3.795   -13.714 -0.599 1.00 0.00 ? 116 GLN A O    10 
ATOM   4612 C  CB   . GLN A 1 15 ? 4.217   -12.076 -3.515 1.00 0.00 ? 116 GLN A CB   10 
ATOM   4613 C  CG   . GLN A 1 15 ? 3.518   -10.766 -3.882 1.00 0.00 ? 116 GLN A CG   10 
ATOM   4614 C  CD   . GLN A 1 15 ? 1.997   -10.927 -3.846 1.00 0.00 ? 116 GLN A CD   10 
ATOM   4615 O  OE1  . GLN A 1 15 ? 1.425   -11.458 -2.908 1.00 0.00 ? 116 GLN A OE1  10 
ATOM   4616 N  NE2  . GLN A 1 15 ? 1.376   -10.441 -4.917 1.00 0.00 ? 116 GLN A NE2  10 
ATOM   4617 H  H    . GLN A 1 15 ? 6.403   -11.106 -2.829 1.00 0.00 ? 116 GLN A H    10 
ATOM   4618 H  HA   . GLN A 1 15 ? 4.090   -11.359 -1.492 1.00 0.00 ? 116 GLN A HA   10 
ATOM   4619 H  HB2  . GLN A 1 15 ? 5.060   -12.242 -4.186 1.00 0.00 ? 116 GLN A HB2  10 
ATOM   4620 H  HB3  . GLN A 1 15 ? 3.530   -12.911 -3.654 1.00 0.00 ? 116 GLN A HB3  10 
ATOM   4621 H  HG2  . GLN A 1 15 ? 3.821   -9.982  -3.187 1.00 0.00 ? 116 GLN A HG2  10 
ATOM   4622 H  HG3  . GLN A 1 15 ? 3.830   -10.449 -4.877 1.00 0.00 ? 116 GLN A HG3  10 
ATOM   4623 H  HE21 . GLN A 1 15 ? 1.346   -9.454  -5.073 1.00 0.00 ? 116 GLN A HE21 10 
ATOM   4624 H  HE22 . GLN A 1 15 ? 0.939   -11.064 -5.567 1.00 0.00 ? 116 GLN A HE22 10 
ATOM   4625 N  N    . GLU A 1 16 ? 5.570   -14.292 -1.876 1.00 0.00 ? 117 GLU A N    10 
ATOM   4626 C  CA   . GLU A 1 16 ? 5.632   -15.653 -1.369 1.00 0.00 ? 117 GLU A CA   10 
ATOM   4627 C  C    . GLU A 1 16 ? 5.573   -15.652 0.160  1.00 0.00 ? 117 GLU A C    10 
ATOM   4628 O  O    . GLU A 1 16 ? 4.964   -16.536 0.761  1.00 0.00 ? 117 GLU A O    10 
ATOM   4629 C  CB   . GLU A 1 16 ? 6.890   -16.366 -1.868 1.00 0.00 ? 117 GLU A CB   10 
ATOM   4630 C  CG   . GLU A 1 16 ? 7.479   -17.265 -0.780 1.00 0.00 ? 117 GLU A CG   10 
ATOM   4631 C  CD   . GLU A 1 16 ? 8.383   -18.340 -1.387 1.00 0.00 ? 117 GLU A CD   10 
ATOM   4632 O  OE1  . GLU A 1 16 ? 7.926   -18.987 -2.353 1.00 0.00 ? 117 GLU A OE1  10 
ATOM   4633 O  OE2  . GLU A 1 16 ? 9.511   -18.491 -0.869 1.00 0.00 ? 117 GLU A OE2  10 
ATOM   4634 H  H    . GLU A 1 16 ? 6.262   -14.064 -2.561 1.00 0.00 ? 117 GLU A H    10 
ATOM   4635 H  HA   . GLU A 1 16 ? 4.753   -16.154 -1.774 1.00 0.00 ? 117 GLU A HA   10 
ATOM   4636 H  HB2  . GLU A 1 16 ? 6.649   -16.964 -2.747 1.00 0.00 ? 117 GLU A HB2  10 
ATOM   4637 H  HB3  . GLU A 1 16 ? 7.632   -15.630 -2.178 1.00 0.00 ? 117 GLU A HB3  10 
ATOM   4638 H  HG2  . GLU A 1 16 ? 8.049   -16.661 -0.074 1.00 0.00 ? 117 GLU A HG2  10 
ATOM   4639 H  HG3  . GLU A 1 16 ? 6.674   -17.737 -0.218 1.00 0.00 ? 117 GLU A HG3  10 
ATOM   4640 N  N    . ALA A 1 17 ? 6.213   -14.652 0.745  1.00 0.00 ? 118 ALA A N    10 
ATOM   4641 C  CA   . ALA A 1 17 ? 6.241   -14.525 2.193  1.00 0.00 ? 118 ALA A CA   10 
ATOM   4642 C  C    . ALA A 1 17 ? 4.816   -14.314 2.709  1.00 0.00 ? 118 ALA A C    10 
ATOM   4643 O  O    . ALA A 1 17 ? 4.492   -14.715 3.826  1.00 0.00 ? 118 ALA A O    10 
ATOM   4644 C  CB   . ALA A 1 17 ? 7.179   -13.382 2.587  1.00 0.00 ? 118 ALA A CB   10 
ATOM   4645 H  H    . ALA A 1 17 ? 6.707   -13.937 0.249  1.00 0.00 ? 118 ALA A H    10 
ATOM   4646 H  HA   . ALA A 1 17 ? 6.633   -15.456 2.600  1.00 0.00 ? 118 ALA A HA   10 
ATOM   4647 H  HB1  . ALA A 1 17 ? 7.765   -13.077 1.721  1.00 0.00 ? 118 ALA A HB1  10 
ATOM   4648 H  HB2  . ALA A 1 17 ? 6.591   -12.537 2.945  1.00 0.00 ? 118 ALA A HB2  10 
ATOM   4649 H  HB3  . ALA A 1 17 ? 7.850   -13.720 3.378  1.00 0.00 ? 118 ALA A HB3  10 
ATOM   4650 N  N    . LEU A 1 18 ? 4.004   -13.686 1.871  1.00 0.00 ? 119 LEU A N    10 
ATOM   4651 C  CA   . LEU A 1 18 ? 2.621   -13.418 2.229  1.00 0.00 ? 119 LEU A CA   10 
ATOM   4652 C  C    . LEU A 1 18 ? 1.806   -14.706 2.097  1.00 0.00 ? 119 LEU A C    10 
ATOM   4653 O  O    . LEU A 1 18 ? 1.311   -15.236 3.091  1.00 0.00 ? 119 LEU A O    10 
ATOM   4654 C  CB   . LEU A 1 18 ? 2.071   -12.254 1.403  1.00 0.00 ? 119 LEU A CB   10 
ATOM   4655 C  CG   . LEU A 1 18 ? 0.546   -12.152 1.322  1.00 0.00 ? 119 LEU A CG   10 
ATOM   4656 C  CD1  . LEU A 1 18 ? -0.075  -12.091 2.719  1.00 0.00 ? 119 LEU A CD1  10 
ATOM   4657 C  CD2  . LEU A 1 18 ? 0.122   -10.966 0.453  1.00 0.00 ? 119 LEU A CD2  10 
ATOM   4658 H  H    . LEU A 1 18 ? 4.276   -13.364 0.964  1.00 0.00 ? 119 LEU A H    10 
ATOM   4659 H  HA   . LEU A 1 18 ? 2.609   -13.107 3.274  1.00 0.00 ? 119 LEU A HA   10 
ATOM   4660 H  HB2  . LEU A 1 18 ? 2.455   -11.324 1.822  1.00 0.00 ? 119 LEU A HB2  10 
ATOM   4661 H  HB3  . LEU A 1 18 ? 2.465   -12.334 0.390  1.00 0.00 ? 119 LEU A HB3  10 
ATOM   4662 H  HG   . LEU A 1 18 ? 0.169   -13.055 0.840  1.00 0.00 ? 119 LEU A HG   10 
ATOM   4663 H  HD11 . LEU A 1 18 ? -0.472  -13.071 2.983  1.00 0.00 ? 119 LEU A HD11 10 
ATOM   4664 H  HD12 . LEU A 1 18 ? 0.686   -11.800 3.442  1.00 0.00 ? 119 LEU A HD12 10 
ATOM   4665 H  HD13 . LEU A 1 18 ? -0.882  -11.358 2.725  1.00 0.00 ? 119 LEU A HD13 10 
ATOM   4666 H  HD21 . LEU A 1 18 ? -0.584  -11.305 -0.306 1.00 0.00 ? 119 LEU A HD21 10 
ATOM   4667 H  HD22 . LEU A 1 18 ? -0.352  -10.210 1.078  1.00 0.00 ? 119 LEU A HD22 10 
ATOM   4668 H  HD23 . LEU A 1 18 ? 1.000   -10.539 -0.033 1.00 0.00 ? 119 LEU A HD23 10 
ATOM   4669 N  N    . LYS A 1 19 ? 1.691   -15.172 0.862  1.00 0.00 ? 120 LYS A N    10 
ATOM   4670 C  CA   . LYS A 1 19 ? 0.945   -16.388 0.587  1.00 0.00 ? 120 LYS A CA   10 
ATOM   4671 C  C    . LYS A 1 19 ? 1.220   -17.411 1.691  1.00 0.00 ? 120 LYS A C    10 
ATOM   4672 O  O    . LYS A 1 19 ? 0.300   -17.848 2.380  1.00 0.00 ? 120 LYS A O    10 
ATOM   4673 C  CB   . LYS A 1 19 ? 1.256   -16.902 -0.820 1.00 0.00 ? 120 LYS A CB   10 
ATOM   4674 C  CG   . LYS A 1 19 ? -0.024  -17.057 -1.643 1.00 0.00 ? 120 LYS A CG   10 
ATOM   4675 C  CD   . LYS A 1 19 ? 0.228   -16.734 -3.117 1.00 0.00 ? 120 LYS A CD   10 
ATOM   4676 C  CE   . LYS A 1 19 ? -0.962  -17.153 -3.982 1.00 0.00 ? 120 LYS A CE   10 
ATOM   4677 N  NZ   . LYS A 1 19 ? -1.411  -18.516 -3.620 1.00 0.00 ? 120 LYS A NZ   10 
ATOM   4678 H  H    . LYS A 1 19 ? 2.098   -14.735 0.060  1.00 0.00 ? 120 LYS A H    10 
ATOM   4679 H  HA   . LYS A 1 19 ? -0.115  -16.132 0.609  1.00 0.00 ? 120 LYS A HA   10 
ATOM   4680 H  HB2  . LYS A 1 19 ? 1.933   -16.211 -1.322 1.00 0.00 ? 120 LYS A HB2  10 
ATOM   4681 H  HB3  . LYS A 1 19 ? 1.770   -17.861 -0.755 1.00 0.00 ? 120 LYS A HB3  10 
ATOM   4682 H  HG2  . LYS A 1 19 ? -0.399  -18.077 -1.549 1.00 0.00 ? 120 LYS A HG2  10 
ATOM   4683 H  HG3  . LYS A 1 19 ? -0.797  -16.398 -1.249 1.00 0.00 ? 120 LYS A HG3  10 
ATOM   4684 H  HD2  . LYS A 1 19 ? 0.408   -15.666 -3.233 1.00 0.00 ? 120 LYS A HD2  10 
ATOM   4685 H  HD3  . LYS A 1 19 ? 1.128   -17.247 -3.456 1.00 0.00 ? 120 LYS A HD3  10 
ATOM   4686 H  HE2  . LYS A 1 19 ? -1.782  -16.447 -3.850 1.00 0.00 ? 120 LYS A HE2  10 
ATOM   4687 H  HE3  . LYS A 1 19 ? -0.682  -17.124 -5.035 1.00 0.00 ? 120 LYS A HE3  10 
ATOM   4688 H  HZ1  . LYS A 1 19 ? -1.795  -18.966 -4.426 1.00 0.00 ? 120 LYS A HZ1  10 
ATOM   4689 H  HZ2  . LYS A 1 19 ? -0.633  -19.045 -3.282 1.00 0.00 ? 120 LYS A HZ2  10 
ATOM   4690 H  HZ3  . LYS A 1 19 ? -2.110  -18.458 -2.906 1.00 0.00 ? 120 LYS A HZ3  10 
ATOM   4691 N  N    . ARG A 1 20 ? 2.490   -17.762 1.823  1.00 0.00 ? 121 ARG A N    10 
ATOM   4692 C  CA   . ARG A 1 20 ? 2.898   -18.727 2.831  1.00 0.00 ? 121 ARG A CA   10 
ATOM   4693 C  C    . ARG A 1 20 ? 2.377   -18.308 4.208  1.00 0.00 ? 121 ARG A C    10 
ATOM   4694 O  O    . ARG A 1 20 ? 1.880   -19.139 4.966  1.00 0.00 ? 121 ARG A O    10 
ATOM   4695 C  CB   . ARG A 1 20 ? 4.422   -18.853 2.887  1.00 0.00 ? 121 ARG A CB   10 
ATOM   4696 C  CG   . ARG A 1 20 ? 4.871   -20.257 2.476  1.00 0.00 ? 121 ARG A CG   10 
ATOM   4697 C  CD   . ARG A 1 20 ? 6.177   -20.642 3.176  1.00 0.00 ? 121 ARG A CD   10 
ATOM   4698 N  NE   . ARG A 1 20 ? 6.892   -21.666 2.383  1.00 0.00 ? 121 ARG A NE   10 
ATOM   4699 C  CZ   . ARG A 1 20 ? 6.540   -22.958 2.331  1.00 0.00 ? 121 ARG A CZ   10 
ATOM   4700 N  NH1  . ARG A 1 20 ? 5.676   -23.454 3.229  1.00 0.00 ? 121 ARG A NH1  10 
ATOM   4701 N  NH2  . ARG A 1 20 ? 7.051   -23.755 1.383  1.00 0.00 ? 121 ARG A NH2  10 
ATOM   4702 H  H    . ARG A 1 20 ? 3.232   -17.403 1.258  1.00 0.00 ? 121 ARG A H    10 
ATOM   4703 H  HA   . ARG A 1 20 ? 2.452   -19.669 2.514  1.00 0.00 ? 121 ARG A HA   10 
ATOM   4704 H  HB2  . ARG A 1 20 ? 4.876   -18.114 2.228  1.00 0.00 ? 121 ARG A HB2  10 
ATOM   4705 H  HB3  . ARG A 1 20 ? 4.772   -18.638 3.897  1.00 0.00 ? 121 ARG A HB3  10 
ATOM   4706 H  HG2  . ARG A 1 20 ? 4.094   -20.979 2.725  1.00 0.00 ? 121 ARG A HG2  10 
ATOM   4707 H  HG3  . ARG A 1 20 ? 5.008   -20.296 1.395  1.00 0.00 ? 121 ARG A HG3  10 
ATOM   4708 H  HD2  . ARG A 1 20 ? 6.806   -19.761 3.299  1.00 0.00 ? 121 ARG A HD2  10 
ATOM   4709 H  HD3  . ARG A 1 20 ? 5.964   -21.025 4.173  1.00 0.00 ? 121 ARG A HD3  10 
ATOM   4710 H  HE   . ARG A 1 20 ? 7.689   -21.377 1.852  1.00 0.00 ? 121 ARG A HE   10 
ATOM   4711 H  HH11 . ARG A 1 20 ? 5.297   -22.859 3.939  1.00 0.00 ? 121 ARG A HH11 10 
ATOM   4712 H  HH12 . ARG A 1 20 ? 5.412   -24.416 3.189  1.00 0.00 ? 121 ARG A HH12 10 
ATOM   4713 H  HH21 . ARG A 1 20 ? 8.022   -23.990 1.397  1.00 0.00 ? 121 ARG A HH21 10 
ATOM   4714 H  HH22 . ARG A 1 20 ? 6.460   -24.115 0.661  1.00 0.00 ? 121 ARG A HH22 10 
ATOM   4715 N  N    . HIS A 1 21 ? 2.509   -17.020 4.488  1.00 0.00 ? 122 HIS A N    10 
ATOM   4716 C  CA   . HIS A 1 21 ? 2.057   -16.481 5.760  1.00 0.00 ? 122 HIS A CA   10 
ATOM   4717 C  C    . HIS A 1 21 ? 0.567   -16.776 5.942  1.00 0.00 ? 122 HIS A C    10 
ATOM   4718 O  O    . HIS A 1 21 ? 0.163   -17.343 6.957  1.00 0.00 ? 122 HIS A O    10 
ATOM   4719 C  CB   . HIS A 1 21 ? 2.384   -14.990 5.865  1.00 0.00 ? 122 HIS A CB   10 
ATOM   4720 C  CG   . HIS A 1 21 ? 1.695   -14.289 7.012  1.00 0.00 ? 122 HIS A CG   10 
ATOM   4721 N  ND1  . HIS A 1 21 ? 2.250   -14.198 8.277  1.00 0.00 ? 122 HIS A ND1  10 
ATOM   4722 C  CD2  . HIS A 1 21 ? 0.493   -13.647 7.070  1.00 0.00 ? 122 HIS A CD2  10 
ATOM   4723 C  CE1  . HIS A 1 21 ? 1.409   -13.530 9.054  1.00 0.00 ? 122 HIS A CE1  10 
ATOM   4724 N  NE2  . HIS A 1 21 ? 0.322   -13.190 8.305  1.00 0.00 ? 122 HIS A NE2  10 
ATOM   4725 H  H    . HIS A 1 21 ? 2.914   -16.351 3.866  1.00 0.00 ? 122 HIS A H    10 
ATOM   4726 H  HA   . HIS A 1 21 ? 2.620   -16.999 6.537  1.00 0.00 ? 122 HIS A HA   10 
ATOM   4727 H  HB2  . HIS A 1 21 ? 3.462   -14.871 5.975  1.00 0.00 ? 122 HIS A HB2  10 
ATOM   4728 H  HB3  . HIS A 1 21 ? 2.103   -14.500 4.931  1.00 0.00 ? 122 HIS A HB3  10 
ATOM   4729 H  HD1  . HIS A 1 21 ? 3.133   -14.573 8.556  1.00 0.00 ? 122 HIS A HD1  10 
ATOM   4730 H  HD2  . HIS A 1 21 ? -0.208  -13.529 6.244  1.00 0.00 ? 122 HIS A HD2  10 
ATOM   4731 H  HE1  . HIS A 1 21 ? 1.562   -13.294 10.107 1.00 0.00 ? 122 HIS A HE1  10 
ATOM   4732 N  N    . TYR A 1 22 ? -0.209  -16.377 4.945  1.00 0.00 ? 123 TYR A N    10 
ATOM   4733 C  CA   . TYR A 1 22 ? -1.645  -16.592 4.983  1.00 0.00 ? 123 TYR A CA   10 
ATOM   4734 C  C    . TYR A 1 22 ? -1.974  -18.048 5.317  1.00 0.00 ? 123 TYR A C    10 
ATOM   4735 O  O    . TYR A 1 22 ? -2.992  -18.331 5.946  1.00 0.00 ? 123 TYR A O    10 
ATOM   4736 C  CB   . TYR A 1 22 ? -2.156  -16.276 3.575  1.00 0.00 ? 123 TYR A CB   10 
ATOM   4737 C  CG   . TYR A 1 22 ? -3.216  -15.175 3.531  1.00 0.00 ? 123 TYR A CG   10 
ATOM   4738 C  CD1  . TYR A 1 22 ? -4.398  -15.326 4.227  1.00 0.00 ? 123 TYR A CD1  10 
ATOM   4739 C  CD2  . TYR A 1 22 ? -2.991  -14.030 2.793  1.00 0.00 ? 123 TYR A CD2  10 
ATOM   4740 C  CE1  . TYR A 1 22 ? -5.396  -14.289 4.185  1.00 0.00 ? 123 TYR A CE1  10 
ATOM   4741 C  CE2  . TYR A 1 22 ? -3.989  -12.994 2.751  1.00 0.00 ? 123 TYR A CE2  10 
ATOM   4742 C  CZ   . TYR A 1 22 ? -5.143  -13.174 3.449  1.00 0.00 ? 123 TYR A CZ   10 
ATOM   4743 O  OH   . TYR A 1 22 ? -6.085  -12.194 3.409  1.00 0.00 ? 123 TYR A OH   10 
ATOM   4744 H  H    . TYR A 1 22 ? 0.129   -15.917 4.124  1.00 0.00 ? 123 TYR A H    10 
ATOM   4745 H  HA   . TYR A 1 22 ? -2.061  -15.946 5.756  1.00 0.00 ? 123 TYR A HA   10 
ATOM   4746 H  HB2  . TYR A 1 22 ? -1.312  -15.981 2.952  1.00 0.00 ? 123 TYR A HB2  10 
ATOM   4747 H  HB3  . TYR A 1 22 ? -2.571  -17.185 3.139  1.00 0.00 ? 123 TYR A HB3  10 
ATOM   4748 H  HD1  . TYR A 1 22 ? -4.575  -16.230 4.810  1.00 0.00 ? 123 TYR A HD1  10 
ATOM   4749 H  HD2  . TYR A 1 22 ? -2.058  -13.911 2.243  1.00 0.00 ? 123 TYR A HD2  10 
ATOM   4750 H  HE1  . TYR A 1 22 ? -6.334  -14.396 4.730  1.00 0.00 ? 123 TYR A HE1  10 
ATOM   4751 H  HE2  . TYR A 1 22 ? -3.824  -12.084 2.173  1.00 0.00 ? 123 TYR A HE2  10 
ATOM   4752 H  HH   . TYR A 1 22 ? -6.315  -11.979 2.460  1.00 0.00 ? 123 TYR A HH   10 
ATOM   4753 N  N    . ARG A 1 23 ? -1.091  -18.935 4.881  1.00 0.00 ? 124 ARG A N    10 
ATOM   4754 C  CA   . ARG A 1 23 ? -1.274  -20.356 5.127  1.00 0.00 ? 124 ARG A CA   10 
ATOM   4755 C  C    . ARG A 1 23 ? -1.121  -20.662 6.619  1.00 0.00 ? 124 ARG A C    10 
ATOM   4756 O  O    . ARG A 1 23 ? -1.630  -21.670 7.105  1.00 0.00 ? 124 ARG A O    10 
ATOM   4757 C  CB   . ARG A 1 23 ? -0.261  -21.187 4.336  1.00 0.00 ? 124 ARG A CB   10 
ATOM   4758 C  CG   . ARG A 1 23 ? -0.952  -21.988 3.231  1.00 0.00 ? 124 ARG A CG   10 
ATOM   4759 C  CD   . ARG A 1 23 ? -0.748  -23.490 3.435  1.00 0.00 ? 124 ARG A CD   10 
ATOM   4760 N  NE   . ARG A 1 23 ? 0.665   -23.768 3.777  1.00 0.00 ? 124 ARG A NE   10 
ATOM   4761 C  CZ   . ARG A 1 23 ? 1.052   -24.601 4.753  1.00 0.00 ? 124 ARG A CZ   10 
ATOM   4762 N  NH1  . ARG A 1 23 ? 0.199   -25.517 5.229  1.00 0.00 ? 124 ARG A NH1  10 
ATOM   4763 N  NH2  . ARG A 1 23 ? 2.292   -24.518 5.253  1.00 0.00 ? 124 ARG A NH2  10 
ATOM   4764 H  H    . ARG A 1 23 ? -0.265  -18.698 4.370  1.00 0.00 ? 124 ARG A H    10 
ATOM   4765 H  HA   . ARG A 1 23 ? -2.287  -20.569 4.785  1.00 0.00 ? 124 ARG A HA   10 
ATOM   4766 H  HB2  . ARG A 1 23 ? 0.490   -20.530 3.898  1.00 0.00 ? 124 ARG A HB2  10 
ATOM   4767 H  HB3  . ARG A 1 23 ? 0.263   -21.866 5.010  1.00 0.00 ? 124 ARG A HB3  10 
ATOM   4768 H  HG2  . ARG A 1 23 ? -2.018  -21.760 3.224  1.00 0.00 ? 124 ARG A HG2  10 
ATOM   4769 H  HG3  . ARG A 1 23 ? -0.555  -21.691 2.260  1.00 0.00 ? 124 ARG A HG3  10 
ATOM   4770 H  HD2  . ARG A 1 23 ? -1.401  -23.850 4.230  1.00 0.00 ? 124 ARG A HD2  10 
ATOM   4771 H  HD3  . ARG A 1 23 ? -1.023  -24.029 2.528  1.00 0.00 ? 124 ARG A HD3  10 
ATOM   4772 H  HE   . ARG A 1 23 ? 1.375   -23.305 3.247  1.00 0.00 ? 124 ARG A HE   10 
ATOM   4773 H  HH11 . ARG A 1 23 ? -0.673  -25.230 5.627  1.00 0.00 ? 124 ARG A HH11 10 
ATOM   4774 H  HH12 . ARG A 1 23 ? 0.433   -26.489 5.187  1.00 0.00 ? 124 ARG A HH12 10 
ATOM   4775 H  HH21 . ARG A 1 23 ? 2.795   -23.654 5.201  1.00 0.00 ? 124 ARG A HH21 10 
ATOM   4776 H  HH22 . ARG A 1 23 ? 2.716   -25.318 5.676  1.00 0.00 ? 124 ARG A HH22 10 
ATOM   4777 N  N    . SER A 1 24 ? -0.417  -19.771 7.303  1.00 0.00 ? 125 SER A N    10 
ATOM   4778 C  CA   . SER A 1 24 ? -0.191  -19.933 8.729  1.00 0.00 ? 125 SER A CA   10 
ATOM   4779 C  C    . SER A 1 24 ? -1.455  -19.560 9.505  1.00 0.00 ? 125 SER A C    10 
ATOM   4780 O  O    . SER A 1 24 ? -1.649  -20.009 10.633 1.00 0.00 ? 125 SER A O    10 
ATOM   4781 C  CB   . SER A 1 24 ? 0.992   -19.082 9.199  1.00 0.00 ? 125 SER A CB   10 
ATOM   4782 O  OG   . SER A 1 24 ? 0.667   -17.695 9.243  1.00 0.00 ? 125 SER A OG   10 
ATOM   4783 H  H    . SER A 1 24 ? -0.006  -18.953 6.899  1.00 0.00 ? 125 SER A H    10 
ATOM   4784 H  HA   . SER A 1 24 ? 0.045   -20.989 8.865  1.00 0.00 ? 125 SER A HA   10 
ATOM   4785 H  HB2  . SER A 1 24 ? 1.306   -19.413 10.189 1.00 0.00 ? 125 SER A HB2  10 
ATOM   4786 H  HB3  . SER A 1 24 ? 1.837   -19.236 8.528  1.00 0.00 ? 125 SER A HB3  10 
ATOM   4787 H  HG   . SER A 1 24 ? 1.244   -17.231 9.914  1.00 0.00 ? 125 SER A HG   10 
ATOM   4788 N  N    . HIS A 1 25 ? -2.281  -18.742 8.870  1.00 0.00 ? 126 HIS A N    10 
ATOM   4789 C  CA   . HIS A 1 25 ? -3.521  -18.303 9.487  1.00 0.00 ? 126 HIS A CA   10 
ATOM   4790 C  C    . HIS A 1 25 ? -4.553  -19.431 9.422  1.00 0.00 ? 126 HIS A C    10 
ATOM   4791 O  O    . HIS A 1 25 ? -5.690  -19.262 9.863  1.00 0.00 ? 126 HIS A O    10 
ATOM   4792 C  CB   . HIS A 1 25 ? -4.018  -17.006 8.845  1.00 0.00 ? 126 HIS A CB   10 
ATOM   4793 C  CG   . HIS A 1 25 ? -3.279  -15.771 9.304  1.00 0.00 ? 126 HIS A CG   10 
ATOM   4794 N  ND1  . HIS A 1 25 ? -3.044  -15.492 10.639 1.00 0.00 ? 126 HIS A ND1  10 
ATOM   4795 C  CD2  . HIS A 1 25 ? -2.725  -14.749 8.592  1.00 0.00 ? 126 HIS A CD2  10 
ATOM   4796 C  CE1  . HIS A 1 25 ? -2.379  -14.348 10.716 1.00 0.00 ? 126 HIS A CE1  10 
ATOM   4797 N  NE2  . HIS A 1 25 ? -2.183  -13.889 9.446  1.00 0.00 ? 126 HIS A NE2  10 
ATOM   4798 H  H    . HIS A 1 25 ? -2.114  -18.380 7.952  1.00 0.00 ? 126 HIS A H    10 
ATOM   4799 H  HA   . HIS A 1 25 ? -3.293  -18.091 10.531 1.00 0.00 ? 126 HIS A HA   10 
ATOM   4800 H  HB2  . HIS A 1 25 ? -3.926  -17.090 7.763  1.00 0.00 ? 126 HIS A HB2  10 
ATOM   4801 H  HB3  . HIS A 1 25 ? -5.078  -16.886 9.068  1.00 0.00 ? 126 HIS A HB3  10 
ATOM   4802 H  HD1  . HIS A 1 25 ? -3.328  -16.056 11.414 1.00 0.00 ? 126 HIS A HD1  10 
ATOM   4803 H  HD2  . HIS A 1 25 ? -2.729  -14.652 7.507  1.00 0.00 ? 126 HIS A HD2  10 
ATOM   4804 H  HE1  . HIS A 1 25 ? -2.046  -13.860 11.632 1.00 0.00 ? 126 HIS A HE1  10 
ATOM   4805 N  N    . THR A 1 26 ? -4.121  -20.554 8.869  1.00 0.00 ? 127 THR A N    10 
ATOM   4806 C  CA   . THR A 1 26 ? -4.993  -21.709 8.740  1.00 0.00 ? 127 THR A CA   10 
ATOM   4807 C  C    . THR A 1 26 ? -4.413  -22.904 9.499  1.00 0.00 ? 127 THR A C    10 
ATOM   4808 O  O    . THR A 1 26 ? -4.820  -23.185 10.625 1.00 0.00 ? 127 THR A O    10 
ATOM   4809 C  CB   . THR A 1 26 ? -5.203  -21.979 7.249  1.00 0.00 ? 127 THR A CB   10 
ATOM   4810 O  OG1  . THR A 1 26 ? -3.936  -21.694 6.663  1.00 0.00 ? 127 THR A OG1  10 
ATOM   4811 C  CG2  . THR A 1 26 ? -6.151  -20.970 6.598  1.00 0.00 ? 127 THR A CG2  10 
ATOM   4812 H  H    . THR A 1 26 ? -3.195  -20.682 8.513  1.00 0.00 ? 127 THR A H    10 
ATOM   4813 H  HA   . THR A 1 26 ? -5.951  -21.470 9.205  1.00 0.00 ? 127 THR A HA   10 
ATOM   4814 H  HB   . THR A 1 26 ? -5.547  -23.000 7.083  1.00 0.00 ? 127 THR A HB   10 
ATOM   4815 H  HG1  . THR A 1 26 ? -4.013  -21.691 5.665  1.00 0.00 ? 127 THR A HG1  10 
ATOM   4816 H  HG21 . THR A 1 26 ? -7.162  -21.127 6.972  1.00 0.00 ? 127 THR A HG21 10 
ATOM   4817 H  HG22 . THR A 1 26 ? -5.826  -19.958 6.841  1.00 0.00 ? 127 THR A HG22 10 
ATOM   4818 H  HG23 . THR A 1 26 ? -6.138  -21.105 5.516  1.00 0.00 ? 127 THR A HG23 10 
ATOM   4819 N  N    . ASN A 1 27 ? -3.471  -23.573 8.851  1.00 0.00 ? 128 ASN A N    10 
ATOM   4820 C  CA   . ASN A 1 27 ? -2.830  -24.731 9.451  1.00 0.00 ? 128 ASN A CA   10 
ATOM   4821 C  C    . ASN A 1 27 ? -1.623  -25.138 8.602  1.00 0.00 ? 128 ASN A C    10 
ATOM   4822 O  O    . ASN A 1 27 ? -1.689  -25.114 7.373  1.00 0.00 ? 128 ASN A O    10 
ATOM   4823 C  CB   . ASN A 1 27 ? -3.788  -25.922 9.511  1.00 0.00 ? 128 ASN A CB   10 
ATOM   4824 C  CG   . ASN A 1 27 ? -3.594  -26.717 10.804 1.00 0.00 ? 128 ASN A CG   10 
ATOM   4825 O  OD1  . ASN A 1 27 ? -3.424  -27.925 10.800 1.00 0.00 ? 128 ASN A OD1  10 
ATOM   4826 N  ND2  . ASN A 1 27 ? -3.629  -25.974 11.906 1.00 0.00 ? 128 ASN A ND2  10 
ATOM   4827 H  H    . ASN A 1 27 ? -3.146  -23.338 7.935  1.00 0.00 ? 128 ASN A H    10 
ATOM   4828 H  HA   . ASN A 1 27 ? -2.546  -24.414 10.454 1.00 0.00 ? 128 ASN A HA   10 
ATOM   4829 H  HB2  . ASN A 1 27 ? -4.818  -25.568 9.448  1.00 0.00 ? 128 ASN A HB2  10 
ATOM   4830 H  HB3  . ASN A 1 27 ? -3.622  -26.571 8.652  1.00 0.00 ? 128 ASN A HB3  10 
ATOM   4831 H  HD21 . ASN A 1 27 ? -4.298  -25.236 11.991 1.00 0.00 ? 128 ASN A HD21 10 
ATOM   4832 H  HD22 . ASN A 1 27 ? -2.986  -26.153 12.651 1.00 0.00 ? 128 ASN A HD22 10 
ATOM   4833 N  N    . GLU A 1 28 ? -0.552  -25.502 9.290  1.00 0.00 ? 129 GLU A N    10 
ATOM   4834 C  CA   . GLU A 1 28 ? 0.668   -25.913 8.614  1.00 0.00 ? 129 GLU A CA   10 
ATOM   4835 C  C    . GLU A 1 28 ? 0.661   -27.426 8.382  1.00 0.00 ? 129 GLU A C    10 
ATOM   4836 O  O    . GLU A 1 28 ? 1.171   -28.185 9.203  1.00 0.00 ? 129 GLU A O    10 
ATOM   4837 C  CB   . GLU A 1 28 ? 1.904   -25.485 9.406  1.00 0.00 ? 129 GLU A CB   10 
ATOM   4838 C  CG   . GLU A 1 28 ? 2.731   -24.463 8.623  1.00 0.00 ? 129 GLU A CG   10 
ATOM   4839 C  CD   . GLU A 1 28 ? 2.081   -23.079 8.673  1.00 0.00 ? 129 GLU A CD   10 
ATOM   4840 O  OE1  . GLU A 1 28 ? 0.930   -22.975 8.194  1.00 0.00 ? 129 GLU A OE1  10 
ATOM   4841 O  OE2  . GLU A 1 28 ? 2.747   -22.156 9.188  1.00 0.00 ? 129 GLU A OE2  10 
ATOM   4842 H  H    . GLU A 1 28 ? -0.507  -25.519 10.289 1.00 0.00 ? 129 GLU A H    10 
ATOM   4843 H  HA   . GLU A 1 28 ? 0.658   -25.391 7.657  1.00 0.00 ? 129 GLU A HA   10 
ATOM   4844 H  HB2  . GLU A 1 28 ? 1.599   -25.057 10.361 1.00 0.00 ? 129 GLU A HB2  10 
ATOM   4845 H  HB3  . GLU A 1 28 ? 2.517   -26.358 9.630  1.00 0.00 ? 129 GLU A HB3  10 
ATOM   4846 H  HG2  . GLU A 1 28 ? 3.738   -24.410 9.037  1.00 0.00 ? 129 GLU A HG2  10 
ATOM   4847 H  HG3  . GLU A 1 28 ? 2.828   -24.785 7.587  1.00 0.00 ? 129 GLU A HG3  10 
ATOM   4848 N  N    . LYS A 1 29 ? 0.079   -27.817 7.258  1.00 0.00 ? 130 LYS A N    10 
ATOM   4849 C  CA   . LYS A 1 29 ? -0.001  -29.225 6.907  1.00 0.00 ? 130 LYS A CA   10 
ATOM   4850 C  C    . LYS A 1 29 ? 0.370   -29.400 5.433  1.00 0.00 ? 130 LYS A C    10 
ATOM   4851 O  O    . LYS A 1 29 ? 0.133   -30.457 4.852  1.00 0.00 ? 130 LYS A O    10 
ATOM   4852 C  CB   . LYS A 1 29 ? -1.377  -29.790 7.266  1.00 0.00 ? 130 LYS A CB   10 
ATOM   4853 C  CG   . LYS A 1 29 ? -1.591  -29.790 8.782  1.00 0.00 ? 130 LYS A CG   10 
ATOM   4854 C  CD   . LYS A 1 29 ? -1.799  -31.212 9.305  1.00 0.00 ? 130 LYS A CD   10 
ATOM   4855 C  CE   . LYS A 1 29 ? -2.236  -31.197 10.772 1.00 0.00 ? 130 LYS A CE   10 
ATOM   4856 N  NZ   . LYS A 1 29 ? -1.863  -32.466 11.436 1.00 0.00 ? 130 LYS A NZ   10 
ATOM   4857 H  H    . LYS A 1 29 ? -0.334  -27.192 6.595  1.00 0.00 ? 130 LYS A H    10 
ATOM   4858 H  HA   . LYS A 1 29 ? 0.734   -29.755 7.514  1.00 0.00 ? 130 LYS A HA   10 
ATOM   4859 H  HB2  . LYS A 1 29 ? -2.155  -29.197 6.786  1.00 0.00 ? 130 LYS A HB2  10 
ATOM   4860 H  HB3  . LYS A 1 29 ? -1.468  -30.806 6.882  1.00 0.00 ? 130 LYS A HB3  10 
ATOM   4861 H  HG2  . LYS A 1 29 ? -0.729  -29.339 9.274  1.00 0.00 ? 130 LYS A HG2  10 
ATOM   4862 H  HG3  . LYS A 1 29 ? -2.457  -29.176 9.031  1.00 0.00 ? 130 LYS A HG3  10 
ATOM   4863 H  HD2  . LYS A 1 29 ? -2.552  -31.719 8.703  1.00 0.00 ? 130 LYS A HD2  10 
ATOM   4864 H  HD3  . LYS A 1 29 ? -0.874  -31.780 9.204  1.00 0.00 ? 130 LYS A HD3  10 
ATOM   4865 H  HE2  . LYS A 1 29 ? -1.770  -30.358 11.288 1.00 0.00 ? 130 LYS A HE2  10 
ATOM   4866 H  HE3  . LYS A 1 29 ? -3.315  -31.051 10.834 1.00 0.00 ? 130 LYS A HE3  10 
ATOM   4867 H  HZ1  . LYS A 1 29 ? -2.671  -32.868 11.866 1.00 0.00 ? 130 LYS A HZ1  10 
ATOM   4868 H  HZ2  . LYS A 1 29 ? -1.494  -33.102 10.759 1.00 0.00 ? 130 LYS A HZ2  10 
ATOM   4869 H  HZ3  . LYS A 1 29 ? -1.169  -32.284 12.135 1.00 0.00 ? 130 LYS A HZ3  10 
HETATM 4870 ZN ZN   . ZN  B 2 .  ? -1.258  -12.188 8.956  1.00 0.00 ? 1   ZN  A ZN   10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ARG 1  102 102 ARG ARG A . n 
A 1 2  SER 2  103 103 SER SER A . n 
A 1 3  PHE 3  104 104 PHE PHE A . n 
A 1 4  VAL 4  105 105 VAL VAL A . n 
A 1 5  CYS 5  106 106 CYS CYS A . n 
A 1 6  GLU 6  107 107 GLU GLU A . n 
A 1 7  VAL 7  108 108 VAL VAL A . n 
A 1 8  CYS 8  109 109 CYS CYS A . n 
A 1 9  THR 9  110 110 THR THR A . n 
A 1 10 ARG 10 111 111 ARG ARG A . n 
A 1 11 ALA 11 112 112 ALA ALA A . n 
A 1 12 PHE 12 113 113 PHE PHE A . n 
A 1 13 ALA 13 114 114 ALA ALA A . n 
A 1 14 ARG 14 115 115 ARG ARG A . n 
A 1 15 GLN 15 116 116 GLN GLN A . n 
A 1 16 GLU 16 117 117 GLU GLU A . n 
A 1 17 ALA 17 118 118 ALA ALA A . n 
A 1 18 LEU 18 119 119 LEU LEU A . n 
A 1 19 LYS 19 120 120 LYS LYS A . n 
A 1 20 ARG 20 121 121 ARG ARG A . n 
A 1 21 HIS 21 122 122 HIS HIS A . n 
A 1 22 TYR 22 123 123 TYR TYR A . n 
A 1 23 ARG 23 124 124 ARG ARG A . n 
A 1 24 SER 24 125 125 SER SER A . n 
A 1 25 HIS 25 126 126 HIS HIS A . n 
A 1 26 THR 26 127 127 THR THR A . n 
A 1 27 ASN 27 128 128 ASN ASN A . n 
A 1 28 GLU 28 129 129 GLU GLU A . n 
A 1 29 LYS 29 130 130 LYS LYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZN 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     1 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      ZN 
_pdbx_nonpoly_scheme.auth_mon_id     ZN 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG  ? A CYS 5  ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 98.3  ? 
2 SG  ? A CYS 5  ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG  ? A CYS 8  ? A CYS 109 ? 1_555 116.8 ? 
3 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 SG  ? A CYS 8  ? A CYS 109 ? 1_555 109.8 ? 
4 SG  ? A CYS 5  ? A CYS 106 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 97.8  ? 
5 NE2 ? A HIS 21 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 94.9  ? 
6 SG  ? A CYS 8  ? A CYS 109 ? 1_555 ZN ? B ZN . ? A ZN 1 ? 1_555 NE2 ? A HIS 25 ? A HIS 126 ? 1_555 132.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-11-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_database_status  
2 4 'Structure model' pdbx_struct_assembly  
3 4 'Structure model' pdbx_struct_oper_list 
4 4 'Structure model' struct_conf           
5 4 'Structure model' struct_conf_type      
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_database_status.process_site' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  O A HIS 122 ? ? H   A SER 125 ? ? 1.56 
2  2  O A HIS 122 ? ? H   A SER 125 ? ? 1.52 
3  2  O A CYS 106 ? ? N   A THR 110 ? ? 2.16 
4  7  O A HIS 122 ? ? HG  A SER 125 ? ? 1.60 
5  8  O A CYS 109 ? ? HG1 A THR 110 ? ? 1.31 
6  8  O A HIS 122 ? ? HG  A SER 125 ? ? 1.50 
7  8  O A ARG 124 ? ? HG1 A THR 127 ? ? 1.54 
8  8  O A CYS 109 ? ? OG1 A THR 110 ? ? 1.60 
9  9  O A CYS 106 ? ? H   A THR 110 ? ? 1.43 
10 9  O A HIS 122 ? ? HG  A SER 125 ? ? 1.48 
11 9  O A CYS 109 ? ? OG1 A THR 110 ? ? 1.79 
12 9  O A CYS 106 ? ? N   A THR 110 ? ? 2.16 
13 9  O A HIS 122 ? ? OG  A SER 125 ? ? 2.17 
14 10 O A CYS 106 ? ? H   A THR 110 ? ? 1.23 
15 10 O A CYS 106 ? ? N   A THR 110 ? ? 2.08 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  THR A 110 ? ? 135.55  -9.66   
2  1  THR A 127 ? ? -131.67 -80.17  
3  1  GLU A 129 ? ? -173.09 83.00   
4  2  THR A 110 ? ? 119.54  12.79   
5  2  THR A 127 ? ? -34.08  -36.06  
6  2  ASN A 128 ? ? -177.52 103.40  
7  2  GLU A 129 ? ? -62.62  80.79   
8  3  THR A 110 ? ? 128.86  20.83   
9  3  ASN A 128 ? ? -134.08 -48.59  
10 3  GLU A 129 ? ? -39.17  -36.44  
11 4  THR A 110 ? ? 131.33  16.20   
12 4  THR A 127 ? ? -127.48 -100.25 
13 4  ASN A 128 ? ? 177.44  96.07   
14 4  GLU A 129 ? ? -164.51 82.91   
15 5  THR A 110 ? ? 130.51  0.73    
16 5  THR A 127 ? ? -34.20  -36.48  
17 5  ASN A 128 ? ? 177.59  111.27  
18 6  THR A 110 ? ? 132.54  -7.21   
19 6  GLU A 129 ? ? -126.27 -146.29 
20 7  VAL A 108 ? ? -102.19 -69.46  
21 7  THR A 110 ? ? 37.82   27.64   
22 7  THR A 127 ? ? -39.26  -27.90  
23 7  ASN A 128 ? ? -24.19  -56.60  
24 8  THR A 110 ? ? 119.63  19.64   
25 8  GLU A 129 ? ? -96.24  30.43   
26 9  VAL A 108 ? ? -66.78  -73.19  
27 9  THR A 110 ? ? 93.29   22.51   
28 10 VAL A 108 ? ? -56.45  -73.08  
29 10 THR A 127 ? ? -119.78 -81.26  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 102 ? ? 0.284 'SIDE CHAIN' 
2  1  ARG A 111 ? ? 0.300 'SIDE CHAIN' 
3  1  ARG A 115 ? ? 0.230 'SIDE CHAIN' 
4  2  ARG A 102 ? ? 0.202 'SIDE CHAIN' 
5  2  ARG A 111 ? ? 0.146 'SIDE CHAIN' 
6  2  ARG A 115 ? ? 0.134 'SIDE CHAIN' 
7  3  ARG A 102 ? ? 0.293 'SIDE CHAIN' 
8  3  ARG A 115 ? ? 0.299 'SIDE CHAIN' 
9  3  ARG A 121 ? ? 0.281 'SIDE CHAIN' 
10 3  ARG A 124 ? ? 0.132 'SIDE CHAIN' 
11 4  ARG A 102 ? ? 0.286 'SIDE CHAIN' 
12 4  ARG A 111 ? ? 0.276 'SIDE CHAIN' 
13 4  ARG A 115 ? ? 0.247 'SIDE CHAIN' 
14 4  ARG A 124 ? ? 0.244 'SIDE CHAIN' 
15 5  ARG A 102 ? ? 0.298 'SIDE CHAIN' 
16 5  ARG A 111 ? ? 0.298 'SIDE CHAIN' 
17 5  ARG A 115 ? ? 0.233 'SIDE CHAIN' 
18 5  ARG A 121 ? ? 0.100 'SIDE CHAIN' 
19 6  ARG A 102 ? ? 0.295 'SIDE CHAIN' 
20 6  ARG A 115 ? ? 0.151 'SIDE CHAIN' 
21 6  ARG A 121 ? ? 0.254 'SIDE CHAIN' 
22 6  ARG A 124 ? ? 0.195 'SIDE CHAIN' 
23 7  ARG A 102 ? ? 0.188 'SIDE CHAIN' 
24 7  ARG A 111 ? ? 0.147 'SIDE CHAIN' 
25 7  ARG A 115 ? ? 0.193 'SIDE CHAIN' 
26 7  ARG A 121 ? ? 0.090 'SIDE CHAIN' 
27 7  ARG A 124 ? ? 0.200 'SIDE CHAIN' 
28 8  ARG A 102 ? ? 0.252 'SIDE CHAIN' 
29 8  ARG A 115 ? ? 0.267 'SIDE CHAIN' 
30 8  ARG A 121 ? ? 0.181 'SIDE CHAIN' 
31 8  ARG A 124 ? ? 0.215 'SIDE CHAIN' 
32 9  ARG A 102 ? ? 0.299 'SIDE CHAIN' 
33 9  ARG A 111 ? ? 0.230 'SIDE CHAIN' 
34 9  ARG A 115 ? ? 0.257 'SIDE CHAIN' 
35 9  ARG A 121 ? ? 0.266 'SIDE CHAIN' 
36 9  ARG A 124 ? ? 0.081 'SIDE CHAIN' 
37 10 ARG A 102 ? ? 0.199 'SIDE CHAIN' 
38 10 ARG A 111 ? ? 0.126 'SIDE CHAIN' 
39 10 ARG A 115 ? ? 0.224 'SIDE CHAIN' 
40 10 ARG A 124 ? ? 0.095 'SIDE CHAIN' 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
#