data_1AU7
# 
_entry.id   1AU7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1AU7         pdb_00001au7 10.2210/pdb1au7/pdb 
RCSB  PDR034       ?            ?                   
WWPDB D_1000171263 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1AU7 
_pdbx_database_status.recvd_initial_deposition_date   1997-09-12 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    NDB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jacobson, E.M.'   1 
'Li, P.'           2 
'Leon-Del-Rio, A.' 3 
'Rosenfeld, M.G.'  4 
'Aggarwal, A.K.'   5 
# 
_citation.id                        primary 
_citation.title                     
'Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility.' 
_citation.journal_abbrev            'Genes Dev.' 
_citation.journal_volume            11 
_citation.page_first                198 
_citation.page_last                 212 
_citation.year                      1997 
_citation.journal_id_ASTM           GEDEEP 
_citation.country                   US 
_citation.journal_id_ISSN           0890-9369 
_citation.journal_id_CSD            2056 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9009203 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Jacobson, E.M.'   1 ? 
primary 'Li, P.'           2 ? 
primary 'Leon-del-Rio, A.' 3 ? 
primary 'Rosenfeld, M.G.'  4 ? 
primary 'Aggarwal, A.K.'   5 ? 
# 
_cell.entry_id           1AU7 
_cell.length_a           42.500 
_cell.length_b           50.100 
_cell.length_c           55.800 
_cell.angle_alpha        76.70 
_cell.angle_beta         79.30 
_cell.angle_gamma        67.20 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1AU7 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'CONSENSUS DNA 25-MER'                                                                     7722.009  1   ? ? ? ? 
2 polymer syn 
;DNA (5'-D(*CP*TP*TP*CP*CP*TP*CP*AP*TP*GP*TP*AP*TP*AP*TP*AP*C P*AP*TP*GP*AP*GP* GP*A)-3')
;
7343.766  1   ? ?          ? ? 
3 polymer man 'PROTEIN PIT-1'                                                                            17003.570 2   ? 
'E5G, I6M' ? ? 
4 water   nat water                                                                                      18.015    176 ? ? ? ? 
# 
_entity_keywords.entity_id   3 
_entity_keywords.text        'MUTATIONS E5G, I6M' 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        GHF-1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DT)(DC)(DC)(DT)(DC)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DG)(DA)(DG)
(DG)(DA)(DA)(DG)(DG)
;
TCCTCATGTATATACATGAGGAAGG C   ? 
2 polydeoxyribonucleotide no no 
;(DC)(DT)(DT)(DC)(DC)(DT)(DC)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DG)
(DA)(DG)(DG)(DA)
;
CTTCCTCATGTATATACATGAGGA D   ? 
3 'polypeptide(L)'        no no 
;GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEK
VGANERKRKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
;
;GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEK
VGANERKRKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQREKRVK
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DC  n 
1 3   DC  n 
1 4   DT  n 
1 5   DC  n 
1 6   DA  n 
1 7   DT  n 
1 8   DG  n 
1 9   DT  n 
1 10  DA  n 
1 11  DT  n 
1 12  DA  n 
1 13  DT  n 
1 14  DA  n 
1 15  DC  n 
1 16  DA  n 
1 17  DT  n 
1 18  DG  n 
1 19  DA  n 
1 20  DG  n 
1 21  DG  n 
1 22  DA  n 
1 23  DA  n 
1 24  DG  n 
1 25  DG  n 
2 1   DC  n 
2 2   DT  n 
2 3   DT  n 
2 4   DC  n 
2 5   DC  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DT  n 
2 10  DG  n 
2 11  DT  n 
2 12  DA  n 
2 13  DT  n 
2 14  DA  n 
2 15  DT  n 
2 16  DA  n 
2 17  DC  n 
2 18  DA  n 
2 19  DT  n 
2 20  DG  n 
2 21  DA  n 
2 22  DG  n 
2 23  DG  n 
2 24  DA  n 
3 1   GLY n 
3 2   MET n 
3 3   ARG n 
3 4   ALA n 
3 5   LEU n 
3 6   GLU n 
3 7   GLN n 
3 8   PHE n 
3 9   ALA n 
3 10  ASN n 
3 11  GLU n 
3 12  PHE n 
3 13  LYS n 
3 14  VAL n 
3 15  ARG n 
3 16  ARG n 
3 17  ILE n 
3 18  LYS n 
3 19  LEU n 
3 20  GLY n 
3 21  TYR n 
3 22  THR n 
3 23  GLN n 
3 24  THR n 
3 25  ASN n 
3 26  VAL n 
3 27  GLY n 
3 28  GLU n 
3 29  ALA n 
3 30  LEU n 
3 31  ALA n 
3 32  ALA n 
3 33  VAL n 
3 34  HIS n 
3 35  GLY n 
3 36  SER n 
3 37  GLU n 
3 38  PHE n 
3 39  SER n 
3 40  GLN n 
3 41  THR n 
3 42  THR n 
3 43  ILE n 
3 44  CYS n 
3 45  ARG n 
3 46  PHE n 
3 47  GLU n 
3 48  ASN n 
3 49  LEU n 
3 50  GLN n 
3 51  LEU n 
3 52  SER n 
3 53  PHE n 
3 54  LYS n 
3 55  ASN n 
3 56  ALA n 
3 57  CYS n 
3 58  LYS n 
3 59  LEU n 
3 60  LYS n 
3 61  ALA n 
3 62  ILE n 
3 63  LEU n 
3 64  SER n 
3 65  LYS n 
3 66  TRP n 
3 67  LEU n 
3 68  GLU n 
3 69  GLU n 
3 70  ALA n 
3 71  GLU n 
3 72  GLN n 
3 73  VAL n 
3 74  GLY n 
3 75  ALA n 
3 76  LEU n 
3 77  TYR n 
3 78  ASN n 
3 79  GLU n 
3 80  LYS n 
3 81  VAL n 
3 82  GLY n 
3 83  ALA n 
3 84  ASN n 
3 85  GLU n 
3 86  ARG n 
3 87  LYS n 
3 88  ARG n 
3 89  LYS n 
3 90  ARG n 
3 91  ARG n 
3 92  THR n 
3 93  THR n 
3 94  ILE n 
3 95  SER n 
3 96  ILE n 
3 97  ALA n 
3 98  ALA n 
3 99  LYS n 
3 100 ASP n 
3 101 ALA n 
3 102 LEU n 
3 103 GLU n 
3 104 ARG n 
3 105 HIS n 
3 106 PHE n 
3 107 GLY n 
3 108 GLU n 
3 109 HIS n 
3 110 SER n 
3 111 LYS n 
3 112 PRO n 
3 113 SER n 
3 114 SER n 
3 115 GLN n 
3 116 GLU n 
3 117 ILE n 
3 118 MET n 
3 119 ARG n 
3 120 MET n 
3 121 ALA n 
3 122 GLU n 
3 123 GLU n 
3 124 LEU n 
3 125 ASN n 
3 126 LEU n 
3 127 GLU n 
3 128 LYS n 
3 129 GLU n 
3 130 VAL n 
3 131 VAL n 
3 132 ARG n 
3 133 VAL n 
3 134 TRP n 
3 135 PHE n 
3 136 CYS n 
3 137 ASN n 
3 138 ARG n 
3 139 ARG n 
3 140 GLN n 
3 141 ARG n 
3 142 GLU n 
3 143 LYS n 
3 144 ARG n 
3 145 VAL n 
3 146 LYS n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 PIT-1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    SPRAGUE-DAWLEY 
_entity_src_gen.gene_src_tissue                    ENDOCRINE 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                'PITUITARY GLAND' 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 'LACTOTROPES, SOMATOTROPES' 
_entity_src_gen.pdbx_gene_src_cellular_location    NUCLEAR 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 PIT-1 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    'INCLUSION BODIES' 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       14B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP PIT1_RAT P10037 3 130 ? ? 
2 PDB 1AU7     1AU7   1 ?   ? ? 
3 PDB 1AU7     1AU7   2 ?   ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1AU7 A 1 ? 146 ? P10037 130 ? 273 ? 5   160 
2 1 1AU7 B 1 ? 146 ? P10037 130 ? 273 ? 5   160 
3 2 1AU7 C 1 ? 25  ? 1AU7   449 ? 473 ? 449 473 
4 3 1AU7 D 1 ? 24  ? 1AU7   475 ? 498 ? 475 498 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1AU7 GLY A 1  ? UNP P10037 GLU 128 'engineered mutation' 5   1 
1 1AU7 MET A 2  ? UNP P10037 ILE 129 'engineered mutation' 6   2 
1 1AU7 ALA A 4  ? UNP P10037 GLU 131 conflict              8   3 
1 1AU7 ILE A 96 ? UNP P10037 VAL 223 conflict              110 4 
2 1AU7 GLY B 1  ? UNP P10037 GLU 128 'engineered mutation' 5   5 
2 1AU7 MET B 2  ? UNP P10037 ILE 129 'engineered mutation' 6   6 
2 1AU7 ALA B 4  ? UNP P10037 GLU 131 conflict              8   7 
2 1AU7 ILE B 96 ? UNP P10037 VAL 223 conflict              110 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1AU7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   33.0000 
_exptl_crystal.description           'BROMO-URACIL MAD EXPERIMENT' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.00 
_exptl_crystal_grow.pdbx_details    
;A 28 BP DNA DUPLEX (10MG/ML) WAS ADDED TO THE PROTEIN IN A 1:2 MOLAR RATIO. CRYSTALS WERE GROWN BY VAPOR DIFFUSION USING HANGING DROPS OF 1 UL. OF PROTEIN/DNA SOLUTION MIXED 1 UL. OF RESERVOIR SOLUTION. THE BEST CRYSTALS WERE OBTAINED WITH RESERVOIRS CONTAINING 400-600 MM PHOSPHORIC ACID ADJUSTED TO PH 4.0 - 4.3 WITH TRIETHYLAMINE., pH 4.00, vapor diffusion - hanging drop
;
_exptl_crystal_grow.pdbx_pH_range   4.0-4.3 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 'PHOSPHORIC ACID' ? ? ? 
1 2 1 TRIETHYLAMINE     ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           111.00 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1994-08 
_diffrn_detector.details                'DUAL SLITS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SILICON 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1AU7 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.000 
_reflns.d_resolution_high            2.700 
_reflns.number_obs                   10021 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         87.200 
_reflns.pdbx_Rmerge_I_obs            0.0580000 
_reflns.pdbx_Rsym_value              5.8000000 
_reflns.pdbx_netI_over_sigmaI        18.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.500 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.700 
_reflns_shell.d_res_low              2.800 
_reflns_shell.percent_possible_all   73.00 
_reflns_shell.Rmerge_I_obs           0.1890000 
_reflns_shell.pdbx_Rsym_value        18.9000000 
_reflns_shell.meanI_over_sigI_obs    7.000 
_reflns_shell.pdbx_redundancy        2.200 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1AU7 
_refine.ls_number_reflns_obs                     14575 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             6.000 
_refine.ls_d_res_high                            2.300 
_refine.ls_percent_reflns_obs                    84.700 
_refine.ls_R_factor_R_work                       0.2300000 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_free                       0.3020000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      NONE 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2653 
_refine_hist.pdbx_number_atoms_nucleic_acid   1094 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             528 
_refine_hist.number_atoms_total               4275 
_refine_hist.d_res_high                       2.300 
_refine_hist.d_res_low                        6.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.71  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct_ncs_oper.id             1 
_struct_ncs_oper.code           given 
_struct_ncs_oper.details        ? 
_struct_ncs_oper.matrix[1][1]   0.388765 
_struct_ncs_oper.matrix[1][2]   -0.637872 
_struct_ncs_oper.matrix[1][3]   0.664816 
_struct_ncs_oper.matrix[2][1]   -0.664442 
_struct_ncs_oper.matrix[2][2]   -0.693985 
_struct_ncs_oper.matrix[2][3]   -0.277312 
_struct_ncs_oper.matrix[3][1]   0.638262 
_struct_ncs_oper.matrix[3][2]   -0.333923 
_struct_ncs_oper.matrix[3][3]   -0.693626 
_struct_ncs_oper.vector[1]      -1.92157 
_struct_ncs_oper.vector[2]      58.74348 
_struct_ncs_oper.vector[3]      62.81211 
# 
_struct.entry_id                  1AU7 
_struct.title                     'PIT-1 MUTANT/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1AU7 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
'COMPLEX (DNA-BINDING PROTEIN-DNA), PITUITARY, CPHD, POU DOMAIN, TRANSCRIPTION FACTOR, TRANSCRIPTION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET C 2   ? LEU C 19  ? MET A 6   LEU A 23  1 ? 18 
HELX_P HELX_P2  2  GLN C 23  ? ALA C 32  ? GLN A 27  ALA A 36  1 ? 10 
HELX_P HELX_P3  3  GLN C 40  ? GLU C 47  ? GLN A 44  GLU A 51  1 ? 8  
HELX_P HELX_P4  4  PHE C 53  ? GLU C 69  ? PHE A 57  GLU A 73  1 ? 17 
HELX_P HELX_P5  5  ILE C 96  ? GLU C 108 ? ILE A 110 GLU A 122 1 ? 13 
HELX_P HELX_P6  6  SER C 114 ? LEU C 124 ? SER A 128 LEU A 138 1 ? 11 
HELX_P HELX_P7  7  LYS C 128 ? LYS C 143 ? LYS A 142 LYS A 157 1 ? 16 
HELX_P HELX_P8  8  MET D 2   ? LYS D 18  ? MET B 6   LYS B 22  1 ? 17 
HELX_P HELX_P9  9  GLN D 23  ? ALA D 32  ? GLN B 27  ALA B 36  1 ? 10 
HELX_P HELX_P10 10 GLN D 40  ? ASN D 48  ? GLN B 44  ASN B 52  1 ? 9  
HELX_P HELX_P11 11 PHE D 53  ? GLU D 69  ? PHE B 57  GLU B 73  1 ? 17 
HELX_P HELX_P12 12 LYS D 99  ? PHE D 106 ? LYS B 113 PHE B 120 1 ? 8  
HELX_P HELX_P13 13 SER D 114 ? LEU D 124 ? SER B 128 LEU B 138 1 ? 11 
HELX_P HELX_P14 14 LYS D 128 ? GLU D 142 ? LYS B 142 GLU B 156 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DT 1  O4 ? ? ? 1_555 B DA 24 N6 ? ? C DT 449 D DA 498 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
hydrog2  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 23 N1 ? ? C DC 450 D DG 497 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 23 O6 ? ? C DC 450 D DG 497 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 23 N2 ? ? C DC 450 D DG 497 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DC 3  N3 ? ? ? 1_555 B DG 22 N1 ? ? C DC 451 D DG 496 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DC 3  N4 ? ? ? 1_555 B DG 22 O6 ? ? C DC 451 D DG 496 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DC 3  O2 ? ? ? 1_555 B DG 22 N2 ? ? C DC 451 D DG 496 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 21 N1 ? ? C DT 452 D DA 495 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 21 N6 ? ? C DT 452 D DA 495 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG 20 N1 ? ? C DC 453 D DG 494 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG 20 O6 ? ? C DC 453 D DG 494 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG 20 N2 ? ? C DC 453 D DG 494 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT 19 N3 ? ? C DA 454 D DT 493 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT 19 O4 ? ? C DA 454 D DT 493 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DT 7  N3 ? ? ? 1_555 B DA 18 N1 ? ? C DT 455 D DA 492 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DT 7  O4 ? ? ? 1_555 B DA 18 N6 ? ? C DT 455 D DA 492 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 17 N3 ? ? C DG 456 D DC 491 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 17 O2 ? ? C DG 456 D DC 491 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 17 N4 ? ? C DG 456 D DC 491 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DT 9  N3 ? ? ? 1_555 B DA 16 N1 ? ? C DT 457 D DA 490 1_555 ? ? ? ? ? ? 'DT-DA PAIR' ? ? ? 
hydrog21 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 15 N3 ? ? C DA 458 D DT 489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 15 O4 ? ? C DA 458 D DT 489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 14 N1 ? ? C DT 459 D DA 488 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 14 N6 ? ? C DT 459 D DA 488 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 13 N3 ? ? C DA 460 D DT 487 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 13 O4 ? ? C DA 460 D DT 487 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DT 13 N3 ? ? ? 1_555 B DA 12 N1 ? ? C DT 461 D DA 486 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DT 13 O4 ? ? ? 1_555 B DA 12 N6 ? ? C DT 461 D DA 486 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 11 N3 ? ? C DA 462 D DT 485 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 11 O4 ? ? C DA 462 D DT 485 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DC 15 N3 ? ? ? 1_555 B DG 10 N1 ? ? C DC 463 D DG 484 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DC 15 N4 ? ? ? 1_555 B DG 10 O6 ? ? C DC 463 D DG 484 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DC 15 O2 ? ? ? 1_555 B DG 10 N2 ? ? C DC 463 D DG 484 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 9  N3 ? ? C DA 464 D DT 483 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? ? 
hydrog35 hydrog ? ? A DG 18 N1 ? ? ? 1_555 B DC 7  N3 ? ? C DG 466 D DC 481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? A DG 18 N2 ? ? ? 1_555 B DC 7  O2 ? ? C DG 466 D DC 481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? A DG 18 O6 ? ? ? 1_555 B DC 7  N4 ? ? C DG 466 D DC 481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? A DA 19 N1 ? ? ? 1_555 B DT 6  N3 ? ? C DA 467 D DT 480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? A DA 19 N6 ? ? ? 1_555 B DT 6  O4 ? ? C DA 467 D DT 480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? A DG 20 N1 ? ? ? 1_555 B DC 5  N3 ? ? C DG 468 D DC 479 1_555 ? ? ? ? ? ? 'DG-DC PAIR' ? ? ? 
hydrog41 hydrog ? ? A DG 21 N1 ? ? ? 1_555 B DC 4  N3 ? ? C DG 469 D DC 478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? A DG 21 N2 ? ? ? 1_555 B DC 4  O2 ? ? C DG 469 D DC 478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? A DG 21 O6 ? ? ? 1_555 B DC 4  N4 ? ? C DG 469 D DC 478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? A DA 22 N1 ? ? ? 1_555 B DT 3  N3 ? ? C DA 470 D DT 477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? A DA 22 N6 ? ? ? 1_555 B DT 3  O4 ? ? C DA 470 D DT 477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46 hydrog ? ? A DA 23 N1 ? ? ? 1_555 B DT 2  N3 ? ? C DA 471 D DT 476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47 hydrog ? ? A DA 23 N6 ? ? ? 1_555 B DT 2  O4 ? ? C DA 471 D DT 476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48 hydrog ? ? A DG 24 N1 ? ? ? 1_555 B DC 1  N3 ? ? C DG 472 D DC 475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49 hydrog ? ? A DG 24 N2 ? ? ? 1_555 B DC 1  O2 ? ? C DG 472 D DC 475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50 hydrog ? ? A DG 24 O6 ? ? ? 1_555 B DC 1  N4 ? ? C DG 472 D DC 475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1AU7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1AU7 
_atom_sites.fract_transf_matrix[1][1]   0.023529 
_atom_sites.fract_transf_matrix[1][2]   -0.009891 
_atom_sites.fract_transf_matrix[1][3]   -0.002762 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021652 
_atom_sites.fract_transf_matrix[2][3]   -0.003838 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.018523 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'"  . DT  A 1 1   ? 2.171   -0.628  60.926 1.00 79.94 ? 449 DT  C "O5'"  1 
ATOM   2    C "C5'"  . DT  A 1 1   ? 0.829   -1.056  61.081 1.00 80.69 ? 449 DT  C "C5'"  1 
ATOM   3    C "C4'"  . DT  A 1 1   ? -0.156  0.069   60.928 1.00 80.34 ? 449 DT  C "C4'"  1 
ATOM   4    O "O4'"  . DT  A 1 1   ? -0.129  0.951   62.074 1.00 78.47 ? 449 DT  C "O4'"  1 
ATOM   5    C "C3'"  . DT  A 1 1   ? 0.058   0.983   59.723 1.00 81.42 ? 449 DT  C "C3'"  1 
ATOM   6    O "O3'"  . DT  A 1 1   ? -1.221  1.420   59.287 1.00 86.84 ? 449 DT  C "O3'"  1 
ATOM   7    C "C2'"  . DT  A 1 1   ? 0.785   2.174   60.315 1.00 77.56 ? 449 DT  C "C2'"  1 
ATOM   8    C "C1'"  . DT  A 1 1   ? 0.084   2.288   61.649 1.00 74.93 ? 449 DT  C "C1'"  1 
ATOM   9    N N1     . DT  A 1 1   ? 0.872   2.940   62.675 1.00 70.34 ? 449 DT  C N1     1 
ATOM   10   C C2     . DT  A 1 1   ? 0.478   4.148   63.190 1.00 68.45 ? 449 DT  C C2     1 
ATOM   11   O O2     . DT  A 1 1   ? -0.526  4.737   62.796 1.00 66.47 ? 449 DT  C O2     1 
ATOM   12   N N3     . DT  A 1 1   ? 1.298   4.650   64.172 1.00 63.23 ? 449 DT  C N3     1 
ATOM   13   C C4     . DT  A 1 1   ? 2.453   4.077   64.647 1.00 63.65 ? 449 DT  C C4     1 
ATOM   14   O O4     . DT  A 1 1   ? 3.111   4.637   65.489 1.00 62.97 ? 449 DT  C O4     1 
ATOM   15   C C5     . DT  A 1 1   ? 2.793   2.803   64.064 1.00 66.01 ? 449 DT  C C5     1 
ATOM   16   C C7     . DT  A 1 1   ? 4.002   2.090   64.563 1.00 67.25 ? 449 DT  C C7     1 
ATOM   17   C C6     . DT  A 1 1   ? 2.003   2.312   63.119 1.00 68.98 ? 449 DT  C C6     1 
ATOM   18   H H3     . DT  A 1 1   ? 1.016   5.486   64.661 1.00 0.00  ? 449 DT  C H3     1 
ATOM   19   H "HO5'" . DT  A 1 1   ? 2.248   -0.362  60.010 1.00 0.00  ? 449 DT  C "HO5'" 1 
ATOM   20   P P      . DC  A 1 2   ? -1.332  2.463   58.075 1.00 90.61 ? 450 DC  C P      1 
ATOM   21   O OP1    . DC  A 1 2   ? -2.786  2.744   57.910 1.00 92.66 ? 450 DC  C OP1    1 
ATOM   22   O OP2    . DC  A 1 2   ? -0.529  1.941   56.920 1.00 90.14 ? 450 DC  C OP2    1 
ATOM   23   O "O5'"  . DC  A 1 2   ? -0.628  3.787   58.586 1.00 80.76 ? 450 DC  C "O5'"  1 
ATOM   24   C "C5'"  . DC  A 1 2   ? -0.174  4.738   57.635 1.00 70.60 ? 450 DC  C "C5'"  1 
ATOM   25   C "C4'"  . DC  A 1 2   ? -0.237  6.133   58.203 1.00 60.22 ? 450 DC  C "C4'"  1 
ATOM   26   O "O4'"  . DC  A 1 2   ? 0.158   6.075   59.598 1.00 60.80 ? 450 DC  C "O4'"  1 
ATOM   27   C "C3'"  . DC  A 1 2   ? 0.741   7.073   57.512 1.00 52.44 ? 450 DC  C "C3'"  1 
ATOM   28   O "O3'"  . DC  A 1 2   ? 0.201   8.383   57.363 1.00 45.42 ? 450 DC  C "O3'"  1 
ATOM   29   C "C2'"  . DC  A 1 2   ? 1.933   7.099   58.448 1.00 55.50 ? 450 DC  C "C2'"  1 
ATOM   30   C "C1'"  . DC  A 1 2   ? 1.274   6.929   59.809 1.00 56.77 ? 450 DC  C "C1'"  1 
ATOM   31   N N1     . DC  A 1 2   ? 2.168   6.304   60.805 1.00 50.20 ? 450 DC  C N1     1 
ATOM   32   C C2     . DC  A 1 2   ? 2.473   7.012   61.980 1.00 49.15 ? 450 DC  C C2     1 
ATOM   33   O O2     . DC  A 1 2   ? 1.926   8.092   62.195 1.00 54.51 ? 450 DC  C O2     1 
ATOM   34   N N3     . DC  A 1 2   ? 3.353   6.503   62.849 1.00 49.49 ? 450 DC  C N3     1 
ATOM   35   C C4     . DC  A 1 2   ? 3.926   5.332   62.599 1.00 52.39 ? 450 DC  C C4     1 
ATOM   36   N N4     . DC  A 1 2   ? 4.833   4.891   63.471 1.00 52.48 ? 450 DC  C N4     1 
ATOM   37   C C5     . DC  A 1 2   ? 3.595   4.558   61.437 1.00 52.18 ? 450 DC  C C5     1 
ATOM   38   C C6     . DC  A 1 2   ? 2.719   5.078   60.579 1.00 46.57 ? 450 DC  C C6     1 
ATOM   39   H H41    . DC  A 1 2   ? 5.289   4.003   63.327 1.00 0.00  ? 450 DC  C H41    1 
ATOM   40   H H42    . DC  A 1 2   ? 5.089   5.478   64.255 1.00 0.00  ? 450 DC  C H42    1 
ATOM   41   P P      . DC  A 1 3   ? 0.982   9.449   56.448 1.00 39.74 ? 451 DC  C P      1 
ATOM   42   O OP1    . DC  A 1 3   ? 0.229   9.662   55.180 1.00 42.19 ? 451 DC  C OP1    1 
ATOM   43   O OP2    . DC  A 1 3   ? 2.347   8.938   56.403 1.00 40.98 ? 451 DC  C OP2    1 
ATOM   44   O "O5'"  . DC  A 1 3   ? 1.029   10.798  57.317 1.00 41.56 ? 451 DC  C "O5'"  1 
ATOM   45   C "C5'"  . DC  A 1 3   ? -0.106  11.228  58.096 1.00 40.25 ? 451 DC  C "C5'"  1 
ATOM   46   C "C4'"  . DC  A 1 3   ? 0.317   12.142  59.234 1.00 35.19 ? 451 DC  C "C4'"  1 
ATOM   47   O "O4'"  . DC  A 1 3   ? 0.961   11.369  60.286 1.00 36.21 ? 451 DC  C "O4'"  1 
ATOM   48   C "C3'"  . DC  A 1 3   ? 1.300   13.237  58.843 1.00 30.49 ? 451 DC  C "C3'"  1 
ATOM   49   O "O3'"  . DC  A 1 3   ? 0.933   14.535  59.239 1.00 26.26 ? 451 DC  C "O3'"  1 
ATOM   50   C "C2'"  . DC  A 1 3   ? 2.595   12.903  59.548 1.00 33.84 ? 451 DC  C "C2'"  1 
ATOM   51   C "C1'"  . DC  A 1 3   ? 2.220   11.933  60.651 1.00 30.30 ? 451 DC  C "C1'"  1 
ATOM   52   N N1     . DC  A 1 3   ? 3.206   10.837  60.683 1.00 27.64 ? 451 DC  C N1     1 
ATOM   53   C C2     . DC  A 1 3   ? 4.274   10.921  61.579 1.00 26.00 ? 451 DC  C C2     1 
ATOM   54   O O2     . DC  A 1 3   ? 4.368   11.900  62.321 1.00 33.18 ? 451 DC  C O2     1 
ATOM   55   N N3     . DC  A 1 3   ? 5.186   9.944   61.606 1.00 27.04 ? 451 DC  C N3     1 
ATOM   56   C C4     . DC  A 1 3   ? 5.084   8.906   60.764 1.00 29.14 ? 451 DC  C C4     1 
ATOM   57   N N4     . DC  A 1 3   ? 6.044   7.960   60.825 1.00 27.42 ? 451 DC  C N4     1 
ATOM   58   C C5     . DC  A 1 3   ? 4.007   8.791   59.824 1.00 24.41 ? 451 DC  C C5     1 
ATOM   59   C C6     . DC  A 1 3   ? 3.097   9.765   59.830 1.00 26.33 ? 451 DC  C C6     1 
ATOM   60   H H41    . DC  A 1 3   ? 6.040   7.195   60.163 1.00 0.00  ? 451 DC  C H41    1 
ATOM   61   H H42    . DC  A 1 3   ? 6.749   8.020   61.548 1.00 0.00  ? 451 DC  C H42    1 
ATOM   62   P P      . DT  A 1 4   ? 1.734   15.756  58.610 1.00 27.77 ? 452 DT  C P      1 
ATOM   63   O OP1    . DT  A 1 4   ? 0.897   16.945  58.380 1.00 23.41 ? 452 DT  C OP1    1 
ATOM   64   O OP2    . DT  A 1 4   ? 2.522   15.166  57.512 1.00 26.21 ? 452 DT  C OP2    1 
ATOM   65   O "O5'"  . DT  A 1 4   ? 2.796   16.120  59.750 1.00 37.82 ? 452 DT  C "O5'"  1 
ATOM   66   C "C5'"  . DT  A 1 4   ? 2.374   16.615  61.027 1.00 33.99 ? 452 DT  C "C5'"  1 
ATOM   67   C "C4'"  . DT  A 1 4   ? 3.569   16.834  61.929 1.00 29.81 ? 452 DT  C "C4'"  1 
ATOM   68   O "O4'"  . DT  A 1 4   ? 4.300   15.593  62.096 1.00 22.92 ? 452 DT  C "O4'"  1 
ATOM   69   C "C3'"  . DT  A 1 4   ? 4.586   17.863  61.435 1.00 27.91 ? 452 DT  C "C3'"  1 
ATOM   70   O "O3'"  . DT  A 1 4   ? 5.096   18.565  62.564 1.00 28.35 ? 452 DT  C "O3'"  1 
ATOM   71   C "C2'"  . DT  A 1 4   ? 5.664   17.010  60.795 1.00 28.86 ? 452 DT  C "C2'"  1 
ATOM   72   C "C1'"  . DT  A 1 4   ? 5.653   15.773  61.684 1.00 27.96 ? 452 DT  C "C1'"  1 
ATOM   73   N N1     . DT  A 1 4   ? 6.090   14.526  61.021 1.00 30.84 ? 452 DT  C N1     1 
ATOM   74   C C2     . DT  A 1 4   ? 7.128   13.800  61.591 1.00 31.08 ? 452 DT  C C2     1 
ATOM   75   O O2     . DT  A 1 4   ? 7.701   14.141  62.616 1.00 28.41 ? 452 DT  C O2     1 
ATOM   76   N N3     . DT  A 1 4   ? 7.473   12.654  60.906 1.00 32.34 ? 452 DT  C N3     1 
ATOM   77   C C4     . DT  A 1 4   ? 6.891   12.173  59.737 1.00 28.98 ? 452 DT  C C4     1 
ATOM   78   O O4     . DT  A 1 4   ? 7.320   11.131  59.243 1.00 28.60 ? 452 DT  C O4     1 
ATOM   79   C C5     . DT  A 1 4   ? 5.805   12.977  59.211 1.00 25.96 ? 452 DT  C C5     1 
ATOM   80   C C7     . DT  A 1 4   ? 5.101   12.513  57.971 1.00 24.25 ? 452 DT  C C7     1 
ATOM   81   C C6     . DT  A 1 4   ? 5.470   14.095  59.852 1.00 29.58 ? 452 DT  C C6     1 
ATOM   82   H H3     . DT  A 1 4   ? 8.225   12.106  61.290 1.00 0.00  ? 452 DT  C H3     1 
ATOM   83   P P      . DC  A 1 5   ? 5.690   20.032  62.372 1.00 33.59 ? 453 DC  C P      1 
ATOM   84   O OP1    . DC  A 1 5   ? 5.172   20.967  63.405 1.00 32.35 ? 453 DC  C OP1    1 
ATOM   85   O OP2    . DC  A 1 5   ? 5.513   20.336  60.942 1.00 37.41 ? 453 DC  C OP2    1 
ATOM   86   O "O5'"  . DC  A 1 5   ? 7.245   19.831  62.611 1.00 39.79 ? 453 DC  C "O5'"  1 
ATOM   87   C "C5'"  . DC  A 1 5   ? 7.821   18.546  62.449 1.00 39.75 ? 453 DC  C "C5'"  1 
ATOM   88   C "C4'"  . DC  A 1 5   ? 9.313   18.605  62.671 1.00 35.25 ? 453 DC  C "C4'"  1 
ATOM   89   O "O4'"  . DC  A 1 5   ? 9.825   17.312  62.275 1.00 37.63 ? 453 DC  C "O4'"  1 
ATOM   90   C "C3'"  . DC  A 1 5   ? 10.038  19.629  61.806 1.00 37.07 ? 453 DC  C "C3'"  1 
ATOM   91   O "O3'"  . DC  A 1 5   ? 11.198  20.123  62.486 1.00 31.73 ? 453 DC  C "O3'"  1 
ATOM   92   C "C2'"  . DC  A 1 5   ? 10.424  18.829  60.570 1.00 35.68 ? 453 DC  C "C2'"  1 
ATOM   93   C "C1'"  . DC  A 1 5   ? 10.638  17.430  61.119 1.00 32.36 ? 453 DC  C "C1'"  1 
ATOM   94   N N1     . DC  A 1 5   ? 10.251  16.353  60.210 1.00 29.65 ? 453 DC  C N1     1 
ATOM   95   C C2     . DC  A 1 5   ? 10.761  15.086  60.446 1.00 27.31 ? 453 DC  C C2     1 
ATOM   96   O O2     . DC  A 1 5   ? 11.456  14.902  61.451 1.00 28.11 ? 453 DC  C O2     1 
ATOM   97   N N3     . DC  A 1 5   ? 10.484  14.093  59.588 1.00 25.52 ? 453 DC  C N3     1 
ATOM   98   C C4     . DC  A 1 5   ? 9.686   14.316  58.549 1.00 23.85 ? 453 DC  C C4     1 
ATOM   99   N N4     . DC  A 1 5   ? 9.437   13.293  57.745 1.00 23.70 ? 453 DC  C N4     1 
ATOM   100  C C5     . DC  A 1 5   ? 9.117   15.590  58.295 1.00 22.71 ? 453 DC  C C5     1 
ATOM   101  C C6     . DC  A 1 5   ? 9.419   16.573  59.144 1.00 29.67 ? 453 DC  C C6     1 
ATOM   102  H H41    . DC  A 1 5   ? 8.890   13.442  56.911 1.00 0.00  ? 453 DC  C H41    1 
ATOM   103  H H42    . DC  A 1 5   ? 9.763   12.364  57.989 1.00 0.00  ? 453 DC  C H42    1 
ATOM   104  P P      . DA  A 1 6   ? 11.918  21.467  61.981 1.00 32.46 ? 454 DA  C P      1 
ATOM   105  O OP1    . DA  A 1 6   ? 11.898  22.470  63.066 1.00 34.22 ? 454 DA  C OP1    1 
ATOM   106  O OP2    . DA  A 1 6   ? 11.384  21.853  60.630 1.00 37.31 ? 454 DA  C OP2    1 
ATOM   107  O "O5'"  . DA  A 1 6   ? 13.431  20.983  61.794 1.00 36.87 ? 454 DA  C "O5'"  1 
ATOM   108  C "C5'"  . DA  A 1 6   ? 14.126  20.287  62.838 1.00 26.81 ? 454 DA  C "C5'"  1 
ATOM   109  C "C4'"  . DA  A 1 6   ? 15.213  19.401  62.266 1.00 24.28 ? 454 DA  C "C4'"  1 
ATOM   110  O "O4'"  . DA  A 1 6   ? 14.633  18.282  61.552 1.00 19.99 ? 454 DA  C "O4'"  1 
ATOM   111  C "C3'"  . DA  A 1 6   ? 16.208  20.057  61.290 1.00 23.37 ? 454 DA  C "C3'"  1 
ATOM   112  O "O3'"  . DA  A 1 6   ? 17.491  19.415  61.494 1.00 27.15 ? 454 DA  C "O3'"  1 
ATOM   113  C "C2'"  . DA  A 1 6   ? 15.626  19.677  59.936 1.00 15.05 ? 454 DA  C "C2'"  1 
ATOM   114  C "C1'"  . DA  A 1 6   ? 15.172  18.255  60.228 1.00 21.50 ? 454 DA  C "C1'"  1 
ATOM   115  N N9     . DA  A 1 6   ? 14.155  17.721  59.330 1.00 16.92 ? 454 DA  C N9     1 
ATOM   116  C C8     . DA  A 1 6   ? 13.083  18.374  58.805 1.00 15.35 ? 454 DA  C C8     1 
ATOM   117  N N7     . DA  A 1 6   ? 12.349  17.637  58.015 1.00 23.00 ? 454 DA  C N7     1 
ATOM   118  C C5     . DA  A 1 6   ? 12.987  16.409  58.011 1.00 17.01 ? 454 DA  C C5     1 
ATOM   119  C C6     . DA  A 1 6   ? 12.716  15.208  57.333 1.00 22.53 ? 454 DA  C C6     1 
ATOM   120  N N6     . DA  A 1 6   ? 11.711  15.059  56.471 1.00 25.02 ? 454 DA  C N6     1 
ATOM   121  N N1     . DA  A 1 6   ? 13.532  14.150  57.567 1.00 27.38 ? 454 DA  C N1     1 
ATOM   122  C C2     . DA  A 1 6   ? 14.568  14.317  58.412 1.00 23.22 ? 454 DA  C C2     1 
ATOM   123  N N3     . DA  A 1 6   ? 14.939  15.416  59.084 1.00 23.40 ? 454 DA  C N3     1 
ATOM   124  C C4     . DA  A 1 6   ? 14.092  16.436  58.835 1.00 18.39 ? 454 DA  C C4     1 
ATOM   125  H H61    . DA  A 1 6   ? 11.588  14.189  55.974 1.00 0.00  ? 454 DA  C H61    1 
ATOM   126  H H62    . DA  A 1 6   ? 11.044  15.807  56.314 1.00 0.00  ? 454 DA  C H62    1 
ATOM   127  P P      . DT  A 1 7   ? 18.874  20.115  60.987 1.00 26.90 ? 455 DT  C P      1 
ATOM   128  O OP1    . DT  A 1 7   ? 19.920  19.877  62.032 1.00 33.29 ? 455 DT  C OP1    1 
ATOM   129  O OP2    . DT  A 1 7   ? 18.600  21.506  60.522 1.00 22.35 ? 455 DT  C OP2    1 
ATOM   130  O "O5'"  . DT  A 1 7   ? 19.334  19.160  59.806 1.00 23.48 ? 455 DT  C "O5'"  1 
ATOM   131  C "C5'"  . DT  A 1 7   ? 19.435  17.760  60.033 1.00 20.01 ? 455 DT  C "C5'"  1 
ATOM   132  C "C4'"  . DT  A 1 7   ? 19.517  17.032  58.713 1.00 24.65 ? 455 DT  C "C4'"  1 
ATOM   133  O "O4'"  . DT  A 1 7   ? 18.198  16.766  58.157 1.00 26.40 ? 455 DT  C "O4'"  1 
ATOM   134  C "C3'"  . DT  A 1 7   ? 20.294  17.803  57.635 1.00 24.74 ? 455 DT  C "C3'"  1 
ATOM   135  O "O3'"  . DT  A 1 7   ? 21.105  16.868  56.930 1.00 25.90 ? 455 DT  C "O3'"  1 
ATOM   136  C "C2'"  . DT  A 1 7   ? 19.202  18.295  56.694 1.00 22.78 ? 455 DT  C "C2'"  1 
ATOM   137  C "C1'"  . DT  A 1 7   ? 18.255  17.103  56.767 1.00 24.79 ? 455 DT  C "C1'"  1 
ATOM   138  N N1     . DT  A 1 7   ? 16.881  17.281  56.223 1.00 10.35 ? 455 DT  C N1     1 
ATOM   139  C C2     . DT  A 1 7   ? 16.224  16.175  55.783 1.00 7.70  ? 455 DT  C C2     1 
ATOM   140  O O2     . DT  A 1 7   ? 16.690  15.046  55.856 1.00 10.31 ? 455 DT  C O2     1 
ATOM   141  N N3     . DT  A 1 7   ? 15.000  16.425  55.222 1.00 15.02 ? 455 DT  C N3     1 
ATOM   142  C C4     . DT  A 1 7   ? 14.388  17.659  55.063 1.00 9.18  ? 455 DT  C C4     1 
ATOM   143  O O4     . DT  A 1 7   ? 13.285  17.732  54.527 1.00 19.45 ? 455 DT  C O4     1 
ATOM   144  C C5     . DT  A 1 7   ? 15.130  18.769  55.561 1.00 7.22  ? 455 DT  C C5     1 
ATOM   145  C C7     . DT  A 1 7   ? 14.550  20.141  55.435 1.00 12.39 ? 455 DT  C C7     1 
ATOM   146  C C6     . DT  A 1 7   ? 16.318  18.532  56.119 1.00 12.43 ? 455 DT  C C6     1 
ATOM   147  H H3     . DT  A 1 7   ? 14.565  15.611  54.814 1.00 0.00  ? 455 DT  C H3     1 
ATOM   148  P P      . DG  A 1 8   ? 22.535  17.310  56.326 1.00 24.18 ? 456 DG  C P      1 
ATOM   149  O OP1    . DG  A 1 8   ? 23.489  17.447  57.448 1.00 30.01 ? 456 DG  C OP1    1 
ATOM   150  O OP2    . DG  A 1 8   ? 22.381  18.451  55.381 1.00 22.18 ? 456 DG  C OP2    1 
ATOM   151  O "O5'"  . DG  A 1 8   ? 22.895  15.995  55.527 1.00 18.16 ? 456 DG  C "O5'"  1 
ATOM   152  C "C5'"  . DG  A 1 8   ? 22.711  14.733  56.145 1.00 27.54 ? 456 DG  C "C5'"  1 
ATOM   153  C "C4'"  . DG  A 1 8   ? 21.965  13.778  55.234 1.00 31.31 ? 456 DG  C "C4'"  1 
ATOM   154  O "O4'"  . DG  A 1 8   ? 20.542  14.092  55.115 1.00 31.22 ? 456 DG  C "O4'"  1 
ATOM   155  C "C3'"  . DG  A 1 8   ? 22.522  13.776  53.820 1.00 33.93 ? 456 DG  C "C3'"  1 
ATOM   156  O "O3'"  . DG  A 1 8   ? 22.890  12.497  53.369 1.00 34.21 ? 456 DG  C "O3'"  1 
ATOM   157  C "C2'"  . DG  A 1 8   ? 21.389  14.279  52.966 1.00 33.23 ? 456 DG  C "C2'"  1 
ATOM   158  C "C1'"  . DG  A 1 8   ? 20.177  13.887  53.776 1.00 29.85 ? 456 DG  C "C1'"  1 
ATOM   159  N N9     . DG  A 1 8   ? 19.120  14.809  53.402 1.00 27.82 ? 456 DG  C N9     1 
ATOM   160  C C8     . DG  A 1 8   ? 18.963  16.140  53.727 1.00 25.57 ? 456 DG  C C8     1 
ATOM   161  N N7     . DG  A 1 8   ? 18.009  16.717  53.036 1.00 26.36 ? 456 DG  C N7     1 
ATOM   162  C C5     . DG  A 1 8   ? 17.483  15.683  52.255 1.00 22.03 ? 456 DG  C C5     1 
ATOM   163  C C6     . DG  A 1 8   ? 16.447  15.682  51.280 1.00 17.69 ? 456 DG  C C6     1 
ATOM   164  O O6     . DG  A 1 8   ? 15.759  16.612  50.893 1.00 16.49 ? 456 DG  C O6     1 
ATOM   165  N N1     . DG  A 1 8   ? 16.263  14.417  50.715 1.00 12.80 ? 456 DG  C N1     1 
ATOM   166  C C2     . DG  A 1 8   ? 16.993  13.300  51.019 1.00 18.61 ? 456 DG  C C2     1 
ATOM   167  N N2     . DG  A 1 8   ? 16.729  12.171  50.317 1.00 19.54 ? 456 DG  C N2     1 
ATOM   168  N N3     . DG  A 1 8   ? 17.944  13.283  51.938 1.00 24.08 ? 456 DG  C N3     1 
ATOM   169  C C4     . DG  A 1 8   ? 18.136  14.503  52.505 1.00 23.56 ? 456 DG  C C4     1 
ATOM   170  H H1     . DG  A 1 8   ? 15.526  14.327  50.031 1.00 0.00  ? 456 DG  C H1     1 
ATOM   171  H H21    . DG  A 1 8   ? 17.243  11.327  50.529 1.00 0.00  ? 456 DG  C H21    1 
ATOM   172  H H22    . DG  A 1 8   ? 16.036  12.169  49.581 1.00 0.00  ? 456 DG  C H22    1 
ATOM   173  P P      . DT  A 1 9   ? 24.290  12.352  52.612 1.00 33.46 ? 457 DT  C P      1 
ATOM   174  O OP1    . DT  A 1 9   ? 25.229  11.623  53.509 1.00 38.44 ? 457 DT  C OP1    1 
ATOM   175  O OP2    . DT  A 1 9   ? 24.624  13.726  52.141 1.00 14.21 ? 457 DT  C OP2    1 
ATOM   176  O "O5'"  . DT  A 1 9   ? 23.955  11.406  51.381 1.00 37.00 ? 457 DT  C "O5'"  1 
ATOM   177  C "C5'"  . DT  A 1 9   ? 23.071  10.290  51.517 1.00 32.31 ? 457 DT  C "C5'"  1 
ATOM   178  C "C4'"  . DT  A 1 9   ? 22.312  10.075  50.227 1.00 29.10 ? 457 DT  C "C4'"  1 
ATOM   179  O "O4'"  . DT  A 1 9   ? 21.302  11.095  50.084 1.00 27.51 ? 457 DT  C "O4'"  1 
ATOM   180  C "C3'"  . DT  A 1 9   ? 23.183  10.187  48.973 1.00 32.29 ? 457 DT  C "C3'"  1 
ATOM   181  O "O3'"  . DT  A 1 9   ? 22.753  9.181   48.060 1.00 34.75 ? 457 DT  C "O3'"  1 
ATOM   182  C "C2'"  . DT  A 1 9   ? 22.874  11.578  48.423 1.00 25.34 ? 457 DT  C "C2'"  1 
ATOM   183  C "C1'"  . DT  A 1 9   ? 21.416  11.720  48.809 1.00 26.16 ? 457 DT  C "C1'"  1 
ATOM   184  N N1     . DT  A 1 9   ? 20.876  13.089  48.914 1.00 22.31 ? 457 DT  C N1     1 
ATOM   185  C C2     . DT  A 1 9   ? 19.638  13.377  48.339 1.00 25.94 ? 457 DT  C C2     1 
ATOM   186  O O2     . DT  A 1 9   ? 19.008  12.571  47.655 1.00 23.45 ? 457 DT  C O2     1 
ATOM   187  N N3     . DT  A 1 9   ? 19.180  14.648  48.579 1.00 22.19 ? 457 DT  C N3     1 
ATOM   188  C C4     . DT  A 1 9   ? 19.823  15.635  49.284 1.00 23.73 ? 457 DT  C C4     1 
ATOM   189  O O4     . DT  A 1 9   ? 19.266  16.719  49.445 1.00 25.21 ? 457 DT  C O4     1 
ATOM   190  C C5     . DT  A 1 9   ? 21.147  15.283  49.782 1.00 21.33 ? 457 DT  C C5     1 
ATOM   191  C C7     . DT  A 1 9   ? 21.971  16.328  50.471 1.00 23.94 ? 457 DT  C C7     1 
ATOM   192  C C6     . DT  A 1 9   ? 21.584  14.046  49.584 1.00 20.29 ? 457 DT  C C6     1 
ATOM   193  H H3     . DT  A 1 9   ? 18.299  14.934  48.180 1.00 0.00  ? 457 DT  C H3     1 
ATOM   194  P P      . DA  A 1 10  ? 23.495  8.983   46.652 1.00 27.24 ? 458 DA  C P      1 
ATOM   195  O OP1    . DA  A 1 10  ? 23.833  7.537   46.626 1.00 24.03 ? 458 DA  C OP1    1 
ATOM   196  O OP2    . DA  A 1 10  ? 24.563  10.016  46.437 1.00 28.68 ? 458 DA  C OP2    1 
ATOM   197  O "O5'"  . DA  A 1 10  ? 22.329  9.282   45.614 1.00 32.86 ? 458 DA  C "O5'"  1 
ATOM   198  C "C5'"  . DA  A 1 10  ? 21.057  8.654   45.759 1.00 30.52 ? 458 DA  C "C5'"  1 
ATOM   199  C "C4'"  . DA  A 1 10  ? 20.123  9.074   44.646 1.00 26.13 ? 458 DA  C "C4'"  1 
ATOM   200  O "O4'"  . DA  A 1 10  ? 19.583  10.395  44.855 1.00 19.27 ? 458 DA  C "O4'"  1 
ATOM   201  C "C3'"  . DA  A 1 10  ? 20.758  9.095   43.269 1.00 24.62 ? 458 DA  C "C3'"  1 
ATOM   202  O "O3'"  . DA  A 1 10  ? 19.847  8.446   42.401 1.00 29.34 ? 458 DA  C "O3'"  1 
ATOM   203  C "C2'"  . DA  A 1 10  ? 20.937  10.575  42.961 1.00 18.45 ? 458 DA  C "C2'"  1 
ATOM   204  C "C1'"  . DA  A 1 10  ? 19.859  11.253  43.774 1.00 14.30 ? 458 DA  C "C1'"  1 
ATOM   205  N N9     . DA  A 1 10  ? 20.304  12.500  44.366 1.00 14.33 ? 458 DA  C N9     1 
ATOM   206  C C8     . DA  A 1 10  ? 21.449  12.662  45.105 1.00 15.83 ? 458 DA  C C8     1 
ATOM   207  N N7     . DA  A 1 10  ? 21.594  13.862  45.599 1.00 11.53 ? 458 DA  C N7     1 
ATOM   208  C C5     . DA  A 1 10  ? 20.468  14.550  45.152 1.00 10.69 ? 458 DA  C C5     1 
ATOM   209  C C6     . DA  A 1 10  ? 20.044  15.859  45.326 1.00 13.24 ? 458 DA  C C6     1 
ATOM   210  N N6     . DA  A 1 10  ? 20.686  16.733  46.084 1.00 14.57 ? 458 DA  C N6     1 
ATOM   211  N N1     . DA  A 1 10  ? 18.925  16.255  44.696 1.00 11.78 ? 458 DA  C N1     1 
ATOM   212  C C2     . DA  A 1 10  ? 18.269  15.371  43.980 1.00 8.04  ? 458 DA  C C2     1 
ATOM   213  N N3     . DA  A 1 10  ? 18.535  14.091  43.765 1.00 12.88 ? 458 DA  C N3     1 
ATOM   214  C C4     . DA  A 1 10  ? 19.674  13.734  44.375 1.00 14.23 ? 458 DA  C C4     1 
ATOM   215  H H61    . DA  A 1 10  ? 21.562  16.477  46.511 1.00 0.00  ? 458 DA  C H61    1 
ATOM   216  H H62    . DA  A 1 10  ? 20.281  17.641  46.266 1.00 0.00  ? 458 DA  C H62    1 
ATOM   217  P P      . DT  A 1 11  ? 19.993  8.605   40.829 1.00 22.30 ? 459 DT  C P      1 
ATOM   218  O OP1    . DT  A 1 11  ? 19.542  7.290   40.354 1.00 20.91 ? 459 DT  C OP1    1 
ATOM   219  O OP2    . DT  A 1 11  ? 21.306  9.113   40.416 1.00 27.20 ? 459 DT  C OP2    1 
ATOM   220  O "O5'"  . DT  A 1 11  ? 18.968  9.767   40.531 1.00 18.65 ? 459 DT  C "O5'"  1 
ATOM   221  C "C5'"  . DT  A 1 11  ? 19.156  10.567  39.414 1.00 22.61 ? 459 DT  C "C5'"  1 
ATOM   222  C "C4'"  . DT  A 1 11  ? 18.356  11.831  39.545 1.00 19.17 ? 459 DT  C "C4'"  1 
ATOM   223  O "O4'"  . DT  A 1 11  ? 18.909  12.677  40.591 1.00 14.09 ? 459 DT  C "O4'"  1 
ATOM   224  C "C3'"  . DT  A 1 11  ? 18.416  12.634  38.246 1.00 22.09 ? 459 DT  C "C3'"  1 
ATOM   225  O "O3'"  . DT  A 1 11  ? 17.080  12.956  37.819 1.00 24.70 ? 459 DT  C "O3'"  1 
ATOM   226  C "C2'"  . DT  A 1 11  ? 19.248  13.859  38.600 1.00 15.33 ? 459 DT  C "C2'"  1 
ATOM   227  C "C1'"  . DT  A 1 11  ? 18.990  14.007  40.093 1.00 17.73 ? 459 DT  C "C1'"  1 
ATOM   228  N N1     . DT  A 1 11  ? 20.036  14.754  40.842 1.00 19.24 ? 459 DT  C N1     1 
ATOM   229  C C2     . DT  A 1 11  ? 19.839  16.104  41.046 1.00 19.69 ? 459 DT  C C2     1 
ATOM   230  O O2     . DT  A 1 11  ? 18.878  16.718  40.614 1.00 20.48 ? 459 DT  C O2     1 
ATOM   231  N N3     . DT  A 1 11  ? 20.820  16.727  41.762 1.00 19.78 ? 459 DT  C N3     1 
ATOM   232  C C4     . DT  A 1 11  ? 21.965  16.167  42.276 1.00 16.47 ? 459 DT  C C4     1 
ATOM   233  O O4     . DT  A 1 11  ? 22.727  16.866  42.932 1.00 19.51 ? 459 DT  C O4     1 
ATOM   234  C C5     . DT  A 1 11  ? 22.142  14.761  42.003 1.00 17.17 ? 459 DT  C C5     1 
ATOM   235  C C7     . DT  A 1 11  ? 23.371  14.076  42.506 1.00 17.56 ? 459 DT  C C7     1 
ATOM   236  C C6     . DT  A 1 11  ? 21.179  14.125  41.313 1.00 21.09 ? 459 DT  C C6     1 
ATOM   237  H H3     . DT  A 1 11  ? 20.650  17.701  41.962 1.00 0.00  ? 459 DT  C H3     1 
ATOM   238  P P      . DA  A 1 12  ? 16.788  13.280  36.272 1.00 23.59 ? 460 DA  C P      1 
ATOM   239  O OP1    . DA  A 1 12  ? 15.401  12.845  35.980 1.00 24.65 ? 460 DA  C OP1    1 
ATOM   240  O OP2    . DA  A 1 12  ? 17.905  12.735  35.455 1.00 23.76 ? 460 DA  C OP2    1 
ATOM   241  O "O5'"  . DA  A 1 12  ? 16.843  14.866  36.224 1.00 12.95 ? 460 DA  C "O5'"  1 
ATOM   242  C "C5'"  . DA  A 1 12  ? 15.843  15.603  36.864 1.00 18.78 ? 460 DA  C "C5'"  1 
ATOM   243  C "C4'"  . DA  A 1 12  ? 16.181  17.069  36.875 1.00 19.56 ? 460 DA  C "C4'"  1 
ATOM   244  O "O4'"  . DA  A 1 12  ? 17.342  17.300  37.708 1.00 23.35 ? 460 DA  C "O4'"  1 
ATOM   245  C "C3'"  . DA  A 1 12  ? 16.454  17.746  35.533 1.00 23.47 ? 460 DA  C "C3'"  1 
ATOM   246  O "O3'"  . DA  A 1 12  ? 15.641  18.924  35.484 1.00 27.76 ? 460 DA  C "O3'"  1 
ATOM   247  C "C2'"  . DA  A 1 12  ? 17.936  18.109  35.610 1.00 28.32 ? 460 DA  C "C2'"  1 
ATOM   248  C "C1'"  . DA  A 1 12  ? 18.155  18.285  37.112 1.00 29.67 ? 460 DA  C "C1'"  1 
ATOM   249  N N9     . DA  A 1 12  ? 19.529  18.098  37.612 1.00 31.66 ? 460 DA  C N9     1 
ATOM   250  C C8     . DA  A 1 12  ? 20.323  16.988  37.466 1.00 30.55 ? 460 DA  C C8     1 
ATOM   251  N N7     . DA  A 1 12  ? 21.499  17.095  38.036 1.00 32.15 ? 460 DA  C N7     1 
ATOM   252  C C5     . DA  A 1 12  ? 21.480  18.368  38.612 1.00 32.62 ? 460 DA  C C5     1 
ATOM   253  C C6     . DA  A 1 12  ? 22.430  19.081  39.402 1.00 33.60 ? 460 DA  C C6     1 
ATOM   254  N N6     . DA  A 1 12  ? 23.627  18.580  39.765 1.00 32.10 ? 460 DA  C N6     1 
ATOM   255  N N1     . DA  A 1 12  ? 22.096  20.335  39.817 1.00 30.39 ? 460 DA  C N1     1 
ATOM   256  C C2     . DA  A 1 12  ? 20.897  20.823  39.468 1.00 28.73 ? 460 DA  C C2     1 
ATOM   257  N N3     . DA  A 1 12  ? 19.928  20.251  38.750 1.00 28.94 ? 460 DA  C N3     1 
ATOM   258  C C4     . DA  A 1 12  ? 20.279  19.004  38.349 1.00 30.30 ? 460 DA  C C4     1 
ATOM   259  H H61    . DA  A 1 12  ? 24.247  19.147  40.328 1.00 0.00  ? 460 DA  C H61    1 
ATOM   260  H H62    . DA  A 1 12  ? 23.914  17.645  39.508 1.00 0.00  ? 460 DA  C H62    1 
ATOM   261  P P      . DT  A 1 13  ? 15.488  19.755  34.119 1.00 26.63 ? 461 DT  C P      1 
ATOM   262  O OP1    . DT  A 1 13  ? 14.045  20.005  33.920 1.00 28.15 ? 461 DT  C OP1    1 
ATOM   263  O OP2    . DT  A 1 13  ? 16.273  19.068  33.067 1.00 29.65 ? 461 DT  C OP2    1 
ATOM   264  O "O5'"  . DT  A 1 13  ? 16.152  21.155  34.451 1.00 22.85 ? 461 DT  C "O5'"  1 
ATOM   265  C "C5'"  . DT  A 1 13  ? 15.718  21.853  35.585 1.00 23.81 ? 461 DT  C "C5'"  1 
ATOM   266  C "C4'"  . DT  A 1 13  ? 16.752  22.854  36.021 1.00 23.87 ? 461 DT  C "C4'"  1 
ATOM   267  O "O4'"  . DT  A 1 13  ? 17.932  22.159  36.480 1.00 20.89 ? 461 DT  C "O4'"  1 
ATOM   268  C "C3'"  . DT  A 1 13  ? 17.212  23.826  34.941 1.00 25.20 ? 461 DT  C "C3'"  1 
ATOM   269  O "O3'"  . DT  A 1 13  ? 17.076  25.157  35.410 1.00 33.50 ? 461 DT  C "O3'"  1 
ATOM   270  C "C2'"  . DT  A 1 13  ? 18.691  23.533  34.796 1.00 28.33 ? 461 DT  C "C2'"  1 
ATOM   271  C "C1'"  . DT  A 1 13  ? 19.038  22.965  36.158 1.00 24.83 ? 461 DT  C "C1'"  1 
ATOM   272  N N1     . DT  A 1 13  ? 20.281  22.142  36.201 1.00 25.05 ? 461 DT  C N1     1 
ATOM   273  C C2     . DT  A 1 13  ? 21.389  22.691  36.835 1.00 25.45 ? 461 DT  C C2     1 
ATOM   274  O O2     . DT  A 1 13  ? 21.377  23.805  37.368 1.00 22.75 ? 461 DT  C O2     1 
ATOM   275  N N3     . DT  A 1 13  ? 22.517  21.906  36.811 1.00 20.53 ? 461 DT  C N3     1 
ATOM   276  C C4     . DT  A 1 13  ? 22.653  20.670  36.212 1.00 26.73 ? 461 DT  C C4     1 
ATOM   277  O O4     . DT  A 1 13  ? 23.738  20.095  36.242 1.00 26.86 ? 461 DT  C O4     1 
ATOM   278  C C5     . DT  A 1 13  ? 21.451  20.148  35.575 1.00 25.45 ? 461 DT  C C5     1 
ATOM   279  C C7     . DT  A 1 13  ? 21.510  18.806  34.918 1.00 25.49 ? 461 DT  C C7     1 
ATOM   280  C C6     . DT  A 1 13  ? 20.339  20.894  35.610 1.00 22.97 ? 461 DT  C C6     1 
ATOM   281  H H3     . DT  A 1 13  ? 23.288  22.281  37.342 1.00 0.00  ? 461 DT  C H3     1 
ATOM   282  P P      . DA  A 1 14  ? 17.285  26.382  34.396 1.00 36.15 ? 462 DA  C P      1 
ATOM   283  O OP1    . DA  A 1 14  ? 16.170  27.359  34.545 1.00 33.79 ? 462 DA  C OP1    1 
ATOM   284  O OP2    . DA  A 1 14  ? 17.637  25.838  33.059 1.00 40.91 ? 462 DA  C OP2    1 
ATOM   285  O "O5'"  . DA  A 1 14  ? 18.603  27.095  34.912 1.00 33.89 ? 462 DA  C "O5'"  1 
ATOM   286  C "C5'"  . DA  A 1 14  ? 18.546  27.927  36.038 1.00 33.94 ? 462 DA  C "C5'"  1 
ATOM   287  C "C4'"  . DA  A 1 14  ? 19.885  28.572  36.258 1.00 30.45 ? 462 DA  C "C4'"  1 
ATOM   288  O "O4'"  . DA  A 1 14  ? 20.871  27.521  36.305 1.00 30.23 ? 462 DA  C "O4'"  1 
ATOM   289  C "C3'"  . DA  A 1 14  ? 20.328  29.520  35.156 1.00 33.54 ? 462 DA  C "C3'"  1 
ATOM   290  O "O3'"  . DA  A 1 14  ? 21.028  30.568  35.834 1.00 38.05 ? 462 DA  C "O3'"  1 
ATOM   291  C "C2'"  . DA  A 1 14  ? 21.234  28.642  34.303 1.00 34.70 ? 462 DA  C "C2'"  1 
ATOM   292  C "C1'"  . DA  A 1 14  ? 21.869  27.729  35.337 1.00 28.42 ? 462 DA  C "C1'"  1 
ATOM   293  N N9     . DA  A 1 14  ? 22.321  26.405  34.898 1.00 27.46 ? 462 DA  C N9     1 
ATOM   294  C C8     . DA  A 1 14  ? 21.676  25.510  34.088 1.00 26.22 ? 462 DA  C C8     1 
ATOM   295  N N7     . DA  A 1 14  ? 22.301  24.369  33.954 1.00 26.47 ? 462 DA  C N7     1 
ATOM   296  C C5     . DA  A 1 14  ? 23.452  24.526  34.731 1.00 23.14 ? 462 DA  C C5     1 
ATOM   297  C C6     . DA  A 1 14  ? 24.523  23.658  35.042 1.00 24.07 ? 462 DA  C C6     1 
ATOM   298  N N6     . DA  A 1 14  ? 24.563  22.367  34.677 1.00 22.14 ? 462 DA  C N6     1 
ATOM   299  N N1     . DA  A 1 14  ? 25.544  24.150  35.789 1.00 22.56 ? 462 DA  C N1     1 
ATOM   300  C C2     . DA  A 1 14  ? 25.444  25.395  36.247 1.00 20.38 ? 462 DA  C C2     1 
ATOM   301  N N3     . DA  A 1 14  ? 24.464  26.280  36.072 1.00 25.74 ? 462 DA  C N3     1 
ATOM   302  C C4     . DA  A 1 14  ? 23.490  25.784  35.287 1.00 25.88 ? 462 DA  C C4     1 
ATOM   303  H H61    . DA  A 1 14  ? 23.789  21.986  34.151 1.00 0.00  ? 462 DA  C H61    1 
ATOM   304  H H62    . DA  A 1 14  ? 25.346  21.769  34.904 1.00 0.00  ? 462 DA  C H62    1 
ATOM   305  P P      . DC  A 1 15  ? 21.329  31.980  35.115 1.00 39.19 ? 463 DC  C P      1 
ATOM   306  O OP1    . DC  A 1 15  ? 20.978  33.040  36.101 1.00 38.49 ? 463 DC  C OP1    1 
ATOM   307  O OP2    . DC  A 1 15  ? 20.770  32.049  33.755 1.00 38.72 ? 463 DC  C OP2    1 
ATOM   308  O "O5'"  . DC  A 1 15  ? 22.922  31.920  35.031 1.00 35.89 ? 463 DC  C "O5'"  1 
ATOM   309  C "C5'"  . DC  A 1 15  ? 23.663  31.786  36.237 1.00 32.71 ? 463 DC  C "C5'"  1 
ATOM   310  C "C4'"  . DC  A 1 15  ? 25.004  31.140  36.001 1.00 28.12 ? 463 DC  C "C4'"  1 
ATOM   311  O "O4'"  . DC  A 1 15  ? 24.901  29.786  35.506 1.00 23.94 ? 463 DC  C "O4'"  1 
ATOM   312  C "C3'"  . DC  A 1 15  ? 25.974  31.862  35.069 1.00 28.23 ? 463 DC  C "C3'"  1 
ATOM   313  O "O3'"  . DC  A 1 15  ? 27.238  31.911  35.710 1.00 28.63 ? 463 DC  C "O3'"  1 
ATOM   314  C "C2'"  . DC  A 1 15  ? 26.092  30.903  33.898 1.00 29.43 ? 463 DC  C "C2'"  1 
ATOM   315  C "C1'"  . DC  A 1 15  ? 25.990  29.591  34.631 1.00 21.91 ? 463 DC  C "C1'"  1 
ATOM   316  N N1     . DC  A 1 15  ? 25.705  28.419  33.793 1.00 26.66 ? 463 DC  C N1     1 
ATOM   317  C C2     . DC  A 1 15  ? 26.588  27.331  33.824 1.00 19.73 ? 463 DC  C C2     1 
ATOM   318  O O2     . DC  A 1 15  ? 27.605  27.406  34.510 1.00 23.97 ? 463 DC  C O2     1 
ATOM   319  N N3     . DC  A 1 15  ? 26.312  26.232  33.093 1.00 20.45 ? 463 DC  C N3     1 
ATOM   320  C C4     . DC  A 1 15  ? 25.226  26.196  32.334 1.00 18.91 ? 463 DC  C C4     1 
ATOM   321  N N4     . DC  A 1 15  ? 24.997  25.094  31.629 1.00 24.91 ? 463 DC  C N4     1 
ATOM   322  C C5     . DC  A 1 15  ? 24.323  27.288  32.264 1.00 20.76 ? 463 DC  C C5     1 
ATOM   323  C C6     . DC  A 1 15  ? 24.594  28.372  33.005 1.00 22.81 ? 463 DC  C C6     1 
ATOM   324  H H41    . DC  A 1 15  ? 24.177  25.042  31.036 1.00 0.00  ? 463 DC  C H41    1 
ATOM   325  H H42    . DC  A 1 15  ? 25.635  24.309  31.680 1.00 0.00  ? 463 DC  C H42    1 
ATOM   326  P P      . DA  A 1 16  ? 28.315  33.003  35.266 1.00 33.54 ? 464 DA  C P      1 
ATOM   327  O OP1    . DA  A 1 16  ? 28.608  33.854  36.458 1.00 36.85 ? 464 DA  C OP1    1 
ATOM   328  O OP2    . DA  A 1 16  ? 27.918  33.645  33.998 1.00 37.13 ? 464 DA  C OP2    1 
ATOM   329  O "O5'"  . DA  A 1 16  ? 29.610  32.132  34.961 1.00 29.68 ? 464 DA  C "O5'"  1 
ATOM   330  C "C5'"  . DA  A 1 16  ? 29.517  30.849  34.371 1.00 19.75 ? 464 DA  C "C5'"  1 
ATOM   331  C "C4'"  . DA  A 1 16  ? 30.808  30.104  34.599 1.00 22.03 ? 464 DA  C "C4'"  1 
ATOM   332  O "O4'"  . DA  A 1 16  ? 30.671  28.757  34.117 1.00 20.97 ? 464 DA  C "O4'"  1 
ATOM   333  C "C3'"  . DA  A 1 16  ? 32.018  30.662  33.875 1.00 26.18 ? 464 DA  C "C3'"  1 
ATOM   334  O "O3'"  . DA  A 1 16  ? 33.193  30.369  34.661 1.00 29.19 ? 464 DA  C "O3'"  1 
ATOM   335  C "C2'"  . DA  A 1 16  ? 31.949  29.942  32.530 1.00 25.05 ? 464 DA  C "C2'"  1 
ATOM   336  C "C1'"  . DA  A 1 16  ? 31.305  28.602  32.869 1.00 24.58 ? 464 DA  C "C1'"  1 
ATOM   337  N N9     . DA  A 1 16  ? 30.262  28.123  31.957 1.00 25.59 ? 464 DA  C N9     1 
ATOM   338  C C8     . DA  A 1 16  ? 29.116  28.766  31.584 1.00 21.42 ? 464 DA  C C8     1 
ATOM   339  N N7     . DA  A 1 16  ? 28.307  28.025  30.861 1.00 20.09 ? 464 DA  C N7     1 
ATOM   340  C C5     . DA  A 1 16  ? 28.984  26.829  30.720 1.00 16.68 ? 464 DA  C C5     1 
ATOM   341  C C6     . DA  A 1 16  ? 28.668  25.647  30.058 1.00 19.20 ? 464 DA  C C6     1 
ATOM   342  N N6     . DA  A 1 16  ? 27.528  25.441  29.407 1.00 25.75 ? 464 DA  C N6     1 
ATOM   343  N N1     . DA  A 1 16  ? 29.575  24.649  30.084 1.00 21.13 ? 464 DA  C N1     1 
ATOM   344  C C2     . DA  A 1 16  ? 30.722  24.843  30.734 1.00 20.27 ? 464 DA  C C2     1 
ATOM   345  N N3     . DA  A 1 16  ? 31.137  25.911  31.401 1.00 22.99 ? 464 DA  C N3     1 
ATOM   346  C C4     . DA  A 1 16  ? 30.205  26.883  31.361 1.00 22.70 ? 464 DA  C C4     1 
ATOM   347  H H61    . DA  A 1 16  ? 26.811  26.147  29.327 1.00 0.00  ? 464 DA  C H61    1 
ATOM   348  H H62    . DA  A 1 16  ? 27.371  24.548  28.957 1.00 0.00  ? 464 DA  C H62    1 
ATOM   349  P P      . DT  A 1 17  ? 34.663  30.738  34.096 1.00 29.29 ? 465 DT  C P      1 
ATOM   350  O OP1    . DT  A 1 17  ? 35.605  30.633  35.244 1.00 37.66 ? 465 DT  C OP1    1 
ATOM   351  O OP2    . DT  A 1 17  ? 34.591  32.008  33.347 1.00 24.42 ? 465 DT  C OP2    1 
ATOM   352  O "O5'"  . DT  A 1 17  ? 35.009  29.520  33.143 1.00 28.04 ? 465 DT  C "O5'"  1 
ATOM   353  C "C5'"  . DT  A 1 17  ? 35.478  28.295  33.692 1.00 28.21 ? 465 DT  C "C5'"  1 
ATOM   354  C "C4'"  . DT  A 1 17  ? 36.165  27.473  32.625 1.00 33.42 ? 465 DT  C "C4'"  1 
ATOM   355  O "O4'"  . DT  A 1 17  ? 35.190  26.920  31.715 1.00 35.48 ? 465 DT  C "O4'"  1 
ATOM   356  C "C3'"  . DT  A 1 17  ? 37.155  28.235  31.744 1.00 35.31 ? 465 DT  C "C3'"  1 
ATOM   357  O "O3'"  . DT  A 1 17  ? 38.187  27.324  31.399 1.00 42.55 ? 465 DT  C "O3'"  1 
ATOM   358  C "C2'"  . DT  A 1 17  ? 36.357  28.531  30.490 1.00 29.99 ? 465 DT  C "C2'"  1 
ATOM   359  C "C1'"  . DT  A 1 17  ? 35.570  27.246  30.388 1.00 33.56 ? 465 DT  C "C1'"  1 
ATOM   360  N N1     . DT  A 1 17  ? 34.359  27.313  29.592 1.00 31.01 ? 465 DT  C N1     1 
ATOM   361  C C2     . DT  A 1 17  ? 33.951  26.167  28.955 1.00 31.54 ? 465 DT  C C2     1 
ATOM   362  O O2     . DT  A 1 17  ? 34.563  25.111  29.041 1.00 29.97 ? 465 DT  C O2     1 
ATOM   363  N N3     . DT  A 1 17  ? 32.814  26.303  28.203 1.00 29.21 ? 465 DT  C N3     1 
ATOM   364  C C4     . DT  A 1 17  ? 32.073  27.457  28.024 1.00 26.61 ? 465 DT  C C4     1 
ATOM   365  O O4     . DT  A 1 17  ? 31.083  27.434  27.309 1.00 29.69 ? 465 DT  C O4     1 
ATOM   366  C C5     . DT  A 1 17  ? 32.565  28.624  28.723 1.00 23.99 ? 465 DT  C C5     1 
ATOM   367  C C7     . DT  A 1 17  ? 31.842  29.919  28.568 1.00 21.33 ? 465 DT  C C7     1 
ATOM   368  C C6     . DT  A 1 17  ? 33.661  28.490  29.473 1.00 28.32 ? 465 DT  C C6     1 
ATOM   369  H H3     . DT  A 1 17  ? 32.506  25.468  27.727 1.00 0.00  ? 465 DT  C H3     1 
ATOM   370  P P      . DG  A 1 18  ? 39.721  27.794  31.423 1.00 43.05 ? 466 DG  C P      1 
ATOM   371  O OP1    . DG  A 1 18  ? 40.275  27.383  32.737 1.00 45.12 ? 466 DG  C OP1    1 
ATOM   372  O OP2    . DG  A 1 18  ? 39.763  29.226  31.029 1.00 40.39 ? 466 DG  C OP2    1 
ATOM   373  O "O5'"  . DG  A 1 18  ? 40.357  26.861  30.311 1.00 38.40 ? 466 DG  C "O5'"  1 
ATOM   374  C "C5'"  . DG  A 1 18  ? 40.128  25.455  30.357 1.00 43.31 ? 466 DG  C "C5'"  1 
ATOM   375  C "C4'"  . DG  A 1 18  ? 40.050  24.893  28.959 1.00 45.70 ? 466 DG  C "C4'"  1 
ATOM   376  O "O4'"  . DG  A 1 18  ? 38.740  25.099  28.376 1.00 46.50 ? 466 DG  C "O4'"  1 
ATOM   377  C "C3'"  . DG  A 1 18  ? 41.035  25.575  28.021 1.00 51.32 ? 466 DG  C "C3'"  1 
ATOM   378  O "O3'"  . DG  A 1 18  ? 41.609  24.617  27.134 1.00 54.99 ? 466 DG  C "O3'"  1 
ATOM   379  C "C2'"  . DG  A 1 18  ? 40.173  26.558  27.247 1.00 49.02 ? 466 DG  C "C2'"  1 
ATOM   380  C "C1'"  . DG  A 1 18  ? 38.883  25.787  27.139 1.00 43.23 ? 466 DG  C "C1'"  1 
ATOM   381  N N9     . DG  A 1 18  ? 37.696  26.605  26.931 1.00 41.64 ? 466 DG  C N9     1 
ATOM   382  C C8     . DG  A 1 18  ? 37.431  27.866  27.428 1.00 42.05 ? 466 DG  C C8     1 
ATOM   383  N N7     . DG  A 1 18  ? 36.269  28.334  27.049 1.00 38.27 ? 466 DG  C N7     1 
ATOM   384  C C5     . DG  A 1 18  ? 35.731  27.311  26.274 1.00 41.17 ? 466 DG  C C5     1 
ATOM   385  C C6     . DG  A 1 18  ? 34.474  27.215  25.599 1.00 41.17 ? 466 DG  C C6     1 
ATOM   386  O O6     . DG  A 1 18  ? 33.544  28.043  25.552 1.00 40.87 ? 466 DG  C O6     1 
ATOM   387  N N1     . DG  A 1 18  ? 34.360  26.004  24.913 1.00 38.30 ? 466 DG  C N1     1 
ATOM   388  C C2     . DG  A 1 18  ? 35.325  25.025  24.865 1.00 39.32 ? 466 DG  C C2     1 
ATOM   389  N N2     . DG  A 1 18  ? 35.054  23.969  24.100 1.00 39.09 ? 466 DG  C N2     1 
ATOM   390  N N3     . DG  A 1 18  ? 36.475  25.087  25.502 1.00 38.49 ? 466 DG  C N3     1 
ATOM   391  C C4     . DG  A 1 18  ? 36.613  26.247  26.180 1.00 41.43 ? 466 DG  C C4     1 
ATOM   392  H H1     . DG  A 1 18  ? 33.529  25.795  24.379 1.00 0.00  ? 466 DG  C H1     1 
ATOM   393  H H21    . DG  A 1 18  ? 35.724  23.217  24.023 1.00 0.00  ? 466 DG  C H21    1 
ATOM   394  H H22    . DG  A 1 18  ? 34.168  23.948  23.613 1.00 0.00  ? 466 DG  C H22    1 
ATOM   395  P P      . DA  A 1 19  ? 43.069  24.878  26.548 1.00 55.97 ? 467 DA  C P      1 
ATOM   396  O OP1    . DA  A 1 19  ? 43.998  24.188  27.487 1.00 57.06 ? 467 DA  C OP1    1 
ATOM   397  O OP2    . DA  A 1 19  ? 43.230  26.342  26.258 1.00 54.25 ? 467 DA  C OP2    1 
ATOM   398  O "O5'"  . DA  A 1 19  ? 43.052  24.092  25.179 1.00 55.11 ? 467 DA  C "O5'"  1 
ATOM   399  C "C5'"  . DA  A 1 19  ? 42.236  22.944  25.031 1.00 49.28 ? 467 DA  C "C5'"  1 
ATOM   400  C "C4'"  . DA  A 1 19  ? 41.578  22.966  23.673 1.00 43.62 ? 467 DA  C "C4'"  1 
ATOM   401  O "O4'"  . DA  A 1 19  ? 40.388  23.787  23.652 1.00 40.74 ? 467 DA  C "O4'"  1 
ATOM   402  C "C3'"  . DA  A 1 19  ? 42.475  23.518  22.573 1.00 39.44 ? 467 DA  C "C3'"  1 
ATOM   403  O "O3'"  . DA  A 1 19  ? 42.184  22.748  21.410 1.00 47.30 ? 467 DA  C "O3'"  1 
ATOM   404  C "C2'"  . DA  A 1 19  ? 41.947  24.929  22.405 1.00 33.79 ? 467 DA  C "C2'"  1 
ATOM   405  C "C1'"  . DA  A 1 19  ? 40.474  24.642  22.543 1.00 32.14 ? 467 DA  C "C1'"  1 
ATOM   406  N N9     . DA  A 1 19  ? 39.550  25.758  22.745 1.00 31.64 ? 467 DA  C N9     1 
ATOM   407  C C8     . DA  A 1 19  ? 39.756  26.985  23.325 1.00 31.33 ? 467 DA  C C8     1 
ATOM   408  N N7     . DA  A 1 19  ? 38.693  27.761  23.316 1.00 32.83 ? 467 DA  C N7     1 
ATOM   409  C C5     . DA  A 1 19  ? 37.714  26.981  22.695 1.00 32.90 ? 467 DA  C C5     1 
ATOM   410  C C6     . DA  A 1 19  ? 36.351  27.210  22.393 1.00 27.38 ? 467 DA  C C6     1 
ATOM   411  N N6     . DA  A 1 19  ? 35.697  28.326  22.672 1.00 28.68 ? 467 DA  C N6     1 
ATOM   412  N N1     . DA  A 1 19  ? 35.671  26.225  21.790 1.00 27.05 ? 467 DA  C N1     1 
ATOM   413  C C2     . DA  A 1 19  ? 36.310  25.089  21.500 1.00 30.12 ? 467 DA  C C2     1 
ATOM   414  N N3     . DA  A 1 19  ? 37.572  24.753  21.723 1.00 28.34 ? 467 DA  C N3     1 
ATOM   415  C C4     . DA  A 1 19  ? 38.233  25.748  22.338 1.00 32.92 ? 467 DA  C C4     1 
ATOM   416  H H61    . DA  A 1 19  ? 36.172  29.082  23.149 1.00 0.00  ? 467 DA  C H61    1 
ATOM   417  H H62    . DA  A 1 19  ? 34.726  28.426  22.411 1.00 0.00  ? 467 DA  C H62    1 
ATOM   418  P P      . DG  A 1 20  ? 43.341  22.417  20.345 1.00 49.19 ? 468 DG  C P      1 
ATOM   419  O OP1    . DG  A 1 20  ? 43.555  20.939  20.395 1.00 41.65 ? 468 DG  C OP1    1 
ATOM   420  O OP2    . DG  A 1 20  ? 44.501  23.339  20.507 1.00 46.62 ? 468 DG  C OP2    1 
ATOM   421  O "O5'"  . DG  A 1 20  ? 42.663  22.821  18.963 1.00 44.74 ? 468 DG  C "O5'"  1 
ATOM   422  C "C5'"  . DG  A 1 20  ? 41.351  22.372  18.637 1.00 39.99 ? 468 DG  C "C5'"  1 
ATOM   423  C "C4'"  . DG  A 1 20  ? 40.643  23.419  17.815 1.00 36.10 ? 468 DG  C "C4'"  1 
ATOM   424  O "O4'"  . DG  A 1 20  ? 40.057  24.464  18.627 1.00 38.48 ? 468 DG  C "O4'"  1 
ATOM   425  C "C3'"  . DG  A 1 20  ? 41.553  24.150  16.843 1.00 39.17 ? 468 DG  C "C3'"  1 
ATOM   426  O "O3'"  . DG  A 1 20  ? 40.827  24.355  15.634 1.00 43.62 ? 468 DG  C "O3'"  1 
ATOM   427  C "C2'"  . DG  A 1 20  ? 41.744  25.502  17.512 1.00 37.49 ? 468 DG  C "C2'"  1 
ATOM   428  C "C1'"  . DG  A 1 20  ? 40.355  25.685  18.007 1.00 33.07 ? 468 DG  C "C1'"  1 
ATOM   429  N N9     . DG  A 1 20  ? 40.081  26.766  18.934 1.00 36.89 ? 468 DG  C N9     1 
ATOM   430  C C8     . DG  A 1 20  ? 40.918  27.334  19.861 1.00 39.59 ? 468 DG  C C8     1 
ATOM   431  N N7     . DG  A 1 20  ? 40.346  28.295  20.546 1.00 43.71 ? 468 DG  C N7     1 
ATOM   432  C C5     . DG  A 1 20  ? 39.047  28.354  20.036 1.00 45.18 ? 468 DG  C C5     1 
ATOM   433  C C6     . DG  A 1 20  ? 37.936  29.206  20.378 1.00 46.29 ? 468 DG  C C6     1 
ATOM   434  O O6     . DG  A 1 20  ? 37.866  30.089  21.251 1.00 46.07 ? 468 DG  C O6     1 
ATOM   435  N N1     . DG  A 1 20  ? 36.824  28.946  19.574 1.00 45.51 ? 468 DG  C N1     1 
ATOM   436  C C2     . DG  A 1 20  ? 36.767  27.997  18.588 1.00 43.25 ? 468 DG  C C2     1 
ATOM   437  N N2     . DG  A 1 20  ? 35.616  27.907  17.909 1.00 42.63 ? 468 DG  C N2     1 
ATOM   438  N N3     . DG  A 1 20  ? 37.771  27.193  18.279 1.00 43.42 ? 468 DG  C N3     1 
ATOM   439  C C4     . DG  A 1 20  ? 38.873  27.427  19.034 1.00 42.43 ? 468 DG  C C4     1 
ATOM   440  H H1     . DG  A 1 20  ? 36.012  29.532  19.709 1.00 0.00  ? 468 DG  C H1     1 
ATOM   441  H H21    . DG  A 1 20  ? 35.534  27.187  17.203 1.00 0.00  ? 468 DG  C H21    1 
ATOM   442  H H22    . DG  A 1 20  ? 34.845  28.537  18.089 1.00 0.00  ? 468 DG  C H22    1 
ATOM   443  P P      . DG  A 1 21  ? 41.621  24.608  14.272 1.00 31.14 ? 469 DG  C P      1 
ATOM   444  O OP1    . DG  A 1 21  ? 42.036  23.264  13.776 1.00 29.63 ? 469 DG  C OP1    1 
ATOM   445  O OP2    . DG  A 1 21  ? 42.634  25.666  14.529 1.00 31.65 ? 469 DG  C OP2    1 
ATOM   446  O "O5'"  . DG  A 1 21  ? 40.556  25.301  13.319 1.00 33.67 ? 469 DG  C "O5'"  1 
ATOM   447  C "C5'"  . DG  A 1 21  ? 39.257  24.760  13.139 1.00 28.46 ? 469 DG  C "C5'"  1 
ATOM   448  C "C4'"  . DG  A 1 21  ? 38.299  25.875  12.817 1.00 29.15 ? 469 DG  C "C4'"  1 
ATOM   449  O "O4'"  . DG  A 1 21  ? 38.067  26.677  13.998 1.00 31.66 ? 469 DG  C "O4'"  1 
ATOM   450  C "C3'"  . DG  A 1 21  ? 38.821  26.838  11.762 1.00 33.68 ? 469 DG  C "C3'"  1 
ATOM   451  O "O3'"  . DG  A 1 21  ? 37.745  27.224  10.913 1.00 36.08 ? 469 DG  C "O3'"  1 
ATOM   452  C "C2'"  . DG  A 1 21  ? 39.289  28.037  12.574 1.00 34.49 ? 469 DG  C "C2'"  1 
ATOM   453  C "C1'"  . DG  A 1 21  ? 38.274  28.055  13.697 1.00 34.39 ? 469 DG  C "C1'"  1 
ATOM   454  N N9     . DG  A 1 21  ? 38.703  28.727  14.927 1.00 38.95 ? 469 DG  C N9     1 
ATOM   455  C C8     . DG  A 1 21  ? 39.824  28.432  15.665 1.00 41.60 ? 469 DG  C C8     1 
ATOM   456  N N7     . DG  A 1 21  ? 39.943  29.165  16.742 1.00 43.75 ? 469 DG  C N7     1 
ATOM   457  C C5     . DG  A 1 21  ? 38.836  30.006  16.717 1.00 41.19 ? 469 DG  C C5     1 
ATOM   458  C C6     . DG  A 1 21  ? 38.425  31.041  17.634 1.00 40.80 ? 469 DG  C C6     1 
ATOM   459  O O6     . DG  A 1 21  ? 38.957  31.401  18.713 1.00 35.35 ? 469 DG  C O6     1 
ATOM   460  N N1     . DG  A 1 21  ? 37.268  31.677  17.195 1.00 33.22 ? 469 DG  C N1     1 
ATOM   461  C C2     . DG  A 1 21  ? 36.582  31.360  16.064 1.00 37.03 ? 469 DG  C C2     1 
ATOM   462  N N2     . DG  A 1 21  ? 35.511  32.112  15.826 1.00 36.08 ? 469 DG  C N2     1 
ATOM   463  N N3     . DG  A 1 21  ? 36.922  30.388  15.220 1.00 41.67 ? 469 DG  C N3     1 
ATOM   464  C C4     . DG  A 1 21  ? 38.061  29.762  15.599 1.00 41.16 ? 469 DG  C C4     1 
ATOM   465  H H1     . DG  A 1 21  ? 36.914  32.474  17.706 1.00 0.00  ? 469 DG  C H1     1 
ATOM   466  H H21    . DG  A 1 21  ? 34.923  31.930  15.025 1.00 0.00  ? 469 DG  C H21    1 
ATOM   467  H H22    . DG  A 1 21  ? 35.326  32.877  16.462 1.00 0.00  ? 469 DG  C H22    1 
ATOM   468  P P      . DA  A 1 22  ? 38.045  28.094  9.597  1.00 31.94 ? 470 DA  C P      1 
ATOM   469  O OP1    . DA  A 1 22  ? 37.428  27.346  8.457  1.00 31.05 ? 470 DA  C OP1    1 
ATOM   470  O OP2    . DA  A 1 22  ? 39.499  28.398  9.593  1.00 33.31 ? 470 DA  C OP2    1 
ATOM   471  O "O5'"  . DA  A 1 22  ? 37.272  29.455  9.853  1.00 29.04 ? 470 DA  C "O5'"  1 
ATOM   472  C "C5'"  . DA  A 1 22  ? 35.885  29.437  10.146 1.00 37.22 ? 470 DA  C "C5'"  1 
ATOM   473  C "C4'"  . DA  A 1 22  ? 35.341  30.841  10.135 1.00 38.35 ? 470 DA  C "C4'"  1 
ATOM   474  O "O4'"  . DA  A 1 22  ? 35.647  31.509  11.378 1.00 34.90 ? 470 DA  C "O4'"  1 
ATOM   475  C "C3'"  . DA  A 1 22  ? 35.977  31.666  9.035  1.00 40.60 ? 470 DA  C "C3'"  1 
ATOM   476  O "O3'"  . DA  A 1 22  ? 35.023  32.526  8.447  1.00 48.16 ? 470 DA  C "O3'"  1 
ATOM   477  C "C2'"  . DA  A 1 22  ? 37.059  32.440  9.757  1.00 40.54 ? 470 DA  C "C2'"  1 
ATOM   478  C "C1'"  . DA  A 1 22  ? 36.499  32.613  11.159 1.00 39.20 ? 470 DA  C "C1'"  1 
ATOM   479  N N9     . DA  A 1 22  ? 37.525  32.570  12.198 1.00 38.69 ? 470 DA  C N9     1 
ATOM   480  C C8     . DA  A 1 22  ? 38.531  31.641  12.301 1.00 40.89 ? 470 DA  C C8     1 
ATOM   481  N N7     . DA  A 1 22  ? 39.307  31.811  13.346 1.00 42.96 ? 470 DA  C N7     1 
ATOM   482  C C5     . DA  A 1 22  ? 38.780  32.934  13.973 1.00 40.02 ? 470 DA  C C5     1 
ATOM   483  C C6     . DA  A 1 22  ? 39.156  33.620  15.140 1.00 36.44 ? 470 DA  C C6     1 
ATOM   484  N N6     . DA  A 1 22  ? 40.152  33.231  15.931 1.00 33.78 ? 470 DA  C N6     1 
ATOM   485  N N1     . DA  A 1 22  ? 38.448  34.716  15.480 1.00 35.40 ? 470 DA  C N1     1 
ATOM   486  C C2     . DA  A 1 22  ? 37.406  35.070  14.711 1.00 37.61 ? 470 DA  C C2     1 
ATOM   487  N N3     . DA  A 1 22  ? 36.939  34.495  13.602 1.00 40.38 ? 470 DA  C N3     1 
ATOM   488  C C4     . DA  A 1 22  ? 37.686  33.420  13.274 1.00 39.84 ? 470 DA  C C4     1 
ATOM   489  H H61    . DA  A 1 22  ? 40.671  32.387  15.726 1.00 0.00  ? 470 DA  C H61    1 
ATOM   490  H H62    . DA  A 1 22  ? 40.381  33.777  16.750 1.00 0.00  ? 470 DA  C H62    1 
ATOM   491  P P      . DA  A 1 23  ? 35.365  33.212  7.046  1.00 53.96 ? 471 DA  C P      1 
ATOM   492  O OP1    . DA  A 1 23  ? 34.094  33.279  6.277  1.00 56.91 ? 471 DA  C OP1    1 
ATOM   493  O OP2    . DA  A 1 23  ? 36.559  32.545  6.443  1.00 52.88 ? 471 DA  C OP2    1 
ATOM   494  O "O5'"  . DA  A 1 23  ? 35.799  34.687  7.456  1.00 54.27 ? 471 DA  C "O5'"  1 
ATOM   495  C "C5'"  . DA  A 1 23  ? 34.887  35.556  8.130  1.00 56.22 ? 471 DA  C "C5'"  1 
ATOM   496  C "C4'"  . DA  A 1 23  ? 35.592  36.824  8.557  1.00 55.49 ? 471 DA  C "C4'"  1 
ATOM   497  O "O4'"  . DA  A 1 23  ? 36.493  36.562  9.661  1.00 54.06 ? 471 DA  C "O4'"  1 
ATOM   498  C "C3'"  . DA  A 1 23  ? 36.453  37.462  7.465  1.00 55.78 ? 471 DA  C "C3'"  1 
ATOM   499  O "O3'"  . DA  A 1 23  ? 36.439  38.873  7.650  1.00 60.62 ? 471 DA  C "O3'"  1 
ATOM   500  C "C2'"  . DA  A 1 23  ? 37.838  36.950  7.790  1.00 54.02 ? 471 DA  C "C2'"  1 
ATOM   501  C "C1'"  . DA  A 1 23  ? 37.786  37.019  9.301  1.00 53.72 ? 471 DA  C "C1'"  1 
ATOM   502  N N9     . DA  A 1 23  ? 38.772  36.219  10.013 1.00 51.39 ? 471 DA  C N9     1 
ATOM   503  C C8     . DA  A 1 23  ? 39.403  35.055  9.642  1.00 50.12 ? 471 DA  C C8     1 
ATOM   504  N N7     . DA  A 1 23  ? 40.250  34.603  10.536 1.00 50.67 ? 471 DA  C N7     1 
ATOM   505  C C5     . DA  A 1 23  ? 40.175  35.540  11.568 1.00 49.76 ? 471 DA  C C5     1 
ATOM   506  C C6     . DA  A 1 23  ? 40.842  35.652  12.821 1.00 46.33 ? 471 DA  C C6     1 
ATOM   507  N N6     . DA  A 1 23  ? 41.751  34.788  13.264 1.00 43.27 ? 471 DA  C N6     1 
ATOM   508  N N1     . DA  A 1 23  ? 40.534  36.703  13.604 1.00 44.84 ? 471 DA  C N1     1 
ATOM   509  C C2     . DA  A 1 23  ? 39.625  37.585  13.161 1.00 50.24 ? 471 DA  C C2     1 
ATOM   510  N N3     . DA  A 1 23  ? 38.937  37.594  12.011 1.00 48.11 ? 471 DA  C N3     1 
ATOM   511  C C4     . DA  A 1 23  ? 39.265  36.534  11.258 1.00 50.06 ? 471 DA  C C4     1 
ATOM   512  H H61    . DA  A 1 23  ? 41.997  33.987  12.698 1.00 0.00  ? 471 DA  C H61    1 
ATOM   513  H H62    . DA  A 1 23  ? 42.197  34.937  14.158 1.00 0.00  ? 471 DA  C H62    1 
ATOM   514  P P      . DG  A 1 24  ? 36.556  39.844  6.382  1.00 66.79 ? 472 DG  C P      1 
ATOM   515  O OP1    . DG  A 1 24  ? 35.230  39.829  5.694  1.00 70.56 ? 472 DG  C OP1    1 
ATOM   516  O OP2    . DG  A 1 24  ? 37.791  39.464  5.626  1.00 64.46 ? 472 DG  C OP2    1 
ATOM   517  O "O5'"  . DG  A 1 24  ? 36.762  41.292  7.016  1.00 66.30 ? 472 DG  C "O5'"  1 
ATOM   518  C "C5'"  . DG  A 1 24  ? 35.952  41.748  8.096  1.00 61.61 ? 472 DG  C "C5'"  1 
ATOM   519  C "C4'"  . DG  A 1 24  ? 36.791  42.563  9.054  1.00 59.35 ? 472 DG  C "C4'"  1 
ATOM   520  O "O4'"  . DG  A 1 24  ? 37.647  41.703  9.853  1.00 54.69 ? 472 DG  C "O4'"  1 
ATOM   521  C "C3'"  . DG  A 1 24  ? 37.717  43.551  8.351  1.00 60.13 ? 472 DG  C "C3'"  1 
ATOM   522  O "O3'"  . DG  A 1 24  ? 37.744  44.786  9.075  1.00 69.17 ? 472 DG  C "O3'"  1 
ATOM   523  C "C2'"  . DG  A 1 24  ? 39.061  42.837  8.368  1.00 54.64 ? 472 DG  C "C2'"  1 
ATOM   524  C "C1'"  . DG  A 1 24  ? 39.012  42.061  9.674  1.00 46.70 ? 472 DG  C "C1'"  1 
ATOM   525  N N9     . DG  A 1 24  ? 39.811  40.836  9.742  1.00 36.83 ? 472 DG  C N9     1 
ATOM   526  C C8     . DG  A 1 24  ? 39.716  39.744  8.927  1.00 33.75 ? 472 DG  C C8     1 
ATOM   527  N N7     . DG  A 1 24  ? 40.519  38.773  9.269  1.00 33.14 ? 472 DG  C N7     1 
ATOM   528  C C5     . DG  A 1 24  ? 41.191  39.254  10.376 1.00 27.51 ? 472 DG  C C5     1 
ATOM   529  C C6     . DG  A 1 24  ? 42.172  38.640  11.188 1.00 25.38 ? 472 DG  C C6     1 
ATOM   530  O O6     . DG  A 1 24  ? 42.638  37.501  11.117 1.00 27.26 ? 472 DG  C O6     1 
ATOM   531  N N1     . DG  A 1 24  ? 42.603  39.484  12.189 1.00 25.44 ? 472 DG  C N1     1 
ATOM   532  C C2     . DG  A 1 24  ? 42.130  40.747  12.407 1.00 32.87 ? 472 DG  C C2     1 
ATOM   533  N N2     . DG  A 1 24  ? 42.648  41.390  13.454 1.00 39.18 ? 472 DG  C N2     1 
ATOM   534  N N3     . DG  A 1 24  ? 41.210  41.335  11.666 1.00 32.60 ? 472 DG  C N3     1 
ATOM   535  C C4     . DG  A 1 24  ? 40.786  40.534  10.670 1.00 31.69 ? 472 DG  C C4     1 
ATOM   536  H H1     . DG  A 1 24  ? 43.295  39.175  12.862 1.00 0.00  ? 472 DG  C H1     1 
ATOM   537  H H21    . DG  A 1 24  ? 42.339  42.325  13.676 1.00 0.00  ? 472 DG  C H21    1 
ATOM   538  H H22    . DG  A 1 24  ? 43.330  40.911  14.027 1.00 0.00  ? 472 DG  C H22    1 
ATOM   539  P P      . DG  A 1 25  ? 36.864  46.034  8.556  1.00 75.82 ? 473 DG  C P      1 
ATOM   540  O OP1    . DG  A 1 25  ? 36.895  47.112  9.586  1.00 78.60 ? 473 DG  C OP1    1 
ATOM   541  O OP2    . DG  A 1 25  ? 35.548  45.494  8.100  1.00 77.65 ? 473 DG  C OP2    1 
ATOM   542  O "O5'"  . DG  A 1 25  ? 37.650  46.548  7.270  1.00 79.85 ? 473 DG  C "O5'"  1 
ATOM   543  C "C5'"  . DG  A 1 25  ? 37.796  45.707  6.132  1.00 84.36 ? 473 DG  C "C5'"  1 
ATOM   544  C "C4'"  . DG  A 1 25  ? 39.260  45.480  5.843  1.00 88.82 ? 473 DG  C "C4'"  1 
ATOM   545  O "O4'"  . DG  A 1 25  ? 39.504  44.053  5.757  1.00 90.82 ? 473 DG  C "O4'"  1 
ATOM   546  C "C3'"  . DG  A 1 25  ? 39.761  46.095  4.531  1.00 90.76 ? 473 DG  C "C3'"  1 
ATOM   547  O "O3'"  . DG  A 1 25  ? 41.055  46.710  4.585  1.00 90.40 ? 473 DG  C "O3'"  1 
ATOM   548  C "C2'"  . DG  A 1 25  ? 39.898  44.897  3.612  1.00 91.84 ? 473 DG  C "C2'"  1 
ATOM   549  C "C1'"  . DG  A 1 25  ? 40.227  43.770  4.577  1.00 91.92 ? 473 DG  C "C1'"  1 
ATOM   550  N N9     . DG  A 1 25  ? 39.819  42.453  4.087  1.00 92.85 ? 473 DG  C N9     1 
ATOM   551  C C8     . DG  A 1 25  ? 38.617  42.120  3.506  1.00 93.50 ? 473 DG  C C8     1 
ATOM   552  N N7     . DG  A 1 25  ? 38.586  40.889  3.073  1.00 94.47 ? 473 DG  C N7     1 
ATOM   553  C C5     . DG  A 1 25  ? 39.836  40.377  3.404  1.00 95.66 ? 473 DG  C C5     1 
ATOM   554  C C6     . DG  A 1 25  ? 40.400  39.097  3.159  1.00 97.12 ? 473 DG  C C6     1 
ATOM   555  O O6     . DG  A 1 25  ? 39.905  38.142  2.536  1.00 99.21 ? 473 DG  C O6     1 
ATOM   556  N N1     . DG  A 1 25  ? 41.684  38.989  3.700  1.00 96.37 ? 473 DG  C N1     1 
ATOM   557  C C2     . DG  A 1 25  ? 42.348  39.995  4.361  1.00 95.11 ? 473 DG  C C2     1 
ATOM   558  N N2     . DG  A 1 25  ? 43.563  39.698  4.840  1.00 92.73 ? 473 DG  C N2     1 
ATOM   559  N N3     . DG  A 1 25  ? 41.849  41.206  4.551  1.00 94.84 ? 473 DG  C N3     1 
ATOM   560  C C4     . DG  A 1 25  ? 40.595  41.326  4.058  1.00 93.94 ? 473 DG  C C4     1 
ATOM   561  H "HO3'" . DG  A 1 25  ? 41.678  46.047  4.897  1.00 0.00  ? 473 DG  C "HO3'" 1 
ATOM   562  H H1     . DG  A 1 25  ? 42.152  38.097  3.622  1.00 0.00  ? 473 DG  C H1     1 
ATOM   563  H H21    . DG  A 1 25  ? 44.064  40.406  5.364  1.00 0.00  ? 473 DG  C H21    1 
ATOM   564  H H22    . DG  A 1 25  ? 43.978  38.787  4.703  1.00 0.00  ? 473 DG  C H22    1 
ATOM   565  O "O5'"  . DC  B 2 1   ? 50.454  40.255  18.503 1.00 62.28 ? 475 DC  D "O5'"  1 
ATOM   566  C "C5'"  . DC  B 2 1   ? 49.578  40.654  17.432 1.00 54.57 ? 475 DC  D "C5'"  1 
ATOM   567  C "C4'"  . DC  B 2 1   ? 48.310  41.330  17.896 1.00 48.02 ? 475 DC  D "C4'"  1 
ATOM   568  O "O4'"  . DC  B 2 1   ? 47.307  41.166  16.876 1.00 42.69 ? 475 DC  D "O4'"  1 
ATOM   569  C "C3'"  . DC  B 2 1   ? 47.704  40.755  19.174 1.00 49.78 ? 475 DC  D "C3'"  1 
ATOM   570  O "O3'"  . DC  B 2 1   ? 47.129  41.824  19.958 1.00 50.04 ? 475 DC  D "O3'"  1 
ATOM   571  C "C2'"  . DC  B 2 1   ? 46.677  39.759  18.658 1.00 44.26 ? 475 DC  D "C2'"  1 
ATOM   572  C "C1'"  . DC  B 2 1   ? 46.220  40.395  17.357 1.00 44.16 ? 475 DC  D "C1'"  1 
ATOM   573  N N1     . DC  B 2 1   ? 45.866  39.424  16.309 1.00 42.36 ? 475 DC  D N1     1 
ATOM   574  C C2     . DC  B 2 1   ? 44.835  39.739  15.394 1.00 41.05 ? 475 DC  D C2     1 
ATOM   575  O O2     . DC  B 2 1   ? 44.247  40.824  15.489 1.00 38.28 ? 475 DC  D O2     1 
ATOM   576  N N3     . DC  B 2 1   ? 44.507  38.843  14.432 1.00 40.95 ? 475 DC  D N3     1 
ATOM   577  C C4     . DC  B 2 1   ? 45.139  37.669  14.361 1.00 42.49 ? 475 DC  D C4     1 
ATOM   578  N N4     . DC  B 2 1   ? 44.747  36.801  13.415 1.00 39.30 ? 475 DC  D N4     1 
ATOM   579  C C5     . DC  B 2 1   ? 46.198  37.327  15.271 1.00 45.42 ? 475 DC  D C5     1 
ATOM   580  C C6     . DC  B 2 1   ? 46.523  38.226  16.217 1.00 43.89 ? 475 DC  D C6     1 
ATOM   581  H H41    . DC  B 2 1   ? 43.941  37.009  12.841 1.00 0.00  ? 475 DC  D H41    1 
ATOM   582  H H42    . DC  B 2 1   ? 45.265  35.945  13.262 1.00 0.00  ? 475 DC  D H42    1 
ATOM   583  H "HO5'" . DC  B 2 1   ? 49.969  39.654  19.070 1.00 0.00  ? 475 DC  D "HO5'" 1 
ATOM   584  P P      . DT  B 2 2   ? 46.290  41.495  21.294 1.00 44.12 ? 476 DT  D P      1 
ATOM   585  O OP1    . DT  B 2 2   ? 46.494  42.619  22.232 1.00 42.40 ? 476 DT  D OP1    1 
ATOM   586  O OP2    . DT  B 2 2   ? 46.575  40.098  21.739 1.00 41.79 ? 476 DT  D OP2    1 
ATOM   587  O "O5'"  . DT  B 2 2   ? 44.801  41.602  20.753 1.00 50.83 ? 476 DT  D "O5'"  1 
ATOM   588  C "C5'"  . DT  B 2 2   ? 44.459  42.651  19.847 1.00 51.54 ? 476 DT  D "C5'"  1 
ATOM   589  C "C4'"  . DT  B 2 2   ? 43.127  42.388  19.187 1.00 52.14 ? 476 DT  D "C4'"  1 
ATOM   590  O "O4'"  . DT  B 2 2   ? 43.215  41.294  18.247 1.00 49.90 ? 476 DT  D "O4'"  1 
ATOM   591  C "C3'"  . DT  B 2 2   ? 42.012  42.026  20.159 1.00 55.49 ? 476 DT  D "C3'"  1 
ATOM   592  O "O3'"  . DT  B 2 2   ? 40.890  42.868  19.910 1.00 62.68 ? 476 DT  D "O3'"  1 
ATOM   593  C "C2'"  . DT  B 2 2   ? 41.714  40.567  19.849 1.00 51.93 ? 476 DT  D "C2'"  1 
ATOM   594  C "C1'"  . DT  B 2 2   ? 42.069  40.484  18.384 1.00 47.33 ? 476 DT  D "C1'"  1 
ATOM   595  N N1     . DT  B 2 2   ? 42.385  39.140  17.841 1.00 44.77 ? 476 DT  D N1     1 
ATOM   596  C C2     . DT  B 2 2   ? 41.716  38.736  16.693 1.00 44.06 ? 476 DT  D C2     1 
ATOM   597  O O2     . DT  B 2 2   ? 40.865  39.422  16.126 1.00 39.50 ? 476 DT  D O2     1 
ATOM   598  N N3     . DT  B 2 2   ? 42.083  37.495  16.220 1.00 39.06 ? 476 DT  D N3     1 
ATOM   599  C C4     . DT  B 2 2   ? 43.021  36.641  16.757 1.00 35.13 ? 476 DT  D C4     1 
ATOM   600  O O4     . DT  B 2 2   ? 43.265  35.571  16.192 1.00 27.55 ? 476 DT  D O4     1 
ATOM   601  C C5     . DT  B 2 2   ? 43.657  37.112  17.970 1.00 36.38 ? 476 DT  D C5     1 
ATOM   602  C C7     . DT  B 2 2   ? 44.656  36.227  18.640 1.00 37.78 ? 476 DT  D C7     1 
ATOM   603  C C6     . DT  B 2 2   ? 43.318  38.323  18.444 1.00 39.34 ? 476 DT  D C6     1 
ATOM   604  H H3     . DT  B 2 2   ? 41.610  37.202  15.376 1.00 0.00  ? 476 DT  D H3     1 
ATOM   605  P P      . DT  B 2 3   ? 39.905  43.248  21.124 1.00 67.38 ? 477 DT  D P      1 
ATOM   606  O OP1    . DT  B 2 3   ? 39.564  44.708  21.021 1.00 64.08 ? 477 DT  D OP1    1 
ATOM   607  O OP2    . DT  B 2 3   ? 40.476  42.705  22.393 1.00 64.86 ? 477 DT  D OP2    1 
ATOM   608  O "O5'"  . DT  B 2 3   ? 38.615  42.373  20.784 1.00 64.47 ? 477 DT  D "O5'"  1 
ATOM   609  C "C5'"  . DT  B 2 3   ? 37.902  42.587  19.562 1.00 56.58 ? 477 DT  D "C5'"  1 
ATOM   610  C "C4'"  . DT  B 2 3   ? 36.911  41.475  19.331 1.00 48.23 ? 477 DT  D "C4'"  1 
ATOM   611  O "O4'"  . DT  B 2 3   ? 37.558  40.359  18.682 1.00 41.96 ? 477 DT  D "O4'"  1 
ATOM   612  C "C3'"  . DT  B 2 3   ? 36.295  40.924  20.614 1.00 45.63 ? 477 DT  D "C3'"  1 
ATOM   613  O "O3'"  . DT  B 2 3   ? 34.895  40.729  20.410 1.00 47.64 ? 477 DT  D "O3'"  1 
ATOM   614  C "C2'"  . DT  B 2 3   ? 36.983  39.578  20.781 1.00 41.17 ? 477 DT  D "C2'"  1 
ATOM   615  C "C1'"  . DT  B 2 3   ? 37.147  39.183  19.339 1.00 40.61 ? 477 DT  D "C1'"  1 
ATOM   616  N N1     . DT  B 2 3   ? 38.110  38.125  19.029 1.00 39.26 ? 477 DT  D N1     1 
ATOM   617  C C2     . DT  B 2 3   ? 38.028  37.551  17.774 1.00 35.62 ? 477 DT  D C2     1 
ATOM   618  O O2     . DT  B 2 3   ? 37.215  37.907  16.947 1.00 34.01 ? 477 DT  D O2     1 
ATOM   619  N N3     . DT  B 2 3   ? 38.917  36.552  17.527 1.00 32.16 ? 477 DT  D N3     1 
ATOM   620  C C4     . DT  B 2 3   ? 39.867  36.054  18.394 1.00 34.46 ? 477 DT  D C4     1 
ATOM   621  O O4     . DT  B 2 3   ? 40.575  35.117  18.032 1.00 28.66 ? 477 DT  D O4     1 
ATOM   622  C C5     . DT  B 2 3   ? 39.914  36.711  19.717 1.00 35.81 ? 477 DT  D C5     1 
ATOM   623  C C7     . DT  B 2 3   ? 40.905  36.239  20.736 1.00 32.33 ? 477 DT  D C7     1 
ATOM   624  C C6     . DT  B 2 3   ? 39.049  37.705  19.954 1.00 36.87 ? 477 DT  D C6     1 
ATOM   625  H H3     . DT  B 2 3   ? 38.865  36.140  16.607 1.00 0.00  ? 477 DT  D H3     1 
ATOM   626  P P      . DC  B 2 4   ? 33.881  40.813  21.663 1.00 50.30 ? 478 DC  D P      1 
ATOM   627  O OP1    . DC  B 2 4   ? 33.479  42.245  21.826 1.00 47.10 ? 478 DC  D OP1    1 
ATOM   628  O OP2    . DC  B 2 4   ? 34.490  40.081  22.817 1.00 46.78 ? 478 DC  D OP2    1 
ATOM   629  O "O5'"  . DC  B 2 4   ? 32.632  39.989  21.131 1.00 47.93 ? 478 DC  D "O5'"  1 
ATOM   630  C "C5'"  . DC  B 2 4   ? 32.282  40.069  19.757 1.00 48.21 ? 478 DC  D "C5'"  1 
ATOM   631  C "C4'"  . DC  B 2 4   ? 32.081  38.692  19.171 1.00 45.40 ? 478 DC  D "C4'"  1 
ATOM   632  O "O4'"  . DC  B 2 4   ? 33.318  38.089  18.691 1.00 42.94 ? 478 DC  D "O4'"  1 
ATOM   633  C "C3'"  . DC  B 2 4   ? 31.437  37.671  20.108 1.00 44.16 ? 478 DC  D "C3'"  1 
ATOM   634  O "O3'"  . DC  B 2 4   ? 30.374  37.007  19.427 1.00 44.60 ? 478 DC  D "O3'"  1 
ATOM   635  C "C2'"  . DC  B 2 4   ? 32.536  36.660  20.332 1.00 42.80 ? 478 DC  D "C2'"  1 
ATOM   636  C "C1'"  . DC  B 2 4   ? 33.242  36.707  18.995 1.00 41.15 ? 478 DC  D "C1'"  1 
ATOM   637  N N1     . DC  B 2 4   ? 34.592  36.112  19.091 1.00 39.52 ? 478 DC  D N1     1 
ATOM   638  C C2     . DC  B 2 4   ? 34.960  35.118  18.166 1.00 36.61 ? 478 DC  D C2     1 
ATOM   639  O O2     . DC  B 2 4   ? 34.277  34.960  17.151 1.00 40.82 ? 478 DC  D O2     1 
ATOM   640  N N3     . DC  B 2 4   ? 36.057  34.371  18.402 1.00 33.69 ? 478 DC  D N3     1 
ATOM   641  C C4     . DC  B 2 4   ? 36.804  34.612  19.476 1.00 34.70 ? 478 DC  D C4     1 
ATOM   642  N N4     . DC  B 2 4   ? 37.822  33.777  19.734 1.00 30.78 ? 478 DC  D N4     1 
ATOM   643  C C5     . DC  B 2 4   ? 36.526  35.707  20.358 1.00 36.28 ? 478 DC  D C5     1 
ATOM   644  C C6     . DC  B 2 4   ? 35.430  36.431  20.123 1.00 36.97 ? 478 DC  D C6     1 
ATOM   645  H H41    . DC  B 2 4   ? 38.352  33.894  20.591 1.00 0.00  ? 478 DC  D H41    1 
ATOM   646  H H42    . DC  B 2 4   ? 38.083  33.057  19.079 1.00 0.00  ? 478 DC  D H42    1 
ATOM   647  P P      . DC  B 2 5   ? 29.390  36.031  20.229 1.00 39.04 ? 479 DC  D P      1 
ATOM   648  O OP1    . DC  B 2 5   ? 28.179  36.810  20.586 1.00 42.06 ? 479 DC  D OP1    1 
ATOM   649  O OP2    . DC  B 2 5   ? 30.172  35.362  21.295 1.00 33.78 ? 479 DC  D OP2    1 
ATOM   650  O "O5'"  . DC  B 2 5   ? 29.017  34.946  19.137 1.00 31.34 ? 479 DC  D "O5'"  1 
ATOM   651  C "C5'"  . DC  B 2 5   ? 29.665  33.698  19.167 1.00 29.29 ? 479 DC  D "C5'"  1 
ATOM   652  C "C4'"  . DC  B 2 5   ? 29.618  33.036  17.822 1.00 25.57 ? 479 DC  D "C4'"  1 
ATOM   653  O "O4'"  . DC  B 2 5   ? 30.978  33.055  17.345 1.00 29.42 ? 479 DC  D "O4'"  1 
ATOM   654  C "C3'"  . DC  B 2 5   ? 29.263  31.569  17.996 1.00 24.20 ? 479 DC  D "C3'"  1 
ATOM   655  O "O3'"  . DC  B 2 5   ? 28.147  31.120  17.271 1.00 19.84 ? 479 DC  D "O3'"  1 
ATOM   656  C "C2'"  . DC  B 2 5   ? 30.539  30.770  17.771 1.00 25.54 ? 479 DC  D "C2'"  1 
ATOM   657  C "C1'"  . DC  B 2 5   ? 31.623  31.800  17.567 1.00 24.09 ? 479 DC  D "C1'"  1 
ATOM   658  N N1     . DC  B 2 5   ? 32.489  31.947  18.759 1.00 22.71 ? 479 DC  D N1     1 
ATOM   659  C C2     . DC  B 2 5   ? 33.437  30.975  19.019 1.00 21.51 ? 479 DC  D C2     1 
ATOM   660  O O2     . DC  B 2 5   ? 33.454  29.950  18.343 1.00 28.17 ? 479 DC  D O2     1 
ATOM   661  N N3     . DC  B 2 5   ? 34.305  31.155  20.022 1.00 19.64 ? 479 DC  D N3     1 
ATOM   662  C C4     . DC  B 2 5   ? 34.260  32.250  20.756 1.00 14.28 ? 479 DC  D C4     1 
ATOM   663  N N4     . DC  B 2 5   ? 35.213  32.402  21.665 1.00 22.24 ? 479 DC  D N4     1 
ATOM   664  C C5     . DC  B 2 5   ? 33.255  33.233  20.582 1.00 11.43 ? 479 DC  D C5     1 
ATOM   665  C C6     . DC  B 2 5   ? 32.402  33.046  19.578 1.00 19.36 ? 479 DC  D C6     1 
ATOM   666  H H41    . DC  B 2 5   ? 35.198  33.208  22.274 1.00 0.00  ? 479 DC  D H41    1 
ATOM   667  H H42    . DC  B 2 5   ? 35.960  31.721  21.736 1.00 0.00  ? 479 DC  D H42    1 
ATOM   668  P P      . DT  B 2 6   ? 27.225  30.002  17.946 1.00 24.75 ? 480 DT  D P      1 
ATOM   669  O OP1    . DT  B 2 6   ? 25.965  29.892  17.191 1.00 29.05 ? 480 DT  D OP1    1 
ATOM   670  O OP2    . DT  B 2 6   ? 27.199  30.325  19.402 1.00 25.08 ? 480 DT  D OP2    1 
ATOM   671  O "O5'"  . DT  B 2 6   ? 28.069  28.669  17.709 1.00 23.99 ? 480 DT  D "O5'"  1 
ATOM   672  C "C5'"  . DT  B 2 6   ? 28.711  28.485  16.445 1.00 27.95 ? 480 DT  D "C5'"  1 
ATOM   673  C "C4'"  . DT  B 2 6   ? 29.456  27.172  16.382 1.00 28.88 ? 480 DT  D "C4'"  1 
ATOM   674  O "O4'"  . DT  B 2 6   ? 30.717  27.277  17.064 1.00 25.33 ? 480 DT  D "O4'"  1 
ATOM   675  C "C3'"  . DT  B 2 6   ? 28.755  25.941  16.951 1.00 30.52 ? 480 DT  D "C3'"  1 
ATOM   676  O "O3'"  . DT  B 2 6   ? 29.090  24.805  16.162 1.00 28.86 ? 480 DT  D "O3'"  1 
ATOM   677  C "C2'"  . DT  B 2 6   ? 29.369  25.789  18.326 1.00 29.70 ? 480 DT  D "C2'"  1 
ATOM   678  C "C1'"  . DT  B 2 6   ? 30.761  26.354  18.139 1.00 27.93 ? 480 DT  D "C1'"  1 
ATOM   679  N N1     . DT  B 2 6   ? 31.230  27.091  19.296 1.00 29.42 ? 480 DT  D N1     1 
ATOM   680  C C2     . DT  B 2 6   ? 32.398  26.665  19.848 1.00 34.11 ? 480 DT  D C2     1 
ATOM   681  O O2     . DT  B 2 6   ? 32.994  25.666  19.431 1.00 33.89 ? 480 DT  D O2     1 
ATOM   682  N N3     . DT  B 2 6   ? 32.849  27.434  20.898 1.00 32.78 ? 480 DT  D N3     1 
ATOM   683  C C4     . DT  B 2 6   ? 32.228  28.558  21.432 1.00 28.64 ? 480 DT  D C4     1 
ATOM   684  O O4     . DT  B 2 6   ? 32.756  29.151  22.380 1.00 34.12 ? 480 DT  D O4     1 
ATOM   685  C C5     . DT  B 2 6   ? 30.972  28.930  20.798 1.00 19.19 ? 480 DT  D C5     1 
ATOM   686  C C7     . DT  B 2 6   ? 30.225  30.123  21.293 1.00 12.10 ? 480 DT  D C7     1 
ATOM   687  C C6     . DT  B 2 6   ? 30.543  28.185  19.790 1.00 22.42 ? 480 DT  D C6     1 
ATOM   688  H H3     . DT  B 2 6   ? 33.739  27.123  21.253 1.00 0.00  ? 480 DT  D H3     1 
ATOM   689  P P      . DC  B 2 7   ? 28.358  23.422  16.426 1.00 33.25 ? 481 DC  D P      1 
ATOM   690  O OP1    . DC  B 2 7   ? 28.616  22.540  15.263 1.00 30.27 ? 481 DC  D OP1    1 
ATOM   691  O OP2    . DC  B 2 7   ? 26.971  23.747  16.815 1.00 35.77 ? 481 DC  D OP2    1 
ATOM   692  O "O5'"  . DC  B 2 7   ? 29.109  22.830  17.701 1.00 37.42 ? 481 DC  D "O5'"  1 
ATOM   693  C "C5'"  . DC  B 2 7   ? 30.487  22.499  17.599 1.00 37.89 ? 481 DC  D "C5'"  1 
ATOM   694  C "C4'"  . DC  B 2 7   ? 30.946  21.638  18.752 1.00 34.25 ? 481 DC  D "C4'"  1 
ATOM   695  O "O4'"  . DC  B 2 7   ? 31.508  22.504  19.758 1.00 32.65 ? 481 DC  D "O4'"  1 
ATOM   696  C "C3'"  . DC  B 2 7   ? 29.945  20.731  19.470 1.00 34.22 ? 481 DC  D "C3'"  1 
ATOM   697  O "O3'"  . DC  B 2 7   ? 30.644  19.526  19.837 1.00 33.58 ? 481 DC  D "O3'"  1 
ATOM   698  C "C2'"  . DC  B 2 7   ? 29.613  21.540  20.716 1.00 35.48 ? 481 DC  D "C2'"  1 
ATOM   699  C "C1'"  . DC  B 2 7   ? 30.951  22.204  21.016 1.00 31.31 ? 481 DC  D "C1'"  1 
ATOM   700  N N1     . DC  B 2 7   ? 30.923  23.461  21.770 1.00 28.37 ? 481 DC  D N1     1 
ATOM   701  C C2     . DC  B 2 7   ? 32.095  23.875  22.413 1.00 27.40 ? 481 DC  D C2     1 
ATOM   702  O O2     . DC  B 2 7   ? 33.116  23.181  22.332 1.00 28.37 ? 481 DC  D O2     1 
ATOM   703  N N3     . DC  B 2 7   ? 32.094  25.023  23.093 1.00 24.26 ? 481 DC  D N3     1 
ATOM   704  C C4     . DC  B 2 7   ? 31.006  25.771  23.136 1.00 22.73 ? 481 DC  D C4     1 
ATOM   705  N N4     . DC  B 2 7   ? 31.084  26.918  23.812 1.00 21.67 ? 481 DC  D N4     1 
ATOM   706  C C5     . DC  B 2 7   ? 29.798  25.383  22.492 1.00 21.61 ? 481 DC  D C5     1 
ATOM   707  C C6     . DC  B 2 7   ? 29.801  24.229  21.834 1.00 26.43 ? 481 DC  D C6     1 
ATOM   708  H H41    . DC  B 2 7   ? 30.276  27.520  23.861 1.00 0.00  ? 481 DC  D H41    1 
ATOM   709  H H42    . DC  B 2 7   ? 31.940  27.181  24.286 1.00 0.00  ? 481 DC  D H42    1 
ATOM   710  P P      . DA  B 2 8   ? 29.843  18.153  20.103 1.00 37.93 ? 482 DA  D P      1 
ATOM   711  O OP1    . DA  B 2 8   ? 30.168  17.127  19.065 1.00 30.72 ? 482 DA  D OP1    1 
ATOM   712  O OP2    . DA  B 2 8   ? 28.421  18.483  20.384 1.00 41.17 ? 482 DA  D OP2    1 
ATOM   713  O "O5'"  . DA  B 2 8   ? 30.469  17.637  21.472 1.00 37.66 ? 482 DA  D "O5'"  1 
ATOM   714  C "C5'"  . DA  B 2 8   ? 31.843  17.258  21.533 1.00 36.84 ? 482 DA  D "C5'"  1 
ATOM   715  C "C4'"  . DA  B 2 8   ? 32.337  17.224  22.963 1.00 29.84 ? 482 DA  D "C4'"  1 
ATOM   716  O "O4'"  . DA  B 2 8   ? 32.295  18.545  23.551 1.00 27.07 ? 482 DA  D "O4'"  1 
ATOM   717  C "C3'"  . DA  B 2 8   ? 31.605  16.305  23.939 1.00 25.21 ? 482 DA  D "C3'"  1 
ATOM   718  O "O3'"  . DA  B 2 8   ? 32.625  15.805  24.814 1.00 26.23 ? 482 DA  D "O3'"  1 
ATOM   719  C "C2'"  . DA  B 2 8   ? 30.680  17.270  24.661 1.00 19.94 ? 482 DA  D "C2'"  1 
ATOM   720  C "C1'"  . DA  B 2 8   ? 31.554  18.505  24.761 1.00 21.95 ? 482 DA  D "C1'"  1 
ATOM   721  N N9     . DA  B 2 8   ? 30.858  19.783  24.897 1.00 18.52 ? 482 DA  D N9     1 
ATOM   722  C C8     . DA  B 2 8   ? 29.626  20.116  24.414 1.00 19.10 ? 482 DA  D C8     1 
ATOM   723  N N7     . DA  B 2 8   ? 29.293  21.367  24.631 1.00 22.70 ? 482 DA  D N7     1 
ATOM   724  C C5     . DA  B 2 8   ? 30.371  21.889  25.343 1.00 15.09 ? 482 DA  D C5     1 
ATOM   725  C C6     . DA  B 2 8   ? 30.621  23.173  25.916 1.00 18.65 ? 482 DA  D C6     1 
ATOM   726  N N6     . DA  B 2 8   ? 29.752  24.193  25.912 1.00 17.73 ? 482 DA  D N6     1 
ATOM   727  N N1     . DA  B 2 8   ? 31.806  23.363  26.532 1.00 17.92 ? 482 DA  D N1     1 
ATOM   728  C C2     . DA  B 2 8   ? 32.652  22.325  26.610 1.00 20.64 ? 482 DA  D C2     1 
ATOM   729  N N3     . DA  B 2 8   ? 32.516  21.073  26.156 1.00 19.69 ? 482 DA  D N3     1 
ATOM   730  C C4     . DA  B 2 8   ? 31.342  20.921  25.516 1.00 19.28 ? 482 DA  D C4     1 
ATOM   731  H H61    . DA  B 2 8   ? 28.829  24.093  25.513 1.00 0.00  ? 482 DA  D H61    1 
ATOM   732  H H62    . DA  B 2 8   ? 30.014  25.083  26.311 1.00 0.00  ? 482 DA  D H62    1 
ATOM   733  P P      . DT  B 2 9   ? 32.348  14.573  25.807 1.00 24.49 ? 483 DT  D P      1 
ATOM   734  O OP1    . DT  B 2 9   ? 33.456  13.590  25.748 1.00 28.69 ? 483 DT  D OP1    1 
ATOM   735  O OP2    . DT  B 2 9   ? 30.943  14.084  25.664 1.00 30.82 ? 483 DT  D OP2    1 
ATOM   736  O "O5'"  . DT  B 2 9   ? 32.498  15.299  27.204 1.00 28.13 ? 483 DT  D "O5'"  1 
ATOM   737  C "C5'"  . DT  B 2 9   ? 33.451  16.321  27.367 1.00 22.24 ? 483 DT  D "C5'"  1 
ATOM   738  C "C4'"  . DT  B 2 9   ? 33.115  17.160  28.574 1.00 24.07 ? 483 DT  D "C4'"  1 
ATOM   739  O "O4'"  . DT  B 2 9   ? 32.463  18.413  28.226 1.00 19.44 ? 483 DT  D "O4'"  1 
ATOM   740  C "C3'"  . DT  B 2 9   ? 32.278  16.503  29.684 1.00 23.97 ? 483 DT  D "C3'"  1 
ATOM   741  O "O3'"  . DT  B 2 9   ? 32.996  16.695  30.923 1.00 31.62 ? 483 DT  D "O3'"  1 
ATOM   742  C "C2'"  . DT  B 2 9   ? 31.020  17.352  29.682 1.00 20.52 ? 483 DT  D "C2'"  1 
ATOM   743  C "C1'"  . DT  B 2 9   ? 31.554  18.709  29.259 1.00 17.97 ? 483 DT  D "C1'"  1 
ATOM   744  N N1     . DT  B 2 9   ? 30.527  19.632  28.752 1.00 17.69 ? 483 DT  D N1     1 
ATOM   745  C C2     . DT  B 2 9   ? 30.731  20.997  28.869 1.00 21.43 ? 483 DT  D C2     1 
ATOM   746  O O2     . DT  B 2 9   ? 31.777  21.487  29.254 1.00 30.42 ? 483 DT  D O2     1 
ATOM   747  N N3     . DT  B 2 9   ? 29.667  21.770  28.512 1.00 20.96 ? 483 DT  D N3     1 
ATOM   748  C C4     . DT  B 2 9   ? 28.456  21.333  28.009 1.00 18.91 ? 483 DT  D C4     1 
ATOM   749  O O4     . DT  B 2 9   ? 27.584  22.156  27.761 1.00 30.08 ? 483 DT  D O4     1 
ATOM   750  C C5     . DT  B 2 9   ? 28.333  19.896  27.833 1.00 15.76 ? 483 DT  D C5     1 
ATOM   751  C C7     . DT  B 2 9   ? 27.088  19.344  27.220 1.00 17.48 ? 483 DT  D C7     1 
ATOM   752  C C6     . DT  B 2 9   ? 29.353  19.131  28.218 1.00 17.68 ? 483 DT  D C6     1 
ATOM   753  H H3     . DT  B 2 9   ? 29.734  22.742  28.772 1.00 0.00  ? 483 DT  D H3     1 
ATOM   754  P P      . DG  B 2 10  ? 32.469  16.100  32.338 1.00 25.47 ? 484 DG  D P      1 
ATOM   755  O OP1    . DG  B 2 10  ? 33.302  14.920  32.683 1.00 23.56 ? 484 DG  D OP1    1 
ATOM   756  O OP2    . DG  B 2 10  ? 30.993  15.953  32.416 1.00 31.80 ? 484 DG  D OP2    1 
ATOM   757  O "O5'"  . DG  B 2 10  ? 32.888  17.333  33.244 1.00 23.67 ? 484 DG  D "O5'"  1 
ATOM   758  C "C5'"  . DG  B 2 10  ? 34.136  17.955  33.006 1.00 20.02 ? 484 DG  D "C5'"  1 
ATOM   759  C "C4'"  . DG  B 2 10  ? 34.146  19.392  33.467 1.00 21.72 ? 484 DG  D "C4'"  1 
ATOM   760  O "O4'"  . DG  B 2 10  ? 33.354  20.174  32.551 1.00 21.52 ? 484 DG  D "O4'"  1 
ATOM   761  C "C3'"  . DG  B 2 10  ? 33.538  19.637  34.843 1.00 27.86 ? 484 DG  D "C3'"  1 
ATOM   762  O "O3'"  . DG  B 2 10  ? 34.492  19.789  35.872 1.00 31.02 ? 484 DG  D "O3'"  1 
ATOM   763  C "C2'"  . DG  B 2 10  ? 32.793  20.952  34.704 1.00 28.46 ? 484 DG  D "C2'"  1 
ATOM   764  C "C1'"  . DG  B 2 10  ? 32.777  21.282  33.223 1.00 19.30 ? 484 DG  D "C1'"  1 
ATOM   765  N N9     . DG  B 2 10  ? 31.379  21.371  32.803 1.00 18.64 ? 484 DG  D N9     1 
ATOM   766  C C8     . DG  B 2 10  ? 30.624  20.414  32.160 1.00 14.44 ? 484 DG  D C8     1 
ATOM   767  N N7     . DG  B 2 10  ? 29.396  20.799  31.950 1.00 16.69 ? 484 DG  D N7     1 
ATOM   768  C C5     . DG  B 2 10  ? 29.349  22.082  32.470 1.00 17.24 ? 484 DG  D C5     1 
ATOM   769  C C6     . DG  B 2 10  ? 28.296  23.006  32.519 1.00 21.97 ? 484 DG  D C6     1 
ATOM   770  O O6     . DG  B 2 10  ? 27.161  22.894  32.079 1.00 27.86 ? 484 DG  D O6     1 
ATOM   771  N N1     . DG  B 2 10  ? 28.666  24.183  33.171 1.00 23.60 ? 484 DG  D N1     1 
ATOM   772  C C2     . DG  B 2 10  ? 29.901  24.423  33.726 1.00 18.46 ? 484 DG  D C2     1 
ATOM   773  N N2     . DG  B 2 10  ? 30.073  25.589  34.367 1.00 17.68 ? 484 DG  D N2     1 
ATOM   774  N N3     . DG  B 2 10  ? 30.895  23.573  33.663 1.00 16.29 ? 484 DG  D N3     1 
ATOM   775  C C4     . DG  B 2 10  ? 30.557  22.436  33.020 1.00 16.22 ? 484 DG  D C4     1 
ATOM   776  H H1     . DG  B 2 10  ? 27.950  24.892  33.229 1.00 0.00  ? 484 DG  D H1     1 
ATOM   777  H H21    . DG  B 2 10  ? 30.972  25.807  34.773 1.00 0.00  ? 484 DG  D H21    1 
ATOM   778  H H22    . DG  B 2 10  ? 29.304  26.237  34.468 1.00 0.00  ? 484 DG  D H22    1 
ATOM   779  P P      . DT  B 2 11  ? 34.086  19.361  37.363 1.00 24.68 ? 485 DT  D P      1 
ATOM   780  O OP1    . DT  B 2 11  ? 35.332  18.959  38.080 1.00 31.68 ? 485 DT  D OP1    1 
ATOM   781  O OP2    . DT  B 2 11  ? 32.981  18.410  37.260 1.00 18.69 ? 485 DT  D OP2    1 
ATOM   782  O "O5'"  . DT  B 2 11  ? 33.529  20.744  37.940 1.00 22.45 ? 485 DT  D "O5'"  1 
ATOM   783  C "C5'"  . DT  B 2 11  ? 34.251  21.956  37.751 1.00 20.18 ? 485 DT  D "C5'"  1 
ATOM   784  C "C4'"  . DT  B 2 11  ? 33.514  23.128  38.362 1.00 21.26 ? 485 DT  D "C4'"  1 
ATOM   785  O "O4'"  . DT  B 2 11  ? 32.326  23.439  37.613 1.00 24.94 ? 485 DT  D "O4'"  1 
ATOM   786  C "C3'"  . DT  B 2 11  ? 33.050  22.984  39.801 1.00 24.08 ? 485 DT  D "C3'"  1 
ATOM   787  O "O3'"  . DT  B 2 11  ? 33.083  24.285  40.401 1.00 28.20 ? 485 DT  D "O3'"  1 
ATOM   788  C "C2'"  . DT  B 2 11  ? 31.612  22.510  39.654 1.00 26.93 ? 485 DT  D "C2'"  1 
ATOM   789  C "C1'"  . DT  B 2 11  ? 31.159  23.259  38.416 1.00 26.39 ? 485 DT  D "C1'"  1 
ATOM   790  N N1     . DT  B 2 11  ? 30.159  22.558  37.589 1.00 24.71 ? 485 DT  D N1     1 
ATOM   791  C C2     . DT  B 2 11  ? 29.068  23.277  37.132 1.00 25.29 ? 485 DT  D C2     1 
ATOM   792  O O2     . DT  B 2 11  ? 28.887  24.448  37.404 1.00 20.21 ? 485 DT  D O2     1 
ATOM   793  N N3     . DT  B 2 11  ? 28.214  22.581  36.320 1.00 27.53 ? 485 DT  D N3     1 
ATOM   794  C C4     . DT  B 2 11  ? 28.367  21.269  35.891 1.00 30.83 ? 485 DT  D C4     1 
ATOM   795  O O4     . DT  B 2 11  ? 27.548  20.790  35.126 1.00 33.54 ? 485 DT  D O4     1 
ATOM   796  C C5     . DT  B 2 11  ? 29.540  20.565  36.409 1.00 29.51 ? 485 DT  D C5     1 
ATOM   797  C C7     . DT  B 2 11  ? 29.805  19.159  35.955 1.00 22.89 ? 485 DT  D C7     1 
ATOM   798  C C6     . DT  B 2 11  ? 30.343  21.229  37.253 1.00 25.67 ? 485 DT  D C6     1 
ATOM   799  H H3     . DT  B 2 11  ? 27.385  23.086  36.042 1.00 0.00  ? 485 DT  D H3     1 
ATOM   800  P P      . DA  B 2 12  ? 32.689  24.469  41.962 1.00 22.42 ? 486 DA  D P      1 
ATOM   801  O OP1    . DA  B 2 12  ? 33.693  25.391  42.537 1.00 22.25 ? 486 DA  D OP1    1 
ATOM   802  O OP2    . DA  B 2 12  ? 32.429  23.136  42.578 1.00 16.10 ? 486 DA  D OP2    1 
ATOM   803  O "O5'"  . DA  B 2 12  ? 31.316  25.249  41.929 1.00 20.95 ? 486 DA  D "O5'"  1 
ATOM   804  C "C5'"  . DA  B 2 12  ? 31.253  26.590  41.468 1.00 17.45 ? 486 DA  D "C5'"  1 
ATOM   805  C "C4'"  . DA  B 2 12  ? 29.840  27.103  41.595 1.00 17.82 ? 486 DA  D "C4'"  1 
ATOM   806  O "O4'"  . DA  B 2 12  ? 28.935  26.312  40.774 1.00 21.95 ? 486 DA  D "O4'"  1 
ATOM   807  C "C3'"  . DA  B 2 12  ? 29.314  26.993  43.016 1.00 21.53 ? 486 DA  D "C3'"  1 
ATOM   808  O "O3'"  . DA  B 2 12  ? 28.576  28.168  43.279 1.00 27.06 ? 486 DA  D "O3'"  1 
ATOM   809  C "C2'"  . DA  B 2 12  ? 28.442  25.746  43.000 1.00 18.88 ? 486 DA  D "C2'"  1 
ATOM   810  C "C1'"  . DA  B 2 12  ? 27.925  25.702  41.572 1.00 18.89 ? 486 DA  D "C1'"  1 
ATOM   811  N N9     . DA  B 2 12  ? 27.627  24.361  41.026 1.00 17.96 ? 486 DA  D N9     1 
ATOM   812  C C8     . DA  B 2 12  ? 28.272  23.162  41.232 1.00 17.25 ? 486 DA  D C8     1 
ATOM   813  N N7     . DA  B 2 12  ? 27.706  22.144  40.626 1.00 15.49 ? 486 DA  D N7     1 
ATOM   814  C C5     . DA  B 2 12  ? 26.622  22.714  39.949 1.00 16.93 ? 486 DA  D C5     1 
ATOM   815  C C6     . DA  B 2 12  ? 25.580  22.166  39.122 1.00 20.07 ? 486 DA  D C6     1 
ATOM   816  N N6     . DA  B 2 12  ? 25.469  20.870  38.764 1.00 20.68 ? 486 DA  D N6     1 
ATOM   817  N N1     . DA  B 2 12  ? 24.637  23.006  38.669 1.00 16.03 ? 486 DA  D N1     1 
ATOM   818  C C2     . DA  B 2 12  ? 24.720  24.289  38.983 1.00 17.63 ? 486 DA  D C2     1 
ATOM   819  N N3     . DA  B 2 12  ? 25.630  24.925  39.719 1.00 26.06 ? 486 DA  D N3     1 
ATOM   820  C C4     . DA  B 2 12  ? 26.565  24.071  40.188 1.00 20.50 ? 486 DA  D C4     1 
ATOM   821  H H61    . DA  B 2 12  ? 26.181  20.200  39.020 1.00 0.00  ? 486 DA  D H61    1 
ATOM   822  H H62    . DA  B 2 12  ? 24.652  20.562  38.253 1.00 0.00  ? 486 DA  D H62    1 
ATOM   823  P P      . DT  B 2 13  ? 27.718  28.285  44.620 1.00 21.11 ? 487 DT  D P      1 
ATOM   824  O OP1    . DT  B 2 13  ? 27.708  29.735  44.892 1.00 16.96 ? 487 DT  D OP1    1 
ATOM   825  O OP2    . DT  B 2 13  ? 28.131  27.318  45.677 1.00 21.11 ? 487 DT  D OP2    1 
ATOM   826  O "O5'"  . DT  B 2 13  ? 26.268  27.848  44.165 1.00 27.80 ? 487 DT  D "O5'"  1 
ATOM   827  C "C5'"  . DT  B 2 13  ? 25.577  28.598  43.191 1.00 25.06 ? 487 DT  D "C5'"  1 
ATOM   828  C "C4'"  . DT  B 2 13  ? 24.300  27.899  42.794 1.00 22.17 ? 487 DT  D "C4'"  1 
ATOM   829  O "O4'"  . DT  B 2 13  ? 24.602  26.538  42.414 1.00 18.59 ? 487 DT  D "O4'"  1 
ATOM   830  C "C3'"  . DT  B 2 13  ? 23.225  27.804  43.881 1.00 25.10 ? 487 DT  D "C3'"  1 
ATOM   831  O "O3'"  . DT  B 2 13  ? 22.026  28.392  43.372 1.00 30.39 ? 487 DT  D "O3'"  1 
ATOM   832  C "C2'"  . DT  B 2 13  ? 23.048  26.307  44.085 1.00 24.42 ? 487 DT  D "C2'"  1 
ATOM   833  C "C1'"  . DT  B 2 13  ? 23.496  25.762  42.748 1.00 19.45 ? 487 DT  D "C1'"  1 
ATOM   834  N N1     . DT  B 2 13  ? 23.864  24.329  42.667 1.00 20.02 ? 487 DT  D N1     1 
ATOM   835  C C2     . DT  B 2 13  ? 23.160  23.578  41.748 1.00 21.11 ? 487 DT  D C2     1 
ATOM   836  O O2     . DT  B 2 13  ? 22.312  24.043  41.006 1.00 26.59 ? 487 DT  D O2     1 
ATOM   837  N N3     . DT  B 2 13  ? 23.475  22.256  41.718 1.00 20.73 ? 487 DT  D N3     1 
ATOM   838  C C4     . DT  B 2 13  ? 24.416  21.604  42.469 1.00 17.38 ? 487 DT  D C4     1 
ATOM   839  O O4     . DT  B 2 13  ? 24.574  20.389  42.307 1.00 14.50 ? 487 DT  D O4     1 
ATOM   840  C C5     . DT  B 2 13  ? 25.146  22.437  43.401 1.00 18.37 ? 487 DT  D C5     1 
ATOM   841  C C7     . DT  B 2 13  ? 26.222  21.806  44.233 1.00 16.46 ? 487 DT  D C7     1 
ATOM   842  C C6     . DT  B 2 13  ? 24.834  23.748  43.465 1.00 17.09 ? 487 DT  D C6     1 
ATOM   843  H H3     . DT  B 2 13  ? 22.944  21.679  41.076 1.00 0.00  ? 487 DT  D H3     1 
ATOM   844  P P      . DA  B 2 14  ? 20.821  28.786  44.362 1.00 27.31 ? 488 DA  D P      1 
ATOM   845  O OP1    . DA  B 2 14  ? 20.387  30.153  44.017 1.00 25.27 ? 488 DA  D OP1    1 
ATOM   846  O OP2    . DA  B 2 14  ? 21.206  28.469  45.750 1.00 38.74 ? 488 DA  D OP2    1 
ATOM   847  O "O5'"  . DA  B 2 14  ? 19.676  27.769  43.954 1.00 25.86 ? 488 DA  D "O5'"  1 
ATOM   848  C "C5'"  . DA  B 2 14  ? 19.003  27.960  42.729 1.00 23.12 ? 488 DA  D "C5'"  1 
ATOM   849  C "C4'"  . DA  B 2 14  ? 18.186  26.747  42.353 1.00 21.94 ? 488 DA  D "C4'"  1 
ATOM   850  O "O4'"  . DA  B 2 14  ? 19.061  25.615  42.210 1.00 16.70 ? 488 DA  D "O4'"  1 
ATOM   851  C "C3'"  . DA  B 2 14  ? 17.066  26.317  43.301 1.00 23.68 ? 488 DA  D "C3'"  1 
ATOM   852  O "O3'"  . DA  B 2 14  ? 15.820  26.328  42.586 1.00 32.14 ? 488 DA  D "O3'"  1 
ATOM   853  C "C2'"  . DA  B 2 14  ? 17.440  24.898  43.707 1.00 20.33 ? 488 DA  D "C2'"  1 
ATOM   854  C "C1'"  . DA  B 2 14  ? 18.398  24.456  42.611 1.00 20.22 ? 488 DA  D "C1'"  1 
ATOM   855  N N9     . DA  B 2 14  ? 19.423  23.550  43.090 1.00 22.83 ? 488 DA  D N9     1 
ATOM   856  C C8     . DA  B 2 14  ? 20.479  23.878  43.895 1.00 25.31 ? 488 DA  D C8     1 
ATOM   857  N N7     . DA  B 2 14  ? 21.240  22.849  44.212 1.00 32.58 ? 488 DA  D N7     1 
ATOM   858  C C5     . DA  B 2 14  ? 20.653  21.778  43.544 1.00 28.02 ? 488 DA  D C5     1 
ATOM   859  C C6     . DA  B 2 14  ? 20.989  20.415  43.444 1.00 26.96 ? 488 DA  D C6     1 
ATOM   860  N N6     . DA  B 2 14  ? 22.045  19.847  44.045 1.00 28.31 ? 488 DA  D N6     1 
ATOM   861  N N1     . DA  B 2 14  ? 20.181  19.624  42.688 1.00 26.75 ? 488 DA  D N1     1 
ATOM   862  C C2     . DA  B 2 14  ? 19.131  20.168  42.087 1.00 19.15 ? 488 DA  D C2     1 
ATOM   863  N N3     . DA  B 2 14  ? 18.718  21.430  42.098 1.00 26.15 ? 488 DA  D N3     1 
ATOM   864  C C4     . DA  B 2 14  ? 19.529  22.199  42.849 1.00 27.20 ? 488 DA  D C4     1 
ATOM   865  H H61    . DA  B 2 14  ? 22.645  20.344  44.691 1.00 0.00  ? 488 DA  D H61    1 
ATOM   866  H H62    . DA  B 2 14  ? 22.261  18.881  43.831 1.00 0.00  ? 488 DA  D H62    1 
ATOM   867  P P      . DT  B 2 15  ? 14.447  25.979  43.350 1.00 26.97 ? 489 DT  D P      1 
ATOM   868  O OP1    . DT  B 2 15  ? 13.409  26.799  42.698 1.00 31.38 ? 489 DT  D OP1    1 
ATOM   869  O OP2    . DT  B 2 15  ? 14.646  26.074  44.819 1.00 35.04 ? 489 DT  D OP2    1 
ATOM   870  O "O5'"  . DT  B 2 15  ? 14.226  24.451  42.998 1.00 25.51 ? 489 DT  D "O5'"  1 
ATOM   871  C "C5'"  . DT  B 2 15  ? 14.437  24.009  41.677 1.00 22.92 ? 489 DT  D "C5'"  1 
ATOM   872  C "C4'"  . DT  B 2 15  ? 14.334  22.507  41.588 1.00 25.04 ? 489 DT  D "C4'"  1 
ATOM   873  O "O4'"  . DT  B 2 15  ? 15.490  21.910  42.211 1.00 20.04 ? 489 DT  D "O4'"  1 
ATOM   874  C "C3'"  . DT  B 2 15  ? 13.115  21.884  42.267 1.00 28.55 ? 489 DT  D "C3'"  1 
ATOM   875  O "O3'"  . DT  B 2 15  ? 12.482  20.944  41.410 1.00 33.72 ? 489 DT  D "O3'"  1 
ATOM   876  C "C2'"  . DT  B 2 15  ? 13.721  21.086  43.408 1.00 28.34 ? 489 DT  D "C2'"  1 
ATOM   877  C "C1'"  . DT  B 2 15  ? 15.069  20.730  42.825 1.00 22.50 ? 489 DT  D "C1'"  1 
ATOM   878  N N1     . DT  B 2 15  ? 16.038  20.381  43.826 1.00 23.47 ? 489 DT  D N1     1 
ATOM   879  C C2     . DT  B 2 15  ? 16.494  19.100  43.829 1.00 25.77 ? 489 DT  D C2     1 
ATOM   880  O O2     . DT  B 2 15  ? 16.146  18.282  43.001 1.00 25.88 ? 489 DT  D O2     1 
ATOM   881  N N3     . DT  B 2 15  ? 17.365  18.800  44.843 1.00 33.16 ? 489 DT  D N3     1 
ATOM   882  C C4     . DT  B 2 15  ? 17.795  19.659  45.853 1.00 33.56 ? 489 DT  D C4     1 
ATOM   883  O O4     . DT  B 2 15  ? 18.536  19.236  46.738 1.00 38.44 ? 489 DT  D O4     1 
ATOM   884  C C5     . DT  B 2 15  ? 17.295  21.020  45.760 1.00 30.89 ? 489 DT  D C5     1 
ATOM   885  C C7     . DT  B 2 15  ? 17.758  22.034  46.761 1.00 21.98 ? 489 DT  D C7     1 
ATOM   886  C C6     . DT  B 2 15  ? 16.454  21.307  44.763 1.00 25.85 ? 489 DT  D C6     1 
ATOM   887  H H3     . DT  B 2 15  ? 17.796  17.890  44.799 1.00 0.00  ? 489 DT  D H3     1 
ATOM   888  P P      . DA  B 2 16  ? 11.042  20.356  41.823 1.00 34.07 ? 490 DA  D P      1 
ATOM   889  O OP1    . DA  B 2 16  ? 10.236  20.476  40.585 1.00 36.73 ? 490 DA  D OP1    1 
ATOM   890  O OP2    . DA  B 2 16  ? 10.570  20.995  43.082 1.00 30.82 ? 490 DA  D OP2    1 
ATOM   891  O "O5'"  . DA  B 2 16  ? 11.294  18.816  42.114 1.00 25.95 ? 490 DA  D "O5'"  1 
ATOM   892  C "C5'"  . DA  B 2 16  ? 11.455  17.917  41.045 1.00 20.89 ? 490 DA  D "C5'"  1 
ATOM   893  C "C4'"  . DA  B 2 16  ? 11.883  16.567  41.558 1.00 22.01 ? 490 DA  D "C4'"  1 
ATOM   894  O "O4'"  . DA  B 2 16  ? 13.038  16.708  42.426 1.00 22.88 ? 490 DA  D "O4'"  1 
ATOM   895  C "C3'"  . DA  B 2 16  ? 10.833  15.837  42.380 1.00 25.88 ? 490 DA  D "C3'"  1 
ATOM   896  O "O3'"  . DA  B 2 16  ? 10.969  14.463  42.064 1.00 28.95 ? 490 DA  D "O3'"  1 
ATOM   897  C "C2'"  . DA  B 2 16  ? 11.277  16.088  43.816 1.00 26.75 ? 490 DA  D "C2'"  1 
ATOM   898  C "C1'"  . DA  B 2 16  ? 12.789  16.085  43.680 1.00 26.87 ? 490 DA  D "C1'"  1 
ATOM   899  N N9     . DA  B 2 16  ? 13.489  16.854  44.704 1.00 23.84 ? 490 DA  D N9     1 
ATOM   900  C C8     . DA  B 2 16  ? 13.235  18.155  45.030 1.00 24.22 ? 490 DA  D C8     1 
ATOM   901  N N7     . DA  B 2 16  ? 14.039  18.638  45.943 1.00 24.65 ? 490 DA  D N7     1 
ATOM   902  C C5     . DA  B 2 16  ? 14.872  17.574  46.255 1.00 21.47 ? 490 DA  D C5     1 
ATOM   903  C C6     . DA  B 2 16  ? 15.974  17.450  47.148 1.00 25.00 ? 490 DA  D C6     1 
ATOM   904  N N1     . DA  B 2 16  ? 16.609  16.255  47.200 1.00 23.60 ? 490 DA  D N1     1 
ATOM   905  C C2     . DA  B 2 16  ? 16.163  15.260  46.408 1.00 16.51 ? 490 DA  D C2     1 
ATOM   906  N N3     . DA  B 2 16  ? 15.151  15.259  45.532 1.00 20.84 ? 490 DA  D N3     1 
ATOM   907  C C4     . DA  B 2 16  ? 14.539  16.460  45.504 1.00 18.74 ? 490 DA  D C4     1 
ATOM   908  P P      . DC  B 2 17  ? 9.798   13.445  42.410 1.00 33.96 ? 491 DC  D P      1 
ATOM   909  O OP1    . DC  B 2 17  ? 9.558   12.646  41.180 1.00 39.18 ? 491 DC  D OP1    1 
ATOM   910  O OP2    . DC  B 2 17  ? 8.675   14.202  43.040 1.00 35.21 ? 491 DC  D OP2    1 
ATOM   911  O "O5'"  . DC  B 2 17  ? 10.477  12.471  43.461 1.00 31.22 ? 491 DC  D "O5'"  1 
ATOM   912  C "C5'"  . DC  B 2 17  ? 11.350  11.455  43.008 1.00 26.21 ? 491 DC  D "C5'"  1 
ATOM   913  C "C4'"  . DC  B 2 17  ? 12.174  10.912  44.149 1.00 20.74 ? 491 DC  D "C4'"  1 
ATOM   914  O "O4'"  . DC  B 2 17  ? 12.739  12.013  44.898 1.00 23.95 ? 491 DC  D "O4'"  1 
ATOM   915  C "C3'"  . DC  B 2 17  ? 11.406  10.072  45.156 1.00 21.12 ? 491 DC  D "C3'"  1 
ATOM   916  O "O3'"  . DC  B 2 17  ? 12.042  8.812   45.299 1.00 22.12 ? 491 DC  D "O3'"  1 
ATOM   917  C "C2'"  . DC  B 2 17  ? 11.470  10.877  46.450 1.00 25.44 ? 491 DC  D "C2'"  1 
ATOM   918  C "C1'"  . DC  B 2 17  ? 12.728  11.694  46.268 1.00 24.34 ? 491 DC  D "C1'"  1 
ATOM   919  N N1     . DC  B 2 17  ? 12.809  12.960  47.029 1.00 24.36 ? 491 DC  D N1     1 
ATOM   920  C C2     . DC  B 2 17  ? 13.839  13.118  47.971 1.00 20.83 ? 491 DC  D C2     1 
ATOM   921  O O2     . DC  B 2 17  ? 14.660  12.241  48.100 1.00 25.77 ? 491 DC  D O2     1 
ATOM   922  N N3     . DC  B 2 17  ? 13.912  14.242  48.705 1.00 19.51 ? 491 DC  D N3     1 
ATOM   923  C C4     . DC  B 2 17  ? 13.021  15.211  48.529 1.00 21.86 ? 491 DC  D C4     1 
ATOM   924  N N4     . DC  B 2 17  ? 13.130  16.290  49.299 1.00 20.73 ? 491 DC  D N4     1 
ATOM   925  C C5     . DC  B 2 17  ? 11.968  15.111  47.552 1.00 19.23 ? 491 DC  D C5     1 
ATOM   926  C C6     . DC  B 2 17  ? 11.902  13.971  46.833 1.00 23.84 ? 491 DC  D C6     1 
ATOM   927  H H41    . DC  B 2 17  ? 12.430  17.016  49.231 1.00 0.00  ? 491 DC  D H41    1 
ATOM   928  H H42    . DC  B 2 17  ? 13.917  16.401  49.926 1.00 0.00  ? 491 DC  D H42    1 
ATOM   929  P P      . DA  B 2 18  ? 11.483  7.766   46.363 1.00 23.63 ? 492 DA  D P      1 
ATOM   930  O OP1    . DA  B 2 18  ? 11.767  6.390   45.947 1.00 16.27 ? 492 DA  D OP1    1 
ATOM   931  O OP2    . DA  B 2 18  ? 10.088  8.155   46.669 1.00 22.89 ? 492 DA  D OP2    1 
ATOM   932  O "O5'"  . DA  B 2 18  ? 12.393  8.082   47.627 1.00 26.05 ? 492 DA  D "O5'"  1 
ATOM   933  C "C5'"  . DA  B 2 18  ? 13.807  7.978   47.539 1.00 27.12 ? 492 DA  D "C5'"  1 
ATOM   934  C "C4'"  . DA  B 2 18  ? 14.443  8.051   48.911 1.00 26.23 ? 492 DA  D "C4'"  1 
ATOM   935  O "O4'"  . DA  B 2 18  ? 14.508  9.388   49.445 1.00 25.03 ? 492 DA  D "O4'"  1 
ATOM   936  C "C3'"  . DA  B 2 18  ? 13.844  7.197   50.016 1.00 26.38 ? 492 DA  D "C3'"  1 
ATOM   937  O "O3'"  . DA  B 2 18  ? 14.954  6.612   50.688 1.00 31.48 ? 492 DA  D "O3'"  1 
ATOM   938  C "C2'"  . DA  B 2 18  ? 13.120  8.217   50.882 1.00 22.29 ? 492 DA  D "C2'"  1 
ATOM   939  C "C1'"  . DA  B 2 18  ? 14.024  9.417   50.769 1.00 18.40 ? 492 DA  D "C1'"  1 
ATOM   940  N N9     . DA  B 2 18  ? 13.435  10.736  50.970 1.00 17.24 ? 492 DA  D N9     1 
ATOM   941  C C8     . DA  B 2 18  ? 12.443  11.360  50.247 1.00 18.46 ? 492 DA  D C8     1 
ATOM   942  N N7     . DA  B 2 18  ? 12.215  12.605  50.617 1.00 16.80 ? 492 DA  D N7     1 
ATOM   943  C C5     . DA  B 2 18  ? 13.097  12.800  51.673 1.00 17.21 ? 492 DA  D C5     1 
ATOM   944  C C6     . DA  B 2 18  ? 13.357  13.914  52.500 1.00 20.97 ? 492 DA  D C6     1 
ATOM   945  N N6     . DA  B 2 18  ? 12.734  15.092  52.384 1.00 24.96 ? 492 DA  D N6     1 
ATOM   946  N N1     . DA  B 2 18  ? 14.295  13.780  53.457 1.00 15.42 ? 492 DA  D N1     1 
ATOM   947  C C2     . DA  B 2 18  ? 14.919  12.602  53.571 1.00 14.56 ? 492 DA  D C2     1 
ATOM   948  N N3     . DA  B 2 18  ? 14.767  11.488  52.860 1.00 16.34 ? 492 DA  D N3     1 
ATOM   949  C C4     . DA  B 2 18  ? 13.838  11.657  51.915 1.00 15.96 ? 492 DA  D C4     1 
ATOM   950  H H61    . DA  B 2 18  ? 12.040  15.204  51.660 1.00 0.00  ? 492 DA  D H61    1 
ATOM   951  H H62    . DA  B 2 18  ? 12.946  15.857  53.011 1.00 0.00  ? 492 DA  D H62    1 
ATOM   952  P P      . DT  B 2 19  ? 14.749  5.334   51.626 1.00 32.94 ? 493 DT  D P      1 
ATOM   953  O OP1    . DT  B 2 19  ? 15.682  4.284   51.150 1.00 34.72 ? 493 DT  D OP1    1 
ATOM   954  O OP2    . DT  B 2 19  ? 13.302  5.024   51.725 1.00 38.57 ? 493 DT  D OP2    1 
ATOM   955  O "O5'"  . DT  B 2 19  ? 15.232  5.907   53.033 1.00 34.92 ? 493 DT  D "O5'"  1 
ATOM   956  C "C5'"  . DT  B 2 19  ? 16.514  6.522   53.165 1.00 30.61 ? 493 DT  D "C5'"  1 
ATOM   957  C "C4'"  . DT  B 2 19  ? 16.657  7.178   54.517 1.00 28.53 ? 493 DT  D "C4'"  1 
ATOM   958  O "O4'"  . DT  B 2 19  ? 15.949  8.431   54.536 1.00 25.68 ? 493 DT  D "O4'"  1 
ATOM   959  C "C3'"  . DT  B 2 19  ? 16.125  6.365   55.700 1.00 35.00 ? 493 DT  D "C3'"  1 
ATOM   960  O "O3'"  . DT  B 2 19  ? 17.053  6.397   56.799 1.00 43.94 ? 493 DT  D "O3'"  1 
ATOM   961  C "C2'"  . DT  B 2 19  ? 14.847  7.094   56.082 1.00 33.96 ? 493 DT  D "C2'"  1 
ATOM   962  C "C1'"  . DT  B 2 19  ? 15.236  8.514   55.757 1.00 31.15 ? 493 DT  D "C1'"  1 
ATOM   963  N N1     . DT  B 2 19  ? 14.131  9.472   55.592 1.00 31.90 ? 493 DT  D N1     1 
ATOM   964  C C2     . DT  B 2 19  ? 14.294  10.706  56.178 1.00 28.78 ? 493 DT  D C2     1 
ATOM   965  O O2     . DT  B 2 19  ? 15.252  10.994  56.859 1.00 30.79 ? 493 DT  D O2     1 
ATOM   966  N N3     . DT  B 2 19  ? 13.284  11.593  55.950 1.00 28.92 ? 493 DT  D N3     1 
ATOM   967  C C4     . DT  B 2 19  ? 12.130  11.374  55.221 1.00 26.60 ? 493 DT  D C4     1 
ATOM   968  O O4     . DT  B 2 19  ? 11.324  12.291  55.077 1.00 29.43 ? 493 DT  D O4     1 
ATOM   969  C C5     . DT  B 2 19  ? 11.984  10.041  54.677 1.00 25.24 ? 493 DT  D C5     1 
ATOM   970  C C7     . DT  B 2 19  ? 10.732  9.707   53.938 1.00 23.19 ? 493 DT  D C7     1 
ATOM   971  C C6     . DT  B 2 19  ? 12.983  9.163   54.875 1.00 29.51 ? 493 DT  D C6     1 
ATOM   972  H H3     . DT  B 2 19  ? 13.385  12.476  56.428 1.00 0.00  ? 493 DT  D H3     1 
ATOM   973  P P      . DG  B 2 20  ? 17.361  5.040   57.632 1.00 47.48 ? 494 DG  D P      1 
ATOM   974  O OP1    . DG  B 2 20  ? 18.734  4.587   57.283 1.00 51.40 ? 494 DG  D OP1    1 
ATOM   975  O OP2    . DG  B 2 20  ? 16.223  4.091   57.480 1.00 41.68 ? 494 DG  D OP2    1 
ATOM   976  O "O5'"  . DG  B 2 20  ? 17.396  5.536   59.146 1.00 48.26 ? 494 DG  D "O5'"  1 
ATOM   977  C "C5'"  . DG  B 2 20  ? 18.001  6.784   59.524 1.00 48.67 ? 494 DG  D "C5'"  1 
ATOM   978  C "C4'"  . DG  B 2 20  ? 17.191  7.438   60.627 1.00 52.59 ? 494 DG  D "C4'"  1 
ATOM   979  O "O4'"  . DG  B 2 20  ? 16.109  8.258   60.099 1.00 48.97 ? 494 DG  D "O4'"  1 
ATOM   980  C "C3'"  . DG  B 2 20  ? 16.522  6.406   61.554 1.00 52.10 ? 494 DG  D "C3'"  1 
ATOM   981  O "O3'"  . DG  B 2 20  ? 16.390  6.928   62.888 1.00 54.20 ? 494 DG  D "O3'"  1 
ATOM   982  C "C2'"  . DG  B 2 20  ? 15.136  6.295   60.958 1.00 46.99 ? 494 DG  D "C2'"  1 
ATOM   983  C "C1'"  . DG  B 2 20  ? 14.902  7.761   60.650 1.00 47.16 ? 494 DG  D "C1'"  1 
ATOM   984  N N9     . DG  B 2 20  ? 13.788  8.092   59.776 1.00 43.28 ? 494 DG  D N9     1 
ATOM   985  C C8     . DG  B 2 20  ? 13.044  7.259   58.957 1.00 45.00 ? 494 DG  D C8     1 
ATOM   986  N N7     . DG  B 2 20  ? 12.013  7.864   58.412 1.00 42.12 ? 494 DG  D N7     1 
ATOM   987  C C5     . DG  B 2 20  ? 12.114  9.177   58.871 1.00 39.54 ? 494 DG  D C5     1 
ATOM   988  C C6     . DG  B 2 20  ? 11.287  10.301  58.637 1.00 37.26 ? 494 DG  D C6     1 
ATOM   989  O O6     . DG  B 2 20  ? 10.284  10.395  57.940 1.00 37.30 ? 494 DG  D O6     1 
ATOM   990  N N1     . DG  B 2 20  ? 11.741  11.412  59.331 1.00 37.66 ? 494 DG  D N1     1 
ATOM   991  C C2     . DG  B 2 20  ? 12.854  11.442  60.130 1.00 40.03 ? 494 DG  D C2     1 
ATOM   992  N N2     . DG  B 2 20  ? 13.109  12.592  60.729 1.00 46.87 ? 494 DG  D N2     1 
ATOM   993  N N3     . DG  B 2 20  ? 13.649  10.423  60.333 1.00 38.51 ? 494 DG  D N3     1 
ATOM   994  C C4     . DG  B 2 20  ? 13.219  9.325   59.689 1.00 41.25 ? 494 DG  D C4     1 
ATOM   995  H H1     . DG  B 2 20  ? 11.241  12.288  59.287 1.00 0.00  ? 494 DG  D H1     1 
ATOM   996  H H21    . DG  B 2 20  ? 13.918  12.669  61.329 1.00 0.00  ? 494 DG  D H21    1 
ATOM   997  H H22    . DG  B 2 20  ? 12.467  13.354  60.575 1.00 0.00  ? 494 DG  D H22    1 
ATOM   998  P P      . DA  B 2 21  ? 17.556  6.688   63.978 1.00 55.30 ? 495 DA  D P      1 
ATOM   999  O OP1    . DA  B 2 21  ? 18.873  7.148   63.459 1.00 59.16 ? 495 DA  D OP1    1 
ATOM   1000 O OP2    . DA  B 2 21  ? 17.422  5.298   64.476 1.00 52.18 ? 495 DA  D OP2    1 
ATOM   1001 O "O5'"  . DA  B 2 21  ? 17.175  7.733   65.104 1.00 48.40 ? 495 DA  D "O5'"  1 
ATOM   1002 C "C5'"  . DA  B 2 21  ? 17.057  9.110   64.788 1.00 40.45 ? 495 DA  D "C5'"  1 
ATOM   1003 C "C4'"  . DA  B 2 21  ? 15.781  9.664   65.373 1.00 39.95 ? 495 DA  D "C4'"  1 
ATOM   1004 O "O4'"  . DA  B 2 21  ? 14.709  9.758   64.399 1.00 41.63 ? 495 DA  D "O4'"  1 
ATOM   1005 C "C3'"  . DA  B 2 21  ? 15.213  8.863   66.551 1.00 40.55 ? 495 DA  D "C3'"  1 
ATOM   1006 O "O3'"  . DA  B 2 21  ? 14.776  9.799   67.538 1.00 45.59 ? 495 DA  D "O3'"  1 
ATOM   1007 C "C2'"  . DA  B 2 21  ? 14.002  8.169   65.948 1.00 35.09 ? 495 DA  D "C2'"  1 
ATOM   1008 C "C1'"  . DA  B 2 21  ? 13.520  9.259   65.001 1.00 33.54 ? 495 DA  D "C1'"  1 
ATOM   1009 N N9     . DA  B 2 21  ? 12.586  8.861   63.945 1.00 26.75 ? 495 DA  D N9     1 
ATOM   1010 C C8     . DA  B 2 21  ? 12.417  7.625   63.354 1.00 25.25 ? 495 DA  D C8     1 
ATOM   1011 N N7     . DA  B 2 21  ? 11.496  7.608   62.421 1.00 23.06 ? 495 DA  D N7     1 
ATOM   1012 C C5     . DA  B 2 21  ? 11.034  8.925   62.386 1.00 22.37 ? 495 DA  D C5     1 
ATOM   1013 C C6     . DA  B 2 21  ? 10.056  9.584   61.582 1.00 21.76 ? 495 DA  D C6     1 
ATOM   1014 N N6     . DA  B 2 21  ? 9.402   8.996   60.572 1.00 23.15 ? 495 DA  D N6     1 
ATOM   1015 N N1     . DA  B 2 21  ? 9.797   10.883  61.842 1.00 21.39 ? 495 DA  D N1     1 
ATOM   1016 C C2     . DA  B 2 21  ? 10.497  11.484  62.812 1.00 23.02 ? 495 DA  D C2     1 
ATOM   1017 N N3     . DA  B 2 21  ? 11.461  10.988  63.599 1.00 20.18 ? 495 DA  D N3     1 
ATOM   1018 C C4     . DA  B 2 21  ? 11.680  9.695   63.333 1.00 17.86 ? 495 DA  D C4     1 
ATOM   1019 H H61    . DA  B 2 21  ? 9.591   8.033   60.328 1.00 0.00  ? 495 DA  D H61    1 
ATOM   1020 H H62    . DA  B 2 21  ? 8.721   9.530   60.050 1.00 0.00  ? 495 DA  D H62    1 
ATOM   1021 P P      . DG  B 2 22  ? 14.729  9.383   69.086 1.00 38.87 ? 496 DG  D P      1 
ATOM   1022 O OP1    . DG  B 2 22  ? 15.803  10.152  69.755 1.00 38.90 ? 496 DG  D OP1    1 
ATOM   1023 O OP2    . DG  B 2 22  ? 14.687  7.910   69.214 1.00 27.97 ? 496 DG  D OP2    1 
ATOM   1024 O "O5'"  . DG  B 2 22  ? 13.350  10.017  69.552 1.00 41.84 ? 496 DG  D "O5'"  1 
ATOM   1025 C "C5'"  . DG  B 2 22  ? 13.103  11.404  69.329 1.00 38.53 ? 496 DG  D "C5'"  1 
ATOM   1026 C "C4'"  . DG  B 2 22  ? 11.619  11.691  69.263 1.00 36.20 ? 496 DG  D "C4'"  1 
ATOM   1027 O "O4'"  . DG  B 2 22  ? 11.029  11.269  68.002 1.00 29.72 ? 496 DG  D "O4'"  1 
ATOM   1028 C "C3'"  . DG  B 2 22  ? 10.756  11.084  70.373 1.00 36.09 ? 496 DG  D "C3'"  1 
ATOM   1029 O "O3'"  . DG  B 2 22  ? 9.878   12.129  70.847 1.00 42.41 ? 496 DG  D "O3'"  1 
ATOM   1030 C "C2'"  . DG  B 2 22  ? 9.990   9.998   69.637 1.00 33.61 ? 496 DG  D "C2'"  1 
ATOM   1031 C "C1'"  . DG  B 2 22  ? 9.787   10.669  68.293 1.00 33.01 ? 496 DG  D "C1'"  1 
ATOM   1032 N N9     . DG  B 2 22  ? 9.403   9.783   67.194 1.00 31.92 ? 496 DG  D N9     1 
ATOM   1033 C C8     . DG  B 2 22  ? 9.808   8.487   67.004 1.00 31.18 ? 496 DG  D C8     1 
ATOM   1034 N N7     . DG  B 2 22  ? 9.220   7.906   65.992 1.00 32.21 ? 496 DG  D N7     1 
ATOM   1035 C C5     . DG  B 2 22  ? 8.396   8.894   65.461 1.00 32.12 ? 496 DG  D C5     1 
ATOM   1036 C C6     . DG  B 2 22  ? 7.506   8.842   64.357 1.00 32.90 ? 496 DG  D C6     1 
ATOM   1037 O O6     . DG  B 2 22  ? 7.252   7.884   63.618 1.00 40.31 ? 496 DG  D O6     1 
ATOM   1038 N N1     . DG  B 2 22  ? 6.865   10.061  64.151 1.00 30.77 ? 496 DG  D N1     1 
ATOM   1039 C C2     . DG  B 2 22  ? 7.042   11.181  64.925 1.00 33.84 ? 496 DG  D C2     1 
ATOM   1040 N N2     . DG  B 2 22  ? 6.310   12.261  64.588 1.00 35.12 ? 496 DG  D N2     1 
ATOM   1041 N N3     . DG  B 2 22  ? 7.870   11.242  65.966 1.00 32.17 ? 496 DG  D N3     1 
ATOM   1042 C C4     . DG  B 2 22  ? 8.510   10.064  66.174 1.00 30.24 ? 496 DG  D C4     1 
ATOM   1043 H H1     . DG  B 2 22  ? 6.242   10.113  63.355 1.00 0.00  ? 496 DG  D H1     1 
ATOM   1044 H H21    . DG  B 2 22  ? 6.414   13.106  65.137 1.00 0.00  ? 496 DG  D H21    1 
ATOM   1045 H H22    . DG  B 2 22  ? 5.641   12.225  63.830 1.00 0.00  ? 496 DG  D H22    1 
ATOM   1046 P P      . DG  B 2 23  ? 8.715   11.808  71.923 1.00 40.19 ? 497 DG  D P      1 
ATOM   1047 O OP1    . DG  B 2 23  ? 8.919   12.694  73.092 1.00 39.31 ? 497 DG  D OP1    1 
ATOM   1048 O OP2    . DG  B 2 23  ? 8.558   10.347  72.121 1.00 39.63 ? 497 DG  D OP2    1 
ATOM   1049 O "O5'"  . DG  B 2 23  ? 7.415   12.317  71.166 1.00 48.73 ? 497 DG  D "O5'"  1 
ATOM   1050 C "C5'"  . DG  B 2 23  ? 7.502   13.447  70.307 1.00 55.60 ? 497 DG  D "C5'"  1 
ATOM   1051 C "C4'"  . DG  B 2 23  ? 6.133   13.798  69.776 1.00 57.28 ? 497 DG  D "C4'"  1 
ATOM   1052 O "O4'"  . DG  B 2 23  ? 5.735   12.948  68.680 1.00 57.44 ? 497 DG  D "O4'"  1 
ATOM   1053 C "C3'"  . DG  B 2 23  ? 5.058   13.645  70.824 1.00 59.43 ? 497 DG  D "C3'"  1 
ATOM   1054 O "O3'"  . DG  B 2 23  ? 4.140   14.700  70.621 1.00 73.96 ? 497 DG  D "O3'"  1 
ATOM   1055 C "C2'"  . DG  B 2 23  ? 4.478   12.268  70.533 1.00 54.13 ? 497 DG  D "C2'"  1 
ATOM   1056 C "C1'"  . DG  B 2 23  ? 4.618   12.144  69.031 1.00 49.32 ? 497 DG  D "C1'"  1 
ATOM   1057 N N9     . DG  B 2 23  ? 4.938   10.814  68.553 1.00 45.77 ? 497 DG  D N9     1 
ATOM   1058 C C8     . DG  B 2 23  ? 5.898   9.984   69.078 1.00 44.50 ? 497 DG  D C8     1 
ATOM   1059 N N7     . DG  B 2 23  ? 6.077   8.902   68.379 1.00 46.06 ? 497 DG  D N7     1 
ATOM   1060 C C5     . DG  B 2 23  ? 5.158   9.010   67.338 1.00 47.77 ? 497 DG  D C5     1 
ATOM   1061 C C6     . DG  B 2 23  ? 4.919   8.138   66.251 1.00 51.49 ? 497 DG  D C6     1 
ATOM   1062 O O6     . DG  B 2 23  ? 5.480   7.082   65.967 1.00 55.74 ? 497 DG  D O6     1 
ATOM   1063 N N1     . DG  B 2 23  ? 3.892   8.607   65.435 1.00 49.38 ? 497 DG  D N1     1 
ATOM   1064 C C2     . DG  B 2 23  ? 3.195   9.767   65.643 1.00 49.44 ? 497 DG  D C2     1 
ATOM   1065 N N2     . DG  B 2 23  ? 2.205   10.022  64.755 1.00 49.13 ? 497 DG  D N2     1 
ATOM   1066 N N3     . DG  B 2 23  ? 3.435   10.611  66.646 1.00 47.46 ? 497 DG  D N3     1 
ATOM   1067 C C4     . DG  B 2 23  ? 4.428   10.161  67.456 1.00 46.85 ? 497 DG  D C4     1 
ATOM   1068 H H1     . DG  B 2 23  ? 3.654   8.034   64.637 1.00 0.00  ? 497 DG  D H1     1 
ATOM   1069 H H21    . DG  B 2 23  ? 2.037   9.380   63.986 1.00 0.00  ? 497 DG  D H21    1 
ATOM   1070 H H22    . DG  B 2 23  ? 1.627   10.847  64.850 1.00 0.00  ? 497 DG  D H22    1 
ATOM   1071 P P      . DA  B 2 24  ? 3.501   15.433  71.891 1.00 85.37 ? 498 DA  D P      1 
ATOM   1072 O OP1    . DA  B 2 24  ? 2.998   16.780  71.466 1.00 84.50 ? 498 DA  D OP1    1 
ATOM   1073 O OP2    . DA  B 2 24  ? 4.565   15.328  72.944 1.00 85.11 ? 498 DA  D OP2    1 
ATOM   1074 O "O5'"  . DA  B 2 24  ? 2.259   14.489  72.226 1.00 81.80 ? 498 DA  D "O5'"  1 
ATOM   1075 C "C5'"  . DA  B 2 24  ? 1.866   13.474  71.294 1.00 77.40 ? 498 DA  D "C5'"  1 
ATOM   1076 C "C4'"  . DA  B 2 24  ? 1.366   12.256  72.027 1.00 75.53 ? 498 DA  D "C4'"  1 
ATOM   1077 O "O4'"  . DA  B 2 24  ? 1.266   11.133  71.108 1.00 73.79 ? 498 DA  D "O4'"  1 
ATOM   1078 C "C3'"  . DA  B 2 24  ? 2.288   11.776  73.160 1.00 75.30 ? 498 DA  D "C3'"  1 
ATOM   1079 O "O3'"  . DA  B 2 24  ? 1.538   11.110  74.208 1.00 80.22 ? 498 DA  D "O3'"  1 
ATOM   1080 C "C2'"  . DA  B 2 24  ? 3.014   10.605  72.537 1.00 71.66 ? 498 DA  D "C2'"  1 
ATOM   1081 C "C1'"  . DA  B 2 24  ? 1.896   10.016  71.706 1.00 71.35 ? 498 DA  D "C1'"  1 
ATOM   1082 N N9     . DA  B 2 24  ? 2.355   9.081   70.676 1.00 71.11 ? 498 DA  D N9     1 
ATOM   1083 C C8     . DA  B 2 24  ? 3.515   8.371   70.781 1.00 70.07 ? 498 DA  D C8     1 
ATOM   1084 N N7     . DA  B 2 24  ? 3.722   7.539   69.796 1.00 69.29 ? 498 DA  D N7     1 
ATOM   1085 C C5     . DA  B 2 24  ? 2.627   7.721   68.972 1.00 69.14 ? 498 DA  D C5     1 
ATOM   1086 C C6     . DA  B 2 24  ? 2.282   7.128   67.762 1.00 71.35 ? 498 DA  D C6     1 
ATOM   1087 N N6     . DA  B 2 24  ? 3.014   6.158   67.205 1.00 70.17 ? 498 DA  D N6     1 
ATOM   1088 N N1     . DA  B 2 24  ? 1.148   7.541   67.154 1.00 71.28 ? 498 DA  D N1     1 
ATOM   1089 C C2     . DA  B 2 24  ? 0.420   8.495   67.757 1.00 71.83 ? 498 DA  D C2     1 
ATOM   1090 N N3     . DA  B 2 24  ? 0.646   9.128   68.920 1.00 71.39 ? 498 DA  D N3     1 
ATOM   1091 C C4     . DA  B 2 24  ? 1.783   8.687   69.485 1.00 70.06 ? 498 DA  D C4     1 
ATOM   1092 H "HO3'" . DA  B 2 24  ? 0.987   10.443  73.790 1.00 0.00  ? 498 DA  D "HO3'" 1 
ATOM   1093 H H61    . DA  B 2 24  ? 3.692   5.649   67.755 1.00 0.00  ? 498 DA  D H61    1 
ATOM   1094 H H62    . DA  B 2 24  ? 2.942   5.979   66.215 1.00 0.00  ? 498 DA  D H62    1 
ATOM   1095 N N      . GLY C 3 1   ? 19.252  4.897   13.627 1.00 66.11 ? 5   GLY A N      1 
ATOM   1096 C CA     . GLY C 3 1   ? 18.367  6.115   13.581 1.00 65.13 ? 5   GLY A CA     1 
ATOM   1097 C C      . GLY C 3 1   ? 18.041  6.642   14.960 1.00 64.42 ? 5   GLY A C      1 
ATOM   1098 O O      . GLY C 3 1   ? 18.376  5.989   15.954 1.00 66.43 ? 5   GLY A O      1 
ATOM   1099 H H1     . GLY C 3 1   ? 18.786  4.124   14.144 1.00 0.00  ? 5   GLY A H1     1 
ATOM   1100 H H2     . GLY C 3 1   ? 19.402  4.587   12.652 1.00 0.00  ? 5   GLY A H2     1 
ATOM   1101 H H3     . GLY C 3 1   ? 20.185  5.091   14.036 1.00 0.00  ? 5   GLY A H3     1 
ATOM   1102 N N      . MET C 3 2   ? 17.353  7.784   15.038 1.00 62.70 ? 6   MET A N      1 
ATOM   1103 C CA     . MET C 3 2   ? 17.014  8.376   16.342 1.00 62.69 ? 6   MET A CA     1 
ATOM   1104 C C      . MET C 3 2   ? 16.056  7.563   17.228 1.00 64.24 ? 6   MET A C      1 
ATOM   1105 O O      . MET C 3 2   ? 16.094  7.660   18.461 1.00 63.16 ? 6   MET A O      1 
ATOM   1106 C CB     . MET C 3 2   ? 16.478  9.794   16.201 1.00 60.48 ? 6   MET A CB     1 
ATOM   1107 C CG     . MET C 3 2   ? 16.918  10.649  17.383 1.00 58.67 ? 6   MET A CG     1 
ATOM   1108 S SD     . MET C 3 2   ? 16.089  12.208  17.521 1.00 58.58 ? 6   MET A SD     1 
ATOM   1109 C CE     . MET C 3 2   ? 16.944  13.191  16.247 1.00 57.66 ? 6   MET A CE     1 
ATOM   1110 H H      . MET C 3 2   ? 17.091  8.248   14.209 1.00 0.00  ? 6   MET A H      1 
ATOM   1111 N N      . ARG C 3 3   ? 15.225  6.743   16.585 1.00 63.98 ? 7   ARG A N      1 
ATOM   1112 C CA     . ARG C 3 3   ? 14.249  5.879   17.255 1.00 59.11 ? 7   ARG A CA     1 
ATOM   1113 C C      . ARG C 3 3   ? 15.029  4.959   18.198 1.00 54.36 ? 7   ARG A C      1 
ATOM   1114 O O      . ARG C 3 3   ? 14.678  4.837   19.373 1.00 52.59 ? 7   ARG A O      1 
ATOM   1115 C CB     . ARG C 3 3   ? 13.502  5.053   16.193 1.00 62.14 ? 7   ARG A CB     1 
ATOM   1116 C CG     . ARG C 3 3   ? 12.121  4.531   16.576 1.00 63.46 ? 7   ARG A CG     1 
ATOM   1117 C CD     . ARG C 3 3   ? 11.367  4.121   15.323 1.00 66.21 ? 7   ARG A CD     1 
ATOM   1118 N NE     . ARG C 3 3   ? 9.923   4.213   15.525 1.00 69.12 ? 7   ARG A NE     1 
ATOM   1119 C CZ     . ARG C 3 3   ? 9.022   4.393   14.558 1.00 68.58 ? 7   ARG A CZ     1 
ATOM   1120 N NH1    . ARG C 3 3   ? 9.397   4.484   13.283 1.00 66.65 ? 7   ARG A NH1    1 
ATOM   1121 N NH2    . ARG C 3 3   ? 7.746   4.583   14.882 1.00 66.57 ? 7   ARG A NH2    1 
ATOM   1122 H H      . ARG C 3 3   ? 15.319  6.698   15.615 1.00 0.00  ? 7   ARG A H      1 
ATOM   1123 H HE     . ARG C 3 3   ? 9.600   4.088   16.434 1.00 0.00  ? 7   ARG A HE     1 
ATOM   1124 H HH11   . ARG C 3 3   ? 10.342  4.426   12.984 1.00 0.00  ? 7   ARG A HH11   1 
ATOM   1125 H HH12   . ARG C 3 3   ? 8.670   4.652   12.609 1.00 0.00  ? 7   ARG A HH12   1 
ATOM   1126 H HH21   . ARG C 3 3   ? 7.509   4.582   15.862 1.00 0.00  ? 7   ARG A HH21   1 
ATOM   1127 H HH22   . ARG C 3 3   ? 7.022   4.755   14.207 1.00 0.00  ? 7   ARG A HH22   1 
ATOM   1128 N N      . ALA C 3 4   ? 16.136  4.401   17.696 1.00 48.30 ? 8   ALA A N      1 
ATOM   1129 C CA     . ALA C 3 4   ? 16.970  3.503   18.487 1.00 43.86 ? 8   ALA A CA     1 
ATOM   1130 C C      . ALA C 3 4   ? 17.665  4.296   19.585 1.00 42.55 ? 8   ALA A C      1 
ATOM   1131 O O      . ALA C 3 4   ? 17.868  3.793   20.691 1.00 40.45 ? 8   ALA A O      1 
ATOM   1132 C CB     . ALA C 3 4   ? 17.974  2.805   17.602 1.00 43.22 ? 8   ALA A CB     1 
ATOM   1133 H H      . ALA C 3 4   ? 16.454  4.648   16.785 1.00 0.00  ? 8   ALA A H      1 
ATOM   1134 N N      . LEU C 3 5   ? 17.999  5.547   19.282 1.00 40.18 ? 9   LEU A N      1 
ATOM   1135 C CA     . LEU C 3 5   ? 18.644  6.432   20.250 1.00 43.35 ? 9   LEU A CA     1 
ATOM   1136 C C      . LEU C 3 5   ? 17.710  6.675   21.451 1.00 46.11 ? 9   LEU A C      1 
ATOM   1137 O O      . LEU C 3 5   ? 18.064  6.399   22.606 1.00 47.05 ? 9   LEU A O      1 
ATOM   1138 C CB     . LEU C 3 5   ? 19.035  7.764   19.589 1.00 34.50 ? 9   LEU A CB     1 
ATOM   1139 C CG     . LEU C 3 5   ? 19.942  8.695   20.410 1.00 31.49 ? 9   LEU A CG     1 
ATOM   1140 C CD1    . LEU C 3 5   ? 21.331  8.066   20.608 1.00 28.23 ? 9   LEU A CD1    1 
ATOM   1141 C CD2    . LEU C 3 5   ? 20.076  10.036  19.724 1.00 22.85 ? 9   LEU A CD2    1 
ATOM   1142 H H      . LEU C 3 5   ? 17.855  5.850   18.368 1.00 0.00  ? 9   LEU A H      1 
ATOM   1143 N N      . GLU C 3 6   ? 16.490  7.113   21.149 1.00 48.94 ? 10  GLU A N      1 
ATOM   1144 C CA     . GLU C 3 6   ? 15.462  7.389   22.152 1.00 48.52 ? 10  GLU A CA     1 
ATOM   1145 C C      . GLU C 3 6   ? 15.134  6.178   23.025 1.00 46.83 ? 10  GLU A C      1 
ATOM   1146 O O      . GLU C 3 6   ? 14.999  6.299   24.247 1.00 46.54 ? 10  GLU A O      1 
ATOM   1147 C CB     . GLU C 3 6   ? 14.191  7.900   21.473 1.00 53.22 ? 10  GLU A CB     1 
ATOM   1148 C CG     . GLU C 3 6   ? 14.365  9.257   20.774 1.00 58.12 ? 10  GLU A CG     1 
ATOM   1149 C CD     . GLU C 3 6   ? 13.130  9.709   20.032 1.00 59.41 ? 10  GLU A CD     1 
ATOM   1150 O OE1    . GLU C 3 6   ? 12.177  8.920   19.935 1.00 64.63 ? 10  GLU A OE1    1 
ATOM   1151 O OE2    . GLU C 3 6   ? 13.113  10.859  19.543 1.00 64.60 ? 10  GLU A OE2    1 
ATOM   1152 H H      . GLU C 3 6   ? 16.291  7.277   20.206 1.00 0.00  ? 10  GLU A H      1 
ATOM   1153 N N      . GLN C 3 7   ? 14.997  5.010   22.415 1.00 44.42 ? 11  GLN A N      1 
ATOM   1154 C CA     . GLN C 3 7   ? 14.690  3.815   23.178 1.00 44.16 ? 11  GLN A CA     1 
ATOM   1155 C C      . GLN C 3 7   ? 15.824  3.358   24.098 1.00 42.96 ? 11  GLN A C      1 
ATOM   1156 O O      . GLN C 3 7   ? 15.563  2.878   25.211 1.00 41.71 ? 11  GLN A O      1 
ATOM   1157 C CB     . GLN C 3 7   ? 14.225  2.685   22.252 1.00 47.47 ? 11  GLN A CB     1 
ATOM   1158 C CG     . GLN C 3 7   ? 12.890  2.953   21.529 1.00 50.49 ? 11  GLN A CG     1 
ATOM   1159 C CD     . GLN C 3 7   ? 12.627  1.929   20.436 1.00 53.87 ? 11  GLN A CD     1 
ATOM   1160 O OE1    . GLN C 3 7   ? 13.172  0.830   20.465 1.00 56.93 ? 11  GLN A OE1    1 
ATOM   1161 N NE2    . GLN C 3 7   ? 11.804  2.290   19.455 1.00 56.57 ? 11  GLN A NE2    1 
ATOM   1162 H H      . GLN C 3 7   ? 14.980  4.941   21.427 1.00 0.00  ? 11  GLN A H      1 
ATOM   1163 H HE21   . GLN C 3 7   ? 11.739  1.592   18.754 1.00 0.00  ? 11  GLN A HE21   1 
ATOM   1164 H HE22   . GLN C 3 7   ? 11.357  3.156   19.471 1.00 0.00  ? 11  GLN A HE22   1 
ATOM   1165 N N      . PHE C 3 8   ? 17.073  3.533   23.660 1.00 41.94 ? 12  PHE A N      1 
ATOM   1166 C CA     . PHE C 3 8   ? 18.237  3.136   24.465 1.00 40.00 ? 12  PHE A CA     1 
ATOM   1167 C C      . PHE C 3 8   ? 18.417  3.975   25.721 1.00 39.79 ? 12  PHE A C      1 
ATOM   1168 O O      . PHE C 3 8   ? 18.751  3.437   26.786 1.00 40.39 ? 12  PHE A O      1 
ATOM   1169 C CB     . PHE C 3 8   ? 19.538  3.186   23.669 1.00 38.69 ? 12  PHE A CB     1 
ATOM   1170 C CG     . PHE C 3 8   ? 20.756  2.865   24.500 1.00 34.00 ? 12  PHE A CG     1 
ATOM   1171 C CD1    . PHE C 3 8   ? 21.160  1.557   24.686 1.00 33.80 ? 12  PHE A CD1    1 
ATOM   1172 C CD2    . PHE C 3 8   ? 21.466  3.860   25.134 1.00 30.24 ? 12  PHE A CD2    1 
ATOM   1173 C CE1    . PHE C 3 8   ? 22.263  1.246   25.490 1.00 28.25 ? 12  PHE A CE1    1 
ATOM   1174 C CE2    . PHE C 3 8   ? 22.556  3.546   25.928 1.00 31.04 ? 12  PHE A CE2    1 
ATOM   1175 C CZ     . PHE C 3 8   ? 22.950  2.239   26.107 1.00 28.11 ? 12  PHE A CZ     1 
ATOM   1176 H H      . PHE C 3 8   ? 17.256  3.854   22.730 1.00 0.00  ? 12  PHE A H      1 
ATOM   1177 N N      . ALA C 3 9   ? 18.299  5.292   25.580 1.00 38.17 ? 13  ALA A N      1 
ATOM   1178 C CA     . ALA C 3 9   ? 18.436  6.164   26.730 1.00 39.76 ? 13  ALA A CA     1 
ATOM   1179 C C      . ALA C 3 9   ? 17.433  5.680   27.764 1.00 42.95 ? 13  ALA A C      1 
ATOM   1180 O O      . ALA C 3 9   ? 17.782  5.452   28.936 1.00 43.43 ? 13  ALA A O      1 
ATOM   1181 C CB     . ALA C 3 9   ? 18.169  7.606   26.338 1.00 37.97 ? 13  ALA A CB     1 
ATOM   1182 H H      . ALA C 3 9   ? 18.208  5.658   24.663 1.00 0.00  ? 13  ALA A H      1 
ATOM   1183 N N      . ASN C 3 10  ? 16.211  5.422   27.304 1.00 44.84 ? 14  ASN A N      1 
ATOM   1184 C CA     . ASN C 3 10  ? 15.170  4.942   28.193 1.00 48.33 ? 14  ASN A CA     1 
ATOM   1185 C C      . ASN C 3 10  ? 15.547  3.639   28.912 1.00 48.50 ? 14  ASN A C      1 
ATOM   1186 O O      . ASN C 3 10  ? 15.562  3.589   30.158 1.00 49.81 ? 14  ASN A O      1 
ATOM   1187 C CB     . ASN C 3 10  ? 13.817  4.835   27.463 1.00 51.57 ? 14  ASN A CB     1 
ATOM   1188 C CG     . ASN C 3 10  ? 13.020  6.150   27.506 1.00 58.42 ? 14  ASN A CG     1 
ATOM   1189 O OD1    . ASN C 3 10  ? 12.113  6.329   28.345 1.00 63.10 ? 14  ASN A OD1    1 
ATOM   1190 N ND2    . ASN C 3 10  ? 13.360  7.078   26.611 1.00 60.61 ? 14  ASN A ND2    1 
ATOM   1191 H H      . ASN C 3 10  ? 15.954  5.588   26.349 1.00 0.00  ? 14  ASN A H      1 
ATOM   1192 H HD21   . ASN C 3 10  ? 12.904  7.941   26.697 1.00 0.00  ? 14  ASN A HD21   1 
ATOM   1193 H HD22   . ASN C 3 10  ? 14.031  6.889   25.925 1.00 0.00  ? 14  ASN A HD22   1 
ATOM   1194 N N      . GLU C 3 11  ? 15.936  2.618   28.148 1.00 46.18 ? 15  GLU A N      1 
ATOM   1195 C CA     . GLU C 3 11  ? 16.319  1.318   28.721 1.00 43.77 ? 15  GLU A CA     1 
ATOM   1196 C C      . GLU C 3 11  ? 17.642  1.357   29.490 1.00 44.16 ? 15  GLU A C      1 
ATOM   1197 O O      . GLU C 3 11  ? 17.977  0.413   30.231 1.00 42.63 ? 15  GLU A O      1 
ATOM   1198 C CB     . GLU C 3 11  ? 16.352  0.242   27.632 1.00 43.56 ? 15  GLU A CB     1 
ATOM   1199 C CG     . GLU C 3 11  ? 16.595  -1.183  28.125 1.00 47.23 ? 15  GLU A CG     1 
ATOM   1200 C CD     . GLU C 3 11  ? 15.396  -1.836  28.808 1.00 52.47 ? 15  GLU A CD     1 
ATOM   1201 O OE1    . GLU C 3 11  ? 14.494  -1.111  29.284 1.00 55.12 ? 15  GLU A OE1    1 
ATOM   1202 O OE2    . GLU C 3 11  ? 15.362  -3.093  28.898 1.00 55.62 ? 15  GLU A OE2    1 
ATOM   1203 H H      . GLU C 3 11  ? 15.883  2.706   27.168 1.00 0.00  ? 15  GLU A H      1 
ATOM   1204 N N      . PHE C 3 12  ? 18.404  2.436   29.318 1.00 43.59 ? 16  PHE A N      1 
ATOM   1205 C CA     . PHE C 3 12  ? 19.662  2.602   30.040 1.00 41.02 ? 16  PHE A CA     1 
ATOM   1206 C C      . PHE C 3 12  ? 19.335  2.984   31.474 1.00 38.74 ? 16  PHE A C      1 
ATOM   1207 O O      . PHE C 3 12  ? 19.957  2.492   32.397 1.00 36.43 ? 16  PHE A O      1 
ATOM   1208 C CB     . PHE C 3 12  ? 20.544  3.678   29.397 1.00 42.94 ? 16  PHE A CB     1 
ATOM   1209 C CG     . PHE C 3 12  ? 21.914  3.846   30.069 1.00 40.04 ? 16  PHE A CG     1 
ATOM   1210 C CD1    . PHE C 3 12  ? 22.916  2.897   29.898 1.00 34.36 ? 16  PHE A CD1    1 
ATOM   1211 C CD2    . PHE C 3 12  ? 22.189  4.957   30.861 1.00 37.20 ? 16  PHE A CD2    1 
ATOM   1212 C CE1    . PHE C 3 12  ? 24.131  3.063   30.499 1.00 30.78 ? 16  PHE A CE1    1 
ATOM   1213 C CE2    . PHE C 3 12  ? 23.408  5.117   31.456 1.00 30.59 ? 16  PHE A CE2    1 
ATOM   1214 C CZ     . PHE C 3 12  ? 24.376  4.172   31.275 1.00 30.59 ? 16  PHE A CZ     1 
ATOM   1215 H H      . PHE C 3 12  ? 18.183  3.094   28.623 1.00 0.00  ? 16  PHE A H      1 
ATOM   1216 N N      . LYS C 3 13  ? 18.372  3.885   31.639 1.00 39.18 ? 17  LYS A N      1 
ATOM   1217 C CA     . LYS C 3 13  ? 17.927  4.311   32.955 1.00 40.55 ? 17  LYS A CA     1 
ATOM   1218 C C      . LYS C 3 13  ? 17.327  3.143   33.778 1.00 43.03 ? 17  LYS A C      1 
ATOM   1219 O O      . LYS C 3 13  ? 17.627  2.990   34.964 1.00 46.07 ? 17  LYS A O      1 
ATOM   1220 C CB     . LYS C 3 13  ? 16.924  5.476   32.824 1.00 39.52 ? 17  LYS A CB     1 
ATOM   1221 C CG     . LYS C 3 13  ? 16.356  5.985   34.165 1.00 33.24 ? 17  LYS A CG     1 
ATOM   1222 C CD     . LYS C 3 13  ? 15.390  7.150   33.994 1.00 33.72 ? 17  LYS A CD     1 
ATOM   1223 C CE     . LYS C 3 13  ? 16.047  8.422   33.390 1.00 41.30 ? 17  LYS A CE     1 
ATOM   1224 N NZ     . LYS C 3 13  ? 15.208  9.720   33.383 1.00 41.94 ? 17  LYS A NZ     1 
ATOM   1225 H H      . LYS C 3 13  ? 18.031  4.332   30.825 1.00 0.00  ? 17  LYS A H      1 
ATOM   1226 H HZ1    . LYS C 3 13  ? 14.280  9.720   32.884 1.00 0.00  ? 17  LYS A HZ1    1 
ATOM   1227 H HZ2    . LYS C 3 13  ? 15.013  10.032  34.349 1.00 0.00  ? 17  LYS A HZ2    1 
ATOM   1228 H HZ3    . LYS C 3 13  ? 15.763  10.465  32.919 1.00 0.00  ? 17  LYS A HZ3    1 
ATOM   1229 N N      . VAL C 3 14  ? 16.507  2.297   33.155 1.00 45.20 ? 18  VAL A N      1 
ATOM   1230 C CA     . VAL C 3 14  ? 15.869  1.172   33.862 1.00 43.84 ? 18  VAL A CA     1 
ATOM   1231 C C      . VAL C 3 14  ? 16.837  0.095   34.290 1.00 42.11 ? 18  VAL A C      1 
ATOM   1232 O O      . VAL C 3 14  ? 16.737  -0.428  35.402 1.00 41.27 ? 18  VAL A O      1 
ATOM   1233 C CB     . VAL C 3 14  ? 14.703  0.541   33.024 1.00 45.95 ? 18  VAL A CB     1 
ATOM   1234 C CG1    . VAL C 3 14  ? 13.990  -0.564  33.804 1.00 41.67 ? 18  VAL A CG1    1 
ATOM   1235 C CG2    . VAL C 3 14  ? 13.693  1.636   32.654 1.00 47.45 ? 18  VAL A CG2    1 
ATOM   1236 H H      . VAL C 3 14  ? 16.231  2.509   32.232 1.00 0.00  ? 18  VAL A H      1 
ATOM   1237 N N      . ARG C 3 15  ? 17.790  -0.220  33.417 1.00 43.24 ? 19  ARG A N      1 
ATOM   1238 C CA     . ARG C 3 15  ? 18.794  -1.243  33.693 1.00 44.49 ? 19  ARG A CA     1 
ATOM   1239 C C      . ARG C 3 15  ? 19.877  -0.768  34.647 1.00 43.64 ? 19  ARG A C      1 
ATOM   1240 O O      . ARG C 3 15  ? 20.548  -1.583  35.290 1.00 45.27 ? 19  ARG A O      1 
ATOM   1241 C CB     . ARG C 3 15  ? 19.407  -1.756  32.397 1.00 52.00 ? 19  ARG A CB     1 
ATOM   1242 C CG     . ARG C 3 15  ? 18.442  -2.608  31.560 1.00 61.08 ? 19  ARG A CG     1 
ATOM   1243 C CD     . ARG C 3 15  ? 19.052  -3.041  30.222 1.00 69.14 ? 19  ARG A CD     1 
ATOM   1244 N NE     . ARG C 3 15  ? 20.210  -3.921  30.401 1.00 74.75 ? 19  ARG A NE     1 
ATOM   1245 C CZ     . ARG C 3 15  ? 20.804  -4.599  29.422 1.00 73.73 ? 19  ARG A CZ     1 
ATOM   1246 N NH1    . ARG C 3 15  ? 20.353  -4.507  28.182 1.00 74.86 ? 19  ARG A NH1    1 
ATOM   1247 N NH2    . ARG C 3 15  ? 21.846  -5.382  29.692 1.00 73.07 ? 19  ARG A NH2    1 
ATOM   1248 H H      . ARG C 3 15  ? 17.817  0.181   32.518 1.00 0.00  ? 19  ARG A H      1 
ATOM   1249 H HE     . ARG C 3 15  ? 20.575  -4.027  31.302 1.00 0.00  ? 19  ARG A HE     1 
ATOM   1250 H HH11   . ARG C 3 15  ? 19.558  -3.956  27.948 1.00 0.00  ? 19  ARG A HH11   1 
ATOM   1251 H HH12   . ARG C 3 15  ? 20.830  -5.034  27.475 1.00 0.00  ? 19  ARG A HH12   1 
ATOM   1252 H HH21   . ARG C 3 15  ? 22.195  -5.464  30.631 1.00 0.00  ? 19  ARG A HH21   1 
ATOM   1253 H HH22   . ARG C 3 15  ? 22.313  -5.911  28.977 1.00 0.00  ? 19  ARG A HH22   1 
ATOM   1254 N N      . ARG C 3 16  ? 20.033  0.548   34.755 1.00 40.75 ? 20  ARG A N      1 
ATOM   1255 C CA     . ARG C 3 16  ? 20.995  1.216   35.640 1.00 40.18 ? 20  ARG A CA     1 
ATOM   1256 C C      . ARG C 3 16  ? 20.507  0.943   37.054 1.00 39.83 ? 20  ARG A C      1 
ATOM   1257 O O      . ARG C 3 16  ? 21.187  0.331   37.876 1.00 38.65 ? 20  ARG A O      1 
ATOM   1258 C CB     . ARG C 3 16  ? 20.891  2.719   35.386 1.00 36.86 ? 20  ARG A CB     1 
ATOM   1259 C CG     . ARG C 3 16  ? 22.020  3.584   35.790 1.00 31.96 ? 20  ARG A CG     1 
ATOM   1260 C CD     . ARG C 3 16  ? 21.519  5.005   35.837 1.00 33.30 ? 20  ARG A CD     1 
ATOM   1261 N NE     . ARG C 3 16  ? 20.647  5.194   36.993 1.00 34.30 ? 20  ARG A NE     1 
ATOM   1262 C CZ     . ARG C 3 16  ? 19.877  6.252   37.205 1.00 33.35 ? 20  ARG A CZ     1 
ATOM   1263 N NH1    . ARG C 3 16  ? 19.837  7.270   36.362 1.00 35.17 ? 20  ARG A NH1    1 
ATOM   1264 N NH2    . ARG C 3 16  ? 19.101  6.274   38.269 1.00 45.46 ? 20  ARG A NH2    1 
ATOM   1265 H H      . ARG C 3 16  ? 19.501  1.146   34.193 1.00 0.00  ? 20  ARG A H      1 
ATOM   1266 H HE     . ARG C 3 16  ? 20.671  4.548   37.737 1.00 0.00  ? 20  ARG A HE     1 
ATOM   1267 H HH11   . ARG C 3 16  ? 20.393  7.280   35.535 1.00 0.00  ? 20  ARG A HH11   1 
ATOM   1268 H HH12   . ARG C 3 16  ? 19.238  8.037   36.564 1.00 0.00  ? 20  ARG A HH12   1 
ATOM   1269 H HH21   . ARG C 3 16  ? 19.124  5.520   38.932 1.00 0.00  ? 20  ARG A HH21   1 
ATOM   1270 H HH22   . ARG C 3 16  ? 18.509  7.067   38.459 1.00 0.00  ? 20  ARG A HH22   1 
ATOM   1271 N N      . ILE C 3 17  ? 19.278  1.391   37.290 1.00 43.64 ? 21  ILE A N      1 
ATOM   1272 C CA     . ILE C 3 17  ? 18.601  1.244   38.558 1.00 44.60 ? 21  ILE A CA     1 
ATOM   1273 C C      . ILE C 3 17  ? 18.440  -0.194  38.996 1.00 46.79 ? 21  ILE A C      1 
ATOM   1274 O O      . ILE C 3 17  ? 18.789  -0.542  40.126 1.00 50.60 ? 21  ILE A O      1 
ATOM   1275 C CB     . ILE C 3 17  ? 17.249  1.950   38.519 1.00 42.09 ? 21  ILE A CB     1 
ATOM   1276 C CG1    . ILE C 3 17  ? 17.478  3.424   38.164 1.00 39.68 ? 21  ILE A CG1    1 
ATOM   1277 C CG2    . ILE C 3 17  ? 16.573  1.829   39.889 1.00 44.48 ? 21  ILE A CG2    1 
ATOM   1278 C CD1    . ILE C 3 17  ? 16.264  4.187   37.812 1.00 37.34 ? 21  ILE A CD1    1 
ATOM   1279 H H      . ILE C 3 17  ? 18.744  1.870   36.601 1.00 0.00  ? 21  ILE A H      1 
ATOM   1280 N N      . LYS C 3 18  ? 17.969  -1.061  38.117 1.00 45.89 ? 22  LYS A N      1 
ATOM   1281 C CA     . LYS C 3 18  ? 17.794  -2.432  38.542 1.00 48.00 ? 22  LYS A CA     1 
ATOM   1282 C C      . LYS C 3 18  ? 19.100  -3.167  38.860 1.00 46.98 ? 22  LYS A C      1 
ATOM   1283 O O      . LYS C 3 18  ? 19.077  -4.224  39.498 1.00 49.16 ? 22  LYS A O      1 
ATOM   1284 C CB     . LYS C 3 18  ? 16.909  -3.209  37.562 1.00 50.89 ? 22  LYS A CB     1 
ATOM   1285 C CG     . LYS C 3 18  ? 15.405  -3.196  37.915 1.00 52.61 ? 22  LYS A CG     1 
ATOM   1286 C CD     . LYS C 3 18  ? 14.683  -1.879  37.571 1.00 53.47 ? 22  LYS A CD     1 
ATOM   1287 C CE     . LYS C 3 18  ? 13.172  -2.020  37.838 1.00 53.49 ? 22  LYS A CE     1 
ATOM   1288 N NZ     . LYS C 3 18  ? 12.313  -0.848  37.445 1.00 53.55 ? 22  LYS A NZ     1 
ATOM   1289 H H      . LYS C 3 18  ? 17.671  -0.827  37.193 1.00 0.00  ? 22  LYS A H      1 
ATOM   1290 H HZ1    . LYS C 3 18  ? 12.637  -0.008  37.975 1.00 0.00  ? 22  LYS A HZ1    1 
ATOM   1291 H HZ2    . LYS C 3 18  ? 12.377  -0.648  36.429 1.00 0.00  ? 22  LYS A HZ2    1 
ATOM   1292 H HZ3    . LYS C 3 18  ? 11.321  -1.002  37.720 1.00 0.00  ? 22  LYS A HZ3    1 
ATOM   1293 N N      . LEU C 3 19  ? 20.229  -2.618  38.406 1.00 46.45 ? 23  LEU A N      1 
ATOM   1294 C CA     . LEU C 3 19  ? 21.559  -3.213  38.656 1.00 43.14 ? 23  LEU A CA     1 
ATOM   1295 C C      . LEU C 3 19  ? 22.135  -2.686  39.961 1.00 41.17 ? 23  LEU A C      1 
ATOM   1296 O O      . LEU C 3 19  ? 22.821  -3.413  40.695 1.00 41.42 ? 23  LEU A O      1 
ATOM   1297 C CB     . LEU C 3 19  ? 22.542  -2.926  37.510 1.00 37.48 ? 23  LEU A CB     1 
ATOM   1298 C CG     . LEU C 3 19  ? 22.508  -3.941  36.373 1.00 31.36 ? 23  LEU A CG     1 
ATOM   1299 C CD1    . LEU C 3 19  ? 23.279  -3.409  35.207 1.00 34.82 ? 23  LEU A CD1    1 
ATOM   1300 C CD2    . LEU C 3 19  ? 23.063  -5.271  36.818 1.00 30.39 ? 23  LEU A CD2    1 
ATOM   1301 H H      . LEU C 3 19  ? 20.206  -1.814  37.840 1.00 0.00  ? 23  LEU A H      1 
ATOM   1302 N N      . GLY C 3 20  ? 21.941  -1.394  40.184 1.00 35.48 ? 24  GLY A N      1 
ATOM   1303 C CA     . GLY C 3 20  ? 22.393  -0.800  41.413 1.00 34.20 ? 24  GLY A CA     1 
ATOM   1304 C C      . GLY C 3 20  ? 23.226  0.445   41.293 1.00 33.56 ? 24  GLY A C      1 
ATOM   1305 O O      . GLY C 3 20  ? 23.772  0.922   42.307 1.00 37.24 ? 24  GLY A O      1 
ATOM   1306 H H      . GLY C 3 20  ? 21.573  -0.841  39.464 1.00 0.00  ? 24  GLY A H      1 
ATOM   1307 N N      . TYR C 3 21  ? 23.289  1.028   40.098 1.00 31.11 ? 25  TYR A N      1 
ATOM   1308 C CA     . TYR C 3 21  ? 24.128  2.221   39.930 1.00 27.09 ? 25  TYR A CA     1 
ATOM   1309 C C      . TYR C 3 21  ? 23.319  3.466   39.951 1.00 22.87 ? 25  TYR A C      1 
ATOM   1310 O O      . TYR C 3 21  ? 22.107  3.414   39.756 1.00 23.85 ? 25  TYR A O      1 
ATOM   1311 C CB     . TYR C 3 21  ? 24.960  2.173   38.648 1.00 26.47 ? 25  TYR A CB     1 
ATOM   1312 C CG     . TYR C 3 21  ? 25.850  0.956   38.509 1.00 27.88 ? 25  TYR A CG     1 
ATOM   1313 C CD1    . TYR C 3 21  ? 25.328  -0.271  38.110 1.00 31.03 ? 25  TYR A CD1    1 
ATOM   1314 C CD2    . TYR C 3 21  ? 27.235  1.052   38.672 1.00 32.44 ? 25  TYR A CD2    1 
ATOM   1315 C CE1    . TYR C 3 21  ? 26.175  -1.391  37.853 1.00 39.20 ? 25  TYR A CE1    1 
ATOM   1316 C CE2    . TYR C 3 21  ? 28.104  -0.062  38.415 1.00 35.16 ? 25  TYR A CE2    1 
ATOM   1317 C CZ     . TYR C 3 21  ? 27.563  -1.280  37.996 1.00 37.48 ? 25  TYR A CZ     1 
ATOM   1318 O OH     . TYR C 3 21  ? 28.376  -2.348  37.650 1.00 37.22 ? 25  TYR A OH     1 
ATOM   1319 H H      . TYR C 3 21  ? 22.687  0.695   39.391 1.00 0.00  ? 25  TYR A H      1 
ATOM   1320 H HH     . TYR C 3 21  ? 29.306  -2.144  37.853 1.00 0.00  ? 25  TYR A HH     1 
ATOM   1321 N N      . THR C 3 22  ? 23.963  4.558   40.335 1.00 22.21 ? 26  THR A N      1 
ATOM   1322 C CA     . THR C 3 22  ? 23.302  5.845   40.379 1.00 23.10 ? 26  THR A CA     1 
ATOM   1323 C C      . THR C 3 22  ? 24.013  6.544   39.254 1.00 20.22 ? 26  THR A C      1 
ATOM   1324 O O      . THR C 3 22  ? 25.001  6.035   38.762 1.00 23.49 ? 26  THR A O      1 
ATOM   1325 C CB     . THR C 3 22  ? 23.456  6.614   41.782 1.00 26.22 ? 26  THR A CB     1 
ATOM   1326 O OG1    . THR C 3 22  ? 24.333  7.726   41.686 1.00 33.54 ? 26  THR A OG1    1 
ATOM   1327 C CG2    . THR C 3 22  ? 24.014  5.761   42.843 1.00 32.05 ? 26  THR A CG2    1 
ATOM   1328 H H      . THR C 3 22  ? 24.903  4.504   40.658 1.00 0.00  ? 26  THR A H      1 
ATOM   1329 H HG1    . THR C 3 22  ? 23.696  8.426   41.465 1.00 0.00  ? 26  THR A HG1    1 
ATOM   1330 N N      . GLN C 3 23  ? 23.538  7.705   38.842 1.00 19.50 ? 27  GLN A N      1 
ATOM   1331 C CA     . GLN C 3 23  ? 24.185  8.402   37.750 1.00 21.58 ? 27  GLN A CA     1 
ATOM   1332 C C      . GLN C 3 23  ? 25.634  8.691   38.136 1.00 22.48 ? 27  GLN A C      1 
ATOM   1333 O O      . GLN C 3 23  ? 26.533  8.641   37.313 1.00 24.11 ? 27  GLN A O      1 
ATOM   1334 C CB     . GLN C 3 23  ? 23.418  9.696   37.402 1.00 18.66 ? 27  GLN A CB     1 
ATOM   1335 C CG     . GLN C 3 23  ? 21.959  9.442   36.857 1.00 15.03 ? 27  GLN A CG     1 
ATOM   1336 C CD     . GLN C 3 23  ? 21.215  10.744  36.555 1.00 20.29 ? 27  GLN A CD     1 
ATOM   1337 O OE1    . GLN C 3 23  ? 21.679  11.844  36.890 1.00 20.97 ? 27  GLN A OE1    1 
ATOM   1338 N NE2    . GLN C 3 23  ? 20.059  10.626  35.931 1.00 23.05 ? 27  GLN A NE2    1 
ATOM   1339 H H      . GLN C 3 23  ? 22.817  8.202   39.324 1.00 0.00  ? 27  GLN A H      1 
ATOM   1340 H HE21   . GLN C 3 23  ? 19.491  11.397  35.782 1.00 0.00  ? 27  GLN A HE21   1 
ATOM   1341 H HE22   . GLN C 3 23  ? 19.792  9.727   35.656 1.00 0.00  ? 27  GLN A HE22   1 
ATOM   1342 N N      . THR C 3 24  ? 25.873  8.876   39.425 1.00 23.77 ? 28  THR A N      1 
ATOM   1343 C CA     . THR C 3 24  ? 27.207  9.173   39.916 1.00 22.63 ? 28  THR A CA     1 
ATOM   1344 C C      . THR C 3 24  ? 28.093  7.927   39.747 1.00 24.51 ? 28  THR A C      1 
ATOM   1345 O O      . THR C 3 24  ? 29.208  7.993   39.232 1.00 29.86 ? 28  THR A O      1 
ATOM   1346 C CB     . THR C 3 24  ? 27.129  9.689   41.373 1.00 19.38 ? 28  THR A CB     1 
ATOM   1347 O OG1    . THR C 3 24  ? 26.739  11.073  41.355 1.00 22.91 ? 28  THR A OG1    1 
ATOM   1348 C CG2    . THR C 3 24  ? 28.436  9.574   42.084 1.00 27.25 ? 28  THR A CG2    1 
ATOM   1349 H H      . THR C 3 24  ? 25.242  8.662   40.163 1.00 0.00  ? 28  THR A H      1 
ATOM   1350 H HG1    . THR C 3 24  ? 27.383  11.645  40.911 1.00 0.00  ? 28  THR A HG1    1 
ATOM   1351 N N      . ASN C 3 25  ? 27.554  6.766   40.071 1.00 25.40 ? 29  ASN A N      1 
ATOM   1352 C CA     . ASN C 3 25  ? 28.319  5.532   39.958 1.00 26.73 ? 29  ASN A CA     1 
ATOM   1353 C C      . ASN C 3 25  ? 28.631  5.156   38.533 1.00 28.04 ? 29  ASN A C      1 
ATOM   1354 O O      . ASN C 3 25  ? 29.654  4.525   38.292 1.00 30.38 ? 29  ASN A O      1 
ATOM   1355 C CB     . ASN C 3 25  ? 27.598  4.365   40.639 1.00 28.96 ? 29  ASN A CB     1 
ATOM   1356 C CG     . ASN C 3 25  ? 27.149  4.706   42.033 1.00 32.83 ? 29  ASN A CG     1 
ATOM   1357 O OD1    . ASN C 3 25  ? 27.507  5.757   42.566 1.00 36.85 ? 29  ASN A OD1    1 
ATOM   1358 N ND2    . ASN C 3 25  ? 26.316  3.845   42.618 1.00 35.42 ? 29  ASN A ND2    1 
ATOM   1359 H H      . ASN C 3 25  ? 26.645  6.861   40.434 1.00 0.00  ? 29  ASN A H      1 
ATOM   1360 H HD21   . ASN C 3 25  ? 26.030  4.054   43.519 1.00 0.00  ? 29  ASN A HD21   1 
ATOM   1361 H HD22   . ASN C 3 25  ? 25.987  3.034   42.182 1.00 0.00  ? 29  ASN A HD22   1 
ATOM   1362 N N      . VAL C 3 26  ? 27.721  5.429   37.594 1.00 29.03 ? 30  VAL A N      1 
ATOM   1363 C CA     . VAL C 3 26  ? 27.968  5.102   36.173 1.00 26.98 ? 30  VAL A CA     1 
ATOM   1364 C C      . VAL C 3 26  ? 29.248  5.833   35.737 1.00 29.02 ? 30  VAL A C      1 
ATOM   1365 O O      . VAL C 3 26  ? 30.147  5.213   35.179 1.00 30.96 ? 30  VAL A O      1 
ATOM   1366 C CB     . VAL C 3 26  ? 26.788  5.504   35.211 1.00 24.80 ? 30  VAL A CB     1 
ATOM   1367 C CG1    . VAL C 3 26  ? 27.094  5.006   33.806 1.00 19.43 ? 30  VAL A CG1    1 
ATOM   1368 C CG2    . VAL C 3 26  ? 25.444  4.928   35.705 1.00 13.95 ? 30  VAL A CG2    1 
ATOM   1369 H H      . VAL C 3 26  ? 26.851  5.783   37.907 1.00 0.00  ? 30  VAL A H      1 
ATOM   1370 N N      . GLY C 3 27  ? 29.329  7.134   36.036 1.00 29.48 ? 31  GLY A N      1 
ATOM   1371 C CA     . GLY C 3 27  ? 30.495  7.932   35.695 1.00 32.65 ? 31  GLY A CA     1 
ATOM   1372 C C      . GLY C 3 27  ? 31.805  7.428   36.289 1.00 34.17 ? 31  GLY A C      1 
ATOM   1373 O O      . GLY C 3 27  ? 32.873  7.635   35.716 1.00 40.33 ? 31  GLY A O      1 
ATOM   1374 H H      . GLY C 3 27  ? 28.545  7.577   36.433 1.00 0.00  ? 31  GLY A H      1 
ATOM   1375 N N      . GLU C 3 28  ? 31.746  6.822   37.462 1.00 33.74 ? 32  GLU A N      1 
ATOM   1376 C CA     . GLU C 3 28  ? 32.932  6.264   38.102 1.00 31.44 ? 32  GLU A CA     1 
ATOM   1377 C C      . GLU C 3 28  ? 33.332  4.921   37.525 1.00 31.88 ? 32  GLU A C      1 
ATOM   1378 O O      . GLU C 3 28  ? 34.503  4.701   37.250 1.00 36.55 ? 32  GLU A O      1 
ATOM   1379 C CB     . GLU C 3 28  ? 32.711  6.117   39.600 1.00 30.93 ? 32  GLU A CB     1 
ATOM   1380 C CG     . GLU C 3 28  ? 32.433  7.431   40.299 1.00 26.52 ? 32  GLU A CG     1 
ATOM   1381 C CD     . GLU C 3 28  ? 31.688  7.263   41.588 1.00 24.82 ? 32  GLU A CD     1 
ATOM   1382 O OE1    . GLU C 3 28  ? 31.163  6.158   41.844 1.00 25.79 ? 32  GLU A OE1    1 
ATOM   1383 O OE2    . GLU C 3 28  ? 31.628  8.259   42.340 1.00 22.81 ? 32  GLU A OE2    1 
ATOM   1384 H H      . GLU C 3 28  ? 30.896  6.913   37.936 1.00 0.00  ? 32  GLU A H      1 
ATOM   1385 N N      . ALA C 3 29  ? 32.385  3.997   37.378 1.00 33.44 ? 33  ALA A N      1 
ATOM   1386 C CA     . ALA C 3 29  ? 32.663  2.659   36.818 1.00 34.87 ? 33  ALA A CA     1 
ATOM   1387 C C      . ALA C 3 29  ? 33.213  2.817   35.393 1.00 37.98 ? 33  ALA A C      1 
ATOM   1388 O O      . ALA C 3 29  ? 34.079  2.058   34.932 1.00 35.93 ? 33  ALA A O      1 
ATOM   1389 C CB     . ALA C 3 29  ? 31.383  1.812   36.810 1.00 33.76 ? 33  ALA A CB     1 
ATOM   1390 H H      . ALA C 3 29  ? 31.460  4.143   37.664 1.00 0.00  ? 33  ALA A H      1 
ATOM   1391 N N      . LEU C 3 30  ? 32.688  3.832   34.721 1.00 40.47 ? 34  LEU A N      1 
ATOM   1392 C CA     . LEU C 3 30  ? 33.072  4.195   33.375 1.00 46.13 ? 34  LEU A CA     1 
ATOM   1393 C C      . LEU C 3 30  ? 34.496  4.819   33.339 1.00 48.54 ? 34  LEU A C      1 
ATOM   1394 O O      . LEU C 3 30  ? 34.957  5.333   32.304 1.00 49.69 ? 34  LEU A O      1 
ATOM   1395 C CB     . LEU C 3 30  ? 32.035  5.192   32.854 1.00 47.48 ? 34  LEU A CB     1 
ATOM   1396 C CG     . LEU C 3 30  ? 31.659  5.249   31.373 1.00 49.07 ? 34  LEU A CG     1 
ATOM   1397 C CD1    . LEU C 3 30  ? 30.840  3.996   31.060 1.00 46.69 ? 34  LEU A CD1    1 
ATOM   1398 C CD2    . LEU C 3 30  ? 30.839  6.533   31.101 1.00 44.94 ? 34  LEU A CD2    1 
ATOM   1399 H H      . LEU C 3 30  ? 31.919  4.361   35.052 1.00 0.00  ? 34  LEU A H      1 
ATOM   1400 N N      . ALA C 3 31  ? 35.177  4.801   34.475 1.00 50.95 ? 35  ALA A N      1 
ATOM   1401 C CA     . ALA C 3 31  ? 36.526  5.326   34.555 1.00 50.28 ? 35  ALA A CA     1 
ATOM   1402 C C      . ALA C 3 31  ? 37.448  4.112   34.681 1.00 49.79 ? 35  ALA A C      1 
ATOM   1403 O O      . ALA C 3 31  ? 38.505  4.074   34.055 1.00 50.33 ? 35  ALA A O      1 
ATOM   1404 C CB     . ALA C 3 31  ? 36.673  6.255   35.755 1.00 48.86 ? 35  ALA A CB     1 
ATOM   1405 H H      . ALA C 3 31  ? 34.849  4.464   35.323 1.00 0.00  ? 35  ALA A H      1 
ATOM   1406 N N      . ALA C 3 32  ? 36.981  3.096   35.407 1.00 46.59 ? 36  ALA A N      1 
ATOM   1407 C CA     . ALA C 3 32  ? 37.742  1.869   35.634 1.00 45.74 ? 36  ALA A CA     1 
ATOM   1408 C C      . ALA C 3 32  ? 38.106  1.150   34.345 1.00 46.39 ? 36  ALA A C      1 
ATOM   1409 O O      . ALA C 3 32  ? 39.117  0.450   34.279 1.00 46.25 ? 36  ALA A O      1 
ATOM   1410 C CB     . ALA C 3 32  ? 36.946  0.945   36.520 1.00 40.99 ? 36  ALA A CB     1 
ATOM   1411 H H      . ALA C 3 32  ? 36.126  3.279   35.840 1.00 0.00  ? 36  ALA A H      1 
ATOM   1412 N N      . VAL C 3 33  ? 37.252  1.313   33.338 1.00 47.09 ? 37  VAL A N      1 
ATOM   1413 C CA     . VAL C 3 33  ? 37.413  0.644   32.052 1.00 46.11 ? 37  VAL A CA     1 
ATOM   1414 C C      . VAL C 3 33  ? 37.676  1.593   30.882 1.00 45.91 ? 37  VAL A C      1 
ATOM   1415 O O      . VAL C 3 33  ? 38.161  1.168   29.848 1.00 48.01 ? 37  VAL A O      1 
ATOM   1416 C CB     . VAL C 3 33  ? 36.107  -0.170  31.744 1.00 48.50 ? 37  VAL A CB     1 
ATOM   1417 C CG1    . VAL C 3 33  ? 36.050  -0.607  30.290 1.00 50.91 ? 37  VAL A CG1    1 
ATOM   1418 C CG2    . VAL C 3 33  ? 35.957  -1.384  32.684 1.00 44.96 ? 37  VAL A CG2    1 
ATOM   1419 H H      . VAL C 3 33  ? 36.420  1.807   33.544 1.00 0.00  ? 37  VAL A H      1 
ATOM   1420 N N      . HIS C 3 34  ? 37.351  2.866   31.049 1.00 45.87 ? 38  HIS A N      1 
ATOM   1421 C CA     . HIS C 3 34  ? 37.485  3.845   29.980 1.00 44.39 ? 38  HIS A CA     1 
ATOM   1422 C C      . HIS C 3 34  ? 38.530  4.933   30.252 1.00 43.77 ? 38  HIS A C      1 
ATOM   1423 O O      . HIS C 3 34  ? 38.862  5.726   29.358 1.00 40.82 ? 38  HIS A O      1 
ATOM   1424 C CB     . HIS C 3 34  ? 36.094  4.458   29.730 1.00 47.72 ? 38  HIS A CB     1 
ATOM   1425 C CG     . HIS C 3 34  ? 36.061  5.591   28.743 1.00 48.31 ? 38  HIS A CG     1 
ATOM   1426 N ND1    . HIS C 3 34  ? 35.869  6.904   29.120 1.00 49.52 ? 38  HIS A ND1    1 
ATOM   1427 C CD2    . HIS C 3 34  ? 36.145  5.602   27.394 1.00 49.46 ? 38  HIS A CD2    1 
ATOM   1428 C CE1    . HIS C 3 34  ? 35.825  7.675   28.048 1.00 48.84 ? 38  HIS A CE1    1 
ATOM   1429 N NE2    . HIS C 3 34  ? 35.988  6.906   26.987 1.00 50.93 ? 38  HIS A NE2    1 
ATOM   1430 H H      . HIS C 3 34  ? 37.004  3.152   31.915 1.00 0.00  ? 38  HIS A H      1 
ATOM   1431 H HD1    . HIS C 3 34  ? 35.799  7.173   30.066 1.00 0.00  ? 38  HIS A HD1    1 
ATOM   1432 H HE2    . HIS C 3 34  ? 35.911  7.223   26.056 1.00 0.00  ? 38  HIS A HE2    1 
ATOM   1433 N N      . GLY C 3 35  ? 39.030  4.994   31.486 1.00 43.99 ? 39  GLY A N      1 
ATOM   1434 C CA     . GLY C 3 35  ? 40.021  6.002   31.821 1.00 44.31 ? 39  GLY A CA     1 
ATOM   1435 C C      . GLY C 3 35  ? 39.561  7.268   32.553 1.00 44.90 ? 39  GLY A C      1 
ATOM   1436 O O      . GLY C 3 35  ? 39.929  7.495   33.718 1.00 48.56 ? 39  GLY A O      1 
ATOM   1437 H H      . GLY C 3 35  ? 38.827  4.413   32.259 1.00 0.00  ? 39  GLY A H      1 
ATOM   1438 N N      . SER C 3 36  ? 38.834  8.134   31.852 1.00 41.85 ? 40  SER A N      1 
ATOM   1439 C CA     . SER C 3 36  ? 38.338  9.391   32.425 1.00 37.81 ? 40  SER A CA     1 
ATOM   1440 C C      . SER C 3 36  ? 36.984  9.170   33.108 1.00 35.54 ? 40  SER A C      1 
ATOM   1441 O O      . SER C 3 36  ? 36.289  8.212   32.784 1.00 35.30 ? 40  SER A O      1 
ATOM   1442 C CB     . SER C 3 36  ? 38.194  10.444  31.331 1.00 39.51 ? 40  SER A CB     1 
ATOM   1443 O OG     . SER C 3 36  ? 39.338  10.473  30.494 1.00 41.34 ? 40  SER A OG     1 
ATOM   1444 H H      . SER C 3 36  ? 38.631  7.863   30.933 1.00 0.00  ? 40  SER A H      1 
ATOM   1445 H HG     . SER C 3 36  ? 39.182  11.104  29.784 1.00 0.00  ? 40  SER A HG     1 
ATOM   1446 N N      . GLU C 3 37  ? 36.645  10.026  34.079 1.00 35.54 ? 41  GLU A N      1 
ATOM   1447 C CA     . GLU C 3 37  ? 35.365  9.926   34.810 1.00 31.17 ? 41  GLU A CA     1 
ATOM   1448 C C      . GLU C 3 37  ? 34.377  11.039  34.355 1.00 27.95 ? 41  GLU A C      1 
ATOM   1449 O O      . GLU C 3 37  ? 34.723  12.230  34.293 1.00 23.15 ? 41  GLU A O      1 
ATOM   1450 C CB     . GLU C 3 37  ? 35.623  9.979   36.339 1.00 26.56 ? 41  GLU A CB     1 
ATOM   1451 C CG     . GLU C 3 37  ? 34.366  9.920   37.248 1.00 26.10 ? 41  GLU A CG     1 
ATOM   1452 C CD     . GLU C 3 37  ? 34.621  10.294  38.744 1.00 26.03 ? 41  GLU A CD     1 
ATOM   1453 O OE1    . GLU C 3 37  ? 35.086  9.436   39.559 1.00 29.18 ? 41  GLU A OE1    1 
ATOM   1454 O OE2    . GLU C 3 37  ? 34.319  11.441  39.150 1.00 18.91 ? 41  GLU A OE2    1 
ATOM   1455 H H      . GLU C 3 37  ? 37.320  10.714  34.348 1.00 0.00  ? 41  GLU A H      1 
ATOM   1456 N N      . PHE C 3 38  ? 33.178  10.639  33.947 1.00 24.88 ? 42  PHE A N      1 
ATOM   1457 C CA     . PHE C 3 38  ? 32.159  11.617  33.534 1.00 23.43 ? 42  PHE A CA     1 
ATOM   1458 C C      . PHE C 3 38  ? 31.373  12.085  34.766 1.00 20.61 ? 42  PHE A C      1 
ATOM   1459 O O      . PHE C 3 38  ? 31.113  11.303  35.671 1.00 19.41 ? 42  PHE A O      1 
ATOM   1460 C CB     . PHE C 3 38  ? 31.180  11.009  32.510 1.00 21.55 ? 42  PHE A CB     1 
ATOM   1461 C CG     . PHE C 3 38  ? 31.688  11.024  31.079 1.00 28.15 ? 42  PHE A CG     1 
ATOM   1462 C CD1    . PHE C 3 38  ? 31.867  12.235  30.392 1.00 27.26 ? 42  PHE A CD1    1 
ATOM   1463 C CD2    . PHE C 3 38  ? 32.043  9.837   30.434 1.00 30.41 ? 42  PHE A CD2    1 
ATOM   1464 C CE1    . PHE C 3 38  ? 32.390  12.258  29.081 1.00 24.09 ? 42  PHE A CE1    1 
ATOM   1465 C CE2    . PHE C 3 38  ? 32.571  9.864   29.113 1.00 29.07 ? 42  PHE A CE2    1 
ATOM   1466 C CZ     . PHE C 3 38  ? 32.743  11.067  28.452 1.00 23.65 ? 42  PHE A CZ     1 
ATOM   1467 H H      . PHE C 3 38  ? 33.060  9.647   34.001 1.00 0.00  ? 42  PHE A H      1 
ATOM   1468 N N      . SER C 3 39  ? 30.981  13.348  34.808 1.00 19.77 ? 43  SER A N      1 
ATOM   1469 C CA     . SER C 3 39  ? 30.217  13.819  35.947 1.00 20.05 ? 43  SER A CA     1 
ATOM   1470 C C      . SER C 3 39  ? 28.849  13.244  35.890 1.00 22.87 ? 43  SER A C      1 
ATOM   1471 O O      . SER C 3 39  ? 28.449  12.664  34.883 1.00 25.22 ? 43  SER A O      1 
ATOM   1472 C CB     . SER C 3 39  ? 30.062  15.337  35.968 1.00 18.69 ? 43  SER A CB     1 
ATOM   1473 O OG     . SER C 3 39  ? 29.399  15.828  34.814 1.00 20.78 ? 43  SER A OG     1 
ATOM   1474 H H      . SER C 3 39  ? 31.179  13.985  34.069 1.00 0.00  ? 43  SER A H      1 
ATOM   1475 H HG     . SER C 3 39  ? 28.463  15.670  34.833 1.00 0.00  ? 43  SER A HG     1 
ATOM   1476 N N      . GLN C 3 40  ? 28.109  13.492  36.972 1.00 26.83 ? 44  GLN A N      1 
ATOM   1477 C CA     . GLN C 3 40  ? 26.727  13.070  37.167 1.00 22.91 ? 44  GLN A CA     1 
ATOM   1478 C C      . GLN C 3 40  ? 25.887  13.816  36.146 1.00 22.24 ? 44  GLN A C      1 
ATOM   1479 O O      . GLN C 3 40  ? 24.986  13.230  35.549 1.00 24.12 ? 44  GLN A O      1 
ATOM   1480 C CB     . GLN C 3 40  ? 26.280  13.448  38.600 1.00 27.31 ? 44  GLN A CB     1 
ATOM   1481 C CG     . GLN C 3 40  ? 24.757  13.273  38.943 1.00 25.14 ? 44  GLN A CG     1 
ATOM   1482 C CD     . GLN C 3 40  ? 23.959  14.568  38.806 1.00 22.44 ? 44  GLN A CD     1 
ATOM   1483 O OE1    . GLN C 3 40  ? 24.392  15.626  39.264 1.00 18.69 ? 44  GLN A OE1    1 
ATOM   1484 N NE2    . GLN C 3 40  ? 22.808  14.494  38.132 1.00 24.96 ? 44  GLN A NE2    1 
ATOM   1485 H H      . GLN C 3 40  ? 28.533  13.946  37.751 1.00 0.00  ? 44  GLN A H      1 
ATOM   1486 H HE21   . GLN C 3 40  ? 22.318  15.328  37.996 1.00 0.00  ? 44  GLN A HE21   1 
ATOM   1487 H HE22   . GLN C 3 40  ? 22.488  13.637  37.765 1.00 0.00  ? 44  GLN A HE22   1 
ATOM   1488 N N      . THR C 3 41  ? 26.197  15.104  35.952 1.00 19.06 ? 45  THR A N      1 
ATOM   1489 C CA     . THR C 3 41  ? 25.494  15.968  35.002 1.00 17.78 ? 45  THR A CA     1 
ATOM   1490 C C      . THR C 3 41  ? 25.450  15.400  33.593 1.00 21.16 ? 45  THR A C      1 
ATOM   1491 O O      . THR C 3 41  ? 24.422  15.414  32.919 1.00 21.49 ? 45  THR A O      1 
ATOM   1492 C CB     . THR C 3 41  ? 26.106  17.348  34.942 1.00 13.78 ? 45  THR A CB     1 
ATOM   1493 O OG1    . THR C 3 41  ? 26.205  17.845  36.265 1.00 15.83 ? 45  THR A OG1    1 
ATOM   1494 C CG2    . THR C 3 41  ? 25.221  18.289  34.176 1.00 18.62 ? 45  THR A CG2    1 
ATOM   1495 H H      . THR C 3 41  ? 26.917  15.519  36.484 1.00 0.00  ? 45  THR A H      1 
ATOM   1496 H HG1    . THR C 3 41  ? 26.503  18.735  36.306 1.00 0.00  ? 45  THR A HG1    1 
ATOM   1497 N N      . THR C 3 42  ? 26.576  14.862  33.156 1.00 22.55 ? 46  THR A N      1 
ATOM   1498 C CA     . THR C 3 42  ? 26.660  14.307  31.821 1.00 22.54 ? 46  THR A CA     1 
ATOM   1499 C C      . THR C 3 42  ? 25.758  13.107  31.712 1.00 24.43 ? 46  THR A C      1 
ATOM   1500 O O      . THR C 3 42  ? 25.003  13.002  30.760 1.00 27.58 ? 46  THR A O      1 
ATOM   1501 C CB     . THR C 3 42  ? 28.134  13.997  31.446 1.00 16.11 ? 46  THR A CB     1 
ATOM   1502 O OG1    . THR C 3 42  ? 28.790  15.231  31.166 1.00 13.40 ? 46  THR A OG1    1 
ATOM   1503 C CG2    . THR C 3 42  ? 28.245  13.107  30.264 1.00 13.33 ? 46  THR A CG2    1 
ATOM   1504 H H      . THR C 3 42  ? 27.419  14.910  33.656 1.00 0.00  ? 46  THR A H      1 
ATOM   1505 H HG1    . THR C 3 42  ? 28.976  15.581  32.032 1.00 0.00  ? 46  THR A HG1    1 
ATOM   1506 N N      . ILE C 3 43  ? 25.803  12.229  32.711 1.00 24.05 ? 47  ILE A N      1 
ATOM   1507 C CA     . ILE C 3 43  ? 24.991  11.016  32.710 1.00 25.55 ? 47  ILE A CA     1 
ATOM   1508 C C      . ILE C 3 43  ? 23.510  11.336  32.691 1.00 26.61 ? 47  ILE A C      1 
ATOM   1509 O O      . ILE C 3 43  ? 22.710  10.641  32.049 1.00 30.74 ? 47  ILE A O      1 
ATOM   1510 C CB     . ILE C 3 43  ? 25.326  10.102  33.910 1.00 27.12 ? 47  ILE A CB     1 
ATOM   1511 C CG1    . ILE C 3 43  ? 26.834  9.811   33.904 1.00 26.43 ? 47  ILE A CG1    1 
ATOM   1512 C CG2    . ILE C 3 43  ? 24.540  8.743   33.807 1.00 17.84 ? 47  ILE A CG2    1 
ATOM   1513 C CD1    . ILE C 3 43  ? 27.286  9.027   32.641 1.00 29.56 ? 47  ILE A CD1    1 
ATOM   1514 H H      . ILE C 3 43  ? 26.455  12.370  33.451 1.00 0.00  ? 47  ILE A H      1 
ATOM   1515 N N      . CYS C 3 44  ? 23.153  12.414  33.368 1.00 23.91 ? 48  CYS A N      1 
ATOM   1516 C CA     . CYS C 3 44  ? 21.785  12.885  33.425 1.00 22.79 ? 48  CYS A CA     1 
ATOM   1517 C C      . CYS C 3 44  ? 21.378  13.454  32.038 1.00 23.48 ? 48  CYS A C      1 
ATOM   1518 O O      . CYS C 3 44  ? 20.314  13.114  31.513 1.00 23.37 ? 48  CYS A O      1 
ATOM   1519 C CB     . CYS C 3 44  ? 21.683  13.926  34.540 1.00 12.70 ? 48  CYS A CB     1 
ATOM   1520 S SG     . CYS C 3 44  ? 20.302  15.010  34.448 1.00 23.21 ? 48  CYS A SG     1 
ATOM   1521 H H      . CYS C 3 44  ? 23.805  12.821  33.979 1.00 0.00  ? 48  CYS A H      1 
ATOM   1522 N N      . ARG C 3 45  ? 22.210  14.324  31.458 1.00 25.55 ? 49  ARG A N      1 
ATOM   1523 C CA     . ARG C 3 45  ? 21.972  14.900  30.134 1.00 25.57 ? 49  ARG A CA     1 
ATOM   1524 C C      . ARG C 3 45  ? 21.752  13.784  29.108 1.00 28.43 ? 49  ARG A C      1 
ATOM   1525 O O      . ARG C 3 45  ? 20.848  13.857  28.263 1.00 29.09 ? 49  ARG A O      1 
ATOM   1526 C CB     . ARG C 3 45  ? 23.168  15.757  29.686 1.00 23.41 ? 49  ARG A CB     1 
ATOM   1527 C CG     . ARG C 3 45  ? 23.180  17.193  30.211 1.00 19.99 ? 49  ARG A CG     1 
ATOM   1528 C CD     . ARG C 3 45  ? 24.377  17.962  29.632 1.00 17.35 ? 49  ARG A CD     1 
ATOM   1529 N NE     . ARG C 3 45  ? 24.588  19.307  30.169 1.00 17.87 ? 49  ARG A NE     1 
ATOM   1530 C CZ     . ARG C 3 45  ? 25.694  19.711  30.808 1.00 14.83 ? 49  ARG A CZ     1 
ATOM   1531 N NH1    . ARG C 3 45  ? 26.688  18.883  31.012 1.00 12.48 ? 49  ARG A NH1    1 
ATOM   1532 N NH2    . ARG C 3 45  ? 25.835  20.966  31.206 1.00 11.91 ? 49  ARG A NH2    1 
ATOM   1533 H H      . ARG C 3 45  ? 22.980  14.686  31.944 1.00 0.00  ? 49  ARG A H      1 
ATOM   1534 H HE     . ARG C 3 45  ? 23.896  19.976  30.052 1.00 0.00  ? 49  ARG A HE     1 
ATOM   1535 H HH11   . ARG C 3 45  ? 26.663  17.947  30.704 1.00 0.00  ? 49  ARG A HH11   1 
ATOM   1536 H HH12   . ARG C 3 45  ? 27.496  19.212  31.504 1.00 0.00  ? 49  ARG A HH12   1 
ATOM   1537 H HH21   . ARG C 3 45  ? 25.121  21.652  31.043 1.00 0.00  ? 49  ARG A HH21   1 
ATOM   1538 H HH22   . ARG C 3 45  ? 26.671  21.237  31.706 1.00 0.00  ? 49  ARG A HH22   1 
ATOM   1539 N N      . PHE C 3 46  ? 22.577  12.753  29.160 1.00 26.48 ? 50  PHE A N      1 
ATOM   1540 C CA     . PHE C 3 46  ? 22.403  11.688  28.226 1.00 25.63 ? 50  PHE A CA     1 
ATOM   1541 C C      . PHE C 3 46  ? 21.022  11.080  28.301 1.00 26.83 ? 50  PHE A C      1 
ATOM   1542 O O      . PHE C 3 46  ? 20.282  11.130  27.324 1.00 29.96 ? 50  PHE A O      1 
ATOM   1543 C CB     . PHE C 3 46  ? 23.429  10.601  28.410 1.00 23.44 ? 50  PHE A CB     1 
ATOM   1544 C CG     . PHE C 3 46  ? 23.245  9.480   27.428 1.00 22.72 ? 50  PHE A CG     1 
ATOM   1545 C CD1    . PHE C 3 46  ? 23.433  9.690   26.076 1.00 19.64 ? 50  PHE A CD1    1 
ATOM   1546 C CD2    . PHE C 3 46  ? 22.858  8.230   27.848 1.00 23.53 ? 50  PHE A CD2    1 
ATOM   1547 C CE1    . PHE C 3 46  ? 23.226  8.684   25.174 1.00 14.44 ? 50  PHE A CE1    1 
ATOM   1548 C CE2    . PHE C 3 46  ? 22.656  7.226   26.931 1.00 24.72 ? 50  PHE A CE2    1 
ATOM   1549 C CZ     . PHE C 3 46  ? 22.852  7.464   25.587 1.00 20.58 ? 50  PHE A CZ     1 
ATOM   1550 H H      . PHE C 3 46  ? 23.354  12.733  29.767 1.00 0.00  ? 50  PHE A H      1 
ATOM   1551 N N      . GLU C 3 47  ? 20.689  10.484  29.448 1.00 27.79 ? 51  GLU A N      1 
ATOM   1552 C CA     . GLU C 3 47  ? 19.392  9.850   29.670 1.00 23.92 ? 51  GLU A CA     1 
ATOM   1553 C C      . GLU C 3 47  ? 18.214  10.747  29.282 1.00 23.20 ? 51  GLU A C      1 
ATOM   1554 O O      . GLU C 3 47  ? 17.207  10.281  28.761 1.00 23.95 ? 51  GLU A O      1 
ATOM   1555 C CB     . GLU C 3 47  ? 19.280  9.431   31.112 1.00 22.54 ? 51  GLU A CB     1 
ATOM   1556 C CG     . GLU C 3 47  ? 20.189  8.280   31.509 1.00 20.61 ? 51  GLU A CG     1 
ATOM   1557 C CD     . GLU C 3 47  ? 20.140  8.035   32.998 1.00 21.39 ? 51  GLU A CD     1 
ATOM   1558 O OE1    . GLU C 3 47  ? 19.788  8.993   33.711 1.00 22.28 ? 51  GLU A OE1    1 
ATOM   1559 O OE2    . GLU C 3 47  ? 20.413  6.894   33.448 1.00 13.29 ? 51  GLU A OE2    1 
ATOM   1560 H H      . GLU C 3 47  ? 21.306  10.496  30.224 1.00 0.00  ? 51  GLU A H      1 
ATOM   1561 N N      . ASN C 3 48  ? 18.324  12.029  29.562 1.00 18.00 ? 52  ASN A N      1 
ATOM   1562 C CA     . ASN C 3 48  ? 17.292  12.947  29.175 1.00 18.84 ? 52  ASN A CA     1 
ATOM   1563 C C      . ASN C 3 48  ? 17.465  13.486  27.752 1.00 23.08 ? 52  ASN A C      1 
ATOM   1564 O O      . ASN C 3 48  ? 16.691  14.333  27.302 1.00 25.75 ? 52  ASN A O      1 
ATOM   1565 C CB     . ASN C 3 48  ? 17.258  14.120  30.160 1.00 25.64 ? 52  ASN A CB     1 
ATOM   1566 C CG     . ASN C 3 48  ? 16.674  13.736  31.515 1.00 31.64 ? 52  ASN A CG     1 
ATOM   1567 O OD1    . ASN C 3 48  ? 15.498  13.375  31.610 1.00 37.33 ? 52  ASN A OD1    1 
ATOM   1568 N ND2    . ASN C 3 48  ? 17.515  13.731  32.552 1.00 26.62 ? 52  ASN A ND2    1 
ATOM   1569 H H      . ASN C 3 48  ? 19.040  12.368  30.147 1.00 0.00  ? 52  ASN A H      1 
ATOM   1570 H HD21   . ASN C 3 48  ? 17.128  13.562  33.429 1.00 0.00  ? 52  ASN A HD21   1 
ATOM   1571 H HD22   . ASN C 3 48  ? 18.466  13.881  32.383 1.00 0.00  ? 52  ASN A HD22   1 
ATOM   1572 N N      . LEU C 3 49  ? 18.498  13.031  27.050 1.00 23.11 ? 53  LEU A N      1 
ATOM   1573 C CA     . LEU C 3 49  ? 18.824  13.490  25.684 1.00 22.96 ? 53  LEU A CA     1 
ATOM   1574 C C      . LEU C 3 49  ? 18.911  15.026  25.575 1.00 23.90 ? 53  LEU A C      1 
ATOM   1575 O O      . LEU C 3 49  ? 18.484  15.624  24.582 1.00 20.18 ? 53  LEU A O      1 
ATOM   1576 C CB     . LEU C 3 49  ? 17.905  12.851  24.608 1.00 19.44 ? 53  LEU A CB     1 
ATOM   1577 C CG     . LEU C 3 49  ? 18.090  11.323  24.429 1.00 19.09 ? 53  LEU A CG     1 
ATOM   1578 C CD1    . LEU C 3 49  ? 17.020  10.636  23.561 1.00 16.08 ? 53  LEU A CD1    1 
ATOM   1579 C CD2    . LEU C 3 49  ? 19.469  11.061  23.866 1.00 21.07 ? 53  LEU A CD2    1 
ATOM   1580 H H      . LEU C 3 49  ? 19.085  12.397  27.494 1.00 0.00  ? 53  LEU A H      1 
ATOM   1581 N N      . GLN C 3 50  ? 19.508  15.648  26.603 1.00 27.52 ? 54  GLN A N      1 
ATOM   1582 C CA     . GLN C 3 50  ? 19.703  17.104  26.652 1.00 26.95 ? 54  GLN A CA     1 
ATOM   1583 C C      . GLN C 3 50  ? 21.102  17.408  26.107 1.00 28.69 ? 54  GLN A C      1 
ATOM   1584 O O      . GLN C 3 50  ? 21.843  18.251  26.625 1.00 28.26 ? 54  GLN A O      1 
ATOM   1585 C CB     . GLN C 3 50  ? 19.513  17.643  28.070 1.00 24.99 ? 54  GLN A CB     1 
ATOM   1586 C CG     . GLN C 3 50  ? 18.066  18.065  28.387 1.00 30.79 ? 54  GLN A CG     1 
ATOM   1587 C CD     . GLN C 3 50  ? 17.664  19.440  27.801 1.00 35.09 ? 54  GLN A CD     1 
ATOM   1588 O OE1    . GLN C 3 50  ? 18.444  20.403  27.803 1.00 39.51 ? 54  GLN A OE1    1 
ATOM   1589 N NE2    . GLN C 3 50  ? 16.432  19.535  27.328 1.00 37.20 ? 54  GLN A NE2    1 
ATOM   1590 H H      . GLN C 3 50  ? 19.880  15.046  27.278 1.00 0.00  ? 54  GLN A H      1 
ATOM   1591 H HE21   . GLN C 3 50  ? 16.158  20.390  26.953 1.00 0.00  ? 54  GLN A HE21   1 
ATOM   1592 H HE22   . GLN C 3 50  ? 15.837  18.757  27.346 1.00 0.00  ? 54  GLN A HE22   1 
ATOM   1593 N N      . LEU C 3 51  ? 21.393  16.755  24.984 1.00 29.93 ? 55  LEU A N      1 
ATOM   1594 C CA     . LEU C 3 51  ? 22.662  16.851  24.278 1.00 31.09 ? 55  LEU A CA     1 
ATOM   1595 C C      . LEU C 3 51  ? 22.415  17.020  22.786 1.00 29.90 ? 55  LEU A C      1 
ATOM   1596 O O      . LEU C 3 51  ? 21.290  16.836  22.312 1.00 29.52 ? 55  LEU A O      1 
ATOM   1597 C CB     . LEU C 3 51  ? 23.449  15.550  24.441 1.00 29.12 ? 55  LEU A CB     1 
ATOM   1598 C CG     . LEU C 3 51  ? 23.909  15.110  25.814 1.00 31.05 ? 55  LEU A CG     1 
ATOM   1599 C CD1    . LEU C 3 51  ? 24.430  13.714  25.682 1.00 35.42 ? 55  LEU A CD1    1 
ATOM   1600 C CD2    . LEU C 3 51  ? 24.982  16.030  26.362 1.00 28.20 ? 55  LEU A CD2    1 
ATOM   1601 H H      . LEU C 3 51  ? 20.650  16.244  24.571 1.00 0.00  ? 55  LEU A H      1 
ATOM   1602 N N      . SER C 3 52  ? 23.465  17.385  22.056 1.00 26.02 ? 56  SER A N      1 
ATOM   1603 C CA     . SER C 3 52  ? 23.401  17.520  20.603 1.00 26.69 ? 56  SER A CA     1 
ATOM   1604 C C      . SER C 3 52  ? 23.374  16.077  20.116 1.00 29.83 ? 56  SER A C      1 
ATOM   1605 O O      . SER C 3 52  ? 24.007  15.212  20.736 1.00 33.02 ? 56  SER A O      1 
ATOM   1606 C CB     . SER C 3 52  ? 24.679  18.161  20.061 1.00 24.91 ? 56  SER A CB     1 
ATOM   1607 O OG     . SER C 3 52  ? 25.780  17.245  20.114 1.00 26.74 ? 56  SER A OG     1 
ATOM   1608 H H      . SER C 3 52  ? 24.319  17.609  22.493 1.00 0.00  ? 56  SER A H      1 
ATOM   1609 H HG     . SER C 3 52  ? 25.763  16.636  19.383 1.00 0.00  ? 56  SER A HG     1 
ATOM   1610 N N      . PHE C 3 53  ? 22.731  15.831  18.973 1.00 30.10 ? 57  PHE A N      1 
ATOM   1611 C CA     . PHE C 3 53  ? 22.590  14.493  18.389 1.00 30.88 ? 57  PHE A CA     1 
ATOM   1612 C C      . PHE C 3 53  ? 23.895  13.730  18.230 1.00 31.41 ? 57  PHE A C      1 
ATOM   1613 O O      . PHE C 3 53  ? 23.944  12.511  18.445 1.00 31.51 ? 57  PHE A O      1 
ATOM   1614 C CB     . PHE C 3 53  ? 21.864  14.580  17.045 1.00 33.89 ? 57  PHE A CB     1 
ATOM   1615 C CG     . PHE C 3 53  ? 21.633  13.247  16.389 1.00 34.31 ? 57  PHE A CG     1 
ATOM   1616 C CD1    . PHE C 3 53  ? 20.765  12.306  16.953 1.00 31.88 ? 57  PHE A CD1    1 
ATOM   1617 C CD2    . PHE C 3 53  ? 22.326  12.907  15.227 1.00 35.85 ? 57  PHE A CD2    1 
ATOM   1618 C CE1    . PHE C 3 53  ? 20.585  11.058  16.369 1.00 29.91 ? 57  PHE A CE1    1 
ATOM   1619 C CE2    . PHE C 3 53  ? 22.156  11.653  14.626 1.00 34.95 ? 57  PHE A CE2    1 
ATOM   1620 C CZ     . PHE C 3 53  ? 21.290  10.727  15.207 1.00 37.89 ? 57  PHE A CZ     1 
ATOM   1621 H H      . PHE C 3 53  ? 22.316  16.590  18.482 1.00 0.00  ? 57  PHE A H      1 
ATOM   1622 N N      . LYS C 3 54  ? 24.952  14.455  17.868 1.00 32.71 ? 58  LYS A N      1 
ATOM   1623 C CA     . LYS C 3 54  ? 26.278  13.875  17.705 1.00 33.16 ? 58  LYS A CA     1 
ATOM   1624 C C      . LYS C 3 54  ? 26.792  13.437  19.067 1.00 31.62 ? 58  LYS A C      1 
ATOM   1625 O O      . LYS C 3 54  ? 27.187  12.283  19.260 1.00 32.02 ? 58  LYS A O      1 
ATOM   1626 C CB     . LYS C 3 54  ? 27.221  14.926  17.091 1.00 39.99 ? 58  LYS A CB     1 
ATOM   1627 C CG     . LYS C 3 54  ? 28.536  14.376  16.484 1.00 48.80 ? 58  LYS A CG     1 
ATOM   1628 C CD     . LYS C 3 54  ? 29.067  15.263  15.330 1.00 51.03 ? 58  LYS A CD     1 
ATOM   1629 C CE     . LYS C 3 54  ? 28.271  15.042  14.021 1.00 56.61 ? 58  LYS A CE     1 
ATOM   1630 N NZ     . LYS C 3 54  ? 28.639  15.950  12.862 1.00 61.41 ? 58  LYS A NZ     1 
ATOM   1631 H H      . LYS C 3 54  ? 24.884  15.431  17.766 1.00 0.00  ? 58  LYS A H      1 
ATOM   1632 H HZ1    . LYS C 3 54  ? 28.524  16.939  13.170 1.00 0.00  ? 58  LYS A HZ1    1 
ATOM   1633 H HZ2    . LYS C 3 54  ? 29.621  15.833  12.536 1.00 0.00  ? 58  LYS A HZ2    1 
ATOM   1634 H HZ3    . LYS C 3 54  ? 28.010  15.825  12.034 1.00 0.00  ? 58  LYS A HZ3    1 
ATOM   1635 N N      . ASN C 3 55  ? 26.705  14.332  20.050 1.00 30.15 ? 59  ASN A N      1 
ATOM   1636 C CA     . ASN C 3 55  ? 27.191  14.024  21.391 1.00 27.97 ? 59  ASN A CA     1 
ATOM   1637 C C      . ASN C 3 55  ? 26.523  12.778  21.930 1.00 29.18 ? 59  ASN A C      1 
ATOM   1638 O O      . ASN C 3 55  ? 27.208  11.844  22.374 1.00 28.27 ? 59  ASN A O      1 
ATOM   1639 C CB     . ASN C 3 55  ? 26.963  15.191  22.350 1.00 30.10 ? 59  ASN A CB     1 
ATOM   1640 C CG     . ASN C 3 55  ? 27.922  15.170  23.540 1.00 28.06 ? 59  ASN A CG     1 
ATOM   1641 O OD1    . ASN C 3 55  ? 28.740  14.273  23.679 1.00 30.77 ? 59  ASN A OD1    1 
ATOM   1642 N ND2    . ASN C 3 55  ? 27.811  16.154  24.386 1.00 19.83 ? 59  ASN A ND2    1 
ATOM   1643 H H      . ASN C 3 55  ? 26.353  15.241  19.982 1.00 0.00  ? 59  ASN A H      1 
ATOM   1644 H HD21   . ASN C 3 55  ? 28.452  16.127  25.086 1.00 0.00  ? 59  ASN A HD21   1 
ATOM   1645 H HD22   . ASN C 3 55  ? 27.165  16.844  24.331 1.00 0.00  ? 59  ASN A HD22   1 
ATOM   1646 N N      . ALA C 3 56  ? 25.189  12.737  21.793 1.00 29.49 ? 60  ALA A N      1 
ATOM   1647 C CA     . ALA C 3 56  ? 24.351  11.609  22.248 1.00 27.73 ? 60  ALA A CA     1 
ATOM   1648 C C      . ALA C 3 56  ? 24.738  10.279  21.604 1.00 26.88 ? 60  ALA A C      1 
ATOM   1649 O O      . ALA C 3 56  ? 24.583  9.211   22.212 1.00 24.14 ? 60  ALA A O      1 
ATOM   1650 C CB     . ALA C 3 56  ? 22.863  11.913  22.009 1.00 24.68 ? 60  ALA A CB     1 
ATOM   1651 H H      . ALA C 3 56  ? 24.787  13.536  21.385 1.00 0.00  ? 60  ALA A H      1 
ATOM   1652 N N      . CYS C 3 57  ? 25.233  10.325  20.364 1.00 30.76 ? 61  CYS A N      1 
ATOM   1653 C CA     . CYS C 3 57  ? 25.666  9.087   19.701 1.00 27.83 ? 61  CYS A CA     1 
ATOM   1654 C C      . CYS C 3 57  ? 27.011  8.654   20.199 1.00 22.04 ? 61  CYS A C      1 
ATOM   1655 O O      . CYS C 3 57  ? 27.233  7.457   20.414 1.00 20.04 ? 61  CYS A O      1 
ATOM   1656 C CB     . CYS C 3 57  ? 25.629  9.195   18.197 1.00 30.49 ? 61  CYS A CB     1 
ATOM   1657 S SG     . CYS C 3 57  ? 23.944  9.295   17.647 1.00 35.08 ? 61  CYS A SG     1 
ATOM   1658 H H      . CYS C 3 57  ? 25.288  11.187  19.890 1.00 0.00  ? 61  CYS A H      1 
ATOM   1659 N N      . LYS C 3 58  ? 27.881  9.619   20.462 1.00 21.50 ? 62  LYS A N      1 
ATOM   1660 C CA     . LYS C 3 58  ? 29.192  9.300   21.019 1.00 25.92 ? 62  LYS A CA     1 
ATOM   1661 C C      . LYS C 3 58  ? 29.025  8.570   22.360 1.00 29.00 ? 62  LYS A C      1 
ATOM   1662 O O      . LYS C 3 58  ? 29.477  7.416   22.506 1.00 30.33 ? 62  LYS A O      1 
ATOM   1663 C CB     . LYS C 3 58  ? 30.032  10.556  21.203 1.00 23.56 ? 62  LYS A CB     1 
ATOM   1664 C CG     . LYS C 3 58  ? 31.328  10.294  21.921 1.00 31.75 ? 62  LYS A CG     1 
ATOM   1665 C CD     . LYS C 3 58  ? 31.935  11.636  22.324 1.00 40.71 ? 62  LYS A CD     1 
ATOM   1666 C CE     . LYS C 3 58  ? 32.933  11.513  23.484 1.00 38.22 ? 62  LYS A CE     1 
ATOM   1667 N NZ     . LYS C 3 58  ? 34.226  10.924  23.084 1.00 41.71 ? 62  LYS A NZ     1 
ATOM   1668 H H      . LYS C 3 58  ? 27.682  10.553  20.158 1.00 0.00  ? 62  LYS A H      1 
ATOM   1669 H HZ1    . LYS C 3 58  ? 34.642  11.517  22.339 1.00 0.00  ? 62  LYS A HZ1    1 
ATOM   1670 H HZ2    . LYS C 3 58  ? 34.884  10.851  23.889 1.00 0.00  ? 62  LYS A HZ2    1 
ATOM   1671 H HZ3    . LYS C 3 58  ? 34.062  9.970   22.696 1.00 0.00  ? 62  LYS A HZ3    1 
ATOM   1672 N N      . LEU C 3 59  ? 28.283  9.195   23.297 1.00 29.67 ? 63  LEU A N      1 
ATOM   1673 C CA     . LEU C 3 59  ? 28.043  8.621   24.642 1.00 25.31 ? 63  LEU A CA     1 
ATOM   1674 C C      . LEU C 3 59  ? 27.388  7.267   24.590 1.00 25.92 ? 63  LEU A C      1 
ATOM   1675 O O      . LEU C 3 59  ? 27.698  6.377   25.379 1.00 22.96 ? 63  LEU A O      1 
ATOM   1676 C CB     . LEU C 3 59  ? 27.174  9.541   25.492 1.00 27.34 ? 63  LEU A CB     1 
ATOM   1677 C CG     . LEU C 3 59  ? 27.650  10.985  25.578 1.00 30.71 ? 63  LEU A CG     1 
ATOM   1678 C CD1    . LEU C 3 59  ? 26.800  11.743  26.524 1.00 32.44 ? 63  LEU A CD1    1 
ATOM   1679 C CD2    . LEU C 3 59  ? 29.084  11.010  26.067 1.00 36.75 ? 63  LEU A CD2    1 
ATOM   1680 H H      . LEU C 3 59  ? 27.948  10.087  23.039 1.00 0.00  ? 63  LEU A H      1 
ATOM   1681 N N      . LYS C 3 60  ? 26.473  7.083   23.649 1.00 29.83 ? 64  LYS A N      1 
ATOM   1682 C CA     . LYS C 3 60  ? 25.782  5.813   23.525 1.00 30.51 ? 64  LYS A CA     1 
ATOM   1683 C C      . LYS C 3 60  ? 26.746  4.662   23.240 1.00 31.76 ? 64  LYS A C      1 
ATOM   1684 O O      . LYS C 3 60  ? 26.584  3.578   23.782 1.00 32.52 ? 64  LYS A O      1 
ATOM   1685 C CB     . LYS C 3 60  ? 24.702  5.888   22.458 1.00 29.56 ? 64  LYS A CB     1 
ATOM   1686 C CG     . LYS C 3 60  ? 24.027  4.568   22.266 1.00 32.74 ? 64  LYS A CG     1 
ATOM   1687 C CD     . LYS C 3 60  ? 23.135  4.587   21.077 1.00 39.07 ? 64  LYS A CD     1 
ATOM   1688 C CE     . LYS C 3 60  ? 22.715  3.171   20.743 1.00 44.48 ? 64  LYS A CE     1 
ATOM   1689 N NZ     . LYS C 3 60  ? 21.846  3.104   19.523 1.00 54.18 ? 64  LYS A NZ     1 
ATOM   1690 H H      . LYS C 3 60  ? 26.236  7.812   23.030 1.00 0.00  ? 64  LYS A H      1 
ATOM   1691 H HZ1    . LYS C 3 60  ? 22.344  3.511   18.704 1.00 0.00  ? 64  LYS A HZ1    1 
ATOM   1692 H HZ2    . LYS C 3 60  ? 21.559  2.132   19.255 1.00 0.00  ? 64  LYS A HZ2    1 
ATOM   1693 H HZ3    . LYS C 3 60  ? 20.968  3.656   19.644 1.00 0.00  ? 64  LYS A HZ3    1 
ATOM   1694 N N      . ALA C 3 61  ? 27.731  4.892   22.366 1.00 36.94 ? 65  ALA A N      1 
ATOM   1695 C CA     . ALA C 3 61  ? 28.732  3.880   22.024 1.00 34.29 ? 65  ALA A CA     1 
ATOM   1696 C C      . ALA C 3 61  ? 29.489  3.426   23.269 1.00 34.44 ? 65  ALA A C      1 
ATOM   1697 O O      . ALA C 3 61  ? 29.713  2.229   23.463 1.00 32.76 ? 65  ALA A O      1 
ATOM   1698 C CB     . ALA C 3 61  ? 29.687  4.436   20.973 1.00 34.97 ? 65  ALA A CB     1 
ATOM   1699 H H      . ALA C 3 61  ? 27.702  5.727   21.839 1.00 0.00  ? 65  ALA A H      1 
ATOM   1700 N N      . ILE C 3 62  ? 29.821  4.383   24.137 1.00 35.28 ? 66  ILE A N      1 
ATOM   1701 C CA     . ILE C 3 62  ? 30.521  4.130   25.420 1.00 35.11 ? 66  ILE A CA     1 
ATOM   1702 C C      . ILE C 3 62  ? 29.629  3.356   26.411 1.00 32.24 ? 66  ILE A C      1 
ATOM   1703 O O      . ILE C 3 62  ? 29.960  2.264   26.871 1.00 30.29 ? 66  ILE A O      1 
ATOM   1704 C CB     . ILE C 3 62  ? 30.914  5.462   26.124 1.00 33.57 ? 66  ILE A CB     1 
ATOM   1705 C CG1    . ILE C 3 62  ? 31.660  6.374   25.157 1.00 36.78 ? 66  ILE A CG1    1 
ATOM   1706 C CG2    . ILE C 3 62  ? 31.835  5.180   27.283 1.00 41.46 ? 66  ILE A CG2    1 
ATOM   1707 C CD1    . ILE C 3 62  ? 32.238  7.655   25.770 1.00 37.40 ? 66  ILE A CD1    1 
ATOM   1708 H H      . ILE C 3 62  ? 29.622  5.312   23.841 1.00 0.00  ? 66  ILE A H      1 
ATOM   1709 N N      . LEU C 3 63  ? 28.446  3.911   26.661 1.00 32.89 ? 67  LEU A N      1 
ATOM   1710 C CA     . LEU C 3 63  ? 27.484  3.373   27.608 1.00 28.60 ? 67  LEU A CA     1 
ATOM   1711 C C      . LEU C 3 63  ? 26.861  2.063   27.220 1.00 33.61 ? 67  LEU A C      1 
ATOM   1712 O O      . LEU C 3 63  ? 26.592  1.226   28.088 1.00 34.04 ? 67  LEU A O      1 
ATOM   1713 C CB     . LEU C 3 63  ? 26.450  4.437   27.916 1.00 23.20 ? 67  LEU A CB     1 
ATOM   1714 C CG     . LEU C 3 63  ? 27.174  5.669   28.517 1.00 22.92 ? 67  LEU A CG     1 
ATOM   1715 C CD1    . LEU C 3 63  ? 26.324  6.929   28.557 1.00 22.54 ? 67  LEU A CD1    1 
ATOM   1716 C CD2    . LEU C 3 63  ? 27.669  5.339   29.907 1.00 22.20 ? 67  LEU A CD2    1 
ATOM   1717 H H      . LEU C 3 63  ? 28.214  4.737   26.198 1.00 0.00  ? 67  LEU A H      1 
ATOM   1718 N N      . SER C 3 64  ? 26.697  1.846   25.917 1.00 39.85 ? 68  SER A N      1 
ATOM   1719 C CA     . SER C 3 64  ? 26.142  0.603   25.366 1.00 44.09 ? 68  SER A CA     1 
ATOM   1720 C C      . SER C 3 64  ? 26.996  -0.631  25.747 1.00 47.54 ? 68  SER A C      1 
ATOM   1721 O O      . SER C 3 64  ? 26.487  -1.621  26.318 1.00 45.72 ? 68  SER A O      1 
ATOM   1722 C CB     . SER C 3 64  ? 26.056  0.721   23.838 1.00 42.15 ? 68  SER A CB     1 
ATOM   1723 O OG     . SER C 3 64  ? 25.466  -0.436  23.250 1.00 43.64 ? 68  SER A OG     1 
ATOM   1724 H H      . SER C 3 64  ? 26.884  2.488   25.205 1.00 0.00  ? 68  SER A H      1 
ATOM   1725 H HG     . SER C 3 64  ? 25.454  -0.248  22.303 1.00 0.00  ? 68  SER A HG     1 
ATOM   1726 N N      . LYS C 3 65  ? 28.300  -0.549  25.456 1.00 50.64 ? 69  LYS A N      1 
ATOM   1727 C CA     . LYS C 3 65  ? 29.236  -1.633  25.758 1.00 51.92 ? 69  LYS A CA     1 
ATOM   1728 C C      . LYS C 3 65  ? 29.366  -1.928  27.278 1.00 51.88 ? 69  LYS A C      1 
ATOM   1729 O O      . LYS C 3 65  ? 29.395  -3.088  27.716 1.00 48.87 ? 69  LYS A O      1 
ATOM   1730 C CB     . LYS C 3 65  ? 30.601  -1.307  25.122 1.00 51.59 ? 69  LYS A CB     1 
ATOM   1731 C CG     . LYS C 3 65  ? 31.735  -1.071  26.124 1.00 56.19 ? 69  LYS A CG     1 
ATOM   1732 C CD     . LYS C 3 65  ? 32.077  0.395   26.285 1.00 59.45 ? 69  LYS A CD     1 
ATOM   1733 C CE     . LYS C 3 65  ? 32.885  0.597   27.557 1.00 61.74 ? 69  LYS A CE     1 
ATOM   1734 N NZ     . LYS C 3 65  ? 33.701  1.857   27.621 1.00 64.80 ? 69  LYS A NZ     1 
ATOM   1735 H H      . LYS C 3 65  ? 28.670  0.261   25.009 1.00 0.00  ? 69  LYS A H      1 
ATOM   1736 H HZ1    . LYS C 3 65  ? 33.138  2.720   27.510 1.00 0.00  ? 69  LYS A HZ1    1 
ATOM   1737 H HZ2    . LYS C 3 65  ? 34.198  1.865   28.548 1.00 0.00  ? 69  LYS A HZ2    1 
ATOM   1738 H HZ3    . LYS C 3 65  ? 34.447  1.787   26.893 1.00 0.00  ? 69  LYS A HZ3    1 
ATOM   1739 N N      . TRP C 3 66  ? 29.470  -0.862  28.068 1.00 52.71 ? 70  TRP A N      1 
ATOM   1740 C CA     . TRP C 3 66  ? 29.596  -0.970  29.513 1.00 52.93 ? 70  TRP A CA     1 
ATOM   1741 C C      . TRP C 3 66  ? 28.414  -1.665  30.192 1.00 54.68 ? 70  TRP A C      1 
ATOM   1742 O O      . TRP C 3 66  ? 28.612  -2.587  30.991 1.00 53.82 ? 70  TRP A O      1 
ATOM   1743 C CB     . TRP C 3 66  ? 29.825  0.418   30.131 1.00 51.89 ? 70  TRP A CB     1 
ATOM   1744 C CG     . TRP C 3 66  ? 29.803  0.398   31.651 1.00 50.99 ? 70  TRP A CG     1 
ATOM   1745 C CD1    . TRP C 3 66  ? 30.808  -0.023  32.484 1.00 48.97 ? 70  TRP A CD1    1 
ATOM   1746 C CD2    . TRP C 3 66  ? 28.707  0.768   32.503 1.00 48.87 ? 70  TRP A CD2    1 
ATOM   1747 N NE1    . TRP C 3 66  ? 30.401  0.051   33.793 1.00 45.22 ? 70  TRP A NE1    1 
ATOM   1748 C CE2    . TRP C 3 66  ? 29.126  0.530   33.840 1.00 46.93 ? 70  TRP A CE2    1 
ATOM   1749 C CE3    . TRP C 3 66  ? 27.423  1.268   32.268 1.00 48.61 ? 70  TRP A CE3    1 
ATOM   1750 C CZ2    . TRP C 3 66  ? 28.301  0.781   34.940 1.00 48.79 ? 70  TRP A CZ2    1 
ATOM   1751 C CZ3    . TRP C 3 66  ? 26.601  1.516   33.368 1.00 53.42 ? 70  TRP A CZ3    1 
ATOM   1752 C CH2    . TRP C 3 66  ? 27.049  1.270   34.688 1.00 50.35 ? 70  TRP A CH2    1 
ATOM   1753 H H      . TRP C 3 66  ? 29.548  0.044   27.674 1.00 0.00  ? 70  TRP A H      1 
ATOM   1754 H HE1    . TRP C 3 66  ? 30.904  -0.269  34.568 1.00 0.00  ? 70  TRP A HE1    1 
ATOM   1755 N N      . LEU C 3 67  ? 27.189  -1.243  29.866 1.00 57.39 ? 71  LEU A N      1 
ATOM   1756 C CA     . LEU C 3 67  ? 25.988  -1.815  30.468 1.00 59.47 ? 71  LEU A CA     1 
ATOM   1757 C C      . LEU C 3 67  ? 25.905  -3.345  30.349 1.00 62.09 ? 71  LEU A C      1 
ATOM   1758 O O      . LEU C 3 67  ? 25.471  -4.020  31.290 1.00 62.93 ? 71  LEU A O      1 
ATOM   1759 C CB     . LEU C 3 67  ? 24.718  -1.154  29.910 1.00 56.89 ? 71  LEU A CB     1 
ATOM   1760 C CG     . LEU C 3 67  ? 23.377  -1.491  30.597 1.00 55.83 ? 71  LEU A CG     1 
ATOM   1761 C CD1    . LEU C 3 67  ? 23.315  -0.837  31.975 1.00 51.48 ? 71  LEU A CD1    1 
ATOM   1762 C CD2    . LEU C 3 67  ? 22.191  -1.034  29.742 1.00 51.59 ? 71  LEU A CD2    1 
ATOM   1763 H H      . LEU C 3 67  ? 27.018  -0.509  29.229 1.00 0.00  ? 71  LEU A H      1 
ATOM   1764 N N      . GLU C 3 68  ? 26.323  -3.905  29.219 1.00 64.08 ? 72  GLU A N      1 
ATOM   1765 C CA     . GLU C 3 68  ? 26.259  -5.352  29.086 1.00 69.19 ? 72  GLU A CA     1 
ATOM   1766 C C      . GLU C 3 68  ? 27.380  -6.099  29.784 1.00 70.22 ? 72  GLU A C      1 
ATOM   1767 O O      . GLU C 3 68  ? 27.273  -7.299  30.003 1.00 70.32 ? 72  GLU A O      1 
ATOM   1768 C CB     . GLU C 3 68  ? 26.162  -5.770  27.633 1.00 74.45 ? 72  GLU A CB     1 
ATOM   1769 C CG     . GLU C 3 68  ? 24.789  -5.587  27.027 1.00 83.55 ? 72  GLU A CG     1 
ATOM   1770 C CD     . GLU C 3 68  ? 24.823  -5.663  25.509 1.00 90.38 ? 72  GLU A CD     1 
ATOM   1771 O OE1    . GLU C 3 68  ? 25.540  -6.531  24.953 1.00 94.45 ? 72  GLU A OE1    1 
ATOM   1772 O OE2    . GLU C 3 68  ? 24.139  -4.834  24.864 1.00 94.20 ? 72  GLU A OE2    1 
ATOM   1773 H H      . GLU C 3 68  ? 26.625  -3.361  28.450 1.00 0.00  ? 72  GLU A H      1 
ATOM   1774 N N      . GLU C 3 69  ? 28.466  -5.413  30.119 1.00 72.81 ? 73  GLU A N      1 
ATOM   1775 C CA     . GLU C 3 69  ? 29.545  -6.076  30.838 1.00 74.78 ? 73  GLU A CA     1 
ATOM   1776 C C      . GLU C 3 69  ? 29.284  -5.857  32.320 1.00 74.28 ? 73  GLU A C      1 
ATOM   1777 O O      . GLU C 3 69  ? 29.983  -6.397  33.182 1.00 75.18 ? 73  GLU A O      1 
ATOM   1778 C CB     . GLU C 3 69  ? 30.928  -5.573  30.411 1.00 77.78 ? 73  GLU A CB     1 
ATOM   1779 C CG     . GLU C 3 69  ? 31.293  -4.173  30.856 1.00 81.34 ? 73  GLU A CG     1 
ATOM   1780 C CD     . GLU C 3 69  ? 32.564  -3.680  30.197 1.00 82.70 ? 73  GLU A CD     1 
ATOM   1781 O OE1    . GLU C 3 69  ? 32.658  -3.727  28.947 1.00 82.28 ? 73  GLU A OE1    1 
ATOM   1782 O OE2    . GLU C 3 69  ? 33.474  -3.241  30.934 1.00 85.03 ? 73  GLU A OE2    1 
ATOM   1783 H H      . GLU C 3 69  ? 28.539  -4.461  29.858 1.00 0.00  ? 73  GLU A H      1 
ATOM   1784 N N      . ALA C 3 70  ? 28.214  -5.122  32.606 1.00 73.93 ? 74  ALA A N      1 
ATOM   1785 C CA     . ALA C 3 70  ? 27.816  -4.843  33.968 1.00 75.95 ? 74  ALA A CA     1 
ATOM   1786 C C      . ALA C 3 70  ? 26.927  -5.948  34.544 1.00 78.27 ? 74  ALA A C      1 
ATOM   1787 O O      . ALA C 3 70  ? 26.162  -5.722  35.477 1.00 79.01 ? 74  ALA A O      1 
ATOM   1788 C CB     . ALA C 3 70  ? 27.115  -3.486  34.043 1.00 71.80 ? 74  ALA A CB     1 
ATOM   1789 H H      . ALA C 3 70  ? 27.648  -4.766  31.890 1.00 0.00  ? 74  ALA A H      1 
ATOM   1790 N N      . GLU C 3 71  ? 27.014  -7.149  33.988 1.00 82.71 ? 75  GLU A N      1 
ATOM   1791 C CA     . GLU C 3 71  ? 26.210  -8.236  34.527 1.00 86.36 ? 75  GLU A CA     1 
ATOM   1792 C C      . GLU C 3 71  ? 27.081  -9.122  35.422 1.00 86.82 ? 75  GLU A C      1 
ATOM   1793 O O      . GLU C 3 71  ? 27.749  -10.050 34.958 1.00 85.87 ? 75  GLU A O      1 
ATOM   1794 C CB     . GLU C 3 71  ? 25.572  -9.041  33.400 1.00 89.72 ? 75  GLU A CB     1 
ATOM   1795 C CG     . GLU C 3 71  ? 24.979  -8.178  32.295 1.00 92.96 ? 75  GLU A CG     1 
ATOM   1796 C CD     . GLU C 3 71  ? 23.946  -7.189  32.803 1.00 95.63 ? 75  GLU A CD     1 
ATOM   1797 O OE1    . GLU C 3 71  ? 23.162  -7.547  33.718 1.00 96.22 ? 75  GLU A OE1    1 
ATOM   1798 O OE2    . GLU C 3 71  ? 23.919  -6.061  32.266 1.00 95.51 ? 75  GLU A OE2    1 
ATOM   1799 H H      . GLU C 3 71  ? 27.602  -7.353  33.211 1.00 0.00  ? 75  GLU A H      1 
ATOM   1800 N N      . GLN C 3 72  ? 27.152  -8.740  36.692 1.00 86.45 ? 76  GLN A N      1 
ATOM   1801 C CA     . GLN C 3 72  ? 27.915  -9.484  37.684 1.00 86.31 ? 76  GLN A CA     1 
ATOM   1802 C C      . GLN C 3 72  ? 27.033  -9.685  38.896 1.00 86.07 ? 76  GLN A C      1 
ATOM   1803 O O      . GLN C 3 72  ? 26.191  -8.790  39.109 1.00 87.33 ? 76  GLN A O      1 
ATOM   1804 C CB     . GLN C 3 72  ? 29.157  -8.717  38.088 1.00 86.05 ? 76  GLN A CB     1 
ATOM   1805 C CG     . GLN C 3 72  ? 30.135  -8.536  36.966 1.00 88.41 ? 76  GLN A CG     1 
ATOM   1806 C CD     . GLN C 3 72  ? 31.127  -7.436  37.254 1.00 90.67 ? 76  GLN A CD     1 
ATOM   1807 O OE1    . GLN C 3 72  ? 32.228  -7.683  37.745 1.00 95.15 ? 76  GLN A OE1    1 
ATOM   1808 N NE2    . GLN C 3 72  ? 30.729  -6.209  36.983 1.00 90.89 ? 76  GLN A NE2    1 
ATOM   1809 H H      . GLN C 3 72  ? 26.646  -7.926  36.998 1.00 0.00  ? 76  GLN A H      1 
ATOM   1810 H HE21   . GLN C 3 72  ? 31.386  -5.511  37.152 1.00 0.00  ? 76  GLN A HE21   1 
ATOM   1811 H HE22   . GLN C 3 72  ? 29.819  -6.119  36.644 1.00 0.00  ? 76  GLN A HE22   1 
ATOM   1812 N N      . LYS C 3 89  ? 18.700  3.450   49.060 1.00 60.94 ? 103 LYS A N      1 
ATOM   1813 C CA     . LYS C 3 89  ? 17.836  4.380   48.282 1.00 61.95 ? 103 LYS A CA     1 
ATOM   1814 C C      . LYS C 3 89  ? 17.038  3.694   47.159 1.00 59.24 ? 103 LYS A C      1 
ATOM   1815 O O      . LYS C 3 89  ? 16.169  2.887   47.462 1.00 57.76 ? 103 LYS A O      1 
ATOM   1816 C CB     . LYS C 3 89  ? 18.674  5.566   47.781 1.00 63.98 ? 103 LYS A CB     1 
ATOM   1817 C CG     . LYS C 3 89  ? 19.258  6.364   48.952 1.00 66.17 ? 103 LYS A CG     1 
ATOM   1818 C CD     . LYS C 3 89  ? 20.729  6.738   48.780 1.00 65.48 ? 103 LYS A CD     1 
ATOM   1819 C CE     . LYS C 3 89  ? 21.312  7.062   50.148 1.00 68.45 ? 103 LYS A CE     1 
ATOM   1820 N NZ     . LYS C 3 89  ? 22.769  7.352   50.200 1.00 63.68 ? 103 LYS A NZ     1 
ATOM   1821 H HZ1    . LYS C 3 89  ? 22.835  8.150   49.556 1.00 0.00  ? 103 LYS A HZ1    1 
ATOM   1822 H HZ2    . LYS C 3 89  ? 23.010  7.620   51.183 1.00 0.00  ? 103 LYS A HZ2    1 
ATOM   1823 H HZ3    . LYS C 3 89  ? 23.373  6.555   49.888 1.00 0.00  ? 103 LYS A HZ3    1 
ATOM   1824 N N      . ARG C 3 90  ? 17.426  3.929   45.903 1.00 56.92 ? 104 ARG A N      1 
ATOM   1825 C CA     . ARG C 3 90  ? 16.782  3.403   44.669 1.00 52.55 ? 104 ARG A CA     1 
ATOM   1826 C C      . ARG C 3 90  ? 15.566  4.246   44.265 1.00 51.03 ? 104 ARG A C      1 
ATOM   1827 O O      . ARG C 3 90  ? 14.408  3.797   44.253 1.00 51.32 ? 104 ARG A O      1 
ATOM   1828 C CB     . ARG C 3 90  ? 16.466  1.903   44.719 1.00 51.05 ? 104 ARG A CB     1 
ATOM   1829 C CG     . ARG C 3 90  ? 17.413  1.063   43.853 1.00 50.58 ? 104 ARG A CG     1 
ATOM   1830 C CD     . ARG C 3 90  ? 16.780  -0.233  43.384 1.00 50.59 ? 104 ARG A CD     1 
ATOM   1831 N NE     . ARG C 3 90  ? 17.755  -1.247  42.963 1.00 52.57 ? 104 ARG A NE     1 
ATOM   1832 C CZ     . ARG C 3 90  ? 17.424  -2.489  42.598 1.00 57.58 ? 104 ARG A CZ     1 
ATOM   1833 N NH1    . ARG C 3 90  ? 16.143  -2.861  42.582 1.00 59.96 ? 104 ARG A NH1    1 
ATOM   1834 N NH2    . ARG C 3 90  ? 18.366  -3.398  42.342 1.00 57.87 ? 104 ARG A NH2    1 
ATOM   1835 H H      . ARG C 3 90  ? 18.214  4.501   45.702 1.00 0.00  ? 104 ARG A H      1 
ATOM   1836 H HE     . ARG C 3 90  ? 18.718  -1.052  42.932 1.00 0.00  ? 104 ARG A HE     1 
ATOM   1837 H HH11   . ARG C 3 90  ? 15.421  -2.234  42.848 1.00 0.00  ? 104 ARG A HH11   1 
ATOM   1838 H HH12   . ARG C 3 90  ? 15.913  -3.810  42.356 1.00 0.00  ? 104 ARG A HH12   1 
ATOM   1839 H HH21   . ARG C 3 90  ? 19.343  -3.195  42.433 1.00 0.00  ? 104 ARG A HH21   1 
ATOM   1840 H HH22   . ARG C 3 90  ? 18.098  -4.352  42.125 1.00 0.00  ? 104 ARG A HH22   1 
ATOM   1841 N N      . ARG C 3 91  ? 15.899  5.480   43.901 1.00 47.80 ? 105 ARG A N      1 
ATOM   1842 C CA     . ARG C 3 91  ? 14.981  6.529   43.499 1.00 43.86 ? 105 ARG A CA     1 
ATOM   1843 C C      . ARG C 3 91  ? 13.908  6.099   42.496 1.00 46.59 ? 105 ARG A C      1 
ATOM   1844 O O      . ARG C 3 91  ? 14.130  5.256   41.613 1.00 50.76 ? 105 ARG A O      1 
ATOM   1845 C CB     . ARG C 3 91  ? 15.778  7.700   42.933 1.00 36.58 ? 105 ARG A CB     1 
ATOM   1846 C CG     . ARG C 3 91  ? 15.554  9.019   43.641 1.00 36.82 ? 105 ARG A CG     1 
ATOM   1847 C CD     . ARG C 3 91  ? 16.437  10.088  43.022 1.00 32.93 ? 105 ARG A CD     1 
ATOM   1848 N NE     . ARG C 3 91  ? 16.419  11.405  43.666 1.00 36.40 ? 105 ARG A NE     1 
ATOM   1849 C CZ     . ARG C 3 91  ? 16.380  11.623  44.985 1.00 39.88 ? 105 ARG A CZ     1 
ATOM   1850 N NH1    . ARG C 3 91  ? 16.474  10.628  45.881 1.00 36.18 ? 105 ARG A NH1    1 
ATOM   1851 N NH2    . ARG C 3 91  ? 16.383  12.883  45.429 1.00 38.13 ? 105 ARG A NH2    1 
ATOM   1852 H H      . ARG C 3 91  ? 16.858  5.677   43.822 1.00 0.00  ? 105 ARG A H      1 
ATOM   1853 H HE     . ARG C 3 91  ? 16.625  12.235  43.190 1.00 0.00  ? 105 ARG A HE     1 
ATOM   1854 H HH11   . ARG C 3 91  ? 16.582  9.657   45.714 1.00 0.00  ? 105 ARG A HH11   1 
ATOM   1855 H HH12   . ARG C 3 91  ? 16.342  10.978  46.803 1.00 0.00  ? 105 ARG A HH12   1 
ATOM   1856 H HH21   . ARG C 3 91  ? 16.721  13.550  44.771 1.00 0.00  ? 105 ARG A HH21   1 
ATOM   1857 H HH22   . ARG C 3 91  ? 16.323  13.164  46.390 1.00 0.00  ? 105 ARG A HH22   1 
ATOM   1858 N N      . THR C 3 92  ? 12.738  6.710   42.636 1.00 45.14 ? 106 THR A N      1 
ATOM   1859 C CA     . THR C 3 92  ? 11.606  6.423   41.776 1.00 40.98 ? 106 THR A CA     1 
ATOM   1860 C C      . THR C 3 92  ? 11.307  7.645   40.969 1.00 40.01 ? 106 THR A C      1 
ATOM   1861 O O      . THR C 3 92  ? 11.230  8.755   41.512 1.00 39.05 ? 106 THR A O      1 
ATOM   1862 C CB     . THR C 3 92  ? 10.339  6.065   42.610 1.00 37.85 ? 106 THR A CB     1 
ATOM   1863 O OG1    . THR C 3 92  ? 10.479  4.731   43.117 1.00 36.51 ? 106 THR A OG1    1 
ATOM   1864 C CG2    . THR C 3 92  ? 9.066   6.160   41.778 1.00 35.42 ? 106 THR A CG2    1 
ATOM   1865 H H      . THR C 3 92  ? 12.593  7.336   43.388 1.00 0.00  ? 106 THR A H      1 
ATOM   1866 H HG1    . THR C 3 92  ? 10.679  4.089   42.435 1.00 0.00  ? 106 THR A HG1    1 
ATOM   1867 N N      . THR C 3 93  ? 11.166  7.452   39.666 1.00 40.74 ? 107 THR A N      1 
ATOM   1868 C CA     . THR C 3 93  ? 10.792  8.572   38.824 1.00 42.77 ? 107 THR A CA     1 
ATOM   1869 C C      . THR C 3 93  ? 9.262   8.569   38.685 1.00 38.09 ? 107 THR A C      1 
ATOM   1870 O O      . THR C 3 93  ? 8.635   7.553   38.352 1.00 33.30 ? 107 THR A O      1 
ATOM   1871 C CB     . THR C 3 93  ? 11.475  8.518   37.430 1.00 46.94 ? 107 THR A CB     1 
ATOM   1872 O OG1    . THR C 3 93  ? 11.458  7.165   36.931 1.00 54.52 ? 107 THR A OG1    1 
ATOM   1873 C CG2    . THR C 3 93  ? 12.919  9.068   37.524 1.00 47.58 ? 107 THR A CG2    1 
ATOM   1874 H H      . THR C 3 93  ? 11.311  6.566   39.242 1.00 0.00  ? 107 THR A H      1 
ATOM   1875 H HG1    . THR C 3 93  ? 11.925  6.552   37.494 1.00 0.00  ? 107 THR A HG1    1 
ATOM   1876 N N      . ILE C 3 94  ? 8.667   9.688   39.054 1.00 34.06 ? 108 ILE A N      1 
ATOM   1877 C CA     . ILE C 3 94  ? 7.231   9.827   38.971 1.00 34.83 ? 108 ILE A CA     1 
ATOM   1878 C C      . ILE C 3 94  ? 6.885   10.562  37.665 1.00 33.63 ? 108 ILE A C      1 
ATOM   1879 O O      . ILE C 3 94  ? 7.366   11.679  37.442 1.00 33.37 ? 108 ILE A O      1 
ATOM   1880 C CB     . ILE C 3 94  ? 6.734   10.544  40.267 1.00 33.73 ? 108 ILE A CB     1 
ATOM   1881 C CG1    . ILE C 3 94  ? 6.851   9.539   41.430 1.00 30.94 ? 108 ILE A CG1    1 
ATOM   1882 C CG2    . ILE C 3 94  ? 5.311   11.113  40.099 1.00 34.57 ? 108 ILE A CG2    1 
ATOM   1883 C CD1    . ILE C 3 94  ? 6.767   10.130  42.805 1.00 31.38 ? 108 ILE A CD1    1 
ATOM   1884 H H      . ILE C 3 94  ? 9.122   10.472  39.463 1.00 0.00  ? 108 ILE A H      1 
ATOM   1885 N N      . SER C 3 95  ? 6.103   9.929   36.780 1.00 32.09 ? 109 SER A N      1 
ATOM   1886 C CA     . SER C 3 95  ? 5.743   10.579  35.492 1.00 32.40 ? 109 SER A CA     1 
ATOM   1887 C C      . SER C 3 95  ? 4.937   11.865  35.569 1.00 31.04 ? 109 SER A C      1 
ATOM   1888 O O      . SER C 3 95  ? 4.248   12.144  36.538 1.00 37.25 ? 109 SER A O      1 
ATOM   1889 C CB     . SER C 3 95  ? 4.996   9.626   34.574 1.00 29.31 ? 109 SER A CB     1 
ATOM   1890 O OG     . SER C 3 95  ? 3.793   9.181   35.181 1.00 31.87 ? 109 SER A OG     1 
ATOM   1891 H H      . SER C 3 95  ? 5.769   9.023   36.986 1.00 0.00  ? 109 SER A H      1 
ATOM   1892 H HG     . SER C 3 95  ? 4.002   8.687   35.959 1.00 0.00  ? 109 SER A HG     1 
ATOM   1893 N N      . ILE C 3 96  ? 4.922   12.591  34.476 1.00 30.17 ? 110 ILE A N      1 
ATOM   1894 C CA     . ILE C 3 96  ? 4.195   13.846  34.417 1.00 29.08 ? 110 ILE A CA     1 
ATOM   1895 C C      . ILE C 3 96  ? 2.692   13.636  34.629 1.00 28.57 ? 110 ILE A C      1 
ATOM   1896 O O      . ILE C 3 96  ? 2.006   14.500  35.172 1.00 29.51 ? 110 ILE A O      1 
ATOM   1897 C CB     . ILE C 3 96  ? 4.513   14.573  33.068 1.00 29.27 ? 110 ILE A CB     1 
ATOM   1898 C CG1    . ILE C 3 96  ? 5.983   15.004  33.105 1.00 28.28 ? 110 ILE A CG1    1 
ATOM   1899 C CG2    . ILE C 3 96  ? 3.578   15.771  32.832 1.00 22.76 ? 110 ILE A CG2    1 
ATOM   1900 C CD1    . ILE C 3 96  ? 6.506   15.558  31.823 1.00 30.87 ? 110 ILE A CD1    1 
ATOM   1901 H H      . ILE C 3 96  ? 5.399   12.317  33.641 1.00 0.00  ? 110 ILE A H      1 
ATOM   1902 N N      . ALA C 3 97  ? 2.199   12.464  34.241 1.00 29.23 ? 111 ALA A N      1 
ATOM   1903 C CA     . ALA C 3 97  ? 0.782   12.122  34.374 1.00 30.69 ? 111 ALA A CA     1 
ATOM   1904 C C      . ALA C 3 97  ? 0.519   11.702  35.820 1.00 30.43 ? 111 ALA A C      1 
ATOM   1905 O O      . ALA C 3 97  ? -0.466  12.109  36.423 1.00 33.48 ? 111 ALA A O      1 
ATOM   1906 C CB     . ALA C 3 97  ? 0.436   10.988  33.428 1.00 32.78 ? 111 ALA A CB     1 
ATOM   1907 H H      . ALA C 3 97  ? 2.782   11.743  33.901 1.00 0.00  ? 111 ALA A H      1 
ATOM   1908 N N      . ALA C 3 98  ? 1.427   10.909  36.381 1.00 30.22 ? 112 ALA A N      1 
ATOM   1909 C CA     . ALA C 3 98  ? 1.342   10.471  37.769 1.00 26.26 ? 112 ALA A CA     1 
ATOM   1910 C C      . ALA C 3 98  ? 1.292   11.697  38.669 1.00 25.03 ? 112 ALA A C      1 
ATOM   1911 O O      . ALA C 3 98  ? 0.462   11.772  39.568 1.00 25.19 ? 112 ALA A O      1 
ATOM   1912 C CB     . ALA C 3 98  ? 2.537   9.570   38.131 1.00 23.61 ? 112 ALA A CB     1 
ATOM   1913 H H      . ALA C 3 98  ? 2.187   10.511  35.886 1.00 0.00  ? 112 ALA A H      1 
ATOM   1914 N N      . LYS C 3 99  ? 2.185   12.649  38.421 1.00 24.39 ? 113 LYS A N      1 
ATOM   1915 C CA     . LYS C 3 99  ? 2.244   13.882  39.179 1.00 23.62 ? 113 LYS A CA     1 
ATOM   1916 C C      . LYS C 3 99  ? 0.989   14.714  39.008 1.00 25.57 ? 113 LYS A C      1 
ATOM   1917 O O      . LYS C 3 99  ? 0.628   15.490  39.897 1.00 26.09 ? 113 LYS A O      1 
ATOM   1918 C CB     . LYS C 3 99  ? 3.447   14.704  38.746 1.00 26.69 ? 113 LYS A CB     1 
ATOM   1919 C CG     . LYS C 3 99  ? 3.459   16.150  39.264 1.00 36.28 ? 113 LYS A CG     1 
ATOM   1920 C CD     . LYS C 3 99  ? 4.702   16.884  38.743 1.00 45.90 ? 113 LYS A CD     1 
ATOM   1921 C CE     . LYS C 3 99  ? 4.586   18.432  38.781 1.00 49.41 ? 113 LYS A CE     1 
ATOM   1922 N NZ     . LYS C 3 99  ? 4.619   19.032  40.143 1.00 54.95 ? 113 LYS A NZ     1 
ATOM   1923 H H      . LYS C 3 99  ? 2.876   12.501  37.725 1.00 0.00  ? 113 LYS A H      1 
ATOM   1924 H HZ1    . LYS C 3 99  ? 3.859   18.554  40.666 1.00 0.00  ? 113 LYS A HZ1    1 
ATOM   1925 H HZ2    . LYS C 3 99  ? 5.494   18.864  40.669 1.00 0.00  ? 113 LYS A HZ2    1 
ATOM   1926 H HZ3    . LYS C 3 99  ? 4.409   20.049  40.147 1.00 0.00  ? 113 LYS A HZ3    1 
ATOM   1927 N N      . ASP C 3 100 ? 0.356   14.612  37.840 1.00 26.66 ? 114 ASP A N      1 
ATOM   1928 C CA     . ASP C 3 100 ? -0.854  15.382  37.563 1.00 21.91 ? 114 ASP A CA     1 
ATOM   1929 C C      . ASP C 3 100 ? -2.000  14.859  38.436 1.00 24.32 ? 114 ASP A C      1 
ATOM   1930 O O      . ASP C 3 100 ? -2.653  15.618  39.167 1.00 26.19 ? 114 ASP A O      1 
ATOM   1931 C CB     . ASP C 3 100 ? -1.206  15.303  36.078 1.00 24.27 ? 114 ASP A CB     1 
ATOM   1932 C CG     . ASP C 3 100 ? -0.313  16.194  35.205 1.00 25.14 ? 114 ASP A CG     1 
ATOM   1933 O OD1    . ASP C 3 100 ? 0.313   17.157  35.695 1.00 24.52 ? 114 ASP A OD1    1 
ATOM   1934 O OD2    . ASP C 3 100 ? -0.276  15.951  33.983 1.00 26.82 ? 114 ASP A OD2    1 
ATOM   1935 H H      . ASP C 3 100 ? 0.746   14.072  37.122 1.00 0.00  ? 114 ASP A H      1 
ATOM   1936 N N      . ALA C 3 101 ? -2.211  13.551  38.403 1.00 21.39 ? 115 ALA A N      1 
ATOM   1937 C CA     . ALA C 3 101 ? -3.220  12.940  39.231 1.00 19.32 ? 115 ALA A CA     1 
ATOM   1938 C C      . ALA C 3 101 ? -2.896  13.248  40.703 1.00 24.86 ? 115 ALA A C      1 
ATOM   1939 O O      . ALA C 3 101 ? -3.763  13.762  41.443 1.00 31.84 ? 115 ALA A O      1 
ATOM   1940 C CB     . ALA C 3 101 ? -3.258  11.447  39.002 1.00 8.49  ? 115 ALA A CB     1 
ATOM   1941 H H      . ALA C 3 101 ? -1.667  13.005  37.784 1.00 0.00  ? 115 ALA A H      1 
ATOM   1942 N N      . LEU C 3 102 ? -1.653  12.972  41.131 1.00 28.60 ? 116 LEU A N      1 
ATOM   1943 C CA     . LEU C 3 102 ? -1.262  13.204  42.527 1.00 26.22 ? 116 LEU A CA     1 
ATOM   1944 C C      . LEU C 3 102 ? -1.700  14.547  43.071 1.00 25.53 ? 116 LEU A C      1 
ATOM   1945 O O      . LEU C 3 102 ? -2.414  14.593  44.065 1.00 31.18 ? 116 LEU A O      1 
ATOM   1946 C CB     . LEU C 3 102 ? 0.231   12.969  42.803 1.00 20.44 ? 116 LEU A CB     1 
ATOM   1947 C CG     . LEU C 3 102 ? 0.762   11.537  42.735 1.00 16.32 ? 116 LEU A CG     1 
ATOM   1948 C CD1    . LEU C 3 102 ? 2.184   11.542  43.084 1.00 12.60 ? 116 LEU A CD1    1 
ATOM   1949 C CD2    . LEU C 3 102 ? 0.024   10.591  43.658 1.00 20.50 ? 116 LEU A CD2    1 
ATOM   1950 H H      . LEU C 3 102 ? -0.965  12.540  40.561 1.00 0.00  ? 116 LEU A H      1 
ATOM   1951 N N      . GLU C 3 103 ? -1.356  15.637  42.408 1.00 23.16 ? 117 GLU A N      1 
ATOM   1952 C CA     . GLU C 3 103 ? -1.778  16.930  42.935 1.00 25.63 ? 117 GLU A CA     1 
ATOM   1953 C C      . GLU C 3 103 ? -3.230  17.304  42.727 1.00 26.05 ? 117 GLU A C      1 
ATOM   1954 O O      . GLU C 3 103 ? -3.693  18.321  43.237 1.00 27.55 ? 117 GLU A O      1 
ATOM   1955 C CB     . GLU C 3 103 ? -0.857  18.067  42.531 1.00 28.98 ? 117 GLU A CB     1 
ATOM   1956 C CG     . GLU C 3 103 ? -0.453  18.976  43.695 1.00 28.84 ? 117 GLU A CG     1 
ATOM   1957 C CD     . GLU C 3 103 ? -1.086  20.362  43.643 1.00 33.38 ? 117 GLU A CD     1 
ATOM   1958 O OE1    . GLU C 3 103 ? -2.188  20.552  44.193 1.00 38.98 ? 117 GLU A OE1    1 
ATOM   1959 O OE2    . GLU C 3 103 ? -0.460  21.291  43.096 1.00 35.85 ? 117 GLU A OE2    1 
ATOM   1960 H H      . GLU C 3 103 ? -0.813  15.588  41.573 1.00 0.00  ? 117 GLU A H      1 
ATOM   1961 N N      . ARG C 3 104 ? -3.967  16.516  41.967 1.00 30.00 ? 118 ARG A N      1 
ATOM   1962 C CA     . ARG C 3 104 ? -5.383  16.822  41.831 1.00 33.27 ? 118 ARG A CA     1 
ATOM   1963 C C      . ARG C 3 104 ? -5.965  16.298  43.135 1.00 32.04 ? 118 ARG A C      1 
ATOM   1964 O O      . ARG C 3 104 ? -6.687  16.995  43.857 1.00 32.01 ? 118 ARG A O      1 
ATOM   1965 C CB     . ARG C 3 104 ? -6.014  16.075  40.687 1.00 36.56 ? 118 ARG A CB     1 
ATOM   1966 C CG     . ARG C 3 104 ? -7.479  16.332  40.703 1.00 43.90 ? 118 ARG A CG     1 
ATOM   1967 C CD     . ARG C 3 104 ? -8.287  15.196  40.207 1.00 47.84 ? 118 ARG A CD     1 
ATOM   1968 N NE     . ARG C 3 104 ? -8.956  15.571  38.972 1.00 56.12 ? 118 ARG A NE     1 
ATOM   1969 C CZ     . ARG C 3 104 ? -8.397  15.739  37.784 1.00 51.27 ? 118 ARG A CZ     1 
ATOM   1970 N NH1    . ARG C 3 104 ? -7.088  15.541  37.650 1.00 56.14 ? 118 ARG A NH1    1 
ATOM   1971 N NH2    . ARG C 3 104 ? -9.145  16.212  36.791 1.00 51.99 ? 118 ARG A NH2    1 
ATOM   1972 H H      . ARG C 3 104 ? -3.625  15.769  41.449 1.00 0.00  ? 118 ARG A H      1 
ATOM   1973 H HE     . ARG C 3 104 ? -9.896  15.769  38.911 1.00 0.00  ? 118 ARG A HE     1 
ATOM   1974 H HH11   . ARG C 3 104 ? -6.490  15.272  38.372 1.00 0.00  ? 118 ARG A HH11   1 
ATOM   1975 H HH12   . ARG C 3 104 ? -6.591  15.540  36.789 1.00 0.00  ? 118 ARG A HH12   1 
ATOM   1976 H HH21   . ARG C 3 104 ? -10.102 16.451  37.047 1.00 0.00  ? 118 ARG A HH21   1 
ATOM   1977 H HH22   . ARG C 3 104 ? -8.931  16.394  35.788 1.00 0.00  ? 118 ARG A HH22   1 
ATOM   1978 N N      . HIS C 3 105 ? -5.606  15.058  43.440 1.00 28.27 ? 119 HIS A N      1 
ATOM   1979 C CA     . HIS C 3 105 ? -6.024  14.436  44.675 1.00 31.31 ? 119 HIS A CA     1 
ATOM   1980 C C      . HIS C 3 105 ? -5.597  15.273  45.899 1.00 32.44 ? 119 HIS A C      1 
ATOM   1981 O O      . HIS C 3 105 ? -6.400  15.534  46.790 1.00 33.99 ? 119 HIS A O      1 
ATOM   1982 C CB     . HIS C 3 105 ? -5.482  13.027  44.731 1.00 31.50 ? 119 HIS A CB     1 
ATOM   1983 C CG     . HIS C 3 105 ? -6.043  12.132  43.670 1.00 33.90 ? 119 HIS A CG     1 
ATOM   1984 N ND1    . HIS C 3 105 ? -6.684  10.952  43.962 1.00 34.47 ? 119 HIS A ND1    1 
ATOM   1985 C CD2    . HIS C 3 105 ? -5.996  12.211  42.324 1.00 35.23 ? 119 HIS A CD2    1 
ATOM   1986 C CE1    . HIS C 3 105 ? -7.004  10.332  42.842 1.00 26.93 ? 119 HIS A CE1    1 
ATOM   1987 N NE2    . HIS C 3 105 ? -6.594  11.074  41.839 1.00 29.16 ? 119 HIS A NE2    1 
ATOM   1988 H H      . HIS C 3 105 ? -5.006  14.634  42.777 1.00 0.00  ? 119 HIS A H      1 
ATOM   1989 H HD1    . HIS C 3 105 ? -6.787  10.537  44.861 1.00 0.00  ? 119 HIS A HD1    1 
ATOM   1990 H HE2    . HIS C 3 105 ? -6.765  10.828  40.935 1.00 0.00  ? 119 HIS A HE2    1 
ATOM   1991 N N      . PHE C 3 106 ? -4.370  15.766  45.906 1.00 28.54 ? 120 PHE A N      1 
ATOM   1992 C CA     . PHE C 3 106 ? -3.906  16.586  47.003 1.00 27.17 ? 120 PHE A CA     1 
ATOM   1993 C C      . PHE C 3 106 ? -4.912  17.701  47.277 1.00 25.91 ? 120 PHE A C      1 
ATOM   1994 O O      . PHE C 3 106 ? -5.323  17.924  48.421 1.00 27.16 ? 120 PHE A O      1 
ATOM   1995 C CB     . PHE C 3 106 ? -2.549  17.200  46.670 1.00 22.50 ? 120 PHE A CB     1 
ATOM   1996 C CG     . PHE C 3 106 ? -1.915  17.917  47.838 1.00 16.12 ? 120 PHE A CG     1 
ATOM   1997 C CD1    . PHE C 3 106 ? -1.353  17.190  48.892 1.00 16.59 ? 120 PHE A CD1    1 
ATOM   1998 C CD2    . PHE C 3 106 ? -1.890  19.290  47.891 1.00 17.58 ? 120 PHE A CD2    1 
ATOM   1999 C CE1    . PHE C 3 106 ? -0.789  17.827  49.961 1.00 12.04 ? 120 PHE A CE1    1 
ATOM   2000 C CE2    . PHE C 3 106 ? -1.321  19.946  48.970 1.00 18.00 ? 120 PHE A CE2    1 
ATOM   2001 C CZ     . PHE C 3 106 ? -0.769  19.209  50.004 1.00 14.57 ? 120 PHE A CZ     1 
ATOM   2002 H H      . PHE C 3 106 ? -3.737  15.535  45.168 1.00 0.00  ? 120 PHE A H      1 
ATOM   2003 N N      . GLY C 3 107 ? -5.296  18.419  46.227 1.00 26.63 ? 121 GLY A N      1 
ATOM   2004 C CA     . GLY C 3 107 ? -6.256  19.508  46.380 1.00 28.83 ? 121 GLY A CA     1 
ATOM   2005 C C      . GLY C 3 107 ? -7.673  19.087  46.794 1.00 27.26 ? 121 GLY A C      1 
ATOM   2006 O O      . GLY C 3 107 ? -8.484  19.915  47.177 1.00 25.14 ? 121 GLY A O      1 
ATOM   2007 H H      . GLY C 3 107 ? -4.993  18.237  45.311 1.00 0.00  ? 121 GLY A H      1 
ATOM   2008 N N      . GLU C 3 108 ? -8.005  17.821  46.638 1.00 23.40 ? 122 GLU A N      1 
ATOM   2009 C CA     . GLU C 3 108 ? -9.312  17.388  47.041 1.00 27.97 ? 122 GLU A CA     1 
ATOM   2010 C C      . GLU C 3 108 ? -9.301  17.006  48.504 1.00 31.56 ? 122 GLU A C      1 
ATOM   2011 O O      . GLU C 3 108 ? -10.201 17.371  49.260 1.00 31.71 ? 122 GLU A O      1 
ATOM   2012 C CB     . GLU C 3 108 ? -9.737  16.245  46.161 1.00 28.92 ? 122 GLU A CB     1 
ATOM   2013 C CG     . GLU C 3 108 ? -9.801  16.702  44.725 1.00 29.74 ? 122 GLU A CG     1 
ATOM   2014 C CD     . GLU C 3 108 ? -10.123 15.589  43.782 1.00 37.44 ? 122 GLU A CD     1 
ATOM   2015 O OE1    . GLU C 3 108 ? -9.922  14.405  44.164 1.00 34.48 ? 122 GLU A OE1    1 
ATOM   2016 O OE2    . GLU C 3 108 ? -10.575 15.911  42.651 1.00 43.53 ? 122 GLU A OE2    1 
ATOM   2017 H H      . GLU C 3 108 ? -7.388  17.268  46.102 1.00 0.00  ? 122 GLU A H      1 
ATOM   2018 N N      . HIS C 3 109 ? -8.233  16.310  48.891 1.00 37.56 ? 123 HIS A N      1 
ATOM   2019 C CA     . HIS C 3 109 ? -7.965  15.842  50.240 1.00 37.64 ? 123 HIS A CA     1 
ATOM   2020 C C      . HIS C 3 109 ? -6.447  15.774  50.431 1.00 39.53 ? 123 HIS A C      1 
ATOM   2021 O O      . HIS C 3 109 ? -5.792  14.854  49.942 1.00 38.86 ? 123 HIS A O      1 
ATOM   2022 C CB     . HIS C 3 109 ? -8.528  14.451  50.449 1.00 40.07 ? 123 HIS A CB     1 
ATOM   2023 C CG     . HIS C 3 109 ? -8.458  14.006  51.868 1.00 48.19 ? 123 HIS A CG     1 
ATOM   2024 N ND1    . HIS C 3 109 ? -8.448  12.676  52.235 1.00 50.97 ? 123 HIS A ND1    1 
ATOM   2025 C CD2    . HIS C 3 109 ? -8.426  14.718  53.018 1.00 47.73 ? 123 HIS A CD2    1 
ATOM   2026 C CE1    . HIS C 3 109 ? -8.419  12.591  53.557 1.00 49.97 ? 123 HIS A CE1    1 
ATOM   2027 N NE2    . HIS C 3 109 ? -8.404  13.818  54.054 1.00 47.83 ? 123 HIS A NE2    1 
ATOM   2028 H H      . HIS C 3 109 ? -7.579  16.051  48.202 1.00 0.00  ? 123 HIS A H      1 
ATOM   2029 H HD1    . HIS C 3 109 ? -8.640  11.924  51.647 1.00 0.00  ? 123 HIS A HD1    1 
ATOM   2030 H HE2    . HIS C 3 109 ? -8.535  14.028  55.002 1.00 0.00  ? 123 HIS A HE2    1 
ATOM   2031 N N      . SER C 3 110 ? -5.923  16.715  51.211 1.00 40.12 ? 124 SER A N      1 
ATOM   2032 C CA     . SER C 3 110 ? -4.493  16.835  51.496 1.00 39.72 ? 124 SER A CA     1 
ATOM   2033 C C      . SER C 3 110 ? -3.829  15.687  52.254 1.00 38.77 ? 124 SER A C      1 
ATOM   2034 O O      . SER C 3 110 ? -2.629  15.454  52.106 1.00 40.50 ? 124 SER A O      1 
ATOM   2035 C CB     . SER C 3 110 ? -4.229  18.144  52.221 1.00 36.81 ? 124 SER A CB     1 
ATOM   2036 O OG     . SER C 3 110 ? -2.871  18.244  52.526 1.00 42.90 ? 124 SER A OG     1 
ATOM   2037 H H      . SER C 3 110 ? -6.495  17.401  51.596 1.00 0.00  ? 124 SER A H      1 
ATOM   2038 H HG     . SER C 3 110 ? -2.663  19.094  52.923 1.00 0.00  ? 124 SER A HG     1 
ATOM   2039 N N      . LYS C 3 111 ? -4.586  15.025  53.123 1.00 36.51 ? 125 LYS A N      1 
ATOM   2040 C CA     . LYS C 3 111 ? -4.037  13.920  53.865 1.00 33.39 ? 125 LYS A CA     1 
ATOM   2041 C C      . LYS C 3 111 ? -4.934  12.702  53.699 1.00 34.49 ? 125 LYS A C      1 
ATOM   2042 O O      . LYS C 3 111 ? -5.949  12.587  54.383 1.00 37.07 ? 125 LYS A O      1 
ATOM   2043 C CB     . LYS C 3 111 ? -3.895  14.289  55.342 1.00 31.39 ? 125 LYS A CB     1 
ATOM   2044 H H      . LYS C 3 111 ? -5.473  15.364  53.284 1.00 0.00  ? 125 LYS A H      1 
ATOM   2045 N N      . PRO C 3 112 ? -4.629  11.840  52.714 1.00 33.21 ? 126 PRO A N      1 
ATOM   2046 C CA     . PRO C 3 112 ? -5.328  10.598  52.346 1.00 31.61 ? 126 PRO A CA     1 
ATOM   2047 C C      . PRO C 3 112 ? -5.266  9.489   53.393 1.00 32.45 ? 126 PRO A C      1 
ATOM   2048 O O      . PRO C 3 112 ? -4.305  9.392   54.149 1.00 35.42 ? 126 PRO A O      1 
ATOM   2049 C CB     . PRO C 3 112 ? -4.590  10.158  51.079 1.00 28.22 ? 126 PRO A CB     1 
ATOM   2050 C CG     . PRO C 3 112 ? -4.238  11.422  50.477 1.00 29.64 ? 126 PRO A CG     1 
ATOM   2051 C CD     . PRO C 3 112 ? -3.700  12.219  51.644 1.00 31.88 ? 126 PRO A CD     1 
ATOM   2052 N N      . SER C 3 113 ? -6.301  8.658   53.451 1.00 32.33 ? 127 SER A N      1 
ATOM   2053 C CA     . SER C 3 113 ? -6.280  7.555   54.391 1.00 36.18 ? 127 SER A CA     1 
ATOM   2054 C C      . SER C 3 113 ? -5.332  6.521   53.815 1.00 37.33 ? 127 SER A C      1 
ATOM   2055 O O      . SER C 3 113 ? -5.038  6.527   52.630 1.00 39.96 ? 127 SER A O      1 
ATOM   2056 C CB     . SER C 3 113 ? -7.676  6.948   54.580 1.00 35.68 ? 127 SER A CB     1 
ATOM   2057 O OG     . SER C 3 113 ? -7.950  5.914   53.645 1.00 40.64 ? 127 SER A OG     1 
ATOM   2058 H H      . SER C 3 113 ? -7.057  8.800   52.839 1.00 0.00  ? 127 SER A H      1 
ATOM   2059 H HG     . SER C 3 113 ? -7.556  5.117   53.977 1.00 0.00  ? 127 SER A HG     1 
ATOM   2060 N N      . SER C 3 114 ? -4.978  5.546   54.632 1.00 39.67 ? 128 SER A N      1 
ATOM   2061 C CA     . SER C 3 114 ? -4.075  4.475   54.236 1.00 42.28 ? 128 SER A CA     1 
ATOM   2062 C C      . SER C 3 114 ? -4.681  3.577   53.133 1.00 47.02 ? 128 SER A C      1 
ATOM   2063 O O      . SER C 3 114 ? -3.960  2.859   52.425 1.00 51.20 ? 128 SER A O      1 
ATOM   2064 C CB     . SER C 3 114 ? -3.715  3.672   55.493 1.00 37.83 ? 128 SER A CB     1 
ATOM   2065 O OG     . SER C 3 114 ? -2.728  2.696   55.283 1.00 36.14 ? 128 SER A OG     1 
ATOM   2066 H H      . SER C 3 114 ? -5.353  5.507   55.536 1.00 0.00  ? 128 SER A H      1 
ATOM   2067 H HG     . SER C 3 114 ? -2.929  2.065   54.583 1.00 0.00  ? 128 SER A HG     1 
ATOM   2068 N N      . GLN C 3 115 ? -5.997  3.671   52.951 1.00 48.89 ? 129 GLN A N      1 
ATOM   2069 C CA     . GLN C 3 115 ? -6.703  2.868   51.955 1.00 48.51 ? 129 GLN A CA     1 
ATOM   2070 C C      . GLN C 3 115 ? -6.552  3.616   50.636 1.00 45.71 ? 129 GLN A C      1 
ATOM   2071 O O      . GLN C 3 115 ? -6.177  3.042   49.610 1.00 41.90 ? 129 GLN A O      1 
ATOM   2072 C CB     . GLN C 3 115 ? -8.184  2.762   52.340 1.00 54.56 ? 129 GLN A CB     1 
ATOM   2073 C CG     . GLN C 3 115 ? -9.058  1.982   51.361 1.00 61.19 ? 129 GLN A CG     1 
ATOM   2074 C CD     . GLN C 3 115 ? -10.172 2.831   50.737 1.00 64.38 ? 129 GLN A CD     1 
ATOM   2075 O OE1    . GLN C 3 115 ? -10.766 2.434   49.729 1.00 65.57 ? 129 GLN A OE1    1 
ATOM   2076 N NE2    . GLN C 3 115 ? -10.452 3.999   51.326 1.00 64.11 ? 129 GLN A NE2    1 
ATOM   2077 H H      . GLN C 3 115 ? -6.559  4.392   53.283 1.00 0.00  ? 129 GLN A H      1 
ATOM   2078 H HE21   . GLN C 3 115 ? -11.226 4.445   50.928 1.00 0.00  ? 129 GLN A HE21   1 
ATOM   2079 H HE22   . GLN C 3 115 ? -9.976  4.381   52.089 1.00 0.00  ? 129 GLN A HE22   1 
ATOM   2080 N N      . GLU C 3 116 ? -6.835  4.911   50.699 1.00 43.04 ? 130 GLU A N      1 
ATOM   2081 C CA     . GLU C 3 116 ? -6.733  5.812   49.566 1.00 43.61 ? 130 GLU A CA     1 
ATOM   2082 C C      . GLU C 3 116 ? -5.309  5.753   48.974 1.00 45.09 ? 130 GLU A C      1 
ATOM   2083 O O      . GLU C 3 116 ? -5.127  5.581   47.754 1.00 47.49 ? 130 GLU A O      1 
ATOM   2084 C CB     . GLU C 3 116 ? -7.011  7.234   50.044 1.00 45.37 ? 130 GLU A CB     1 
ATOM   2085 C CG     . GLU C 3 116 ? -8.230  7.915   49.461 1.00 51.59 ? 130 GLU A CG     1 
ATOM   2086 C CD     . GLU C 3 116 ? -8.449  9.306   50.078 1.00 55.80 ? 130 GLU A CD     1 
ATOM   2087 O OE1    . GLU C 3 116 ? -9.082  9.372   51.164 1.00 57.42 ? 130 GLU A OE1    1 
ATOM   2088 O OE2    . GLU C 3 116 ? -7.975  10.325  49.497 1.00 55.42 ? 130 GLU A OE2    1 
ATOM   2089 H H      . GLU C 3 116 ? -7.126  5.251   51.566 1.00 0.00  ? 130 GLU A H      1 
ATOM   2090 N N      . ILE C 3 117 ? -4.294  5.900   49.835 1.00 41.98 ? 131 ILE A N      1 
ATOM   2091 C CA     . ILE C 3 117 ? -2.894  5.887   49.387 1.00 34.83 ? 131 ILE A CA     1 
ATOM   2092 C C      . ILE C 3 117 ? -2.581  4.586   48.685 1.00 34.19 ? 131 ILE A C      1 
ATOM   2093 O O      . ILE C 3 117 ? -1.929  4.561   47.643 1.00 32.56 ? 131 ILE A O      1 
ATOM   2094 C CB     . ILE C 3 117 ? -1.910  6.141   50.577 1.00 35.38 ? 131 ILE A CB     1 
ATOM   2095 C CG1    . ILE C 3 117 ? -1.865  7.649   50.860 1.00 25.44 ? 131 ILE A CG1    1 
ATOM   2096 C CG2    . ILE C 3 117 ? -0.485  5.560   50.279 1.00 30.34 ? 131 ILE A CG2    1 
ATOM   2097 C CD1    . ILE C 3 117 ? -0.967  8.044   51.968 1.00 20.50 ? 131 ILE A CD1    1 
ATOM   2098 H H      . ILE C 3 117 ? -4.519  6.041   50.795 1.00 0.00  ? 131 ILE A H      1 
ATOM   2099 N N      . MET C 3 118 ? -3.137  3.515   49.229 1.00 33.45 ? 132 MET A N      1 
ATOM   2100 C CA     . MET C 3 118 ? -2.948  2.172   48.701 1.00 33.00 ? 132 MET A CA     1 
ATOM   2101 C C      . MET C 3 118 ? -3.655  1.996   47.354 1.00 33.94 ? 132 MET A C      1 
ATOM   2102 O O      . MET C 3 118 ? -3.265  1.162   46.532 1.00 35.14 ? 132 MET A O      1 
ATOM   2103 C CB     . MET C 3 118 ? -3.486  1.179   49.727 1.00 33.34 ? 132 MET A CB     1 
ATOM   2104 C CG     . MET C 3 118 ? -3.622  -0.244  49.262 1.00 39.28 ? 132 MET A CG     1 
ATOM   2105 S SD     . MET C 3 118 ? -2.151  -1.150  49.632 1.00 48.82 ? 132 MET A SD     1 
ATOM   2106 C CE     . MET C 3 118 ? -2.665  -2.780  49.258 1.00 48.20 ? 132 MET A CE     1 
ATOM   2107 H H      . MET C 3 118 ? -3.723  3.641   50.012 1.00 0.00  ? 132 MET A H      1 
ATOM   2108 N N      . ARG C 3 119 ? -4.719  2.762   47.147 1.00 32.26 ? 133 ARG A N      1 
ATOM   2109 C CA     . ARG C 3 119 ? -5.493  2.714   45.918 1.00 31.40 ? 133 ARG A CA     1 
ATOM   2110 C C      . ARG C 3 119 ? -4.781  3.501   44.816 1.00 29.59 ? 133 ARG A C      1 
ATOM   2111 O O      . ARG C 3 119 ? -4.615  2.983   43.717 1.00 31.14 ? 133 ARG A O      1 
ATOM   2112 C CB     . ARG C 3 119 ? -6.910  3.240   46.160 1.00 37.38 ? 133 ARG A CB     1 
ATOM   2113 C CG     . ARG C 3 119 ? -8.025  2.237   45.840 1.00 41.90 ? 133 ARG A CG     1 
ATOM   2114 C CD     . ARG C 3 119 ? -9.330  2.570   46.535 1.00 45.88 ? 133 ARG A CD     1 
ATOM   2115 N NE     . ARG C 3 119 ? -9.449  3.966   46.982 1.00 51.45 ? 133 ARG A NE     1 
ATOM   2116 C CZ     . ARG C 3 119 ? -9.832  4.985   46.220 1.00 52.67 ? 133 ARG A CZ     1 
ATOM   2117 N NH1    . ARG C 3 119 ? -10.153 4.800   44.940 1.00 50.58 ? 133 ARG A NH1    1 
ATOM   2118 N NH2    . ARG C 3 119 ? -9.880  6.195   46.746 1.00 53.29 ? 133 ARG A NH2    1 
ATOM   2119 H H      . ARG C 3 119 ? -5.031  3.321   47.880 1.00 0.00  ? 133 ARG A H      1 
ATOM   2120 H HE     . ARG C 3 119 ? -9.347  4.199   47.926 1.00 0.00  ? 133 ARG A HE     1 
ATOM   2121 H HH11   . ARG C 3 119 ? -10.144 3.899   44.511 1.00 0.00  ? 133 ARG A HH11   1 
ATOM   2122 H HH12   . ARG C 3 119 ? -10.486 5.581   44.409 1.00 0.00  ? 133 ARG A HH12   1 
ATOM   2123 H HH21   . ARG C 3 119 ? -9.658  6.407   47.700 1.00 0.00  ? 133 ARG A HH21   1 
ATOM   2124 H HH22   . ARG C 3 119 ? -10.142 6.919   46.149 1.00 0.00  ? 133 ARG A HH22   1 
ATOM   2125 N N      . MET C 3 120 ? -4.366  4.738   45.101 1.00 25.49 ? 134 MET A N      1 
ATOM   2126 C CA     . MET C 3 120 ? -3.616  5.569   44.146 1.00 25.60 ? 134 MET A CA     1 
ATOM   2127 C C      . MET C 3 120 ? -2.303  4.867   43.694 1.00 27.10 ? 134 MET A C      1 
ATOM   2128 O O      . MET C 3 120 ? -1.758  5.125   42.622 1.00 29.99 ? 134 MET A O      1 
ATOM   2129 C CB     . MET C 3 120 ? -3.226  6.900   44.786 1.00 22.89 ? 134 MET A CB     1 
ATOM   2130 C CG     . MET C 3 120 ? -4.249  8.001   44.770 1.00 18.99 ? 134 MET A CG     1 
ATOM   2131 S SD     . MET C 3 120 ? -3.744  9.353   45.913 1.00 28.90 ? 134 MET A SD     1 
ATOM   2132 C CE     . MET C 3 120 ? -3.699  10.708  44.939 1.00 22.74 ? 134 MET A CE     1 
ATOM   2133 H H      . MET C 3 120 ? -4.603  5.082   46.004 1.00 0.00  ? 134 MET A H      1 
ATOM   2134 N N      . ALA C 3 121 ? -1.772  4.014   44.549 1.00 28.19 ? 135 ALA A N      1 
ATOM   2135 C CA     . ALA C 3 121 ? -0.557  3.280   44.266 1.00 27.47 ? 135 ALA A CA     1 
ATOM   2136 C C      . ALA C 3 121 ? -0.880  2.193   43.265 1.00 28.85 ? 135 ALA A C      1 
ATOM   2137 O O      . ALA C 3 121 ? -0.136  2.004   42.304 1.00 35.49 ? 135 ALA A O      1 
ATOM   2138 C CB     . ALA C 3 121 ? 0.016   2.674   45.564 1.00 28.43 ? 135 ALA A CB     1 
ATOM   2139 H H      . ALA C 3 121 ? -2.190  3.871   45.436 1.00 0.00  ? 135 ALA A H      1 
ATOM   2140 N N      . GLU C 3 122 ? -1.948  1.450   43.512 1.00 28.37 ? 136 GLU A N      1 
ATOM   2141 C CA     . GLU C 3 122 ? -2.356  0.393   42.610 1.00 28.03 ? 136 GLU A CA     1 
ATOM   2142 C C      . GLU C 3 122 ? -2.768  1.014   41.270 1.00 28.02 ? 136 GLU A C      1 
ATOM   2143 O O      . GLU C 3 122 ? -2.426  0.502   40.229 1.00 30.12 ? 136 GLU A O      1 
ATOM   2144 C CB     . GLU C 3 122 ? -3.469  -0.457  43.263 1.00 28.31 ? 136 GLU A CB     1 
ATOM   2145 C CG     . GLU C 3 122 ? -2.971  -1.227  44.498 1.00 28.32 ? 136 GLU A CG     1 
ATOM   2146 C CD     . GLU C 3 122 ? -4.073  -1.917  45.328 1.00 37.34 ? 136 GLU A CD     1 
ATOM   2147 O OE1    . GLU C 3 122 ? -5.091  -1.245  45.668 1.00 36.55 ? 136 GLU A OE1    1 
ATOM   2148 O OE2    . GLU C 3 122 ? -3.895  -3.135  45.655 1.00 36.06 ? 136 GLU A OE2    1 
ATOM   2149 H H      . GLU C 3 122 ? -2.474  1.545   44.338 1.00 0.00  ? 136 GLU A H      1 
ATOM   2150 N N      . GLU C 3 123 ? -3.414  2.169   41.316 1.00 29.36 ? 137 GLU A N      1 
ATOM   2151 C CA     . GLU C 3 123 ? -3.862  2.883   40.132 1.00 30.04 ? 137 GLU A CA     1 
ATOM   2152 C C      . GLU C 3 123 ? -2.730  3.408   39.227 1.00 34.54 ? 137 GLU A C      1 
ATOM   2153 O O      . GLU C 3 123 ? -2.906  3.527   37.993 1.00 32.85 ? 137 GLU A O      1 
ATOM   2154 C CB     . GLU C 3 123 ? -4.747  4.058   40.546 1.00 31.99 ? 137 GLU A CB     1 
ATOM   2155 C CG     . GLU C 3 123 ? -5.042  5.039   39.410 1.00 30.61 ? 137 GLU A CG     1 
ATOM   2156 C CD     . GLU C 3 123 ? -5.405  6.446   39.891 1.00 32.64 ? 137 GLU A CD     1 
ATOM   2157 O OE1    . GLU C 3 123 ? -5.988  6.604   40.991 1.00 29.84 ? 137 GLU A OE1    1 
ATOM   2158 O OE2    . GLU C 3 123 ? -5.078  7.412   39.165 1.00 27.09 ? 137 GLU A OE2    1 
ATOM   2159 H H      . GLU C 3 123 ? -3.698  2.516   42.205 1.00 0.00  ? 137 GLU A H      1 
ATOM   2160 N N      . LEU C 3 124 ? -1.618  3.815   39.846 1.00 33.53 ? 138 LEU A N      1 
ATOM   2161 C CA     . LEU C 3 124 ? -0.473  4.357   39.116 1.00 33.94 ? 138 LEU A CA     1 
ATOM   2162 C C      . LEU C 3 124 ? 0.717   3.385   39.032 1.00 33.41 ? 138 LEU A C      1 
ATOM   2163 O O      . LEU C 3 124 ? 1.729   3.667   38.372 1.00 32.43 ? 138 LEU A O      1 
ATOM   2164 C CB     . LEU C 3 124 ? -0.056  5.706   39.740 1.00 35.07 ? 138 LEU A CB     1 
ATOM   2165 C CG     . LEU C 3 124 ? -1.161  6.781   39.814 1.00 34.98 ? 138 LEU A CG     1 
ATOM   2166 C CD1    . LEU C 3 124 ? -0.774  7.997   40.654 1.00 32.25 ? 138 LEU A CD1    1 
ATOM   2167 C CD2    . LEU C 3 124 ? -1.542  7.215   38.430 1.00 34.70 ? 138 LEU A CD2    1 
ATOM   2168 H H      . LEU C 3 124 ? -1.587  3.873   40.804 1.00 0.00  ? 138 LEU A H      1 
ATOM   2169 N N      . ASN C 3 125 ? 0.570   2.223   39.665 1.00 36.14 ? 139 ASN A N      1 
ATOM   2170 C CA     . ASN C 3 125 ? 1.603   1.189   39.667 1.00 39.28 ? 139 ASN A CA     1 
ATOM   2171 C C      . ASN C 3 125 ? 2.905   1.648   40.322 1.00 39.98 ? 139 ASN A C      1 
ATOM   2172 O O      . ASN C 3 125 ? 3.985   1.526   39.728 1.00 40.50 ? 139 ASN A O      1 
ATOM   2173 C CB     . ASN C 3 125 ? 1.876   0.675   38.256 1.00 40.81 ? 139 ASN A CB     1 
ATOM   2174 C CG     . ASN C 3 125 ? 2.340   -0.757  38.263 1.00 46.14 ? 139 ASN A CG     1 
ATOM   2175 O OD1    . ASN C 3 125 ? 1.846   -1.570  39.058 1.00 51.69 ? 139 ASN A OD1    1 
ATOM   2176 N ND2    . ASN C 3 125 ? 3.288   -1.101  37.394 1.00 44.19 ? 139 ASN A ND2    1 
ATOM   2177 H H      . ASN C 3 125 ? -0.260  2.055   40.183 1.00 0.00  ? 139 ASN A H      1 
ATOM   2178 H HD21   . ASN C 3 125 ? 3.642   -2.016  37.426 1.00 0.00  ? 139 ASN A HD21   1 
ATOM   2179 H HD22   . ASN C 3 125 ? 3.617   -0.431  36.777 1.00 0.00  ? 139 ASN A HD22   1 
ATOM   2180 N N      . LEU C 3 126 ? 2.771   2.278   41.488 1.00 41.23 ? 140 LEU A N      1 
ATOM   2181 C CA     . LEU C 3 126 ? 3.911   2.779   42.292 1.00 39.81 ? 140 LEU A CA     1 
ATOM   2182 C C      . LEU C 3 126 ? 3.842   2.038   43.627 1.00 41.72 ? 140 LEU A C      1 
ATOM   2183 O O      . LEU C 3 126 ? 2.827   1.416   43.937 1.00 44.92 ? 140 LEU A O      1 
ATOM   2184 C CB     . LEU C 3 126 ? 3.796   4.290   42.561 1.00 34.36 ? 140 LEU A CB     1 
ATOM   2185 C CG     . LEU C 3 126 ? 3.792   5.305   41.410 1.00 31.82 ? 140 LEU A CG     1 
ATOM   2186 C CD1    . LEU C 3 126 ? 3.581   6.724   41.899 1.00 26.75 ? 140 LEU A CD1    1 
ATOM   2187 C CD2    . LEU C 3 126 ? 5.079   5.233   40.644 1.00 32.61 ? 140 LEU A CD2    1 
ATOM   2188 H H      . LEU C 3 126 ? 1.841   2.312   41.773 1.00 0.00  ? 140 LEU A H      1 
ATOM   2189 N N      . GLU C 3 127 ? 4.893   2.059   44.433 1.00 44.15 ? 141 GLU A N      1 
ATOM   2190 C CA     . GLU C 3 127 ? 4.781   1.359   45.706 1.00 46.15 ? 141 GLU A CA     1 
ATOM   2191 C C      . GLU C 3 127 ? 4.060   2.295   46.669 1.00 46.79 ? 141 GLU A C      1 
ATOM   2192 O O      . GLU C 3 127 ? 4.275   3.507   46.646 1.00 46.63 ? 141 GLU A O      1 
ATOM   2193 C CB     . GLU C 3 127 ? 6.156   0.992   46.250 1.00 54.09 ? 141 GLU A CB     1 
ATOM   2194 C CG     . GLU C 3 127 ? 7.064   0.262   45.239 1.00 67.70 ? 141 GLU A CG     1 
ATOM   2195 C CD     . GLU C 3 127 ? 6.792   -1.250  45.086 1.00 75.42 ? 141 GLU A CD     1 
ATOM   2196 O OE1    . GLU C 3 127 ? 5.928   -1.825  45.799 1.00 79.75 ? 141 GLU A OE1    1 
ATOM   2197 O OE2    . GLU C 3 127 ? 7.474   -1.870  44.237 1.00 77.75 ? 141 GLU A OE2    1 
ATOM   2198 H H      . GLU C 3 127 ? 5.721   2.539   44.164 1.00 0.00  ? 141 GLU A H      1 
ATOM   2199 N N      . LYS C 3 128 ? 3.232   1.727   47.540 1.00 47.30 ? 142 LYS A N      1 
ATOM   2200 C CA     . LYS C 3 128 ? 2.470   2.506   48.518 1.00 47.16 ? 142 LYS A CA     1 
ATOM   2201 C C      . LYS C 3 128 ? 3.367   3.533   49.255 1.00 46.05 ? 142 LYS A C      1 
ATOM   2202 O O      . LYS C 3 128 ? 2.969   4.681   49.494 1.00 47.60 ? 142 LYS A O      1 
ATOM   2203 C CB     . LYS C 3 128 ? 1.787   1.542   49.502 1.00 47.55 ? 142 LYS A CB     1 
ATOM   2204 C CG     . LYS C 3 128 ? 0.970   2.221   50.573 1.00 51.83 ? 142 LYS A CG     1 
ATOM   2205 C CD     . LYS C 3 128 ? 0.440   1.209   51.589 1.00 52.92 ? 142 LYS A CD     1 
ATOM   2206 C CE     . LYS C 3 128 ? 0.140   1.870   52.922 1.00 54.91 ? 142 LYS A CE     1 
ATOM   2207 N NZ     . LYS C 3 128 ? -0.678  3.100   52.771 1.00 53.06 ? 142 LYS A NZ     1 
ATOM   2208 H H      . LYS C 3 128 ? 3.178   0.736   47.597 1.00 0.00  ? 142 LYS A H      1 
ATOM   2209 H HZ1    . LYS C 3 128 ? -0.151  3.740   52.150 1.00 0.00  ? 142 LYS A HZ1    1 
ATOM   2210 H HZ2    . LYS C 3 128 ? -1.613  2.842   52.413 1.00 0.00  ? 142 LYS A HZ2    1 
ATOM   2211 H HZ3    . LYS C 3 128 ? -0.779  3.459   53.740 1.00 0.00  ? 142 LYS A HZ3    1 
ATOM   2212 N N      . GLU C 3 129 ? 4.630   3.163   49.456 1.00 44.21 ? 143 GLU A N      1 
ATOM   2213 C CA     . GLU C 3 129 ? 5.585   4.023   50.156 1.00 41.10 ? 143 GLU A CA     1 
ATOM   2214 C C      . GLU C 3 129 ? 5.944   5.297   49.411 1.00 36.17 ? 143 GLU A C      1 
ATOM   2215 O O      . GLU C 3 129 ? 6.152   6.356   50.018 1.00 37.16 ? 143 GLU A O      1 
ATOM   2216 C CB     . GLU C 3 129 ? 6.861   3.258   50.503 1.00 41.24 ? 143 GLU A CB     1 
ATOM   2217 C CG     . GLU C 3 129 ? 7.807   4.033   51.402 1.00 45.23 ? 143 GLU A CG     1 
ATOM   2218 C CD     . GLU C 3 129 ? 7.253   4.264   52.789 1.00 42.54 ? 143 GLU A CD     1 
ATOM   2219 O OE1    . GLU C 3 129 ? 6.495   3.395   53.252 1.00 48.90 ? 143 GLU A OE1    1 
ATOM   2220 O OE2    . GLU C 3 129 ? 7.575   5.302   53.406 1.00 41.86 ? 143 GLU A OE2    1 
ATOM   2221 H H      . GLU C 3 129 ? 4.965   2.302   49.092 1.00 0.00  ? 143 GLU A H      1 
ATOM   2222 N N      . VAL C 3 130 ? 5.929   5.202   48.089 1.00 31.08 ? 144 VAL A N      1 
ATOM   2223 C CA     . VAL C 3 130 ? 6.243   6.322   47.219 1.00 24.66 ? 144 VAL A CA     1 
ATOM   2224 C C      . VAL C 3 130 ? 5.130   7.360   47.283 1.00 19.83 ? 144 VAL A C      1 
ATOM   2225 O O      . VAL C 3 130 ? 5.392   8.563   47.354 1.00 19.84 ? 144 VAL A O      1 
ATOM   2226 C CB     . VAL C 3 130 ? 6.473   5.839   45.768 1.00 24.23 ? 144 VAL A CB     1 
ATOM   2227 C CG1    . VAL C 3 130 ? 7.005   7.004   44.890 1.00 23.41 ? 144 VAL A CG1    1 
ATOM   2228 C CG2    . VAL C 3 130 ? 7.443   4.652   45.766 1.00 19.78 ? 144 VAL A CG2    1 
ATOM   2229 H H      . VAL C 3 130 ? 5.622   4.389   47.671 1.00 0.00  ? 144 VAL A H      1 
ATOM   2230 N N      . VAL C 3 131 ? 3.883   6.879   47.319 1.00 19.92 ? 145 VAL A N      1 
ATOM   2231 C CA     . VAL C 3 131 ? 2.719   7.774   47.383 1.00 18.13 ? 145 VAL A CA     1 
ATOM   2232 C C      . VAL C 3 131 ? 2.708   8.414   48.756 1.00 18.76 ? 145 VAL A C      1 
ATOM   2233 O O      . VAL C 3 131 ? 2.491   9.622   48.871 1.00 21.24 ? 145 VAL A O      1 
ATOM   2234 C CB     . VAL C 3 131 ? 1.367   7.035   47.150 1.00 16.52 ? 145 VAL A CB     1 
ATOM   2235 C CG1    . VAL C 3 131 ? 0.373   7.938   46.504 1.00 7.97  ? 145 VAL A CG1    1 
ATOM   2236 C CG2    . VAL C 3 131 ? 1.543   5.853   46.302 1.00 15.58 ? 145 VAL A CG2    1 
ATOM   2237 H H      . VAL C 3 131 ? 3.844   5.885   47.240 1.00 0.00  ? 145 VAL A H      1 
ATOM   2238 N N      . ARG C 3 132 ? 2.956   7.605   49.793 1.00 20.51 ? 146 ARG A N      1 
ATOM   2239 C CA     . ARG C 3 132 ? 3.021   8.089   51.176 1.00 23.08 ? 146 ARG A CA     1 
ATOM   2240 C C      . ARG C 3 132 ? 3.990   9.270   51.345 1.00 24.29 ? 146 ARG A C      1 
ATOM   2241 O O      . ARG C 3 132 ? 3.604   10.347  51.848 1.00 26.16 ? 146 ARG A O      1 
ATOM   2242 C CB     . ARG C 3 132 ? 3.462   6.972   52.101 1.00 27.42 ? 146 ARG A CB     1 
ATOM   2243 C CG     . ARG C 3 132 ? 3.142   7.295   53.545 1.00 28.95 ? 146 ARG A CG     1 
ATOM   2244 C CD     . ARG C 3 132 ? 3.725   6.273   54.464 1.00 29.39 ? 146 ARG A CD     1 
ATOM   2245 N NE     . ARG C 3 132 ? 5.162   6.455   54.631 1.00 32.22 ? 146 ARG A NE     1 
ATOM   2246 C CZ     . ARG C 3 132 ? 5.720   7.434   55.343 1.00 35.18 ? 146 ARG A CZ     1 
ATOM   2247 N NH1    . ARG C 3 132 ? 5.009   8.345   55.981 1.00 31.44 ? 146 ARG A NH1    1 
ATOM   2248 N NH2    . ARG C 3 132 ? 7.041   7.546   55.326 1.00 38.86 ? 146 ARG A NH2    1 
ATOM   2249 H H      . ARG C 3 132 ? 3.023   6.629   49.669 1.00 0.00  ? 146 ARG A H      1 
ATOM   2250 H HE     . ARG C 3 132 ? 5.784   5.812   54.247 1.00 0.00  ? 146 ARG A HE     1 
ATOM   2251 H HH11   . ARG C 3 132 ? 4.016   8.428   56.045 1.00 0.00  ? 146 ARG A HH11   1 
ATOM   2252 H HH12   . ARG C 3 132 ? 5.521   9.027   56.495 1.00 0.00  ? 146 ARG A HH12   1 
ATOM   2253 H HH21   . ARG C 3 132 ? 7.455   6.879   54.717 1.00 0.00  ? 146 ARG A HH21   1 
ATOM   2254 H HH22   . ARG C 3 132 ? 7.538   8.271   55.809 1.00 0.00  ? 146 ARG A HH22   1 
ATOM   2255 N N      . VAL C 3 133 ? 5.255   9.071   50.948 1.00 22.60 ? 147 VAL A N      1 
ATOM   2256 C CA     . VAL C 3 133 ? 6.267   10.131  51.026 1.00 17.32 ? 147 VAL A CA     1 
ATOM   2257 C C      . VAL C 3 133 ? 6.013   11.331  50.117 1.00 17.61 ? 147 VAL A C      1 
ATOM   2258 O O      . VAL C 3 133 ? 6.419   12.481  50.410 1.00 18.67 ? 147 VAL A O      1 
ATOM   2259 C CB     . VAL C 3 133 ? 7.662   9.572   50.718 1.00 20.79 ? 147 VAL A CB     1 
ATOM   2260 C CG1    . VAL C 3 133 ? 8.729   10.671  50.889 1.00 18.25 ? 147 VAL A CG1    1 
ATOM   2261 C CG2    . VAL C 3 133 ? 7.934   8.382   51.599 1.00 15.14 ? 147 VAL A CG2    1 
ATOM   2262 H H      . VAL C 3 133 ? 5.582   8.181   50.626 1.00 0.00  ? 147 VAL A H      1 
ATOM   2263 N N      . TRP C 3 134 ? 5.360   11.078  48.991 1.00 16.65 ? 148 TRP A N      1 
ATOM   2264 C CA     . TRP C 3 134 ? 5.069   12.147  48.085 1.00 16.46 ? 148 TRP A CA     1 
ATOM   2265 C C      . TRP C 3 134 ? 4.095   13.101  48.753 1.00 18.35 ? 148 TRP A C      1 
ATOM   2266 O O      . TRP C 3 134 ? 4.216   14.326  48.635 1.00 22.09 ? 148 TRP A O      1 
ATOM   2267 C CB     . TRP C 3 134 ? 4.526   11.608  46.758 1.00 24.06 ? 148 TRP A CB     1 
ATOM   2268 C CG     . TRP C 3 134 ? 4.387   12.708  45.726 1.00 24.83 ? 148 TRP A CG     1 
ATOM   2269 C CD1    . TRP C 3 134 ? 5.343   13.096  44.787 1.00 23.42 ? 148 TRP A CD1    1 
ATOM   2270 C CD2    . TRP C 3 134 ? 3.293   13.643  45.603 1.00 22.88 ? 148 TRP A CD2    1 
ATOM   2271 N NE1    . TRP C 3 134 ? 4.894   14.219  44.107 1.00 26.58 ? 148 TRP A NE1    1 
ATOM   2272 C CE2    . TRP C 3 134 ? 3.651   14.576  44.587 1.00 24.26 ? 148 TRP A CE2    1 
ATOM   2273 C CE3    . TRP C 3 134 ? 2.061   13.784  46.251 1.00 17.72 ? 148 TRP A CE3    1 
ATOM   2274 C CZ2    . TRP C 3 134 ? 2.809   15.634  44.218 1.00 21.70 ? 148 TRP A CZ2    1 
ATOM   2275 C CZ3    . TRP C 3 134 ? 1.236   14.829  45.885 1.00 14.55 ? 148 TRP A CZ3    1 
ATOM   2276 C CH2    . TRP C 3 134 ? 1.612   15.746  44.879 1.00 20.33 ? 148 TRP A CH2    1 
ATOM   2277 H H      . TRP C 3 134 ? 5.184   10.157  48.680 1.00 0.00  ? 148 TRP A H      1 
ATOM   2278 H HE1    . TRP C 3 134 ? 5.405   14.666  43.399 1.00 0.00  ? 148 TRP A HE1    1 
ATOM   2279 N N      . PHE C 3 135 ? 3.131   12.552  49.483 1.00 20.46 ? 149 PHE A N      1 
ATOM   2280 C CA     . PHE C 3 135 ? 2.163   13.398  50.171 1.00 18.33 ? 149 PHE A CA     1 
ATOM   2281 C C      . PHE C 3 135 ? 2.809   14.177  51.276 1.00 15.62 ? 149 PHE A C      1 
ATOM   2282 O O      . PHE C 3 135 ? 2.595   15.396  51.394 1.00 16.09 ? 149 PHE A O      1 
ATOM   2283 C CB     . PHE C 3 135 ? 0.970   12.594  50.726 1.00 22.41 ? 149 PHE A CB     1 
ATOM   2284 C CG     . PHE C 3 135 ? -0.227  12.602  49.810 1.00 25.77 ? 149 PHE A CG     1 
ATOM   2285 C CD1    . PHE C 3 135 ? -0.949  13.766  49.580 1.00 26.72 ? 149 PHE A CD1    1 
ATOM   2286 C CD2    . PHE C 3 135 ? -0.548  11.478  49.073 1.00 28.18 ? 149 PHE A CD2    1 
ATOM   2287 C CE1    . PHE C 3 135 ? -1.956  13.811  48.613 1.00 28.68 ? 149 PHE A CE1    1 
ATOM   2288 C CE2    . PHE C 3 135 ? -1.563  11.527  48.102 1.00 32.13 ? 149 PHE A CE2    1 
ATOM   2289 C CZ     . PHE C 3 135 ? -2.257  12.703  47.876 1.00 24.85 ? 149 PHE A CZ     1 
ATOM   2290 H H      . PHE C 3 135 ? 2.953   11.590  49.400 1.00 0.00  ? 149 PHE A H      1 
ATOM   2291 N N      . CYS C 3 136 ? 3.605   13.491  52.102 1.00 15.06 ? 150 CYS A N      1 
ATOM   2292 C CA     . CYS C 3 136 ? 4.276   14.158  53.233 1.00 14.62 ? 150 CYS A CA     1 
ATOM   2293 C C      . CYS C 3 136 ? 5.113   15.347  52.777 1.00 19.36 ? 150 CYS A C      1 
ATOM   2294 O O      . CYS C 3 136 ? 4.983   16.447  53.332 1.00 22.64 ? 150 CYS A O      1 
ATOM   2295 C CB     . CYS C 3 136 ? 5.162   13.197  54.008 1.00 8.28  ? 150 CYS A CB     1 
ATOM   2296 S SG     . CYS C 3 136 ? 4.444   11.630  54.407 1.00 22.28 ? 150 CYS A SG     1 
ATOM   2297 H H      . CYS C 3 136 ? 3.683   12.490  52.008 1.00 0.00  ? 150 CYS A H      1 
ATOM   2298 N N      . ASN C 3 137 ? 5.968   15.153  51.769 1.00 22.05 ? 151 ASN A N      1 
ATOM   2299 C CA     . ASN C 3 137 ? 6.797   16.243  51.269 1.00 24.02 ? 151 ASN A CA     1 
ATOM   2300 C C      . ASN C 3 137 ? 6.038   17.450  50.773 1.00 24.50 ? 151 ASN A C      1 
ATOM   2301 O O      . ASN C 3 137 ? 6.469   18.607  50.931 1.00 26.62 ? 151 ASN A O      1 
ATOM   2302 C CB     . ASN C 3 137 ? 7.666   15.751  50.137 1.00 30.28 ? 151 ASN A CB     1 
ATOM   2303 C CG     . ASN C 3 137 ? 8.979   15.197  50.623 1.00 33.23 ? 151 ASN A CG     1 
ATOM   2304 O OD1    . ASN C 3 137 ? 9.182   13.983  50.621 1.00 33.60 ? 151 ASN A OD1    1 
ATOM   2305 N ND2    . ASN C 3 137 ? 9.915   16.089  50.953 1.00 29.60 ? 151 ASN A ND2    1 
ATOM   2306 H H      . ASN C 3 137 ? 6.106   14.271  51.340 1.00 0.00  ? 151 ASN A H      1 
ATOM   2307 H HD21   . ASN C 3 137 ? 10.719  15.739  51.355 1.00 0.00  ? 151 ASN A HD21   1 
ATOM   2308 H HD22   . ASN C 3 137 ? 9.668   16.970  50.731 1.00 0.00  ? 151 ASN A HD22   1 
ATOM   2309 N N      . ARG C 3 138 ? 4.932   17.171  50.110 1.00 25.99 ? 152 ARG A N      1 
ATOM   2310 C CA     . ARG C 3 138 ? 4.049   18.183  49.552 1.00 26.14 ? 152 ARG A CA     1 
ATOM   2311 C C      . ARG C 3 138 ? 3.441   19.019  50.691 1.00 21.98 ? 152 ARG A C      1 
ATOM   2312 O O      . ARG C 3 138 ? 3.304   20.239  50.579 1.00 18.49 ? 152 ARG A O      1 
ATOM   2313 C CB     . ARG C 3 138 ? 2.985   17.460  48.721 1.00 32.23 ? 152 ARG A CB     1 
ATOM   2314 C CG     . ARG C 3 138 ? 2.054   18.321  47.958 1.00 36.97 ? 152 ARG A CG     1 
ATOM   2315 C CD     . ARG C 3 138 ? 2.702   18.895  46.765 1.00 41.90 ? 152 ARG A CD     1 
ATOM   2316 N NE     . ARG C 3 138 ? 1.795   19.759  46.038 1.00 48.90 ? 152 ARG A NE     1 
ATOM   2317 C CZ     . ARG C 3 138 ? 1.232   20.861  46.528 1.00 51.48 ? 152 ARG A CZ     1 
ATOM   2318 N NH1    . ARG C 3 138 ? 1.465   21.245  47.788 1.00 50.37 ? 152 ARG A NH1    1 
ATOM   2319 N NH2    . ARG C 3 138 ? 0.556   21.662  45.723 1.00 53.44 ? 152 ARG A NH2    1 
ATOM   2320 H H      . ARG C 3 138 ? 4.704   16.243  49.920 1.00 0.00  ? 152 ARG A H      1 
ATOM   2321 H HE     . ARG C 3 138 ? 1.650   19.556  45.098 1.00 0.00  ? 152 ARG A HE     1 
ATOM   2322 H HH11   . ARG C 3 138 ? 2.070   20.763  48.416 1.00 0.00  ? 152 ARG A HH11   1 
ATOM   2323 H HH12   . ARG C 3 138 ? 1.047   22.071  48.149 1.00 0.00  ? 152 ARG A HH12   1 
ATOM   2324 H HH21   . ARG C 3 138 ? 0.581   21.450  44.732 1.00 0.00  ? 152 ARG A HH21   1 
ATOM   2325 H HH22   . ARG C 3 138 ? 0.162   22.522  46.016 1.00 0.00  ? 152 ARG A HH22   1 
ATOM   2326 N N      . ARG C 3 139 ? 3.024   18.350  51.767 1.00 25.98 ? 153 ARG A N      1 
ATOM   2327 C CA     . ARG C 3 139 ? 2.499   19.054  52.966 1.00 26.21 ? 153 ARG A CA     1 
ATOM   2328 C C      . ARG C 3 139 ? 3.618   19.884  53.611 1.00 27.90 ? 153 ARG A C      1 
ATOM   2329 O O      . ARG C 3 139 ? 3.413   21.065  53.954 1.00 28.50 ? 153 ARG A O      1 
ATOM   2330 C CB     . ARG C 3 139 ? 1.986   18.075  54.009 1.00 18.55 ? 153 ARG A CB     1 
ATOM   2331 C CG     . ARG C 3 139 ? 0.676   17.427  53.677 1.00 16.92 ? 153 ARG A CG     1 
ATOM   2332 C CD     . ARG C 3 139 ? 0.393   16.347  54.712 1.00 18.74 ? 153 ARG A CD     1 
ATOM   2333 N NE     . ARG C 3 139 ? -0.251  15.205  54.092 1.00 21.84 ? 153 ARG A NE     1 
ATOM   2334 C CZ     . ARG C 3 139 ? 0.090   13.949  54.305 1.00 22.70 ? 153 ARG A CZ     1 
ATOM   2335 N NH1    . ARG C 3 139 ? 1.070   13.664  55.136 1.00 24.18 ? 153 ARG A NH1    1 
ATOM   2336 N NH2    . ARG C 3 139 ? -0.556  12.979  53.668 1.00 31.08 ? 153 ARG A NH2    1 
ATOM   2337 H H      . ARG C 3 139 ? 2.971   17.357  51.696 1.00 0.00  ? 153 ARG A H      1 
ATOM   2338 H HE     . ARG C 3 139 ? -0.987  15.371  53.478 1.00 0.00  ? 153 ARG A HE     1 
ATOM   2339 H HH11   . ARG C 3 139 ? 1.611   14.307  55.660 1.00 0.00  ? 153 ARG A HH11   1 
ATOM   2340 H HH12   . ARG C 3 139 ? 1.276   12.683  55.234 1.00 0.00  ? 153 ARG A HH12   1 
ATOM   2341 H HH21   . ARG C 3 139 ? -1.317  13.273  53.079 1.00 0.00  ? 153 ARG A HH21   1 
ATOM   2342 H HH22   . ARG C 3 139 ? -0.378  12.001  53.841 1.00 0.00  ? 153 ARG A HH22   1 
ATOM   2343 N N      . GLN C 3 140 ? 4.797   19.263  53.764 1.00 28.84 ? 154 GLN A N      1 
ATOM   2344 C CA     . GLN C 3 140 ? 5.987   19.906  54.345 1.00 27.11 ? 154 GLN A CA     1 
ATOM   2345 C C      . GLN C 3 140 ? 6.462   21.150  53.615 1.00 23.63 ? 154 GLN A C      1 
ATOM   2346 O O      . GLN C 3 140 ? 6.789   22.148  54.228 1.00 23.86 ? 154 GLN A O      1 
ATOM   2347 C CB     . GLN C 3 140 ? 7.129   18.920  54.474 1.00 30.36 ? 154 GLN A CB     1 
ATOM   2348 C CG     . GLN C 3 140 ? 8.464   19.610  54.697 1.00 35.99 ? 154 GLN A CG     1 
ATOM   2349 C CD     . GLN C 3 140 ? 9.439   18.727  55.411 1.00 39.34 ? 154 GLN A CD     1 
ATOM   2350 O OE1    . GLN C 3 140 ? 9.415   17.502  55.263 1.00 44.40 ? 154 GLN A OE1    1 
ATOM   2351 N NE2    . GLN C 3 140 ? 10.349  19.338  56.156 1.00 41.80 ? 154 GLN A NE2    1 
ATOM   2352 H H      . GLN C 3 140 ? 4.870   18.320  53.548 1.00 0.00  ? 154 GLN A H      1 
ATOM   2353 H HE21   . GLN C 3 140 ? 11.370  18.438  54.684 1.00 0.00  ? 154 GLN A HE21   1 
ATOM   2354 H HE22   . GLN C 3 140 ? 10.461  19.864  54.419 1.00 0.00  ? 154 GLN A HE22   1 
ATOM   2355 N N      . ARG C 3 141 ? 6.477   21.102  52.301 1.00 25.85 ? 155 ARG A N      1 
ATOM   2356 C CA     . ARG C 3 141 ? 6.691   22.467  51.655 1.00 28.36 ? 155 ARG A CA     1 
ATOM   2357 C C      . ARG C 3 141 ? 5.793   23.642  51.985 1.00 27.63 ? 155 ARG A C      1 
ATOM   2358 O O      . ARG C 3 141 ? 6.254   24.778  51.986 1.00 26.85 ? 155 ARG A O      1 
ATOM   2359 C CB     . ARG C 3 141 ? 6.665   22.209  50.151 1.00 42.77 ? 155 ARG A CB     1 
ATOM   2360 C CG     . ARG C 3 141 ? 7.565   21.048  49.713 1.00 52.32 ? 155 ARG A CG     1 
ATOM   2361 C CD     . ARG C 3 141 ? 7.241   20.608  48.294 1.00 60.14 ? 155 ARG A CD     1 
ATOM   2362 N NE     . ARG C 3 141 ? 8.086   19.481  47.890 1.00 67.07 ? 155 ARG A NE     1 
ATOM   2363 C CZ     . ARG C 3 141 ? 8.052   18.921  46.685 1.00 70.20 ? 155 ARG A CZ     1 
ATOM   2364 N NH1    . ARG C 3 141 ? 7.218   19.372  45.758 1.00 72.67 ? 155 ARG A NH1    1 
ATOM   2365 N NH2    . ARG C 3 141 ? 8.909   17.949  46.385 1.00 71.64 ? 155 ARG A NH2    1 
ATOM   2366 H H      . ARG C 3 141 ? 6.197   20.434  51.850 1.00 0.00  ? 155 ARG A H      1 
ATOM   2367 H HE     . ARG C 3 141 ? 8.752   19.154  48.503 1.00 0.00  ? 155 ARG A HE     1 
ATOM   2368 H HH11   . ARG C 3 141 ? 6.609   20.134  45.935 1.00 0.00  ? 155 ARG A HH11   1 
ATOM   2369 H HH12   . ARG C 3 141 ? 7.220   18.955  44.837 1.00 0.00  ? 155 ARG A HH12   1 
ATOM   2370 H HH21   . ARG C 3 141 ? 9.614   17.619  47.017 1.00 0.00  ? 155 ARG A HH21   1 
ATOM   2371 H HH22   . ARG C 3 141 ? 8.872   17.561  45.451 1.00 0.00  ? 155 ARG A HH22   1 
ATOM   2372 N N      . GLU C 3 142 ? 4.512   23.403  52.255 1.00 30.97 ? 156 GLU A N      1 
ATOM   2373 C CA     . GLU C 3 142 ? 3.634   24.525  52.591 1.00 31.55 ? 156 GLU A CA     1 
ATOM   2374 C C      . GLU C 3 142 ? 3.839   25.120  53.969 1.00 34.20 ? 156 GLU A C      1 
ATOM   2375 O O      . GLU C 3 142 ? 3.237   26.154  54.301 1.00 36.15 ? 156 GLU A O      1 
ATOM   2376 C CB     . GLU C 3 142 ? 2.164   24.231  52.329 1.00 32.92 ? 156 GLU A CB     1 
ATOM   2377 C CG     . GLU C 3 142 ? 1.698   22.856  52.646 1.00 33.68 ? 156 GLU A CG     1 
ATOM   2378 C CD     . GLU C 3 142 ? 0.587   22.445  51.704 1.00 40.75 ? 156 GLU A CD     1 
ATOM   2379 O OE1    . GLU C 3 142 ? 0.857   22.416  50.485 1.00 46.35 ? 156 GLU A OE1    1 
ATOM   2380 O OE2    . GLU C 3 142 ? -0.561  22.181  52.154 1.00 38.63 ? 156 GLU A OE2    1 
ATOM   2381 H H      . GLU C 3 142 ? 4.124   22.499  52.195 1.00 0.00  ? 156 GLU A H      1 
ATOM   2382 N N      . LYS C 3 143 ? 4.739   24.503  54.742 1.00 33.10 ? 157 LYS A N      1 
ATOM   2383 C CA     . LYS C 3 143 ? 5.085   24.968  56.083 1.00 28.29 ? 157 LYS A CA     1 
ATOM   2384 C C      . LYS C 3 143 ? 6.334   25.867  56.064 1.00 29.87 ? 157 LYS A C      1 
ATOM   2385 O O      . LYS C 3 143 ? 6.882   26.211  57.127 1.00 28.48 ? 157 LYS A O      1 
ATOM   2386 C CB     . LYS C 3 143 ? 5.314   23.780  56.978 1.00 29.15 ? 157 LYS A CB     1 
ATOM   2387 H H      . LYS C 3 143 ? 5.183   23.703  54.382 1.00 0.00  ? 157 LYS A H      1 
ATOM   2388 N N      . ARG C 3 144 ? 6.751   26.275  54.859 1.00 30.25 ? 158 ARG A N      1 
ATOM   2389 C CA     . ARG C 3 144 ? 7.952   27.089  54.651 1.00 28.70 ? 158 ARG A CA     1 
ATOM   2390 C C      . ARG C 3 144 ? 7.763   28.580  54.607 1.00 30.30 ? 158 ARG A C      1 
ATOM   2391 O O      . ARG C 3 144 ? 6.727   29.068  54.147 1.00 32.06 ? 158 ARG A O      1 
ATOM   2392 C CB     . ARG C 3 144 ? 8.633   26.708  53.354 1.00 26.60 ? 158 ARG A CB     1 
ATOM   2393 C CG     . ARG C 3 144 ? 9.337   25.438  53.402 1.00 25.29 ? 158 ARG A CG     1 
ATOM   2394 C CD     . ARG C 3 144 ? 9.847   25.112  52.043 1.00 23.06 ? 158 ARG A CD     1 
ATOM   2395 N NE     . ARG C 3 144 ? 10.326  23.751  52.110 1.00 25.51 ? 158 ARG A NE     1 
ATOM   2396 C CZ     . ARG C 3 144 ? 10.706  23.024  51.076 1.00 31.54 ? 158 ARG A CZ     1 
ATOM   2397 N NH1    . ARG C 3 144 ? 10.648  23.513  49.836 1.00 34.68 ? 158 ARG A NH1    1 
ATOM   2398 N NH2    . ARG C 3 144 ? 11.226  21.823  51.318 1.00 35.89 ? 158 ARG A NH2    1 
ATOM   2399 H H      . ARG C 3 144 ? 6.214   26.042  54.071 1.00 0.00  ? 158 ARG A H      1 
ATOM   2400 H HE     . ARG C 3 144 ? 10.333  23.305  52.988 1.00 0.00  ? 158 ARG A HE     1 
ATOM   2401 H HH11   . ARG C 3 144 ? 10.337  24.429  49.610 1.00 0.00  ? 158 ARG A HH11   1 
ATOM   2402 H HH12   . ARG C 3 144 ? 11.009  22.919  49.112 1.00 0.00  ? 158 ARG A HH12   1 
ATOM   2403 H HH21   . ARG C 3 144 ? 11.312  21.498  52.268 1.00 0.00  ? 158 ARG A HH21   1 
ATOM   2404 H HH22   . ARG C 3 144 ? 11.592  21.240  50.589 1.00 0.00  ? 158 ARG A HH22   1 
ATOM   2405 N N      . VAL C 3 145 ? 8.804   29.297  55.029 1.00 32.22 ? 159 VAL A N      1 
ATOM   2406 C CA     . VAL C 3 145 ? 8.788   30.759  55.026 1.00 36.41 ? 159 VAL A CA     1 
ATOM   2407 C C      . VAL C 3 145 ? 8.751   31.275  53.607 1.00 36.85 ? 159 VAL A C      1 
ATOM   2408 O O      . VAL C 3 145 ? 8.173   32.323  53.340 1.00 38.06 ? 159 VAL A O      1 
ATOM   2409 C CB     . VAL C 3 145 ? 10.025  31.378  55.723 1.00 37.91 ? 159 VAL A CB     1 
ATOM   2410 C CG1    . VAL C 3 145 ? 9.753   31.570  57.183 1.00 42.66 ? 159 VAL A CG1    1 
ATOM   2411 C CG2    . VAL C 3 145 ? 11.228  30.483  55.569 1.00 42.87 ? 159 VAL A CG2    1 
ATOM   2412 H H      . VAL C 3 145 ? 9.584   28.755  55.341 1.00 0.00  ? 159 VAL A H      1 
ATOM   2413 N N      . LYS C 3 146 ? 9.449   30.581  52.718 1.00 36.48 ? 160 LYS A N      1 
ATOM   2414 C CA     . LYS C 3 146 ? 9.475   30.964  51.323 1.00 36.73 ? 160 LYS A CA     1 
ATOM   2415 C C      . LYS C 3 146 ? 9.364   29.725  50.472 1.00 38.49 ? 160 LYS A C      1 
ATOM   2416 O O      . LYS C 3 146 ? 8.781   28.752  50.995 1.00 37.89 ? 160 LYS A O      1 
ATOM   2417 C CB     . LYS C 3 146 ? 10.760  31.707  51.010 1.00 41.03 ? 160 LYS A CB     1 
ATOM   2418 C CG     . LYS C 3 146 ? 10.613  33.203  50.986 1.00 45.92 ? 160 LYS A CG     1 
ATOM   2419 C CD     . LYS C 3 146 ? 11.569  33.777  49.958 1.00 58.74 ? 160 LYS A CD     1 
ATOM   2420 C CE     . LYS C 3 146 ? 11.083  35.118  49.404 1.00 64.81 ? 160 LYS A CE     1 
ATOM   2421 N NZ     . LYS C 3 146 ? 11.392  36.233  50.345 1.00 69.71 ? 160 LYS A NZ     1 
ATOM   2422 H H      . LYS C 3 146 ? 10.038  29.835  52.965 1.00 0.00  ? 160 LYS A H      1 
ATOM   2423 H HZ1    . LYS C 3 146 ? 11.091  36.017  51.311 1.00 0.00  ? 160 LYS A HZ1    1 
ATOM   2424 H HZ2    . LYS C 3 146 ? 12.435  36.237  50.300 1.00 0.00  ? 160 LYS A HZ2    1 
ATOM   2425 H HZ3    . LYS C 3 146 ? 11.043  37.148  49.994 1.00 0.00  ? 160 LYS A HZ3    1 
ATOM   2426 N N      . GLY D 3 1   ? 12.031  36.535  64.382 1.00 48.40 ? 5   GLY B N      1 
ATOM   2427 C CA     . GLY D 3 1   ? 11.199  37.373  63.461 1.00 51.52 ? 5   GLY B CA     1 
ATOM   2428 C C      . GLY D 3 1   ? 11.622  37.310  61.996 1.00 52.68 ? 5   GLY B C      1 
ATOM   2429 O O      . GLY D 3 1   ? 12.821  37.350  61.699 1.00 53.20 ? 5   GLY B O      1 
ATOM   2430 H H1     . GLY D 3 1   ? 11.995  35.550  64.078 1.00 0.00  ? 5   GLY B H1     1 
ATOM   2431 H H2     . GLY D 3 1   ? 13.018  36.866  64.354 1.00 0.00  ? 5   GLY B H2     1 
ATOM   2432 H H3     . GLY D 3 1   ? 11.685  36.617  65.358 1.00 0.00  ? 5   GLY B H3     1 
ATOM   2433 N N      . MET D 3 2   ? 10.636  37.303  61.091 1.00 51.83 ? 6   MET B N      1 
ATOM   2434 C CA     . MET D 3 2   ? 10.837  37.206  59.625 1.00 50.35 ? 6   MET B CA     1 
ATOM   2435 C C      . MET D 3 2   ? 11.730  38.229  58.974 1.00 45.60 ? 6   MET B C      1 
ATOM   2436 O O      . MET D 3 2   ? 12.560  37.904  58.144 1.00 42.79 ? 6   MET B O      1 
ATOM   2437 C CB     . MET D 3 2   ? 9.498   37.251  58.902 1.00 54.61 ? 6   MET B CB     1 
ATOM   2438 C CG     . MET D 3 2   ? 8.678   36.021  59.130 1.00 63.68 ? 6   MET B CG     1 
ATOM   2439 S SD     . MET D 3 2   ? 8.784   34.956  57.702 1.00 72.01 ? 6   MET B SD     1 
ATOM   2440 C CE     . MET D 3 2   ? 7.211   33.975  57.882 1.00 71.70 ? 6   MET B CE     1 
ATOM   2441 H H      . MET D 3 2   ? 9.736   37.396  61.485 1.00 0.00  ? 6   MET B H      1 
ATOM   2442 N N      . ARG D 3 3   ? 11.555  39.478  59.356 1.00 42.05 ? 7   ARG B N      1 
ATOM   2443 C CA     . ARG D 3 3   ? 12.343  40.559  58.789 1.00 39.64 ? 7   ARG B CA     1 
ATOM   2444 C C      . ARG D 3 3   ? 13.844  40.458  59.041 1.00 38.81 ? 7   ARG B C      1 
ATOM   2445 O O      . ARG D 3 3   ? 14.625  40.765  58.163 1.00 42.96 ? 7   ARG B O      1 
ATOM   2446 C CB     . ARG D 3 3   ? 11.809  41.876  59.284 1.00 36.39 ? 7   ARG B CB     1 
ATOM   2447 C CG     . ARG D 3 3   ? 12.615  43.040  58.933 1.00 36.61 ? 7   ARG B CG     1 
ATOM   2448 C CD     . ARG D 3 3   ? 11.949  44.180  59.556 1.00 36.84 ? 7   ARG B CD     1 
ATOM   2449 N NE     . ARG D 3 3   ? 12.935  45.126  60.032 1.00 46.57 ? 7   ARG B NE     1 
ATOM   2450 C CZ     . ARG D 3 3   ? 12.648  46.167  60.796 1.00 48.97 ? 7   ARG B CZ     1 
ATOM   2451 N NH1    . ARG D 3 3   ? 11.390  46.387  61.184 1.00 48.09 ? 7   ARG B NH1    1 
ATOM   2452 N NH2    . ARG D 3 3   ? 13.617  47.023  61.107 1.00 50.18 ? 7   ARG B NH2    1 
ATOM   2453 H H      . ARG D 3 3   ? 10.958  39.656  60.112 1.00 0.00  ? 7   ARG B H      1 
ATOM   2454 H HE     . ARG D 3 3   ? 13.858  44.965  59.776 1.00 0.00  ? 7   ARG B HE     1 
ATOM   2455 H HH11   . ARG D 3 3   ? 10.612  45.824  60.918 1.00 0.00  ? 7   ARG B HH11   1 
ATOM   2456 H HH12   . ARG D 3 3   ? 11.227  47.175  61.784 1.00 0.00  ? 7   ARG B HH12   1 
ATOM   2457 H HH21   . ARG D 3 3   ? 14.551  46.862  60.775 1.00 0.00  ? 7   ARG B HH21   1 
ATOM   2458 H HH22   . ARG D 3 3   ? 13.435  47.787  61.723 1.00 0.00  ? 7   ARG B HH22   1 
ATOM   2459 N N      . ALA D 3 4   ? 14.245  40.003  60.216 1.00 37.49 ? 8   ALA B N      1 
ATOM   2460 C CA     . ALA D 3 4   ? 15.659  39.854  60.535 1.00 36.42 ? 8   ALA B CA     1 
ATOM   2461 C C      . ALA D 3 4   ? 16.176  38.569  59.919 1.00 34.34 ? 8   ALA B C      1 
ATOM   2462 O O      . ALA D 3 4   ? 17.378  38.383  59.778 1.00 37.48 ? 8   ALA B O      1 
ATOM   2463 C CB     . ALA D 3 4   ? 15.868  39.835  62.047 1.00 39.59 ? 8   ALA B CB     1 
ATOM   2464 H H      . ALA D 3 4   ? 13.563  39.839  60.898 1.00 0.00  ? 8   ALA B H      1 
ATOM   2465 N N      . LEU D 3 5   ? 15.276  37.644  59.635 1.00 31.83 ? 9   LEU B N      1 
ATOM   2466 C CA     . LEU D 3 5   ? 15.660  36.382  59.014 1.00 34.94 ? 9   LEU B CA     1 
ATOM   2467 C C      . LEU D 3 5   ? 15.919  36.671  57.511 1.00 36.66 ? 9   LEU B C      1 
ATOM   2468 O O      . LEU D 3 5   ? 17.005  36.408  56.975 1.00 36.87 ? 9   LEU B O      1 
ATOM   2469 C CB     . LEU D 3 5   ? 14.538  35.364  59.224 1.00 32.46 ? 9   LEU B CB     1 
ATOM   2470 C CG     . LEU D 3 5   ? 14.682  33.876  58.903 1.00 30.96 ? 9   LEU B CG     1 
ATOM   2471 C CD1    . LEU D 3 5   ? 15.897  33.274  59.655 1.00 30.01 ? 9   LEU B CD1    1 
ATOM   2472 C CD2    . LEU D 3 5   ? 13.363  33.181  59.312 1.00 19.72 ? 9   LEU B CD2    1 
ATOM   2473 H H      . LEU D 3 5   ? 14.362  37.738  59.961 1.00 0.00  ? 9   LEU B H      1 
ATOM   2474 N N      . GLU D 3 6   ? 14.952  37.312  56.867 1.00 36.11 ? 10  GLU B N      1 
ATOM   2475 C CA     . GLU D 3 6   ? 15.084  37.689  55.473 1.00 36.37 ? 10  GLU B CA     1 
ATOM   2476 C C      . GLU D 3 6   ? 16.327  38.536  55.271 1.00 35.34 ? 10  GLU B C      1 
ATOM   2477 O O      . GLU D 3 6   ? 17.163  38.182  54.459 1.00 37.75 ? 10  GLU B O      1 
ATOM   2478 C CB     . GLU D 3 6   ? 13.837  38.441  54.997 1.00 38.72 ? 10  GLU B CB     1 
ATOM   2479 C CG     . GLU D 3 6   ? 12.733  37.513  54.547 1.00 42.14 ? 10  GLU B CG     1 
ATOM   2480 C CD     . GLU D 3 6   ? 11.355  38.000  54.878 1.00 44.57 ? 10  GLU B CD     1 
ATOM   2481 O OE1    . GLU D 3 6   ? 11.179  39.220  55.130 1.00 45.10 ? 10  GLU B OE1    1 
ATOM   2482 O OE2    . GLU D 3 6   ? 10.452  37.131  54.887 1.00 42.81 ? 10  GLU B OE2    1 
ATOM   2483 H H      . GLU D 3 6   ? 14.125  37.547  57.339 1.00 0.00  ? 10  GLU B H      1 
ATOM   2484 N N      . GLN D 3 7   ? 16.468  39.623  56.034 1.00 35.57 ? 11  GLN B N      1 
ATOM   2485 C CA     . GLN D 3 7   ? 17.631  40.526  55.950 1.00 35.99 ? 11  GLN B CA     1 
ATOM   2486 C C      . GLN D 3 7   ? 18.960  39.738  56.097 1.00 37.37 ? 11  GLN B C      1 
ATOM   2487 O O      . GLN D 3 7   ? 19.905  39.919  55.293 1.00 34.28 ? 11  GLN B O      1 
ATOM   2488 C CB     . GLN D 3 7   ? 17.551  41.660  57.020 1.00 34.14 ? 11  GLN B CB     1 
ATOM   2489 C CG     . GLN D 3 7   ? 16.376  42.679  56.870 1.00 33.45 ? 11  GLN B CG     1 
ATOM   2490 C CD     . GLN D 3 7   ? 16.261  43.704  58.026 1.00 32.38 ? 11  GLN B CD     1 
ATOM   2491 O OE1    . GLN D 3 7   ? 16.775  43.475  59.109 1.00 37.25 ? 11  GLN B OE1    1 
ATOM   2492 N NE2    . GLN D 3 7   ? 15.602  44.836  57.779 1.00 23.01 ? 11  GLN B NE2    1 
ATOM   2493 H H      . GLN D 3 7   ? 15.801  39.930  56.705 1.00 0.00  ? 11  GLN B H      1 
ATOM   2494 H HE21   . GLN D 3 7   ? 15.473  45.441  58.544 1.00 0.00  ? 11  GLN B HE21   1 
ATOM   2495 H HE22   . GLN D 3 7   ? 15.261  45.015  56.880 1.00 0.00  ? 11  GLN B HE22   1 
ATOM   2496 N N      . PHE D 3 8   ? 19.011  38.817  57.064 1.00 34.79 ? 12  PHE B N      1 
ATOM   2497 C CA     . PHE D 3 8   ? 20.203  38.014  57.295 1.00 35.36 ? 12  PHE B CA     1 
ATOM   2498 C C      . PHE D 3 8   ? 20.532  37.073  56.151 1.00 36.39 ? 12  PHE B C      1 
ATOM   2499 O O      . PHE D 3 8   ? 21.656  37.071  55.667 1.00 37.86 ? 12  PHE B O      1 
ATOM   2500 C CB     . PHE D 3 8   ? 20.090  37.217  58.571 1.00 33.99 ? 12  PHE B CB     1 
ATOM   2501 C CG     . PHE D 3 8   ? 21.341  36.473  58.923 1.00 29.75 ? 12  PHE B CG     1 
ATOM   2502 C CD1    . PHE D 3 8   ? 22.378  37.110  59.560 1.00 31.76 ? 12  PHE B CD1    1 
ATOM   2503 C CD2    . PHE D 3 8   ? 21.454  35.123  58.678 1.00 31.82 ? 12  PHE B CD2    1 
ATOM   2504 C CE1    . PHE D 3 8   ? 23.505  36.407  59.953 1.00 29.16 ? 12  PHE B CE1    1 
ATOM   2505 C CE2    . PHE D 3 8   ? 22.580  34.422  59.073 1.00 29.95 ? 12  PHE B CE2    1 
ATOM   2506 C CZ     . PHE D 3 8   ? 23.595  35.062  59.708 1.00 29.14 ? 12  PHE B CZ     1 
ATOM   2507 H H      . PHE D 3 8   ? 18.244  38.681  57.658 1.00 0.00  ? 12  PHE B H      1 
ATOM   2508 N N      . ALA D 3 9   ? 19.566  36.262  55.728 1.00 39.76 ? 13  ALA B N      1 
ATOM   2509 C CA     . ALA D 3 9   ? 19.774  35.333  54.619 1.00 37.85 ? 13  ALA B CA     1 
ATOM   2510 C C      . ALA D 3 9   ? 20.298  36.108  53.412 1.00 37.45 ? 13  ALA B C      1 
ATOM   2511 O O      . ALA D 3 9   ? 21.119  35.594  52.647 1.00 41.55 ? 13  ALA B O      1 
ATOM   2512 C CB     . ALA D 3 9   ? 18.490  34.608  54.299 1.00 37.65 ? 13  ALA B CB     1 
ATOM   2513 H H      . ALA D 3 9   ? 18.690  36.292  56.163 1.00 0.00  ? 13  ALA B H      1 
ATOM   2514 N N      . ASN D 3 10  ? 19.839  37.343  53.236 1.00 36.43 ? 14  ASN B N      1 
ATOM   2515 C CA     . ASN D 3 10  ? 20.340  38.165  52.148 1.00 41.48 ? 14  ASN B CA     1 
ATOM   2516 C C      . ASN D 3 10  ? 21.835  38.458  52.312 1.00 44.30 ? 14  ASN B C      1 
ATOM   2517 O O      . ASN D 3 10  ? 22.658  38.113  51.451 1.00 44.49 ? 14  ASN B O      1 
ATOM   2518 C CB     . ASN D 3 10  ? 19.584  39.480  52.056 1.00 44.63 ? 14  ASN B CB     1 
ATOM   2519 C CG     . ASN D 3 10  ? 18.359  39.373  51.191 1.00 52.10 ? 14  ASN B CG     1 
ATOM   2520 O OD1    . ASN D 3 10  ? 18.451  39.289  49.960 1.00 56.59 ? 14  ASN B OD1    1 
ATOM   2521 N ND2    . ASN D 3 10  ? 17.195  39.342  51.828 1.00 53.96 ? 14  ASN B ND2    1 
ATOM   2522 H H      . ASN D 3 10  ? 19.059  37.672  53.761 1.00 0.00  ? 14  ASN B H      1 
ATOM   2523 H HD21   . ASN D 3 10  ? 16.416  39.262  51.249 1.00 0.00  ? 14  ASN B HD21   1 
ATOM   2524 H HD22   . ASN D 3 10  ? 17.155  39.380  52.803 1.00 0.00  ? 14  ASN B HD22   1 
ATOM   2525 N N      . GLU D 3 11  ? 22.193  39.060  53.440 1.00 44.77 ? 15  GLU B N      1 
ATOM   2526 C CA     . GLU D 3 11  ? 23.576  39.408  53.712 1.00 44.61 ? 15  GLU B CA     1 
ATOM   2527 C C      . GLU D 3 11  ? 24.534  38.245  53.901 1.00 41.90 ? 15  GLU B C      1 
ATOM   2528 O O      . GLU D 3 11  ? 25.707  38.355  53.551 1.00 45.61 ? 15  GLU B O      1 
ATOM   2529 C CB     . GLU D 3 11  ? 23.627  40.371  54.869 1.00 49.30 ? 15  GLU B CB     1 
ATOM   2530 C CG     . GLU D 3 11  ? 22.708  41.553  54.625 1.00 59.55 ? 15  GLU B CG     1 
ATOM   2531 C CD     . GLU D 3 11  ? 23.227  42.546  53.583 1.00 62.14 ? 15  GLU B CD     1 
ATOM   2532 O OE1    . GLU D 3 11  ? 24.464  42.705  53.476 1.00 62.04 ? 15  GLU B OE1    1 
ATOM   2533 O OE2    . GLU D 3 11  ? 22.392  43.203  52.907 1.00 65.66 ? 15  GLU B OE2    1 
ATOM   2534 H H      . GLU D 3 11  ? 21.470  39.342  54.051 1.00 0.00  ? 15  GLU B H      1 
ATOM   2535 N N      . PHE D 3 12  ? 24.055  37.119  54.397 1.00 36.98 ? 16  PHE B N      1 
ATOM   2536 C CA     . PHE D 3 12  ? 24.902  35.955  54.561 1.00 35.43 ? 16  PHE B CA     1 
ATOM   2537 C C      . PHE D 3 12  ? 25.415  35.555  53.186 1.00 37.03 ? 16  PHE B C      1 
ATOM   2538 O O      . PHE D 3 12  ? 26.609  35.294  53.019 1.00 36.81 ? 16  PHE B O      1 
ATOM   2539 C CB     . PHE D 3 12  ? 24.130  34.796  55.193 1.00 35.52 ? 16  PHE B CB     1 
ATOM   2540 C CG     . PHE D 3 12  ? 24.883  33.466  55.206 1.00 33.27 ? 16  PHE B CG     1 
ATOM   2541 C CD1    . PHE D 3 12  ? 25.861  33.209  56.163 1.00 29.54 ? 16  PHE B CD1    1 
ATOM   2542 C CD2    . PHE D 3 12  ? 24.574  32.458  54.295 1.00 30.90 ? 16  PHE B CD2    1 
ATOM   2543 C CE1    . PHE D 3 12  ? 26.498  31.976  56.212 1.00 28.42 ? 16  PHE B CE1    1 
ATOM   2544 C CE2    . PHE D 3 12  ? 25.209  31.227  54.347 1.00 28.32 ? 16  PHE B CE2    1 
ATOM   2545 C CZ     . PHE D 3 12  ? 26.175  30.987  55.301 1.00 30.03 ? 16  PHE B CZ     1 
ATOM   2546 H H      . PHE D 3 12  ? 23.134  37.087  54.724 1.00 0.00  ? 16  PHE B H      1 
ATOM   2547 N N      . LYS D 3 13  ? 24.523  35.527  52.192 1.00 39.55 ? 17  LYS B N      1 
ATOM   2548 C CA     . LYS D 3 13  ? 24.930  35.173  50.828 1.00 37.28 ? 17  LYS B CA     1 
ATOM   2549 C C      . LYS D 3 13  ? 25.954  36.163  50.279 1.00 33.21 ? 17  LYS B C      1 
ATOM   2550 O O      . LYS D 3 13  ? 26.951  35.749  49.682 1.00 29.95 ? 17  LYS B O      1 
ATOM   2551 C CB     . LYS D 3 13  ? 23.727  35.049  49.887 1.00 39.76 ? 17  LYS B CB     1 
ATOM   2552 C CG     . LYS D 3 13  ? 24.145  34.520  48.505 1.00 45.05 ? 17  LYS B CG     1 
ATOM   2553 C CD     . LYS D 3 13  ? 22.960  34.135  47.682 1.00 48.08 ? 17  LYS B CD     1 
ATOM   2554 C CE     . LYS D 3 13  ? 23.338  33.428  46.382 1.00 46.78 ? 17  LYS B CE     1 
ATOM   2555 N NZ     . LYS D 3 13  ? 22.223  32.486  45.973 1.00 48.36 ? 17  LYS B NZ     1 
ATOM   2556 H H      . LYS D 3 13  ? 23.567  35.728  52.370 1.00 0.00  ? 17  LYS B H      1 
ATOM   2557 H HZ1    . LYS D 3 13  ? 21.286  32.954  45.892 1.00 0.00  ? 17  LYS B HZ1    1 
ATOM   2558 H HZ2    . LYS D 3 13  ? 22.416  31.965  45.087 1.00 0.00  ? 17  LYS B HZ2    1 
ATOM   2559 H HZ3    . LYS D 3 13  ? 22.228  31.828  46.783 1.00 0.00  ? 17  LYS B HZ3    1 
ATOM   2560 N N      . VAL D 3 14  ? 25.701  37.460  50.498 1.00 32.75 ? 18  VAL B N      1 
ATOM   2561 C CA     . VAL D 3 14  ? 26.583  38.541  50.068 1.00 35.38 ? 18  VAL B CA     1 
ATOM   2562 C C      . VAL D 3 14  ? 27.990  38.317  50.593 1.00 40.56 ? 18  VAL B C      1 
ATOM   2563 O O      . VAL D 3 14  ? 28.974  38.336  49.823 1.00 41.59 ? 18  VAL B O      1 
ATOM   2564 C CB     . VAL D 3 14  ? 26.115  39.897  50.597 1.00 35.05 ? 18  VAL B CB     1 
ATOM   2565 C CG1    . VAL D 3 14  ? 27.103  41.003  50.196 1.00 31.34 ? 18  VAL B CG1    1 
ATOM   2566 C CG2    . VAL D 3 14  ? 24.733  40.208  50.078 1.00 34.38 ? 18  VAL B CG2    1 
ATOM   2567 H H      . VAL D 3 14  ? 24.818  37.718  50.890 1.00 0.00  ? 18  VAL B H      1 
ATOM   2568 N N      . ARG D 3 15  ? 28.081  38.099  51.907 1.00 41.42 ? 19  ARG B N      1 
ATOM   2569 C CA     . ARG D 3 15  ? 29.346  37.851  52.581 1.00 41.81 ? 19  ARG B CA     1 
ATOM   2570 C C      . ARG D 3 15  ? 30.023  36.567  52.135 1.00 39.79 ? 19  ARG B C      1 
ATOM   2571 O O      . ARG D 3 15  ? 31.212  36.566  51.796 1.00 40.45 ? 19  ARG B O      1 
ATOM   2572 C CB     . ARG D 3 15  ? 29.155  37.832  54.096 1.00 46.08 ? 19  ARG B CB     1 
ATOM   2573 C CG     . ARG D 3 15  ? 29.021  39.229  54.686 1.00 53.43 ? 19  ARG B CG     1 
ATOM   2574 C CD     . ARG D 3 15  ? 29.241  39.216  56.194 1.00 62.38 ? 19  ARG B CD     1 
ATOM   2575 N NE     . ARG D 3 15  ? 29.904  40.428  56.663 1.00 68.31 ? 19  ARG B NE     1 
ATOM   2576 C CZ     . ARG D 3 15  ? 31.219  40.535  56.837 1.00 73.42 ? 19  ARG B CZ     1 
ATOM   2577 N NH1    . ARG D 3 15  ? 32.010  39.497  56.585 1.00 71.89 ? 19  ARG B NH1    1 
ATOM   2578 N NH2    . ARG D 3 15  ? 31.751  41.707  57.211 1.00 77.78 ? 19  ARG B NH2    1 
ATOM   2579 H H      . ARG D 3 15  ? 27.271  38.147  52.466 1.00 0.00  ? 19  ARG B H      1 
ATOM   2580 H HE     . ARG D 3 15  ? 29.379  41.225  56.868 1.00 0.00  ? 19  ARG B HE     1 
ATOM   2581 H HH11   . ARG D 3 15  ? 31.626  38.645  56.239 1.00 0.00  ? 19  ARG B HH11   1 
ATOM   2582 H HH12   . ARG D 3 15  ? 32.996  39.601  56.696 1.00 0.00  ? 19  ARG B HH12   1 
ATOM   2583 H HH21   . ARG D 3 15  ? 31.171  42.520  57.341 1.00 0.00  ? 19  ARG B HH21   1 
ATOM   2584 H HH22   . ARG D 3 15  ? 32.743  41.811  57.323 1.00 0.00  ? 19  ARG B HH22   1 
ATOM   2585 N N      . ARG D 3 16  ? 29.258  35.482  52.105 1.00 38.99 ? 20  ARG B N      1 
ATOM   2586 C CA     . ARG D 3 16  ? 29.738  34.155  51.720 1.00 38.41 ? 20  ARG B CA     1 
ATOM   2587 C C      . ARG D 3 16  ? 30.492  34.139  50.389 1.00 37.42 ? 20  ARG B C      1 
ATOM   2588 O O      . ARG D 3 16  ? 31.548  33.498  50.264 1.00 32.40 ? 20  ARG B O      1 
ATOM   2589 C CB     . ARG D 3 16  ? 28.552  33.193  51.659 1.00 39.87 ? 20  ARG B CB     1 
ATOM   2590 C CG     . ARG D 3 16  ? 28.945  31.759  51.475 1.00 40.13 ? 20  ARG B CG     1 
ATOM   2591 C CD     . ARG D 3 16  ? 27.741  30.962  51.109 1.00 41.99 ? 20  ARG B CD     1 
ATOM   2592 N NE     . ARG D 3 16  ? 27.889  30.270  49.823 1.00 44.08 ? 20  ARG B NE     1 
ATOM   2593 C CZ     . ARG D 3 16  ? 27.461  30.733  48.650 1.00 37.50 ? 20  ARG B CZ     1 
ATOM   2594 N NH1    . ARG D 3 16  ? 26.845  31.903  48.549 1.00 40.31 ? 20  ARG B NH1    1 
ATOM   2595 N NH2    . ARG D 3 16  ? 27.607  29.982  47.584 1.00 38.49 ? 20  ARG B NH2    1 
ATOM   2596 H H      . ARG D 3 16  ? 28.309  35.508  52.361 1.00 0.00  ? 20  ARG B H      1 
ATOM   2597 H HE     . ARG D 3 16  ? 28.280  29.377  49.830 1.00 0.00  ? 20  ARG B HE     1 
ATOM   2598 H HH11   . ARG D 3 16  ? 26.696  32.459  49.370 1.00 0.00  ? 20  ARG B HH11   1 
ATOM   2599 H HH12   . ARG D 3 16  ? 26.511  32.266  47.683 1.00 0.00  ? 20  ARG B HH12   1 
ATOM   2600 H HH21   . ARG D 3 16  ? 27.989  29.060  47.634 1.00 0.00  ? 20  ARG B HH21   1 
ATOM   2601 H HH22   . ARG D 3 16  ? 27.247  30.354  46.724 1.00 0.00  ? 20  ARG B HH22   1 
ATOM   2602 N N      . ILE D 3 17  ? 29.891  34.777  49.384 1.00 38.79 ? 21  ILE B N      1 
ATOM   2603 C CA     . ILE D 3 17  ? 30.453  34.899  48.050 1.00 40.53 ? 21  ILE B CA     1 
ATOM   2604 C C      . ILE D 3 17  ? 31.702  35.801  48.051 1.00 43.78 ? 21  ILE B C      1 
ATOM   2605 O O      . ILE D 3 17  ? 32.777  35.350  47.652 1.00 43.92 ? 21  ILE B O      1 
ATOM   2606 C CB     . ILE D 3 17  ? 29.386  35.404  47.078 1.00 38.59 ? 21  ILE B CB     1 
ATOM   2607 C CG1    . ILE D 3 17  ? 28.391  34.277  46.796 1.00 34.31 ? 21  ILE B CG1    1 
ATOM   2608 C CG2    . ILE D 3 17  ? 30.033  35.990  45.819 1.00 38.22 ? 21  ILE B CG2    1 
ATOM   2609 C CD1    . ILE D 3 17  ? 27.097  34.758  46.278 1.00 33.24 ? 21  ILE B CD1    1 
ATOM   2610 H H      . ILE D 3 17  ? 28.985  35.172  49.459 1.00 0.00  ? 21  ILE B H      1 
ATOM   2611 N N      . LYS D 3 18  ? 31.587  37.044  48.526 1.00 43.33 ? 22  LYS B N      1 
ATOM   2612 C CA     . LYS D 3 18  ? 32.744  37.925  48.583 1.00 43.69 ? 22  LYS B CA     1 
ATOM   2613 C C      . LYS D 3 18  ? 33.945  37.212  49.233 1.00 44.37 ? 22  LYS B C      1 
ATOM   2614 O O      . LYS D 3 18  ? 35.082  37.412  48.825 1.00 45.23 ? 22  LYS B O      1 
ATOM   2615 C CB     . LYS D 3 18  ? 32.421  39.212  49.348 1.00 44.11 ? 22  LYS B CB     1 
ATOM   2616 C CG     . LYS D 3 18  ? 31.449  40.163  48.657 1.00 45.38 ? 22  LYS B CG     1 
ATOM   2617 C CD     . LYS D 3 18  ? 31.528  41.558  49.325 1.00 47.52 ? 22  LYS B CD     1 
ATOM   2618 C CE     . LYS D 3 18  ? 30.667  42.628  48.644 1.00 45.68 ? 22  LYS B CE     1 
ATOM   2619 N NZ     . LYS D 3 18  ? 30.670  43.956  49.331 1.00 43.66 ? 22  LYS B NZ     1 
ATOM   2620 H H      . LYS D 3 18  ? 30.741  37.410  48.892 1.00 0.00  ? 22  LYS B H      1 
ATOM   2621 H HZ1    . LYS D 3 18  ? 30.319  43.917  50.308 1.00 0.00  ? 22  LYS B HZ1    1 
ATOM   2622 H HZ2    . LYS D 3 18  ? 31.615  44.386  49.333 1.00 0.00  ? 22  LYS B HZ2    1 
ATOM   2623 H HZ3    . LYS D 3 18  ? 30.029  44.596  48.810 1.00 0.00  ? 22  LYS B HZ3    1 
ATOM   2624 N N      . LEU D 3 19  ? 33.687  36.384  50.245 1.00 45.76 ? 23  LEU B N      1 
ATOM   2625 C CA     . LEU D 3 19  ? 34.726  35.632  50.959 1.00 45.14 ? 23  LEU B CA     1 
ATOM   2626 C C      . LEU D 3 19  ? 35.268  34.368  50.283 1.00 43.72 ? 23  LEU B C      1 
ATOM   2627 O O      . LEU D 3 19  ? 36.017  33.612  50.904 1.00 43.83 ? 23  LEU B O      1 
ATOM   2628 C CB     . LEU D 3 19  ? 34.224  35.254  52.360 1.00 48.72 ? 23  LEU B CB     1 
ATOM   2629 C CG     . LEU D 3 19  ? 34.844  35.771  53.674 1.00 50.82 ? 23  LEU B CG     1 
ATOM   2630 C CD1    . LEU D 3 19  ? 34.926  37.316  53.701 1.00 49.71 ? 23  LEU B CD1    1 
ATOM   2631 C CD2    . LEU D 3 19  ? 33.985  35.231  54.844 1.00 46.57 ? 23  LEU B CD2    1 
ATOM   2632 H H      . LEU D 3 19  ? 32.790  36.312  50.668 1.00 0.00  ? 23  LEU B H      1 
ATOM   2633 N N      . GLY D 3 20  ? 34.867  34.101  49.040 1.00 45.40 ? 24  GLY B N      1 
ATOM   2634 C CA     . GLY D 3 20  ? 35.361  32.919  48.325 1.00 43.77 ? 24  GLY B CA     1 
ATOM   2635 C C      . GLY D 3 20  ? 34.751  31.555  48.626 1.00 41.48 ? 24  GLY B C      1 
ATOM   2636 O O      . GLY D 3 20  ? 35.241  30.515  48.140 1.00 40.29 ? 24  GLY B O      1 
ATOM   2637 H H      . GLY D 3 20  ? 34.226  34.657  48.554 1.00 0.00  ? 24  GLY B H      1 
ATOM   2638 N N      . TYR D 3 21  ? 33.635  31.541  49.344 1.00 38.21 ? 25  TYR B N      1 
ATOM   2639 C CA     . TYR D 3 21  ? 33.038  30.272  49.721 1.00 35.08 ? 25  TYR B CA     1 
ATOM   2640 C C      . TYR D 3 21  ? 31.914  29.723  48.847 1.00 32.91 ? 25  TYR B C      1 
ATOM   2641 O O      . TYR D 3 21  ? 31.066  30.455  48.341 1.00 28.97 ? 25  TYR B O      1 
ATOM   2642 C CB     . TYR D 3 21  ? 32.587  30.323  51.174 1.00 38.36 ? 25  TYR B CB     1 
ATOM   2643 C CG     . TYR D 3 21  ? 33.721  30.247  52.170 1.00 36.58 ? 25  TYR B CG     1 
ATOM   2644 C CD1    . TYR D 3 21  ? 34.352  31.396  52.632 1.00 35.27 ? 25  TYR B CD1    1 
ATOM   2645 C CD2    . TYR D 3 21  ? 34.121  29.021  52.699 1.00 32.57 ? 25  TYR B CD2    1 
ATOM   2646 C CE1    . TYR D 3 21  ? 35.343  31.326  53.618 1.00 42.63 ? 25  TYR B CE1    1 
ATOM   2647 C CE2    . TYR D 3 21  ? 35.089  28.936  53.676 1.00 36.79 ? 25  TYR B CE2    1 
ATOM   2648 C CZ     . TYR D 3 21  ? 35.705  30.081  54.136 1.00 43.96 ? 25  TYR B CZ     1 
ATOM   2649 O OH     . TYR D 3 21  ? 36.646  29.960  55.143 1.00 51.36 ? 25  TYR B OH     1 
ATOM   2650 H H      . TYR D 3 21  ? 33.142  32.350  49.613 1.00 0.00  ? 25  TYR B H      1 
ATOM   2651 H HH     . TYR D 3 21  ? 36.956  30.830  55.437 1.00 0.00  ? 25  TYR B HH     1 
ATOM   2652 N N      . THR D 3 22  ? 31.931  28.402  48.706 1.00 31.38 ? 26  THR B N      1 
ATOM   2653 C CA     . THR D 3 22  ? 30.968  27.639  47.927 1.00 33.08 ? 26  THR B CA     1 
ATOM   2654 C C      . THR D 3 22  ? 29.979  27.057  48.936 1.00 32.77 ? 26  THR B C      1 
ATOM   2655 O O      . THR D 3 22  ? 30.415  26.638  49.998 1.00 31.70 ? 26  THR B O      1 
ATOM   2656 C CB     . THR D 3 22  ? 31.696  26.447  47.219 1.00 34.93 ? 26  THR B CB     1 
ATOM   2657 O OG1    . THR D 3 22  ? 32.537  26.933  46.165 1.00 39.85 ? 26  THR B OG1    1 
ATOM   2658 C CG2    . THR D 3 22  ? 30.732  25.443  46.676 1.00 33.34 ? 26  THR B CG2    1 
ATOM   2659 H H      . THR D 3 22  ? 32.704  27.934  49.093 1.00 0.00  ? 26  THR B H      1 
ATOM   2660 H HG1    . THR D 3 22  ? 32.133  27.431  45.429 1.00 0.00  ? 26  THR B HG1    1 
ATOM   2661 N N      . GLN D 3 23  ? 28.707  26.877  48.556 1.00 30.60 ? 27  GLN B N      1 
ATOM   2662 C CA     . GLN D 3 23  ? 27.705  26.326  49.485 1.00 27.18 ? 27  GLN B CA     1 
ATOM   2663 C C      . GLN D 3 23  ? 28.228  25.046  50.102 1.00 25.70 ? 27  GLN B C      1 
ATOM   2664 O O      . GLN D 3 23  ? 28.004  24.757  51.280 1.00 23.20 ? 27  GLN B O      1 
ATOM   2665 C CB     . GLN D 3 23  ? 26.341  26.069  48.802 1.00 24.64 ? 27  GLN B CB     1 
ATOM   2666 C CG     . GLN D 3 23  ? 25.613  27.338  48.325 1.00 20.03 ? 27  GLN B CG     1 
ATOM   2667 C CD     . GLN D 3 23  ? 24.336  27.031  47.553 1.00 18.75 ? 27  GLN B CD     1 
ATOM   2668 O OE1    . GLN D 3 23  ? 24.096  25.888  47.136 1.00 13.03 ? 27  GLN B OE1    1 
ATOM   2669 N NE2    . GLN D 3 23  ? 23.504  28.047  47.381 1.00 10.83 ? 27  GLN B NE2    1 
ATOM   2670 H H      . GLN D 3 23  ? 28.450  26.996  47.598 1.00 0.00  ? 27  GLN B H      1 
ATOM   2671 H HE21   . GLN D 3 23  ? 22.670  27.995  46.887 1.00 0.00  ? 27  GLN B HE21   1 
ATOM   2672 H HE22   . GLN D 3 23  ? 23.780  28.899  47.773 1.00 0.00  ? 27  GLN B HE22   1 
ATOM   2673 N N      . THR D 3 24  ? 29.032  24.328  49.339 1.00 26.24 ? 28  THR B N      1 
ATOM   2674 C CA     . THR D 3 24  ? 29.579  23.083  49.860 1.00 29.02 ? 28  THR B CA     1 
ATOM   2675 C C      . THR D 3 24  ? 30.703  23.336  50.863 1.00 28.89 ? 28  THR B C      1 
ATOM   2676 O O      . THR D 3 24  ? 30.753  22.710  51.908 1.00 30.01 ? 28  THR B O      1 
ATOM   2677 C CB     . THR D 3 24  ? 30.067  22.164  48.734 1.00 27.87 ? 28  THR B CB     1 
ATOM   2678 O OG1    . THR D 3 24  ? 29.213  22.348  47.597 1.00 33.96 ? 28  THR B OG1    1 
ATOM   2679 C CG2    . THR D 3 24  ? 30.003  20.713  49.187 1.00 27.31 ? 28  THR B CG2    1 
ATOM   2680 H H      . THR D 3 24  ? 29.252  24.692  48.447 1.00 0.00  ? 28  THR B H      1 
ATOM   2681 H HG1    . THR D 3 24  ? 29.382  23.220  47.243 1.00 0.00  ? 28  THR B HG1    1 
ATOM   2682 N N      . ASN D 3 25  ? 31.552  24.311  50.561 1.00 31.24 ? 29  ASN B N      1 
ATOM   2683 C CA     . ASN D 3 25  ? 32.690  24.687  51.411 1.00 31.67 ? 29  ASN B CA     1 
ATOM   2684 C C      . ASN D 3 25  ? 32.138  25.097  52.757 1.00 32.36 ? 29  ASN B C      1 
ATOM   2685 O O      . ASN D 3 25  ? 32.605  24.625  53.795 1.00 31.81 ? 29  ASN B O      1 
ATOM   2686 C CB     . ASN D 3 25  ? 33.485  25.878  50.801 1.00 35.30 ? 29  ASN B CB     1 
ATOM   2687 C CG     . ASN D 3 25  ? 34.275  25.495  49.515 1.00 36.89 ? 29  ASN B CG     1 
ATOM   2688 O OD1    . ASN D 3 25  ? 34.490  24.306  49.205 1.00 41.65 ? 29  ASN B OD1    1 
ATOM   2689 N ND2    . ASN D 3 25  ? 34.691  26.508  48.772 1.00 34.27 ? 29  ASN B ND2    1 
ATOM   2690 H H      . ASN D 3 25  ? 31.407  24.815  49.730 1.00 0.00  ? 29  ASN B H      1 
ATOM   2691 H HD21   . ASN D 3 25  ? 35.193  26.286  47.976 1.00 0.00  ? 29  ASN B HD21   1 
ATOM   2692 H HD22   . ASN D 3 25  ? 34.506  27.425  49.044 1.00 0.00  ? 29  ASN B HD22   1 
ATOM   2693 N N      . VAL D 3 26  ? 31.125  25.962  52.735 1.00 30.78 ? 30  VAL B N      1 
ATOM   2694 C CA     . VAL D 3 26  ? 30.492  26.444  53.957 1.00 31.12 ? 30  VAL B CA     1 
ATOM   2695 C C      . VAL D 3 26  ? 29.874  25.307  54.764 1.00 33.04 ? 30  VAL B C      1 
ATOM   2696 O O      . VAL D 3 26  ? 30.169  25.165  55.943 1.00 36.04 ? 30  VAL B O      1 
ATOM   2697 C CB     . VAL D 3 26  ? 29.426  27.494  53.681 1.00 32.94 ? 30  VAL B CB     1 
ATOM   2698 C CG1    . VAL D 3 26  ? 28.828  27.991  55.006 1.00 36.16 ? 30  VAL B CG1    1 
ATOM   2699 C CG2    . VAL D 3 26  ? 30.044  28.650  52.953 1.00 29.12 ? 30  VAL B CG2    1 
ATOM   2700 H H      . VAL D 3 26  ? 30.824  26.241  51.846 1.00 0.00  ? 30  VAL B H      1 
ATOM   2701 N N      . GLY D 3 27  ? 29.059  24.475  54.132 1.00 32.95 ? 31  GLY B N      1 
ATOM   2702 C CA     . GLY D 3 27  ? 28.446  23.355  54.826 1.00 32.93 ? 31  GLY B CA     1 
ATOM   2703 C C      . GLY D 3 27  ? 29.471  22.435  55.460 1.00 33.07 ? 31  GLY B C      1 
ATOM   2704 O O      . GLY D 3 27  ? 29.214  21.861  56.517 1.00 37.69 ? 31  GLY B O      1 
ATOM   2705 H H      . GLY D 3 27  ? 28.806  24.576  53.178 1.00 0.00  ? 31  GLY B H      1 
ATOM   2706 N N      . GLU D 3 28  ? 30.615  22.280  54.803 1.00 32.97 ? 32  GLU B N      1 
ATOM   2707 C CA     . GLU D 3 28  ? 31.695  21.436  55.274 1.00 33.63 ? 32  GLU B CA     1 
ATOM   2708 C C      . GLU D 3 28  ? 32.563  22.116  56.366 1.00 33.36 ? 32  GLU B C      1 
ATOM   2709 O O      . GLU D 3 28  ? 33.118  21.431  57.219 1.00 34.94 ? 32  GLU B O      1 
ATOM   2710 C CB     . GLU D 3 28  ? 32.501  20.977  54.063 1.00 35.90 ? 32  GLU B CB     1 
ATOM   2711 C CG     . GLU D 3 28  ? 33.438  19.796  54.281 1.00 43.73 ? 32  GLU B CG     1 
ATOM   2712 C CD     . GLU D 3 28  ? 33.865  19.113  52.975 1.00 47.25 ? 32  GLU B CD     1 
ATOM   2713 O OE1    . GLU D 3 28  ? 33.956  19.787  51.914 1.00 51.29 ? 32  GLU B OE1    1 
ATOM   2714 O OE2    . GLU D 3 28  ? 34.097  17.880  53.018 1.00 45.98 ? 32  GLU B OE2    1 
ATOM   2715 H H      . GLU D 3 28  ? 30.739  22.618  53.890 1.00 0.00  ? 32  GLU B H      1 
ATOM   2716 N N      . ALA D 3 29  ? 32.602  23.450  56.389 1.00 32.85 ? 33  ALA B N      1 
ATOM   2717 C CA     . ALA D 3 29  ? 33.364  24.252  57.378 1.00 34.35 ? 33  ALA B CA     1 
ATOM   2718 C C      . ALA D 3 29  ? 32.640  24.459  58.738 1.00 37.91 ? 33  ALA B C      1 
ATOM   2719 O O      . ALA D 3 29  ? 33.273  24.824  59.763 1.00 34.75 ? 33  ALA B O      1 
ATOM   2720 C CB     . ALA D 3 29  ? 33.727  25.613  56.781 1.00 30.80 ? 33  ALA B CB     1 
ATOM   2721 H H      . ALA D 3 29  ? 32.127  23.923  55.670 1.00 0.00  ? 33  ALA B H      1 
ATOM   2722 N N      . LEU D 3 30  ? 31.315  24.284  58.734 1.00 39.31 ? 34  LEU B N      1 
ATOM   2723 C CA     . LEU D 3 30  ? 30.496  24.427  59.948 1.00 38.89 ? 34  LEU B CA     1 
ATOM   2724 C C      . LEU D 3 30  ? 30.875  23.453  61.067 1.00 39.60 ? 34  LEU B C      1 
ATOM   2725 O O      . LEU D 3 30  ? 30.465  23.658  62.203 1.00 40.34 ? 34  LEU B O      1 
ATOM   2726 C CB     . LEU D 3 30  ? 28.996  24.316  59.633 1.00 26.32 ? 34  LEU B CB     1 
ATOM   2727 C CG     . LEU D 3 30  ? 28.442  25.494  58.846 1.00 19.77 ? 34  LEU B CG     1 
ATOM   2728 C CD1    . LEU D 3 30  ? 27.002  25.204  58.511 1.00 22.39 ? 34  LEU B CD1    1 
ATOM   2729 C CD2    . LEU D 3 30  ? 28.585  26.813  59.605 1.00 18.72 ? 34  LEU B CD2    1 
ATOM   2730 H H      . LEU D 3 30  ? 30.894  24.213  57.858 1.00 0.00  ? 34  LEU B H      1 
ATOM   2731 N N      . ALA D 3 31  ? 31.671  22.422  60.761 1.00 41.33 ? 35  ALA B N      1 
ATOM   2732 C CA     . ALA D 3 31  ? 32.124  21.460  61.778 1.00 40.83 ? 35  ALA B CA     1 
ATOM   2733 C C      . ALA D 3 31  ? 33.001  22.150  62.851 1.00 39.38 ? 35  ALA B C      1 
ATOM   2734 O O      . ALA D 3 31  ? 33.255  21.592  63.897 1.00 40.02 ? 35  ALA B O      1 
ATOM   2735 C CB     . ALA D 3 31  ? 32.884  20.307  61.110 1.00 35.01 ? 35  ALA B CB     1 
ATOM   2736 H H      . ALA D 3 31  ? 31.998  22.289  59.838 1.00 0.00  ? 35  ALA B H      1 
ATOM   2737 N N      . ALA D 3 32  ? 33.421  23.380  62.573 1.00 43.32 ? 36  ALA B N      1 
ATOM   2738 C CA     . ALA D 3 32  ? 34.240  24.184  63.479 1.00 45.34 ? 36  ALA B CA     1 
ATOM   2739 C C      . ALA D 3 32  ? 33.420  24.856  64.582 1.00 47.01 ? 36  ALA B C      1 
ATOM   2740 O O      . ALA D 3 32  ? 33.980  25.482  65.500 1.00 51.11 ? 36  ALA B O      1 
ATOM   2741 C CB     . ALA D 3 32  ? 34.989  25.274  62.677 1.00 46.61 ? 36  ALA B CB     1 
ATOM   2742 H H      . ALA D 3 32  ? 33.230  23.818  61.697 1.00 0.00  ? 36  ALA B H      1 
ATOM   2743 N N      . VAL D 3 33  ? 32.101  24.830  64.433 1.00 43.53 ? 37  VAL B N      1 
ATOM   2744 C CA     . VAL D 3 33  ? 31.245  25.440  65.419 1.00 41.39 ? 37  VAL B CA     1 
ATOM   2745 C C      . VAL D 3 33  ? 30.153  24.462  65.816 1.00 41.89 ? 37  VAL B C      1 
ATOM   2746 O O      . VAL D 3 33  ? 29.797  24.335  66.989 1.00 47.73 ? 37  VAL B O      1 
ATOM   2747 C CB     . VAL D 3 33  ? 30.615  26.780  64.898 1.00 39.31 ? 37  VAL B CB     1 
ATOM   2748 C CG1    . VAL D 3 33  ? 31.663  27.866  64.768 1.00 37.62 ? 37  VAL B CG1    1 
ATOM   2749 C CG2    . VAL D 3 33  ? 29.939  26.584  63.572 1.00 38.55 ? 37  VAL B CG2    1 
ATOM   2750 H H      . VAL D 3 33  ? 31.695  24.437  63.632 1.00 0.00  ? 37  VAL B H      1 
ATOM   2751 N N      . HIS D 3 34  ? 29.696  23.692  64.851 1.00 39.51 ? 38  HIS B N      1 
ATOM   2752 C CA     . HIS D 3 34  ? 28.599  22.777  65.079 1.00 36.80 ? 38  HIS B CA     1 
ATOM   2753 C C      . HIS D 3 34  ? 28.974  21.380  65.540 1.00 33.58 ? 38  HIS B C      1 
ATOM   2754 O O      . HIS D 3 34  ? 28.153  20.679  66.111 1.00 37.20 ? 38  HIS B O      1 
ATOM   2755 C CB     . HIS D 3 34  ? 27.759  22.712  63.802 1.00 37.61 ? 38  HIS B CB     1 
ATOM   2756 C CG     . HIS D 3 34  ? 26.440  22.027  63.957 1.00 38.68 ? 38  HIS B CG     1 
ATOM   2757 N ND1    . HIS D 3 34  ? 26.111  20.890  63.253 1.00 43.37 ? 38  HIS B ND1    1 
ATOM   2758 C CD2    . HIS D 3 34  ? 25.351  22.339  64.696 1.00 42.41 ? 38  HIS B CD2    1 
ATOM   2759 C CE1    . HIS D 3 34  ? 24.872  20.530  63.540 1.00 45.22 ? 38  HIS B CE1    1 
ATOM   2760 N NE2    . HIS D 3 34  ? 24.388  21.395  64.416 1.00 47.39 ? 38  HIS B NE2    1 
ATOM   2761 H H      . HIS D 3 34  ? 30.020  23.751  63.927 1.00 0.00  ? 38  HIS B H      1 
ATOM   2762 H HD1    . HIS D 3 34  ? 26.704  20.370  62.666 1.00 0.00  ? 38  HIS B HD1    1 
ATOM   2763 H HE2    . HIS D 3 34  ? 23.511  21.322  64.864 1.00 0.00  ? 38  HIS B HE2    1 
ATOM   2764 N N      . GLY D 3 35  ? 30.186  20.934  65.252 1.00 30.85 ? 39  GLY B N      1 
ATOM   2765 C CA     . GLY D 3 35  ? 30.554  19.602  65.679 1.00 25.82 ? 39  GLY B CA     1 
ATOM   2766 C C      . GLY D 3 35  ? 30.225  18.628  64.589 1.00 29.83 ? 39  GLY B C      1 
ATOM   2767 O O      . GLY D 3 35  ? 30.536  17.444  64.719 1.00 32.20 ? 39  GLY B O      1 
ATOM   2768 H H      . GLY D 3 35  ? 30.786  21.455  64.683 1.00 0.00  ? 39  GLY B H      1 
ATOM   2769 N N      . SER D 3 36  ? 29.534  19.104  63.552 1.00 33.85 ? 40  SER B N      1 
ATOM   2770 C CA     . SER D 3 36  ? 29.187  18.301  62.378 1.00 36.78 ? 40  SER B CA     1 
ATOM   2771 C C      . SER D 3 36  ? 28.996  19.203  61.153 1.00 36.76 ? 40  SER B C      1 
ATOM   2772 O O      . SER D 3 36  ? 28.893  20.426  61.273 1.00 36.54 ? 40  SER B O      1 
ATOM   2773 C CB     . SER D 3 36  ? 27.951  17.435  62.637 1.00 35.87 ? 40  SER B CB     1 
ATOM   2774 O OG     . SER D 3 36  ? 26.933  18.163  63.307 1.00 44.05 ? 40  SER B OG     1 
ATOM   2775 H H      . SER D 3 36  ? 29.153  20.014  63.535 1.00 0.00  ? 40  SER B H      1 
ATOM   2776 H HG     . SER D 3 36  ? 26.293  17.477  63.557 1.00 0.00  ? 40  SER B HG     1 
ATOM   2777 N N      . GLU D 3 37  ? 28.988  18.603  59.968 1.00 40.72 ? 41  GLU B N      1 
ATOM   2778 C CA     . GLU D 3 37  ? 28.848  19.355  58.716 1.00 40.53 ? 41  GLU B CA     1 
ATOM   2779 C C      . GLU D 3 37  ? 27.403  19.306  58.202 1.00 40.51 ? 41  GLU B C      1 
ATOM   2780 O O      . GLU D 3 37  ? 26.671  18.352  58.489 1.00 38.04 ? 41  GLU B O      1 
ATOM   2781 C CB     . GLU D 3 37  ? 29.795  18.775  57.638 1.00 41.95 ? 41  GLU B CB     1 
ATOM   2782 C CG     . GLU D 3 37  ? 31.285  18.758  58.024 1.00 44.41 ? 41  GLU B CG     1 
ATOM   2783 C CD     . GLU D 3 37  ? 32.225  18.132  56.968 1.00 46.24 ? 41  GLU B CD     1 
ATOM   2784 O OE1    . GLU D 3 37  ? 31.784  17.420  56.029 1.00 43.25 ? 41  GLU B OE1    1 
ATOM   2785 O OE2    . GLU D 3 37  ? 33.452  18.323  57.122 1.00 48.61 ? 41  GLU B OE2    1 
ATOM   2786 H H      . GLU D 3 37  ? 29.014  17.610  59.889 1.00 0.00  ? 41  GLU B H      1 
ATOM   2787 N N      . PHE D 3 38  ? 26.999  20.362  57.486 1.00 41.40 ? 42  PHE B N      1 
ATOM   2788 C CA     . PHE D 3 38  ? 25.672  20.469  56.863 1.00 43.30 ? 42  PHE B CA     1 
ATOM   2789 C C      . PHE D 3 38  ? 25.901  20.255  55.369 1.00 40.47 ? 42  PHE B C      1 
ATOM   2790 O O      . PHE D 3 38  ? 26.987  20.573  54.876 1.00 41.51 ? 42  PHE B O      1 
ATOM   2791 C CB     . PHE D 3 38  ? 25.035  21.850  57.087 1.00 48.07 ? 42  PHE B CB     1 
ATOM   2792 C CG     . PHE D 3 38  ? 24.318  21.985  58.419 1.00 58.66 ? 42  PHE B CG     1 
ATOM   2793 C CD1    . PHE D 3 38  ? 23.166  21.230  58.699 1.00 60.28 ? 42  PHE B CD1    1 
ATOM   2794 C CD2    . PHE D 3 38  ? 24.829  22.802  59.422 1.00 60.98 ? 42  PHE B CD2    1 
ATOM   2795 C CE1    . PHE D 3 38  ? 22.543  21.320  59.945 1.00 58.18 ? 42  PHE B CE1    1 
ATOM   2796 C CE2    . PHE D 3 38  ? 24.194  22.885  60.671 1.00 59.17 ? 42  PHE B CE2    1 
ATOM   2797 C CZ     . PHE D 3 38  ? 23.069  22.140  60.926 1.00 56.99 ? 42  PHE B CZ     1 
ATOM   2798 H H      . PHE D 3 38  ? 27.688  21.038  57.321 1.00 0.00  ? 42  PHE B H      1 
ATOM   2799 N N      . SER D 3 39  ? 24.892  19.782  54.636 1.00 35.38 ? 43  SER B N      1 
ATOM   2800 C CA     . SER D 3 39  ? 25.056  19.524  53.215 1.00 27.21 ? 43  SER B CA     1 
ATOM   2801 C C      . SER D 3 39  ? 24.891  20.754  52.337 1.00 25.06 ? 43  SER B C      1 
ATOM   2802 O O      . SER D 3 39  ? 24.445  21.805  52.800 1.00 23.39 ? 43  SER B O      1 
ATOM   2803 C CB     . SER D 3 39  ? 24.092  18.432  52.757 1.00 27.49 ? 43  SER B CB     1 
ATOM   2804 O OG     . SER D 3 39  ? 22.737  18.843  52.817 1.00 24.48 ? 43  SER B OG     1 
ATOM   2805 H H      . SER D 3 39  ? 23.961  19.661  54.936 1.00 0.00  ? 43  SER B H      1 
ATOM   2806 H HG     . SER D 3 39  ? 22.147  18.109  52.595 1.00 0.00  ? 43  SER B HG     1 
ATOM   2807 N N      . GLN D 3 40  ? 25.252  20.619  51.058 1.00 24.48 ? 44  GLN B N      1 
ATOM   2808 C CA     . GLN D 3 40  ? 25.129  21.701  50.069 1.00 21.60 ? 44  GLN B CA     1 
ATOM   2809 C C      . GLN D 3 40  ? 23.670  22.154  50.002 1.00 16.99 ? 44  GLN B C      1 
ATOM   2810 O O      . GLN D 3 40  ? 23.367  23.356  50.015 1.00 14.09 ? 44  GLN B O      1 
ATOM   2811 C CB     . GLN D 3 40  ? 25.584  21.209  48.675 1.00 20.09 ? 44  GLN B CB     1 
ATOM   2812 C CG     . GLN D 3 40  ? 25.456  22.266  47.566 1.00 18.51 ? 44  GLN B CG     1 
ATOM   2813 C CD     . GLN D 3 40  ? 24.176  22.132  46.721 1.00 17.70 ? 44  GLN B CD     1 
ATOM   2814 O OE1    . GLN D 3 40  ? 23.882  21.057  46.210 1.00 16.65 ? 44  GLN B OE1    1 
ATOM   2815 N NE2    . GLN D 3 40  ? 23.454  23.228  46.526 1.00 15.34 ? 44  GLN B NE2    1 
ATOM   2816 H H      . GLN D 3 40  ? 25.622  19.847  50.618 1.00 0.00  ? 44  GLN B H      1 
ATOM   2817 H HE21   . GLN D 3 40  ? 22.609  23.084  46.059 1.00 0.00  ? 44  GLN B HE21   1 
ATOM   2818 H HE22   . GLN D 3 40  ? 23.699  24.128  46.822 1.00 0.00  ? 44  GLN B HE22   1 
ATOM   2819 N N      . THR D 3 41  ? 22.792  21.156  49.987 1.00 16.28 ? 45  THR B N      1 
ATOM   2820 C CA     . THR D 3 41  ? 21.350  21.313  49.913 1.00 17.02 ? 45  THR B CA     1 
ATOM   2821 C C      . THR D 3 41  ? 20.869  22.181  51.042 1.00 17.12 ? 45  THR B C      1 
ATOM   2822 O O      . THR D 3 41  ? 20.240  23.214  50.826 1.00 17.62 ? 45  THR B O      1 
ATOM   2823 C CB     . THR D 3 41  ? 20.695  19.951  50.003 1.00 18.90 ? 45  THR B CB     1 
ATOM   2824 O OG1    . THR D 3 41  ? 21.210  19.131  48.956 1.00 24.33 ? 45  THR B OG1    1 
ATOM   2825 C CG2    . THR D 3 41  ? 19.227  20.047  49.836 1.00 25.75 ? 45  THR B CG2    1 
ATOM   2826 H H      . THR D 3 41  ? 23.111  20.227  50.073 1.00 0.00  ? 45  THR B H      1 
ATOM   2827 H HG1    . THR D 3 41  ? 20.900  19.453  48.095 1.00 0.00  ? 45  THR B HG1    1 
ATOM   2828 N N      . THR D 3 42  ? 21.244  21.803  52.254 1.00 20.45 ? 46  THR B N      1 
ATOM   2829 C CA     . THR D 3 42  ? 20.860  22.554  53.436 1.00 19.13 ? 46  THR B CA     1 
ATOM   2830 C C      . THR D 3 42  ? 21.216  24.033  53.270 1.00 20.51 ? 46  THR B C      1 
ATOM   2831 O O      . THR D 3 42  ? 20.358  24.926  53.398 1.00 24.51 ? 46  THR B O      1 
ATOM   2832 C CB     . THR D 3 42  ? 21.517  21.928  54.747 1.00 21.15 ? 46  THR B CB     1 
ATOM   2833 O OG1    . THR D 3 42  ? 21.000  20.605  54.960 1.00 13.55 ? 46  THR B OG1    1 
ATOM   2834 C CG2    . THR D 3 42  ? 21.268  22.807  56.002 1.00 15.57 ? 46  THR B CG2    1 
ATOM   2835 H H      . THR D 3 42  ? 21.741  20.978  52.470 1.00 0.00  ? 46  THR B H      1 
ATOM   2836 H HG1    . THR D 3 42  ? 20.029  20.601  55.027 1.00 0.00  ? 46  THR B HG1    1 
ATOM   2837 N N      . ILE D 3 43  ? 22.474  24.316  52.949 1.00 21.95 ? 47  ILE B N      1 
ATOM   2838 C CA     . ILE D 3 43  ? 22.870  25.716  52.823 1.00 21.33 ? 47  ILE B CA     1 
ATOM   2839 C C      . ILE D 3 43  ? 22.072  26.416  51.760 1.00 22.20 ? 47  ILE B C      1 
ATOM   2840 O O      . ILE D 3 43  ? 21.832  27.620  51.878 1.00 22.25 ? 47  ILE B O      1 
ATOM   2841 C CB     . ILE D 3 43  ? 24.381  25.888  52.548 1.00 20.97 ? 47  ILE B CB     1 
ATOM   2842 C CG1    . ILE D 3 43  ? 25.169  25.074  53.569 1.00 22.04 ? 47  ILE B CG1    1 
ATOM   2843 C CG2    . ILE D 3 43  ? 24.770  27.367  52.610 1.00 17.06 ? 47  ILE B CG2    1 
ATOM   2844 C CD1    . ILE D 3 43  ? 24.836  25.464  54.978 1.00 26.92 ? 47  ILE B CD1    1 
ATOM   2845 H H      . ILE D 3 43  ? 23.135  23.578  52.832 1.00 0.00  ? 47  ILE B H      1 
ATOM   2846 N N      . CYS D 3 44  ? 21.723  25.707  50.679 1.00 24.68 ? 48  CYS B N      1 
ATOM   2847 C CA     . CYS D 3 44  ? 20.896  26.304  49.612 1.00 21.36 ? 48  CYS B CA     1 
ATOM   2848 C C      . CYS D 3 44  ? 19.522  26.600  50.247 1.00 16.21 ? 48  CYS B C      1 
ATOM   2849 O O      . CYS D 3 44  ? 19.072  27.748  50.246 1.00 17.28 ? 48  CYS B O      1 
ATOM   2850 C CB     . CYS D 3 44  ? 20.771  25.380  48.357 1.00 22.30 ? 48  CYS B CB     1 
ATOM   2851 S SG     . CYS D 3 44  ? 19.631  25.979  46.977 1.00 22.12 ? 48  CYS B SG     1 
ATOM   2852 H H      . CYS D 3 44  ? 22.120  24.816  50.537 1.00 0.00  ? 48  CYS B H      1 
ATOM   2853 N N      . ARG D 3 45  ? 18.901  25.605  50.870 1.00 15.01 ? 49  ARG B N      1 
ATOM   2854 C CA     . ARG D 3 45  ? 17.588  25.821  51.519 1.00 17.98 ? 49  ARG B CA     1 
ATOM   2855 C C      . ARG D 3 45  ? 17.613  27.061  52.438 1.00 22.76 ? 49  ARG B C      1 
ATOM   2856 O O      . ARG D 3 45  ? 16.741  27.959  52.299 1.00 25.24 ? 49  ARG B O      1 
ATOM   2857 C CB     . ARG D 3 45  ? 17.120  24.591  52.303 1.00 13.20 ? 49  ARG B CB     1 
ATOM   2858 C CG     . ARG D 3 45  ? 16.555  23.430  51.498 1.00 4.52  ? 49  ARG B CG     1 
ATOM   2859 C CD     . ARG D 3 45  ? 16.663  22.223  52.394 1.00 6.09  ? 49  ARG B CD     1 
ATOM   2860 N NE     . ARG D 3 45  ? 16.211  20.978  51.796 1.00 4.94  ? 49  ARG B NE     1 
ATOM   2861 C CZ     . ARG D 3 45  ? 16.681  19.768  52.106 1.00 12.57 ? 49  ARG B CZ     1 
ATOM   2862 N NH1    . ARG D 3 45  ? 17.637  19.600  53.001 1.00 17.16 ? 49  ARG B NH1    1 
ATOM   2863 N NH2    . ARG D 3 45  ? 16.202  18.701  51.494 1.00 12.24 ? 49  ARG B NH2    1 
ATOM   2864 H H      . ARG D 3 45  ? 19.354  24.750  50.856 1.00 0.00  ? 49  ARG B H      1 
ATOM   2865 H HE     . ARG D 3 45  ? 15.494  20.994  51.128 1.00 0.00  ? 49  ARG B HE     1 
ATOM   2866 H HH11   . ARG D 3 45  ? 18.078  20.331  53.496 1.00 0.00  ? 49  ARG B HH11   1 
ATOM   2867 H HH12   . ARG D 3 45  ? 17.925  18.656  53.210 1.00 0.00  ? 49  ARG B HH12   1 
ATOM   2868 H HH21   . ARG D 3 45  ? 15.508  18.722  50.767 1.00 0.00  ? 49  ARG B HH21   1 
ATOM   2869 H HH22   . ARG D 3 45  ? 16.574  17.788  51.756 1.00 0.00  ? 49  ARG B HH22   1 
ATOM   2870 N N      . PHE D 3 46  ? 18.615  27.173  53.321 1.00 24.03 ? 50  PHE B N      1 
ATOM   2871 C CA     . PHE D 3 46  ? 18.677  28.347  54.184 1.00 22.75 ? 50  PHE B CA     1 
ATOM   2872 C C      . PHE D 3 46  ? 18.746  29.669  53.412 1.00 24.88 ? 50  PHE B C      1 
ATOM   2873 O O      . PHE D 3 46  ? 18.031  30.615  53.738 1.00 29.24 ? 50  PHE B O      1 
ATOM   2874 C CB     . PHE D 3 46  ? 19.842  28.266  55.157 1.00 22.86 ? 50  PHE B CB     1 
ATOM   2875 C CG     . PHE D 3 46  ? 20.054  29.546  55.949 1.00 23.74 ? 50  PHE B CG     1 
ATOM   2876 C CD1    . PHE D 3 46  ? 20.815  30.599  55.433 1.00 22.41 ? 50  PHE B CD1    1 
ATOM   2877 C CD2    . PHE D 3 46  ? 19.457  29.713  57.195 1.00 21.95 ? 50  PHE B CD2    1 
ATOM   2878 C CE1    . PHE D 3 46  ? 20.973  31.780  56.140 1.00 22.57 ? 50  PHE B CE1    1 
ATOM   2879 C CE2    . PHE D 3 46  ? 19.615  30.908  57.912 1.00 23.52 ? 50  PHE B CE2    1 
ATOM   2880 C CZ     . PHE D 3 46  ? 20.369  31.937  57.387 1.00 21.54 ? 50  PHE B CZ     1 
ATOM   2881 H H      . PHE D 3 46  ? 19.292  26.456  53.342 1.00 0.00  ? 50  PHE B H      1 
ATOM   2882 N N      . GLU D 3 47  ? 19.637  29.758  52.429 1.00 28.18 ? 51  GLU B N      1 
ATOM   2883 C CA     . GLU D 3 47  ? 19.814  30.973  51.624 1.00 28.37 ? 51  GLU B CA     1 
ATOM   2884 C C      . GLU D 3 47  ? 18.580  31.330  50.849 1.00 25.23 ? 51  GLU B C      1 
ATOM   2885 O O      . GLU D 3 47  ? 18.280  32.493  50.653 1.00 22.80 ? 51  GLU B O      1 
ATOM   2886 C CB     . GLU D 3 47  ? 20.978  30.812  50.646 1.00 35.71 ? 51  GLU B CB     1 
ATOM   2887 C CG     . GLU D 3 47  ? 22.357  31.238  51.146 1.00 37.82 ? 51  GLU B CG     1 
ATOM   2888 C CD     . GLU D 3 47  ? 23.416  31.072  50.064 1.00 41.32 ? 51  GLU B CD     1 
ATOM   2889 O OE1    . GLU D 3 47  ? 23.065  31.112  48.858 1.00 44.91 ? 51  GLU B OE1    1 
ATOM   2890 O OE2    . GLU D 3 47  ? 24.592  30.871  50.424 1.00 35.71 ? 51  GLU B OE2    1 
ATOM   2891 H H      . GLU D 3 47  ? 20.294  29.033  52.252 1.00 0.00  ? 51  GLU B H      1 
ATOM   2892 N N      . ASN D 3 48  ? 17.901  30.315  50.347 1.00 25.74 ? 52  ASN B N      1 
ATOM   2893 C CA     . ASN D 3 48  ? 16.671  30.534  49.606 1.00 30.37 ? 52  ASN B CA     1 
ATOM   2894 C C      . ASN D 3 48  ? 15.431  30.569  50.522 1.00 31.17 ? 52  ASN B C      1 
ATOM   2895 O O      . ASN D 3 48  ? 14.309  30.902  50.097 1.00 28.65 ? 52  ASN B O      1 
ATOM   2896 C CB     . ASN D 3 48  ? 16.566  29.501  48.472 1.00 28.09 ? 52  ASN B CB     1 
ATOM   2897 C CG     . ASN D 3 48  ? 17.725  29.619  47.479 1.00 24.62 ? 52  ASN B CG     1 
ATOM   2898 O OD1    . ASN D 3 48  ? 17.825  30.600  46.745 1.00 21.04 ? 52  ASN B OD1    1 
ATOM   2899 N ND2    . ASN D 3 48  ? 18.631  28.650  47.501 1.00 20.54 ? 52  ASN B ND2    1 
ATOM   2900 H H      . ASN D 3 48  ? 18.282  29.420  50.371 1.00 0.00  ? 52  ASN B H      1 
ATOM   2901 H HD21   . ASN D 3 48  ? 19.394  28.725  46.900 1.00 0.00  ? 52  ASN B HD21   1 
ATOM   2902 H HD22   . ASN D 3 48  ? 18.503  27.906  48.130 1.00 0.00  ? 52  ASN B HD22   1 
ATOM   2903 N N      . LEU D 3 49  ? 15.669  30.304  51.804 1.00 31.93 ? 53  LEU B N      1 
ATOM   2904 C CA     . LEU D 3 49  ? 14.632  30.307  52.842 1.00 29.74 ? 53  LEU B CA     1 
ATOM   2905 C C      . LEU D 3 49  ? 13.514  29.281  52.582 1.00 27.65 ? 53  LEU B C      1 
ATOM   2906 O O      . LEU D 3 49  ? 12.334  29.520  52.841 1.00 24.25 ? 53  LEU B O      1 
ATOM   2907 C CB     . LEU D 3 49  ? 14.073  31.737  53.049 1.00 26.46 ? 53  LEU B CB     1 
ATOM   2908 C CG     . LEU D 3 49  ? 14.986  32.726  53.785 1.00 22.17 ? 53  LEU B CG     1 
ATOM   2909 C CD1    . LEU D 3 49  ? 14.228  33.979  54.079 1.00 20.34 ? 53  LEU B CD1    1 
ATOM   2910 C CD2    . LEU D 3 49  ? 15.519  32.130  55.094 1.00 23.15 ? 53  LEU B CD2    1 
ATOM   2911 H H      . LEU D 3 49  ? 16.610  30.121  52.043 1.00 0.00  ? 53  LEU B H      1 
ATOM   2912 N N      . GLN D 3 50  ? 13.930  28.123  52.086 1.00 26.06 ? 54  GLN B N      1 
ATOM   2913 C CA     . GLN D 3 50  ? 13.020  27.040  51.775 1.00 21.10 ? 54  GLN B CA     1 
ATOM   2914 C C      . GLN D 3 50  ? 13.064  26.089  52.946 1.00 20.78 ? 54  GLN B C      1 
ATOM   2915 O O      . GLN D 3 50  ? 13.441  24.932  52.807 1.00 18.52 ? 54  GLN B O      1 
ATOM   2916 C CB     . GLN D 3 50  ? 13.415  26.327  50.458 1.00 24.48 ? 54  GLN B CB     1 
ATOM   2917 C CG     . GLN D 3 50  ? 13.199  27.145  49.144 1.00 25.05 ? 54  GLN B CG     1 
ATOM   2918 C CD     . GLN D 3 50  ? 11.841  26.878  48.506 1.00 35.81 ? 54  GLN B CD     1 
ATOM   2919 O OE1    . GLN D 3 50  ? 11.353  25.731  48.512 1.00 42.29 ? 54  GLN B OE1    1 
ATOM   2920 N NE2    . GLN D 3 50  ? 11.198  27.931  47.989 1.00 34.45 ? 54  GLN B NE2    1 
ATOM   2921 H H      . GLN D 3 50  ? 14.899  28.054  52.011 1.00 0.00  ? 54  GLN B H      1 
ATOM   2922 H HE21   . GLN D 3 50  ? 10.328  27.728  47.610 1.00 0.00  ? 54  GLN B HE21   1 
ATOM   2923 H HE22   . GLN D 3 50  ? 11.555  28.841  48.009 1.00 0.00  ? 54  GLN B HE22   1 
ATOM   2924 N N      . LEU D 3 51  ? 12.736  26.605  54.125 1.00 24.59 ? 55  LEU B N      1 
ATOM   2925 C CA     . LEU D 3 51  ? 12.694  25.791  55.355 1.00 24.97 ? 55  LEU B CA     1 
ATOM   2926 C C      . LEU D 3 51  ? 11.607  26.347  56.272 1.00 28.07 ? 55  LEU B C      1 
ATOM   2927 O O      . LEU D 3 51  ? 10.960  27.373  55.969 1.00 27.49 ? 55  LEU B O      1 
ATOM   2928 C CB     . LEU D 3 51  ? 14.036  25.837  56.128 1.00 22.69 ? 55  LEU B CB     1 
ATOM   2929 C CG     . LEU D 3 51  ? 15.347  25.237  55.593 1.00 21.64 ? 55  LEU B CG     1 
ATOM   2930 C CD1    . LEU D 3 51  ? 16.509  25.737  56.440 1.00 20.54 ? 55  LEU B CD1    1 
ATOM   2931 C CD2    . LEU D 3 51  ? 15.304  23.693  55.565 1.00 13.86 ? 55  LEU B CD2    1 
ATOM   2932 H H      . LEU D 3 51  ? 12.528  27.573  54.159 1.00 0.00  ? 55  LEU B H      1 
ATOM   2933 N N      . SER D 3 52  ? 11.378  25.672  57.389 1.00 29.52 ? 56  SER B N      1 
ATOM   2934 C CA     . SER D 3 52  ? 10.398  26.182  58.338 1.00 32.58 ? 56  SER B CA     1 
ATOM   2935 C C      . SER D 3 52  ? 11.043  27.376  59.059 1.00 34.54 ? 56  SER B C      1 
ATOM   2936 O O      . SER D 3 52  ? 12.256  27.537  59.053 1.00 34.57 ? 56  SER B O      1 
ATOM   2937 C CB     . SER D 3 52  ? 9.982   25.088  59.339 1.00 33.49 ? 56  SER B CB     1 
ATOM   2938 O OG     . SER D 3 52  ? 11.086  24.591  60.099 1.00 38.34 ? 56  SER B OG     1 
ATOM   2939 H H      . SER D 3 52  ? 11.846  24.817  57.548 1.00 0.00  ? 56  SER B H      1 
ATOM   2940 H HG     . SER D 3 52  ? 11.648  24.092  59.509 1.00 0.00  ? 56  SER B HG     1 
ATOM   2941 N N      . PHE D 3 53  ? 10.228  28.201  59.698 1.00 38.06 ? 57  PHE B N      1 
ATOM   2942 C CA     . PHE D 3 53  ? 10.721  29.366  60.425 1.00 38.03 ? 57  PHE B CA     1 
ATOM   2943 C C      . PHE D 3 53  ? 11.642  28.875  61.530 1.00 38.14 ? 57  PHE B C      1 
ATOM   2944 O O      . PHE D 3 53  ? 12.722  29.428  61.748 1.00 34.32 ? 57  PHE B O      1 
ATOM   2945 C CB     . PHE D 3 53  ? 9.543   30.123  61.047 1.00 37.88 ? 57  PHE B CB     1 
ATOM   2946 C CG     . PHE D 3 53  ? 9.940   31.366  61.796 1.00 36.82 ? 57  PHE B CG     1 
ATOM   2947 C CD1    . PHE D 3 53  ? 10.370  32.504  61.117 1.00 33.37 ? 57  PHE B CD1    1 
ATOM   2948 C CD2    . PHE D 3 53  ? 9.807   31.435  63.181 1.00 35.32 ? 57  PHE B CD2    1 
ATOM   2949 C CE1    . PHE D 3 53  ? 10.656  33.697  61.817 1.00 34.33 ? 57  PHE B CE1    1 
ATOM   2950 C CE2    . PHE D 3 53  ? 10.095  32.636  63.877 1.00 35.09 ? 57  PHE B CE2    1 
ATOM   2951 C CZ     . PHE D 3 53  ? 10.517  33.763  63.183 1.00 29.71 ? 57  PHE B CZ     1 
ATOM   2952 H H      . PHE D 3 53  ? 9.249   28.005  59.692 1.00 0.00  ? 57  PHE B H      1 
ATOM   2953 N N      . LYS D 3 54  ? 11.184  27.833  62.229 1.00 40.97 ? 58  LYS B N      1 
ATOM   2954 C CA     . LYS D 3 54  ? 11.933  27.230  63.323 1.00 43.05 ? 58  LYS B CA     1 
ATOM   2955 C C      . LYS D 3 54  ? 13.301  26.788  62.851 1.00 44.64 ? 58  LYS B C      1 
ATOM   2956 O O      . LYS D 3 54  ? 14.329  27.165  63.450 1.00 48.10 ? 58  LYS B O      1 
ATOM   2957 C CB     . LYS D 3 54  ? 11.199  26.022  63.914 1.00 39.67 ? 58  LYS B CB     1 
ATOM   2958 C CG     . LYS D 3 54  ? 10.265  26.368  65.058 1.00 47.46 ? 58  LYS B CG     1 
ATOM   2959 C CD     . LYS D 3 54  ? 9.766   25.092  65.786 1.00 50.74 ? 58  LYS B CD     1 
ATOM   2960 C CE     . LYS D 3 54  ? 8.756   25.366  66.942 1.00 51.87 ? 58  LYS B CE     1 
ATOM   2961 N NZ     . LYS D 3 54  ? 7.347   25.718  66.503 1.00 50.99 ? 58  LYS B NZ     1 
ATOM   2962 H H      . LYS D 3 54  ? 10.315  27.428  61.985 1.00 0.00  ? 58  LYS B H      1 
ATOM   2963 H HZ1    . LYS D 3 54  ? 7.348   26.597  65.935 1.00 0.00  ? 58  LYS B HZ1    1 
ATOM   2964 H HZ2    . LYS D 3 54  ? 6.882   24.957  65.958 1.00 0.00  ? 58  LYS B HZ2    1 
ATOM   2965 H HZ3    . LYS D 3 54  ? 6.767   25.897  67.355 1.00 0.00  ? 58  LYS B HZ3    1 
ATOM   2966 N N      . ASN D 3 55  ? 13.324  26.033  61.745 1.00 42.10 ? 59  ASN B N      1 
ATOM   2967 C CA     . ASN D 3 55  ? 14.566  25.511  61.197 1.00 36.05 ? 59  ASN B CA     1 
ATOM   2968 C C      . ASN D 3 55  ? 15.531  26.599  60.763 1.00 35.38 ? 59  ASN B C      1 
ATOM   2969 O O      . ASN D 3 55  ? 16.683  26.635  61.214 1.00 34.79 ? 59  ASN B O      1 
ATOM   2970 C CB     . ASN D 3 55  ? 14.303  24.563  60.052 1.00 31.25 ? 59  ASN B CB     1 
ATOM   2971 C CG     . ASN D 3 55  ? 15.421  23.559  59.871 1.00 31.45 ? 59  ASN B CG     1 
ATOM   2972 O OD1    . ASN D 3 55  ? 15.247  22.551  59.196 1.00 28.83 ? 59  ASN B OD1    1 
ATOM   2973 N ND2    . ASN D 3 55  ? 16.582  23.831  60.468 1.00 28.43 ? 59  ASN B ND2    1 
ATOM   2974 H H      . ASN D 3 55  ? 12.529  25.746  61.258 1.00 0.00  ? 59  ASN B H      1 
ATOM   2975 H HD21   . ASN D 3 55  ? 17.219  23.082  60.353 1.00 0.00  ? 59  ASN B HD21   1 
ATOM   2976 H HD22   . ASN D 3 55  ? 16.867  24.619  60.976 1.00 0.00  ? 59  ASN B HD22   1 
ATOM   2977 N N      . ALA D 3 56  ? 15.026  27.525  59.957 1.00 34.12 ? 60  ALA B N      1 
ATOM   2978 C CA     . ALA D 3 56  ? 15.823  28.623  59.452 1.00 34.37 ? 60  ALA B CA     1 
ATOM   2979 C C      . ALA D 3 56  ? 16.442  29.440  60.589 1.00 34.75 ? 60  ALA B C      1 
ATOM   2980 O O      . ALA D 3 56  ? 17.606  29.834  60.499 1.00 37.33 ? 60  ALA B O      1 
ATOM   2981 C CB     . ALA D 3 56  ? 15.000  29.501  58.503 1.00 26.37 ? 60  ALA B CB     1 
ATOM   2982 H H      . ALA D 3 56  ? 14.082  27.504  59.679 1.00 0.00  ? 60  ALA B H      1 
ATOM   2983 N N      . CYS D 3 57  ? 15.694  29.685  61.661 1.00 34.88 ? 61  CYS B N      1 
ATOM   2984 C CA     . CYS D 3 57  ? 16.241  30.451  62.793 1.00 35.62 ? 61  CYS B CA     1 
ATOM   2985 C C      . CYS D 3 57  ? 17.352  29.722  63.533 1.00 32.03 ? 61  CYS B C      1 
ATOM   2986 O O      . CYS D 3 57  ? 18.322  30.334  63.972 1.00 28.93 ? 61  CYS B O      1 
ATOM   2987 C CB     . CYS D 3 57  ? 15.145  30.857  63.774 1.00 37.33 ? 61  CYS B CB     1 
ATOM   2988 S SG     . CYS D 3 57  ? 14.080  32.106  63.116 1.00 38.57 ? 61  CYS B SG     1 
ATOM   2989 H H      . CYS D 3 57  ? 14.729  29.482  61.706 1.00 0.00  ? 61  CYS B H      1 
ATOM   2990 N N      . LYS D 3 58  ? 17.182  28.421  63.713 1.00 32.29 ? 62  LYS B N      1 
ATOM   2991 C CA     . LYS D 3 58  ? 18.195  27.638  64.378 1.00 34.67 ? 62  LYS B CA     1 
ATOM   2992 C C      . LYS D 3 58  ? 19.500  27.817  63.625 1.00 35.36 ? 62  LYS B C      1 
ATOM   2993 O O      . LYS D 3 58  ? 20.542  28.154  64.224 1.00 34.46 ? 62  LYS B O      1 
ATOM   2994 C CB     . LYS D 3 58  ? 17.809  26.176  64.396 1.00 37.35 ? 62  LYS B CB     1 
ATOM   2995 C CG     . LYS D 3 58  ? 17.440  25.692  65.782 1.00 49.70 ? 62  LYS B CG     1 
ATOM   2996 C CD     . LYS D 3 58  ? 18.375  24.571  66.179 1.00 57.45 ? 62  LYS B CD     1 
ATOM   2997 C CE     . LYS D 3 58  ? 17.872  23.807  67.393 1.00 63.07 ? 62  LYS B CE     1 
ATOM   2998 N NZ     . LYS D 3 58  ? 18.257  24.465  68.658 1.00 68.97 ? 62  LYS B NZ     1 
ATOM   2999 H H      . LYS D 3 58  ? 16.306  28.007  63.461 1.00 0.00  ? 62  LYS B H      1 
ATOM   3000 H HZ1    . LYS D 3 58  ? 17.894  25.445  68.610 1.00 0.00  ? 62  LYS B HZ1    1 
ATOM   3001 H HZ2    . LYS D 3 58  ? 17.784  23.955  69.428 1.00 0.00  ? 62  LYS B HZ2    1 
ATOM   3002 H HZ3    . LYS D 3 58  ? 19.291  24.470  68.767 1.00 0.00  ? 62  LYS B HZ3    1 
ATOM   3003 N N      . LEU D 3 59  ? 19.419  27.644  62.302 1.00 34.61 ? 63  LEU B N      1 
ATOM   3004 C CA     . LEU D 3 59  ? 20.570  27.781  61.411 1.00 33.60 ? 63  LEU B CA     1 
ATOM   3005 C C      . LEU D 3 59  ? 21.144  29.169  61.415 1.00 33.42 ? 63  LEU B C      1 
ATOM   3006 O O      . LEU D 3 59  ? 22.357  29.330  61.451 1.00 34.79 ? 63  LEU B O      1 
ATOM   3007 C CB     . LEU D 3 59  ? 20.229  27.374  59.989 1.00 35.06 ? 63  LEU B CB     1 
ATOM   3008 C CG     . LEU D 3 59  ? 20.218  25.856  59.916 1.00 35.48 ? 63  LEU B CG     1 
ATOM   3009 C CD1    . LEU D 3 59  ? 19.791  25.384  58.532 1.00 43.69 ? 63  LEU B CD1    1 
ATOM   3010 C CD2    . LEU D 3 59  ? 21.604  25.347  60.251 1.00 40.35 ? 63  LEU B CD2    1 
ATOM   3011 H H      . LEU D 3 59  ? 18.545  27.384  61.933 1.00 0.00  ? 63  LEU B H      1 
ATOM   3012 N N      . LYS D 3 60  ? 20.283  30.175  61.394 1.00 33.18 ? 64  LYS B N      1 
ATOM   3013 C CA     . LYS D 3 60  ? 20.728  31.550  61.425 1.00 33.94 ? 64  LYS B CA     1 
ATOM   3014 C C      . LYS D 3 60  ? 21.725  31.759  62.576 1.00 37.63 ? 64  LYS B C      1 
ATOM   3015 O O      . LYS D 3 60  ? 22.542  32.692  62.533 1.00 43.46 ? 64  LYS B O      1 
ATOM   3016 C CB     . LYS D 3 60  ? 19.530  32.488  61.569 1.00 28.96 ? 64  LYS B CB     1 
ATOM   3017 C CG     . LYS D 3 60  ? 19.885  33.946  61.512 1.00 28.01 ? 64  LYS B CG     1 
ATOM   3018 C CD     . LYS D 3 60  ? 18.713  34.825  61.793 1.00 32.75 ? 64  LYS B CD     1 
ATOM   3019 C CE     . LYS D 3 60  ? 18.871  35.526  63.130 1.00 34.18 ? 64  LYS B CE     1 
ATOM   3020 N NZ     . LYS D 3 60  ? 19.898  36.618  63.118 1.00 38.49 ? 64  LYS B NZ     1 
ATOM   3021 H H      . LYS D 3 60  ? 19.315  30.017  61.298 1.00 0.00  ? 64  LYS B H      1 
ATOM   3022 H HZ1    . LYS D 3 60  ? 19.679  37.327  62.389 1.00 0.00  ? 64  LYS B HZ1    1 
ATOM   3023 H HZ2    . LYS D 3 60  ? 19.901  37.107  64.048 1.00 0.00  ? 64  LYS B HZ2    1 
ATOM   3024 H HZ3    . LYS D 3 60  ? 20.823  36.188  62.967 1.00 0.00  ? 64  LYS B HZ3    1 
ATOM   3025 N N      . ALA D 3 61  ? 21.663  30.914  63.601 1.00 37.74 ? 65  ALA B N      1 
ATOM   3026 C CA     . ALA D 3 61  ? 22.578  31.060  64.718 1.00 37.87 ? 65  ALA B CA     1 
ATOM   3027 C C      . ALA D 3 61  ? 23.891  30.399  64.378 1.00 38.50 ? 65  ALA B C      1 
ATOM   3028 O O      . ALA D 3 61  ? 24.960  31.027  64.469 1.00 39.93 ? 65  ALA B O      1 
ATOM   3029 C CB     . ALA D 3 61  ? 21.993  30.425  65.967 1.00 38.13 ? 65  ALA B CB     1 
ATOM   3030 H H      . ALA D 3 61  ? 20.966  30.214  63.656 1.00 0.00  ? 65  ALA B H      1 
ATOM   3031 N N      . ILE D 3 62  ? 23.815  29.130  63.973 1.00 35.90 ? 66  ILE B N      1 
ATOM   3032 C CA     . ILE D 3 62  ? 25.006  28.375  63.640 1.00 32.55 ? 66  ILE B CA     1 
ATOM   3033 C C      . ILE D 3 62  ? 25.823  29.194  62.658 1.00 37.37 ? 66  ILE B C      1 
ATOM   3034 O O      . ILE D 3 62  ? 26.930  29.652  62.973 1.00 40.27 ? 66  ILE B O      1 
ATOM   3035 C CB     . ILE D 3 62  ? 24.670  27.058  62.970 1.00 32.75 ? 66  ILE B CB     1 
ATOM   3036 C CG1    . ILE D 3 62  ? 23.671  26.290  63.804 1.00 35.17 ? 66  ILE B CG1    1 
ATOM   3037 C CG2    . ILE D 3 62  ? 25.925  26.205  62.840 1.00 27.23 ? 66  ILE B CG2    1 
ATOM   3038 C CD1    . ILE D 3 62  ? 24.199  25.951  65.170 1.00 44.16 ? 66  ILE B CD1    1 
ATOM   3039 H H      . ILE D 3 62  ? 22.884  28.751  63.967 1.00 0.00  ? 66  ILE B H      1 
ATOM   3040 N N      . LEU D 3 63  ? 25.180  29.529  61.544 1.00 34.35 ? 67  LEU B N      1 
ATOM   3041 C CA     . LEU D 3 63  ? 25.798  30.246  60.456 1.00 31.71 ? 67  LEU B CA     1 
ATOM   3042 C C      . LEU D 3 63  ? 26.366  31.610  60.781 1.00 33.21 ? 67  LEU B C      1 
ATOM   3043 O O      . LEU D 3 63  ? 27.303  32.072  60.121 1.00 34.79 ? 67  LEU B O      1 
ATOM   3044 C CB     . LEU D 3 63  ? 24.800  30.350  59.308 1.00 29.73 ? 67  LEU B CB     1 
ATOM   3045 C CG     . LEU D 3 63  ? 24.305  29.028  58.733 1.00 24.63 ? 67  LEU B CG     1 
ATOM   3046 C CD1    . LEU D 3 63  ? 23.180  29.350  57.801 1.00 26.82 ? 67  LEU B CD1    1 
ATOM   3047 C CD2    . LEU D 3 63  ? 25.388  28.277  58.004 1.00 24.97 ? 67  LEU B CD2    1 
ATOM   3048 H H      . LEU D 3 63  ? 24.197  29.415  61.496 1.00 0.00  ? 67  LEU B H      1 
ATOM   3049 N N      . SER D 3 64  ? 25.796  32.269  61.773 1.00 35.73 ? 68  SER B N      1 
ATOM   3050 C CA     . SER D 3 64  ? 26.275  33.580  62.165 1.00 40.92 ? 68  SER B CA     1 
ATOM   3051 C C      . SER D 3 64  ? 27.574  33.412  62.966 1.00 44.48 ? 68  SER B C      1 
ATOM   3052 O O      . SER D 3 64  ? 28.521  34.221  62.830 1.00 46.91 ? 68  SER B O      1 
ATOM   3053 C CB     . SER D 3 64  ? 25.208  34.302  62.970 1.00 40.09 ? 68  SER B CB     1 
ATOM   3054 O OG     . SER D 3 64  ? 25.461  35.698  63.006 1.00 49.07 ? 68  SER B OG     1 
ATOM   3055 H H      . SER D 3 64  ? 25.064  31.877  62.291 1.00 0.00  ? 68  SER B H      1 
ATOM   3056 H HG     . SER D 3 64  ? 24.880  36.076  63.662 1.00 0.00  ? 68  SER B HG     1 
ATOM   3057 N N      . LYS D 3 65  ? 27.637  32.352  63.777 1.00 47.05 ? 69  LYS B N      1 
ATOM   3058 C CA     . LYS D 3 65  ? 28.827  32.041  64.562 1.00 48.34 ? 69  LYS B CA     1 
ATOM   3059 C C      . LYS D 3 65  ? 29.974  31.862  63.573 1.00 49.54 ? 69  LYS B C      1 
ATOM   3060 O O      . LYS D 3 65  ? 30.946  32.618  63.587 1.00 52.99 ? 69  LYS B O      1 
ATOM   3061 C CB     . LYS D 3 65  ? 28.616  30.775  65.396 1.00 50.70 ? 69  LYS B CB     1 
ATOM   3062 C CG     . LYS D 3 65  ? 29.448  30.756  66.672 1.00 56.36 ? 69  LYS B CG     1 
ATOM   3063 C CD     . LYS D 3 65  ? 28.983  29.639  67.599 1.00 60.46 ? 69  LYS B CD     1 
ATOM   3064 C CE     . LYS D 3 65  ? 29.382  29.862  69.073 1.00 58.98 ? 69  LYS B CE     1 
ATOM   3065 N NZ     . LYS D 3 65  ? 28.803  28.796  69.949 1.00 57.91 ? 69  LYS B NZ     1 
ATOM   3066 H H      . LYS D 3 65  ? 26.812  31.830  63.954 1.00 0.00  ? 69  LYS B H      1 
ATOM   3067 H HZ1    . LYS D 3 65  ? 27.853  28.645  69.555 1.00 0.00  ? 69  LYS B HZ1    1 
ATOM   3068 H HZ2    . LYS D 3 65  ? 29.288  27.868  69.918 1.00 0.00  ? 69  LYS B HZ2    1 
ATOM   3069 H HZ3    . LYS D 3 65  ? 28.713  29.116  70.936 1.00 0.00  ? 69  LYS B HZ3    1 
ATOM   3070 N N      . TRP D 3 66  ? 29.777  30.960  62.616 1.00 48.73 ? 70  TRP B N      1 
ATOM   3071 C CA     . TRP D 3 66  ? 30.779  30.692  61.581 1.00 44.89 ? 70  TRP B CA     1 
ATOM   3072 C C      . TRP D 3 66  ? 31.226  31.977  60.892 1.00 43.55 ? 70  TRP B C      1 
ATOM   3073 O O      . TRP D 3 66  ? 32.416  32.280  60.850 1.00 44.11 ? 70  TRP B O      1 
ATOM   3074 C CB     . TRP D 3 66  ? 30.217  29.708  60.540 1.00 46.56 ? 70  TRP B CB     1 
ATOM   3075 C CG     . TRP D 3 66  ? 31.120  29.431  59.334 1.00 44.20 ? 70  TRP B CG     1 
ATOM   3076 C CD1    . TRP D 3 66  ? 32.063  28.444  59.227 1.00 44.28 ? 70  TRP B CD1    1 
ATOM   3077 C CD2    . TRP D 3 66  ? 31.120  30.127  58.076 1.00 42.37 ? 70  TRP B CD2    1 
ATOM   3078 N NE1    . TRP D 3 66  ? 32.654  28.485  57.977 1.00 41.03 ? 70  TRP B NE1    1 
ATOM   3079 C CE2    . TRP D 3 66  ? 32.098  29.505  57.259 1.00 42.94 ? 70  TRP B CE2    1 
ATOM   3080 C CE3    . TRP D 3 66  ? 30.401  31.210  57.568 1.00 43.82 ? 70  TRP B CE3    1 
ATOM   3081 C CZ2    . TRP D 3 66  ? 32.369  29.939  55.953 1.00 44.54 ? 70  TRP B CZ2    1 
ATOM   3082 C CZ3    . TRP D 3 66  ? 30.682  31.646  56.258 1.00 45.24 ? 70  TRP B CZ3    1 
ATOM   3083 C CH2    . TRP D 3 66  ? 31.657  31.008  55.476 1.00 43.42 ? 70  TRP B CH2    1 
ATOM   3084 H H      . TRP D 3 66  ? 28.874  30.553  62.634 1.00 0.00  ? 70  TRP B H      1 
ATOM   3085 H HE1    . TRP D 3 66  ? 33.470  28.014  57.711 1.00 0.00  ? 70  TRP B HE1    1 
ATOM   3086 N N      . LEU D 3 67  ? 30.270  32.770  60.417 1.00 43.23 ? 71  LEU B N      1 
ATOM   3087 C CA     . LEU D 3 67  ? 30.584  33.998  59.705 1.00 43.96 ? 71  LEU B CA     1 
ATOM   3088 C C      . LEU D 3 67  ? 31.562  34.936  60.427 1.00 48.23 ? 71  LEU B C      1 
ATOM   3089 O O      . LEU D 3 67  ? 32.654  35.151  59.892 1.00 48.66 ? 71  LEU B O      1 
ATOM   3090 C CB     . LEU D 3 67  ? 29.304  34.736  59.250 1.00 39.84 ? 71  LEU B CB     1 
ATOM   3091 C CG     . LEU D 3 67  ? 29.359  35.756  58.095 1.00 33.50 ? 71  LEU B CG     1 
ATOM   3092 C CD1    . LEU D 3 67  ? 29.787  35.055  56.810 1.00 32.94 ? 71  LEU B CD1    1 
ATOM   3093 C CD2    . LEU D 3 67  ? 28.010  36.395  57.874 1.00 27.29 ? 71  LEU B CD2    1 
ATOM   3094 H H      . LEU D 3 67  ? 29.318  32.575  60.525 1.00 0.00  ? 71  LEU B H      1 
ATOM   3095 N N      . GLU D 3 68  ? 31.271  35.424  61.646 1.00 51.14 ? 72  GLU B N      1 
ATOM   3096 C CA     . GLU D 3 68  ? 32.236  36.361  62.257 1.00 54.06 ? 72  GLU B CA     1 
ATOM   3097 C C      . GLU D 3 68  ? 33.543  35.686  62.585 1.00 54.39 ? 72  GLU B C      1 
ATOM   3098 O O      . GLU D 3 68  ? 34.556  36.351  62.773 1.00 57.78 ? 72  GLU B O      1 
ATOM   3099 C CB     . GLU D 3 68  ? 31.703  37.152  63.468 1.00 57.10 ? 72  GLU B CB     1 
ATOM   3100 C CG     . GLU D 3 68  ? 32.404  38.558  63.589 1.00 57.54 ? 72  GLU B CG     1 
ATOM   3101 C CD     . GLU D 3 68  ? 31.800  39.472  64.651 1.00 57.25 ? 72  GLU B CD     1 
ATOM   3102 O OE1    . GLU D 3 68  ? 32.058  39.229  65.843 1.00 57.34 ? 72  GLU B OE1    1 
ATOM   3103 O OE2    . GLU D 3 68  ? 31.086  40.437  64.300 1.00 53.36 ? 72  GLU B OE2    1 
ATOM   3104 H H      . GLU D 3 68  ? 30.461  35.104  62.137 1.00 0.00  ? 72  GLU B H      1 
ATOM   3105 N N      . GLU D 3 69  ? 33.503  34.366  62.686 1.00 53.39 ? 73  GLU B N      1 
ATOM   3106 C CA     . GLU D 3 69  ? 34.675  33.562  62.945 1.00 53.61 ? 73  GLU B CA     1 
ATOM   3107 C C      . GLU D 3 69  ? 35.515  33.619  61.681 1.00 55.39 ? 73  GLU B C      1 
ATOM   3108 O O      . GLU D 3 69  ? 36.750  33.720  61.734 1.00 57.69 ? 73  GLU B O      1 
ATOM   3109 C CB     . GLU D 3 69  ? 34.248  32.141  63.190 1.00 52.33 ? 73  GLU B CB     1 
ATOM   3110 C CG     . GLU D 3 69  ? 35.328  31.284  63.674 1.00 54.48 ? 73  GLU B CG     1 
ATOM   3111 C CD     . GLU D 3 69  ? 34.766  30.125  64.402 1.00 56.54 ? 73  GLU B CD     1 
ATOM   3112 O OE1    . GLU D 3 69  ? 34.459  30.279  65.612 1.00 60.00 ? 73  GLU B OE1    1 
ATOM   3113 O OE2    . GLU D 3 69  ? 34.603  29.068  63.757 1.00 57.53 ? 73  GLU B OE2    1 
ATOM   3114 H H      . GLU D 3 69  ? 32.668  33.879  62.692 1.00 0.00  ? 73  GLU B H      1 
ATOM   3115 N N      . ALA D 3 70  ? 34.843  33.457  60.548 1.00 56.28 ? 74  ALA B N      1 
ATOM   3116 C CA     . ALA D 3 70  ? 35.497  33.543  59.262 1.00 56.06 ? 74  ALA B CA     1 
ATOM   3117 C C      . ALA D 3 70  ? 35.463  35.042  58.918 1.00 55.20 ? 74  ALA B C      1 
ATOM   3118 O O      . ALA D 3 70  ? 35.788  35.390  57.771 1.00 59.00 ? 74  ALA B O      1 
ATOM   3119 C CB     . ALA D 3 70  ? 34.744  32.706  58.229 1.00 52.35 ? 74  ALA B CB     1 
ATOM   3120 H H      . ALA D 3 70  ? 33.903  33.230  60.593 1.00 0.00  ? 74  ALA B H      1 
ATOM   3121 N N      . LYS D 3 89  ? 34.591  31.227  37.521 1.00 82.14 ? 103 LYS B N      1 
ATOM   3122 C CA     . LYS D 3 89  ? 33.883  32.494  37.918 1.00 79.05 ? 103 LYS B CA     1 
ATOM   3123 C C      . LYS D 3 89  ? 33.075  32.404  39.203 1.00 77.55 ? 103 LYS B C      1 
ATOM   3124 O O      . LYS D 3 89  ? 32.818  31.314  39.731 1.00 77.68 ? 103 LYS B O      1 
ATOM   3125 C CB     . LYS D 3 89  ? 32.928  32.944  36.807 1.00 75.84 ? 103 LYS B CB     1 
ATOM   3126 C CG     . LYS D 3 89  ? 33.426  34.143  36.054 1.00 73.82 ? 103 LYS B CG     1 
ATOM   3127 C CD     . LYS D 3 89  ? 32.315  34.761  35.233 1.00 72.03 ? 103 LYS B CD     1 
ATOM   3128 C CE     . LYS D 3 89  ? 32.626  36.207  34.869 1.00 71.05 ? 103 LYS B CE     1 
ATOM   3129 N NZ     . LYS D 3 89  ? 31.483  36.835  34.153 1.00 69.37 ? 103 LYS B NZ     1 
ATOM   3130 H HZ1    . LYS D 3 89  ? 30.635  36.741  34.756 1.00 0.00  ? 103 LYS B HZ1    1 
ATOM   3131 H HZ2    . LYS D 3 89  ? 31.681  37.839  33.989 1.00 0.00  ? 103 LYS B HZ2    1 
ATOM   3132 H HZ3    . LYS D 3 89  ? 31.340  36.333  33.251 1.00 0.00  ? 103 LYS B HZ3    1 
ATOM   3133 N N      . ARG D 3 90  ? 32.747  33.574  39.737 1.00 75.63 ? 104 ARG B N      1 
ATOM   3134 C CA     . ARG D 3 90  ? 31.908  33.646  40.925 1.00 73.40 ? 104 ARG B CA     1 
ATOM   3135 C C      . ARG D 3 90  ? 30.576  33.823  40.222 1.00 72.29 ? 104 ARG B C      1 
ATOM   3136 O O      . ARG D 3 90  ? 30.377  34.807  39.499 1.00 71.98 ? 104 ARG B O      1 
ATOM   3137 C CB     . ARG D 3 90  ? 32.243  34.870  41.769 1.00 72.77 ? 104 ARG B CB     1 
ATOM   3138 C CG     . ARG D 3 90  ? 33.558  34.732  42.526 1.00 76.68 ? 104 ARG B CG     1 
ATOM   3139 C CD     . ARG D 3 90  ? 33.865  35.985  43.369 1.00 78.59 ? 104 ARG B CD     1 
ATOM   3140 N NE     . ARG D 3 90  ? 34.956  35.777  44.341 1.00 76.63 ? 104 ARG B NE     1 
ATOM   3141 C CZ     . ARG D 3 90  ? 35.511  36.752  45.066 1.00 76.30 ? 104 ARG B CZ     1 
ATOM   3142 N NH1    . ARG D 3 90  ? 35.091  38.016  44.930 1.00 76.53 ? 104 ARG B NH1    1 
ATOM   3143 N NH2    . ARG D 3 90  ? 36.510  36.478  45.895 1.00 74.80 ? 104 ARG B NH2    1 
ATOM   3144 H H      . ARG D 3 90  ? 32.942  34.414  39.269 1.00 0.00  ? 104 ARG B H      1 
ATOM   3145 H HE     . ARG D 3 90  ? 35.382  34.894  44.364 1.00 0.00  ? 104 ARG B HE     1 
ATOM   3146 H HH11   . ARG D 3 90  ? 34.431  38.256  44.217 1.00 0.00  ? 104 ARG B HH11   1 
ATOM   3147 H HH12   . ARG D 3 90  ? 35.537  38.748  45.441 1.00 0.00  ? 104 ARG B HH12   1 
ATOM   3148 H HH21   . ARG D 3 90  ? 36.880  35.546  45.915 1.00 0.00  ? 104 ARG B HH21   1 
ATOM   3149 H HH22   . ARG D 3 90  ? 36.950  37.216  46.420 1.00 0.00  ? 104 ARG B HH22   1 
ATOM   3150 N N      . ARG D 3 91  ? 29.758  32.770  40.276 1.00 71.04 ? 105 ARG B N      1 
ATOM   3151 C CA     . ARG D 3 91  ? 28.436  32.757  39.650 1.00 65.93 ? 105 ARG B CA     1 
ATOM   3152 C C      . ARG D 3 91  ? 27.592  34.016  39.813 1.00 65.07 ? 105 ARG B C      1 
ATOM   3153 O O      . ARG D 3 91  ? 27.342  34.522  40.931 1.00 63.62 ? 105 ARG B O      1 
ATOM   3154 C CB     . ARG D 3 91  ? 27.606  31.585  40.166 1.00 62.96 ? 105 ARG B CB     1 
ATOM   3155 C CG     . ARG D 3 91  ? 27.845  30.270  39.473 1.00 57.41 ? 105 ARG B CG     1 
ATOM   3156 C CD     . ARG D 3 91  ? 26.897  29.252  40.079 1.00 53.24 ? 105 ARG B CD     1 
ATOM   3157 N NE     . ARG D 3 91  ? 26.167  28.487  39.066 1.00 46.16 ? 105 ARG B NE     1 
ATOM   3158 C CZ     . ARG D 3 91  ? 24.839  28.320  39.041 1.00 44.46 ? 105 ARG B CZ     1 
ATOM   3159 N NH1    . ARG D 3 91  ? 24.055  28.909  39.931 1.00 45.70 ? 105 ARG B NH1    1 
ATOM   3160 N NH2    . ARG D 3 91  ? 24.292  27.541  38.147 1.00 41.27 ? 105 ARG B NH2    1 
ATOM   3161 H H      . ARG D 3 91  ? 30.057  31.949  40.762 1.00 0.00  ? 105 ARG B H      1 
ATOM   3162 H HE     . ARG D 3 91  ? 26.722  28.115  38.345 1.00 0.00  ? 105 ARG B HE     1 
ATOM   3163 H HH11   . ARG D 3 91  ? 24.347  29.436  40.726 1.00 0.00  ? 105 ARG B HH11   1 
ATOM   3164 H HH12   . ARG D 3 91  ? 23.107  28.641  39.797 1.00 0.00  ? 105 ARG B HH12   1 
ATOM   3165 H HH21   . ARG D 3 91  ? 24.990  27.119  37.543 1.00 0.00  ? 105 ARG B HH21   1 
ATOM   3166 H HH22   . ARG D 3 91  ? 23.329  27.313  38.001 1.00 0.00  ? 105 ARG B HH22   1 
ATOM   3167 N N      . THR D 3 92  ? 27.063  34.439  38.672 1.00 64.25 ? 106 THR B N      1 
ATOM   3168 C CA     . THR D 3 92  ? 26.201  35.603  38.594 1.00 62.46 ? 106 THR B CA     1 
ATOM   3169 C C      . THR D 3 92  ? 24.778  35.056  38.480 1.00 59.92 ? 106 THR B C      1 
ATOM   3170 O O      . THR D 3 92  ? 24.537  34.105  37.708 1.00 59.58 ? 106 THR B O      1 
ATOM   3171 C CB     . THR D 3 92  ? 26.582  36.459  37.343 1.00 61.16 ? 106 THR B CB     1 
ATOM   3172 O OG1    . THR D 3 92  ? 28.013  36.664  37.339 1.00 58.27 ? 106 THR B OG1    1 
ATOM   3173 C CG2    . THR D 3 92  ? 25.877  37.820  37.380 1.00 60.60 ? 106 THR B CG2    1 
ATOM   3174 H H      . THR D 3 92  ? 27.217  33.938  37.844 1.00 0.00  ? 106 THR B H      1 
ATOM   3175 H HG1    . THR D 3 92  ? 28.369  35.776  37.261 1.00 0.00  ? 106 THR B HG1    1 
ATOM   3176 N N      . THR D 3 93  ? 23.876  35.538  39.327 1.00 56.36 ? 107 THR B N      1 
ATOM   3177 C CA     . THR D 3 93  ? 22.487  35.084  39.232 1.00 55.68 ? 107 THR B CA     1 
ATOM   3178 C C      . THR D 3 93  ? 21.765  36.127  38.395 1.00 51.24 ? 107 THR B C      1 
ATOM   3179 O O      . THR D 3 93  ? 21.873  37.321  38.679 1.00 50.29 ? 107 THR B O      1 
ATOM   3180 C CB     . THR D 3 93  ? 21.822  34.984  40.631 1.00 57.60 ? 107 THR B CB     1 
ATOM   3181 O OG1    . THR D 3 93  ? 22.269  36.089  41.452 1.00 65.06 ? 107 THR B OG1    1 
ATOM   3182 C CG2    . THR D 3 93  ? 22.194  33.660  41.297 1.00 59.35 ? 107 THR B CG2    1 
ATOM   3183 H H      . THR D 3 93  ? 24.090  36.202  40.040 1.00 0.00  ? 107 THR B H      1 
ATOM   3184 H HG1    . THR D 3 93  ? 21.934  36.221  42.345 1.00 0.00  ? 107 THR B HG1    1 
ATOM   3185 N N      . ILE D 3 94  ? 21.128  35.702  37.320 1.00 49.70 ? 108 ILE B N      1 
ATOM   3186 C CA     . ILE D 3 94  ? 20.422  36.642  36.465 1.00 48.03 ? 108 ILE B CA     1 
ATOM   3187 C C      . ILE D 3 94  ? 18.973  36.592  36.882 1.00 48.74 ? 108 ILE B C      1 
ATOM   3188 O O      . ILE D 3 94  ? 18.383  35.514  36.924 1.00 52.56 ? 108 ILE B O      1 
ATOM   3189 C CB     . ILE D 3 94  ? 20.621  36.263  34.984 1.00 48.77 ? 108 ILE B CB     1 
ATOM   3190 C CG1    . ILE D 3 94  ? 22.108  36.402  34.662 1.00 45.98 ? 108 ILE B CG1    1 
ATOM   3191 C CG2    . ILE D 3 94  ? 19.768  37.116  34.047 1.00 43.85 ? 108 ILE B CG2    1 
ATOM   3192 C CD1    . ILE D 3 94  ? 22.714  37.752  34.997 1.00 48.85 ? 108 ILE B CD1    1 
ATOM   3193 H H      . ILE D 3 94  ? 21.108  34.754  37.013 1.00 0.00  ? 108 ILE B H      1 
ATOM   3194 N N      . SER D 3 95  ? 18.409  37.741  37.225 1.00 46.68 ? 109 SER B N      1 
ATOM   3195 C CA     . SER D 3 95  ? 17.032  37.789  37.694 1.00 46.54 ? 109 SER B CA     1 
ATOM   3196 C C      . SER D 3 95  ? 15.957  37.247  36.784 1.00 46.57 ? 109 SER B C      1 
ATOM   3197 O O      . SER D 3 95  ? 16.093  37.250  35.573 1.00 47.24 ? 109 SER B O      1 
ATOM   3198 C CB     . SER D 3 95  ? 16.666  39.202  38.110 1.00 46.71 ? 109 SER B CB     1 
ATOM   3199 O OG     . SER D 3 95  ? 16.869  40.109  37.053 1.00 52.33 ? 109 SER B OG     1 
ATOM   3200 H H      . SER D 3 95  ? 18.948  38.582  37.223 1.00 0.00  ? 109 SER B H      1 
ATOM   3201 H HG     . SER D 3 95  ? 16.838  41.028  37.381 1.00 0.00  ? 109 SER B HG     1 
ATOM   3202 N N      . ILE D 3 96  ? 14.813  36.936  37.390 1.00 50.06 ? 110 ILE B N      1 
ATOM   3203 C CA     . ILE D 3 96  ? 13.657  36.390  36.675 1.00 49.00 ? 110 ILE B CA     1 
ATOM   3204 C C      . ILE D 3 96  ? 12.932  37.511  35.968 1.00 48.18 ? 110 ILE B C      1 
ATOM   3205 O O      . ILE D 3 96  ? 11.716  37.497  35.819 1.00 53.46 ? 110 ILE B O      1 
ATOM   3206 C CB     . ILE D 3 96  ? 12.700  35.678  37.648 1.00 49.74 ? 110 ILE B CB     1 
ATOM   3207 C CG1    . ILE D 3 96  ? 13.522  34.762  38.557 1.00 50.64 ? 110 ILE B CG1    1 
ATOM   3208 C CG2    . ILE D 3 96  ? 11.670  34.842  36.863 1.00 49.43 ? 110 ILE B CG2    1 
ATOM   3209 C CD1    . ILE D 3 96  ? 12.809  34.324  39.812 1.00 53.09 ? 110 ILE B CD1    1 
ATOM   3210 H H      . ILE D 3 96  ? 14.663  37.097  38.362 1.00 0.00  ? 110 ILE B H      1 
ATOM   3211 N N      . ALA D 3 97  ? 13.679  38.550  35.660 1.00 45.83 ? 111 ALA B N      1 
ATOM   3212 C CA     . ALA D 3 97  ? 13.156  39.690  34.945 1.00 44.17 ? 111 ALA B CA     1 
ATOM   3213 C C      . ALA D 3 97  ? 14.128  39.878  33.764 1.00 40.92 ? 111 ALA B C      1 
ATOM   3214 O O      . ALA D 3 97  ? 13.724  40.148  32.621 1.00 35.57 ? 111 ALA B O      1 
ATOM   3215 C CB     . ALA D 3 97  ? 13.154  40.916  35.858 1.00 44.14 ? 111 ALA B CB     1 
ATOM   3216 H H      . ALA D 3 97  ? 14.546  38.722  36.042 1.00 0.00  ? 111 ALA B H      1 
ATOM   3217 N N      . ALA D 3 98  ? 15.414  39.773  34.079 1.00 37.67 ? 112 ALA B N      1 
ATOM   3218 C CA     . ALA D 3 98  ? 16.475  39.891  33.105 1.00 38.43 ? 112 ALA B CA     1 
ATOM   3219 C C      . ALA D 3 98  ? 16.442  38.671  32.207 1.00 38.13 ? 112 ALA B C      1 
ATOM   3220 O O      . ALA D 3 98  ? 16.396  38.810  30.989 1.00 39.53 ? 112 ALA B O      1 
ATOM   3221 C CB     . ALA D 3 98  ? 17.825  39.988  33.811 1.00 33.88 ? 112 ALA B CB     1 
ATOM   3222 H H      . ALA D 3 98  ? 15.709  39.741  35.009 1.00 0.00  ? 112 ALA B H      1 
ATOM   3223 N N      . LYS D 3 99  ? 16.365  37.487  32.814 1.00 38.23 ? 113 LYS B N      1 
ATOM   3224 C CA     . LYS D 3 99  ? 16.369  36.200  32.098 1.00 36.80 ? 113 LYS B CA     1 
ATOM   3225 C C      . LYS D 3 99  ? 15.261  36.023  31.054 1.00 39.56 ? 113 LYS B C      1 
ATOM   3226 O O      . LYS D 3 99  ? 15.528  35.679  29.915 1.00 39.74 ? 113 LYS B O      1 
ATOM   3227 C CB     . LYS D 3 99  ? 16.321  35.038  33.089 1.00 29.20 ? 113 LYS B CB     1 
ATOM   3228 C CG     . LYS D 3 99  ? 16.411  33.703  32.422 1.00 34.95 ? 113 LYS B CG     1 
ATOM   3229 C CD     . LYS D 3 99  ? 17.869  33.188  32.332 1.00 37.94 ? 113 LYS B CD     1 
ATOM   3230 C CE     . LYS D 3 99  ? 17.884  31.697  31.935 1.00 33.93 ? 113 LYS B CE     1 
ATOM   3231 N NZ     . LYS D 3 99  ? 19.183  31.024  32.192 1.00 30.39 ? 113 LYS B NZ     1 
ATOM   3232 H H      . LYS D 3 99  ? 16.278  37.437  33.790 1.00 0.00  ? 113 LYS B H      1 
ATOM   3233 H HZ1    . LYS D 3 99  ? 19.562  31.380  33.049 1.00 0.00  ? 113 LYS B HZ1    1 
ATOM   3234 H HZ2    . LYS D 3 99  ? 19.124  29.995  32.392 1.00 0.00  ? 113 LYS B HZ2    1 
ATOM   3235 H HZ3    . LYS D 3 99  ? 19.835  31.208  31.388 1.00 0.00  ? 113 LYS B HZ3    1 
ATOM   3236 N N      . ASP D 3 100 ? 14.015  36.290  31.442 1.00 41.50 ? 114 ASP B N      1 
ATOM   3237 C CA     . ASP D 3 100 ? 12.901  36.133  30.522 1.00 36.93 ? 114 ASP B CA     1 
ATOM   3238 C C      . ASP D 3 100 ? 12.668  37.384  29.711 1.00 33.45 ? 114 ASP B C      1 
ATOM   3239 O O      . ASP D 3 100 ? 11.614  37.578  29.118 1.00 37.61 ? 114 ASP B O      1 
ATOM   3240 C CB     . ASP D 3 100 ? 11.649  35.676  31.258 1.00 42.39 ? 114 ASP B CB     1 
ATOM   3241 C CG     . ASP D 3 100 ? 11.386  36.455  32.531 1.00 45.63 ? 114 ASP B CG     1 
ATOM   3242 O OD1    . ASP D 3 100 ? 12.149  37.395  32.848 1.00 50.70 ? 114 ASP B OD1    1 
ATOM   3243 O OD2    . ASP D 3 100 ? 10.404  36.125  33.222 1.00 46.29 ? 114 ASP B OD2    1 
ATOM   3244 H H      . ASP D 3 100 ? 13.896  36.598  32.386 1.00 0.00  ? 114 ASP B H      1 
ATOM   3245 N N      . ALA D 3 101 ? 13.671  38.247  29.715 1.00 30.57 ? 115 ALA B N      1 
ATOM   3246 C CA     . ALA D 3 101 ? 13.667  39.472  28.938 1.00 28.65 ? 115 ALA B CA     1 
ATOM   3247 C C      . ALA D 3 101 ? 14.904  39.399  28.011 1.00 28.44 ? 115 ALA B C      1 
ATOM   3248 O O      . ALA D 3 101 ? 15.112  40.260  27.154 1.00 31.06 ? 115 ALA B O      1 
ATOM   3249 C CB     . ALA D 3 101 ? 13.734  40.644  29.829 1.00 26.13 ? 115 ALA B CB     1 
ATOM   3250 H H      . ALA D 3 101 ? 14.457  38.087  30.279 1.00 0.00  ? 115 ALA B H      1 
ATOM   3251 N N      . LEU D 3 102 ? 15.750  38.397  28.241 1.00 25.88 ? 116 LEU B N      1 
ATOM   3252 C CA     . LEU D 3 102 ? 16.915  38.175  27.406 1.00 26.17 ? 116 LEU B CA     1 
ATOM   3253 C C      . LEU D 3 102 ? 16.336  37.236  26.389 1.00 27.38 ? 116 LEU B C      1 
ATOM   3254 O O      . LEU D 3 102 ? 16.651  37.356  25.195 1.00 30.79 ? 116 LEU B O      1 
ATOM   3255 C CB     . LEU D 3 102 ? 18.055  37.451  28.151 1.00 23.53 ? 116 LEU B CB     1 
ATOM   3256 C CG     . LEU D 3 102 ? 19.101  38.258  28.936 1.00 22.15 ? 116 LEU B CG     1 
ATOM   3257 C CD1    . LEU D 3 102 ? 20.131  37.335  29.492 1.00 19.03 ? 116 LEU B CD1    1 
ATOM   3258 C CD2    . LEU D 3 102 ? 19.786  39.283  28.096 1.00 18.18 ? 116 LEU B CD2    1 
ATOM   3259 H H      . LEU D 3 102 ? 15.584  37.789  29.012 1.00 0.00  ? 116 LEU B H      1 
ATOM   3260 N N      . GLU D 3 103 ? 15.492  36.324  26.892 1.00 23.08 ? 117 GLU B N      1 
ATOM   3261 C CA     . GLU D 3 103 ? 14.791  35.305  26.120 1.00 24.26 ? 117 GLU B CA     1 
ATOM   3262 C C      . GLU D 3 103 ? 13.813  35.954  25.162 1.00 24.70 ? 117 GLU B C      1 
ATOM   3263 O O      . GLU D 3 103 ? 13.444  35.364  24.154 1.00 31.88 ? 117 GLU B O      1 
ATOM   3264 C CB     . GLU D 3 103 ? 14.023  34.372  27.057 1.00 30.67 ? 117 GLU B CB     1 
ATOM   3265 C CG     . GLU D 3 103 ? 14.124  32.866  26.705 1.00 41.11 ? 117 GLU B CG     1 
ATOM   3266 C CD     . GLU D 3 103 ? 14.773  32.030  27.816 1.00 45.21 ? 117 GLU B CD     1 
ATOM   3267 O OE1    . GLU D 3 103 ? 15.109  32.598  28.879 1.00 49.47 ? 117 GLU B OE1    1 
ATOM   3268 O OE2    . GLU D 3 103 ? 14.956  30.803  27.629 1.00 50.29 ? 117 GLU B OE2    1 
ATOM   3269 H H      . GLU D 3 103 ? 15.370  36.244  27.862 1.00 0.00  ? 117 GLU B H      1 
ATOM   3270 N N      . ARG D 3 104 ? 13.378  37.161  25.484 1.00 23.51 ? 118 ARG B N      1 
ATOM   3271 C CA     . ARG D 3 104 ? 12.473  37.918  24.637 1.00 23.06 ? 118 ARG B CA     1 
ATOM   3272 C C      . ARG D 3 104 ? 13.301  38.672  23.546 1.00 28.93 ? 118 ARG B C      1 
ATOM   3273 O O      . ARG D 3 104 ? 12.773  39.147  22.555 1.00 31.37 ? 118 ARG B O      1 
ATOM   3274 C CB     . ARG D 3 104 ? 11.743  38.900  25.538 1.00 25.61 ? 118 ARG B CB     1 
ATOM   3275 C CG     . ARG D 3 104 ? 10.961  40.000  24.865 1.00 30.67 ? 118 ARG B CG     1 
ATOM   3276 C CD     . ARG D 3 104 ? 9.655   39.494  24.309 1.00 36.07 ? 118 ARG B CD     1 
ATOM   3277 N NE     . ARG D 3 104 ? 8.833   40.618  23.874 1.00 40.73 ? 118 ARG B NE     1 
ATOM   3278 C CZ     . ARG D 3 104 ? 7.728   40.514  23.146 1.00 43.06 ? 118 ARG B CZ     1 
ATOM   3279 N NH1    . ARG D 3 104 ? 7.280   39.323  22.765 1.00 47.30 ? 118 ARG B NH1    1 
ATOM   3280 N NH2    . ARG D 3 104 ? 7.093   41.613  22.788 1.00 45.95 ? 118 ARG B NH2    1 
ATOM   3281 H H      . ARG D 3 104 ? 13.712  37.576  26.322 1.00 0.00  ? 118 ARG B H      1 
ATOM   3282 H HE     . ARG D 3 104 ? 9.103   41.514  24.138 1.00 0.00  ? 118 ARG B HE     1 
ATOM   3283 H HH11   . ARG D 3 104 ? 7.779   38.504  23.034 1.00 0.00  ? 118 ARG B HH11   1 
ATOM   3284 H HH12   . ARG D 3 104 ? 6.468   39.259  22.192 1.00 0.00  ? 118 ARG B HH12   1 
ATOM   3285 H HH21   . ARG D 3 104 ? 7.408   42.528  23.043 1.00 0.00  ? 118 ARG B HH21   1 
ATOM   3286 H HH22   . ARG D 3 104 ? 6.309   41.539  22.205 1.00 0.00  ? 118 ARG B HH22   1 
ATOM   3287 N N      . HIS D 3 105 ? 14.592  38.848  23.799 1.00 30.88 ? 119 HIS B N      1 
ATOM   3288 C CA     . HIS D 3 105 ? 15.517  39.509  22.904 1.00 29.32 ? 119 HIS B CA     1 
ATOM   3289 C C      . HIS D 3 105 ? 16.087  38.434  21.940 1.00 31.44 ? 119 HIS B C      1 
ATOM   3290 O O      . HIS D 3 105 ? 16.437  38.719  20.784 1.00 31.37 ? 119 HIS B O      1 
ATOM   3291 C CB     . HIS D 3 105 ? 16.629  40.131  23.753 1.00 31.47 ? 119 HIS B CB     1 
ATOM   3292 C CG     . HIS D 3 105 ? 16.589  41.628  23.821 1.00 38.57 ? 119 HIS B CG     1 
ATOM   3293 N ND1    . HIS D 3 105 ? 16.399  42.312  25.006 1.00 41.10 ? 119 HIS B ND1    1 
ATOM   3294 C CD2    . HIS D 3 105 ? 16.803  42.577  22.871 1.00 40.09 ? 119 HIS B CD2    1 
ATOM   3295 C CE1    . HIS D 3 105 ? 16.517  43.613  24.792 1.00 39.83 ? 119 HIS B CE1    1 
ATOM   3296 N NE2    . HIS D 3 105 ? 16.758  43.801  23.504 1.00 42.60 ? 119 HIS B NE2    1 
ATOM   3297 H H      . HIS D 3 105 ? 14.945  38.453  24.601 1.00 0.00  ? 119 HIS B H      1 
ATOM   3298 H HD1    . HIS D 3 105 ? 16.054  41.850  25.817 1.00 0.00  ? 119 HIS B HD1    1 
ATOM   3299 H HE2    . HIS D 3 105 ? 16.817  44.652  23.022 1.00 0.00  ? 119 HIS B HE2    1 
ATOM   3300 N N      . PHE D 3 106 ? 16.111  37.192  22.415 1.00 29.37 ? 120 PHE B N      1 
ATOM   3301 C CA     . PHE D 3 106 ? 16.601  36.055  21.652 1.00 29.56 ? 120 PHE B CA     1 
ATOM   3302 C C      . PHE D 3 106 ? 15.651  35.732  20.487 1.00 35.55 ? 120 PHE B C      1 
ATOM   3303 O O      . PHE D 3 106 ? 16.100  35.491  19.350 1.00 37.02 ? 120 PHE B O      1 
ATOM   3304 C CB     . PHE D 3 106 ? 16.724  34.861  22.592 1.00 18.94 ? 120 PHE B CB     1 
ATOM   3305 C CG     . PHE D 3 106 ? 17.219  33.581  21.948 1.00 12.24 ? 120 PHE B CG     1 
ATOM   3306 C CD1    . PHE D 3 106 ? 18.568  33.352  21.771 1.00 12.18 ? 120 PHE B CD1    1 
ATOM   3307 C CD2    . PHE D 3 106 ? 16.343  32.553  21.649 1.00 14.05 ? 120 PHE B CD2    1 
ATOM   3308 C CE1    . PHE D 3 106 ? 19.046  32.097  21.331 1.00 10.53 ? 120 PHE B CE1    1 
ATOM   3309 C CE2    . PHE D 3 106 ? 16.803  31.293  21.209 1.00 13.92 ? 120 PHE B CE2    1 
ATOM   3310 C CZ     . PHE D 3 106 ? 18.164  31.066  21.043 1.00 13.87 ? 120 PHE B CZ     1 
ATOM   3311 H H      . PHE D 3 106 ? 15.819  37.017  23.340 1.00 0.00  ? 120 PHE B H      1 
ATOM   3312 N N      . GLY D 3 107 ? 14.347  35.648  20.791 1.00 37.63 ? 121 GLY B N      1 
ATOM   3313 C CA     . GLY D 3 107 ? 13.361  35.338  19.766 1.00 37.96 ? 121 GLY B CA     1 
ATOM   3314 C C      . GLY D 3 107 ? 13.412  36.335  18.632 1.00 42.81 ? 121 GLY B C      1 
ATOM   3315 O O      . GLY D 3 107 ? 13.176  35.961  17.475 1.00 46.01 ? 121 GLY B O      1 
ATOM   3316 H H      . GLY D 3 107 ? 14.005  35.744  21.712 1.00 0.00  ? 121 GLY B H      1 
ATOM   3317 N N      . GLU D 3 108 ? 13.698  37.597  18.969 1.00 39.68 ? 122 GLU B N      1 
ATOM   3318 C CA     . GLU D 3 108 ? 13.788  38.672  17.993 1.00 43.26 ? 122 GLU B CA     1 
ATOM   3319 C C      . GLU D 3 108 ? 14.976  38.350  17.121 1.00 46.01 ? 122 GLU B C      1 
ATOM   3320 O O      . GLU D 3 108 ? 14.869  38.306  15.876 1.00 50.89 ? 122 GLU B O      1 
ATOM   3321 C CB     . GLU D 3 108 ? 14.049  40.013  18.646 1.00 44.88 ? 122 GLU B CB     1 
ATOM   3322 C CG     . GLU D 3 108 ? 13.139  40.304  19.791 1.00 53.61 ? 122 GLU B CG     1 
ATOM   3323 C CD     . GLU D 3 108 ? 12.124  41.362  19.493 1.00 57.45 ? 122 GLU B CD     1 
ATOM   3324 O OE1    . GLU D 3 108 ? 11.482  41.264  18.427 1.00 61.55 ? 122 GLU B OE1    1 
ATOM   3325 O OE2    . GLU D 3 108 ? 11.948  42.276  20.340 1.00 61.20 ? 122 GLU B OE2    1 
ATOM   3326 H H      . GLU D 3 108 ? 13.900  37.758  19.919 1.00 0.00  ? 122 GLU B H      1 
ATOM   3327 N N      . HIS D 3 109 ? 16.141  38.200  17.761 1.00 41.72 ? 123 HIS B N      1 
ATOM   3328 C CA     . HIS D 3 109 ? 17.360  37.869  17.043 1.00 36.73 ? 123 HIS B CA     1 
ATOM   3329 C C      . HIS D 3 109 ? 18.204  37.014  17.948 1.00 36.64 ? 123 HIS B C      1 
ATOM   3330 O O      . HIS D 3 109 ? 18.469  37.409  19.068 1.00 39.29 ? 123 HIS B O      1 
ATOM   3331 C CB     . HIS D 3 109 ? 18.025  39.159  16.621 1.00 35.30 ? 123 HIS B CB     1 
ATOM   3332 C CG     . HIS D 3 109 ? 17.177  39.994  15.701 1.00 39.32 ? 123 HIS B CG     1 
ATOM   3333 N ND1    . HIS D 3 109 ? 16.689  41.238  16.048 1.00 41.74 ? 123 HIS B ND1    1 
ATOM   3334 C CD2    . HIS D 3 109 ? 16.660  39.727  14.477 1.00 36.60 ? 123 HIS B CD2    1 
ATOM   3335 C CE1    . HIS D 3 109 ? 15.928  41.705  15.080 1.00 38.65 ? 123 HIS B CE1    1 
ATOM   3336 N NE2    . HIS D 3 109 ? 15.899  40.807  14.116 1.00 41.59 ? 123 HIS B NE2    1 
ATOM   3337 H H      . HIS D 3 109 ? 16.235  38.411  18.723 1.00 0.00  ? 123 HIS B H      1 
ATOM   3338 H HD1    . HIS D 3 109 ? 16.845  41.614  16.955 1.00 0.00  ? 123 HIS B HD1    1 
ATOM   3339 H HE2    . HIS D 3 109 ? 15.469  40.929  13.219 1.00 0.00  ? 123 HIS B HE2    1 
ATOM   3340 N N      . SER D 3 110 ? 18.587  35.824  17.485 1.00 33.92 ? 124 SER B N      1 
ATOM   3341 C CA     . SER D 3 110 ? 19.370  34.926  18.323 1.00 31.77 ? 124 SER B CA     1 
ATOM   3342 C C      . SER D 3 110 ? 20.869  35.041  18.159 1.00 31.26 ? 124 SER B C      1 
ATOM   3343 O O      . SER D 3 110 ? 21.612  34.154  18.546 1.00 34.15 ? 124 SER B O      1 
ATOM   3344 C CB     . SER D 3 110 ? 18.934  33.483  18.116 1.00 31.82 ? 124 SER B CB     1 
ATOM   3345 O OG     . SER D 3 110 ? 19.346  32.992  16.864 1.00 35.82 ? 124 SER B OG     1 
ATOM   3346 H H      . SER D 3 110 ? 18.292  35.570  16.562 1.00 0.00  ? 124 SER B H      1 
ATOM   3347 H HG     . SER D 3 110 ? 20.299  32.871  16.813 1.00 0.00  ? 124 SER B HG     1 
ATOM   3348 N N      . LYS D 3 111 ? 21.329  36.141  17.597 1.00 30.84 ? 125 LYS B N      1 
ATOM   3349 C CA     . LYS D 3 111 ? 22.756  36.309  17.408 1.00 34.06 ? 125 LYS B CA     1 
ATOM   3350 C C      . LYS D 3 111 ? 22.978  37.804  17.322 1.00 37.09 ? 125 LYS B C      1 
ATOM   3351 O O      . LYS D 3 111 ? 23.127  38.340  16.225 1.00 36.23 ? 125 LYS B O      1 
ATOM   3352 C CB     . LYS D 3 111 ? 23.183  35.639  16.104 1.00 35.80 ? 125 LYS B CB     1 
ATOM   3353 H H      . LYS D 3 111 ? 20.699  36.815  17.241 1.00 0.00  ? 125 LYS B H      1 
ATOM   3354 N N      . PRO D 3 112 ? 22.899  38.493  18.469 1.00 38.07 ? 126 PRO B N      1 
ATOM   3355 C CA     . PRO D 3 112 ? 23.102  39.932  18.415 1.00 39.45 ? 126 PRO B CA     1 
ATOM   3356 C C      . PRO D 3 112 ? 24.571  40.174  18.169 1.00 43.40 ? 126 PRO B C      1 
ATOM   3357 O O      . PRO D 3 112 ? 25.417  39.322  18.467 1.00 42.50 ? 126 PRO B O      1 
ATOM   3358 C CB     . PRO D 3 112 ? 22.683  40.394  19.807 1.00 38.56 ? 126 PRO B CB     1 
ATOM   3359 C CG     . PRO D 3 112 ? 21.832  39.266  20.325 1.00 41.14 ? 126 PRO B CG     1 
ATOM   3360 C CD     . PRO D 3 112 ? 22.588  38.070  19.840 1.00 35.68 ? 126 PRO B CD     1 
ATOM   3361 N N      . SER D 3 113 ? 24.885  41.309  17.576 1.00 46.67 ? 127 SER B N      1 
ATOM   3362 C CA     . SER D 3 113 ? 26.262  41.609  17.310 1.00 50.01 ? 127 SER B CA     1 
ATOM   3363 C C      . SER D 3 113 ? 26.890  42.376  18.454 1.00 49.23 ? 127 SER B C      1 
ATOM   3364 O O      . SER D 3 113 ? 26.202  42.828  19.364 1.00 51.80 ? 127 SER B O      1 
ATOM   3365 C CB     . SER D 3 113 ? 26.394  42.248  15.931 1.00 53.41 ? 127 SER B CB     1 
ATOM   3366 O OG     . SER D 3 113 ? 26.079  41.241  14.954 1.00 57.42 ? 127 SER B OG     1 
ATOM   3367 H H      . SER D 3 113 ? 24.184  41.907  17.225 1.00 0.00  ? 127 SER B H      1 
ATOM   3368 H HG     . SER D 3 113 ? 26.109  41.384  14.007 1.00 0.00  ? 127 SER B HG     1 
ATOM   3369 N N      . SER D 3 114 ? 28.213  42.447  18.448 1.00 49.47 ? 128 SER B N      1 
ATOM   3370 C CA     . SER D 3 114 ? 28.981  43.082  19.514 1.00 50.18 ? 128 SER B CA     1 
ATOM   3371 C C      . SER D 3 114 ? 28.382  44.313  20.222 1.00 46.81 ? 128 SER B C      1 
ATOM   3372 O O      . SER D 3 114 ? 28.308  44.381  21.465 1.00 42.11 ? 128 SER B O      1 
ATOM   3373 C CB     . SER D 3 114 ? 30.380  43.409  18.988 1.00 53.78 ? 128 SER B CB     1 
ATOM   3374 O OG     . SER D 3 114 ? 31.340  43.031  19.946 1.00 61.90 ? 128 SER B OG     1 
ATOM   3375 H H      . SER D 3 114 ? 28.716  42.127  17.656 1.00 0.00  ? 128 SER B H      1 
ATOM   3376 H HG     . SER D 3 114 ? 31.155  42.256  20.494 1.00 0.00  ? 128 SER B HG     1 
ATOM   3377 N N      . GLN D 3 115 ? 27.894  45.260  19.428 1.00 43.13 ? 129 GLN B N      1 
ATOM   3378 C CA     . GLN D 3 115 ? 27.337  46.476  19.982 1.00 41.78 ? 129 GLN B CA     1 
ATOM   3379 C C      . GLN D 3 115 ? 26.018  46.267  20.776 1.00 39.93 ? 129 GLN B C      1 
ATOM   3380 O O      . GLN D 3 115 ? 25.864  46.789  21.892 1.00 38.89 ? 129 GLN B O      1 
ATOM   3381 C CB     . GLN D 3 115 ? 27.168  47.517  18.875 1.00 43.92 ? 129 GLN B CB     1 
ATOM   3382 C CG     . GLN D 3 115 ? 27.174  48.948  19.384 1.00 54.54 ? 129 GLN B CG     1 
ATOM   3383 C CD     . GLN D 3 115 ? 26.730  49.933  18.323 1.00 62.30 ? 129 GLN B CD     1 
ATOM   3384 O OE1    . GLN D 3 115 ? 25.532  50.150  18.124 1.00 68.60 ? 129 GLN B OE1    1 
ATOM   3385 N NE2    . GLN D 3 115 ? 27.695  50.513  17.620 1.00 66.58 ? 129 GLN B NE2    1 
ATOM   3386 H H      . GLN D 3 115 ? 27.831  45.098  18.438 1.00 0.00  ? 129 GLN B H      1 
ATOM   3387 H HE21   . GLN D 3 115 ? 27.465  51.146  16.914 1.00 0.00  ? 129 GLN B HE21   1 
ATOM   3388 H HE22   . GLN D 3 115 ? 28.613  50.250  17.842 1.00 0.00  ? 129 GLN B HE22   1 
ATOM   3389 N N      . GLU D 3 116 ? 25.136  45.414  20.255 1.00 34.89 ? 130 GLU B N      1 
ATOM   3390 C CA     . GLU D 3 116 ? 23.848  45.145  20.869 1.00 34.80 ? 130 GLU B CA     1 
ATOM   3391 C C      . GLU D 3 116 ? 23.956  44.423  22.215 1.00 35.14 ? 130 GLU B C      1 
ATOM   3392 O O      . GLU D 3 116 ? 23.253  44.778  23.178 1.00 33.75 ? 130 GLU B O      1 
ATOM   3393 C CB     . GLU D 3 116 ? 22.929  44.430  19.880 1.00 29.39 ? 130 GLU B CB     1 
ATOM   3394 C CG     . GLU D 3 116 ? 21.644  43.891  20.482 1.00 37.45 ? 130 GLU B CG     1 
ATOM   3395 C CD     . GLU D 3 116 ? 20.633  44.958  20.956 1.00 36.82 ? 130 GLU B CD     1 
ATOM   3396 O OE1    . GLU D 3 116 ? 20.758  46.154  20.566 1.00 38.25 ? 130 GLU B OE1    1 
ATOM   3397 O OE2    . GLU D 3 116 ? 19.693  44.565  21.706 1.00 33.63 ? 130 GLU B OE2    1 
ATOM   3398 H H      . GLU D 3 116 ? 25.397  44.914  19.466 1.00 0.00  ? 130 GLU B H      1 
ATOM   3399 N N      . ILE D 3 117 ? 24.851  43.438  22.313 1.00 36.70 ? 131 ILE B N      1 
ATOM   3400 C CA     . ILE D 3 117 ? 25.077  42.732  23.590 1.00 33.96 ? 131 ILE B CA     1 
ATOM   3401 C C      . ILE D 3 117 ? 25.579  43.740  24.656 1.00 36.59 ? 131 ILE B C      1 
ATOM   3402 O O      . ILE D 3 117 ? 25.354  43.552  25.848 1.00 30.03 ? 131 ILE B O      1 
ATOM   3403 C CB     . ILE D 3 117 ? 26.157  41.662  23.475 1.00 31.60 ? 131 ILE B CB     1 
ATOM   3404 C CG1    . ILE D 3 117 ? 25.822  40.672  22.361 1.00 25.63 ? 131 ILE B CG1    1 
ATOM   3405 C CG2    . ILE D 3 117 ? 26.356  40.988  24.830 1.00 30.81 ? 131 ILE B CG2    1 
ATOM   3406 C CD1    . ILE D 3 117 ? 26.670  39.403  22.384 1.00 19.38 ? 131 ILE B CD1    1 
ATOM   3407 H H      . ILE D 3 117 ? 25.361  43.212  21.484 1.00 0.00  ? 131 ILE B H      1 
ATOM   3408 N N      . MET D 3 118 ? 26.340  44.754  24.216 1.00 40.39 ? 132 MET B N      1 
ATOM   3409 C CA     . MET D 3 118 ? 26.842  45.807  25.096 1.00 43.46 ? 132 MET B CA     1 
ATOM   3410 C C      . MET D 3 118 ? 25.690  46.707  25.516 1.00 43.88 ? 132 MET B C      1 
ATOM   3411 O O      . MET D 3 118 ? 25.645  47.175  26.649 1.00 46.62 ? 132 MET B O      1 
ATOM   3412 C CB     . MET D 3 118 ? 27.905  46.665  24.413 1.00 45.71 ? 132 MET B CB     1 
ATOM   3413 C CG     . MET D 3 118 ? 28.585  47.666  25.369 1.00 47.19 ? 132 MET B CG     1 
ATOM   3414 S SD     . MET D 3 118 ? 29.817  48.773  24.560 1.00 53.85 ? 132 MET B SD     1 
ATOM   3415 C CE     . MET D 3 118 ? 29.022  50.366  24.832 1.00 49.73 ? 132 MET B CE     1 
ATOM   3416 H H      . MET D 3 118 ? 26.695  44.763  23.300 1.00 0.00  ? 132 MET B H      1 
ATOM   3417 N N      . ARG D 3 119 ? 24.799  47.011  24.581 1.00 43.64 ? 133 ARG B N      1 
ATOM   3418 C CA     . ARG D 3 119 ? 23.631  47.840  24.870 1.00 43.50 ? 133 ARG B CA     1 
ATOM   3419 C C      . ARG D 3 119 ? 22.704  47.121  25.866 1.00 41.37 ? 133 ARG B C      1 
ATOM   3420 O O      . ARG D 3 119 ? 22.207  47.714  26.824 1.00 37.73 ? 133 ARG B O      1 
ATOM   3421 C CB     . ARG D 3 119 ? 22.869  48.193  23.576 1.00 49.31 ? 133 ARG B CB     1 
ATOM   3422 C CG     . ARG D 3 119 ? 23.676  48.965  22.509 1.00 49.43 ? 133 ARG B CG     1 
ATOM   3423 C CD     . ARG D 3 119 ? 22.764  49.663  21.500 1.00 48.99 ? 133 ARG B CD     1 
ATOM   3424 N NE     . ARG D 3 119 ? 22.806  51.129  21.643 1.00 55.28 ? 133 ARG B NE     1 
ATOM   3425 C CZ     . ARG D 3 119 ? 23.137  51.994  20.673 1.00 55.37 ? 133 ARG B CZ     1 
ATOM   3426 N NH1    . ARG D 3 119 ? 23.454  51.563  19.458 1.00 52.71 ? 133 ARG B NH1    1 
ATOM   3427 N NH2    . ARG D 3 119 ? 23.178  53.304  20.929 1.00 55.04 ? 133 ARG B NH2    1 
ATOM   3428 H H      . ARG D 3 119 ? 25.067  46.808  23.659 1.00 0.00  ? 133 ARG B H      1 
ATOM   3429 H HE     . ARG D 3 119 ? 22.525  51.541  22.493 1.00 0.00  ? 133 ARG B HE     1 
ATOM   3430 H HH11   . ARG D 3 119 ? 23.449  50.596  19.233 1.00 0.00  ? 133 ARG B HH11   1 
ATOM   3431 H HH12   . ARG D 3 119 ? 23.699  52.238  18.753 1.00 0.00  ? 133 ARG B HH12   1 
ATOM   3432 H HH21   . ARG D 3 119 ? 22.946  53.634  21.846 1.00 0.00  ? 133 ARG B HH21   1 
ATOM   3433 H HH22   . ARG D 3 119 ? 23.421  53.982  20.220 1.00 0.00  ? 133 ARG B HH22   1 
ATOM   3434 N N      . MET D 3 120 ? 22.492  45.830  25.644 1.00 41.82 ? 134 MET B N      1 
ATOM   3435 C CA     . MET D 3 120 ? 21.659  45.004  26.523 1.00 39.88 ? 134 MET B CA     1 
ATOM   3436 C C      . MET D 3 120 ? 22.263  44.932  27.908 1.00 38.14 ? 134 MET B C      1 
ATOM   3437 O O      . MET D 3 120 ? 21.544  45.053  28.901 1.00 41.65 ? 134 MET B O      1 
ATOM   3438 C CB     . MET D 3 120 ? 21.457  43.582  25.966 1.00 40.58 ? 134 MET B CB     1 
ATOM   3439 C CG     . MET D 3 120 ? 20.512  43.516  24.760 1.00 39.43 ? 134 MET B CG     1 
ATOM   3440 S SD     . MET D 3 120 ? 20.362  41.903  24.012 1.00 37.48 ? 134 MET B SD     1 
ATOM   3441 C CE     . MET D 3 120 ? 20.054  40.925  25.315 1.00 34.39 ? 134 MET B CE     1 
ATOM   3442 H H      . MET D 3 120 ? 22.864  45.448  24.822 1.00 0.00  ? 134 MET B H      1 
ATOM   3443 N N      . ALA D 3 121 ? 23.577  44.727  27.997 1.00 38.16 ? 135 ALA B N      1 
ATOM   3444 C CA     . ALA D 3 121 ? 24.254  44.691  29.310 1.00 34.94 ? 135 ALA B CA     1 
ATOM   3445 C C      . ALA D 3 121 ? 23.977  46.023  29.995 1.00 33.17 ? 135 ALA B C      1 
ATOM   3446 O O      . ALA D 3 121 ? 23.589  46.048  31.159 1.00 32.36 ? 135 ALA B O      1 
ATOM   3447 C CB     . ALA D 3 121 ? 25.766  44.472  29.168 1.00 29.72 ? 135 ALA B CB     1 
ATOM   3448 H H      . ALA D 3 121 ? 24.157  44.558  27.207 1.00 0.00  ? 135 ALA B H      1 
ATOM   3449 N N      . GLU D 3 122 ? 24.129  47.113  29.252 1.00 31.77 ? 136 GLU B N      1 
ATOM   3450 C CA     . GLU D 3 122 ? 23.904  48.435  29.788 1.00 36.21 ? 136 GLU B CA     1 
ATOM   3451 C C      . GLU D 3 122 ? 22.538  48.649  30.373 1.00 40.20 ? 136 GLU B C      1 
ATOM   3452 O O      . GLU D 3 122 ? 22.421  49.131  31.500 1.00 45.96 ? 136 GLU B O      1 
ATOM   3453 C CB     . GLU D 3 122 ? 24.193  49.509  28.754 1.00 35.39 ? 136 GLU B CB     1 
ATOM   3454 C CG     . GLU D 3 122 ? 25.474  50.240  29.042 1.00 41.28 ? 136 GLU B CG     1 
ATOM   3455 C CD     . GLU D 3 122 ? 26.358  50.324  27.837 1.00 40.82 ? 136 GLU B CD     1 
ATOM   3456 O OE1    . GLU D 3 122 ? 25.911  50.942  26.855 1.00 46.43 ? 136 GLU B OE1    1 
ATOM   3457 O OE2    . GLU D 3 122 ? 27.482  49.781  27.864 1.00 41.14 ? 136 GLU B OE2    1 
ATOM   3458 H H      . GLU D 3 122 ? 24.474  47.075  28.331 1.00 0.00  ? 136 GLU B H      1 
ATOM   3459 N N      . GLU D 3 123 ? 21.504  48.311  29.615 1.00 39.71 ? 137 GLU B N      1 
ATOM   3460 C CA     . GLU D 3 123 ? 20.141  48.490  30.084 1.00 39.68 ? 137 GLU B CA     1 
ATOM   3461 C C      . GLU D 3 123 ? 19.758  47.542  31.204 1.00 39.01 ? 137 GLU B C      1 
ATOM   3462 O O      . GLU D 3 123 ? 18.839  47.828  31.977 1.00 36.82 ? 137 GLU B O      1 
ATOM   3463 C CB     . GLU D 3 123 ? 19.167  48.347  28.934 1.00 42.64 ? 137 GLU B CB     1 
ATOM   3464 C CG     . GLU D 3 123 ? 19.100  46.962  28.390 1.00 40.13 ? 137 GLU B CG     1 
ATOM   3465 C CD     . GLU D 3 123 ? 18.185  46.882  27.223 1.00 40.39 ? 137 GLU B CD     1 
ATOM   3466 O OE1    . GLU D 3 123 ? 18.136  47.877  26.448 1.00 35.34 ? 137 GLU B OE1    1 
ATOM   3467 O OE2    . GLU D 3 123 ? 17.506  45.824  27.105 1.00 38.15 ? 137 GLU B OE2    1 
ATOM   3468 H H      . GLU D 3 123 ? 21.684  48.038  28.681 1.00 0.00  ? 137 GLU B H      1 
ATOM   3469 N N      . LEU D 3 124 ? 20.404  46.381  31.227 1.00 37.84 ? 138 LEU B N      1 
ATOM   3470 C CA     . LEU D 3 124 ? 20.171  45.400  32.266 1.00 37.84 ? 138 LEU B CA     1 
ATOM   3471 C C      . LEU D 3 124 ? 21.228  45.456  33.365 1.00 38.13 ? 138 LEU B C      1 
ATOM   3472 O O      . LEU D 3 124 ? 21.311  44.536  34.188 1.00 41.21 ? 138 LEU B O      1 
ATOM   3473 C CB     . LEU D 3 124 ? 20.124  43.997  31.661 1.00 40.50 ? 138 LEU B CB     1 
ATOM   3474 C CG     . LEU D 3 124 ? 18.859  43.605  30.880 1.00 43.22 ? 138 LEU B CG     1 
ATOM   3475 C CD1    . LEU D 3 124 ? 19.073  42.318  30.075 1.00 44.62 ? 138 LEU B CD1    1 
ATOM   3476 C CD2    . LEU D 3 124 ? 17.730  43.415  31.853 1.00 43.56 ? 138 LEU B CD2    1 
ATOM   3477 H H      . LEU D 3 124 ? 20.960  46.097  30.477 1.00 0.00  ? 138 LEU B H      1 
ATOM   3478 N N      . ASN D 3 125 ? 22.082  46.481  33.336 1.00 37.74 ? 139 ASN B N      1 
ATOM   3479 C CA     . ASN D 3 125 ? 23.142  46.663  34.330 1.00 38.87 ? 139 ASN B CA     1 
ATOM   3480 C C      . ASN D 3 125 ? 23.888  45.360  34.700 1.00 38.03 ? 139 ASN B C      1 
ATOM   3481 O O      . ASN D 3 125 ? 24.157  45.095  35.868 1.00 36.76 ? 139 ASN B O      1 
ATOM   3482 C CB     . ASN D 3 125 ? 22.595  47.332  35.593 1.00 43.86 ? 139 ASN B CB     1 
ATOM   3483 C CG     . ASN D 3 125 ? 23.703  47.821  36.524 1.00 47.04 ? 139 ASN B CG     1 
ATOM   3484 O OD1    . ASN D 3 125 ? 24.864  47.850  36.125 1.00 48.13 ? 139 ASN B OD1    1 
ATOM   3485 N ND2    . ASN D 3 125 ? 23.363  48.187  37.757 1.00 46.72 ? 139 ASN B ND2    1 
ATOM   3486 H H      . ASN D 3 125 ? 22.087  47.069  32.520 1.00 0.00  ? 139 ASN B H      1 
ATOM   3487 H HD21   . ASN D 3 125 ? 23.998  48.567  38.402 1.00 0.00  ? 139 ASN B HD21   1 
ATOM   3488 H HD22   . ASN D 3 125 ? 22.440  48.035  37.956 1.00 0.00  ? 139 ASN B HD22   1 
ATOM   3489 N N      . LEU D 3 126 ? 24.126  44.504  33.696 1.00 38.14 ? 140 LEU B N      1 
ATOM   3490 C CA     . LEU D 3 126 ? 24.865  43.237  33.888 1.00 38.76 ? 140 LEU B CA     1 
ATOM   3491 C C      . LEU D 3 126 ? 26.188  43.459  33.187 1.00 36.30 ? 140 LEU B C      1 
ATOM   3492 O O      . LEU D 3 126 ? 26.397  44.523  32.614 1.00 34.81 ? 140 LEU B O      1 
ATOM   3493 C CB     . LEU D 3 126 ? 24.185  42.056  33.195 1.00 39.23 ? 140 LEU B CB     1 
ATOM   3494 C CG     . LEU D 3 126 ? 22.772  41.633  33.600 1.00 43.66 ? 140 LEU B CG     1 
ATOM   3495 C CD1    . LEU D 3 126 ? 22.363  40.412  32.778 1.00 43.99 ? 140 LEU B CD1    1 
ATOM   3496 C CD2    . LEU D 3 126 ? 22.718  41.322  35.097 1.00 48.02 ? 140 LEU B CD2    1 
ATOM   3497 H H      . LEU D 3 126 ? 23.844  44.842  32.835 1.00 0.00  ? 140 LEU B H      1 
ATOM   3498 N N      . GLU D 3 127 ? 27.084  42.477  33.229 1.00 38.79 ? 141 GLU B N      1 
ATOM   3499 C CA     . GLU D 3 127 ? 28.390  42.614  32.548 1.00 38.32 ? 141 GLU B CA     1 
ATOM   3500 C C      . GLU D 3 127 ? 28.429  41.933  31.165 1.00 35.87 ? 141 GLU B C      1 
ATOM   3501 O O      . GLU D 3 127 ? 28.089  40.767  31.037 1.00 36.51 ? 141 GLU B O      1 
ATOM   3502 C CB     . GLU D 3 127 ? 29.528  42.119  33.457 1.00 34.77 ? 141 GLU B CB     1 
ATOM   3503 C CG     . GLU D 3 127 ? 29.345  40.733  34.042 1.00 42.08 ? 141 GLU B CG     1 
ATOM   3504 C CD     . GLU D 3 127 ? 30.425  40.363  35.064 1.00 51.51 ? 141 GLU B CD     1 
ATOM   3505 O OE1    . GLU D 3 127 ? 31.441  41.093  35.152 1.00 53.37 ? 141 GLU B OE1    1 
ATOM   3506 O OE2    . GLU D 3 127 ? 30.264  39.338  35.790 1.00 53.70 ? 141 GLU B OE2    1 
ATOM   3507 H H      . GLU D 3 127 ? 26.939  41.660  33.786 1.00 0.00  ? 141 GLU B H      1 
ATOM   3508 N N      . LYS D 3 128 ? 28.899  42.648  30.150 1.00 36.53 ? 142 LYS B N      1 
ATOM   3509 C CA     . LYS D 3 128 ? 28.964  42.143  28.769 1.00 35.47 ? 142 LYS B CA     1 
ATOM   3510 C C      . LYS D 3 128 ? 29.129  40.630  28.644 1.00 34.33 ? 142 LYS B C      1 
ATOM   3511 O O      . LYS D 3 128 ? 28.384  39.996  27.907 1.00 34.14 ? 142 LYS B O      1 
ATOM   3512 C CB     . LYS D 3 128 ? 30.080  42.869  27.996 1.00 39.09 ? 142 LYS B CB     1 
ATOM   3513 C CG     . LYS D 3 128 ? 29.906  42.920  26.486 1.00 38.35 ? 142 LYS B CG     1 
ATOM   3514 C CD     . LYS D 3 128 ? 30.570  41.734  25.759 1.00 44.76 ? 142 LYS B CD     1 
ATOM   3515 C CE     . LYS D 3 128 ? 32.096  41.727  25.886 1.00 38.77 ? 142 LYS B CE     1 
ATOM   3516 N NZ     . LYS D 3 128 ? 32.533  40.513  26.645 1.00 42.16 ? 142 LYS B NZ     1 
ATOM   3517 H H      . LYS D 3 128 ? 29.296  43.554  30.309 1.00 0.00  ? 142 LYS B H      1 
ATOM   3518 H HZ1    . LYS D 3 128 ? 32.153  39.646  26.215 1.00 0.00  ? 142 LYS B HZ1    1 
ATOM   3519 H HZ2    . LYS D 3 128 ? 33.571  40.467  26.718 1.00 0.00  ? 142 LYS B HZ2    1 
ATOM   3520 H HZ3    . LYS D 3 128 ? 32.102  40.671  27.579 1.00 0.00  ? 142 LYS B HZ3    1 
ATOM   3521 N N      . GLU D 3 129 ? 30.049  40.055  29.427 1.00 35.95 ? 143 GLU B N      1 
ATOM   3522 C CA     . GLU D 3 129 ? 30.327  38.606  29.417 1.00 37.57 ? 143 GLU B CA     1 
ATOM   3523 C C      . GLU D 3 129 ? 29.285  37.590  29.919 1.00 36.90 ? 143 GLU B C      1 
ATOM   3524 O O      . GLU D 3 129 ? 29.225  36.463  29.401 1.00 35.61 ? 143 GLU B O      1 
ATOM   3525 C CB     . GLU D 3 129 ? 31.667  38.312  30.061 1.00 41.05 ? 143 GLU B CB     1 
ATOM   3526 C CG     . GLU D 3 129 ? 32.831  38.432  29.041 1.00 49.03 ? 143 GLU B CG     1 
ATOM   3527 C CD     . GLU D 3 129 ? 32.784  37.373  27.906 1.00 46.81 ? 143 GLU B CD     1 
ATOM   3528 O OE1    . GLU D 3 129 ? 33.086  36.172  28.162 1.00 40.41 ? 143 GLU B OE1    1 
ATOM   3529 O OE2    . GLU D 3 129 ? 32.466  37.771  26.761 1.00 46.41 ? 143 GLU B OE2    1 
ATOM   3530 H H      . GLU D 3 129 ? 30.571  40.627  30.032 1.00 0.00  ? 143 GLU B H      1 
ATOM   3531 N N      . VAL D 3 130 ? 28.417  37.981  30.850 1.00 35.36 ? 144 VAL B N      1 
ATOM   3532 C CA     . VAL D 3 130 ? 27.401  37.046  31.321 1.00 31.26 ? 144 VAL B CA     1 
ATOM   3533 C C      . VAL D 3 130 ? 26.344  37.013  30.237 1.00 27.13 ? 144 VAL B C      1 
ATOM   3534 O O      . VAL D 3 130 ? 25.871  35.948  29.872 1.00 27.11 ? 144 VAL B O      1 
ATOM   3535 C CB     . VAL D 3 130 ? 26.810  37.409  32.721 1.00 29.50 ? 144 VAL B CB     1 
ATOM   3536 C CG1    . VAL D 3 130 ? 27.928  37.607  33.739 1.00 26.21 ? 144 VAL B CG1    1 
ATOM   3537 C CG2    . VAL D 3 130 ? 25.959  38.632  32.649 1.00 35.50 ? 144 VAL B CG2    1 
ATOM   3538 H H      . VAL D 3 130 ? 28.359  38.939  31.061 1.00 0.00  ? 144 VAL B H      1 
ATOM   3539 N N      . VAL D 3 131 ? 26.057  38.173  29.646 1.00 26.56 ? 145 VAL B N      1 
ATOM   3540 C CA     . VAL D 3 131 ? 25.067  38.261  28.563 1.00 25.05 ? 145 VAL B CA     1 
ATOM   3541 C C      . VAL D 3 131 ? 25.570  37.472  27.331 1.00 29.46 ? 145 VAL B C      1 
ATOM   3542 O O      . VAL D 3 131 ? 24.821  36.694  26.704 1.00 32.15 ? 145 VAL B O      1 
ATOM   3543 C CB     . VAL D 3 131 ? 24.805  39.728  28.177 1.00 20.48 ? 145 VAL B CB     1 
ATOM   3544 C CG1    . VAL D 3 131 ? 23.684  39.839  27.164 1.00 23.64 ? 145 VAL B CG1    1 
ATOM   3545 C CG2    . VAL D 3 131 ? 24.430  40.506  29.372 1.00 23.63 ? 145 VAL B CG2    1 
ATOM   3546 H H      . VAL D 3 131 ? 26.561  38.974  29.945 1.00 0.00  ? 145 VAL B H      1 
ATOM   3547 N N      . ARG D 3 132 ? 26.855  37.623  27.004 1.00 30.19 ? 146 ARG B N      1 
ATOM   3548 C CA     . ARG D 3 132 ? 27.427  36.930  25.869 1.00 25.77 ? 146 ARG B CA     1 
ATOM   3549 C C      . ARG D 3 132 ? 27.280  35.467  26.058 1.00 22.95 ? 146 ARG B C      1 
ATOM   3550 O O      . ARG D 3 132 ? 26.714  34.781  25.220 1.00 27.64 ? 146 ARG B O      1 
ATOM   3551 C CB     . ARG D 3 132 ? 28.906  37.255  25.664 1.00 30.69 ? 146 ARG B CB     1 
ATOM   3552 C CG     . ARG D 3 132 ? 29.381  36.823  24.261 1.00 31.47 ? 146 ARG B CG     1 
ATOM   3553 C CD     . ARG D 3 132 ? 30.889  36.843  24.101 1.00 32.25 ? 146 ARG B CD     1 
ATOM   3554 N NE     . ARG D 3 132 ? 31.551  35.811  24.910 1.00 30.62 ? 146 ARG B NE     1 
ATOM   3555 C CZ     . ARG D 3 132 ? 31.619  34.517  24.605 1.00 27.85 ? 146 ARG B CZ     1 
ATOM   3556 N NH1    . ARG D 3 132 ? 31.083  34.036  23.499 1.00 33.33 ? 146 ARG B NH1    1 
ATOM   3557 N NH2    . ARG D 3 132 ? 32.239  33.692  25.416 1.00 31.28 ? 146 ARG B NH2    1 
ATOM   3558 H H      . ARG D 3 132 ? 27.393  38.331  27.428 1.00 0.00  ? 146 ARG B H      1 
ATOM   3559 H HE     . ARG D 3 132 ? 31.988  36.105  25.731 1.00 0.00  ? 146 ARG B HE     1 
ATOM   3560 H HH11   . ARG D 3 132 ? 30.688  34.580  22.770 1.00 0.00  ? 146 ARG B HH11   1 
ATOM   3561 H HH12   . ARG D 3 132 ? 31.210  33.058  23.342 1.00 0.00  ? 146 ARG B HH12   1 
ATOM   3562 H HH21   . ARG D 3 132 ? 32.652  34.088  26.240 1.00 0.00  ? 146 ARG B HH21   1 
ATOM   3563 H HH22   . ARG D 3 132 ? 32.328  32.715  25.221 1.00 0.00  ? 146 ARG B HH22   1 
ATOM   3564 N N      . VAL D 3 133 ? 27.783  34.953  27.166 1.00 23.20 ? 147 VAL B N      1 
ATOM   3565 C CA     . VAL D 3 133 ? 27.681  33.519  27.410 1.00 20.00 ? 147 VAL B CA     1 
ATOM   3566 C C      . VAL D 3 133 ? 26.246  32.980  27.535 1.00 21.56 ? 147 VAL B C      1 
ATOM   3567 O O      . VAL D 3 133 ? 25.998  31.804  27.293 1.00 17.20 ? 147 VAL B O      1 
ATOM   3568 C CB     . VAL D 3 133 ? 28.511  33.136  28.630 1.00 22.43 ? 147 VAL B CB     1 
ATOM   3569 C CG1    . VAL D 3 133 ? 28.441  31.620  28.882 1.00 22.28 ? 147 VAL B CG1    1 
ATOM   3570 C CG2    . VAL D 3 133 ? 29.915  33.598  28.408 1.00 20.57 ? 147 VAL B CG2    1 
ATOM   3571 H H      . VAL D 3 133 ? 28.246  35.463  27.899 1.00 0.00  ? 147 VAL B H      1 
ATOM   3572 N N      . TRP D 3 134 ? 25.305  33.814  27.957 1.00 18.64 ? 148 TRP B N      1 
ATOM   3573 C CA     . TRP D 3 134 ? 23.948  33.375  28.069 1.00 20.96 ? 148 TRP B CA     1 
ATOM   3574 C C      . TRP D 3 134 ? 23.443  33.061  26.668 1.00 22.67 ? 148 TRP B C      1 
ATOM   3575 O O      . TRP D 3 134 ? 22.866  31.997  26.394 1.00 21.87 ? 148 TRP B O      1 
ATOM   3576 C CB     . TRP D 3 134 ? 23.099  34.465  28.670 1.00 22.47 ? 148 TRP B CB     1 
ATOM   3577 C CG     . TRP D 3 134 ? 21.730  33.932  28.939 1.00 33.18 ? 148 TRP B CG     1 
ATOM   3578 C CD1    . TRP D 3 134 ? 21.335  33.268  30.072 1.00 32.13 ? 148 TRP B CD1    1 
ATOM   3579 C CD2    . TRP D 3 134 ? 20.575  33.976  28.066 1.00 30.46 ? 148 TRP B CD2    1 
ATOM   3580 N NE1    . TRP D 3 134 ? 20.020  32.907  29.953 1.00 33.59 ? 148 TRP B NE1    1 
ATOM   3581 C CE2    . TRP D 3 134 ? 19.525  33.330  28.744 1.00 26.93 ? 148 TRP B CE2    1 
ATOM   3582 C CE3    . TRP D 3 134 ? 20.342  34.496  26.786 1.00 29.49 ? 148 TRP B CE3    1 
ATOM   3583 C CZ2    . TRP D 3 134 ? 18.245  33.206  28.204 1.00 22.17 ? 148 TRP B CZ2    1 
ATOM   3584 C CZ3    . TRP D 3 134 ? 19.062  34.369  26.255 1.00 27.43 ? 148 TRP B CZ3    1 
ATOM   3585 C CH2    . TRP D 3 134 ? 18.038  33.713  26.965 1.00 20.63 ? 148 TRP B CH2    1 
ATOM   3586 H H      . TRP D 3 134 ? 25.556  34.678  28.341 1.00 0.00  ? 148 TRP B H      1 
ATOM   3587 H HE1    . TRP D 3 134 ? 19.596  32.422  30.664 1.00 0.00  ? 148 TRP B HE1    1 
ATOM   3588 N N      . PHE D 3 135 ? 23.697  33.999  25.765 1.00 25.19 ? 149 PHE B N      1 
ATOM   3589 C CA     . PHE D 3 135 ? 23.315  33.850  24.386 1.00 26.41 ? 149 PHE B CA     1 
ATOM   3590 C C      . PHE D 3 135 ? 23.941  32.614  23.746 1.00 27.00 ? 149 PHE B C      1 
ATOM   3591 O O      . PHE D 3 135 ? 23.245  31.836  23.097 1.00 31.67 ? 149 PHE B O      1 
ATOM   3592 C CB     . PHE D 3 135 ? 23.617  35.133  23.623 1.00 31.06 ? 149 PHE B CB     1 
ATOM   3593 C CG     . PHE D 3 135 ? 22.480  36.117  23.647 1.00 33.95 ? 149 PHE B CG     1 
ATOM   3594 C CD1    . PHE D 3 135 ? 22.380  37.048  24.667 1.00 34.04 ? 149 PHE B CD1    1 
ATOM   3595 C CD2    . PHE D 3 135 ? 21.487  36.085  22.662 1.00 33.49 ? 149 PHE B CD2    1 
ATOM   3596 C CE1    . PHE D 3 135 ? 21.296  37.934  24.716 1.00 35.42 ? 149 PHE B CE1    1 
ATOM   3597 C CE2    . PHE D 3 135 ? 20.407  36.967  22.711 1.00 36.09 ? 149 PHE B CE2    1 
ATOM   3598 C CZ     . PHE D 3 135 ? 20.316  37.898  23.745 1.00 36.01 ? 149 PHE B CZ     1 
ATOM   3599 H H      . PHE D 3 135 ? 24.087  34.862  26.031 1.00 0.00  ? 149 PHE B H      1 
ATOM   3600 N N      . CYS D 3 136 ? 25.234  32.383  23.970 1.00 24.15 ? 150 CYS B N      1 
ATOM   3601 C CA     . CYS D 3 136 ? 25.877  31.191  23.422 1.00 21.60 ? 150 CYS B CA     1 
ATOM   3602 C C      . CYS D 3 136 ? 25.189  29.937  23.965 1.00 26.28 ? 150 CYS B C      1 
ATOM   3603 O O      . CYS D 3 136 ? 24.975  28.970  23.231 1.00 30.38 ? 150 CYS B O      1 
ATOM   3604 C CB     . CYS D 3 136 ? 27.364  31.165  23.758 1.00 17.99 ? 150 CYS B CB     1 
ATOM   3605 S SG     . CYS D 3 136 ? 28.286  32.584  23.101 1.00 20.45 ? 150 CYS B SG     1 
ATOM   3606 H H      . CYS D 3 136 ? 25.749  33.078  24.486 1.00 0.00  ? 150 CYS B H      1 
ATOM   3607 N N      . ASN D 3 137 ? 24.847  29.946  25.257 1.00 27.83 ? 151 ASN B N      1 
ATOM   3608 C CA     . ASN D 3 137 ? 24.184  28.822  25.919 1.00 29.49 ? 151 ASN B CA     1 
ATOM   3609 C C      . ASN D 3 137 ? 22.764  28.586  25.411 1.00 29.99 ? 151 ASN B C      1 
ATOM   3610 O O      . ASN D 3 137 ? 22.333  27.443  25.213 1.00 31.06 ? 151 ASN B O      1 
ATOM   3611 C CB     . ASN D 3 137 ? 24.183  29.022  27.447 1.00 29.24 ? 151 ASN B CB     1 
ATOM   3612 C CG     . ASN D 3 137 ? 25.422  28.457  28.108 1.00 27.16 ? 151 ASN B CG     1 
ATOM   3613 O OD1    . ASN D 3 137 ? 25.462  27.309  28.489 1.00 32.96 ? 151 ASN B OD1    1 
ATOM   3614 N ND2    . ASN D 3 137 ? 26.428  29.270  28.256 1.00 30.26 ? 151 ASN B ND2    1 
ATOM   3615 H H      . ASN D 3 137 ? 25.090  30.690  25.851 1.00 0.00  ? 151 ASN B H      1 
ATOM   3616 H HD21   . ASN D 3 137 ? 27.187  28.841  28.708 1.00 0.00  ? 151 ASN B HD21   1 
ATOM   3617 H HD22   . ASN D 3 137 ? 26.339  30.166  27.922 1.00 0.00  ? 151 ASN B HD22   1 
ATOM   3618 N N      . ARG D 3 138 ? 22.032  29.675  25.211 1.00 31.11 ? 152 ARG B N      1 
ATOM   3619 C CA     . ARG D 3 138 ? 20.661  29.600  24.708 1.00 29.06 ? 152 ARG B CA     1 
ATOM   3620 C C      . ARG D 3 138 ? 20.641  28.909  23.339 1.00 27.33 ? 152 ARG B C      1 
ATOM   3621 O O      . ARG D 3 138 ? 19.733  28.133  23.053 1.00 27.91 ? 152 ARG B O      1 
ATOM   3622 C CB     . ARG D 3 138 ? 20.037  30.995  24.678 1.00 25.74 ? 152 ARG B CB     1 
ATOM   3623 C CG     . ARG D 3 138 ? 18.545  31.009  24.458 1.00 29.33 ? 152 ARG B CG     1 
ATOM   3624 C CD     . ARG D 3 138 ? 17.753  30.137  25.387 1.00 30.17 ? 152 ARG B CD     1 
ATOM   3625 N NE     . ARG D 3 138 ? 16.342  30.195  25.031 1.00 34.64 ? 152 ARG B NE     1 
ATOM   3626 C CZ     . ARG D 3 138 ? 15.727  29.366  24.188 1.00 36.29 ? 152 ARG B CZ     1 
ATOM   3627 N NH1    . ARG D 3 138 ? 16.397  28.384  23.600 1.00 28.98 ? 152 ARG B NH1    1 
ATOM   3628 N NH2    . ARG D 3 138 ? 14.440  29.577  23.877 1.00 36.37 ? 152 ARG B NH2    1 
ATOM   3629 H H      . ARG D 3 138 ? 22.356  30.535  25.516 1.00 0.00  ? 152 ARG B H      1 
ATOM   3630 H HE     . ARG D 3 138 ? 15.759  30.846  25.460 1.00 0.00  ? 152 ARG B HE     1 
ATOM   3631 H HH11   . ARG D 3 138 ? 17.360  28.205  23.729 1.00 0.00  ? 152 ARG B HH11   1 
ATOM   3632 H HH12   . ARG D 3 138 ? 15.851  27.833  22.961 1.00 0.00  ? 152 ARG B HH12   1 
ATOM   3633 H HH21   . ARG D 3 138 ? 13.965  30.383  24.264 1.00 0.00  ? 152 ARG B HH21   1 
ATOM   3634 H HH22   . ARG D 3 138 ? 13.938  29.037  23.198 1.00 0.00  ? 152 ARG B HH22   1 
ATOM   3635 N N      . ARG D 3 139 ? 21.690  29.137  22.544 1.00 26.48 ? 153 ARG B N      1 
ATOM   3636 C CA     . ARG D 3 139 ? 21.858  28.509  21.229 1.00 21.61 ? 153 ARG B CA     1 
ATOM   3637 C C      . ARG D 3 139 ? 22.109  27.016  21.356 1.00 22.38 ? 153 ARG B C      1 
ATOM   3638 O O      . ARG D 3 139 ? 21.485  26.210  20.665 1.00 28.34 ? 153 ARG B O      1 
ATOM   3639 C CB     . ARG D 3 139 ? 22.982  29.174  20.441 1.00 13.91 ? 153 ARG B CB     1 
ATOM   3640 C CG     . ARG D 3 139 ? 22.708  30.616  20.163 1.00 10.51 ? 153 ARG B CG     1 
ATOM   3641 C CD     . ARG D 3 139 ? 23.703  31.182  19.216 1.00 19.98 ? 153 ARG B CD     1 
ATOM   3642 N NE     . ARG D 3 139 ? 23.841  32.621  19.396 1.00 20.54 ? 153 ARG B NE     1 
ATOM   3643 C CZ     . ARG D 3 139 ? 24.982  33.228  19.694 1.00 13.03 ? 153 ARG B CZ     1 
ATOM   3644 N NH1    . ARG D 3 139 ? 26.095  32.528  19.816 1.00 16.07 ? 153 ARG B NH1    1 
ATOM   3645 N NH2    . ARG D 3 139 ? 24.997  34.525  19.947 1.00 14.65 ? 153 ARG B NH2    1 
ATOM   3646 H H      . ARG D 3 139 ? 22.335  29.836  22.809 1.00 0.00  ? 153 ARG B H      1 
ATOM   3647 H HE     . ARG D 3 139 ? 23.056  33.138  19.167 1.00 0.00  ? 153 ARG B HE     1 
ATOM   3648 H HH11   . ARG D 3 139 ? 26.086  31.557  19.687 1.00 0.00  ? 153 ARG B HH11   1 
ATOM   3649 H HH12   . ARG D 3 139 ? 26.934  33.014  20.058 1.00 0.00  ? 153 ARG B HH12   1 
ATOM   3650 H HH21   . ARG D 3 139 ? 24.107  34.977  19.902 1.00 0.00  ? 153 ARG B HH21   1 
ATOM   3651 H HH22   . ARG D 3 139 ? 25.825  35.050  20.217 1.00 0.00  ? 153 ARG B HH22   1 
ATOM   3652 N N      . GLN D 3 140 ? 22.984  26.619  22.258 1.00 22.24 ? 154 GLN B N      1 
ATOM   3653 C CA     . GLN D 3 140 ? 23.207  25.188  22.433 1.00 27.85 ? 154 GLN B CA     1 
ATOM   3654 C C      . GLN D 3 140 ? 21.880  24.498  22.721 1.00 29.53 ? 154 GLN B C      1 
ATOM   3655 O O      . GLN D 3 140 ? 21.619  23.434  22.168 1.00 31.04 ? 154 GLN B O      1 
ATOM   3656 C CB     . GLN D 3 140 ? 24.219  24.889  23.536 1.00 30.48 ? 154 GLN B CB     1 
ATOM   3657 C CG     . GLN D 3 140 ? 25.581  24.468  22.981 1.00 33.87 ? 154 GLN B CG     1 
ATOM   3658 C CD     . GLN D 3 140 ? 26.595  24.144  24.061 1.00 28.75 ? 154 GLN B CD     1 
ATOM   3659 O OE1    . GLN D 3 140 ? 27.083  25.032  24.747 1.00 28.15 ? 154 GLN B OE1    1 
ATOM   3660 N NE2    . GLN D 3 140 ? 26.939  22.872  24.190 1.00 27.15 ? 154 GLN B NE2    1 
ATOM   3661 H H      . GLN D 3 140 ? 23.522  27.327  22.714 1.00 0.00  ? 154 GLN B H      1 
ATOM   3662 H HE21   . GLN D 3 140 ? 27.607  22.691  24.866 1.00 0.00  ? 154 GLN B HE21   1 
ATOM   3663 H HE22   . GLN D 3 140 ? 26.520  22.187  23.618 1.00 0.00  ? 154 GLN B HE22   1 
ATOM   3664 N N      . ARG D 3 141 ? 21.024  25.131  23.533 1.00 31.76 ? 155 ARG B N      1 
ATOM   3665 C CA     . ARG D 3 141 ? 19.701  24.588  23.867 1.00 29.34 ? 155 ARG B CA     1 
ATOM   3666 C C      . ARG D 3 141 ? 18.899  24.240  22.609 1.00 28.01 ? 155 ARG B C      1 
ATOM   3667 O O      . ARG D 3 141 ? 18.395  23.127  22.489 1.00 27.32 ? 155 ARG B O      1 
ATOM   3668 C CB     . ARG D 3 141 ? 18.886  25.542  24.759 1.00 34.80 ? 155 ARG B CB     1 
ATOM   3669 C CG     . ARG D 3 141 ? 17.792  24.819  25.583 1.00 38.93 ? 155 ARG B CG     1 
ATOM   3670 C CD     . ARG D 3 141 ? 16.679  25.730  26.078 1.00 43.87 ? 155 ARG B CD     1 
ATOM   3671 N NE     . ARG D 3 141 ? 15.410  24.989  26.186 1.00 53.93 ? 155 ARG B NE     1 
ATOM   3672 C CZ     . ARG D 3 141 ? 14.198  25.522  26.413 1.00 53.97 ? 155 ARG B CZ     1 
ATOM   3673 N NH1    . ARG D 3 141 ? 14.026  26.833  26.578 1.00 54.90 ? 155 ARG B NH1    1 
ATOM   3674 N NH2    . ARG D 3 141 ? 13.132  24.728  26.456 1.00 52.66 ? 155 ARG B NH2    1 
ATOM   3675 H H      . ARG D 3 141 ? 21.315  25.958  23.991 1.00 0.00  ? 155 ARG B H      1 
ATOM   3676 H HE     . ARG D 3 141 ? 15.467  24.021  26.094 1.00 0.00  ? 155 ARG B HE     1 
ATOM   3677 H HH11   . ARG D 3 141 ? 14.790  27.469  26.582 1.00 0.00  ? 155 ARG B HH11   1 
ATOM   3678 H HH12   . ARG D 3 141 ? 13.102  27.193  26.755 1.00 0.00  ? 155 ARG B HH12   1 
ATOM   3679 H HH21   . ARG D 3 141 ? 13.238  23.740  26.314 1.00 0.00  ? 155 ARG B HH21   1 
ATOM   3680 H HH22   . ARG D 3 141 ? 12.221  25.115  26.613 1.00 0.00  ? 155 ARG B HH22   1 
ATOM   3681 N N      . GLU D 3 142 ? 18.833  25.160  21.652 1.00 26.51 ? 156 GLU B N      1 
ATOM   3682 C CA     . GLU D 3 142 ? 18.098  24.926  20.401 1.00 27.45 ? 156 GLU B CA     1 
ATOM   3683 C C      . GLU D 3 142 ? 18.565  23.689  19.642 1.00 28.79 ? 156 GLU B C      1 
ATOM   3684 O O      . GLU D 3 142 ? 17.749  23.025  18.984 1.00 29.45 ? 156 GLU B O      1 
ATOM   3685 C CB     . GLU D 3 142 ? 18.209  26.121  19.452 1.00 28.11 ? 156 GLU B CB     1 
ATOM   3686 C CG     . GLU D 3 142 ? 17.551  27.371  19.933 1.00 31.36 ? 156 GLU B CG     1 
ATOM   3687 C CD     . GLU D 3 142 ? 16.034  27.304  19.884 1.00 37.02 ? 156 GLU B CD     1 
ATOM   3688 O OE1    . GLU D 3 142 ? 15.415  26.674  20.774 1.00 35.12 ? 156 GLU B OE1    1 
ATOM   3689 O OE2    . GLU D 3 142 ? 15.463  27.926  18.959 1.00 43.60 ? 156 GLU B OE2    1 
ATOM   3690 H H      . GLU D 3 142 ? 19.262  26.024  21.854 1.00 0.00  ? 156 GLU B H      1 
ATOM   3691 N N      . LYS D 3 143 ? 19.872  23.406  19.683 1.00 27.59 ? 157 LYS B N      1 
ATOM   3692 C CA     . LYS D 3 143 ? 20.431  22.248  18.976 1.00 25.84 ? 157 LYS B CA     1 
ATOM   3693 C C      . LYS D 3 143 ? 20.309  20.856  19.649 1.00 27.25 ? 157 LYS B C      1 
ATOM   3694 O O      . LYS D 3 143 ? 20.751  19.831  19.089 1.00 29.44 ? 157 LYS B O      1 
ATOM   3695 C CB     . LYS D 3 143 ? 21.877  22.536  18.598 1.00 24.30 ? 157 LYS B CB     1 
ATOM   3696 C CG     . LYS D 3 143 ? 22.059  23.827  17.833 1.00 29.51 ? 157 LYS B CG     1 
ATOM   3697 C CD     . LYS D 3 143 ? 23.488  23.927  17.275 1.00 36.12 ? 157 LYS B CD     1 
ATOM   3698 C CE     . LYS D 3 143 ? 23.679  25.143  16.354 1.00 37.67 ? 157 LYS B CE     1 
ATOM   3699 N NZ     . LYS D 3 143 ? 25.018  25.193  15.648 1.00 35.67 ? 157 LYS B NZ     1 
ATOM   3700 H H      . LYS D 3 143 ? 20.432  24.085  20.128 1.00 0.00  ? 157 LYS B H      1 
ATOM   3701 H HZ1    . LYS D 3 143 ? 25.198  24.259  15.226 1.00 0.00  ? 157 LYS B HZ1    1 
ATOM   3702 H HZ2    . LYS D 3 143 ? 25.085  25.939  14.917 1.00 0.00  ? 157 LYS B HZ2    1 
ATOM   3703 H HZ3    . LYS D 3 143 ? 25.728  25.386  16.386 1.00 0.00  ? 157 LYS B HZ3    1 
ATOM   3704 N N      . ARG D 3 144 ? 19.709  20.802  20.836 1.00 26.94 ? 158 ARG B N      1 
ATOM   3705 C CA     . ARG D 3 144 ? 19.541  19.547  21.559 1.00 24.61 ? 158 ARG B CA     1 
ATOM   3706 C C      . ARG D 3 144 ? 18.440  18.639  21.075 1.00 25.63 ? 158 ARG B C      1 
ATOM   3707 O O      . ARG D 3 144 ? 17.390  19.095  20.608 1.00 24.42 ? 158 ARG B O      1 
ATOM   3708 C CB     . ARG D 3 144 ? 19.314  19.824  23.013 1.00 24.14 ? 158 ARG B CB     1 
ATOM   3709 C CG     . ARG D 3 144 ? 20.496  20.444  23.655 1.00 26.77 ? 158 ARG B CG     1 
ATOM   3710 C CD     . ARG D 3 144 ? 20.229  20.643  25.092 1.00 29.77 ? 158 ARG B CD     1 
ATOM   3711 N NE     . ARG D 3 144 ? 21.476  20.574  25.829 1.00 38.45 ? 158 ARG B NE     1 
ATOM   3712 C CZ     . ARG D 3 144 ? 21.688  21.179  26.989 1.00 41.60 ? 158 ARG B CZ     1 
ATOM   3713 N NH1    . ARG D 3 144 ? 20.723  21.914  27.561 1.00 41.79 ? 158 ARG B NH1    1 
ATOM   3714 N NH2    . ARG D 3 144 ? 22.877  21.069  27.563 1.00 43.09 ? 158 ARG B NH2    1 
ATOM   3715 H H      . ARG D 3 144 ? 19.383  21.649  21.210 1.00 0.00  ? 158 ARG B H      1 
ATOM   3716 H HE     . ARG D 3 144 ? 22.222  20.075  25.437 1.00 0.00  ? 158 ARG B HE     1 
ATOM   3717 H HH11   . ARG D 3 144 ? 19.821  22.080  27.170 1.00 0.00  ? 158 ARG B HH11   1 
ATOM   3718 H HH12   . ARG D 3 144 ? 20.928  22.366  28.438 1.00 0.00  ? 158 ARG B HH12   1 
ATOM   3719 H HH21   . ARG D 3 144 ? 23.592  20.537  27.114 1.00 0.00  ? 158 ARG B HH21   1 
ATOM   3720 H HH22   . ARG D 3 144 ? 23.046  21.510  28.450 1.00 0.00  ? 158 ARG B HH22   1 
ATOM   3721 N N      . VAL D 3 145 ? 18.682  17.339  21.219 1.00 26.85 ? 159 VAL B N      1 
ATOM   3722 C CA     . VAL D 3 145 ? 17.726  16.340  20.804 1.00 30.65 ? 159 VAL B CA     1 
ATOM   3723 C C      . VAL D 3 145 ? 16.380  16.528  21.460 1.00 34.07 ? 159 VAL B C      1 
ATOM   3724 O O      . VAL D 3 145 ? 15.440  16.928  20.777 1.00 40.86 ? 159 VAL B O      1 
ATOM   3725 C CB     . VAL D 3 145 ? 18.206  14.895  21.048 1.00 28.96 ? 159 VAL B CB     1 
ATOM   3726 C CG1    . VAL D 3 145 ? 17.078  13.901  20.703 1.00 28.86 ? 159 VAL B CG1    1 
ATOM   3727 C CG2    . VAL D 3 145 ? 19.407  14.613  20.210 1.00 27.18 ? 159 VAL B CG2    1 
ATOM   3728 H H      . VAL D 3 145 ? 19.547  17.060  21.624 1.00 0.00  ? 159 VAL B H      1 
ATOM   3729 N N      . LYS D 3 146 ? 16.278  16.176  22.746 1.00 36.80 ? 160 LYS B N      1 
ATOM   3730 C CA     . LYS D 3 146 ? 15.031  16.306  23.481 1.00 33.54 ? 160 LYS B CA     1 
ATOM   3731 C C      . LYS D 3 146 ? 15.086  17.520  24.374 1.00 34.74 ? 160 LYS B C      1 
ATOM   3732 O O      . LYS D 3 146 ? 15.962  18.367  24.095 1.00 37.83 ? 160 LYS B O      1 
ATOM   3733 C CB     . LYS D 3 146 ? 14.733  15.048  24.301 1.00 36.24 ? 160 LYS B CB     1 
ATOM   3734 C CG     . LYS D 3 146 ? 13.813  14.067  23.544 1.00 43.51 ? 160 LYS B CG     1 
ATOM   3735 C CD     . LYS D 3 146 ? 13.093  13.046  24.456 1.00 44.19 ? 160 LYS B CD     1 
ATOM   3736 C CE     . LYS D 3 146 ? 11.876  12.388  23.736 1.00 48.41 ? 160 LYS B CE     1 
ATOM   3737 N NZ     . LYS D 3 146 ? 11.923  10.891  23.494 1.00 45.31 ? 160 LYS B NZ     1 
ATOM   3738 H H      . LYS D 3 146 ? 17.061  15.942  23.290 1.00 0.00  ? 160 LYS B H      1 
ATOM   3739 H HZ1    . LYS D 3 146 ? 12.113  10.427  24.403 1.00 0.00  ? 160 LYS B HZ1    1 
ATOM   3740 H HZ2    . LYS D 3 146 ? 11.008  10.563  23.113 1.00 0.00  ? 160 LYS B HZ2    1 
ATOM   3741 H HZ3    . LYS D 3 146 ? 12.664  10.648  22.806 1.00 0.00  ? 160 LYS B HZ3    1 
HETATM 3742 O O      . HOH E 4 .   ? 8.088   11.999  55.184 1.00 34.91 ? 702 HOH C O      1 
HETATM 3743 H H1     . HOH E 4 .   ? 7.496   11.703  55.894 1.00 0.00  ? 702 HOH C H1     1 
HETATM 3744 H H2     . HOH E 4 .   ? 8.850   12.335  55.640 1.00 0.00  ? 702 HOH C H2     1 
HETATM 3745 O O      . HOH E 4 .   ? 23.331  10.548  40.567 1.00 19.28 ? 713 HOH C O      1 
HETATM 3746 H H1     . HOH E 4 .   ? 23.350  11.498  40.470 1.00 0.00  ? 713 HOH C H1     1 
HETATM 3747 H H2     . HOH E 4 .   ? 24.167  10.383  41.019 1.00 0.00  ? 713 HOH C H2     1 
HETATM 3748 O O      . HOH E 4 .   ? 15.357  19.734  39.169 1.00 27.24 ? 740 HOH C O      1 
HETATM 3749 H H1     . HOH E 4 .   ? 15.325  20.692  39.223 1.00 0.00  ? 740 HOH C H1     1 
HETATM 3750 H H2     . HOH E 4 .   ? 15.278  19.500  38.243 1.00 0.00  ? 740 HOH C H2     1 
HETATM 3751 O O      . HOH E 4 .   ? 23.150  16.428  59.945 1.00 30.33 ? 746 HOH C O      1 
HETATM 3752 H H1     . HOH E 4 .   ? 22.550  16.222  59.229 1.00 0.00  ? 746 HOH C H1     1 
HETATM 3753 H H2     . HOH E 4 .   ? 22.695  16.151  60.737 1.00 0.00  ? 746 HOH C H2     1 
HETATM 3754 O O      . HOH E 4 .   ? 18.581  17.103  31.307 1.00 44.18 ? 755 HOH C O      1 
HETATM 3755 H H1     . HOH E 4 .   ? 17.784  17.597  31.471 1.00 0.00  ? 755 HOH C H1     1 
HETATM 3756 H H2     . HOH E 4 .   ? 18.380  16.207  31.548 1.00 0.00  ? 755 HOH C H2     1 
HETATM 3757 O O      . HOH E 4 .   ? 38.547  36.942  4.627  1.00 51.14 ? 757 HOH C O      1 
HETATM 3758 H H1     . HOH E 4 .   ? 38.452  37.905  4.638  1.00 0.00  ? 757 HOH C H1     1 
HETATM 3759 H H2     . HOH E 4 .   ? 38.475  36.722  3.696  1.00 0.00  ? 757 HOH C H2     1 
HETATM 3760 O O      . HOH E 4 .   ? 17.607  10.477  34.619 1.00 21.74 ? 763 HOH C O      1 
HETATM 3761 H H1     . HOH E 4 .   ? 18.066  11.231  34.229 1.00 0.00  ? 763 HOH C H1     1 
HETATM 3762 H H2     . HOH E 4 .   ? 16.794  10.876  34.936 1.00 0.00  ? 763 HOH C H2     1 
HETATM 3763 O O      . HOH E 4 .   ? 22.892  34.525  33.118 1.00 41.86 ? 766 HOH C O      1 
HETATM 3764 H H1     . HOH E 4 .   ? 23.332  34.764  32.309 1.00 0.00  ? 766 HOH C H1     1 
HETATM 3765 H H2     . HOH E 4 .   ? 23.642  34.330  33.660 1.00 0.00  ? 766 HOH C H2     1 
HETATM 3766 O O      . HOH E 4 .   ? 6.936   19.648  58.506 1.00 33.74 ? 768 HOH C O      1 
HETATM 3767 H H1     . HOH E 4 .   ? 6.511   19.634  59.374 1.00 0.00  ? 768 HOH C H1     1 
HETATM 3768 H H2     . HOH E 4 .   ? 6.447   20.364  58.080 1.00 0.00  ? 768 HOH C H2     1 
HETATM 3769 O O      . HOH E 4 .   ? 37.745  22.800  19.856 1.00 25.25 ? 789 HOH C O      1 
HETATM 3770 H H1     . HOH E 4 .   ? 37.694  23.760  19.854 1.00 0.00  ? 789 HOH C H1     1 
HETATM 3771 H H2     . HOH E 4 .   ? 37.662  22.587  18.925 1.00 0.00  ? 789 HOH C H2     1 
HETATM 3772 O O      . HOH E 4 .   ? 36.333  44.299  4.357  1.00 46.35 ? 791 HOH C O      1 
HETATM 3773 H H1     . HOH E 4 .   ? 36.266  45.251  4.381  1.00 0.00  ? 791 HOH C H1     1 
HETATM 3774 H H2     . HOH E 4 .   ? 36.278  44.093  3.420  1.00 0.00  ? 791 HOH C H2     1 
HETATM 3775 O O      . HOH E 4 .   ? 2.138   19.433  57.913 1.00 64.92 ? 799 HOH C O      1 
HETATM 3776 H H1     . HOH E 4 .   ? 1.709   19.354  58.771 1.00 0.00  ? 799 HOH C H1     1 
HETATM 3777 H H2     . HOH E 4 .   ? 2.381   18.538  57.724 1.00 0.00  ? 799 HOH C H2     1 
HETATM 3778 O O      . HOH E 4 .   ? 23.615  15.625  46.579 1.00 49.39 ? 804 HOH C O      1 
HETATM 3779 H H1     . HOH E 4 .   ? 24.150  16.205  46.029 1.00 0.00  ? 804 HOH C H1     1 
HETATM 3780 H H2     . HOH E 4 .   ? 23.138  16.234  47.141 1.00 0.00  ? 804 HOH C H2     1 
HETATM 3781 O O      . HOH E 4 .   ? 14.206  23.512  64.120 1.00 41.58 ? 822 HOH C O      1 
HETATM 3782 H H1     . HOH E 4 .   ? 14.482  22.598  64.064 1.00 0.00  ? 822 HOH C H1     1 
HETATM 3783 H H2     . HOH E 4 .   ? 14.796  24.008  63.552 1.00 0.00  ? 822 HOH C H2     1 
HETATM 3784 O O      . HOH E 4 .   ? 19.057  19.983  32.173 1.00 31.30 ? 835 HOH C O      1 
HETATM 3785 H H1     . HOH E 4 .   ? 19.034  19.951  31.213 1.00 0.00  ? 835 HOH C H1     1 
HETATM 3786 H H2     . HOH E 4 .   ? 18.244  20.438  32.415 1.00 0.00  ? 835 HOH C H2     1 
HETATM 3787 O O      . HOH E 4 .   ? 38.938  22.041  24.651 1.00 48.42 ? 838 HOH C O      1 
HETATM 3788 H H1     . HOH E 4 .   ? 38.942  23.005  24.665 1.00 0.00  ? 838 HOH C H1     1 
HETATM 3789 H H2     . HOH E 4 .   ? 39.002  21.873  23.711 1.00 0.00  ? 838 HOH C H2     1 
HETATM 3790 O O      . HOH E 4 .   ? 7.428   14.524  55.865 1.00 24.09 ? 839 HOH C O      1 
HETATM 3791 H H1     . HOH E 4 .   ? 8.090   15.228  55.924 1.00 0.00  ? 839 HOH C H1     1 
HETATM 3792 H H2     . HOH E 4 .   ? 7.737   13.772  56.332 1.00 0.00  ? 839 HOH C H2     1 
HETATM 3793 O O      . HOH E 4 .   ? 12.778  20.082  37.601 1.00 52.59 ? 845 HOH C O      1 
HETATM 3794 H H1     . HOH E 4 .   ? 12.751  21.039  37.591 1.00 0.00  ? 845 HOH C H1     1 
HETATM 3795 H H2     . HOH E 4 .   ? 12.762  19.819  36.681 1.00 0.00  ? 845 HOH C H2     1 
HETATM 3796 O O      . HOH E 4 .   ? 35.540  31.225  30.108 1.00 42.65 ? 856 HOH C O      1 
HETATM 3797 H H1     . HOH E 4 .   ? 35.173  32.055  29.792 1.00 0.00  ? 856 HOH C H1     1 
HETATM 3798 H H2     . HOH E 4 .   ? 35.200  30.565  29.515 1.00 0.00  ? 856 HOH C H2     1 
HETATM 3799 O O      . HOH E 4 .   ? 45.143  41.865  4.627  1.00 42.37 ? 863 HOH C O      1 
HETATM 3800 H H1     . HOH E 4 .   ? 45.259  42.826  4.714  1.00 0.00  ? 863 HOH C H1     1 
HETATM 3801 H H2     . HOH E 4 .   ? 45.316  41.740  3.714  1.00 0.00  ? 863 HOH C H2     1 
HETATM 3802 O O      . HOH E 4 .   ? 12.028  24.300  67.187 1.00 39.63 ? 867 HOH C O      1 
HETATM 3803 H H1     . HOH E 4 .   ? 11.995  23.950  68.069 1.00 0.00  ? 867 HOH C H1     1 
HETATM 3804 H H2     . HOH E 4 .   ? 11.586  23.647  66.650 1.00 0.00  ? 867 HOH C H2     1 
HETATM 3805 O O      . HOH E 4 .   ? 40.593  40.449  6.728  1.00 61.12 ? 884 HOH C O      1 
HETATM 3806 H H1     . HOH E 4 .   ? 40.634  41.405  6.584  1.00 0.00  ? 884 HOH C H1     1 
HETATM 3807 H H2     . HOH E 4 .   ? 40.566  40.051  5.867  1.00 0.00  ? 884 HOH C H2     1 
HETATM 3808 O O      . HOH E 4 .   ? 42.246  18.537  19.747 1.00 39.59 ? 889 HOH C O      1 
HETATM 3809 H H1     . HOH E 4 .   ? 42.292  19.493  19.670 1.00 0.00  ? 889 HOH C H1     1 
HETATM 3810 H H2     . HOH E 4 .   ? 42.310  18.219  18.849 1.00 0.00  ? 889 HOH C H2     1 
HETATM 3811 O O      . HOH E 4 .   ? 19.853  25.246  38.822 1.00 52.27 ? 915 HOH C O      1 
HETATM 3812 H H1     . HOH E 4 .   ? 19.862  26.203  38.794 1.00 0.00  ? 915 HOH C H1     1 
HETATM 3813 H H2     . HOH E 4 .   ? 19.814  24.973  37.909 1.00 0.00  ? 915 HOH C H2     1 
HETATM 3814 O O      . HOH F 4 .   ? 8.075   9.798   46.653 1.00 8.67  ? 700 HOH D O      1 
HETATM 3815 H H1     . HOH F 4 .   ? 8.862   10.322  46.562 1.00 0.00  ? 700 HOH D H1     1 
HETATM 3816 H H2     . HOH F 4 .   ? 7.601   10.260  47.345 1.00 0.00  ? 700 HOH D H2     1 
HETATM 3817 O O      . HOH F 4 .   ? 11.297  18.993  49.125 1.00 34.76 ? 701 HOH D O      1 
HETATM 3818 H H1     . HOH F 4 .   ? 11.757  19.816  48.907 1.00 0.00  ? 701 HOH D H1     1 
HETATM 3819 H H2     . HOH F 4 .   ? 11.966  18.336  49.040 1.00 0.00  ? 701 HOH D H2     1 
HETATM 3820 O O      . HOH F 4 .   ? 28.814  28.315  24.743 1.00 40.49 ? 704 HOH D O      1 
HETATM 3821 H H1     . HOH F 4 .   ? 29.496  28.940  24.983 1.00 0.00  ? 704 HOH D H1     1 
HETATM 3822 H H2     . HOH F 4 .   ? 28.106  28.804  24.330 1.00 0.00  ? 704 HOH D H2     1 
HETATM 3823 O O      . HOH F 4 .   ? 12.044  23.240  45.264 1.00 29.43 ? 712 HOH D O      1 
HETATM 3824 H H1     . HOH F 4 .   ? 11.859  23.776  46.043 1.00 0.00  ? 712 HOH D H1     1 
HETATM 3825 H H2     . HOH F 4 .   ? 11.437  23.570  44.596 1.00 0.00  ? 712 HOH D H2     1 
HETATM 3826 O O      . HOH F 4 .   ? 25.548  31.325  44.487 1.00 39.20 ? 714 HOH D O      1 
HETATM 3827 H H1     . HOH F 4 .   ? 25.195  30.898  45.258 1.00 0.00  ? 714 HOH D H1     1 
HETATM 3828 H H2     . HOH F 4 .   ? 26.136  30.688  44.085 1.00 0.00  ? 714 HOH D H2     1 
HETATM 3829 O O      . HOH F 4 .   ? 14.921  4.950   64.237 1.00 33.27 ? 715 HOH D O      1 
HETATM 3830 H H1     . HOH F 4 .   ? 14.854  5.905   64.267 1.00 0.00  ? 715 HOH D H1     1 
HETATM 3831 H H2     . HOH F 4 .   ? 14.867  4.717   63.312 1.00 0.00  ? 715 HOH D H2     1 
HETATM 3832 O O      . HOH F 4 .   ? 45.949  40.703  24.314 1.00 33.10 ? 721 HOH D O      1 
HETATM 3833 H H1     . HOH F 4 .   ? 45.971  41.667  24.289 1.00 0.00  ? 721 HOH D H1     1 
HETATM 3834 H H2     . HOH F 4 .   ? 45.755  40.427  23.412 1.00 0.00  ? 721 HOH D H2     1 
HETATM 3835 O O      . HOH F 4 .   ? 15.754  16.852  40.662 1.00 20.74 ? 722 HOH D O      1 
HETATM 3836 H H1     . HOH F 4 .   ? 15.734  17.823  40.636 1.00 0.00  ? 722 HOH D H1     1 
HETATM 3837 H H2     . HOH F 4 .   ? 15.746  16.653  39.735 1.00 0.00  ? 722 HOH D H2     1 
HETATM 3838 O O      . HOH F 4 .   ? 32.723  28.770  15.631 1.00 63.06 ? 725 HOH D O      1 
HETATM 3839 H H1     . HOH F 4 .   ? 32.660  29.729  15.652 1.00 0.00  ? 725 HOH D H1     1 
HETATM 3840 H H2     . HOH F 4 .   ? 32.673  28.589  14.700 1.00 0.00  ? 725 HOH D H2     1 
HETATM 3841 O O      . HOH F 4 .   ? 30.915  17.967  39.169 1.00 33.07 ? 734 HOH D O      1 
HETATM 3842 H H1     . HOH F 4 .   ? 31.750  17.770  39.607 1.00 0.00  ? 734 HOH D H1     1 
HETATM 3843 H H2     . HOH F 4 .   ? 30.383  18.398  39.837 1.00 0.00  ? 734 HOH D H2     1 
HETATM 3844 O O      . HOH F 4 .   ? 27.854  24.824  46.424 1.00 27.79 ? 738 HOH D O      1 
HETATM 3845 H H1     . HOH F 4 .   ? 27.623  24.043  46.916 1.00 0.00  ? 738 HOH D H1     1 
HETATM 3846 H H2     . HOH F 4 .   ? 28.450  24.507  45.726 1.00 0.00  ? 738 HOH D H2     1 
HETATM 3847 O O      . HOH F 4 .   ? 15.697  26.602  47.656 1.00 34.93 ? 747 HOH D O      1 
HETATM 3848 H H1     . HOH F 4 .   ? 16.336  26.425  48.334 1.00 0.00  ? 747 HOH D H1     1 
HETATM 3849 H H2     . HOH F 4 .   ? 15.183  25.795  47.588 1.00 0.00  ? 747 HOH D H2     1 
HETATM 3850 O O      . HOH F 4 .   ? 7.789   8.175   71.675 1.00 36.52 ? 749 HOH D O      1 
HETATM 3851 H H1     . HOH F 4 .   ? 7.486   9.098   71.703 1.00 0.00  ? 749 HOH D H1     1 
HETATM 3852 H H2     . HOH F 4 .   ? 7.710   7.945   70.775 1.00 0.00  ? 749 HOH D H2     1 
HETATM 3853 O O      . HOH F 4 .   ? 17.483  11.818  68.518 1.00 44.83 ? 752 HOH D O      1 
HETATM 3854 H H1     . HOH F 4 .   ? 17.443  12.761  68.612 1.00 0.00  ? 752 HOH D H1     1 
HETATM 3855 H H2     . HOH F 4 .   ? 17.674  11.680  67.587 1.00 0.00  ? 752 HOH D H2     1 
HETATM 3856 O O      . HOH F 4 .   ? 10.910  6.098   51.529 1.00 20.93 ? 756 HOH D O      1 
HETATM 3857 H H1     . HOH F 4 .   ? 10.310  5.764   52.193 1.00 0.00  ? 756 HOH D H1     1 
HETATM 3858 H H2     . HOH F 4 .   ? 11.779  6.135   51.951 1.00 0.00  ? 756 HOH D H2     1 
HETATM 3859 O O      . HOH F 4 .   ? 26.711  24.010  19.464 1.00 27.78 ? 759 HOH D O      1 
HETATM 3860 H H1     . HOH F 4 .   ? 27.614  24.215  19.697 1.00 0.00  ? 759 HOH D H1     1 
HETATM 3861 H H2     . HOH F 4 .   ? 26.752  23.817  18.517 1.00 0.00  ? 759 HOH D H2     1 
HETATM 3862 O O      . HOH F 4 .   ? 17.316  21.530  39.759 1.00 16.05 ? 762 HOH D O      1 
HETATM 3863 H H1     . HOH F 4 .   ? 17.330  22.489  39.784 1.00 0.00  ? 762 HOH D H1     1 
HETATM 3864 H H2     . HOH F 4 .   ? 17.342  21.327  38.824 1.00 0.00  ? 762 HOH D H2     1 
HETATM 3865 O O      . HOH F 4 .   ? 11.544  4.054   46.785 1.00 28.90 ? 769 HOH D O      1 
HETATM 3866 H H1     . HOH F 4 .   ? 12.102  3.827   47.531 1.00 0.00  ? 769 HOH D H1     1 
HETATM 3867 H H2     . HOH F 4 .   ? 12.169  4.059   46.051 1.00 0.00  ? 769 HOH D H2     1 
HETATM 3868 O O      . HOH F 4 .   ? 15.019  13.005  71.071 1.00 37.57 ? 771 HOH D O      1 
HETATM 3869 H H1     . HOH F 4 .   ? 15.018  13.963  70.991 1.00 0.00  ? 771 HOH D H1     1 
HETATM 3870 H H2     . HOH F 4 .   ? 14.987  12.700  70.165 1.00 0.00  ? 771 HOH D H2     1 
HETATM 3871 O O      . HOH F 4 .   ? 48.923  31.553  20.272 1.00 61.98 ? 779 HOH D O      1 
HETATM 3872 H H1     . HOH F 4 .   ? 48.922  32.509  20.271 1.00 0.00  ? 779 HOH D H1     1 
HETATM 3873 H H2     . HOH F 4 .   ? 48.922  31.314  19.345 1.00 0.00  ? 779 HOH D H2     1 
HETATM 3874 O O      . HOH F 4 .   ? 39.801  39.869  22.195 1.00 50.95 ? 781 HOH D O      1 
HETATM 3875 H H1     . HOH F 4 .   ? 39.715  40.829  22.247 1.00 0.00  ? 781 HOH D H1     1 
HETATM 3876 H H2     . HOH F 4 .   ? 39.762  39.705  21.261 1.00 0.00  ? 781 HOH D H2     1 
HETATM 3877 O O      . HOH F 4 .   ? 32.126  24.126  15.733 1.00 45.18 ? 785 HOH D O      1 
HETATM 3878 H H1     . HOH F 4 .   ? 32.071  25.086  15.733 1.00 0.00  ? 785 HOH D H1     1 
HETATM 3879 H H2     . HOH F 4 .   ? 32.073  23.875  14.812 1.00 0.00  ? 785 HOH D H2     1 
HETATM 3880 O O      . HOH F 4 .   ? 32.444  31.322  23.933 1.00 37.43 ? 793 HOH D O      1 
HETATM 3881 H H1     . HOH F 4 .   ? 32.969  31.858  24.527 1.00 0.00  ? 793 HOH D H1     1 
HETATM 3882 H H2     . HOH F 4 .   ? 33.047  30.677  23.554 1.00 0.00  ? 793 HOH D H2     1 
HETATM 3883 O O      . HOH F 4 .   ? 8.693   18.182  39.277 1.00 37.92 ? 794 HOH D O      1 
HETATM 3884 H H1     . HOH F 4 .   ? 8.548   17.306  38.924 1.00 0.00  ? 794 HOH D H1     1 
HETATM 3885 H H2     . HOH F 4 .   ? 9.648   18.246  39.405 1.00 0.00  ? 794 HOH D H2     1 
HETATM 3886 O O      . HOH F 4 .   ? 31.810  31.400  13.888 1.00 54.41 ? 815 HOH D O      1 
HETATM 3887 H H1     . HOH F 4 .   ? 31.723  32.355  13.896 1.00 0.00  ? 815 HOH D H1     1 
HETATM 3888 H H2     . HOH F 4 .   ? 31.741  31.159  12.962 1.00 0.00  ? 815 HOH D H2     1 
HETATM 3889 O O      . HOH F 4 .   ? 26.790  35.055  22.047 1.00 45.03 ? 825 HOH D O      1 
HETATM 3890 H H1     . HOH F 4 .   ? 26.378  34.655  22.810 1.00 0.00  ? 825 HOH D H1     1 
HETATM 3891 H H2     . HOH F 4 .   ? 27.436  35.655  22.417 1.00 0.00  ? 825 HOH D H2     1 
HETATM 3892 O O      . HOH F 4 .   ? 54.131  37.460  21.027 1.00 43.72 ? 827 HOH D O      1 
HETATM 3893 H H1     . HOH F 4 .   ? 53.948  38.374  21.182 1.00 0.00  ? 827 HOH D H1     1 
HETATM 3894 H H2     . HOH F 4 .   ? 53.457  37.350  20.388 1.00 0.00  ? 827 HOH D H2     1 
HETATM 3895 O O      . HOH F 4 .   ? 42.418  43.981  16.324 1.00 48.85 ? 830 HOH D O      1 
HETATM 3896 H H1     . HOH F 4 .   ? 42.541  44.927  16.304 1.00 0.00  ? 830 HOH D H1     1 
HETATM 3897 H H2     . HOH F 4 .   ? 42.554  43.678  15.429 1.00 0.00  ? 830 HOH D H2     1 
HETATM 3898 O O      . HOH F 4 .   ? 25.373  26.275  19.201 1.00 26.04 ? 837 HOH D O      1 
HETATM 3899 H H1     . HOH F 4 .   ? 24.465  25.971  19.233 1.00 0.00  ? 837 HOH D H1     1 
HETATM 3900 H H2     . HOH F 4 .   ? 25.740  25.741  18.497 1.00 0.00  ? 837 HOH D H2     1 
HETATM 3901 O O      . HOH F 4 .   ? 8.381   12.238  46.926 1.00 35.61 ? 843 HOH D O      1 
HETATM 3902 H H1     . HOH F 4 .   ? 9.240   12.634  46.791 1.00 0.00  ? 843 HOH D H1     1 
HETATM 3903 H H2     . HOH F 4 .   ? 8.158   12.475  47.835 1.00 0.00  ? 843 HOH D H2     1 
HETATM 3904 O O      . HOH F 4 .   ? 30.428  30.917  44.399 1.00 37.19 ? 844 HOH D O      1 
HETATM 3905 H H1     . HOH F 4 .   ? 30.769  30.309  45.056 1.00 0.00  ? 844 HOH D H1     1 
HETATM 3906 H H2     . HOH F 4 .   ? 30.048  31.607  44.945 1.00 0.00  ? 844 HOH D H2     1 
HETATM 3907 O O      . HOH F 4 .   ? 32.990  40.514  17.155 1.00 46.19 ? 847 HOH D O      1 
HETATM 3908 H H1     . HOH F 4 .   ? 32.843  39.830  16.502 1.00 0.00  ? 847 HOH D H1     1 
HETATM 3909 H H2     . HOH F 4 .   ? 32.116  40.714  17.476 1.00 0.00  ? 847 HOH D H2     1 
HETATM 3910 O O      . HOH F 4 .   ? 30.541  14.283  20.025 1.00 56.42 ? 851 HOH D O      1 
HETATM 3911 H H1     . HOH F 4 .   ? 31.408  14.606  20.260 1.00 0.00  ? 851 HOH D H1     1 
HETATM 3912 H H2     . HOH F 4 .   ? 30.140  14.095  20.882 1.00 0.00  ? 851 HOH D H2     1 
HETATM 3913 O O      . HOH F 4 .   ? 34.120  37.052  22.880 1.00 52.91 ? 852 HOH D O      1 
HETATM 3914 H H1     . HOH F 4 .   ? 33.925  37.573  22.093 1.00 0.00  ? 852 HOH D H1     1 
HETATM 3915 H H2     . HOH F 4 .   ? 34.444  36.204  22.596 1.00 0.00  ? 852 HOH D H2     1 
HETATM 3916 O O      . HOH F 4 .   ? 34.109  15.455  35.496 1.00 40.70 ? 853 HOH D O      1 
HETATM 3917 H H1     . HOH F 4 .   ? 33.851  14.962  34.741 1.00 0.00  ? 853 HOH D H1     1 
HETATM 3918 H H2     . HOH F 4 .   ? 35.045  15.501  35.193 1.00 0.00  ? 853 HOH D H2     1 
HETATM 3919 O O      . HOH F 4 .   ? 6.379   10.237  74.297 1.00 76.15 ? 866 HOH D O      1 
HETATM 3920 H H1     . HOH F 4 .   ? 6.300   11.200  74.296 1.00 0.00  ? 866 HOH D H1     1 
HETATM 3921 H H2     . HOH F 4 .   ? 6.306   10.023  73.366 1.00 0.00  ? 866 HOH D H2     1 
HETATM 3922 O O      . HOH F 4 .   ? 10.540  32.273  40.054 1.00 50.90 ? 871 HOH D O      1 
HETATM 3923 H H1     . HOH F 4 .   ? 10.660  33.015  39.459 1.00 0.00  ? 871 HOH D H1     1 
HETATM 3924 H H2     . HOH F 4 .   ? 9.684   31.930  39.812 1.00 0.00  ? 871 HOH D H2     1 
HETATM 3925 O O      . HOH F 4 .   ? 28.975  39.447  18.551 1.00 27.05 ? 872 HOH D O      1 
HETATM 3926 H H1     . HOH F 4 .   ? 28.042  39.176  18.517 1.00 0.00  ? 872 HOH D H1     1 
HETATM 3927 H H2     . HOH F 4 .   ? 29.429  38.630  18.332 1.00 0.00  ? 872 HOH D H2     1 
HETATM 3928 O O      . HOH F 4 .   ? 10.824  7.100   71.638 1.00 45.55 ? 879 HOH D O      1 
HETATM 3929 H H1     . HOH F 4 .   ? 10.845  8.052   71.715 1.00 0.00  ? 879 HOH D H1     1 
HETATM 3930 H H2     . HOH F 4 .   ? 10.952  6.928   70.721 1.00 0.00  ? 879 HOH D H2     1 
HETATM 3931 O O      . HOH F 4 .   ? 41.587  32.951  18.290 1.00 49.65 ? 882 HOH D O      1 
HETATM 3932 H H1     . HOH F 4 .   ? 42.014  33.796  18.402 1.00 0.00  ? 882 HOH D H1     1 
HETATM 3933 H H2     . HOH F 4 .   ? 41.709  32.736  17.368 1.00 0.00  ? 882 HOH D H2     1 
HETATM 3934 O O      . HOH G 4 .   ? 11.197  21.455  55.163 1.00 22.09 ? 703 HOH A O      1 
HETATM 3935 H H1     . HOH G 4 .   ? 12.056  21.129  55.467 1.00 0.00  ? 703 HOH A H1     1 
HETATM 3936 H H2     . HOH G 4 .   ? 11.457  22.371  54.982 1.00 0.00  ? 703 HOH A H2     1 
HETATM 3937 O O      . HOH G 4 .   ? 2.850   17.899  42.700 1.00 59.85 ? 706 HOH A O      1 
HETATM 3938 H H1     . HOH G 4 .   ? 2.623   18.685  43.158 1.00 0.00  ? 706 HOH A H1     1 
HETATM 3939 H H2     . HOH G 4 .   ? 2.145   17.783  42.084 1.00 0.00  ? 706 HOH A H2     1 
HETATM 3940 O O      . HOH G 4 .   ? 27.590  13.579  42.239 1.00 22.71 ? 707 HOH A O      1 
HETATM 3941 H H1     . HOH G 4 .   ? 28.293  13.407  42.881 1.00 0.00  ? 707 HOH A H1     1 
HETATM 3942 H H2     . HOH G 4 .   ? 27.517  14.540  42.263 1.00 0.00  ? 707 HOH A H2     1 
HETATM 3943 O O      . HOH G 4 .   ? 7.183   9.800   56.684 1.00 40.42 ? 708 HOH A O      1 
HETATM 3944 H H1     . HOH G 4 .   ? 6.821   9.717   55.808 1.00 0.00  ? 708 HOH A H1     1 
HETATM 3945 H H2     . HOH G 4 .   ? 7.772   9.053   56.824 1.00 0.00  ? 708 HOH A H2     1 
HETATM 3946 O O      . HOH G 4 .   ? 14.586  10.207  27.529 1.00 24.58 ? 709 HOH A O      1 
HETATM 3947 H H1     . HOH G 4 .   ? 14.700  11.149  27.422 1.00 0.00  ? 709 HOH A H1     1 
HETATM 3948 H H2     . HOH G 4 .   ? 15.335  9.962   28.110 1.00 0.00  ? 709 HOH A H2     1 
HETATM 3949 O O      . HOH G 4 .   ? -6.563  12.542  48.541 1.00 40.07 ? 716 HOH A O      1 
HETATM 3950 H H1     . HOH G 4 .   ? -6.293  13.341  49.008 1.00 0.00  ? 716 HOH A H1     1 
HETATM 3951 H H2     . HOH G 4 .   ? -6.298  12.792  47.667 1.00 0.00  ? 716 HOH A H2     1 
HETATM 3952 O O      . HOH G 4 .   ? 0.187   18.905  40.218 1.00 26.25 ? 718 HOH A O      1 
HETATM 3953 H H1     . HOH G 4 .   ? 0.478   18.004  40.376 1.00 0.00  ? 718 HOH A H1     1 
HETATM 3954 H H2     . HOH G 4 .   ? 0.513   19.492  40.883 1.00 0.00  ? 718 HOH A H2     1 
HETATM 3955 O O      . HOH G 4 .   ? 30.621  10.080  38.077 1.00 24.18 ? 719 HOH A O      1 
HETATM 3956 H H1     . HOH G 4 .   ? 30.041  9.914   37.331 1.00 0.00  ? 719 HOH A H1     1 
HETATM 3957 H H2     . HOH G 4 .   ? 31.165  10.751  37.669 1.00 0.00  ? 719 HOH A H2     1 
HETATM 3958 O O      . HOH G 4 .   ? 26.261  18.064  23.451 1.00 20.18 ? 720 HOH A O      1 
HETATM 3959 H H1     . HOH G 4 .   ? 25.669  17.318  23.522 1.00 0.00  ? 720 HOH A H1     1 
HETATM 3960 H H2     . HOH G 4 .   ? 26.538  18.149  22.524 1.00 0.00  ? 720 HOH A H2     1 
HETATM 3961 O O      . HOH G 4 .   ? 9.040   6.174   49.356 1.00 27.57 ? 723 HOH A O      1 
HETATM 3962 H H1     . HOH G 4 .   ? 9.188   6.415   48.435 1.00 0.00  ? 723 HOH A H1     1 
HETATM 3963 H H2     . HOH G 4 .   ? 9.924   5.938   49.676 1.00 0.00  ? 723 HOH A H2     1 
HETATM 3964 O O      . HOH G 4 .   ? -10.915 8.128   45.486 1.00 52.15 ? 726 HOH A O      1 
HETATM 3965 H H1     . HOH G 4 .   ? -11.221 7.594   44.747 1.00 0.00  ? 726 HOH A H1     1 
HETATM 3966 H H2     . HOH G 4 .   ? -11.414 7.740   46.199 1.00 0.00  ? 726 HOH A H2     1 
HETATM 3967 O O      . HOH G 4 .   ? 28.650  -5.132  25.868 1.00 35.38 ? 728 HOH A O      1 
HETATM 3968 H H1     . HOH G 4 .   ? 29.386  -5.471  25.373 1.00 0.00  ? 728 HOH A H1     1 
HETATM 3969 H H2     . HOH G 4 .   ? 27.891  -5.548  25.429 1.00 0.00  ? 728 HOH A H2     1 
HETATM 3970 O O      . HOH G 4 .   ? -10.094 3.637   41.910 1.00 38.77 ? 729 HOH A O      1 
HETATM 3971 H H1     . HOH G 4 .   ? -10.383 4.232   41.222 1.00 0.00  ? 729 HOH A H1     1 
HETATM 3972 H H2     . HOH G 4 .   ? -10.734 2.920   41.955 1.00 0.00  ? 729 HOH A H2     1 
HETATM 3973 O O      . HOH G 4 .   ? 9.463   12.737  53.050 1.00 38.99 ? 732 HOH A O      1 
HETATM 3974 H H1     . HOH G 4 .   ? 10.036  12.616  53.812 1.00 0.00  ? 732 HOH A H1     1 
HETATM 3975 H H2     . HOH G 4 .   ? 8.682   12.217  53.273 1.00 0.00  ? 732 HOH A H2     1 
HETATM 3976 O O      . HOH G 4 .   ? 14.677  15.811  27.999 1.00 77.10 ? 733 HOH A O      1 
HETATM 3977 H H1     . HOH G 4 .   ? 13.911  16.240  28.390 1.00 0.00  ? 733 HOH A H1     1 
HETATM 3978 H H2     . HOH G 4 .   ? 14.983  15.213  28.674 1.00 0.00  ? 733 HOH A H2     1 
HETATM 3979 O O      . HOH G 4 .   ? 33.719  7.644   33.062 1.00 24.44 ? 739 HOH A O      1 
HETATM 3980 H H1     . HOH G 4 .   ? 32.785  7.544   32.940 1.00 0.00  ? 739 HOH A H1     1 
HETATM 3981 H H2     . HOH G 4 .   ? 34.087  7.595   32.188 1.00 0.00  ? 739 HOH A H2     1 
HETATM 3982 O O      . HOH G 4 .   ? 21.440  -5.483  32.693 1.00 34.55 ? 745 HOH A O      1 
HETATM 3983 H H1     . HOH G 4 .   ? 21.689  -4.952  31.942 1.00 0.00  ? 745 HOH A H1     1 
HETATM 3984 H H2     . HOH G 4 .   ? 20.556  -5.152  32.896 1.00 0.00  ? 745 HOH A H2     1 
HETATM 3985 O O      . HOH G 4 .   ? 13.314  -2.629  31.000 1.00 41.49 ? 750 HOH A O      1 
HETATM 3986 H H1     . HOH G 4 .   ? 13.074  -3.430  31.471 1.00 0.00  ? 750 HOH A H1     1 
HETATM 3987 H H2     . HOH G 4 .   ? 13.964  -2.936  30.370 1.00 0.00  ? 750 HOH A H2     1 
HETATM 3988 O O      . HOH G 4 .   ? 9.023   0.700   15.471 1.00 67.51 ? 753 HOH A O      1 
HETATM 3989 H H1     . HOH G 4 .   ? 9.745   0.722   16.090 1.00 0.00  ? 753 HOH A H1     1 
HETATM 3990 H H2     . HOH G 4 .   ? 8.970   -0.190  15.126 1.00 0.00  ? 753 HOH A H2     1 
HETATM 3991 O O      . HOH G 4 .   ? 9.660   18.583  51.213 1.00 25.13 ? 754 HOH A O      1 
HETATM 3992 H H1     . HOH G 4 .   ? 10.544  18.246  51.349 1.00 0.00  ? 754 HOH A H1     1 
HETATM 3993 H H2     . HOH G 4 .   ? 8.976   17.923  51.278 1.00 0.00  ? 754 HOH A H2     1 
HETATM 3994 O O      . HOH G 4 .   ? 23.952  -2.225  23.882 1.00 39.14 ? 761 HOH A O      1 
HETATM 3995 H H1     . HOH G 4 .   ? 24.904  -2.296  23.858 1.00 0.00  ? 761 HOH A H1     1 
HETATM 3996 H H2     . HOH G 4 .   ? 23.801  -1.290  23.772 1.00 0.00  ? 761 HOH A H2     1 
HETATM 3997 O O      . HOH G 4 .   ? 21.280  7.625   15.445 1.00 47.43 ? 764 HOH A O      1 
HETATM 3998 H H1     . HOH G 4 .   ? 21.204  8.315   16.107 1.00 0.00  ? 764 HOH A H1     1 
HETATM 3999 H H2     . HOH G 4 .   ? 20.617  6.989   15.697 1.00 0.00  ? 764 HOH A H2     1 
HETATM 4000 O O      . HOH G 4 .   ? 38.202  -2.495  29.941 1.00 57.42 ? 772 HOH A O      1 
HETATM 4001 H H1     . HOH G 4 .   ? 38.651  -3.306  30.159 1.00 0.00  ? 772 HOH A H1     1 
HETATM 4002 H H2     . HOH G 4 .   ? 37.479  -2.375  30.556 1.00 0.00  ? 772 HOH A H2     1 
HETATM 4003 O O      . HOH G 4 .   ? 10.741  5.145   20.139 1.00 38.13 ? 774 HOH A O      1 
HETATM 4004 H H1     . HOH G 4 .   ? 11.642  5.460   19.994 1.00 0.00  ? 774 HOH A H1     1 
HETATM 4005 H H2     . HOH G 4 .   ? 10.287  5.974   20.297 1.00 0.00  ? 774 HOH A H2     1 
HETATM 4006 O O      . HOH G 4 .   ? 24.824  16.913  16.794 1.00 23.11 ? 776 HOH A O      1 
HETATM 4007 H H1     . HOH G 4 .   ? 25.406  17.568  17.172 1.00 0.00  ? 776 HOH A H1     1 
HETATM 4008 H H2     . HOH G 4 .   ? 24.761  17.227  15.881 1.00 0.00  ? 776 HOH A H2     1 
HETATM 4009 O O      . HOH G 4 .   ? -0.402  -0.937  47.277 1.00 44.47 ? 777 HOH A O      1 
HETATM 4010 H H1     . HOH G 4 .   ? 0.156   -1.718  47.265 1.00 0.00  ? 777 HOH A H1     1 
HETATM 4011 H H2     . HOH G 4 .   ? -1.207  -1.235  46.852 1.00 0.00  ? 777 HOH A H2     1 
HETATM 4012 O O      . HOH G 4 .   ? 7.411   28.117  58.907 1.00 36.48 ? 778 HOH A O      1 
HETATM 4013 H H1     . HOH G 4 .   ? 8.098   28.069  58.257 1.00 0.00  ? 778 HOH A H1     1 
HETATM 4014 H H2     . HOH G 4 .   ? 6.753   27.490  58.559 1.00 0.00  ? 778 HOH A H2     1 
HETATM 4015 O O      . HOH G 4 .   ? -3.389  12.855  34.826 1.00 38.25 ? 780 HOH A O      1 
HETATM 4016 H H1     . HOH G 4 .   ? -3.877  13.534  34.350 1.00 0.00  ? 780 HOH A H1     1 
HETATM 4017 H H2     . HOH G 4 .   ? -2.508  13.226  34.909 1.00 0.00  ? 780 HOH A H2     1 
HETATM 4018 O O      . HOH G 4 .   ? 30.360  11.195  18.109 1.00 58.32 ? 783 HOH A O      1 
HETATM 4019 H H1     . HOH G 4 .   ? 30.141  12.133  18.063 1.00 0.00  ? 783 HOH A H1     1 
HETATM 4020 H H2     . HOH G 4 .   ? 31.262  11.163  17.790 1.00 0.00  ? 783 HOH A H2     1 
HETATM 4021 O O      . HOH G 4 .   ? -10.371 11.811  39.699 1.00 63.06 ? 786 HOH A O      1 
HETATM 4022 H H1     . HOH G 4 .   ? -10.615 12.048  38.810 1.00 0.00  ? 786 HOH A H1     1 
HETATM 4023 H H2     . HOH G 4 .   ? -10.312 10.846  39.687 1.00 0.00  ? 786 HOH A H2     1 
HETATM 4024 O O      . HOH G 4 .   ? 41.390  1.104   36.104 1.00 30.17 ? 790 HOH A O      1 
HETATM 4025 H H1     . HOH G 4 .   ? 42.257  1.257   36.452 1.00 0.00  ? 790 HOH A H1     1 
HETATM 4026 H H2     . HOH G 4 .   ? 41.011  1.963   35.873 1.00 0.00  ? 790 HOH A H2     1 
HETATM 4027 O O      . HOH G 4 .   ? 38.896  9.451   28.263 1.00 39.65 ? 795 HOH A O      1 
HETATM 4028 H H1     . HOH G 4 .   ? 38.995  8.540   27.987 1.00 0.00  ? 795 HOH A H1     1 
HETATM 4029 H H2     . HOH G 4 .   ? 39.423  9.448   29.069 1.00 0.00  ? 795 HOH A H2     1 
HETATM 4030 O O      . HOH G 4 .   ? 4.703   7.028   37.317 1.00 40.57 ? 796 HOH A O      1 
HETATM 4031 H H1     . HOH G 4 .   ? 5.661   7.084   37.407 1.00 0.00  ? 796 HOH A H1     1 
HETATM 4032 H H2     . HOH G 4 .   ? 4.426   7.442   36.525 1.00 0.00  ? 796 HOH A H2     1 
HETATM 4033 O O      . HOH G 4 .   ? -7.347  0.247   48.475 1.00 66.45 ? 797 HOH A O      1 
HETATM 4034 H H1     . HOH G 4 .   ? -7.583  0.977   49.049 1.00 0.00  ? 797 HOH A H1     1 
HETATM 4035 H H2     . HOH G 4 .   ? -8.085  -0.357  48.543 1.00 0.00  ? 797 HOH A H2     1 
HETATM 4036 O O      . HOH G 4 .   ? 5.704   15.844  47.047 1.00 18.99 ? 798 HOH A O      1 
HETATM 4037 H H1     . HOH G 4 .   ? 4.776   15.958  46.828 1.00 0.00  ? 798 HOH A H1     1 
HETATM 4038 H H2     . HOH G 4 .   ? 6.218   16.234  46.336 1.00 0.00  ? 798 HOH A H2     1 
HETATM 4039 O O      . HOH G 4 .   ? 26.446  7.708   43.743 1.00 48.17 ? 801 HOH A O      1 
HETATM 4040 H H1     . HOH G 4 .   ? 26.230  8.470   44.285 1.00 0.00  ? 801 HOH A H1     1 
HETATM 4041 H H2     . HOH G 4 .   ? 25.798  7.763   43.052 1.00 0.00  ? 801 HOH A H2     1 
HETATM 4042 O O      . HOH G 4 .   ? 10.251  7.379   55.617 1.00 42.12 ? 802 HOH A O      1 
HETATM 4043 H H1     . HOH G 4 .   ? 9.960   6.476   55.757 1.00 0.00  ? 802 HOH A H1     1 
HETATM 4044 H H2     . HOH G 4 .   ? 9.831   7.642   54.796 1.00 0.00  ? 802 HOH A H2     1 
HETATM 4045 O O      . HOH G 4 .   ? 2.508   20.653  42.820 1.00 43.63 ? 803 HOH A O      1 
HETATM 4046 H H1     . HOH G 4 .   ? 2.764   20.167  43.596 1.00 0.00  ? 803 HOH A H1     1 
HETATM 4047 H H2     . HOH G 4 .   ? 1.580   20.880  42.878 1.00 0.00  ? 803 HOH A H2     1 
HETATM 4048 O O      . HOH G 4 .   ? 34.339  13.065  37.149 1.00 38.46 ? 807 HOH A O      1 
HETATM 4049 H H1     . HOH G 4 .   ? 34.593  12.496  36.395 1.00 0.00  ? 807 HOH A H1     1 
HETATM 4050 H H2     . HOH G 4 .   ? 34.027  12.567  37.833 1.00 0.00  ? 807 HOH A H2     1 
HETATM 4051 O O      . HOH G 4 .   ? 13.371  6.885   31.637 1.00 36.01 ? 809 HOH A O      1 
HETATM 4052 H H1     . HOH G 4 .   ? 13.933  6.154   31.883 1.00 0.00  ? 809 HOH A H1     1 
HETATM 4053 H H2     . HOH G 4 .   ? 12.983  6.591   30.800 1.00 0.00  ? 809 HOH A H2     1 
HETATM 4054 O O      . HOH G 4 .   ? -6.383  23.687  45.117 1.00 49.51 ? 810 HOH A O      1 
HETATM 4055 H H1     . HOH G 4 .   ? -5.524  23.442  44.789 1.00 0.00  ? 810 HOH A H1     1 
HETATM 4056 H H2     . HOH G 4 .   ? -6.717  22.904  45.561 1.00 0.00  ? 810 HOH A H2     1 
HETATM 4057 O O      . HOH G 4 .   ? 13.730  2.132   36.488 1.00 51.16 ? 812 HOH A O      1 
HETATM 4058 H H1     . HOH G 4 .   ? 14.615  2.404   36.255 1.00 0.00  ? 812 HOH A H1     1 
HETATM 4059 H H2     . HOH G 4 .   ? 13.777  1.182   36.622 1.00 0.00  ? 812 HOH A H2     1 
HETATM 4060 O O      . HOH G 4 .   ? 9.050   23.086  55.742 1.00 25.83 ? 816 HOH A O      1 
HETATM 4061 H H1     . HOH G 4 .   ? 8.158   23.093  55.375 1.00 0.00  ? 816 HOH A H1     1 
HETATM 4062 H H2     . HOH G 4 .   ? 9.493   22.330  55.323 1.00 0.00  ? 816 HOH A H2     1 
HETATM 4063 O O      . HOH G 4 .   ? 27.212  16.698  29.490 1.00 41.08 ? 818 HOH A O      1 
HETATM 4064 H H1     . HOH G 4 .   ? 27.908  16.381  30.071 1.00 0.00  ? 818 HOH A H1     1 
HETATM 4065 H H2     . HOH G 4 .   ? 27.696  16.984  28.702 1.00 0.00  ? 818 HOH A H2     1 
HETATM 4066 O O      . HOH G 4 .   ? -6.283  10.611  56.867 1.00 49.99 ? 820 HOH A O      1 
HETATM 4067 H H1     . HOH G 4 .   ? -5.669  10.378  56.167 1.00 0.00  ? 820 HOH A H1     1 
HETATM 4068 H H2     . HOH G 4 .   ? -6.512  11.521  56.659 1.00 0.00  ? 820 HOH A H2     1 
HETATM 4069 O O      . HOH G 4 .   ? 28.658  15.732  27.036 1.00 29.43 ? 826 HOH A O      1 
HETATM 4070 H H1     . HOH G 4 .   ? 28.644  15.514  27.975 1.00 0.00  ? 826 HOH A H1     1 
HETATM 4071 H H2     . HOH G 4 .   ? 28.696  14.840  26.663 1.00 0.00  ? 826 HOH A H2     1 
HETATM 4072 O O      . HOH G 4 .   ? 0.836   4.640   54.152 1.00 53.29 ? 829 HOH A O      1 
HETATM 4073 H H1     . HOH G 4 .   ? 0.755   5.036   55.027 1.00 0.00  ? 829 HOH A H1     1 
HETATM 4074 H H2     . HOH G 4 .   ? 1.593   5.069   53.785 1.00 0.00  ? 829 HOH A H2     1 
HETATM 4075 O O      . HOH G 4 .   ? -14.079 15.116  48.131 1.00 37.67 ? 832 HOH A O      1 
HETATM 4076 H H1     . HOH G 4 .   ? -14.997 14.846  48.195 1.00 0.00  ? 832 HOH A H1     1 
HETATM 4077 H H2     . HOH G 4 .   ? -13.780 14.749  47.305 1.00 0.00  ? 832 HOH A H2     1 
HETATM 4078 O O      . HOH G 4 .   ? 4.839   18.133  57.469 1.00 25.72 ? 836 HOH A O      1 
HETATM 4079 H H1     . HOH G 4 .   ? 3.919   18.014  57.275 1.00 0.00  ? 836 HOH A H1     1 
HETATM 4080 H H2     . HOH G 4 .   ? 4.877   18.460  58.365 1.00 0.00  ? 836 HOH A H2     1 
HETATM 4081 O O      . HOH G 4 .   ? 24.323  10.192  43.086 1.00 38.96 ? 840 HOH A O      1 
HETATM 4082 H H1     . HOH G 4 .   ? 23.862  10.682  43.784 1.00 0.00  ? 840 HOH A H1     1 
HETATM 4083 H H2     . HOH G 4 .   ? 25.008  10.830  42.849 1.00 0.00  ? 840 HOH A H2     1 
HETATM 4084 O O      . HOH G 4 .   ? 19.962  2.613   41.829 1.00 37.77 ? 842 HOH A O      1 
HETATM 4085 H H1     . HOH G 4 .   ? 19.771  1.840   41.299 1.00 0.00  ? 842 HOH A H1     1 
HETATM 4086 H H2     . HOH G 4 .   ? 20.682  3.026   41.333 1.00 0.00  ? 842 HOH A H2     1 
HETATM 4087 O O      . HOH G 4 .   ? 29.356  14.133  39.748 1.00 44.42 ? 846 HOH A O      1 
HETATM 4088 H H1     . HOH G 4 .   ? 28.573  14.674  39.672 1.00 0.00  ? 846 HOH A H1     1 
HETATM 4089 H H2     . HOH G 4 .   ? 29.055  13.354  40.230 1.00 0.00  ? 846 HOH A H2     1 
HETATM 4090 O O      . HOH G 4 .   ? 16.269  3.970   14.464 1.00 44.17 ? 850 HOH A O      1 
HETATM 4091 H H1     . HOH G 4 .   ? 15.883  3.428   13.751 1.00 0.00  ? 850 HOH A H1     1 
HETATM 4092 H H2     . HOH G 4 .   ? 15.665  3.674   15.168 1.00 0.00  ? 850 HOH A H2     1 
HETATM 4093 O O      . HOH G 4 .   ? 5.006   15.946  56.106 1.00 28.18 ? 854 HOH A O      1 
HETATM 4094 H H1     . HOH G 4 .   ? 5.893   16.301  56.074 1.00 0.00  ? 854 HOH A H1     1 
HETATM 4095 H H2     . HOH G 4 .   ? 4.648   16.175  55.254 1.00 0.00  ? 854 HOH A H2     1 
HETATM 4096 O O      . HOH G 4 .   ? 32.701  -1.419  35.022 1.00 55.22 ? 855 HOH A O      1 
HETATM 4097 H H1     . HOH G 4 .   ? 33.045  -1.498  34.123 1.00 0.00  ? 855 HOH A H1     1 
HETATM 4098 H H2     . HOH G 4 .   ? 32.901  -0.507  35.233 1.00 0.00  ? 855 HOH A H2     1 
HETATM 4099 O O      . HOH G 4 .   ? 8.764   21.344  58.378 1.00 30.73 ? 857 HOH A O      1 
HETATM 4100 H H1     . HOH G 4 .   ? 8.693   20.468  58.766 1.00 0.00  ? 857 HOH A H1     1 
HETATM 4101 H H2     . HOH G 4 .   ? 8.289   21.252  57.553 1.00 0.00  ? 857 HOH A H2     1 
HETATM 4102 O O      . HOH G 4 .   ? 11.817  7.598   16.429 1.00 51.10 ? 860 HOH A O      1 
HETATM 4103 H H1     . HOH G 4 .   ? 11.905  7.827   15.509 1.00 0.00  ? 860 HOH A H1     1 
HETATM 4104 H H2     . HOH G 4 .   ? 12.083  8.402   16.865 1.00 0.00  ? 860 HOH A H2     1 
HETATM 4105 O O      . HOH G 4 .   ? -12.225 1.713   42.235 1.00 40.92 ? 861 HOH A O      1 
HETATM 4106 H H1     . HOH G 4 .   ? -12.295 2.665   42.285 1.00 0.00  ? 861 HOH A H1     1 
HETATM 4107 H H2     . HOH G 4 .   ? -12.202 1.447   41.311 1.00 0.00  ? 861 HOH A H2     1 
HETATM 4108 O O      . HOH G 4 .   ? -7.418  6.653   45.825 1.00 85.74 ? 870 HOH A O      1 
HETATM 4109 H H1     . HOH G 4 .   ? -8.292  6.902   45.531 1.00 0.00  ? 870 HOH A H1     1 
HETATM 4110 H H2     . HOH G 4 .   ? -6.958  6.388   45.028 1.00 0.00  ? 870 HOH A H2     1 
HETATM 4111 O O      . HOH G 4 .   ? 0.613   10.549  46.538 1.00 59.12 ? 877 HOH A O      1 
HETATM 4112 H H1     . HOH G 4 .   ? -0.235  10.234  46.787 1.00 0.00  ? 877 HOH A H1     1 
HETATM 4113 H H2     . HOH G 4 .   ? 0.738   10.673  45.613 1.00 0.00  ? 877 HOH A H2     1 
HETATM 4114 O O      . HOH G 4 .   ? 2.953   17.753  36.273 1.00 57.31 ? 878 HOH A O      1 
HETATM 4115 H H1     . HOH G 4 .   ? 3.688   17.165  36.146 1.00 0.00  ? 878 HOH A H1     1 
HETATM 4116 H H2     . HOH G 4 .   ? 2.229   17.187  36.020 1.00 0.00  ? 878 HOH A H2     1 
HETATM 4117 O O      . HOH G 4 .   ? 30.457  -7.359  26.462 1.00 60.61 ? 880 HOH A O      1 
HETATM 4118 H H1     . HOH G 4 .   ? 30.156  -6.544  26.896 1.00 0.00  ? 880 HOH A H1     1 
HETATM 4119 H H2     . HOH G 4 .   ? 31.208  -7.105  25.939 1.00 0.00  ? 880 HOH A H2     1 
HETATM 4120 O O      . HOH G 4 .   ? 3.918   -4.367  45.040 1.00 44.83 ? 885 HOH A O      1 
HETATM 4121 H H1     . HOH G 4 .   ? 4.651   -4.625  44.479 1.00 0.00  ? 885 HOH A H1     1 
HETATM 4122 H H2     . HOH G 4 .   ? 4.158   -3.514  45.394 1.00 0.00  ? 885 HOH A H2     1 
HETATM 4123 O O      . HOH G 4 .   ? 16.383  8.032   29.941 1.00 38.13 ? 887 HOH A O      1 
HETATM 4124 H H1     . HOH G 4 .   ? 15.551  7.636   30.237 1.00 0.00  ? 887 HOH A H1     1 
HETATM 4125 H H2     . HOH G 4 .   ? 16.949  7.310   29.687 1.00 0.00  ? 887 HOH A H2     1 
HETATM 4126 O O      . HOH G 4 .   ? 5.264   18.007  45.103 1.00 44.48 ? 888 HOH A O      1 
HETATM 4127 H H1     . HOH G 4 .   ? 5.460   18.066  46.032 1.00 0.00  ? 888 HOH A H1     1 
HETATM 4128 H H2     . HOH G 4 .   ? 4.900   17.122  44.920 1.00 0.00  ? 888 HOH A H2     1 
HETATM 4129 O O      . HOH G 4 .   ? 35.211  13.568  39.296 1.00 77.12 ? 904 HOH A O      1 
HETATM 4130 H H1     . HOH G 4 .   ? 35.710  13.046  38.656 1.00 0.00  ? 904 HOH A H1     1 
HETATM 4131 H H2     . HOH G 4 .   ? 34.379  13.242  39.628 1.00 0.00  ? 904 HOH A H2     1 
HETATM 4132 O O      . HOH G 4 .   ? 19.027  5.286   42.910 1.00 34.96 ? 910 HOH A O      1 
HETATM 4133 H H1     . HOH G 4 .   ? 18.487  4.574   42.560 1.00 0.00  ? 910 HOH A H1     1 
HETATM 4134 H H2     . HOH G 4 .   ? 19.839  5.073   42.445 1.00 0.00  ? 910 HOH A H2     1 
HETATM 4135 O O      . HOH H 4 .   ? 21.063  30.575  28.355 1.00 38.43 ? 705 HOH B O      1 
HETATM 4136 H H1     . HOH H 4 .   ? 20.891  31.348  28.900 1.00 0.00  ? 705 HOH B H1     1 
HETATM 4137 H H2     . HOH H 4 .   ? 20.530  29.886  28.740 1.00 0.00  ? 705 HOH B H2     1 
HETATM 4138 O O      . HOH H 4 .   ? 17.718  21.345  57.307 1.00 33.46 ? 710 HOH B O      1 
HETATM 4139 H H1     . HOH H 4 .   ? 17.585  22.253  57.583 1.00 0.00  ? 710 HOH B H1     1 
HETATM 4140 H H2     . HOH H 4 .   ? 16.949  20.930  57.714 1.00 0.00  ? 710 HOH B H2     1 
HETATM 4141 O O      . HOH H 4 .   ? 20.107  35.697  48.977 1.00 33.62 ? 730 HOH B O      1 
HETATM 4142 H H1     . HOH H 4 .   ? 20.526  35.854  49.825 1.00 0.00  ? 730 HOH B H1     1 
HETATM 4143 H H2     . HOH H 4 .   ? 20.466  36.374  48.396 1.00 0.00  ? 730 HOH B H2     1 
HETATM 4144 O O      . HOH H 4 .   ? 15.309  34.929  63.265 1.00 51.35 ? 735 HOH B O      1 
HETATM 4145 H H1     . HOH H 4 .   ? 14.425  35.197  63.080 1.00 0.00  ? 735 HOH B H1     1 
HETATM 4146 H H2     . HOH H 4 .   ? 15.258  34.128  63.802 1.00 0.00  ? 735 HOH B H2     1 
HETATM 4147 O O      . HOH H 4 .   ? 28.466  19.557  46.149 1.00 44.25 ? 736 HOH B O      1 
HETATM 4148 H H1     . HOH H 4 .   ? 27.518  19.592  46.058 1.00 0.00  ? 736 HOH B H1     1 
HETATM 4149 H H2     . HOH H 4 .   ? 28.692  20.386  46.579 1.00 0.00  ? 736 HOH B H2     1 
HETATM 4150 O O      . HOH H 4 .   ? 17.963  24.787  71.269 1.00 44.58 ? 737 HOH B O      1 
HETATM 4151 H H1     . HOH H 4 .   ? 18.021  25.721  71.097 1.00 0.00  ? 737 HOH B H1     1 
HETATM 4152 H H2     . HOH H 4 .   ? 18.012  24.339  70.451 1.00 0.00  ? 737 HOH B H2     1 
HETATM 4153 O O      . HOH H 4 .   ? 8.671   26.732  62.175 1.00 24.01 ? 741 HOH B O      1 
HETATM 4154 H H1     . HOH H 4 .   ? 8.794   25.786  62.050 1.00 0.00  ? 741 HOH B H1     1 
HETATM 4155 H H2     . HOH H 4 .   ? 7.907   26.779  62.761 1.00 0.00  ? 741 HOH B H2     1 
HETATM 4156 O O      . HOH H 4 .   ? 14.421  49.212  62.646 1.00 26.75 ? 742 HOH B O      1 
HETATM 4157 H H1     . HOH H 4 .   ? 14.781  48.450  62.190 1.00 0.00  ? 742 HOH B H1     1 
HETATM 4158 H H2     . HOH H 4 .   ? 14.022  48.869  63.449 1.00 0.00  ? 742 HOH B H2     1 
HETATM 4159 O O      . HOH H 4 .   ? 23.990  30.824  30.998 1.00 40.31 ? 743 HOH B O      1 
HETATM 4160 H H1     . HOH H 4 .   ? 23.549  30.340  31.701 1.00 0.00  ? 743 HOH B H1     1 
HETATM 4161 H H2     . HOH H 4 .   ? 24.284  30.155  30.378 1.00 0.00  ? 743 HOH B H2     1 
HETATM 4162 O O      . HOH H 4 .   ? 13.823  41.827  55.863 1.00 27.48 ? 758 HOH B O      1 
HETATM 4163 H H1     . HOH H 4 .   ? 13.201  41.110  55.899 1.00 0.00  ? 758 HOH B H1     1 
HETATM 4164 H H2     . HOH H 4 .   ? 14.170  41.919  56.752 1.00 0.00  ? 758 HOH B H2     1 
HETATM 4165 O O      . HOH H 4 .   ? 35.949  38.368  63.682 1.00 75.33 ? 765 HOH B O      1 
HETATM 4166 H H1     . HOH H 4 .   ? 35.841  37.591  63.118 1.00 0.00  ? 765 HOH B H1     1 
HETATM 4167 H H2     . HOH H 4 .   ? 36.886  38.567  63.674 1.00 0.00  ? 765 HOH B H2     1 
HETATM 4168 O O      . HOH H 4 .   ? 25.429  33.645  31.922 1.00 29.28 ? 770 HOH B O      1 
HETATM 4169 H H1     . HOH H 4 .   ? 25.060  32.883  32.375 1.00 0.00  ? 770 HOH B H1     1 
HETATM 4170 H H2     . HOH H 4 .   ? 25.380  33.403  30.997 1.00 0.00  ? 770 HOH B H2     1 
HETATM 4171 O O      . HOH H 4 .   ? 26.765  28.246  21.300 1.00 32.90 ? 773 HOH B O      1 
HETATM 4172 H H1     . HOH H 4 .   ? 27.345  27.677  20.799 1.00 0.00  ? 773 HOH B H1     1 
HETATM 4173 H H2     . HOH H 4 .   ? 26.544  27.743  22.082 1.00 0.00  ? 773 HOH B H2     1 
HETATM 4174 O O      . HOH H 4 .   ? 18.728  29.111  31.007 1.00 52.13 ? 775 HOH B O      1 
HETATM 4175 H H1     . HOH H 4 .   ? 18.831  28.234  30.627 1.00 0.00  ? 775 HOH B H1     1 
HETATM 4176 H H2     . HOH H 4 .   ? 18.060  29.508  30.460 1.00 0.00  ? 775 HOH B H2     1 
HETATM 4177 O O      . HOH H 4 .   ? 29.527  23.422  44.924 1.00 33.77 ? 782 HOH B O      1 
HETATM 4178 H H1     . HOH H 4 .   ? 30.020  23.924  44.249 1.00 0.00  ? 782 HOH B H1     1 
HETATM 4179 H H2     . HOH H 4 .   ? 30.135  23.236  45.628 1.00 0.00  ? 782 HOH B H2     1 
HETATM 4180 O O      . HOH H 4 .   ? 24.253  19.837  24.573 1.00 43.36 ? 787 HOH B O      1 
HETATM 4181 H H1     . HOH H 4 .   ? 24.610  19.895  23.696 1.00 0.00  ? 787 HOH B H1     1 
HETATM 4182 H H2     . HOH H 4 .   ? 23.326  19.579  24.596 1.00 0.00  ? 787 HOH B H2     1 
HETATM 4183 O O      . HOH H 4 .   ? 33.855  33.580  46.365 1.00 32.47 ? 788 HOH B O      1 
HETATM 4184 H H1     . HOH H 4 .   ? 33.346  34.381  46.244 1.00 0.00  ? 788 HOH B H1     1 
HETATM 4185 H H2     . HOH H 4 .   ? 33.943  33.236  45.488 1.00 0.00  ? 788 HOH B H2     1 
HETATM 4186 O O      . HOH H 4 .   ? 21.794  17.961  17.141 1.00 39.55 ? 792 HOH B O      1 
HETATM 4187 H H1     . HOH H 4 .   ? 21.959  18.462  17.936 1.00 0.00  ? 792 HOH B H1     1 
HETATM 4188 H H2     . HOH H 4 .   ? 20.996  18.410  16.828 1.00 0.00  ? 792 HOH B H2     1 
HETATM 4189 O O      . HOH H 4 .   ? 23.813  18.691  48.567 1.00 78.21 ? 800 HOH B O      1 
HETATM 4190 H H1     . HOH H 4 .   ? 23.921  19.276  47.801 1.00 0.00  ? 800 HOH B H1     1 
HETATM 4191 H H2     . HOH H 4 .   ? 22.894  18.731  48.806 1.00 0.00  ? 800 HOH B H2     1 
HETATM 4192 O O      . HOH H 4 .   ? 17.851  22.903  16.272 1.00 52.93 ? 805 HOH B O      1 
HETATM 4193 H H1     . HOH H 4 .   ? 17.505  23.234  17.113 1.00 0.00  ? 805 HOH B H1     1 
HETATM 4194 H H2     . HOH H 4 .   ? 17.383  23.413  15.603 1.00 0.00  ? 805 HOH B H2     1 
HETATM 4195 O O      . HOH H 4 .   ? 26.787  41.221  54.070 1.00 47.95 ? 806 HOH B O      1 
HETATM 4196 H H1     . HOH H 4 .   ? 26.723  40.294  53.831 1.00 0.00  ? 806 HOH B H1     1 
HETATM 4197 H H2     . HOH H 4 .   ? 27.707  41.447  54.178 1.00 0.00  ? 806 HOH B H2     1 
HETATM 4198 O O      . HOH H 4 .   ? 17.822  37.260  13.469 1.00 48.28 ? 813 HOH B O      1 
HETATM 4199 H H1     . HOH H 4 .   ? 17.739  36.572  14.132 1.00 0.00  ? 813 HOH B H1     1 
HETATM 4200 H H2     . HOH H 4 .   ? 16.915  37.494  13.290 1.00 0.00  ? 813 HOH B H2     1 
HETATM 4201 O O      . HOH H 4 .   ? 15.214  43.839  61.921 1.00 36.84 ? 814 HOH B O      1 
HETATM 4202 H H1     . HOH H 4 .   ? 15.972  43.963  61.331 1.00 0.00  ? 814 HOH B H1     1 
HETATM 4203 H H2     . HOH H 4 .   ? 15.463  44.302  62.717 1.00 0.00  ? 814 HOH B H2     1 
HETATM 4204 O O      . HOH H 4 .   ? 30.761  41.312  45.892 1.00 60.77 ? 817 HOH B O      1 
HETATM 4205 H H1     . HOH H 4 .   ? 30.106  40.921  46.458 1.00 0.00  ? 817 HOH B H1     1 
HETATM 4206 H H2     . HOH H 4 .   ? 30.249  41.902  45.335 1.00 0.00  ? 817 HOH B H2     1 
HETATM 4207 O O      . HOH H 4 .   ? 24.439  50.493  33.092 1.00 30.61 ? 819 HOH B O      1 
HETATM 4208 H H1     . HOH H 4 .   ? 25.165  50.942  33.513 1.00 0.00  ? 819 HOH B H1     1 
HETATM 4209 H H2     . HOH H 4 .   ? 24.352  49.687  33.610 1.00 0.00  ? 819 HOH B H2     1 
HETATM 4210 O O      . HOH H 4 .   ? 9.439   40.908  61.050 1.00 28.71 ? 821 HOH B O      1 
HETATM 4211 H H1     . HOH H 4 .   ? 8.885   41.491  60.526 1.00 0.00  ? 821 HOH B H1     1 
HETATM 4212 H H2     . HOH H 4 .   ? 9.890   40.408  60.409 1.00 0.00  ? 821 HOH B H2     1 
HETATM 4213 O O      . HOH H 4 .   ? 20.613  42.266  15.729 1.00 41.67 ? 823 HOH B O      1 
HETATM 4214 H H1     . HOH H 4 .   ? 19.898  41.771  16.103 1.00 0.00  ? 823 HOH B H1     1 
HETATM 4215 H H2     . HOH H 4 .   ? 20.373  43.196  15.670 1.00 0.00  ? 823 HOH B H2     1 
HETATM 4216 O O      . HOH H 4 .   ? 15.836  29.549  66.360 1.00 54.16 ? 824 HOH B O      1 
HETATM 4217 H H1     . HOH H 4 .   ? 16.290  30.158  66.953 1.00 0.00  ? 824 HOH B H1     1 
HETATM 4218 H H2     . HOH H 4 .   ? 15.091  29.281  66.909 1.00 0.00  ? 824 HOH B H2     1 
HETATM 4219 O O      . HOH H 4 .   ? 18.142  46.782  22.756 1.00 38.56 ? 828 HOH B O      1 
HETATM 4220 H H1     . HOH H 4 .   ? 18.759  46.191  22.332 1.00 0.00  ? 828 HOH B H1     1 
HETATM 4221 H H2     . HOH H 4 .   ? 17.616  46.318  23.388 1.00 0.00  ? 828 HOH B H2     1 
HETATM 4222 O O      . HOH H 4 .   ? 29.378  20.058  52.304 1.00 46.22 ? 831 HOH B O      1 
HETATM 4223 H H1     . HOH H 4 .   ? 28.682  19.738  52.878 1.00 0.00  ? 831 HOH B H1     1 
HETATM 4224 H H2     . HOH H 4 .   ? 29.496  20.977  52.540 1.00 0.00  ? 831 HOH B H2     1 
HETATM 4225 O O      . HOH H 4 .   ? 20.806  39.463  14.370 1.00 25.29 ? 834 HOH B O      1 
HETATM 4226 H H1     . HOH H 4 .   ? 20.199  38.796  14.645 1.00 0.00  ? 834 HOH B H1     1 
HETATM 4227 H H2     . HOH H 4 .   ? 20.394  39.997  13.696 1.00 0.00  ? 834 HOH B H2     1 
HETATM 4228 O O      . HOH H 4 .   ? 26.314  18.217  50.551 1.00 30.84 ? 841 HOH B O      1 
HETATM 4229 H H1     . HOH H 4 .   ? 25.511  18.610  50.762 1.00 0.00  ? 841 HOH B H1     1 
HETATM 4230 H H2     . HOH H 4 .   ? 26.049  17.317  50.307 1.00 0.00  ? 841 HOH B H2     1 
HETATM 4231 O O      . HOH H 4 .   ? 28.456  25.800  69.060 1.00 48.30 ? 848 HOH B O      1 
HETATM 4232 H H1     . HOH H 4 .   ? 28.154  25.154  68.429 1.00 0.00  ? 848 HOH B H1     1 
HETATM 4233 H H2     . HOH H 4 .   ? 29.207  26.180  68.595 1.00 0.00  ? 848 HOH B H2     1 
HETATM 4234 O O      . HOH H 4 .   ? 23.152  21.383  22.500 1.00 46.58 ? 849 HOH B O      1 
HETATM 4235 H H1     . HOH H 4 .   ? 23.696  20.613  22.533 1.00 0.00  ? 849 HOH B H1     1 
HETATM 4236 H H2     . HOH H 4 .   ? 22.504  21.212  21.817 1.00 0.00  ? 849 HOH B H2     1 
HETATM 4237 O O      . HOH H 4 .   ? 16.178  31.624  68.761 1.00 94.90 ? 859 HOH B O      1 
HETATM 4238 H H1     . HOH H 4 .   ? 15.698  32.099  69.445 1.00 0.00  ? 859 HOH B H1     1 
HETATM 4239 H H2     . HOH H 4 .   ? 16.810  31.101  69.256 1.00 0.00  ? 859 HOH B H2     1 
HETATM 4240 O O      . HOH H 4 .   ? 16.039  49.313  65.280 1.00 42.62 ? 862 HOH B O      1 
HETATM 4241 H H1     . HOH H 4 .   ? 15.939  50.273  65.245 1.00 0.00  ? 862 HOH B H1     1 
HETATM 4242 H H2     . HOH H 4 .   ? 16.012  49.135  64.336 1.00 0.00  ? 862 HOH B H2     1 
HETATM 4243 O O      . HOH H 4 .   ? 14.212  51.476  64.111 1.00 41.80 ? 865 HOH B O      1 
HETATM 4244 H H1     . HOH H 4 .   ? 14.228  52.428  64.003 1.00 0.00  ? 865 HOH B H1     1 
HETATM 4245 H H2     . HOH H 4 .   ? 14.168  51.114  63.194 1.00 0.00  ? 865 HOH B H2     1 
HETATM 4246 O O      . HOH H 4 .   ? 12.603  50.928  61.860 1.00 48.23 ? 868 HOH B O      1 
HETATM 4247 H H1     . HOH H 4 .   ? 12.603  51.881  61.838 1.00 0.00  ? 868 HOH B H1     1 
HETATM 4248 H H2     . HOH H 4 .   ? 12.640  50.662  60.941 1.00 0.00  ? 868 HOH B H2     1 
HETATM 4249 O O      . HOH H 4 .   ? 6.049   25.307  60.507 1.00 40.49 ? 869 HOH B O      1 
HETATM 4250 H H1     . HOH H 4 .   ? 6.181   25.183  61.442 1.00 0.00  ? 869 HOH B H1     1 
HETATM 4251 H H2     . HOH H 4 .   ? 6.931   25.393  60.138 1.00 0.00  ? 869 HOH B H2     1 
HETATM 4252 O O      . HOH H 4 .   ? 15.101  42.820  39.000 1.00 48.76 ? 873 HOH B O      1 
HETATM 4253 H H1     . HOH H 4 .   ? 15.892  43.369  39.079 1.00 0.00  ? 873 HOH B H1     1 
HETATM 4254 H H2     . HOH H 4 .   ? 14.439  43.364  39.428 1.00 0.00  ? 873 HOH B H2     1 
HETATM 4255 O O      . HOH H 4 .   ? 25.185  36.938  19.634 1.00 30.99 ? 874 HOH B O      1 
HETATM 4256 H H1     . HOH H 4 .   ? 24.550  36.295  19.374 1.00 0.00  ? 874 HOH B H1     1 
HETATM 4257 H H2     . HOH H 4 .   ? 25.193  37.655  19.001 1.00 0.00  ? 874 HOH B H2     1 
HETATM 4258 O O      . HOH H 4 .   ? 24.444  24.598  27.302 1.00 40.30 ? 875 HOH B O      1 
HETATM 4259 H H1     . HOH H 4 .   ? 24.093  24.877  28.144 1.00 0.00  ? 875 HOH B H1     1 
HETATM 4260 H H2     . HOH H 4 .   ? 24.171  23.683  27.182 1.00 0.00  ? 875 HOH B H2     1 
HETATM 4261 O O      . HOH H 4 .   ? 35.629  20.959  58.997 1.00 48.65 ? 876 HOH B O      1 
HETATM 4262 H H1     . HOH H 4 .   ? 35.174  20.164  58.724 1.00 0.00  ? 876 HOH B H1     1 
HETATM 4263 H H2     . HOH H 4 .   ? 35.186  21.630  58.470 1.00 0.00  ? 876 HOH B H2     1 
HETATM 4264 O O      . HOH H 4 .   ? 12.434  22.626  57.391 1.00 38.64 ? 881 HOH B O      1 
HETATM 4265 H H1     . HOH H 4 .   ? 11.474  22.762  57.452 1.00 0.00  ? 881 HOH B H1     1 
HETATM 4266 H H2     . HOH H 4 .   ? 12.789  22.755  58.270 1.00 0.00  ? 881 HOH B H2     1 
HETATM 4267 O O      . HOH H 4 .   ? 12.401  41.938  63.249 1.00 21.02 ? 906 HOH B O      1 
HETATM 4268 H H1     . HOH H 4 .   ? 12.301  41.597  64.133 1.00 0.00  ? 906 HOH B H1     1 
HETATM 4269 H H2     . HOH H 4 .   ? 12.658  42.850  63.396 1.00 0.00  ? 906 HOH B H2     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   449 449 DT  T   C . n 
A 1 2   DC  2   450 450 DC  C   C . n 
A 1 3   DC  3   451 451 DC  C   C . n 
A 1 4   DT  4   452 452 DT  T   C . n 
A 1 5   DC  5   453 453 DC  C   C . n 
A 1 6   DA  6   454 454 DA  A   C . n 
A 1 7   DT  7   455 455 DT  T   C . n 
A 1 8   DG  8   456 456 DG  G   C . n 
A 1 9   DT  9   457 457 DT  T   C . n 
A 1 10  DA  10  458 458 DA  A   C . n 
A 1 11  DT  11  459 459 DT  T   C . n 
A 1 12  DA  12  460 460 DA  A   C . n 
A 1 13  DT  13  461 461 DT  T   C . n 
A 1 14  DA  14  462 462 DA  A   C . n 
A 1 15  DC  15  463 463 DC  C   C . n 
A 1 16  DA  16  464 464 DA  A   C . n 
A 1 17  DT  17  465 465 DT  T   C . n 
A 1 18  DG  18  466 466 DG  G   C . n 
A 1 19  DA  19  467 467 DA  A   C . n 
A 1 20  DG  20  468 468 DG  G   C . n 
A 1 21  DG  21  469 469 DG  G   C . n 
A 1 22  DA  22  470 470 DA  A   C . n 
A 1 23  DA  23  471 471 DA  A   C . n 
A 1 24  DG  24  472 472 DG  G   C . n 
A 1 25  DG  25  473 473 DG  G   C . n 
B 2 1   DC  1   475 475 DC  C   D . n 
B 2 2   DT  2   476 476 DT  T   D . n 
B 2 3   DT  3   477 477 DT  T   D . n 
B 2 4   DC  4   478 478 DC  C   D . n 
B 2 5   DC  5   479 479 DC  C   D . n 
B 2 6   DT  6   480 480 DT  T   D . n 
B 2 7   DC  7   481 481 DC  C   D . n 
B 2 8   DA  8   482 482 DA  A   D . n 
B 2 9   DT  9   483 483 DT  T   D . n 
B 2 10  DG  10  484 484 DG  G   D . n 
B 2 11  DT  11  485 485 DT  T   D . n 
B 2 12  DA  12  486 486 DA  A   D . n 
B 2 13  DT  13  487 487 DT  T   D . n 
B 2 14  DA  14  488 488 DA  A   D . n 
B 2 15  DT  15  489 489 DT  T   D . n 
B 2 16  DA  16  490 490 DA  A   D . n 
B 2 17  DC  17  491 491 DC  C   D . n 
B 2 18  DA  18  492 492 DA  A   D . n 
B 2 19  DT  19  493 493 DT  T   D . n 
B 2 20  DG  20  494 494 DG  G   D . n 
B 2 21  DA  21  495 495 DA  A   D . n 
B 2 22  DG  22  496 496 DG  G   D . n 
B 2 23  DG  23  497 497 DG  G   D . n 
B 2 24  DA  24  498 498 DA  A   D . n 
C 3 1   GLY 1   5   5   GLY GLY A . n 
C 3 2   MET 2   6   6   MET MET A . n 
C 3 3   ARG 3   7   7   ARG ARG A . n 
C 3 4   ALA 4   8   8   ALA ALA A . n 
C 3 5   LEU 5   9   9   LEU LEU A . n 
C 3 6   GLU 6   10  10  GLU GLU A . n 
C 3 7   GLN 7   11  11  GLN GLN A . n 
C 3 8   PHE 8   12  12  PHE PHE A . n 
C 3 9   ALA 9   13  13  ALA ALA A . n 
C 3 10  ASN 10  14  14  ASN ASN A . n 
C 3 11  GLU 11  15  15  GLU GLU A . n 
C 3 12  PHE 12  16  16  PHE PHE A . n 
C 3 13  LYS 13  17  17  LYS LYS A . n 
C 3 14  VAL 14  18  18  VAL VAL A . n 
C 3 15  ARG 15  19  19  ARG ARG A . n 
C 3 16  ARG 16  20  20  ARG ARG A . n 
C 3 17  ILE 17  21  21  ILE ILE A . n 
C 3 18  LYS 18  22  22  LYS LYS A . n 
C 3 19  LEU 19  23  23  LEU LEU A . n 
C 3 20  GLY 20  24  24  GLY GLY A . n 
C 3 21  TYR 21  25  25  TYR TYR A . n 
C 3 22  THR 22  26  26  THR THR A . n 
C 3 23  GLN 23  27  27  GLN GLN A . n 
C 3 24  THR 24  28  28  THR THR A . n 
C 3 25  ASN 25  29  29  ASN ASN A . n 
C 3 26  VAL 26  30  30  VAL VAL A . n 
C 3 27  GLY 27  31  31  GLY GLY A . n 
C 3 28  GLU 28  32  32  GLU GLU A . n 
C 3 29  ALA 29  33  33  ALA ALA A . n 
C 3 30  LEU 30  34  34  LEU LEU A . n 
C 3 31  ALA 31  35  35  ALA ALA A . n 
C 3 32  ALA 32  36  36  ALA ALA A . n 
C 3 33  VAL 33  37  37  VAL VAL A . n 
C 3 34  HIS 34  38  38  HIS HIS A . n 
C 3 35  GLY 35  39  39  GLY GLY A . n 
C 3 36  SER 36  40  40  SER SER A . n 
C 3 37  GLU 37  41  41  GLU GLU A . n 
C 3 38  PHE 38  42  42  PHE PHE A . n 
C 3 39  SER 39  43  43  SER SER A . n 
C 3 40  GLN 40  44  44  GLN GLN A . n 
C 3 41  THR 41  45  45  THR THR A . n 
C 3 42  THR 42  46  46  THR THR A . n 
C 3 43  ILE 43  47  47  ILE ILE A . n 
C 3 44  CYS 44  48  48  CYS CYS A . n 
C 3 45  ARG 45  49  49  ARG ARG A . n 
C 3 46  PHE 46  50  50  PHE PHE A . n 
C 3 47  GLU 47  51  51  GLU GLU A . n 
C 3 48  ASN 48  52  52  ASN ASN A . n 
C 3 49  LEU 49  53  53  LEU LEU A . n 
C 3 50  GLN 50  54  54  GLN GLN A . n 
C 3 51  LEU 51  55  55  LEU LEU A . n 
C 3 52  SER 52  56  56  SER SER A . n 
C 3 53  PHE 53  57  57  PHE PHE A . n 
C 3 54  LYS 54  58  58  LYS LYS A . n 
C 3 55  ASN 55  59  59  ASN ASN A . n 
C 3 56  ALA 56  60  60  ALA ALA A . n 
C 3 57  CYS 57  61  61  CYS CYS A . n 
C 3 58  LYS 58  62  62  LYS LYS A . n 
C 3 59  LEU 59  63  63  LEU LEU A . n 
C 3 60  LYS 60  64  64  LYS LYS A . n 
C 3 61  ALA 61  65  65  ALA ALA A . n 
C 3 62  ILE 62  66  66  ILE ILE A . n 
C 3 63  LEU 63  67  67  LEU LEU A . n 
C 3 64  SER 64  68  68  SER SER A . n 
C 3 65  LYS 65  69  69  LYS LYS A . n 
C 3 66  TRP 66  70  70  TRP TRP A . n 
C 3 67  LEU 67  71  71  LEU LEU A . n 
C 3 68  GLU 68  72  72  GLU GLU A . n 
C 3 69  GLU 69  73  73  GLU GLU A . n 
C 3 70  ALA 70  74  74  ALA ALA A . n 
C 3 71  GLU 71  75  75  GLU GLU A . n 
C 3 72  GLN 72  76  76  GLN GLN A . n 
C 3 73  VAL 73  87  ?   ?   ?   A . n 
C 3 74  GLY 74  88  ?   ?   ?   A . n 
C 3 75  ALA 75  89  ?   ?   ?   A . n 
C 3 76  LEU 76  90  ?   ?   ?   A . n 
C 3 77  TYR 77  91  ?   ?   ?   A . n 
C 3 78  ASN 78  92  ?   ?   ?   A . n 
C 3 79  GLU 79  93  ?   ?   ?   A . n 
C 3 80  LYS 80  94  ?   ?   ?   A . n 
C 3 81  VAL 81  95  ?   ?   ?   A . n 
C 3 82  GLY 82  96  ?   ?   ?   A . n 
C 3 83  ALA 83  97  ?   ?   ?   A . n 
C 3 84  ASN 84  98  ?   ?   ?   A . n 
C 3 85  GLU 85  99  ?   ?   ?   A . n 
C 3 86  ARG 86  100 ?   ?   ?   A . n 
C 3 87  LYS 87  101 ?   ?   ?   A . n 
C 3 88  ARG 88  102 ?   ?   ?   A . n 
C 3 89  LYS 89  103 103 LYS LYS A . n 
C 3 90  ARG 90  104 104 ARG ARG A . n 
C 3 91  ARG 91  105 105 ARG ARG A . n 
C 3 92  THR 92  106 106 THR THR A . n 
C 3 93  THR 93  107 107 THR THR A . n 
C 3 94  ILE 94  108 108 ILE ILE A . n 
C 3 95  SER 95  109 109 SER SER A . n 
C 3 96  ILE 96  110 110 ILE ILE A . n 
C 3 97  ALA 97  111 111 ALA ALA A . n 
C 3 98  ALA 98  112 112 ALA ALA A . n 
C 3 99  LYS 99  113 113 LYS LYS A . n 
C 3 100 ASP 100 114 114 ASP ASP A . n 
C 3 101 ALA 101 115 115 ALA ALA A . n 
C 3 102 LEU 102 116 116 LEU LEU A . n 
C 3 103 GLU 103 117 117 GLU GLU A . n 
C 3 104 ARG 104 118 118 ARG ARG A . n 
C 3 105 HIS 105 119 119 HIS HIS A . n 
C 3 106 PHE 106 120 120 PHE PHE A . n 
C 3 107 GLY 107 121 121 GLY GLY A . n 
C 3 108 GLU 108 122 122 GLU GLU A . n 
C 3 109 HIS 109 123 123 HIS HIS A . n 
C 3 110 SER 110 124 124 SER SER A . n 
C 3 111 LYS 111 125 125 LYS LYS A . n 
C 3 112 PRO 112 126 126 PRO PRO A . n 
C 3 113 SER 113 127 127 SER SER A . n 
C 3 114 SER 114 128 128 SER SER A . n 
C 3 115 GLN 115 129 129 GLN GLN A . n 
C 3 116 GLU 116 130 130 GLU GLU A . n 
C 3 117 ILE 117 131 131 ILE ILE A . n 
C 3 118 MET 118 132 132 MET MET A . n 
C 3 119 ARG 119 133 133 ARG ARG A . n 
C 3 120 MET 120 134 134 MET MET A . n 
C 3 121 ALA 121 135 135 ALA ALA A . n 
C 3 122 GLU 122 136 136 GLU GLU A . n 
C 3 123 GLU 123 137 137 GLU GLU A . n 
C 3 124 LEU 124 138 138 LEU LEU A . n 
C 3 125 ASN 125 139 139 ASN ASN A . n 
C 3 126 LEU 126 140 140 LEU LEU A . n 
C 3 127 GLU 127 141 141 GLU GLU A . n 
C 3 128 LYS 128 142 142 LYS LYS A . n 
C 3 129 GLU 129 143 143 GLU GLU A . n 
C 3 130 VAL 130 144 144 VAL VAL A . n 
C 3 131 VAL 131 145 145 VAL VAL A . n 
C 3 132 ARG 132 146 146 ARG ARG A . n 
C 3 133 VAL 133 147 147 VAL VAL A . n 
C 3 134 TRP 134 148 148 TRP TRP A . n 
C 3 135 PHE 135 149 149 PHE PHE A . n 
C 3 136 CYS 136 150 150 CYS CYS A . n 
C 3 137 ASN 137 151 151 ASN ASN A . n 
C 3 138 ARG 138 152 152 ARG ARG A . n 
C 3 139 ARG 139 153 153 ARG ARG A . n 
C 3 140 GLN 140 154 154 GLN GLN A . n 
C 3 141 ARG 141 155 155 ARG ARG A . n 
C 3 142 GLU 142 156 156 GLU GLU A . n 
C 3 143 LYS 143 157 157 LYS LYS A . n 
C 3 144 ARG 144 158 158 ARG ARG A . n 
C 3 145 VAL 145 159 159 VAL VAL A . n 
C 3 146 LYS 146 160 160 LYS LYS A . n 
D 3 1   GLY 1   5   5   GLY GLY B . n 
D 3 2   MET 2   6   6   MET MET B . n 
D 3 3   ARG 3   7   7   ARG ARG B . n 
D 3 4   ALA 4   8   8   ALA ALA B . n 
D 3 5   LEU 5   9   9   LEU LEU B . n 
D 3 6   GLU 6   10  10  GLU GLU B . n 
D 3 7   GLN 7   11  11  GLN GLN B . n 
D 3 8   PHE 8   12  12  PHE PHE B . n 
D 3 9   ALA 9   13  13  ALA ALA B . n 
D 3 10  ASN 10  14  14  ASN ASN B . n 
D 3 11  GLU 11  15  15  GLU GLU B . n 
D 3 12  PHE 12  16  16  PHE PHE B . n 
D 3 13  LYS 13  17  17  LYS LYS B . n 
D 3 14  VAL 14  18  18  VAL VAL B . n 
D 3 15  ARG 15  19  19  ARG ARG B . n 
D 3 16  ARG 16  20  20  ARG ARG B . n 
D 3 17  ILE 17  21  21  ILE ILE B . n 
D 3 18  LYS 18  22  22  LYS LYS B . n 
D 3 19  LEU 19  23  23  LEU LEU B . n 
D 3 20  GLY 20  24  24  GLY GLY B . n 
D 3 21  TYR 21  25  25  TYR TYR B . n 
D 3 22  THR 22  26  26  THR THR B . n 
D 3 23  GLN 23  27  27  GLN GLN B . n 
D 3 24  THR 24  28  28  THR THR B . n 
D 3 25  ASN 25  29  29  ASN ASN B . n 
D 3 26  VAL 26  30  30  VAL VAL B . n 
D 3 27  GLY 27  31  31  GLY GLY B . n 
D 3 28  GLU 28  32  32  GLU GLU B . n 
D 3 29  ALA 29  33  33  ALA ALA B . n 
D 3 30  LEU 30  34  34  LEU LEU B . n 
D 3 31  ALA 31  35  35  ALA ALA B . n 
D 3 32  ALA 32  36  36  ALA ALA B . n 
D 3 33  VAL 33  37  37  VAL VAL B . n 
D 3 34  HIS 34  38  38  HIS HIS B . n 
D 3 35  GLY 35  39  39  GLY GLY B . n 
D 3 36  SER 36  40  40  SER SER B . n 
D 3 37  GLU 37  41  41  GLU GLU B . n 
D 3 38  PHE 38  42  42  PHE PHE B . n 
D 3 39  SER 39  43  43  SER SER B . n 
D 3 40  GLN 40  44  44  GLN GLN B . n 
D 3 41  THR 41  45  45  THR THR B . n 
D 3 42  THR 42  46  46  THR THR B . n 
D 3 43  ILE 43  47  47  ILE ILE B . n 
D 3 44  CYS 44  48  48  CYS CYS B . n 
D 3 45  ARG 45  49  49  ARG ARG B . n 
D 3 46  PHE 46  50  50  PHE PHE B . n 
D 3 47  GLU 47  51  51  GLU GLU B . n 
D 3 48  ASN 48  52  52  ASN ASN B . n 
D 3 49  LEU 49  53  53  LEU LEU B . n 
D 3 50  GLN 50  54  54  GLN GLN B . n 
D 3 51  LEU 51  55  55  LEU LEU B . n 
D 3 52  SER 52  56  56  SER SER B . n 
D 3 53  PHE 53  57  57  PHE PHE B . n 
D 3 54  LYS 54  58  58  LYS LYS B . n 
D 3 55  ASN 55  59  59  ASN ASN B . n 
D 3 56  ALA 56  60  60  ALA ALA B . n 
D 3 57  CYS 57  61  61  CYS CYS B . n 
D 3 58  LYS 58  62  62  LYS LYS B . n 
D 3 59  LEU 59  63  63  LEU LEU B . n 
D 3 60  LYS 60  64  64  LYS LYS B . n 
D 3 61  ALA 61  65  65  ALA ALA B . n 
D 3 62  ILE 62  66  66  ILE ILE B . n 
D 3 63  LEU 63  67  67  LEU LEU B . n 
D 3 64  SER 64  68  68  SER SER B . n 
D 3 65  LYS 65  69  69  LYS LYS B . n 
D 3 66  TRP 66  70  70  TRP TRP B . n 
D 3 67  LEU 67  71  71  LEU LEU B . n 
D 3 68  GLU 68  72  72  GLU GLU B . n 
D 3 69  GLU 69  73  73  GLU GLU B . n 
D 3 70  ALA 70  74  74  ALA ALA B . n 
D 3 71  GLU 71  85  ?   ?   ?   B . n 
D 3 72  GLN 72  86  ?   ?   ?   B . n 
D 3 73  VAL 73  87  ?   ?   ?   B . n 
D 3 74  GLY 74  88  ?   ?   ?   B . n 
D 3 75  ALA 75  89  ?   ?   ?   B . n 
D 3 76  LEU 76  90  ?   ?   ?   B . n 
D 3 77  TYR 77  91  ?   ?   ?   B . n 
D 3 78  ASN 78  92  ?   ?   ?   B . n 
D 3 79  GLU 79  93  ?   ?   ?   B . n 
D 3 80  LYS 80  94  ?   ?   ?   B . n 
D 3 81  VAL 81  95  ?   ?   ?   B . n 
D 3 82  GLY 82  96  ?   ?   ?   B . n 
D 3 83  ALA 83  97  ?   ?   ?   B . n 
D 3 84  ASN 84  98  ?   ?   ?   B . n 
D 3 85  GLU 85  99  ?   ?   ?   B . n 
D 3 86  ARG 86  100 ?   ?   ?   B . n 
D 3 87  LYS 87  101 ?   ?   ?   B . n 
D 3 88  ARG 88  102 ?   ?   ?   B . n 
D 3 89  LYS 89  103 103 LYS LYS B . n 
D 3 90  ARG 90  104 104 ARG ARG B . n 
D 3 91  ARG 91  105 105 ARG ARG B . n 
D 3 92  THR 92  106 106 THR THR B . n 
D 3 93  THR 93  107 107 THR THR B . n 
D 3 94  ILE 94  108 108 ILE ILE B . n 
D 3 95  SER 95  109 109 SER SER B . n 
D 3 96  ILE 96  110 110 ILE ILE B . n 
D 3 97  ALA 97  111 111 ALA ALA B . n 
D 3 98  ALA 98  112 112 ALA ALA B . n 
D 3 99  LYS 99  113 113 LYS LYS B . n 
D 3 100 ASP 100 114 114 ASP ASP B . n 
D 3 101 ALA 101 115 115 ALA ALA B . n 
D 3 102 LEU 102 116 116 LEU LEU B . n 
D 3 103 GLU 103 117 117 GLU GLU B . n 
D 3 104 ARG 104 118 118 ARG ARG B . n 
D 3 105 HIS 105 119 119 HIS HIS B . n 
D 3 106 PHE 106 120 120 PHE PHE B . n 
D 3 107 GLY 107 121 121 GLY GLY B . n 
D 3 108 GLU 108 122 122 GLU GLU B . n 
D 3 109 HIS 109 123 123 HIS HIS B . n 
D 3 110 SER 110 124 124 SER SER B . n 
D 3 111 LYS 111 125 125 LYS LYS B . n 
D 3 112 PRO 112 126 126 PRO PRO B . n 
D 3 113 SER 113 127 127 SER SER B . n 
D 3 114 SER 114 128 128 SER SER B . n 
D 3 115 GLN 115 129 129 GLN GLN B . n 
D 3 116 GLU 116 130 130 GLU GLU B . n 
D 3 117 ILE 117 131 131 ILE ILE B . n 
D 3 118 MET 118 132 132 MET MET B . n 
D 3 119 ARG 119 133 133 ARG ARG B . n 
D 3 120 MET 120 134 134 MET MET B . n 
D 3 121 ALA 121 135 135 ALA ALA B . n 
D 3 122 GLU 122 136 136 GLU GLU B . n 
D 3 123 GLU 123 137 137 GLU GLU B . n 
D 3 124 LEU 124 138 138 LEU LEU B . n 
D 3 125 ASN 125 139 139 ASN ASN B . n 
D 3 126 LEU 126 140 140 LEU LEU B . n 
D 3 127 GLU 127 141 141 GLU GLU B . n 
D 3 128 LYS 128 142 142 LYS LYS B . n 
D 3 129 GLU 129 143 143 GLU GLU B . n 
D 3 130 VAL 130 144 144 VAL VAL B . n 
D 3 131 VAL 131 145 145 VAL VAL B . n 
D 3 132 ARG 132 146 146 ARG ARG B . n 
D 3 133 VAL 133 147 147 VAL VAL B . n 
D 3 134 TRP 134 148 148 TRP TRP B . n 
D 3 135 PHE 135 149 149 PHE PHE B . n 
D 3 136 CYS 136 150 150 CYS CYS B . n 
D 3 137 ASN 137 151 151 ASN ASN B . n 
D 3 138 ARG 138 152 152 ARG ARG B . n 
D 3 139 ARG 139 153 153 ARG ARG B . n 
D 3 140 GLN 140 154 154 GLN GLN B . n 
D 3 141 ARG 141 155 155 ARG ARG B . n 
D 3 142 GLU 142 156 156 GLU GLU B . n 
D 3 143 LYS 143 157 157 LYS LYS B . n 
D 3 144 ARG 144 158 158 ARG ARG B . n 
D 3 145 VAL 145 159 159 VAL VAL B . n 
D 3 146 LYS 146 160 160 LYS LYS B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 HOH 1  702 702 HOH HOH C . 
E 4 HOH 2  713 713 HOH HOH C . 
E 4 HOH 3  740 740 HOH HOH C . 
E 4 HOH 4  746 746 HOH HOH C . 
E 4 HOH 5  755 755 HOH HOH C . 
E 4 HOH 6  757 757 HOH HOH C . 
E 4 HOH 7  763 763 HOH HOH C . 
E 4 HOH 8  766 766 HOH HOH C . 
E 4 HOH 9  768 768 HOH HOH C . 
E 4 HOH 10 789 789 HOH HOH C . 
E 4 HOH 11 791 791 HOH HOH C . 
E 4 HOH 12 799 799 HOH HOH C . 
E 4 HOH 13 804 804 HOH HOH C . 
E 4 HOH 14 822 822 HOH HOH C . 
E 4 HOH 15 835 835 HOH HOH C . 
E 4 HOH 16 838 838 HOH HOH C . 
E 4 HOH 17 839 839 HOH HOH C . 
E 4 HOH 18 845 845 HOH HOH C . 
E 4 HOH 19 856 856 HOH HOH C . 
E 4 HOH 20 863 863 HOH HOH C . 
E 4 HOH 21 867 867 HOH HOH C . 
E 4 HOH 22 884 884 HOH HOH C . 
E 4 HOH 23 889 889 HOH HOH C . 
E 4 HOH 24 915 915 HOH HOH C . 
F 4 HOH 1  700 700 HOH HOH D . 
F 4 HOH 2  701 701 HOH HOH D . 
F 4 HOH 3  704 704 HOH HOH D . 
F 4 HOH 4  712 712 HOH HOH D . 
F 4 HOH 5  714 714 HOH HOH D . 
F 4 HOH 6  715 715 HOH HOH D . 
F 4 HOH 7  721 721 HOH HOH D . 
F 4 HOH 8  722 722 HOH HOH D . 
F 4 HOH 9  725 725 HOH HOH D . 
F 4 HOH 10 734 734 HOH HOH D . 
F 4 HOH 11 738 738 HOH HOH D . 
F 4 HOH 12 747 747 HOH HOH D . 
F 4 HOH 13 749 749 HOH HOH D . 
F 4 HOH 14 752 752 HOH HOH D . 
F 4 HOH 15 756 756 HOH HOH D . 
F 4 HOH 16 759 759 HOH HOH D . 
F 4 HOH 17 762 762 HOH HOH D . 
F 4 HOH 18 769 769 HOH HOH D . 
F 4 HOH 19 771 771 HOH HOH D . 
F 4 HOH 20 779 779 HOH HOH D . 
F 4 HOH 21 781 781 HOH HOH D . 
F 4 HOH 22 785 785 HOH HOH D . 
F 4 HOH 23 793 793 HOH HOH D . 
F 4 HOH 24 794 794 HOH HOH D . 
F 4 HOH 25 815 815 HOH HOH D . 
F 4 HOH 26 825 825 HOH HOH D . 
F 4 HOH 27 827 827 HOH HOH D . 
F 4 HOH 28 830 830 HOH HOH D . 
F 4 HOH 29 837 837 HOH HOH D . 
F 4 HOH 30 843 843 HOH HOH D . 
F 4 HOH 31 844 844 HOH HOH D . 
F 4 HOH 32 847 847 HOH HOH D . 
F 4 HOH 33 851 851 HOH HOH D . 
F 4 HOH 34 852 852 HOH HOH D . 
F 4 HOH 35 853 853 HOH HOH D . 
F 4 HOH 36 866 866 HOH HOH D . 
F 4 HOH 37 871 871 HOH HOH D . 
F 4 HOH 38 872 872 HOH HOH D . 
F 4 HOH 39 879 879 HOH HOH D . 
F 4 HOH 40 882 882 HOH HOH D . 
G 4 HOH 1  703 703 HOH HOH A . 
G 4 HOH 2  706 706 HOH HOH A . 
G 4 HOH 3  707 707 HOH HOH A . 
G 4 HOH 4  708 708 HOH HOH A . 
G 4 HOH 5  709 709 HOH HOH A . 
G 4 HOH 6  716 716 HOH HOH A . 
G 4 HOH 7  718 718 HOH HOH A . 
G 4 HOH 8  719 719 HOH HOH A . 
G 4 HOH 9  720 720 HOH HOH A . 
G 4 HOH 10 723 723 HOH HOH A . 
G 4 HOH 11 726 726 HOH HOH A . 
G 4 HOH 12 728 728 HOH HOH A . 
G 4 HOH 13 729 729 HOH HOH A . 
G 4 HOH 14 732 732 HOH HOH A . 
G 4 HOH 15 733 733 HOH HOH A . 
G 4 HOH 16 739 739 HOH HOH A . 
G 4 HOH 17 745 745 HOH HOH A . 
G 4 HOH 18 750 750 HOH HOH A . 
G 4 HOH 19 753 753 HOH HOH A . 
G 4 HOH 20 754 754 HOH HOH A . 
G 4 HOH 21 761 761 HOH HOH A . 
G 4 HOH 22 764 764 HOH HOH A . 
G 4 HOH 23 772 772 HOH HOH A . 
G 4 HOH 24 774 774 HOH HOH A . 
G 4 HOH 25 776 776 HOH HOH A . 
G 4 HOH 26 777 777 HOH HOH A . 
G 4 HOH 27 778 778 HOH HOH A . 
G 4 HOH 28 780 780 HOH HOH A . 
G 4 HOH 29 783 783 HOH HOH A . 
G 4 HOH 30 786 786 HOH HOH A . 
G 4 HOH 31 790 790 HOH HOH A . 
G 4 HOH 32 795 795 HOH HOH A . 
G 4 HOH 33 796 796 HOH HOH A . 
G 4 HOH 34 797 797 HOH HOH A . 
G 4 HOH 35 798 798 HOH HOH A . 
G 4 HOH 36 801 801 HOH HOH A . 
G 4 HOH 37 802 802 HOH HOH A . 
G 4 HOH 38 803 803 HOH HOH A . 
G 4 HOH 39 807 807 HOH HOH A . 
G 4 HOH 40 809 809 HOH HOH A . 
G 4 HOH 41 810 810 HOH HOH A . 
G 4 HOH 42 812 812 HOH HOH A . 
G 4 HOH 43 816 816 HOH HOH A . 
G 4 HOH 44 818 818 HOH HOH A . 
G 4 HOH 45 820 820 HOH HOH A . 
G 4 HOH 46 826 826 HOH HOH A . 
G 4 HOH 47 829 829 HOH HOH A . 
G 4 HOH 48 832 832 HOH HOH A . 
G 4 HOH 49 836 836 HOH HOH A . 
G 4 HOH 50 840 840 HOH HOH A . 
G 4 HOH 51 842 842 HOH HOH A . 
G 4 HOH 52 846 846 HOH HOH A . 
G 4 HOH 53 850 850 HOH HOH A . 
G 4 HOH 54 854 854 HOH HOH A . 
G 4 HOH 55 855 855 HOH HOH A . 
G 4 HOH 56 857 857 HOH HOH A . 
G 4 HOH 57 860 860 HOH HOH A . 
G 4 HOH 58 861 861 HOH HOH A . 
G 4 HOH 59 870 870 HOH HOH A . 
G 4 HOH 60 877 877 HOH HOH A . 
G 4 HOH 61 878 878 HOH HOH A . 
G 4 HOH 62 880 880 HOH HOH A . 
G 4 HOH 63 885 885 HOH HOH A . 
G 4 HOH 64 887 887 HOH HOH A . 
G 4 HOH 65 888 888 HOH HOH A . 
G 4 HOH 66 904 904 HOH HOH A . 
G 4 HOH 67 910 910 HOH HOH A . 
H 4 HOH 1  705 705 HOH HOH B . 
H 4 HOH 2  710 710 HOH HOH B . 
H 4 HOH 3  730 730 HOH HOH B . 
H 4 HOH 4  735 735 HOH HOH B . 
H 4 HOH 5  736 736 HOH HOH B . 
H 4 HOH 6  737 737 HOH HOH B . 
H 4 HOH 7  741 741 HOH HOH B . 
H 4 HOH 8  742 742 HOH HOH B . 
H 4 HOH 9  743 743 HOH HOH B . 
H 4 HOH 10 758 758 HOH HOH B . 
H 4 HOH 11 765 765 HOH HOH B . 
H 4 HOH 12 770 770 HOH HOH B . 
H 4 HOH 13 773 773 HOH HOH B . 
H 4 HOH 14 775 775 HOH HOH B . 
H 4 HOH 15 782 782 HOH HOH B . 
H 4 HOH 16 787 787 HOH HOH B . 
H 4 HOH 17 788 788 HOH HOH B . 
H 4 HOH 18 792 792 HOH HOH B . 
H 4 HOH 19 800 800 HOH HOH B . 
H 4 HOH 20 805 805 HOH HOH B . 
H 4 HOH 21 806 806 HOH HOH B . 
H 4 HOH 22 813 813 HOH HOH B . 
H 4 HOH 23 814 814 HOH HOH B . 
H 4 HOH 24 817 817 HOH HOH B . 
H 4 HOH 25 819 819 HOH HOH B . 
H 4 HOH 26 821 821 HOH HOH B . 
H 4 HOH 27 823 823 HOH HOH B . 
H 4 HOH 28 824 824 HOH HOH B . 
H 4 HOH 29 828 828 HOH HOH B . 
H 4 HOH 30 831 831 HOH HOH B . 
H 4 HOH 31 834 834 HOH HOH B . 
H 4 HOH 32 841 841 HOH HOH B . 
H 4 HOH 33 848 848 HOH HOH B . 
H 4 HOH 34 849 849 HOH HOH B . 
H 4 HOH 35 859 859 HOH HOH B . 
H 4 HOH 36 862 862 HOH HOH B . 
H 4 HOH 37 865 865 HOH HOH B . 
H 4 HOH 38 868 868 HOH HOH B . 
H 4 HOH 39 869 869 HOH HOH B . 
H 4 HOH 40 873 873 HOH HOH B . 
H 4 HOH 41 874 874 HOH HOH B . 
H 4 HOH 42 875 875 HOH HOH B . 
H 4 HOH 43 876 876 HOH HOH B . 
H 4 HOH 44 881 881 HOH HOH B . 
H 4 HOH 45 906 906 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-01-28 
2 'Structure model' 1 1 2008-05-22 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHASIT    'model building' .    ? 1 
X-PLOR    refinement       3.1F ? 2 
DENZO     'data reduction' .    ? 3 
SCALEPACK 'data scaling'   .    ? 4 
PHASIT    phasing          .    ? 5 
# 
_pdbx_entry_details.entry_id                 1AU7 
_pdbx_entry_details.compound_details         
;LINKERS CONNECTING POU SPECIFIC DOMAIN AND POU HOMEO DOMAIN
ARE DISORDERED IN THE STRUCTURE AND NOT VISIBLE IN THE
ELECTRON DENSITY MAP.
;
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 HZ2  B LYS 62  ? ? H2  B HOH 737 ? ? 1.12 
2  1 H    B GLN 44  ? ? H1  B HOH 841 ? ? 1.25 
3  1 HH22 B ARG 146 ? ? H1  D HOH 793 ? ? 1.28 
4  1 HD22 A ASN 151 ? ? H2  A HOH 754 ? ? 1.30 
5  1 HH22 A ARG 146 ? ? H2  A HOH 708 ? ? 1.30 
6  1 H41  C DC  453 ? ? H2  C HOH 839 ? ? 1.33 
7  1 H    B ARG 7   ? ? H2  B HOH 821 ? ? 1.34 
8  1 O4   C DT  449 ? ? H62 D DA  498 ? ? 1.54 
9  1 OP2  C DC  463 ? ? HZ1 B LYS 113 ? ? 1.55 
10 1 HH22 A ARG 133 ? ? O   A HOH 726 ? ? 1.58 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 HH22 A ARG 118 ? ? 1_555 O    D HOH 853 ? ? 1_455 1.12 
2  1 H2   D HOH 879 ? ? 1_555 H2   B HOH 823 ? ? 1_546 1.18 
3  1 HH21 A ARG 7   ? ? 1_555 HE21 B GLN 129 ? ? 1_545 1.24 
4  1 NH2  A ARG 7   ? ? 1_555 H1   D HOH 752 ? ? 1_554 1.56 
5  1 OE1  A GLU 72  ? ? 1_555 O    D HOH 721 ? ? 1_545 1.58 
6  1 HD22 A ASN 139 ? ? 1_555 O    B ASN 139 ? ? 1_545 1.59 
7  1 NH2  A ARG 118 ? ? 1_555 O    D HOH 853 ? ? 1_455 1.68 
8  1 OE1  B GLN 129 ? ? 1_555 O    D HOH 771 ? ? 1_564 1.87 
9  1 O    A ASN 139 ? ? 1_555 ND2  B ASN 139 ? ? 1_545 2.03 
10 1 CD   A GLU 72  ? ? 1_555 O    D HOH 721 ? ? 1_545 2.10 
11 1 ND2  A ASN 139 ? ? 1_555 O    B ASN 139 ? ? 1_545 2.11 
12 1 CD   A ARG 118 ? ? 1_555 O    A HOH 904 ? ? 1_455 2.12 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DT 455 ? ? "C1'" C DT 455 ? ? N1 C DT 455 ? ? 110.26 108.30 1.96 0.30 N 
2 1 "O4'" D DC 478 ? ? "C1'" D DC 478 ? ? N1 D DC 478 ? ? 110.94 108.30 2.64 0.30 N 
3 1 "O4'" D DA 498 ? ? "C1'" D DA 498 ? ? N9 D DA 498 ? ? 110.26 108.30 1.96 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 54  ? ? -94.27  45.76  
2 1 ARG A 104 ? ? 82.08   65.91  
3 1 VAL B 37  ? ? -130.57 -35.90 
4 1 GLN B 54  ? ? -98.22  58.45  
5 1 ILE B 110 ? ? -78.83  26.14  
6 1 LYS B 125 ? ? -156.48 74.50  
7 1 LYS B 142 ? ? -28.92  -46.00 
8 1 VAL B 159 ? ? -56.38  -74.83 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG C 456 ? ? 0.065 'SIDE CHAIN' 
2 1 DA C 462 ? ? 0.063 'SIDE CHAIN' 
3 1 DC D 478 ? ? 0.121 'SIDE CHAIN' 
4 1 DC D 479 ? ? 0.067 'SIDE CHAIN' 
5 1 DG D 497 ? ? 0.053 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 D DA  490 ? N6 ? B DA  16  N6 
2  1 Y 1 A LYS 125 ? CG ? C LYS 111 CG 
3  1 Y 1 A LYS 125 ? CD ? C LYS 111 CD 
4  1 Y 1 A LYS 125 ? CE ? C LYS 111 CE 
5  1 Y 1 A LYS 125 ? NZ ? C LYS 111 NZ 
6  1 Y 1 A LYS 157 ? CG ? C LYS 143 CG 
7  1 Y 1 A LYS 157 ? CD ? C LYS 143 CD 
8  1 Y 1 A LYS 157 ? CE ? C LYS 143 CE 
9  1 Y 1 A LYS 157 ? NZ ? C LYS 143 NZ 
10 1 Y 1 B LYS 125 ? CG ? D LYS 111 CG 
11 1 Y 1 B LYS 125 ? CD ? D LYS 111 CD 
12 1 Y 1 B LYS 125 ? CE ? D LYS 111 CE 
13 1 Y 1 B LYS 125 ? NZ ? D LYS 111 NZ 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 87  ? C VAL 73 
2  1 Y 1 A GLY 88  ? C GLY 74 
3  1 Y 1 A ALA 89  ? C ALA 75 
4  1 Y 1 A LEU 90  ? C LEU 76 
5  1 Y 1 A TYR 91  ? C TYR 77 
6  1 Y 1 A ASN 92  ? C ASN 78 
7  1 Y 1 A GLU 93  ? C GLU 79 
8  1 Y 1 A LYS 94  ? C LYS 80 
9  1 Y 1 A VAL 95  ? C VAL 81 
10 1 Y 1 A GLY 96  ? C GLY 82 
11 1 Y 1 A ALA 97  ? C ALA 83 
12 1 Y 1 A ASN 98  ? C ASN 84 
13 1 Y 1 A GLU 99  ? C GLU 85 
14 1 Y 1 A ARG 100 ? C ARG 86 
15 1 Y 1 A LYS 101 ? C LYS 87 
16 1 Y 1 A ARG 102 ? C ARG 88 
17 1 Y 1 B GLU 85  ? D GLU 71 
18 1 Y 1 B GLN 86  ? D GLN 72 
19 1 Y 1 B VAL 87  ? D VAL 73 
20 1 Y 1 B GLY 88  ? D GLY 74 
21 1 Y 1 B ALA 89  ? D ALA 75 
22 1 Y 1 B LEU 90  ? D LEU 76 
23 1 Y 1 B TYR 91  ? D TYR 77 
24 1 Y 1 B ASN 92  ? D ASN 78 
25 1 Y 1 B GLU 93  ? D GLU 79 
26 1 Y 1 B LYS 94  ? D LYS 80 
27 1 Y 1 B VAL 95  ? D VAL 81 
28 1 Y 1 B GLY 96  ? D GLY 82 
29 1 Y 1 B ALA 97  ? D ALA 83 
30 1 Y 1 B ASN 98  ? D ASN 84 
31 1 Y 1 B GLU 99  ? D GLU 85 
32 1 Y 1 B ARG 100 ? D ARG 86 
33 1 Y 1 B LYS 101 ? D LYS 87 
34 1 Y 1 B ARG 102 ? D ARG 88 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1AU7 'double helix'         
1AU7 'b-form double helix'  
1AU7 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 1  1_555 B DA 24 1_555 -0.455 1.085  0.404  -17.612 4.535   -53.036 1  C_DT449:DA498_D C 449 ? D 498 ? ?  ? 
1 A DC 2  1_555 B DG 23 1_555 0.603  0.273  -0.091 3.911   4.624   0.134   2  C_DC450:DG497_D C 450 ? D 497 ? 19 1 
1 A DC 3  1_555 B DG 22 1_555 0.429  -0.096 0.811  -13.433 -10.521 -3.679  3  C_DC451:DG496_D C 451 ? D 496 ? 19 1 
1 A DT 4  1_555 B DA 21 1_555 -0.338 0.172  -0.056 -8.410  -15.238 3.082   4  C_DT452:DA495_D C 452 ? D 495 ? 20 1 
1 A DC 5  1_555 B DG 20 1_555 -0.410 -0.029 -0.311 5.830   -18.131 2.825   5  C_DC453:DG494_D C 453 ? D 494 ? 19 1 
1 A DA 6  1_555 B DT 19 1_555 -0.100 0.049  -0.346 -0.041  -7.787  0.492   6  C_DA454:DT493_D C 454 ? D 493 ? 20 1 
1 A DT 7  1_555 B DA 18 1_555 0.403  0.271  -0.831 23.619  6.626   1.487   7  C_DT455:DA492_D C 455 ? D 492 ? 20 1 
1 A DG 8  1_555 B DC 17 1_555 -0.262 0.048  0.212  0.885   -11.279 -0.958  8  C_DG456:DC491_D C 456 ? D 491 ? 19 1 
1 A DT 9  1_555 B DA 16 1_555 -0.873 0.429  -0.369 13.127  -4.037  6.071   9  C_DT457:DA490_D C 457 ? D 490 ? ?  ? 
1 A DA 10 1_555 B DT 15 1_555 0.327  0.034  0.727  7.664   -18.559 1.869   10 C_DA458:DT489_D C 458 ? D 489 ? 20 1 
1 A DT 11 1_555 B DA 14 1_555 -0.114 0.132  0.556  0.989   -5.734  1.930   11 C_DT459:DA488_D C 459 ? D 488 ? 20 1 
1 A DA 12 1_555 B DT 13 1_555 0.365  0.123  0.257  -6.112  -21.221 0.984   12 C_DA460:DT487_D C 460 ? D 487 ? 20 1 
1 A DT 13 1_555 B DA 12 1_555 0.107  0.035  0.681  -11.891 -19.755 -2.397  13 C_DT461:DA486_D C 461 ? D 486 ? 20 1 
1 A DA 14 1_555 B DT 11 1_555 -0.143 0.201  -0.511 -4.211  -0.733  3.563   14 C_DA462:DT485_D C 462 ? D 485 ? 20 1 
1 A DC 15 1_555 B DG 10 1_555 0.539  0.002  -0.060 6.918   -12.943 -0.765  15 C_DC463:DG484_D C 463 ? D 484 ? 19 1 
1 A DA 16 1_555 B DT 9  1_555 0.048  0.348  -1.103 -18.107 -2.526  8.983   16 C_DA464:DT483_D C 464 ? D 483 ? ?  ? 
1 A DG 18 1_555 B DC 7  1_555 0.286  0.119  -0.259 -4.929  -6.448  5.324   17 C_DG466:DC481_D C 466 ? D 481 ? 19 1 
1 A DA 19 1_555 B DT 6  1_555 -0.525 0.082  0.213  17.217  -15.794 -5.422  18 C_DA467:DT480_D C 467 ? D 480 ? 20 1 
1 A DG 20 1_555 B DC 5  1_555 -0.663 0.377  0.510  21.065  -1.020  6.326   19 C_DG468:DC479_D C 468 ? D 479 ? ?  1 
1 A DG 21 1_555 B DC 4  1_555 0.681  0.107  -0.432 2.438   1.570   -8.538  20 C_DG469:DC478_D C 469 ? D 478 ? 19 1 
1 A DA 22 1_555 B DT 3  1_555 0.313  -0.171 -0.697 -12.048 -3.424  0.157   21 C_DA470:DT477_D C 470 ? D 477 ? 20 1 
1 A DA 23 1_555 B DT 2  1_555 -0.088 0.241  -0.035 8.489   -4.403  5.129   22 C_DA471:DT476_D C 471 ? D 476 ? 20 1 
1 A DG 24 1_555 B DC 1  1_555 0.163  0.065  0.320  2.704   2.173   5.611   23 C_DG472:DC475_D C 472 ? D 475 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 1  1_555 B DA 24 1_555 A DC 2  1_555 B DG 23 1_555 1.559  -0.246 2.779 1.885   13.581  18.130 -4.799 -3.382 2.208 36.991  
-5.134  22.696 1  CC_DT449DC450:DG497DA498_DD C 449 ? D 498 ? C 450 ? D 497 ? 
1 A DC 2  1_555 B DG 23 1_555 A DC 3  1_555 B DG 22 1_555 -0.375 -0.408 3.748 -8.377  2.742   41.456 -0.888 -0.469 3.719 3.821   
11.675  42.343 2  CC_DC450DC451:DG496DG497_DD C 450 ? D 497 ? C 451 ? D 496 ? 
1 A DC 3  1_555 B DG 22 1_555 A DT 4  1_555 B DA 21 1_555 -0.207 -0.252 3.273 2.868   -0.566  32.544 -0.350 0.864  3.247 -1.008  
-5.106  32.671 3  CC_DC451DT452:DA495DG496_DD C 451 ? D 496 ? C 452 ? D 495 ? 
1 A DT 4  1_555 B DA 21 1_555 A DC 5  1_555 B DG 20 1_555 0.322  0.169  2.939 5.944   6.945   31.714 -0.782 0.357  2.921 12.391  
-10.603 32.973 4  CC_DT452DC453:DG494DA495_DD C 452 ? D 495 ? C 453 ? D 494 ? 
1 A DC 5  1_555 B DG 20 1_555 A DA 6  1_555 B DT 19 1_555 -0.186 1.163  3.487 -3.793  12.118  32.659 -0.139 -0.340 3.674 20.605  
6.450   34.978 5  CC_DC453DA454:DT493DG494_DD C 453 ? D 494 ? C 454 ? D 493 ? 
1 A DA 6  1_555 B DT 19 1_555 A DT 7  1_555 B DA 18 1_555 1.010  -0.420 2.950 2.463   -5.687  30.261 0.235  -1.454 3.047 -10.753 
-4.657  30.874 6  CC_DA454DT455:DA492DT493_DD C 454 ? D 493 ? C 455 ? D 492 ? 
1 A DT 7  1_555 B DA 18 1_555 A DG 8  1_555 B DC 17 1_555 -0.202 -1.150 3.811 -7.078  2.706   31.091 -2.655 -1.117 3.657 4.956   
12.964  31.979 7  CC_DT455DG456:DC491DA492_DD C 455 ? D 492 ? C 456 ? D 491 ? 
1 A DG 8  1_555 B DC 17 1_555 A DT 9  1_555 B DA 16 1_555 0.182  -0.271 3.188 6.920   -1.258  34.833 -0.263 0.695  3.172 -2.075  
-11.416 35.514 8  CC_DG456DT457:DA490DC491_DD C 456 ? D 491 ? C 457 ? D 490 ? 
1 A DT 9  1_555 B DA 16 1_555 A DA 10 1_555 B DT 15 1_555 -0.364 0.001  3.169 -7.380  4.358   47.716 -0.329 -0.115 3.177 5.337   
9.038   48.436 9  CC_DT457DA458:DT489DA490_DD C 457 ? D 490 ? C 458 ? D 489 ? 
1 A DA 10 1_555 B DT 15 1_555 A DT 11 1_555 B DA 14 1_555 0.312  -1.351 3.701 -2.316  -10.789 27.209 0.143  -1.220 3.903 -21.829 
4.685   29.323 10 CC_DA458DT459:DA488DT489_DD C 458 ? D 489 ? C 459 ? D 488 ? 
1 A DT 11 1_555 B DA 14 1_555 A DA 12 1_555 B DT 13 1_555 -0.073 -0.520 3.313 5.997   0.240   43.405 -0.721 0.676  3.273 0.323   
-8.062  43.799 11 CC_DT459DA460:DT487DA488_DD C 459 ? D 488 ? C 460 ? D 487 ? 
1 A DA 12 1_555 B DT 13 1_555 A DT 13 1_555 B DA 12 1_555 -0.666 -0.878 3.280 -6.695  -4.524  30.595 -0.737 -0.072 3.437 -8.390  
12.419  31.619 12 CC_DA460DT461:DA486DT487_DD C 460 ? D 487 ? C 461 ? D 486 ? 
1 A DT 13 1_555 B DA 12 1_555 A DA 14 1_555 B DT 11 1_555 -0.039 0.033  3.156 5.211   -1.660  39.413 0.235  0.640  3.123 -2.447  
-7.681  39.776 13 CC_DT461DA462:DT485DA486_DD C 461 ? D 486 ? C 462 ? D 485 ? 
1 A DA 14 1_555 B DT 11 1_555 A DC 15 1_555 B DG 10 1_555 0.103  -0.214 3.128 -6.953  0.963   37.707 -0.441 -0.987 3.056 1.474   
10.645  38.331 14 CC_DA462DC463:DG484DT485_DD C 462 ? D 485 ? C 463 ? D 484 ? 
1 A DC 15 1_555 B DG 10 1_555 A DA 16 1_555 B DT 9  1_555 0.333  -1.205 3.905 10.493  3.609   35.394 -2.475 1.156  3.715 5.764   
-16.758 37.040 15 CC_DC463DA464:DT483DG484_DD C 463 ? D 484 ? C 464 ? D 483 ? 
1 A DA 16 1_555 B DT 9  1_555 A DG 18 1_555 B DC 7  1_555 -1.732 1.350  6.316 -10.889 9.908   60.498 0.392  0.671  6.639 9.680   
10.638  62.098 16 CC_DA464DG466:DC481DT483_DD C 464 ? D 483 ? C 466 ? D 481 ? 
1 A DG 18 1_555 B DC 7  1_555 A DA 19 1_555 B DT 6  1_555 -0.761 0.072  2.801 -3.371  2.019   26.366 -0.304 0.883  2.871 4.395   
7.338   26.652 17 CC_DG466DA467:DT480DC481_DD C 466 ? D 481 ? C 467 ? D 480 ? 
1 A DA 19 1_555 B DT 6  1_555 A DG 20 1_555 B DC 5  1_555 1.316  -0.145 3.194 -4.396  9.101   32.498 -1.625 -2.916 2.854 15.793  
7.628   33.993 18 CC_DA467DG468:DC479DT480_DD C 467 ? D 480 ? C 468 ? D 479 ? 
1 A DG 20 1_555 B DC 5  1_555 A DG 21 1_555 B DC 4  1_555 -0.930 -0.645 3.764 1.858   8.411   45.819 -1.613 1.353  3.561 10.692  
-2.362  46.579 19 CC_DG468DG469:DC478DC479_DD C 468 ? D 479 ? C 469 ? D 478 ? 
1 A DG 21 1_555 B DC 4  1_555 A DA 22 1_555 B DT 3  1_555 -0.370 -0.218 3.661 1.488   7.559   33.829 -1.655 0.876  3.513 12.784  
-2.517  34.670 20 CC_DG469DA470:DT477DC478_DD C 469 ? D 478 ? C 470 ? D 477 ? 
1 A DA 22 1_555 B DT 3  1_555 A DA 23 1_555 B DT 2  1_555 0.188  0.336  2.955 -4.850  9.030   23.481 -1.597 -1.689 2.797 20.956  
11.256  25.592 21 CC_DA470DA471:DT476DT477_DD C 470 ? D 477 ? C 471 ? D 476 ? 
1 A DA 23 1_555 B DT 2  1_555 A DG 24 1_555 B DC 1  1_555 -1.113 0.061  3.283 -6.983  5.057   34.497 -0.669 0.764  3.411 8.367   
11.552  35.527 22 CC_DA471DG472:DC475DT476_DD C 471 ? D 476 ? C 472 ? D 475 ? 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#