data_1AU0
# 
_entry.id   1AU0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1AU0         
WWPDB D_1000171256 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AU0 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-09 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhao, B.'           1 
'Smith, W.W.'        2 
'Janson, C.A.'       3 
'Abdel-Meguid, S.S.' 4 
# 
_citation.id                        primary 
_citation.title                     'Structure and Design of Potent and Selective Cathepsin K Inhibitors' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            119 
_citation.page_first                11351 
_citation.page_last                 11352 
_citation.year                      1997 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   -1 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yamashita, D.S.'  1  
primary 'Smith, W.W.'      2  
primary 'Zhao, B.'         3  
primary 'Janson, C.A.'     4  
primary 'Tomaszek, T.A.'   5  
primary 'Bossard, M.J.'    6  
primary 'Levy, M.A.'       7  
primary 'Oh, H.-J.'        8  
primary 'Carr, T.J.'       9  
primary 'Thompson, S.K.'   10 
primary 'Ijames, C.F.'     11 
primary 'Carr, S.A.'       12 
primary 'Mcqueney, M.'     13 
primary 
;D'Alessio, K.J.
;
14 
primary 'Amegadzie, B.Y.'  15 
primary 'Hanning, C.R.'    16 
primary 'Abdel-Meguid, S.' 17 
primary 'Desjarlais, R.L.' 18 
primary 'Gleason, J.G.'    19 
primary 'Veber, D.F.'      20 
# 
_cell.entry_id           1AU0 
_cell.length_a           57.750 
_cell.length_b           57.750 
_cell.length_c           131.120 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AU0 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CATHEPSIN K'                                                      23523.480 1  3.4.22.38 ? ? 
'INHIBITOR COVALENTLY BOUND TO ACTIVE SITE CYS 25' 
2 non-polymer syn '1,3-BIS[[N-[(PHENYLMETHOXY)CARBONYL]-L-LEUCYL]AMINO]-2-PROPANONE' 582.688   1  ?         ? ? ? 
3 water       nat water                                                              18.015    65 ?         ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   ASP n 
1 4   SER n 
1 5   VAL n 
1 6   ASP n 
1 7   TYR n 
1 8   ARG n 
1 9   LYS n 
1 10  LYS n 
1 11  GLY n 
1 12  TYR n 
1 13  VAL n 
1 14  THR n 
1 15  PRO n 
1 16  VAL n 
1 17  LYS n 
1 18  ASN n 
1 19  GLN n 
1 20  GLY n 
1 21  GLN n 
1 22  CYS n 
1 23  GLY n 
1 24  SER n 
1 25  CYS n 
1 26  TRP n 
1 27  ALA n 
1 28  PHE n 
1 29  SER n 
1 30  SER n 
1 31  VAL n 
1 32  GLY n 
1 33  ALA n 
1 34  LEU n 
1 35  GLU n 
1 36  GLY n 
1 37  GLN n 
1 38  LEU n 
1 39  LYS n 
1 40  LYS n 
1 41  LYS n 
1 42  THR n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  LEU n 
1 47  ASN n 
1 48  LEU n 
1 49  SER n 
1 50  PRO n 
1 51  GLN n 
1 52  ASN n 
1 53  LEU n 
1 54  VAL n 
1 55  ASP n 
1 56  CYS n 
1 57  VAL n 
1 58  SER n 
1 59  GLU n 
1 60  ASN n 
1 61  ASP n 
1 62  GLY n 
1 63  CYS n 
1 64  GLY n 
1 65  GLY n 
1 66  GLY n 
1 67  TYR n 
1 68  MET n 
1 69  THR n 
1 70  ASN n 
1 71  ALA n 
1 72  PHE n 
1 73  GLN n 
1 74  TYR n 
1 75  VAL n 
1 76  GLN n 
1 77  LYS n 
1 78  ASN n 
1 79  ARG n 
1 80  GLY n 
1 81  ILE n 
1 82  ASP n 
1 83  SER n 
1 84  GLU n 
1 85  ASP n 
1 86  ALA n 
1 87  TYR n 
1 88  PRO n 
1 89  TYR n 
1 90  VAL n 
1 91  GLY n 
1 92  GLN n 
1 93  GLU n 
1 94  GLU n 
1 95  SER n 
1 96  CYS n 
1 97  MET n 
1 98  TYR n 
1 99  ASN n 
1 100 PRO n 
1 101 THR n 
1 102 GLY n 
1 103 LYS n 
1 104 ALA n 
1 105 ALA n 
1 106 LYS n 
1 107 CYS n 
1 108 ARG n 
1 109 GLY n 
1 110 TYR n 
1 111 ARG n 
1 112 GLU n 
1 113 ILE n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 ASN n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 LEU n 
1 122 LYS n 
1 123 ARG n 
1 124 ALA n 
1 125 VAL n 
1 126 ALA n 
1 127 ARG n 
1 128 VAL n 
1 129 GLY n 
1 130 PRO n 
1 131 VAL n 
1 132 SER n 
1 133 VAL n 
1 134 ALA n 
1 135 ILE n 
1 136 ASP n 
1 137 ALA n 
1 138 SER n 
1 139 LEU n 
1 140 THR n 
1 141 SER n 
1 142 PHE n 
1 143 GLN n 
1 144 PHE n 
1 145 TYR n 
1 146 SER n 
1 147 LYS n 
1 148 GLY n 
1 149 VAL n 
1 150 TYR n 
1 151 TYR n 
1 152 ASP n 
1 153 GLU n 
1 154 SER n 
1 155 CYS n 
1 156 ASN n 
1 157 SER n 
1 158 ASP n 
1 159 ASN n 
1 160 LEU n 
1 161 ASN n 
1 162 HIS n 
1 163 ALA n 
1 164 VAL n 
1 165 LEU n 
1 166 ALA n 
1 167 VAL n 
1 168 GLY n 
1 169 TYR n 
1 170 GLY n 
1 171 ILE n 
1 172 GLN n 
1 173 LYS n 
1 174 GLY n 
1 175 ASN n 
1 176 LYS n 
1 177 HIS n 
1 178 TRP n 
1 179 ILE n 
1 180 ILE n 
1 181 LYS n 
1 182 ASN n 
1 183 SER n 
1 184 TRP n 
1 185 GLY n 
1 186 GLU n 
1 187 ASN n 
1 188 TRP n 
1 189 GLY n 
1 190 ASN n 
1 191 LYS n 
1 192 GLY n 
1 193 TYR n 
1 194 ILE n 
1 195 LEU n 
1 196 MET n 
1 197 ALA n 
1 198 ARG n 
1 199 ASN n 
1 200 LYS n 
1 201 ASN n 
1 202 ASN n 
1 203 ALA n 
1 204 CYS n 
1 205 GLY n 
1 206 ILE n 
1 207 ALA n 
1 208 ASN n 
1 209 LEU n 
1 210 ALA n 
1 211 SER n 
1 212 PHE n 
1 213 PRO n 
1 214 LYS n 
1 215 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            SF9 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 OSTEOCLAST 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               BACULOVIRUS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CATK_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P43235 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGD
MTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLL
NLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGI
ANLASFPKM
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1AU0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P43235 
_struct_ref_seq.db_align_beg                  115 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  329 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       215 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                            ?                                   
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                           ?                                   
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ?                                   
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ?                                   
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                           ?                                   
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                          ?                                   
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ?                                   
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                            ?                                   
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                          ?                                   
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                              ?                                   
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ?                                   
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                            ?                                   
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                             ?                                   
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                         ?                                   
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                      ?                                   
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                            ?                                   
'C5 H9 N O2'     115.130 
SDK non-polymer         . '1,3-BIS[[N-[(PHENYLMETHOXY)CARBONYL]-L-LEUCYL]AMINO]-2-PROPANONE' 'SYMMETRIC DIACYLAMINOETHYL KETONE' 
'C31 H42 N4 O7'  582.688 
SER 'L-peptide linking' y SERINE                                                             ?                                   
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                          ?                                   
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ?                                   
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ?                                   
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                             ?                                   
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1AU0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.33 
_exptl_crystal.density_percent_sol   47 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '10% ISOPROPANOL,0.1M NAPO4-CITRATE, PH4.2' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1996-12 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        SIEMENS 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AU0 
_reflns.observed_criterion_sigma_I   2 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25. 
_reflns.d_resolution_high            2.6 
_reflns.number_obs                   36083 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        13 
_reflns.B_iso_Wilson_estimate        35.4 
_reflns.pdbx_redundancy              5.0 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_all   96 
_reflns_shell.Rmerge_I_obs           0.27 
_reflns_shell.pdbx_Rsym_value        0.27 
_reflns_shell.meanI_over_sigI_obs    3.6 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AU0 
_refine.ls_number_reflns_obs                     6155 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2 
_refine.pdbx_data_cutoff_high_absF               1000000 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8 
_refine.ls_d_res_high                            2.6 
_refine.ls_percent_reflns_obs                    87.5 
_refine.ls_R_factor_obs                          0.217 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.217 
_refine.ls_R_factor_R_free                       0.365 
_refine.ls_R_factor_R_free_error                 0.014 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.8 
_refine.ls_number_reflns_R_free                  663 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               15.0 
_refine.aniso_B[1][1]                            0 
_refine.aniso_B[2][2]                            0 
_refine.aniso_B[3][3]                            0 
_refine.aniso_B[1][2]                            0 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][3]                            0 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ATK 
_refine.pdbx_method_to_determine_struct          MR 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1AU0 
_refine_analyze.Luzzati_coordinate_error_obs    0.30 
_refine_analyze.Luzzati_sigma_a_obs             0.32 
_refine_analyze.Luzzati_d_res_low_obs           8 
_refine_analyze.Luzzati_coordinate_error_free   0.57 
_refine_analyze.Luzzati_sigma_a_free            0.49 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1648 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             65 
_refine_hist.number_atoms_total               1755 
_refine_hist.d_res_high                       2.6 
_refine_hist.d_res_low                        8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.2  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.23  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.6 
_refine_ls_shell.d_res_low                        2.71 
_refine_ls_shell.number_reflns_R_work             518 
_refine_ls_shell.R_factor_R_work                  0.319 
_refine_ls_shell.percent_reflns_obs               67.5 
_refine_ls_shell.R_factor_R_free                  0.497 
_refine_ls_shell.R_factor_R_free_error            0.064 
_refine_ls_shell.percent_reflns_R_free            10.8 
_refine_ls_shell.number_reflns_R_free             61 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  ?            'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1AU0 
_struct.title                     
;CRYSTAL STRUCTURE OF THE CYSTEINE PROTEASE HUMAN CATHEPSIN K IN COMPLEX WITH A COVALENT SYMMETRIC DIACYLAMINOMETHYL KETONE INHIBITOR
;
_struct.pdbx_descriptor           'CATHEPSIN K, 1,3-BIS[[N-[(PHENYLMETHOXY)CARBONYL]-L-LEUCYL]AMINO]-2-PROPANONE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AU0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, SULFHYDRYL PROTEINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 TYR A 7   ? LYS A 10  ? TYR A 7   LYS A 10  5 ? 4  
HELX_P HELX_P2 2 CYS A 25  ? THR A 42  ? CYS A 25  THR A 42  1 ? 18 
HELX_P HELX_P3 3 PRO A 50  ? CYS A 56  ? PRO A 50  CYS A 56  1 ? 7  
HELX_P HELX_P4 4 GLY A 62  ? GLY A 64  ? GLY A 62  GLY A 64  5 ? 3  
HELX_P HELX_P5 5 MET A 68  ? LYS A 77  ? MET A 68  LYS A 77  1 ? 10 
HELX_P HELX_P6 6 PRO A 100 ? GLY A 102 ? PRO A 100 GLY A 102 5 ? 3  
HELX_P HELX_P7 7 GLU A 118 ? ARG A 127 ? GLU A 118 ARG A 127 1 ? 10 
HELX_P HELX_P8 8 THR A 140 ? GLN A 143 ? THR A 140 GLN A 143 1 ? 4  
HELX_P HELX_P9 9 ALA A 203 ? GLY A 205 ? ALA A 203 GLY A 205 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG  ? ? ? 1_555 A CYS 63  SG ? ? A CYS 22  A CYS 63  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2 disulf ? ? A CYS 56  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 56  A CYS 96  1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf3 disulf ? ? A CYS 155 SG  ? ? ? 1_555 A CYS 204 SG ? ? A CYS 155 A CYS 204 1_555 ? ? ? ? ? ? ? 2.030 ? 
covale1 covale ? ? B SDK .   C21 ? ? ? 1_555 A CYS 25  SG ? ? A SDK 300 A CYS 25  1_555 ? ? ? ? ? ? ? 1.768 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 110 ? GLU A 112 ? TYR A 110 GLU A 112 
A 2 SER A 211 ? PRO A 213 ? SER A 211 PRO A 213 
B 1 VAL A 131 ? ILE A 135 ? VAL A 131 ILE A 135 
B 2 HIS A 162 ? ILE A 171 ? HIS A 162 ILE A 171 
B 3 LYS A 176 ? LYS A 181 ? LYS A 176 LYS A 181 
B 4 TYR A 193 ? ALA A 197 ? TYR A 193 ALA A 197 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 111 ? O ARG A 111 N PHE A 212 ? N PHE A 212 
B 1 2 O VAL A 131 ? O VAL A 131 N ALA A 166 ? N ALA A 166 
B 2 3 O LEU A 165 ? O LEU A 165 N LYS A 181 ? N LYS A 181 
B 3 4 O TRP A 178 ? O TRP A 178 N MET A 196 ? N MET A 196 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    17 
_struct_site.details              'BINDING SITE FOR RESIDUE SDK A 300' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 ASN A 18  ? ASN A 18  . ? 1_555 ? 
2  AC1 17 GLN A 19  ? GLN A 19  . ? 1_555 ? 
3  AC1 17 GLY A 20  ? GLY A 20  . ? 1_555 ? 
4  AC1 17 GLY A 23  ? GLY A 23  . ? 1_555 ? 
5  AC1 17 SER A 24  ? SER A 24  . ? 1_555 ? 
6  AC1 17 CYS A 25  ? CYS A 25  . ? 1_555 ? 
7  AC1 17 LYS A 44  ? LYS A 44  . ? 6_566 ? 
8  AC1 17 GLY A 65  ? GLY A 65  . ? 1_555 ? 
9  AC1 17 GLY A 66  ? GLY A 66  . ? 1_555 ? 
10 AC1 17 TYR A 67  ? TYR A 67  . ? 1_555 ? 
11 AC1 17 ARG A 123 ? ARG A 123 . ? 3_554 ? 
12 AC1 17 ARG A 127 ? ARG A 127 . ? 3_554 ? 
13 AC1 17 LEU A 160 ? LEU A 160 . ? 1_555 ? 
14 AC1 17 ASN A 161 ? ASN A 161 . ? 1_555 ? 
15 AC1 17 HIS A 162 ? HIS A 162 . ? 1_555 ? 
16 AC1 17 TRP A 184 ? TRP A 184 . ? 1_555 ? 
17 AC1 17 LEU A 209 ? LEU A 209 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1AU0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AU0 
_atom_sites.fract_transf_matrix[1][1]   0.017316 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017316 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007627 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? -6.239  13.436 92.352 1.00 15.00 ? 1   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? -6.764  14.526 91.481 1.00 15.00 ? 1   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? -5.758  14.718 90.341 1.00 15.00 ? 1   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? -4.582  14.367 90.500 1.00 15.00 ? 1   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? -6.925  15.808 92.287 1.00 15.00 ? 1   ALA A CB  1 
ATOM   6    N N   . PRO A 1 2   ? -6.211  15.228 89.167 1.00 15.00 ? 2   PRO A N   1 
ATOM   7    C CA  . PRO A 1 2   ? -5.334  15.448 88.006 1.00 15.00 ? 2   PRO A CA  1 
ATOM   8    C C   . PRO A 1 2   ? -4.186  16.422 88.254 1.00 15.00 ? 2   PRO A C   1 
ATOM   9    O O   . PRO A 1 2   ? -4.374  17.484 88.851 1.00 15.00 ? 2   PRO A O   1 
ATOM   10   C CB  . PRO A 1 2   ? -6.302  15.992 86.949 1.00 15.00 ? 2   PRO A CB  1 
ATOM   11   C CG  . PRO A 1 2   ? -7.350  16.695 87.762 1.00 15.00 ? 2   PRO A CG  1 
ATOM   12   C CD  . PRO A 1 2   ? -7.584  15.682 88.864 1.00 15.00 ? 2   PRO A CD  1 
ATOM   13   N N   . ASP A 1 3   ? -2.982  16.053 87.823 1.00 15.00 ? 3   ASP A N   1 
ATOM   14   C CA  . ASP A 1 3   ? -1.823  16.926 87.977 1.00 15.00 ? 3   ASP A CA  1 
ATOM   15   C C   . ASP A 1 3   ? -1.938  17.973 86.879 1.00 15.00 ? 3   ASP A C   1 
ATOM   16   O O   . ASP A 1 3   ? -1.232  17.906 85.869 1.00 15.00 ? 3   ASP A O   1 
ATOM   17   C CB  . ASP A 1 3   ? -0.519  16.141 87.792 1.00 15.00 ? 3   ASP A CB  1 
ATOM   18   C CG  . ASP A 1 3   ? -0.132  15.327 89.022 1.00 15.00 ? 3   ASP A CG  1 
ATOM   19   O OD1 . ASP A 1 3   ? -0.187  15.882 90.157 1.00 15.00 ? 3   ASP A OD1 1 
ATOM   20   O OD2 . ASP A 1 3   ? 0.254   14.140 88.841 1.00 15.00 ? 3   ASP A OD2 1 
ATOM   21   N N   . SER A 1 4   ? -2.854  18.920 87.037 1.00 15.00 ? 4   SER A N   1 
ATOM   22   C CA  . SER A 1 4   ? -3.046  19.956 86.027 1.00 15.00 ? 4   SER A CA  1 
ATOM   23   C C   . SER A 1 4   ? -3.618  21.244 86.591 1.00 15.00 ? 4   SER A C   1 
ATOM   24   O O   . SER A 1 4   ? -4.317  21.234 87.608 1.00 15.00 ? 4   SER A O   1 
ATOM   25   C CB  . SER A 1 4   ? -3.984  19.453 84.914 1.00 15.00 ? 4   SER A CB  1 
ATOM   26   O OG  . SER A 1 4   ? -3.374  18.459 84.101 1.00 15.00 ? 4   SER A OG  1 
ATOM   27   N N   . VAL A 1 5   ? -3.316  22.348 85.917 1.00 15.00 ? 5   VAL A N   1 
ATOM   28   C CA  . VAL A 1 5   ? -3.819  23.653 86.300 1.00 15.00 ? 5   VAL A CA  1 
ATOM   29   C C   . VAL A 1 5   ? -3.990  24.445 85.008 1.00 15.00 ? 5   VAL A C   1 
ATOM   30   O O   . VAL A 1 5   ? -3.115  24.436 84.144 1.00 15.00 ? 5   VAL A O   1 
ATOM   31   C CB  . VAL A 1 5   ? -2.883  24.375 87.299 1.00 15.00 ? 5   VAL A CB  1 
ATOM   32   C CG1 . VAL A 1 5   ? -1.488  24.559 86.718 1.00 15.00 ? 5   VAL A CG1 1 
ATOM   33   C CG2 . VAL A 1 5   ? -3.486  25.709 87.691 1.00 15.00 ? 5   VAL A CG2 1 
ATOM   34   N N   . ASP A 1 6   ? -5.145  25.076 84.846 1.00 15.00 ? 6   ASP A N   1 
ATOM   35   C CA  . ASP A 1 6   ? -5.445  25.844 83.658 1.00 15.00 ? 6   ASP A CA  1 
ATOM   36   C C   . ASP A 1 6   ? -6.036  27.157 84.142 1.00 15.00 ? 6   ASP A C   1 
ATOM   37   O O   . ASP A 1 6   ? -7.202  27.228 84.516 1.00 15.00 ? 6   ASP A O   1 
ATOM   38   C CB  . ASP A 1 6   ? -6.450  25.061 82.801 1.00 15.00 ? 6   ASP A CB  1 
ATOM   39   C CG  . ASP A 1 6   ? -6.787  25.749 81.484 1.00 15.00 ? 6   ASP A CG  1 
ATOM   40   O OD1 . ASP A 1 6   ? -5.954  26.508 80.949 1.00 15.00 ? 6   ASP A OD1 1 
ATOM   41   O OD2 . ASP A 1 6   ? -7.900  25.515 80.977 1.00 15.00 ? 6   ASP A OD2 1 
ATOM   42   N N   . TYR A 1 7   ? -5.242  28.218 84.108 1.00 15.00 ? 7   TYR A N   1 
ATOM   43   C CA  . TYR A 1 7   ? -5.687  29.522 84.583 1.00 15.00 ? 7   TYR A CA  1 
ATOM   44   C C   . TYR A 1 7   ? -6.748  30.239 83.776 1.00 15.00 ? 7   TYR A C   1 
ATOM   45   O O   . TYR A 1 7   ? -7.359  31.202 84.251 1.00 15.00 ? 7   TYR A O   1 
ATOM   46   C CB  . TYR A 1 7   ? -4.488  30.430 84.812 1.00 15.00 ? 7   TYR A CB  1 
ATOM   47   C CG  . TYR A 1 7   ? -3.699  30.007 86.022 1.00 15.00 ? 7   TYR A CG  1 
ATOM   48   C CD1 . TYR A 1 7   ? -4.166  30.284 87.305 1.00 15.00 ? 7   TYR A CD1 1 
ATOM   49   C CD2 . TYR A 1 7   ? -2.516  29.284 85.890 1.00 15.00 ? 7   TYR A CD2 1 
ATOM   50   C CE1 . TYR A 1 7   ? -3.488  29.852 88.422 1.00 15.00 ? 7   TYR A CE1 1 
ATOM   51   C CE2 . TYR A 1 7   ? -1.828  28.848 87.004 1.00 15.00 ? 7   TYR A CE2 1 
ATOM   52   C CZ  . TYR A 1 7   ? -2.325  29.136 88.265 1.00 15.00 ? 7   TYR A CZ  1 
ATOM   53   O OH  . TYR A 1 7   ? -1.664  28.708 89.378 1.00 15.00 ? 7   TYR A OH  1 
ATOM   54   N N   . ARG A 1 8   ? -7.003  29.763 82.567 1.00 15.00 ? 8   ARG A N   1 
ATOM   55   C CA  . ARG A 1 8   ? -8.008  30.392 81.719 1.00 15.00 ? 8   ARG A CA  1 
ATOM   56   C C   . ARG A 1 8   ? -9.366  30.328 82.398 1.00 15.00 ? 8   ARG A C   1 
ATOM   57   O O   . ARG A 1 8   ? -10.041 31.350 82.556 1.00 15.00 ? 8   ARG A O   1 
ATOM   58   C CB  . ARG A 1 8   ? -8.066  29.713 80.346 1.00 15.00 ? 8   ARG A CB  1 
ATOM   59   C CG  . ARG A 1 8   ? -6.793  29.861 79.525 1.00 15.00 ? 8   ARG A CG  1 
ATOM   60   C CD  . ARG A 1 8   ? -6.850  29.018 78.261 1.00 15.00 ? 8   ARG A CD  1 
ATOM   61   N NE  . ARG A 1 8   ? -7.119  27.615 78.554 1.00 15.00 ? 8   ARG A NE  1 
ATOM   62   C CZ  . ARG A 1 8   ? -7.033  26.628 77.665 1.00 15.00 ? 8   ARG A CZ  1 
ATOM   63   N NH1 . ARG A 1 8   ? -6.675  26.884 76.414 1.00 15.00 ? 8   ARG A NH1 1 
ATOM   64   N NH2 . ARG A 1 8   ? -7.335  25.386 78.021 1.00 15.00 ? 8   ARG A NH2 1 
ATOM   65   N N   . LYS A 1 9   ? -9.716  29.142 82.889 1.00 15.00 ? 9   LYS A N   1 
ATOM   66   C CA  . LYS A 1 9   ? -11.000 28.944 83.542 1.00 15.00 ? 9   LYS A CA  1 
ATOM   67   C C   . LYS A 1 9   ? -11.105 29.451 84.973 1.00 15.00 ? 9   LYS A C   1 
ATOM   68   O O   . LYS A 1 9   ? -12.008 29.066 85.710 1.00 15.00 ? 9   LYS A O   1 
ATOM   69   C CB  . LYS A 1 9   ? -11.420 27.479 83.457 1.00 15.00 ? 9   LYS A CB  1 
ATOM   70   C CG  . LYS A 1 9   ? -10.355 26.492 83.812 1.00 15.00 ? 9   LYS A CG  1 
ATOM   71   C CD  . LYS A 1 9   ? -10.866 25.083 83.576 1.00 15.00 ? 9   LYS A CD  1 
ATOM   72   C CE  . LYS A 1 9   ? -9.904  24.034 84.128 1.00 15.00 ? 9   LYS A CE  1 
ATOM   73   N NZ  . LYS A 1 9   ? -10.421 22.644 83.918 1.00 15.00 ? 9   LYS A NZ  1 
ATOM   74   N N   . LYS A 1 10  ? -10.203 30.347 85.361 1.00 15.00 ? 10  LYS A N   1 
ATOM   75   C CA  . LYS A 1 10  ? -10.211 30.928 86.703 1.00 15.00 ? 10  LYS A CA  1 
ATOM   76   C C   . LYS A 1 10  ? -10.296 32.462 86.674 1.00 15.00 ? 10  LYS A C   1 
ATOM   77   O O   . LYS A 1 10  ? -10.323 33.103 87.728 1.00 15.00 ? 10  LYS A O   1 
ATOM   78   C CB  . LYS A 1 10  ? -8.957  30.509 87.478 1.00 15.00 ? 10  LYS A CB  1 
ATOM   79   C CG  . LYS A 1 10  ? -8.892  29.037 87.850 1.00 15.00 ? 10  LYS A CG  1 
ATOM   80   C CD  . LYS A 1 10  ? -7.607  28.734 88.607 1.00 15.00 ? 10  LYS A CD  1 
ATOM   81   C CE  . LYS A 1 10  ? -7.475  27.255 88.898 1.00 15.00 ? 10  LYS A CE  1 
ATOM   82   N NZ  . LYS A 1 10  ? -7.510  26.402 87.669 1.00 15.00 ? 10  LYS A NZ  1 
ATOM   83   N N   . GLY A 1 11  ? -10.321 33.055 85.479 1.00 15.00 ? 11  GLY A N   1 
ATOM   84   C CA  . GLY A 1 11  ? -10.385 34.502 85.361 1.00 15.00 ? 11  GLY A CA  1 
ATOM   85   C C   . GLY A 1 11  ? -9.031  35.166 85.516 1.00 15.00 ? 11  GLY A C   1 
ATOM   86   O O   . GLY A 1 11  ? -8.943  36.368 85.734 1.00 15.00 ? 11  GLY A O   1 
ATOM   87   N N   . TYR A 1 12  ? -7.966  34.385 85.358 1.00 15.00 ? 12  TYR A N   1 
ATOM   88   C CA  . TYR A 1 12  ? -6.594  34.879 85.491 1.00 15.00 ? 12  TYR A CA  1 
ATOM   89   C C   . TYR A 1 12  ? -6.017  35.356 84.177 1.00 15.00 ? 12  TYR A C   1 
ATOM   90   O O   . TYR A 1 12  ? -4.935  35.939 84.156 1.00 15.00 ? 12  TYR A O   1 
ATOM   91   C CB  . TYR A 1 12  ? -5.667  33.769 85.985 1.00 15.00 ? 12  TYR A CB  1 
ATOM   92   C CG  . TYR A 1 12  ? -5.503  33.588 87.482 1.00 15.00 ? 12  TYR A CG  1 
ATOM   93   C CD1 . TYR A 1 12  ? -6.542  33.080 88.266 1.00 15.00 ? 12  TYR A CD1 1 
ATOM   94   C CD2 . TYR A 1 12  ? -4.261  33.789 88.089 1.00 15.00 ? 12  TYR A CD2 1 
ATOM   95   C CE1 . TYR A 1 12  ? -6.343  32.759 89.610 1.00 15.00 ? 12  TYR A CE1 1 
ATOM   96   C CE2 . TYR A 1 12  ? -4.052  33.473 89.424 1.00 15.00 ? 12  TYR A CE2 1 
ATOM   97   C CZ  . TYR A 1 12  ? -5.097  32.957 90.175 1.00 15.00 ? 12  TYR A CZ  1 
ATOM   98   O OH  . TYR A 1 12  ? -4.895  32.626 91.487 1.00 15.00 ? 12  TYR A OH  1 
ATOM   99   N N   . VAL A 1 13  ? -6.691  35.048 83.071 1.00 15.00 ? 13  VAL A N   1 
ATOM   100  C CA  . VAL A 1 13  ? -6.192  35.420 81.751 1.00 15.00 ? 13  VAL A CA  1 
ATOM   101  C C   . VAL A 1 13  ? -7.178  36.254 80.931 1.00 15.00 ? 13  VAL A C   1 
ATOM   102  O O   . VAL A 1 13  ? -8.399  36.087 81.041 1.00 15.00 ? 13  VAL A O   1 
ATOM   103  C CB  . VAL A 1 13  ? -5.736  34.156 80.970 1.00 15.00 ? 13  VAL A CB  1 
ATOM   104  C CG1 . VAL A 1 13  ? -6.925  33.385 80.452 1.00 15.00 ? 13  VAL A CG1 1 
ATOM   105  C CG2 . VAL A 1 13  ? -4.796  34.527 79.854 1.00 15.00 ? 13  VAL A CG2 1 
ATOM   106  N N   . THR A 1 14  ? -6.617  37.178 80.149 1.00 15.00 ? 14  THR A N   1 
ATOM   107  C CA  . THR A 1 14  ? -7.373  38.096 79.291 1.00 15.00 ? 14  THR A CA  1 
ATOM   108  C C   . THR A 1 14  ? -7.455  37.624 77.842 1.00 15.00 ? 14  THR A C   1 
ATOM   109  O O   . THR A 1 14  ? -6.692  36.757 77.421 1.00 15.00 ? 14  THR A O   1 
ATOM   110  C CB  . THR A 1 14  ? -6.732  39.491 79.297 1.00 15.00 ? 14  THR A CB  1 
ATOM   111  O OG1 . THR A 1 14  ? -5.369  39.387 78.879 1.00 15.00 ? 14  THR A OG1 1 
ATOM   112  C CG2 . THR A 1 14  ? -6.781  40.094 80.678 1.00 15.00 ? 14  THR A CG2 1 
ATOM   113  N N   . PRO A 1 15  ? -8.401  38.177 77.063 1.00 15.00 ? 15  PRO A N   1 
ATOM   114  C CA  . PRO A 1 15  ? -8.549  37.786 75.659 1.00 15.00 ? 15  PRO A CA  1 
ATOM   115  C C   . PRO A 1 15  ? -7.236  37.807 74.879 1.00 15.00 ? 15  PRO A C   1 
ATOM   116  O O   . PRO A 1 15  ? -6.344  38.612 75.157 1.00 15.00 ? 15  PRO A O   1 
ATOM   117  C CB  . PRO A 1 15  ? -9.554  38.813 75.118 1.00 15.00 ? 15  PRO A CB  1 
ATOM   118  C CG  . PRO A 1 15  ? -9.566  39.934 76.169 1.00 15.00 ? 15  PRO A CG  1 
ATOM   119  C CD  . PRO A 1 15  ? -9.436  39.157 77.433 1.00 15.00 ? 15  PRO A CD  1 
ATOM   120  N N   . VAL A 1 16  ? -7.117  36.892 73.918 1.00 15.00 ? 16  VAL A N   1 
ATOM   121  C CA  . VAL A 1 16  ? -5.924  36.788 73.091 1.00 15.00 ? 16  VAL A CA  1 
ATOM   122  C C   . VAL A 1 16  ? -5.784  38.020 72.210 1.00 15.00 ? 16  VAL A C   1 
ATOM   123  O O   . VAL A 1 16  ? -6.725  38.409 71.516 1.00 15.00 ? 16  VAL A O   1 
ATOM   124  C CB  . VAL A 1 16  ? -5.972  35.546 72.188 1.00 15.00 ? 16  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 16  ? -4.603  35.278 71.597 1.00 15.00 ? 16  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 16  ? -6.455  34.354 72.961 1.00 15.00 ? 16  VAL A CG2 1 
ATOM   127  N N   . LYS A 1 17  ? -4.608  38.636 72.247 1.00 15.00 ? 17  LYS A N   1 
ATOM   128  C CA  . LYS A 1 17  ? -4.324  39.816 71.452 1.00 15.00 ? 17  LYS A CA  1 
ATOM   129  C C   . LYS A 1 17  ? -3.428  39.477 70.276 1.00 15.00 ? 17  LYS A C   1 
ATOM   130  O O   . LYS A 1 17  ? -2.769  38.440 70.254 1.00 15.00 ? 17  LYS A O   1 
ATOM   131  C CB  . LYS A 1 17  ? -3.647  40.882 72.311 1.00 15.00 ? 17  LYS A CB  1 
ATOM   132  C CG  . LYS A 1 17  ? -4.585  41.963 72.839 1.00 15.00 ? 17  LYS A CG  1 
ATOM   133  C CD  . LYS A 1 17  ? -5.560  41.439 73.894 1.00 15.00 ? 17  LYS A CD  1 
ATOM   134  C CE  . LYS A 1 17  ? -4.984  41.506 75.304 1.00 15.00 ? 17  LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 17  ? -4.779  42.921 75.738 1.00 15.00 ? 17  LYS A NZ  1 
ATOM   136  N N   . ASN A 1 18  ? -3.442  40.357 69.281 1.00 15.00 ? 18  ASN A N   1 
ATOM   137  C CA  . ASN A 1 18  ? -2.628  40.217 68.079 1.00 15.00 ? 18  ASN A CA  1 
ATOM   138  C C   . ASN A 1 18  ? -1.543  41.281 68.125 1.00 15.00 ? 18  ASN A C   1 
ATOM   139  O O   . ASN A 1 18  ? -1.835  42.473 68.219 1.00 15.00 ? 18  ASN A O   1 
ATOM   140  C CB  . ASN A 1 18  ? -3.475  40.418 66.824 1.00 15.00 ? 18  ASN A CB  1 
ATOM   141  C CG  . ASN A 1 18  ? -2.628  40.534 65.570 1.00 15.00 ? 18  ASN A CG  1 
ATOM   142  O OD1 . ASN A 1 18  ? -1.664  39.786 65.384 1.00 15.00 ? 18  ASN A OD1 1 
ATOM   143  N ND2 . ASN A 1 18  ? -2.946  41.507 64.730 1.00 15.00 ? 18  ASN A ND2 1 
ATOM   144  N N   . GLN A 1 19  ? -0.287  40.868 68.048 1.00 15.00 ? 19  GLN A N   1 
ATOM   145  C CA  . GLN A 1 19  ? 0.808   41.818 68.108 1.00 15.00 ? 19  GLN A CA  1 
ATOM   146  C C   . GLN A 1 19  ? 1.023   42.640 66.853 1.00 15.00 ? 19  GLN A C   1 
ATOM   147  O O   . GLN A 1 19  ? 1.682   43.685 66.903 1.00 15.00 ? 19  GLN A O   1 
ATOM   148  C CB  . GLN A 1 19  ? 2.105   41.119 68.501 1.00 15.00 ? 19  GLN A CB  1 
ATOM   149  C CG  . GLN A 1 19  ? 2.401   39.871 67.717 1.00 15.00 ? 19  GLN A CG  1 
ATOM   150  C CD  . GLN A 1 19  ? 3.790   39.371 67.969 1.00 15.00 ? 19  GLN A CD  1 
ATOM   151  O OE1 . GLN A 1 19  ? 4.027   38.166 68.070 1.00 15.00 ? 19  GLN A OE1 1 
ATOM   152  N NE2 . GLN A 1 19  ? 4.738   40.291 68.028 1.00 15.00 ? 19  GLN A NE2 1 
ATOM   153  N N   . GLY A 1 20  ? 0.490   42.169 65.728 1.00 15.00 ? 20  GLY A N   1 
ATOM   154  C CA  . GLY A 1 20  ? 0.640   42.889 64.476 1.00 15.00 ? 20  GLY A CA  1 
ATOM   155  C C   . GLY A 1 20  ? 2.026   42.744 63.875 1.00 15.00 ? 20  GLY A C   1 
ATOM   156  O O   . GLY A 1 20  ? 2.636   41.684 63.983 1.00 15.00 ? 20  GLY A O   1 
ATOM   157  N N   . GLN A 1 21  ? 2.522   43.813 63.252 1.00 15.00 ? 21  GLN A N   1 
ATOM   158  C CA  . GLN A 1 21  ? 3.842   43.811 62.612 1.00 15.00 ? 21  GLN A CA  1 
ATOM   159  C C   . GLN A 1 21  ? 4.925   44.314 63.574 1.00 15.00 ? 21  GLN A C   1 
ATOM   160  O O   . GLN A 1 21  ? 6.069   44.569 63.189 1.00 15.00 ? 21  GLN A O   1 
ATOM   161  C CB  . GLN A 1 21  ? 3.836   44.688 61.340 1.00 15.00 ? 21  GLN A CB  1 
ATOM   162  C CG  . GLN A 1 21  ? 2.710   44.418 60.338 1.00 15.00 ? 21  GLN A CG  1 
ATOM   163  C CD  . GLN A 1 21  ? 2.564   42.949 59.983 1.00 15.00 ? 21  GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 21  ? 3.542   42.270 59.683 1.00 15.00 ? 21  GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 21  ? 1.335   42.446 60.035 1.00 15.00 ? 21  GLN A NE2 1 
ATOM   166  N N   . CYS A 1 22  ? 4.565   44.508 64.833 1.00 15.00 ? 22  CYS A N   1 
ATOM   167  C CA  . CYS A 1 22  ? 5.512   44.990 65.821 1.00 15.00 ? 22  CYS A CA  1 
ATOM   168  C C   . CYS A 1 22  ? 6.099   43.807 66.593 1.00 15.00 ? 22  CYS A C   1 
ATOM   169  O O   . CYS A 1 22  ? 5.395   42.852 66.914 1.00 15.00 ? 22  CYS A O   1 
ATOM   170  C CB  . CYS A 1 22  ? 4.804   45.984 66.744 1.00 15.00 ? 22  CYS A CB  1 
ATOM   171  S SG  . CYS A 1 22  ? 5.799   46.639 68.109 1.00 15.00 ? 22  CYS A SG  1 
ATOM   172  N N   . GLY A 1 23  ? 7.407   43.819 66.834 1.00 15.00 ? 23  GLY A N   1 
ATOM   173  C CA  . GLY A 1 23  ? 8.034   42.729 67.560 1.00 15.00 ? 23  GLY A CA  1 
ATOM   174  C C   . GLY A 1 23  ? 7.925   42.964 69.053 1.00 15.00 ? 23  GLY A C   1 
ATOM   175  O O   . GLY A 1 23  ? 8.926   43.012 69.761 1.00 15.00 ? 23  GLY A O   1 
ATOM   176  N N   . SER A 1 24  ? 6.689   43.082 69.523 1.00 15.00 ? 24  SER A N   1 
ATOM   177  C CA  . SER A 1 24  ? 6.387   43.335 70.923 1.00 15.00 ? 24  SER A CA  1 
ATOM   178  C C   . SER A 1 24  ? 5.806   42.112 71.632 1.00 15.00 ? 24  SER A C   1 
ATOM   179  O O   . SER A 1 24  ? 5.056   42.242 72.600 1.00 15.00 ? 24  SER A O   1 
ATOM   180  C CB  . SER A 1 24  ? 5.396   44.485 71.009 1.00 15.00 ? 24  SER A CB  1 
ATOM   181  O OG  . SER A 1 24  ? 4.251   44.169 70.234 1.00 15.00 ? 24  SER A OG  1 
ATOM   182  N N   . CYS A 1 25  ? 6.145   40.908 71.179 1.00 15.00 ? 25  CYS A N   1 
ATOM   183  C CA  . CYS A 1 25  ? 5.630   39.715 71.825 1.00 15.00 ? 25  CYS A CA  1 
ATOM   184  C C   . CYS A 1 25  ? 6.125   39.678 73.273 1.00 15.00 ? 25  CYS A C   1 
ATOM   185  O O   . CYS A 1 25  ? 5.434   39.188 74.170 1.00 15.00 ? 25  CYS A O   1 
ATOM   186  C CB  . CYS A 1 25  ? 6.006   38.448 71.044 1.00 15.00 ? 25  CYS A CB  1 
ATOM   187  S SG  . CYS A 1 25  ? 7.771   38.112 70.819 1.00 15.00 ? 25  CYS A SG  1 
ATOM   188  N N   . TRP A 1 26  ? 7.297   40.262 73.517 1.00 15.00 ? 26  TRP A N   1 
ATOM   189  C CA  . TRP A 1 26  ? 7.865   40.320 74.857 1.00 15.00 ? 26  TRP A CA  1 
ATOM   190  C C   . TRP A 1 26  ? 7.025   41.254 75.745 1.00 15.00 ? 26  TRP A C   1 
ATOM   191  O O   . TRP A 1 26  ? 6.932   41.054 76.953 1.00 15.00 ? 26  TRP A O   1 
ATOM   192  C CB  . TRP A 1 26  ? 9.324   40.794 74.809 1.00 15.00 ? 26  TRP A CB  1 
ATOM   193  C CG  . TRP A 1 26  ? 9.474   42.187 74.344 1.00 15.00 ? 26  TRP A CG  1 
ATOM   194  C CD1 . TRP A 1 26  ? 9.534   42.606 73.058 1.00 15.00 ? 26  TRP A CD1 1 
ATOM   195  C CD2 . TRP A 1 26  ? 9.483   43.369 75.160 1.00 15.00 ? 26  TRP A CD2 1 
ATOM   196  N NE1 . TRP A 1 26  ? 9.565   43.980 73.010 1.00 15.00 ? 26  TRP A NE1 1 
ATOM   197  C CE2 . TRP A 1 26  ? 9.533   44.475 74.284 1.00 15.00 ? 26  TRP A CE2 1 
ATOM   198  C CE3 . TRP A 1 26  ? 9.444   43.604 76.544 1.00 15.00 ? 26  TRP A CE3 1 
ATOM   199  C CZ2 . TRP A 1 26  ? 9.545   45.796 74.741 1.00 15.00 ? 26  TRP A CZ2 1 
ATOM   200  C CZ3 . TRP A 1 26  ? 9.457   44.917 77.000 1.00 15.00 ? 26  TRP A CZ3 1 
ATOM   201  C CH2 . TRP A 1 26  ? 9.506   45.999 76.097 1.00 15.00 ? 26  TRP A CH2 1 
ATOM   202  N N   . ALA A 1 27  ? 6.389   42.262 75.149 1.00 15.00 ? 27  ALA A N   1 
ATOM   203  C CA  . ALA A 1 27  ? 5.559   43.200 75.897 1.00 15.00 ? 27  ALA A CA  1 
ATOM   204  C C   . ALA A 1 27  ? 4.258   42.506 76.273 1.00 15.00 ? 27  ALA A C   1 
ATOM   205  O O   . ALA A 1 27  ? 3.803   42.586 77.410 1.00 15.00 ? 27  ALA A O   1 
ATOM   206  C CB  . ALA A 1 27  ? 5.283   44.441 75.077 1.00 15.00 ? 27  ALA A CB  1 
ATOM   207  N N   . PHE A 1 28  ? 3.669   41.776 75.334 1.00 15.00 ? 28  PHE A N   1 
ATOM   208  C CA  . PHE A 1 28  ? 2.440   41.064 75.621 1.00 15.00 ? 28  PHE A CA  1 
ATOM   209  C C   . PHE A 1 28  ? 2.662   40.025 76.714 1.00 15.00 ? 28  PHE A C   1 
ATOM   210  O O   . PHE A 1 28  ? 1.911   39.960 77.679 1.00 15.00 ? 28  PHE A O   1 
ATOM   211  C CB  . PHE A 1 28  ? 1.887   40.419 74.351 1.00 15.00 ? 28  PHE A CB  1 
ATOM   212  C CG  . PHE A 1 28  ? 1.216   41.394 73.428 1.00 15.00 ? 28  PHE A CG  1 
ATOM   213  C CD1 . PHE A 1 28  ? 1.961   42.145 72.528 1.00 15.00 ? 28  PHE A CD1 1 
ATOM   214  C CD2 . PHE A 1 28  ? -0.153  41.598 73.493 1.00 15.00 ? 28  PHE A CD2 1 
ATOM   215  C CE1 . PHE A 1 28  ? 1.353   43.087 71.717 1.00 15.00 ? 28  PHE A CE1 1 
ATOM   216  C CE2 . PHE A 1 28  ? -0.768  42.543 72.682 1.00 15.00 ? 28  PHE A CE2 1 
ATOM   217  C CZ  . PHE A 1 28  ? -0.019  43.287 71.797 1.00 15.00 ? 28  PHE A CZ  1 
ATOM   218  N N   . SER A 1 29  ? 3.724   39.242 76.582 1.00 15.00 ? 29  SER A N   1 
ATOM   219  C CA  . SER A 1 29  ? 4.066   38.223 77.563 1.00 15.00 ? 29  SER A CA  1 
ATOM   220  C C   . SER A 1 29  ? 4.196   38.822 78.957 1.00 15.00 ? 29  SER A C   1 
ATOM   221  O O   . SER A 1 29  ? 3.551   38.354 79.899 1.00 15.00 ? 29  SER A O   1 
ATOM   222  C CB  . SER A 1 29  ? 5.381   37.559 77.180 1.00 15.00 ? 29  SER A CB  1 
ATOM   223  O OG  . SER A 1 29  ? 5.804   36.650 78.174 1.00 15.00 ? 29  SER A OG  1 
ATOM   224  N N   . SER A 1 30  ? 5.035   39.849 79.088 1.00 15.00 ? 30  SER A N   1 
ATOM   225  C CA  . SER A 1 30  ? 5.264   40.520 80.367 1.00 15.00 ? 30  SER A CA  1 
ATOM   226  C C   . SER A 1 30  ? 3.927   40.918 80.995 1.00 15.00 ? 30  SER A C   1 
ATOM   227  O O   . SER A 1 30  ? 3.621   40.568 82.143 1.00 15.00 ? 30  SER A O   1 
ATOM   228  C CB  . SER A 1 30  ? 6.116   41.781 80.160 1.00 15.00 ? 30  SER A CB  1 
ATOM   229  O OG  . SER A 1 30  ? 7.374   41.497 79.579 1.00 15.00 ? 30  SER A OG  1 
ATOM   230  N N   . VAL A 1 31  ? 3.123   41.625 80.207 1.00 15.00 ? 31  VAL A N   1 
ATOM   231  C CA  . VAL A 1 31  ? 1.821   42.102 80.639 1.00 15.00 ? 31  VAL A CA  1 
ATOM   232  C C   . VAL A 1 31  ? 0.901   40.938 81.031 1.00 15.00 ? 31  VAL A C   1 
ATOM   233  O O   . VAL A 1 31  ? 0.114   41.034 81.980 1.00 15.00 ? 31  VAL A O   1 
ATOM   234  C CB  . VAL A 1 31  ? 1.208   43.025 79.547 1.00 15.00 ? 31  VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 31  ? -0.285  42.931 79.515 1.00 15.00 ? 31  VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 31  ? 1.613   44.465 79.795 1.00 15.00 ? 31  VAL A CG2 1 
ATOM   237  N N   . GLY A 1 32  ? 1.053   39.801 80.364 1.00 15.00 ? 32  GLY A N   1 
ATOM   238  C CA  . GLY A 1 32  ? 0.231   38.650 80.674 1.00 15.00 ? 32  GLY A CA  1 
ATOM   239  C C   . GLY A 1 32  ? 0.493   38.140 82.076 1.00 15.00 ? 32  GLY A C   1 
ATOM   240  O O   . GLY A 1 32  ? -0.414  37.687 82.773 1.00 15.00 ? 32  GLY A O   1 
ATOM   241  N N   . ALA A 1 33  ? 1.748   38.177 82.502 1.00 15.00 ? 33  ALA A N   1 
ATOM   242  C CA  . ALA A 1 33  ? 2.106   37.716 83.834 1.00 15.00 ? 33  ALA A CA  1 
ATOM   243  C C   . ALA A 1 33  ? 1.605   38.738 84.844 1.00 15.00 ? 33  ALA A C   1 
ATOM   244  O O   . ALA A 1 33  ? 1.127   38.381 85.922 1.00 15.00 ? 33  ALA A O   1 
ATOM   245  C CB  . ALA A 1 33  ? 3.605   37.533 83.946 1.00 15.00 ? 33  ALA A CB  1 
ATOM   246  N N   . LEU A 1 34  ? 1.690   40.017 84.487 1.00 15.00 ? 34  LEU A N   1 
ATOM   247  C CA  . LEU A 1 34  ? 1.227   41.092 85.355 1.00 15.00 ? 34  LEU A CA  1 
ATOM   248  C C   . LEU A 1 34  ? -0.282  40.990 85.599 1.00 15.00 ? 34  LEU A C   1 
ATOM   249  O O   . LEU A 1 34  ? -0.772  41.275 86.693 1.00 15.00 ? 34  LEU A O   1 
ATOM   250  C CB  . LEU A 1 34  ? 1.572   42.444 84.741 1.00 15.00 ? 34  LEU A CB  1 
ATOM   251  C CG  . LEU A 1 34  ? 3.014   42.897 84.941 1.00 15.00 ? 34  LEU A CG  1 
ATOM   252  C CD1 . LEU A 1 34  ? 3.305   44.136 84.135 1.00 15.00 ? 34  LEU A CD1 1 
ATOM   253  C CD2 . LEU A 1 34  ? 3.241   43.184 86.400 1.00 15.00 ? 34  LEU A CD2 1 
ATOM   254  N N   . GLU A 1 35  ? -1.038  40.566 84.592 1.00 15.00 ? 35  GLU A N   1 
ATOM   255  C CA  . GLU A 1 35  ? -2.483  40.430 84.734 1.00 15.00 ? 35  GLU A CA  1 
ATOM   256  C C   . GLU A 1 35  ? -2.824  39.245 85.623 1.00 15.00 ? 35  GLU A C   1 
ATOM   257  O O   . GLU A 1 35  ? -3.718  39.330 86.459 1.00 15.00 ? 35  GLU A O   1 
ATOM   258  C CB  . GLU A 1 35  ? -3.142  40.275 83.365 1.00 15.00 ? 35  GLU A CB  1 
ATOM   259  C CG  . GLU A 1 35  ? -3.007  41.510 82.488 1.00 15.00 ? 35  GLU A CG  1 
ATOM   260  C CD  . GLU A 1 35  ? -3.205  41.237 81.007 1.00 15.00 ? 35  GLU A CD  1 
ATOM   261  O OE1 . GLU A 1 35  ? -3.403  40.067 80.617 1.00 15.00 ? 35  GLU A OE1 1 
ATOM   262  O OE2 . GLU A 1 35  ? -3.145  42.208 80.226 1.00 15.00 ? 35  GLU A OE2 1 
ATOM   263  N N   . GLY A 1 36  ? -2.090  38.148 85.477 1.00 15.00 ? 36  GLY A N   1 
ATOM   264  C CA  . GLY A 1 36  ? -2.349  36.970 86.285 1.00 15.00 ? 36  GLY A CA  1 
ATOM   265  C C   . GLY A 1 36  ? -2.202  37.241 87.769 1.00 15.00 ? 36  GLY A C   1 
ATOM   266  O O   . GLY A 1 36  ? -3.039  36.831 88.572 1.00 15.00 ? 36  GLY A O   1 
ATOM   267  N N   . GLN A 1 37  ? -1.135  37.950 88.127 1.00 15.00 ? 37  GLN A N   1 
ATOM   268  C CA  . GLN A 1 37  ? -0.860  38.306 89.514 1.00 15.00 ? 37  GLN A CA  1 
ATOM   269  C C   . GLN A 1 37  ? -1.880  39.304 90.043 1.00 15.00 ? 37  GLN A C   1 
ATOM   270  O O   . GLN A 1 37  ? -2.329  39.212 91.190 1.00 15.00 ? 37  GLN A O   1 
ATOM   271  C CB  . GLN A 1 37  ? 0.557   38.854 89.642 1.00 15.00 ? 37  GLN A CB  1 
ATOM   272  C CG  . GLN A 1 37  ? 1.621   37.791 89.407 1.00 15.00 ? 37  GLN A CG  1 
ATOM   273  C CD  . GLN A 1 37  ? 1.413   36.578 90.288 1.00 15.00 ? 37  GLN A CD  1 
ATOM   274  O OE1 . GLN A 1 37  ? 1.293   36.700 91.502 1.00 15.00 ? 37  GLN A OE1 1 
ATOM   275  N NE2 . GLN A 1 37  ? 1.332   35.407 89.682 1.00 15.00 ? 37  GLN A NE2 1 
ATOM   276  N N   . LEU A 1 38  ? -2.269  40.252 89.198 1.00 15.00 ? 38  LEU A N   1 
ATOM   277  C CA  . LEU A 1 38  ? -3.272  41.251 89.564 1.00 15.00 ? 38  LEU A CA  1 
ATOM   278  C C   . LEU A 1 38  ? -4.515  40.508 90.063 1.00 15.00 ? 38  LEU A C   1 
ATOM   279  O O   . LEU A 1 38  ? -4.973  40.710 91.187 1.00 15.00 ? 38  LEU A O   1 
ATOM   280  C CB  . LEU A 1 38  ? -3.646  42.094 88.341 1.00 15.00 ? 38  LEU A CB  1 
ATOM   281  C CG  . LEU A 1 38  ? -4.527  43.321 88.567 1.00 15.00 ? 38  LEU A CG  1 
ATOM   282  C CD1 . LEU A 1 38  ? -3.723  44.387 89.295 1.00 15.00 ? 38  LEU A CD1 1 
ATOM   283  C CD2 . LEU A 1 38  ? -5.022  43.853 87.237 1.00 15.00 ? 38  LEU A CD2 1 
ATOM   284  N N   . LYS A 1 39  ? -5.022  39.596 89.241 1.00 15.00 ? 39  LYS A N   1 
ATOM   285  C CA  . LYS A 1 39  ? -6.195  38.817 89.588 1.00 15.00 ? 39  LYS A CA  1 
ATOM   286  C C   . LYS A 1 39  ? -5.960  38.090 90.902 1.00 15.00 ? 39  LYS A C   1 
ATOM   287  O O   . LYS A 1 39  ? -6.831  38.071 91.766 1.00 15.00 ? 39  LYS A O   1 
ATOM   288  C CB  . LYS A 1 39  ? -6.512  37.819 88.476 1.00 15.00 ? 39  LYS A CB  1 
ATOM   289  C CG  . LYS A 1 39  ? -7.628  36.841 88.786 1.00 15.00 ? 39  LYS A CG  1 
ATOM   290  C CD  . LYS A 1 39  ? -8.945  37.521 89.073 1.00 15.00 ? 39  LYS A CD  1 
ATOM   291  C CE  . LYS A 1 39  ? -10.008 36.489 89.308 1.00 15.00 ? 39  LYS A CE  1 
ATOM   292  N NZ  . LYS A 1 39  ? -11.280 37.109 89.736 1.00 15.00 ? 39  LYS A NZ  1 
ATOM   293  N N   . LYS A 1 40  ? -4.769  37.531 91.084 1.00 15.00 ? 40  LYS A N   1 
ATOM   294  C CA  . LYS A 1 40  ? -4.456  36.805 92.312 1.00 15.00 ? 40  LYS A CA  1 
ATOM   295  C C   . LYS A 1 40  ? -4.627  37.703 93.549 1.00 15.00 ? 40  LYS A C   1 
ATOM   296  O O   . LYS A 1 40  ? -5.332  37.349 94.507 1.00 15.00 ? 40  LYS A O   1 
ATOM   297  C CB  . LYS A 1 40  ? -3.018  36.281 92.253 1.00 15.00 ? 40  LYS A CB  1 
ATOM   298  C CG  . LYS A 1 40  ? -2.655  35.239 93.305 1.00 15.00 ? 40  LYS A CG  1 
ATOM   299  C CD  . LYS A 1 40  ? -1.182  34.843 93.204 1.00 15.00 ? 40  LYS A CD  1 
ATOM   300  C CE  . LYS A 1 40  ? -0.841  33.695 94.147 1.00 15.00 ? 40  LYS A CE  1 
ATOM   301  N NZ  . LYS A 1 40  ? -1.588  32.447 93.829 1.00 15.00 ? 40  LYS A NZ  1 
ATOM   302  N N   . LYS A 1 41  ? -4.028  38.890 93.495 1.00 15.00 ? 41  LYS A N   1 
ATOM   303  C CA  . LYS A 1 41  ? -4.078  39.822 94.607 1.00 15.00 ? 41  LYS A CA  1 
ATOM   304  C C   . LYS A 1 41  ? -5.406  40.557 94.780 1.00 15.00 ? 41  LYS A C   1 
ATOM   305  O O   . LYS A 1 41  ? -6.093  40.369 95.781 1.00 15.00 ? 41  LYS A O   1 
ATOM   306  C CB  . LYS A 1 41  ? -2.922  40.819 94.500 1.00 15.00 ? 41  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 41  ? -1.562  40.160 94.232 1.00 15.00 ? 41  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 41  ? -1.274  39.021 95.214 1.00 15.00 ? 41  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 41  ? -0.026  38.231 94.827 1.00 15.00 ? 41  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 41  ? 0.195   37.045 95.723 1.00 15.00 ? 41  LYS A NZ  1 
ATOM   311  N N   . THR A 1 42  ? -5.789  41.385 93.811 1.00 15.00 ? 42  THR A N   1 
ATOM   312  C CA  . THR A 1 42  ? -7.021  42.166 93.898 1.00 15.00 ? 42  THR A CA  1 
ATOM   313  C C   . THR A 1 42  ? -8.319  41.410 93.627 1.00 15.00 ? 42  THR A C   1 
ATOM   314  O O   . THR A 1 42  ? -9.409  41.926 93.899 1.00 15.00 ? 42  THR A O   1 
ATOM   315  C CB  . THR A 1 42  ? -6.972  43.353 92.935 1.00 15.00 ? 42  THR A CB  1 
ATOM   316  O OG1 . THR A 1 42  ? -6.940  42.874 91.586 1.00 15.00 ? 42  THR A OG1 1 
ATOM   317  C CG2 . THR A 1 42  ? -5.733  44.177 93.184 1.00 15.00 ? 42  THR A CG2 1 
ATOM   318  N N   . GLY A 1 43  ? -8.217  40.213 93.059 1.00 15.00 ? 43  GLY A N   1 
ATOM   319  C CA  . GLY A 1 43  ? -9.400  39.440 92.741 1.00 15.00 ? 43  GLY A CA  1 
ATOM   320  C C   . GLY A 1 43  ? -10.130 39.911 91.486 1.00 15.00 ? 43  GLY A C   1 
ATOM   321  O O   . GLY A 1 43  ? -11.166 39.374 91.110 1.00 15.00 ? 43  GLY A O   1 
ATOM   322  N N   . LYS A 1 44  ? -9.641  40.931 90.793 1.00 15.00 ? 44  LYS A N   1 
ATOM   323  C CA  . LYS A 1 44  ? -10.319 41.398 89.584 1.00 15.00 ? 44  LYS A CA  1 
ATOM   324  C C   . LYS A 1 44  ? -9.324  41.532 88.450 1.00 15.00 ? 44  LYS A C   1 
ATOM   325  O O   . LYS A 1 44  ? -8.223  42.058 88.640 1.00 15.00 ? 44  LYS A O   1 
ATOM   326  C CB  . LYS A 1 44  ? -11.000 42.746 89.813 1.00 15.00 ? 44  LYS A CB  1 
ATOM   327  C CG  . LYS A 1 44  ? -12.098 42.747 90.860 1.00 15.00 ? 44  LYS A CG  1 
ATOM   328  C CD  . LYS A 1 44  ? -12.730 44.122 90.955 1.00 15.00 ? 44  LYS A CD  1 
ATOM   329  C CE  . LYS A 1 44  ? -11.766 45.146 91.508 1.00 15.00 ? 44  LYS A CE  1 
ATOM   330  N NZ  . LYS A 1 44  ? -11.461 44.863 92.925 1.00 15.00 ? 44  LYS A NZ  1 
ATOM   331  N N   . LEU A 1 45  ? -9.723  41.039 87.282 1.00 15.00 ? 45  LEU A N   1 
ATOM   332  C CA  . LEU A 1 45  ? -8.897  41.073 86.082 1.00 15.00 ? 45  LEU A CA  1 
ATOM   333  C C   . LEU A 1 45  ? -9.146  42.370 85.320 1.00 15.00 ? 45  LEU A C   1 
ATOM   334  O O   . LEU A 1 45  ? -10.276 42.857 85.234 1.00 15.00 ? 45  LEU A O   1 
ATOM   335  C CB  . LEU A 1 45  ? -9.224  39.872 85.192 1.00 15.00 ? 45  LEU A CB  1 
ATOM   336  C CG  . LEU A 1 45  ? -8.250  39.494 84.077 1.00 15.00 ? 45  LEU A CG  1 
ATOM   337  C CD1 . LEU A 1 45  ? -6.994  38.867 84.674 1.00 15.00 ? 45  LEU A CD1 1 
ATOM   338  C CD2 . LEU A 1 45  ? -8.924  38.517 83.133 1.00 15.00 ? 45  LEU A CD2 1 
ATOM   339  N N   . LEU A 1 46  ? -8.082  42.921 84.756 1.00 15.00 ? 46  LEU A N   1 
ATOM   340  C CA  . LEU A 1 46  ? -8.156  44.159 83.999 1.00 15.00 ? 46  LEU A CA  1 
ATOM   341  C C   . LEU A 1 46  ? -7.120  44.004 82.886 1.00 15.00 ? 46  LEU A C   1 
ATOM   342  O O   . LEU A 1 46  ? -6.146  43.253 83.030 1.00 15.00 ? 46  LEU A O   1 
ATOM   343  C CB  . LEU A 1 46  ? -7.825  45.336 84.927 1.00 15.00 ? 46  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 46  ? -8.212  46.782 84.601 1.00 15.00 ? 46  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 46  ? -7.155  47.434 83.766 1.00 15.00 ? 46  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 46  ? -9.556  46.831 83.908 1.00 15.00 ? 46  LEU A CD2 1 
ATOM   347  N N   . ASN A 1 47  ? -7.350  44.638 81.739 1.00 15.00 ? 47  ASN A N   1 
ATOM   348  C CA  . ASN A 1 47  ? -6.414  44.535 80.629 1.00 15.00 ? 47  ASN A CA  1 
ATOM   349  C C   . ASN A 1 47  ? -5.320  45.582 80.717 1.00 15.00 ? 47  ASN A C   1 
ATOM   350  O O   . ASN A 1 47  ? -5.584  46.778 80.684 1.00 15.00 ? 47  ASN A O   1 
ATOM   351  C CB  . ASN A 1 47  ? -7.141  44.620 79.283 1.00 15.00 ? 47  ASN A CB  1 
ATOM   352  C CG  . ASN A 1 47  ? -7.515  43.254 78.736 1.00 15.00 ? 47  ASN A CG  1 
ATOM   353  O OD1 . ASN A 1 47  ? -8.614  42.768 78.965 1.00 15.00 ? 47  ASN A OD1 1 
ATOM   354  N ND2 . ASN A 1 47  ? -6.589  42.622 78.030 1.00 15.00 ? 47  ASN A ND2 1 
ATOM   355  N N   . LEU A 1 48  ? -4.083  45.121 80.841 1.00 15.00 ? 48  LEU A N   1 
ATOM   356  C CA  . LEU A 1 48  ? -2.944  46.013 80.946 1.00 15.00 ? 48  LEU A CA  1 
ATOM   357  C C   . LEU A 1 48  ? -2.406  46.455 79.584 1.00 15.00 ? 48  LEU A C   1 
ATOM   358  O O   . LEU A 1 48  ? -2.705  45.840 78.556 1.00 15.00 ? 48  LEU A O   1 
ATOM   359  C CB  . LEU A 1 48  ? -1.859  45.389 81.835 1.00 15.00 ? 48  LEU A CB  1 
ATOM   360  C CG  . LEU A 1 48  ? -2.214  45.316 83.329 1.00 15.00 ? 48  LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 48  ? -1.047  44.817 84.147 1.00 15.00 ? 48  LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 48  ? -2.591  46.676 83.812 1.00 15.00 ? 48  LEU A CD2 1 
ATOM   363  N N   . SER A 1 49  ? -1.613  47.521 79.592 1.00 15.00 ? 49  SER A N   1 
ATOM   364  C CA  . SER A 1 49  ? -1.052  48.112 78.383 1.00 15.00 ? 49  SER A CA  1 
ATOM   365  C C   . SER A 1 49  ? 0.320   47.632 77.885 1.00 15.00 ? 49  SER A C   1 
ATOM   366  O O   . SER A 1 49  ? 1.356   47.959 78.470 1.00 15.00 ? 49  SER A O   1 
ATOM   367  C CB  . SER A 1 49  ? -1.031  49.637 78.557 1.00 15.00 ? 49  SER A CB  1 
ATOM   368  O OG  . SER A 1 49  ? -0.345  50.293 77.509 1.00 15.00 ? 49  SER A OG  1 
ATOM   369  N N   . PRO A 1 50  ? 0.343   46.853 76.780 1.00 15.00 ? 50  PRO A N   1 
ATOM   370  C CA  . PRO A 1 50  ? 1.596   46.351 76.205 1.00 15.00 ? 50  PRO A CA  1 
ATOM   371  C C   . PRO A 1 50  ? 2.341   47.525 75.557 1.00 15.00 ? 50  PRO A C   1 
ATOM   372  O O   . PRO A 1 50  ? 3.569   47.562 75.524 1.00 15.00 ? 50  PRO A O   1 
ATOM   373  C CB  . PRO A 1 50  ? 1.111   45.373 75.132 1.00 15.00 ? 50  PRO A CB  1 
ATOM   374  C CG  . PRO A 1 50  ? -0.197  44.923 75.631 1.00 15.00 ? 50  PRO A CG  1 
ATOM   375  C CD  . PRO A 1 50  ? -0.808  46.197 76.137 1.00 15.00 ? 50  PRO A CD  1 
ATOM   376  N N   . GLN A 1 51  ? 1.585   48.484 75.024 1.00 15.00 ? 51  GLN A N   1 
ATOM   377  C CA  . GLN A 1 51  ? 2.166   49.657 74.377 1.00 15.00 ? 51  GLN A CA  1 
ATOM   378  C C   . GLN A 1 51  ? 2.960   50.458 75.402 1.00 15.00 ? 51  GLN A C   1 
ATOM   379  O O   . GLN A 1 51  ? 4.063   50.929 75.118 1.00 15.00 ? 51  GLN A O   1 
ATOM   380  C CB  . GLN A 1 51  ? 1.063   50.523 73.743 1.00 15.00 ? 51  GLN A CB  1 
ATOM   381  C CG  . GLN A 1 51  ? 1.545   51.760 72.956 1.00 15.00 ? 51  GLN A CG  1 
ATOM   382  C CD  . GLN A 1 51  ? 2.184   51.433 71.604 1.00 15.00 ? 51  GLN A CD  1 
ATOM   383  O OE1 . GLN A 1 51  ? 1.704   50.583 70.858 1.00 15.00 ? 51  GLN A OE1 1 
ATOM   384  N NE2 . GLN A 1 51  ? 3.242   52.138 71.278 1.00 15.00 ? 51  GLN A NE2 1 
ATOM   385  N N   . ASN A 1 52  ? 2.439   50.558 76.623 1.00 15.00 ? 52  ASN A N   1 
ATOM   386  C CA  . ASN A 1 52  ? 3.105   51.307 77.691 1.00 15.00 ? 52  ASN A CA  1 
ATOM   387  C C   . ASN A 1 52  ? 4.536   50.810 77.888 1.00 15.00 ? 52  ASN A C   1 
ATOM   388  O O   . ASN A 1 52  ? 5.433   51.587 78.211 1.00 15.00 ? 52  ASN A O   1 
ATOM   389  C CB  . ASN A 1 52  ? 2.304   51.190 79.000 1.00 15.00 ? 52  ASN A CB  1 
ATOM   390  C CG  . ASN A 1 52  ? 2.857   52.056 80.119 1.00 15.00 ? 52  ASN A CG  1 
ATOM   391  O OD1 . ASN A 1 52  ? 2.501   51.871 81.278 1.00 15.00 ? 52  ASN A OD1 1 
ATOM   392  N ND2 . ASN A 1 52  ? 3.706   53.014 79.781 1.00 15.00 ? 52  ASN A ND2 1 
ATOM   393  N N   . LEU A 1 53  ? 4.737   49.516 77.665 1.00 15.00 ? 53  LEU A N   1 
ATOM   394  C CA  . LEU A 1 53  ? 6.047   48.891 77.792 1.00 15.00 ? 53  LEU A CA  1 
ATOM   395  C C   . LEU A 1 53  ? 6.901   49.136 76.563 1.00 15.00 ? 53  LEU A C   1 
ATOM   396  O O   . LEU A 1 53  ? 8.094   49.417 76.669 1.00 15.00 ? 53  LEU A O   1 
ATOM   397  C CB  . LEU A 1 53  ? 5.893   47.383 77.982 1.00 15.00 ? 53  LEU A CB  1 
ATOM   398  C CG  . LEU A 1 53  ? 5.260   46.924 79.288 1.00 15.00 ? 53  LEU A CG  1 
ATOM   399  C CD1 . LEU A 1 53  ? 5.129   45.417 79.287 1.00 15.00 ? 53  LEU A CD1 1 
ATOM   400  C CD2 . LEU A 1 53  ? 6.116   47.397 80.448 1.00 15.00 ? 53  LEU A CD2 1 
ATOM   401  N N   . VAL A 1 54  ? 6.270   49.023 75.402 1.00 15.00 ? 54  VAL A N   1 
ATOM   402  C CA  . VAL A 1 54  ? 6.933   49.203 74.117 1.00 15.00 ? 54  VAL A CA  1 
ATOM   403  C C   . VAL A 1 54  ? 7.625   50.554 73.994 1.00 15.00 ? 54  VAL A C   1 
ATOM   404  O O   . VAL A 1 54  ? 8.782   50.629 73.584 1.00 15.00 ? 54  VAL A O   1 
ATOM   405  C CB  . VAL A 1 54  ? 5.924   49.038 72.967 1.00 15.00 ? 54  VAL A CB  1 
ATOM   406  C CG1 . VAL A 1 54  ? 6.587   49.306 71.629 1.00 15.00 ? 54  VAL A CG1 1 
ATOM   407  C CG2 . VAL A 1 54  ? 5.331   47.638 72.999 1.00 15.00 ? 54  VAL A CG2 1 
ATOM   408  N N   . ASP A 1 55  ? 6.920   51.617 74.371 1.00 15.00 ? 55  ASP A N   1 
ATOM   409  C CA  . ASP A 1 55  ? 7.448   52.973 74.291 1.00 15.00 ? 55  ASP A CA  1 
ATOM   410  C C   . ASP A 1 55  ? 8.303   53.421 75.472 1.00 15.00 ? 55  ASP A C   1 
ATOM   411  O O   . ASP A 1 55  ? 9.128   54.317 75.331 1.00 15.00 ? 55  ASP A O   1 
ATOM   412  C CB  . ASP A 1 55  ? 6.302   53.975 74.169 1.00 15.00 ? 55  ASP A CB  1 
ATOM   413  C CG  . ASP A 1 55  ? 5.355   53.670 73.030 1.00 15.00 ? 55  ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 55  ? 5.715   52.895 72.126 1.00 15.00 ? 55  ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 55  ? 4.237   54.225 73.047 1.00 15.00 ? 55  ASP A OD2 1 
ATOM   416  N N   . CYS A 1 56  ? 8.112   52.826 76.646 1.00 15.00 ? 56  CYS A N   1 
ATOM   417  C CA  . CYS A 1 56  ? 8.838   53.255 77.834 1.00 15.00 ? 56  CYS A CA  1 
ATOM   418  C C   . CYS A 1 56  ? 10.050  52.455 78.321 1.00 15.00 ? 56  CYS A C   1 
ATOM   419  O O   . CYS A 1 56  ? 10.971  53.022 78.914 1.00 15.00 ? 56  CYS A O   1 
ATOM   420  C CB  . CYS A 1 56  ? 7.846   53.472 78.968 1.00 15.00 ? 56  CYS A CB  1 
ATOM   421  S SG  . CYS A 1 56  ? 6.383   54.441 78.470 1.00 15.00 ? 56  CYS A SG  1 
ATOM   422  N N   . VAL A 1 57  ? 10.090  51.142 78.102 1.00 15.00 ? 57  VAL A N   1 
ATOM   423  C CA  . VAL A 1 57  ? 11.242  50.350 78.550 1.00 15.00 ? 57  VAL A CA  1 
ATOM   424  C C   . VAL A 1 57  ? 12.424  50.601 77.621 1.00 15.00 ? 57  VAL A C   1 
ATOM   425  O O   . VAL A 1 57  ? 12.699  49.802 76.734 1.00 15.00 ? 57  VAL A O   1 
ATOM   426  C CB  . VAL A 1 57  ? 10.945  48.830 78.577 1.00 15.00 ? 57  VAL A CB  1 
ATOM   427  C CG1 . VAL A 1 57  ? 12.125  48.081 79.197 1.00 15.00 ? 57  VAL A CG1 1 
ATOM   428  C CG2 . VAL A 1 57  ? 9.679   48.542 79.335 1.00 15.00 ? 57  VAL A CG2 1 
ATOM   429  N N   . SER A 1 58  ? 13.142  51.695 77.848 1.00 15.00 ? 58  SER A N   1 
ATOM   430  C CA  . SER A 1 58  ? 14.280  52.062 77.015 1.00 15.00 ? 58  SER A CA  1 
ATOM   431  C C   . SER A 1 58  ? 15.361  50.997 76.978 1.00 15.00 ? 58  SER A C   1 
ATOM   432  O O   . SER A 1 58  ? 16.211  50.993 76.090 1.00 15.00 ? 58  SER A O   1 
ATOM   433  C CB  . SER A 1 58  ? 14.895  53.363 77.509 1.00 15.00 ? 58  SER A CB  1 
ATOM   434  O OG  . SER A 1 58  ? 15.418  53.193 78.813 1.00 15.00 ? 58  SER A OG  1 
ATOM   435  N N   . GLU A 1 59  ? 15.368  50.112 77.964 1.00 15.00 ? 59  GLU A N   1 
ATOM   436  C CA  . GLU A 1 59  ? 16.359  49.052 78.004 1.00 15.00 ? 59  GLU A CA  1 
ATOM   437  C C   . GLU A 1 59  ? 16.101  48.067 76.870 1.00 15.00 ? 59  GLU A C   1 
ATOM   438  O O   . GLU A 1 59  ? 16.956  47.249 76.530 1.00 15.00 ? 59  GLU A O   1 
ATOM   439  C CB  . GLU A 1 59  ? 16.317  48.317 79.350 1.00 15.00 ? 59  GLU A CB  1 
ATOM   440  C CG  . GLU A 1 59  ? 16.677  49.169 80.545 1.00 15.00 ? 59  GLU A CG  1 
ATOM   441  C CD  . GLU A 1 59  ? 15.626  50.207 80.862 1.00 15.00 ? 59  GLU A CD  1 
ATOM   442  O OE1 . GLU A 1 59  ? 14.426  49.861 80.866 1.00 15.00 ? 59  GLU A OE1 1 
ATOM   443  O OE2 . GLU A 1 59  ? 15.994  51.374 81.113 1.00 15.00 ? 59  GLU A OE2 1 
ATOM   444  N N   . ASN A 1 60  ? 14.900  48.122 76.305 1.00 15.00 ? 60  ASN A N   1 
ATOM   445  C CA  . ASN A 1 60  ? 14.515  47.237 75.218 1.00 15.00 ? 60  ASN A CA  1 
ATOM   446  C C   . ASN A 1 60  ? 14.483  47.959 73.886 1.00 15.00 ? 60  ASN A C   1 
ATOM   447  O O   . ASN A 1 60  ? 14.592  49.176 73.837 1.00 15.00 ? 60  ASN A O   1 
ATOM   448  C CB  . ASN A 1 60  ? 13.179  46.567 75.520 1.00 15.00 ? 60  ASN A CB  1 
ATOM   449  C CG  . ASN A 1 60  ? 13.306  45.461 76.544 1.00 15.00 ? 60  ASN A CG  1 
ATOM   450  O OD1 . ASN A 1 60  ? 12.321  44.851 76.926 1.00 15.00 ? 60  ASN A OD1 1 
ATOM   451  N ND2 . ASN A 1 60  ? 14.526  45.175 76.968 1.00 15.00 ? 60  ASN A ND2 1 
ATOM   452  N N   . ASP A 1 61  ? 14.292  47.204 72.812 1.00 15.00 ? 61  ASP A N   1 
ATOM   453  C CA  . ASP A 1 61  ? 14.294  47.754 71.469 1.00 15.00 ? 61  ASP A CA  1 
ATOM   454  C C   . ASP A 1 61  ? 12.942  48.213 70.909 1.00 15.00 ? 61  ASP A C   1 
ATOM   455  O O   . ASP A 1 61  ? 12.863  48.686 69.772 1.00 15.00 ? 61  ASP A O   1 
ATOM   456  C CB  . ASP A 1 61  ? 14.929  46.731 70.525 1.00 15.00 ? 61  ASP A CB  1 
ATOM   457  C CG  . ASP A 1 61  ? 15.946  47.347 69.583 1.00 15.00 ? 61  ASP A CG  1 
ATOM   458  O OD1 . ASP A 1 61  ? 15.795  48.533 69.216 1.00 15.00 ? 61  ASP A OD1 1 
ATOM   459  O OD2 . ASP A 1 61  ? 16.900  46.637 69.211 1.00 15.00 ? 61  ASP A OD2 1 
ATOM   460  N N   . GLY A 1 62  ? 11.872  48.101 71.687 1.00 15.00 ? 62  GLY A N   1 
ATOM   461  C CA  . GLY A 1 62  ? 10.563  48.503 71.194 1.00 15.00 ? 62  GLY A CA  1 
ATOM   462  C C   . GLY A 1 62  ? 10.029  47.389 70.316 1.00 15.00 ? 62  GLY A C   1 
ATOM   463  O O   . GLY A 1 62  ? 9.924   46.246 70.757 1.00 15.00 ? 62  GLY A O   1 
ATOM   464  N N   . CYS A 1 63  ? 9.709   47.689 69.060 1.00 15.00 ? 63  CYS A N   1 
ATOM   465  C CA  . CYS A 1 63  ? 9.213   46.670 68.130 1.00 15.00 ? 63  CYS A CA  1 
ATOM   466  C C   . CYS A 1 63  ? 10.350  45.789 67.634 1.00 15.00 ? 63  CYS A C   1 
ATOM   467  O O   . CYS A 1 63  ? 10.118  44.862 66.867 1.00 15.00 ? 63  CYS A O   1 
ATOM   468  C CB  . CYS A 1 63  ? 8.515   47.303 66.924 1.00 15.00 ? 63  CYS A CB  1 
ATOM   469  S SG  . CYS A 1 63  ? 6.943   48.118 67.306 1.00 15.00 ? 63  CYS A SG  1 
ATOM   470  N N   . GLY A 1 64  ? 11.581  46.118 68.018 1.00 15.00 ? 64  GLY A N   1 
ATOM   471  C CA  . GLY A 1 64  ? 12.727  45.333 67.603 1.00 15.00 ? 64  GLY A CA  1 
ATOM   472  C C   . GLY A 1 64  ? 12.974  44.188 68.568 1.00 15.00 ? 64  GLY A C   1 
ATOM   473  O O   . GLY A 1 64  ? 13.527  43.147 68.201 1.00 15.00 ? 64  GLY A O   1 
ATOM   474  N N   . GLY A 1 65  ? 12.567  44.369 69.820 1.00 15.00 ? 65  GLY A N   1 
ATOM   475  C CA  . GLY A 1 65  ? 12.769  43.323 70.801 1.00 15.00 ? 65  GLY A CA  1 
ATOM   476  C C   . GLY A 1 65  ? 12.917  43.760 72.242 1.00 15.00 ? 65  GLY A C   1 
ATOM   477  O O   . GLY A 1 65  ? 12.975  44.950 72.561 1.00 15.00 ? 65  GLY A O   1 
ATOM   478  N N   . GLY A 1 66  ? 12.990  42.777 73.128 1.00 15.00 ? 66  GLY A N   1 
ATOM   479  C CA  . GLY A 1 66  ? 13.134  43.070 74.537 1.00 15.00 ? 66  GLY A CA  1 
ATOM   480  C C   . GLY A 1 66  ? 12.974  41.863 75.432 1.00 15.00 ? 66  GLY A C   1 
ATOM   481  O O   . GLY A 1 66  ? 12.481  40.824 75.008 1.00 15.00 ? 66  GLY A O   1 
ATOM   482  N N   . TYR A 1 67  ? 13.405  41.999 76.679 1.00 15.00 ? 67  TYR A N   1 
ATOM   483  C CA  . TYR A 1 67  ? 13.315  40.917 77.650 1.00 15.00 ? 67  TYR A CA  1 
ATOM   484  C C   . TYR A 1 67  ? 12.221  41.286 78.632 1.00 15.00 ? 67  TYR A C   1 
ATOM   485  O O   . TYR A 1 67  ? 12.075  42.459 78.982 1.00 15.00 ? 67  TYR A O   1 
ATOM   486  C CB  . TYR A 1 67  ? 14.632  40.752 78.406 1.00 15.00 ? 67  TYR A CB  1 
ATOM   487  C CG  . TYR A 1 67  ? 15.818  40.379 77.554 1.00 15.00 ? 67  TYR A CG  1 
ATOM   488  C CD1 . TYR A 1 67  ? 16.007  39.063 77.121 1.00 15.00 ? 67  TYR A CD1 1 
ATOM   489  C CD2 . TYR A 1 67  ? 16.789  41.322 77.234 1.00 15.00 ? 67  TYR A CD2 1 
ATOM   490  C CE1 . TYR A 1 67  ? 17.139  38.698 76.401 1.00 15.00 ? 67  TYR A CE1 1 
ATOM   491  C CE2 . TYR A 1 67  ? 17.919  40.972 76.511 1.00 15.00 ? 67  TYR A CE2 1 
ATOM   492  C CZ  . TYR A 1 67  ? 18.090  39.658 76.097 1.00 15.00 ? 67  TYR A CZ  1 
ATOM   493  O OH  . TYR A 1 67  ? 19.208  39.308 75.366 1.00 15.00 ? 67  TYR A OH  1 
ATOM   494  N N   . MET A 1 68  ? 11.482  40.280 79.094 1.00 15.00 ? 68  MET A N   1 
ATOM   495  C CA  . MET A 1 68  ? 10.386  40.484 80.040 1.00 15.00 ? 68  MET A CA  1 
ATOM   496  C C   . MET A 1 68  ? 10.903  41.066 81.347 1.00 15.00 ? 68  MET A C   1 
ATOM   497  O O   . MET A 1 68  ? 10.320  41.999 81.900 1.00 15.00 ? 68  MET A O   1 
ATOM   498  C CB  . MET A 1 68  ? 9.642   39.167 80.308 1.00 15.00 ? 68  MET A CB  1 
ATOM   499  C CG  . MET A 1 68  ? 8.928   38.553 79.090 1.00 15.00 ? 68  MET A CG  1 
ATOM   500  S SD  . MET A 1 68  ? 9.998   37.814 77.842 1.00 15.00 ? 68  MET A SD  1 
ATOM   501  C CE  . MET A 1 68  ? 10.189  36.188 78.477 1.00 15.00 ? 68  MET A CE  1 
ATOM   502  N N   . THR A 1 69  ? 12.034  40.546 81.816 1.00 15.00 ? 69  THR A N   1 
ATOM   503  C CA  . THR A 1 69  ? 12.638  41.013 83.059 1.00 15.00 ? 69  THR A CA  1 
ATOM   504  C C   . THR A 1 69  ? 12.846  42.526 83.032 1.00 15.00 ? 69  THR A C   1 
ATOM   505  O O   . THR A 1 69  ? 12.590  43.207 84.026 1.00 15.00 ? 69  THR A O   1 
ATOM   506  C CB  . THR A 1 69  ? 13.981  40.286 83.360 1.00 15.00 ? 69  THR A CB  1 
ATOM   507  O OG1 . THR A 1 69  ? 14.839  40.339 82.211 1.00 15.00 ? 69  THR A OG1 1 
ATOM   508  C CG2 . THR A 1 69  ? 13.733  38.832 83.730 1.00 15.00 ? 69  THR A CG2 1 
ATOM   509  N N   . ASN A 1 70  ? 13.240  43.061 81.874 1.00 15.00 ? 70  ASN A N   1 
ATOM   510  C CA  . ASN A 1 70  ? 13.478  44.499 81.715 1.00 15.00 ? 70  ASN A CA  1 
ATOM   511  C C   . ASN A 1 70  ? 12.197  45.296 81.865 1.00 15.00 ? 70  ASN A C   1 
ATOM   512  O O   . ASN A 1 70  ? 12.209  46.404 82.408 1.00 15.00 ? 70  ASN A O   1 
ATOM   513  C CB  . ASN A 1 70  ? 14.114  44.802 80.365 1.00 15.00 ? 70  ASN A CB  1 
ATOM   514  C CG  . ASN A 1 70  ? 15.598  44.513 80.342 1.00 15.00 ? 70  ASN A CG  1 
ATOM   515  O OD1 . ASN A 1 70  ? 16.388  45.351 79.931 1.00 15.00 ? 70  ASN A OD1 1 
ATOM   516  N ND2 . ASN A 1 70  ? 15.985  43.324 80.762 1.00 15.00 ? 70  ASN A ND2 1 
ATOM   517  N N   . ALA A 1 71  ? 11.094  44.714 81.398 1.00 15.00 ? 71  ALA A N   1 
ATOM   518  C CA  . ALA A 1 71  ? 9.773   45.336 81.483 1.00 15.00 ? 71  ALA A CA  1 
ATOM   519  C C   . ALA A 1 71  ? 9.270   45.306 82.918 1.00 15.00 ? 71  ALA A C   1 
ATOM   520  O O   . ALA A 1 71  ? 8.539   46.200 83.345 1.00 15.00 ? 71  ALA A O   1 
ATOM   521  C CB  . ALA A 1 71  ? 8.792   44.617 80.574 1.00 15.00 ? 71  ALA A CB  1 
ATOM   522  N N   . PHE A 1 72  ? 9.616   44.243 83.640 1.00 15.00 ? 72  PHE A N   1 
ATOM   523  C CA  . PHE A 1 72  ? 9.232   44.087 85.040 1.00 15.00 ? 72  PHE A CA  1 
ATOM   524  C C   . PHE A 1 72  ? 9.926   45.198 85.821 1.00 15.00 ? 72  PHE A C   1 
ATOM   525  O O   . PHE A 1 72  ? 9.286   46.022 86.480 1.00 15.00 ? 72  PHE A O   1 
ATOM   526  C CB  . PHE A 1 72  ? 9.706   42.731 85.581 1.00 15.00 ? 72  PHE A CB  1 
ATOM   527  C CG  . PHE A 1 72  ? 8.993   41.551 85.004 1.00 15.00 ? 72  PHE A CG  1 
ATOM   528  C CD1 . PHE A 1 72  ? 7.647   41.615 84.689 1.00 15.00 ? 72  PHE A CD1 1 
ATOM   529  C CD2 . PHE A 1 72  ? 9.673   40.373 84.771 1.00 15.00 ? 72  PHE A CD2 1 
ATOM   530  C CE1 . PHE A 1 72  ? 6.997   40.521 84.146 1.00 15.00 ? 72  PHE A CE1 1 
ATOM   531  C CE2 . PHE A 1 72  ? 9.035   39.277 84.228 1.00 15.00 ? 72  PHE A CE2 1 
ATOM   532  C CZ  . PHE A 1 72  ? 7.696   39.349 83.916 1.00 15.00 ? 72  PHE A CZ  1 
ATOM   533  N N   . GLN A 1 73  ? 11.248  45.218 85.698 1.00 15.00 ? 73  GLN A N   1 
ATOM   534  C CA  . GLN A 1 73  ? 12.108  46.194 86.342 1.00 15.00 ? 73  GLN A CA  1 
ATOM   535  C C   . GLN A 1 73  ? 11.543  47.600 86.101 1.00 15.00 ? 73  GLN A C   1 
ATOM   536  O O   . GLN A 1 73  ? 11.598  48.469 86.973 1.00 15.00 ? 73  GLN A O   1 
ATOM   537  C CB  . GLN A 1 73  ? 13.515  46.060 85.738 1.00 15.00 ? 73  GLN A CB  1 
ATOM   538  C CG  . GLN A 1 73  ? 14.661  46.596 86.578 1.00 15.00 ? 73  GLN A CG  1 
ATOM   539  C CD  . GLN A 1 73  ? 15.020  45.690 87.737 1.00 15.00 ? 73  GLN A CD  1 
ATOM   540  O OE1 . GLN A 1 73  ? 14.499  45.840 88.852 1.00 15.00 ? 73  GLN A OE1 1 
ATOM   541  N NE2 . GLN A 1 73  ? 15.938  44.754 87.489 1.00 15.00 ? 73  GLN A NE2 1 
ATOM   542  N N   . TYR A 1 74  ? 10.968  47.821 84.922 1.00 15.00 ? 74  TYR A N   1 
ATOM   543  C CA  . TYR A 1 74  ? 10.395  49.118 84.588 1.00 15.00 ? 74  TYR A CA  1 
ATOM   544  C C   . TYR A 1 74  ? 9.150   49.438 85.412 1.00 15.00 ? 74  TYR A C   1 
ATOM   545  O O   . TYR A 1 74  ? 9.026   50.548 85.921 1.00 15.00 ? 74  TYR A O   1 
ATOM   546  C CB  . TYR A 1 74  ? 10.089  49.234 83.083 1.00 15.00 ? 74  TYR A CB  1 
ATOM   547  C CG  . TYR A 1 74  ? 9.166   50.388 82.728 1.00 15.00 ? 74  TYR A CG  1 
ATOM   548  C CD1 . TYR A 1 74  ? 9.599   51.706 82.816 1.00 15.00 ? 74  TYR A CD1 1 
ATOM   549  C CD2 . TYR A 1 74  ? 7.835   50.158 82.377 1.00 15.00 ? 74  TYR A CD2 1 
ATOM   550  C CE1 . TYR A 1 74  ? 8.732   52.768 82.579 1.00 15.00 ? 74  TYR A CE1 1 
ATOM   551  C CE2 . TYR A 1 74  ? 6.959   51.210 82.135 1.00 15.00 ? 74  TYR A CE2 1 
ATOM   552  C CZ  . TYR A 1 74  ? 7.413   52.513 82.244 1.00 15.00 ? 74  TYR A CZ  1 
ATOM   553  O OH  . TYR A 1 74  ? 6.538   53.564 82.064 1.00 15.00 ? 74  TYR A OH  1 
ATOM   554  N N   . VAL A 1 75  ? 8.208   48.503 85.549 1.00 15.00 ? 75  VAL A N   1 
ATOM   555  C CA  . VAL A 1 75  ? 6.976   48.769 86.320 1.00 15.00 ? 75  VAL A CA  1 
ATOM   556  C C   . VAL A 1 75  ? 7.275   48.954 87.815 1.00 15.00 ? 75  VAL A C   1 
ATOM   557  O O   . VAL A 1 75  ? 6.519   49.584 88.556 1.00 15.00 ? 75  VAL A O   1 
ATOM   558  C CB  . VAL A 1 75  ? 5.901   47.657 86.114 1.00 15.00 ? 75  VAL A CB  1 
ATOM   559  C CG1 . VAL A 1 75  ? 4.644   47.973 86.925 1.00 15.00 ? 75  VAL A CG1 1 
ATOM   560  C CG2 . VAL A 1 75  ? 5.550   47.527 84.632 1.00 15.00 ? 75  VAL A CG2 1 
ATOM   561  N N   . GLN A 1 76  ? 8.404   48.422 88.257 1.00 15.00 ? 76  GLN A N   1 
ATOM   562  C CA  . GLN A 1 76  ? 8.813   48.546 89.638 1.00 15.00 ? 76  GLN A CA  1 
ATOM   563  C C   . GLN A 1 76  ? 9.498   49.904 89.870 1.00 15.00 ? 76  GLN A C   1 
ATOM   564  O O   . GLN A 1 76  ? 9.198   50.621 90.840 1.00 15.00 ? 76  GLN A O   1 
ATOM   565  C CB  . GLN A 1 76  ? 9.767   47.406 89.976 1.00 15.00 ? 76  GLN A CB  1 
ATOM   566  C CG  . GLN A 1 76  ? 10.220  47.360 91.422 1.00 15.00 ? 76  GLN A CG  1 
ATOM   567  C CD  . GLN A 1 76  ? 11.533  46.650 91.572 1.00 15.00 ? 76  GLN A CD  1 
ATOM   568  O OE1 . GLN A 1 76  ? 11.787  45.660 90.897 1.00 15.00 ? 76  GLN A OE1 1 
ATOM   569  N NE2 . GLN A 1 76  ? 12.393  47.171 92.433 1.00 15.00 ? 76  GLN A NE2 1 
ATOM   570  N N   . LYS A 1 77  ? 10.421  50.267 88.982 1.00 15.00 ? 77  LYS A N   1 
ATOM   571  C CA  . LYS A 1 77  ? 11.154  51.525 89.104 1.00 15.00 ? 77  LYS A CA  1 
ATOM   572  C C   . LYS A 1 77  ? 10.352  52.742 88.689 1.00 15.00 ? 77  LYS A C   1 
ATOM   573  O O   . LYS A 1 77  ? 10.718  53.861 89.015 1.00 15.00 ? 77  LYS A O   1 
ATOM   574  C CB  . LYS A 1 77  ? 12.471  51.476 88.325 1.00 15.00 ? 77  LYS A CB  1 
ATOM   575  C CG  . LYS A 1 77  ? 12.321  51.492 86.819 1.00 15.00 ? 77  LYS A CG  1 
ATOM   576  C CD  . LYS A 1 77  ? 13.671  51.280 86.125 1.00 15.00 ? 77  LYS A CD  1 
ATOM   577  C CE  . LYS A 1 77  ? 14.256  49.896 86.445 1.00 15.00 ? 77  LYS A CE  1 
ATOM   578  N NZ  . LYS A 1 77  ? 15.590  49.612 85.809 1.00 15.00 ? 77  LYS A NZ  1 
ATOM   579  N N   . ASN A 1 78  ? 9.297   52.549 87.914 1.00 15.00 ? 78  ASN A N   1 
ATOM   580  C CA  . ASN A 1 78  ? 8.453   53.659 87.500 1.00 15.00 ? 78  ASN A CA  1 
ATOM   581  C C   . ASN A 1 78  ? 7.197   53.643 88.362 1.00 15.00 ? 78  ASN A C   1 
ATOM   582  O O   . ASN A 1 78  ? 6.493   54.642 88.464 1.00 15.00 ? 78  ASN A O   1 
ATOM   583  C CB  . ASN A 1 78  ? 8.082   53.535 86.026 1.00 15.00 ? 78  ASN A CB  1 
ATOM   584  C CG  . ASN A 1 78  ? 7.046   54.562 85.596 1.00 15.00 ? 78  ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 78  ? 7.353   55.742 85.425 1.00 15.00 ? 78  ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 78  ? 5.814   54.114 85.417 1.00 15.00 ? 78  ASN A ND2 1 
ATOM   587  N N   . ARG A 1 79  ? 6.944   52.484 88.977 1.00 15.00 ? 79  ARG A N   1 
ATOM   588  C CA  . ARG A 1 79  ? 5.807   52.235 89.871 1.00 15.00 ? 79  ARG A CA  1 
ATOM   589  C C   . ARG A 1 79  ? 4.433   52.483 89.279 1.00 15.00 ? 79  ARG A C   1 
ATOM   590  O O   . ARG A 1 79  ? 3.666   53.333 89.739 1.00 15.00 ? 79  ARG A O   1 
ATOM   591  C CB  . ARG A 1 79  ? 5.983   52.942 91.230 1.00 15.00 ? 79  ARG A CB  1 
ATOM   592  C CG  . ARG A 1 79  ? 5.971   54.472 91.218 1.00 15.00 ? 79  ARG A CG  1 
ATOM   593  C CD  . ARG A 1 79  ? 6.992   55.052 92.183 1.00 15.00 ? 79  ARG A CD  1 
ATOM   594  N NE  . ARG A 1 79  ? 6.879   54.454 93.509 1.00 15.00 ? 79  ARG A NE  1 
ATOM   595  C CZ  . ARG A 1 79  ? 7.548   53.370 93.892 1.00 15.00 ? 79  ARG A CZ  1 
ATOM   596  N NH1 . ARG A 1 79  ? 8.393   52.775 93.042 1.00 15.00 ? 79  ARG A NH1 1 
ATOM   597  N NH2 . ARG A 1 79  ? 7.307   52.830 95.087 1.00 15.00 ? 79  ARG A NH2 1 
ATOM   598  N N   . GLY A 1 80  ? 4.107   51.681 88.277 1.00 15.00 ? 80  GLY A N   1 
ATOM   599  C CA  . GLY A 1 80  ? 2.822   51.799 87.630 1.00 15.00 ? 80  GLY A CA  1 
ATOM   600  C C   . GLY A 1 80  ? 2.880   51.511 86.147 1.00 15.00 ? 80  GLY A C   1 
ATOM   601  O O   . GLY A 1 80  ? 3.865   51.821 85.468 1.00 15.00 ? 80  GLY A O   1 
ATOM   602  N N   . ILE A 1 81  ? 1.833   50.851 85.668 1.00 15.00 ? 81  ILE A N   1 
ATOM   603  C CA  . ILE A 1 81  ? 1.686   50.517 84.272 1.00 15.00 ? 81  ILE A CA  1 
ATOM   604  C C   . ILE A 1 81  ? 0.230   50.821 83.977 1.00 15.00 ? 81  ILE A C   1 
ATOM   605  O O   . ILE A 1 81  ? -0.644  50.488 84.777 1.00 15.00 ? 81  ILE A O   1 
ATOM   606  C CB  . ILE A 1 81  ? 1.998   49.033 83.992 1.00 15.00 ? 81  ILE A CB  1 
ATOM   607  C CG1 . ILE A 1 81  ? 1.892   48.762 82.481 1.00 15.00 ? 81  ILE A CG1 1 
ATOM   608  C CG2 . ILE A 1 81  ? 1.080   48.129 84.810 1.00 15.00 ? 81  ILE A CG2 1 
ATOM   609  C CD1 . ILE A 1 81  ? 2.403   47.406 82.020 1.00 15.00 ? 81  ILE A CD1 1 
ATOM   610  N N   . ASP A 1 82  ? -0.026  51.519 82.874 1.00 15.00 ? 82  ASP A N   1 
ATOM   611  C CA  . ASP A 1 82  ? -1.385  51.879 82.491 1.00 15.00 ? 82  ASP A CA  1 
ATOM   612  C C   . ASP A 1 82  ? -2.202  50.694 82.017 1.00 15.00 ? 82  ASP A C   1 
ATOM   613  O O   . ASP A 1 82  ? -1.680  49.612 81.766 1.00 15.00 ? 82  ASP A O   1 
ATOM   614  C CB  . ASP A 1 82  ? -1.372  52.924 81.377 1.00 15.00 ? 82  ASP A CB  1 
ATOM   615  C CG  . ASP A 1 82  ? -0.877  54.277 81.833 1.00 15.00 ? 82  ASP A CG  1 
ATOM   616  O OD1 . ASP A 1 82  ? -1.092  54.652 83.005 1.00 15.00 ? 82  ASP A OD1 1 
ATOM   617  O OD2 . ASP A 1 82  ? -0.290  54.979 80.992 1.00 15.00 ? 82  ASP A OD2 1 
ATOM   618  N N   . SER A 1 83  ? -3.503  50.907 81.900 1.00 15.00 ? 83  SER A N   1 
ATOM   619  C CA  . SER A 1 83  ? -4.404  49.885 81.412 1.00 15.00 ? 83  SER A CA  1 
ATOM   620  C C   . SER A 1 83  ? -4.509  50.119 79.917 1.00 15.00 ? 83  SER A C   1 
ATOM   621  O O   . SER A 1 83  ? -4.039  51.142 79.402 1.00 15.00 ? 83  SER A O   1 
ATOM   622  C CB  . SER A 1 83  ? -5.770  50.045 82.062 1.00 15.00 ? 83  SER A CB  1 
ATOM   623  O OG  . SER A 1 83  ? -6.233  51.376 81.934 1.00 15.00 ? 83  SER A OG  1 
ATOM   624  N N   . GLU A 1 84  ? -5.129  49.189 79.201 1.00 15.00 ? 84  GLU A N   1 
ATOM   625  C CA  . GLU A 1 84  ? -5.286  49.340 77.764 1.00 15.00 ? 84  GLU A CA  1 
ATOM   626  C C   . GLU A 1 84  ? -6.071  50.613 77.426 1.00 15.00 ? 84  GLU A C   1 
ATOM   627  O O   . GLU A 1 84  ? -5.629  51.411 76.605 1.00 15.00 ? 84  GLU A O   1 
ATOM   628  C CB  . GLU A 1 84  ? -5.948  48.101 77.158 1.00 15.00 ? 84  GLU A CB  1 
ATOM   629  C CG  . GLU A 1 84  ? -6.031  48.103 75.633 1.00 15.00 ? 84  GLU A CG  1 
ATOM   630  C CD  . GLU A 1 84  ? -4.669  48.102 74.931 1.00 15.00 ? 84  GLU A CD  1 
ATOM   631  O OE1 . GLU A 1 84  ? -3.706  47.461 75.407 1.00 15.00 ? 84  GLU A OE1 1 
ATOM   632  O OE2 . GLU A 1 84  ? -4.572  48.738 73.869 1.00 15.00 ? 84  GLU A OE2 1 
ATOM   633  N N   . ASP A 1 85  ? -7.211  50.850 78.072 1.00 15.00 ? 85  ASP A N   1 
ATOM   634  C CA  . ASP A 1 85  ? -7.985  52.062 77.800 1.00 15.00 ? 85  ASP A CA  1 
ATOM   635  C C   . ASP A 1 85  ? -7.173  53.294 78.205 1.00 15.00 ? 85  ASP A C   1 
ATOM   636  O O   . ASP A 1 85  ? -7.418  54.402 77.731 1.00 15.00 ? 85  ASP A O   1 
ATOM   637  C CB  . ASP A 1 85  ? -9.332  52.053 78.549 1.00 15.00 ? 85  ASP A CB  1 
ATOM   638  C CG  . ASP A 1 85  ? -10.244 53.273 78.193 1.00 15.00 ? 85  ASP A CG  1 
ATOM   639  O OD1 . ASP A 1 85  ? -9.974  54.000 77.205 1.00 15.00 ? 85  ASP A OD1 1 
ATOM   640  O OD2 . ASP A 1 85  ? -11.256 53.502 78.904 1.00 15.00 ? 85  ASP A OD2 1 
ATOM   641  N N   . ALA A 1 86  ? -6.170  53.124 79.055 1.00 15.00 ? 86  ALA A N   1 
ATOM   642  C CA  . ALA A 1 86  ? -5.382  54.269 79.473 1.00 15.00 ? 86  ALA A CA  1 
ATOM   643  C C   . ALA A 1 86  ? -4.193  54.532 78.559 1.00 15.00 ? 86  ALA A C   1 
ATOM   644  O O   . ALA A 1 86  ? -3.663  55.646 78.527 1.00 15.00 ? 86  ALA A O   1 
ATOM   645  C CB  . ALA A 1 86  ? -4.924  54.092 80.895 1.00 15.00 ? 86  ALA A CB  1 
ATOM   646  N N   . TYR A 1 87  ? -3.764  53.518 77.807 1.00 15.00 ? 87  TYR A N   1 
ATOM   647  C CA  . TYR A 1 87  ? -2.623  53.663 76.903 1.00 15.00 ? 87  TYR A CA  1 
ATOM   648  C C   . TYR A 1 87  ? -2.728  52.600 75.807 1.00 15.00 ? 87  TYR A C   1 
ATOM   649  O O   . TYR A 1 87  ? -1.936  51.652 75.786 1.00 15.00 ? 87  TYR A O   1 
ATOM   650  C CB  . TYR A 1 87  ? -1.343  53.461 77.709 1.00 15.00 ? 87  TYR A CB  1 
ATOM   651  C CG  . TYR A 1 87  ? -0.067  54.016 77.116 1.00 15.00 ? 87  TYR A CG  1 
ATOM   652  C CD1 . TYR A 1 87  ? 0.190   53.962 75.750 1.00 15.00 ? 87  TYR A CD1 1 
ATOM   653  C CD2 . TYR A 1 87  ? 0.918   54.544 77.945 1.00 15.00 ? 87  TYR A CD2 1 
ATOM   654  C CE1 . TYR A 1 87  ? 1.400   54.412 75.237 1.00 15.00 ? 87  TYR A CE1 1 
ATOM   655  C CE2 . TYR A 1 87  ? 2.124   54.991 77.438 1.00 15.00 ? 87  TYR A CE2 1 
ATOM   656  C CZ  . TYR A 1 87  ? 2.361   54.923 76.093 1.00 15.00 ? 87  TYR A CZ  1 
ATOM   657  O OH  . TYR A 1 87  ? 3.577   55.346 75.621 1.00 15.00 ? 87  TYR A OH  1 
ATOM   658  N N   . PRO A 1 88  ? -3.681  52.764 74.860 1.00 15.00 ? 88  PRO A N   1 
ATOM   659  C CA  . PRO A 1 88  ? -3.920  51.834 73.749 1.00 15.00 ? 88  PRO A CA  1 
ATOM   660  C C   . PRO A 1 88  ? -2.732  51.424 72.897 1.00 15.00 ? 88  PRO A C   1 
ATOM   661  O O   . PRO A 1 88  ? -1.758  52.156 72.754 1.00 15.00 ? 88  PRO A O   1 
ATOM   662  C CB  . PRO A 1 88  ? -4.986  52.553 72.930 1.00 15.00 ? 88  PRO A CB  1 
ATOM   663  C CG  . PRO A 1 88  ? -5.773  53.264 73.986 1.00 15.00 ? 88  PRO A CG  1 
ATOM   664  C CD  . PRO A 1 88  ? -4.652  53.874 74.801 1.00 15.00 ? 88  PRO A CD  1 
ATOM   665  N N   . TYR A 1 89  ? -2.854  50.236 72.320 1.00 15.00 ? 89  TYR A N   1 
ATOM   666  C CA  . TYR A 1 89  ? -1.835  49.649 71.467 1.00 15.00 ? 89  TYR A CA  1 
ATOM   667  C C   . TYR A 1 89  ? -2.005  50.192 70.039 1.00 15.00 ? 89  TYR A C   1 
ATOM   668  O O   . TYR A 1 89  ? -3.039  49.984 69.401 1.00 15.00 ? 89  TYR A O   1 
ATOM   669  C CB  . TYR A 1 89  ? -1.967  48.117 71.502 1.00 15.00 ? 89  TYR A CB  1 
ATOM   670  C CG  . TYR A 1 89  ? -0.798  47.389 70.903 1.00 15.00 ? 89  TYR A CG  1 
ATOM   671  C CD1 . TYR A 1 89  ? 0.497   47.619 71.360 1.00 15.00 ? 89  TYR A CD1 1 
ATOM   672  C CD2 . TYR A 1 89  ? -0.975  46.500 69.844 1.00 15.00 ? 89  TYR A CD2 1 
ATOM   673  C CE1 . TYR A 1 89  ? 1.588   46.990 70.771 1.00 15.00 ? 89  TYR A CE1 1 
ATOM   674  C CE2 . TYR A 1 89  ? 0.107   45.869 69.251 1.00 15.00 ? 89  TYR A CE2 1 
ATOM   675  C CZ  . TYR A 1 89  ? 1.382   46.122 69.717 1.00 15.00 ? 89  TYR A CZ  1 
ATOM   676  O OH  . TYR A 1 89  ? 2.459   45.534 69.112 1.00 15.00 ? 89  TYR A OH  1 
ATOM   677  N N   . VAL A 1 90  ? -1.003  50.923 69.557 1.00 15.00 ? 90  VAL A N   1 
ATOM   678  C CA  . VAL A 1 90  ? -1.044  51.507 68.221 1.00 15.00 ? 90  VAL A CA  1 
ATOM   679  C C   . VAL A 1 90  ? -0.294  50.694 67.189 1.00 15.00 ? 90  VAL A C   1 
ATOM   680  O O   . VAL A 1 90  ? -0.135  51.118 66.055 1.00 15.00 ? 90  VAL A O   1 
ATOM   681  C CB  . VAL A 1 90  ? -0.488  52.941 68.191 1.00 15.00 ? 90  VAL A CB  1 
ATOM   682  C CG1 . VAL A 1 90  ? -1.264  53.825 69.150 1.00 15.00 ? 90  VAL A CG1 1 
ATOM   683  C CG2 . VAL A 1 90  ? 1.002   52.942 68.505 1.00 15.00 ? 90  VAL A CG2 1 
ATOM   684  N N   . GLY A 1 91  ? 0.222   49.544 67.592 1.00 15.00 ? 91  GLY A N   1 
ATOM   685  C CA  . GLY A 1 91  ? 0.927   48.689 66.657 1.00 15.00 ? 91  GLY A CA  1 
ATOM   686  C C   . GLY A 1 91  ? 2.257   49.204 66.160 1.00 15.00 ? 91  GLY A C   1 
ATOM   687  O O   . GLY A 1 91  ? 2.748   48.760 65.117 1.00 15.00 ? 91  GLY A O   1 
ATOM   688  N N   . GLN A 1 92  ? 2.862   50.121 66.901 1.00 15.00 ? 92  GLN A N   1 
ATOM   689  C CA  . GLN A 1 92  ? 4.154   50.665 66.514 1.00 15.00 ? 92  GLN A CA  1 
ATOM   690  C C   . GLN A 1 92  ? 4.758   51.516 67.622 1.00 15.00 ? 92  GLN A C   1 
ATOM   691  O O   . GLN A 1 92  ? 4.083   51.903 68.579 1.00 15.00 ? 92  GLN A O   1 
ATOM   692  C CB  . GLN A 1 92  ? 4.021   51.494 65.249 1.00 15.00 ? 92  GLN A CB  1 
ATOM   693  C CG  . GLN A 1 92  ? 3.108   52.680 65.414 1.00 15.00 ? 92  GLN A CG  1 
ATOM   694  C CD  . GLN A 1 92  ? 2.777   53.309 64.095 1.00 15.00 ? 92  GLN A CD  1 
ATOM   695  O OE1 . GLN A 1 92  ? 3.056   54.491 63.858 1.00 15.00 ? 92  GLN A OE1 1 
ATOM   696  N NE2 . GLN A 1 92  ? 2.193   52.516 63.205 1.00 15.00 ? 92  GLN A NE2 1 
ATOM   697  N N   . GLU A 1 93  ? 6.028   51.841 67.443 1.00 15.00 ? 93  GLU A N   1 
ATOM   698  C CA  . GLU A 1 93  ? 6.779   52.622 68.400 1.00 15.00 ? 93  GLU A CA  1 
ATOM   699  C C   . GLU A 1 93  ? 6.401   54.093 68.357 1.00 15.00 ? 93  GLU A C   1 
ATOM   700  O O   . GLU A 1 93  ? 6.167   54.668 67.292 1.00 15.00 ? 93  GLU A O   1 
ATOM   701  C CB  . GLU A 1 93  ? 8.274   52.452 68.133 1.00 15.00 ? 93  GLU A CB  1 
ATOM   702  C CG  . GLU A 1 93  ? 8.745   50.990 68.086 1.00 15.00 ? 93  GLU A CG  1 
ATOM   703  C CD  . GLU A 1 93  ? 10.157  50.853 67.546 1.00 15.00 ? 93  GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 93  ? 10.931  51.822 67.683 1.00 15.00 ? 93  GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 93  ? 10.498  49.790 66.976 1.00 15.00 ? 93  GLU A OE2 1 
ATOM   706  N N   . GLU A 1 94  ? 6.348   54.700 69.532 1.00 15.00 ? 94  GLU A N   1 
ATOM   707  C CA  . GLU A 1 94  ? 6.017   56.104 69.671 1.00 15.00 ? 94  GLU A CA  1 
ATOM   708  C C   . GLU A 1 94  ? 6.583   56.595 70.992 1.00 15.00 ? 94  GLU A C   1 
ATOM   709  O O   . GLU A 1 94  ? 7.111   55.811 71.775 1.00 15.00 ? 94  GLU A O   1 
ATOM   710  C CB  . GLU A 1 94  ? 4.500   56.320 69.635 1.00 15.00 ? 94  GLU A CB  1 
ATOM   711  C CG  . GLU A 1 94  ? 3.691   55.276 70.367 1.00 15.00 ? 94  GLU A CG  1 
ATOM   712  C CD  . GLU A 1 94  ? 2.319   55.769 70.768 1.00 15.00 ? 94  GLU A CD  1 
ATOM   713  O OE1 . GLU A 1 94  ? 1.478   55.995 69.872 1.00 15.00 ? 94  GLU A OE1 1 
ATOM   714  O OE2 . GLU A 1 94  ? 2.087   55.934 71.986 1.00 15.00 ? 94  GLU A OE2 1 
ATOM   715  N N   . SER A 1 95  ? 6.501   57.895 71.220 1.00 15.00 ? 95  SER A N   1 
ATOM   716  C CA  . SER A 1 95  ? 6.999   58.503 72.435 1.00 15.00 ? 95  SER A CA  1 
ATOM   717  C C   . SER A 1 95  ? 6.271   57.941 73.650 1.00 15.00 ? 95  SER A C   1 
ATOM   718  O O   . SER A 1 95  ? 5.045   57.755 73.620 1.00 15.00 ? 95  SER A O   1 
ATOM   719  C CB  . SER A 1 95  ? 6.811   60.021 72.360 1.00 15.00 ? 95  SER A CB  1 
ATOM   720  O OG  . SER A 1 95  ? 7.617   60.596 71.341 1.00 15.00 ? 95  SER A OG  1 
ATOM   721  N N   . CYS A 1 96  ? 7.044   57.632 74.695 1.00 15.00 ? 96  CYS A N   1 
ATOM   722  C CA  . CYS A 1 96  ? 6.482   57.105 75.940 1.00 15.00 ? 96  CYS A CA  1 
ATOM   723  C C   . CYS A 1 96  ? 5.462   58.124 76.431 1.00 15.00 ? 96  CYS A C   1 
ATOM   724  O O   . CYS A 1 96  ? 5.741   59.325 76.501 1.00 15.00 ? 96  CYS A O   1 
ATOM   725  C CB  . CYS A 1 96  ? 7.585   56.871 76.986 1.00 15.00 ? 96  CYS A CB  1 
ATOM   726  S SG  . CYS A 1 96  ? 6.996   56.377 78.644 1.00 15.00 ? 96  CYS A SG  1 
ATOM   727  N N   . MET A 1 97  ? 4.260   57.646 76.727 1.00 15.00 ? 97  MET A N   1 
ATOM   728  C CA  . MET A 1 97  ? 3.171   58.506 77.158 1.00 15.00 ? 97  MET A CA  1 
ATOM   729  C C   . MET A 1 97  ? 2.488   57.989 78.416 1.00 15.00 ? 97  MET A C   1 
ATOM   730  O O   . MET A 1 97  ? 1.253   58.004 78.517 1.00 15.00 ? 97  MET A O   1 
ATOM   731  C CB  . MET A 1 97  ? 2.150   58.647 76.021 1.00 15.00 ? 97  MET A CB  1 
ATOM   732  C CG  . MET A 1 97  ? 2.669   59.413 74.787 1.00 15.00 ? 97  MET A CG  1 
ATOM   733  S SD  . MET A 1 97  ? 1.951   58.837 73.217 1.00 15.00 ? 97  MET A SD  1 
ATOM   734  C CE  . MET A 1 97  ? 0.178   59.218 73.486 1.00 15.00 ? 97  MET A CE  1 
ATOM   735  N N   . TYR A 1 98  ? 3.277   57.539 79.388 1.00 15.00 ? 98  TYR A N   1 
ATOM   736  C CA  . TYR A 1 98  ? 2.714   57.035 80.624 1.00 15.00 ? 98  TYR A CA  1 
ATOM   737  C C   . TYR A 1 98  ? 1.842   58.094 81.264 1.00 15.00 ? 98  TYR A C   1 
ATOM   738  O O   . TYR A 1 98  ? 2.300   59.208 81.520 1.00 15.00 ? 98  TYR A O   1 
ATOM   739  C CB  . TYR A 1 98  ? 3.798   56.627 81.616 1.00 15.00 ? 98  TYR A CB  1 
ATOM   740  C CG  . TYR A 1 98  ? 3.225   56.094 82.919 1.00 15.00 ? 98  TYR A CG  1 
ATOM   741  C CD1 . TYR A 1 98  ? 2.553   54.876 82.960 1.00 15.00 ? 98  TYR A CD1 1 
ATOM   742  C CD2 . TYR A 1 98  ? 3.330   56.824 84.108 1.00 15.00 ? 98  TYR A CD2 1 
ATOM   743  C CE1 . TYR A 1 98  ? 1.996   54.401 84.151 1.00 15.00 ? 98  TYR A CE1 1 
ATOM   744  C CE2 . TYR A 1 98  ? 2.779   56.352 85.301 1.00 15.00 ? 98  TYR A CE2 1 
ATOM   745  C CZ  . TYR A 1 98  ? 2.117   55.145 85.310 1.00 15.00 ? 98  TYR A CZ  1 
ATOM   746  O OH  . TYR A 1 98  ? 1.578   54.668 86.474 1.00 15.00 ? 98  TYR A OH  1 
ATOM   747  N N   . ASN A 1 99  ? 0.577   57.747 81.461 1.00 15.00 ? 99  ASN A N   1 
ATOM   748  C CA  . ASN A 1 99  ? -0.392  58.627 82.095 1.00 15.00 ? 99  ASN A CA  1 
ATOM   749  C C   . ASN A 1 99  ? -0.626  58.067 83.494 1.00 15.00 ? 99  ASN A C   1 
ATOM   750  O O   . ASN A 1 99  ? -1.488  57.199 83.692 1.00 15.00 ? 99  ASN A O   1 
ATOM   751  C CB  . ASN A 1 99  ? -1.715  58.645 81.319 1.00 15.00 ? 99  ASN A CB  1 
ATOM   752  C CG  . ASN A 1 99  ? -2.801  59.422 82.045 1.00 15.00 ? 99  ASN A CG  1 
ATOM   753  O OD1 . ASN A 1 99  ? -2.518  60.257 82.919 1.00 15.00 ? 99  ASN A OD1 1 
ATOM   754  N ND2 . ASN A 1 99  ? -4.053  59.132 81.713 1.00 15.00 ? 99  ASN A ND2 1 
ATOM   755  N N   . PRO A 1 100 ? 0.108   58.588 84.490 1.00 15.00 ? 100 PRO A N   1 
ATOM   756  C CA  . PRO A 1 100 ? 0.025   58.167 85.894 1.00 15.00 ? 100 PRO A CA  1 
ATOM   757  C C   . PRO A 1 100 ? -1.379  57.906 86.422 1.00 15.00 ? 100 PRO A C   1 
ATOM   758  O O   . PRO A 1 100 ? -1.586  57.015 87.242 1.00 15.00 ? 100 PRO A O   1 
ATOM   759  C CB  . PRO A 1 100 ? 0.711   59.312 86.643 1.00 15.00 ? 100 PRO A CB  1 
ATOM   760  C CG  . PRO A 1 100 ? 0.628   60.485 85.668 1.00 15.00 ? 100 PRO A CG  1 
ATOM   761  C CD  . PRO A 1 100 ? 0.913   59.813 84.365 1.00 15.00 ? 100 PRO A CD  1 
ATOM   762  N N   . THR A 1 101 ? -2.361  58.659 85.947 1.00 15.00 ? 101 THR A N   1 
ATOM   763  C CA  . THR A 1 101 ? -3.728  58.474 86.417 1.00 15.00 ? 101 THR A CA  1 
ATOM   764  C C   . THR A 1 101 ? -4.274  57.121 85.967 1.00 15.00 ? 101 THR A C   1 
ATOM   765  O O   . THR A 1 101 ? -4.950  56.418 86.731 1.00 15.00 ? 101 THR A O   1 
ATOM   766  C CB  . THR A 1 101 ? -4.644  59.602 85.918 1.00 15.00 ? 101 THR A CB  1 
ATOM   767  O OG1 . THR A 1 101 ? -4.700  59.584 84.484 1.00 15.00 ? 101 THR A OG1 1 
ATOM   768  C CG2 . THR A 1 101 ? -4.106  60.955 86.375 1.00 15.00 ? 101 THR A CG2 1 
ATOM   769  N N   . GLY A 1 102 ? -3.946  56.743 84.731 1.00 15.00 ? 102 GLY A N   1 
ATOM   770  C CA  . GLY A 1 102 ? -4.398  55.473 84.193 1.00 15.00 ? 102 GLY A CA  1 
ATOM   771  C C   . GLY A 1 102 ? -3.705  54.246 84.775 1.00 15.00 ? 102 GLY A C   1 
ATOM   772  O O   . GLY A 1 102 ? -3.968  53.119 84.323 1.00 15.00 ? 102 GLY A O   1 
ATOM   773  N N   . LYS A 1 103 ? -2.818  54.431 85.758 1.00 15.00 ? 103 LYS A N   1 
ATOM   774  C CA  . LYS A 1 103 ? -2.104  53.311 86.375 1.00 15.00 ? 103 LYS A CA  1 
ATOM   775  C C   . LYS A 1 103 ? -3.079  52.253 86.871 1.00 15.00 ? 103 LYS A C   1 
ATOM   776  O O   . LYS A 1 103 ? -4.055  52.563 87.541 1.00 15.00 ? 103 LYS A O   1 
ATOM   777  C CB  . LYS A 1 103 ? -1.253  53.793 87.546 1.00 15.00 ? 103 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 103 ? -0.534  52.676 88.272 1.00 15.00 ? 103 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 103 ? 0.105   53.156 89.575 1.00 15.00 ? 103 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 103 ? -0.941  53.349 90.662 1.00 15.00 ? 103 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 103 ? -1.602  52.048 90.993 1.00 15.00 ? 103 LYS A NZ  1 
ATOM   782  N N   . ALA A 1 104 ? -2.808  50.996 86.551 1.00 15.00 ? 104 ALA A N   1 
ATOM   783  C CA  . ALA A 1 104 ? -3.683  49.903 86.960 1.00 15.00 ? 104 ALA A CA  1 
ATOM   784  C C   . ALA A 1 104 ? -2.949  48.788 87.694 1.00 15.00 ? 104 ALA A C   1 
ATOM   785  O O   . ALA A 1 104 ? -3.568  47.828 88.144 1.00 15.00 ? 104 ALA A O   1 
ATOM   786  C CB  . ALA A 1 104 ? -4.422  49.341 85.745 1.00 15.00 ? 104 ALA A CB  1 
ATOM   787  N N   . ALA A 1 105 ? -1.632  48.899 87.830 1.00 15.00 ? 105 ALA A N   1 
ATOM   788  C CA  . ALA A 1 105 ? -0.865  47.872 88.524 1.00 15.00 ? 105 ALA A CA  1 
ATOM   789  C C   . ALA A 1 105 ? 0.537   48.327 88.926 1.00 15.00 ? 105 ALA A C   1 
ATOM   790  O O   . ALA A 1 105 ? 1.068   49.293 88.380 1.00 15.00 ? 105 ALA A O   1 
ATOM   791  C CB  . ALA A 1 105 ? -0.794  46.603 87.683 1.00 15.00 ? 105 ALA A CB  1 
ATOM   792  N N   . LYS A 1 106 ? 1.103   47.626 89.902 1.00 15.00 ? 106 LYS A N   1 
ATOM   793  C CA  . LYS A 1 106 ? 2.433   47.892 90.437 1.00 15.00 ? 106 LYS A CA  1 
ATOM   794  C C   . LYS A 1 106 ? 3.080   46.526 90.625 1.00 15.00 ? 106 LYS A C   1 
ATOM   795  O O   . LYS A 1 106 ? 2.390   45.500 90.584 1.00 15.00 ? 106 LYS A O   1 
ATOM   796  C CB  . LYS A 1 106 ? 2.335   48.534 91.824 1.00 15.00 ? 106 LYS A CB  1 
ATOM   797  C CG  . LYS A 1 106 ? 2.061   50.026 91.901 1.00 15.00 ? 106 LYS A CG  1 
ATOM   798  C CD  . LYS A 1 106 ? 1.776   50.381 93.360 1.00 15.00 ? 106 LYS A CD  1 
ATOM   799  C CE  . LYS A 1 106 ? 2.038   51.851 93.678 1.00 15.00 ? 106 LYS A CE  1 
ATOM   800  N NZ  . LYS A 1 106 ? 3.495   52.164 93.721 1.00 15.00 ? 106 LYS A NZ  1 
ATOM   801  N N   . CYS A 1 107 ? 4.394   46.492 90.817 1.00 15.00 ? 107 CYS A N   1 
ATOM   802  C CA  . CYS A 1 107 ? 5.088   45.233 91.065 1.00 15.00 ? 107 CYS A CA  1 
ATOM   803  C C   . CYS A 1 107 ? 6.340   45.553 91.874 1.00 15.00 ? 107 CYS A C   1 
ATOM   804  O O   . CYS A 1 107 ? 6.868   46.657 91.798 1.00 15.00 ? 107 CYS A O   1 
ATOM   805  C CB  . CYS A 1 107 ? 5.395   44.474 89.762 1.00 15.00 ? 107 CYS A CB  1 
ATOM   806  S SG  . CYS A 1 107 ? 6.974   44.811 88.978 1.00 15.00 ? 107 CYS A SG  1 
ATOM   807  N N   . ARG A 1 108 ? 6.765   44.622 92.715 1.00 15.00 ? 108 ARG A N   1 
ATOM   808  C CA  . ARG A 1 108 ? 7.929   44.817 93.577 1.00 15.00 ? 108 ARG A CA  1 
ATOM   809  C C   . ARG A 1 108 ? 9.144   43.947 93.242 1.00 15.00 ? 108 ARG A C   1 
ATOM   810  O O   . ARG A 1 108 ? 9.797   43.400 94.133 1.00 15.00 ? 108 ARG A O   1 
ATOM   811  C CB  . ARG A 1 108 ? 7.520   44.627 95.047 1.00 15.00 ? 108 ARG A CB  1 
ATOM   812  C CG  . ARG A 1 108 ? 6.353   43.648 95.262 1.00 15.00 ? 108 ARG A CG  1 
ATOM   813  C CD  . ARG A 1 108 ? 6.216   43.218 96.713 1.00 15.00 ? 108 ARG A CD  1 
ATOM   814  N NE  . ARG A 1 108 ? 7.458   42.614 97.208 1.00 15.00 ? 108 ARG A NE  1 
ATOM   815  C CZ  . ARG A 1 108 ? 7.581   41.363 97.655 1.00 15.00 ? 108 ARG A CZ  1 
ATOM   816  N NH1 . ARG A 1 108 ? 6.534   40.540 97.681 1.00 15.00 ? 108 ARG A NH1 1 
ATOM   817  N NH2 . ARG A 1 108 ? 8.763   40.937 98.085 1.00 15.00 ? 108 ARG A NH2 1 
ATOM   818  N N   . GLY A 1 109 ? 9.476   43.842 91.961 1.00 15.00 ? 109 GLY A N   1 
ATOM   819  C CA  . GLY A 1 109 ? 10.617  43.038 91.563 1.00 15.00 ? 109 GLY A CA  1 
ATOM   820  C C   . GLY A 1 109 ? 10.219  41.921 90.625 1.00 15.00 ? 109 GLY A C   1 
ATOM   821  O O   . GLY A 1 109 ? 9.181   41.998 89.961 1.00 15.00 ? 109 GLY A O   1 
ATOM   822  N N   . TYR A 1 110 ? 11.011  40.855 90.583 1.00 15.00 ? 110 TYR A N   1 
ATOM   823  C CA  . TYR A 1 110 ? 10.717  39.728 89.706 1.00 15.00 ? 110 TYR A CA  1 
ATOM   824  C C   . TYR A 1 110 ? 11.644  38.565 89.993 1.00 15.00 ? 110 TYR A C   1 
ATOM   825  O O   . TYR A 1 110 ? 12.790  38.766 90.396 1.00 15.00 ? 110 TYR A O   1 
ATOM   826  C CB  . TYR A 1 110 ? 10.899  40.148 88.244 1.00 15.00 ? 110 TYR A CB  1 
ATOM   827  C CG  . TYR A 1 110 ? 12.332  40.496 87.875 1.00 15.00 ? 110 TYR A CG  1 
ATOM   828  C CD1 . TYR A 1 110 ? 12.819  41.792 88.044 1.00 15.00 ? 110 TYR A CD1 1 
ATOM   829  C CD2 . TYR A 1 110 ? 13.191  39.531 87.340 1.00 15.00 ? 110 TYR A CD2 1 
ATOM   830  C CE1 . TYR A 1 110 ? 14.118  42.118 87.686 1.00 15.00 ? 110 TYR A CE1 1 
ATOM   831  C CE2 . TYR A 1 110 ? 14.494  39.853 86.983 1.00 15.00 ? 110 TYR A CE2 1 
ATOM   832  C CZ  . TYR A 1 110 ? 14.952  41.147 87.154 1.00 15.00 ? 110 TYR A CZ  1 
ATOM   833  O OH  . TYR A 1 110 ? 16.236  41.486 86.769 1.00 15.00 ? 110 TYR A OH  1 
ATOM   834  N N   . ARG A 1 111 ? 11.180  37.356 89.706 1.00 15.00 ? 111 ARG A N   1 
ATOM   835  C CA  . ARG A 1 111 ? 11.979  36.159 89.926 1.00 15.00 ? 111 ARG A CA  1 
ATOM   836  C C   . ARG A 1 111 ? 12.139  35.300 88.667 1.00 15.00 ? 111 ARG A C   1 
ATOM   837  O O   . ARG A 1 111 ? 11.168  34.995 87.983 1.00 15.00 ? 111 ARG A O   1 
ATOM   838  C CB  . ARG A 1 111 ? 11.380  35.315 91.060 1.00 15.00 ? 111 ARG A CB  1 
ATOM   839  C CG  . ARG A 1 111 ? 11.588  35.883 92.457 1.00 15.00 ? 111 ARG A CG  1 
ATOM   840  C CD  . ARG A 1 111 ? 11.771  34.767 93.486 1.00 15.00 ? 111 ARG A CD  1 
ATOM   841  N NE  . ARG A 1 111 ? 12.974  34.993 94.281 1.00 15.00 ? 111 ARG A NE  1 
ATOM   842  C CZ  . ARG A 1 111 ? 12.984  35.535 95.497 1.00 15.00 ? 111 ARG A CZ  1 
ATOM   843  N NH1 . ARG A 1 111 ? 11.844  35.891 96.091 1.00 15.00 ? 111 ARG A NH1 1 
ATOM   844  N NH2 . ARG A 1 111 ? 14.140  35.707 96.125 1.00 15.00 ? 111 ARG A NH2 1 
ATOM   845  N N   . GLU A 1 112 ? 13.371  34.914 88.357 1.00 15.00 ? 112 GLU A N   1 
ATOM   846  C CA  . GLU A 1 112 ? 13.649  34.085 87.191 1.00 15.00 ? 112 GLU A CA  1 
ATOM   847  C C   . GLU A 1 112 ? 13.439  32.623 87.566 1.00 15.00 ? 112 GLU A C   1 
ATOM   848  O O   . GLU A 1 112 ? 12.962  32.326 88.649 1.00 15.00 ? 112 GLU A O   1 
ATOM   849  C CB  . GLU A 1 112 ? 15.083  34.318 86.709 1.00 15.00 ? 112 GLU A CB  1 
ATOM   850  C CG  . GLU A 1 112 ? 15.362  35.747 86.244 1.00 15.00 ? 112 GLU A CG  1 
ATOM   851  C CD  . GLU A 1 112 ? 15.810  35.825 84.780 1.00 15.00 ? 112 GLU A CD  1 
ATOM   852  O OE1 . GLU A 1 112 ? 15.063  35.353 83.887 1.00 15.00 ? 112 GLU A OE1 1 
ATOM   853  O OE2 . GLU A 1 112 ? 16.914  36.364 84.522 1.00 15.00 ? 112 GLU A OE2 1 
ATOM   854  N N   . ILE A 1 113 ? 13.733  31.700 86.660 1.00 15.00 ? 113 ILE A N   1 
ATOM   855  C CA  . ILE A 1 113 ? 13.579  30.267 86.932 1.00 15.00 ? 113 ILE A CA  1 
ATOM   856  C C   . ILE A 1 113 ? 14.895  29.654 86.475 1.00 15.00 ? 113 ILE A C   1 
ATOM   857  O O   . ILE A 1 113 ? 15.478  30.104 85.490 1.00 15.00 ? 113 ILE A O   1 
ATOM   858  C CB  . ILE A 1 113 ? 12.395  29.626 86.138 1.00 15.00 ? 113 ILE A CB  1 
ATOM   859  C CG1 . ILE A 1 113 ? 11.092  30.393 86.382 1.00 15.00 ? 113 ILE A CG1 1 
ATOM   860  C CG2 . ILE A 1 113 ? 12.193  28.178 86.546 1.00 15.00 ? 113 ILE A CG2 1 
ATOM   861  C CD1 . ILE A 1 113 ? 10.522  30.261 87.778 1.00 15.00 ? 113 ILE A CD1 1 
ATOM   862  N N   . PRO A 1 114 ? 15.419  28.669 87.221 1.00 15.00 ? 114 PRO A N   1 
ATOM   863  C CA  . PRO A 1 114 ? 16.685  28.035 86.853 1.00 15.00 ? 114 PRO A CA  1 
ATOM   864  C C   . PRO A 1 114 ? 16.728  27.682 85.386 1.00 15.00 ? 114 PRO A C   1 
ATOM   865  O O   . PRO A 1 114 ? 15.881  26.941 84.901 1.00 15.00 ? 114 PRO A O   1 
ATOM   866  C CB  . PRO A 1 114 ? 16.697  26.791 87.730 1.00 15.00 ? 114 PRO A CB  1 
ATOM   867  C CG  . PRO A 1 114 ? 16.078  27.308 88.989 1.00 15.00 ? 114 PRO A CG  1 
ATOM   868  C CD  . PRO A 1 114 ? 14.885  28.077 88.458 1.00 15.00 ? 114 PRO A CD  1 
ATOM   869  N N   . GLU A 1 115 ? 17.688  28.246 84.668 1.00 15.00 ? 115 GLU A N   1 
ATOM   870  C CA  . GLU A 1 115 ? 17.811  27.970 83.253 1.00 15.00 ? 115 GLU A CA  1 
ATOM   871  C C   . GLU A 1 115 ? 17.756  26.473 82.977 1.00 15.00 ? 115 GLU A C   1 
ATOM   872  O O   . GLU A 1 115 ? 18.558  25.707 83.511 1.00 15.00 ? 115 GLU A O   1 
ATOM   873  C CB  . GLU A 1 115 ? 19.107  28.560 82.683 1.00 15.00 ? 115 GLU A CB  1 
ATOM   874  C CG  . GLU A 1 115 ? 19.048  30.056 82.310 1.00 15.00 ? 115 GLU A CG  1 
ATOM   875  C CD  . GLU A 1 115 ? 20.265  30.524 81.473 1.00 15.00 ? 115 GLU A CD  1 
ATOM   876  O OE1 . GLU A 1 115 ? 20.876  29.690 80.753 1.00 15.00 ? 115 GLU A OE1 1 
ATOM   877  O OE2 . GLU A 1 115 ? 20.608  31.734 81.531 1.00 15.00 ? 115 GLU A OE2 1 
ATOM   878  N N   . GLY A 1 116 ? 16.748  26.080 82.202 1.00 15.00 ? 116 GLY A N   1 
ATOM   879  C CA  . GLY A 1 116 ? 16.564  24.702 81.789 1.00 15.00 ? 116 GLY A CA  1 
ATOM   880  C C   . GLY A 1 116 ? 15.861  23.832 82.793 1.00 15.00 ? 116 GLY A C   1 
ATOM   881  O O   . GLY A 1 116 ? 15.926  22.606 82.694 1.00 15.00 ? 116 GLY A O   1 
ATOM   882  N N   . ASN A 1 117 ? 15.111  24.436 83.708 1.00 15.00 ? 117 ASN A N   1 
ATOM   883  C CA  . ASN A 1 117 ? 14.435  23.663 84.744 1.00 15.00 ? 117 ASN A CA  1 
ATOM   884  C C   . ASN A 1 117 ? 12.924  23.503 84.581 1.00 15.00 ? 117 ASN A C   1 
ATOM   885  O O   . ASN A 1 117 ? 12.137  24.333 85.051 1.00 15.00 ? 117 ASN A O   1 
ATOM   886  C CB  . ASN A 1 117 ? 14.749  24.265 86.107 1.00 15.00 ? 117 ASN A CB  1 
ATOM   887  C CG  . ASN A 1 117 ? 14.774  23.232 87.200 1.00 15.00 ? 117 ASN A CG  1 
ATOM   888  O OD1 . ASN A 1 117 ? 13.837  22.447 87.358 1.00 15.00 ? 117 ASN A OD1 1 
ATOM   889  N ND2 . ASN A 1 117 ? 15.860  23.215 87.961 1.00 15.00 ? 117 ASN A ND2 1 
ATOM   890  N N   . GLU A 1 118 ? 12.489  22.390 83.997 1.00 15.00 ? 118 GLU A N   1 
ATOM   891  C CA  . GLU A 1 118 ? 11.064  22.160 83.792 1.00 15.00 ? 118 GLU A CA  1 
ATOM   892  C C   . GLU A 1 118 ? 10.315  21.815 85.063 1.00 15.00 ? 118 GLU A C   1 
ATOM   893  O O   . GLU A 1 118 ? 9.131   22.095 85.182 1.00 15.00 ? 118 GLU A O   1 
ATOM   894  C CB  . GLU A 1 118 ? 10.816  21.073 82.753 1.00 15.00 ? 118 GLU A CB  1 
ATOM   895  C CG  . GLU A 1 118 ? 10.987  21.509 81.314 1.00 15.00 ? 118 GLU A CG  1 
ATOM   896  C CD  . GLU A 1 118 ? 10.343  20.530 80.356 1.00 15.00 ? 118 GLU A CD  1 
ATOM   897  O OE1 . GLU A 1 118 ? 9.250   20.032 80.677 1.00 15.00 ? 118 GLU A OE1 1 
ATOM   898  O OE2 . GLU A 1 118 ? 10.920  20.247 79.290 1.00 15.00 ? 118 GLU A OE2 1 
ATOM   899  N N   . LYS A 1 119 ? 10.981  21.152 86.000 1.00 15.00 ? 119 LYS A N   1 
ATOM   900  C CA  . LYS A 1 119 ? 10.344  20.794 87.268 1.00 15.00 ? 119 LYS A CA  1 
ATOM   901  C C   . LYS A 1 119 ? 10.000  22.078 88.015 1.00 15.00 ? 119 LYS A C   1 
ATOM   902  O O   . LYS A 1 119 ? 8.850   22.298 88.412 1.00 15.00 ? 119 LYS A O   1 
ATOM   903  C CB  . LYS A 1 119 ? 11.288  19.928 88.094 1.00 15.00 ? 119 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 119 ? 11.677  18.625 87.389 1.00 15.00 ? 119 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 119 ? 10.441  17.776 87.095 1.00 15.00 ? 119 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 119 ? 10.780  16.542 86.290 1.00 15.00 ? 119 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 119 ? 11.096  16.873 84.877 1.00 15.00 ? 119 LYS A NZ  1 
ATOM   908  N N   . ALA A 1 120 ? 10.997  22.948 88.123 1.00 15.00 ? 120 ALA A N   1 
ATOM   909  C CA  . ALA A 1 120 ? 10.861  24.231 88.789 1.00 15.00 ? 120 ALA A CA  1 
ATOM   910  C C   . ALA A 1 120 ? 9.823   25.096 88.095 1.00 15.00 ? 120 ALA A C   1 
ATOM   911  O O   . ALA A 1 120 ? 9.088   25.847 88.742 1.00 15.00 ? 120 ALA A O   1 
ATOM   912  C CB  . ALA A 1 120 ? 12.193  24.946 88.808 1.00 15.00 ? 120 ALA A CB  1 
ATOM   913  N N   . LEU A 1 121 ? 9.780   25.036 86.767 1.00 15.00 ? 121 LEU A N   1 
ATOM   914  C CA  . LEU A 1 121 ? 8.804   25.825 86.024 1.00 15.00 ? 121 LEU A CA  1 
ATOM   915  C C   . LEU A 1 121 ? 7.391   25.344 86.350 1.00 15.00 ? 121 LEU A C   1 
ATOM   916  O O   . LEU A 1 121 ? 6.475   26.141 86.545 1.00 15.00 ? 121 LEU A O   1 
ATOM   917  C CB  . LEU A 1 121 ? 9.067   25.756 84.514 1.00 15.00 ? 121 LEU A CB  1 
ATOM   918  C CG  . LEU A 1 121 ? 8.010   26.427 83.628 1.00 15.00 ? 121 LEU A CG  1 
ATOM   919  C CD1 . LEU A 1 121 ? 8.090   27.928 83.750 1.00 15.00 ? 121 LEU A CD1 1 
ATOM   920  C CD2 . LEU A 1 121 ? 8.199   26.000 82.190 1.00 15.00 ? 121 LEU A CD2 1 
ATOM   921  N N   . LYS A 1 122 ? 7.209   24.034 86.430 1.00 15.00 ? 122 LYS A N   1 
ATOM   922  C CA  . LYS A 1 122 ? 5.910   23.475 86.756 1.00 15.00 ? 122 LYS A CA  1 
ATOM   923  C C   . LYS A 1 122 ? 5.483   24.024 88.105 1.00 15.00 ? 122 LYS A C   1 
ATOM   924  O O   . LYS A 1 122 ? 4.348   24.478 88.258 1.00 15.00 ? 122 LYS A O   1 
ATOM   925  C CB  . LYS A 1 122 ? 5.975   21.951 86.819 1.00 15.00 ? 122 LYS A CB  1 
ATOM   926  C CG  . LYS A 1 122 ? 4.650   21.327 87.183 1.00 15.00 ? 122 LYS A CG  1 
ATOM   927  C CD  . LYS A 1 122 ? 4.738   19.826 87.347 1.00 15.00 ? 122 LYS A CD  1 
ATOM   928  C CE  . LYS A 1 122 ? 3.345   19.259 87.590 1.00 15.00 ? 122 LYS A CE  1 
ATOM   929  N NZ  . LYS A 1 122 ? 3.312   17.766 87.582 1.00 15.00 ? 122 LYS A NZ  1 
ATOM   930  N N   . ARG A 1 123 ? 6.408   23.991 89.069 1.00 15.00 ? 123 ARG A N   1 
ATOM   931  C CA  . ARG A 1 123 ? 6.158   24.500 90.420 1.00 15.00 ? 123 ARG A CA  1 
ATOM   932  C C   . ARG A 1 123 ? 5.793   25.976 90.412 1.00 15.00 ? 123 ARG A C   1 
ATOM   933  O O   . ARG A 1 123 ? 4.945   26.407 91.179 1.00 15.00 ? 123 ARG A O   1 
ATOM   934  C CB  . ARG A 1 123 ? 7.372   24.295 91.328 1.00 15.00 ? 123 ARG A CB  1 
ATOM   935  C CG  . ARG A 1 123 ? 7.388   22.972 92.063 1.00 15.00 ? 123 ARG A CG  1 
ATOM   936  C CD  . ARG A 1 123 ? 8.492   22.931 93.109 1.00 15.00 ? 123 ARG A CD  1 
ATOM   937  N NE  . ARG A 1 123 ? 9.801   22.592 92.557 1.00 15.00 ? 123 ARG A NE  1 
ATOM   938  C CZ  . ARG A 1 123 ? 10.823  23.438 92.474 1.00 15.00 ? 123 ARG A CZ  1 
ATOM   939  N NH1 . ARG A 1 123 ? 10.700  24.690 92.897 1.00 15.00 ? 123 ARG A NH1 1 
ATOM   940  N NH2 . ARG A 1 123 ? 11.981  23.021 91.982 1.00 15.00 ? 123 ARG A NH2 1 
ATOM   941  N N   . ALA A 1 124 ? 6.442   26.760 89.557 1.00 15.00 ? 124 ALA A N   1 
ATOM   942  C CA  . ALA A 1 124 ? 6.162   28.182 89.461 1.00 15.00 ? 124 ALA A CA  1 
ATOM   943  C C   . ALA A 1 124 ? 4.754   28.410 88.936 1.00 15.00 ? 124 ALA A C   1 
ATOM   944  O O   . ALA A 1 124 ? 3.955   29.105 89.562 1.00 15.00 ? 124 ALA A O   1 
ATOM   945  C CB  . ALA A 1 124 ? 7.169   28.853 88.563 1.00 15.00 ? 124 ALA A CB  1 
ATOM   946  N N   . VAL A 1 125 ? 4.431   27.820 87.791 1.00 15.00 ? 125 VAL A N   1 
ATOM   947  C CA  . VAL A 1 125 ? 3.107   27.972 87.194 1.00 15.00 ? 125 VAL A CA  1 
ATOM   948  C C   . VAL A 1 125 ? 2.042   27.475 88.157 1.00 15.00 ? 125 VAL A C   1 
ATOM   949  O O   . VAL A 1 125 ? 0.934   28.007 88.199 1.00 15.00 ? 125 VAL A O   1 
ATOM   950  C CB  . VAL A 1 125 ? 3.011   27.208 85.849 1.00 15.00 ? 125 VAL A CB  1 
ATOM   951  C CG1 . VAL A 1 125 ? 1.573   27.079 85.388 1.00 15.00 ? 125 VAL A CG1 1 
ATOM   952  C CG2 . VAL A 1 125 ? 3.809   27.935 84.797 1.00 15.00 ? 125 VAL A CG2 1 
ATOM   953  N N   . ALA A 1 126 ? 2.389   26.478 88.963 1.00 15.00 ? 126 ALA A N   1 
ATOM   954  C CA  . ALA A 1 126 ? 1.455   25.917 89.929 1.00 15.00 ? 126 ALA A CA  1 
ATOM   955  C C   . ALA A 1 126 ? 1.262   26.823 91.141 1.00 15.00 ? 126 ALA A C   1 
ATOM   956  O O   . ALA A 1 126 ? 0.131   27.066 91.573 1.00 15.00 ? 126 ALA A O   1 
ATOM   957  C CB  . ALA A 1 126 ? 1.930   24.545 90.372 1.00 15.00 ? 126 ALA A CB  1 
ATOM   958  N N   . ARG A 1 127 ? 2.373   27.328 91.672 1.00 15.00 ? 127 ARG A N   1 
ATOM   959  C CA  . ARG A 1 127 ? 2.369   28.195 92.841 1.00 15.00 ? 127 ARG A CA  1 
ATOM   960  C C   . ARG A 1 127 ? 1.997   29.637 92.558 1.00 15.00 ? 127 ARG A C   1 
ATOM   961  O O   . ARG A 1 127 ? 1.089   30.174 93.193 1.00 15.00 ? 127 ARG A O   1 
ATOM   962  C CB  . ARG A 1 127 ? 3.737   28.186 93.520 1.00 15.00 ? 127 ARG A CB  1 
ATOM   963  C CG  . ARG A 1 127 ? 3.868   27.265 94.715 1.00 15.00 ? 127 ARG A CG  1 
ATOM   964  C CD  . ARG A 1 127 ? 4.376   25.899 94.341 1.00 15.00 ? 127 ARG A CD  1 
ATOM   965  N NE  . ARG A 1 127 ? 5.565   25.522 95.108 1.00 15.00 ? 127 ARG A NE  1 
ATOM   966  C CZ  . ARG A 1 127 ? 6.017   24.274 95.220 1.00 15.00 ? 127 ARG A CZ  1 
ATOM   967  N NH1 . ARG A 1 127 ? 5.359   23.268 94.670 1.00 15.00 ? 127 ARG A NH1 1 
ATOM   968  N NH2 . ARG A 1 127 ? 7.109   24.020 95.918 1.00 15.00 ? 127 ARG A NH2 1 
ATOM   969  N N   . VAL A 1 128 ? 2.745   30.265 91.645 1.00 15.00 ? 128 VAL A N   1 
ATOM   970  C CA  . VAL A 1 128 ? 2.565   31.679 91.275 1.00 15.00 ? 128 VAL A CA  1 
ATOM   971  C C   . VAL A 1 128 ? 1.458   31.962 90.261 1.00 15.00 ? 128 VAL A C   1 
ATOM   972  O O   . VAL A 1 128 ? 0.698   32.915 90.401 1.00 15.00 ? 128 VAL A O   1 
ATOM   973  C CB  . VAL A 1 128 ? 3.879   32.275 90.706 1.00 15.00 ? 128 VAL A CB  1 
ATOM   974  C CG1 . VAL A 1 128 ? 3.817   33.790 90.688 1.00 15.00 ? 128 VAL A CG1 1 
ATOM   975  C CG2 . VAL A 1 128 ? 5.057   31.813 91.513 1.00 15.00 ? 128 VAL A CG2 1 
ATOM   976  N N   . GLY A 1 129 ? 1.396   31.163 89.205 1.00 15.00 ? 129 GLY A N   1 
ATOM   977  C CA  . GLY A 1 129 ? 0.397   31.373 88.175 1.00 15.00 ? 129 GLY A CA  1 
ATOM   978  C C   . GLY A 1 129 ? 1.112   31.608 86.857 1.00 15.00 ? 129 GLY A C   1 
ATOM   979  O O   . GLY A 1 129 ? 2.250   31.138 86.691 1.00 15.00 ? 129 GLY A O   1 
ATOM   980  N N   . PRO A 1 130 ? 0.485   32.327 85.907 1.00 15.00 ? 130 PRO A N   1 
ATOM   981  C CA  . PRO A 1 130 ? 1.037   32.642 84.587 1.00 15.00 ? 130 PRO A CA  1 
ATOM   982  C C   . PRO A 1 130 ? 2.456   33.197 84.615 1.00 15.00 ? 130 PRO A C   1 
ATOM   983  O O   . PRO A 1 130 ? 2.716   34.288 85.136 1.00 15.00 ? 130 PRO A O   1 
ATOM   984  C CB  . PRO A 1 130 ? 0.048   33.659 84.047 1.00 15.00 ? 130 PRO A CB  1 
ATOM   985  C CG  . PRO A 1 130 ? -1.242  33.151 84.587 1.00 15.00 ? 130 PRO A CG  1 
ATOM   986  C CD  . PRO A 1 130 ? -0.887  32.851 86.021 1.00 15.00 ? 130 PRO A CD  1 
ATOM   987  N N   . VAL A 1 131 ? 3.359   32.424 84.025 1.00 15.00 ? 131 VAL A N   1 
ATOM   988  C CA  . VAL A 1 131 ? 4.770   32.762 83.934 1.00 15.00 ? 131 VAL A CA  1 
ATOM   989  C C   . VAL A 1 131 ? 5.104   33.176 82.499 1.00 15.00 ? 131 VAL A C   1 
ATOM   990  O O   . VAL A 1 131 ? 4.518   32.671 81.529 1.00 15.00 ? 131 VAL A O   1 
ATOM   991  C CB  . VAL A 1 131 ? 5.650   31.548 84.332 1.00 15.00 ? 131 VAL A CB  1 
ATOM   992  C CG1 . VAL A 1 131 ? 7.116   31.896 84.245 1.00 15.00 ? 131 VAL A CG1 1 
ATOM   993  C CG2 . VAL A 1 131 ? 5.299   31.086 85.743 1.00 15.00 ? 131 VAL A CG2 1 
ATOM   994  N N   . SER A 1 132 ? 6.024   34.124 82.372 1.00 15.00 ? 132 SER A N   1 
ATOM   995  C CA  . SER A 1 132 ? 6.459   34.609 81.080 1.00 15.00 ? 132 SER A CA  1 
ATOM   996  C C   . SER A 1 132 ? 7.642   33.754 80.642 1.00 15.00 ? 132 SER A C   1 
ATOM   997  O O   . SER A 1 132 ? 8.638   33.680 81.362 1.00 15.00 ? 132 SER A O   1 
ATOM   998  C CB  . SER A 1 132 ? 6.893   36.063 81.196 1.00 15.00 ? 132 SER A CB  1 
ATOM   999  O OG  . SER A 1 132 ? 5.821   36.883 81.605 1.00 15.00 ? 132 SER A OG  1 
ATOM   1000 N N   . VAL A 1 133 ? 7.517   33.084 79.495 1.00 15.00 ? 133 VAL A N   1 
ATOM   1001 C CA  . VAL A 1 133 ? 8.574   32.227 78.955 1.00 15.00 ? 133 VAL A CA  1 
ATOM   1002 C C   . VAL A 1 133 ? 8.949   32.679 77.537 1.00 15.00 ? 133 VAL A C   1 
ATOM   1003 O O   . VAL A 1 133 ? 8.215   33.442 76.908 1.00 15.00 ? 133 VAL A O   1 
ATOM   1004 C CB  . VAL A 1 133 ? 8.135   30.731 78.884 1.00 15.00 ? 133 VAL A CB  1 
ATOM   1005 C CG1 . VAL A 1 133 ? 7.665   30.233 80.239 1.00 15.00 ? 133 VAL A CG1 1 
ATOM   1006 C CG2 . VAL A 1 133 ? 7.035   30.550 77.871 1.00 15.00 ? 133 VAL A CG2 1 
ATOM   1007 N N   . ALA A 1 134 ? 10.092  32.221 77.031 1.00 15.00 ? 134 ALA A N   1 
ATOM   1008 C CA  . ALA A 1 134 ? 10.540  32.561 75.683 1.00 15.00 ? 134 ALA A CA  1 
ATOM   1009 C C   . ALA A 1 134 ? 10.919  31.258 75.001 1.00 15.00 ? 134 ALA A C   1 
ATOM   1010 O O   . ALA A 1 134 ? 11.572  30.408 75.596 1.00 15.00 ? 134 ALA A O   1 
ATOM   1011 C CB  . ALA A 1 134 ? 11.729  33.499 75.731 1.00 15.00 ? 134 ALA A CB  1 
ATOM   1012 N N   . ILE A 1 135 ? 10.508  31.084 73.754 1.00 15.00 ? 135 ILE A N   1 
ATOM   1013 C CA  . ILE A 1 135 ? 10.784  29.846 73.032 1.00 15.00 ? 135 ILE A CA  1 
ATOM   1014 C C   . ILE A 1 135 ? 11.242  30.095 71.596 1.00 15.00 ? 135 ILE A C   1 
ATOM   1015 O O   . ILE A 1 135 ? 11.313  31.243 71.132 1.00 15.00 ? 135 ILE A O   1 
ATOM   1016 C CB  . ILE A 1 135 ? 9.503   28.973 72.947 1.00 15.00 ? 135 ILE A CB  1 
ATOM   1017 C CG1 . ILE A 1 135 ? 8.432   29.700 72.111 1.00 15.00 ? 135 ILE A CG1 1 
ATOM   1018 C CG2 . ILE A 1 135 ? 8.985   28.636 74.339 1.00 15.00 ? 135 ILE A CG2 1 
ATOM   1019 C CD1 . ILE A 1 135 ? 7.110   28.968 71.980 1.00 15.00 ? 135 ILE A CD1 1 
ATOM   1020 N N   . ASP A 1 136 ? 11.581  29.008 70.905 1.00 15.00 ? 136 ASP A N   1 
ATOM   1021 C CA  . ASP A 1 136 ? 11.971  29.073 69.504 1.00 15.00 ? 136 ASP A CA  1 
ATOM   1022 C C   . ASP A 1 136 ? 10.677  28.920 68.712 1.00 15.00 ? 136 ASP A C   1 
ATOM   1023 O O   . ASP A 1 136 ? 10.043  27.859 68.737 1.00 15.00 ? 136 ASP A O   1 
ATOM   1024 C CB  . ASP A 1 136 ? 12.921  27.940 69.125 1.00 15.00 ? 136 ASP A CB  1 
ATOM   1025 C CG  . ASP A 1 136 ? 13.189  27.883 67.627 1.00 15.00 ? 136 ASP A CG  1 
ATOM   1026 O OD1 . ASP A 1 136 ? 13.101  28.927 66.951 1.00 15.00 ? 136 ASP A OD1 1 
ATOM   1027 O OD2 . ASP A 1 136 ? 13.475  26.785 67.113 1.00 15.00 ? 136 ASP A OD2 1 
ATOM   1028 N N   . ALA A 1 137 ? 10.257  29.998 68.064 1.00 15.00 ? 137 ALA A N   1 
ATOM   1029 C CA  . ALA A 1 137 ? 9.040   29.971 67.273 1.00 15.00 ? 137 ALA A CA  1 
ATOM   1030 C C   . ALA A 1 137 ? 9.357   29.985 65.772 1.00 15.00 ? 137 ALA A C   1 
ATOM   1031 O O   . ALA A 1 137 ? 8.449   29.947 64.937 1.00 15.00 ? 137 ALA A O   1 
ATOM   1032 C CB  . ALA A 1 137 ? 8.143   31.135 67.646 1.00 15.00 ? 137 ALA A CB  1 
ATOM   1033 N N   . SER A 1 138 ? 10.644  30.081 65.435 1.00 15.00 ? 138 SER A N   1 
ATOM   1034 C CA  . SER A 1 138 ? 11.089  30.069 64.045 1.00 15.00 ? 138 SER A CA  1 
ATOM   1035 C C   . SER A 1 138 ? 11.099  28.618 63.622 1.00 15.00 ? 138 SER A C   1 
ATOM   1036 O O   . SER A 1 138 ? 12.109  27.935 63.802 1.00 15.00 ? 138 SER A O   1 
ATOM   1037 C CB  . SER A 1 138 ? 12.497  30.658 63.913 1.00 15.00 ? 138 SER A CB  1 
ATOM   1038 O OG  . SER A 1 138 ? 12.466  32.081 63.968 1.00 15.00 ? 138 SER A OG  1 
ATOM   1039 N N   . LEU A 1 139 ? 9.951   28.179 63.096 1.00 15.00 ? 139 LEU A N   1 
ATOM   1040 C CA  . LEU A 1 139 ? 9.720   26.801 62.640 1.00 15.00 ? 139 LEU A CA  1 
ATOM   1041 C C   . LEU A 1 139 ? 8.306   26.753 62.048 1.00 15.00 ? 139 LEU A C   1 
ATOM   1042 O O   . LEU A 1 139 ? 7.328   27.108 62.722 1.00 15.00 ? 139 LEU A O   1 
ATOM   1043 C CB  . LEU A 1 139 ? 9.786   25.844 63.834 1.00 15.00 ? 139 LEU A CB  1 
ATOM   1044 C CG  . LEU A 1 139 ? 10.632  24.585 63.723 1.00 15.00 ? 139 LEU A CG  1 
ATOM   1045 C CD1 . LEU A 1 139 ? 12.084  24.952 63.567 1.00 15.00 ? 139 LEU A CD1 1 
ATOM   1046 C CD2 . LEU A 1 139 ? 10.442  23.744 64.958 1.00 15.00 ? 139 LEU A CD2 1 
ATOM   1047 N N   . THR A 1 140 ? 8.169   26.292 60.805 1.00 15.00 ? 140 THR A N   1 
ATOM   1048 C CA  . THR A 1 140 ? 6.864   26.244 60.146 1.00 15.00 ? 140 THR A CA  1 
ATOM   1049 C C   . THR A 1 140 ? 5.835   25.334 60.817 1.00 15.00 ? 140 THR A C   1 
ATOM   1050 O O   . THR A 1 140 ? 4.657   25.666 60.876 1.00 15.00 ? 140 THR A O   1 
ATOM   1051 C CB  . THR A 1 140 ? 7.001   25.876 58.651 1.00 15.00 ? 140 THR A CB  1 
ATOM   1052 O OG1 . THR A 1 140 ? 8.387   25.917 58.273 1.00 15.00 ? 140 THR A OG1 1 
ATOM   1053 C CG2 . THR A 1 140 ? 6.223   26.872 57.786 1.00 15.00 ? 140 THR A CG2 1 
ATOM   1054 N N   . SER A 1 141 ? 6.278   24.201 61.357 1.00 15.00 ? 141 SER A N   1 
ATOM   1055 C CA  . SER A 1 141 ? 5.384   23.264 62.036 1.00 15.00 ? 141 SER A CA  1 
ATOM   1056 C C   . SER A 1 141 ? 4.716   23.954 63.210 1.00 15.00 ? 141 SER A C   1 
ATOM   1057 O O   . SER A 1 141 ? 3.583   23.650 63.565 1.00 15.00 ? 141 SER A O   1 
ATOM   1058 C CB  . SER A 1 141 ? 6.167   22.052 62.533 1.00 15.00 ? 141 SER A CB  1 
ATOM   1059 O OG  . SER A 1 141 ? 7.352   22.456 63.197 1.00 15.00 ? 141 SER A OG  1 
ATOM   1060 N N   . PHE A 1 142 ? 5.424   24.895 63.814 1.00 15.00 ? 142 PHE A N   1 
ATOM   1061 C CA  . PHE A 1 142 ? 4.899   25.628 64.948 1.00 15.00 ? 142 PHE A CA  1 
ATOM   1062 C C   . PHE A 1 142 ? 3.867   26.632 64.473 1.00 15.00 ? 142 PHE A C   1 
ATOM   1063 O O   . PHE A 1 142 ? 2.757   26.710 65.002 1.00 15.00 ? 142 PHE A O   1 
ATOM   1064 C CB  . PHE A 1 142 ? 6.032   26.363 65.671 1.00 15.00 ? 142 PHE A CB  1 
ATOM   1065 C CG  . PHE A 1 142 ? 5.567   27.211 66.816 1.00 15.00 ? 142 PHE A CG  1 
ATOM   1066 C CD1 . PHE A 1 142 ? 5.423   26.665 68.080 1.00 15.00 ? 142 PHE A CD1 1 
ATOM   1067 C CD2 . PHE A 1 142 ? 5.261   28.549 66.624 1.00 15.00 ? 142 PHE A CD2 1 
ATOM   1068 C CE1 . PHE A 1 142 ? 4.979   27.439 69.133 1.00 15.00 ? 142 PHE A CE1 1 
ATOM   1069 C CE2 . PHE A 1 142 ? 4.814   29.332 67.669 1.00 15.00 ? 142 PHE A CE2 1 
ATOM   1070 C CZ  . PHE A 1 142 ? 4.672   28.780 68.928 1.00 15.00 ? 142 PHE A CZ  1 
ATOM   1071 N N   . GLN A 1 143 ? 4.225   27.376 63.439 1.00 15.00 ? 143 GLN A N   1 
ATOM   1072 C CA  . GLN A 1 143 ? 3.351   28.404 62.907 1.00 15.00 ? 143 GLN A CA  1 
ATOM   1073 C C   . GLN A 1 143 ? 2.006   27.928 62.408 1.00 15.00 ? 143 GLN A C   1 
ATOM   1074 O O   . GLN A 1 143 ? 0.989   28.539 62.717 1.00 15.00 ? 143 GLN A O   1 
ATOM   1075 C CB  . GLN A 1 143 ? 4.088   29.183 61.843 1.00 15.00 ? 143 GLN A CB  1 
ATOM   1076 C CG  . GLN A 1 143 ? 5.421   29.637 62.344 1.00 15.00 ? 143 GLN A CG  1 
ATOM   1077 C CD  . GLN A 1 143 ? 6.070   30.606 61.424 1.00 15.00 ? 143 GLN A CD  1 
ATOM   1078 O OE1 . GLN A 1 143 ? 5.458   31.588 60.996 1.00 15.00 ? 143 GLN A OE1 1 
ATOM   1079 N NE2 . GLN A 1 143 ? 7.326   30.344 61.096 1.00 15.00 ? 143 GLN A NE2 1 
ATOM   1080 N N   . PHE A 1 144 ? 1.956   26.826 61.661 1.00 15.00 ? 144 PHE A N   1 
ATOM   1081 C CA  . PHE A 1 144 ? 0.658   26.339 61.163 1.00 15.00 ? 144 PHE A CA  1 
ATOM   1082 C C   . PHE A 1 144 ? -0.029  25.308 62.062 1.00 15.00 ? 144 PHE A C   1 
ATOM   1083 O O   . PHE A 1 144 ? -0.870  24.525 61.594 1.00 15.00 ? 144 PHE A O   1 
ATOM   1084 C CB  . PHE A 1 144 ? 0.750   25.828 59.713 1.00 15.00 ? 144 PHE A CB  1 
ATOM   1085 C CG  . PHE A 1 144 ? 1.746   24.716 59.504 1.00 15.00 ? 144 PHE A CG  1 
ATOM   1086 C CD1 . PHE A 1 144 ? 1.619   23.501 60.168 1.00 15.00 ? 144 PHE A CD1 1 
ATOM   1087 C CD2 . PHE A 1 144 ? 2.808   24.885 58.632 1.00 15.00 ? 144 PHE A CD2 1 
ATOM   1088 C CE1 . PHE A 1 144 ? 2.532   22.479 59.972 1.00 15.00 ? 144 PHE A CE1 1 
ATOM   1089 C CE2 . PHE A 1 144 ? 3.725   23.870 58.428 1.00 15.00 ? 144 PHE A CE2 1 
ATOM   1090 C CZ  . PHE A 1 144 ? 3.586   22.663 59.101 1.00 15.00 ? 144 PHE A CZ  1 
ATOM   1091 N N   . TYR A 1 145 ? 0.330   25.321 63.348 1.00 15.00 ? 145 TYR A N   1 
ATOM   1092 C CA  . TYR A 1 145 ? -0.232  24.411 64.345 1.00 15.00 ? 145 TYR A CA  1 
ATOM   1093 C C   . TYR A 1 145 ? -1.718  24.677 64.453 1.00 15.00 ? 145 TYR A C   1 
ATOM   1094 O O   . TYR A 1 145 ? -2.152  25.810 64.265 1.00 15.00 ? 145 TYR A O   1 
ATOM   1095 C CB  . TYR A 1 145 ? 0.448   24.660 65.696 1.00 15.00 ? 145 TYR A CB  1 
ATOM   1096 C CG  . TYR A 1 145 ? -0.294  24.107 66.882 1.00 15.00 ? 145 TYR A CG  1 
ATOM   1097 C CD1 . TYR A 1 145 ? -1.296  24.850 67.499 1.00 15.00 ? 145 TYR A CD1 1 
ATOM   1098 C CD2 . TYR A 1 145 ? -0.024  22.834 67.369 1.00 15.00 ? 145 TYR A CD2 1 
ATOM   1099 C CE1 . TYR A 1 145 ? -2.017  24.340 68.562 1.00 15.00 ? 145 TYR A CE1 1 
ATOM   1100 C CE2 . TYR A 1 145 ? -0.739  22.309 68.441 1.00 15.00 ? 145 TYR A CE2 1 
ATOM   1101 C CZ  . TYR A 1 145 ? -1.739  23.072 69.029 1.00 15.00 ? 145 TYR A CZ  1 
ATOM   1102 O OH  . TYR A 1 145 ? -2.500  22.570 70.059 1.00 15.00 ? 145 TYR A OH  1 
ATOM   1103 N N   . SER A 1 146 ? -2.498  23.657 64.795 1.00 15.00 ? 146 SER A N   1 
ATOM   1104 C CA  . SER A 1 146 ? -3.940  23.836 64.925 1.00 15.00 ? 146 SER A CA  1 
ATOM   1105 C C   . SER A 1 146 ? -4.552  23.090 66.111 1.00 15.00 ? 146 SER A C   1 
ATOM   1106 O O   . SER A 1 146 ? -5.561  23.519 66.674 1.00 15.00 ? 146 SER A O   1 
ATOM   1107 C CB  . SER A 1 146 ? -4.652  23.440 63.634 1.00 15.00 ? 146 SER A CB  1 
ATOM   1108 O OG  . SER A 1 146 ? -4.508  22.056 63.381 1.00 15.00 ? 146 SER A OG  1 
ATOM   1109 N N   . LYS A 1 147 ? -3.962  21.960 66.490 1.00 15.00 ? 147 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 147 ? -4.469  21.185 67.624 1.00 15.00 ? 147 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 147 ? -3.543  20.042 68.017 1.00 15.00 ? 147 LYS A C   1 
ATOM   1112 O O   . LYS A 1 147 ? -2.836  19.487 67.177 1.00 15.00 ? 147 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 147 ? -5.874  20.636 67.339 1.00 15.00 ? 147 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 147 ? -5.956  19.472 66.347 1.00 15.00 ? 147 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 147 ? -7.362  19.401 65.737 1.00 15.00 ? 147 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 147 ? -7.697  20.710 64.970 1.00 15.00 ? 147 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 147 ? -9.141  20.892 64.577 1.00 15.00 ? 147 LYS A NZ  1 
ATOM   1118 N N   . GLY A 1 148 ? -3.545  19.700 69.302 1.00 15.00 ? 148 GLY A N   1 
ATOM   1119 C CA  . GLY A 1 148 ? -2.718  18.614 69.784 1.00 15.00 ? 148 GLY A CA  1 
ATOM   1120 C C   . GLY A 1 148 ? -1.567  19.113 70.623 1.00 15.00 ? 148 GLY A C   1 
ATOM   1121 O O   . GLY A 1 148 ? -1.505  20.283 70.983 1.00 15.00 ? 148 GLY A O   1 
ATOM   1122 N N   . VAL A 1 149 ? -0.647  18.219 70.953 1.00 15.00 ? 149 VAL A N   1 
ATOM   1123 C CA  . VAL A 1 149 ? 0.511   18.582 71.756 1.00 15.00 ? 149 VAL A CA  1 
ATOM   1124 C C   . VAL A 1 149 ? 1.697   18.715 70.808 1.00 15.00 ? 149 VAL A C   1 
ATOM   1125 O O   . VAL A 1 149 ? 2.203   17.733 70.279 1.00 15.00 ? 149 VAL A O   1 
ATOM   1126 C CB  . VAL A 1 149 ? 0.776   17.523 72.865 1.00 15.00 ? 149 VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 149 ? 1.988   17.900 73.685 1.00 15.00 ? 149 VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 149 ? -0.436  17.396 73.761 1.00 15.00 ? 149 VAL A CG2 1 
ATOM   1129 N N   . TYR A 1 150 ? 2.119   19.945 70.572 1.00 15.00 ? 150 TYR A N   1 
ATOM   1130 C CA  . TYR A 1 150 ? 3.222   20.232 69.667 1.00 15.00 ? 150 TYR A CA  1 
ATOM   1131 C C   . TYR A 1 150 ? 4.589   19.725 70.075 1.00 15.00 ? 150 TYR A C   1 
ATOM   1132 O O   . TYR A 1 150 ? 5.062   20.011 71.169 1.00 15.00 ? 150 TYR A O   1 
ATOM   1133 C CB  . TYR A 1 150 ? 3.326   21.740 69.425 1.00 15.00 ? 150 TYR A CB  1 
ATOM   1134 C CG  . TYR A 1 150 ? 4.481   22.134 68.531 1.00 15.00 ? 150 TYR A CG  1 
ATOM   1135 C CD1 . TYR A 1 150 ? 4.549   21.678 67.212 1.00 15.00 ? 150 TYR A CD1 1 
ATOM   1136 C CD2 . TYR A 1 150 ? 5.514   22.941 69.008 1.00 15.00 ? 150 TYR A CD2 1 
ATOM   1137 C CE1 . TYR A 1 150 ? 5.620   22.007 66.387 1.00 15.00 ? 150 TYR A CE1 1 
ATOM   1138 C CE2 . TYR A 1 150 ? 6.592   23.278 68.193 1.00 15.00 ? 150 TYR A CE2 1 
ATOM   1139 C CZ  . TYR A 1 150 ? 6.637   22.803 66.882 1.00 15.00 ? 150 TYR A CZ  1 
ATOM   1140 O OH  . TYR A 1 150 ? 7.701   23.098 66.071 1.00 15.00 ? 150 TYR A OH  1 
ATOM   1141 N N   . TYR A 1 151 ? 5.240   19.036 69.146 1.00 15.00 ? 151 TYR A N   1 
ATOM   1142 C CA  . TYR A 1 151 ? 6.588   18.529 69.352 1.00 15.00 ? 151 TYR A CA  1 
ATOM   1143 C C   . TYR A 1 151 ? 7.285   18.321 67.999 1.00 15.00 ? 151 TYR A C   1 
ATOM   1144 O O   . TYR A 1 151 ? 6.715   17.746 67.064 1.00 15.00 ? 151 TYR A O   1 
ATOM   1145 C CB  . TYR A 1 151 ? 6.596   17.240 70.180 1.00 15.00 ? 151 TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 151 ? 8.000   16.792 70.518 1.00 15.00 ? 151 TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 151 ? 8.938   17.699 71.008 1.00 15.00 ? 151 TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 151 ? 8.417   15.488 70.265 1.00 15.00 ? 151 TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 151 ? 10.255  17.326 71.230 1.00 15.00 ? 151 TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 151 ? 9.745   15.099 70.485 1.00 15.00 ? 151 TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 151 ? 10.655  16.028 70.966 1.00 15.00 ? 151 TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 151 ? 11.968  15.656 71.182 1.00 15.00 ? 151 TYR A OH  1 
ATOM   1153 N N   . ASP A 1 152 ? 8.522   18.798 67.909 1.00 15.00 ? 152 ASP A N   1 
ATOM   1154 C CA  . ASP A 1 152 ? 9.311   18.716 66.692 1.00 15.00 ? 152 ASP A CA  1 
ATOM   1155 C C   . ASP A 1 152 ? 10.770  18.686 67.107 1.00 15.00 ? 152 ASP A C   1 
ATOM   1156 O O   . ASP A 1 152 ? 11.302  19.680 67.604 1.00 15.00 ? 152 ASP A O   1 
ATOM   1157 C CB  . ASP A 1 152 ? 9.041   19.968 65.860 1.00 15.00 ? 152 ASP A CB  1 
ATOM   1158 C CG  . ASP A 1 152 ? 9.688   19.927 64.499 1.00 15.00 ? 152 ASP A CG  1 
ATOM   1159 O OD1 . ASP A 1 152 ? 10.935  19.937 64.419 1.00 15.00 ? 152 ASP A OD1 1 
ATOM   1160 O OD2 . ASP A 1 152 ? 8.933   19.913 63.507 1.00 15.00 ? 152 ASP A OD2 1 
ATOM   1161 N N   . GLU A 1 153 ? 11.451  17.585 66.815 1.00 15.00 ? 153 GLU A N   1 
ATOM   1162 C CA  . GLU A 1 153 ? 12.852  17.416 67.199 1.00 15.00 ? 153 GLU A CA  1 
ATOM   1163 C C   . GLU A 1 153 ? 13.839  18.495 66.767 1.00 15.00 ? 153 GLU A C   1 
ATOM   1164 O O   . GLU A 1 153 ? 15.016  18.448 67.136 1.00 15.00 ? 153 GLU A O   1 
ATOM   1165 C CB  . GLU A 1 153 ? 13.367  16.028 66.794 1.00 15.00 ? 153 GLU A CB  1 
ATOM   1166 C CG  . GLU A 1 153 ? 12.990  15.559 65.378 1.00 15.00 ? 153 GLU A CG  1 
ATOM   1167 C CD  . GLU A 1 153 ? 13.591  16.410 64.248 1.00 15.00 ? 153 GLU A CD  1 
ATOM   1168 O OE1 . GLU A 1 153 ? 14.825  16.643 64.241 1.00 15.00 ? 153 GLU A OE1 1 
ATOM   1169 O OE2 . GLU A 1 153 ? 12.818  16.840 63.357 1.00 15.00 ? 153 GLU A OE2 1 
ATOM   1170 N N   . SER A 1 154 ? 13.388  19.465 65.979 1.00 15.00 ? 154 SER A N   1 
ATOM   1171 C CA  . SER A 1 154 ? 14.274  20.540 65.526 1.00 15.00 ? 154 SER A CA  1 
ATOM   1172 C C   . SER A 1 154 ? 14.092  21.872 66.259 1.00 15.00 ? 154 SER A C   1 
ATOM   1173 O O   . SER A 1 154 ? 14.818  22.847 66.021 1.00 15.00 ? 154 SER A O   1 
ATOM   1174 C CB  . SER A 1 154 ? 14.164  20.729 64.009 1.00 15.00 ? 154 SER A CB  1 
ATOM   1175 O OG  . SER A 1 154 ? 14.631  19.567 63.339 1.00 15.00 ? 154 SER A OG  1 
ATOM   1176 N N   . CYS A 1 155 ? 13.120  21.940 67.159 1.00 15.00 ? 155 CYS A N   1 
ATOM   1177 C CA  . CYS A 1 155 ? 12.897  23.159 67.918 1.00 15.00 ? 155 CYS A CA  1 
ATOM   1178 C C   . CYS A 1 155 ? 14.215  23.381 68.642 1.00 15.00 ? 155 CYS A C   1 
ATOM   1179 O O   . CYS A 1 155 ? 14.696  22.504 69.365 1.00 15.00 ? 155 CYS A O   1 
ATOM   1180 C CB  . CYS A 1 155 ? 11.788  22.933 68.918 1.00 15.00 ? 155 CYS A CB  1 
ATOM   1181 S SG  . CYS A 1 155 ? 10.791  24.418 69.176 1.00 15.00 ? 155 CYS A SG  1 
ATOM   1182 N N   . ASN A 1 156 ? 14.841  24.531 68.431 1.00 15.00 ? 156 ASN A N   1 
ATOM   1183 C CA  . ASN A 1 156 ? 16.137  24.778 69.045 1.00 15.00 ? 156 ASN A CA  1 
ATOM   1184 C C   . ASN A 1 156 ? 16.165  25.569 70.343 1.00 15.00 ? 156 ASN A C   1 
ATOM   1185 O O   . ASN A 1 156 ? 16.074  26.798 70.339 1.00 15.00 ? 156 ASN A O   1 
ATOM   1186 C CB  . ASN A 1 156 ? 17.080  25.409 68.024 1.00 15.00 ? 156 ASN A CB  1 
ATOM   1187 C CG  . ASN A 1 156 ? 18.497  25.509 68.535 1.00 15.00 ? 156 ASN A CG  1 
ATOM   1188 O OD1 . ASN A 1 156 ? 18.890  24.794 69.462 1.00 15.00 ? 156 ASN A OD1 1 
ATOM   1189 N ND2 . ASN A 1 156 ? 19.270  26.414 67.956 1.00 15.00 ? 156 ASN A ND2 1 
ATOM   1190 N N   . SER A 1 157 ? 16.425  24.861 71.441 1.00 15.00 ? 157 SER A N   1 
ATOM   1191 C CA  . SER A 1 157 ? 16.500  25.455 72.774 1.00 15.00 ? 157 SER A CA  1 
ATOM   1192 C C   . SER A 1 157 ? 17.477  26.626 72.851 1.00 15.00 ? 157 SER A C   1 
ATOM   1193 O O   . SER A 1 157 ? 17.453  27.407 73.811 1.00 15.00 ? 157 SER A O   1 
ATOM   1194 C CB  . SER A 1 157 ? 16.917  24.394 73.791 1.00 15.00 ? 157 SER A CB  1 
ATOM   1195 O OG  . SER A 1 157 ? 16.042  23.277 73.747 1.00 15.00 ? 157 SER A OG  1 
ATOM   1196 N N   . ASP A 1 158 ? 18.332  26.756 71.841 1.00 15.00 ? 158 ASP A N   1 
ATOM   1197 C CA  . ASP A 1 158 ? 19.331  27.817 71.804 1.00 15.00 ? 158 ASP A CA  1 
ATOM   1198 C C   . ASP A 1 158 ? 18.846  29.068 71.083 1.00 15.00 ? 158 ASP A C   1 
ATOM   1199 O O   . ASP A 1 158 ? 19.407  30.155 71.250 1.00 15.00 ? 158 ASP A O   1 
ATOM   1200 C CB  . ASP A 1 158 ? 20.608  27.297 71.136 1.00 15.00 ? 158 ASP A CB  1 
ATOM   1201 C CG  . ASP A 1 158 ? 21.178  26.054 71.831 1.00 15.00 ? 158 ASP A CG  1 
ATOM   1202 O OD1 . ASP A 1 158 ? 20.481  25.006 71.865 1.00 15.00 ? 158 ASP A OD1 1 
ATOM   1203 O OD2 . ASP A 1 158 ? 22.333  26.126 72.326 1.00 15.00 ? 158 ASP A OD2 1 
ATOM   1204 N N   . ASN A 1 159 ? 17.792  28.945 70.286 1.00 15.00 ? 159 ASN A N   1 
ATOM   1205 C CA  . ASN A 1 159 ? 17.294  30.098 69.547 1.00 15.00 ? 159 ASN A CA  1 
ATOM   1206 C C   . ASN A 1 159 ? 15.983  30.593 70.129 1.00 15.00 ? 159 ASN A C   1 
ATOM   1207 O O   . ASN A 1 159 ? 14.911  30.326 69.578 1.00 15.00 ? 159 ASN A O   1 
ATOM   1208 C CB  . ASN A 1 159 ? 17.108  29.734 68.067 1.00 15.00 ? 159 ASN A CB  1 
ATOM   1209 C CG  . ASN A 1 159 ? 17.032  30.959 67.150 1.00 15.00 ? 159 ASN A CG  1 
ATOM   1210 O OD1 . ASN A 1 159 ? 16.496  32.004 67.515 1.00 15.00 ? 159 ASN A OD1 1 
ATOM   1211 N ND2 . ASN A 1 159 ? 17.558  30.815 65.938 1.00 15.00 ? 159 ASN A ND2 1 
ATOM   1212 N N   . LEU A 1 160 ? 16.029  31.303 71.248 1.00 15.00 ? 160 LEU A N   1 
ATOM   1213 C CA  . LEU A 1 160 ? 14.792  31.812 71.840 1.00 15.00 ? 160 LEU A CA  1 
ATOM   1214 C C   . LEU A 1 160 ? 14.513  33.123 71.140 1.00 15.00 ? 160 LEU A C   1 
ATOM   1215 O O   . LEU A 1 160 ? 15.258  34.082 71.292 1.00 15.00 ? 160 LEU A O   1 
ATOM   1216 C CB  . LEU A 1 160 ? 14.938  32.002 73.352 1.00 15.00 ? 160 LEU A CB  1 
ATOM   1217 C CG  . LEU A 1 160 ? 15.309  30.748 74.167 1.00 15.00 ? 160 LEU A CG  1 
ATOM   1218 C CD1 . LEU A 1 160 ? 15.157  31.060 75.642 1.00 15.00 ? 160 LEU A CD1 1 
ATOM   1219 C CD2 . LEU A 1 160 ? 14.437  29.547 73.799 1.00 15.00 ? 160 LEU A CD2 1 
ATOM   1220 N N   . ASN A 1 161 ? 13.468  33.136 70.324 1.00 15.00 ? 161 ASN A N   1 
ATOM   1221 C CA  . ASN A 1 161 ? 13.110  34.320 69.539 1.00 15.00 ? 161 ASN A CA  1 
ATOM   1222 C C   . ASN A 1 161 ? 11.714  34.861 69.768 1.00 15.00 ? 161 ASN A C   1 
ATOM   1223 O O   . ASN A 1 161 ? 11.418  36.001 69.419 1.00 15.00 ? 161 ASN A O   1 
ATOM   1224 C CB  . ASN A 1 161 ? 13.270  34.011 68.050 1.00 15.00 ? 161 ASN A CB  1 
ATOM   1225 C CG  . ASN A 1 161 ? 12.641  32.670 67.658 1.00 15.00 ? 161 ASN A CG  1 
ATOM   1226 O OD1 . ASN A 1 161 ? 11.415  32.521 67.608 1.00 15.00 ? 161 ASN A OD1 1 
ATOM   1227 N ND2 . ASN A 1 161 ? 13.486  31.680 67.419 1.00 15.00 ? 161 ASN A ND2 1 
ATOM   1228 N N   . HIS A 1 162 ? 10.847  34.061 70.372 1.00 15.00 ? 162 HIS A N   1 
ATOM   1229 C CA  . HIS A 1 162 ? 9.470   34.478 70.608 1.00 15.00 ? 162 HIS A CA  1 
ATOM   1230 C C   . HIS A 1 162 ? 9.051   34.315 72.072 1.00 15.00 ? 162 HIS A C   1 
ATOM   1231 O O   . HIS A 1 162 ? 9.079   33.213 72.614 1.00 15.00 ? 162 HIS A O   1 
ATOM   1232 C CB  . HIS A 1 162 ? 8.531   33.656 69.716 1.00 15.00 ? 162 HIS A CB  1 
ATOM   1233 C CG  . HIS A 1 162 ? 7.146   34.205 69.617 1.00 15.00 ? 162 HIS A CG  1 
ATOM   1234 N ND1 . HIS A 1 162 ? 6.891   35.532 69.339 1.00 15.00 ? 162 HIS A ND1 1 
ATOM   1235 C CD2 . HIS A 1 162 ? 5.939   33.608 69.731 1.00 15.00 ? 162 HIS A CD2 1 
ATOM   1236 C CE1 . HIS A 1 162 ? 5.588   35.727 69.282 1.00 15.00 ? 162 HIS A CE1 1 
ATOM   1237 N NE2 . HIS A 1 162 ? 4.987   34.574 69.515 1.00 15.00 ? 162 HIS A NE2 1 
ATOM   1238 N N   . ALA A 1 163 ? 8.684   35.425 72.708 1.00 15.00 ? 163 ALA A N   1 
ATOM   1239 C CA  . ALA A 1 163 ? 8.232   35.420 74.095 1.00 15.00 ? 163 ALA A CA  1 
ATOM   1240 C C   . ALA A 1 163 ? 6.772   34.992 74.087 1.00 15.00 ? 163 ALA A C   1 
ATOM   1241 O O   . ALA A 1 163 ? 6.022   35.314 73.163 1.00 15.00 ? 163 ALA A O   1 
ATOM   1242 C CB  . ALA A 1 163 ? 8.367   36.809 74.705 1.00 15.00 ? 163 ALA A CB  1 
ATOM   1243 N N   . VAL A 1 164 ? 6.349   34.290 75.126 1.00 15.00 ? 164 VAL A N   1 
ATOM   1244 C CA  . VAL A 1 164 ? 4.982   33.819 75.203 1.00 15.00 ? 164 VAL A CA  1 
ATOM   1245 C C   . VAL A 1 164 ? 4.606   33.692 76.679 1.00 15.00 ? 164 VAL A C   1 
ATOM   1246 O O   . VAL A 1 164 ? 5.355   34.154 77.533 1.00 15.00 ? 164 VAL A O   1 
ATOM   1247 C CB  . VAL A 1 164 ? 4.844   32.501 74.404 1.00 15.00 ? 164 VAL A CB  1 
ATOM   1248 C CG1 . VAL A 1 164 ? 5.082   31.281 75.268 1.00 15.00 ? 164 VAL A CG1 1 
ATOM   1249 C CG2 . VAL A 1 164 ? 3.535   32.472 73.688 1.00 15.00 ? 164 VAL A CG2 1 
ATOM   1250 N N   . LEU A 1 165 ? 3.476   33.075 77.009 1.00 15.00 ? 165 LEU A N   1 
ATOM   1251 C CA  . LEU A 1 165 ? 3.058   32.974 78.408 1.00 15.00 ? 165 LEU A CA  1 
ATOM   1252 C C   . LEU A 1 165 ? 2.431   31.643 78.778 1.00 15.00 ? 165 LEU A C   1 
ATOM   1253 O O   . LEU A 1 165 ? 1.436   31.246 78.184 1.00 15.00 ? 165 LEU A O   1 
ATOM   1254 C CB  . LEU A 1 165 ? 2.047   34.084 78.703 1.00 15.00 ? 165 LEU A CB  1 
ATOM   1255 C CG  . LEU A 1 165 ? 1.562   34.332 80.124 1.00 15.00 ? 165 LEU A CG  1 
ATOM   1256 C CD1 . LEU A 1 165 ? 2.626   35.052 80.915 1.00 15.00 ? 165 LEU A CD1 1 
ATOM   1257 C CD2 . LEU A 1 165 ? 0.316   35.173 80.070 1.00 15.00 ? 165 LEU A CD2 1 
ATOM   1258 N N   . ALA A 1 166 ? 2.980   30.989 79.799 1.00 15.00 ? 166 ALA A N   1 
ATOM   1259 C CA  . ALA A 1 166 ? 2.469   29.702 80.274 1.00 15.00 ? 166 ALA A CA  1 
ATOM   1260 C C   . ALA A 1 166 ? 1.257   29.942 81.169 1.00 15.00 ? 166 ALA A C   1 
ATOM   1261 O O   . ALA A 1 166 ? 1.356   30.640 82.171 1.00 15.00 ? 166 ALA A O   1 
ATOM   1262 C CB  . ALA A 1 166 ? 3.545   28.961 81.043 1.00 15.00 ? 166 ALA A CB  1 
ATOM   1263 N N   . VAL A 1 167 ? 0.119   29.359 80.808 1.00 15.00 ? 167 VAL A N   1 
ATOM   1264 C CA  . VAL A 1 167 ? -1.139  29.517 81.544 1.00 15.00 ? 167 VAL A CA  1 
ATOM   1265 C C   . VAL A 1 167 ? -1.504  28.232 82.298 1.00 15.00 ? 167 VAL A C   1 
ATOM   1266 O O   . VAL A 1 167 ? -2.559  28.127 82.931 1.00 15.00 ? 167 VAL A O   1 
ATOM   1267 C CB  . VAL A 1 167 ? -2.295  29.908 80.553 1.00 15.00 ? 167 VAL A CB  1 
ATOM   1268 C CG1 . VAL A 1 167 ? -3.594  30.108 81.284 1.00 15.00 ? 167 VAL A CG1 1 
ATOM   1269 C CG2 . VAL A 1 167 ? -1.949  31.189 79.807 1.00 15.00 ? 167 VAL A CG2 1 
ATOM   1270 N N   . GLY A 1 168 ? -0.624  27.240 82.248 1.00 15.00 ? 168 GLY A N   1 
ATOM   1271 C CA  . GLY A 1 168 ? -0.887  25.990 82.925 1.00 15.00 ? 168 GLY A CA  1 
ATOM   1272 C C   . GLY A 1 168 ? -0.143  24.839 82.288 1.00 15.00 ? 168 GLY A C   1 
ATOM   1273 O O   . GLY A 1 168 ? 0.822   25.049 81.557 1.00 15.00 ? 168 GLY A O   1 
ATOM   1274 N N   . TYR A 1 169 ? -0.603  23.627 82.566 1.00 15.00 ? 169 TYR A N   1 
ATOM   1275 C CA  . TYR A 1 169 ? -0.012  22.393 82.046 1.00 15.00 ? 169 TYR A CA  1 
ATOM   1276 C C   . TYR A 1 169 ? -1.023  21.265 82.221 1.00 15.00 ? 169 TYR A C   1 
ATOM   1277 O O   . TYR A 1 169 ? -2.095  21.465 82.789 1.00 15.00 ? 169 TYR A O   1 
ATOM   1278 C CB  . TYR A 1 169 ? 1.292   22.044 82.785 1.00 15.00 ? 169 TYR A CB  1 
ATOM   1279 C CG  . TYR A 1 169 ? 1.174   21.957 84.300 1.00 15.00 ? 169 TYR A CG  1 
ATOM   1280 C CD1 . TYR A 1 169 ? 0.544   20.871 84.917 1.00 15.00 ? 169 TYR A CD1 1 
ATOM   1281 C CD2 . TYR A 1 169 ? 1.682   22.974 85.114 1.00 15.00 ? 169 TYR A CD2 1 
ATOM   1282 C CE1 . TYR A 1 169 ? 0.417   20.804 86.304 1.00 15.00 ? 169 TYR A CE1 1 
ATOM   1283 C CE2 . TYR A 1 169 ? 1.566   22.919 86.501 1.00 15.00 ? 169 TYR A CE2 1 
ATOM   1284 C CZ  . TYR A 1 169 ? 0.931   21.836 87.093 1.00 15.00 ? 169 TYR A CZ  1 
ATOM   1285 O OH  . TYR A 1 169 ? 0.785   21.800 88.467 1.00 15.00 ? 169 TYR A OH  1 
ATOM   1286 N N   . GLY A 1 170 ? -0.696  20.065 81.762 1.00 15.00 ? 170 GLY A N   1 
ATOM   1287 C CA  . GLY A 1 170 ? -1.615  18.954 81.912 1.00 15.00 ? 170 GLY A CA  1 
ATOM   1288 C C   . GLY A 1 170 ? -1.237  17.768 81.058 1.00 15.00 ? 170 GLY A C   1 
ATOM   1289 O O   . GLY A 1 170 ? -0.093  17.607 80.643 1.00 15.00 ? 170 GLY A O   1 
ATOM   1290 N N   . ILE A 1 171 ? -2.214  16.925 80.776 1.00 15.00 ? 171 ILE A N   1 
ATOM   1291 C CA  . ILE A 1 171 ? -2.015  15.743 79.949 1.00 15.00 ? 171 ILE A CA  1 
ATOM   1292 C C   . ILE A 1 171 ? -3.266  15.730 79.101 1.00 15.00 ? 171 ILE A C   1 
ATOM   1293 O O   . ILE A 1 171 ? -4.355  15.527 79.621 1.00 15.00 ? 171 ILE A O   1 
ATOM   1294 C CB  . ILE A 1 171 ? -2.017  14.456 80.809 1.00 15.00 ? 171 ILE A CB  1 
ATOM   1295 C CG1 . ILE A 1 171 ? -0.828  14.440 81.772 1.00 15.00 ? 171 ILE A CG1 1 
ATOM   1296 C CG2 . ILE A 1 171 ? -2.030  13.210 79.914 1.00 15.00 ? 171 ILE A CG2 1 
ATOM   1297 C CD1 . ILE A 1 171 ? 0.436   13.868 81.182 1.00 15.00 ? 171 ILE A CD1 1 
ATOM   1298 N N   . GLN A 1 172 ? -3.157  16.027 77.813 1.00 15.00 ? 172 GLN A N   1 
ATOM   1299 C CA  . GLN A 1 172 ? -4.351  16.017 76.972 1.00 15.00 ? 172 GLN A CA  1 
ATOM   1300 C C   . GLN A 1 172 ? -4.833  14.572 76.940 1.00 15.00 ? 172 GLN A C   1 
ATOM   1301 O O   . GLN A 1 172 ? -5.978  14.261 77.295 1.00 15.00 ? 172 GLN A O   1 
ATOM   1302 C CB  . GLN A 1 172 ? -4.029  16.505 75.555 1.00 15.00 ? 172 GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 172 ? -5.263  16.747 74.675 1.00 15.00 ? 172 GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 172 ? -4.897  17.182 73.266 1.00 15.00 ? 172 GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 172 ? -3.831  16.830 72.750 1.00 15.00 ? 172 GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 172 ? -5.781  17.947 72.632 1.00 15.00 ? 172 GLN A NE2 1 
ATOM   1307 N N   . LYS A 1 173 ? -3.946  13.679 76.523 1.00 15.00 ? 173 LYS A N   1 
ATOM   1308 C CA  . LYS A 1 173 ? -4.273  12.266 76.477 1.00 15.00 ? 173 LYS A CA  1 
ATOM   1309 C C   . LYS A 1 173 ? -2.945  11.569 76.325 1.00 15.00 ? 173 LYS A C   1 
ATOM   1310 O O   . LYS A 1 173 ? -2.380  11.510 75.234 1.00 15.00 ? 173 LYS A O   1 
ATOM   1311 C CB  . LYS A 1 173 ? -5.207  11.943 75.308 1.00 15.00 ? 173 LYS A CB  1 
ATOM   1312 C CG  . LYS A 1 173 ? -6.181  10.787 75.572 1.00 15.00 ? 173 LYS A CG  1 
ATOM   1313 C CD  . LYS A 1 173 ? -7.334  10.823 74.557 1.00 15.00 ? 173 LYS A CD  1 
ATOM   1314 C CE  . LYS A 1 173 ? -8.440  9.830  74.892 1.00 15.00 ? 173 LYS A CE  1 
ATOM   1315 N NZ  . LYS A 1 173 ? -9.543  9.922  73.888 1.00 15.00 ? 173 LYS A NZ  1 
ATOM   1316 N N   . GLY A 1 174 ? -2.391  11.182 77.469 1.00 15.00 ? 174 GLY A N   1 
ATOM   1317 C CA  . GLY A 1 174 ? -1.115  10.496 77.488 1.00 15.00 ? 174 GLY A CA  1 
ATOM   1318 C C   . GLY A 1 174 ? 0.051   11.452 77.418 1.00 15.00 ? 174 GLY A C   1 
ATOM   1319 O O   . GLY A 1 174 ? 1.094   11.205 78.029 1.00 15.00 ? 174 GLY A O   1 
ATOM   1320 N N   . ASN A 1 175 ? -0.110  12.569 76.714 1.00 15.00 ? 175 ASN A N   1 
ATOM   1321 C CA  . ASN A 1 175 ? 0.997   13.514 76.583 1.00 15.00 ? 175 ASN A CA  1 
ATOM   1322 C C   . ASN A 1 175 ? 0.983   14.746 77.492 1.00 15.00 ? 175 ASN A C   1 
ATOM   1323 O O   . ASN A 1 175 ? 0.007   15.515 77.513 1.00 15.00 ? 175 ASN A O   1 
ATOM   1324 C CB  . ASN A 1 175 ? 1.162   13.929 75.120 1.00 15.00 ? 175 ASN A CB  1 
ATOM   1325 C CG  . ASN A 1 175 ? 1.490   12.746 74.214 1.00 15.00 ? 175 ASN A CG  1 
ATOM   1326 O OD1 . ASN A 1 175 ? 0.640   12.281 73.447 1.00 15.00 ? 175 ASN A OD1 1 
ATOM   1327 N ND2 . ASN A 1 175 ? 2.721   12.246 74.311 1.00 15.00 ? 175 ASN A ND2 1 
ATOM   1328 N N   . LYS A 1 176 ? 2.079   14.909 78.237 1.00 15.00 ? 176 LYS A N   1 
ATOM   1329 C CA  . LYS A 1 176 ? 2.267   16.032 79.151 1.00 15.00 ? 176 LYS A CA  1 
ATOM   1330 C C   . LYS A 1 176 ? 2.412   17.283 78.299 1.00 15.00 ? 176 LYS A C   1 
ATOM   1331 O O   . LYS A 1 176 ? 3.119   17.270 77.283 1.00 15.00 ? 176 LYS A O   1 
ATOM   1332 C CB  . LYS A 1 176 ? 3.531   15.843 79.994 1.00 15.00 ? 176 LYS A CB  1 
ATOM   1333 C CG  . LYS A 1 176 ? 3.693   14.458 80.606 1.00 15.00 ? 176 LYS A CG  1 
ATOM   1334 C CD  . LYS A 1 176 ? 4.713   14.464 81.738 1.00 15.00 ? 176 LYS A CD  1 
ATOM   1335 C CE  . LYS A 1 176 ? 5.124   13.053 82.158 1.00 15.00 ? 176 LYS A CE  1 
ATOM   1336 N NZ  . LYS A 1 176 ? 6.128   12.453 81.214 1.00 15.00 ? 176 LYS A NZ  1 
ATOM   1337 N N   . HIS A 1 177 ? 1.778   18.379 78.714 1.00 15.00 ? 177 HIS A N   1 
ATOM   1338 C CA  . HIS A 1 177 ? 1.843   19.603 77.934 1.00 15.00 ? 177 HIS A CA  1 
ATOM   1339 C C   . HIS A 1 177 ? 1.729   20.903 78.708 1.00 15.00 ? 177 HIS A C   1 
ATOM   1340 O O   . HIS A 1 177 ? 1.077   20.950 79.748 1.00 15.00 ? 177 HIS A O   1 
ATOM   1341 C CB  . HIS A 1 177 ? 0.772   19.569 76.849 1.00 15.00 ? 177 HIS A CB  1 
ATOM   1342 C CG  . HIS A 1 177 ? -0.628  19.739 77.356 1.00 15.00 ? 177 HIS A CG  1 
ATOM   1343 N ND1 . HIS A 1 177 ? -1.573  18.744 77.271 1.00 15.00 ? 177 HIS A ND1 1 
ATOM   1344 C CD2 . HIS A 1 177 ? -1.269  20.817 77.872 1.00 15.00 ? 177 HIS A CD2 1 
ATOM   1345 C CE1 . HIS A 1 177 ? -2.737  19.200 77.704 1.00 15.00 ? 177 HIS A CE1 1 
ATOM   1346 N NE2 . HIS A 1 177 ? -2.573  20.455 78.073 1.00 15.00 ? 177 HIS A NE2 1 
ATOM   1347 N N   . TRP A 1 178 ? 2.358   21.942 78.161 1.00 15.00 ? 178 TRP A N   1 
ATOM   1348 C CA  . TRP A 1 178 ? 2.351   23.292 78.701 1.00 15.00 ? 178 TRP A CA  1 
ATOM   1349 C C   . TRP A 1 178 ? 1.295   24.051 77.908 1.00 15.00 ? 178 TRP A C   1 
ATOM   1350 O O   . TRP A 1 178 ? 1.335   24.069 76.671 1.00 15.00 ? 178 TRP A O   1 
ATOM   1351 C CB  . TRP A 1 178 ? 3.693   23.967 78.442 1.00 15.00 ? 178 TRP A CB  1 
ATOM   1352 C CG  . TRP A 1 178 ? 4.842   23.407 79.202 1.00 15.00 ? 178 TRP A CG  1 
ATOM   1353 C CD1 . TRP A 1 178 ? 5.931   22.762 78.688 1.00 15.00 ? 178 TRP A CD1 1 
ATOM   1354 C CD2 . TRP A 1 178 ? 5.043   23.468 80.618 1.00 15.00 ? 178 TRP A CD2 1 
ATOM   1355 N NE1 . TRP A 1 178 ? 6.798   22.416 79.696 1.00 15.00 ? 178 TRP A NE1 1 
ATOM   1356 C CE2 . TRP A 1 178 ? 6.277   22.836 80.890 1.00 15.00 ? 178 TRP A CE2 1 
ATOM   1357 C CE3 . TRP A 1 178 ? 4.298   23.997 81.683 1.00 15.00 ? 178 TRP A CE3 1 
ATOM   1358 C CZ2 . TRP A 1 178 ? 6.783   22.715 82.184 1.00 15.00 ? 178 TRP A CZ2 1 
ATOM   1359 C CZ3 . TRP A 1 178 ? 4.795   23.880 82.960 1.00 15.00 ? 178 TRP A CZ3 1 
ATOM   1360 C CH2 . TRP A 1 178 ? 6.030   23.241 83.204 1.00 15.00 ? 178 TRP A CH2 1 
ATOM   1361 N N   . ILE A 1 179 ? 0.330   24.669 78.585 1.00 15.00 ? 179 ILE A N   1 
ATOM   1362 C CA  . ILE A 1 179 ? -0.700  25.426 77.881 1.00 15.00 ? 179 ILE A CA  1 
ATOM   1363 C C   . ILE A 1 179 ? -0.147  26.825 77.652 1.00 15.00 ? 179 ILE A C   1 
ATOM   1364 O O   . ILE A 1 179 ? 0.102   27.573 78.596 1.00 15.00 ? 179 ILE A O   1 
ATOM   1365 C CB  . ILE A 1 179 ? -2.015  25.447 78.668 1.00 15.00 ? 179 ILE A CB  1 
ATOM   1366 C CG1 . ILE A 1 179 ? -2.460  24.004 78.944 1.00 15.00 ? 179 ILE A CG1 1 
ATOM   1367 C CG2 . ILE A 1 179 ? -3.072  26.200 77.890 1.00 15.00 ? 179 ILE A CG2 1 
ATOM   1368 C CD1 . ILE A 1 179 ? -3.788  23.862 79.640 1.00 15.00 ? 179 ILE A CD1 1 
ATOM   1369 N N   . ILE A 1 180 ? 0.080   27.162 76.385 1.00 15.00 ? 180 ILE A N   1 
ATOM   1370 C CA  . ILE A 1 180 ? 0.669   28.448 76.016 1.00 15.00 ? 180 ILE A CA  1 
ATOM   1371 C C   . ILE A 1 180 ? -0.267  29.479 75.376 1.00 15.00 ? 180 ILE A C   1 
ATOM   1372 O O   . ILE A 1 180 ? -1.096  29.142 74.530 1.00 15.00 ? 180 ILE A O   1 
ATOM   1373 C CB  . ILE A 1 180 ? 1.878   28.217 75.082 1.00 15.00 ? 180 ILE A CB  1 
ATOM   1374 C CG1 . ILE A 1 180 ? 2.930   27.346 75.767 1.00 15.00 ? 180 ILE A CG1 1 
ATOM   1375 C CG2 . ILE A 1 180 ? 2.483   29.518 74.677 1.00 15.00 ? 180 ILE A CG2 1 
ATOM   1376 C CD1 . ILE A 1 180 ? 3.635   28.035 76.891 1.00 15.00 ? 180 ILE A CD1 1 
ATOM   1377 N N   . LYS A 1 181 ? -0.120  30.737 75.792 1.00 15.00 ? 181 LYS A N   1 
ATOM   1378 C CA  . LYS A 1 181 ? -0.917  31.835 75.271 1.00 15.00 ? 181 LYS A CA  1 
ATOM   1379 C C   . LYS A 1 181 ? -0.048  32.657 74.342 1.00 15.00 ? 181 LYS A C   1 
ATOM   1380 O O   . LYS A 1 181 ? 0.789   33.433 74.812 1.00 15.00 ? 181 LYS A O   1 
ATOM   1381 C CB  . LYS A 1 181 ? -1.397  32.745 76.403 1.00 15.00 ? 181 LYS A CB  1 
ATOM   1382 C CG  . LYS A 1 181 ? -2.282  33.885 75.904 1.00 15.00 ? 181 LYS A CG  1 
ATOM   1383 C CD  . LYS A 1 181 ? -2.579  34.932 76.951 1.00 15.00 ? 181 LYS A CD  1 
ATOM   1384 C CE  . LYS A 1 181 ? -3.613  35.908 76.422 1.00 15.00 ? 181 LYS A CE  1 
ATOM   1385 N NZ  . LYS A 1 181 ? -3.773  37.137 77.233 1.00 15.00 ? 181 LYS A NZ  1 
ATOM   1386 N N   . ASN A 1 182 ? -0.234  32.506 73.031 1.00 15.00 ? 182 ASN A N   1 
ATOM   1387 C CA  . ASN A 1 182 ? 0.557   33.248 72.046 1.00 15.00 ? 182 ASN A CA  1 
ATOM   1388 C C   . ASN A 1 182 ? -0.093  34.620 71.841 1.00 15.00 ? 182 ASN A C   1 
ATOM   1389 O O   . ASN A 1 182 ? -1.100  34.934 72.474 1.00 15.00 ? 182 ASN A O   1 
ATOM   1390 C CB  . ASN A 1 182 ? 0.597   32.463 70.727 1.00 15.00 ? 182 ASN A CB  1 
ATOM   1391 C CG  . ASN A 1 182 ? 1.856   32.730 69.906 1.00 15.00 ? 182 ASN A CG  1 
ATOM   1392 O OD1 . ASN A 1 182 ? 2.576   33.690 70.142 1.00 15.00 ? 182 ASN A OD1 1 
ATOM   1393 N ND2 . ASN A 1 182 ? 2.114   31.879 68.927 1.00 15.00 ? 182 ASN A ND2 1 
ATOM   1394 N N   . SER A 1 183 ? 0.473   35.465 70.985 1.00 15.00 ? 183 SER A N   1 
ATOM   1395 C CA  . SER A 1 183 ? -0.097  36.790 70.732 1.00 15.00 ? 183 SER A CA  1 
ATOM   1396 C C   . SER A 1 183 ? -0.268  37.093 69.234 1.00 15.00 ? 183 SER A C   1 
ATOM   1397 O O   . SER A 1 183 ? 0.084   38.174 68.746 1.00 15.00 ? 183 SER A O   1 
ATOM   1398 C CB  . SER A 1 183 ? 0.757   37.875 71.398 1.00 15.00 ? 183 SER A CB  1 
ATOM   1399 O OG  . SER A 1 183 ? 2.132   37.728 71.069 1.00 15.00 ? 183 SER A OG  1 
ATOM   1400 N N   . TRP A 1 184 ? -0.828  36.146 68.494 1.00 15.00 ? 184 TRP A N   1 
ATOM   1401 C CA  . TRP A 1 184 ? -1.046  36.322 67.071 1.00 15.00 ? 184 TRP A CA  1 
ATOM   1402 C C   . TRP A 1 184 ? -2.541  36.267 66.782 1.00 15.00 ? 184 TRP A C   1 
ATOM   1403 O O   . TRP A 1 184 ? -2.992  35.441 66.000 1.00 15.00 ? 184 TRP A O   1 
ATOM   1404 C CB  . TRP A 1 184 ? -0.343  35.214 66.288 1.00 15.00 ? 184 TRP A CB  1 
ATOM   1405 C CG  . TRP A 1 184 ? 1.144   35.247 66.335 1.00 15.00 ? 184 TRP A CG  1 
ATOM   1406 C CD1 . TRP A 1 184 ? 1.936   36.303 66.670 1.00 15.00 ? 184 TRP A CD1 1 
ATOM   1407 C CD2 . TRP A 1 184 ? 2.023   34.176 65.995 1.00 15.00 ? 184 TRP A CD2 1 
ATOM   1408 N NE1 . TRP A 1 184 ? 3.259   35.960 66.564 1.00 15.00 ? 184 TRP A NE1 1 
ATOM   1409 C CE2 . TRP A 1 184 ? 3.345   34.660 66.149 1.00 15.00 ? 184 TRP A CE2 1 
ATOM   1410 C CE3 . TRP A 1 184 ? 1.830   32.859 65.574 1.00 15.00 ? 184 TRP A CE3 1 
ATOM   1411 C CZ2 . TRP A 1 184 ? 4.466   33.863 65.892 1.00 15.00 ? 184 TRP A CZ2 1 
ATOM   1412 C CZ3 . TRP A 1 184 ? 2.944   32.069 65.322 1.00 15.00 ? 184 TRP A CZ3 1 
ATOM   1413 C CH2 . TRP A 1 184 ? 4.246   32.577 65.482 1.00 15.00 ? 184 TRP A CH2 1 
ATOM   1414 N N   . GLY A 1 185 ? -3.324  37.117 67.435 1.00 15.00 ? 185 GLY A N   1 
ATOM   1415 C CA  . GLY A 1 185 ? -4.761  37.127 67.216 1.00 15.00 ? 185 GLY A CA  1 
ATOM   1416 C C   . GLY A 1 185 ? -5.366  35.813 67.661 1.00 15.00 ? 185 GLY A C   1 
ATOM   1417 O O   . GLY A 1 185 ? -4.648  34.911 68.081 1.00 15.00 ? 185 GLY A O   1 
ATOM   1418 N N   . GLU A 1 186 ? -6.684  35.662 67.626 1.00 15.00 ? 186 GLU A N   1 
ATOM   1419 C CA  . GLU A 1 186 ? -7.261  34.390 68.045 1.00 15.00 ? 186 GLU A CA  1 
ATOM   1420 C C   . GLU A 1 186 ? -7.511  33.485 66.858 1.00 15.00 ? 186 GLU A C   1 
ATOM   1421 O O   . GLU A 1 186 ? -7.984  32.359 67.007 1.00 15.00 ? 186 GLU A O   1 
ATOM   1422 C CB  . GLU A 1 186 ? -8.527  34.570 68.890 1.00 15.00 ? 186 GLU A CB  1 
ATOM   1423 C CG  . GLU A 1 186 ? -9.649  35.321 68.232 1.00 15.00 ? 186 GLU A CG  1 
ATOM   1424 C CD  . GLU A 1 186 ? -10.914 35.300 69.066 1.00 15.00 ? 186 GLU A CD  1 
ATOM   1425 O OE1 . GLU A 1 186 ? -11.380 34.189 69.402 1.00 15.00 ? 186 GLU A OE1 1 
ATOM   1426 O OE2 . GLU A 1 186 ? -11.448 36.387 69.386 1.00 15.00 ? 186 GLU A OE2 1 
ATOM   1427 N N   . ASN A 1 187 ? -7.150  33.975 65.678 1.00 15.00 ? 187 ASN A N   1 
ATOM   1428 C CA  . ASN A 1 187 ? -7.310  33.215 64.451 1.00 15.00 ? 187 ASN A CA  1 
ATOM   1429 C C   . ASN A 1 187 ? -6.156  32.216 64.353 1.00 15.00 ? 187 ASN A C   1 
ATOM   1430 O O   . ASN A 1 187 ? -6.233  31.223 63.635 1.00 15.00 ? 187 ASN A O   1 
ATOM   1431 C CB  . ASN A 1 187 ? -7.318  34.157 63.236 1.00 15.00 ? 187 ASN A CB  1 
ATOM   1432 C CG  . ASN A 1 187 ? -8.091  33.585 62.043 1.00 15.00 ? 187 ASN A CG  1 
ATOM   1433 O OD1 . ASN A 1 187 ? -7.749  33.838 60.891 1.00 15.00 ? 187 ASN A OD1 1 
ATOM   1434 N ND2 . ASN A 1 187 ? -9.156  32.843 62.321 1.00 15.00 ? 187 ASN A ND2 1 
ATOM   1435 N N   . TRP A 1 188 ? -5.070  32.461 65.082 1.00 15.00 ? 188 TRP A N   1 
ATOM   1436 C CA  . TRP A 1 188 ? -3.921  31.559 65.052 1.00 15.00 ? 188 TRP A CA  1 
ATOM   1437 C C   . TRP A 1 188 ? -4.154  30.329 65.934 1.00 15.00 ? 188 TRP A C   1 
ATOM   1438 O O   . TRP A 1 188 ? -4.982  30.370 66.852 1.00 15.00 ? 188 TRP A O   1 
ATOM   1439 C CB  . TRP A 1 188 ? -2.652  32.287 65.500 1.00 15.00 ? 188 TRP A CB  1 
ATOM   1440 C CG  . TRP A 1 188 ? -1.466  31.394 65.505 1.00 15.00 ? 188 TRP A CG  1 
ATOM   1441 C CD1 . TRP A 1 188 ? -0.739  31.010 64.428 1.00 15.00 ? 188 TRP A CD1 1 
ATOM   1442 C CD2 . TRP A 1 188 ? -0.917  30.698 66.631 1.00 15.00 ? 188 TRP A CD2 1 
ATOM   1443 N NE1 . TRP A 1 188 ? 0.223   30.107 64.800 1.00 15.00 ? 188 TRP A NE1 1 
ATOM   1444 C CE2 . TRP A 1 188 ? 0.141   29.895 66.148 1.00 15.00 ? 188 TRP A CE2 1 
ATOM   1445 C CE3 . TRP A 1 188 ? -1.217  30.666 67.998 1.00 15.00 ? 188 TRP A CE3 1 
ATOM   1446 C CZ2 . TRP A 1 188 ? 0.902   29.071 66.983 1.00 15.00 ? 188 TRP A CZ2 1 
ATOM   1447 C CZ3 . TRP A 1 188 ? -0.460  29.847 68.826 1.00 15.00 ? 188 TRP A CZ3 1 
ATOM   1448 C CH2 . TRP A 1 188 ? 0.587   29.060 68.314 1.00 15.00 ? 188 TRP A CH2 1 
ATOM   1449 N N   . GLY A 1 189 ? -3.429  29.249 65.642 1.00 15.00 ? 189 GLY A N   1 
ATOM   1450 C CA  . GLY A 1 189 ? -3.528  28.013 66.402 1.00 15.00 ? 189 GLY A CA  1 
ATOM   1451 C C   . GLY A 1 189 ? -4.897  27.716 66.972 1.00 15.00 ? 189 GLY A C   1 
ATOM   1452 O O   . GLY A 1 189 ? -5.919  28.008 66.365 1.00 15.00 ? 189 GLY A O   1 
ATOM   1453 N N   . ASN A 1 190 ? -4.946  27.153 68.171 1.00 15.00 ? 190 ASN A N   1 
ATOM   1454 C CA  . ASN A 1 190 ? -6.227  26.849 68.792 1.00 15.00 ? 190 ASN A CA  1 
ATOM   1455 C C   . ASN A 1 190 ? -6.778  28.084 69.497 1.00 15.00 ? 190 ASN A C   1 
ATOM   1456 O O   . ASN A 1 190 ? -6.609  28.237 70.700 1.00 15.00 ? 190 ASN A O   1 
ATOM   1457 C CB  . ASN A 1 190 ? -6.093  25.700 69.790 1.00 15.00 ? 190 ASN A CB  1 
ATOM   1458 C CG  . ASN A 1 190 ? -7.414  25.016 70.064 1.00 15.00 ? 190 ASN A CG  1 
ATOM   1459 O OD1 . ASN A 1 190 ? -7.470  23.799 70.177 1.00 15.00 ? 190 ASN A OD1 1 
ATOM   1460 N ND2 . ASN A 1 190 ? -8.486  25.790 70.174 1.00 15.00 ? 190 ASN A ND2 1 
ATOM   1461 N N   . LYS A 1 191 ? -7.453  28.952 68.744 1.00 15.00 ? 191 LYS A N   1 
ATOM   1462 C CA  . LYS A 1 191 ? -8.052  30.181 69.276 1.00 15.00 ? 191 LYS A CA  1 
ATOM   1463 C C   . LYS A 1 191 ? -7.041  31.019 70.048 1.00 15.00 ? 191 LYS A C   1 
ATOM   1464 O O   . LYS A 1 191 ? -7.346  31.543 71.111 1.00 15.00 ? 191 LYS A O   1 
ATOM   1465 C CB  . LYS A 1 191 ? -9.236  29.855 70.192 1.00 15.00 ? 191 LYS A CB  1 
ATOM   1466 C CG  . LYS A 1 191 ? -10.330 28.997 69.573 1.00 15.00 ? 191 LYS A CG  1 
ATOM   1467 C CD  . LYS A 1 191 ? -11.297 28.507 70.655 1.00 15.00 ? 191 LYS A CD  1 
ATOM   1468 C CE  . LYS A 1 191 ? -12.174 27.345 70.162 1.00 15.00 ? 191 LYS A CE  1 
ATOM   1469 N NZ  . LYS A 1 191 ? -12.993 26.756 71.271 1.00 15.00 ? 191 LYS A NZ  1 
ATOM   1470 N N   . GLY A 1 192 ? -5.821  31.111 69.536 1.00 15.00 ? 192 GLY A N   1 
ATOM   1471 C CA  . GLY A 1 192 ? -4.793  31.886 70.197 1.00 15.00 ? 192 GLY A CA  1 
ATOM   1472 C C   . GLY A 1 192 ? -3.813  31.086 71.036 1.00 15.00 ? 192 GLY A C   1 
ATOM   1473 O O   . GLY A 1 192 ? -2.684  31.534 71.262 1.00 15.00 ? 192 GLY A O   1 
ATOM   1474 N N   . TYR A 1 193 ? -4.216  29.902 71.489 1.00 15.00 ? 193 TYR A N   1 
ATOM   1475 C CA  . TYR A 1 193 ? -3.357  29.060 72.322 1.00 15.00 ? 193 TYR A CA  1 
ATOM   1476 C C   . TYR A 1 193 ? -2.641  27.926 71.584 1.00 15.00 ? 193 TYR A C   1 
ATOM   1477 O O   . TYR A 1 193 ? -2.895  27.646 70.410 1.00 15.00 ? 193 TYR A O   1 
ATOM   1478 C CB  . TYR A 1 193 ? -4.167  28.475 73.485 1.00 15.00 ? 193 TYR A CB  1 
ATOM   1479 C CG  . TYR A 1 193 ? -4.674  29.522 74.443 1.00 15.00 ? 193 TYR A CG  1 
ATOM   1480 C CD1 . TYR A 1 193 ? -5.863  30.202 74.194 1.00 15.00 ? 193 TYR A CD1 1 
ATOM   1481 C CD2 . TYR A 1 193 ? -3.928  29.888 75.567 1.00 15.00 ? 193 TYR A CD2 1 
ATOM   1482 C CE1 . TYR A 1 193 ? -6.289  31.226 75.028 1.00 15.00 ? 193 TYR A CE1 1 
ATOM   1483 C CE2 . TYR A 1 193 ? -4.350  30.915 76.408 1.00 15.00 ? 193 TYR A CE2 1 
ATOM   1484 C CZ  . TYR A 1 193 ? -5.526  31.579 76.128 1.00 15.00 ? 193 TYR A CZ  1 
ATOM   1485 O OH  . TYR A 1 193 ? -5.932  32.613 76.932 1.00 15.00 ? 193 TYR A OH  1 
ATOM   1486 N N   . ILE A 1 194 ? -1.730  27.268 72.284 1.00 15.00 ? 194 ILE A N   1 
ATOM   1487 C CA  . ILE A 1 194 ? -0.995  26.146 71.737 1.00 15.00 ? 194 ILE A CA  1 
ATOM   1488 C C   . ILE A 1 194 ? -0.434  25.305 72.880 1.00 15.00 ? 194 ILE A C   1 
ATOM   1489 O O   . ILE A 1 194 ? 0.068   25.832 73.874 1.00 15.00 ? 194 ILE A O   1 
ATOM   1490 C CB  . ILE A 1 194 ? 0.145   26.592 70.776 1.00 15.00 ? 194 ILE A CB  1 
ATOM   1491 C CG1 . ILE A 1 194 ? 0.888   25.366 70.238 1.00 15.00 ? 194 ILE A CG1 1 
ATOM   1492 C CG2 . ILE A 1 194 ? 1.112   27.525 71.467 1.00 15.00 ? 194 ILE A CG2 1 
ATOM   1493 C CD1 . ILE A 1 194 ? 2.100   25.687 69.401 1.00 15.00 ? 194 ILE A CD1 1 
ATOM   1494 N N   . LEU A 1 195 ? -0.639  23.998 72.784 1.00 15.00 ? 195 LEU A N   1 
ATOM   1495 C CA  . LEU A 1 195 ? -0.147  23.055 73.773 1.00 15.00 ? 195 LEU A CA  1 
ATOM   1496 C C   . LEU A 1 195 ? 1.211   22.610 73.289 1.00 15.00 ? 195 LEU A C   1 
ATOM   1497 O O   . LEU A 1 195 ? 1.368   22.209 72.139 1.00 15.00 ? 195 LEU A O   1 
ATOM   1498 C CB  . LEU A 1 195 ? -1.081  21.857 73.878 1.00 15.00 ? 195 LEU A CB  1 
ATOM   1499 C CG  . LEU A 1 195 ? -2.278  22.033 74.812 1.00 15.00 ? 195 LEU A CG  1 
ATOM   1500 C CD1 . LEU A 1 195 ? -2.793  23.455 74.799 1.00 15.00 ? 195 LEU A CD1 1 
ATOM   1501 C CD2 . LEU A 1 195 ? -3.363  21.055 74.443 1.00 15.00 ? 195 LEU A CD2 1 
ATOM   1502 N N   . MET A 1 196 ? 2.217   22.737 74.141 1.00 15.00 ? 196 MET A N   1 
ATOM   1503 C CA  . MET A 1 196 ? 3.561   22.344 73.772 1.00 15.00 ? 196 MET A CA  1 
ATOM   1504 C C   . MET A 1 196 ? 4.028   21.210 74.681 1.00 15.00 ? 196 MET A C   1 
ATOM   1505 O O   . MET A 1 196 ? 3.651   21.144 75.847 1.00 15.00 ? 196 MET A O   1 
ATOM   1506 C CB  . MET A 1 196 ? 4.484   23.560 73.845 1.00 15.00 ? 196 MET A CB  1 
ATOM   1507 C CG  . MET A 1 196 ? 4.166   24.623 72.793 1.00 15.00 ? 196 MET A CG  1 
ATOM   1508 S SD  . MET A 1 196 ? 5.221   26.070 72.919 1.00 15.00 ? 196 MET A SD  1 
ATOM   1509 C CE  . MET A 1 196 ? 6.803   25.354 72.492 1.00 15.00 ? 196 MET A CE  1 
ATOM   1510 N N   . ALA A 1 197 ? 4.813   20.281 74.147 1.00 15.00 ? 197 ALA A N   1 
ATOM   1511 C CA  . ALA A 1 197 ? 5.294   19.149 74.929 1.00 15.00 ? 197 ALA A CA  1 
ATOM   1512 C C   . ALA A 1 197 ? 5.990   19.546 76.232 1.00 15.00 ? 197 ALA A C   1 
ATOM   1513 O O   . ALA A 1 197 ? 6.753   20.513 76.279 1.00 15.00 ? 197 ALA A O   1 
ATOM   1514 C CB  . ALA A 1 197 ? 6.209   18.278 74.083 1.00 15.00 ? 197 ALA A CB  1 
ATOM   1515 N N   . ARG A 1 198 ? 5.693   18.792 77.290 1.00 15.00 ? 198 ARG A N   1 
ATOM   1516 C CA  . ARG A 1 198 ? 6.272   19.002 78.610 1.00 15.00 ? 198 ARG A CA  1 
ATOM   1517 C C   . ARG A 1 198 ? 6.994   17.744 79.074 1.00 15.00 ? 198 ARG A C   1 
ATOM   1518 O O   . ARG A 1 198 ? 6.424   16.652 79.101 1.00 15.00 ? 198 ARG A O   1 
ATOM   1519 C CB  . ARG A 1 198 ? 5.196   19.373 79.629 1.00 15.00 ? 198 ARG A CB  1 
ATOM   1520 C CG  . ARG A 1 198 ? 5.717   19.424 81.057 1.00 15.00 ? 198 ARG A CG  1 
ATOM   1521 C CD  . ARG A 1 198 ? 4.780   20.135 82.013 1.00 15.00 ? 198 ARG A CD  1 
ATOM   1522 N NE  . ARG A 1 198 ? 3.529   19.438 82.280 1.00 15.00 ? 198 ARG A NE  1 
ATOM   1523 C CZ  . ARG A 1 198 ? 3.394   18.462 83.170 1.00 15.00 ? 198 ARG A CZ  1 
ATOM   1524 N NH1 . ARG A 1 198 ? 4.441   18.048 83.866 1.00 15.00 ? 198 ARG A NH1 1 
ATOM   1525 N NH2 . ARG A 1 198 ? 2.189   17.973 83.441 1.00 15.00 ? 198 ARG A NH2 1 
ATOM   1526 N N   . ASN A 1 199 ? 8.265   17.920 79.407 1.00 15.00 ? 199 ASN A N   1 
ATOM   1527 C CA  . ASN A 1 199 ? 9.146   16.866 79.896 1.00 15.00 ? 199 ASN A CA  1 
ATOM   1528 C C   . ASN A 1 199 ? 9.844   16.061 78.811 1.00 15.00 ? 199 ASN A C   1 
ATOM   1529 O O   . ASN A 1 199 ? 10.622  15.148 79.104 1.00 15.00 ? 199 ASN A O   1 
ATOM   1530 C CB  . ASN A 1 199 ? 8.450   15.965 80.926 1.00 15.00 ? 199 ASN A CB  1 
ATOM   1531 C CG  . ASN A 1 199 ? 8.110   16.705 82.223 1.00 15.00 ? 199 ASN A CG  1 
ATOM   1532 O OD1 . ASN A 1 199 ? 7.035   16.499 82.797 1.00 15.00 ? 199 ASN A OD1 1 
ATOM   1533 N ND2 . ASN A 1 199 ? 9.015   17.582 82.680 1.00 15.00 ? 199 ASN A ND2 1 
ATOM   1534 N N   . LYS A 1 200 ? 9.618   16.424 77.553 1.00 15.00 ? 200 LYS A N   1 
ATOM   1535 C CA  . LYS A 1 200 ? 10.293  15.751 76.446 1.00 15.00 ? 200 LYS A CA  1 
ATOM   1536 C C   . LYS A 1 200 ? 11.577  16.543 76.255 1.00 15.00 ? 200 LYS A C   1 
ATOM   1537 O O   . LYS A 1 200 ? 11.744  17.252 75.265 1.00 15.00 ? 200 LYS A O   1 
ATOM   1538 C CB  . LYS A 1 200 ? 9.446   15.758 75.164 1.00 15.00 ? 200 LYS A CB  1 
ATOM   1539 C CG  . LYS A 1 200 ? 8.145   14.972 75.294 1.00 15.00 ? 200 LYS A CG  1 
ATOM   1540 C CD  . LYS A 1 200 ? 7.572   14.570 73.944 1.00 15.00 ? 200 LYS A CD  1 
ATOM   1541 C CE  . LYS A 1 200 ? 6.295   13.722 74.103 1.00 15.00 ? 200 LYS A CE  1 
ATOM   1542 N NZ  . LYS A 1 200 ? 5.795   13.150 72.795 1.00 15.00 ? 200 LYS A NZ  1 
ATOM   1543 N N   . ASN A 1 201 ? 12.424  16.492 77.281 1.00 15.00 ? 201 ASN A N   1 
ATOM   1544 C CA  . ASN A 1 201 ? 13.704  17.181 77.299 1.00 15.00 ? 201 ASN A CA  1 
ATOM   1545 C C   . ASN A 1 201 ? 13.601  18.634 76.868 1.00 15.00 ? 201 ASN A C   1 
ATOM   1546 O O   . ASN A 1 201 ? 13.754  18.936 75.690 1.00 15.00 ? 201 ASN A O   1 
ATOM   1547 C CB  . ASN A 1 201 ? 14.728  16.480 76.397 1.00 15.00 ? 201 ASN A CB  1 
ATOM   1548 C CG  . ASN A 1 201 ? 14.908  15.000 76.725 1.00 15.00 ? 201 ASN A CG  1 
ATOM   1549 O OD1 . ASN A 1 201 ? 15.209  14.199 75.834 1.00 15.00 ? 201 ASN A OD1 1 
ATOM   1550 N ND2 . ASN A 1 201 ? 14.736  14.629 77.997 1.00 15.00 ? 201 ASN A ND2 1 
ATOM   1551 N N   . ASN A 1 202 ? 13.268  19.511 77.814 1.00 15.00 ? 202 ASN A N   1 
ATOM   1552 C CA  . ASN A 1 202 ? 13.180  20.957 77.594 1.00 15.00 ? 202 ASN A CA  1 
ATOM   1553 C C   . ASN A 1 202 ? 12.777  21.395 76.171 1.00 15.00 ? 202 ASN A C   1 
ATOM   1554 O O   . ASN A 1 202 ? 13.464  22.198 75.516 1.00 15.00 ? 202 ASN A O   1 
ATOM   1555 C CB  . ASN A 1 202 ? 14.514  21.577 78.018 1.00 15.00 ? 202 ASN A CB  1 
ATOM   1556 C CG  . ASN A 1 202 ? 14.468  23.073 78.109 1.00 15.00 ? 202 ASN A CG  1 
ATOM   1557 O OD1 . ASN A 1 202 ? 13.468  23.657 78.522 1.00 15.00 ? 202 ASN A OD1 1 
ATOM   1558 N ND2 . ASN A 1 202 ? 15.564  23.707 77.749 1.00 15.00 ? 202 ASN A ND2 1 
ATOM   1559 N N   . ALA A 1 203 ? 11.641  20.913 75.701 1.00 15.00 ? 203 ALA A N   1 
ATOM   1560 C CA  . ALA A 1 203 ? 11.131  21.165 74.354 1.00 15.00 ? 203 ALA A CA  1 
ATOM   1561 C C   . ALA A 1 203 ? 11.152  22.674 74.063 1.00 15.00 ? 203 ALA A C   1 
ATOM   1562 O O   . ALA A 1 203 ? 10.604  23.512 74.767 1.00 15.00 ? 203 ALA A O   1 
ATOM   1563 C CB  . ALA A 1 203 ? 9.684   20.700 74.220 1.00 15.00 ? 203 ALA A CB  1 
ATOM   1564 N N   . CYS A 1 204 ? 11.800  23.030 72.935 1.00 15.00 ? 204 CYS A N   1 
ATOM   1565 C CA  . CYS A 1 204 ? 11.852  24.413 72.480 1.00 15.00 ? 204 CYS A CA  1 
ATOM   1566 C C   . CYS A 1 204 ? 12.486  25.391 73.460 1.00 15.00 ? 204 CYS A C   1 
ATOM   1567 O O   . CYS A 1 204 ? 12.411  26.610 73.259 1.00 15.00 ? 204 CYS A O   1 
ATOM   1568 C CB  . CYS A 1 204 ? 10.443  24.884 72.129 1.00 15.00 ? 204 CYS A CB  1 
ATOM   1569 S SG  . CYS A 1 204 ? 9.665   23.918 70.789 1.00 15.00 ? 204 CYS A SG  1 
ATOM   1570 N N   . GLY A 1 205 ? 13.127  24.872 74.507 1.00 15.00 ? 205 GLY A N   1 
ATOM   1571 C CA  . GLY A 1 205 ? 13.740  25.735 75.497 1.00 15.00 ? 205 GLY A CA  1 
ATOM   1572 C C   . GLY A 1 205 ? 12.698  26.585 76.203 1.00 15.00 ? 205 GLY A C   1 
ATOM   1573 O O   . GLY A 1 205 ? 12.936  27.751 76.527 1.00 15.00 ? 205 GLY A O   1 
ATOM   1574 N N   . ILE A 1 206 ? 11.519  26.015 76.432 1.00 15.00 ? 206 ILE A N   1 
ATOM   1575 C CA  . ILE A 1 206 ? 10.451  26.734 77.114 1.00 15.00 ? 206 ILE A CA  1 
ATOM   1576 C C   . ILE A 1 206 ? 10.892  27.215 78.500 1.00 15.00 ? 206 ILE A C   1 
ATOM   1577 O O   . ILE A 1 206 ? 10.452  28.269 78.976 1.00 15.00 ? 206 ILE A O   1 
ATOM   1578 C CB  . ILE A 1 206 ? 9.175   25.873 77.256 1.00 15.00 ? 206 ILE A CB  1 
ATOM   1579 C CG1 . ILE A 1 206 ? 8.116   26.639 78.047 1.00 15.00 ? 206 ILE A CG1 1 
ATOM   1580 C CG2 . ILE A 1 206 ? 9.493   24.553 77.946 1.00 15.00 ? 206 ILE A CG2 1 
ATOM   1581 C CD1 . ILE A 1 206 ? 6.736   26.071 77.937 1.00 15.00 ? 206 ILE A CD1 1 
ATOM   1582 N N   . ALA A 1 207 ? 11.795  26.471 79.135 1.00 15.00 ? 207 ALA A N   1 
ATOM   1583 C CA  . ALA A 1 207 ? 12.271  26.839 80.456 1.00 15.00 ? 207 ALA A CA  1 
ATOM   1584 C C   . ALA A 1 207 ? 13.658  27.469 80.475 1.00 15.00 ? 207 ALA A C   1 
ATOM   1585 O O   . ALA A 1 207 ? 14.410  27.261 81.410 1.00 15.00 ? 207 ALA A O   1 
ATOM   1586 C CB  . ALA A 1 207 ? 12.223  25.631 81.385 1.00 15.00 ? 207 ALA A CB  1 
ATOM   1587 N N   . ASN A 1 208 ? 13.997  28.313 79.505 1.00 15.00 ? 208 ASN A N   1 
ATOM   1588 C CA  . ASN A 1 208 ? 15.323  28.938 79.477 1.00 15.00 ? 208 ASN A CA  1 
ATOM   1589 C C   . ASN A 1 208 ? 15.344  30.434 79.694 1.00 15.00 ? 208 ASN A C   1 
ATOM   1590 O O   . ASN A 1 208 ? 16.413  31.031 79.839 1.00 15.00 ? 208 ASN A O   1 
ATOM   1591 C CB  . ASN A 1 208 ? 16.038  28.625 78.171 1.00 15.00 ? 208 ASN A CB  1 
ATOM   1592 C CG  . ASN A 1 208 ? 16.672  27.269 78.182 1.00 15.00 ? 208 ASN A CG  1 
ATOM   1593 O OD1 . ASN A 1 208 ? 15.981  26.258 78.229 1.00 15.00 ? 208 ASN A OD1 1 
ATOM   1594 N ND2 . ASN A 1 208 ? 18.003  27.231 78.185 1.00 15.00 ? 208 ASN A ND2 1 
ATOM   1595 N N   . LEU A 1 209 ? 14.178  31.065 79.651 1.00 15.00 ? 209 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 209 ? 14.083  32.497 79.858 1.00 15.00 ? 209 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 209 ? 12.743  32.770 80.506 1.00 15.00 ? 209 LEU A C   1 
ATOM   1598 O O   . LEU A 1 209 ? 12.009  33.658 80.077 1.00 15.00 ? 209 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 209 ? 14.188  33.246 78.534 1.00 15.00 ? 209 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 209 ? 14.682  34.689 78.655 1.00 15.00 ? 209 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 209 ? 16.117  34.687 79.170 1.00 15.00 ? 209 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 209 ? 14.616  35.388 77.324 1.00 15.00 ? 209 LEU A CD2 1 
ATOM   1603 N N   . ALA A 1 210 ? 12.433  31.954 81.497 1.00 15.00 ? 210 ALA A N   1 
ATOM   1604 C CA  . ALA A 1 210 ? 11.186  32.109 82.244 1.00 15.00 ? 210 ALA A CA  1 
ATOM   1605 C C   . ALA A 1 210 ? 11.398  33.078 83.418 1.00 15.00 ? 210 ALA A C   1 
ATOM   1606 O O   . ALA A 1 210 ? 12.539  33.218 83.875 1.00 15.00 ? 210 ALA A O   1 
ATOM   1607 C CB  . ALA A 1 210 ? 10.732  30.778 82.836 1.00 15.00 ? 210 ALA A CB  1 
ATOM   1608 N N   . SER A 1 211 ? 10.355  33.759 83.806 1.00 15.00 ? 211 SER A N   1 
ATOM   1609 C CA  . SER A 1 211 ? 10.422  34.713 84.910 1.00 15.00 ? 211 SER A CA  1 
ATOM   1610 C C   . SER A 1 211 ? 9.015   35.074 85.309 1.00 15.00 ? 211 SER A C   1 
ATOM   1611 O O   . SER A 1 211 ? 8.071   34.806 84.578 1.00 15.00 ? 211 SER A O   1 
ATOM   1612 C CB  . SER A 1 211 ? 11.163  35.988 84.492 1.00 15.00 ? 211 SER A CB  1 
ATOM   1613 O OG  . SER A 1 211 ? 10.487  36.671 83.447 1.00 15.00 ? 211 SER A OG  1 
ATOM   1614 N N   . PHE A 1 212 ? 8.855   35.647 86.490 1.00 15.00 ? 212 PHE A N   1 
ATOM   1615 C CA  . PHE A 1 212 ? 7.542   36.067 86.942 1.00 15.00 ? 212 PHE A CA  1 
ATOM   1616 C C   . PHE A 1 212 ? 7.710   37.298 87.798 1.00 15.00 ? 212 PHE A C   1 
ATOM   1617 O O   . PHE A 1 212 ? 8.735   37.478 88.439 1.00 15.00 ? 212 PHE A O   1 
ATOM   1618 C CB  . PHE A 1 212 ? 6.795   34.935 87.677 1.00 15.00 ? 212 PHE A CB  1 
ATOM   1619 C CG  . PHE A 1 212 ? 7.485   34.424 88.928 1.00 15.00 ? 212 PHE A CG  1 
ATOM   1620 C CD1 . PHE A 1 212 ? 7.344   35.096 90.158 1.00 15.00 ? 212 PHE A CD1 1 
ATOM   1621 C CD2 . PHE A 1 212 ? 8.215   33.240 88.899 1.00 15.00 ? 212 PHE A CD2 1 
ATOM   1622 C CE1 . PHE A 1 212 ? 7.909   34.593 91.325 1.00 15.00 ? 212 PHE A CE1 1 
ATOM   1623 C CE2 . PHE A 1 212 ? 8.784   32.730 90.072 1.00 15.00 ? 212 PHE A CE2 1 
ATOM   1624 C CZ  . PHE A 1 212 ? 8.629   33.409 91.282 1.00 15.00 ? 212 PHE A CZ  1 
ATOM   1625 N N   . PRO A 1 213 ? 6.777   38.239 87.693 1.00 15.00 ? 213 PRO A N   1 
ATOM   1626 C CA  . PRO A 1 213 ? 6.895   39.451 88.504 1.00 15.00 ? 213 PRO A CA  1 
ATOM   1627 C C   . PRO A 1 213 ? 6.438   39.169 89.925 1.00 15.00 ? 213 PRO A C   1 
ATOM   1628 O O   . PRO A 1 213 ? 5.647   38.261 90.167 1.00 15.00 ? 213 PRO A O   1 
ATOM   1629 C CB  . PRO A 1 213 ? 5.935   40.409 87.810 1.00 15.00 ? 213 PRO A CB  1 
ATOM   1630 C CG  . PRO A 1 213 ? 4.849   39.496 87.344 1.00 15.00 ? 213 PRO A CG  1 
ATOM   1631 C CD  . PRO A 1 213 ? 5.615   38.309 86.792 1.00 15.00 ? 213 PRO A CD  1 
ATOM   1632 N N   . LYS A 1 214 ? 6.956   39.921 90.878 1.00 15.00 ? 214 LYS A N   1 
ATOM   1633 C CA  . LYS A 1 214 ? 6.548   39.741 92.253 1.00 15.00 ? 214 LYS A CA  1 
ATOM   1634 C C   . LYS A 1 214 ? 5.558   40.859 92.511 1.00 15.00 ? 214 LYS A C   1 
ATOM   1635 O O   . LYS A 1 214 ? 5.781   41.990 92.102 1.00 15.00 ? 214 LYS A O   1 
ATOM   1636 C CB  . LYS A 1 214 ? 7.763   39.870 93.179 1.00 15.00 ? 214 LYS A CB  1 
ATOM   1637 C CG  . LYS A 1 214 ? 8.233   38.544 93.815 1.00 15.00 ? 214 LYS A CG  1 
ATOM   1638 C CD  . LYS A 1 214 ? 9.757   38.433 93.840 1.00 15.00 ? 214 LYS A CD  1 
ATOM   1639 C CE  . LYS A 1 214 ? 10.406  39.632 94.506 1.00 15.00 ? 214 LYS A CE  1 
ATOM   1640 N NZ  . LYS A 1 214 ? 11.889  39.586 94.372 1.00 15.00 ? 214 LYS A NZ  1 
ATOM   1641 N N   . MET A 1 215 ? 4.419   40.554 93.109 1.00 15.00 ? 215 MET A N   1 
ATOM   1642 C CA  . MET A 1 215 ? 3.460   41.607 93.395 1.00 15.00 ? 215 MET A CA  1 
ATOM   1643 C C   . MET A 1 215 ? 2.993   41.596 94.853 1.00 15.00 ? 215 MET A C   1 
ATOM   1644 O O   . MET A 1 215 ? 3.026   40.516 95.490 1.00 15.00 ? 215 MET A O   1 
ATOM   1645 C CB  . MET A 1 215 ? 2.269   41.540 92.437 1.00 15.00 ? 215 MET A CB  1 
ATOM   1646 C CG  . MET A 1 215 ? 1.808   42.921 91.972 1.00 15.00 ? 215 MET A CG  1 
ATOM   1647 S SD  . MET A 1 215 ? 0.395   42.914 90.864 1.00 15.00 ? 215 MET A SD  1 
ATOM   1648 C CE  . MET A 1 215 ? -0.940  43.084 91.995 1.00 15.00 ? 215 MET A CE  1 
ATOM   1649 O OXT . MET A 1 215 ? 2.650   42.693 95.355 1.00 15.00 ? 215 MET A OXT 1 
HETATM 1650 C C1  . SDK B 2 .   ? 0.130   37.037 62.798 1.00 15.00 ? 300 SDK A C1  1 
HETATM 1651 C C2  . SDK B 2 .   ? 0.177   38.189 63.596 1.00 15.00 ? 300 SDK A C2  1 
HETATM 1652 C C3  . SDK B 2 .   ? 1.373   38.894 63.736 1.00 15.00 ? 300 SDK A C3  1 
HETATM 1653 C C4  . SDK B 2 .   ? 2.525   38.463 63.090 1.00 15.00 ? 300 SDK A C4  1 
HETATM 1654 C C5  . SDK B 2 .   ? 2.463   37.317 62.295 1.00 15.00 ? 300 SDK A C5  1 
HETATM 1655 C C6  . SDK B 2 .   ? 1.274   36.603 62.148 1.00 15.00 ? 300 SDK A C6  1 
HETATM 1656 C C7  . SDK B 2 .   ? 3.829   39.195 63.276 1.00 15.00 ? 300 SDK A C7  1 
HETATM 1657 O O8  . SDK B 2 .   ? 4.415   39.079 64.586 1.00 15.00 ? 300 SDK A O8  1 
HETATM 1658 C C9  . SDK B 2 .   ? 5.752   38.656 64.619 1.00 15.00 ? 300 SDK A C9  1 
HETATM 1659 O O10 . SDK B 2 .   ? 6.619   39.264 63.982 1.00 15.00 ? 300 SDK A O10 1 
HETATM 1660 C C11 . SDK B 2 .   ? 7.300   36.903 65.495 1.00 15.00 ? 300 SDK A C11 1 
HETATM 1661 C C12 . SDK B 2 .   ? 8.225   37.188 64.304 1.00 15.00 ? 300 SDK A C12 1 
HETATM 1662 C C13 . SDK B 2 .   ? 8.263   36.155 63.175 1.00 15.00 ? 300 SDK A C13 1 
HETATM 1663 C C14 . SDK B 2 .   ? 9.565   36.310 62.407 1.00 15.00 ? 300 SDK A C14 1 
HETATM 1664 C C15 . SDK B 2 .   ? 8.100   34.713 63.693 1.00 15.00 ? 300 SDK A C15 1 
HETATM 1665 C C16 . SDK B 2 .   ? 8.102   36.995 66.795 1.00 15.00 ? 300 SDK A C16 1 
HETATM 1666 O O17 . SDK B 2 .   ? 8.474   35.956 67.354 1.00 15.00 ? 300 SDK A O17 1 
HETATM 1667 N N18 . SDK B 2 .   ? 8.410   38.196 67.287 1.00 15.00 ? 300 SDK A N18 1 
HETATM 1668 C C19 . SDK B 2 .   ? 9.204   38.394 68.511 1.00 15.00 ? 300 SDK A C19 1 
HETATM 1669 N N20 . SDK B 2 .   ? 5.986   37.562 65.351 1.00 15.00 ? 300 SDK A N20 1 
HETATM 1670 C C21 . SDK B 2 .   ? 8.486   39.168 69.595 1.00 15.00 ? 300 SDK A C21 1 
HETATM 1671 O O22 . SDK B 2 .   ? 7.604   39.863 69.099 1.00 15.00 ? 300 SDK A O22 1 
HETATM 1672 C C23 . SDK B 2 .   ? 18.574  35.216 73.806 1.00 15.00 ? 300 SDK A C23 1 
HETATM 1673 C C24 . SDK B 2 .   ? 17.211  35.385 73.580 1.00 15.00 ? 300 SDK A C24 1 
HETATM 1674 C C25 . SDK B 2 .   ? 16.780  36.393 72.734 1.00 15.00 ? 300 SDK A C25 1 
HETATM 1675 C C26 . SDK B 2 .   ? 17.688  37.248 72.100 1.00 15.00 ? 300 SDK A C26 1 
HETATM 1676 C C27 . SDK B 2 .   ? 19.047  37.074 72.335 1.00 15.00 ? 300 SDK A C27 1 
HETATM 1677 C C28 . SDK B 2 .   ? 19.498  36.065 73.182 1.00 15.00 ? 300 SDK A C28 1 
HETATM 1678 C C29 . SDK B 2 .   ? 17.210  38.324 71.159 1.00 15.00 ? 300 SDK A C29 1 
HETATM 1679 O O30 . SDK B 2 .   ? 16.137  38.057 70.241 1.00 15.00 ? 300 SDK A O30 1 
HETATM 1680 C C31 . SDK B 2 .   ? 14.829  37.780 70.706 1.00 15.00 ? 300 SDK A C31 1 
HETATM 1681 O O32 . SDK B 2 .   ? 14.369  36.636 70.706 1.00 15.00 ? 300 SDK A O32 1 
HETATM 1682 C C33 . SDK B 2 .   ? 12.740  38.598 71.650 1.00 15.00 ? 300 SDK A C33 1 
HETATM 1683 C C34 . SDK B 2 .   ? 12.676  38.712 73.171 1.00 15.00 ? 300 SDK A C34 1 
HETATM 1684 C C35 . SDK B 2 .   ? 12.841  37.432 73.970 1.00 15.00 ? 300 SDK A C35 1 
HETATM 1685 C C36 . SDK B 2 .   ? 12.557  36.209 73.097 1.00 15.00 ? 300 SDK A C36 1 
HETATM 1686 C C37 . SDK B 2 .   ? 14.256  37.403 74.485 1.00 15.00 ? 300 SDK A C37 1 
HETATM 1687 C C38 . SDK B 2 .   ? 11.771  39.592 71.035 1.00 15.00 ? 300 SDK A C38 1 
HETATM 1688 O O39 . SDK B 2 .   ? 12.168  40.691 70.663 1.00 15.00 ? 300 SDK A O39 1 
HETATM 1689 N N40 . SDK B 2 .   ? 10.502  39.203 70.936 1.00 15.00 ? 300 SDK A N40 1 
HETATM 1690 C C41 . SDK B 2 .   ? 9.430   40.021 70.368 1.00 15.00 ? 300 SDK A C41 1 
HETATM 1691 N N42 . SDK B 2 .   ? 14.107  38.804 71.159 1.00 15.00 ? 300 SDK A N42 1 
HETATM 1692 O O   . HOH C 3 .   ? -8.463  50.955 86.187 1.00 15.00 ? 301 HOH A O   1 
HETATM 1693 O O   . HOH C 3 .   ? 5.457   48.164 94.466 1.00 15.00 ? 302 HOH A O   1 
HETATM 1694 O O   . HOH C 3 .   ? -2.570  36.821 73.465 1.00 15.00 ? 303 HOH A O   1 
HETATM 1695 O O   . HOH C 3 .   ? 1.413   36.013 75.472 1.00 15.00 ? 304 HOH A O   1 
HETATM 1696 O O   . HOH C 3 .   ? 7.840   49.783 64.394 1.00 15.00 ? 305 HOH A O   1 
HETATM 1697 O O   . HOH C 3 .   ? 4.544   58.201 67.197 1.00 15.00 ? 306 HOH A O   1 
HETATM 1698 O O   . HOH C 3 .   ? -2.749  35.834 82.344 1.00 15.00 ? 307 HOH A O   1 
HETATM 1699 O O   . HOH C 3 .   ? 17.784  41.534 83.209 1.00 15.00 ? 308 HOH A O   1 
HETATM 1700 O O   . HOH C 3 .   ? 6.720   47.270 63.601 1.00 15.00 ? 309 HOH A O   1 
HETATM 1701 O O   . HOH C 3 .   ? 12.217  36.307 81.103 1.00 15.00 ? 310 HOH A O   1 
HETATM 1702 O O   . HOH C 3 .   ? 3.497   57.069 62.220 1.00 15.00 ? 311 HOH A O   1 
HETATM 1703 O O   . HOH C 3 .   ? 10.047  53.049 70.769 1.00 15.00 ? 312 HOH A O   1 
HETATM 1704 O O   . HOH C 3 .   ? 5.463   13.395 78.440 1.00 15.00 ? 313 HOH A O   1 
HETATM 1705 O O   . HOH C 3 .   ? 6.076   15.926 86.703 1.00 15.00 ? 314 HOH A O   1 
HETATM 1706 O O   . HOH C 3 .   ? -8.146  34.250 76.393 1.00 15.00 ? 315 HOH A O   1 
HETATM 1707 O O   . HOH C 3 .   ? 11.741  17.790 81.600 1.00 15.00 ? 316 HOH A O   1 
HETATM 1708 O O   . HOH C 3 .   ? 19.786  38.244 84.239 1.00 15.00 ? 317 HOH A O   1 
HETATM 1709 O O   . HOH C 3 .   ? 11.232  12.625 78.369 1.00 15.00 ? 318 HOH A O   1 
HETATM 1710 O O   . HOH C 3 .   ? 3.497   36.449 73.298 1.00 15.00 ? 319 HOH A O   1 
HETATM 1711 O O   . HOH C 3 .   ? 13.223  38.391 79.853 1.00 15.00 ? 320 HOH A O   1 
HETATM 1712 O O   . HOH C 3 .   ? -7.646  48.416 72.505 1.00 15.00 ? 321 HOH A O   1 
HETATM 1713 O O   . HOH C 3 .   ? -4.938  45.682 85.018 1.00 15.00 ? 322 HOH A O   1 
HETATM 1714 O O   . HOH C 3 .   ? -6.960  47.838 89.651 1.00 15.00 ? 323 HOH A O   1 
HETATM 1715 O O   . HOH C 3 .   ? -2.034  21.153 64.175 1.00 15.00 ? 324 HOH A O   1 
HETATM 1716 O O   . HOH C 3 .   ? 7.632   21.294 71.429 1.00 15.00 ? 325 HOH A O   1 
HETATM 1717 O O   . HOH C 3 .   ? 3.626   15.441 86.026 1.00 15.00 ? 326 HOH A O   1 
HETATM 1718 O O   . HOH C 3 .   ? -4.052  43.250 60.104 1.00 15.00 ? 327 HOH A O   1 
HETATM 1719 O O   . HOH C 3 .   ? -10.144 27.624 77.113 1.00 15.00 ? 328 HOH A O   1 
HETATM 1720 O O   . HOH C 3 .   ? -4.432  43.776 64.350 1.00 15.00 ? 329 HOH A O   1 
HETATM 1721 O O   . HOH C 3 .   ? 0.415   35.957 86.417 1.00 15.00 ? 330 HOH A O   1 
HETATM 1722 O O   . HOH C 3 .   ? -11.503 29.309 93.038 1.00 15.00 ? 331 HOH A O   1 
HETATM 1723 O O   . HOH C 3 .   ? -0.556  59.714 77.777 1.00 15.00 ? 332 HOH A O   1 
HETATM 1724 O O   . HOH C 3 .   ? 9.931   58.621 74.469 1.00 15.00 ? 333 HOH A O   1 
HETATM 1725 O O   . HOH C 3 .   ? 8.188   60.865 74.865 1.00 15.00 ? 334 HOH A O   1 
HETATM 1726 O O   . HOH C 3 .   ? 15.538  31.570 83.271 1.00 15.00 ? 335 HOH A O   1 
HETATM 1727 O O   . HOH C 3 .   ? -2.106  28.363 63.326 1.00 15.00 ? 336 HOH A O   1 
HETATM 1728 O O   . HOH C 3 .   ? 12.409  20.236 70.765 1.00 15.00 ? 337 HOH A O   1 
HETATM 1729 O O   . HOH C 3 .   ? 2.237   17.328 63.878 1.00 15.00 ? 338 HOH A O   1 
HETATM 1730 O O   . HOH C 3 .   ? 7.099   18.767 84.138 1.00 15.00 ? 339 HOH A O   1 
HETATM 1731 O O   . HOH C 3 .   ? -10.463 34.026 81.839 1.00 15.00 ? 340 HOH A O   1 
HETATM 1732 O O   . HOH C 3 .   ? -2.364  33.818 69.065 1.00 15.00 ? 341 HOH A O   1 
HETATM 1733 O O   . HOH C 3 .   ? -8.411  28.683 66.185 1.00 15.00 ? 342 HOH A O   1 
HETATM 1734 O O   . HOH C 3 .   ? -6.928  39.341 68.199 1.00 15.00 ? 343 HOH A O   1 
HETATM 1735 O O   . HOH C 3 .   ? -7.419  38.567 64.822 1.00 15.00 ? 344 HOH A O   1 
HETATM 1736 O O   . HOH C 3 .   ? 1.518   46.542 63.461 1.00 15.00 ? 345 HOH A O   1 
HETATM 1737 O O   . HOH C 3 .   ? -3.819  37.374 80.041 1.00 15.00 ? 346 HOH A O   1 
HETATM 1738 O O   . HOH C 3 .   ? 11.680  29.678 94.491 1.00 15.00 ? 347 HOH A O   1 
HETATM 1739 O O   . HOH C 3 .   ? 7.151   56.262 82.030 1.00 15.00 ? 348 HOH A O   1 
HETATM 1740 O O   . HOH C 3 .   ? 12.520  57.119 77.721 1.00 15.00 ? 349 HOH A O   1 
HETATM 1741 O O   . HOH C 3 .   ? 15.090  56.069 85.206 1.00 15.00 ? 350 HOH A O   1 
HETATM 1742 O O   . HOH C 3 .   ? 16.420  38.039 82.452 1.00 15.00 ? 351 HOH A O   1 
HETATM 1743 O O   . HOH C 3 .   ? 19.790  33.956 93.621 1.00 15.00 ? 352 HOH A O   1 
HETATM 1744 O O   . HOH C 3 .   ? 18.006  49.790 84.471 1.00 15.00 ? 353 HOH A O   1 
HETATM 1745 O O   . HOH C 3 .   ? 13.290  52.487 81.157 1.00 15.00 ? 354 HOH A O   1 
HETATM 1746 O O   . HOH C 3 .   ? 9.645   49.600 93.161 1.00 15.00 ? 355 HOH A O   1 
HETATM 1747 O O   . HOH C 3 .   ? 13.903  41.139 91.017 1.00 15.00 ? 356 HOH A O   1 
HETATM 1748 O O   . HOH C 3 .   ? -10.098 46.353 94.744 1.00 15.00 ? 357 HOH A O   1 
HETATM 1749 O O   . HOH C 3 .   ? 10.414  56.653 65.595 1.00 15.00 ? 358 HOH A O   1 
HETATM 1750 O O   . HOH C 3 .   ? 14.848  55.863 75.429 1.00 15.00 ? 359 HOH A O   1 
HETATM 1751 O O   . HOH C 3 .   ? 14.082  40.466 67.532 1.00 15.00 ? 360 HOH A O   1 
HETATM 1752 O O   . HOH C 3 .   ? 9.920   27.027 66.430 1.00 15.00 ? 361 HOH A O   1 
HETATM 1753 O O   . HOH C 3 .   ? 14.989  26.592 64.797 1.00 15.00 ? 362 HOH A O   1 
HETATM 1754 O O   . HOH C 3 .   ? 14.226  20.328 83.301 1.00 15.00 ? 363 HOH A O   1 
HETATM 1755 O O   . HOH C 3 .   ? 22.471  28.519 66.518 1.00 15.00 ? 364 HOH A O   1 
HETATM 1756 O O   . HOH C 3 .   ? 13.556  12.683 72.666 1.00 15.00 ? 365 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   ASP 3   3   3   ASP ASP A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   ASP 6   6   6   ASP ASP A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   ARG 8   8   8   ARG ARG A . n 
A 1 9   LYS 9   9   9   LYS LYS A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  GLY 11  11  11  GLY GLY A . n 
A 1 12  TYR 12  12  12  TYR TYR A . n 
A 1 13  VAL 13  13  13  VAL VAL A . n 
A 1 14  THR 14  14  14  THR THR A . n 
A 1 15  PRO 15  15  15  PRO PRO A . n 
A 1 16  VAL 16  16  16  VAL VAL A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  ASN 18  18  18  ASN ASN A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  CYS 22  22  22  CYS CYS A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  CYS 25  25  25  CYS CYS A . n 
A 1 26  TRP 26  26  26  TRP TRP A . n 
A 1 27  ALA 27  27  27  ALA ALA A . n 
A 1 28  PHE 28  28  28  PHE PHE A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  LEU 34  34  34  LEU LEU A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  GLY 36  36  36  GLY GLY A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LYS 40  40  40  LYS LYS A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LEU 46  46  46  LEU LEU A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLN 51  51  51  GLN GLN A . n 
A 1 52  ASN 52  52  52  ASN ASN A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  CYS 56  56  56  CYS CYS A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLY 62  62  62  GLY GLY A . n 
A 1 63  CYS 63  63  63  CYS CYS A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  GLY 66  66  66  GLY GLY A . n 
A 1 67  TYR 67  67  67  TYR TYR A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  ASN 70  70  70  ASN ASN A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  PHE 72  72  72  PHE PHE A . n 
A 1 73  GLN 73  73  73  GLN GLN A . n 
A 1 74  TYR 74  74  74  TYR TYR A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  GLN 76  76  76  GLN GLN A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  ARG 79  79  79  ARG ARG A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  ALA 86  86  86  ALA ALA A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  VAL 90  90  90  VAL VAL A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  GLN 92  92  92  GLN GLN A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  SER 95  95  95  SER SER A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ARG 108 108 108 ARG ARG A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ILE 113 113 113 ILE ILE A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 GLU 118 118 118 GLU GLU A . n 
A 1 119 LYS 119 119 119 LYS LYS A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ARG 123 123 123 ARG ARG A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ARG 127 127 127 ARG ARG A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 SER 138 138 138 SER SER A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 THR 140 140 140 THR THR A . n 
A 1 141 SER 141 141 141 SER SER A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PHE 144 144 144 PHE PHE A . n 
A 1 145 TYR 145 145 145 TYR TYR A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 SER 157 157 157 SER SER A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ALA 166 166 166 ALA ALA A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 GLN 172 172 172 GLN GLN A . n 
A 1 173 LYS 173 173 173 LYS LYS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 TRP 184 184 184 TRP TRP A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 TRP 188 188 188 TRP TRP A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASN 190 190 190 ASN ASN A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 ILE 194 194 194 ILE ILE A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 MET 196 196 196 MET MET A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 LYS 200 200 200 LYS LYS A . n 
A 1 201 ASN 201 201 201 ASN ASN A . n 
A 1 202 ASN 202 202 202 ASN ASN A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 CYS 204 204 204 CYS CYS A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 MET 215 215 215 MET MET A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SDK 1  300 300 SDK SDK A . 
C 3 HOH 1  301 301 HOH HOH A . 
C 3 HOH 2  302 302 HOH HOH A . 
C 3 HOH 3  303 303 HOH HOH A . 
C 3 HOH 4  304 304 HOH HOH A . 
C 3 HOH 5  305 305 HOH HOH A . 
C 3 HOH 6  306 306 HOH HOH A . 
C 3 HOH 7  307 307 HOH HOH A . 
C 3 HOH 8  308 308 HOH HOH A . 
C 3 HOH 9  309 309 HOH HOH A . 
C 3 HOH 10 310 310 HOH HOH A . 
C 3 HOH 11 311 311 HOH HOH A . 
C 3 HOH 12 312 312 HOH HOH A . 
C 3 HOH 13 313 313 HOH HOH A . 
C 3 HOH 14 314 314 HOH HOH A . 
C 3 HOH 15 315 315 HOH HOH A . 
C 3 HOH 16 316 316 HOH HOH A . 
C 3 HOH 17 317 317 HOH HOH A . 
C 3 HOH 18 318 318 HOH HOH A . 
C 3 HOH 19 319 319 HOH HOH A . 
C 3 HOH 20 320 320 HOH HOH A . 
C 3 HOH 21 321 321 HOH HOH A . 
C 3 HOH 22 322 322 HOH HOH A . 
C 3 HOH 23 323 323 HOH HOH A . 
C 3 HOH 24 324 324 HOH HOH A . 
C 3 HOH 25 325 325 HOH HOH A . 
C 3 HOH 26 326 326 HOH HOH A . 
C 3 HOH 27 327 327 HOH HOH A . 
C 3 HOH 28 328 328 HOH HOH A . 
C 3 HOH 29 329 329 HOH HOH A . 
C 3 HOH 30 330 330 HOH HOH A . 
C 3 HOH 31 331 331 HOH HOH A . 
C 3 HOH 32 332 332 HOH HOH A . 
C 3 HOH 33 333 333 HOH HOH A . 
C 3 HOH 34 334 334 HOH HOH A . 
C 3 HOH 35 335 335 HOH HOH A . 
C 3 HOH 36 336 336 HOH HOH A . 
C 3 HOH 37 337 337 HOH HOH A . 
C 3 HOH 38 338 338 HOH HOH A . 
C 3 HOH 39 339 339 HOH HOH A . 
C 3 HOH 40 340 340 HOH HOH A . 
C 3 HOH 41 341 341 HOH HOH A . 
C 3 HOH 42 342 342 HOH HOH A . 
C 3 HOH 43 343 343 HOH HOH A . 
C 3 HOH 44 344 344 HOH HOH A . 
C 3 HOH 45 345 345 HOH HOH A . 
C 3 HOH 46 346 346 HOH HOH A . 
C 3 HOH 47 347 347 HOH HOH A . 
C 3 HOH 48 348 348 HOH HOH A . 
C 3 HOH 49 349 349 HOH HOH A . 
C 3 HOH 50 350 350 HOH HOH A . 
C 3 HOH 51 351 351 HOH HOH A . 
C 3 HOH 52 352 352 HOH HOH A . 
C 3 HOH 53 353 353 HOH HOH A . 
C 3 HOH 54 354 354 HOH HOH A . 
C 3 HOH 55 355 355 HOH HOH A . 
C 3 HOH 56 356 356 HOH HOH A . 
C 3 HOH 57 357 357 HOH HOH A . 
C 3 HOH 58 358 358 HOH HOH A . 
C 3 HOH 59 359 359 HOH HOH A . 
C 3 HOH 60 360 360 HOH HOH A . 
C 3 HOH 61 361 361 HOH HOH A . 
C 3 HOH 62 362 362 HOH HOH A . 
C 3 HOH 63 363 363 HOH HOH A . 
C 3 HOH 64 364 364 HOH HOH A . 
C 3 HOH 65 365 365 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-10-14 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source        
2 4 'Structure model' pdbx_database_status 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_source.source'              
2 4 'Structure model' '_pdbx_database_status.process_site' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XENGEN 'data collection' .   ? 1 
XENGEN 'data reduction'  .   ? 2 
X-PLOR 'model building'  3.1 ? 3 
X-PLOR refinement        3.1 ? 4 
XENGEN 'data scaling'    .   ? 5 
X-PLOR phasing           3.1 ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 87  ? ? -156.92 72.39  
2  1 LEU A 139 ? ? -177.22 125.64 
3  1 SER A 146 ? ? -140.01 -30.15 
4  1 LYS A 147 ? ? -171.77 149.70 
5  1 GLU A 153 ? ? -54.32  -5.28  
6  1 ASN A 159 ? ? -107.69 77.09  
7  1 LYS A 173 ? ? -165.14 93.69  
8  1 TRP A 184 ? ? -117.67 55.97  
9  1 ASN A 199 ? ? 86.30   2.17   
10 1 ASN A 201 ? ? 48.04   84.92  
11 1 ASN A 202 ? ? 30.31   55.96  
12 1 CYS A 204 ? ? 59.28   11.26  
13 1 LEU A 209 ? ? -148.62 45.14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,3-BIS[[N-[(PHENYLMETHOXY)CARBONYL]-L-LEUCYL]AMINO]-2-PROPANONE' SDK 
3 water                                                              HOH 
#